1GCQC

Crystal structure of vav and grb2 sh3 domains
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
GSHMPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcqC00
2DX1A 1X6BA 3H0HA 2CREA 3I5SA 1QCFA 1RLPC 4JPBW 2W0ZA 2HSPA 5IHKA 4KRTA 1Z9QA 5L23A 1K0SA 3VS6A 1VYUA 3ULRB 1TUCA 1JO8A 1AVZC 2LJ0A 1UDLA 1PHTA 2M51A 4AG2C 1OOTA 2EKHA 3PVQA 1KJWA 1PNJA 2KT8A 4RTYA 4F17A 1S1NA 2F2WA 2BZYA 1UHCA 4J9HA 1VYTA 2DILA 1GL5A 1BB9A 2C0OA 1ABOA 1GBRA 3EHQA 3SHWA 4J9GA 1WIEA 2PTKA 1WYXA 1MUZA 5I11A 1W6XA 1OEBA 5IHNA 1I0CA 1OPLA 1TUDA 1WI7A 1AWXA 2CH4A 3R6NA 1ZLMA 2AZSA 1NLPC 2LNHB 2L3SA 1X2KA 2ENMA 1ZX6A 2YUOA 5IHIA 2FO0A 2IIMA 2DE0X 3C0CA 2L2PA 4M4ZA 2KRSA 2YSQA 2EVRA 1MV0B 1NG2A 2AKKA 3VS0A 3GBQA 2EGAA 1H3HA 1LCKA 1AOJA 2K7AA 2O88A 4J9CA 2KXDA 3VS5A 1B07A 2HBWA 2YUPA 4J9DA 3UF4A 3H0IA 2O31A 1YN8A 2VWFA 2F2VA 2QDLA 4RTXA 2DLPA 2GGRA 2M0YA 3QWXX 2SEMA 1QKWA 1BBZA 1T0HA 2FRYA 2JMAA 4AFZC 1HSQA 2FPEA 2RN8A 4OMNA 3TSWA 2L0AA 2RQUA 5I22A 3VS7A 2ROLA 2L3PA 2D8JA 1I1JA 2O2OA 3EG1A 2CSIA 2K9GA 2EYZA 1IO6A 2FG0A 2CUDA 1UJYA 1JQQA 4J9EA 4Z88A 3JV3A 1UUEA 1E6HA 4GLMA 1U06A 1T3LA 4OMQA 4CC7A 1JEGA 1W70A 2KXCA 2JS0A 1BK2A 2LQWA 1AZEA 1K1ZA 1M3AA 2MIOA 1UHFA 4J9IA 3UA7A 4RTVA 3A98A 1ARKA 1J3TA 4K11A 5FWCA 1PWTA 1UGVA 1YP5A 4CC3A 2RMOA 4Z8AA 2J7IA 2LJ1A 1NYGA 5FWBA 2RPNA 1M27C 3U23A 2P4RA 2ED0A 1ABQA 4LN2A 4WCIA 1KSWA 2D8HA 1OPKA 3NHNA 1SHFA 4OMPA 2FPDA 2DL8A 3UATA 1X69A 1U5SA 1WX6A 1RI9A 1V1CA 5FW9A 3VS1A 3FJ5A 2A08A 4J9FA 2X3WD 3H41A 1SSHA 2LCSA 1G2BA 4JZ3A 2EQIA 5GJWB 1K9AA 2YUNA 3ZL7C 1RUWA 3QWYA 2RQVA 4OMLA 4OMOA 2LZ6B 1YNZA 2HDAA 2DM1A 4RTTA 5IXBA 4CC4B 2RNAA 2LMJA 2JS2A 1RLQC 1SRLA 2CSQA 2X3XD 1JXMA 1SPKA 1WXUA 3NGPA 3M0SA 2KE9A 4HXJA 1M3BA 1UFFA 1QWEA 2JM8A 3TVTA 4Y92A 1NM7A 3VRZA 1A0NB 3THKA 2EBPA 1AWJA 2DBKA 3M0QA 2MOXA 2A28A 2LP5A 1H8KA 2ABLA 2EYYA 2K6DA 2EYWA 4AFQC 1M3CA 2DBMA 3O5ZA 1WA7A 2J6KA 4X1VA 2DF6A 2KYMA 2KR3A 2CUBA 1GCQA 4F14A 4DEYA 4LUDA 1CSKA 2FRWA 1NLOC 1SEMA 1PRLC 1AWWA 1ZUUA 2F2XA 2BTTA 3I9QA 4ORZA 3REAB 1NEBA 2I0NA 2YUQA 2ECZA 1SRMA 2OJ2A 2ED1A 3EG0A 1Y0MA 2HCKA 4JJCA 1GBQA 2AKLA 1AEYA 4A63B 2O9SA 4CC2A 2YT6A 4R0KA 4IIMA 4E6RA 1CKAA 1AWOA 2ESWA 4QT7A 4J9BA 2RQRA 2KRMA 1ZUYA 2DL4A 4AG1C 2J6FA 4LUEA 1T0JA 1ZBJA 2JTEA 2NUZA 3H0FA 2EYXA 2HEQA 3EG3A 2KYBA 1T3SA 1W1FA 1VYVA 3NPFA 4LE9A 4EIKA 2LX7A 1OV3A 4RTUA 1HD3A 2JMCA 3M0RA 2CT4A 2L3QA 2GQIA 2DVJA 3PE0A 1MV3A 1WLPB 3IQLA 4HCKA 3CQTA 1NYFA 1YWOA 2B86A 5ECAA 2JT4A 1M8MA 1QLYA 2K79A 2OAWA 2DA9A 4JJDA 2KEAA 1WXBA 2DJQA 4D8DA 2GTJA 2RQTA 1VA7A 1UJ0A 2A36A 5IXFA 1YWPA 2LJ3A 1ZSGA 1WXTA 2KRNA 1K0XA 2OI3A 2E5KA 2D0NA 3M0TA 2CT3A 2J6OA 2SRCA 3LH5A 2EGEA 2KNBB 2KGTA 2VVKA 4JJBA 4OMMA 2DYBA 2H8HA 1FYNA 2JXBA 1WDXA 1XOVA 1GFDA 2A37A 1FMKA 2JM9A 2DMOA 1KIKA 1HJDA 1GCPA 1E7OA 4HVVA 2EGCA 1AZGB 2K2MA 2VKNA 2KROA 1U3OA 1TG0A 2LQNA 3VS4A 2DL7A 1CKBA 3RBBB 4Z89A 4JZ4A 4RTWA 2C0IA 2JW4A 1YCSB 2RF0A 1N5ZA 3RNJA 1X43A 1E6GA 3SEMA 1PKTA 1PRMC 3M0UA 2D1XA 1GFCA 3NMZC 2MCNA 2C0TA 2CH4W 3EG2A 2FPFA 2EW3A 1UECA 2V1QA 2DRKA 3PVLA 2DL3A 3EGUA 4LNPA 1Y57A 1X2QA 1JU5C 1K76A 1X27A 2DRMA 1BU1A 3REBB 3I35A 2PNIA 3TSZA 1QWFA 1PKSA 3VS2A 2G6FX 1K4US 1G83A 1H92A 1SHGA 4RUGA 1B3QA 3VRYA 2W10A 1Z9ZA 2O9VA 1X6GA 1KFZA 5EC7A 1JXOA 1M30A 3EHRA 3M0PA 1NEGA 1UE9A 1QKXA 4HVWA 2GTOA 2J06A 2BZXA 1GCQC 2NWMA 5IH2A 2KBTA 1AD5A 2KT1A 2V1RA 2XMFA 4HVUA 2RQWA 1I07A 2DL5A 4F16A 1GRIA 2DNUA 4AFSC 2K3BA 3UA6A 4D8KA 1WFWA 1ZUKA 5GJVB 1UTIA 3KFVA 2YDLA 2GNCA 4DEXA 2PZ1A 2J05A 2ROTA 4ESRA 1EFNA 1UG1A 2BZ8A 4GBQA 4RTZA 4ZNXA 2CDTA 4AFUC 2AK5A 2AZVA 2GBQA 3VS3A 4IIOA 2FEIA 5HCKA 2EPDA 3I5RA 4FSSA
chains in the Genus database with same CATH superfamily
2DX1A 3HTRA 2CREA 3CPWS 1OZ2A 1QCFA 4C92B 2W0ZA 4KRTA 1Z9QA 5LJ5f 2RHIA 3CC2T 5L23A 3CCUT 3CCJQ 1VYUA 3TCJA 3ULRB 3EFOB 1Y71A 1PHTA 1W2BA 2M51A 1SG5A 3TREA 1C0MA 3SFMA 1VQOA 2EKHA 4N4IA 4BI3A 1WHMA 2LRQA 4RTYA 4DQ2A 4F17A 1S1NA 4JRQA 2QDYB 1OX8A 2BZYA 4J9HA 1VYTA 2DILA 4M7DG 1GL5A 2QQRA 5DY9A 5C6SA 4XK8E 2DKGA 3E1SA 1QMCA 4JS4A 4C8QG 4LD9K 3EHQA 4JRKA 2M0OA 5GAN3 1W6XA 4J8OA 1OEBA 1EX4A 2DERA 2KAFA 4M7DA 3GNGA 1BI2A 3SWNC 4KUDK 1YCYA 2P0KA 2FO0A 2DIQA 2E12A 2KRSA 2HZYA 4EDUA 4JLGA 3L42A 1LCKA 1AOJA 4IUTA 2KXDA 4J7FA 2XD0A 4EMKC 1KC8U 3H0IA 5GANh 1B34B 3I55Q 1QVFP 1VQ8A 2VWFA 2F2VA 2QDLA 1JRIA 4WTOB 1F1BB 5LJ3j 3P8BB 3CCMQ 3FIFA 3E9GA 1OU8A 3OBYA 1BBZA 2FRYA 2JMAA 4AFZC 2RN8A 2L0AA 3I56Q 9ATCB 3CMEA 2EJ9A 2O2OA 2D8JA 1I1JA 5KYYB 1XNIA 4JRIA 3OQ5A 3PFSA 1BCMA 2CUDA 3UPUA 1M8VA 1UJYA 1I5OB 4RCBA 1JBMA 3CC7Q 1Q86R 4L6V5 2XDBA 4JLIA 2ZPIB 1M90U 1JEGA 2GF7A 2L8DA 1W70A 2JS0A 1N8RC 2LQWA 2V8IA 2YHTA 5KCOA 1K1ZA 3A8LB 4FW2A 3M57A 4J9IA 2RHYA 3CMAA 1J3TA 5FWCA 4C0DB 3JCMQ 2EJFA 1PWTA 4M78E 3QZ9B 2Y4YA 2LJ1A 4A4KA 1H641 5HK0A 3HFNA 2OTJA 2P4RA 2RA2A 2P4TA 4HCCA 4LN2A 1PSEA 3BW1A 1SHFA 4FM4B 4OMPA 1Q81C 4HT9A 2FPDA 3UATA 4M7AD 2MPXC 1VQ5A 5KE2A 2ZCFB 4M77E 5FW9A 4DBHA 5GANe 3JCMh 4EPCA 1SSHA 3MP8A 1MMAA 1MHNA 2EQIA 4MMLA 2XDDA 1RUWA 2RQVA 2K57A 2WSCE 4JUVA 4OP0A 3JCMe 2HDAA 2RNAA 3CC2Q 4C92E 2JS2A 2CSQA 2YRVA 4IUVA 1WXUA 2VXEA 3S3MA 1PCXA 4Y92A 4JJNK 1FWZA 3ZBDA 3T9NA 1A0NB 2RJFA 3THKA 2QI2A 1AWJA 1KQ1A 2LP5A 1NPRA 5A0DA 2ABLA 2KSSA 2EQJA 2KK4A 2DBMA 1GCQA 4VUBA 4F14A 4DEYA 4LUDA 1CSKA 2AIRB 1SEMA 4BI4A 4ME7A 3ME9A 5AYFA 4OB2B 1WGSA 1TSFA 1VQKT 2LQ8A 3EG0A 3QJ6A 3JCMg 1BKBA 1Q95G 2QK0A 3I55A 4CI0C 1WNLA 4A63B 2Y90A 4R0KA 3EGXA 4C92F 5GMKj 4QT7A 1QVFA 4J9BA 3HRTA 2G3RA 2PQWA 2LNVA 2MYSA 1QVGP 2FZGB 3M4GA 5DLQE 3H0FA 4EMGA 4C8QA 1VYVA 3AT1B 4LE9A 1OV3A 4RTUA 5I2MA 3CD6T 1WHKA 1HD3A 3M0RA 1YHQT 3JCMd 1VQ4T 3KXTA 3QSUA 3QYGB 4A4GA 4OGCA 4FL6A 4HCKA 3JRZA 3CQTA 1K9MC 1O9SA 2L5QA 2JT4A 2FHDA 3URGA 2COYA 4FIBA 8ATCB 5GAMh 2M02A 3FDRA 3G4SQ 1ZSGA 2EAYA 1WXTA 3LGLA 2OI3A 2E5KA 4P5NA 3QDRB 2XHCA 2J6OA 2E64A 2M16A 5GAOn 5FLXE 3DKMA 5J3BA 2EGEA 1PC0A 2VVKA 3JAME 2A37A 3V8KA 1O75A 1Q7YU 4PJJA 1KG1A 3X26B 5KYUB 1YBYA 2R5AA 5GAOl 3QZ5B 2FYKA 2CP7A 2FL7A 3SD4A 1PD1A 4LDYA 3V7SA 4Z02A 3C95A 3RBBB 4Z89A 1G3YA 2IVWA 4JZ4A 3FC3A 2D6FA 1MMDA 2X4YA 4B9XA 