1GCQC

Crystal structure of vav and grb2 sh3 domains
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
GSHMPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcqC00
1YWOA 1RLQC 1SHGA 2DL5A 1OEBA 2O31A 4KRTA 1OPLA 2BZ8A 4CC4B 2LNHB 1LCKA 1WXTA 4J9HA 1SSHA 4AFSC 2X3XD 2RQWA 4HVVA 2A37A 1HSQA 3VS4A 1GRIA 2HBWA 2FEIA 2D8HA 1AZGB 2KNBB 5IXBA 1WXUA 2DYBA 1S1NA 5GJVB 4AG1C 1I07A 3VS1A 1ZSGA 2JS2A 4RTYA 1SPKA 4WCIA 2J06A 1YWPA 2LX7A 1YCSB 3R6NA 2KEAA 4QT7A 4OMNA 2RF0A 3UA6A 5EC7A 3M0RA 2LQWA 3EHQA 2CUBA 1FMKA 3TSWA 2CT3A 2EYXA 2RQVA 4DEYA 2LP5A 2KE9A 3UF4A 2J05A 4J9EA 2MCNA 1AOJA 2DRMA 1ABOA 1TG0A 3CQTA 3I5SA 2KR3A 3SHWA 3UATA 2M51A 4IIOA 3ZL7C 2O88A 4ZNXA 1QKWA 2JT4A 3FJ5A 3I9QA 1BBZA 1K1ZA 3VRZA 2ROTA 1WIEA 2VWFA 2JW4A 2EGCA 2V1RA 2EYZA 2EYYA 1CSKA 1E7OA 1GBQA 2OJ2A 2PTKA 3M0UA 4JJCA 1GFDA 1M3AA 1CKAA 3H41A 5HCKA 2GGRA 4Y92A 5FW9A 1JU5C 1NG2A 1Z9ZA 2F2XA 1VYVA 1QCFA 1PRLC 3NPFA 4D8DA 1PRMC 2F2VA 1SRLA 1QWEA 3U23A 1GFCA 2CUDA 2HDAA 2DRKA 2CREA 2VKNA 1K9AA 1ZUUA 1NM7A 4JJBA 1X69A 2C0TA 2FRWA 1T0HA 2JS0A 2W0ZA 3LH5A 5GJWB 1A0NB 2PZ1A 2IIMA 2W10A 4E6RA 1W6XA 5IHIA 1YNZA 2ENMA 5I11A 4LE9A 2JXBA 2PNIA 3NHNA 2V1QA 1M3CA 1GCQC 1JXMA 2YDLA 1HJDA 4J9DA 2CH4W 2KRSA 1SEMA 4AFQC 2LMJA 2DL4A 4J9FA 1KSWA 2BZYA 2YUNA 2QDLA 1ARKA 1VYUA 2CSIA 2C0OA 2DLPA 2JM8A 2XMFA 1W1FA 5FWCA 2DM1A 1T0JA 2P4RA 2I0NA 1GCPA 2FPDA 3H0HA 1KJWA 1T3SA 2KROA 2AKKA 2FG0A 1T3LA 1GCQA 2KRMA 2FO0A 2LQNA 1I1JA 3THKA 1CKBA 2CT4A 2FPFA 4OMQA 2RMOA 2MIOA 4CC3A 2HEQA 1NLPC 1JO8A 1H3HA 2GQIA 3SEMA 2YUOA 2J6FA 2J6KA 5I22A 3TVTA 4J9BA 2FPEA 2LJ3A 2SEMA 4LNPA 1B3QA 2CSQA 1AZEA 2EGAA 4ORZA 2LZ6B 1NYFA 1SHFA 2YUQA 2L3SA 3I5RA 1UECA 2CH4A 4EIKA 2DBMA 4DEXA 3VS0A 1ABQA 3VS6A 4D8KA 1AD5A 5L23A 2DE0X 1OPKA 1EFNA 1TUCA 3O5ZA 1X27A 3REBB 4RTUA 2EW3A 1JQQA 3KFVA 4K11A 1E6HA 1B07A 1K0XA 1M30A 3C0CA 1WX6A 2GNCA 2EVRA 1MUZA 2A28A 1WFWA 3EG1A 4HVWA 3QWXX 4F16A 1K0SA 1YN8A 1UJ0A 1UGVA 1AWWA 3H0IA 4LN2A 2O9VA 2LJ1A 2KYMA 3RNJA 4HVUA 3PVQA 1UJYA 5IXFA 2RQRA 1M8MA 1H8KA 2YSQA 1PHTA 4FSSA 4RTWA 4GLMA 4CC7A 2O2OA 1NEBA 2F2WA 1X2KA 4HCKA 4J9IA 1X2QA 1I0CA 4AG2C 1MV0B 2SRCA 1UG1A 1AVZC 4ESRA 4AFUC 2CDTA 2ESWA 2E5KA 2DNUA 1FYNA 3RBBB 2EBPA 2AK5A 1GL5A 4F17A 2ROLA 2YT6A 1WDXA 2DBKA 2DL3A 1JEGA 1X6GA 4R0KA 1PWTA 1IO6A 2GBQA 3UA7A 4J9GA 4RTTA 4A63B 1PKTA 1U3OA 1WXBA 2K6DA 4HXJA 1AEYA 2GTJA 3EGUA 1SRMA 2K3BA 3NMZC 3PE0A 1HD3A 2YUPA 2KXDA 2L3QA 1WYXA 1BK2A 2A08A 4CC2A 1ZBJA 5FWBA 1JXOA 1G2BA 1M27C 1PKSA 4AFZC 2L0AA 2JM9A 2OI3A 2RNAA 1Z9QA 2K2MA 3TSZA 2KGTA 2DL8A 1WI7A 2DF6A 1U06A 2HCKA 1KIKA 1X43A 2LCSA 2NWMA 2KT1A 2K7AA 2K79A 1J3TA 2D0NA 3VRYA 1MV3A 3H0FA 4LUEA 4Z89A 2JTEA 2KYBA 2RQUA 2AKLA 1W70A 1UUEA 4JJDA 4Z88A 1GBRA 2JMAA 2OAWA 2D8JA 2AZVA 1UDLA 1H92A 2RN8A 1ZUYA 1AWJA 1XOVA 2EYWA 4M4ZA 3ULRB 2RPNA 3M0QA 3PVLA 3IQLA 5IHKA 4J9CA 5IHNA 4OMMA 2ED1A 2EKHA 4IIMA 1X6BA 1ZLMA 3M0SA 1M3BA 1QWFA 1ZUKA 1N5ZA 1V1CA 1RI9A 1UTIA 1AWXA 2KT8A 1OV3A 4GBQA 4RTVA 2DILA 2ED0A 2DA9A 1UFFA 4OMOA 3M0PA 1VYTA 2J6OA 2ECZA 1WA7A 3QWYA 1AWOA 1YP5A 3EG0A 1WLPB 2RQTA 2DMOA 2O9SA 2EGEA 1OOTA 1QKXA 3VS7A 2D1XA 1NEGA 2X3WD 2DJQA 5ECAA 1KFZA 4Z8AA 1QLYA 3EG3A 3NGPA 1E6GA 1UHCA 2K9GA 3VS3A 3GBQA 1G83A 1VA7A 2KXCA 3EG2A 1NYGA 2BTTA 3M0TA 2MOXA 2EQIA 2NUZA 2KRNA 2AZSA 2KBTA 1U5SA 1BU1A 3A98A 1Y57A 4LUDA 2DVJA 1K76A 4JZ3A 2H8HA 2HSPA 1K4US 3I35A 2L3PA 4RUGA 2GTOA 2FRYA 1TUDA 3JV3A 4OMLA 4RTXA 1Y0MA 2G6FX 4RTZA 2DX1A 2LJ0A 4F14A 1ZX6A 4JPBW 2JMCA 3VS2A 2DL7A 5IH2A 2J7IA 2A36A 1UE9A 1PNJA 1RUWA 2M0YA 4JZ4A 2L2PA 3VS5A 2C0IA 3EHRA 4X1VA 1NLOC 2EPDA 2ABLA 4OMPA 2BZXA 3REAB 1RLPC 2B86A 1UHFA 2VVKA 1BB9A
chains in the Genus database with same CATH superfamily
1YWOA 3MPUB 2FZGB 2LNHB 1QVFS 2P0KA 4KBMB 2DFUA 2KK4A 2E3IA 2LCLA 2NLUA 5KH6A 2RQWA 4MDXA 2NYSA 4FT4A 2DYBA 4LDXA 4MZPA 2GFAA 5GAOp 1N27A 4AG1C 3VU3C 5LJ5f 4PLIA 3J7AF 4RMOA 4PJOC 3I55Q 4M77C 1SPKA 1YWPA 2LX7A 2KEAA 3EFRA 3C94A 1YJ9T 4L6V5 1M90U 2FVUA 1PD1A 1SG5A 1Y96A 2LQWA 3META 1S72T 3RKYA 2EYXA 3M4YA 2LP5A 4C0FA 2VB6A 5D7UA 5J26A 4NS5A 2CZ0B 2RM4A 3TCJA 1IXDA 4C8QC 2MCNA 4J5YA 2DRMA 1Q7YC 3I5SA 3LLRA 2VXFA 1VIFA 1OX9A 2DZCA 4M77A 4X9DA 4BY6B 1KK7A 1QKWA 3FJ5A 5A0LA 3CC4T 5LJ3f 1KC8U 3RMSA 2YRDA 3QUIA 2O4XA 3QKJA 3VV0A 2XIDA 1GFDA 1CKAA 2RH2A 2V8KA 2HMAA 2DXUA 3OYBA 5I21A 1JU5C 1NG2A 2QI2A 3CCST 4HT8A 2F2XA 3NPFA 4FSXA 4D8DA 2YLBA 1PRMC 1LJOA 3U23A 1NJIC 3CXCP 2VKNA 2CS7A 3EH2A 1M1KR 4A4FA 1NM7A 1RAIB 3EAEA 2C0TA 1QVGP 5GJWB 1OU9A 1A0NB 2PZ1A 2LX9A 1WHLA 3JCMJ 3URGA 5IAYA 2E4HA 1D3BB 1YNZA 4J6WA 3VUBA 4LE9A 4J7IA 1M3CA 1TTHB 3JCMh 1JXMA 2YDLA 1YITA 3JCMX 4C5GA 4DOVA 5I2MA 2HL5C 3H9NA 1WHJA 3EG9B 4OB1B 2YRCA 3CPWP 2BKDN 2DL4A 3DB3A 1KSWA 5CCAA 1M1GA 2QDLA 4BE0A 1ARKA 3RUXA 2CSIA 1W1FA 5GANj 3HFNA 1EIFA 4YTLA 2I0NA 1GCPA 2OTLA 3MEAA 5DLOA 3CCMA 2E5QA 4AT1B 4C5EA 3CCRA 1TSFA 1GCQA 2JVVA 2KRMA 2FO0A 5CKEA 3CCMQ 1I1JA 4RG2A 2QA4Q 2HEQA 1NLPC 1YITT 1H3HA 2GQIA 4EMKC 3TVTA 1VQPQ 2LJ3A 3JCMc 3OA6A 2YXYA 1Q86R 1SHFA 1Y07A 2L3SA 3OMCA 1VQPA 1I5OB 3CCSQ 2GCXA 3VS0A 1BI2A 2NUTB 1TUCA 1X27A 4XTUA 4RTUA 2R5MA 2CZ7B 1JQQA 3MEWA 1E6HA 1KC8R 3CCSA 1B07A 1YI2T 4IKFA 1K0XA 1TH7A 4M75B 5A0GA 3Q1JA 3E1SA 4HVWA 3QJ6A 1MMNA 2EJ9A 1PM3A 3MP1A 1YIJQ 1ZHIA 3CCQA 1UGVA 4C5IA 2O9VA 2LQ8A 2KYMA 5IXFA 1RAHB 1M8MA 1YCYA 1H8KA 2YSQA 3OB9A 2QAZA 3EH1A 2CP3A 4QQDA 1NEBA 1B34B 1VQ6Q 1RADB 1MGQA 3QBYA 1BCMA 2SRCA 5CR2A 1M2OA 4E2FB 5LJ5h 2ESWA 2JTFA 2E5KA 4EMGA 2DNUA 1YJWA 1KD1R 2H3JA 2IG0A 2V8IA 4PKCC 1WDXA 2DBKA 2CYZB 3S6WA 1K9MU 5CQXA 2HQEA 3QPHA 2DVEA 4A63B 3G1JA 2E6NA 4HXJA 3EG9A 3JB9I 3G71T 3EGUA 1KD1C 2OTJT 4MDWA 4DOWA 1VQ7Q 2YUPA 1BK2A 2K2VA 4TVRA 1M90R 4CC2A 3LGLA 2VYTA 4LD9K 3HRSA 1KD1U 1VQOQ 3V7CA 1PKSA 1KQ2A 2OI3A 2ZCFB 1Z9QA 4JRQA 2QEXA 1M4ZA 1WI7A 2HL3A 1X43A 4J6XA 4A4EA 2EJFA 2NWMA 1D0YA 3PMTA 1J3TA 4IUQA 4P5NA 4XTYA 3CCMT 1OULA 5GANe 3UT1A 4PFOA 1PSFA 1W70A 5GANf 4JJDA 1I4K1 1H641 2MI6A 5LJ3g 4M77B 4Z88A 3ZBDA 3CCVA 1VQMQ 1R0CB 5CKDA 2RJFA 3L2QA 3QHSA 5FROA 2E64A 1M2VA 1UDLA 2OTJQ 2RN8A 1ZUYA 1XOVA 3CMEQ 4M7AD 1VQ8T 2RPNA 3M0QA 3PVLA 4PJOG 