4C92E

Crystal structure of the yeast lsm1-7 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
84
structure length
84
Chain Sequence
b'PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92E00
4PJOG 5LJ3g 4XQ3A 4EMHA 4C8QC 3JB9D 4M78G 3QSUA 4M7AD 1MGQA 4NOYA 4WF2A 1TH7A 4XTXA 4C92E 5LJ5f 4XTWA 4PJOA 3JCMX 2QTXA 5GAMh 1D3BB 2E41A 3L1AA 2DTIA 4EMKA 5GANg 1KQ1A 4M7DG 4M78A 4MMLA 3JB9H 4C8QB 2I2LA 3RKWA 4M75F 1BIAA 5GAOn 4M7AG 4M7DA 5GAOr 3BW1A 3M4GA 4J6YA 5LJ5h 5GAN5 4M77F 4V2SA 5GANd 2DXTA 3FB9A 4PJOD 4XTYA 3JCMb 4C8QG 4X9CA 2K57A 4M78D 1U1TA 4XU0A 3JCMg 4A54A 1X01A 2EAYA 5GAMf 1H641 1WNLA 2DZ9A 2RB6A 2RD1A 1WQ7A 4RCCA 3RKYA 3SWNA 3JCMV 4C8QA 5GAN2 4M7DD 2JN0A 1I8FA 4MMKA 2CGHA 3EFSA 4QVCA 2FB7A 3JB9F 4M77C 4N0AA 4C92C 5GANe 4EMGA 4M77E 4XTZA 3V8LA 3JCMd 3AHUA 3JCMP 3FJPA 4A53A 2ZGWA 4RCBA 4QVDA 2EJGA 5GMKi 2DVEA 5GAOm 4F7UE 2DJZA 2EJFA 4C8QD 4J6XA 3EFRA 3HFNA 4M77B 4C92B 5LJ3h 3RERA 2Y90A 4PNOA 4PJOF 5GMKj 3JCMe 4F7UB 5GAN4 3V8KA 4M78F 5GAN6 5GMKm 4HT8A 1D3BA 2E1HA 1JRIA 3V7RA 4C92G 5GMKe 2EJ9A 2HNIA 1LNXA 2VXEA 5GAMd 4M7DF 4F7UG 4JRIA 2DTOA 4M75C 4M77A 5DY9A 4C92A 2E10A 4M75E 4X9DA 4XTUA 4HT9A 2E64A 4PJOC 5I21A 4M7AF 5LJ3f 4F7UA 1I5LA 5GANj 4PJOE 3VU3C 5GAMj 1JBMA 1LOJA 1N9SA 4J6WA 2RM4A 4NL2A 4XU1A 3SB2A 5LJ5d 4JUVA 2DXUA 4NL3A 3JB9I 5CAIA 2DTHA 1I81A 4C8QF 4M75B 4XU2A 5GANf 5GAMe 4M77D 4C92D 4M7DC 1Y96B 1KQ2A 4M7DE 1M8VA 4PJOB 5LJ5j 4HA8A 1HK9A 2FYKA 5GAMg 3BFMA 3QUIA 4M7AC 3JCMW 4M75G 3HSBA 3JB9J 4M7AE 5GAN3 2DZCA 5LJ5e 2E65A 4XTVA 5GANh 1BIBA 3L2ZA 4M77G 3JCMQ 1YCYA 4XU3A 3SWNC 3JCMc 4M7DB 1WQWA 2YLCA 5LJ5g 4M75A 3JCMf 4C8QE 3HFOA 1N9RA 1HXDA 1B34B 5GAN8 1Y96A 1I4K1 2EWNA 4M7AB 1LJOA 4N0AC 3RESA 1WPYA 4J5YA 5GMKl 3GIBA 2DEQA 1M5Q1 2RA2A 4JRKA 2VC8A 2YLBA 3QO3A 3SWNB 5LJ3d 4Y91A 4EMKC 5GAOq 2VXFA 4M78C 3RKXA 3JCMh 3JB9G 4M78E 3V7SA 4M75D 1U1SA 3JCMJ 3FIFA 3V8JA 4C92F 3RUXA 1B34A 5GMKh 5LJ3j 5GAN7 3PGGA 2YHTA 4OP0A 4M7AA 4F7UF 4EMKB 2DKGA 3V7CA 4M78B 4DQ2A 5GAOl 3INZA 3RIRA 4JLIA 3QHSA 3BDUA 5LJ3e 3BY7A 5GAOp
chains in the Genus database with same CATH superfamily
2JT4A 1Y71A 4JJNK 2VYTA 3H8ZA 4ESRA 2DL4A 1YJWT 3EHRA 3CXCS 2CZ0B 3VS5A 1D3BB 2MWPA 3JB9H 1KJWA 5GAOn 4M75F 2X4XA 5GAOr 2HAXA 4ELZC 2KVQG 2DXTA 3EAEA 4XTYA 1HSQA 4C8QG 2CUDA 1QCOA 4RTZA 4LD6A 1H641 5FWCA 4D6WA 4C8QA 1RAIB 1NLOC 4OF1A 3JB9F 1VQ6T 3JCMd 1JJ2S 4A53A 1RAHB 3C95A 4P5NA 8ATCB 3VS2A 3X20B 6AT1B 4JJDA 2IG0A 1H3ZA 2HSEB 1WA7A 2X4WA 1D3BA 3DKMA 1X27A 2GTJA 5GMKe 3X24B 4BDYA 1OQKA 4LDUA 5GJWB 1M90R 2J6FA 2KY9A 4ELYC 3PT9A 2AKLA 1ARKA 1WHHA 1H8KA 2DIQA 2KROA 2RQTA 3E9GA 1Q81C 3F70A 2OTJA 2FPDA 3RMSA 2CP3A 1ABOA 2LNHB 2O2OA 3DB4A 1WHMA 4M75G 1IREB 5D6XA 1OPKA 2HKQB 3KUFA 2ECZA 2EYXA 4M75A 1YITA 4FYYB 1VQ4T 4ANJA 1WXBA 2E3IA 3UATA 4ZTJA 1AHJB 5A2QE 2RA2A 3TVTA 3JB9G 3CMAQ 2QEXQ 2K6DA 2XU8A 4PJNA 1N8RR 1MMAA 1ZLMA 4HKEA 2PVGB 1R0CB 1YIJQ 4RG8A 2E12A 4E7LA 3NPFA 3H6ZA 2MWOA 2QASA 2QEXT 3L2VA 2QGGA 2I0NA 3PIOA 3CC2Q 4FSXA 5CVIA 1WFWA 1OOTA 1YJNQ 3ZBDA 1ZSZB 2XDDA 1UGSB 3ASKA 1FMWA 4OMFB 3WXMB 5HCKA 2NUTA 1YWOA 4MZTA 1VQ5A 2M02A 2QA4Q 1KD1C 4Z8AA 1A0NB 1VQOT 3CC4T 4EMGA 4KGXB 3L2UA 1QW1A 2DK3A 4OMMA 4IIMA 4C8QD 4C5GA 3EFOA 5AYFA 2GCXA 2CDTA 4PJOF 1GCPA 2IPOB 1Q82U 5KYUA 1KSWA 3V7RA 2EJ9A 1M1FA 1M3CA 1XQHA 4Z02A 4F16A 4JRIA 3NMZC 1MNEA 4X9DA 3CCQA 4CC2A 5LJ3f 5IXBA 5GAMj 1ZA2B 4IURA 1I0CA 1K76A 4XAXB 1C1AA 1MMGA 5GANf 1MUZA 2E5QA 1S1NA 2B86A 2ZPIB 4JLGA 3SHWA 4M7DC 4PJOB 2YDLA 2EQUA 3OYGA 2LJ0A 4C5HA 2FYKA 2P4RA 1XOVA 1YWPA 3CXCP 1UGRB 3QUIA 1FX7A 4A4GA 1KC8R 3DB3A 1G3SA 1TXQA 4LN2A 5GAN8 1OI1A 1QWFA 3VJPA 1T0JA 4J9GA 1QWEA 4MZPA 2DEQA 2O9VA 2Z0WA 3OYFA 1YI2Q 4M75D 1U1SA 2JS0A 2V8IA 1D1CA 3GOXA 1VYVA 1WX6A 3FC3A 1O75A 4JPBW 3X26B 4EMKB 3INZA 4JLIA 3HRUA 1JO8A 2HQEA 3VS1A 4PJOG 3CCJA 5LJ3g 3JB9D 1RL2A 3PE0A 4E7KA 4PJOA 2QTXA 2ATCB 5GANg 1VQPT 1KQ1A 1B07A 1F1BB 1K4US 2EGEA 3A8OB 1BIAA 1OU9A 1E6HA 1K8AR 2V1RA 2QXFA 2LCSA 1EIFA 1I5OB 4LD9K 1U1TA 2SEMA 2HDAA 3PIPA 2A08A 1BI1A 2JM8A 4LE9A 2CGHA 2XIDA 3I9QA 2RPNA 3A8GB 3G71T 3JCMP 1KC8C 1M2VB 2A0FB 2EPDA 3OYHA 2COYA 2LQ8A 2FO0A 1G83A 1AD5A 2LRQA 2YUOA 2NYSA 3JCMe 2RJFA 4A4HA 2PQWA 2M51A 1AWWA 4BE2A 2OX7A 1LPLA 3CPWS 1MHNA 1M27C 2EFIA 2EVRA 4XU1A 4CC3A 1ZBJA 1QVGS 4C0FA 1QVFS 1I81A 1Y96B 1K0SA 5LJ5j 2FZCB 4CI0C 3CCUA 2RF0A 1X2QA 2DZCA 3VYHB 4DOVA 1PD1A 1K8AC 3CC7T 2XI9A 2EWNA 2GF7A 1SSFA 4RTXA 3M54A 4OGEA 1TWBA 3I56A 2K3YA 1BI2A 3A8HB 3CCMQ 1VQ7A 2LTOA 2CSQA 1KHIA 2OJ2A 4X1VA 4M7AA 2ZPGB 2DYIA 2YRCA 2SRCA 3KXTA 2RJEA 2AHJB 3A98A 3P8BB 2HMAA 3CCLA 2HD0A 4C8QC 2BE9B 4OMQA 1VQLT 1MGQA 5C0MA 1M1KC 4PLIA 3L1AA 3TSWA 5GAMh 2ENMA 2EQIA 4J7FA 1JEGA 2EGAA 3I5RA 4MMLA 1ZX6A 2CP5A 2K3BA 3QWXX 3PVLA 3RNJA 2CZ6B 5GANd 1D1BA 1X75C 4PJOD 3LLRA 3OYNA 1G3WA 1M90U 2R5AA 3RDVA 1JXMA 1X01A 5I22A 5KYXA 2K5LA 2DL3A 3LGFA 2Y4XA 2RO0A 1D0YA 1UB4A 2AZVA 4LDYA 2EJGA 5GAOm 2A37A 2O31A 2P0QA 2YXYA 2VASA 3TCJA 2CT3A 3OYMA 4PNOA 5J39A 4R55A 2FPFA 5EG2A 1WXTA 2MIOA 2DRKA 2P84A 5AT1B 3TSZA 4IUTA 4M7DF 2L3QA 4DEYA 2DTOA 1TS9A 4M75C 3MEAA 1TSFA 2KRSA 2DEUA 1YCSB 5KYWA 1N8RU 2CYZB 1VQ9T 3J80E 2DTHA 3OW2P 2RQWA 1KIKA 2L5QA 4IIOA 2CREA 3R6OA 1PM3A 2JW4A 2YUPA 2E65A 4XTVA 4M7DB 5HY6A 2VV5A 4A4KA 1RUWA 1OX8A 3M0SA 2D1XA 1SSHA 2D9TA 2DE0X 1V76A 5GAOq 2VXFA 4AG1C 2LZ6B 4FT4A 3PGGA 1AWOA 2F2WA 2LDMA 1OX9A 3G4SQ 1YJWA 1UE9A 2HSPA 4E7ZA 2GGRA 4E6RA 5A0GA 4M7AD 1TH7A 2MI6A 3CD6A 1SPKA 1XNIA 1TG0A 4M7DG 5FU6C 1FWZA 4ZNXA 4YTLA 2KDSA 3I55T 4M7DA 2K5FA 5IAYA 5LJ5h 4LXCA 1VQKQ 2WSFE 3CPWP 4FW2A 1TTHB 2MF2A 4QQ6A 1IHWA 3SDZA 2XICA 5J26A 3RKYA 1QVGP 1RLPC 1OU8A 5KYNA 1QVFP 2KEAA 1H3HA 3FJPA 1GRIA 1N5ZA 1K0XA 3REAB 4BUGA 3KBGA 4O6JA 3RR6A 4LNPA 3FRNA 4J8OA 4KUIA 3CCRQ 2GBQA 2QAZA 4IUVA 3NGPA 2HBWA 2YUQA 3J7AF 5KE3A 1W1FA 1X69A 3HTRA 2VXEA 3UWNA 1N27A 3MKDA 1RAFB 3OMCA 5I21A 3DLLA 4OMOA 1AZGB 2JJ9A 1PKSA 5CKDA 1Q82C 3REBB 4RUGA 1VQ8Q 2EKHA 4J9HA 3JCMW 1RAAB 1YJ9T 3CCET 2FZKB 3CXCA 1B3QA 1NEBA 2VKNA 3I35A 4B9XA 4II1A 2YRDA 1OEBA 3PVQA 1I4K1 4Y91A 3G6EA 5GJVB 3V7SA 3M53A 2YRVA 5CIUA 1V1CA 2JMCA 2NUPA 5CQXA 2MYSA 5LJ3j 4B6MA 2DD4A 1Q86R 8AT1B 4EPCA 2C0IA 3CMEQ 2XDPA 2RHXA 2DPPB 4OGCA 1UHCA 1R0BG 1VYUA 4MDXA 3QZ5B 4VUBA 5KYYA 3I5SA 1W2BP 2W0ZA 1VQMQ 1GBRA 1LCKA 1SRLA 2JMAA 4C8QB 2QQSA 5KCHA 1YN8A 2OTLT 5I2MA 4J9FA 5HKCA 2K3XA 2L3RA 1JXOA 4OMPA 3UT1A 1VQMT 4A54A 1UEBA 1VQOA 2EAYA 2PVDB 3CC4A 4M7DD 5GAN2 2KMTA 4QVCA 5GANe 5I11A 5FLXE 2ZGWA 3LYIA 2J05A 5IHKA 3CCVQ 1FXXA 1OYXA 4GBQA 3HFNA 1PRLC 5GMKj 3CD6Q 3V8KA 3S3OA 1FMKA 2A28A 2L8DA 1QP2A 2RK1A 1ZHIA 3HRTA 1BI3A 3ER0A 3MEVA 3JB9I 2ED0A 1C0MA 4J9CA 1SKUB 4M75B 2K79A 4XU2A 1KFZA 4ATOA 4E2FB 2DF6A 5A0LA 3SEMA 