1GCQC

Crystal structure of vav and grb2 sh3 domains
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
GSHMPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/signaling protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcqC00
4RTYA 2VKNA 1WLPB 1QWFA 4OMOA 1BB9A 1TUCA 4JZ4A 2RQTA 2D8JA 2DL3A 1W70A 1G83A 1UHCA 2C0OA 4DEYA 4ESRA 1ZLMA 1ZUUA 5HCKA 2O9VA 3H0IA 3PVLA 2YUNA 3VS5A 4Z89A 4J9BA 2J6FA 1YNZA 1PHTA 1OEBA 2V1RA 3NGPA 5EC7A 1H8KA 4ORZA 3UATA 1I0CA 4JZ3A 3JV3A 2YUPA 1JXOA 1SHGA 1PKSA 1JU5C 1UGVA 2ABLA 3FJ5A 4RUGA 3VRZA 3UA7A 4J9DA 2LJ1A 1SEMA 1M27C 1YWPA 3I9QA 2YSQA 1CKAA 2DRMA 1YP5A 4HVUA 1VYTA 4RTWA 1BU1A 1HD3A 1VA7A 1H3HA 2F2VA 4RTTA 1KSWA 1U06A 1SRMA 4IIOA 1I1JA 2PZ1A 4JJDA 1N5ZA 1AOJA 3U23A 2EYXA 4AFQC 2SRCA 1WYXA 1WXTA 1X6BA 2DNUA 2V1QA 2CT3A 2AZVA 4E6RA 2KGTA 2YUOA 2B86A 1AD5A 3NPFA 3M0RA 1A0NB 2AZSA 2KT8A 2XMFA 3THKA 4J9IA 4A63B 1WFWA 3VS6A 1JXMA 2K2MA 2KRMA 3QWXX 1GRIA 4GBQA 1AWXA 2KROA 2DYBA 2CDTA 1B3QA 1X2KA 3TSWA 2LX7A 2J06A 2KXDA 2DE0X 2KYMA 5I22A 1YWOA 4J9GA 1X69A 2EKHA 4OMQA 1AZGB 3I5SA 2DF6A 4OMLA 4RTZA 3RNJA 3QWYA 1UHFA 2G6FX 1OV3A 4WCIA 2MOXA 1M8MA 2DL8A 1QKXA 2ENMA 2O2OA 4HCKA 1VYUA 1ZX6A 3NMZC 1WIEA 2DX1A 1Y0MA 1J3TA 1GL5A 3RBBB 1Z9QA 2F2XA 2LZ6B 2O88A 2C0TA 4J9CA 2BZXA 4K11A 2JS0A 3SHWA 2EYWA 1S1NA 1ZUYA 2X3WD 4QT7A 2LCSA 1MV0B 1PNJA 2L3PA 4ZNXA 1NYFA 2D1XA 1KFZA 2VVKA 2A36A 3I35A 1K0XA 1X2QA 2HBWA 3NHNA 1SHFA 2P4RA 1WXBA 5FWBA 1WDXA 2KXCA 1G2BA 2EBPA 2J05A 1K76A 1K0SA 2DL5A 1X6GA 4JJBA 2CT4A 2L3SA 4F16A 1PKTA 2JW4A 3O5ZA 1U3OA 2GTJA 2CH4A 2OI3A 5I11A 2LQWA 2RN8A 1RLPC 2AKLA 2DL7A 2VWFA 1UDLA 1VYVA 1M3BA 1K1ZA 1K9AA 4RTXA 3CQTA 1UECA 2L0AA 2SEMA 4LE9A 2MCNA 1KIKA 2CUBA 1T3SA 1M3CA 2FEIA 1AEYA 1B07A 2CREA 3UA6A 1CSKA 3VS0A 2FPFA 4HVVA 2K79A 2RQVA 1QWEA 1AWJA 2EPDA 1OOTA 2RMOA 4X1VA 4IIMA 1MV3A 2RQUA 4LUDA 2C0IA 5FW9A 2LJ0A 1WX6A 3H0FA 3R6NA 2F2WA 2BTTA 1E6GA 3KFVA 2KE9A 1ZUKA 4D8DA 1QKWA 2BZ8A 4CC2A 3EG0A 3REAB 1SSHA 2DBKA 2EGCA 2DMOA 4LN2A 2DL4A 4GLMA 4JJCA 5IHIA 3ZL7C 1FYNA 2PNIA 4Z88A 2JT4A 1AVZC 4Z8AA 2JS2A 5IXBA 1YCSB 3M0PA 3M0UA 2JTEA 1AWWA 3VS4A 2X3XD 1BBZA 3VS2A 1TG0A 2ED0A 5IXFA 2GQIA 1KJWA 2ECZA 2EGAA 4J9HA 2J7IA 2GBQA 3EGUA 2ESWA 1GBQA 3TSZA 1W6XA 2DJQA 2JMCA 3TVTA 2K9GA 4R0KA 2KT1A 3A98A 1NEGA 1U5SA 1UE9A 1PRLC 2GGRA 3REBB 2FPEA 4AG1C 2CSQA 2ED1A 2YDLA 2AKKA 2D8HA 1GBRA 1JEGA 1WA7A 1E7OA 1WXUA 2A28A 2DM1A 4CC7A 3EHQA 2RNAA 4HXJA 2A08A 2HEQA 3EG1A 3H0HA 4M4ZA 3H41A 2KEAA 2NUZA 1GCPA 3PE0A 4AFZC 1ZSGA 2I0NA 4RTUA 2DA9A 2DLPA 1T0HA 3ULRB 3VS3A 1NM7A 1NYGA 1CKBA 2EQIA 2EVRA 3M0QA 2O9SA 1RI9A 1UG1A 5IHKA 2L2PA 4CC3A 2H8HA 1OPKA 2HDAA 5GJWB 2CSIA 2W0ZA 2KBTA 1V1CA 2K3BA 1HSQA 2CUDA 1UUEA 2J6OA 4F17A 3VS7A 2LP5A 1PRMC 1GFCA 2K7AA 4F14A 2DVJA 2KYBA 1IO6A 2HSPA 1ABOA 1BK2A 5GJVB 2YUQA 3M0TA 2FO0A 2JM9A 1XOVA 1SRLA 2M51A 3EG2A 2E5KA 2NWMA 4LUEA 2RPNA 1WI7A 2FPDA 2ROLA 1NLOC 4OMNA 5IH2A 2GNCA 1YN8A 1UJYA 2W10A 2OJ2A 2KNBB 1E6HA 3EG3A 4AFSC 2J6KA 2PTKA 2CH4W 2O31A 3PVQA 1GFDA 2AK5A 4Y92A 4CC4B 2JM8A 4LNPA 2QDLA 2YT6A 1T0JA 4RTVA 2IIMA 3EHRA 1RLQC 2L3QA 1FMKA 4AG2C 2FRWA 4AFUC 1NEBA 1UFFA 4OMPA 4EIKA 3M0SA 2LNHB 1TUDA 1M30A 2EYZA 4OMMA 1X43A 2LJ3A 1H92A 1NG2A 1GCQC 2JMAA 2BZYA 2EW3A 1ZBJA 2KRNA 1OPLA 2K6DA 2HCKA 4JPBW 1JO8A 3IQLA 2DBMA 1W1FA 1T3LA 1Z9ZA 2MIOA 1HJDA 1MUZA 2D0NA 4HVWA 4KRTA 1JQQA 1LCKA 3GBQA 4J9FA 1I07A 1UJ0A 2LQNA 2EGEA 2KRSA 1QCFA 1QLYA 1AZEA 3C0CA 2RQRA 1NLPC 2M0YA 5L23A 1ARKA 5IHNA 2RQWA 1SPKA 4DEXA 1GCQA 2JXBA 1EFNA 1AWOA 4FSSA 1ABQA 1UTIA 2KR3A 2ROTA 2FRYA 1RUWA 2A37A 1M3AA 4J9EA 1Y57A 3UF4A 2GTOA 2FG0A 2EYYA 3VRYA 1PWTA 2DRKA 5FWCA 1X27A 5ECAA 2LMJA 2RF0A 3VS1A 3LH5A 1K4US 2DILA 3I5RA 4D8KA 2OAWA 3SEMA
chains in the Genus database with same CATH superfamily
3EFSA 1ZHIA 4EMHA 4ZTJA 3WVDB 3PIPA 3MEVA 1UHCA 1M5Q1 2V8IA 2C0OA 1KC8U 1ZSZA 2QTXA 1H3ZA 3PVLA 2QEXQ 1OX9A 1YNZA 2BE9B 1YJ9Q 3NGPA 5EC7A 4O6JA 2YHTA 4ORZA 5FU7C 2KAFA 4JZ3A 4PNOA 1JXOA 1VQLA 5LJ3j 1UGVA 2XG8D 1MNEA 2GFAA 3MKDA 1SEMA 2NUTA 3A8OB 3E2UA 3CBMA 1B34B 1CKAA 3V8LA 2CZ6B 1VYTA 1NE8A 3C4SA 2CP2A 5GMKh 4DQ2A 1NPRA 3VKIA 7AT1B 1H3HA 2F2VA 1KSWA 1QVGA 1OI1A 1I1JA 2KQWA 4R55A 3HRUA 1N5ZA 1AOJA 3X24B 5AT1B 5KYWA 2DNUA 3G71T 3S3NA 2AZVA 4C92F 2YUOA 5KYYB 3CD6T 1Q82U 3QZ5B 3NPFA 3JB9I 5C0MA 3M0RA 1KHIA 2KK4A 3L2WA 1VQ4Q 2AZSA 3LYIA 2QDYB 4E7LA 2JJ9A 1WFWA 3VS6A 2M9UA 3HSBA 1RI0A 1BI2A 3PGGA 1R0BG 2HMAA 2DTOA 5GAOp 1AHJB 3LX7A 2HAXA 4PLIA 1K73U 3L1AA 2KROA 3V8JA 1X2KA 5CKDA 2RB6A 2KDSA 2LX7A 2PVOB 4V2SA 4M75A 1BI1A 1JBMA 3KUFA 4BE1A 5I22A 4BY6C 2KMTA 1AZGB 4A4EA 3E1SA 4RTZA 1UHFA 1OV3A 5CQXA 5LL6S 2MOXA 2DL8A 3GNFB 1Z9QA 2YRCA 3J80E 4J9CA 4ZGJB 1VQNQ 1VQPT 2JS0A 2VGMA 1QVGS 2WACA 1VQKA 2ZPHB 4E7SA 4J6XA 2X3WD 3NFCA 1VQ7A 1YHQT 4QVZA 1MV0B 5DLQE 4DBFA 3GF5A 3X28B 2E6NA 1ZBXA 4D6WA 1X2QA 4XU3A 3QDFA 5FWBA 3OYLA 3SWNA 5GAN3 1K76A 2E4HA 4CRIA 4M7DC 3OMGA 1MMAA 2E41A 4DBRA 5J26A 2CH4A 3E19A 5I2SA 2XICA 2A0FB 4KGZB 5GAMg 2VWFA 3HP9A 1VYVA 3QDRB 4PKCC 1M3BA 2CGHA 1ZSZB 4RTXA 3LGFA 6AT1B 2DD4A 4M77F 3V8KA 1KIKA 2WSCE 2MK5A 1T3SA 3ZFJA 3H6ZA 1X75C 2VV5A 3CCVT 1NJIC 1AEYA 4FW2A 3MPUB 3S6WA 2FZGB 5EG2A 1OULA 3DB3A 1WZOA 2QYZA 1JRIA 4BD3A 3M5AA 1Q82R 2RQVA 1AWJA 2NUTB 3RERA 2DO3A 2DEQA 4X1VA 1JJ2A 3QJ6A 2RQUA 5LJ3d 2LJ0A 3OYMA 5CR2A 3KFVA 2KE9A 1VQLQ 4L6V5 2F5TX 2DMOA 3MEWA 4FIBA 3EH1A 3T9NA 3CC2A 2BE7D 4C8QD 1XNIA 2RJFA 4HCCA 1FYNA 5GAOr 2PNIA 1AVZC 2IG0A 2JS2A 5KYWB 1KC8C 2JTEA 3MJXA 2HL5C 1FMWA 3VS4A 1V29B 3VS2A 1TG0A 2OX7A 3EFRA 3G6EA 1VQ6A 1KJWA 4A53A 1PM3A 3SB2A 3SDZA 5FRMA 2ESWA 3A8MB 3OYGA 2DTIA 2DJQA 2GFUA 2WSEE 5KCOA 1QVFP 3GOXA 2K9GA 1M1KR 1BIAA 2KT1A 4GLKA 3A98A 1EIFA 1NEGA 1UE9A 2GGRA 3A1PA 1S72A 1BYMA 1IHWA 3UWNA 3CMET 1WNLA 1E7OA 3R6OA 2E70A 2X35A 2R57A 1BI3A 2HEQA 3EG1A 3M59A 2RJEA 2KEAA 5GANh 2DAQA 3OSSC 1K8AU 1EZZB 2M02A 1ZSGA 4N0AC 3OYYA 4C92A 1VQOA 4IUTA 2DLPA 4BE2A 1Y96B 1HYOA 1JJ2S 1IRXA 2QTVA 5GMKj 1NYGA 1TOVA 5GANg 2EVRA 2O9SA 4BUGA 2XHCA 4XQ3A 3CCQT 3QYHB 1M1GA 3NTKA 4CC3A 2F69A 2H8HA 3EAEA 2HDAA 1YITT 2W0ZA 4PJOA 1KQSA 4LDUA 2K57A 1LPLA 4Y91A 2K3XA 