1AT1B 4OMMA 1G3SA 2QA4A 4J83A 3M0SA 1ZUKA 2X4XA 3LWIA 3VKIA 3PMIA 1AWXA 1YJNQ 2XD0A 2PVGB 2KT8A 3HRTA 1NZ9A 2BUDA 4JJNK 2ED0A 4B6MA 1VYTA 5D6XA 1Y7XA 1Y96B 1QVPA 4XAXB 1BI3A 5HKCA 4ATOA 5KYXA 2F1LA 5GAMf 4M78G 1UGPB 3KUFA 5LJ5j 4HCCA 2R58A 2X3WD 1F1BB 3KXTA 4C0DC 3I55A 3VS3A 1UHCA 2K9GA 1YIJT 3EG2A 1NYGA 3M0TA 4M7AE 5KYWB 4N4IA 3CC4A 4PL6A 3UDCA 2FL7A 4N0AA 3TREA 4CI0C 1OYXA 1UB4A 3P8BB 4LUDA 2H8HA 2MPXC 1K4US 1RACB 2GTOA 4RTXA 4KGVB 1LPLA 3EFSA 4FYVB 3I55T 2G6FX 1ZX6A 3L1AA 4ZTJA 1IGQA 4JPBW 1KHCA 3VS2A 1S72A 2RI2A 2K4YA 2PVOB 3C95A 4A53A 3BW1A 2DPPB 5A0DA 3OYGA 2KDSA 2JZ2A 4M7AF 3VS5A 8AT1B 4X1VA 4E7SA 4FIBA 4FT2A 4JRPA 1BB9A 1VQ5A 1RLQC 4X34A 5GANh 1LCKA 1WXTA 4FM4B 1SSHA 3RIRA 5GAOq 2A37A 1HSQA 3M55A 2HBWA 2KMTA 2O01E 3UWNA 3JB9G 4EPCA 1WXUA 1I8FA 1TXQA 3A8GB 4Y28E 2DK3A 1ZSGA 2Z0WA 2JS2A 2PU9B 4DBFA 4WCIA 2J06A 2XHCA 5C0MA 4MZTA 5LJ3e 3R6NA 2QK0A 3GP8A 4OMNA 3CD6T 3UA6A 3M5AA 4F7UA 2M9UA 1FMKA 2RQVA 4M75F 4C92B 5KYUB 2QEXQ 4EMHA 4OGEA 4A4HA 3S3NA 2VUBA 2KE9A 3TEEA 4PJOF 3X26B 3SHWA 3CBMA 1EX4A 3UATA 4PJOA 4IIOA 3RDVA 1KC8C 2O88A 4GY5A 5CKBA 2E10A 1WGSA 3X24B 4ZN1A 3I9QA 3CCEQ 1BBZA 1K1ZA 4PFPA 4XU0A 4M75D 1WIEA 4C8QE 1G3WA 2EGCA 4E7IA 2EYYA 4L5GA 1CSKA 2QGFB 1M1FA 3CCET 1GBQA 3M0UA 4M77G 4BE1A 3OS0A 2A7YA 5HCKA 1WNLA 5GAOn 2GGRA 3A8MB 1OI1A 1NE8A 3QXEB 5CKHA 3CC2Q 3BDUA 1QCFA 2DIGA 3X28B 5FRMA 2F2VA 3L2ZA 1SRLA 2E1HA 4M77E 3EGDB 3MP6A 5LJ3j 1GFCA 4Y91A 4OB2B 2CREA 3VYGA 5GANg 2Y90A 2EYQA 1DJ7B 2V26A 2MF2A 2LQKA 1TUGB 1W2BP 3LH5A 1JBMA 2DEQA 2EQUA 4WF2A 2IIMA 3CMAA 3J81E 1W6XA 5IHIA 3OBWA 3E9FA 2G3RA 2JXBA 1UGSB 4M7AB 1FX7A 1OX8A 2JN0A 1TOVA 4M78C 4E7LA 1C0MA 1HJDA 5A2QE 1IB8A 3JAME 2FB7A 2DZ9A 4M7DB 1SEMA 3WXMB 1C6VX 1YIJA 4J9FA 1IGUA 1QP2A 4C92D 2XICA 1YHQA 2P0QA 3BY7A 2DTHA 4R56A 1G3TA 1Q82U 4XK8E 3SDZA 2HNIA 2KROA 4IUTA 2QQBA 1T3LA 2RHIA 2JNGA 2PQWA 3CCUT 5GAMh 3RESA 1CKBA 2CT4A 2MIOA 5GMKh 2YUOA 2LTOA 5I22A 3FDRA 5GAMe 1N8RC 2SEMA 3M58A 1YJWQ 2RJDA 1B3QA 1RAGB 1AZEA 2DERA 4DA4A 1NYFA 3DLMA 2EKOA 2CH4A 4EIKA 3JSCA 4DEXA 3LW5E 1ABQA 2M16A 4C92C 1K9MC 2DD5A 1AD5A 2C06A 1ZSZC 2RK2A 4M77D 3OYHA 3KFVA 1IHVA 3CCRT 3PIOA 3GNGA 3FJPA 1N9SA 1JRIA 1M30A 3C0CA 4PJLA 3OYJA 3G7ZA 2B8AA 2XKOC 3QDRB 1G5VA 4EMKA 3OYLA 3QWXX 2DD4A 3EGXB 4AMCA 5CK9A 2OTLT 3E19A 1YN8A 1UJ0A 5CVIA 1SF9A 1AWWA 2ZPFB 3H0IA 2FZKB 2LJ1A 1UJYA 1MMAA 3QJYA 3MEVA 5LJ5d 1VQNA 4FSSA 2O2OA 5DLQE 5M9OA 1RAFB 5LJ3d 1X2KA 4HCKA 3OW2A 4O6JA 3L2RA 4AG2C 4C8QF 1UG1A 1YITQ 4AFUC 2CDTA 4KUDK 3EGDA 2BE9B 2X4JA 5KYYA 4BDZA 4JRKA 5FU6C 1VQMT 2DL3A 3C12A 4LXCA 3FB9A 2VGNA 3SB2A 3X25B 2CP5A 5IT9E 2GBQA 5D6YA 4M7AC 1FMVA 4J8OA 4J9GA 4LD6A 4RTTA 2HSEB 1PKTA 3CBPA 3CCVT 2K6DA 1V76A 1WXBA 2L5QA 1AEYA 1FXXA 4BACA 2K3BA 3NMZC 1ZBJA 3LX7A 5FWBA 1G2BA 4AFZC 3VJPA 4F7UE 2JM9A 4BI3A 5GAMj 2KAFA 3OYKA 1V29B 3CC7T 1C1AA 2DL8A 4PJMA 2M1HA 2NUPB 1U06A 1PCXA 3A8LB 2LCSA 5CKFA 3G4SA 2D0NA 2LRQA 1MV3A 3H0FA 4Z89A 2RI3A 2AKLA 2RQUA 3CMAT 3G71A 2CP6A 1QCOA 3M57A 2NUTA 4M75C 2E41A 2D8JA 3V8KA 1SKUB 4ME7A 4M4ZA 1VQ6T 2K3XA 5IHNA 3M4GA 2EKHA 3A8OB 4IIMA 1X6BA 3DB4A 3TU4K 2HZYA 3AT1B 2K5IA 1VQ5Q 2GF7A 1OV3A 2ZPBB 1WZOA 4GBQA 2DILA 4RTVA 4XTXA 1PD0A 3HPWA 3L2VA 2DA9A 3V7RA 1U1TA 3CCLQ 3G6EA 2J6OA 2ECZA 3QWYA 1AWOA 2FYKA 2FZCB 3EG0A 1WLPB 4LDWA 1M1KU 5KCOA 3MCAB 4Z02A 2EGEA 2QXFA 2PVDB 2DXBA 5C6SA 1YJ9Q 1NEGA 5GMKm 2MMPA 1QLYA 3BDLA 5GAMd 3GBQA 1G83A 4PJOB 2KXCA 2BTTA 3GLXA 2EFIA 1WQ7A 4FL6A 1IZ6A 5D6WA 2M0OA 4QQ6A 2JJ9A 1Q81C 1M8VA 2KBTA 3C4SA 2F5TX 1WJQA 1WJRA 2E6ZA 3A98A 1K76A 1Q7YR 4E7JA 4JZ3A 2VV5A 4HCBA 2QG9B 1VQPT 2ZPIB 2L3PA 4RUGA 2XG8D 2FRYA 1TUDA 4KGZB 1IRXA 4OMLA 2QTVA 4RTZA 4X9CA 4F14A 3MO8A 3L2WA 2DXTA 2QQRA 4JDSA 5GAN6 1K8AR 2MK5A 2A36A 1UE9A 1VQNQ 1PNJA 3JB9H 4JZ4A 4OGCA 2DETA 1MHNA 3HKSA 4CRIA 3EHRA 4NL3A 3QYHB 1QQJA 3REAB 2B86A 1UHFA 3I56T 5GAOm 1OEBA 1OPLA 2BZ8A 3RERA 1O75A 4J9HA 4AFSC 1X6OA 2X51A 2D8HA 5J3BA 1VQLT 1AZGB 5IXBA 5GJVB 3H6ZA 1N9RA 4C8QA 1I07A 1VQKT 3VS1A 1RAEB 1NJIR 5GMKj 2GFUA 3G6ET 4FU6A 1VQ4T 1WHKA 1YCSB 1NPPA 4HKEA 4QT7A 4M7DF 2RF0A 2R5AA 5GMKl 5GAOr 3M0RA 3EHQA 2CUBA 1YJNA 5GAMg 2CT3A 1UGRB 3D7SB 3OSSC 2PUOB 1P92A 1Q82R 4JUVA 3UF4A 1B7TA 1VQ6A 3OYCA 3T9NA 4ZGJB 1ABOA 4QVCA 3CQTA 3CCJA 1VQ5T 1XJWB 2HQXA 2Y4XA 2D0QB 4IURA 4ELYC 2JT4A 4B9WA 3JB9D 3QZ9B 4C5HA 1M2VB 2ROTA 2VWFA 2V1RA 2EYZA 4KH0B 4OB0B 4MZMA 2VASA 3GOXA 1JB0E 2COYA 2K5FA 2I2LA 4DBQA 1RL2A 1YHQT 4Y92A 5FW9A 2RI5A 4LDUA 4BDYA 1SSFA 3H8ZA 2FHDA 1JJ2A 3PT9A 2CGHA 3FIFA 4M78A 1OQKA 3CC7A 2KQWA 5GANd 3KBGA 5GAN8 4BUGA 2HDAA 2CUDA 2DRKA 1S72Q 2D9TA 4GLKA 3SD4A 2QQSA 1X69A 2W0ZA 2JS0A 4N4GA 4BB7A 3JCMV 2DTIA 4IUVA 3I56Q 3G6EQ 2DIQA 2WSCE 3CPFA 4C8QG 2PNIA 3NHNA 2CZ1B 2V1QA 1G3YA 3I56A 4F7UF 2M02A 4QW2A 4J9DA 2YLCA 3CD6Q 2KRSA 3F70A 4AFQC 2EQKA 2LMJA 4M7DD 4M75E 4C8QD 2YUNA 4N4HA 1VYUA 2ZPEB 2JM8A 3CCEA 2DM1A 1T0JA 1I5LA 2JTMA 2FPDA 3H0HA 1KJWA 1T3SA 2QDYB 4EDUA 2WACA 2PUKB 3M53A 2MWOA 2CP0A 1VQNT 2AKKA 2FG0A 5LJ3h 1OZ3A 4C92G 1WHGA 2LQNA 3RKWA 2FPFA 4OMQA 2RMOA 4D6WA 4CC3A 1D09B 1QW1A 1JO8A 4B9XA 2J6FA 1O9SA 3VUZA 3JRZA 5IN1A 2EGAA 3ZEHA 4ORZA 2KI7A 1Q7YU 2YUQA 3I5RA 4PLLA 2LT1A 3CCLT 1UECA 3A1PA 3VS6A 4D8KA 2X4YA 2DE0X 1OPKA 3REBB 4IUPA 3QYGB 3DKMA 4RCCA 1AHJB 5HK3A 1WX6A 4PK4A 1MUZA 2A28A 1R8OB 1OZ2A 4V2SA 2RO0A 4WTOB 3PNWC 1R0BG 1Y71A 4F16A 2COWA 2QQAA 1K0SA 3P8DA 3J80E 4OP0A 1YHQQ 5KYUA 4C92A 2QQ9A 4LN2A 4EMKB 3RNJA 4HVUA 3PVQA 6AT1B 3M59A 3G4SQ 1JJ2S 2RQRA 2COZA 3JCMW 2V8JA 3RMQA 2X9HA 3NTHA 1R77A 1WQWA 1PC0A 4JRIA 2LCCA 5KYXB 3INZA 1I0CA 4M7DA 1PSEA 4KULA 2AIRB 2RB6A 3PTAA 4ESRA 1NJIU 3JB9J 1FYNA 3OYNA 2EBPA 2AK5A 1BIAA 1VQ4A 1FWZA 4F17A 2ROLA 3OQ5A 1LNXA 1JEGA 1H3ZA 4FW1A 1PWTA 3TQ7P 4HT9A 1VQKA 2GTJA 2RHYA 5FU7C 2K5LA 1VQ9A 1SRMA 2EAYA 1D3BA 2R57A 3PE0A 1KQSS 2L3QA 5GAN2 2A08A 1BYMA 3BE3A 4M77F 2L8DA 2QTXA 2XDPA 1JXOA 1M27C 1VQ7A 4FCYA 3OYIA 2ZGWA 2RNAA 2K2MA 3TSZA 3QSUA 5GAOl 1QVFP 2RD1A 4PFZA 3LWHA 4M7AA 2ZPHB 1M5Q1 2K7AA 2K79A 3VRYA 1ZQ1A 2QA4T 4JS4A 4LUEA 1XNIA 4ZGDB 2X4WA 2JTEA 2KYBA 2HBPA 2ZPGB 3LH0A 1UUEA 2OTJA 4DBHA 4ELZC 4A54A 1GBRA 