2K5IA 4C0GA 3KFVA 2ZZDA 4M7AC 4Z88A 3HP9A 1SHGA 3O8VA 2QYZA 3L2ZA 3HHTB 2A7YA 2ABLA 4PFOA 4Q5WA 3PMIA 2C06A 2BZ8A 4CC7A 1TUGB 1Y57A 2DETA 2YLBA 2OI3A 2LX7A 4DOWA 4M78E 5IHNA 3JAME 3JCMJ 2ZCFB 1B34A 2DAQA 2IIMA 4QT7A 2QQAA 5IN1A 2ZPBB 2ZPEB 2RI2A 3OSSC 3QBYA 1OULA 3VV0A 4D8KA 1VQPA 3NHNA 4GLKA 4QKUA 2M0OA 2V1QA 2NUTB 3E1SA 2P4TA 2HZYA 4C0ZA 2F2XA 4PKCC 3SD4A 3MPUB 3OB9A 1KHCA 5FRMA 1PCXA 1Z9QA 3C94A 4FSSA 3C4SA 4JRPA 1VQNA 2DERA 3JCMb 2PU9B 5FU6B 1XTDA 4KULA 3G6EQ 3GNFB 3G71A 1I8FA 1NM7A 3EFOB 2K7AA 2YT6A 3CMAT 1BBZA 3AHUA 5DLQE 1GFCA 2RI3A 5KYUB 3C12A 4BD3A 1RABB 2CP7A 2RQRA 2EQMA 4WTOB 3NTKA 1M90C 1WHGA 1YIJT 3A8LB 5LJ3h 1WLPB 1WXUA 1H92A 3M59A 1IGQA 5GAN6 5GMKm 4KUDK 2LVMA 1CKBA 3C0CA 1ZBXA 3QDFA 3CC2T 2DO3A 1Q7YR 1PWTA 1WDXA 1YJNT 2KRMA 1IRXA 2C0TA 2EW3A 1WYXA 3M0UA 1BK2A 2QA4T 2WACA 1CKAA 1E6GA 1UGVA 4JDSA 2DXCA 3OW2A 2BZXA 2HQHA 1PSEA 2DL5A 1FYNA 4ME7A 3HSBA 3JB9J 3U23A 2KSSA 3CC7A 4DBRA 3JCMQ 3JCMc 4KH0B 2KRNA 1N8RC 2HEQA 1LJOA 3S3MA 1IGUA 5GMKl 4BDZA 2CZ1B 2W10A 4FYXB 2H8HA 2EYYA 4C92F 5IT9E 5GMKh 1BB9A 3X25B 4FYWB 1MMNA 1VQLA 3BDUA 1PHTA 4K11A 5CKBA 4Z89A 1G5VA 2FHDA 1ABQA 2JUFA 2DTIA 2QDYB 3RKWA 3UPUA 2R58A 2KXCA 1D1AA 2EYQA 3CPFA 1QQJA 3OYLA 2VB6A 1JJ2P 3CPWA 1WNLA 4FM4B 4RCCA 1D0XA 4MMKA 4R0KA 1QVGA 1YI2T 3UA6A 1QVFA 4M77E 2OTJQ 3HPWA 1EZZB 1WIEA 4F7UE 1D09B 2DX1A 2RHZA 3BDLA 4JZ3A 3JV3A 3EG2A 2Y90A 4FT2A 1YITQ 1NJIR 2GQIA 3VS3A 5GAN4 3LWIA 4C92G 3OA6A 2PNIA 4QQDA 1SRMA 1UJYA 4IUUA 4C92A 2LC4A 1G3TA 1VQNQ 2PTKA 1VQ9A 4M7AF 1YITT 2ZPFB 1UG1A 3SB2A 1Q86U 1KQ2A 2EKOA 2JS2A 2NLUA 1RADB 2V26A 3MCAB 4KT0E 4ORZA 1QKXA 4C8QE 3HFOA 1X6BA 4M7AB 1KQSS 2E6NA 2X4YA 3GIBA 3MHXA 1W4SA 3TQ7P 4JRKA 1VQ5Q 3QXEB 2DBMA 2QI2A 5D7UA 2KNBB 4XK8E 3LGLA 4FW1A 4AFSC 2QQBA 3RIRA 1GXIE 4HVWA 2Y4YA 3CBMA 3QDRB 1MMDA 1ZQ1A 1RI0A 3I55A 4F17A 5IXFA 1W2BA 2FZGB 3QYGB 3OQ5A 1NE8A 2VGMA 3OBYA 5KYXB 4M7AG 3M4GA 2CS7A 4FYVB 4FCYA 3GBQA 3M0RA 2CUBA 2F69A 3CCQQ 1Y7XA 2RHUA 2CT4A 3H0IA 2RD1A 4GY5A 3JCMV 5FROA 2JN0A 1PNJA 3EFSA 3CCMT 4OB1B 3RMQA 3MP8A 5DM7R 2XKOC 4RTWA 5FW9A 1S72A 4DBQA 1HJDA 3HKSA 2JVVA 4L5GA 3LWHA 5KYWB 4M78F 1WGSA 3QZ9B 2BIVA 3GPLA 2E5KA 2DJQA 4ZTFA 1I1JA 3FEOA 2JZ2A 3ZFJA 4RKUE 1JBMA 2XD0A 4BB7A 1K9MR 3CCJQ 4C92D 1YJ9A 1M8VA 3OS0A 3CCEA 4HA8A 4PJJA 3A8MB 4HCCA 5CK9A 1YHQA 2HQXA 2KT1A 2H3EB 3J81E 3CCSA 1WQWA 2YLCA 2MMPA 3CBPA 1N9RA 2R57A 3RESA 4JS4A 1QLYA 1MNDA 1QCNA 3RKXA 3JCMh 3VUBA 1NYFA 1OPLA 3OYYA 3V8JA 1GFDA 1UJ0A 2RI5A 3L42A 5GAN7 3M0TA 5GAOl 4FL6A 1U8RA 2COZA 1IZ6A 4HVUA 4M78G 2L3SA 2JTMA 2KI7A 4HXJA 1U3OA 4R56A 1TU0B 4M78A 1OZ2A 1LVKA 2QTVA 2OTLA 2K4YA 3CQTA 2L89A 3URGA 4OB0B 2YWWA 3VKIA 2O9SA 4RTUA 2LT4A 1BCMA 2PVOB 4RG2A 1Q7YU 1W70A 2K57A 4QQGA 1KK7A 1SEMA 2J6KA 3FJ5A 2VGNA 2HL5C 4OB2B 1HYOA 5CR2A 1MV0B 2FB7A 4BY6C 1WJQA 2JTFA 3WVDB 2AT1B 1UDLA 4RCBA 3CCUQ 4Y92A 2ESWA 4JJCA 1E7OA 2KE9A 3OYAA 3M55A 3G4ST 4LDXA 3RERA 4JS5A 3ME9A 1KQSP 2WSCE 1O9SA 2G6FX 3I56Q 1WI7A 2E3HA 1VQ6A 3JSCA 4N4GA 1VQ7Q 2X35A 4XTUA 4PJOE 2EGCA 1RAGB 4AFZC 4LUEA 1VQKT 2DL8A 3E9FA 4C0DC 3R6NA 5ECAA 3OYBA 1ZUYA 3EGDA 3QJYA 3CCLQ 1BYMA 1J3TA 5DLOA 2RK2A 4J9EA 4HCBA 1K73R 4AG2C 2O4XA 1ZUKA 1S72Q 5CO7A 2NUPB 3M56A 2BTTA 2CP2A 2X51A 2YSQA 4PK4A 1BKBA 3CCRT 2MCNA 3S6WA 4ZGDB 2FG0A 4N4HA 4BI4A 2DIGA 5KYYB 2L3PA 1SHFA 2YHTA 4F7UF 2D8HA 4EIKA 2M0YA 3BE3A 1GL5A 5GAOp 2G3RA 1VQ4A 1VIFA 2EYZA 2JXBA 4QVZA 2R5MA 2LQNA 4DEXA 4WF2A 4XTXA 5LJ5f 2EBPA 5I2SA 1ACMB 1NJIU 1VQ8T 1YHQQ 4PJMA 1K1ZA 3JRZA 3OYCA 3CCSQ 3M0QA 3BW1A 2XHCA 4F04B 3EG9A 2YUNA 4M78D 1T0HA 3CMAA 2QEXA 5GANj 4DA4A 2H3JA 1JJ2A 1WQ7A 4HCKA 4TVRA 2LJ3A 2AZSA 4AT1B 1TUDA 4GLMA 2PZ1A 4C92C 3A1PA 4JJBA 4QVDA 1M3BA 1EFNA 1M1GA 2DVEA 4J6XA 3CMET 1WJRA 2XDBA 3CC2A 2B8AA 3SFMA 4OB3B 1YJNA 2CP0A 3MP6A 1NZ9A 1PG5B 2DVJA 2HL3A 5GAMd 4F7UG 2OAUA 4M77A 2E10A 2CP6A 5KCOA 2QA4A 4J9DA 1NG2A 4F7UA 5KE2A 4HCZA 4C5EA 4J6WA 2RM4A 4DBHA 1YJWQ 1UFFA 5LL6S 1VUBA 3EH2A 1HK9A 1JQQA 3M5AA 5CQYA 4BI8B 2V8KA 3VS7A 1Q81R 3H9NA 3GF5A 3CCVT 1B34B 1Q86C 4N0AC 4A63B 3VRYA 4RMOA 2COWA 2VC8A 3QO3A 3FLGA 5D6WA 4Y28E 3CD6T 1VQ6Q 2D0QB 5L23A 3FIFA 2FVUA 2RQVA 3V7CA 1NLPC 1DJ7B 3QHSA 1X6OA 3M57A 3BY7A 3THKA 4PFPA 3NTIA 4ZN3A 3M58A 5A0DA 1AOJA 3L2RA 2RH2A 3QYHB 3QPHA 1JB0E 1XJWB 3ULRB 3PTAA 1BI0A 2DBKA 2J7IA 1IXDA 2DFUA 2IVWA 1YI2A 3E2UA 2F2VA 1YP5A 2GQVA 3EG1A 5FRNA 1K9MU 3OS5A 1QCFA 4EDUA 2VVKA 5GMKi 4X34A 1NYGA 4LDVA 2PUKB 1KD1R 1VQ4Q 4PL6A 4BY6B 2EIFA 7AT1B 2FRWA 4B9WA 1M8MA 2L2PA 2E1HA 1JRIA 2LNVA 1TOVA 1Y07A 2J06A 4E47A 5FWBA 4HT9A 4DBFA 1RACB 2JM9A 3VU3C 3OMGA 1VYTA 5LJ5d 2LCLA 1QMCA 1AT1B 1UHFA 2P0KA 4M77D 4M7DE 3G6ET 2EQJA 4E7JA 2JNGA 3BFMA 2D8JA 2BUDA 1UGPB 5GAN3 1AZEA 5GANh 2CH4W 3SWNC 1GCQA 4C0DB 1WHKA 1UECA 2DRMA 3H41A 4M78C 4RTVA 1VQOQ 3CEYA 3CC4Q 1UGQB 2RJCA 2KYBA 1VA7A 2QG9B 2K2MA 2XG8D 1CSKA 3S3NA 4XQ3A 4EMHA 1M4ZA 2DL7A 2MK5A 4ZGEB 4F14A 1PKTA 3M4YA 1HD3A 3DLMA 3UDCA 5IH2A 2X4JA 3TEEA 2CZ7B 2KR3A 2EYWA 4AMCA 2L0AA 2QQRA 1IO6A 1MV3A 3QJ6A 3CCMA 4AFUC 1SF9A 1ZSZA 1WJSA 2KYMA 1G3YA 2F1LA 1GBQA 2E70A 3PMTA 2DJZA 3EG3A 1Q7YC 1R8OB 2CH4A 2FEIA 1K73U 4C92B 3VUZA 1ZA1B 4HT8A 2DILA 1KQSA 1UTIA 3FDRA 4A4EA 3T9NA 5FU7C 2GFUA 4HVVA 4BE1A 2DA9A 5C6SA 2DXUA 1P92A 5CCAA 4MZMA 3VS4A 3VS6A 5GAMe 4IUPA 2LP5A 1VQPQ 3OYEA 3UF4A 2O88A 2O01E 2F5TX 4E7SA 1WHJA 1QVPA 3OW2S 2OTJT 1BCOA 2KGTA 2HCKA 1AVZC 3TREA 2LX9A 3MEWA 2ZAEA 4J5YA 2DNUA 3EHQA 3HRSA 4KGZB 2DLPA 2VUBA 1RAEB 3G71Q 2RMOA 1NPRA 1R77A 1ZSGA 2DKGA 3LX7A 1VQNT 4DQ2A 1D0ZA 4J9IA 2M9UA 3TU4K 1G2BA 2KAFA 3JCMX 2E41A 3A5ZB 4EMKA 2RNAA 1RLQC 4LUDA 3OYKA 3HL8A 1M30A 1VIEA 4RTTA 4ZGJB 3FB9A 3LH5A 1M1KR 2FRYA 1JU5C 5D6YA 2DZ9A 9ATCB 1VQ5T 2X3XD 1NJIC 4M77C 4N0AA 2E6ZA 2ZPHB 1OV3A 4ZN1A 1NBEB 3G4SA 3CC7Q 4J9BA 3NFCA 3OY9A 4NS5A 3X28B 2KXDA 1UUEA 4CRIA 3LW5E 1Q81U 1M2VA 2M16A 2KQWA 5J3BA 3OYJA 2LQWA 3UA7A 4FU6A 2ED1A 2K9GA 2K2VA 3QG1A 1VQKA 4M75E 1U5SA 1T3SA 3CCQT 1VQLQ 4O5VA 1PSFA 1QKWA 1B7TA 3EGXB 2FPEA 1KG1A 2BE7D 2KK4A 3M0PA 3MJXA 3WVEB 4OMNA 4PJLA 5LJ5e 3GNGA 2E4HA 4PFZA 3Q1JA 3CCRA 1Y96A 2RHYA 4N4IA 4RTYA 5LJ3d 3SWNB 3OSVA 3H0FA 2QDLA 1NEGA 1TUCA 2HBPA 3RUXA 2A3LA 2FL7A 4M78B 2HKNA 2GNCA 2QQ9A 1U06A 2DM1A 2GTOA 3OYIA 1VQ8A 1KD1U 5CKFA 3G1JA 3CCJT 2V8JA 4XTWA 5KH6A 3EGXA 1QP3A 1VOMA 2I2LA 3P8HA 1W2BS 2F5KA 4QW2A 4J6YA 5GAN5 2QK0A 3GP8A 5HK0A 3L2WA 2XK0A 2JOYA 2RHIA 3VYGA 4KGVB 4X9CA 1VQ9Q 4XU0A 3META 5GAMf 3SWNA 2RB6A 2AIRB 3LH0A 1OZ3A 1PD0A 2D6FA 4KH1B 1NPPA 4FIBA 2DD5A 1SG5A 4XTZA 2MOXA 4OVAA 3MEUA 3V8LA 3CMEA 3PNWC 2P0PA 2EJFA 2VWFA 3EFRA 1FMVA 1YBYA 2OAWA 2CSIA 1ZUUA 1VQMA 5IHIA 5CKEA 2JTEA 3OS1A 1WHLA 2DMOA 3AT1B 3M9QA 3QWYA 1K9MC 1LNXA 2LCCA 2GFAA 3MP1A 1GCQC 1M2OA 3EGDB 5DY9A 