4PJNA 4DBFA 3RMSA 2F1LA 2GFUA 3V7RA 1VQLQ 3M0UA 2D1XA 3M54A 3CCRQ 2MCNA 2C0TA 2OTLA 1NBEB 2CH4W 3CC2A 2DEUA 2FPFA 4N4GA 1RI0A 3CBMA 4LNPA 1Y57A 1M1KR 2DXCA 1RABB 1GXIE 4XTXA 1QWFA 1PKSA 1D09B 2XI9A 1G83A 1SHGA 1VQKQ 1BYMA 3VRYA 3UWNA 2RK1A 1JXOA 2A0FB 3EHRA 3M0PA 4M75F 1QCOA 1PSFA 3MEVA 1GCQC 4A4FA 2YLCA 2P84A 2V1RA 2QEXT 1FMVA 2RM4A 1VQ6T 3WXMB 2RQWA 1I07A 1GRIA 2QGGA 2QQ9A 2JJ9A 3G1JA 5GAN5 2RI5A 3UA6A 1VQ4Q 5GJVB 2K2VA 4FYWB 3CCUQ 3J81E 3KFVA 1YJ9A 2YDLA 1QVPA 4PNOA 3NTKA 3JCMX 2GFAA 4QKUA 1UG1A 4GBQA 4C8QB 2CDTA 4AFUC 1ACMB 4IIOA 2EPDA 4X34A 3I5RA 2DVEA 1TTHB 4KT0E 1IZ6A 1X6BA 1VQLT 3KBGA 5D6WA 2K3YA 1AHJB 3MP1A 3OYEA 4F7UB 2QGFB 2P0PA 4M77D 4DOWA 1K0SA 3VS6A 1MMGA 3CXCA 1KC8R 1QQJA 1H3ZA 5CKBA 4PJOB 3RIRA 5J39A 1MNDA 1YFNA 3NFCA 2B8AA 4F7UF 4R56A 1R0BG 3S3OA 2CGHA 3C4SA 4GY5A 2KT8A 5KH6A 1NPPA 2F2WA 4M78D 5CVIA 2X4WA 1VOMA 1UHCA 3LYIA 4LXCA 2LQKA 4M7AF 4B9WA 1BB9A 3BY7A 3CCRA 3SHWA 1WIEA 2PTKA 4PFPA 1VQPQ 1MUZA 2QQBA 3L2UA 1YJWT 5IHNA 1I0CA 4M77B 2CH4A 4N4HA 1WQ7A 1X2KA 4M75C 4NOYA 2YUOA 1RAAB 3MEUA 3QO3A 1NJIR 1VQMA 2L2PA 2YSQA 2EVRA 1NG2A 2AKKA 3GBQA 3CCJA 2K7AA 1VQ8T 3JCMW 5LJ5e 4J9CA 2M1HA 4F7UE 5KCHA 2HBWA 2K5LA 2RHUA 1JJ2P 3UF4A 4ELYC 1TS9A 5CKHA 4QVZA 1M1GA 1VQOQ 2CP3A 1K8AU 1Q86U 2GGRA 3CBPA 1TH7A 2COZA 4ZGEB 1V76A 4WF2A 2BE9B 1EZZB 1QKWA 4PJOC 1LJOA 2RQUA 5CR2A 2K3XA 3VS7A 4E7LA 2ROLA 5A2QE 5CK9A 2AHJB 2QXFA 1IO6A 3CCRT 1RAEB 4C92D 1JQQA 3VU3C 4J83A 3GF5A 1E6HA 1N6AA 1M5Q1 2PVGB 1U06A 2VGNA 4X9CA 1SKUB 3CPFA 4OMQA 2KY9A 2PUKB 3CC4T 1KC8C 5LJ3g 1YIJT 4M7DB 3OW2P 1VIEA 1WJQA 4A4EA 1I81A 5GAN8 2MI6A 4RTVA 1S72Q 1ARKA 2E3HA 1OULA 1YP5A 5GAOp 2OTLT 2JTFA 3TEEA 5GMKl 1K73R 1N8RR 4KBMB 1M27C 2MK5A 3U23A 1YI2T 1BCOA 4WCIA 4XU0A 3NHNA 4ANJA 4MMKA 2DL8A 4F7UA 1U5SA 1WX6A 4QW2A 2HBPA 4JS5A 1RI9A 2E70A 2O4XA 3FJ5A 2H3JA 4J9FA 2ATCB 1M90C 3G71Q 3CCLA 4A53A 3CC7A 2XICA 3H41A 5FROA 2HQHA 4MDWA 4QVDA 2DTHA 1K9AA 1KHIA 2CYZB 3ZL7C 1G3SA 1M1KU 4OMLA 2QTVA 4OMOA 1UGQB 2DM1A 4RTTA 5IXBA 3OSVA 3CEYA 1X01A 3OY9A 2KI7A 1RLQC 2QQSA 3CCQT 1D0YA 3OYFA 2RJEA 3M0SA 2CZ6B 5FU7B 1Q81U 3PMTA 1D0ZA 3HRUA 4C5EA 4PJOD 3VRZA 3PGGA 3M0QA 5CKDA 3L2VA 2A28A 4IURA 5LJ3f 2K6DA 2HAXA 4AFQC 1M3CA 3O5ZA 4FYXB 4X1VA 2KYMA 2ZGWA 3LGFA 2KR3A 3PIPA 1G3WA 5GANj 4M75A 2FRWA 1NLOC 3OS5A 2KMTA 4M7DD 1AWWA 4II1A 4FYYB 3I9QA 3A1PA 4ORZA 5GMKm 3CPWA 2NYSA 1NEBA 2I0NA 1D1CA 5GAN4 2OJ2A 4M75G 1VQ9T 5FRMA 2DPPB 3M59A 6AT1B 4BUGA 2AKLA 3WVEB 1TWBA 4E6RA 4E7JA 5LJ5j 1AWOA 2K5FA 4XTUA 1IHVA 2HKNA 2O4XB 1RADB 3GPLA 2X35A 4LUEA 3Q1JA 1OZ3A 2ZPEB 4PL6A 2BE7D 2EYXA 4PJMA 1C1AA 2LX7A 3GOXA 5LL6S 1QW1A 4KUIA 2JMCA 4MDXA 3VUZA 2DVJA 3PE0A 4OMFB 3CCVA 3S3NA 1YWOA 2B86A 1D3BA 4C5HA 2CZ1B 1QLYA 4XU2A 2K79A 5GAMf 3RKXA 2DJQA 2JNGA 1KD1R 2RQTA 4OGEA 1UJ0A 4IUPA 1X75C 4N0AA 5GAN2 2KRNA 2PUOB 3VUBA 1N8RU 3CD6Q 4FT2A 4DOVA 1YITA 2D0NA 3RKWA 3M0TA 1IXDA 4JDSA 2RB6A 4LDUA 1VQ7T 2E4HA 1MNEA 3JB9I 1YIJQ 1RAFB 2DYBA 2H8HA 4BY6C 2JXBA 1WDXA 1XOVA 5GAMd 4HCZA 2JM9A 3OS0A 1E7OA 1K9MU 3JCMJ 4M7AG 4J6XA 2VXFA 2EGCA 4O5VA 2JN0A 1XJWB 1LPLA 2KROA 4TVRA 1IGUA 3VS4A 1HYOA 5L8RE 4C0ZA 1VQNT 2MF2A 3M4YA 2E41A 1MGQA 1MMNA 2DL7A 3O8VA 4C0DC 2VC8A 2Y4XA 2C0IA 1Y7XA 2JW4A 3I56T 5GAMg 2DFUA 3RNJA 3JB9D 1E6GA 2DAQA 3RR6A 2X4JA 1M4ZA 1UECA 2V1QA 2DL3A 3CCJT 2LCCA 3OA6A 1K76A 2DRMA 2HL5C 2PNIA 4QVCA 3JB9G 2DZ9A 2G6FX 2BIVA 2OX7A 1VQ5T 1ZSZB 4RUGA 5GAOq 4QQGA 1X6GA 4HCBA 1KQ2A 1X6OA 2E1HA 3CCQQ 1QVGS 3OYDA 1M30A 1UE9A 2YLBA 3SDZA 4C8QC 4LDXA 1VUBA 2NUPB 2NWMA 5IH2A 2JZ2A 3RMQA 4Q5WA 1YJNQ 4FCYA 2XMFA 4C0FA 4HVUA 3OYCA 2X51A 2DL5A 4F16A 1D1BA 2K3BA 5KYYA 1ZUKA 1Q82U 3OSSC 1I5LA 4DEXA 2PZ1A 2ROTA 4ESRA 1EFNA 2BZ8A 3EH1A 4RTZA 4ZNXA 1KQSA 2AK5A 2GBQA 3QKJA 2FEIA 5HCKA 1RL2A 4ZTJA 4FSSA 3L1AA 1VQMQ 3H0HA 2H3EB 2RI3A 1RLPC 1PG5B 3EFRA 2DYIA 4C8QD 3MEAA 4XTVA 4E7HA 4LD6A 3HL8A 1TUCA 3CMAT 1AVZC 2VASA 4BY6B 1YJWQ 1KHCA 1UGPB 4AG2C 4E47A 1OOTA 2JUFA 3PVQA 3X28B 1K9MR 3CCLQ 4N0AC 4C0GA 4QQDA 8AT1B 5D6XA 5GMKi 1D1AA 1ABOA 4M78G 4BE1A 4M78C 1WHGA 3DLLA 3M53A 3JSCA 4J9GA 1WYXA 3QYHB 4ZTFA 2DD5A 3CCEA 2E3IA 4E7IA 1C6VX 1AWXA 1WI7A 3R6NA 5LJ5h 1ZLMA 2LT4A 2FVUA 5GAOm 3OYHA 1VQNA 1TXQA 2MWPA 2L3SA 3E19A 4M78B 1N9RA 4ZGJB 2ENMA 1ZX6A 4YTLA 5IHIA 4IUQA 3OYYA 2IIMA 2ZPBB 2DE0X 3C0CA 3I56A 2RJCA 1R8OB 1MV0B 4L5GA 3VS0A 1KD1U 5CKFA 1VQLA 2EGAA 2P0QA 1H3HA 3RKYA 1Q81R 4BI8B 1VQPT 4IKFA 1B07A 1HXDA 4J9DA 4OF1A 1K73U 2CKKA 2EJGA 1YN8A 2DK3A 1ZBXA 3PIOA 3QWXX 3M9QA 2SEMA 3V8JA 2DXBA 1T0HA 1WQWA 4L59A 3QDFA 3CMAQ 5LJ5g 1HSQA 2QEXA 1QVGA 3TSWA 1KK7A 5I22A 2KQWA 2L3PA 2LC4A 3EG1A 2K9GA 1QP3A 2K4YA 2EYZA 3NTIA 3OYJA 2DXTA 1PD0A 3GP8A 2OTLQ 1JB0E 1VIFA 3JV3A 1UUEA 1IGQA 4FYVB 3HSBA 2KXCA 1BK2A 4M7DF 3M5AA 1AZEA 4C92A 1YJ9Q 1Q86C 2EWNA 1M3AA 1UHFA 3UA7A 1M9SA 3A98A 3G6ET 2GCXA 3G71T 4CC3A 4RCCA 1OI1A 2RMOA 4Z8AA 1D0XA 1NJIC 2EQKA 1NYGA 2V26A 3ER0A 4PJOF 1D3BB 3AHUA 2D8HA 3I55T 1X69A 1FXXA 4AT1B 2K5IA 3VS1A 4M78F 2A08A 3G7ZA 1SSFA 4JRPA 1YJNA 2V8JA 4XAXB 1HK9A 2LCSA 2OAUA 5A0LA 5KE3A 4JZ3A 1YIJA 4DBRA 5GJWB 3QJYA 5I2SA 3CCSA 1ZHIA 3HKSA 3WVDB 2DXUA 2DEQA 1EIFA 2WSEE 2QG9B 2HKQB 2FZCB 1WJSA 3S6WA 3JB9H 2LZ6B 4FU6A 4NL2A 4E7KA 1M90R 2DO3A 2ZPFB 4M77F 1TOVA 4CC4B 1Q82C 2E65A 1YHQQ 2LMJA 1R0CB 5LJ3d 1JXMA 3L2QA 1SPKA 4PFOA 4HA8A 3E2UA 4HXJA 2FB7A 1M3BA 1UFFA 3JB9J 2JM8A 3L2RA 3MJXA 1WPYA 2DBKA 4M78A 1QP2A 2MOXA 3QPHA 1H8KA 2F5KA 5M9OA 3QBYA 3PMIA 2EYWA 3VJPA 3CCLT 4C5IA 5FU6B 1WA7A 2J6KA 2DF6A 4PJOA 2CUBA 5FRNA 2QASA 3X25B 4PKCC 3CCMT 5KYXA 3VYHB 5GAMj 3BDUA 1PRLC 3M56A 1IREB 1N9SA 1RAGB 2YUQA 3X24B 5KYNA 1SRMA 2ZAEA 2M9UA 1U1SA 4M75D 4JJCA 1P92A 1AEYA 2O9SA 4CC2A 2YT6A 3CCET 1CKAA 2ESWA 3OYMA 2RQRA 2KRMA 3EG9B 2DL4A 1VQKA 4AG1C 4AMCA 3BDLA 1T0JA 2JTEA 2NUZA 3EG3A 3QXEB 1T3SA 3NPFA 3J7AF 2MMPA 5LJ3e 2LCLA 3OBWA 4FSXA 4J6WA 1WHHA 2CP2A 3VKIA 2OTJQ 2DTIA 5CO7A 1LVKA 2CT4A 2L3QA 2XG8D 1KQSP 1MV3A 1WLPB 1KD1C 1BI0A 2E6ZA 1S72A 2YRCA 2DA9A 4JJDA 2KEAA 4M75B 1VQ4A 2QYZA 3LWHA 2GTJA 1K73C 1R77A 4M77C 1YWPA 1BI1A 5HKCA 1UEBA 4C92C 2A3LA 5GMKe 3KUFA 1W2BP 1OX9A 1XTDA 1BIAA 4NS5A 2VYTA 1RAHB 