1YBYA 2HD0A 2JMAA 2OAWA 3CC2T 2O4XB 1VQ8A 1NPRA 3MEUA 1H92A 1MNEA 2XDDA 5KYWA 1AWJA 4M78E 3CXCA 2OTLQ 1BI1A 2EJGA 1Q81R 3ULRB 3QG1A 1IHWA 1FMWA 3IQLA 2ED1A 1TS9A 4FYXB 2JOYA 4E7KA 3RR6A 3JCMg 1KHIA 1M3BA 1QWFA 1N5ZA 2KSSA 3JCMP 3V8LA 1V1CA 4M75A 2EWNA 1UTIA 2RJCA 2IVWA 4KH1B 5FU6B 3AHUA 1UFFA 4OMOA 4L59A 3PIPA 3M0PA 2LC4A 3HRUA 2E12A 1WA7A 1YP5A 2EQMA 4E7HA 4XTWA 2RQTA 3OW2S 2DMOA 3E9GA 2MWPA 3OYMA 3QZ5B 3WVDB 1Q86C 1OOTA 1QKXA 3X20B 3VS7A 1WPYA 7AT1B 2DJQA 1EZZB 5ECAA 1KFZA 3NGPA 4C8QB 1E6GA 2RA2A 5LJ5g 2MOXA 4IUUA 5AYFA 2KRNA 2JUFA 2AZSA 1U5SA 1Y57A 2DVJA 1YJWT 3CC4Q 3ASKA 2HSPA 3QO3A 3CCQQ 1G8XA 3I35A 4J6YA 1WHMA 1M1KC 3JV3A 4QQGA 1HK9A 1Y0MA 3M9QA 4F04B 2Y4YA 5GMKi 2DX1A 2RJEA 2YHTA 2M0YA 4KT0E 2OX7A 5AT1B 2C0IA 4A4KA 1WHHA 2EPDA 3HTRA 1X75C 4OMPA 2CP2A 2AT1B 2RHUA 1SHGA 2DL5A 3OS5A 2O31A 3E2UA 4KRTA 4CC4B 3LYIA 2XI9A 2X3XD 1W4SA 4HVVA 4NL2A 3VS4A 3CCQT 1GRIA 4XTZA 2FEIA 1K9MR 2EQJA 2KNBB 4RCBA 4XTVA 1S1NA 5LJ5e 2HAXA 3M56A 4M7DG 1U8RA 4RTYA 3QDFA 5GAN5 4PJNA 4QVZA 2DXCA 4BI8B 5EC7A 5HK0A 3TSWA 2DEUA 4DEYA 3ME9A 1KG1A 5FRNA 3RKXA 1U1SA 2J05A 4J9EA 4MMLA 5CO7A 5GAN4 1AOJA 1TG0A 2KR3A 3ZL7C 2M51A 3S3OA 3JCMe 1LOJA 4ZNXA 2BE7D 2K57A 4JLGA 3VRZA 5I2SA 2KVQG 2JW4A 4OB3B 1E7OA 4C0GA 1KQ1A 2OJ2A 4OMFB 2PTKA 4JJCA 1VQ8Q 1M3AA 3PFSA 4FW2A 3H41A 3OS1A 3CPWA 2IPOB 1N8RR 1Z9ZA 3GF5A 1VYVA 1D1CA 1PRLC 1K8AC 1HYOA 2QEXT 1QWEA 1QVFA 5GAN7 3CC2A 1K9AA 1ZUUA 2EIFA 2XK0A 4JJBA 5HY6A 2FRWA 4ZGEB 1T0HA 4R55A 5KYYB 5FU7B 2VC8A 1XQHA 4HCZA 2WSFE 3FEOA 3VYHB 2W10A 4NOYA 1MMGA 3OYYA 5KYNA 4E6RA 1ZA2B 2K3YA 2ENMA 5I11A 1BIBA 4F7UB 4DBRA 4A4GA 9ATCB 1GCQC 3CMAQ 1K73C 3MJXA 3CCUA 2CP7A 2CH4W 3CCJT 1VOMA 1VQ4Q 5KE2A 2BZYA 3MHXA 3HFOA 2QYZA 2C0OA 2DLPA 2RHXA 2XMFA 5FWCA 3CPWS 3CCUQ 3SWNA 2DAQA 2MAMA 2P4RA 3V7SA 1PG5B 4M7DE 3OY9A 1VQLQ 4E47A 1VQ9Q 2BIVA 2H3EB 3ER0A 4PJOD 4KGXB 3THKA 1VIEA 1YFNA 5GMKe 1Q81U 4XU2A 3SEMA 3DLLA 4F7UG 2J6KA 4J9BA 3CC7Q 1BI0A 5CQYA 3OMGA 2FPEA 4LNPA 3CCLA 2CSQA 2P4TA 3EFOA 3SWNC 1RAAB 2LZ6B 4KUIA 2WSEE 2D6FA 3FRNA 3PGGA 2DJZA 3CEYA 2DBMA 1IREB 3FC3A 3GPLA 3LGFA 5L23A 1YI2A 1QP3A 2HKNA 1EFNA 1YJ9A 3O5ZA 4QKUA 2EW3A 3NFCA 4FYWB 4K11A 1D1AA 3HSBA 2HKQB 1W2BA 3CCVQ 1VQMA 2A0FB 2GNCA 3CXCS 3A8HB 2EVRA 4PNOA 3A5ZB 1QCNA 1RI0A 1WFWA 3EG1A 1UEBA 4M7DC 1WJSA 4PJJA 3N5BB 2MYSA 4XU1A 1K73U 2E70A 4ZTFA 4FYYB 3S3MA 3EFOB 4BI4A 4M78F 1I81A 4M78B 1D0XA 1ZSZA 2XU8A 2P0PA 4OVAA 1GXIE 3M54A 2E3HA 1PHTA 4RTWA 3JCMb 4GLMA 4CC7A 1QMCA 1QVGA 1W2BS 1VUBA 2F2WA 2GQVA 4J9IA 1X2QA 3CMET 1MV0B 1M9SA 1AVZC 2LNVA 2YWWA 2HQHA 2RHZA 1K8AU 2QASA 3CD6A 1KQSA 2VGMA 3RBBB 4LDVA 4C0ZA 1GL5A 2YT6A 4E7ZA 3OYEA 4R0KA 1X6GA 1TWBA 2YRVA 1ZBXA 1IO6A 3NTIA 3UA7A 5DY9A 3O8VA 5DM7R 4DQ2A 1U3OA 2L3RA 1UGQB 3HL8A 2CKKA 5KCHA 3JCMd 1MNDA 5CAIA 3OYDA 4JLIA 5GAN3 1HD3A 3GIBA 2KXDA 1WYXA 5FLXE 4UC4A 2ATCB 1ACMB 1ZSZB 2ZZDA 4C0DB 1VQOT 3OYAA 5J39A 2L0AA 1JJ2P 2LVMA 4HA8A 1Q86U 2LDMA 2KGTA 2DO3A 5LL6S 2DF6A 1VQ7T 2HCKA 1KIKA 1XTDA 3MKDA 3SWNB 3G71Q 2KT1A 2CZ6B 3CCJQ 4C92F 1VQ9T 2X35A 4RG8A 2DKGA 4ZN3A 4BD3A 1B34A 1Q95G 3G4ST 3BFMA 2AZVA 2QGGA 1NBEB 2EYWA 4Q5WA 3L2UA 3JCMf 1BCOA 2VXEA 3OYFA 2NUPA 1VQLA 1QVGS 5IHKA 4J9CA 3SFMA 2DTOA 3HP9A 3OW2P 1KQSP 1ZLMA 2E65A 3WVEB 4XQ3A 1RI9A 3EGXA 4N0AC 2F69A 3JCMQ 4QVDA 3L42A 2KY9A 1VQOA 4RKUE 2DYIA 4C92E 3P8HA 2O9SA 2ZAEA 1RABB 3FLGA 2LT4A 1YI2Q 2D1XA 1N6AA 3GNFB 3V8JA 2XDBA 3UPUA 4Z8AA 4M7AG 1D1BA 3EG3A 4ANJA 2P84A 3CBOA 4O5VA 1YJNT 1VA7A 1X01A 3R6OA 4M75G 1N8RU 1VQKQ 4M78D 4BY6C 3HHTB 2EQIA 2NUZA 1HXDA 1OU8A 1MMDA 3OSVA 1BU1A 5CIUA 2L89A 8ATCB 1D0ZA 4JS5A 3OBYA 3CCRQ 2AHJB 5KE3A 3JB9F 3ZFJA 4XU3A 2F5KA 2RK1A 4VUBA 3NTKA 3CMEA 5L8RE 4MMKA 1Q82C 2LJ0A 1ZA1B 5EG2A 2JMCA 2DL7A 5IH2A 2J7IA 3OS2A 1M90C 1BKBA 1RUWA 3MP8A 2L2PA 2A3LA 1TU0B 1LVKA 2OAUA 4OF1A 1K73R 1NLOC 2ABLA 4LDYA 4II1A 4J7FA 2BZXA 1RLPC 4BE2A 4PJOE 3QIIA 2VVKA
chains in the Genus database with same CATH topology
1YWOA 1RLQC 1SHGA 2DL5A 1OEBA 2O31A 4KRTA 1OPLA 2BZ8A 4CC4B 2LNHB 1LCKA 1WXTA 4J9HA 1SSHA 4AFSC 2X3XD 2RQWA 4HVVA 2A37A 1HSQA 3VS4A 1GRIA 2HBWA 2FEIA 2D8HA 1AZGB 2KNBB 5IXBA 1WXUA 2DYBA 1S1NA 5GJVB 4AG1C 1I07A 3VS1A 1ZSGA 2JS2A 4RTYA 1SPKA 4WCIA 2J06A 1YWPA 2LX7A 1YCSB 3R6NA 2KEAA 4QT7A 4OMNA 2RF0A 3UA6A 5EC7A 3M0RA 2LQWA 3EHQA 2CUBA 1FMKA 3TSWA 2CT3A 2EYXA 2RQVA 4DEYA 2LP5A 2KE9A 3UF4A 2J05A 4J9EA 2MCNA 1AOJA 2DRMA 1ABOA 1TG0A 3CQTA 3I5SA 2KR3A 3SHWA 3UATA 2M51A 4IIOA 3ZL7C 2O88A 4ZNXA 1QKWA 2JT4A 3FJ5A 3I9QA 1BBZA 1K1ZA 3VRZA 2ROTA 1WIEA 2VWFA 2JW4A 2EGCA 2V1RA 2EYZA 2EYYA 1CSKA 1E7OA 1GBQA 2OJ2A 2PTKA 3M0UA 4JJCA 1GFDA 1M3AA 1CKAA 3H41A 5HCKA 2GGRA 4Y92A 5FW9A 1JU5C 1NG2A 1Z9ZA 2F2XA 1VYVA 1QCFA 1PRLC 3NPFA 4D8DA 1PRMC 2F2VA 1SRLA 1QWEA 3U23A 1GFCA 2CUDA 2HDAA 2DRKA 2CREA 2VKNA 1K9AA 1ZUUA 1NM7A 4JJBA 1X69A 2C0TA 2FRWA 1T0HA 2JS0A 2W0ZA 3LH5A 5GJWB 1A0NB 2PZ1A 2IIMA 2W10A 4E6RA 1W6XA 5IHIA 1YNZA 2ENMA 5I11A 4LE9A 2JXBA 2PNIA 3NHNA 2V1QA 1M3CA 1GCQC 1JXMA 2YDLA 1HJDA 4J9DA 2CH4W 2KRSA 1SEMA 4AFQC 2LMJA 2DL4A 4J9FA 1KSWA 2BZYA 2YUNA 2QDLA 1ARKA 1VYUA 2CSIA 2C0OA 2DLPA 2JM8A 2XMFA 1W1FA 5FWCA 2DM1A 1T0JA 2P4RA 2I0NA 1GCPA 2FPDA 3H0HA 1KJWA 1T3SA 2KROA 2AKKA 2FG0A 1T3LA 1GCQA 2KRMA 2FO0A 2LQNA 1I1JA 3THKA 1CKBA 2CT4A 2FPFA 4OMQA 2RMOA 2MIOA 4CC3A 2HEQA 1NLPC 1JO8A 1H3HA 2GQIA 3SEMA 2YUOA 2J6FA 2J6KA 5I22A 3TVTA 4J9BA 2FPEA 2LJ3A 2SEMA 4LNPA 1B3QA 2CSQA 1AZEA 2EGAA 4ORZA 2LZ6B 1NYFA 1SHFA 2YUQA 2L3SA 3I5RA 1UECA 2CH4A 4EIKA 2DBMA 4DEXA 3VS0A 1ABQA 3VS6A 4D8KA 1AD5A 5L23A 2DE0X 1OPKA 1EFNA 1TUCA 3O5ZA 1X27A 3REBB 4RTUA 2EW3A 1JQQA 3KFVA 4K11A 1E6HA 1B07A 1K0XA 1M30A 3C0CA 1WX6A 2GNCA 2EVRA 1MUZA 2A28A 1WFWA 3EG1A 4HVWA 3QWXX 4F16A 1K0SA 1YN8A 1UJ0A 1UGVA 1AWWA 3H0IA 4LN2A 2O9VA 2LJ1A 2KYMA 3RNJA 4HVUA 3PVQA 1UJYA 5IXFA 2RQRA 1M8MA 1H8KA 2YSQA 1PHTA 4FSSA 4RTWA 4GLMA 4CC7A 2O2OA 1NEBA 2F2WA 1X2KA 4HCKA 4J9IA 1X2QA 1I0CA 4AG2C 1MV0B 2SRCA 1UG1A 1AVZC 4ESRA 4AFUC 2CDTA 2ESWA 2E5KA 2DNUA 1FYNA 3RBBB 2EBPA 2AK5A 1GL5A 4F17A 2ROLA 2YT6A 1WDXA 2DBKA 2DL3A 1JEGA 1X6GA 4R0KA 1PWTA 1IO6A 2GBQA 3UA7A 4J9GA 4RTTA 4A63B 