4C92E

Crystal structure of the yeast lsm1-7 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
84
structure length
84
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92E00
2E64A 1LNXA 5GAN8 5GAN2 3JCMg 4C8QE 5GAN7 2DEQA 2RM4A 4M75E 4RCBA 3JCMX 4M78D 3AHUA 4M7DC 4V2SA 1X01A 4Y91A 4J6XA 5GAMf 3INZA 1I5LA 3JB9H 2E41A 4F7UE 3SWNC 4M7DE 4M78G 4M78B 4C8QF 4EMKA 5CAIA 4M75F 2VXFA 2DJZA 2E65A 3FB9A 4M77F 4C92C 2ZGWA 5GAMg 5GAOn 4M7AD 2YHTA 4F7UF 1LJOA 4M7DF 5LJ5h 1WQWA 1YCYA 4C92E 5GAN5 2DVEA 5GAOl 4PJOC 4M7AG 3V7SA 4EMGA 4C8QA 1KQ1A 1BIBA 4M75A 3V8LA 1HXDA 2DZCA 4PJOE 3JCMJ 4XTYA 2DTHA 3PGGA 3RKYA 4C92F 3JCMf 3QSUA 1WPYA 2FB7A 4F7UA 1D3BB 3JCMV 4M7DA 3FJPA 3HFOA 4J5YA 2I2LA 3BFMA 4DQ2A 2DXTA 2DKGA 1B34B 5LJ3e 3SWNA 4JRKA 1KQ2A 1WNLA 3BW1A 2Y90A 1I81A 5LJ5f 3RERA 4EMKB 4C92A 5LJ3j 4HA8A 5GMKl 1TH7A 2DTIA 4XTXA 5GAOm 2CGHA 3QHSA 4J6WA 5LJ3d 5GANe 4C8QD 4PJOA 5LJ5g 3L2ZA 3JB9F 4M75D 4X9DA 4A53A 4M78C 4J6YA 4M77D 4PNOA 4RCCA 4C8QG 5GANj 1MGQA 4M75G 4M7DD 5GAOp 4M77G 4M77B 4M7AB 5GANd 1M8VA 4XU0A 2K57A 4F7UG 4QVDA 4XTVA 4M7DG 1HK9A 5GMKi 3QUIA 3BDUA 4NL3A 2E1HA 4C92D 3JCMe 2JN0A 5GMKm 2DZ9A 3SWNB 2FYKA 5GMKe 1Y96A 1WQ7A 4PJOF 4XU3A 4C92G 1JRIA 4MMKA 5GAN3 4WF2A 5DY9A 4A54A 5GMKj 4XU2A 4XU1A 3JCMd 2RB6A 3EFSA 5GAMe 4OP0A 2YLBA 4JRIA 4EMKC 1BIAA 5GAMj 3HFNA 4X9CA 3JCMQ 3JB9D 1H641 5GANh 4QVCA 4HT8A 3JCMc 3VU3C 3EFRA 4C8QB 4JUVA 2VC8A 5GAMd 4M75B 2E10A 3JB9G 2EJFA 4M78E 3M4GA 2EAYA 2RD1A 5GAN4 3HSBA 4HT9A 3JB9J 5I21A 4F7UB 4XTWA 2EJ9A 4M7DB 4M77C 4M7AC 1LOJA 1D3BA 4N0AC 1Y96B 3RESA 2EWNA 3JCMb 4M78F 2DTOA 3V7RA 3RKWA 1B34A 4M77E 5GAOq 3V7CA 3V8JA 5LJ3g 1I8FA 4M7AE 1M5Q1 3JCMh 4C92B 4PJOD 4XQ3A 3SB2A 3RUXA 5GANf 3BY7A 1JBMA 5GMKh 3JCMW 3L1AA 2DXUA 2RA2A 5LJ3h 4EMHA 5LJ5e 2QTXA 4PJOG 4M7AF 4M78A 1N9SA 4PJOB 3FIFA 5GANg 3GIBA 4NL2A 5GAOr 5LJ5j 5GAMh 3RIRA 1N9RA 3JB9I 2HNIA 1U1SA 1U1TA 3V8KA 5LJ5d 4MMLA 2VXEA 5GAN6 4XTUA 4M77A 4M7AA 2EJGA 3JCMP 4N0AA 4JLIA 3RKXA 2YLCA 4C8QC 4XTZA 3QO3A 4M75C 4NOYA 5LJ3f 1I4K1
chains in the Genus database with same CATH superfamily
2E64A 1LVKA 4J8OA 1E7OA 3EG9A 5GAMf 1JQQA 1QVFS 2MK5A 4M75F 3OYYA 3WXMB 1VOMA 5IN1A 2EGEA 3LH5A 1FMVA 4FL6A 3S3NA 2XDBA 4Q5WA 3JCMf 1UGRB 2FB7A 1YJNQ 3A5ZB 4C0DC 1B34B 1NBEB 3OYFA 2RHIA 5C6SA 3QJYA 1I81A 1I1JA 3QXEB 5CKHA 3CMEQ 5GAOm 1JJ2A 1QCOA 3OY9A 4NS5A 4M75D 2KRMA 4BY6B 1PG5B 3H8ZA 4M75G 2CDTA 2GTJA 2RJEA 2OJ2A 2ZPGB 2FEIA 4JZ4A 1QP3A 1YHQQ 2DZ9A 1PRMC 2QG9B 2YUQA 1HJDA 1M90R 4KRTA 2NWMA 1JRIA 7AT1B 1YJNA 1YJWT 1IO6A 2L0AA 3I56Q 3UWNA 2HQHA 3CCEQ 4FSSA 3QG1A 3CMEA 1A0NB 5GANh 4C8QB 2KEAA 3A8OB 2DETA 4FU6A 4HT9A 4KT0E 5LL6S 4F7UB 2RMOA 3MEWA 4ELYC 1D3BA 1H8KA 2EIFA 1SEMA 3KUFA 1QVFP 1M5Q1 3FLGA 3QYGB 1KD1R 1AVZC 2X35A 1VYTA 4ZN1A 2BUDA 3DB3A 4BACA 5A0DA 2CT3A 2HSEB 5LJ5j 5GAMh 3OYKA 5KYWB 2CP6A 3I56A 1NEGA 3A1PA 1B3QA 2RJCA 3OYLA 3P8HA 2EVRA 2D8HA 1LNXA 3TQ7P 3JCMg 2XU8A 2DEQA 1W2BA 1AEYA 2E70A 2CYZB 1VQ7T 1S1NA 2E41A 4BB7A 1KHCA 3CCQT 2VXFA 1WIEA 2DYIA 3LW5E 1TUGB 2HSPA 1WQWA 4L5GA 2DVEA 4QQGA 3V7SA 2D0QB 4LE9A 1YFNA 2J06A 1Q86U 1NLPC 2BZXA 2DL7A 2L5QA 2HD0A 4J7FA 3H0HA 2KVQG 3M55A 4HA8A 1Q81U 2CGHA 1JO8A 2KRNA 5IXBA 3LWHA 5IH2A 4Z88A 1YWPA 3I5RA 1OZ2A 1DJ7B 2KROA 1MGQA 4M77B 1G8XA 1OYXA 3BDUA 4FIBA 3T9NA 2HQEA 1WXUA 3M53A 1XTDA 4EIKA 3M4YA 5FROA 1GBQA 2QQRA 1YJ9T 2YWWA 1Z9QA 3VRYA 3HTRA 3TSWA 4HT8A 1JXMA 2EYYA 4PFZA 1W70A 4M75B 4E7ZA 1OU9A 2A08A 1VQ7Q 2KSSA 3CCQQ 4FM4B 3RESA 4M78F 2X9HA 3EGXA 2DTOA 2BE7D 4BD3A 4AFSC 3G7ZA 3OYCA 1QMCA 1EIFA 5CKBA 4F04B 2A36A 2XICA 1G5VA 1QVGS 2IPOB 2QGFB 2PNIA 3ME9A 2VXEA 3WVEB 1FMWA 2AK5A 4N0AA 4C0DB 2YLCA 2COYA 4IIMA 4NOYA 3EG2A 1XNIA 5LJ3f 4RTTA 4ME7A 2RHYA 1VQ7A 4M78D 5KCHA 3G1JA 4ZTJA 3CCQA 2C0TA 1GFCA 1ZHIA 4RTXA 3UATA 4A4EA 4M78G 1ACMB 4C0ZA 3KBGA 2QK0A 2OAWA 3OYEA 1U5SA 1YBYA 2ZPHB 1V29B 4PJOC 1KQ1A 2DBKA 1SHGA 1WYXA 4CRIA 1M90C 3CD6T 2X3WD 4E2FB 1RLPC 3SWNA 2FRWA 1W2BP 2JMCA 2DRKA 3VV0A 1TH7A 4J6WA 5CKDA 3OYBA 3L2ZA 1NJIU 5HY6A 2VVKA 2QEXT 2DILA 1GCQA 1B7TA 1UGVA 2DJQA 2ED1A 3LGLA 1AD5A 1KQSP 2ESWA 4QQDA 3M0SA 1KD1C 1MMGA 3L2RA 1TWBA 1ZUYA 2KI7A 2RQRA 1QVGP 3CBMA 3JCMd 4RG2A 3F70A 2O9VA 2CP5A 1WHMA 4OMOA 3GNFB 1ZSGA 2DBMA 2X3XD 4Y28E 3CPFA 4EPCA 2L89A 2QQAA 3JRZA 3EGUA 2QQSA 2ZCFB 1B34A 1VQOQ 2YUPA 5LJ3g 1HYOA 1QWEA 2RHXA 1JBMA 1X6GA 5LJ3h 2BTTA 5LJ5e 2J05A 5CVIA 5GJVB 2LJ3A 3UT1A 1U3OA 1U1TA 1BI0A 1M2VB 2LT4A 3VS4A 3I55T 2VGNA 1RI9A 4AFUC 1BK2A 3QO3A 1D09B 1K8AU 2CP0A 2HBPA 2IIMA 3C95A 5KYYB 2E3IA 1M8MA 2QEXQ 4KUDK 3VS3A 3E2UA 1QVPA 4M7DE 3PNWC 3VKIA 1NYFA 1VQOA 3NGPA 1H3HA 3LWIA 1TG0A 4C92E 1K9MR 1MHNA 2EW3A 4C8QA 3CPWS 4CC2A 3X26B 1BB9A 3V8LA 3MCAB 5L8RE 4F7UA 1Q7YU 1IGUA 2PVGB 1AZGB 4HCBA 1Q82C 3E19A 1R77A 1AWWA 3CEYA 1UJ0A 3WVDB 2L2PA 1NPPA 4RCCA 5CQXA 3DLMA 5KYWA 1YN8A 3ASKA 3MP1A 5IAYA 1SRLA 2LQWA 4QVDA 1KG1A 3EGDB 2CSQA 5J26A 5KE2A 4BDZA 1BI1A 2D1XA 2J6OA 4HKEA 1VQKQ 2B86A 4AMCA 4JS4A 2H3EB 2DO3A 2F2WA 5DY9A 3VS0A 1YI2A 1PNJA 3CC4Q 2QYZA 1W4SA 3OQ5A 3I55Q 1GBRA 4EMKC 3OB9A 3OYGA 3OA6A 3I9QA 2MWOA 2RF0A 2EJFA 3CC2T 4LDXA 4E6RA 2RHZA 2NYSA 1WHKA 2G3RA 4WTOB 2L3SA 4M7AE 3V7CA 3V8JA 3HKSA 3SB2A 1VQKA 1C6VX 3BY7A 4RTZA 4PJOB 1VQ9Q 2CT4A 3CC4A 1RAEB 2DLPA 4F17A 1Y7XA 4YTLA 4OB2B 2KQWA 2JM8A 1U06A 3QZ5B 3I55A 2K3YA 4MMLA 1O75A 4M77A 1VQLT 4JLIA 2EFIA 4XTZA 2BZ8A 1IGQA 3OS5A 5D6WA 1N8RC 2DMOA 5D6YA 4KGVB 3JB9H 4DA4A 2HL3A 4II1A 2A28A 3CBOA 3RMSA 3CMAT 1M3BA 1YCYA 2GNCA 1VQ9A 2M9UA 2LT1A 3CCLQ 4M75A 2HQXA 8AT1B 1ZA1B 4J7IA 2YUOA 2O4XB 2ZPFB 1BBZA 4ORZA 5LJ5f 4IUVA 1M4ZA 2RJDA 3M59A 5LJ3d 3TVTA 1WDXA 4PK4A 3M0PA 1UGQB 2M16A 1D1BA 2YDLA 5IHNA 1LCKA 2J7IA 2K3BA 3QUIA 3CCLA 3PTAA 3VUZA 1ZSZC 5GAN3 2BKDN 4WCIA 2RB6A 4AG2C 4DBFA 2X4XA 4F14A 2GFUA 4BUGA 4D6WA 4OF1A 4ELZC 3VU3C 2EQKA 3M0UA 3HSBA 2RK2A 2EAYA 1GL5A 2XDDA 1I07A 4QQ6A 1UUEA 2D0NA 1CKAA 1QVFA 1YITT 1LPLA 2VASA 2Y4XA 1VYVA 2JW4A 3DKMA 2FPDA 3REBB 3EAEA 1YJNT 2AHJB 2JTEA 3QIIA 2HL5C 2JS0A 2QDLA 5IHKA 1K9MC 3QDFA 1AHJB 1PD1A 1KC8U 3CMET 2QGGA 4PLLA 4RTVA 3H9NA 3CCVT 4KUIA 1WA7A 4GBQA 3LYIA 2CZ7B 3AHUA 3PIOA 4J6XA 3OSVA 1H3ZA 2MWPA 3OS1A 4M77F 2Y4YA 4E7HA 2LDMA 1BI2A 2ATCB 2PUKB 5LJ5h 3H6ZA 3E1SA 4PJMA 3JCMV 3VRZA 2HEQA 2DL8A 1D0YA 3BW1A 2Y90A 4C5IA 4EMKB 2M0YA 1D1CA 2DTIA 2K2MA 3QHSA 4ZGJB 1Q95G 1NEBA 2LX9A 4M77D 4PNOA 2E5KA 3LH0A 2F2XA 2PVDB 4HCKA 5A0GA 4M77G 1M2VA 4L6V5 3X28B 1YITQ 3CXCS 2DM1A 2CZ1B 