2FVUA 2DVJA 2EQUA 1BIBA 3GPLA 5GJVB 3CXCA 3OYKA 1K73C 1XOVA 1TXQA 2M51A 4XTVA 3EG2A 4L59A 2NWMA 1VQKQ 2K5LA 2RH2A 2P0QA 3CMAA 3OYIA 1WI7A 1VQ7Q 5A2QE 1NLOC 1Q81R 1YN8A 1UJYA 2EYQA 1I8FA 3LGLA 1E6HA 1Q7YU 5I21A 1YFNA 1O9SA 3M9QA 4FU6A 2X9HA 2KY9A 4C0DC 1NPPA 3F70A 3CCUT 2QGFB 1IZ6A 3MP6A 4CC4B 4LNPA 5CIUA 2QDLA 1RABB 1TSFA 4RTVA 4B6MA 2DIGA 2L3QA 2MAMA 3LH0A 2LT1A 2FRWA 5FU7B 3JCMh 5GAMf 4J6YA 3M0SA 2P4TA 2LNHB 1MMGA 4RG8A 2DXTA 1GCQC 3CCRT 3JCMg 1ZBJA 2Y4XA 3FEOA 4C0FA 1K9MU 1SSFA 1IREB 1KQSS 5KCHA 2D0NA 3TEEA 1LCKA 3TQ7P 4OMFB 4M77A 3VYGA 1OU9A 2LQNA 2EGEA 3JAME 3C94A 4PLLA 1RAIB 2MWPA 3CXCS 1I5OB 5L23A 5LJ5g 1ARKA 3JB9H 3DKMA 8ATCB 1VQ8T 4OB3B 1RADB 3GNGA 1M9SA 3CC2Q 1QCOA 4M78B 4XTYA 2FRYA 1B7TA 1M3AA 1ZSZC 2QA4T 3MEAA 5D6YA 4XTUA 3EGDB 3QKJA 3UF4A 3CCET 4M7AA 1I5LA 4NL2A 3G6EQ 1YHQA 3LH5A 3NTHA 2P84A 2DILA 1VQ6Q 2E3IA 3V7SA 3INZA 5KE3A 2NUPA 3HL8A 3HRSA 3BW1A 5CKEA 1WLPB 2EWNA 1QWFA 4LDXA 4OMOA 1BB9A 1YJWT 1TUCA 5KYUB 2RQTA 1PG5B 3OSVA 2DL3A 5HK0A 4KGXB 1G83A 1U1TA 2QQBA 5GAN2 1U1SA 1S72Q 3VS5A 2YUNA 2LX9A 4RKUE 3QJYA 1QMCA 1WHHA 5M9OA 2V26A 1PHTA 1PD1A 3C12A 4J5YA 3UATA 3OB9A 2YUPA 1SHGA 2R5MA 1JU5C 1VQOQ 2ABLA 4PJOB 3H9NA 3VRZA 3I55Q 2LDMA 3EFOB 1LVKA 2LJ1A 2Y90A 1N27A 1M27C 3CCVA 3I9QA 4JLGA 4HVUA 5GANf 3OW2P 4KUIA 1BU1A 1VA7A 4ANJA 3OBWA 4F04B 1SRMA 4IIOA 1BCMA 4M7DB 2EJ9A 1WHMA 1K8AC 4AFQC 4M7DE 2DK3A 2XDBA 3ME9A 1WYXA 1WXTA 1X6BA 3FDRA 4M75C 3QBYA 4IUPA 5GAN7 3E9FA 2KGTA 2DVEA 2B86A 3CMAQ 1N8RR 2K4YA 3LWIA 3EGXA 4M7DG 1A0NB 2OTLQ 4JRQA 3JB9D 4O5VA 4J8OA 3G7ZA 2K2MA 2NYSA 1WQ7A 4N4IA 2JTMA 1VQMA 2XD0A 2V8JA 2D9TA 5CKBA 5GAOq 3OS0A 2YRDA 4RCBA 3MP1A 1KQ2A 2HNIA 3WXMB 2KXDA 2KYMA 4J9GA 2HBPA 1I81A 2LC4A 3QXEB 4OMLA 1KQ1A 3JSCA 3QWYA 1VQ9T 4WCIA 1X01A 1QKXA 1YIJT 2O2OA 1Q7YC 3SWNC 1VYUA 3NMZC 1WIEA 2DX1A 1GL5A 2LZ6B 2F2XA 8AT1B 1IXDA 4LDYA 3JCMf 2O88A 1C0MA 3C95A 4K11A 5DLOA 5CO7A 1FX7A 2QQRA 2ZAEA 2EYWA 2L5QA 1S1NA 1BI0A 2AHJB 4EMKA 1NYFA 1KFZA 2VVKA 1WHKA 2K3YA 2P4RA 5LJ5f 5KYNA 3JCMc 4QKUA 3CC4A 1UGSB 5D6XA 4MZMA 4F16A 3CCLT 1K9MC 1PKTA 3HTRA 3DLLA 4N4HA 1N9RA 1D0XA 2LQWA 3OYNA 1VIEA 4JDSA 3BE3A 4LD6A 1UDLA 3GLXA 1YHQQ 3UPUA 1K9AA 2L0AA 2SEMA 2MCNA 4LE9A 1RACB 2EJFA 2ZZDA 2OTJA 1D1AA 3NTIA 4IKFA 4Z02A 1NZ9A 4MZTA 5A0LA 2FEIA 2RI2A 1B07A 4ZGEB 3CPFA 2L8DA 4XU1A 2FPFA 4PFOA 1YCYA 2K79A 1QWEA 2EPDA 1OOTA 4GY5A 1MV3A 1WX6A 2CKKA 2DZCA 4M78C 3R6NA 2ZPEB 1BKBA 2BTTA 2RA2A 4D8DA 2BZ8A 4CI0C 3EG0A 3REAB 5GAOn 2H3JA 3N5BB 2EGCA 4LN2A 4OB1B 4GLMA 3RKXA 3D7SB 1MHNA 3OYEA 3CCVQ 2ZGWA 4IUVA 2BUDA 1YCSB 3RMQA 1H641 2JOYA 4PJMA 4R56A 1F1BB 2X3XD 3CCMT 1BBZA 5IXFA 2ED0A 2EGAA 3CEYA 1GBQA 4C0DB 4C92C 1D0ZA 4M78D 2F5KA 1YJNT 2C06A 1TTHB 1VQ5A 4F7UB 4FYWB 3X25B 3HHTB 2FPEA 4AG1C 2CSQA 1PC0A 2JNGA 2ED1A 4NL3A 2E10A 3M55A 1MNDA 2AKKA 5FLXE 4PJOC 3G1JA 3CCEA 4L5GA 1M1KU 4E7HA 4X9DA 5GMKe 2DXBA 3EHQA 3CCSA 2RNAA 4HXJA 2A08A 3H0HA 4FT4A 2PQWA 2RK2A 3PE0A 1KD1R 2QEXT 4NOYA 1VQMQ 2HKQB 5KE2A 1QVFA 3OYAA 1OZ3A 4BDYA 1PD0A 3M0QA 2DKGA 2YRVA 2RI3A 2LTOA 5GAMh 2DETA 2GCXA 4KH0B 5D7UA 2RO0A 5GJWB 3UDCA 5CAIA 2CSIA 2PUOB 1Y71A 1QP3A 1RAFB 3JCMV 3EH2A 1V1CA 1M90R 1KG1A 2J6OA 2IVWA 4F17A 2ZPBB 4PJOD 3VS7A 2G3RA 3QHSA 1UB4A 3META 1GFCA 4C8QF 4JRIA 2LCCA 2KYBA 1ABOA 1BK2A 1RAAB 2YUQA 4ME7A 2FO0A 2ZPGB 4MMKA 4A4HA 4C5HA 5DY9A 1YI2A 4BI4A 5IT9E 2COYA 2W10A 2KNBB 4M7DD 1Y07A 2PTKA 1SG5A 4QVCA 4MDXA 2HL3A 3CC4Q 1Q81U 1FWZA 1VQ4T 4E7JA 2EJGA 2JM8A 1UGPB 3CC7A 4PFPA 3L2UA 1WJQA 2IIMA 3BDLA 2EQKA 1AT1B 4ELZC 1QVFS 4ZTFA 2LCLA 4X9CA 1UFFA 4OMPA 2HZYA 2OTJQ 1X43A 1KHCA 3G4SA 2LJ3A 2XI9A 1NG2A 5GAOm 1G5VA 1H92A 3JCMb 2BZYA 5CK9A 2KRNA 2MPXC 1JO8A 3IQLA 2DBMA 1OYXA 5GAMe 4FSXA 1T3LA 4WTOB 1Z9ZA 1EX4A 1MUZA 1N9SA 4KRTA 4HVWA 2AT1B 1JQQA 4M7AC 3MO8A 1I07A 2DIQA 2DZ9A 3LLRA 3DLMA 1YBYA 3BY7A 1AZEA 2K2VA 1IGQA 1VQNT 2RQRA 5KH6A 3TCJA 3ZEHA 4A54A 3I56T 3JB9G 2RQWA 3CCJA 1YIJA 2Z0WA 4M75B 4Q5WA 2EFIA 1TS9A 4FSSA 3ER0A 4M75E 2CYZB 2KR3A 2ROTA 4KUDK 4XTWA 1FMVA 1XTDA 2A37A 1P92A 4FM4B 5GAOl 4J9EA 2GTOA 2EYYA 3HFOA 2XU8A 1PWTA 2E1HA 2RHIA 4M7AD 5FWCA 4M75G 2LMJA 2CZ1B 1K4US 3PT9A 1RL2A 3SEMA 1Q82C 2VKNA 1C1AA 4KULA 4JZ4A 2Y4YA 5FU6C 1VQ5Q 2DJZA 4JRPA 1SKUB 4ESRA 1ZLMA 3SFMA 1M2VA 3CCLA 5HCKA 2L3RA 2O9VA 1BCOA 4JRKA 5L8RE 3CCEQ 3OBYA 4J7IA 9ATCB 2CP7A 2E65A 3CCSQ 2V1RA 2DXCA 3UT1A 4ELYC 4QW2A 3SWNB 4E47A 1I0CA 2E5QA 3JV3A 3M53A 2YXYA 1V76A 3FJ5A 4RUGA 3UA7A 4J9DA 1IGUA 4E7KA 3X26B 4XK8E 4C5IA 1VQLT 2DRMA 1KK7A 1HD3A 3J81E 1M1KC 3GP8A 3G71A 2XDDA 2BKDN 1LOJA 3OYDA 2VYTA 3SD4A 3L42A 5GANe 2PZ1A 4JJDA 3CD6A 5CKFA 2EAYA 2PU9B 4E6RA 2I2LA 1FXXA 3RESA 1AD5A 1LNXA 3OW2A 1YI2Q 1GXIE 2QQAA 4A4FA 2KI7A 3VJPA 5AYFA 4C8QA 4TVRA 2XMFA 4IUQA 1OU8A 5LJ5h 1N8RU 4A63B 1JXMA 5LJ3h 1LJOA 1ZA2B 2KVQG 3DB4A 1NBEB 2EKOA 4GBQA 1AWXA 5GAMj 3TSWA 1YJNA 3CC7Q 2J06A 4KGVB 5LJ3g 2D0QB 2K5IA 3QPHA 1YWOA 3A8HB 2EKHA 4OMQA 1PCXA 4EMKC 2DF6A 5D6WA 1W2BP 3RNJA 2G6FX 4DBQA 4M78E 1M8MA 1VQPA 2ENMA 3G4SQ 3OS5A 2MI6A 1J3TA 3JCMW 4PJNA 2C0TA 2QGGA 1Q81C 3GIBA 5GMKm 4M78G 3PMTA 4DA4A 2BZXA 3SHWA 4J83A 1ZUYA 4QT7A 5FROA 1JB0E 2L3PA 4ZNXA 4B9WA 3JCMe 1U8RA 4C92B 1C6VX 3I35A 2B8AA 1VQKT 4C92E 1SHFA 3RKYA 3CCJQ 3HRTA 1YIJQ 1VQ7T 1G3SA 3OW2S 4XU2A 1WDXA 1G2BA 2EBPA 3FRNA 4JJBA 2JN0A 1TH7A 2YLCA 3JB9J 1Q86R 2IPOB 1D0YA 3JB9F 5LJ5e 2OI3A 5I11A 2M1HA 2RN8A 1RLPC 2AKLA 2VASA 4PJOE 2DL7A 2M0OA 5GAN4 5GMKl 4C0ZA 3JCMJ 1K1ZA 2QXFA 4RG2A 3M54A 2PUKB 2A3LA 4PJOG 1OX8A 3V7CA 1M3CA 3OS2A 2CREA 1D09B 1CSKA 1RAGB 3VS0A 3CCLQ 4HVVA 4HA8A 2RMOA 3QZ9B 1HXDA 4IIMA 5KYYA 4XTZA 5FW9A 3VV0A 2QQ9A 2F2WA 3AT1B 2O01E 2DEUA 1IHVA 4FT2A 4MDWA 1QKWA 4CC2A 5GANj 3PTAA 2RJDA 2YWWA 4JJCA 2L89A 3ZL7C 4KH1B 2MMPA 2DTHA 5CQYA 1VUBA 2JT4A 3A8GB 4Z8AA 3OYBA 4YTLA 2LVMA 4AMCA 3JCMX 3M0UA 4PFZA 3RR6A 5GAN8 4EMGA 1D1BA 3G71Q 3S3MA 3TU4K 2GQIA 1UGRB 2ECZA 4J9HA 4M75D 3EGUA 3TSZA 3CD6Q 2JMCA 2QI2A 3I56A 3CPWP 3TVTA 3CMEA 4UC4A 1VQ6T 3VUBA 4M77B 4E7IA 1U5SA 3BFMA 1PRLC 2COZA 1I4K1 1MGQA 3P8HA 3L2ZA 1GBRA 1WA7A 1QCNA 2R58A 2DD5A 2JVVA 5GAMd 3FB9A 2NUZA 4DBHA 3RIRA 3CCQA 2I0NA 4RTUA 2MF2A 2V8KA 1T0HA 1PSEA 