1PKTA 1U3OA 1WXBA 2K6DA 4HXJA 1AEYA 2GTJA 3EGUA 1SRMA 2K3BA 3NMZC 3PE0A 1HD3A 2YUPA 2KXDA 2L3QA 1WYXA 1BK2A 2A08A 4CC2A 1ZBJA 5FWBA 1JXOA 1G2BA 1M27C 1PKSA 4AFZC 2L0AA 2JM9A 2OI3A 2RNAA 1Z9QA 2K2MA 3TSZA 2KGTA 2DL8A 1WI7A 2DF6A 1U06A 2HCKA 1KIKA 1X43A 2LCSA 2NWMA 2KT1A 2K7AA 2K79A 1J3TA 2D0NA 3VRYA 1MV3A 3H0FA 4LUEA 4Z89A 2JTEA 2KYBA 2RQUA 2AKLA 1W70A 1UUEA 4JJDA 4Z88A 1GBRA 2JMAA 2OAWA 2D8JA 2AZVA 1UDLA 1H92A 2RN8A 1ZUYA 1AWJA 1XOVA 2EYWA 4M4ZA 3ULRB 2RPNA 3M0QA 3PVLA 3IQLA 5IHKA 4J9CA 5IHNA 4OMMA 2ED1A 2EKHA 4IIMA 1X6BA 1ZLMA 3M0SA 1M3BA 1QWFA 1ZUKA 1N5ZA 1V1CA 1RI9A 1UTIA 1AWXA 2KT8A 1OV3A 4GBQA 4RTVA 2DILA 2ED0A 2DA9A 1UFFA 4OMOA 3M0PA 1VYTA 2J6OA 2ECZA 1WA7A 3QWYA 1AWOA 1YP5A 3EG0A 1WLPB 2RQTA 2DMOA 2O9SA 2EGEA 1OOTA 1QKXA 3VS7A 2D1XA 1NEGA 2X3WD 2DJQA 5ECAA 1KFZA 4Z8AA 1QLYA 3EG3A 3NGPA 1E6GA 1UHCA 2K9GA 3VS3A 3GBQA 1G83A 1VA7A 2KXCA 3EG2A 1NYGA 2BTTA 3M0TA 2MOXA 2EQIA 2NUZA 2KRNA 2AZSA 2KBTA 1U5SA 1BU1A 3A98A 1Y57A 4LUDA 2DVJA 1K76A 4JZ3A 2H8HA 2HSPA 1K4US 3I35A 2L3PA 4RUGA 2GTOA 2FRYA 1TUDA 3JV3A 4OMLA 4RTXA 1Y0MA 2G6FX 4RTZA 2DX1A 2LJ0A 4F14A 1ZX6A 4JPBW 2JMCA 3VS2A 2DL7A 5IH2A 2J7IA 2A36A 1UE9A 1PNJA 1RUWA 2M0YA 4JZ4A 2L2PA 3VS5A 2C0IA 3EHRA 4X1VA 1NLOC 2EPDA 2ABLA 4OMPA 2BZXA 3REAB 1RLPC 2B86A 1UHFA 2VVKA 1BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWO A;  1RLQ C;  1SHG A;  2DL5 A;  1OEB A;  2O31 A;  4KRT A;  1OPL A;  2BZ8 A;  4CC4 B;  2LNH B;  1LCK A;  1WXT A;  4J9H A;  1SSH A;  4AFS C;  2X3X D;  2RQW A;  4HVV A;  2A37 A;  1HSQ A;  3VS4 A;  1GRI A;  2HBW A;  2FEI A;  2D8H A;  1AZG B;  2KNB B;  5IXB A;  1WXU A;  2DYB A;  1S1N A;  5GJV B;  4AG1 C;  1I07 A;  3VS1 A;  1ZSG A;  2JS2 A;  4RTY A;  1SPK A;  4WCI A;  2J06 A;  1YWP A;  2LX7 A;  1YCS B;  3R6N A;  2KEA A;  4QT7 A;  4OMN A;  2RF0 A;  3UA6 A;  5EC7 A;  3M0R A;  2LQW A;  3EHQ A;  2CUB A;  1FMK A;  3TSW A;  2CT3 A;  2EYX A;  2RQV A;  4DEY A;  2LP5 A;  2KE9 A;  3UF4 A;  2J05 A;  4J9E A;  2MCN A;  1AOJ A;  2DRM A;  1ABO A;  1TG0 A;  3CQT A;  3I5S A;  2KR3 A;  3SHW A;  3UAT A;  2M51 A;  4IIO A;  3ZL7 C;  2O88 A;  4ZNX A;  1QKW A;  2JT4 A;  3FJ5 A;  3I9Q A;  1BBZ A;  1K1Z A;  3VRZ A;  2ROT A;  1WIE A;  2VWF A;  2JW4 A;  2EGC A;  2V1R A;  2EYZ A;  2EYY A;  1CSK A;  1E7O A;  1GBQ A;  2OJ2 A;  2PTK A;  3M0U A;  4JJC A;  1GFD A;  1M3A A;  1CKA A;  3H41 A;  5HCK A;  2GGR A;  4Y92 A;  5FW9 A;  1JU5 C;  1NG2 A;  1Z9Z A;  2F2X A;  1VYV A;  1QCF A;  1PRL C;  3NPF A;  4D8D A;  1PRM C;  2F2V A;  1SRL A;  1QWE A;  3U23 A;  1GFC A;  2CUD A;  2HDA A;  2DRK A;  2CRE A;  2VKN A;  1K9A A;  1ZUU A;  1NM7 A;  4JJB A;  1X69 A;  2C0T A;  2FRW A;  1T0H A;  2JS0 A;  2W0Z A;  3LH5 A;  5GJW B;  1A0N B;  2PZ1 A;  2IIM A;  2W10 A;  4E6R A;  1W6X A;  5IHI A;  1YNZ A;  2ENM A;  5I11 A;  4LE9 A;  2JXB A;  2PNI A;  3NHN A;  2V1Q A;  1M3C A;  1GCQ C;  1JXM A;  2YDL A;  1HJD A;  4J9D A;  2CH4 W;  2KRS A;  1SEM A;  4AFQ C;  2LMJ A;  2DL4 A;  4J9F A;  1KSW A;  2BZY A;  2YUN A;  2QDL A;  1ARK A;  1VYU A;  2CSI A;  2C0O A;  2DLP A;  2JM8 A;  2XMF A;  1W1F A;  5FWC A;  2DM1 A;  1T0J A;  2P4R A;  2I0N A;  1GCP A;  2FPD A;  3H0H A;  1KJW A;  1T3S A;  2KRO A;  2AKK A;  2FG0 A;  1T3L A;  1GCQ A;  2KRM A;  2FO0 A;  2LQN A;  1I1J A;  3THK A;  1CKB A;  2CT4 A;  2FPF A;  4OMQ A;  2RMO A;  2MIO A;  4CC3 A;  2HEQ A;  1NLP C;  1JO8 A;  1H3H A;  2GQI A;  3SEM A;  2YUO A;  2J6F A;  2J6K A;  5I22 A;  3TVT A;  4J9B A;  2FPE A;  2LJ3 A;  2SEM A;  4LNP A;  1B3Q A;  2CSQ A;  1AZE A;  2EGA A;  4ORZ A;  2LZ6 B;  1NYF A;  1SHF A;  2YUQ A;  2L3S A;  3I5R A;  1UEC A;  2CH4 A;  4EIK A;  2DBM A;  4DEX A;  3VS0 A;  1ABQ A;  3VS6 A;  4D8K A;  1AD5 A;  5L23 A;  2DE0 X;  1OPK A;  1EFN A;  1TUC A;  3O5Z A;  1X27 A;  3REB B;  4RTU A;  2EW3 A;  1JQQ A;  3KFV A;  4K11 A;  1E6H A;  1B07 A;  1K0X A;  1M30 A;  3C0C A;  1WX6 A;  2GNC A;  2EVR A;  1MUZ A;  2A28 A;  1WFW A;  3EG1 A;  4HVW A;  3QWX X;  4F16 A;  1K0S A;  1YN8 A;  1UJ0 A;  1UGV A;  1AWW A;  3H0I A;  4LN2 A;  2O9V A;  2LJ1 A;  2KYM A;  3RNJ A;  4HVU A;  3PVQ A;  1UJY A;  5IXF A;  2RQR A;  1M8M A;  1H8K A;  2YSQ A;  1PHT A;  4FSS A;  4RTW A;  4GLM A;  4CC7 A;  2O2O A;  1NEB A;  2F2W A;  1X2K A;  4HCK A;  4J9I A;  1X2Q A;  1I0C A;  4AG2 C;  1MV0 B;  2SRC A;  1UG1 A;  1AVZ C;  4ESR A;  4AFU C;  2CDT A;  2ESW A;  2E5K A;  2DNU A;  1FYN A;  3RBB B;  2EBP A;  2AK5 A;  1GL5 A;  4F17 A;  2ROL A;  2YT6 A;  1WDX A;  2DBK A;  2DL3 A;  1JEG A;  1X6G A;  4R0K A;  1PWT A;  1IO6 A;  2GBQ A;  3UA7 A;  4J9G A;  4RTT A;  4A63 B;  1PKT A;  1U3O A;  1WXB A;  2K6D A;  4HXJ A;  1AEY A;  2GTJ A;  3EGU A;  1SRM A;  2K3B A;  3NMZ C;  3PE0 A;  1HD3 A;  2YUP A;  2KXD A;  2L3Q A;  1WYX A;  1BK2 A;  2A08 A;  4CC2 A;  1ZBJ A;  5FWB A;  1JXO A;  1G2B A;  1M27 C;  1PKS A;  4AFZ C;  2L0A A;  2JM9 A;  2OI3 A;  2RNA A;  1Z9Q A;  2K2M A;  3TSZ A;  2KGT A;  2DL8 A;  1WI7 A;  2DF6 A;  1U06 A;  2HCK A;  1KIK A;  1X43 A;  2LCS A;  2NWM A;  2KT1 A;  2K7A A;  2K79 A;  1J3T A;  2D0N A;  3VRY A;  1MV3 A;  3H0F A;  4LUE A;  4Z89 A;  2JTE A;  2KYB A;  2RQU A;  2AKL A;  1W70 A;  1UUE A;  4JJD A;  4Z88 A;  1GBR A;  2JMA A;  2OAW A;  2D8J A;  2AZV A;  1UDL A;  1H92 A;  2RN8 A;  1ZUY A;  1AWJ A;  1XOV A;  2EYW A;  4M4Z A;  3ULR B;  2RPN A;  3M0Q A;  3PVL A;  3IQL A;  5IHK A;  4J9C A;  5IHN A;  4OMM A;  2ED1 A;  2EKH A;  4IIM A;  1X6B A;  1ZLM A;  3M0S A;  1M3B A;  1QWF A;  1ZUK A;  1N5Z A;  1V1C A;  1RI9 A;  1UTI A;  1AWX A;  2KT8 A;  1OV3 A;  4GBQ A;  4RTV A;  2DIL A;  2ED0 A;  2DA9 A;  1UFF A;  4OMO A;  3M0P A;  1VYT A;  2J6O A;  2ECZ A;  1WA7 A;  3QWY A;  1AWO A;  1YP5 A;  3EG0 A;  1WLP B;  2RQT A;  2DMO A;  2O9S A;  2EGE A;  1OOT A;  1QKX A;  3VS7 A;  2D1X A;  1NEG A;  2X3W D;  2DJQ A;  5ECA A;  1KFZ A;  4Z8A A;  1QLY A;  3EG3 A;  3NGP A;  1E6G A;  1UHC A;  2K9G A;  3VS3 A;  3GBQ A;  1G83 A;  1VA7 A;  2KXC A;  3EG2 A;  1NYG A;  2BTT A;  3M0T A;  2MOX A;  2EQI A;  2NUZ A;  2KRN A;  2AZS A;  2KBT A;  1U5S A;  1BU1 A;  3A98 A;  1Y57 A;  4LUD A;  2DVJ A;  1K76 A;  4JZ3 A;  2H8H A;  2HSP A;  1K4U S;  3I35 A;  2L3P A;  4RUG A;  2GTO A;  2FRY A;  1TUD A;  3JV3 A;  4OML A;  4RTX A;  1Y0M A;  2G6F X;  4RTZ A;  2DX1 A;  2LJ0 A;  4F14 A;  1ZX6 A;  4JPB W;  2JMC A;  3VS2 A;  2DL7 A;  5IH2 A;  2J7I A;  2A36 A;  1UE9 A;  1PNJ A;  1RUW A;  2M0Y A;  4JZ4 A;  2L2P A;  3VS5 A;  2C0I A;  3EHR A;  4X1V A;  1NLO C;  2EPD A;  2ABL A;  4OMP A;  2BZX A;  3REA B;  1RLP C;  2B86 A;  1UHF A;  2VVK A;  1BB9 A; 