5FLXE 5KYYA 4RKUE 3I5SA 4DEXA 3RR6A 4E7LA 3QDRB 4QT7A 3CCVQ 1NPRA 1K76A 2LNHB 4L59A 1JB0E 1OX9A 2MMPA 2JZ2A 1T0JA 2HDAA 2E10A 4AG1C 2EJ9A 3L2UA 1M1GA 3LLRA 1OOTA 1YITA 1K1ZA 2ROLA 2HBWA 3SEMA 5HK3A 5KYXA 2DYBA 3KFVA 1K73R 4M78A 1WFWA 5GANg 3EG3A 1WXTA 1KK7A 1MNEA 2EYWA 4OMQA 5GAN6 3CCVA 2BIVA 2EJGA 2W10A 2K7AA 4D8KA 3GP8A 2D6FA 1NE8A 3D7SB 2IVWA 1GFDA 4RCBA 4CI0C 3QWXX 3CCSQ 5GAMg 3OYDA 5DM7R 1EZZB 2CUDA 2RQUA 3CXCP 3HRSA 1X6OA 1ZSZB 2QDYB 4XTYA 3RKYA 2OTLQ 4F16A 4DQ2A 4LDVA 2HAXA 4JJCA 1RUWA 2COZA 2K5FA 3GNGA 2XIDA 5GMKl 4A4HA 4O6JA 2WSFE 5AT1B 1MMAA 2ENMA 2COWA 4PJOA 4X9DA 3CCMT 4J6YA 5AYFA 4RTUA 3J80E 3CCSA 1SRMA 2J6FA 4PFOA 2CZ6B 4ZN3A 5FW9A 4JRQA 2DVJA 3EHQA 1KQSA 1N27A 1T3SA 2LJ1A 2B8AA 2OTLA 1VQ6Q 1QVGA 1BYMA 2EGCA 4KH1B 4OP0A 4Z89A 3META 2HKQB 2CUBA 2KRSA 3OMCA 3HFNA 4X9CA 3OW2S 2DD5A 3EFRA 1PKTA 2V8KA 5FU7C 2DL5A 2LCCA 1SHFA 1Y96B 3M9QA 3PMIA 3JCMb 2O4XA 3S3OA 5HKCA 1TXQA 2QASA 4OMNA 3CCJQ 3RUXA 1RLQC 3JCMW 3L1AA 5C0MA 4VUBA 1Q82R 2FPFA 1VQ6A 2W0ZA 5GAOr 2F5TX 2JM9A 2AZVA 2JS2A 4X34A 2LP5A 1HD3A 4OGCA 2GQVA 3JCMP 3NPFA 3RKXA 4DOVA 2NUPA 5FU6C 3S6WA 3OYIA 1OPKA 4C8QE 1NG2A 2LMJA 1NM7A 3CCMQ 2PVOB 3INZA 2LX7A 4F7UE 2A0FB 3U23A 4CC4B 3CCJA 1MV0B 2K5IA 5DLQE 2M51A 3MKDA 1OV3A 1Y07A 1KIKA 1RAAB 2A7YA 5ECAA 1TS9A 3FJPA 1MUZA 2P4TA 4ZTFA 3JV3A 2Z0WA 2K4YA 3OSSC 1UGPB 3RERA 1M1KR 3GLXA 4J9BA 4RUGA 2DXCA 2HCKA 3CCMA 1VQOT 1VIFA 4FSXA 2A37A 3OBYA 4A4FA 5KH6A 5GANd 5GAOp 5DLOA 1M8VA 1E6GA 2XD0A 1VQ8Q 2MPXC 4A4GA 4KGXB 2K6DA 4HCZA 4PJOF 3OYHA 3FRNA 2YRCA 1RACB 4XU3A 1K73C 1G83A 1PCXA 1N8RR 3ZBDA 1BIAA 2RN8A 1XOVA 5GAMd 4LUEA 1QCNA 1YCSB 3GOXA 1TU0B 4M77E 1I8FA 5J3BA 1VQ8A 4LNPA 1PSEA 4PJOD 1N6AA 2CP2A 3NTHA 1RAFB 4EMHA 2QTXA 4PJOG 1ARKA 1YI2T 1F1BB 2VB6A 3EH1A 1SF9A 4CC7A 3SDZA 1JU5C 3TCJA 1U1SA 3SFMA 1CKBA 3CQTA 2E3HA 2DIGA 3J7AF 3NTKA 2EQIA 3GPLA 3S3MA 5GAN7 1KSWA 2DXBA 4M75E 3TU4K 2OTJQ 3M58A 4N4GA 5FWCA 2JT4A 4UC4A 2X51A 4Z8AA 1VQKT 1UJYA 4RTWA 3OBWA 1R8OB 1MMNA 4LXCA 3VS5A 3CC4T 4LD6A 3JCMJ 2DTHA 1UDLA 2M0OA 1X75C 1QQJA 3EG9B 1QWFA 1C0MA 2KYMA 4B6MA 5CR2A 2OTJA 1RL2A 5IHIA 4RG8A 2SEMA 1ZBXA 5FU7B 1UG1A 1WJRA 2EQMA 1Z9ZA 1ZQ1A 3URGA 1V1CA 1VQ9T 4JS5A 3C94A 1PKSA 5A0LA 1YI2Q 2GGRA 3FJ5A 4MMKA 3M54A 5GMKj 4J83A 4OB0B 2FZCB 1IRXA 4JRIA 3QBYA 4LD9K 2QAZA 5FU6B 2DRMA 2FZKB 1Q81R 1RAIB 2CP7A 3MO8A 4JRPA 2RI2A 1ZSZA 2P84A 4LDUA 4BI4A 2PUOB 1VIEA 3HRUA 3CCLT 2FG0A 2KMTA 1AZEA 2RJFA 4XQ3A 4FYXB 2EYZA 3GF5A 4TVRA 1PRLC 2K9GA 3C0CA 1WHGA 1N9SA 2RNAA 3FIFA 2X4WA 3MEVA 1BU1A 4EDUA 3RIRA 1X2KA 2LQNA 4Y92A 2ZAEA 4J9FA 1GCQC 2V8JA 3VS6A 1I4K1 2JXBA 4HVVA 5GAN8 1M1KC 2LQ8A 2CH4W 2JNGA 5I2MA 1D1AA 3VS2A 1BCOA 3MJXA 1BCMA 2LCLA 3JSCA 5FWBA 1IHWA 4M4ZA 3CPWP 1PHTA 1M90U 2RPNA 4BE1A 1UE9A 2H8HA 3PVLA 3OYNA 1TTHB 2XMFA 3PIPA 4BDYA 2ZZDA 2EGAA 1TOVA 2VKNA 1X69A 5LJ3j 1WLPB 2VYTA 2AT1B 4XTXA 3OYMA 4OGEA 2DERA 1FXXA 2FL7A 2XK0A 2E4HA 1AWJA 2KXCA 3RDVA 3C12A 1KD1U 3CBPA 3M0TA 2DPPB 1PC0A 4JDSA 3JCMe 2JN0A 2AIRB 2FYKA 1BI3A 2VGMA 3TREA 1AOJA 3M0RA 2RI5A 1WJQA 2YT6A 4FYYB 3M57A 3G71Q 3CCUQ 3G6EQ 4JZ3A 1ABOA 2DIQA 1NYGA 4M78E 1NJIR 2J6KA 2FHDA 1PWTA 1WI7A 4K11A 1OU8A 1VQ4T 2FPEA 2HKNA 3HPWA 2DXUA 1X43A 2XHCA 4NL2A 2K5LA 3G71A 3CCRQ 4C0GA 4J9GA 3CCUA 3G6EA 4XTUA 2YRVA 1VQPT 2M02A 1M3CA 1XQHA 2L3RA 1D0XA 1VQ5T 4OB3B 1OI1A 3JCMX 4V2SA 2EKHA 3VYHB 3A8HB 1M27C 1UB4A 1X27A 1KJWA 2LNVA 2V1QA 4KH0B 3OS0A 4A63B 2E65A 4PKCC 4C5GA 2RQVA 3GBQA 1AWOA 4N4HA 4JJDA 1Y57A 3CXCA 4PJOE 2DNUA 1FYNA 3PGGA 1Q82U 1WPYA 3CCRA 1ZBJA 2D9TA 3BFMA 1G3TA 2VV5A 1XJWB 2HMAA 1Q86C 4A4KA 3L2VA 3PVQA 3A8MB 4DEYA 1K8AR 5LJ5g 1S72T 4A53A 2KT1A 2JUFA 1Q81C 1SKUB 1UEBA 2GCXA 1VQ4Q 3QJ6A 4QVZA 4XTVA 1HK9A 2MF2A 4C0FA 3SWNB 2R5AA 5GMKe 2DL3A 3SD4A 3G4SQ 1YIJQ 4XU1A 4IUUA 3J81E 1Q7YR 5FRMA 1VQPQ 2WACA 3M0QA 2MAMA 1VQ5Q 3JCMQ 3FDRA 1ZX6A 2V26A 2JVVA 3CCST 3EFOB 4R56A 3RBBB 1VQ4A 4IURA 2AKKA 3RKWA 3UA6A 1OULA 3VYGA 4HVUA 3M5AA 2OTLT 3G4SA 4PLIA 1YIJA 3UA7A 2CREA 1IB8A 1VQPA 3V8KA 3ZEHA 1MMDA 1VQ5A 1UFFA 3VS7A 2C0IA 1N8RU 4PJLA 2MCNA 1WHHA 1WXBA 2EBPA 5GAN2 2RM4A 1S72Q 4M7DC 2CKKA 1X01A 4ZGDB 3A8GB 1ABQA 2M1HA 1QCFA 2K2VA 2KK4A 2DJZA 4C92C 5D7UA 1J3TA 4AFQC 4M7DF 5GAOl 1VQ6T 2DE0X 1E6HA 3OMGA 5J39A 3TSZA 4C92F 3QSUA 3EGDA 4JLGA 4AFZC 5LJ3e 1SSFA 3CC7Q 3UDCA 1S72A 2GQIA 1V76A 2FZGB 3Q1JA 2DL4A 3JB9F 3OW2A 4GLMA 3E9GA 2RHUA 4JJBA 2LZ6B 3CCJT 1VA7A 4M7DD 1NJIC 2R58A 3EHRA 3OYAA 1Y0MA 4M7DG 2OX7A 2X4JA 1JEGA 5CKEA 1G2BA 1O9SA 5GMKi 2E1HA 4LDYA 4C92D 5GMKm 5I2SA 1M1FA 3HHTB 2E6ZA 4J9DA 4JPBW 4C92G 1YHQA 3L42A 4XU2A 3OYJA 2LC4A 1JJ2S 3CC7A 1RABB 1QW1A 3JB9D 1H641 2VWFA 2DFUA 3JCMc 3CCEA 2RI3A 1VQMT 3JB9G 2XKOC 2F69A 4BI8B 2OI3A 1YWOA 4M7AC 2NUZA 1N5ZA 4P5NA 2ROTA 3KXTA 3JCMh 1K9MU 1W1FA 5M9OA 1UHCA 1K4US 1EFNA 4R55A 2MYSA 4M7AF 2DF6A 2HZYA 3P8DA 2MIOA 3PFSA 1T0HA 4DBQA 2LRQA 3UPUA 4BE2A 3O8VA 5LJ5d 1T3LA 1QKWA 2FRYA 1YJWQ 2LCSA 1M9SA 4MZMA 2PTKA 4OVAA 2P0PA 1VQNT 3HL8A 2R57A 2DEUA 4FYWB 8ATCB 1K8AC 1FMKA 2GFAA 4LUDA 3AT1B 2RQTA 1VQ8T 2K79A 3FB9A 2O31A 2ZGWA 5L23A 4M7AD 1B07A 3VJPA 2YRDA 5GAN5 4M7AG 2K3XA 2CP3A 5A2QE 3X20B 1M2OA 4J9HA 1YJWA 1KC8R 2DKGA 1X2QA 4IUTA 1WNLA 2QQBA 3M56A 5CQYA 1Q7YC 4R0KA 1W2BS 2L3QA 1JJ2P 4E47A 3N5BB 2F1LA 1VQMQ 1UECA 1Y71A 1IZ6A 4M78C 2XDPA 3BE3A 2CZ0B 5GANj 2GTOA 2AZSA 4D8DA 4XK8E 1H92A 5CIUA 3EG0A 4NL3A 1KQSS 2E12A 2EYXA 3ER0A 2XI9A 3MPUB 2NUTB 2WSCE 1ZLMA 2KYBA 1G3SA 2KGTA 3EFSA 2O2OA 2ABLA 3A98A 2E5QA 3E9FA 1YP5A 2YLBA 4BI3A 5CKFA 3OW2P 3VS1A 2C06A 4J9EA 5KE3A 5GAMj 4JJNK 2OTJT 1VQMA 1VQNQ 2GF7A 2YXYA 2VC8A 3P8BB 2OAUA 5GAN4 3M4GA 1YNZA 2AKLA 3JB9J 2EQUA 4M7DB 4J9CA 5GJWB 1LOJA 4HCCA 2EWNA 3IQLA 4C92B 5GMKh 2P0KA 1HSQA 1OX8A 3GIBA 3ZFJA 1I0CA 3H0IA 3PT9A 3VUBA 2L8DA 5D6XA 1VQNA 2PZ1A 2DA9A 3A8LB 2ZPIB 2I0NA 4IUPA 4FCYA 1YJ9Q 4ESRA 4PJNA 1SG5A 1GXIE 1I5LA 4OB1B 2CSIA 4EMKA 5CAIA 1WJSA 1UTIA 4RMOA 2YHTA 2DAQA 2O88A 1K9AA 2CH4A 3CPWA 5IT9E 1BIBA 4FW2A 4ZGEB 5KCOA 2R5MA 3EFOA 3HFOA 4J5YA 3L2QA 2FO0A 2RH2A 2F2VA 4OMPA 1PD0A 4Z02A 1WZOA 1YJ9A 3I35A 4E7SA 4QKUA 1OPLA 1RAGB 2D8JA 5KYUB 1EX4A 3MP6A 4M7AB 2ECZA 2KT8A 1CSKA 2EQJA 4XU0A 2RK1A 4PJJA 4C5EA 1R0CB 5I22A 1ZUKA 2JTMA 3FEOA 1WHLA 3MP8A 3CD6Q 2LTOA 2L3PA 2KR3A 1G3WA 2E6NA 3C4SA 4XTWA 1PM3A 4HXJA 4N0AC 3PMTA 4KGZB 3V7RA 2LVMA 2BE9B 1NZ9A 2H3JA 1KFZA 1W6XA 2ZPBB 2KY9A 2YUNA 2SRCA 5I11A 1Q86R 2KBTA 1PSFA 3LX7A 2QXFA 1WX6A 1N9RA 3H0FA 4ANJA 3QKJA 