1O75A 1YITA 4LD9K 4QQ6A 4M7AB 3VS3A 1NM7A 4OB2B 1CKBA 2E6ZA 2LQKA 2EQIA 4M7AE 1KD1U 1RI9A 1UG1A 3L2RA 5IHKA 4WF2A 1VQOT 1XQHA 3OYFA 4LDVA 2L2PA 5LJ3f 3I55T 1OPKA 2NUPB 2KBTA 1ZQ1A 1HSQA 2CUDA 1VQPQ 4HT8A 1UUEA 1RAEB 4M7AG 3HPWA 4BI3A 1PRMC 3S3OA 1N8RC 4F14A 3M58A 4ZN1A 4J6WA 1M90U 3AHUA 3QIIA 1SRLA 1QW1A 4II1A 5LJ5j 2E5KA 2RPNA 3OYCA 2FPDA 3JRZA 1N6AA 3LW5E 4OMNA 2XKOC 4M78F 2E64A 2GNCA 3CCUA 2P0KA 4FYXB 3EG3A 4AFSC 3CMAT 4EPCA 5FU6B 3QUIA 3PVQA 2H3EB 2WSFE 2OTLT 3M57A 2CP6A 3OQ5A 1T0JA 3EHRA 4JUVA 1FMKA 4BACA 4AG2C 4A4GA 4EDUA 3L2QA 3CCRA 4AFUC 5KYXA 2RK1A 3RUXA 1NEBA 2VC8A 1M30A 4OMMA 2K6DA 2HCKA 3MEUA 3CBPA 5HKCA 2MIOA 3EGXB 4BDZA 2HQXA 1M4ZA 1WHLA 2R5AA 1R8OB 2CZ7B 4PJOF 3URGA 2KRSA 1VQ8A 1OQKA 3M56A 1NJIR 5GANd 2M0YA 4F7UE 1TUGB 5J39A 1TU0B 2QA4A 1QP2A 2RI5A 1AWOA 2JXBA 1EFNA 1ABQA 1UTIA 3QSUA 4IURA 2X4WA 4KBMB 3VUZA 4F7UG 1Y96A 4QQGA 2FG0A 4M7DF 2CS7A 3QO3A 2ZPFB 1YJ9T 2DRKA 4C92D 1X27A 5ECAA 1YJWA 5IN1A 3VS1A 3PIOA 4J7FA 3I5RA 4LDWA 4J9IA 4RTYA 2RHUA 3I56Q 2RHYA 1KC8R 4JLIA 3MCAB 3CMEQ 5HY6A 2D8JA 1W70A 3A5ZB 4FL6A 2A7YA 4DEYA 2COWA 2XIDA 4LXCA 1ZUUA 1PSFA 2CP5A 4EMKB 2FB7A 1HK9A 3H0IA 4Z89A 4J9BA 2J6FA 2CP0A 4QVDA 1OEBA 1D1CA 1H8KA 1R0CB 1QVGP 2ATCB 1PKSA 3CCQQ 2XK0A 3P8DA 1G3YA 2JUFA 4HCBA 1YITQ 1VOMA 3KBGA 1YWPA 3LWHA 2YSQA 2VXEA 4FCYA 2F1LA 1YP5A 3JCMd 4C8QC 4RTWA 2DYIA 1G3WA 5IAYA 4RMOA 2QASA 4RTTA 1U06A 3HKSA 4M77C 5FRNA 1VIFA 3JCMP 4OGCA 5GAN5 3U23A 2EYXA 2SRCA 3KXTA 2AIRB 5LJ5d 2V1QA 4IUUA 4ATOA 2CT3A 2CP3A 2D6FA 4M7AF 4Y28E 3WVEB 1Q95G 1KD1C 2ZCFB 3CCUQ 2KT8A 2FZCB 3THKA 3HFNA 1K73R 2RHZA 4X34A 2FZKB 2BIVA 2KRMA 2KSSA 3VU3C 4PJLA 3QWXX 5GMKi 5KYXB 1GRIA 4M77D 3A8LB 1MMDA 3FLGA 2DYBA 2PVGB 2CDTA 1B3QA 3TREA 4JS4A 4RCCA 1M90C 1VQ9A 2DE0X 4M78A 1D3BA 1QVPA 1X69A 1VQMT 2DERA 3CCRQ 3I5SA 4PL6A 3L2VA 3EGDA 2HSEB 3H8ZA 3J7AF 3BDUA 4XAXB 1WJSA 4HCKA 4HKEA 1M8VA 1ZX6A 4FYYB 1Y0MA 2E12A 3P8BB 3RBBB 5HK3A 2MWOA 4FW1A 4DOVA 5KYUA 3M4GA 5DM7R 3JCMQ 1WHJA 1VQ8Q 2LCSA 1PNJA 1W2BA 4N4GA 4QQDA 1WQWA 2D1XA 5A0GA 3I55A 2CZ0B 3EG9A 4BB7A 4HCZA 2A36A 1K0XA 2HBWA 3FJPA 2QA4Q 3NHNA 1UGQB 4BI8B 1WXBA 2KXCA 4C5GA 2J05A 1K0SA 2DL5A 1X6GA 4MZPA 2CT4A 2L3SA 2VUBA 2JW4A 3O5ZA 1U3OA 2GTJA 3EFOA 3ZBDA 3CC4T 1YJWQ 1JJ2P 1Q86U 3RKWA 1M1FA 3CQTA 1UECA 2MYSA 2FYKA 3QYGB 4F7UF 3QG1A 1OZ2A 2CUBA 2RM4A 5CVIA 4OVAA 1WGSA 4OF1A 4M7DA 4PJJA 3UA6A 2OTLA 1WPYA 2OTJT 4HT9A 2X4XA 4A4KA 4B9XA 3Q1JA 4LUDA 2C0IA 2HQEA 3H0FA 3OYJA 4MMLA 2HKNA 1E6GA 4E7ZA 1ZUKA 4OGEA 2LNVA 1SSHA 2DBKA 2O4XA 1MMNA 2DL4A 4JS5A 3O8VA 5IHIA 1W2BS 1M2OA 3CCMA 2JZ2A 4Z88A 5IXBA 3CBOA 3M0PA 1IB8A 1AWWA 3OMCA 2VGNA 4OB0B 5GAN6 1SF9A 2VB6A 4NS5A 3VYHB 3RDVA 2J7IA 2GBQA 5J3BA 1W6XA 2VXFA 3FIFA 4AT1B 4R0KA 2JTFA 4ZN3A 3REBB 2YDLA 3PFSA 4DOWA 2D8HA 2HD0A 1K8AR 2QEXA 4JJNK 1VQ5T 2YLBA 1JEGA 1KQSP 1WXUA 2A28A 2DM1A 4CC7A 1YJ9A 1D3BB 4E2FB 4M4ZA 3H41A 1R77A 1GCPA 3X20B 4AFZC 1RAHB 3CPWA 1WHGA 2DA9A 3ASKA 2FL7A 3OYHA 3CXCP 3CCST 1VQ9Q 3ULRB 1QQJA 2DFUA 3RMSA 5C6SA 1ZA1B 4KT0E 2NLUA 2K3BA 2RHXA 4C92G 4BY6B 2X51A 2LP5A 3OS1A 1B34A 2K7AA 2DXUA 5LJ3e 1IO6A 2HSPA 2LRQA 3EG9B 4N0AA 1M2VB 2P0PA 3M0TA 2JM9A 2QG9B 2XDPA 4OP0A 1G3TA 4LUEA 1Q7YR 2LQ8A 1W4SA 4M75F 2ROLA 4PK4A 5IH2A 1VQ4A 2OJ2A 2RD1A 1YI2T 2J6KA 2CH4W 1UEBA 3PMIA 1ACMB 1WJRA 5CKHA 2HQHA 2O31A 3PNWC 5CCAA 3M4YA 1GFDA 2AK5A 4VUBA 4Y92A 2QAZA 2M16A 2YT6A 1RLQC 3CPWS 2K5FA 5I2MA 1K9MR 3CC7T 4EIKA 1TUDA 2EYZA 4C0GA 2QK0A 2JMAA 3OY9A 3CC2T 2PVDB 2FHDA 2EW3A 1OPLA 4C5EA 4JPBW 1DJ7B 2LT4A 1W1FA 3FC3A 1HJDA 3OA6A 1VQNA 2X4JA 4XU0A 3G4ST 3GBQA 4J9FA 2O4XB 4P5NA 1XJWB 4FYVB 4ZGDB 1UJ0A 3V7RA 4C8QB 4F7UA 1QCFA 4C8QE 1QLYA 3G6ET 3C0CA 1NLPC 2ZPIB 2RJCA 1Y7XA 4M77E 1Q86C 5IHNA 3MHXA 1TWBA 1SPKA 4BE0A 4DEXA 1GCQA 1NJIU 3E9GA 4C8QG 2X4YA 2DPPB 2GQVA 5A0DA 2EQMA 2EQJA 3CCMQ 2GF7A 1S72T 1RUWA 2QQSA 4M77G 3CCJT 2OAUA 4XTXA 1Y57A 2E3HA 1G8XA 3VRYA 1YJNQ 3MP8A 1X6OA 2RF0A 2EIFA 4D8KA 2OAWA
chains in the Genus database with same CATH topology
4RTYA 2VKNA 1WLPB 1QWFA 4OMOA 1BB9A 1TUCA 4JZ4A 2RQTA 2D8JA 2DL3A 1W70A 1G83A 1UHCA 2C0OA 4DEYA 4ESRA 1ZLMA 1ZUUA 5HCKA 2O9VA 3H0IA 3PVLA 2YUNA 3VS5A 4Z89A 4J9BA 2J6FA 1YNZA 1PHTA 1OEBA 2V1RA 3NGPA 5EC7A 1H8KA 4ORZA 3UATA 1I0CA 4JZ3A 3JV3A 2YUPA 1JXOA 1SHGA 1PKSA 1JU5C 1UGVA 2ABLA 3FJ5A 4RUGA 3VRZA 3UA7A 4J9DA 2LJ1A 1SEMA 1M27C 1YWPA 3I9QA 2YSQA 1CKAA 2DRMA 1YP5A 4HVUA 1VYTA 4RTWA 1BU1A 1HD3A 1VA7A 1H3HA 2F2VA 4RTTA 1KSWA 1U06A 1SRMA 4IIOA 1I1JA 2PZ1A 4JJDA 1N5ZA 1AOJA 3U23A 2EYXA 4AFQC 2SRCA 1WYXA 1WXTA 1X6BA 2DNUA 2V1QA 2CT3A 2AZVA 4E6RA 2KGTA 2YUOA 2B86A 1AD5A 3NPFA 3M0RA 1A0NB 2AZSA 2KT8A 2XMFA 3THKA 4J9IA 4A63B 1WFWA 3VS6A 1JXMA 2K2MA 2KRMA 3QWXX 1GRIA 4GBQA 1AWXA 2KROA 2DYBA 2CDTA 1B3QA 1X2KA 3TSWA 2LX7A 2J06A 2KXDA 2DE0X 2KYMA 5I22A 1YWOA 4J9GA 1X69A 2EKHA 4OMQA 1AZGB 3I5SA 2DF6A 4OMLA 4RTZA 3RNJA 3QWYA 1UHFA 2G6FX 1OV3A 4WCIA 2MOXA 1M8MA 2DL8A 1QKXA 2ENMA 2O2OA 4HCKA 1VYUA 1ZX6A 3NMZC 1WIEA 2DX1A 1Y0MA 1J3TA 1GL5A 3RBBB 1Z9QA 2F2XA 2LZ6B 2O88A 2C0TA 4J9CA 2BZXA 4K11A 2JS0A 3SHWA 2EYWA 1S1NA 1ZUYA 2X3WD 4QT7A 2LCSA 1MV0B 1PNJA 2L3PA 4ZNXA 1NYFA 2D1XA 1KFZA 2VVKA 2A36A 3I35A 1K0XA 1X2QA 2HBWA 3NHNA 1SHFA 2P4RA 1WXBA 5FWBA 1WDXA 2KXCA 1G2BA 2EBPA 2J05A 1K76A 1K0SA 2DL5A 1X6GA 4JJBA 2CT4A 2L3SA 4F16A 1PKTA 2JW4A 3O5ZA 1U3OA 2GTJA 2CH4A 2OI3A 5I11A 2LQWA 2RN8A 1RLPC 2AKLA 2DL7A 2VWFA 1UDLA 1VYVA 1M3BA 1K1ZA 1K9AA 4RTXA 3CQTA 1UECA 2L0AA 2SEMA 4LE9A 2MCNA 1KIKA 2CUBA 1T3SA 1M3CA 2FEIA 1AEYA 1B07A 2CREA 3UA6A 1CSKA 3VS0A 2FPFA 4HVVA 2K79A 2RQVA 1QWEA 1AWJA 2EPDA 1OOTA 2RMOA 4X1VA 4IIMA 1MV3A 2RQUA 4LUDA 2C0IA 5FW9A 2LJ0A 1WX6A 3H0FA 3R6NA 2F2WA 2BTTA 1E6GA 3KFVA 2KE9A 1ZUKA 4D8DA 1QKWA 2BZ8A 4CC2A 3EG0A 3REAB 1SSHA 2DBKA 2EGCA 2DMOA 4LN2A 2DL4A 4GLMA 4JJCA 5IHIA 3ZL7C 1FYNA 2PNIA 4Z88A 2JT4A 1AVZC 4Z8AA 2JS2A 5IXBA 1YCSB 3M0PA 3M0UA 2JTEA 1AWWA 3VS4A 2X3XD 1BBZA 3VS2A 1TG0A 2ED0A 5IXFA 2GQIA 1KJWA 2ECZA 2EGAA 4J9HA 2J7IA 2GBQA 3EGUA 2ESWA 1GBQA 3TSZA 1W6XA 2DJQA 2JMCA 3TVTA 2K9GA 4R0KA 2KT1A 3A98A 1NEGA 1U5SA 1UE9A 1PRLC 2GGRA 3REBB 2FPEA 4AG1C 2CSQA 2ED1A 2YDLA 