4DA4A 2SRCA 2NUPA 4O6JA 4XTYA 3CCSQ 1YJWA 1YJ9T 2EIFA 2EFIA 4BD3A 5GMKh 1KIKA 3E9FA 1HJDA 4HVVA 1Y96B 3RESA 2KDSA 3MP6A 2K2MA 2QA4A 2VKNA 1K8AR 2KVQG 2RD1A 1U3OA 3L2WA 2LQNA 1UGRB 2DETA 2IG0A 2F69A 5FU7C 1CKBA 3V7CA 5IAYA 1YCSB 3L2ZA 2EKOA 2EYQA 1N5ZA 2NLUA 1X43A 2DZCA 2XKOC 1JJ2A 3A5ZB 2OTJT 2LTOA 3V8LA 3SEMA 3LWIA 3PNWC 3HPWA 1YITQ 2L3RA 1IRXA 3EG2A 5GANf 3A8OB 3SWNA 4M75E 2DRKA 2DJZA 2JOYA 4DBQA 1TUGB 1X27A 3FLGA 3REBB 3RERA 3TSZA 4J5YA 3VS2A 2F5TX 4EMKB 1K4US 3N5BB 4BACA 1VQOT 2CS7A 4EMKA 3FRNA 3MEWA 1Z9ZA 2A7YA 1KFZA 1N27A 5EC7A 2CP0A 1NEGA 3RDVA 2QTXA 2DTOA 3CPWP 1QVFS 4HVWA 1UB4A 4HT8A 2GTOA 5HK3A 2XK0A 1Q7YR 3OW2A 1AD5A 4QQ6A 3CMET 2KT1A 1KQSS 5GAMe 2BUDA 3CBOA 1FMWA 4AFSC 2R57A 3JCMc 2EQUA 1UTIA 3HRSA 5IT9E 4KGVB 2GNCA 4MZMA 2MWOA 3P8DA 3CXCP 2AZVA 1VQ7A 2YXYA 3QIIA 1G8XA 4J6YA 2LX9A 4BE2A 3G4ST 4A4HA 3I5SA 4XTWA 1YITT 4JPBW 2HSPA 5IHKA 3OW2S 1VQ6A 4OB1B 5IN1A 3HFOA 4ZN1A 1ZA1B 3QHSA 3CCST 2E5QA 3SWNB 1JO8A 1ZSZA 4V2SA 2LJ0A 4ATOA 1UDLA 4CRIA 4F04B 3UDCA 3C12A 5GANg 2WACA 3M58A 3JCMV 3JCMP 5CQXA 5LJ5d 1KJWA 1PNJA 2I2LA 2LDMA 4KH0B 4J7IA 2JTMA 7AT1B 2HQXA 2C0OA 3PT9A 3X20B 2QQAA 1GBRA 2PVDB 2LVMA 5FU6C 3H8ZA 3SB2A 4M77G 3CC4Q 2VV5A 5I11A 1OPLA 1TUDA 5CIUA 2C06A 5GANd 2AZSA 1NLPC 3MHXA 2LNHB 3VYGA 4C5GA 3RUXA 3GIBA 3ZFJA 4M4ZA 3G4SA 3MCAB 3EAEA 3OYNA 5GAN6 1W4SA 4BB7A 2O88A 4E2FB 4PJLA 3VS5A 3ASKA 4XTZA 2YUPA 2O31A 4PJOG 5C0MA 3DLMA 3MO8A 1Y07A 4RTXA 3CC7T 2R58A 2DLPA 2MAMA 5LJ3h 2M0YA 2XU8A 4F7UG 3DB3A 2LT1A 3FB9A 2FPEA 4OMNA 3OYIA 1WHLA 5KYXB 2CSIA 3H6ZA 2HL3A 2FG0A 3G6EQ 5HY6A 3META 3QUIA 4GLKA 5GAN7 3OB9A 4J9EA 2JVVA 2HD0A 4Z88A 3JCMb 4XQ3A 1WJRA 4GLMA 2Z0WA 1T3LA 1VQ7Q 1NE8A 1JJ2S 2RJDA 4CC7A 1ZQ1A 1XQHA 2HSEB 1G5VA 4HKEA 3F70A 2ZZDA 3GNFB 2MIOA 3HHTB 1RACB 4M7AB 4K11A 1UGVA 3PTAA 2FZKB 2RO0A 3LX7A 2COWA 2J7IA 4M7AA 4LDVA 5AT1B 5FWBA 2RPNA 1FX7A 3OS1A 4RG2A 1Q7YC 1VQ8Q 2ED0A 4PFZA 1ABQA 2QEXQ 2HNIA 4PK4A 4FW1A 1KSWA 1QCNA 1OPKA 2ZPGB 3OYLA 1VQ9Q 5D7UA 1V1CA 2QA4T 2X3WD 1B34A 4ELZC 2BKDN 1G2BA 5DM7R 1RAIB 4MZPA 3ZEHA 1W2BS 3FEOA 3CC4A 2YUNA 2RH2A 4FT4A 1U8RA 1M1KC 4PLIA 3QWYA 4XU1A 4RMOA 2IPOB 4KULA 3NTHA 1B7TA 4KGZB 2O01E 1ZSZC 1YNZA 4UC4A 1NJIU 2RK2A 1I8FA 5GAOr 3QG1A 5KYWB 2ZPHB 1SRLA 2X3XD 4A54A 4OB3B 2VGMA 3NGPA 1VQNQ 2KE9A 2NUTA 4BDYA 1QWEA 1SF9A 2X4XA 1BI3A 3TVTA 3FJPA 1NM7A 4EMHA 2EBPA 2WSFE 5DLOA 1S72T 2RI2A 1LNXA 2CZ7B 2D9TA 1LOJA 1YI2A 2EYYA 4RKUE 3OYKA 4D6WA 4OB0B 3MKDA 4M7AE 3A8MB 2YWWA 3HP9A 1IB8A 1ZUUA 2F2XA 2BTTA 3TQ7P 3REAB 2R5MA 2ECZA 3C94A 5CQYA 1VQMT 2ED1A 3VV0A 1OU9A 1DJ7B 1Y0MA 2HCKA 1GBQA 4ZN3A 2EQMA 4IIMA 1ZUYA 3EGXB 2J6FA 3OS2A 4Y91A 2E6NA 1ZBJA 3CCVT 2HEQA 2KYBA 1W1FA 2D0QB 2XIDA 2E10A 3DB4A 4EIKA 1M2OA 1ZA2B 1UGSB 1M2VA 2GQIA 2HMAA 3IQLA 3TU4K 1PM3A 4MZTA 1NYFA 3CCEQ 5ECAA 4R55A 1M8MA 2GQVA 3JB9F 2X9HA 2OAWA 1OYXA 4XU3A 4BE0A 3INZA 3OMCA 1WXBA 2PU9B 3EH2A 3M55A 4X9DA 4D8DA 3G71A 1VA7A 3EFOA 2RHZA 2A36A 3MPUB 5IXFA 2LJ3A 4C8QE 2AT1B 1VQ9A 3OYAA 1M1FA 1K0XA 1VQ5Q 2CP6A 1V29B 4Y28E 5CAIA 3A8GB 2CT3A 3LH5A 2KNBB 1U1TA 4B6MA 3LH0A 2KGTA 4JJBA 4OMMA 4M7AC 3OMGA 3GLXA 1FYNA 4M7DC 1GFDA 1WHJA 3BFMA 1FMKA 2DMOA 1YJNT 3UT1A 2VB6A 1GCPA 3EFSA 5A0GA 5D6YA 1AZGB 3LLRA 5KYUA 4E7SA 5J26A 1TG0A 1YI2Q 3JCMf 1OQKA 2VUBA 5KYWA 3P8HA 5EG2A 3EGDB 1AT1B 3CCQA 4RTWA 1M2VB 2NUTB 2QAZA 1K8AC 2RF0A 2YRDA 2CP5A 4OVAA 3BE3A 4C8QF 1PKTA 1PRMC 2QA4Q 1GFCA 2CZ0B 3NMZC 2DD4A 1TU0B 3CCUA 4IUUA 3CCMA 4LDWA 2EW3A 5I21A 2RHXA 3PVLA 3EGUA 3A8HB 4KGXB 1X2QA 1JU5C 1BU1A 3CMEQ 3I35A 3H9NA 3J80E 4NL3A 1VQ6Q 4M7DE 2L89A 5CCAA 1H92A 3CXCS 1Q82R 1B3QA 4PLLA 2W10A 2O9VA 2PVOB 3OYGA 1NZ9A 3R6OA 1QKXA 2V8KA 2HQEA 4KH1B 4BDZA 1WZOA 2J06A 4C92G 2BZXA 2KBTA 5CKEA 3D7SB 1I4K1 1Y96A 4PJOE 3CCVQ 3EG9A 4ZGDB 3G6EA 4RG8A 2DNUA 4E7ZA 3LW5E 4D8KA 1WFWA 1BIBA 3EGDA 2XDPA 1IHWA 3OYBA 2DIGA 2J05A 3CD6A 1VQPA 1YHQA 3VS3A 4M77A 1G3TA
chains in the Genus database with same CATH topology
2DX1A 1X6BA 3H0HA 2CREA 3I5SA 1QCFA 1RLPC 4JPBW 2W0ZA 2HSPA 5IHKA 4KRTA 1Z9QA 5L23A 1K0SA 3VS6A 1VYUA 3ULRB 1TUCA 1JO8A 1AVZC 2LJ0A 1UDLA 1PHTA 2M51A 4AG2C 1OOTA 2EKHA 3PVQA 1KJWA 1PNJA 2KT8A 4RTYA 4F17A 1S1NA 2F2WA 2BZYA 1UHCA 4J9HA 1VYTA 2DILA 1GL5A 1BB9A 2C0OA 1ABOA 1GBRA 3EHQA 3SHWA 4J9GA 1WIEA 2PTKA 1WYXA 1MUZA 5I11A 1W6XA 1OEBA 5IHNA 1I0CA 1OPLA 1TUDA 1WI7A 1AWXA 2CH4A 3R6NA 1ZLMA 2AZSA 1NLPC 2LNHB 2L3SA 1X2KA 2ENMA 1ZX6A 2YUOA 5IHIA 2FO0A 2IIMA 2DE0X 3C0CA 2L2PA 4M4ZA 2KRSA 2YSQA 2EVRA 1MV0B 1NG2A 2AKKA 3VS0A 3GBQA 2EGAA 1H3HA 1LCKA 1AOJA 2K7AA 2O88A 4J9CA 2KXDA 3VS5A 1B07A 2HBWA 2YUPA 4J9DA 3UF4A 3H0IA 2O31A 1YN8A 2VWFA 2F2VA 2QDLA 4RTXA 2DLPA 2GGRA 2M0YA 3QWXX 2SEMA 1QKWA 1BBZA 1T0HA 2FRYA 2JMAA 4AFZC 1HSQA 2FPEA 2RN8A 4OMNA 3TSWA 2L0AA 2RQUA 5I22A 3VS7A 2ROLA 2L3PA 2D8JA 1I1JA 2O2OA 3EG1A 2CSIA 2K9GA 2EYZA 1IO6A 2FG0A 2CUDA 1UJYA 1JQQA 4J9EA 4Z88A 3JV3A 1UUEA 1E6HA 4GLMA 1U06A 1T3LA 4OMQA 4CC7A 1JEGA 1W70A 2KXCA 2JS0A 1BK2A 2LQWA 1AZEA 1K1ZA 1M3AA 2MIOA 1UHFA 4J9IA 3UA7A 4RTVA 3A98A 1ARKA 1J3TA 4K11A 5FWCA 1PWTA 1UGVA 1YP5A 4CC3A 2RMOA 4Z8AA 2J7IA 2LJ1A 1NYGA 5FWBA 2RPNA 1M27C 3U23A 2P4RA 2ED0A 1ABQA 4LN2A 4WCIA 1KSWA 2D8HA 1OPKA 3NHNA 1SHFA 4OMPA 2FPDA 2DL8A 3UATA 1X69A 1U5SA 1WX6A 1RI9A 1V1CA 5FW9A 3VS1A 3FJ5A 2A08A 4J9FA 2X3WD 3H41A 1SSHA 2LCSA 1G2BA 4JZ3A 2EQIA 5GJWB 1K9AA 2YUNA 3ZL7C 1RUWA 3QWYA 2RQVA 4OMLA 4OMOA 2LZ6B 1YNZA 2HDAA 2DM1A 4RTTA 5IXBA 4CC4B 2RNAA 2LMJA 2JS2A 1RLQC 1SRLA 2CSQA 2X3XD 1JXMA 1SPKA 1WXUA 3NGPA 3M0SA 2KE9A 4HXJA 1M3BA 1UFFA 1QWEA 2JM8A 3TVTA 4Y92A 1NM7A 3VRZA 1A0NB 3THKA 2EBPA 1AWJA 2DBKA 3M0QA 2MOXA 2A28A 2LP5A 1H8KA 2ABLA 2EYYA 2K6DA 2EYWA 4AFQC 1M3CA 2DBMA 3O5ZA 1WA7A 2J6KA 4X1VA 2DF6A 2KYMA 2KR3A 2CUBA 1GCQA 4F14A 4DEYA 4LUDA 1CSKA 2FRWA 1NLOC 1SEMA 1PRLC 1AWWA 1ZUUA 2F2XA 2BTTA 3I9QA 4ORZA 3REAB 1NEBA 2I0NA 2YUQA 2ECZA 1SRMA 2OJ2A 2ED1A 3EG0A 1Y0MA 2HCKA 4JJCA 1GBQA 2AKLA 1AEYA 4A63B 2O9SA 4CC2A 2YT6A 4R0KA 4IIMA 4E6RA 1CKAA 1AWOA 2ESWA 4QT7A 4J9BA 2RQRA 2KRMA 1ZUYA 2DL4A 4AG1C 2J6FA 4LUEA 1T0JA 1ZBJA 2JTEA 2NUZA 3H0FA 2EYXA 2HEQA 3EG3A 2KYBA 1T3SA 1W1FA 1VYVA 