4PFPA 1U8RA 2C0OA 2F5KA 3CD6A 1TUDA 1KC8C 2A3LA 1M3AA 4Y91A 1QP2A 5KYXB 4MZTA 2DK3A 1GRIA 2O9SA 4OMFB 4M78B 3REAB 3SWNC 2QA4T 1IXDA 2QEXA 5GAOn 4AT1B 4HVWA 2G6FX 4EMGA 1HXDA 2DZCA 1UHFA 1SSHA 3G71T 3CCUT 3G6ET 4C5HA 4MDWA 1D3BB 2PQWA 2I2LA 2DXTA 1QLYA 2EKOA 1RI0A 1RAHB 4RTYA 1KQ2A 3NMZC 5HK0A 1JXOA 1OEBA 6AT1B 3X25B 1MV3A 4ATOA 3NTIA 5GANe 2P0QA 3QPHA 1G3YA 4B9XA 4XAXB 2BZYA 4IKFA 2DX1A 2P4RA 1K73U 2YSQA 4FT2A 3R6OA 3CCRT 4X1VA 1OQKA 1Y96A 1I5OB 1WQ7A 1UGSB 4N4IA 4A54A 3DB4A 2ZPEB 4KBMB 5GAMe 1AT1B 4GLKA 4E7JA 1RADB 2O01E 1VYUA 3SHWA 5HCKA 4BY6C 2V8IA 3QWYA 2QA4Q 1R0BG 2XG8D 2QQ9A 2JOYA 2PU9B 4DBRA 3DLLA 2RA2A 3MEUA 2KDSA 2KNBB 3HP9A 1FWZA 3R6NA 3L2WA 4LDWA 3QZ9B 3EG1A 5KYNA 3JB9I 2HNIA 1TSFA 1D0ZA 4KULA 1GCPA 4C8QC 5CK9A 1M30A 3RMQA 2QA4A 2NUTA 3HRTA 2MI6A 4C8QF 4LN2A 3RNJA 1BKBA 3CC2Q 4F7UF 1LJOA 3G4ST 2V1RA 4E7KA 1ZUUA 2DD4A 1C1AA 1YIJT 2FVUA 2NUPB 1QKXA 2IG0A 3PE0A 4MDXA 4M7DA 4B9WA 1VUBA 3EGXB 2JJ9A 3NHNA 4JRKA 3X24B 1WHJA 4BE0A 4C92A 1ZA2B 1TUCA 3H41A 1VQLQ 1KHIA 4IIOA 4C8QD 2LQKA 3BDLA 2ED0A 2KAFA 4C8QG 1P92A 4CC3A 5FRNA 3CC2A 1FX7A 3OS2A 2WSEE 5CO7A 2QI2A 2K57A 3O5ZA 3ZL7C 4F7UG 3UF4A 4OMMA 4DBHA 5CCAA 3ULRB 3CMAQ 1IHVA 5EG2A 4WF2A 2LJ0A 2QTVA 9ATCB 2VUBA 5EC7A 1WGSA 2EPDA 4OMLA 4PL6A 4QW2A 2JMAA 3TEEA 3MEAA 4QVCA 1VQLA 4O5VA 4JUVA 1OZ3A 1K0XA 2EYQA 1NLOC 2RD1A 5I21A 4M77C 4ZNXA 2KXDA 3QYHB 2NLUA 2RO0A 1MNDA 2MOXA 4GY5A 5GAOq 4E7IA 5GANf 3CMAA 3FC3A 2JTFA 1X6BA 1SPKA 1YHQT 2RQWA 3THKA 3EH2A 4DOWA 4J9IA 5IXFA 2CS7A 1IREB 2GBQA 5KYUA 3CC7T 2X4YA 4FW1A 3NFCA 4FYVB 4FT4A 3I56T 3JAME 4M7AA 1M1KU 1AWXA 3CCET 3MHXA 1K0SA 4M75C 4MZPA 4IUQA 2KE9A 3LGFA
chains in the Genus database with same CATH topology
2E64A 2R57A 3OS5A 5D6WA 5GAN7 2DXBA 4M75E 1N8RC 4J8OA 3TU4K 5D6YA 5GAMf 3JB9H 1K8AC 3M58A 4N4GA 1QVFS 2GFAA 4DA4A 1VQ8T 4M75F 4II1A 3OYYA 4UC4A 1VQKT 3FB9A 3CBOA 3WXMB 2ZGWA 3OBWA 3RMSA 1R8OB 3CMAT 4M7AD 3VJPA 1YCYA 5GAN5 5IN1A 4M7AG 3CC4T 1VQ9A 2M9UA 2LT1A 4M75A 4FL6A 4LD6A 2K3XA 3JCMJ 2HQXA 3S3NA 5A2QE 4Q5WA 2DTHA 3X20B 2XDBA 3JCMf 1UGRB 2FB7A 4J7IA 2M0OA 1X75C 2O4XB 3A5ZB 4C0DC 2ZPFB 2DKGA 1B34B 3OYFA 1YJWA 2RHIA 4IUTA 5C6SA 1WNLA 2QQBA 3M56A 3QJYA 5CQYA 1Q7YC 1I81A 5LJ5f 3QXEB 1W2BS 5CKHA 4IUVA 1M4ZA 2RJDA 3M59A 4E47A 3N5BB 5GAOp 5GAOm 1JJ2A 5CR2A 1Y71A 5LJ3d 2OTJA 3OY9A 4NS5A 4M75D 1RL2A 1IZ6A 4M78C 4BY6B 2XDPA 2CZ0B 4RG8A 5GANj 3H8ZA 4M75G 1ZBXA 5FU7B 2RJEA 1UGQB 2ZPGB 1WJRA 2M16A 2EQMA 1ZQ1A 3URGA 4XK8E 4JS5A 1VQ9T 3C94A 5CIUA 3QUIA 3CCLA 1QP3A 4NL3A 1KQSS 3PTAA 2DZ9A 3VUZA 5A0LA 2E12A 3ER0A 2XI9A 1JRIA 4MMKA 5GAN3 2BKDN 2WSCE 1YJNA 1YJWT 3M54A 5GMKj 1G3SA 4J83A 4OB0B 2RB6A 3EFSA 2E5QA 2X4XA 3E9FA 4BI3A 2YLBA 4JRIA 3UWNA 5CKFA 2C06A 2GFUA 3QG1A 3CMEA 4BUGA 5GAMj 3QBYA 4D6WA 5KE3A 4OF1A 4JJNK 4ELZC 5GANh 2GF7A 3VU3C 5FU6B 1VQMA 2OTJT 4C8QB 2EQKA 2VC8A 3P8BB 2OAUA 3A8OB 5GAN4 3HSBA 2RK2A 2EAYA 3M4GA 4FU6A 3MO8A 4HT9A 4JRPA 2RI2A 4KT0E 2EQUA 5LL6S 4F7UB 3JB9J 4M7DB 4LDUA 4BI4A 3MEWA 4ELYC 2XDDA 1LOJA 1D3BA 2PUOB 4HCCA 2EWNA 4QQ6A 1VIEA 3HRUA 2EIFA 3CCLT 3KUFA 1QVFA 1YITT 1M5Q1 3FLGA 3QYGB 2KMTA 2Y4XA 4C92B 2RJFA 4XQ3A 2X35A 5GMKh 3GF5A 3DKMA 2P0KA 4TVRA 4ZN1A 3EAEA 1YJNT 2AHJB 1N9SA 2BUDA 3QIIA 3DB3A 1K9MC 3FIFA 5A0DA 4BACA 2X4WA 1AHJB 3MEVA 3GIBA 4EDUA 5LJ5j 3ZFJA 3RIRA 5GAMh 3OYKA 1KC8U 3I56A 3PT9A 3VUBA 3CMET 2L8DA 5D6XA 2V8JA 4PLLA 1VQNA 2RJCA 3CCVT 3OYLA 3P8HA 3A8LB 2ZPIB 4KUIA 4IUPA 1I4K1 3LYIA 1LNXA 5GAN8 3JCMg 1M1KC 2XU8A 2DEQA 2CZ7B 2LQ8A 1W2BA 3AHUA 1GXIE 3PIOA 2E70A 4J6XA 2CYZB 1I5LA 1VQ7T 3CC7T 4OB1B 2E41A 3OSVA 2JNGA 5I2MA 4BB7A 1KHCA 3CCQT 1H3ZA 4EMKA 5CAIA 2LCLA 1WJSA 2MWPA 2VXFA 3JSCA 3OS1A 4M77F 2Y4YA 4E7HA 4RMOA 2LDMA 2YHTA 3LW5E 1BI2A 2DAQA 2PUKB 5LJ5h 1WQWA 4L5GA 3CPWA 2DVEA 5IT9E 1M90U 4QQGA 3V7SA 1BIBA 2D0QB 3H6ZA 4ZGEB 5KCOA 2R5MA 4BE1A 3E1SA 1Q86U 3JCMV 3HFOA 4J5YA 3L2QA 3OYNA 3PIPA 4BDYA 2L5QA 2ZZDA 2HD0A 2RH2A 3BW1A 2Y90A 4Z02A 4C5IA 4J7FA 4EMKB 1YJ9A 5LJ3j 2KVQG 3M55A 4HA8A 1Q81U 2DTIA 2VYTA 4XTXA 2CGHA 3QHSA 3OYMA 4OGEA 4ZGJB 3LWHA 2LX9A 4M77D 1FXXA 4PNOA 1OZ2A 3LH0A 1DJ7B 2FL7A 1MGQA 2XK0A 2PVDB 5A0GA 3MP6A 4M77G 4M77B 4M7AB 3C12A 4L6V5 1KD1U 2EQJA 3CBPA 4XU0A 3X28B 2RK1A 2DPPB 3CXCS 4JDSA 1OYXA 3BDUA 4FIBA 2JN0A 3T9NA 3JCMe 4C5EA 2CZ1B 2HQEA 5FLXE 2FYKA 1BI3A 2VGMA 4RKUE 3M53A 3TREA 1XTDA 2JTMA 3FEOA 3M4YA 2RI5A 1WJQA 5FROA 4E7LA 3QDRB 2QQRA 1YJ9T 3M57A 3MP8A 1NPRA 4L59A 1JB0E 4HT8A 2DIQA 2LTOA 2MMPA 2JZ2A 4M75B 2E10A 1G3WA 2E6NA 3C4SA 4M78E 4XTWA 2EJ9A 3L2UA 2KSSA 4FM4B 1M1GA 2FHDA 3LLRA 3PMTA 4N0AC 3RESA 4M78F 1YITA 2DTOA 3V7RA 4BD3A 1VQ4T 2LVMA 3G7ZA 1NZ9A 3OYCA 2H3JA 1EIFA 5CKBA 2ZPBB 3HPWA 2KY9A 5HK3A 2DXUA 2XICA 1G5VA 1QVGS 4M78A 1PSFA 5GANg 3LX7A 2XHCA 4NL2A 2QXFA 1N9RA 2K5LA 3QKJA 3G71A 4C0GA 1U8RA 3ME9A 3CCUA 3G6EA 2VXEA 5GAN6 4XTUA 3WVEB 2BIVA 2F5KA 2EJGA 2YRVA 3CCVA 1VQPT 4N0AA 3CD6A 4C0DB 1XQHA 2L3RA 2YLCA 3GP8A 1KC8C 1VQ5T 2A3LA 4NOYA 2D6FA 4OB3B 1NE8A 1XNIA 5LJ3f 1OI1A 2IVWA 4ME7A 2RHYA 1VQ7A 4RCBA 3JCMX 4M78D 5KCHA 4ZTJA 4V2SA 3CCQA 4Y91A 1QP2A 3VYHB 4CI0C 1ZHIA 3A8HB 1UB4A 2LNVA 4MZTA 4A4EA 2DK3A 4OMFB 3SWNC 3OS0A 4M78G 4M78B 2QA4T 4C0ZA 2E65A 5GAMg 3KBGA 2QEXA 5GAOn 4PKCC 4C5GA 3OYDA 3OYEA 1YBYA 2ZPHB 1V29B 4N4HA 5DM7R 4PJOC 4EMGA 1KQ1A 3HRSA 1HXDA 1X6OA 2DZCA 3CXCA 4PJOE 2QDYB 4XTYA 3G71T 3PGGA 3RKYA 4CRIA 3G6ET 3CCUT 1WPYA 4C5HA 3CCRA 4MDWA 1D3BB 1Q82U 1M90C 3CD6T 2D9TA 2PQWA 2I2LA 3BFMA 4DQ2A 2DXTA 1G3TA 2VV5A 2EKOA 4LDVA 1RI0A 2HAXA 3SWNA 1KQ2A 1Q86C 4A4KA 3L2VA 5HK0A 2K5FA 3X25B 3GNGA 2XIDA 3VV0A 1TH7A 4A4HA 5GMKl 3A8MB 4ATOA 4J6WA 3NTIA 4O6JA 5GANe 5CKDA 2WSFE 3OYBA 4PJOA 5LJ5g 3L2ZA 1S72T 2P0QA 5HY6A 4X9DA 4A53A 3QPHA 1NJIU 1G3YA 4B9XA 3CCMT 4J6YA 2JUFA 4XAXB 1Q81C 5AYFA 1UEBA 3J80E 2QEXT 3CCSA 4IKFA 2GCXA 3QJ6A 2CZ6B 4ZN3A 4JRQA 4QVZA 4XTVA 1HK9A 3LGLA 2MF2A 4QQDA 1K73U 1KQSA 4FT2A 1N27A 4C0FA 3SWNB 2R5AA 1KD1C 3R6OA 3CCRT 5GMKe 1Y96A 1WQ7A 3SD4A 2B8AA 3L2RA 1UGSB 4N4IA 2OTLA 4A54A 3DB4A 2ZPEB 4XU1A 1QVGA 3CBMA 4IUUA 3JCMd 4RG2A 3J81E 4KBMB 3F70A 1BYMA 5GAMe 5FRMA 4OP0A 2WACA 3META 3OMCA 2MAMA 4GLKA 4E7JA 3HFNA 4X9CA 3JCMQ 3OW2S 2DD5A 3GNFB 2O01E 3EFRA 3FDRA 4BY6C 2V8KA 2JVVA 3CCST 2V8IA 4Y28E 3CPFA 5FU7C 4R56A 4EPCA 2L89A 2QQAA 3JRZA 2LCCA 1VQ4A 4IURA 1Y96B 2XG8D 3M9QA 3PMIA 3JCMb 2QQSA 2O4XA 2QQ9A 3S3OA 2ZCFB 3RKWA 5HKCA 1B34A 3VYGA 5LJ3g 2JOYA 2PU9B 3RUXA 2RHXA 3M5AA 1JBMA 3DLLA 3JCMW 