#chains in the Genus database with same CATH topology
 1YWO A;  3MPU B;  2FZG B;  2LNH B;  1QVF S;  2P0K A;  4KBM B;  2DFU A;  2KK4 A;  2E3I A;  2LCL A;  2NLU A;  5KH6 A;  2RQW A;  4MDX A;  2NYS A;  4FT4 A;  2DYB A;  4LDX A;  4MZP A;  2GFA A;  5GAO p;  1N27 A;  4AG1 C;  3VU3 C;  5LJ5 f;  4PLI A;  3J7A F;  4RMO A;  4PJO C;  3I55 Q;  4M77 C;  1SPK A;  1YWP A;  2LX7 A;  2KEA A;  3EFR A;  3C94 A;  1YJ9 T;  4L6V 5;  1M90 U;  2FVU A;  1PD1 A;  1SG5 A;  1Y96 A;  2LQW A;  3MET A;  1S72 T;  3RKY A;  2EYX A;  3M4Y A;  2LP5 A;  4C0F A;  2VB6 A;  5D7U A;  5J26 A;  4NS5 A;  2CZ0 B;  2RM4 A;  3TCJ A;  1IXD A;  4C8Q C;  2MCN A;  4J5Y A;  2DRM A;  1Q7Y C;  3I5S A;  3LLR A;  2VXF A;  1VIF A;  1OX9 A;  2DZC A;  4M77 A;  4X9D A;  4BY6 B;  1KK7 A;  1QKW A;  3FJ5 A;  5A0L A;  3CC4 T;  5LJ3 f;  1KC8 U;  3RMS A;  2YRD A;  3QUI A;  2O4X A;  3QKJ A;  3VV0 A;  2XID A;  1GFD A;  1CKA A;  2RH2 A;  2V8K A;  2HMA A;  2DXU A;  3OYB A;  5I21 A;  1JU5 C;  1NG2 A;  2QI2 A;  3CCS T;  4HT8 A;  2F2X A;  3NPF A;  4FSX A;  4D8D A;  2YLB A;  1PRM C;  1LJO A;  3U23 A;  1NJI C;  3CXC P;  2VKN A;  2CS7 A;  3EH2 A;  1M1K R;  4A4F A;  1NM7 A;  1RAI B;  3EAE A;  2C0T A;  1QVG P;  5GJW B;  1OU9 A;  1A0N B;  2PZ1 A;  2LX9 A;  1WHL A;  3JCM J;  3URG A;  5IAY A;  2E4H A;  1D3B B;  1YNZ A;  4J6W A;  3VUB A;  4LE9 A;  4J7I A;  1M3C A;  1TTH B;  3JCM h;  1JXM A;  2YDL A;  1YIT A;  3JCM X;  4C5G A;  4DOV A;  5I2M A;  2HL5 C;  3H9N A;  1WHJ A;  3EG9 B;  4OB1 B;  2YRC A;  3CPW P;  2BKD N;  2DL4 A;  3DB3 A;  1KSW A;  5CCA A;  1M1G A;  2QDL A;  4BE0 A;  1ARK A;  3RUX A;  2CSI A;  1W1F A;  5GAN j;  3HFN A;  1EIF A;  4YTL A;  2I0N A;  1GCP A;  2OTL A;  3MEA A;  5DLO A;  3CCM A;  2E5Q A;  4AT1 B;  4C5E A;  3CCR A;  1TSF A;  1GCQ A;  2JVV A;  2KRM A;  2FO0 A;  5CKE A;  3CCM Q;  1I1J A;  4RG2 A;  2QA4 Q;  2HEQ A;  1NLP C;  1YIT T;  1H3H A;  2GQI A;  4EMK C;  3TVT A;  1VQP Q;  2LJ3 A;  3JCM c;  3OA6 A;  2YXY A;  1Q86 R;  1SHF A;  1Y07 A;  2L3S A;  3OMC A;  1VQP A;  1I5O B;  3CCS Q;  2GCX A;  3VS0 A;  1BI2 A;  2NUT B;  1TUC A;  1X27 A;  4XTU A;  4RTU A;  2R5M A;  2CZ7 B;  1JQQ A;  3MEW A;  1E6H A;  1KC8 R;  3CCS A;  1B07 A;  1YI2 T;  4IKF A;  1K0X A;  1TH7 A;  4M75 B;  5A0G A;  3Q1J A;  3E1S A;  4HVW A;  3QJ6 A;  1MMN A;  2EJ9 A;  1PM3 A;  3MP1 A;  1YIJ Q;  1ZHI A;  3CCQ A;  1UGV A;  4C5I A;  2O9V A;  2LQ8 A;  2KYM A;  5IXF A;  1RAH B;  1M8M A;  1YCY A;  1H8K A;  2YSQ A;  3OB9 A;  2QAZ A;  3EH1 A;  2CP3 A;  4QQD A;  1NEB A;  1B34 B;  1VQ6 Q;  1RAD B;  1MGQ A;  3QBY A;  1BCM A;  2SRC A;  5CR2 A;  1M2O A;  4E2F B;  5LJ5 h;  2ESW A;  2JTF A;  2E5K A;  4EMG A;  2DNU A;  1YJW A;  1KD1 R;  2H3J A;  2IG0 A;  2V8I A;  4PKC C;  1WDX A;  2DBK A;  2CYZ B;  3S6W A;  1K9M U;  5CQX A;  2HQE A;  3QPH A;  2DVE A;  4A63 B;  3G1J A;  2E6N A;  4HXJ A;  3EG9 A;  3JB9 I;  3G71 T;  3EGU A;  1KD1 C;  2OTJ T;  4MDW A;  4DOW A;  1VQ7 Q;  2YUP A;  1BK2 A;  2K2V A;  4TVR A;  1M90 R;  4CC2 A;  3LGL A;  2VYT A;  4LD9 K;  3HRS A;  1KD1 U;  1VQO Q;  3V7C A;  1PKS A;  1KQ2 A;  2OI3 A;  2ZCF B;  1Z9Q A;  4JRQ A;  2QEX A;  1M4Z A;  1WI7 A;  2HL3 A;  1X43 A;  4J6X A;  4A4E A;  2EJF A;  2NWM A;  1D0Y A;  3PMT A;  1J3T A;  4IUQ A;  4P5N A;  4XTY A;  3CCM T;  1OUL A;  5GAN e;  3UT1 A;  4PFO A;  1PSF A;  1W70 A;  5GAN f;  4JJD A;  1I4K 1;  1H64 1;  2MI6 A;  5LJ3 g;  4M77 B;  4Z88 A;  3ZBD A;  3CCV A;  1VQM Q;  1R0C B;  5CKD A;  2RJF A;  3L2Q A;  3QHS A;  5FRO A;  2E64 A;  1M2V A;  1UDL A;  2OTJ Q;  2RN8 A;  1ZUY A;  1XOV A;  3CME Q;  4M7A D;  1VQ8 T;  2RPN A;  3M0Q A;  3PVL A;  4PJO G;  1AT1 B;  4OMM A;  1G3S A;  2QA4 A;  4J83 A;  3M0S A;  1ZUK A;  2X4X A;  3LWI A;  3VKI A;  3PMI A;  1AWX A;  1YJN Q;  2XD0 A;  2PVG B;  2KT8 A;  3HRT A;  1NZ9 A;  2BUD A;  4JJN K;  2ED0 A;  4B6M A;  1VYT A;  5D6X A;  1Y7X A;  1Y96 B;  1QVP A;  4XAX B;  1BI3 A;  5HKC A;  4ATO A;  5KYX A;  2F1L A;  5GAM f;  4M78 G;  1UGP B;  3KUF A;  5LJ5 j;  4HCC A;  2R58 A;  2X3W D;  1F1B B;  3KXT A;  4C0D C;  3I55 A;  3VS3 A;  1UHC A;  2K9G A;  1YIJ T;  3EG2 A;  1NYG A;  3M0T A;  4M7A E;  5KYW B;  4N4I A;  3CC4 A;  4PL6 A;  3UDC A;  2FL7 A;  4N0A A;  3TRE A;  4CI0 C;  1OYX A;  1UB4 A;  3P8B B;  4LUD A;  2H8H A;  2MPX C;  1K4U S;  1RAC B;  2GTO A;  4RTX A;  4KGV B;  1LPL A;  3EFS A;  4FYV B;  3I55 T;  2G6F X;  1ZX6 A;  3L1A A;  4ZTJ A;  1IGQ A;  4JPB W;  1KHC A;  3VS2 A;  1S72 A;  2RI2 A;  2K4Y A;  2PVO B;  3C95 A;  4A53 A;  3BW1 A;  2DPP B;  5A0D A;  3OYG A;  2KDS A;  2JZ2 A;  4M7A F;  3VS5 A;  8AT1 B;  4X1V A;  4E7S A;  4FIB A;  4FT2 A;  4JRP A;  1BB9 A;  1VQ5 A;  1RLQ C;  4X34 A;  5GAN h;  1LCK A;  1WXT A;  4FM4 B;  1SSH A;  3RIR A;  5GAO q;  2A37 A;  1HSQ A;  3M55 A;  2HBW A;  2KMT A;  2O01 E;  3UWN A;  3JB9 G;  4EPC A;  1WXU A;  1I8F A;  1TXQ A;  3A8G B;  4Y28 E;  2DK3 A;  1ZSG A;  2Z0W A;  2JS2 A;  2PU9 B;  4DBF A;  4WCI A;  2J06 A;  2XHC A;  5C0M A;  4MZT A;  5LJ3 e;  3R6N A;  2QK0 A;  3GP8 A;  4OMN A;  3CD6 T;  3UA6 A;  3M5A A;  4F7U A;  2M9U A;  1FMK A;  2RQV A;  4M75 F;  4C92 B;  5KYU B;  2QEX Q;  4EMH A;  4OGE A;  4A4H A;  3S3N A;  2VUB A;  2KE9 A;  3TEE A;  4PJO F;  3X26 B;  3SHW A;  3CBM A;  1EX4 A;  3UAT A;  4PJO A;  4IIO A;  3RDV A;  1KC8 C;  2O88 A;  4GY5 A;  5CKB A;  2E10 A;  1WGS A;  3X24 B;  4ZN1 A;  3I9Q A;  3CCE Q;  1BBZ A;  1K1Z A;  4PFP A;  4XU0 A;  4M75 D;  1WIE A;  4C8Q E;  1G3W A;  2EGC A;  4E7I A;  2EYY A;  4L5G A;  1CSK A;  2QGF B;  1M1F A;  3CCE T;  1GBQ A;  3M0U A;  4M77 G;  4BE1 A;  3OS0 A;  2A7Y A;  5HCK A;  1WNL A;  5GAO n;  2GGR A;  3A8M