2AKKA 2D8HA 1GBRA 1JEGA 1WA7A 1E7OA 1WXUA 2A28A 2DM1A 4CC7A 3EHQA 2RNAA 4HXJA 2A08A 2HEQA 3EG1A 3H0HA 4M4ZA 3H41A 2KEAA 2NUZA 1GCPA 3PE0A 4AFZC 1ZSGA 2I0NA 4RTUA 2DA9A 2DLPA 1T0HA 3ULRB 3VS3A 1NM7A 1NYGA 1CKBA 2EQIA 2EVRA 3M0QA 2O9SA 1RI9A 1UG1A 5IHKA 2L2PA 4CC3A 2H8HA 1OPKA 2HDAA 5GJWB 2CSIA 2W0ZA 2KBTA 1V1CA 2K3BA 1HSQA 2CUDA 1UUEA 2J6OA 4F17A 3VS7A 2LP5A 1PRMC 1GFCA 2K7AA 4F14A 2DVJA 2KYBA 1IO6A 2HSPA 1ABOA 1BK2A 5GJVB 2YUQA 3M0TA 2FO0A 2JM9A 1XOVA 1SRLA 2M51A 3EG2A 2E5KA 2NWMA 4LUEA 2RPNA 1WI7A 2FPDA 2ROLA 1NLOC 4OMNA 5IH2A 2GNCA 1YN8A 1UJYA 2W10A 2OJ2A 2KNBB 1E6HA 3EG3A 4AFSC 2J6KA 2PTKA 2CH4W 2O31A 3PVQA 1GFDA 2AK5A 4Y92A 4CC4B 2JM8A 4LNPA 2QDLA 2YT6A 1T0JA 4RTVA 2IIMA 3EHRA 1RLQC 2L3QA 1FMKA 4AG2C 2FRWA 4AFUC 1NEBA 1UFFA 4OMPA 4EIKA 3M0SA 2LNHB 1TUDA 1M30A 2EYZA 4OMMA 1X43A 2LJ3A 1H92A 1NG2A 1GCQC 2JMAA 2BZYA 2EW3A 1ZBJA 2KRNA 1OPLA 2K6DA 2HCKA 4JPBW 1JO8A 3IQLA 2DBMA 1W1FA 1T3LA 1Z9ZA 2MIOA 1HJDA 1MUZA 2D0NA 4HVWA 4KRTA 1JQQA 1LCKA 3GBQA 4J9FA 1I07A 1UJ0A 2LQNA 2EGEA 2KRSA 1QCFA 1QLYA 1AZEA 3C0CA 2RQRA 1NLPC 2M0YA 5L23A 1ARKA 5IHNA 2RQWA 1SPKA 4DEXA 1GCQA 2JXBA 1EFNA 1AWOA 4FSSA 1ABQA 1UTIA 2KR3A 2ROTA 2FRYA 1RUWA 2A37A 1M3AA 4J9EA 1Y57A 3UF4A 2GTOA 2FG0A 2EYYA 3VRYA 1PWTA 2DRKA 5FWCA 1X27A 5ECAA 2LMJA 2RF0A 3VS1A 3LH5A 1K4US 2DILA 3I5RA 4D8KA 2OAWA 3SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTY A;  2VKN A;  1WLP B;  1QWF A;  4OMO A;  1BB9 A;  1TUC A;  4JZ4 A;  2RQT A;  2D8J A;  2DL3 A;  1W70 A;  1G83 A;  1UHC A;  2C0O A;  4DEY A;  4ESR A;  1ZLM A;  1ZUU A;  5HCK A;  2O9V A;  3H0I A;  3PVL A;  2YUN A;  3VS5 A;  4Z89 A;  4J9B A;  2J6F A;  1YNZ A;  1PHT A;  1OEB A;  2V1R A;  3NGP A;  5EC7 A;  1H8K A;  4ORZ A;  3UAT A;  1I0C A;  4JZ3 A;  3JV3 A;  2YUP A;  1JXO A;  1SHG A;  1PKS A;  1JU5 C;  1UGV A;  2ABL A;  3FJ5 A;  4RUG A;  3VRZ A;  3UA7 A;  4J9D A;  2LJ1 A;  1SEM A;  1M27 C;  1YWP A;  3I9Q A;  2YSQ A;  1CKA A;  2DRM A;  1YP5 A;  4HVU A;  1VYT A;  4RTW A;  1BU1 A;  1HD3 A;  1VA7 A;  1H3H A;  2F2V A;  4RTT A;  1KSW A;  1U06 A;  1SRM A;  4IIO A;  1I1J A;  2PZ1 A;  4JJD A;  1N5Z A;  1AOJ A;  3U23 A;  2EYX A;  4AFQ C;  2SRC A;  1WYX A;  1WXT A;  1X6B A;  2DNU A;  2V1Q A;  2CT3 A;  2AZV A;  4E6R A;  2KGT A;  2YUO A;  2B86 A;  1AD5 A;  3NPF A;  3M0R A;  1A0N B;  2AZS A;  2KT8 A;  2XMF A;  3THK A;  4J9I A;  4A63 B;  1WFW A;  3VS6 A;  1JXM A;  2K2M A;  2KRM A;  3QWX X;  1GRI A;  4GBQ A;  1AWX A;  2KRO A;  2DYB A;  2CDT A;  1B3Q A;  1X2K A;  3TSW A;  2LX7 A;  2J06 A;  2KXD A;  2DE0 X;  2KYM A;  5I22 A;  1YWO A;  4J9G A;  1X69 A;  2EKH A;  4OMQ A;  1AZG B;  3I5S A;  2DF6 A;  4OML A;  4RTZ A;  3RNJ A;  3QWY A;  1UHF A;  2G6F X;  1OV3 A;  4WCI A;  2MOX A;  1M8M A;  2DL8 A;  1QKX A;  2ENM A;  2O2O A;  4HCK A;  1VYU A;  1ZX6 A;  3NMZ C;  1WIE A;  2DX1 A;  1Y0M A;  1J3T A;  1GL5 A;  3RBB B;  1Z9Q A;  2F2X A;  2LZ6 B;  2O88 A;  2C0T A;  4J9C A;  2BZX A;  4K11 A;  2JS0 A;  3SHW A;  2EYW A;  1S1N A;  1ZUY A;  2X3W D;  4QT7 A;  2LCS A;  1MV0 B;  1PNJ A;  2L3P A;  4ZNX A;  1NYF A;  2D1X A;  1KFZ A;  2VVK A;  2A36 A;  3I35 A;  1K0X A;  1X2Q A;  2HBW A;  3NHN A;  1SHF A;  2P4R A;  1WXB A;  5FWB A;  1WDX A;  2KXC A;  1G2B A;  2EBP A;  2J05 A;  1K76 A;  1K0S A;  2DL5 A;  1X6G A;  4JJB A;  2CT4 A;  2L3S A;  4F16 A;  1PKT A;  2JW4 A;  3O5Z A;  1U3O A;  2GTJ A;  2CH4 A;  2OI3 A;  5I11 A;  2LQW A;  2RN8 A;  1RLP C;  2AKL A;  2DL7 A;  2VWF A;  1UDL A;  1VYV A;  1M3B A;  1K1Z A;  1K9A A;  4RTX A;  3CQT A;  1UEC A;  2L0A A;  2SEM A;  4LE9 A;  2MCN A;  1KIK A;  2CUB A;  1T3S A;  1M3C A;  2FEI A;  1AEY A;  1B07 A;  2CRE A;  3UA6 A;  1CSK A;  3VS0 A;  2FPF A;  4HVV A;  2K79 A;  2RQV A;  1QWE A;  1AWJ A;  2EPD A;  1OOT A;  2RMO A;  4X1V A;  4IIM A;  1MV3 A;  2RQU A;  4LUD A;  2C0I A;  5FW9 A;  2LJ0 A;  1WX6 A;  3H0F A;  3R6N A;  2F2W A;  2BTT A;  1E6G A;  3KFV A;  2KE9 A;  1ZUK A;  4D8D A;  1QKW A;  2BZ8 A;  4CC2 A;  3EG0 A;  3REA B;  1SSH A;  2DBK A;  2EGC A;  2DMO A;  4LN2 A;  2DL4 A;  4GLM A;  4JJC A;  5IHI A;  3ZL7 C;  1FYN A;  2PNI A;  4Z88 A;  2JT4 A;  1AVZ C;  4Z8A A;  2JS2 A;  5IXB A;  1YCS B;  3M0P A;  3M0U A;  2JTE A;  1AWW A;  3VS4 A;  2X3X D;  1BBZ A;  3VS2 A;  1TG0 A;  2ED0 A;  5IXF A;  2GQI A;  1KJW A;  2ECZ A;  2EGA A;  4J9H A;  2J7I A;  2GBQ A;  3EGU A;  2ESW A;  1GBQ A;  3TSZ A;  1W6X A;  2DJQ A;  2JMC A;  3TVT A;  2K9G A;  4R0K A;  2KT1 A;  3A98 A;  1NEG A;  1U5S A;  1UE9 A;  1PRL C;  2GGR A;  3REB B;  2FPE A;  4AG1 C;  2CSQ A;  2ED1 A;  2YDL A;  2AKK A;  2D8H A;  1GBR A;  1JEG A;  1WA7 A;  1E7O A;  1WXU A;  2A28 A;  2DM1 A;  4CC7 A;  3EHQ A;  2RNA A;  4HXJ A;  2A08 A;  2HEQ A;  3EG1 A;  3H0H A;  4M4Z A;  3H41 A;  2KEA A;  2NUZ A;  1GCP A;  3PE0 A;  4AFZ C;  1ZSG A;  2I0N A;  4RTU A;  2DA9 A;  2DLP A;  1T0H A;  3ULR B;  3VS3 A;  1NM7 A;  1NYG A;  1CKB A;  2EQI A;  2EVR A;  3M0Q A;  2O9S A;  1RI9 A;  1UG1 A;  5IHK A;  2L2P A;  4CC3 A;  2H8H A;  1OPK A;  2HDA A;  5GJW B;  2CSI A;  2W0Z A;  2KBT A;  1V1C A;  2K3B A;  1HSQ A;  2CUD A;  1UUE A;  2J6O A;  4F17 A;  3VS7 A;  2LP5 A;  1PRM C;  1GFC A;  2K7A A;  4F14 A;  2DVJ A;  2KYB A;  1IO6 A;  2HSP A;  1ABO A;  1BK2 A;  5GJV B;  2YUQ A;  3M0T A;  2FO0 A;  2JM9 A;  1XOV A;  1SRL A;  2M51 A;  3EG2 A;  2E5K A;  2NWM A;  4LUE A;  2RPN A;  1WI7 A;  2FPD A;  2ROL A;  1NLO C;  4OMN A;  5IH2 A;  2GNC A;  1YN8 A;  1UJY A;  2W10 A;  2OJ2 A;  2KNB B;  1E6H A;  3EG3 A;  4AFS C;  2J6K A;  2PTK A;  2CH4 W;  2O31 A;  3PVQ A;  1GFD A;  2AK5 A;  4Y92 A;  4CC4 B;  2JM8 A;  4LNP A;  2QDL A;  2YT6 A;  1T0J A;  4RTV A;  2IIM A;  3EHR A;  1RLQ C;  2L3Q A;  1FMK A;  4AG2 C;  2FRW A;  4AFU C;  1NEB A;  1UFF A;  4OMP A;  4EIK A;  3M0S A;  2LNH B;  1TUD A;  1M30 A;  2EYZ A;  4OMM A;  1X43 A;  2LJ3 A;  1H92 A;  1NG2 A;  1GCQ C;  2JMA A;  2BZY A;  2EW3 A;  1ZBJ A;  2KRN A;  1OPL A;  2K6D A;  2HCK A;  4JPB W;  1JO8 A;  3IQL A;  2DBM A;  1W1F A;  1T3L A;  1Z9Z A;  2MIO A;  1HJD A;  1MUZ A;  2D0N A;  4HVW A;  4KRT A;  1JQQ A;  1LCK A;  3GBQ A;  4J9F A;  1I07 A;  1UJ0 A;  2LQN A;  2EGE A;  2KRS A;  1QCF A;  1QLY A;  1AZE A;  3C0C A;  2RQR A;  1NLP C;  2M0Y A;  5L23 A;  1ARK A;  5IHN A;  2RQW A;  1SPK A;  4DEX A;  1GCQ A;  2JXB A;  1EFN A;  1AWO A;  4FSS A;  1ABQ A;  1UTI A;  2KR3 A;  2ROT A;  2FRY A;  1RUW A;  2A37 A;  1M3A A;  4J9E A;  1Y57 A;  3UF4 A;  2GTO A;  2FG0 A;  2EYY A;  3VRY A;  1PWT A;  2DRK A;  5FWC A;  1X27 A;  5ECA A;  2LMJ A;  2RF0 A;  3VS1 A;  3LH5 A;  1K4U S;  2DIL A;  3I5R A;  4D8K A;  2OAW A;  3SEM A; 