3L1AA 2RA2A 5LJ3h 3MEUA 4VUBA 2KDSA 3HP9A 5C0MA 5LJ5e 3G4SA 2OTLT 1FWZA 4PLIA 3L2WA 4LDWA 1VQ6A 1YIJA 3QZ9B 5CVIA 5GAOr 2F5TX 3JB9I 4X34A 2HNIA 3UT1A 1VQPA 1U1TA 1BI0A 3V8KA 2LT4A 3ZEHA 3I55T 4OGCA 1VQ5A 2GQVA 4KULA 2VGNA 4DOVA 3RKXA 3JCMP 5FU6C 1N8RU 4C8QC 5CK9A 3QO3A 3S6WA 3OYIA 1NJIC 1K8AU 2HBPA 5GAN2 4C8QE 3C95A 2RM4A 4M7DC 3RMQA 2CKKA 2QA4A 1X01A 2PVOB 4ZGDB 3INZA 3A8GB 3HRTA 4F7UE 4KUDK 1QVPA 2M1HA 2MI6A 2K2VA 2KK4A 3PNWC 3VKIA 4C8QF 1VQOA 4M7DE 1BKBA 3LWIA 2DJZA 4C92C 3CCJA 4F7UF 1LJOA 4M7DF 3G4ST 2K5IA 5DLQE 4C92E 2DD4A 5GAOl 4E7KA 1YIJT 1MHNA 1VQ6T 4C8QA 3CPWS 3OMGA 2FVUA 5J39A 1Y07A 3X26B 3V8LA 3MCAB 2IG0A 4C92F 3QSUA 5L8RE 2A7YA 4F7UA 1Q7YU 4M7DA 4MDXA 4B9WA 3FJPA 4JLGA 1VUBA 4ZTFA 2P4TA 2PVGB 5LJ3e 4HCBA 2K4YA 3OSSC 4JRKA 3X24B 1Q82C 3E19A 1SSFA 1UGPB 4BE0A 3RERA 3CEYA 4C92A 3GLXA 3UDCA 1S72A 2DXCA 3WVDB 3CCMA 1KHIA 3Q1JA 4C8QD 3JB9F 2LQKA 3BDLA 3OW2A 3E9GA 1NPPA 1VIFA 1VQOT 2RHUA 4FSXA 4RCCA 2KAFA 5CQXA 1P92A 4C8QG 3CCJT 5FRNA 3DLMA 3CC2A 4M7DD 3OBYA 4A4FA 3ASKA 1FX7A 5KH6A 2WSEE 5GANd 2R58A 5DLOA 3MP1A 5CO7A 2QI2A 5IAYA 3OYAA 4QVDA 2K57A 4F7UG 1M8VA 1KG1A 4M7DG 5J26A 2X4JA 5CKEA 5GMKi 1O9SA 5KE2A 2XD0A 4BDZA 1BI1A 2E1HA 4LDYA 4C92D 5CCAA 4A4GA 4HKEA 5GMKm 5I2SA 4HCZA 1M1FA 3HHTB 2E6ZA 4PJOF 3OYHA 3FRNA 4JS4A 4XU3A 4C92G 1YHQA 3L42A 1K73C 5EG2A 4WF2A 2DO3A 1YI2A 5DY9A 4XU2A 1W4SA 3OQ5A 2VUBA 3OYJA 1WGSA 2LC4A 3OS2A 4PL6A 4EMKC 3OB9A 3ZBDA 3CC7A 1JJ2S 3OYGA 4QW2A 1QW1A 1BIAA 3TEEA 3JB9D 3MEAA 1H641 4QVCA 3OA6A 3JCMc 1VQLA 4O5VA 1XOVA 2RI3A 1OZ3A 4JUVA 5GAMd 3CCEA 2MWOA 1VQMT 4M7AA 3JB9G 2XKOC 2EJFA 2F69A 2EYQA 2RD1A 4BI8B 3CC2T 5I21A 4LDXA 4M77C 4M7AC 2RHZA 3QYHB 2NLUA 2G3RA 2RO0A 4P5NA 3GOXA 4GY5A 5GAOq 4M77E 3KXTA 3V7CA 3V8JA 4E7IA 1I8FA 5J3BA 4M7AE 1VQ8A 3HKSA 3JCMh 1K9MU 1PSEA 4PJOD 3SB2A 1N6AA 5GANf 1VQKA 3BY7A 3NTHA 5M9OA 3CMAA 3FC3A 2JTFA 1YHQT 4EMHA 4R55A 2QTXA 4PJOG 4M7AF 1YI2T 4PJOB 4DOWA 3P8DA 3CC4A 3SDZA 1Y7XA 3PFSA 4YTLA 2KQWA 2CS7A 2LRQA 1IREB 4OB2B 3QZ5B 1U1SA 3TCJA 3I55A 2K3YA 3O8VA 4BE2A 5LJ5d 3SFMA 4MMLA 3UPUA 1O75A 2X4YA 4M77A 3NFCA 4FT4A 2DIGA 3I56T 3JAME 1VQLT 4JLIA 4LD9K 1M1KU 2EFIA 3CCET 3J7AF 1M9SA 3MHXA 3NTKA 4MZMA 4XTZA 3GPLA 4M75C 2P0PA 4OVAA 3HL8A 4IUQA 4MZPA 3S3MA 1VQNT 3LGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  1LNX A;  5GAN 8;  5GAN 2;  3JCM g;  4C8Q E;  5GAN 7;  2DEQ A;  2RM4 A;  4M75 E;  4RCB A;  3JCM X;  4M78 D;  3AHU A;  4M7D C;  4V2S A;  1X01 A;  4Y91 A;  4J6X A;  5GAM f;  3INZ A;  1I5L A;  3JB9 H;  2E41 A;  4F7U E;  3SWN C;  4M7D E;  4M78 G;  4M78 B;  4C8Q F;  4EMK A;  5CAI A;  4M75 F;  2VXF A;  2DJZ A;  2E65 A;  3FB9 A;  4M77 F;  4C92 C;  2ZGW A;  5GAM g;  5GAO n;  4M7A D;  2YHT A;  4F7U F;  1LJO A;  4M7D F;  5LJ5 h;  1WQW A;  1YCY A;  4C92 E;  5GAN 5;  2DVE A;  5GAO l;  4PJO C;  4M7A G;  3V7S A;  4EMG A;  4C8Q A;  1KQ1 A;  1BIB A;  4M75 A;  3V8L A;  1HXD A;  2DZC A;  4PJO E;  3JCM J;  4XTY A;  2DTH A;  3PGG A;  3RKY A;  4C92 F;  3JCM f;  3QSU A;  1WPY A;  2FB7 A;  4F7U A;  1D3B B;  3JCM V;  4M7D A;  3FJP A;  3HFO A;  4J5Y A;  2I2L A;  3BFM A;  4DQ2 A;  2DXT A;  2DKG A;  1B34 B;  5LJ3 e;  3SWN A;  4JRK A;  1KQ2 A;  1WNL A;  3BW1 A;  2Y90 A;  1I81 A;  5LJ5 f;  3RER A;  4EMK B;  4C92 A;  5LJ3 j;  4HA8 A;  5GMK l;  1TH7 A;  2DTI A;  4XTX A;  5GAO m;  2CGH A;  3QHS A;  4J6W A;  5LJ3 d;  5GAN e;  4C8Q D;  4PJO A;  5LJ5 g;  3L2Z A;  3JB9 F;  4M75 D;  4X9D A;  4A53 A;  4M78 C;  4J6Y A;  4M77 D;  4PNO A;  4RCC A;  4C8Q G;  5GAN j;  1MGQ A;  4M75 G;  4M7D D;  5GAO p;  4M77 G;  4M77 B;  4M7A B;  5GAN d;  1M8V A;  4XU0 A;  2K57 A;  4F7U G;  4QVD A;  4XTV A;  4M7D G;  1HK9 A;  5GMK i;  3QUI A;  3BDU A;  4NL3 A;  2E1H A;  4C92 D;  3JCM e;  2JN0 A;  5GMK m;  2DZ9 A;  3SWN B;  2FYK A;  5GMK e;  1Y96 A;  1WQ7 A;  4PJO F;  4XU3 A;  4C92 G;  1JRI A;  4MMK A;  5GAN 3;  4WF2 A;  5DY9 A;  4A54 A;  5GMK j;  4XU2 A;  4XU1 A;  3JCM d;  2RB6 A;  3EFS A;  5GAM e;  4OP0 A;  2YLB A;  4JRI A;  4EMK C;  1BIA A;  5GAM j;  3HFN A;  4X9C A;  3JCM Q;  3JB9 D;  1H64 1;  5GAN h;  4QVC A;  4HT8 A;  3JCM c;  3VU3 C;  3EFR A;  4C8Q B;  4JUV A;  2VC8 A;  5GAM d;  4M75 B;  2E10 A;  3JB9 G;  2EJF A;  4M78 E;  3M4G A;  2EAY A;  2RD1 A;  5GAN 4;  3HSB A;  4HT9 A;  3JB9 J;  5I21 A;  4F7U B;  4XTW A;  2EJ9 A;  4M7D B;  4M77 C;  4M7A C;  1LOJ A;  1D3B A;  4N0A C;  1Y96 B;  3RES A;  2EWN A;  3JCM b;  4M78 F;  2DTO A;  3V7R A;  3RKW A;  1B34 A;  4M77 E;  5GAO q;  3V7C A;  3V8J A;  5LJ3 g;  1I8F A;  4M7A E;  1M5Q 1;  3JCM h;  4C92 B;  4PJO D;  4XQ3 A;  3SB2 A;  3RUX A;  5GAN f;  3BY7 A;  1JBM A;  5GMK h;  3JCM W;  3L1A A;  2DXU A;  2RA2 A;  5LJ3 h;  4EMH A;  5LJ5 e;  2QTX A;  4PJO G;  4M7A F;  4M78 A;  1N9S A;  4PJO B;  3FIF A;  5GAN g;  3GIB A;  4NL2 A;  5GAO r;  5LJ5 j;  5GAM h;  3RIR A;  1N9R A;  3JB9 I;  2HNI A;  1U1S A;  1U1T A;  3V8K A;  5LJ5 d;  4MML A;  2VXE A;  5GAN 6;  4XTU A;  4M77 A;  4M7A A;  2EJG A;  3JCM P;  4N0A A;  4JLI A;  3RKX A;  2YLC A;  4C8Q C;  4XTZ A;  3QO3 A;  4M75 C;  4NOY A;  5LJ3 f;  1I4K 1; 
#chains in the Genus database with same CATH topology
 2E64 A;  1LVK A;  4J8O A;  1E7O A;  3EG9 A;  5GAM f;  1JQQ A;  1QVF S;  2MK5 A;  4M75 F;  3OYY A;  3WXM B;  1VOM A;  5IN1 A;  2EGE A;  3LH5 A;  1FMV A;  4FL6 A;  3S3N A;  2XDB A;  4Q5W A;  3JCM f;  1UGR B;  2FB7 A;  1YJN Q;  3A5Z B;  4C0D C;  1B34 B;  1NBE B;  3OYF A;  2RHI A;  5C6S A;  3QJY A;  1I81 A;  1I1J A;  3QXE B;  5CKH A;  3CME Q;  5GAO m;  1JJ2 A;  1QCO A;  3OY9 A;  4NS5 A;  4M75 D;  2KRM A;  4BY6 B;  1PG5 B;  3H8Z A;  4M75 G;  2CDT A;  2GTJ A;  2RJE A;  2OJ2 A;  2ZPG B;  2FEI A;  4JZ4 A;  1QP3 A;  1YHQ Q;  2DZ9 A;  1PRM C;  2QG9 B;  2YUQ A;  1HJD A;  1M90 R;  4KRT A;  2NWM A;  1JRI A;  7AT1 B;  1YJN A;  1YJW T;  1IO6 A;  2L0A A;  3I56 Q;  3UWN A;  2HQH A;  3CCE Q;  4FSS A;  3QG1 A;  3CME A;  1A0N B;  5GAN h;  4C8Q B;  2KEA A;  3A8O B;  2DET A;  4FU6 A;  4HT9 A;  4KT0 E;  5LL6 S;  4F7U B;  2RMO A;  3MEW A;  4ELY C;  1D3B A;  1H8K A;  2EIF A;  1SEM A;  3KUF A;  1QVF P;  1M5Q 1;  3FLG A;  3QYG B;  1KD1 R;  1AVZ C;  2X35 A;  1VYT A;  4ZN1 A;  2BUD A;  3DB3 A;  4BAC A;  5A0D A;  2CT3 A;  2HSE B;  5LJ5 j;  5GAM h;  3OYK A;  5KYW B;  2CP6 A;  3I56 A;  1NEG A;  3A1P A;  1B3Q A;  2RJC A;  3OYL A;  3P8H A;  2EVR A;  2D8H A;  1LNX A;  3TQ7 P;  3JCM g;  2XU8 A;  