4BI3A 1X6GA 1Q95G 1Z9ZA 3RBBB 3O5ZA 2C0OA 4BE0A 1LOJA 2RN8A 4NL2A 3ZEHA 4IUQA 4J83A 4PLLA 2O4XB 5FU7B 2RJDA 1PC0A 2ROLA 2BKDN 5GAMg 3L2QA 2MAMA 1BU1A 3P8DA 3CCVA 3I55Q 3QKJA 4XU3A 3CCUT 2AK5A 3D7SB 1Y0MA 1G8XA 3JCMf 1Q82R 2LQKA 1WPYA 1IB8A 1I07A 3OS2A 1K9AA 4AFQC 3GLXA 3I56T 2X3WD 4OP0A 1VQ7T 2CKKA 4JZ4A 5L8RE 1YNZA 3IQLA 1WZOA 2RQUA 4WCIA 4BACA 1ZSZC 3QSUA 3EG9B 4NOYA 4C92E 2ROTA 2LJ1A 1AWJA 3CCLT 2X9HA 3PFSA 4JRQA 4KRTA 2NWMA 1KC8U 4IKFA 1M9SA 4M77F 4V2SA 3QIIA 1S72T 3H0HA 3JCMg 2BZYA 1IHVA 1RI9A 2DXBA 4E7HA 1YJ9Q 1X2KA 3CCEQ 2WSEE 2PUOB 2QGFB 2D0NA 2KBTA 2XMFA 4M77B 3CBOA 3G7ZA 3EGUA 5HK3A 3OYDA 4F7UB 3VRZA 4A4FA 3N5BB 2LMJA 2AKKA 4C5IA 3ZL7C 2HNIA 3VS0A 1YHQT 1PRMC 3MO8A 4M4ZA 4L6V5 2M1HA 3CCST 2E64A 4PJOC 1I5LA 3EG0A 1K73C 1K8AU 1N9SA 1YIJA 4NL3A 4JUVA 4MDWA 5CAIA 5CKHA 4C8QF 4E7IA 3OBWA 1X43A 5EC7A 1YFNA 4M7AE 1N6AA 1BIBA 2MPXC 4M77G 1YCYA 2OTLQ 4J7IA 4LDWA 2DYBA 4OMLA 5LJ5g 4L59A 1HXDA 3EH1A 1M3AA 2J6OA 2NUZA 2LT1A 2A36A 1M5Q1 4EMKC 2KT8A 1M1KU 1EX4A 3E19A 1T3LA 1W6XA 5M9OA 1AEYA 1AWXA 4CC4B 4UC4A 4D8DA 2EQKA 4KBMB 1V29B 5LJ3e 1C6VX 3NTHA
chains in the Genus database with same CATH topology
2XG8D 1Y71A 4JJNK 3S3NA 4XQ3A 4EMHA 2VYTA 3H8ZA 1M4ZA 3CBMA 5A0GA 3QDRB 1YJWT 4M7AD 4ZGEB 3CXCS 1TH7A 2CZ0B 1ZQ1A 2MI6A 1D3BB 1RI0A 3M4YA 3I55A 3CD6A 1XNIA 1W2BA 4M7DG 2MWPA 3QYGB 3OQ5A 1NE8A 5FU6C 3JB9H 2VGMA 3DLMA 3OBYA 3UDCA 5GAOn 4M75F 1FWZA 4YTLA 2X4XA 2KDSA 3I55T 5GAOr 2HAXA 4M7AG 4M7DA 2K5FA 3M4GA 5IAYA 2X4JA 3TEEA 2CS7A 4ELZC 5LJ5h 2KVQG 2DXTA 3EAEA 4XTYA 2CZ7B 2F69A 2WSFE 4C8QG 1Y7XA 2RHUA 2QQRA 3QJ6A 2MF2A 4QQ6A 3CCMA 4LD6A 3SDZA 2XICA 1H641 5J26A 2RD1A 3RKYA 4D6WA 4GY5A 3JCMV 5FROA 4C8QA 2JN0A 3EFSA 4OF1A 1WJSA 3JB9F 3CCMT 1VQ6T 1G3YA 3JCMd 1JJ2S 4OB1B 3RMQA 3MP8A 5DM7R 2XKOC 3FJPA 4A53A 2E70A 3PMTA 3C95A 4P5NA 2DJZA 4BUGA 3KBGA 3X20B 1S72A 4O6JA 1Q7YC 1R8OB 1K73U 3HKSA 2IG0A 4C92B 3FRNA 4J8OA 4KUIA 1H3ZA 2JVVA 4L5GA 3VUZA 4IUVA 2X4WA 3LWHA 4M78F 5KE3A 1WGSA 4HT8A 1D3BA 3DKMA 3J7AF 3QZ9B 2BIVA 5GMKe 1KQSA 3X24B 3GPLA 4BDYA 2VXEA 3FDRA 3UWNA 4A4EA 3T9NA 4ZTFA 4LDUA 5FU7C 1N27A 2GFUA 2KY9A 4ELYC 3FEOA 3OMCA 3PT9A 5I21A 3DLLA 2JZ2A 3ZFJA 1YJWA 4BE1A 4RKUE 1JBMA 2DIQA 5C6SA 2XD0A 2DXUA 1P92A 5CCAA 3E9GA 1Q81C 4MZMA 4BB7A 5GAMe 5CKDA 4C92D 4IUPA 3F70A 1YJ9A 1Q82C 1M8VA 3OS0A 3CCEA 2OTJA 4HA8A 3RMSA 3OYEA 2O01E 2F5TX 3A8MB 3DB4A 3JCMW 4M75G 5CK9A 1YJ9T 1IREB 4HCCA 1YHQA 1QVPA 5D6XA 3OW2S 3CCET 2OTJT 3CXCA 2HQXA 3KUFA 3J81E 3CCSA 1WQWA 2YLCA 4B9XA 2MMPA 4M75A 4II1A 3CBPA 1N9RA 1YITA 2R57A 1VQ4T 1I4K1 3TREA 2LX9A 3RESA 3MEWA 4ZTJA 1AHJB 4J5YA 4JS4A 5A2QE 2RA2A 4Y91A 3HRSA 3JB9G 3RKXA 3JCMh 3G6EA 3V7SA 3M53A 2YRVA 5CIUA 3VUBA 2VUBA 3OYYA 2XU8A 3V8JA 2RI5A 3L42A 5CQXA 5LJ3j 5GAN7 2DD4A 1NPRA 2DKGA 4EPCA 4HKEA 3LX7A 2PVGB 1VQNT 4DQ2A 5GAOl 4FL6A 1U8RA 2XDPA 4RG8A 2RHXA 2E12A 2DPPB 4E7LA 1IZ6A 3H6ZA 2MWOA 4OGCA 2M9UA 4MDXA 3TU4K 3QZ5B 4VUBA 2QEXT 2KAFA 4M78G 3L2VA 2JTMA 3JCMX 2E41A 3A5ZB 4EMKA 3PIOA 4R56A 4FSXA 4M78A 1OZ2A 5CVIA 2OTLA 3OYKA 2K4YA 4C8QB 3HL8A 2QQSA 3ZBDA 1VIEA 2XDDA 2L89A 1UGSB 3ASKA 3URGA 4OB0B 4OMFB 4ZGJB 3VKIA 5KCHA 5I2MA 2LT4A 3FB9A 2PVOB 3WXMB 5HKCA 4RG2A 2OTLT 2K3XA 2L3RA 1Q7YU 4MZTA 4QQGA 2K57A 1VQ5A 3UT1A 1VQMT 4A54A 1UEBA 1VQOA 1KD1C 2EAYA 2PVDB 3CC4A 5D6YA 2DZ9A 2VGNA 4OB2B 4M7DD 1VQ5T 5GAN2 2KMTA 5CR2A 4QVCA 1NJIC 2FB7A 4BY6C 1VQOT 3AHUA 1WJQA 2JTFA 4M77C 4N0AA 2E6ZA 3WVDB 4EMGA 5GANe 2ZPHB 3CC4T 3L2UA 4ZN1A 5FLXE 2ZGWA 4RCBA 1QW1A 3G4SA 2DK3A 3LYIA 4C8QD 1FXXA 1OYXA 3NFCA 4C5GA 3OYAA 3HFNA 3M55A 3G4ST 3OY9A 4LDXA 3RERA 4NS5A 3X28B 5AYFA 2GCXA 4PJOF 4CRIA 5GMKj 4JS5A 3LW5E 3ME9A 1Q81U 2WSCE 2M16A 3V8KA 1O9SA 1Q82U 2KQWA 5J3BA 3OYJA 3V7RA 2EJ9A 4FU6A 1VQ6A 1M1FA 1XQHA 3S3OA 4Z02A 4JRIA 3JSCA 2K2VA 3QG1A 4N4GA 2X35A 2L8DA 4M75E 4X9DA 4XTUA 3CCQA 1VQKA 1QP2A 2RK1A 5LJ3f 4PJOE 1ZHIA 5GAMj 4IURA 3HRTA 3CCQT 1VQKT 1BI3A 3ER0A 3MEVA 4XAXB 3JB9I 3E9FA 4O5VA 1PSFA 4M75B 4XU2A 5GANf 4C0DC 2E5QA 4M7DC 2ZPIB 4JLGA 3OYBA 4ATOA 3QJYA 4PJOB 2EQUA 5A0LA 3OYGA 1BYMA 4C5HA 2FYKA 1KG1A 1XOVA 2K5IA 2KK4A 4C0GA 2ZZDA 1UGRB 3QUIA 3HP9A 3WVEB 4M7AC 1FX7A 4A4GA 2RK2A 5DLOA 5LJ5e 4HCBA 3O8VA 3GNGA 3L2ZA 3HHTB 2A7YA 3DB3A 2O4XA 3Q1JA 1G3SA 4Q5WA 5CO7A 3PMIA 3CCRA 5GAN8 1OI1A 1Y96A 3M56A 2C06A 3VJPA 2RHYA 4N4IA 1BKBA 4MZPA 3CCRT 2DEQA 5LJ3d 3SWNB 2YLBA 3OSVA 3S6WA 4ZGDB 4DOWA 4M78E 3OYFA 4M75D 1U1SA 2V8IA 4N4HA 3JAME 4BI4A 2DIGA 3JCMJ 2ZCFB 3GOXA 3RUXA 2HBPA 3FC3A 1B34A 1O75A 2DAQA 2QQAA 3X26B 2YHTA 2A3LA 5IN1A 4F7UF 4EMKB 2ZPBB 2FL7A 2ZPEB 2RI2A 4M78B 3INZA 3OSSC 3HRUA 3QBYA 4JLIA 5GAOp 2HQEA 2G3RA 3VV0A 4PJOG 3CCJA 2QQ9A 1VIFA 1VQ4A 5LJ3g 1VQPA 4QVZA 3OYIA 2R5MA 4GLKA 1RL2A 3JB9D 2M0OA 1VQ8A 4E7KA 1KD1U 4WF2A 4XTXA 5CKFA 4PJOA 5LJ5f 2V8JA 4XTWA 3E1SA 5KH6A 2P4TA 2QTXA 3CCJT 5GANg 5I2SA 1VQPT 1KQ1A 4C0ZA 1NJIU 1VQ8T 1QP3A 3A8OB 4PKCC 3SD4A 3JRZA 3OB9A 2I2LA 3P8HA 3OYCA 1BIAA 1KHCA 1W2BS 2F5KA 3BW1A 5FRMA 4QW2A 4J6YA 5GAN5 3C94A 1VQNA 2XHCA 3C4SA 4JRPA 3GP8A 5HK0A 3JCMb 3L2WA 2XK0A 2QXFA 2JOYA 2RHIA 1EIFA 4X9CA 3VYGA 2PU9B 1U1TA 4M78D 4XU0A 5FU6B 4LD9K 1XTDA 3CMAA 4KULA 3PIPA 3META 5GAMf 2QEXA 3SWNA 3GNFB 2RB6A 1BI1A 2H3JA 1WQ7A 1OZ3A 3LH0A 3G71A 4DA4A 5GANj 1JJ2A 1I8FA 4TVRA 2D6FA 2CGHA 1NPPA 3CMAT 4FIBA 2XIDA 4C92C 2DD5A 3A8GB 4XTZA 3V8LA 3MEUA 4OVAA 5DLQE 3G71T 3PNWC 3CMEA 3JCMP 2RI3A 4QVDA 1KC8C 3C12A 2P0PA 4BD3A 1M1GA 2DVEA 2EJFA 2EQMA 3NTKA 4J6XA 3EFRA 3CMET 1M90C 1YIJT 3A8LB 3OYHA 2LQ8A 5LJ3h 1YBYA 1VQMA 2LRQA 5CKEA 3JCMe 1WJRA 2RJFA 4A4HA 3CC2A 2PQWA 3M59A 2XDBA 2B8AA 5GAN6 5GMKm 3OS1A 4BE2A 3SFMA 2LVMA 4KUDK 4PJOD 4OB3B 1YJNA 3M9QA 3MP6A 1NZ9A 1K9MC 1LNXA 2LCCA 1ZBXA 2GFAA 3MP1A 5GAMd 2DO3A 2OAUA 4F7UG 3CC2T 5DY9A 4M77A 4BI3A 2E10A 1YJNT 3CPWS 1MHNA 5KCOA 2QA4A 4F7UA 5KE2A 2EFIA 4HCZA 4BE0A 1LOJA 4J6WA 4C5EA 2RM4A 4NL2A 4XU1A 4IUQA 4J83A 3ZEHA 1QVGS 4C0FA 4PLLA 1QVFS 2O4XB 5FU7B 2QA4T 1I81A 2RJDA 2WACA 5LL6S 1Y96B 1VUBA 2BKDN 4JDSA 5LJ5j 2DXCA 4CI0C 1HK9A 5GAMg 3L2QA 3OW2A 2MAMA 1PSEA 3CCUA 3M5AA 4ME7A 3P8DA 3HSBA 5CQYA 3JB9J 2KSSA 3CC7A 3CCVA 2DZCA 3VYHB 4DOVA 4BI8B 3QKJA 3JCMQ 2V8KA 4XU3A 3JCMc 3CCUT 3JCMf 3GF5A 3CCVT 1B34B 1K8AC 3CC7T 1N8RC 1Q86C 2XI9A 2EWNA 2GF7A 1LJOA 1SSFA 2LQKA 4N0AC 3S3MA 3M54A 1WPYA 4OGEA 5GMKl 4RMOA 3I56A 2K3YA 4BDZA 2VC8A 2CZ1B 1BI2A 3A8HB 3FLGA 3QO3A 4Y28E 5D6WA 3OS2A 3CD6T 2D0QB 3GLXA 1VQ7A 3FIFA 2LTOA 3I56T 4C92F 1KHIA 5IT9E 5GMKh 2FVUA 4OP0A 3X25B 2ZPGB 4M7AA 3V7CA 1VQ7T 2CKKA 1DJ7B 3QHSA 3BDUA 1X6OA 3M57A 2RJEA 3BY7A 5L8RE 2AHJB 3KXTA 1VQLA 3P8BB 5CKBA 3NTIA 3CCLA 2HD0A 4C8QC 1G5VA 2FHDA 1VQLT 4BACA 3QSUA 1MGQA 4NOYA 4C92E 4ZN3A 5C0MA 1M1KC 3M58A 5A0DA 4PLIA 3L1AA 2JUFA 5GAMh 