3NPFA 4LE9A 4EIKA 2LX7A 1OV3A 4RTUA 1HD3A 2JMCA 3M0RA 2CT4A 2L3QA 2GQIA 2DVJA 3PE0A 1MV3A 1WLPB 3IQLA 4HCKA 3CQTA 1NYFA 1YWOA 2B86A 5ECAA 2JT4A 1M8MA 1QLYA 2K79A 2OAWA 2DA9A 4JJDA 2KEAA 1WXBA 2DJQA 4D8DA 2GTJA 2RQTA 1VA7A 1UJ0A 2A36A 5IXFA 1YWPA 2LJ3A 1ZSGA 1WXTA 2KRNA 1K0XA 2OI3A 2E5KA 2D0NA 3M0TA 2CT3A 2J6OA 2SRCA 3LH5A 2EGEA 2KNBB 2KGTA 2VVKA 4JJBA 4OMMA 2DYBA 2H8HA 1FYNA 2JXBA 1WDXA 1XOVA 1GFDA 2A37A 1FMKA 2JM9A 2DMOA 1KIKA 1HJDA 1GCPA 1E7OA 4HVVA 2EGCA 1AZGB 2K2MA 2VKNA 2KROA 1U3OA 1TG0A 2LQNA 3VS4A 2DL7A 1CKBA 3RBBB 4Z89A 4JZ4A 4RTWA 2C0IA 2JW4A 1YCSB 2RF0A 1N5ZA 3RNJA 1X43A 1E6GA 3SEMA 1PKTA 1PRMC 3M0UA 2D1XA 1GFCA 3NMZC 2MCNA 2C0TA 2CH4W 3EG2A 2FPFA 2EW3A 1UECA 2V1QA 2DRKA 3PVLA 2DL3A 3EGUA 4LNPA 1Y57A 1X2QA 1JU5C 1K76A 1X27A 2DRMA 1BU1A 3REBB 3I35A 2PNIA 3TSZA 1QWFA 1PKSA 3VS2A 2G6FX 1K4US 1G83A 1H92A 1SHGA 4RUGA 1B3QA 3VRYA 2W10A 1Z9ZA 2O9VA 1X6GA 1KFZA 5EC7A 1JXOA 1M30A 3EHRA 3M0PA 1NEGA 1UE9A 1QKXA 4HVWA 2GTOA 2J06A 2BZXA 1GCQC 2NWMA 5IH2A 2KBTA 1AD5A 2KT1A 2V1RA 2XMFA 4HVUA 2RQWA 1I07A 2DL5A 4F16A 1GRIA 2DNUA 4AFSC 2K3BA 3UA6A 4D8KA 1WFWA 1ZUKA 5GJVB 1UTIA 3KFVA 2YDLA 2GNCA 4DEXA 2PZ1A 2J05A 2ROTA 4ESRA 1EFNA 1UG1A 2BZ8A 4GBQA 4RTZA 4ZNXA 2CDTA 4AFUC 2AK5A 2AZVA 2GBQA 3VS3A 4IIOA 2FEIA 5HCKA 2EPDA 3I5RA 4FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX1 A;  1X6B A;  3H0H A;  2CRE A;  3I5S A;  1QCF A;  1RLP C;  4JPB W;  2W0Z A;  2HSP A;  5IHK A;  4KRT A;  1Z9Q A;  5L23 A;  1K0S A;  3VS6 A;  1VYU A;  3ULR B;  1TUC A;  1JO8 A;  1AVZ C;  2LJ0 A;  1UDL A;  1PHT A;  2M51 A;  4AG2 C;  1OOT A;  2EKH A;  3PVQ A;  1KJW A;  1PNJ A;  2KT8 A;  4RTY A;  4F17 A;  1S1N A;  2F2W A;  2BZY A;  1UHC A;  4J9H A;  1VYT A;  2DIL A;  1GL5 A;  1BB9 A;  2C0O A;  1ABO A;  1GBR A;  3EHQ A;  3SHW A;  4J9G A;  1WIE A;  2PTK A;  1WYX A;  1MUZ A;  5I11 A;  1W6X A;  1OEB A;  5IHN A;  1I0C A;  1OPL A;  1TUD A;  1WI7 A;  1AWX A;  2CH4 A;  3R6N A;  1ZLM A;  2AZS A;  1NLP C;  2LNH B;  2L3S A;  1X2K A;  2ENM A;  1ZX6 A;  2YUO A;  5IHI A;  2FO0 A;  2IIM A;  2DE0 X;  3C0C A;  2L2P A;  4M4Z A;  2KRS A;  2YSQ A;  2EVR A;  1MV0 B;  1NG2 A;  2AKK A;  3VS0 A;  3GBQ A;  2EGA A;  1H3H A;  1LCK A;  1AOJ A;  2K7A A;  2O88 A;  4J9C A;  2KXD A;  3VS5 A;  1B07 A;  2HBW A;  2YUP A;  4J9D A;  3UF4 A;  3H0I A;  2O31 A;  1YN8 A;  2VWF A;  2F2V A;  2QDL A;  4RTX A;  2DLP A;  2GGR A;  2M0Y A;  3QWX X;  2SEM A;  1QKW A;  1BBZ A;  1T0H A;  2FRY A;  2JMA A;  4AFZ C;  1HSQ A;  2FPE A;  2RN8 A;  4OMN A;  3TSW A;  2L0A A;  2RQU A;  5I22 A;  3VS7 A;  2ROL A;  2L3P A;  2D8J A;  1I1J A;  2O2O A;  3EG1 A;  2CSI A;  2K9G A;  2EYZ A;  1IO6 A;  2FG0 A;  2CUD A;  1UJY A;  1JQQ A;  4J9E A;  4Z88 A;  3JV3 A;  1UUE A;  1E6H A;  4GLM A;  1U06 A;  1T3L A;  4OMQ A;  4CC7 A;  1JEG A;  1W70 A;  2KXC A;  2JS0 A;  1BK2 A;  2LQW A;  1AZE A;  1K1Z A;  1M3A A;  2MIO A;  1UHF A;  4J9I A;  3UA7 A;  4RTV A;  3A98 A;  1ARK A;  1J3T A;  4K11 A;  5FWC A;  1PWT A;  1UGV A;  1YP5 A;  4CC3 A;  2RMO A;  4Z8A A;  2J7I A;  2LJ1 A;  1NYG A;  5FWB A;  2RPN A;  1M27 C;  3U23 A;  2P4R A;  2ED0 A;  1ABQ A;  4LN2 A;  4WCI A;  1KSW A;  2D8H A;  1OPK A;  3NHN A;  1SHF A;  4OMP A;  2FPD A;  2DL8 A;  3UAT A;  1X69 A;  1U5S A;  1WX6 A;  1RI9 A;  1V1C A;  5FW9 A;  3VS1 A;  3FJ5 A;  2A08 A;  4J9F A;  2X3W D;  3H41 A;  1SSH A;  2LCS A;  1G2B A;  4JZ3 A;  2EQI A;  5GJW B;  1K9A A;  2YUN A;  3ZL7 C;  1RUW A;  3QWY A;  2RQV A;  4OML A;  4OMO A;  2LZ6 B;  1YNZ A;  2HDA A;  2DM1 A;  4RTT A;  5IXB A;  4CC4 B;  2RNA A;  2LMJ A;  2JS2 A;  1RLQ C;  1SRL A;  2CSQ A;  2X3X D;  1JXM A;  1SPK A;  1WXU A;  3NGP A;  3M0S A;  2KE9 A;  4HXJ A;  1M3B A;  1UFF A;  1QWE A;  2JM8 A;  3TVT A;  4Y92 A;  1NM7 A;  3VRZ A;  1A0N B;  3THK A;  2EBP A;  1AWJ A;  2DBK A;  3M0Q A;  2MOX A;  2A28 A;  2LP5 A;  1H8K A;  2ABL A;  2EYY A;  2K6D A;  2EYW A;  4AFQ C;  1M3C A;  2DBM A;  3O5Z A;  1WA7 A;  2J6K A;  4X1V A;  2DF6 A;  2KYM A;  2KR3 A;  2CUB A;  1GCQ A;  4F14 A;  4DEY A;  4LUD A;  1CSK A;  2FRW A;  1NLO C;  1SEM A;  1PRL C;  1AWW A;  1ZUU A;  2F2X A;  2BTT A;  3I9Q A;  4ORZ A;  3REA B;  1NEB A;  2I0N A;  2YUQ A;  2ECZ A;  1SRM A;  2OJ2 A;  2ED1 A;  3EG0 A;  1Y0M A;  2HCK A;  4JJC A;  1GBQ A;  2AKL A;  1AEY A;  4A63 B;  2O9S A;  4CC2 A;  2YT6 A;  4R0K A;  4IIM A;  4E6R A;  1CKA A;  1AWO A;  2ESW A;  4QT7 A;  4J9B A;  2RQR A;  2KRM A;  1ZUY A;  2DL4 A;  4AG1 C;  2J6F A;  4LUE A;  1T0J A;  1ZBJ A;  2JTE A;  2NUZ A;  3H0F A;  2EYX A;  2HEQ A;  3EG3 A;  2KYB A;  1T3S A;  1W1F A;  1VYV A;  3NPF A;  4LE9 A;  4EIK A;  2LX7 A;  1OV3 A;  4RTU A;  1HD3 A;  2JMC A;  3M0R A;  2CT4 A;  2L3Q A;  2GQI A;  2DVJ A;  3PE0 A;  1MV3 A;  1WLP B;  3IQL A;  4HCK A;  3CQT A;  1NYF A;  1YWO A;  2B86 A;  5ECA A;  2JT4 A;  1M8M A;  1QLY A;  2K79 A;  2OAW A;  2DA9 A;  4JJD A;  2KEA A;  1WXB A;  2DJQ A;  4D8D A;  2GTJ A;  2RQT A;  1VA7 A;  1UJ0 A;  2A36 A;  5IXF A;  1YWP A;  2LJ3 A;  1ZSG A;  1WXT A;  2KRN A;  1K0X A;  2OI3 A;  2E5K A;  2D0N A;  3M0T A;  2CT3 A;  2J6O A;  2SRC A;  3LH5 A;  2EGE A;  2KNB B;  2KGT A;  2VVK A;  4JJB A;  4OMM A;  2DYB A;  2H8H A;  1FYN A;  2JXB A;  1WDX A;  1XOV A;  1GFD A;  2A37 A;  1FMK A;  2JM9 A;  2DMO A;  1KIK A;  1HJD A;  1GCP A;  1E7O A;  4HVV A;  2EGC A;  1AZG B;  2K2M A;  2VKN A;  2KRO A;  1U3O A;  1TG0 A;  2LQN A;  3VS4 A;  2DL7 A;  1CKB A;  3RBB B;  4Z89 A;  4JZ4 A;  4RTW A;  2C0I A;  2JW4 A;  1YCS B;  2RF0 A;  1N5Z A;  3RNJ A;  1X43 A;  1E6G A;  3SEM A;  1PKT A;  1PRM C;  3M0U A;  2D1X A;  1GFC A;  3NMZ C;  2MCN A;  2C0T A;  2CH4 W;  3EG2 A;  2FPF A;  2EW3 A;  1UEC A;  2V1Q A;  2DRK A;  3PVL A;  2DL3 A;  3EGU A;  4LNP A;  1Y57 A;  1X2Q A;  1JU5 C;  1K76 A;  1X27 A;  2DRM A;  1BU1 A;  3REB B;  3I35 A;  2PNI A;  3TSZ A;  1QWF A;  1PKS A;  3VS2 A;  2G6F X;  1K4U S;  1G83 A;  1H92 A;  1SHG A;  4RUG A;  1B3Q A;  3VRY A;  2W10 A;  1Z9Z A;  2O9V A;  1X6G A;  1KFZ A;  5EC7 A;  1JXO A;  1M30 A;  3EHR A;  3M0P A;  1NEG A;  1UE9 A;  1QKX A;  4HVW A;  2GTO A;  2J06 A;  2BZX A;  1GCQ C;  2NWM A;  5IH2 A;  2KBT A;  1AD5 A;  2KT1 A;  2V1R A;  2XMF A;  4HVU A;  2RQW A;  1I07 A;  2DL5 A;  4F16 A;  1GRI A;  2DNU A;  4AFS C;  2K3B A;  3UA6 A;  4D8K A;  1WFW A;  1ZUK A;  5GJV B;  1UTI A;  3KFV A;  2YDL A;  2GNC A;  4DEX A;  2PZ1 A;  2J05 A;  2ROT A;  4ESR A;  1EFN A;  1UG1 A;  2BZ8 A;  4GBQ A;  4RTZ A;  4ZNX A;  2CDT A;  4AFU C;  2AK5 A;  2AZV A;  2GBQ A;  3VS3 A;  4IIO A;  2FEI A;  5HCK A;  2EPD A;  3I5R A;  4FSS A; 