2DEQ A;  1W2B A;  1AEY A;  2E70 A;  2CYZ B;  1VQ7 T;  1S1N A;  2E41 A;  4BB7 A;  1KHC A;  3CCQ T;  2VXF A;  1WIE A;  2DYI A;  3LW5 E;  1TUG B;  2HSP A;  1WQW A;  4L5G A;  2DVE A;  4QQG A;  3V7S A;  2D0Q B;  4LE9 A;  1YFN A;  2J06 A;  1Q86 U;  1NLP C;  2BZX A;  2DL7 A;  2L5Q A;  2HD0 A;  4J7F A;  3H0H A;  2KVQ G;  3M55 A;  4HA8 A;  1Q81 U;  2CGH A;  1JO8 A;  2KRN A;  5IXB A;  3LWH A;  5IH2 A;  4Z88 A;  1YWP A;  3I5R A;  1OZ2 A;  1DJ7 B;  2KRO A;  1MGQ A;  4M77 B;  1G8X A;  1OYX A;  3BDU A;  4FIB A;  3T9N A;  2HQE A;  1WXU A;  3M53 A;  1XTD A;  4EIK A;  3M4Y A;  5FRO A;  1GBQ A;  2QQR A;  1YJ9 T;  2YWW A;  1Z9Q A;  3VRY A;  3HTR A;  3TSW A;  4HT8 A;  1JXM A;  2EYY A;  4PFZ A;  1W70 A;  4M75 B;  4E7Z A;  1OU9 A;  2A08 A;  1VQ7 Q;  2KSS A;  3CCQ Q;  4FM4 B;  3RES A;  4M78 F;  2X9H A;  3EGX A;  2DTO A;  2BE7 D;  4BD3 A;  4AFS C;  3G7Z A;  3OYC A;  1QMC A;  1EIF A;  5CKB A;  4F04 B;  2A36 A;  2XIC A;  1G5V A;  1QVG S;  2IPO B;  2QGF B;  2PNI A;  3ME9 A;  2VXE A;  3WVE B;  1FMW A;  2AK5 A;  4N0A A;  4C0D B;  2YLC A;  2COY A;  4IIM A;  4NOY A;  3EG2 A;  1XNI A;  5LJ3 f;  4RTT A;  4ME7 A;  2RHY A;  1VQ7 A;  4M78 D;  5KCH A;  3G1J A;  4ZTJ A;  3CCQ A;  2C0T A;  1GFC A;  1ZHI A;  4RTX A;  3UAT A;  4A4E A;  4M78 G;  1ACM B;  4C0Z A;  3KBG A;  2QK0 A;  2OAW A;  3OYE A;  1U5S A;  1YBY A;  2ZPH B;  1V29 B;  4PJO C;  1KQ1 A;  2DBK A;  1SHG A;  1WYX A;  4CRI A;  1M90 C;  3CD6 T;  2X3W D;  4E2F B;  1RLP C;  3SWN A;  2FRW A;  1W2B P;  2JMC A;  2DRK A;  3VV0 A;  1TH7 A;  4J6W A;  5CKD A;  3OYB A;  3L2Z A;  1NJI U;  5HY6 A;  2VVK A;  2QEX T;  2DIL A;  1GCQ A;  1B7T A;  1UGV A;  2DJQ A;  2ED1 A;  3LGL A;  1AD5 A;  1KQS P;  2ESW A;  4QQD A;  3M0S A;  1KD1 C;  1MMG A;  3L2R A;  1TWB A;  1ZUY A;  2KI7 A;  2RQR A;  1QVG P;  3CBM A;  3JCM d;  4RG2 A;  3F70 A;  2O9V A;  2CP5 A;  1WHM A;  4OMO A;  3GNF B;  1ZSG A;  2DBM A;  2X3X D;  4Y28 E;  3CPF A;  4EPC A;  2L89 A;  2QQA A;  3JRZ A;  3EGU A;  2QQS A;  2ZCF B;  1B34 A;  1VQO Q;  2YUP A;  5LJ3 g;  1HYO A;  1QWE A;  2RHX A;  1JBM A;  1X6G A;  5LJ3 h;  2BTT A;  5LJ5 e;  2J05 A;  5CVI A;  5GJV B;  2LJ3 A;  3UT1 A;  1U3O A;  1U1T A;  1BI0 A;  1M2V B;  2LT4 A;  3VS4 A;  3I55 T;  2VGN A;  1RI9 A;  4AFU C;  1BK2 A;  3QO3 A;  1D09 B;  1K8A U;  2CP0 A;  2HBP A;  2IIM A;  3C95 A;  5KYY B;  2E3I A;  1M8M A;  2QEX Q;  4KUD K;  3VS3 A;  3E2U A;  1QVP A;  4M7D E;  3PNW C;  3VKI A;  1NYF A;  1VQO A;  3NGP A;  1H3H A;  3LWI A;  1TG0 A;  4C92 E;  1K9M R;  1MHN A;  2EW3 A;  4C8Q A;  3CPW S;  4CC2 A;  3X26 B;  1BB9 A;  3V8L A;  3MCA B;  5L8R E;  4F7U A;  1Q7Y U;  1IGU A;  2PVG B;  1AZG B;  4HCB A;  1Q82 C;  3E19 A;  1R77 A;  1AWW A;  3CEY A;  1UJ0 A;  3WVD B;  2L2P A;  1NPP A;  4RCC A;  5CQX A;  3DLM A;  5KYW A;  1YN8 A;  3ASK A;  3MP1 A;  5IAY A;  1SRL A;  2LQW A;  4QVD A;  1KG1 A;  3EGD B;  2CSQ A;  5J26 A;  5KE2 A;  4BDZ A;  1BI1 A;  2D1X A;  2J6O A;  4HKE A;  1VQK Q;  2B86 A;  4AMC A;  4JS4 A;  2H3E B;  2DO3 A;  2F2W A;  5DY9 A;  3VS0 A;  1YI2 A;  1PNJ A;  3CC4 Q;  2QYZ A;  1W4S A;  3OQ5 A;  3I55 Q;  1GBR A;  4EMK C;  3OB9 A;  3OYG A;  3OA6 A;  3I9Q A;  2MWO A;  2RF0 A;  2EJF A;  3CC2 T;  4LDX A;  4E6R A;  2RHZ A;  2NYS A;  1WHK A;  2G3R A;  4WTO B;  2L3S A;  4M7A E;  3V7C A;  3V8J A;  3HKS A;  3SB2 A;  1VQK A;  1C6V X;  3BY7 A;  4RTZ A;  4PJO B;  1VQ9 Q;  2CT4 A;  3CC4 A;  1RAE B;  2DLP A;  4F17 A;  1Y7X A;  4YTL A;  4OB2 B;  2KQW A;  2JM8 A;  1U06 A;  3QZ5 B;  3I55 A;  2K3Y A;  4MML A;  1O75 A;  4M77 A;  1VQL T;  4JLI A;  2EFI A;  4XTZ A;  2BZ8 A;  1IGQ A;  3OS5 A;  5D6W A;  1N8R C;  2DMO A;  5D6Y A;  4KGV B;  3JB9 H;  4DA4 A;  2HL3 A;  4II1 A;  2A28 A;  3CBO A;  3RMS A;  3CMA T;  1M3B A;  1YCY A;  2GNC A;  1VQ9 A;  2M9U A;  2LT1 A;  3CCL Q;  4M75 A;  2HQX A;  8AT1 B;  1ZA1 B;  4J7I A;  2YUO A;  2O4X B;  2ZPF B;  1BBZ A;  4ORZ A;  5LJ5 f;  4IUV A;  1M4Z A;  2RJD A;  3M59 A;  5LJ3 d;  3TVT A;  1WDX A;  4PK4 A;  3M0P A;  1UGQ B;  2M16 A;  1D1B A;  2YDL A;  5IHN A;  1LCK A;  2J7I A;  2K3B A;  3QUI A;  3CCL A;  3PTA A;  3VUZ A;  1ZSZ C;  5GAN 3;  2BKD N;  4WCI A;  2RB6 A;  4AG2 C;  4DBF A;  2X4X A;  4F14 A;  2GFU A;  4BUG A;  4D6W A;  4OF1 A;  4ELZ C;  3VU3 C;  2EQK A;  3M0U A;  3HSB A;  2RK2 A;  2EAY A;  1GL5 A;  2XDD A;  1I07 A;  4QQ6 A;  1UUE A;  2D0N A;  1CKA A;  1QVF A;  1YIT T;  1LPL A;  2VAS A;  2Y4X A;  1VYV A;  2JW4 A;  3DKM A;  2FPD A;  3REB B;  3EAE A;  1YJN T;  2AHJ B;  2JTE A;  3QII A;  2HL5 C;  2JS0 A;  2QDL A;  5IHK A;  1K9M C;  3QDF A;  1AHJ B;  1PD1 A;  1KC8 U;  3CME T;  2QGG A;  4PLL A;  4RTV A;  3H9N A;  3CCV T;  4KUI A;  1WA7 A;  4GBQ A;  3LYI A;  2CZ7 B;  3AHU A;  3PIO A;  4J6X A;  3OSV A;  1H3Z A;  2MWP A;  3OS1 A;  4M77 F;  2Y4Y A;  4E7H A;  2LDM A;  1BI2 A;  2ATC B;  2PUK B;  5LJ5 h;  3H6Z A;  3E1S A;  4PJM A;  3JCM V;  3VRZ A;  2HEQ A;  2DL8 A;  1D0Y A;  3BW1 A;  2Y90 A;  4C5I A;  4EMK B;  2M0Y A;  1D1C A;  2DTI A;  2K2M A;  3QHS A;  4ZGJ B;  1Q95 G;  1NEB A;  2LX9 A;  4M77 D;  4PNO A;  2E5K A;  3LH0 A;  2F2X A;  2PVD B;  4HCK A;  5A0G A;  4M77 G;  1M2V A;  4L6V 5;  3X28 B;  1YIT Q;  3CXC S;  2DM1 A;  2CZ1 B;  5FLX E;  5KYY A;  4RKU E;  3I5S A;  4DEX A;  3RR6 A;  4E7L A;  3QDR B;  4QT7 A;  3CCV Q;  1NPR A;  1K76 A;  2LNH B;  4L59 A;  1JB0 E;  1OX9 A;  2MMP A;  2JZ2 A;  1T0J A;  2HDA A;  2E10 A;  4AG1 C;  2EJ9 A;  3L2U A;  1M1G A;  3LLR A;  1OOT A;  1YIT A;  1K1Z A;  2ROL A;  2HBW A;  3SEM A;  5HK3 A;  5KYX A;  2DYB A;  3KFV A;  1K73 R;  4M78 A;  1WFW A;  5GAN g;  3EG3 A;  1WXT A;  1KK7 A;  1MNE A;  2EYW A;  4OMQ A;  5GAN 6;  3CCV A;  2BIV A;  2EJG A;  2W10 A;  2K7A A;  4D8K A;  3GP8 A;  2D6F A;  1NE8 A;  3D7S B;  2IVW A;  1GFD A;  4RCB A;  4CI0 C;  3QWX X;  3CCS Q;  5GAM g;  3OYD A;  5DM7 R;  1EZZ B;  2CUD A;  2RQU A;  3CXC P;  3HRS A;  1X6O A;  1ZSZ B;  2QDY B;  4XTY A;  3RKY A;  2OTL Q;  4F16 A;  4DQ2 A;  4LDV A;  2HAX A;  4JJC A;  1RUW A;  2COZ A;  2K5F A;  3GNG A;  2XID A;  5GMK l;  4A4H A;  4O6J A;  2WSF E;  5AT1 B;  1MMA A;  2ENM A;  2COW A;  4PJO A;  4X9D A;  3CCM T;  4J6Y A;  5AYF A;  4RTU A;  3J80 E;  3CCS A;  1SRM A;  2J6F A;  4PFO A;  2CZ6 B;  4ZN3 A;  5FW9 A;  4JRQ A;  2DVJ A;  3EHQ A;  1KQS A;  1N27 A;  1T3S A;  2LJ1 A;  2B8A A;  2OTL A;  1VQ6 Q;  1QVG A;  1BYM A;  2EGC A;  4KH1 B;  4OP0 A;  4Z89 A;  3MET