#chains in the Genus database with same CATH topology
 3EFS A;  1ZHI A;  4EMH A;  4ZTJ A;  3WVD B;  3PIP A;  3MEV A;  1UHC A;  1M5Q 1;  2V8I A;  2C0O A;  1KC8 U;  1ZSZ A;  2QTX A;  1H3Z A;  3PVL A;  2QEX Q;  1OX9 A;  1YNZ A;  2BE9 B;  1YJ9 Q;  3NGP A;  5EC7 A;  4O6J A;  2YHT A;  4ORZ A;  5FU7 C;  2KAF A;  4JZ3 A;  4PNO A;  1JXO A;  1VQL A;  5LJ3 j;  1UGV A;  2XG8 D;  1MNE A;  2GFA A;  3MKD A;  1SEM A;  2NUT A;  3A8O B;  3E2U A;  3CBM A;  1B34 B;  1CKA A;  3V8L A;  2CZ6 B;  1VYT A;  1NE8 A;  3C4S A;  2CP2 A;  5GMK h;  4DQ2 A;  1NPR A;  3VKI A;  7AT1 B;  1H3H A;  2F2V A;  1KSW A;  1QVG A;  1OI1 A;  1I1J A;  2KQW A;  4R55 A;  3HRU A;  1N5Z A;  1AOJ A;  3X24 B;  5AT1 B;  5KYW A;  2DNU A;  3G71 T;  3S3N A;  2AZV A;  4C92 F;  2YUO A;  5KYY B;  3CD6 T;  1Q82 U;  3QZ5 B;  3NPF A;  3JB9 I;  5C0M A;  3M0R A;  1KHI A;  2KK4 A;  3L2W A;  1VQ4 Q;  2AZS A;  3LYI A;  2QDY B;  4E7L A;  2JJ9 A;  1WFW A;  3VS6 A;  2M9U A;  3HSB A;  1RI0 A;  1BI2 A;  3PGG A;  1R0B G;  2HMA A;  2DTO A;  5GAO p;  1AHJ B;  3LX7 A;  2HAX A;  4PLI A;  1K73 U;  3L1A A;  2KRO A;  3V8J A;  1X2K A;  5CKD A;  2RB6 A;  2KDS A;  2LX7 A;  2PVO B;  4V2S A;  4M75 A;  1BI1 A;  1JBM A;  3KUF A;  4BE1 A;  5I22 A;  4BY6 C;  2KMT A;  1AZG B;  4A4E A;  3E1S A;  4RTZ A;  1UHF A;  1OV3 A;  5CQX A;  5LL6 S;  2MOX A;  2DL8 A;  3GNF B;  1Z9Q A;  2YRC A;  3J80 E;  4J9C A;  4ZGJ B;  1VQN Q;  1VQP T;  2JS0 A;  2VGM A;  1QVG S;  2WAC A;  1VQK A;  2ZPH B;  4E7S A;  4J6X A;  2X3W D;  3NFC A;  1VQ7 A;  1YHQ T;  4QVZ A;  1MV0 B;  5DLQ E;  4DBF A;  3GF5 A;  3X28 B;  2E6N A;  1ZBX A;  4D6W A;  1X2Q A;  4XU3 A;  3QDF A;  5FWB A;  3OYL A;  3SWN A;  5GAN 3;  1K76 A;  2E4H A;  4CRI A;  4M7D C;  3OMG A;  1MMA A;  2E41 A;  4DBR A;  5J26 A;  2CH4 A;  3E19 A;  5I2S A;  2XIC A;  2A0F B;  4KGZ B;  5GAM g;  2VWF A;  3HP9 A;  1VYV A;  3QDR B;  4PKC C;  1M3B A;  2CGH A;  1ZSZ B;  4RTX A;  3LGF A;  6AT1 B;  2DD4 A;  4M77 F;  3V8K A;  1KIK A;  2WSC E;  2MK5 A;  1T3S A;  3ZFJ A;  3H6Z A;  1X75 C;  2VV5 A;  3CCV T;  1NJI C;  1AEY A;  4FW2 A;  3MPU B;  3S6W A;  2FZG B;  5EG2 A;  1OUL A;  3DB3 A;  1WZO A;  2QYZ A;  1JRI A;  4BD3 A;  3M5A A;  1Q82 R;  2RQV A;  1AWJ A;  2NUT B;  3RER A;  2DO3 A;  2DEQ A;  4X1V A;  1JJ2 A;  3QJ6 A;  2RQU A;  5LJ3 d;  2LJ0 A;  3OYM A;  5CR2 A;  3KFV A;  2KE9 A;  1VQL Q;  4L6V 5;  2F5T X;  2DMO A;  3MEW A;  4FIB A;  3EH1 A;  3T9N A;  3CC2 A;  2BE7 D;  4C8Q D;  1XNI A;  2RJF A;  4HCC A;  1FYN A;  5GAO r;  2PNI A;  1AVZ C;  2IG0 A;  2JS2 A;  5KYW B;  1KC8 C;  2JTE A;  3MJX A;  2HL5 C;  1FMW A;  3VS4 A;  1V29 B;  3VS2 A;  1TG0 A;  2OX7 A;  3EFR A;  3G6E A;  1VQ6 A;  1KJW A;  4A53 A;  1PM3 A;  3SB2 A;  3SDZ A;  5FRM A;  2ESW A;  3A8M B;  3OYG A;  2DTI A;  2DJQ A;  2GFU A;  2WSE E;  5KCO A;  1QVF P;  3GOX A;  2K9G A;  1M1K R;  1BIA A;  2KT1 A;  4GLK A;  3A98 A;  1EIF A;  1NEG A;  1UE9 A;  2GGR A;  3A1P A;  1S72 A;  1BYM A;  1IHW A;  3UWN A;  3CME T;  1WNL A;  1E7O A;  3R6O A;  2E70 A;  2X35 A;  2R57 A;  1BI3 A;  2HEQ A;  3EG1 A;  3M59 A;  2RJE A;  2KEA A;  5GAN h;  2DAQ A;  3OSS C;  1K8A U;  1EZZ B;  2M02 A;  1ZSG A;  4N0A C;  3OYY A;  4C92 A;  1VQO A;  4IUT A;  2DLP A;  4BE2 A;  1Y96 B;  1HYO A;  1JJ2 S;  1IRX A;  2QTV A;  5GMK j;  1NYG A;  1TOV A;  5GAN g;  2EVR A;  2O9S A;  4BUG A;  2XHC A;  4XQ3 A;  3CCQ T;  3QYH B;  1M1G A;  3NTK A;  4CC3 A;  2F69 A;  2H8H A;  3EAE A;  2HDA A;  1YIT T;  2W0Z A;  4PJO A;  1KQS A;  4LDU A;  2K57 A;  1LPL A;  4Y91 A;  2K3X A;  2FVU A;  2DVJ A;  2EQU A;  1BIB A;  3GPL A;  5GJV B;  3CXC A;  3OYK A;  1K73 C;  1XOV A;  1TXQ A;  2M51 A;  4XTV A;  3EG2 A;  4L59 A;  2NWM A;  1VQK Q;  2K5L A;  2RH2 A;  2P0Q A;  3CMA A;  3OYI A;  1WI7 A;  1VQ7 Q;  5A2Q E;  1NLO C;  1Q81 R;  1YN8 A;  1UJY A;  2EYQ A;  1I8F A;  3LGL A;  1E6H A;  1Q7Y U;  5I21 A;  1YFN A;  1O9S A;  3M9Q A;  4FU6 A;  2X9H A;  2KY9 A;  4C0D C;  1NPP A;  3F70 A;  3CCU T;  2QGF B;  1IZ6 A;  3MP6 A;  4CC4 B;  4LNP A;  5CIU A;  2QDL A;  1RAB B;  1TSF A;  4RTV A;  4B6M A;  2DIG A;  2L3Q A;  2MAM A;  3LH0 A;  2LT1 A;  2FRW A;  5FU7 B;  3JCM h;  5GAM f;  4J6Y A;  3M0S A;  2P4T A;  2LNH B;  1MMG A;  4RG8 A;  2DXT A;  1GCQ C;  3CCR T;  3JCM g;  1ZBJ A;  2Y4X A;  3FEO A;  4C0F A;  1K9M U;  1SSF A;  1IRE B;  1KQS S;  5KCH A;  2D0N A;  3TEE A;  1LCK A;  3TQ7 P;  4OMF B;  4M77 A;  3VYG A;  1OU9 A;  2LQN A;  2EGE A;  3JAM E;  3C94 A;  4PLL A;  1RAI B;  2MWP A;  3CXC S;  1I5O B;  5L23 A;  5LJ5 g;  1ARK A;  3JB9 H;  3DKM A;  8ATC B;  1VQ8 T;  4OB3 B;  1RAD B;  3GNG A;  1M9S A;  3CC2 Q;  1QCO A;  4M78 B;  4XTY A;  2FRY A;  1B7T A;  1M3A A;  1ZSZ C;  2QA4 T;  3MEA A;  5D6Y A;  4XTU A;  3EGD B;  3QKJ A;  3UF4 A;  3CCE T;  4M7A A;  1I5L A;  4NL2 A;  3G6E Q;  1YHQ A;  3LH5 A;  3NTH A;  2P84 A;  2DIL A;  1VQ6 Q;  2E3I A;  3V7S A;  3INZ A;  5KE3 A;  2NUP A;  3HL8 A;  3HRS A;  3BW1 A;  5CKE A;  1WLP B;  2EWN A;  1QWF A;  4LDX A;  4OMO A;  1BB9 A;  1YJW T;  1TUC A;  5KYU B;  2RQT A;  1PG5 B;  3OSV A;  2DL3 A;  5HK0 A;  4KGX B;  1G83 A;  1U1T A;  2QQB A;  5GAN 2;  1U1S A;  1S72 Q;  3VS5 A;  2YUN A;  2LX9 A;  4RKU E;  3QJY A;  1QMC A;  1WHH A;  5M9O A;  2V26 A;  1PHT A;  1PD1 A;  3C12 A;  4J5Y A;  3UAT A;  3OB9 A;  2YUP A;  1SHG A;  2R5M A;  1JU5 C;  1VQO Q;  2ABL A;  4PJO B;  3H9N A;  3VRZ A;  3I55 Q;  2LDM A;  3EFO B;  1LVK A;  2LJ1 A;  2Y90 A;  1N27 A;  1M27 C;  3CCV A;  3I9Q A;  4JLG A;  4HVU A;  5GAN f;  3OW2 P;  4KUI A;  1BU1 A;  1VA7 A;  4ANJ A;  3OBW A;  4F04 B;  1SRM A;  4IIO A;  1BCM A;  4M7D B;  2EJ9 