#chains in the Genus database with same CATH topology
 2DX1 A;  3HTR A;  2CRE A;  3CPW S;  1OZ2 A;  1QCF A;  4C92 B;  2W0Z A;  4KRT A;  1Z9Q A;  5LJ5 f;  2RHI A;  3CC2 T;  5L23 A;  3CCU T;  3CCJ Q;  1VYU A;  3TCJ A;  3ULR B;  3EFO B;  1Y71 A;  1PHT A;  1W2B A;  2M51 A;  1SG5 A;  3TRE A;  1C0M A;  3SFM A;  1VQO A;  2EKH A;  4N4I A;  4BI3 A;  1WHM A;  2LRQ A;  4RTY A;  4DQ2 A;  4F17 A;  1S1N A;  4JRQ A;  2QDY B;  1OX8 A;  2BZY A;  4J9H A;  1VYT A;  2DIL A;  4M7D G;  1GL5 A;  2QQR A;  5DY9 A;  5C6S A;  4XK8 E;  2DKG A;  3E1S A;  1QMC A;  4JS4 A;  4C8Q G;  4LD9 K;  3EHQ A;  4JRK A;  2M0O A;  5GAN 3;  1W6X A;  4J8O A;  1OEB A;  1EX4 A;  2DER A;  2KAF A;  4M7D A;  3GNG A;  1BI2 A;  3SWN C;  4KUD K;  1YCY A;  2P0K A;  2FO0 A;  2DIQ A;  2E12 A;  2KRS A;  2HZY A;  4EDU A;  4JLG A;  3L42 A;  1LCK A;  1AOJ A;  4IUT A;  2KXD A;  4J7F A;  2XD0 A;  4EMK C;  1KC8 U;  3H0I A;  5GAN h;  1B34 B;  3I55 Q;  1QVF P;  1VQ8 A;  2VWF A;  2F2V A;  2QDL A;  1JRI A;  4WTO B;  1F1B B;  5LJ3 j;  3P8B B;  3CCM Q;  3FIF A;  3E9G A;  1OU8 A;  3OBY A;  1BBZ A;  2FRY A;  2JMA A;  4AFZ C;  2RN8 A;  2L0A A;  3I56 Q;  9ATC B;  3CME A;  2EJ9 A;  2O2O A;  2D8J A;  1I1J A;  5KYY B;  1XNI A;  4JRI A;  3OQ5 A;  3PFS A;  1BCM A;  2CUD A;  3UPU A;  1M8V A;  1UJY A;  1I5O B;  4RCB A;  1JBM A;  3CC7 Q;  1Q86 R;  4L6V 5;  2XDB A;  4JLI A;  2ZPI B;  1M90 U;  1JEG A;  2GF7 A;  2L8D A;  1W70 A;  2JS0 A;  1N8R C;  2LQW A;  2V8I A;  2YHT A;  5KCO A;  1K1Z A;  3A8L B;  4FW2 A;  3M57 A;  4J9I A;  2RHY A;  3CMA A;  1J3T A;  5FWC A;  4C0D B;  3JCM Q;  2EJF A;  1PWT A;  4M78 E;  3QZ9 B;  2Y4Y A;  2LJ1 A;  4A4K A;  1H64 1;  5HK0 A;  3HFN A;  2OTJ A;  2P4R A;  2RA2 A;  2P4T A;  4HCC A;  4LN2 A;  1PSE A;  3BW1 A;  1SHF A;  4FM4 B;  4OMP A;  1Q81 C;  4HT9 A;  2FPD A;  3UAT A;  4M7A D;  2MPX C;  1VQ5 A;  5KE2 A;  2ZCF B;  4M77 E;  5FW9 A;  4DBH A;  5GAN e;  3JCM h;  4EPC A;  1SSH A;  3MP8 A;  1MMA A;  1MHN A;  2EQI A;  4MML A;  2XDD A;  1RUW A;  2RQV A;  2K57 A;  2WSC E;  4JUV A;  4OP0 A;  3JCM e;  2HDA A;  2RNA A;  3CC2 Q;  4C92 E;  2JS2 A;  2CSQ A;  2YRV A;  4IUV A;  1WXU A;  2VXE A;  3S3M A;  1PCX A;  4Y92 A;  4JJN K;  1FWZ A;  3ZBD A;  3T9N A;  1A0N B;  2RJF A;  3THK A;  2QI2 A;  1AWJ A;  1KQ1 A;  2LP5 A;  1NPR A;  5A0D A;  2ABL A;  2KSS A;  2EQJ A;  2KK4 A;  2DBM A;  1GCQ A;  4VUB A;  4F14 A;  4DEY A;  4LUD A;  1CSK A;  2AIR B;  1SEM A;  4BI4 A;  4ME7 A;  3ME9 A;  5AYF A;  4OB2 B;  1WGS A;  1TSF A;  1VQK T;  2LQ8 A;  3EG0 A;  3QJ6 A;  3JCM g;  1BKB A;  1Q95 G;  2QK0 A;  3I55 A;  4CI0 C;  1WNL A;  4A63 B;  2Y90 A;  4R0K A;  3EGX A;  4C92 F;  5GMK j;  4QT7 A;  1QVF A;  4J9B A;  3HRT A;  2G3R A;  2PQW A;  2LNV A;  2MYS A;  1QVG P;  2FZG B;  3M4G A;  5DLQ E;  3H0F A;  4EMG A;  4C8Q A;  1VYV A;  3AT1 B;  4LE9 A;  1OV3 A;  4RTU A;  5I2M A;  3CD6 T;  1WHK A;  1HD3 A;  3M0R A;  1YHQ T;  3JCM d;  1VQ4 T;  3KXT A;  3QSU A;  3QYG B;  4A4G A;  4OGC A;  4FL6 A;  4HCK A;  3JRZ A;  3CQT A;  1K9M C;  1O9S A;  2L5Q A;  2JT4 A;  2FHD A;  3URG A;  2COY A;  4FIB A;  8ATC B;  5GAM h;  2M02 A;  3FDR A;  3G4S Q;  1ZSG A;  2EAY A;  1WXT A;  3LGL A;  2OI3 A;  2E5K A;  4P5N A;  3QDR B;  2XHC A;  2J6O A;  2E64 A;  2M16 A;  5GAO n;  5FLX E;  3DKM A;  5J3B A;  2EGE A;  1PC0 A;  2VVK A;  3JAM E;  2A37 A;  3V8K A;  1O75 A;  1Q7Y U;  4PJJ A;  1KG1 A;  3X26 B;  5KYU B;  1YBY A;  2R5A A;  5GAO l;  3QZ5 B;  2FYK A;  2CP7 A;  2FL7 A;  3SD4 A;  1PD1 A;  4LDY A;  3V7S A;  4Z02 A;  3C95 A;  3RBB B;  4Z89 A;  1G3Y A;  2IVW A;  4JZ4 A;  3FC3 A;  2D6F A;  1MMD A;  2X4Y A;  4B9X A;  4PJN A;  4DBF A;  3RMS A;  2F1L A;  2GFU A;  3V7R A;  1VQL Q;  3M0U A;  2D1X A;  3M54 A;  3CCR Q;  2MCN A;  2C0T A;  2OTL A;  1NBE B;  2CH4 W;  3CC2 A;  2DEU A;  2FPF A;  4N4G A;  1RI0 A;  3CBM A;  4LNP A;  1Y57 A;  1M1K R;  2DXC A;  1RAB B;  1GXI E;  4XTX A;  1QWF A;  1PKS A;  1D09 B;  2XI9 A;  1G83 A;  1SHG A;  1VQK Q;  1BYM A;  3VRY A;  3UWN A;  2RK1 A;  1JXO A;  2A0F B;  3EHR A;  3M0P A;  4M75 F;  1QCO A;  1PSF A;  3MEV A;  1GCQ C;  4A4F A;  2YLC A;  2P84 A;  2V1R A;  2QEX T;  1FMV A;  2RM4 A;  1VQ6 T;  3WXM B;  2RQW A;  1I07 A;  1GRI A;  2QGG A;  2QQ9 A;  2JJ9 A;  3G1J A;  5GAN 5;  2RI5 A;  3UA6 A;  1VQ4 Q;  5GJV B;  2K2V A;  4FYW B;  3CCU Q;  3J81 E;  3KFV A;  1YJ9 A;  2YDL A;  1QVP A;  4PNO A;  3NTK A;  3JCM X;  2GFA A;  4QKU A;  1UG1 A;  4GBQ A;  4C8Q B;  2CDT A;  4AFU C;  1ACM B;  4IIO A;  2EPD A;  4X34 A;  3I5R A;  2DVE A;  1TTH B;  4KT0 E;  1IZ6 A;  1X6B A;  1VQL T;  3KBG A;  5D6W A;  2K3Y A;  1AHJ B;  3MP1 A;  3OYE A;  4F7U B;  2QGF B;  2P0P A;  4M77 D;  4DOW A;  1K0S A;  3VS6 A;  1MMG A;  3CXC A;  1KC8 R;  1QQJ A;  1H3Z A;  5CKB A;  4PJO B;  3RIR A;  5J39 A;  1MND A;  1YFN A;  3NFC A;  2B8A A;  4F7U F;  4R56 A;  1R0B G;  3S3O A;  2CGH A;  3C4S A;  4GY5 A;  2KT8 A;  5KH6 A;  1NPP A;  2F2W A;  4M78 D;  5CVI A;  2X4W A;  1VOM A;  1UHC A;  3LYI A;  4LXC A;  2LQK A;  4M7A F;  4B9W A;  1BB9 A;  3BY7 A;  3CCR A;  3SHW A;  1WIE A;  2PTK A;  4PFP A;  1VQP Q;  1MUZ A;  2QQB A;  3L2U A;  1YJW T;  5IHN A;  1I0C A;  4M77 B;  2CH4 A;  4N4H A;  1WQ7 A;  1X2K A;  4M75 C;  4NOY A;  2YUO A;  1RAA B;  3MEU A;  3QO3 A;  1NJI R;  1VQM A;  2L2P A;  2YSQ A;  2EVR A;  1NG2 A;  2AKK A;  3GBQ A;  3CCJ A;  2K7A A;  1VQ8 T;  3JCM W;  5LJ5 e;  4J9C A;  2M1H A;  4F7U E;  5KCH A;  2HBW A;  2K5L A;  2RHU A;  1JJ2 P;  3UF4 A;  4ELY C;  1TS9 A;  5CKH A;  4QVZ A;  1M1G A;  1VQO Q;  2CP3 A;  1K8A U;  1Q86 U;  2GGR A;  3CBP A;  1TH7 A;  2COZ A;  4ZGE B;  1V76 A;  4WF2 A;  2BE9 