A;  2HKQ B;  2CUB A;  2KRS A;  3OMC A;  3HFN A;  4X9C A;  3OW2 S;  2DD5 A;  3EFR A;  1PKT A;  2V8K A;  5FU7 C;  2DL5 A;  2LCC A;  1SHF A;  1Y96 B;  3M9Q A;  3PMI A;  3JCM b;  2O4X A;  3S3O A;  5HKC A;  1TXQ A;  2QAS A;  4OMN A;  3CCJ Q;  3RUX A;  1RLQ C;  3JCM W;  3L1A A;  5C0M A;  4VUB A;  1Q82 R;  2FPF A;  1VQ6 A;  2W0Z A;  5GAO r;  2F5T X;  2JM9 A;  2AZV A;  2JS2 A;  4X34 A;  2LP5 A;  1HD3 A;  4OGC A;  2GQV A;  3JCM P;  3NPF A;  3RKX A;  4DOV A;  2NUP A;  5FU6 C;  3S6W A;  3OYI A;  1OPK A;  4C8Q E;  1NG2 A;  2LMJ A;  1NM7 A;  3CCM Q;  2PVO B;  3INZ A;  2LX7 A;  4F7U E;  2A0F B;  3U23 A;  4CC4 B;  3CCJ A;  1MV0 B;  2K5I A;  5DLQ E;  2M51 A;  3MKD A;  1OV3 A;  1Y07 A;  1KIK A;  1RAA B;  2A7Y A;  5ECA A;  1TS9 A;  3FJP A;  1MUZ A;  2P4T A;  4ZTF A;  3JV3 A;  2Z0W A;  2K4Y A;  3OSS C;  1UGP B;  3RER A;  1M1K R;  3GLX A;  4J9B A;  4RUG A;  2DXC A;  2HCK A;  3CCM A;  1VQO T;  1VIF A;  4FSX A;  2A37 A;  3OBY A;  4A4F A;  5KH6 A;  5GAN d;  5GAO p;  5DLO A;  1M8V A;  1E6G A;  2XD0 A;  1VQ8 Q;  2MPX C;  4A4G A;  4KGX B;  2K6D A;  4HCZ A;  4PJO F;  3OYH A;  3FRN A;  2YRC A;  1RAC B;  4XU3 A;  1K73 C;  1G83 A;  1PCX A;  1N8R R;  3ZBD A;  1BIA A;  2RN8 A;  1XOV A;  5GAM d;  4LUE A;  1QCN A;  1YCS B;  3GOX A;  1TU0 B;  4M77 E;  1I8F A;  5J3B A;  1VQ8 A;  4LNP A;  1PSE A;  4PJO D;  1N6A A;  2CP2 A;  3NTH A;  1RAF B;  4EMH A;  2QTX A;  4PJO G;  1ARK A;  1YI2 T;  1F1B B;  2VB6 A;  3EH1 A;  1SF9 A;  4CC7 A;  3SDZ A;  1JU5 C;  3TCJ A;  1U1S A;  3SFM A;  1CKB A;  3CQT A;  2E3H A;  2DIG A;  3J7A F;  3NTK A;  2EQI A;  3GPL A;  3S3M A;  5GAN 7;  1KSW A;  2DXB A;  4M75 E;  3TU4 K;  2OTJ Q;  3M58 A;  4N4G A;  5FWC A;  2JT4 A;  4UC4 A;  2X51 A;  4Z8A A;  1VQK T;  1UJY A;  4RTW A;  3OBW A;  1R8O B;  1MMN A;  4LXC A;  3VS5 A;  3CC4 T;  4LD6 A;  3JCM J;  2DTH A;  1UDL A;  2M0O A;  1X75 C;  1QQJ A;  3EG9 B;  1QWF A;  1C0M A;  2KYM A;  4B6M A;  5CR2 A;  2OTJ A;  1RL2 A;  5IHI A;  4RG8 A;  2SEM A;  1ZBX A;  5FU7 B;  1UG1 A;  1WJR A;  2EQM A;  1Z9Z A;  1ZQ1 A;  3URG A;  1V1C A;  1VQ9 T;  4JS5 A;  3C94 A;  1PKS A;  5A0L A;  1YI2 Q;  2GGR A;  3FJ5 A;  4MMK A;  3M54 A;  5GMK j;  4J83 A;  4OB0 B;  2FZC B;  1IRX A;  4JRI A;  3QBY A;  4LD9 K;  2QAZ A;  5FU6 B;  2DRM A;  2FZK B;  1Q81 R;  1RAI B;  2CP7 A;  3MO8 A;  4JRP A;  2RI2 A;  1ZSZ A;  2P84 A;  4LDU A;  4BI4 A;  2PUO B;  1VIE A;  3HRU A;  3CCL T;  2FG0 A;  2KMT A;  1AZE A;  2RJF A;  4XQ3 A;  4FYX B;  2EYZ A;  3GF5 A;  4TVR A;  1PRL C;  2K9G A;  3C0C A;  1WHG A;  1N9S A;  2RNA A;  3FIF A;  2X4W A;  3MEV A;  1BU1 A;  4EDU A;  3RIR A;  1X2K A;  2LQN A;  4Y92 A;  2ZAE A;  4J9F A;  1GCQ C;  2V8J A;  3VS6 A;  1I4K 1;  2JXB A;  4HVV A;  5GAN 8;  1M1K C;  2LQ8 A;  2CH4 W;  2JNG A;  5I2M A;  1D1A A;  3VS2 A;  1BCO A;  3MJX A;  1BCM A;  2LCL A;  3JSC A;  5FWB A;  1IHW A;  4M4Z A;  3CPW P;  1PHT A;  1M90 U;  2RPN A;  4BE1 A;  1UE9 A;  2H8H A;  3PVL A;  3OYN A;  1TTH B;  2XMF A;  3PIP A;  4BDY A;  2ZZD A;  2EGA A;  1TOV A;  2VKN A;  1X69 A;  5LJ3 j;  1WLP B;  2VYT A;  2AT1 B;  4XTX A;  3OYM A;  4OGE A;  2DER A;  1FXX A;  2FL7 A;  2XK0 A;  2E4H A;  1AWJ A;  2KXC A;  3RDV A;  3C12 A;  1KD1 U;  3CBP A;  3M0T A;  2DPP B;  1PC0 A;  4JDS A;  3JCM e;  2JN0 A;  2AIR B;  2FYK A;  1BI3 A;  2VGM A;  3TRE A;  1AOJ A;  3M0R A;  2RI5 A;  1WJQ A;  2YT6 A;  4FYY B;  3M57 A;  3G71 Q;  3CCU Q;  3G6E Q;  4JZ3 A;  1ABO A;  2DIQ A;  1NYG A;  4M78 E;  1NJI R;  2J6K A;  2FHD A;  1PWT A;  1WI7 A;  4K11 A;  1OU8 A;  1VQ4 T;  2FPE A;  2HKN A;  3HPW A;  2DXU A;  1X43 A;  2XHC A;  4NL2 A;  2K5L A;  3G71 A;  3CCR Q;  4C0G A;  4J9G A;  3CCU A;  3G6E A;  4XTU A;  2YRV A;  1VQP T;  2M02 A;  1M3C A;  1XQH A;  2L3R A;  1D0X A;  1VQ5 T;  4OB3 B;  1OI1 A;  3JCM X;  4V2S A;  2EKH A;  3VYH B;  3A8H B;  1M27 C;  1UB4 A;  1X27 A;  1KJW A;  2LNV A;  2V1Q A;  4KH0 B;  3OS0 A;  4A63 B;  2E65 A;  4PKC C;  4C5G A;  2RQV A;  3GBQ A;  1AWO A;  4N4H A;  4JJD A;  1Y57 A;  3CXC A;  4PJO E;  2DNU A;  1FYN A;  3PGG A;  1Q82 U;  1WPY A;  3CCR A;  1ZBJ A;  2D9T A;  3BFM A;  1G3T A;  2VV5 A;  1XJW B;  2HMA A;  1Q86 C;  4A4K A;  3L2V A;  3PVQ A;  3A8M B;  4DEY A;  1K8A R;  5LJ5 g;  1S72 T;  4A53 A;  2KT1 A;  2JUF A;  1Q81 C;  1SKU B;  1UEB A;  2GCX A;  1VQ4 Q;  3QJ6 A;  4QVZ A;  4XTV A;  1HK9 A;  2MF2 A;  4C0F A;  3SWN B;  2R5A A;  5GMK e;  2DL3 A;  3SD4 A;  3G4S Q;  1YIJ Q;  4XU1 A;  4IUU A;  3J81 E;  1Q7Y R;  5FRM A;  1VQP Q;  2WAC A;  3M0Q A;  2MAM A;  1VQ5 Q;  3JCM Q;  3FDR A;  1ZX6 A;  2V26 A;  2JVV A;  3CCS T;  3EFO B;  4R56 A;  3RBB B;  1VQ4 A;  4IUR A;  2AKK A;  3RKW A;  3UA6 A;  1OUL A;  3VYG A;  4HVU A;  3M5A A;  2OTL T;  3G4S A;  4PLI A;  1YIJ A;  3UA7 A;  2CRE A;  1IB8 A;  1VQP A;  3V8K A;  3ZEH A;  1MMD A;  1VQ5 A;  1UFF A;  3VS7 A;  2C0I A;  1N8R U;  4PJL A;  2MCN A;  1WHH A;  1WXB A;  2EBP A;  5GAN 2;  2RM4 A;  1S72 Q;  4M7D C;  2CKK A;  1X01 A;  4ZGD B;  3A8G B;  1ABQ A;  2M1H A;  1QCF A;  2K2V A;  2KK4 A;  2DJZ A;  4C92 C;  5D7U A;  1J3T A;  4AFQ C;  4M7D F;  5GAO l;  1VQ6 T;  2DE0 X;  1E6H A;  3OMG A;  5J39 A;  3TSZ A;  4C92 F;  3QSU A;  3EGD A;  4JLG A;  4AFZ C;  5LJ3 e;  1SSF A;  3CC7 Q;  3UDC A;  1S72 A;  2GQI A;  1V76 A;  2FZG B;  3Q1J A;  2DL4 A;  3JB9 F;  3OW2 A;  4GLM A;  3E9G A;  2RHU A;  4JJB A;  2LZ6 B;  3CCJ T;  1VA7 A;  4M7D D;  1NJI C;  2R58 A;  3EHR A;  3OYA A;  1Y0M A;  4M7D G;  2OX7 A;  2X4J A;  1JEG A;  5CKE A;  1G2B A;  1O9S A;  5GMK i;  2E1H A;  4LDY A;  4C92 D;  5GMK m;  5I2S A;  1M1F A;  3HHT B;  2E6Z A;  4J9D A;  4JPB W;  4C92 G;  1YHQ A;  3L42 A;  4XU2 A;  3OYJ A;  2LC4 A;  1JJ2 S;  3CC7 A;  1RAB B;  1QW1 A;  3JB9 D;  1H64 1;  2VWF A;  2DFU A;  3JCM c;  3CCE A;  2RI3 A;  1VQM T;  3JB9 G;  2XKO C;  2F69 A;  4BI8 B;  2OI3 A;  1YWO A;  4M7A C;  2NUZ A;  1N5Z A;  4P5N A;  2ROT A;  3KXT A;  3JCM h;  1K9M U;  1W1F A;  5M9O A;  1UHC A;  1K4U S;  1EFN A;  4R55 A;  2MYS A;  4M7A F;  2DF6 A;  2HZY A;  3P8D A;  2MIO A;  3PFS A;  1T0H A;  4DBQ A;  2LRQ A;  3UPU A;  4BE2 A;  3O8V A;  5LJ5 d;  1T3L A;  1QKW A;  2FRY A;  1YJW Q;  2LCS A;  1M9S A;  4MZM A;  2PTK A;  4OVA A;  2P0P A;  1VQN T;  3HL8 A;  2R57 A;  2DEU A;  4FYW B;  8ATC B;  1K8A C;  1FMK A;  2GFA A;  4LUD A;  3AT1 B;  2RQT A;  1VQ8 T;  2K79 A;  3FB9 A;  2O31 A;  2ZGW A;  5L23 A;  4M7A D;  1B07 A;  3VJP A;  