A;  1WHM A;  1K8A C;  4AFQ C;  4M7D E;  2DK3 A;  2XDB A;  3ME9 A;  1WYX A;  1WXT A;  1X6B A;  3FDR A;  4M75 C;  3QBY A;  4IUP A;  5GAN 7;  3E9F A;  2KGT A;  2DVE A;  2B86 A;  3CMA Q;  1N8R R;  2K4Y A;  3LWI A;  3EGX A;  4M7D G;  1A0N B;  2OTL Q;  4JRQ A;  3JB9 D;  4O5V A;  4J8O A;  3G7Z A;  2K2M A;  2NYS A;  1WQ7 A;  4N4I A;  2JTM A;  1VQM A;  2XD0 A;  2V8J A;  2D9T A;  5CKB A;  5GAO q;  3OS0 A;  2YRD A;  4RCB A;  3MP1 A;  1KQ2 A;  2HNI A;  3WXM B;  2KXD A;  2KYM A;  4J9G A;  2HBP A;  1I81 A;  2LC4 A;  3QXE B;  4OML A;  1KQ1 A;  3JSC A;  3QWY A;  1VQ9 T;  4WCI A;  1X01 A;  1QKX A;  1YIJ T;  2O2O A;  1Q7Y C;  3SWN C;  1VYU A;  3NMZ C;  1WIE A;  2DX1 A;  1GL5 A;  2LZ6 B;  2F2X A;  8AT1 B;  1IXD A;  4LDY A;  3JCM f;  2O88 A;  1C0M A;  3C95 A;  4K11 A;  5DLO A;  5CO7 A;  1FX7 A;  2QQR A;  2ZAE A;  2EYW A;  2L5Q A;  1S1N A;  1BI0 A;  2AHJ B;  4EMK A;  1NYF A;  1KFZ A;  2VVK A;  1WHK A;  2K3Y A;  2P4R A;  5LJ5 f;  5KYN A;  3JCM c;  4QKU A;  3CC4 A;  1UGS B;  5D6X A;  4MZM A;  4F16 A;  3CCL T;  1K9M C;  1PKT A;  3HTR A;  3DLL A;  4N4H A;  1N9R A;  1D0X A;  2LQW A;  3OYN A;  1VIE A;  4JDS A;  3BE3 A;  4LD6 A;  1UDL A;  3GLX A;  1YHQ Q;  3UPU A;  1K9A A;  2L0A A;  2SEM A;  2MCN A;  4LE9 A;  1RAC B;  2EJF A;  2ZZD A;  2OTJ A;  1D1A A;  3NTI A;  4IKF A;  4Z02 A;  1NZ9 A;  4MZT A;  5A0L A;  2FEI A;  2RI2 A;  1B07 A;  4ZGE B;  3CPF A;  2L8D A;  4XU1 A;  2FPF A;  4PFO A;  1YCY A;  2K79 A;  1QWE A;  2EPD A;  1OOT A;  4GY5 A;  1MV3 A;  1WX6 A;  2CKK A;  2DZC A;  4M78 C;  3R6N A;  2ZPE B;  1BKB A;  2BTT A;  2RA2 A;  4D8D A;  2BZ8 A;  4CI0 C;  3EG0 A;  3REA B;  5GAO n;  2H3J A;  3N5B B;  2EGC A;  4LN2 A;  4OB1 B;  4GLM A;  3RKX A;  3D7S B;  1MHN A;  3OYE A;  3CCV Q;  2ZGW A;  4IUV A;  2BUD A;  1YCS B;  3RMQ A;  1H64 1;  2JOY A;  4PJM A;  4R56 A;  1F1B B;  2X3X D;  3CCM T;  1BBZ A;  5IXF A;  2ED0 A;  2EGA A;  3CEY A;  1GBQ A;  4C0D B;  4C92 C;  1D0Z A;  4M78 D;  2F5K A;  1YJN T;  2C06 A;  1TTH B;  1VQ5 A;  4F7U B;  4FYW B;  3X25 B;  3HHT B;  2FPE A;  4AG1 C;  2CSQ A;  1PC0 A;  2JNG A;  2ED1 A;  4NL3 A;  2E10 A;  3M55 A;  1MND A;  2AKK A;  5FLX E;  4PJO C;  3G1J A;  3CCE A;  4L5G A;  1M1K U;  4E7H A;  4X9D A;  5GMK e;  2DXB A;  3EHQ A;  3CCS A;  2RNA A;  4HXJ A;  2A08 A;  3H0H A;  4FT4 A;  2PQW A;  2RK2 A;  3PE0 A;  1KD1 R;  2QEX T;  4NOY A;  1VQM Q;  2HKQ B;  5KE2 A;  1QVF A;  3OYA A;  1OZ3 A;  4BDY A;  1PD0 A;  3M0Q A;  2DKG A;  2YRV A;  2RI3 A;  2LTO A;  5GAM h;  2DET A;  2GCX A;  4KH0 B;  5D7U A;  2RO0 A;  5GJW B;  3UDC A;  5CAI A;  2CSI A;  2PUO B;  1Y71 A;  1QP3 A;  1RAF B;  3JCM V;  3EH2 A;  1V1C A;  1M90 R;  1KG1 A;  2J6O A;  2IVW A;  4F17 A;  2ZPB B;  4PJO D;  3VS7 A;  2G3R A;  3QHS A;  1UB4 A;  3MET A;  1GFC A;  4C8Q F;  4JRI A;  2LCC A;  2KYB A;  1ABO A;  1BK2 A;  1RAA B;  2YUQ A;  4ME7 A;  2FO0 A;  2ZPG B;  4MMK A;  4A4H A;  4C5H A;  5DY9 A;  1YI2 A;  4BI4 A;  5IT9 E;  2COY A;  2W10 A;  2KNB B;  4M7D D;  1Y07 A;  2PTK A;  1SG5 A;  4QVC A;  4MDX A;  2HL3 A;  3CC4 Q;  1Q81 U;  1FWZ A;  1VQ4 T;  4E7J A;  2EJG A;  2JM8 A;  1UGP B;  3CC7 A;  4PFP A;  3L2U A;  1WJQ A;  2IIM A;  3BDL A;  2EQK A;  1AT1 B;  4ELZ C;  1QVF S;  4ZTF A;  2LCL A;  4X9C A;  1UFF A;  4OMP A;  2HZY A;  2OTJ Q;  1X43 A;  1KHC A;  3G4S A;  2LJ3 A;  2XI9 A;  1NG2 A;  5GAO m;  1G5V A;  1H92 A;  3JCM b;  2BZY A;  5CK9 A;  2KRN A;  2MPX C;  1JO8 A;  3IQL A;  2DBM A;  1OYX A;  5GAM e;  4FSX A;  1T3L A;  4WTO B;  1Z9Z A;  1EX4 A;  1MUZ A;  1N9S A;  4KRT A;  4HVW A;  2AT1 B;  1JQQ A;  4M7A C;  3MO8 A;  1I07 A;  2DIQ A;  2DZ9 A;  3LLR A;  3DLM A;  1YBY A;  3BY7 A;  1AZE A;  2K2V A;  1IGQ A;  1VQN T;  2RQR A;  5KH6 A;  3TCJ A;  3ZEH A;  4A54 A;  3I56 T;  3JB9 G;  2RQW A;  3CCJ A;  1YIJ A;  2Z0W A;  4M75 B;  4Q5W A;  2EFI A;  1TS9 A;  4FSS A;  3ER0 A;  4M75 E;  2CYZ B;  2KR3 A;  2ROT A;  4KUD K;  4XTW A;  1FMV A;  1XTD A;  2A37 A;  1P92 A;  4FM4 B;  5GAO l;  4J9E A;  2GTO A;  2EYY A;  3HFO A;  2XU8 A;  1PWT A;  2E1H A;  2RHI A;  4M7A D;  5FWC A;  4M75 G;  2LMJ A;  2CZ1 B;  1K4U S;  3PT9 A;  1RL2 A;  3SEM A;  1Q82 C;  2VKN A;  1C1A A;  4KUL A;  4JZ4 A;  2Y4Y A;  5FU6 C;  1VQ5 Q;  2DJZ A;  4JRP A;  1SKU B;  4ESR A;  1ZLM A;  3SFM A;  1M2V A;  3CCL A;  5HCK A;  2L3R A;  2O9V A;  1BCO A;  4JRK A;  5L8R E;  3CCE Q;  3OBY A;  4J7I A;  9ATC B;  2CP7 A;  2E65 A;  3CCS Q;  2V1R A;  2DXC A;  3UT1 A;  4ELY C;  4QW2 A;  3SWN B;  4E47 A;  1I0C A;  2E5Q A;  3JV3 A;  3M53 A;  2YXY A;  1V76 A;  3FJ5 A;  4RUG A;  3UA7 A;  4J9D A;  1IGU A;  4E7K A;  3X26 B;  4XK8 E;  4C5I A;  1VQL T;  2DRM A;  1KK7 A;  1HD3 A;  3J81 E;  1M1K C;  3GP8 A;  3G71 A;  2XDD A;  2BKD N;  1LOJ A;  3OYD A;  2VYT A;  3SD4 A;  3L42 A;  5GAN e;  2PZ1 A;  4JJD A;  3CD6 A;  5CKF A;  2EAY A;  2PU9 B;  4E6R A;  2I2L A;  1FXX A;  3RES A;  1AD5 A;  1LNX A;  3OW2 A;  1YI2 Q;  1GXI E;  2QQA A;  4A4F A;  2KI7 A;  3VJP A;  5AYF A;  4C8Q A;  4TVR A;  2XMF A;  4IUQ A;  1OU8 A;  5LJ5 h;  1N8R U;  4A63 B;  1JXM A;  5LJ3 h;  1LJO A;  1ZA2 B;  2KVQ G;  3DB4 A;  1NBE B;  2EKO A;  4GBQ A;  1AWX A;  5GAM j;  3TSW A;  1YJN A;  3CC7 Q;  2J06 A;  4KGV B;  5LJ3 g;  2D0Q B;  2K5I A;  3QPH A;  1YWO A;  3A8H B;  2EKH A;  4OMQ A;  1PCX A;  4EMK C;  2DF6 A;  5D6W A;  1W2B P;  3RNJ A;  2G6F X;  4DBQ A;  4M78 E;  1M8M A;  1VQP A;  2ENM A;  3G4S Q;  3OS5 A;  2MI6 A;  1J3T A;  3JCM W;  4PJN A;  2C0T A;  2QGG A;  1Q81 C;  3GIB A;  5GMK m;  4M78 G;  3PMT A;  4DA4 A;  2BZX A;  3SHW A;  4J83 A;  1ZUY A;  4QT7 A;  5FRO A;  1JB0 E;  2L3P A;  4ZNX A;  4B9W A;  3JCM e;  1U8R A;  4C92 B;  1C6V X;  3I35 A;  2B8A A;  1VQK T;  4C92 E;  1SHF A;  3RKY A;  3CCJ Q;  3HRT A;  1YIJ Q;  1VQ7 T;  1G3S A;  3OW2 S;  4XU2 A;  1WDX A;  1G2B A;  2EBP A;  3FRN A;  4JJB A;  2JN0 A;  1TH7 A;  2YLC A;  3JB9 J;  1Q86 R;  2IPO B;  1D0Y A;  3JB9 F;  5LJ5 e;  2OI3 A;  5I11 A;  2M1H A;  2RN8 A;  1RLP C;  2AKL A;  2VAS A;  4PJO E;  2DL7 A;  2M0O A;  5GAN 4;  5GMK l;  4C0Z A;  3JCM J;  1K1Z A;  2QXF A;  4RG2 A;  3M54 A;  2PUK B;  2A3L A;  