2DTIA 3PFSA 3CCLT 4J7FA 2QDYB 4MMLA 4JRQA 3L2RA 2RH2A 3RKWA 3QYHB 3UPUA 1KC8U 3QPHA 2R58A 4IKFA 1M9SA 3CPFA 2EYQA 1JB0E 2CZ6B 4M77F 5GANd 1X75C 3QIIA 1S72T 4V2SA 3LLRA 3OYNA 3OYLA 3PTAA 1G3WA 1BI0A 1M90U 2R5AA 3JCMg 2IVWA 3CPWA 1YI2A 1X01A 1WNLA 4FM4B 4RCCA 2GQVA 2K5LA 2DXBA 4MMKA 1QVGA 4E7HA 1YI2T 5FRNA 3LGFA 2Y4XA 2RO0A 1UB4A 1K9MU 4M77E 1QVFA 2WSEE 3OS5A 2PUOB 3HPWA 4LDYA 4EDUA 5GMKi 2EJGA 4X34A 5GAOm 4F7UE 4LDVA 2PUKB 4PL6A 4BY6B 2P0QA 2RHZA 3BDLA 4M77B 2EIFA 3CBOA 3G7ZA 3TCJA 2Y90A 4FT2A 4B9WA 4PNOA 5J39A 5HK3A 3OYMA 3OYDA 4F7UB 4R55A 4A4FA 5EG2A 5GAN4 3N5BB 4C5IA 3LWIA 2E1HA 1JRIA 2LNVA 4C92G 3OA6A 2HNIA 4QQDA 1Y07A 4IUTA 4E47A 1YHQT 4M7DF 2DTOA 3MO8A 4M75C 4HT9A 4IUUA 3MEAA 4C92A 2LC4A 4L6V5 2M1HA 1G3TA 3CCST 1VQ9A 2E64A 4PJOC 4M7AF 1YITT 2ZPFB 1I5LA 3VU3C 3OMGA 1K73C 1K8AU 1N9SA 5LJ5d 4NL3A 1YIJA 2CYZB 2LCLA 3SB2A 1Q86U 4JUVA 4MDWA 1VQ9T 1N8RU 5CAIA 5CKHA 3J80E 2DTHA 2P0KA 4C8QF 4M77D 2L5QA 1KQ2A 4M7DE 3G6ET 2EKOA 4E7IA 3OBWA 3R6OA 2EQJA 4E7JA 2JNGA 2NLUA 3BFMA 4M7AE 1N6AA 2BUDA 1UGPB 5GAN3 3MCAB 2E65A 4XTVA 5GANh 1BIBA 4M77G 1YCYA 3SWNC 4KT0E 5HY6A 4C0DB 4M7DB 2VV5A 4J7IA 4LDWA 4A4KA 5LJ5g 4C8QE 3HFOA 4L59A 1HXDA 4M7AB 1KQSS 2E6NA 2X4YA 2LT1A 3GIBA 3MHXA 1W4SA 2D9TA 1M5Q1 4JRKA 4EMKC 3QXEB 5GAOq 2VXFA 3E19A 4M78C 1M1KU 3CEYA 4FT4A 5M9OA 2QI2A 1UGQB 2RJCA 4XK8E 4UC4A 3PGGA 2EQKA 3LGLA 4KBMB 1V29B 2LDMA 2QQBA 3RIRA 1GXIE 5LJ3e 3NTHA 2Y4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO G;  5LJ3 g;  4XQ3 A;  4EMH A;  4C8Q C;  3JB9 D;  4M78 G;  3QSU A;  4M7A D;  1MGQ A;  4NOY A;  4WF2 A;  1TH7 A;  4XTX A;  4C92 E;  5LJ5 f;  4XTW A;  4PJO A;  3JCM X;  2QTX A;  5GAM h;  1D3B B;  2E41 A;  3L1A A;  2DTI A;  4EMK A;  5GAN g;  1KQ1 A;  4M7D G;  4M78 A;  4MML A;  3JB9 H;  4C8Q B;  2I2L A;  3RKW A;  4M75 F;  1BIA A;  5GAO n;  4M7A G;  4M7D A;  5GAO r;  3BW1 A;  3M4G A;  4J6Y A;  5LJ5 h;  5GAN 5;  4M77 F;  4V2S A;  5GAN d;  2DXT A;  3FB9 A;  4PJO D;  4XTY A;  3JCM b;  4C8Q G;  4X9C A;  2K57 A;  4M78 D;  1U1T A;  4XU0 A;  3JCM g;  4A54 A;  1X01 A;  2EAY A;  5GAM f;  1H64 1;  1WNL A;  2DZ9 A;  2RB6 A;  2RD1 A;  1WQ7 A;  4RCC A;  3RKY A;  3SWN A;  3JCM V;  4C8Q A;  5GAN 2;  4M7D D;  2JN0 A;  1I8F A;  4MMK A;  2CGH A;  3EFS A;  4QVC A;  2FB7 A;  3JB9 F;  4M77 C;  4N0A A;  4C92 C;  5GAN e;  4EMG A;  4M77 E;  4XTZ A;  3V8L A;  3JCM d;  3AHU A;  3JCM P;  3FJP A;  4A53 A;  2ZGW A;  4RCB A;  4QVD A;  2EJG A;  5GMK i;  2DVE A;  5GAO m;  4F7U E;  2DJZ A;  2EJF A;  4C8Q D;  4J6X A;  3EFR A;  3HFN A;  4M77 B;  4C92 B;  5LJ3 h;  3RER A;  2Y90 A;  4PNO A;  4PJO F;  5GMK j;  3JCM e;  4F7U B;  5GAN 4;  3V8K A;  4M78 F;  5GAN 6;  5GMK m;  4HT8 A;  1D3B A;  2E1H A;  1JRI A;  3V7R A;  4C92 G;  5GMK e;  2EJ9 A;  2HNI A;  1LNX A;  2VXE A;  5GAM d;  4M7D F;  4F7U G;  4JRI A;  2DTO A;  4M75 C;  4M77 A;  5DY9 A;  4C92 A;  2E10 A;  4M75 E;  4X9D A;  4XTU A;  4HT9 A;  2E64 A;  4PJO C;  5I21 A;  4M7A F;  5LJ3 f;  4F7U A;  1I5L A;  5GAN j;  4PJO E;  3VU3 C;  5GAM j;  1JBM A;  1LOJ A;  1N9S A;  4J6W A;  2RM4 A;  4NL2 A;  4XU1 A;  3SB2 A;  5LJ5 d;  4JUV A;  2DXU A;  4NL3 A;  3JB9 I;  5CAI A;  2DTH A;  1I81 A;  4C8Q F;  4M75 B;  4XU2 A;  5GAN f;  5GAM e;  4M77 D;  4C92 D;  4M7D C;  1Y96 B;  1KQ2 A;  4M7D E;  1M8V A;  4PJO B;  5LJ5 j;  4HA8 A;  1HK9 A;  2FYK A;  5GAM g;  3BFM A;  3QUI A;  4M7A C;  3JCM W;  4M75 G;  3HSB A;  3JB9 J;  4M7A E;  5GAN 3;  2DZC A;  5LJ5 e;  2E65 A;  4XTV A;  5GAN h;  1BIB A;  3L2Z A;  4M77 G;  3JCM Q;  1YCY A;  4XU3 A;  3SWN C;  3JCM c;  4M7D B;  1WQW A;  2YLC A;  5LJ5 g;  4M75 A;  3JCM f;  4C8Q E;  3HFO A;  1N9R A;  1HXD A;  1B34 B;  5GAN 8;  1Y96 A;  1I4K 1;  2EWN A;  4M7A B;  1LJO A;  4N0A C;  3RES A;  1WPY A;  4J5Y A;  5GMK l;  3GIB A;  2DEQ A;  1M5Q 1;  2RA2 A;  4JRK A;  2VC8 A;  2YLB A;  3QO3 A;  3SWN B;  5LJ3 d;  4Y91 A;  4EMK C;  5GAO q;  2VXF A;  4M78 C;  3RKX A;  3JCM h;  3JB9 G;  4M78 E;  3V7S A;  4M75 D;  1U1S A;  3JCM J;  3FIF A;  3V8J A;  4C92 F;  3RUX A;  1B34 A;  5GMK h;  5LJ3 j;  5GAN 7;  3PGG A;  2YHT A;  4OP0 A;  4M7A A;  4F7U F;  4EMK B;  2DKG A;  3V7C A;  4M78 B;  4DQ2 A;  5GAO l;  3INZ A;  3RIR A;  4JLI A;  3QHS A;  3BDU A;  5LJ3 e;  3BY7 A;  5GAO p; 
#chains in the Genus database with same CATH topology
 2JT4 A;  1Y71 A;  4JJN K;  2VYT A;  3H8Z A;  4ESR A;  2DL4 A;  1YJW T;  3EHR A;  3CXC S;  2CZ0 B;  3VS5 A;  1D3B B;  2MWP A;  3JB9 H;  1KJW A;  5GAO n;  4M75 F;  2X4X A;  5GAO r;  2HAX A;  4ELZ C;  2KVQ G;  2DXT A;  3EAE A;  4XTY A;  1HSQ A;  4C8Q G;  2CUD A;  1QCO A;  4RTZ A;  4LD6 A;  1H64 1;  5FWC A;  4D6W A;  4C8Q A;  1RAI B;  1NLO C;  4OF1 A;  3JB9 F;  1VQ6 T;  3JCM d;  1JJ2 S;  4A53 A;  1RAH B;  3C95 A;  4P5N A;  8ATC B;  3VS2 A;  3X20 B;  6AT1 B;  4JJD A;  2IG0 A;  1H3Z A;  2HSE B;  1WA7 A;  2X4W A;  1D3B A;  3DKM A;  1X27 A;  2GTJ A;  5GMK e;  3X24 B;  4BDY A;  1OQK A;  4LDU A;  5GJW B;  1M90 R;  2J6F A;  2KY9 A;  4ELY C;  3PT9 A;  2AKL A;  1ARK A;  1WHH A;  1H8K A;  2DIQ A;  2KRO A;  2RQT A;  3E9G A;  1Q81 C;  3F70 A;  2OTJ A;  2FPD A;  3RMS A;  2CP3 A;  1ABO A;  2LNH B;  2O2O A;  3DB4 A;  1WHM A;  4M75 G;  1IRE B;  5D6X A;  1OPK A;  2HKQ B;  3KUF A;  2ECZ A;  2EYX A;  4M75 A;  1YIT A;  4FYY B;  1VQ4 T;  4ANJ A;  1WXB A;  2E3I A;  3UAT A;  4ZTJ A;  1AHJ B;  5A2Q E;  2RA2 A;  3TVT A;  3JB9 G;  3CMA Q;  2QEX Q;  2K6D A;  2XU8 A;  4PJN A;  1N8R R;  1MMA A;  1ZLM A;  4HKE A;  2PVG B;  1R0C B;  1YIJ Q;  4RG8 A;  2E12 A;  4E7L A;  3NPF A;  3H6Z A;  2MWO A;  2QAS A;  2QEX T;  3L2V A;  2QGG A;  2I0N A;  3PIO A;  3CC2 Q;  4FSX A;  5CVI A;  1WFW A;  1OOT A;  1YJN Q;  3ZBD A;  1ZSZ B;  2XDD A;  1UGS B;  3ASK A;  1FMW A;  4OMF B;  3WXM B;  5HCK A;  2NUT A;  1YWO A;  4MZT A;  1VQ5 A;  2M02 A;  2QA4 Q;  1KD1 C;  4Z8A A;  1A0N B;  1VQO T;  3CC4 T;  4EMG A;  4KGX B;  3L2U A;  1QW1 A;  2DK3 A;  4OMM A;  4IIM A;  4C8Q D;  4C5G A;  3EFO A;  5AYF A;  2GCX A;  2CDT A;  4PJO F;  1GCP A;  2IPO B;  1Q82 U;  5KYU A;  1KSW A;  3V7R A;  2EJ9 A;  1M1F A;  1M3C A;  1XQH A;  4Z02 A;  4F16 A;  4JRI A;  3NMZ C;  1MNE A;  4X9D A;  3CCQ A;  4CC2 A;  5LJ3 f;  5IXB A;  5GAM j;  1ZA2 B;  4IUR A;  1I0C A;  1K76 A;  4XAX B;  1C1A A;  1MMG A;  5GAN f;  1MUZ A;  2E5Q A;  1S1N A;  2B86 A;  2ZPI B;  4JLG A;  3SHW A;  4M7D C;  4PJO B;  2YDL A;  2EQU A;  3OYG A;  2LJ0 A;  4C5H A;  2FYK A;  2P4R A;  1XOV A;  1YWP A;  3CXC P;  1UGR B;  3QUI A;  1FX7 A;  4A4G A;  1KC8 R;  3DB3 A;  1G3S A;  1TXQ A;  4LN2 A;  5GAN 8;  1OI1 A;  1QWF A;  3VJP A;  1T0J A;  4J9G A;  1QWE A;  4MZP A;  2DEQ A;  2O9V A;  2Z0W A;  3OYF A;  1YI2 Q;  4M75 D;  