2YRD A;  5GAN 5;  4M7A G;  2K3X A;  2CP3 A;  5A2Q E;  3X20 B;  1M2O A;  4J9H A;  1YJW A;  1KC8 R;  2DKG A;  1X2Q A;  4IUT A;  1WNL A;  2QQB A;  3M56 A;  5CQY A;  1Q7Y C;  4R0K A;  1W2B S;  2L3Q A;  1JJ2 P;  4E47 A;  3N5B B;  2F1L A;  1VQM Q;  1UEC A;  1Y71 A;  1IZ6 A;  4M78 C;  2XDP A;  3BE3 A;  2CZ0 B;  5GAN j;  2GTO A;  2AZS A;  4D8D A;  4XK8 E;  1H92 A;  5CIU A;  3EG0 A;  4NL3 A;  1KQS S;  2E12 A;  2EYX A;  3ER0 A;  2XI9 A;  3MPU B;  2NUT B;  2WSC E;  1ZLM A;  2KYB A;  1G3S A;  2KGT A;  3EFS A;  2O2O A;  2ABL A;  3A98 A;  2E5Q A;  3E9F A;  1YP5 A;  2YLB A;  4BI3 A;  5CKF A;  3OW2 P;  3VS1 A;  2C06 A;  4J9E A;  5KE3 A;  5GAM j;  4JJN K;  2OTJ T;  1VQM A;  1VQN Q;  2GF7 A;  2YXY A;  2VC8 A;  3P8B B;  2OAU A;  5GAN 4;  3M4G A;  1YNZ A;  2AKL A;  3JB9 J;  2EQU A;  4M7D B;  4J9C A;  5GJW B;  1LOJ A;  4HCC A;  2EWN A;  3IQL A;  4C92 B;  5GMK h;  2P0K A;  1HSQ A;  1OX8 A;  3GIB A;  3ZFJ A;  1I0C A;  3H0I A;  3PT9 A;  3VUB A;  2L8D A;  5D6X A;  1VQN A;  2PZ1 A;  2DA9 A;  3A8L B;  2ZPI B;  2I0N A;  4IUP A;  4FCY A;  1YJ9 Q;  4ESR A;  4PJN A;  1SG5 A;  1GXI E;  1I5L A;  4OB1 B;  2CSI A;  4EMK A;  5CAI A;  1WJS A;  1UTI A;  4RMO A;  2YHT A;  2DAQ A;  2O88 A;  1K9A A;  2CH4 A;  3CPW A;  5IT9 E;  1BIB A;  4FW2 A;  4ZGE B;  5KCO A;  2R5M A;  3EFO A;  3HFO A;  4J5Y A;  3L2Q A;  2FO0 A;  2RH2 A;  2F2V A;  4OMP A;  1PD0 A;  4Z02 A;  1WZO A;  1YJ9 A;  3I35 A;  4E7S A;  4QKU A;  1OPL A;  1RAG B;  2D8J A;  5KYU B;  1EX4 A;  3MP6 A;  4M7A B;  2ECZ A;  2KT8 A;  1CSK A;  2EQJ A;  4XU0 A;  2RK1 A;  4PJJ A;  4C5E A;  1R0C B;  5I22 A;  1ZUK A;  2JTM A;  3FEO A;  1WHL A;  3MP8 A;  3CD6 Q;  2LTO A;  2L3P A;  2KR3 A;  1G3W A;  2E6N A;  3C4S A;  4XTW A;  1PM3 A;  4HXJ A;  4N0A C;  3PMT A;  4KGZ B;  3V7R A;  2LVM A;  2BE9 B;  1NZ9 A;  2H3J A;  1KFZ A;  1W6X A;  2ZPB B;  2KY9 A;  2YUN A;  2SRC A;  5I11 A;  1Q86 R;  2KBT A;  1PSF A;  3LX7 A;  2QXF A;  1WX6 A;  1N9R A;  3H0F A;  4ANJ A;  3QKJ A;  4PFP A;  1U8R A;  2C0O A;  2F5K A;  3CD6 A;  1TUD A;  1KC8 C;  2A3L A;  1M3A A;  4Y91 A;  1QP2 A;  5KYX B;  4MZT A;  2DK3 A;  1GRI A;  2O9S A;  4OMF B;  4M78 B;  3REA B;  3SWN C;  2QA4 T;  1IXD A;  2QEX A;  5GAO n;  4AT1 B;  4HVW A;  2G6F X;  4EMG A;  1HXD A;  2DZC A;  1UHF A;  1SSH A;  3G71 T;  3CCU T;  3G6E T;  4C5H A;  4MDW A;  1D3B B;  2PQW A;  2I2L A;  2DXT A;  1QLY A;  2EKO A;  1RI0 A;  1RAH B;  4RTY A;  1KQ2 A;  3NMZ C;  5HK0 A;  1JXO A;  1OEB A;  6AT1 B;  3X25 B;  1MV3 A;  4ATO A;  3NTI A;  5GAN e;  2P0Q A;  3QPH A;  1G3Y A;  4B9X A;  4XAX B;  2BZY A;  4IKF A;  2DX1 A;  2P4R A;  1K73 U;  2YSQ A;  4FT2 A;  3R6O A;  3CCR T;  4X1V A;  1OQK A;  1Y96 A;  1I5O B;  1WQ7 A;  1UGS B;  4N4I A;  4A54 A;  3DB4 A;  2ZPE B;  4KBM B;  5GAM e;  1AT1 B;  4GLK A;  4E7J A;  1RAD B;  2O01 E;  1VYU A;  3SHW A;  5HCK A;  4BY6 C;  2V8I A;  3QWY A;  2QA4 Q;  1R0B G;  2XG8 D;  2QQ9 A;  2JOY A;  2PU9 B;  4DBR A;  3DLL A;  2RA2 A;  3MEU A;  2KDS A;  2KNB B;  3HP9 A;  1FWZ A;  3R6N A;  3L2W A;  4LDW A;  3QZ9 B;  3EG1 A;  5KYN A;  3JB9 I;  2HNI A;  1TSF A;  1D0Z A;  4KUL A;  1GCP A;  4C8Q C;  5CK9 A;  1M30 A;  3RMQ A;  2QA4 A;  2NUT A;  3HRT A;  2MI6 A;  4C8Q F;  4LN2 A;  3RNJ A;  1BKB A;  3CC2 Q;  4F7U F;  1LJO A;  3G4S T;  2V1R A;  4E7K A;  1ZUU A;  2DD4 A;  1C1A A;  1YIJ T;  2FVU A;  2NUP B;  1QKX A;  2IG0 A;  3PE0 A;  4MDX A;  4M7D A;  4B9W A;  1VUB A;  3EGX B;  2JJ9 A;  3NHN A;  4JRK A;  3X24 B;  1WHJ A;  4BE0 A;  4C92 A;  1ZA2 B;  1TUC A;  3H41 A;  1VQL Q;  1KHI A;  4IIO A;  4C8Q D;  2LQK A;  3BDL A;  2ED0 A;  2KAF A;  4C8Q G;  1P92 A;  4CC3 A;  5FRN A;  3CC2 A;  1FX7 A;  3OS2 A;  2WSE E;  5CO7 A;  2QI2 A;  2K57 A;  3O5Z A;  3ZL7 C;  4F7U G;  3UF4 A;  4OMM A;  4DBH A;  5CCA A;  3ULR B;  3CMA Q;  1IHV A;  5EG2 A;  4WF2 A;  2LJ0 A;  2QTV A;  9ATC B;  2VUB A;  5EC7 A;  1WGS A;  2EPD A;  4OML A;  4PL6 A;  4QW2 A;  2JMA A;  3TEE A;  3MEA A;  4QVC A;  1VQL A;  4O5V A;  4JUV A;  1OZ3 A;  1K0X A;  2EYQ A;  1NLO C;  2RD1 A;  5I21 A;  4M77 C;  4ZNX A;  2KXD A;  3QYH B;  2NLU A;  2RO0 A;  1MND A;  2MOX A;  4GY5 A;  5GAO q;  4E7I A;  5GAN f;  3CMA A;  3FC3 A;  2JTF A;  1X6B A;  1SPK A;  1YHQ T;  2RQW A;  3THK A;  3EH2 A;  4DOW A;  4J9I A;  5IXF A;  2CS7 A;  1IRE B;  2GBQ A;  5KYU A;  3CC7 T;  2X4Y A;  4FW1 A;  3NFC A;  4FYV B;  4FT4 A;  3I56 T;  3JAM E;  4M7A A;  1M1K U;  1AWX A;  3CCE T;  3MHX A;  1K0S A;  4M75 C;  4MZP A;  4IUQ A;  2KE9 A;  3LGF A; 
#chains in the Genus database with same CATH homology
 2E64 A;  2R57 A;  3OS5 A;  5D6W A;  5GAN 7;  2DXB A;  4M75 E;  1N8R C;  4J8O A;  3TU4 K;  5D6Y A;  5GAM f;  3JB9 H;  1K8A C;  3M58 A;  4N4G A;  1QVF S;  2GFA A;  4DA4 A;  1VQ8 T;  4M75 F;  4II1 A;  3OYY A;  4UC4 A;  1VQK T;  3FB9 A;  3CBO A;  3WXM B;  2ZGW A;  3OBW A;  3RMS A;  1R8O B;  3CMA T;  4M7A D;  3VJP A;  1YCY A;  5GAN 5;  5IN1 A;  4M7A G;  3CC4 T;  1VQ9 A;  2M9U A;  2LT1 A;  4M75 A;  4FL6 A;  4LD6 A;  2K3X A;  3JCM J;  2HQX A;  3S3N A;  5A2Q E;  4Q5W A;  2DTH A;  3X20 B;  2XDB A;  3JCM f;  1UGR B;  2FB7 A;  4J7I A;  2M0O A;  1X75 C;  2O4X B;  3A5Z B;  4C0D C;  2ZPF B;  2DKG A;  1B34 B;  3OYF A;  1YJW A;  2RHI A;  4IUT A;  5C6S A;  1WNL A;  2QQB A;  3M56 A;  3QJY A;  5CQY A;  1Q7Y C;  1I81 A;  5LJ5 f;  3QXE B;  1W2B S;  5CKH A;  4IUV A;  1M4Z A;  2RJD A;  3M59 A;  4E47 A;  3N5B B;  5GAO p;  5GAO m;  1JJ2 A;  5CR2 A;  1Y71 A;  5LJ3 d;  2OTJ A;  3OY9 A;  4NS5 A;  4M75 D;  1RL2 A;  1IZ6 A;  4M78 C;  4BY6 B;  2XDP A;  2CZ0 B;  4RG8 A;  5GAN j;  3H8Z A;  4M75 G;  1ZBX A;  5FU7 B;  2RJE A;  1UGQ B;  2ZPG B;  1WJR A;  2M16 A;  2EQM A;  1ZQ1 A;  3URG A;  4XK8 E;  4JS5 A;  1VQ9 T;  3C94 A;  5CIU A;  3QUI A;  3CCL A;  1QP3 A;  4NL3 A;  1KQS S;  3PTA A;  2DZ9 A;  3VUZ A;  5A0L A;  2E12 A;  3ER0 A;  2XI9 A;  1JRI A;  4MMK A;  5GAN 3;  2BKD N;  2WSC E;  1YJN A;  1YJW T;  3M54 A;  5GMK j;  1G3S A;  4J83 A;  4OB0 B;  2RB6 A;  3EFS A;  2E5Q A;  2X4X A;  3E9F A;  4BI3 A;  2YLB A;  4JRI A;  3UWN A;  5CKF A;  2C06 A;  2GFU A;  3QG1 A;  3CME A;  4BUG A;  5GAM j;  3QBY A;  4D6W A;  5KE3 A;  4OF1 A;  4JJN K;  4ELZ C;  5GAN h;  2GF7 A;  3VU3 C;  5FU6 B;  1VQM A;  2OTJ T;  4C8Q B;  2EQK A;  2VC8 A;  3P8B B;  2OAU A;  3A8O B;  5GAN 4;  3HSB A;  2RK2 A;  2EAY A;  3M4G A;  4FU6 A;  3MO8 A;  4HT9 A;  4JRP A;  2RI2 A;  4KT0 E;  