B;  1EZZ B;  1QKW A;  4PJO C;  1LJO A;  2RQU A;  5CR2 A;  2K3X A;  3VS7 A;  4E7L A;  2ROL A;  5A2Q E;  5CK9 A;  2AHJ B;  2QXF A;  1IO6 A;  3CCR T;  1RAE B;  4C92 D;  1JQQ A;  3VU3 C;  4J83 A;  3GF5 A;  1E6H A;  1N6A A;  1M5Q 1;  2PVG B;  1U06 A;  2VGN A;  4X9C A;  1SKU B;  3CPF A;  4OMQ A;  2KY9 A;  2PUK B;  3CC4 T;  1KC8 C;  5LJ3 g;  1YIJ T;  4M7D B;  3OW2 P;  1VIE A;  1WJQ A;  4A4E A;  1I81 A;  5GAN 8;  2MI6 A;  4RTV A;  1S72 Q;  1ARK A;  2E3H A;  1OUL A;  1YP5 A;  5GAO p;  2OTL T;  2JTF A;  3TEE A;  5GMK l;  1K73 R;  1N8R R;  4KBM B;  1M27 C;  2MK5 A;  3U23 A;  1YI2 T;  1BCO A;  4WCI A;  4XU0 A;  3NHN A;  4ANJ A;  4MMK A;  2DL8 A;  4F7U A;  1U5S A;  1WX6 A;  4QW2 A;  2HBP A;  4JS5 A;  1RI9 A;  2E70 A;  2O4X A;  3FJ5 A;  2H3J A;  4J9F A;  2ATC B;  1M90 C;  3G71 Q;  3CCL A;  4A53 A;  3CC7 A;  2XIC A;  3H41 A;  5FRO A;  2HQH A;  4MDW A;  4QVD A;  2DTH A;  1K9A A;  1KHI A;  2CYZ B;  3ZL7 C;  1G3S A;  1M1K U;  4OML A;  2QTV A;  4OMO A;  1UGQ B;  2DM1 A;  4RTT A;  5IXB A;  3OSV A;  3CEY A;  1X01 A;  3OY9 A;  2KI7 A;  1RLQ C;  2QQS A;  3CCQ T;  1D0Y A;  3OYF A;  2RJE A;  3M0S A;  2CZ6 B;  5FU7 B;  1Q81 U;  3PMT A;  1D0Z A;  3HRU A;  4C5E A;  4PJO D;  3VRZ A;  3PGG A;  3M0Q A;  5CKD A;  3L2V A;  2A28 A;  4IUR A;  5LJ3 f;  2K6D A;  2HAX A;  4AFQ C;  1M3C A;  3O5Z A;  4FYX B;  4X1V A;  2KYM A;  2ZGW A;  3LGF A;  2KR3 A;  3PIP A;  1G3W A;  5GAN j;  4M75 A;  2FRW A;  1NLO C;  3OS5 A;  2KMT A;  4M7D D;  1AWW A;  4II1 A;  4FYY B;  3I9Q A;  3A1P A;  4ORZ A;  5GMK m;  3CPW A;  2NYS A;  1NEB A;  2I0N A;  1D1C A;  5GAN 4;  2OJ2 A;  4M75 G;  1VQ9 T;  5FRM A;  2DPP B;  3M59 A;  6AT1 B;  4BUG A;  2AKL A;  3WVE B;  1TWB A;  4E6R A;  4E7J A;  5LJ5 j;  1AWO A;  2K5F A;  4XTU A;  1IHV A;  2HKN A;  2O4X B;  1RAD B;  3GPL A;  2X35 A;  4LUE A;  3Q1J A;  1OZ3 A;  2ZPE B;  4PL6 A;  2BE7 D;  2EYX A;  4PJM A;  1C1A A;  2LX7 A;  3GOX A;  5LL6 S;  1QW1 A;  4KUI A;  2JMC A;  4MDX A;  3VUZ A;  2DVJ A;  3PE0 A;  4OMF B;  3CCV A;  3S3N A;  1YWO A;  2B86 A;  1D3B A;  4C5H A;  2CZ1 B;  1QLY A;  4XU2 A;  2K79 A;  5GAM f;  3RKX A;  2DJQ A;  2JNG A;  1KD1 R;  2RQT A;  4OGE A;  1UJ0 A;  4IUP A;  1X75 C;  4N0A A;  5GAN 2;  2KRN A;  2PUO B;  3VUB A;  1N8R U;  3CD6 Q;  4FT2 A;  4DOV A;  1YIT A;  2D0N A;  3RKW A;  3M0T A;  1IXD A;  4JDS A;  2RB6 A;  4LDU A;  1VQ7 T;  2E4H A;  1MNE A;  3JB9 I;  1YIJ Q;  1RAF B;  2DYB A;  2H8H A;  4BY6 C;  2JXB A;  1WDX A;  1XOV A;  5GAM d;  4HCZ A;  2JM9 A;  3OS0 A;  1E7O A;  1K9M U;  3JCM J;  4M7A G;  4J6X A;  2VXF A;  2EGC A;  4O5V A;  2JN0 A;  1XJW B;  1LPL A;  2KRO A;  4TVR A;  1IGU A;  3VS4 A;  1HYO A;  5L8R E;  4C0Z A;  1VQN T;  2MF2 A;  3M4Y A;  2E41 A;  1MGQ A;  1MMN A;  2DL7 A;  3O8V A;  4C0D C;  2VC8 A;  2Y4X A;  2C0I A;  1Y7X A;  2JW4 A;  3I56 T;  5GAM g;  2DFU A;  3RNJ A;  3JB9 D;  1E6G A;  2DAQ A;  3RR6 A;  2X4J A;  1M4Z A;  1UEC A;  2V1Q A;  2DL3 A;  3CCJ T;  2LCC A;  3OA6 A;  1K76 A;  2DRM A;  2HL5 C;  2PNI A;  4QVC A;  3JB9 G;  2DZ9 A;  2G6F X;  2BIV A;  2OX7 A;  1VQ5 T;  1ZSZ B;  4RUG A;  5GAO q;  4QQG A;  1X6G A;  4HCB A;  1KQ2 A;  1X6O A;  2E1H A;  3CCQ Q;  1QVG S;  3OYD A;  1M30 A;  1UE9 A;  2YLB A;  3SDZ A;  4C8Q C;  4LDX A;  1VUB A;  2NUP B;  2NWM A;  5IH2 A;  2JZ2 A;  3RMQ A;  4Q5W A;  1YJN Q;  4FCY A;  2XMF A;  4C0F A;  4HVU A;  3OYC A;  2X51 A;  2DL5 A;  4F16 A;  1D1B A;  2K3B A;  5KYY A;  1ZUK A;  1Q82 U;  3OSS C;  1I5L A;  4DEX A;  2PZ1 A;  2ROT A;  4ESR A;  1EFN A;  2BZ8 A;  3EH1 A;  4RTZ A;  4ZNX A;  1KQS A;  2AK5 A;  2GBQ A;  3QKJ A;  2FEI A;  5HCK A;  1RL2 A;  4ZTJ A;  4FSS A;  3L1A A;  1VQM Q;  3H0H A;  2H3E B;  2RI3 A;  1RLP C;  1PG5 B;  3EFR A;  2DYI A;  4C8Q D;  3MEA A;  4XTV A;  4E7H A;  4LD6 A;  3HL8 A;  1TUC A;  3CMA T;  1AVZ C;  2VAS A;  4BY6 B;  1YJW Q;  1KHC A;  1UGP B;  4AG2 C;  4E47 A;  1OOT A;  2JUF A;  3PVQ A;  3X28 B;  1K9M R;  3CCL Q;  4N0A C;  4C0G A;  4QQD A;  8AT1 B;  5D6X A;  5GMK i;  1D1A A;  1ABO A;  4M78 G;  4BE1 A;  4M78 C;  1WHG A;  3DLL A;  3M53 A;  3JSC A;  4J9G A;  1WYX A;  3QYH B;  4ZTF A;  2DD5 A;  3CCE A;  2E3I A;  4E7I A;  1C6V X;  1AWX A;  1WI7 A;  3R6N A;  5LJ5 h;  1ZLM A;  2LT4 A;  2FVU A;  5GAO m;  3OYH A;  1VQN A;  1TXQ A;  2MWP A;  2L3S A;  3E19 A;  4M78 B;  1N9R A;  4ZGJ B;  2ENM A;  1ZX6 A;  4YTL A;  5IHI A;  4IUQ A;  3OYY A;  2IIM A;  2ZPB B;  2DE0 X;  3C0C A;  3I56 A;  2RJC A;  1R8O B;  1MV0 B;  4L5G A;  3VS0 A;  1KD1 U;  5CKF A;  1VQL A;  2EGA A;  2P0Q A;  1H3H A;  3RKY A;  1Q81 R;  4BI8 B;  1VQP T;  4IKF A;  1B07 A;  1HXD A;  4J9D A;  4OF1 A;  1K73 U;  2CKK A;  2EJG A;  1YN8 A;  2DK3 A;  1ZBX A;  3PIO A;  3QWX X;  3M9Q A;  2SEM A;  3V8J A;  2DXB A;  1T0H A;  1WQW A;  4L59 A;  3QDF A;  3CMA Q;  5LJ5 g;  1HSQ A;  2QEX A;  1QVG A;  3TSW A;  1KK7 A;  5I22 A;  2KQW A;  2L3P A;  2LC4 A;  3EG1 A;  2K9G A;  1QP3 A;  2K4Y A;  2EYZ A;  3NTI A;  3OYJ A;  2DXT A;  1PD0 A;  3GP8 A;  2OTL Q;  1JB0 E;  1VIF A;  3JV3 A;  1UUE A;  1IGQ A;  4FYV B;  3HSB A;  2KXC A;  1BK2 A;  4M7D F;  3M5A A;  1AZE A;  4C92 A;  1YJ9 Q;  1Q86 C;  2EWN A;  1M3A A;  1UHF A;  3UA7 A;  1M9S A;  3A98 A;  3G6E T;  2GCX A;  3G71 T;  4CC3 A;  4RCC A;  1OI1 A;  2RMO A;  4Z8A A;  1D0X A;  1NJI C;  2EQK A;  1NYG A;  2V26 A;  3ER0 A;  4PJO F;  1D3B B;  3AHU A;  2D8H A;  3I55 T;  1X69 A;  1FXX A;  4AT1 B;  2K5I A;  3VS1 A;  4M78 F;  2A08 A;  3G7Z A;  1SSF A;  4JRP A;  1YJN A;  2V8J A;  4XAX B;  1HK9 A;  2LCS A;  2OAU A;  5A0L A;  5KE3 A;  4JZ3 A;  1YIJ A;  4DBR A;  5GJW B;  3QJY A;  5I2S A;  3CCS A;  1ZHI A;  3HKS A;  3WVD B;  2DXU A;  2DEQ A;  1EIF A;  2WSE E;  2QG9 B;  2HKQ B;  2FZC B;  1WJS A;  3S6W A;  3JB9 H;  2LZ6 B;  4FU6 A;  4NL2 A;  4E7K A;  1M90 R;  2DO3 A;  2ZPF B;  4M77 F;  1TOV A;  4CC4 B;  1Q82 C;  2E65 A;  1YHQ Q;  2LMJ A;  1R0C B;  5LJ3 d;  1JXM A;  3L2Q A;  1SPK A;  4PFO A;  4HA8 A;  3E2U A;  4HXJ A;  2FB7 A;  1M3B A;  1UFF A;  3JB9 J;  2JM8 A;  3L2R A;  3MJX A;  1WPY A;  2DBK A;  4M78 A;  1QP2 A;  2MOX A;  3QPH A;  1H8K A;  2F5K A;  5M9O A;  3QBY A;  3PMI A;  2EYW A;  3VJP A;  3CCL T;  4C5I A;  5FU6 B;  1WA7 A;  2J6K A;  2DF6 A;  4PJO A;  2CUB A;  5FRN A;  2QAS A;  3X25 B;  4PKC C;  3CCM T;  5KYX A;  3VYH B;  5GAM j;  3BDU A;  1PRL C;  3M56 A;  1IRE B;  1N9S A;  1RAG B;  2YUQ A;  3X24 B;  5KYN A;  1SRM A;  2ZAE A;  2M9U A;  1U1S A;  4M75 D;  4JJC A;  1P92 A;  1AEY A;  2O9S A;  4CC2 A;  2YT6 A;  3CCE T;  1CKA A;  2ESW A;  3OYM A;  2RQR A;  2KRM A;  3EG9 B;  2DL4 A;  1VQK A;  4AG1 C;  4AMC A;  3BDL A;  1T0J A;  2JTE A;  2NUZ A;  3EG3 A;  3QXE B;  1T3S A;  3NPF A;  3J7A F;  2MMP A;  5LJ3 e;  2LCL A;  3OBW A;  4FSX A;  4J6W A;  1WHH A;  2CP2 A;  3VKI A;  2OTJ Q;  2DTI A;  5CO7 A;  1LVK A;  2CT4 A;  2L3Q A;  2XG8 D;  1KQS P;  1MV3 A;  1WLP B;  1KD1 C;  1BI0 A;  2E6Z A;  1S72 A;  2YRC A;  2DA9 A;  4JJD A;  2KEA A;  4M75 B;  1VQ4 A;  2QYZ A;  3LWH A;  2GTJ A;  1K73 C;  1R77 A;  4M77 C;  1YWP A;  1BI1 A;  5HKC A;  1UEB A;  4C92 C;  2A3L A;  5GMK e;  3KUF A;  1W2B P;  1OX9 A;  1XTD A;  1BIA A;  4NS5 A;  2VYT A;  1RAH B;  4DA4 A;  2SRC A;  2NUP A;  4O6J A;  4XTY A;  3CCS Q;  1YJW A;  1YJ9 T;  2EIF A;  2EFI A;  4BD3 A;  5GMK h;  1KIK A;  3E9F A;  1HJD A;  4HVV A;  1Y96 B;  3RES A;  2KDS A;  3MP6 A;  2K2M A;  2QA4 A;  2VKN A;  1K8A R;  2KVQ G;  2RD1 A;  1U3O A;  3L2W A;  2LQN A;  1UGR B;  2DET A;  2IG0 A;  2F69 A;  5FU7 C;  1CKB A;  3V7C A;  5IAY A;  1YCS B;  3L2Z A;  2EKO A;  2EYQ A;  1N5Z A;  2NLU A;  1X43 A;  2DZC A;  2XKO C;  1JJ2 A;  3A5Z B;  2OTJ T;  2LTO A;  3V8L A;  3SEM A;  3LWI A;  3PNW C;  3HPW A;  1YIT Q;  2L3R A;  1IRX A;  3EG2 A;  5GAN f;  3A8O B;  3SWN A;  4M75 E;  2DRK A;  2DJZ A;  2JOY A;  4DBQ A;  1TUG B;  1X27 A;  3FLG A;  3REB B;  3RER A;  3TSZ A;  4J5Y A;  3VS2 A;  2F5T X;  4EMK B;  1K4U S;  3N5B B;  4BAC A;  1VQO T;  2CS7 A;  4EMK A;  3FRN A;  3MEW A;  1Z9Z A;  2A7Y A;  1KFZ A;  1N27 A;  5EC7 A;  2CP0 A;  1NEG A;  3RDV A;  2QTX A;  2DTO A;  3CPW P;  1QVF S;  4HVW A;  1UB4 A;  4HT8 A;  2GTO A;  5HK3 A;  2XK0 A;  1Q7Y R;  3OW2 A;  1AD5 A;  4QQ6 A;  3CME T;  2KT1 A;  1KQS S;  5GAM e;  2BUD A;  3CBO A;  1FMW A;  4AFS C;  2R57 A;  3JCM c;  2EQU A;  1UTI A;  3HRS A;  5IT9 E;  4KGV B;  2GNC A;  4MZM A;  2MWO A;  3P8D A;  3CXC P;  2AZV A;  1VQ7 A;  2YXY A;  3QII A;  1G8X A;  4J6Y A;  2LX9 A;  4BE2 A;  3G4S T;  4A4H A;  3I5S A;  4XTW A;  1YIT T;  4JPB W;  2HSP A;  5IHK A;  3OW2 S;  1VQ6 A;  4OB1 B;  5IN1 A;  3HFO A;  4ZN1 A;  1ZA1 B;  3QHS A;  3CCS T;  2E5Q A;  3SWN B;  1JO8 A;  1ZSZ A;  4V2S A;  2LJ0 A;  4ATO A;  1UDL A;  4CRI A;  4F04 B;  3UDC A;  3C12 A;  5GAN g;  2WAC A;  3M58 A;  3JCM V;  3JCM P;  5CQX A;  5LJ5 d;  1KJW A;  1PNJ A;  2I2L A;  2LDM A;  4KH0 B;  4J7I A;  2JTM A;  7AT1 B;  2HQX A;  2C0O A;  3PT9 A;  3X20 B;  2QQA A;  1GBR A;  2PVD B;  2LVM A;  5FU6 C;  3H8Z A;  3SB2 A;  4M77 G;  3CC4 Q;  2VV5 A;  5I11 A;  1OPL A;  1TUD A;  5CIU A;  2C06 A;  5GAN d;  2AZS A;  1NLP C;  3MHX A;  2LNH B;  3VYG A;  4C5G A;  3RUX A;  3GIB A;  3ZFJ A;  4M4Z A;  3G4S A;  3MCA B;  3EAE A;  3OYN A;  5GAN 6;  1W4S A;  4BB7 A;  2O88 A;  4E2F B;  4PJL A;  3VS5 A;  3ASK A;  4XTZ A;  2YUP A;  2O31 A;  4PJO G;  5C0M A;  3DLM A;  3MO8 A;  1Y07 A;  4RTX A;  3CC7 T;  2R58 A;  2DLP A;  2MAM A;  5LJ3 h;  2M0Y A;  2XU8 A;  4F7U G;  3DB3 A;  2LT1 A;  3FB9 A;  2FPE A;  4OMN A;  3OYI A;  1WHL A;  5KYX B;  2CSI A;  3H6Z A;  2HL3 A;  2FG0 A;  3G6E Q;  5HY6 A;  3MET A;  3QUI A;  4GLK A;  5GAN 7;  3OB9 A;  4J9E A;  2JVV A;  2HD0 A;  4Z88 A;  3JCM b;  4XQ3 A;  1WJR A;  4GLM A;  2Z0W A;  1T3L A;  1VQ7 Q;  1NE8 A;  1JJ2 S;  2RJD A;  4CC7 A;  1ZQ1 A;  1XQH A;  2HSE B;  1G5V A;  4HKE A;  3F70 A;  2ZZD A;  3GNF B;  2MIO A;  3HHT B;  1RAC B;  4M7A B;  4K11 A;  1UGV A;  3PTA A;  2FZK B;  2RO0 A;  3LX7 A;  2COW A;  2J7I A;  4M7A A;  4LDV A;  5AT1 B;  5FWB A;  2RPN A;  1FX7 A;  3OS1 A;  4RG2 A;  1Q7Y C;  1VQ8 Q;  2ED0 A;  4PFZ A;  1ABQ A;  2QEX Q;  2HNI A;  4PK4 A;  4FW1 A;  1KSW A;  1QCN A;  1OPK A;  2ZPG B;  3OYL A;  1VQ9 Q;  5D7U A;  1V1C A;  2QA4 T;  2X3W D;  1B34 A;  4ELZ C;  2BKD N;  1G2B A;  5DM7 R;  1RAI B;  4MZP A;  3ZEH A;  1W2B S;  3FEO A;  3CC4 A;  2YUN A;  2RH2 A;  4FT4 A;  1U8R A;  1M1K C;  4PLI A;  3QWY A;  4XU1 A;  4RMO A;  2IPO B;  4KUL A;  3NTH A;  1B7T A;  4KGZ B;  2O01 E;  1ZSZ C;  1YNZ A;  4UC4 A;  1NJI U;  2RK2 A;  1I8F A;  5GAO r;  3QG1 A;  5KYW B;  2ZPH B;  1SRL A;  2X3X D;  4A54 A;  4OB3 B;  2VGM A;  3NGP A;  1VQN Q;  2KE9 A;  2NUT A;  4BDY A;  1QWE A;  1SF9 A;  2X4X A;  1BI3 A;  3TVT A;  3FJP A;  1NM7 A;  4EMH A;  2EBP A;  2WSF E;  5DLO A;  1S72 T;  2RI2 A;  1LNX A;  2CZ7 B;  2D9T A;  1LOJ A;  1YI2 A;  2EYY A;  4RKU E;  3OYK A;  4D6W A;  4OB0 B;  3MKD A;  4M7A E;  3A8M B;  2YWW A;  3HP9 A;  1IB8 A;  1ZUU A;  2F2X A;  2BTT A;  3TQ7 P;  3REA B;  2R5M A;  2ECZ A;  3C94 A;  5CQY A;  1VQM T;  2ED1 A;  3VV0 A;  1OU9 A;  1DJ7 B;  1Y0M A;  2HCK A;  1GBQ A;  4ZN3 A;  2EQM A;  4IIM A;  1ZUY A;  3EGX B;  2J6F A;  3OS2 A;  4Y91 A;  2E6N A;  1ZBJ A;  3CCV T;  2HEQ A;  2KYB A;  1W1F A;  2D0Q B;  2XID A;  2E10 A;  3DB4 A;  4EIK A;  1M2O A;  1ZA2 B;  1UGS B;  1M2V A;  2GQI A;  2HMA A;  3IQL A;  3TU4 K;  1PM3 A;  4MZT A;  1NYF A;  3CCE Q;  5ECA A;  4R55 A;  1M8M A;  2GQV A;  3JB9 F;  2X9H A;  2OAW A;  1OYX A;  4XU3 A;  4BE0 A;  3INZ A;  3OMC A;  1WXB A;  2PU9 B;  3EH2 A;  3M55 A;  4X9D A;  4D8D A;  3G71 A;  1VA7 A;  3EFO A;  2RHZ A;  2A36 A;  3MPU B;  5IXF A;  2LJ3 A;  4C8Q E;  2AT1 B;  1VQ9 A;  3OYA A;  1M1F A;  1K0X A;  1VQ5 Q;  2CP6 A;  1V29 B;  4Y28 E;  5CAI A;  3A8G B;  2CT3 A;  3LH5 A;  2KNB B;  1U1T A;  4B6M A;  3LH0 A;  2KGT A;  4JJB A;  4OMM A;  4M7A C;  3OMG A;  3GLX A;  1FYN A;  4M7D C;  1GFD A;  1WHJ A;  3BFM A;  1FMK A;  2DMO A;  1YJN T;  3UT1 A;  2VB6 A;  1GCP A;  3EFS A;  5A0G A;  5D6Y A;  1AZG B;  3LLR A;  5KYU A;  4E7S A;  5J26 A;  1TG0 A;  1YI2 Q;  3JCM f;  1OQK A;  2VUB A;  5KYW A;  3P8H A;  5EG2 A;  3EGD B;  1AT1 B;  3CCQ A;  4RTW A;  1M2V B;  2NUT B;  2QAZ A;  1K8A C;  2RF0 A;  2YRD A;  2CP5 A;  4OVA A;  3BE3 A;  4C8Q F;  1PKT A;  1PRM C;  2QA4 Q;  1GFC A;  2CZ0 B;  3NMZ C;  2DD4 A;  1TU0 B;  3CCU A;  4IUU A;  3CCM A;  4LDW A;  2EW3 A;  5I21 A;  2RHX A;  3PVL A;  3EGU A;  3A8H B;  4KGX B;  1X2Q A;  1JU5 C;  1BU1 A;  3CME Q;  3I35 A;  3H9N A;  3J80 E;  4NL3 A;  1VQ6 Q;  4M7D E;  2L89 A;  5CCA A;  1H92 A;  3CXC S;  1Q82 R;  1B3Q A;  4PLL A;  2W10 A;  2O9V A;  2PVO B;  3OYG A;  1NZ9 A;  3R6O A;  1QKX A;  2V8K A;  2HQE A;  4KH1 B;  4BDZ A;  1WZO A;  2J06 A;  4C92 G;  2BZX A;  2KBT A;  5CKE A;  3D7S B;  1I4K 1;  1Y96 A;  4PJO E;  3CCV Q;  3EG9 A;  4ZGD B;  3G6E A;  4RG8 A;  2DNU A;  4E7Z A;  3LW5 E;  4D8K A;  1WFW A;  1BIB A;  3EGD A;  2XDP A;  1IHW A;  3OYB A;  2DIG A;  2J05 A;  3CD6 A;  1VQP A;  1YHQ A;  3VS3 A;  4M77 A;  1G3T A; 