1U1S A;  2JS0 A;  2V8I A;  1D1C A;  3GOX A;  1VYV A;  1WX6 A;  3FC3 A;  1O75 A;  4JPB W;  3X26 B;  4EMK B;  3INZ A;  4JLI A;  3HRU A;  1JO8 A;  2HQE A;  3VS1 A;  4PJO G;  3CCJ A;  5LJ3 g;  3JB9 D;  1RL2 A;  3PE0 A;  4E7K A;  4PJO A;  2QTX A;  2ATC B;  5GAN g;  1VQP T;  1KQ1 A;  1B07 A;  1F1B B;  1K4U S;  2EGE A;  3A8O B;  1BIA A;  1OU9 A;  1E6H A;  1K8A R;  2V1R A;  2QXF A;  2LCS A;  1EIF A;  1I5O B;  4LD9 K;  1U1T A;  2SEM A;  2HDA A;  3PIP A;  2A08 A;  1BI1 A;  2JM8 A;  4LE9 A;  2CGH A;  2XID A;  3I9Q A;  2RPN A;  3A8G B;  3G71 T;  3JCM P;  1KC8 C;  1M2V B;  2A0F B;  2EPD A;  3OYH A;  2COY A;  2LQ8 A;  2FO0 A;  1G83 A;  1AD5 A;  2LRQ A;  2YUO A;  2NYS A;  3JCM e;  2RJF A;  4A4H A;  2PQW A;  2M51 A;  1AWW A;  4BE2 A;  2OX7 A;  1LPL A;  3CPW S;  1MHN A;  1M27 C;  2EFI A;  2EVR A;  4XU1 A;  4CC3 A;  1ZBJ A;  1QVG S;  4C0F A;  1QVF S;  1I81 A;  1Y96 B;  1K0S A;  5LJ5 j;  2FZC B;  4CI0 C;  3CCU A;  2RF0 A;  1X2Q A;  2DZC A;  3VYH B;  4DOV A;  1PD1 A;  1K8A C;  3CC7 T;  2XI9 A;  2EWN A;  2GF7 A;  1SSF A;  4RTX A;  3M54 A;  4OGE A;  1TWB A;  3I56 A;  2K3Y A;  1BI2 A;  3A8H B;  3CCM Q;  1VQ7 A;  2LTO A;  2CSQ A;  1KHI A;  2OJ2 A;  4X1V A;  4M7A A;  2ZPG B;  2DYI A;  2YRC A;  2SRC A;  3KXT A;  2RJE A;  2AHJ B;  3A98 A;  3P8B B;  2HMA A;  3CCL A;  2HD0 A;  4C8Q C;  2BE9 B;  4OMQ A;  1VQL T;  1MGQ A;  5C0M A;  1M1K C;  4PLI A;  3L1A A;  3TSW A;  5GAM h;  2ENM A;  2EQI A;  4J7F A;  1JEG A;  2EGA A;  3I5R A;  4MML A;  1ZX6 A;  2CP5 A;  2K3B A;  3QWX X;  3PVL A;  3RNJ A;  2CZ6 B;  5GAN d;  1D1B A;  1X75 C;  4PJO D;  3LLR A;  3OYN A;  1G3W A;  1M90 U;  2R5A A;  3RDV A;  1JXM A;  1X01 A;  5I22 A;  5KYX A;  2K5L A;  2DL3 A;  3LGF A;  2Y4X A;  2RO0 A;  1D0Y A;  1UB4 A;  2AZV A;  4LDY A;  2EJG A;  5GAO m;  2A37 A;  2O31 A;  2P0Q A;  2YXY A;  2VAS A;  3TCJ A;  2CT3 A;  3OYM A;  4PNO A;  5J39 A;  4R55 A;  2FPF A;  5EG2 A;  1WXT A;  2MIO A;  2DRK A;  2P84 A;  5AT1 B;  3TSZ A;  4IUT A;  4M7D F;  2L3Q A;  4DEY A;  2DTO A;  1TS9 A;  4M75 C;  3MEA A;  1TSF A;  2KRS A;  2DEU A;  1YCS B;  5KYW A;  1N8R U;  2CYZ B;  1VQ9 T;  3J80 E;  2DTH A;  3OW2 P;  2RQW A;  1KIK A;  2L5Q A;  4IIO A;  2CRE A;  3R6O A;  1PM3 A;  2JW4 A;  2YUP A;  2E65 A;  4XTV A;  4M7D B;  5HY6 A;  2VV5 A;  4A4K A;  1RUW A;  1OX8 A;  3M0S A;  2D1X A;  1SSH A;  2D9T A;  2DE0 X;  1V76 A;  5GAO q;  2VXF A;  4AG1 C;  2LZ6 B;  4FT4 A;  3PGG A;  1AWO A;  2F2W A;  2LDM A;  1OX9 A;  3G4S Q;  1YJW A;  1UE9 A;  2HSP A;  4E7Z A;  2GGR A;  4E6R A;  5A0G A;  4M7A D;  1TH7 A;  2MI6 A;  3CD6 A;  1SPK A;  1XNI A;  1TG0 A;  4M7D G;  5FU6 C;  1FWZ A;  4ZNX A;  4YTL A;  2KDS A;  3I55 T;  4M7D A;  2K5F A;  5IAY A;  5LJ5 h;  4LXC A;  1VQK Q;  2WSF E;  3CPW P;  4FW2 A;  1TTH B;  2MF2 A;  4QQ6 A;  1IHW A;  3SDZ A;  2XIC A;  5J26 A;  3RKY A;  1QVG P;  1RLP C;  1OU8 A;  5KYN A;  1QVF P;  2KEA A;  1H3H A;  3FJP A;  1GRI A;  1N5Z A;  1K0X A;  3REA B;  4BUG A;  3KBG A;  4O6J A;  3RR6 A;  4LNP A;  3FRN A;  4J8O A;  4KUI A;  3CCR Q;  2GBQ A;  2QAZ A;  4IUV A;  3NGP A;  2HBW A;  2YUQ A;  3J7A F;  5KE3 A;  1W1F A;  1X69 A;  3HTR A;  2VXE A;  3UWN A;  1N27 A;  3MKD A;  1RAF B;  3OMC A;  5I21 A;  3DLL A;  4OMO A;  1AZG B;  2JJ9 A;  1PKS A;  5CKD A;  1Q82 C;  3REB B;  4RUG A;  1VQ8 Q;  2EKH A;  4J9H A;  3JCM W;  1RAA B;  1YJ9 T;  3CCE T;  2FZK B;  3CXC A;  1B3Q A;  1NEB A;  2VKN A;  3I35 A;  4B9X A;  4II1 A;  2YRD A;  1OEB A;  3PVQ A;  1I4K 1;  4Y91 A;  3G6E A;  5GJV B;  3V7S A;  3M53 A;  2YRV A;  5CIU A;  1V1C A;  2JMC A;  2NUP A;  5CQX A;  2MYS A;  5LJ3 j;  4B6M A;  2DD4 A;  1Q86 R;  8AT1 B;  4EPC A;  2C0I A;  3CME Q;  2XDP A;  2RHX A;  2DPP B;  4OGC A;  1UHC A;  1R0B G;  1VYU A;  4MDX A;  3QZ5 B;  4VUB A;  5KYY A;  3I5S A;  1W2B P;  2W0Z A;  1VQM Q;  1GBR A;  1LCK A;  1SRL A;  2JMA A;  4C8Q B;  2QQS A;  5KCH A;  1YN8 A;  2OTL T;  5I2M A;  4J9F A;  5HKC A;  2K3X A;  2L3R A;  1JXO A;  4OMP A;  3UT1 A;  1VQM T;  4A54 A;  1UEB A;  1VQO A;  2EAY A;  2PVD B;  3CC4 A;  4M7D D;  5GAN 2;  2KMT A;  4QVC A;  5GAN e;  5I11 A;  5FLX E;  2ZGW A;  3LYI A;  2J05 A;  5IHK A;  3CCV Q;  1FXX A;  1OYX A;  4GBQ A;  3HFN A;  1PRL C;  5GMK j;  3CD6 Q;  3V8K A;  3S3O A;  1FMK A;  2A28 A;  2L8D A;  1QP2 A;  2RK1 A;  1ZHI A;  3HRT A;  1BI3 A;  3ER0 A;  3MEV A;  3JB9 I;  2ED0 A;  1C0M A;  4J9C A;  1SKU B;  4M75 B;  2K79 A;  4XU2 A;  1KFZ A;  4ATO A;  4E2F B;  2DF6 A;  5A0L A;  3SEM A;  2K5I A;  4C0G A;  3KFV A;  2ZZD A;  4M7A C;  4Z88 A;  3HP9 A;  1SHG A;  3O8V A;  2QYZ A;  3L2Z A;  3HHT B;  2A7Y A;  2ABL A;  4PFO A;  4Q5W A;  3PMI A;  2C06 A;  2BZ8 A;  4CC7 A;  1TUG B;  1Y57 A;  2DET A;  2YLB A;  2OI3 A;  2LX7 A;  4DOW A;  4M78 E;  5IHN A;  3JAM E;  3JCM J;  2ZCF B;  1B34 A;  2DAQ A;  2IIM A;  4QT7 A;  2QQA A;  5IN1 A;  2ZPB B;  2ZPE B;  2RI2 A;  3OSS C;  3QBY A;  1OUL A;  3VV0 A;  4D8K A;  1VQP A;  3NHN A;  4GLK A;  4QKU A;  2M0O A;  2V1Q A;  2NUT B;  3E1S A;  2P4T A;  2HZY A;  4C0Z A;  2F2X A;  4PKC C;  3SD4 A;  3MPU B;  3OB9 A;  1KHC A;  5FRM A;  1PCX A;  1Z9Q A;  3C94 A;  4FSS A;  3C4S A;  4JRP A;  1VQN A;  2DER A;  3JCM b;  2PU9 B;  5FU6 B;  1XTD A;  4KUL A;  3G6E Q;  3GNF B;  3G71 A;  1I8F A;  1NM7 A;  3EFO B;  2K7A A;  2YT6 A;  3CMA T;  1BBZ A;  3AHU A;  5DLQ E;  1GFC A;  2RI3 A;  5KYU B;  3C12 A;  4BD3 A;  1RAB B;  2CP7 A;  2RQR A;  2EQM A;  4WTO B;  3NTK A;  1M90 C;  1WHG A;  1YIJ T;  3A8L B;  5LJ3 h;  1WLP B;  1WXU A;  1H92 A;  3M59 A;  1IGQ A;  5GAN 6;  5GMK m;  4KUD K;  2LVM A;  1CKB A;  3C0C A;  1ZBX A;  3QDF A;  3CC2 T;  2DO3 A;  1Q7Y R;  1PWT A;  1WDX A;  1YJN T;  2KRM A;  1IRX A;  2C0T A;  2EW3 A;  1WYX A;  3M0U A;  1BK2 A;  2QA4 T;  2WAC A;  1CKA A;  1E6G A;  1UGV A;  4JDS A;  2DXC A;  3OW2 A;  2BZX A;  2HQH A;  1PSE A;  2DL5 A;  1FYN A;  4ME7 A;  3HSB A;  3JB9 J;  3U23 A;  2KSS A;  3CC7 A;  4DBR A;  3JCM Q;  3JCM c;  4KH0 B;  2KRN A;  1N8R C;  2HEQ A;  1LJO A;  3S3M A;  1IGU A;  5GMK l;  4BDZ A;  2CZ1 B;  2W10 A;  4FYX B;  2H8H A;  2EYY A;  4C92 F;  5IT9 E;  5GMK h;  1BB9 A;  3X25 B;  4FYW B;  1MMN A;  1VQL A;  3BDU A;  1PHT A;  4K11 A;  5CKB A;  4Z89 A;  1G5V A;  2FHD A;  1ABQ A;  2JUF A;  2DTI A;  2QDY B;  3RKW A;  3UPU A;  2R58 A;  2KXC A;  1D1A A;  2EYQ A;  3CPF A;  1QQJ A;  3OYL A;  2VB6 A;  1JJ2 P;  3CPW A;  1WNL A;  4FM4 B;  4RCC A;  1D0X A;  4MMK A;  4R0K A;  1QVG A;  1YI2 T;  3UA6 A;  1QVF A;  4M77 E;  2OTJ Q;  3HPW A;  1EZZ B;  1WIE A;  4F7U E;  1D09 B;  2DX1 A;  2RHZ A;  3BDL A;  4JZ3 A;  3JV3 A;  3EG2 A;  2Y90 A;  4FT2 A;  1YIT Q;  1NJI R;  2GQI A;  3VS3 A;  5GAN 4;  3LWI A;  4C92 G;  3OA6 A;  