4PJO G;  1OX8 A;  3V7C A;  1M3C A;  3OS2 A;  2CRE A;  1D09 B;  1CSK A;  1RAG B;  3VS0 A;  3CCL Q;  4HVV A;  4HA8 A;  2RMO A;  3QZ9 B;  1HXD A;  4IIM A;  5KYY A;  4XTZ A;  5FW9 A;  3VV0 A;  2QQ9 A;  2F2W A;  3AT1 B;  2O01 E;  2DEU A;  1IHV A;  4FT2 A;  4MDW A;  1QKW A;  4CC2 A;  5GAN j;  3PTA A;  2RJD A;  2YWW A;  4JJC A;  2L89 A;  3ZL7 C;  4KH1 B;  2MMP A;  2DTH A;  5CQY A;  1VUB A;  2JT4 A;  3A8G B;  4Z8A A;  3OYB A;  4YTL A;  2LVM A;  4AMC A;  3JCM X;  3M0U A;  4PFZ A;  3RR6 A;  5GAN 8;  4EMG A;  1D1B A;  3G71 Q;  3S3M A;  3TU4 K;  2GQI A;  1UGR B;  2ECZ A;  4J9H A;  4M75 D;  3EGU A;  3TSZ A;  3CD6 Q;  2JMC A;  2QI2 A;  3I56 A;  3CPW P;  3TVT A;  3CME A;  4UC4 A;  1VQ6 T;  3VUB A;  4M77 B;  4E7I A;  1U5S A;  3BFM A;  1PRL C;  2COZ A;  1I4K 1;  1MGQ A;  3P8H A;  3L2Z A;  1GBR A;  1WA7 A;  1QCN A;  2R58 A;  2DD5 A;  2JVV A;  5GAM d;  3FB9 A;  2NUZ A;  4DBH A;  3RIR A;  3CCQ A;  2I0N A;  4RTU A;  2MF2 A;  2V8K A;  1T0H A;  1PSE A;  1O75 A;  1YIT A;  4LD9 K;  4QQ6 A;  4M7A B;  3VS3 A;  1NM7 A;  4OB2 B;  1CKB A;  2E6Z A;  2LQK A;  2EQI A;  4M7A E;  1KD1 U;  1RI9 A;  1UG1 A;  3L2R A;  5IHK A;  4WF2 A;  1VQO T;  1XQH A;  3OYF A;  4LDV A;  2L2P A;  5LJ3 f;  3I55 T;  1OPK A;  2NUP B;  2KBT A;  1ZQ1 A;  1HSQ A;  2CUD A;  1VQP Q;  4HT8 A;  1UUE A;  1RAE B;  4M7A G;  3HPW A;  4BI3 A;  1PRM C;  3S3O A;  1N8R C;  4F14 A;  3M58 A;  4ZN1 A;  4J6W A;  1M90 U;  3AHU A;  3QII A;  1SRL A;  1QW1 A;  4II1 A;  5LJ5 j;  2E5K A;  2RPN A;  3OYC A;  2FPD A;  3JRZ A;  1N6A A;  3LW5 E;  4OMN A;  2XKO C;  4M78 F;  2E64 A;  2GNC A;  3CCU A;  2P0K A;  4FYX B;  3EG3 A;  4AFS C;  3CMA T;  4EPC A;  5FU6 B;  3QUI A;  3PVQ A;  2H3E B;  2WSF E;  2OTL T;  3M57 A;  2CP6 A;  3OQ5 A;  1T0J A;  3EHR A;  4JUV A;  1FMK A;  4BAC A;  4AG2 C;  4A4G A;  4EDU A;  3L2Q A;  3CCR A;  4AFU C;  5KYX A;  2RK1 A;  3RUX A;  1NEB A;  2VC8 A;  1M30 A;  4OMM A;  2K6D A;  2HCK A;  3MEU A;  3CBP A;  5HKC A;  2MIO A;  3EGX B;  4BDZ A;  2HQX A;  1M4Z A;  1WHL A;  2R5A A;  1R8O B;  2CZ7 B;  4PJO F;  3URG A;  2KRS A;  1VQ8 A;  1OQK A;  3M56 A;  1NJI R;  5GAN d;  2M0Y A;  4F7U E;  1TUG B;  5J39 A;  1TU0 B;  2QA4 A;  1QP2 A;  2RI5 A;  1AWO A;  2JXB A;  1EFN A;  1ABQ A;  1UTI A;  3QSU A;  4IUR A;  2X4W A;  4KBM B;  3VUZ A;  4F7U G;  1Y96 A;  4QQG A;  2FG0 A;  4M7D F;  2CS7 A;  3QO3 A;  2ZPF B;  1YJ9 T;  2DRK A;  4C92 D;  1X27 A;  5ECA A;  1YJW A;  5IN1 A;  3VS1 A;  3PIO A;  4J7F A;  3I5R A;  4LDW A;  4J9I A;  4RTY A;  2RHU A;  3I56 Q;  2RHY A;  1KC8 R;  4JLI A;  3MCA B;  3CME Q;  5HY6 A;  2D8J A;  1W70 A;  3A5Z B;  4FL6 A;  2A7Y A;  4DEY A;  2COW A;  2XID A;  4LXC A;  1ZUU A;  1PSF A;  2CP5 A;  4EMK B;  2FB7 A;  1HK9 A;  3H0I A;  4Z89 A;  4J9B A;  2J6F A;  2CP0 A;  4QVD A;  1OEB A;  1D1C A;  1H8K A;  1R0C B;  1QVG P;  2ATC B;  1PKS A;  3CCQ Q;  2XK0 A;  3P8D A;  1G3Y A;  2JUF A;  4HCB A;  1YIT Q;  1VOM A;  3KBG A;  1YWP A;  3LWH A;  2YSQ A;  2VXE A;  4FCY A;  2F1L A;  1YP5 A;  3JCM d;  4C8Q C;  4RTW A;  2DYI A;  1G3W A;  5IAY A;  4RMO A;  2QAS A;  4RTT A;  1U06 A;  3HKS A;  4M77 C;  5FRN A;  1VIF A;  3JCM P;  4OGC A;  5GAN 5;  3U23 A;  2EYX A;  2SRC A;  3KXT A;  2AIR B;  5LJ5 d;  2V1Q A;  4IUU A;  4ATO A;  2CT3 A;  2CP3 A;  2D6F A;  4M7A F;  4Y28 E;  3WVE B;  1Q95 G;  1KD1 C;  2ZCF B;  3CCU Q;  2KT8 A;  2FZC B;  3THK A;  3HFN A;  1K73 R;  2RHZ A;  4X34 A;  2FZK B;  2BIV A;  2KRM A;  2KSS A;  3VU3 C;  4PJL A;  3QWX X;  5GMK i;  5KYX B;  1GRI A;  4M77 D;  3A8L B;  1MMD A;  3FLG A;  2DYB A;  2PVG B;  2CDT A;  1B3Q A;  3TRE A;  4JS4 A;  4RCC A;  1M90 C;  1VQ9 A;  2DE0 X;  4M78 A;  1D3B A;  1QVP A;  1X69 A;  1VQM T;  2DER A;  3CCR Q;  3I5S A;  4PL6 A;  3L2V A;  3EGD A;  2HSE B;  3H8Z A;  3J7A F;  3BDU A;  4XAX B;  1WJS A;  4HCK A;  4HKE A;  1M8V A;  1ZX6 A;  4FYY B;  1Y0M A;  2E12 A;  3P8B B;  3RBB B;  5HK3 A;  2MWO A;  4FW1 A;  4DOV A;  5KYU A;  3M4G A;  5DM7 R;  3JCM Q;  1WHJ A;  1VQ8 Q;  2LCS A;  1PNJ A;  1W2B A;  4N4G A;  4QQD A;  1WQW A;  2D1X A;  5A0G A;  3I55 A;  2CZ0 B;  3EG9 A;  4BB7 A;  4HCZ A;  2A36 A;  1K0X A;  2HBW A;  3FJP A;  2QA4 Q;  3NHN A;  1UGQ B;  4BI8 B;  1WXB A;  2KXC A;  4C5G A;  2J05 A;  1K0S A;  2DL5 A;  1X6G A;  4MZP A;  2CT4 A;  2L3S A;  2VUB A;  2JW4 A;  3O5Z A;  1U3O A;  2GTJ A;  3EFO A;  3ZBD A;  3CC4 T;  1YJW Q;  1JJ2 P;  1Q86 U;  3RKW A;  1M1F A;  3CQT A;  1UEC A;  2MYS A;  2FYK A;  3QYG B;  4F7U F;  3QG1 A;  1OZ2 A;  2CUB A;  2RM4 A;  5CVI A;  4OVA A;  1WGS A;  4OF1 A;  4M7D A;  4PJJ A;  3UA6 A;  2OTL A;  1WPY A;  2OTJ T;  4HT9 A;  2X4X A;  4A4K A;  4B9X A;  3Q1J A;  4LUD A;  2C0I A;  2HQE A;  3H0F A;  3OYJ A;  4MML A;  2HKN A;  1E6G A;  4E7Z A;  1ZUK A;  4OGE A;  2LNV A;  1SSH A;  2DBK A;  2O4X A;  1MMN A;  2DL4 A;  4JS5 A;  3O8V A;  5IHI A;  1W2B S;  1M2O A;  3CCM A;  2JZ2 A;  4Z88 A;  5IXB A;  3CBO A;  3M0P A;  1IB8 A;  1AWW A;  3OMC A;  2VGN A;  4OB0 B;  5GAN 6;  1SF9 A;  2VB6 A;  4NS5 A;  3VYH B;  3RDV A;  2J7I A;  2GBQ A;  5J3B A;  1W6X A;  2VXF A;  3FIF A;  4AT1 B;  4R0K A;  2JTF A;  4ZN3 A;  3REB B;  2YDL A;  3PFS A;  4DOW A;  2D8H A;  2HD0 A;  1K8A R;  2QEX A;  4JJN K;  1VQ5 T;  2YLB A;  1JEG A;  1KQS P;  1WXU A;  2A28 A;  2DM1 A;  4CC7 A;  1YJ9 A;  1D3B B;  4E2F B;  4M4Z A;  3H41 A;  1R77 A;  1GCP A;  3X20 B;  4AFZ C;  1RAH B;  3CPW A;  1WHG A;  2DA9 A;  3ASK A;  2FL7 A;  3OYH A;  3CXC P;  3CCS T;  1VQ9 Q;  3ULR B;  1QQJ A;  2DFU A;  3RMS A;  5C6S A;  1ZA1 B;  4KT0 E;  2NLU A;  2K3B A;  2RHX A;  4C92 G;  4BY6 B;  2X51 A;  2LP5 A;  3OS1 A;  1B34 A;  2K7A A;  2DXU A;  5LJ3 e;  1IO6 A;  2HSP A;  2LRQ A;  3EG9 B;  4N0A A;  1M2V B;  2P0P A;  3M0T A;  2JM9 A;  2QG9 B;  2XDP A;  4OP0 A;  1G3T A;  4LUE A;  1Q7Y R;  2LQ8 A;  1W4S A;  4M75 F;  2ROL A;  4PK4 A;  5IH2 A;  1VQ4 A;  2OJ2 A;  2RD1 A;  1YI2 T;  2J6K A;  2CH4 W;  1UEB A;  3PMI A;  1ACM B;  1WJR A;  5CKH A;  2HQH A;  2O31 A;  3PNW C;  5CCA A;  3M4Y A;  1GFD A;  2AK5 A;  4VUB A;  4Y92 A;  2QAZ A;  2M16 A;  2YT6 A;  1RLQ C;  3CPW S;  2K5F A;  5I2M A;  1K9M R;  3CC7 T;  4EIK A;  1TUD A;  2EYZ A;  4C0G A;  2QK0 A;  2JMA A;  3OY9 A;  3CC2 T;  2PVD B;  2FHD A;  2EW3 A;  1OPL A;  4C5E A;  4JPB W;  1DJ7 B;  2LT4 A;  1W1F A;  3FC3 A;  1HJD A;  3OA6 A;  1VQN A;  2X4J A;  4XU0 A;  3G4S T;  3GBQ A;  4J9F A;  2O4X B;  4P5N A;  1XJW B;  4FYV B;  4ZGD B;  1UJ0 A;  3V7R A;  4C8Q B;  4F7U A;  1QCF A;  4C8Q E;  1QLY A;  3G6E T;  3C0C A;  1NLP C;  2ZPI B;  2RJC A;  1Y7X A;  4M77 E;  1Q86 C;  5IHN A;  3MHX A;  1TWB A;  1SPK A;  4BE0 A;  4DEX A;  1GCQ A;  1NJI U;  3E9G A;  4C8Q G;  2X4Y A;  2DPP B;  2GQV A;  5A0D A;  2EQM A;  2EQJ A;  3CCM Q;  2GF7 A;  1S72 T;  1RUW A;  2QQS A;  4M77 G;  3CCJ T;  2OAU A;  4XTX A;  1Y57 A;  2E3H A;  1G8X A;  3VRY A;  1YJN Q;  3MP8 A;  1X6O A;  2RF0 A;  2EIF A;  4D8K A;  2OAW A; 