B;  1OI1 A;  1NE8 A;  3QXE B;  5CKH A;  3CC2 Q;  3BDU A;  1QCF A;  2DIG A;  3X28 B;  5FRM A;  2F2V A;  3L2Z A;  1SRL A;  2E1H A;  4M77 E;  3EGD B;  3MP6 A;  5LJ3 j;  1GFC A;  4Y91 A;  4OB2 B;  2CRE A;  3VYG A;  5GAN g;  2Y90 A;  2EYQ A;  1DJ7 B;  2V26 A;  2MF2 A;  2LQK A;  1TUG B;  1W2B P;  3LH5 A;  1JBM A;  2DEQ A;  2EQU A;  4WF2 A;  2IIM A;  3CMA A;  3J81 E;  1W6X A;  5IHI A;  3OBW A;  3E9F A;  2G3R A;  2JXB A;  1UGS B;  4M7A B;  1FX7 A;  1OX8 A;  2JN0 A;  1TOV A;  4M78 C;  4E7L A;  1C0M A;  1HJD A;  5A2Q E;  1IB8 A;  3JAM E;  2FB7 A;  2DZ9 A;  4M7D B;  1SEM A;  3WXM B;  1C6V X;  1YIJ A;  4J9F A;  1IGU A;  1QP2 A;  4C92 D;  2XIC A;  1YHQ A;  2P0Q A;  3BY7 A;  2DTH A;  4R56 A;  1G3T A;  1Q82 U;  4XK8 E;  3SDZ A;  2HNI A;  2KRO A;  4IUT A;  2QQB A;  1T3L A;  2RHI A;  2JNG A;  2PQW A;  3CCU T;  5GAM h;  3RES A;  1CKB A;  2CT4 A;  2MIO A;  5GMK h;  2YUO A;  2LTO A;  5I22 A;  3FDR A;  5GAM e;  1N8R C;  2SEM A;  3M58 A;  1YJW Q;  2RJD A;  1B3Q A;  1RAG B;  1AZE A;  2DER A;  4DA4 A;  1NYF A;  3DLM A;  2EKO A;  2CH4 A;  4EIK A;  3JSC A;  4DEX A;  3LW5 E;  1ABQ A;  2M16 A;  4C92 C;  1K9M C;  2DD5 A;  1AD5 A;  2C06 A;  1ZSZ C;  2RK2 A;  4M77 D;  3OYH A;  3KFV A;  1IHV A;  3CCR T;  3PIO A;  3GNG A;  3FJP A;  1N9S A;  1JRI A;  1M30 A;  3C0C A;  4PJL A;  3OYJ A;  3G7Z A;  2B8A A;  2XKO C;  3QDR B;  1G5V A;  4EMK A;  3OYL A;  3QWX X;  2DD4 A;  3EGX B;  4AMC A;  5CK9 A;  2OTL T;  3E19 A;  1YN8 A;  1UJ0 A;  5CVI A;  1SF9 A;  1AWW A;  2ZPF B;  3H0I A;  2FZK B;  2LJ1 A;  1UJY A;  1MMA A;  3QJY A;  3MEV A;  5LJ5 d;  1VQN A;  4FSS A;  2O2O A;  5DLQ E;  5M9O A;  1RAF B;  5LJ3 d;  1X2K A;  4HCK A;  3OW2 A;  4O6J A;  3L2R A;  4AG2 C;  4C8Q F;  1UG1 A;  1YIT Q;  4AFU C;  2CDT A;  4KUD K;  3EGD A;  2BE9 B;  2X4J A;  5KYY A;  4BDZ A;  4JRK A;  5FU6 C;  1VQM T;  2DL3 A;  3C12 A;  4LXC A;  3FB9 A;  2VGN A;  3SB2 A;  3X25 B;  2CP5 A;  5IT9 E;  2GBQ A;  5D6Y A;  4M7A C;  1FMV A;  4J8O A;  4J9G A;  4LD6 A;  4RTT A;  2HSE B;  1PKT A;  3CBP A;  3CCV T;  2K6D A;  1V76 A;  1WXB A;  2L5Q A;  1AEY A;  1FXX A;  4BAC A;  2K3B A;  3NMZ C;  1ZBJ A;  3LX7 A;  5FWB A;  1G2B A;  4AFZ C;  3VJP A;  4F7U E;  2JM9 A;  4BI3 A;  5GAM j;  2KAF A;  3OYK A;  1V29 B;  3CC7 T;  1C1A A;  2DL8 A;  4PJM A;  2M1H A;  2NUP B;  1U06 A;  1PCX A;  3A8L B;  2LCS A;  5CKF A;  3G4S A;  2D0N A;  2LRQ A;  1MV3 A;  3H0F A;  4Z89 A;  2RI3 A;  2AKL A;  2RQU A;  3CMA T;  3G71 A;  2CP6 A;  1QCO A;  3M57 A;  2NUT A;  4M75 C;  2E41 A;  2D8J A;  3V8K A;  1SKU B;  4ME7 A;  4M4Z A;  1VQ6 T;  2K3X A;  5IHN A;  3M4G A;  2EKH A;  3A8O B;  4IIM A;  1X6B A;  3DB4 A;  3TU4 K;  2HZY A;  3AT1 B;  2K5I A;  1VQ5 Q;  2GF7 A;  1OV3 A;  2ZPB B;  1WZO A;  4GBQ A;  2DIL A;  4RTV A;  4XTX A;  1PD0 A;  3HPW A;  3L2V A;  2DA9 A;  3V7R A;  1U1T A;  3CCL Q;  3G6E A;  2J6O A;  2ECZ A;  3QWY A;  1AWO A;  2FYK A;  2FZC B;  3EG0 A;  1WLP B;  4LDW A;  1M1K U;  5KCO A;  3MCA B;  4Z02 A;  2EGE A;  2QXF A;  2PVD B;  2DXB A;  5C6S A;  1YJ9 Q;  1NEG A;  5GMK m;  2MMP A;  1QLY A;  3BDL A;  5GAM d;  3GBQ A;  1G83 A;  4PJO B;  2KXC A;  2BTT A;  3GLX A;  2EFI A;  1WQ7 A;  4FL6 A;  1IZ6 A;  5D6W A;  2M0O A;  4QQ6 A;  2JJ9 A;  1Q81 C;  1M8V A;  2KBT A;  3C4S A;  2F5T X;  1WJQ A;  1WJR A;  2E6Z A;  3A98 A;  1K76 A;  1Q7Y R;  4E7J A;  4JZ3 A;  2VV5 A;  4HCB A;  2QG9 B;  1VQP T;  2ZPI B;  2L3P A;  4RUG A;  2XG8 D;  2FRY A;  1TUD A;  4KGZ B;  1IRX A;  4OML A;  2QTV A;  4RTZ A;  4X9C A;  4F14 A;  3MO8 A;  3L2W A;  2DXT A;  2QQR A;  4JDS A;  5GAN 6;  1K8A R;  2MK5 A;  2A36 A;  1UE9 A;  1VQN Q;  1PNJ A;  3JB9 H;  4JZ4 A;  4OGC A;  2DET A;  1MHN A;  3HKS A;  4CRI A;  3EHR A;  4NL3 A;  3QYH B;  1QQJ A;  3REA B;  2B86 A;  1UHF A;  3I56 T;  5GAO m;  1OEB A;  1OPL A;  2BZ8 A;  3RER A;  1O75 A;  4J9H A;  4AFS C;  1X6O A;  2X51 A;  2D8H A;  5J3B A;  1VQL T;  1AZG B;  5IXB A;  5GJV B;  3H6Z A;  1N9R A;  4C8Q A;  1I07 A;  1VQK T;  3VS1 A;  1RAE B;  1NJI R;  5GMK j;  2GFU A;  3G6E T;  4FU6 A;  1VQ4 T;  1WHK A;  1YCS B;  1NPP A;  4HKE A;  4QT7 A;  4M7D F;  2RF0 A;  2R5A A;  5GMK l;  5GAO r;  3M0R A;  3EHQ A;  2CUB A;  1YJN A;  5GAM g;  2CT3 A;  1UGR B;  3D7S B;  3OSS C;  2PUO B;  1P92 A;  1Q82 R;  4JUV A;  3UF4 A;  1B7T A;  1VQ6 A;  3OYC A;  3T9N A;  4ZGJ B;  1ABO A;  4QVC A;  3CQT A;  3CCJ A;  1VQ5 T;  1XJW B;  2HQX A;  2Y4X A;  2D0Q B;  4IUR A;  4ELY C;  2JT4 A;  4B9W A;  3JB9 D;  3QZ9 B;  4C5H A;  1M2V B;  2ROT A;  2VWF A;  2V1R A;  2EYZ A;  4KH0 B;  4OB0 B;  4MZM A;  2VAS A;  3GOX A;  1JB0 E;  2COY A;  2K5F A;  2I2L A;  4DBQ A;  1RL2 A;  1YHQ T;  4Y92 A;  5FW9 A;  2RI5 A;  4LDU A;  4BDY A;  1SSF A;  3H8Z A;  2FHD A;  1JJ2 A;  3PT9 A;  2CGH A;  3FIF A;  4M78 A;  1OQK A;  3CC7 A;  2KQW A;  5GAN d;  3KBG A;  5GAN 8;  4BUG A;  2HDA A;  2CUD A;  2DRK A;  1S72 Q;  2D9T A;  4GLK A;  3SD4 A;  2QQS A;  1X69 A;  2W0Z A;  2JS0 A;  4N4G A;  4BB7 A;  3JCM V;  2DTI A;  4IUV A;  3I56 Q;  3G6E Q;  2DIQ A;  2WSC E;  3CPF A;  4C8Q G;  2PNI A;  3NHN A;  2CZ1 B;  2V1Q A;  1G3Y A;  3I56 A;  4F7U F;  2M02 A;  4QW2 A;  4J9D A;  2YLC A;  3CD6 Q;  2KRS A;  3F70 A;  4AFQ C;  2EQK A;  2LMJ A;  4M7D D;  4M75 E;  4C8Q D;  2YUN A;  4N4H A;  1VYU A;  2ZPE B;  2JM8 A;  3CCE A;  2DM1 A;  1T0J A;  1I5L A;  2JTM A;  2FPD A;  3H0H A;  1KJW A;  1T3S A;  2QDY B;  4EDU A;  2WAC A;  2PUK B;  3M53 A;  2MWO A;  2CP0 A;  1VQN T;  2AKK A;  2FG0 A;  5LJ3 h;  1OZ3 A;  4C92 G;  1WHG A;  2LQN A;  3RKW A;  2FPF A;  4OMQ A;  2RMO A;  4D6W A;  4CC3 A;  1D09 B;  1QW1 A;  1JO8 A;  4B9X A;  2J6F A;  1O9S A;  3VUZ A;  3JRZ A;  5IN1 A;  2EGA A;  3ZEH A;  4ORZ A;  2KI7 A;  1Q7Y U;  2YUQ A;  3I5R A;  4PLL A;  2LT1 A;  3CCL T;  1UEC A;  3A1P A;  3VS6 A;  4D8K A;  2X4Y A;  2DE0 X;  1OPK A;  3REB B;  4IUP A;  3QYG B;  3DKM A;  4RCC A;  1AHJ B;  5HK3 A;  1WX6 A;  4PK4 A;  1MUZ A;  2A28 A;  1R8O B;  1OZ2 A;  4V2S A;  2RO0 A;  4WTO B;  3PNW C;  1R0B G;  1Y71 A;  4F16 A;  2COW A;  2QQA A;  1K0S A;  3P8D A;  3J80 E;  4OP0 A;  1YHQ Q;  5KYU A;  4C92 A;  