2PNI A;  4QQD A;  1SRM A;  1UJY A;  4IUU A;  4C92 A;  2LC4 A;  1G3T A;  1VQN Q;  2PTK A;  1VQ9 A;  4M7A F;  1YIT T;  2ZPF B;  1UG1 A;  3SB2 A;  1Q86 U;  1KQ2 A;  2EKO A;  2JS2 A;  2NLU A;  1RAD B;  2V26 A;  3MCA B;  4KT0 E;  4ORZ A;  1QKX A;  4C8Q E;  3HFO A;  1X6B A;  4M7A B;  1KQS S;  2E6N A;  2X4Y A;  3GIB A;  3MHX A;  1W4S A;  3TQ7 P;  4JRK A;  1VQ5 Q;  3QXE B;  2DBM A;  2QI2 A;  5D7U A;  2KNB B;  4XK8 E;  3LGL A;  4FW1 A;  4AFS C;  2QQB A;  3RIR A;  1GXI E;  4HVW A;  2Y4Y A;  3CBM A;  3QDR B;  1MMD A;  1ZQ1 A;  1RI0 A;  3I55 A;  4F17 A;  5IXF A;  1W2B A;  2FZG B;  3QYG B;  3OQ5 A;  1NE8 A;  2VGM A;  3OBY A;  5KYX B;  4M7A G;  3M4G A;  2CS7 A;  4FYV B;  4FCY A;  3GBQ A;  3M0R A;  2CUB A;  2F69 A;  3CCQ Q;  1Y7X A;  2RHU A;  2CT4 A;  3H0I A;  2RD1 A;  4GY5 A;  3JCM V;  5FRO A;  2JN0 A;  1PNJ A;  3EFS A;  3CCM T;  4OB1 B;  3RMQ A;  3MP8 A;  5DM7 R;  2XKO C;  4RTW A;  5FW9 A;  1S72 A;  4DBQ A;  1HJD A;  3HKS A;  2JVV A;  4L5G A;  3LWH A;  5KYW B;  4M78 F;  1WGS A;  3QZ9 B;  2BIV A;  3GPL A;  2E5K A;  2DJQ A;  4ZTF A;  1I1J A;  3FEO A;  2JZ2 A;  3ZFJ A;  4RKU E;  1JBM A;  2XD0 A;  4BB7 A;  1K9M R;  3CCJ Q;  4C92 D;  1YJ9 A;  1M8V A;  3OS0 A;  3CCE A;  4HA8 A;  4PJJ A;  3A8M B;  4HCC A;  5CK9 A;  1YHQ A;  2HQX A;  2KT1 A;  2H3E B;  3J81 E;  3CCS A;  1WQW A;  2YLC A;  2MMP A;  3CBP A;  1N9R A;  2R57 A;  3RES A;  4JS4 A;  1QLY A;  1MND A;  1QCN A;  3RKX A;  3JCM h;  3VUB A;  1NYF A;  1OPL A;  3OYY A;  3V8J A;  1GFD A;  1UJ0 A;  2RI5 A;  3L42 A;  5GAN 7;  3M0T A;  5GAO l;  4FL6 A;  1U8R A;  2COZ A;  1IZ6 A;  4HVU A;  4M78 G;  2L3S A;  2JTM A;  2KI7 A;  4HXJ A;  1U3O A;  4R56 A;  1TU0 B;  4M78 A;  1OZ2 A;  1LVK A;  2QTV A;  2OTL A;  2K4Y A;  3CQT A;  2L89 A;  3URG A;  4OB0 B;  2YWW A;  3VKI A;  2O9S A;  4RTU A;  2LT4 A;  1BCM A;  2PVO B;  4RG2 A;  1Q7Y U;  1W70 A;  2K57 A;  4QQG A;  1KK7 A;  1SEM A;  2J6K A;  3FJ5 A;  2VGN A;  2HL5 C;  4OB2 B;  1HYO A;  5CR2 A;  1MV0 B;  2FB7 A;  4BY6 C;  1WJQ A;  2JTF A;  3WVD B;  2AT1 B;  1UDL A;  4RCB A;  3CCU Q;  4Y92 A;  2ESW A;  4JJC A;  1E7O A;  2KE9 A;  3OYA A;  3M55 A;  3G4S T;  4LDX A;  3RER A;  4JS5 A;  3ME9 A;  1KQS P;  2WSC E;  1O9S A;  2G6F X;  3I56 Q;  1WI7 A;  2E3H A;  1VQ6 A;  3JSC A;  4N4G A;  1VQ7 Q;  2X35 A;  4XTU A;  4PJO E;  2EGC A;  1RAG B;  4AFZ C;  4LUE A;  1VQK T;  2DL8 A;  3E9F A;  4C0D C;  3R6N A;  5ECA A;  3OYB A;  1ZUY A;  3EGD A;  3QJY A;  3CCL Q;  1BYM A;  1J3T A;  5DLO A;  2RK2 A;  4J9E A;  4HCB A;  1K73 R;  4AG2 C;  2O4X A;  1ZUK A;  1S72 Q;  5CO7 A;  2NUP B;  3M56 A;  2BTT A;  2CP2 A;  2X51 A;  2YSQ A;  4PK4 A;  1BKB A;  3CCR T;  2MCN A;  3S6W A;  4ZGD B;  2FG0 A;  4N4H A;  4BI4 A;  2DIG A;  5KYY B;  2L3P A;  1SHF A;  2YHT A;  4F7U F;  2D8H A;  4EIK A;  2M0Y A;  3BE3 A;  1GL5 A;  5GAO p;  2G3R A;  1VQ4 A;  1VIF A;  2EYZ A;  2JXB A;  4QVZ A;  2R5M A;  2LQN A;  4DEX A;  4WF2 A;  4XTX A;  5LJ5 f;  2EBP A;  5I2S A;  1ACM B;  1NJI U;  1VQ8 T;  1YHQ Q;  4PJM A;  1K1Z A;  3JRZ A;  3OYC A;  3CCS Q;  3M0Q A;  3BW1 A;  2XHC A;  4F04 B;  3EG9 A;  2YUN A;  4M78 D;  1T0H A;  3CMA A;  2QEX A;  5GAN j;  4DA4 A;  2H3J A;  1JJ2 A;  1WQ7 A;  4HCK A;  4TVR A;  2LJ3 A;  2AZS A;  4AT1 B;  1TUD A;  4GLM A;  2PZ1 A;  4C92 C;  3A1P A;  4JJB A;  4QVD A;  1M3B A;  1EFN A;  1M1G A;  2DVE A;  4J6X A;  3CME T;  1WJR A;  2XDB A;  3CC2 A;  2B8A A;  3SFM A;  4OB3 B;  1YJN A;  2CP0 A;  3MP6 A;  1NZ9 A;  1PG5 B;  2DVJ A;  2HL3 A;  5GAM d;  4F7U G;  2OAU A;  4M77 A;  2E10 A;  2CP6 A;  5KCO A;  2QA4 A;  4J9D A;  1NG2 A;  4F7U A;  5KE2 A;  4HCZ A;  4C5E A;  4J6W A;  2RM4 A;  4DBH A;  1YJW Q;  1UFF A;  5LL6 S;  1VUB A;  3EH2 A;  1HK9 A;  1JQQ A;  3M5A A;  5CQY A;  4BI8 B;  2V8K A;  3VS7 A;  1Q81 R;  3H9N A;  3GF5 A;  3CCV T;  1B34 B;  1Q86 C;  4N0A C;  4A63 B;  3VRY A;  4RMO A;  2COW A;  2VC8 A;  3QO3 A;  3FLG A;  5D6W A;  4Y28 E;  3CD6 T;  1VQ6 Q;  2D0Q B;  5L23 A;  3FIF A;  2FVU A;  2RQV A;  3V7C A;  1NLP C;  1DJ7 B;  3QHS A;  1X6O A;  3M57 A;  3BY7 A;  3THK A;  4PFP A;  3NTI A;  4ZN3 A;  3M58 A;  5A0D A;  1AOJ A;  3L2R A;  2RH2 A;  3QYH B;  3QPH A;  1JB0 E;  1XJW B;  3ULR B;  3PTA A;  1BI0 A;  2DBK A;  2J7I A;  1IXD A;  2DFU A;  2IVW A;  1YI2 A;  3E2U A;  2F2V A;  1YP5 A;  2GQV A;  3EG1 A;  5FRN A;  1K9M U;  3OS5 A;  1QCF A;  4EDU A;  2VVK A;  5GMK i;  4X34 A;  1NYG A;  4LDV A;  2PUK B;  1KD1 R;  1VQ4 Q;  4PL6 A;  4BY6 B;  2EIF A;  7AT1 B;  2FRW A;  4B9W A;  1M8M A;  2L2P A;  2E1H A;  1JRI A;  2LNV A;  1TOV A;  1Y07 A;  2J06 A;  4E47 A;  5FWB A;  4HT9 A;  4DBF A;  1RAC B;  2JM9 A;  3VU3 C;  3OMG A;  1VYT A;  5LJ5 d;  2LCL A;  1QMC A;  1AT1 B;  1UHF A;  2P0K A;  4M77 D;  4M7D E;  3G6E T;  2EQJ A;  4E7J A;  2JNG A;  3BFM A;  2D8J A;  2BUD A;  1UGP B;  5GAN 3;  1AZE A;  5GAN h;  2CH4 W;  3SWN C;  1GCQ A;  4C0D B;  1WHK A;  1UEC A;  2DRM A;  3H41 A;  4M78 C;  4RTV A;  1VQO Q;  3CEY A;  3CC4 Q;  1UGQ B;  2RJC A;  2KYB A;  1VA7 A;  2QG9 B;  2K2M A;  2XG8 D;  1CSK A;  3S3N A;  4XQ3 A;  4EMH A;  1M4Z A;  2DL7 A;  2MK5 A;  4ZGE B;  4F14 A;  1PKT A;  3M4Y A;  1HD3 A;  3DLM A;  3UDC A;  5IH2 A;  2X4J A;  3TEE A;  2CZ7 B;  2KR3 A;  2EYW A;  4AMC A;  2L0A A;  2QQR A;  1IO6 A;  1MV3 A;  3QJ6 A;  3CCM A;  4AFU C;  1SF9 A;  1ZSZ A;  1WJS A;  2KYM A;  1G3Y A;  2F1L A;  1GBQ A;  2E70 A;  3PMT A;  2DJZ A;  3EG3 A;  1Q7Y C;  1R8O B;  2CH4 A;  2FEI A;  1K73 U;  4C92 B;  3VUZ A;  1ZA1 B;  4HT8 A;  2DIL A;  1KQS A;  1UTI A;  3FDR A;  4A4E A;  3T9N A;  5FU7 C;  2GFU A;  4HVV A;  4BE1 A;  2DA9 A;  5C6S A;  2DXU A;  1P92 A;  5CCA A;  4MZM A;  3VS4 A;  3VS6 A;  5GAM e;  4IUP A;  2LP5 A;  1VQP Q;  3OYE A;  3UF4 A;  2O88 A;  2O01 E;  2F5T X;  4E7S A;  1WHJ A;  1QVP A;  3OW2 S;  2OTJ T;  1BCO A;  2KGT A;  2HCK A;  1AVZ C;  3TRE A;  2LX9 A;  3MEW A;  2ZAE A;  4J5Y A;  2DNU A;  3EHQ A;  3HRS A;  4KGZ B;  2DLP A;  2VUB A;  1RAE B;  3G71 Q;  2RMO A;  1NPR A;  1R77 A;  1ZSG A;  2DKG A;  3LX7 A;  1VQN T;  4DQ2 A;  1D0Z A;  4J9I A;  2M9U A;  3TU4 K;  1G2B A;  2KAF A;  3JCM X;  2E41 A;  3A5Z B;  4EMK A;  2RNA A;  1RLQ C;  4LUD A;  3OYK A;  3HL8 A;  1M30 A;  1VIE A;  4RTT A;  4ZGJ B;  3FB9 A;  3LH5 A;  1M1K R;  2FRY A;  1JU5 C;  5D6Y A;  2DZ9 A;  9ATC B;  1VQ5 T;  2X3X D;  1NJI C;  4M77 C;  4N0A A;  2E6Z A;  2ZPH B;  1OV3 A;  4ZN1 A;  1NBE B;  3G4S A;  3CC7 Q;  4J9B A;  3NFC A;  3OY9 A;  4NS5 A;  3X28 B;  2KXD A;  1UUE A;  4CRI A;  3LW5 E;  1Q81 U;  1M2V A;  2M16 A;  2KQW A;  5J3B A;  3OYJ A;  2LQW A;  3UA7 A;  4FU6 A;  2ED1 A;  2K9G A;  2K2V A;  3QG1 A;  1VQK A;  4M75 E;  1U5S A;  1T3S A;  3CCQ T;  1VQL Q;  4O5V A;  