#chains in the Genus database with same CATH homology
 2DX1 A;  1X6B A;  3H0H A;  2CRE A;  3I5S A;  1QCF A;  1RLP C;  4JPB W;  2W0Z A;  2HSP A;  5IHK A;  4KRT A;  1Z9Q A;  5L23 A;  1K0S A;  3VS6 A;  1VYU A;  3ULR B;  1TUC A;  1JO8 A;  1AVZ C;  2LJ0 A;  1UDL A;  1PHT A;  2M51 A;  4AG2 C;  1OOT A;  2EKH A;  3PVQ A;  1KJW A;  1PNJ A;  2KT8 A;  4RTY A;  4F17 A;  1S1N A;  2F2W A;  2BZY A;  1UHC A;  4J9H A;  1VYT A;  2DIL A;  1GL5 A;  1BB9 A;  2C0O A;  1ABO A;  1GBR A;  3EHQ A;  3SHW A;  4J9G A;  1WIE A;  2PTK A;  1WYX A;  1MUZ A;  5I11 A;  1W6X A;  1OEB A;  5IHN A;  1I0C A;  1OPL A;  1TUD A;  1WI7 A;  1AWX A;  2CH4 A;  3R6N A;  1ZLM A;  2AZS A;  1NLP C;  2LNH B;  2L3S A;  1X2K A;  2ENM A;  1ZX6 A;  2YUO A;  5IHI A;  2FO0 A;  2IIM A;  2DE0 X;  3C0C A;  2L2P A;  4M4Z A;  2KRS A;  2YSQ A;  2EVR A;  1MV0 B;  1NG2 A;  2AKK A;  3VS0 A;  3GBQ A;  2EGA A;  1H3H A;  1LCK A;  1AOJ A;  2K7A A;  2O88 A;  4J9C A;  2KXD A;  3VS5 A;  1B07 A;  2HBW A;  2YUP A;  4J9D A;  3UF4 A;  3H0I A;  2O31 A;  1YN8 A;  2VWF A;  2F2V A;  2QDL A;  4RTX A;  2DLP A;  2GGR A;  2M0Y A;  3QWX X;  2SEM A;  1QKW A;  1BBZ A;  1T0H A;  2FRY A;  2JMA A;  4AFZ C;  1HSQ A;  2FPE A;  2RN8 A;  4OMN A;  3TSW A;  2L0A A;  2RQU A;  5I22 A;  3VS7 A;  2ROL A;  2L3P A;  2D8J A;  1I1J A;  2O2O A;  3EG1 A;  2CSI A;  2K9G A;  2EYZ A;  1IO6 A;  2FG0 A;  2CUD A;  1UJY A;  1JQQ A;  4J9E A;  4Z88 A;  3JV3 A;  1UUE A;  1E6H A;  4GLM A;  1U06 A;  1T3L A;  4OMQ A;  4CC7 A;  1JEG A;  1W70 A;  2KXC A;  2JS0 A;  1BK2 A;  2LQW A;  1AZE A;  1K1Z A;  1M3A A;  2MIO A;  1UHF A;  4J9I A;  3UA7 A;  4RTV A;  3A98 A;  1ARK A;  1J3T A;  4K11 A;  5FWC A;  1PWT A;  1UGV A;  1YP5 A;  4CC3 A;  2RMO A;  4Z8A A;  2J7I A;  2LJ1 A;  1NYG A;  5FWB A;  2RPN A;  1M27 C;  3U23 A;  2P4R A;  2ED0 A;  1ABQ A;  4LN2 A;  4WCI A;  1KSW A;  2D8H A;  1OPK A;  3NHN A;  1SHF A;  4OMP A;  2FPD A;  2DL8 A;  3UAT A;  1X69 A;  1U5S A;  1WX6 A;  1RI9 A;  1V1C A;  5FW9 A;  3VS1 A;  3FJ5 A;  2A08 A;  4J9F A;  2X3W D;  3H41 A;  1SSH A;  2LCS A;  1G2B A;  4JZ3 A;  2EQI A;  5GJW B;  1K9A A;  2YUN A;  3ZL7 C;  1RUW A;  3QWY A;  2RQV A;  4OML A;  4OMO A;  2LZ6 B;  1YNZ A;  2HDA A;  2DM1 A;  4RTT A;  5IXB A;  4CC4 B;  2RNA A;  2LMJ A;  2JS2 A;  1RLQ C;  1SRL A;  2CSQ A;  2X3X D;  1JXM A;  1SPK A;  1WXU A;  3NGP A;  3M0S A;  2KE9 A;  4HXJ A;  1M3B A;  1UFF A;  1QWE A;  2JM8 A;  3TVT A;  4Y92 A;  1NM7 A;  3VRZ A;  1A0N B;  3THK A;  2EBP A;  1AWJ A;  2DBK A;  3M0Q A;  2MOX A;  2A28 A;  2LP5 A;  1H8K A;  2ABL A;  2EYY A;  2K6D A;  2EYW A;  4AFQ C;  1M3C A;  2DBM A;  3O5Z A;  1WA7 A;  2J6K A;  4X1V A;  2DF6 A;  2KYM A;  2KR3 A;  2CUB A;  1GCQ A;  4F14 A;  4DEY A;  4LUD A;  1CSK A;  2FRW A;  1NLO C;  1SEM A;  1PRL C;  1AWW A;  1ZUU A;  2F2X A;  2BTT A;  3I9Q A;  4ORZ A;  3REA B;  1NEB A;  2I0N A;  2YUQ A;  2ECZ A;  1SRM A;  2OJ2 A;  2ED1 A;  3EG0 A;  1Y0M A;  2HCK A;  4JJC A;  1GBQ A;  2AKL A;  1AEY A;  4A63 B;  2O9S A;  4CC2 A;  2YT6 A;  4R0K A;  4IIM A;  4E6R A;  1CKA A;  1AWO A;  2ESW A;  4QT7 A;  4J9B A;  2RQR A;  2KRM A;  1ZUY A;  2DL4 A;  4AG1 C;  2J6F A;  4LUE A;  1T0J A;  1ZBJ A;  2JTE A;  2NUZ A;  3H0F A;  2EYX A;  2HEQ A;  3EG3 A;  2KYB A;  1T3S A;  1W1F A;  1VYV A;  3NPF A;  4LE9 A;  4EIK A;  2LX7 A;  1OV3 A;  4RTU A;  1HD3 A;  2JMC A;  3M0R A;  2CT4 A;  2L3Q A;  2GQI A;  2DVJ A;  3PE0 A;  1MV3 A;  1WLP B;  3IQL A;  4HCK A;  3CQT A;  1NYF A;  1YWO A;  2B86 A;  5ECA A;  2JT4 A;  1M8M A;  1QLY A;  2K79 A;  2OAW A;  2DA9 A;  4JJD A;  2KEA A;  1WXB A;  2DJQ A;  4D8D A;  2GTJ A;  2RQT A;  1VA7 A;  1UJ0 A;  2A36 A;  5IXF A;  1YWP A;  2LJ3 A;  1ZSG A;  1WXT A;  2KRN A;  1K0X A;  2OI3 A;  2E5K A;  2D0N A;  3M0T A;  2CT3 A;  2J6O A;  2SRC A;  3LH5 A;  2EGE A;  2KNB B;  2KGT A;  2VVK A;  4JJB A;  4OMM A;  2DYB A;  2H8H A;  1FYN A;  2JXB A;  1WDX A;  1XOV A;  1GFD A;  2A37 A;  1FMK A;  2JM9 A;  2DMO A;  1KIK A;  1HJD A;  1GCP A;  1E7O A;  4HVV A;  2EGC A;  1AZG B;  2K2M A;  2VKN A;  2KRO A;  1U3O A;  1TG0 A;  2LQN A;  3VS4 A;  2DL7 A;  1CKB A;  3RBB B;  4Z89 A;  4JZ4 A;  4RTW A;  2C0I A;  2JW4 A;  1YCS B;  2RF0 A;  1N5Z A;  3RNJ A;  1X43 A;  1E6G A;  3SEM A;  1PKT A;  1PRM C;  3M0U A;  2D1X A;  1GFC A;  3NMZ C;  2MCN A;  2C0T A;  2CH4 W;  3EG2 A;  2FPF A;  2EW3 A;  1UEC A;  2V1Q A;  2DRK A;  3PVL A;  2DL3 A;  3EGU A;  4LNP A;  1Y57 A;  1X2Q A;  1JU5 C;  1K76 A;  1X27 A;  2DRM A;  1BU1 A;  3REB B;  3I35 A;  2PNI A;  3TSZ A;  1QWF A;  1PKS A;  3VS2 A;  2G6F X;  1K4U S;  1G83 A;  1H92 A;  1SHG A;  4RUG A;  1B3Q A;  3VRY A;  2W10 A;  1Z9Z A;  2O9V A;  1X6G A;  1KFZ A;  5EC7 A;  1JXO A;  1M30 A;  3EHR A;  3M0P A;  1NEG A;  1UE9 A;  1QKX A;  4HVW A;  2GTO A;  2J06 A;  2BZX A;  1GCQ C;  2NWM A;  5IH2 A;  2KBT A;  1AD5 A;  2KT1 A;  2V1R A;  2XMF A;  4HVU A;  2RQW A;  1I07 A;  2DL5 A;  4F16 A;  1GRI A;  2DNU A;  4AFS C;  2K3B A;  3UA6 A;  4D8K A;  1WFW A;  1ZUK A;  5GJV B;  1UTI A;  3KFV A;  2YDL A;  2GNC A;  4DEX A;  2PZ1 A;  2J05 A;  2ROT A;  4ESR A;  1EFN A;  1UG1 A;  2BZ8 A;  4GBQ A;  4RTZ A;  4ZNX A;  2CDT A;  4AFU C;  2AK5 A;  2AZV A;  2GBQ A;  3VS3 A;  4IIO A;  2FEI A;  5HCK A;  2EPD A;  3I5R A;  4FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...