2QQ9 A;  4LN2 A;  4EMK B;  3RNJ A;  4HVU A;  3PVQ A;  6AT1 B;  3M59 A;  3G4S Q;  1JJ2 S;  2RQR A;  2COZ A;  3JCM W;  2V8J A;  3RMQ A;  2X9H A;  3NTH A;  1R77 A;  1WQW A;  1PC0 A;  4JRI A;  2LCC A;  5KYX B;  3INZ A;  1I0C A;  4M7D A;  1PSE A;  4KUL A;  2AIR B;  2RB6 A;  3PTA A;  4ESR A;  1NJI U;  3JB9 J;  1FYN A;  3OYN A;  2EBP A;  2AK5 A;  1BIA A;  1VQ4 A;  1FWZ A;  4F17 A;  2ROL A;  3OQ5 A;  1LNX A;  1JEG A;  1H3Z A;  4FW1 A;  1PWT A;  3TQ7 P;  4HT9 A;  1VQK A;  2GTJ A;  2RHY A;  5FU7 C;  2K5L A;  1VQ9 A;  1SRM A;  2EAY A;  1D3B A;  2R57 A;  3PE0 A;  1KQS S;  2L3Q A;  5GAN 2;  2A08 A;  1BYM A;  3BE3 A;  4M77 F;  2L8D A;  2QTX A;  2XDP A;  1JXO A;  1M27 C;  1VQ7 A;  4FCY A;  3OYI A;  2ZGW A;  2RNA A;  2K2M A;  3TSZ A;  3QSU A;  5GAO l;  1QVF P;  2RD1 A;  4PFZ A;  3LWH A;  4M7A A;  2ZPH B;  1M5Q 1;  2K7A A;  2K79 A;  3VRY A;  1ZQ1 A;  2QA4 T;  4JS4 A;  4LUE A;  1XNI A;  4ZGD B;  2X4W A;  2JTE A;  2KYB A;  2HBP A;  2ZPG B;  3LH0 A;  1UUE A;  2OTJ A;  4DBH A;  4ELZ C;  4A54 A;  1GBR A;  1YBY A;  2HD0 A;  2JMA A;  2OAW A;  3CC2 T;  2O4X B;  1VQ8 A;  1NPR A;  3MEU A;  1H92 A;  1MNE A;  2XDD A;  5KYW A;  1AWJ A;  4M78 E;  3CXC A;  2OTL Q;  1BI1 A;  2EJG A;  1Q81 R;  3ULR B;  3QG1 A;  1IHW A;  1FMW A;  3IQL A;  2ED1 A;  1TS9 A;  4FYX B;  2JOY A;  4E7K A;  3RR6 A;  3JCM g;  1KHI A;  1M3B A;  1QWF A;  1N5Z A;  2KSS A;  3JCM P;  3V8L A;  1V1C A;  4M75 A;  2EWN A;  1UTI A;  2RJC A;  2IVW A;  4KH1 B;  5FU6 B;  3AHU A;  1UFF A;  4OMO A;  4L59 A;  3PIP A;  3M0P A;  2LC4 A;  3HRU A;  2E12 A;  1WA7 A;  1YP5 A;  2EQM A;  4E7H A;  4XTW A;  2RQT A;  3OW2 S;  2DMO A;  3E9G A;  2MWP A;  3OYM A;  3QZ5 B;  3WVD B;  1Q86 C;  1OOT A;  1QKX A;  3X20 B;  3VS7 A;  1WPY A;  7AT1 B;  2DJQ A;  1EZZ B;  5ECA A;  1KFZ A;  3NGP A;  4C8Q B;  1E6G A;  2RA2 A;  5LJ5 g;  2MOX A;  4IUU A;  5AYF A;  2KRN A;  2JUF A;  2AZS A;  1U5S A;  1Y57 A;  2DVJ A;  1YJW T;  3CC4 Q;  3ASK A;  2HSP A;  3QO3 A;  3CCQ Q;  1G8X A;  3I35 A;  4J6Y A;  1WHM A;  1M1K C;  3JV3 A;  4QQG A;  1HK9 A;  1Y0M A;  3M9Q A;  4F04 B;  2Y4Y A;  5GMK i;  2DX1 A;  2RJE A;  2YHT A;  2M0Y A;  4KT0 E;  2OX7 A;  5AT1 B;  2C0I A;  4A4K A;  1WHH A;  2EPD A;  3HTR A;  1X75 C;  4OMP A;  2CP2 A;  2AT1 B;  2RHU A;  1SHG A;  2DL5 A;  3OS5 A;  2O31 A;  3E2U A;  4KRT A;  4CC4 B;  3LYI A;  2XI9 A;  2X3X D;  1W4S A;  4HVV A;  4NL2 A;  3VS4 A;  3CCQ T;  1GRI A;  4XTZ A;  2FEI A;  1K9M R;  2EQJ A;  2KNB B;  4RCB A;  4XTV A;  1S1N A;  5LJ5 e;  2HAX A;  3M56 A;  4M7D G;  1U8R A;  4RTY A;  3QDF A;  5GAN 5;  4PJN A;  4QVZ A;  2DXC A;  4BI8 B;  5EC7 A;  5HK0 A;  3TSW A;  2DEU A;  4DEY A;  3ME9 A;  1KG1 A;  5FRN A;  3RKX A;  1U1S A;  2J05 A;  4J9E A;  4MML A;  5CO7 A;  5GAN 4;  1AOJ A;  1TG0 A;  2KR3 A;  3ZL7 C;  2M51 A;  3S3O A;  3JCM e;  1LOJ A;  4ZNX A;  2BE7 D;  2K57 A;  4JLG A;  3VRZ A;  5I2S A;  2KVQ G;  2JW4 A;  4OB3 B;  1E7O A;  4C0G A;  1KQ1 A;  2OJ2 A;  4OMF B;  2PTK A;  4JJC A;  1VQ8 Q;  1M3A A;  3PFS A;  4FW2 A;  3H41 A;  3OS1 A;  3CPW A;  2IPO B;  1N8R R;  1Z9Z A;  3GF5 A;  1VYV A;  1D1C A;  1PRL C;  1K8A C;  1HYO A;  2QEX T;  1QWE A;  1QVF A;  5GAN 7;  3CC2 A;  1K9A A;  1ZUU A;  2EIF A;  2XK0 A;  4JJB A;  5HY6 A;  2FRW A;  4ZGE B;  1T0H A;  4R55 A;  5KYY B;  5FU7 B;  2VC8 A;  1XQH A;  4HCZ A;  2WSF E;  3FEO A;  3VYH B;  2W10 A;  4NOY A;  1MMG A;  3OYY A;  5KYN A;  4E6R A;  1ZA2 B;  2K3Y A;  2ENM A;  5I11 A;  1BIB A;  4F7U B;  4DBR A;  4A4G A;  9ATC B;  1GCQ C;  3CMA Q;  1K73 C;  3MJX A;  3CCU A;  2CP7 A;  2CH4 W;  3CCJ T;  1VOM A;  1VQ4 Q;  5KE2 A;  2BZY A;  3MHX A;  3HFO A;  2QYZ A;  2C0O A;  2DLP A;  2RHX A;  2XMF A;  5FWC A;  3CPW S;  3CCU Q;  3SWN A;  2DAQ A;  2MAM A;  2P4R A;  3V7S A;  1PG5 B;  4M7D E;  3OY9 A;  1VQL Q;  4E47 A;  1VQ9 Q;  2BIV A;  2H3E B;  3ER0 A;  4PJO D;  4KGX B;  3THK A;  1VIE A;  1YFN A;  5GMK e;  1Q81 U;  4XU2 A;  3SEM A;  3DLL A;  4F7U G;  2J6K A;  4J9B A;  3CC7 Q;  1BI0 A;  5CQY A;  3OMG A;  2FPE A;  4LNP A;  3CCL A;  2CSQ A;  2P4T A;  3EFO A;  3SWN C;  1RAA B;  2LZ6 B;  4KUI A;  2WSE E;  2D6F A;  3FRN A;  3PGG A;  2DJZ A;  3CEY A;  2DBM A;  1IRE B;  3FC3 A;  3GPL A;  3LGF A;  5L23 A;  1YI2 A;  1QP3 A;  2HKN A;  1EFN A;  1YJ9 A;  3O5Z A;  4QKU A;  2EW3 A;  3NFC A;  4FYW B;  4K11 A;  1D1A A;  3HSB A;  2HKQ B;  1W2B A;  3CCV Q;  1VQM A;  2A0F B;  2GNC A;  3CXC S;  3A8H B;  2EVR A;  4PNO A;  3A5Z B;  1QCN A;  1RI0 A;  1WFW A;  3EG1 A;  1UEB A;  4M7D C;  1WJS A;  4PJJ A;  3N5B B;  2MYS A;  4XU1 A;  1K73 U;  2E70 A;  4ZTF A;  4FYY B;  3S3M A;  3EFO B;  4BI4 A;  4M78 F;  1I81 A;  4M78 B;  1D0X A;  1ZSZ A;  2XU8 A;  2P0P A;  4OVA A;  1GXI E;  3M54 A;  2E3H A;  1PHT A;  4RTW A;  3JCM b;  4GLM A;  4CC7 A;  1QMC A;  1QVG A;  1W2B S;  1VUB A;  2F2W A;  2GQV A;  4J9I A;  1X2Q A;  3CME T;  1MV0 B;  1M9S A;  1AVZ C;  2LNV A;  2YWW A;  2HQH A;  2RHZ A;  1K8A U;  2QAS A;  3CD6 A;  1KQS A;  2VGM A;  3RBB B;  4LDV A;  4C0Z A;  1GL5 A;  2YT6 A;  4E7Z A;  3OYE A;  4R0K A;  1X6G A;  1TWB A;  2YRV A;  1ZBX A;  1IO6 A;  3NTI A;  3UA7 A;  5DY9 A;  3O8V A;  5DM7 R;  4DQ2 A;  1U3O A;  2L3R A;  1UGQ B;  3HL8 A;  2CKK A;  5KCH A;  3JCM d;  1MND A;  5CAI A;  3OYD A;  4JLI A;  5GAN 3;  1HD3 A;  3GIB A;  2KXD A;  1WYX A;  5FLX E;  4UC4 A;  2ATC B;  1ACM B;  1ZSZ B;  2ZZD A;  4C0D B;  1VQO T;  3OYA A;  5J39 A;  2L0A A;  1JJ2 P;  2LVM A;  4HA8 A;  1Q86 U;  2LDM A;  2KGT A;  2DO3 A;  5LL6 S;  2DF6 A;  1VQ7 T;  2HCK A;  1KIK A;  1XTD A;  3MKD A;  3SWN B;  3G71 Q;  2KT1 A;  2CZ6 B;  3CCJ Q;  4C92 F;  1VQ9 T;  2X35 A;  4RG8 A;  2DKG A;  4ZN3 A;  4BD3 A;  1B34 A;  1Q95 G;  3G4S T;  3BFM A;  2AZV A;  2QGG A;  1NBE B;  2EYW A;  4Q5W A;  3L2U A;  3JCM f;  1BCO A;  2VXE A;  3OYF A;  2NUP A;  1VQL A;  1QVG S;  5IHK A;  4J9C A;  3SFM A;  2DTO A;  3HP9 A;  3OW2 P;  1KQS P;  1ZLM A;  2E65 A;  3WVE B;  4XQ3 A;  1RI9 A;  3EGX A;  4N0A C;  2F69 A;  3JCM Q;  4QVD A;  3L42 A;  2KY9 A;  1VQO A;  4RKU E;  2DYI A;  4C92 E;  3P8H A;  2O9S A;  2ZAE A;  1RAB B;  3FLG A;  2LT4 A;  1YI2 Q;  2D1X A;  1N6A A;  3GNF B;  3V8J A;  2XDB A;  3UPU A;  4Z8A A;  4M7A G;  1D1B A;  3EG3 A;  4ANJ A;  2P84 A;  3CBO A;  4O5V A;  1YJN T;  1VA7 A;  1X01 A;  3R6O A;  4M75 G;  1N8R U;  1VQK Q;  4M78 D;  4BY6 C;  3HHT B;  2EQI A;  2NUZ A;  1HXD A;  1OU8 A;  1MMD A;  3OSV A;  1BU1 A;  5CIU A;  2L89 A;  8ATC B;  1D0Z A;  4JS5 A;  3OBY A;  3CCR Q;  2AHJ B;  5KE3 A;  3JB9 F;  3ZFJ A;  4XU3 A;  2F5K A;  2RK1 A;  4VUB A;  3NTK A;  3CME A;  5L8R E;  4MMK A;  1Q82 C;  2LJ0 A;  1ZA1 B;  5EG2 A;  2JMC A;  2DL7 A;  5IH2 A;  2J7I A;  3OS2 A;  1M90 C;  1BKB A;  1RUW A;  3MP8 A;  2L2P A;  2A3L A;  1TU0 B;  1LVK A;  2OAU A;  4OF1 A;  1K73 R;  1NLO C;  2ABL A;  4LDY A;  4II1 A;  4J7F A;  2BZX A;  1RLP C;  4BE2 A;  4PJO E;  3QII A;  2VVK A; 