1PSF A;  1QKW A;  1B7T A;  3EGX B;  2FPE A;  1KG1 A;  2BE7 D;  2KK4 A;  3M0P A;  3MJX A;  3WVE B;  4OMN A;  4PJL A;  5LJ5 e;  3GNG A;  2E4H A;  4PFZ A;  3Q1J A;  3CCR A;  1Y96 A;  2RHY A;  4N4I A;  4RTY A;  5LJ3 d;  3SWN B;  3OSV A;  3H0F A;  2QDL A;  1NEG A;  1TUC A;  2HBP A;  3RUX A;  2A3L A;  2FL7 A;  4M78 B;  2HKN A;  2GNC A;  2QQ9 A;  1U06 A;  2DM1 A;  2GTO A;  3OYI A;  1VQ8 A;  1KD1 U;  5CKF A;  3G1J A;  3CCJ T;  2V8J A;  4XTW A;  5KH6 A;  3EGX A;  1QP3 A;  1VOM A;  2I2L A;  3P8H A;  1W2B S;  2F5K A;  4QW2 A;  4J6Y A;  5GAN 5;  2QK0 A;  3GP8 A;  5HK0 A;  3L2W A;  2XK0 A;  2JOY A;  2RHI A;  3VYG A;  4KGV B;  4X9C A;  1VQ9 Q;  4XU0 A;  3MET A;  5GAM f;  3SWN A;  2RB6 A;  2AIR B;  3LH0 A;  1OZ3 A;  1PD0 A;  2D6F A;  4KH1 B;  1NPP A;  4FIB A;  2DD5 A;  1SG5 A;  4XTZ A;  2MOX A;  4OVA A;  3MEU A;  3V8L A;  3CME A;  3PNW C;  2P0P A;  2EJF A;  2VWF A;  3EFR A;  1FMV A;  1YBY A;  2OAW A;  2CSI A;  1ZUU A;  1VQM A;  5IHI A;  5CKE A;  2JTE A;  3OS1 A;  1WHL A;  2DMO A;  3AT1 B;  3M9Q A;  3QWY A;  1K9M C;  1LNX A;  2LCC A;  2GFA A;  3MP1 A;  1GCQ C;  1M2O A;  3EGD B;  5DY9 A;  4BI3 A;  1X6G A;  1Q95 G;  1Z9Z A;  3RBB B;  3O5Z A;  2C0O A;  4BE0 A;  1LOJ A;  2RN8 A;  4NL2 A;  3ZEH A;  4IUQ A;  4J83 A;  4PLL A;  2O4X B;  5FU7 B;  2RJD A;  1PC0 A;  2ROL A;  2BKD N;  5GAM g;  3L2Q A;  2MAM A;  1BU1 A;  3P8D A;  3CCV A;  3I55 Q;  3QKJ A;  4XU3 A;  3CCU T;  2AK5 A;  3D7S B;  1Y0M A;  1G8X A;  3JCM f;  1Q82 R;  2LQK A;  1WPY A;  1IB8 A;  1I07 A;  3OS2 A;  1K9A A;  4AFQ C;  3GLX A;  3I56 T;  2X3W D;  4OP0 A;  1VQ7 T;  2CKK A;  4JZ4 A;  5L8R E;  1YNZ A;  3IQL A;  1WZO A;  2RQU A;  4WCI A;  4BAC A;  1ZSZ C;  3QSU A;  3EG9 B;  4NOY A;  4C92 E;  2ROT A;  2LJ1 A;  1AWJ A;  3CCL T;  2X9H A;  3PFS A;  4JRQ A;  4KRT A;  2NWM A;  1KC8 U;  4IKF A;  1M9S A;  4M77 F;  4V2S A;  3QII A;  1S72 T;  3H0H A;  3JCM g;  2BZY A;  1IHV A;  1RI9 A;  2DXB A;  4E7H A;  1YJ9 Q;  1X2K A;  3CCE Q;  2WSE E;  2PUO B;  2QGF B;  2D0N A;  2KBT A;  2XMF A;  4M77 B;  3CBO A;  3G7Z A;  3EGU A;  5HK3 A;  3OYD A;  4F7U B;  3VRZ A;  4A4F A;  3N5B B;  2LMJ A;  2AKK A;  4C5I A;  3ZL7 C;  2HNI A;  3VS0 A;  1YHQ T;  1PRM C;  3MO8 A;  4M4Z A;  4L6V 5;  2M1H A;  3CCS T;  2E64 A;  4PJO C;  1I5L A;  3EG0 A;  1K73 C;  1K8A U;  1N9S A;  1YIJ A;  4NL3 A;  4JUV A;  4MDW A;  5CAI A;  5CKH A;  4C8Q F;  4E7I A;  3OBW A;  1X43 A;  5EC7 A;  1YFN A;  4M7A E;  1N6A A;  1BIB A;  2MPX C;  4M77 G;  1YCY A;  2OTL Q;  4J7I A;  4LDW A;  2DYB A;  4OML A;  5LJ5 g;  4L59 A;  1HXD A;  3EH1 A;  1M3A A;  2J6O A;  2NUZ A;  2LT1 A;  2A36 A;  1M5Q 1;  4EMK C;  2KT8 A;  1M1K U;  1EX4 A;  3E19 A;  1T3L A;  1W6X A;  5M9O A;  1AEY A;  1AWX A;  4CC4 B;  4UC4 A;  4D8D A;  2EQK A;  4KBM B;  1V29 B;  5LJ3 e;  1C6V X;  3NTH A; 
#chains in the Genus database with same CATH homology
 2XG8 D;  1Y71 A;  4JJN K;  3S3N A;  4XQ3 A;  4EMH A;  2VYT A;  3H8Z A;  1M4Z A;  3CBM A;  5A0G A;  3QDR B;  1YJW T;  4M7A D;  4ZGE B;  3CXC S;  1TH7 A;  2CZ0 B;  1ZQ1 A;  2MI6 A;  1D3B B;  1RI0 A;  3M4Y A;  3I55 A;  3CD6 A;  1XNI A;  1W2B A;  4M7D G;  2MWP A;  3QYG B;  3OQ5 A;  1NE8 A;  5FU6 C;  3JB9 H;  2VGM A;  3DLM A;  3OBY A;  3UDC A;  5GAO n;  4M75 F;  1FWZ A;  4YTL A;  2X4X A;  2KDS A;  3I55 T;  5GAO r;  2HAX A;  4M7A G;  4M7D A;  2K5F A;  3M4G A;  5IAY A;  2X4J A;  3TEE A;  2CS7 A;  4ELZ C;  5LJ5 h;  2KVQ G;  2DXT A;  3EAE A;  4XTY A;  2CZ7 B;  2F69 A;  2WSF E;  4C8Q G;  1Y7X A;  2RHU A;  2QQR A;  3QJ6 A;  2MF2 A;  4QQ6 A;  3CCM A;  4LD6 A;  3SDZ A;  2XIC A;  1H64 1;  5J26 A;  2RD1 A;  3RKY A;  4D6W A;  4GY5 A;  3JCM V;  5FRO A;  4C8Q A;  2JN0 A;  3EFS A;  4OF1 A;  1WJS A;  3JB9 F;  3CCM T;  1VQ6 T;  1G3Y A;  3JCM d;  1JJ2 S;  4OB1 B;  3RMQ A;  3MP8 A;  5DM7 R;  2XKO C;  3FJP A;  4A53 A;  2E70 A;  3PMT A;  3C95 A;  4P5N A;  2DJZ A;  4BUG A;  3KBG A;  3X20 B;  1S72 A;  4O6J A;  1Q7Y C;  1R8O B;  1K73 U;  3HKS A;  2IG0 A;  4C92 B;  3FRN A;  4J8O A;  4KUI A;  1H3Z A;  2JVV A;  4L5G A;  3VUZ A;  4IUV A;  2X4W A;  3LWH A;  4M78 F;  5KE3 A;  1WGS A;  4HT8 A;  1D3B A;  3DKM A;  3J7A F;  3QZ9 B;  2BIV A;  5GMK e;  1KQS A;  3X24 B;  3GPL A;  4BDY A;  2VXE A;  3FDR A;  3UWN A;  4A4E A;  3T9N A;  4ZTF A;  4LDU A;  5FU7 C;  1N27 A;  2GFU A;  2KY9 A;  4ELY C;  3FEO A;  3OMC A;  3PT9 A;  5I21 A;  3DLL A;  2JZ2 A;  3ZFJ A;  1YJW A;  4BE1 A;  4RKU E;  1JBM A;  2DIQ A;  5C6S A;  2XD0 A;  2DXU A;  1P92 A;  5CCA A;  3E9G A;  1Q81 C;  4MZM A;  4BB7 A;  5GAM e;  5CKD A;  4C92 D;  4IUP A;  3F70 A;  1YJ9 A;  1Q82 C;  1M8V A;  3OS0 A;  3CCE A;  2OTJ A;  4HA8 A;  3RMS A;  3OYE A;  2O01 E;  2F5T X;  3A8M B;  3DB4 A;  3JCM W;  4M75 G;  5CK9 A;  1YJ9 T;  1IRE B;  4HCC A;  1YHQ A;  1QVP A;  5D6X A;  3OW2 S;  3CCE T;  2OTJ T;  3CXC A;  2HQX A;  3KUF A;  3J81 E;  3CCS A;  1WQW A;  2YLC A;  4B9X A;  2MMP A;  4M75 A;  4II1 A;  3CBP A;  1N9R A;  1YIT A;  2R57 A;  1VQ4 T;  1I4K 1;  3TRE A;  2LX9 A;  3RES A;  3MEW A;  4ZTJ A;  1AHJ B;  4J5Y A;  4JS4 A;  5A2Q E;  2RA2 A;  4Y91 A;  3HRS A;  3JB9 G;  3RKX A;  3JCM h;  3G6E A;  3V7S A;  3M53 A;  2YRV A;  5CIU A;  3VUB A;  2VUB A;  3OYY A;  2XU8 A;  3V8J A;  2RI5 A;  3L42 A;  5CQX A;  5LJ3 j;  5GAN 7;  2DD4 A;  1NPR A;  2DKG A;  4EPC A;  4HKE A;  3LX7 A;  2PVG B;  1VQN T;  4DQ2 A;  5GAO l;  4FL6 A;  1U8R A;  2XDP A;  4RG8 A;  2RHX A;  2E12 A;  2DPP B;  4E7L A;  1IZ6 A;  3H6Z A;  2MWO A;  4OGC A;  2M9U A;  4MDX A;  3TU4 K;  3QZ5 B;  4VUB A;  2QEX T;  2KAF A;  4M78 G;  3L2V A;  2JTM A;  3JCM X;  2E41 A;  3A5Z B;  4EMK A;  3PIO A;  4R56 A;  4FSX A;  4M78 A;  1OZ2 A;  5CVI A;  2OTL A;  3OYK A;  2K4Y A;  4C8Q B;  3HL8 A;  2QQS A;  3ZBD A;  1VIE A;  2XDD A;  2L89 A;  1UGS B;  3ASK A;  3URG A;  4OB0 B;  4OMF B;  4ZGJ B;  3VKI A;  5KCH A;  5I2M A;  2LT4 A;  3FB9 A;  2PVO B;  3WXM B;  5HKC A;  4RG2 A;  2OTL T;  2K3X A;  2L3R A;  1Q7Y U;  4MZT A;  4QQG A;  2K57 A;  1VQ5 A;  3UT1 A;  1VQM T;  4A54 A;  1UEB A;  1VQO A;  1KD1 C;  2EAY A;  2PVD B;  3CC4 A;  5D6Y A;  2DZ9 A;  2VGN A;  4OB2 B;  4M7D D;  1VQ5 T;  5GAN 2;  2KMT A;  5CR2 A;  4QVC A;  1NJI C;  2FB7 A;  4BY6 C;  1VQO T;  3AHU A;  1WJQ A;  2JTF A;  4M77 C;  4N0A A;  2E6Z A;  3WVD B;  4EMG A;  5GAN e;  2ZPH B;  3CC4 T;  3L2U A;  4ZN1 A;  5FLX E;  2ZGW A;  4RCB A;  1QW1 A;  3G4S A;  2DK3 A;  3LYI A;  4C8Q D;  1FXX A;  1OYX A;  3NFC A;  4C5G A;  3OYA A;  3HFN A;  3M55 A;  3G4S T;  3OY9 A;  4LDX A;  3RER A;  4NS5 A;  3X28 B;  5AYF A;  2GCX A;  4PJO F;  4CRI A;  5GMK j;  4JS5 A;  3LW5 E;  3ME9 A;  1Q81 U;  2WSC E;  2M16 A;  3V8K A;  1O9S A;  1Q82 U;  2KQW A;  5J3B A;  3OYJ A;  3V7R A;  2EJ9 A;  4FU6 A;  1VQ6 A;  1M1F A;  1XQH A;  3S3O A;  4Z02 A;  4JRI A;  3JSC A;  2K2V A;  3QG1 A;  4N4G A;  2X35 A;  2L8D A;  4M75 E;  4X9D A;  4XTU A;  3CCQ A;  1VQK A;  1QP2 A;  2RK1 A;  5LJ3 f;  4PJO E;  1ZHI A;  5GAM j;  4IUR A;  3HRT A;  3CCQ T;  1VQK T;  1BI3 A;  3ER0 A;  3MEV A;  4XAX B;  3JB9 I;  3E9F A;  4O5V A;  1PSF A;  4M75 B;  4XU2 A;  5GAN f;  4C0D C;  2E5Q A;  4M7D C;  2ZPI B;  4JLG A;  3OYB A;  4ATO A;  3QJY A;  4PJO B;  2EQU A;  5A0L A;  3OYG A;  1BYM A;  4C5H A;  2FYK A;  1KG1 A;  1XOV A;  2K5I A;  2KK4 A;  4C0G A;  2ZZD A;  1UGR B;  3QUI A;  3HP9 A;  3WVE B;  4M7A C;  1FX7 A;  4A4G A;  2RK2 A;  5DLO A;  5LJ5 e;  4HCB A;  3O8V A;  3GNG A;  3L2Z A;  3HHT B;  2A7Y A;  3DB3 A;  2O4X A;  3Q1J A;  1G3S A;  4Q5W A;  5CO7 A;  3PMI A;  3CCR A;  5GAN 8;  1OI1 A;  1Y96 A;  3M56 A;  2C06 A;  3VJP A;  2RHY A;  4N4I A;  1BKB A;  4MZP A;  3CCR T;  2DEQ A;  5LJ3 d;  3SWN B;  2YLB A;  3OSV A;  3S6W A;  4ZGD B;  4DOW A;  4M78 E;  3OYF A;  4M75 D;  1U1S A;  2V8I A;  4N4H A;  3JAM E;  4BI4 A;  2DIG A;  3JCM J;  2ZCF B;  3GOX A;  3RUX A;  2HBP A;  3FC3 A;  1B34 A;  1O75 A;  2DAQ A;  2QQA A;  3X26 B;  2YHT A;  2A3L A;  5IN1 A;  4F7U F;  4EMK B;  2ZPB B;  2FL7 A;  2ZPE B;  2RI2 A;  4M78 B;  3INZ A;  3OSS C;  3HRU A;  3QBY A;  4JLI A;  5GAO p;  2HQE A;  2G3R A;  3VV0 A;  4PJO G;  3CCJ A;  2QQ9 A;  1VIF A;  1VQ4 A;  5LJ3 g;  1VQP A;  4QVZ A;  3OYI A;  2R5M A;  4GLK A;  1RL2 A;  3JB9 D;  2M0O A;  1VQ8 A;  4E7K A;  1KD1 U;  4WF2 A;  4XTX A;  5CKF A;  4PJO A;  5LJ5 f;  2V8J A;  4XTW A;  3E1S A;  5KH6 A;  2P4T A;  2QTX A;  3CCJ T;  5GAN g;  5I2S A;  1VQP T;  1KQ1 A;  4C0Z A;  1NJI U;  1VQ8 T;  1QP3 A;  3A8O B;  4PKC C;  3SD4 A;  3JRZ A;  3OB9 A;  2I2L A;  3P8H A;  3OYC A;  1BIA A;  1KHC A;  1W2B S;  2F5K A;  3BW1 A;  5FRM A;  4QW2 A;  4J6Y A;  5GAN 5;  3C94 A;  1VQN A;  2XHC A;  3C4S A;  4JRP A;  3GP8 A;  5HK0 A;  3JCM b;  3L2W A;  2XK0 A;  2QXF A;  2JOY A;  2RHI A;  1EIF A;  4X9C A;  3VYG A;  2PU9 B;  1U1T A;  4M78 D;  4XU0 A;  5FU6 B;  4LD9 K;  1XTD A;  3CMA A;  4KUL A;  3PIP A;  3MET A;  5GAM f;  2QEX A;  3SWN A;  3GNF B;  2RB6 A;  1BI1 A;  2H3J A;  1WQ7 A;  1OZ3 A;  3LH0 A;  3G71 A;  4DA4 A;  5GAN j;  1JJ2 A;  1I8F A;  4TVR A;  2D6F A;  2CGH A;  1NPP A;  3CMA T;  4FIB A;  2XID A;  4C92 C;  2DD5 A;  3A8G B;  4XTZ A;  3V8L A;  3MEU A;  4OVA A;  5DLQ E;  3G71 T;  3PNW C;  3CME A;  3JCM P;  2RI3 A;  4QVD A;  1KC8 C;  3C12 A;  2P0P A;  4BD3 A;  1M1G A;  2DVE A;  2EJF A;  2EQM A;  3NTK A;  4J6X A;  3EFR A;  3CME T;  1M90 C;  1YIJ T;  3A8L B;  3OYH A;  2LQ8 A;  5LJ3 h;  1YBY A;  1VQM A;  2LRQ A;  5CKE A;  3JCM e;  1WJR A;  2RJF A;  4A4H A;  3CC2 A;  2PQW A;  3M59 A;  2XDB A;  2B8A A;  5GAN 6;  5GMK m;  3OS1 A;  4BE2 A;  3SFM A;  2LVM A;  4KUD K;  4PJO D;  4OB3 B;  1YJN A;  3M9Q A;  3MP6 A;  1NZ9 A;  1K9M C;  1LNX A;  2LCC A;  1ZBX A;  2GFA A;  3MP1 A;  5GAM d;  2DO3 A;  2OAU A;  4F7U G;  3CC2 T;  5DY9 A;  4M77 A;  4BI3 A;  2E10 A;  1YJN T;  3CPW S;  1MHN A;  5KCO A;  2QA4 A;  4F7U A;  5KE2 A;  2EFI A;  4HCZ A;  4BE0 A;  1LOJ A;  4J6W A;  4C5E A;  2RM4 A;  4NL2 A;  4XU1 A;  4IUQ A;  4J83 A;  3ZEH A;  1QVG S;  4C0F A;  4PLL A;  1QVF S;  2O4X B;  5FU7 B;  2QA4 T;  1I81 A;  2RJD A;  2WAC A;  5LL6 S;  1Y96 B;  1VUB A;  2BKD N;  4JDS A;  5LJ5 j;  2DXC A;  4CI0 C;  1HK9 A;  5GAM g;  3L2Q A;  3OW2 A;  2MAM A;  1PSE A;  3CCU A;  3M5A A;  4ME7 A;  3P8D A;  3HSB A;  5CQY A;  3JB9 J;  2KSS A;  3CC7 A;  3CCV A;  2DZC A;  3VYH B;  4DOV A;  4BI8 B;  3QKJ A;  3JCM Q;  2V8K A;  4XU3 A;  3JCM c;  3CCU T;  3JCM f;  3GF5 A;  3CCV T;  1B34 B;  1K8A C;  3CC7 T;  1N8R C;  1Q86 C;  2XI9 A;  2EWN A;  2GF7 A;  1LJO A;  1SSF A;  2LQK A;  4N0A C;  3S3M A;  3M54 A;  1WPY A;  4OGE A;  5GMK l;  4RMO A;  3I56 A;  2K3Y A;  4BDZ A;  2VC8 A;  2CZ1 B;  1BI2 A;  3A8H B;  3FLG A;  3QO3 A;  4Y28 E;  5D6W A;  3OS2 A;  3CD6 T;  2D0Q B;  3GLX A;  1VQ7 A;  3FIF A;  2LTO A;  3I56 T;  4C92 F;  1KHI A;  5IT9 E;  5GMK h;  2FVU A;  4OP0 A;  3X25 B;  2ZPG B;  4M7A A;  3V7C A;  1VQ7 T;  2CKK A;  1DJ7 B;  3QHS A;  3BDU A;  1X6O A;  3M57 A;  2RJE A;  3BY7 A;  5L8R E;  2AHJ B;  3KXT A;  1VQL A;  3P8B B;  5CKB A;  3NTI A;  3CCL A;  2HD0 A;  4C8Q C;  1G5V A;  2FHD A;  1VQL T;  4BAC A;  3QSU A;  1MGQ A;  4NOY A;  4C92 E;  4ZN3 A;  5C0M A;  1M1K C;  3M58 A;  5A0D A;  4PLI A;  3L1A A;  2JUF A;  5GAM h;  2DTI A;  3PFS A;  3CCL T;  4J7F A;  2QDY B;  4MML A;  4JRQ A;  3L2R A;  2RH2 A;  3RKW A;  3QYH B;  3UPU A;  1KC8 U;  3QPH A;  2R58 A;  4IKF A;  1M9S A;  3CPF A;  2EYQ A;  1JB0 E;  2CZ6 B;  4M77 F;  5GAN d;  1X75 C;  3QII A;  1S72 T;  4V2S A;  3LLR A;  3OYN A;  3OYL A;  3PTA A;  1G3W A;  1BI0 A;  1M90 U;  2R5A A;  3JCM g;  2IVW A;  3CPW A;  1YI2 A;  1X01 A;  1WNL A;  4FM4 B;  4RCC A;  2GQV A;  2K5L A;  2DXB A;  4MMK A;  1QVG A;  4E7H A;  1YI2 T;  5FRN A;  3LGF A;  2Y4X A;  2RO0 A;  1UB4 A;  1K9M U;  4M77 E;  1QVF A;  2WSE E;  3OS5 A;  2PUO B;  3HPW A;  4LDY A;  4EDU A;  5GMK i;  2EJG A;  4X34 A;  5GAO m;  4F7U E;  4LDV A;  2PUK B;  4PL6 A;  4BY6 B;  2P0Q A;  2RHZ A;  3BDL A;  4M77 B;  2EIF A;  3CBO A;  3G7Z A;  3TCJ A;  2Y90 A;  4FT2 A;  4B9W A;  4PNO A;  5J39 A;  5HK3 A;  3OYM A;  3OYD A;  4F7U B;  4R55 A;  4A4F A;  5EG2 A;  5GAN 4;  3N5B B;  4C5I A;  3LWI A;  2E1H A;  1JRI A;  2LNV A;  4C92 G;  3OA6 A;  2HNI A;  4QQD A;  1Y07 A;  4IUT A;  4E47 A;  1YHQ T;  4M7D F;  2DTO A;  3MO8 A;  4M75 C;  4HT9 A;  4IUU A;  3MEA A;  4C92 A;  2LC4 A;  4L6V 5;  2M1H A;  1G3T A;  3CCS T;  1VQ9 A;  2E64 A;  4PJO C;  4M7A F;  1YIT T;  2ZPF B;  1I5L A;  3VU3 C;  3OMG A;  1K73 C;  1K8A U;  1N9S A;  5LJ5 d;  4NL3 A;  1YIJ A;  2CYZ B;  2LCL A;  3SB2 A;  1Q86 U;  4JUV A;  4MDW A;  1VQ9 T;  1N8R U;  5CAI A;  5CKH A;  3J80 E;  2DTH A;  2P0K A;  4C8Q F;  4M77 D;  2L5Q A;  1KQ2 A;  4M7D E;  3G6E T;  2EKO A;  4E7I A;  3OBW A;  3R6O A;  2EQJ A;  4E7J A;  2JNG A;  2NLU A;  3BFM A;  4M7A E;  1N6A A;  2BUD A;  1UGP B;  5GAN 3;  3MCA B;  2E65 A;  4XTV A;  5GAN h;  1BIB A;  4M77 G;  1YCY A;  3SWN C;  4KT0 E;  5HY6 A;  4C0D B;  4M7D B;  2VV5 A;  4J7I A;  4LDW A;  4A4K A;  5LJ5 g;  4C8Q E;  3HFO A;  4L59 A;  1HXD A;  4M7A B;  1KQS S;  2E6N A;  2X4Y A;  2LT1 A;  3GIB A;  3MHX A;  1W4S A;  2D9T A;  1M5Q 1;  4JRK A;  4EMK C;  3QXE B;  5GAO q;  2VXF A;  3E19 A;  4M78 C;  1M1K U;  3CEY A;  4FT4 A;  5M9O A;  2QI2 A;  1UGQ B;  2RJC A;  4XK8 E;  4UC4 A;  3PGG A;  2EQK A;  3LGL A;  4KBM B;  1V29 B;  2LDM A;  2QQB A;  3RIR A;  1GXI E;  5LJ3 e;  3NTH A;  2Y4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...