#chains in the Genus database with same CATH homology
 4RTY A;  2VKN A;  1WLP B;  1QWF A;  4OMO A;  1BB9 A;  1TUC A;  4JZ4 A;  2RQT A;  2D8J A;  2DL3 A;  1W70 A;  1G83 A;  1UHC A;  2C0O A;  4DEY A;  4ESR A;  1ZLM A;  1ZUU A;  5HCK A;  2O9V A;  3H0I A;  3PVL A;  2YUN A;  3VS5 A;  4Z89 A;  4J9B A;  2J6F A;  1YNZ A;  1PHT A;  1OEB A;  2V1R A;  3NGP A;  5EC7 A;  1H8K A;  4ORZ A;  3UAT A;  1I0C A;  4JZ3 A;  3JV3 A;  2YUP A;  1JXO A;  1SHG A;  1PKS A;  1JU5 C;  1UGV A;  2ABL A;  3FJ5 A;  4RUG A;  3VRZ A;  3UA7 A;  4J9D A;  2LJ1 A;  1SEM A;  1M27 C;  1YWP A;  3I9Q A;  2YSQ A;  1CKA A;  2DRM A;  1YP5 A;  4HVU A;  1VYT A;  4RTW A;  1BU1 A;  1HD3 A;  1VA7 A;  1H3H A;  2F2V A;  4RTT A;  1KSW A;  1U06 A;  1SRM A;  4IIO A;  1I1J A;  2PZ1 A;  4JJD A;  1N5Z A;  1AOJ A;  3U23 A;  2EYX A;  4AFQ C;  2SRC A;  1WYX A;  1WXT A;  1X6B A;  2DNU A;  2V1Q A;  2CT3 A;  2AZV A;  4E6R A;  2KGT A;  2YUO A;  2B86 A;  1AD5 A;  3NPF A;  3M0R A;  1A0N B;  2AZS A;  2KT8 A;  2XMF A;  3THK A;  4J9I A;  4A63 B;  1WFW A;  3VS6 A;  1JXM A;  2K2M A;  2KRM A;  3QWX X;  1GRI A;  4GBQ A;  1AWX A;  2KRO A;  2DYB A;  2CDT A;  1B3Q A;  1X2K A;  3TSW A;  2LX7 A;  2J06 A;  2KXD A;  2DE0 X;  2KYM A;  5I22 A;  1YWO A;  4J9G A;  1X69 A;  2EKH A;  4OMQ A;  1AZG B;  3I5S A;  2DF6 A;  4OML A;  4RTZ A;  3RNJ A;  3QWY A;  1UHF A;  2G6F X;  1OV3 A;  4WCI A;  2MOX A;  1M8M A;  2DL8 A;  1QKX A;  2ENM A;  2O2O A;  4HCK A;  1VYU A;  1ZX6 A;  3NMZ C;  1WIE A;  2DX1 A;  1Y0M A;  1J3T A;  1GL5 A;  3RBB B;  1Z9Q A;  2F2X A;  2LZ6 B;  2O88 A;  2C0T A;  4J9C A;  2BZX A;  4K11 A;  2JS0 A;  3SHW A;  2EYW A;  1S1N A;  1ZUY A;  2X3W D;  4QT7 A;  2LCS A;  1MV0 B;  1PNJ A;  2L3P A;  4ZNX A;  1NYF A;  2D1X A;  1KFZ A;  2VVK A;  2A36 A;  3I35 A;  1K0X A;  1X2Q A;  2HBW A;  3NHN A;  1SHF A;  2P4R A;  1WXB A;  5FWB A;  1WDX A;  2KXC A;  1G2B A;  2EBP A;  2J05 A;  1K76 A;  1K0S A;  2DL5 A;  1X6G A;  4JJB A;  2CT4 A;  2L3S A;  4F16 A;  1PKT A;  2JW4 A;  3O5Z A;  1U3O A;  2GTJ A;  2CH4 A;  2OI3 A;  5I11 A;  2LQW A;  2RN8 A;  1RLP C;  2AKL A;  2DL7 A;  2VWF A;  1UDL A;  1VYV A;  1M3B A;  1K1Z A;  1K9A A;  4RTX A;  3CQT A;  1UEC A;  2L0A A;  2SEM A;  4LE9 A;  2MCN A;  1KIK A;  2CUB A;  1T3S A;  1M3C A;  2FEI A;  1AEY A;  1B07 A;  2CRE A;  3UA6 A;  1CSK A;  3VS0 A;  2FPF A;  4HVV A;  2K79 A;  2RQV A;  1QWE A;  1AWJ A;  2EPD A;  1OOT A;  2RMO A;  4X1V A;  4IIM A;  1MV3 A;  2RQU A;  4LUD A;  2C0I A;  5FW9 A;  2LJ0 A;  1WX6 A;  3H0F A;  3R6N A;  2F2W A;  2BTT A;  1E6G A;  3KFV A;  2KE9 A;  1ZUK A;  4D8D A;  1QKW A;  2BZ8 A;  4CC2 A;  3EG0 A;  3REA B;  1SSH A;  2DBK A;  2EGC A;  2DMO A;  4LN2 A;  2DL4 A;  4GLM A;  4JJC A;  5IHI A;  3ZL7 C;  1FYN A;  2PNI A;  4Z88 A;  2JT4 A;  1AVZ C;  4Z8A A;  2JS2 A;  5IXB A;  1YCS B;  3M0P A;  3M0U A;  2JTE A;  1AWW A;  3VS4 A;  2X3X D;  1BBZ A;  3VS2 A;  1TG0 A;  2ED0 A;  5IXF A;  2GQI A;  1KJW A;  2ECZ A;  2EGA A;  4J9H A;  2J7I A;  2GBQ A;  3EGU A;  2ESW A;  1GBQ A;  3TSZ A;  1W6X A;  2DJQ A;  2JMC A;  3TVT A;  2K9G A;  4R0K A;  2KT1 A;  3A98 A;  1NEG A;  1U5S A;  1UE9 A;  1PRL C;  2GGR A;  3REB B;  2FPE A;  4AG1 C;  2CSQ A;  2ED1 A;  2YDL A;  2AKK A;  2D8H A;  1GBR A;  1JEG A;  1WA7 A;  1E7O A;  1WXU A;  2A28 A;  2DM1 A;  4CC7 A;  3EHQ A;  2RNA A;  4HXJ A;  2A08 A;  2HEQ A;  3EG1 A;  3H0H A;  4M4Z A;  3H41 A;  2KEA A;  2NUZ A;  1GCP A;  3PE0 A;  4AFZ C;  1ZSG A;  2I0N A;  4RTU A;  2DA9 A;  2DLP A;  1T0H A;  3ULR B;  3VS3 A;  1NM7 A;  1NYG A;  1CKB A;  2EQI A;  2EVR A;  3M0Q A;  2O9S A;  1RI9 A;  1UG1 A;  5IHK A;  2L2P A;  4CC3 A;  2H8H A;  1OPK A;  2HDA A;  5GJW B;  2CSI A;  2W0Z A;  2KBT A;  1V1C A;  2K3B A;  1HSQ A;  2CUD A;  1UUE A;  2J6O A;  4F17 A;  3VS7 A;  2LP5 A;  1PRM C;  1GFC A;  2K7A A;  4F14 A;  2DVJ A;  2KYB A;  1IO6 A;  2HSP A;  1ABO A;  1BK2 A;  5GJV B;  2YUQ A;  3M0T A;  2FO0 A;  2JM9 A;  1XOV A;  1SRL A;  2M51 A;  3EG2 A;  2E5K A;  2NWM A;  4LUE A;  2RPN A;  1WI7 A;  2FPD A;  2ROL A;  1NLO C;  4OMN A;  5IH2 A;  2GNC A;  1YN8 A;  1UJY A;  2W10 A;  2OJ2 A;  2KNB B;  1E6H A;  3EG3 A;  4AFS C;  2J6K A;  2PTK A;  2CH4 W;  2O31 A;  3PVQ A;  1GFD A;  2AK5 A;  4Y92 A;  4CC4 B;  2JM8 A;  4LNP A;  2QDL A;  2YT6 A;  1T0J A;  4RTV A;  2IIM A;  3EHR A;  1RLQ C;  2L3Q A;  1FMK A;  4AG2 C;  2FRW A;  4AFU C;  1NEB A;  1UFF A;  4OMP A;  4EIK A;  3M0S A;  2LNH B;  1TUD A;  1M30 A;  2EYZ A;  4OMM A;  1X43 A;  2LJ3 A;  1H92 A;  1NG2 A;  1GCQ C;  2JMA A;  2BZY A;  2EW3 A;  1ZBJ A;  2KRN A;  1OPL A;  2K6D A;  2HCK A;  4JPB W;  1JO8 A;  3IQL A;  2DBM A;  1W1F A;  1T3L A;  1Z9Z A;  2MIO A;  1HJD A;  1MUZ A;  2D0N A;  4HVW A;  4KRT A;  1JQQ A;  1LCK A;  3GBQ A;  4J9F A;  1I07 A;  1UJ0 A;  2LQN A;  2EGE A;  2KRS A;  1QCF A;  1QLY A;  1AZE A;  3C0C A;  2RQR A;  1NLP C;  2M0Y A;  5L23 A;  1ARK A;  5IHN A;  2RQW A;  1SPK A;  4DEX A;  1GCQ A;  2JXB A;  1EFN A;  1AWO A;  4FSS A;  1ABQ A;  1UTI A;  2KR3 A;  2ROT A;  2FRY A;  1RUW A;  2A37 A;  1M3A A;  4J9E A;  1Y57 A;  3UF4 A;  2GTO A;  2FG0 A;  2EYY A;  3VRY A;  1PWT A;  2DRK A;  5FWC A;  1X27 A;  5ECA A;  2LMJ A;  2RF0 A;  3VS1 A;  3LH5 A;  1K4U S;  2DIL A;  3I5R A;  4D8K A;  2OAW A;  3SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...