#chains in the Genus database with same CATH homology
 1YWO A;  1RLQ C;  1SHG A;  2DL5 A;  1OEB A;  2O31 A;  4KRT A;  1OPL A;  2BZ8 A;  4CC4 B;  2LNH B;  1LCK A;  1WXT A;  4J9H A;  1SSH A;  4AFS C;  2X3X D;  2RQW A;  4HVV A;  2A37 A;  1HSQ A;  3VS4 A;  1GRI A;  2HBW A;  2FEI A;  2D8H A;  1AZG B;  2KNB B;  5IXB A;  1WXU A;  2DYB A;  1S1N A;  5GJV B;  4AG1 C;  1I07 A;  3VS1 A;  1ZSG A;  2JS2 A;  4RTY A;  1SPK A;  4WCI A;  2J06 A;  1YWP A;  2LX7 A;  1YCS B;  3R6N A;  2KEA A;  4QT7 A;  4OMN A;  2RF0 A;  3UA6 A;  5EC7 A;  3M0R A;  2LQW A;  3EHQ A;  2CUB A;  1FMK A;  3TSW A;  2CT3 A;  2EYX A;  2RQV A;  4DEY A;  2LP5 A;  2KE9 A;  3UF4 A;  2J05 A;  4J9E A;  2MCN A;  1AOJ A;  2DRM A;  1ABO A;  1TG0 A;  3CQT A;  3I5S A;  2KR3 A;  3SHW A;  3UAT A;  2M51 A;  4IIO A;  3ZL7 C;  2O88 A;  4ZNX A;  1QKW A;  2JT4 A;  3FJ5 A;  3I9Q A;  1BBZ A;  1K1Z A;  3VRZ A;  2ROT A;  1WIE A;  2VWF A;  2JW4 A;  2EGC A;  2V1R A;  2EYZ A;  2EYY A;  1CSK A;  1E7O A;  1GBQ A;  2OJ2 A;  2PTK A;  3M0U A;  4JJC A;  1GFD A;  1M3A A;  1CKA A;  3H41 A;  5HCK A;  2GGR A;  4Y92 A;  5FW9 A;  1JU5 C;  1NG2 A;  1Z9Z A;  2F2X A;  1VYV A;  1QCF A;  1PRL C;  3NPF A;  4D8D A;  1PRM C;  2F2V A;  1SRL A;  1QWE A;  3U23 A;  1GFC A;  2CUD A;  2HDA A;  2DRK A;  2CRE A;  2VKN A;  1K9A A;  1ZUU A;  1NM7 A;  4JJB A;  1X69 A;  2C0T A;  2FRW A;  1T0H A;  2JS0 A;  2W0Z A;  3LH5 A;  5GJW B;  1A0N B;  2PZ1 A;  2IIM A;  2W10 A;  4E6R A;  1W6X A;  5IHI A;  1YNZ A;  2ENM A;  5I11 A;  4LE9 A;  2JXB A;  2PNI A;  3NHN A;  2V1Q A;  1M3C A;  1GCQ C;  1JXM A;  2YDL A;  1HJD A;  4J9D A;  2CH4 W;  2KRS A;  1SEM A;  4AFQ C;  2LMJ A;  2DL4 A;  4J9F A;  1KSW A;  2BZY A;  2YUN A;  2QDL A;  1ARK A;  1VYU A;  2CSI A;  2C0O A;  2DLP A;  2JM8 A;  2XMF A;  1W1F A;  5FWC A;  2DM1 A;  1T0J A;  2P4R A;  2I0N A;  1GCP A;  2FPD A;  3H0H A;  1KJW A;  1T3S A;  2KRO A;  2AKK A;  2FG0 A;  1T3L A;  1GCQ A;  2KRM A;  2FO0 A;  2LQN A;  1I1J A;  3THK A;  1CKB A;  2CT4 A;  2FPF A;  4OMQ A;  2RMO A;  2MIO A;  4CC3 A;  2HEQ A;  1NLP C;  1JO8 A;  1H3H A;  2GQI A;  3SEM A;  2YUO A;  2J6F A;  2J6K A;  5I22 A;  3TVT A;  4J9B A;  2FPE A;  2LJ3 A;  2SEM A;  4LNP A;  1B3Q A;  2CSQ A;  1AZE A;  2EGA A;  4ORZ A;  2LZ6 B;  1NYF A;  1SHF A;  2YUQ A;  2L3S A;  3I5R A;  1UEC A;  2CH4 A;  4EIK A;  2DBM A;  4DEX A;  3VS0 A;  1ABQ A;  3VS6 A;  4D8K A;  1AD5 A;  5L23 A;  2DE0 X;  1OPK A;  1EFN A;  1TUC A;  3O5Z A;  1X27 A;  3REB B;  4RTU A;  2EW3 A;  1JQQ A;  3KFV A;  4K11 A;  1E6H A;  1B07 A;  1K0X A;  1M30 A;  3C0C A;  1WX6 A;  2GNC A;  2EVR A;  1MUZ A;  2A28 A;  1WFW A;  3EG1 A;  4HVW A;  3QWX X;  4F16 A;  1K0S A;  1YN8 A;  1UJ0 A;  1UGV A;  1AWW A;  3H0I A;  4LN2 A;  2O9V A;  2LJ1 A;  2KYM A;  3RNJ A;  4HVU A;  3PVQ A;  1UJY A;  5IXF A;  2RQR A;  1M8M A;  1H8K A;  2YSQ A;  1PHT A;  4FSS A;  4RTW A;  4GLM A;  4CC7 A;  2O2O A;  1NEB A;  2F2W A;  1X2K A;  4HCK A;  4J9I A;  1X2Q A;  1I0C A;  4AG2 C;  1MV0 B;  2SRC A;  1UG1 A;  1AVZ C;  4ESR A;  4AFU C;  2CDT A;  2ESW A;  2E5K A;  2DNU A;  1FYN A;  3RBB B;  2EBP A;  2AK5 A;  1GL5 A;  4F17 A;  2ROL A;  2YT6 A;  1WDX A;  2DBK A;  2DL3 A;  1JEG A;  1X6G A;  4R0K A;  1PWT A;  1IO6 A;  2GBQ A;  3UA7 A;  4J9G A;  4RTT A;  4A63 B;  1PKT A;  1U3O A;  1WXB A;  2K6D A;  4HXJ A;  1AEY A;  2GTJ A;  3EGU A;  1SRM A;  2K3B A;  3NMZ C;  3PE0 A;  1HD3 A;  2YUP A;  2KXD A;  2L3Q A;  1WYX A;  1BK2 A;  2A08 A;  4CC2 A;  1ZBJ A;  5FWB A;  1JXO A;  1G2B A;  1M27 C;  1PKS A;  4AFZ C;  2L0A A;  2JM9 A;  2OI3 A;  2RNA A;  1Z9Q A;  2K2M A;  3TSZ A;  2KGT A;  2DL8 A;  1WI7 A;  2DF6 A;  1U06 A;  2HCK A;  1KIK A;  1X43 A;  2LCS A;  2NWM A;  2KT1 A;  2K7A A;  2K79 A;  1J3T A;  2D0N A;  3VRY A;  1MV3 A;  3H0F A;  4LUE A;  4Z89 A;  2JTE A;  2KYB A;  2RQU A;  2AKL A;  1W70 A;  1UUE A;  4JJD A;  4Z88 A;  1GBR A;  2JMA A;  2OAW A;  2D8J A;  2AZV A;  1UDL A;  1H92 A;  2RN8 A;  1ZUY A;  1AWJ A;  1XOV A;  2EYW A;  4M4Z A;  3ULR B;  2RPN A;  3M0Q A;  3PVL A;  3IQL A;  5IHK A;  4J9C A;  5IHN A;  4OMM A;  2ED1 A;  2EKH A;  4IIM A;  1X6B A;  1ZLM A;  3M0S A;  1M3B A;  1QWF A;  1ZUK A;  1N5Z A;  1V1C A;  1RI9 A;  1UTI A;  1AWX A;  2KT8 A;  1OV3 A;  4GBQ A;  4RTV A;  2DIL A;  2ED0 A;  2DA9 A;  1UFF A;  4OMO A;  3M0P A;  1VYT A;  2J6O A;  2ECZ A;  1WA7 A;  3QWY A;  1AWO A;  1YP5 A;  3EG0 A;  1WLP B;  2RQT A;  2DMO A;  2O9S A;  2EGE A;  1OOT A;  1QKX A;  3VS7 A;  2D1X A;  1NEG A;  2X3W D;  2DJQ A;  5ECA A;  1KFZ A;  4Z8A A;  1QLY A;  3EG3 A;  3NGP A;  1E6G A;  1UHC A;  2K9G A;  3VS3 A;  3GBQ A;  1G83 A;  1VA7 A;  2KXC A;  3EG2 A;  1NYG A;  2BTT A;  3M0T A;  2MOX A;  2EQI A;  2NUZ A;  2KRN A;  2AZS A;  2KBT A;  1U5S A;  1BU1 A;  3A98 A;  1Y57 A;  4LUD A;  2DVJ A;  1K76 A;  4JZ3 A;  2H8H A;  2HSP A;  1K4U S;  3I35 A;  2L3P A;  4RUG A;  2GTO A;  2FRY A;  1TUD A;  3JV3 A;  4OML A;  4RTX A;  1Y0M A;  2G6F X;  4RTZ A;  2DX1 A;  2LJ0 A;  4F14 A;  1ZX6 A;  4JPB W;  2JMC A;  3VS2 A;  2DL7 A;  5IH2 A;  2J7I A;  2A36 A;  1UE9 A;  1PNJ A;  1RUW A;  2M0Y A;  4JZ4 A;  2L2P A;  3VS5 A;  2C0I A;  3EHR A;  4X1V A;  1NLO C;  2EPD A;  2ABL A;  4OMP A;  2BZX A;  3REA B;  1RLP C;  2B86 A;  1UHF A;  2VVK A;  1BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...