2EQU A;  5LL6 S;  4F7U B;  3JB9 J;  4M7D B;  4LDU A;  4BI4 A;  3MEW A;  4ELY C;  2XDD A;  1LOJ A;  1D3B A;  2PUO B;  4HCC A;  2EWN A;  4QQ6 A;  1VIE A;  3HRU A;  2EIF A;  3CCL T;  3KUF A;  1QVF A;  1YIT T;  1M5Q 1;  3FLG A;  3QYG B;  2KMT A;  2Y4X A;  4C92 B;  2RJF A;  4XQ3 A;  2X35 A;  5GMK h;  3GF5 A;  3DKM A;  2P0K A;  4TVR A;  4ZN1 A;  3EAE A;  1YJN T;  2AHJ B;  1N9S A;  2BUD A;  3QII A;  3DB3 A;  1K9M C;  3FIF A;  5A0D A;  4BAC A;  2X4W A;  1AHJ B;  3MEV A;  3GIB A;  4EDU A;  5LJ5 j;  3ZFJ A;  3RIR A;  5GAM h;  3OYK A;  1KC8 U;  3I56 A;  3PT9 A;  3VUB A;  3CME T;  2L8D A;  5D6X A;  2V8J A;  4PLL A;  1VQN A;  2RJC A;  3CCV T;  3OYL A;  3P8H A;  3A8L B;  2ZPI B;  4KUI A;  4IUP A;  1I4K 1;  3LYI A;  1LNX A;  5GAN 8;  3JCM g;  1M1K C;  2XU8 A;  2DEQ A;  2CZ7 B;  2LQ8 A;  1W2B A;  3AHU A;  1GXI E;  3PIO A;  2E70 A;  4J6X A;  2CYZ B;  1I5L A;  1VQ7 T;  3CC7 T;  4OB1 B;  2E41 A;  3OSV A;  2JNG A;  5I2M A;  4BB7 A;  1KHC A;  3CCQ T;  1H3Z A;  4EMK A;  5CAI A;  2LCL A;  1WJS A;  2MWP A;  2VXF A;  3JSC A;  3OS1 A;  4M77 F;  2Y4Y A;  4E7H A;  4RMO A;  2LDM A;  2YHT A;  3LW5 E;  1BI2 A;  2DAQ A;  2PUK B;  5LJ5 h;  1WQW A;  4L5G A;  3CPW A;  2DVE A;  5IT9 E;  1M90 U;  4QQG A;  3V7S A;  1BIB A;  2D0Q B;  3H6Z A;  4ZGE B;  5KCO A;  2R5M A;  4BE1 A;  3E1S A;  1Q86 U;  3JCM V;  3HFO A;  4J5Y A;  3L2Q A;  3OYN A;  3PIP A;  4BDY A;  2L5Q A;  2ZZD A;  2HD0 A;  2RH2 A;  3BW1 A;  2Y90 A;  4Z02 A;  4C5I A;  4J7F A;  4EMK B;  1YJ9 A;  5LJ3 j;  2KVQ G;  3M55 A;  4HA8 A;  1Q81 U;  2DTI A;  2VYT A;  4XTX A;  2CGH A;  3QHS A;  3OYM A;  4OGE A;  4ZGJ B;  3LWH A;  2LX9 A;  4M77 D;  1FXX A;  4PNO A;  1OZ2 A;  3LH0 A;  1DJ7 B;  2FL7 A;  1MGQ A;  2XK0 A;  2PVD B;  5A0G A;  3MP6 A;  4M77 G;  4M77 B;  4M7A B;  3C12 A;  4L6V 5;  1KD1 U;  2EQJ A;  3CBP A;  4XU0 A;  3X28 B;  2RK1 A;  2DPP B;  3CXC S;  4JDS A;  1OYX A;  3BDU A;  4FIB A;  2JN0 A;  3T9N A;  3JCM e;  4C5E A;  2CZ1 B;  2HQE A;  5FLX E;  2FYK A;  1BI3 A;  2VGM A;  4RKU E;  3M53 A;  3TRE A;  1XTD A;  2JTM A;  3FEO A;  3M4Y A;  2RI5 A;  1WJQ A;  5FRO A;  4E7L A;  3QDR B;  2QQR A;  1YJ9 T;  3M57 A;  3MP8 A;  1NPR A;  4L59 A;  1JB0 E;  4HT8 A;  2DIQ A;  2LTO A;  2MMP A;  2JZ2 A;  4M75 B;  2E10 A;  1G3W A;  2E6N A;  3C4S A;  4M78 E;  4XTW A;  2EJ9 A;  3L2U A;  2KSS A;  4FM4 B;  1M1G A;  2FHD A;  3LLR A;  3PMT A;  4N0A C;  3RES A;  4M78 F;  1YIT A;  2DTO A;  3V7R A;  4BD3 A;  1VQ4 T;  2LVM A;  3G7Z A;  1NZ9 A;  3OYC A;  2H3J A;  1EIF A;  5CKB A;  2ZPB B;  3HPW A;  2KY9 A;  5HK3 A;  2DXU A;  2XIC A;  1G5V A;  1QVG S;  4M78 A;  1PSF A;  5GAN g;  3LX7 A;  2XHC A;  4NL2 A;  2QXF A;  1N9R A;  2K5L A;  3QKJ A;  3G71 A;  4C0G A;  1U8R A;  3ME9 A;  3CCU A;  3G6E A;  2VXE A;  5GAN 6;  4XTU A;  3WVE B;  2BIV A;  2F5K A;  2EJG A;  2YRV A;  3CCV A;  1VQP T;  4N0A A;  3CD6 A;  4C0D B;  1XQH A;  2L3R A;  2YLC A;  3GP8 A;  1KC8 C;  1VQ5 T;  2A3L A;  4NOY A;  2D6F A;  4OB3 B;  1NE8 A;  1XNI A;  5LJ3 f;  1OI1 A;  2IVW A;  4ME7 A;  2RHY A;  1VQ7 A;  4RCB A;  3JCM X;  4M78 D;  5KCH A;  4ZTJ A;  4V2S A;  3CCQ A;  4Y91 A;  1QP2 A;  3VYH B;  4CI0 C;  1ZHI A;  3A8H B;  1UB4 A;  2LNV A;  4MZT A;  4A4E A;  2DK3 A;  4OMF B;  3SWN C;  3OS0 A;  4M78 G;  4M78 B;  2QA4 T;  4C0Z A;  2E65 A;  5GAM g;  3KBG A;  2QEX A;  5GAO n;  4PKC C;  4C5G A;  3OYD A;  3OYE A;  1YBY A;  2ZPH B;  1V29 B;  4N4H A;  5DM7 R;  4PJO C;  4EMG A;  1KQ1 A;  3HRS A;  1HXD A;  1X6O A;  2DZC A;  3CXC A;  4PJO E;  2QDY B;  4XTY A;  3G71 T;  3PGG A;  3RKY A;  4CRI A;  3G6E T;  3CCU T;  1WPY A;  4C5H A;  3CCR A;  4MDW A;  1D3B B;  1Q82 U;  1M90 C;  3CD6 T;  2D9T A;  2PQW A;  2I2L A;  3BFM A;  4DQ2 A;  2DXT A;  1G3T A;  2VV5 A;  2EKO A;  4LDV A;  1RI0 A;  2HAX A;  3SWN A;  1KQ2 A;  1Q86 C;  4A4K A;  3L2V A;  5HK0 A;  2K5F A;  3X25 B;  3GNG A;  2XID A;  3VV0 A;  1TH7 A;  4A4H A;  5GMK l;  3A8M B;  4ATO A;  4J6W A;  3NTI A;  4O6J A;  5GAN e;  5CKD A;  2WSF E;  3OYB A;  4PJO A;  5LJ5 g;  3L2Z A;  1S72 T;  2P0Q A;  5HY6 A;  4X9D A;  4A53 A;  3QPH A;  1NJI U;  1G3Y A;  4B9X A;  3CCM T;  4J6Y A;  2JUF A;  4XAX B;  1Q81 C;  5AYF A;  1UEB A;  3J80 E;  2QEX T;  3CCS A;  4IKF A;  2GCX A;  3QJ6 A;  2CZ6 B;  4ZN3 A;  4JRQ A;  4QVZ A;  4XTV A;  1HK9 A;  3LGL A;  2MF2 A;  4QQD A;  1K73 U;  1KQS A;  4FT2 A;  1N27 A;  4C0F A;  3SWN B;  2R5A A;  1KD1 C;  3R6O A;  3CCR T;  5GMK e;  1Y96 A;  1WQ7 A;  3SD4 A;  2B8A A;  3L2R A;  1UGS B;  4N4I A;  2OTL A;  4A54 A;  3DB4 A;  2ZPE B;  4XU1 A;  1QVG A;  3CBM A;  4IUU A;  3JCM d;  4RG2 A;  3J81 E;  4KBM B;  3F70 A;  1BYM A;  5GAM e;  5FRM A;  4OP0 A;  2WAC A;  3MET A;  3OMC A;  2MAM A;  4GLK A;  4E7J A;  3HFN A;  4X9C A;  3JCM Q;  3OW2 S;  2DD5 A;  3GNF B;  2O01 E;  3EFR A;  3FDR A;  4BY6 C;  2V8K A;  2JVV A;  3CCS T;  2V8I A;  4Y28 E;  3CPF A;  5FU7 C;  4R56 A;  4EPC A;  2L89 A;  2QQA A;  3JRZ A;  2LCC A;  1VQ4 A;  4IUR A;  1Y96 B;  2XG8 D;  3M9Q A;  3PMI A;  3JCM b;  2QQS A;  2O4X A;  2QQ9 A;  3S3O A;  2ZCF B;  3RKW A;  5HKC A;  1B34 A;  3VYG A;  5LJ3 g;  2JOY A;  2PU9 B;  3RUX A;  2RHX A;  3M5A A;  1JBM A;  3DLL A;  3JCM W;  3L1A A;  2RA2 A;  5LJ3 h;  3MEU A;  4VUB A;  2KDS A;  3HP9 A;  5C0M A;  5LJ5 e;  3G4S A;  2OTL T;  1FWZ A;  4PLI A;  3L2W A;  4LDW A;  1VQ6 A;  1YIJ A;  3QZ9 B;  5CVI A;  5GAO r;  2F5T X;  3JB9 I;  4X34 A;  2HNI A;  3UT1 A;  1VQP A;  1U1T A;  1BI0 A;  3V8K A;  2LT4 A;  3ZEH A;  3I55 T;  4OGC A;  1VQ5 A;  2GQV A;  4KUL A;  2VGN A;  4DOV A;  3RKX A;  3JCM P;  5FU6 C;  1N8R U;  4C8Q C;  5CK9 A;  3QO3 A;  3S6W A;  3OYI A;  1NJI C;  1K8A U;  2HBP A;  5GAN 2;  4C8Q E;  3C95 A;  2RM4 A;  4M7D C;  3RMQ A;  2CKK A;  2QA4 A;  1X01 A;  2PVO B;  4ZGD B;  3INZ A;  3A8G B;  3HRT A;  4F7U E;  4KUD K;  1QVP A;  2M1H A;  2MI6 A;  2K2V A;  2KK4 A;  3PNW C;  3VKI A;  4C8Q F;  1VQO A;  4M7D E;  1BKB A;  3LWI A;  2DJZ A;  4C92 C;  3CCJ A;  4F7U F;  1LJO A;  4M7D F;  3G4S T;  2K5I A;  5DLQ E;  4C92 E;  2DD4 A;  5GAO l;  4E7K A;  1YIJ T;  1MHN A;  1VQ6 T;  4C8Q A;  3CPW S;  3OMG A;  2FVU A;  5J39 A;  1Y07 A;  3X26 B;  3V8L A;  3MCA B;  2IG0 A;  4C92 F;  3QSU A;  5L8R E;  2A7Y A;  4F7U A;  1Q7Y U;  4M7D A;  4MDX A;  4B9W A;  3FJP A;  4JLG A;  1VUB A;  4ZTF A;  2P4T A;  2PVG B;  5LJ3 e;  4HCB A;  2K4Y A;  3OSS C;  4JRK A;  3X24 B;  1Q82 C;  3E19 A;  1SSF A;  1UGP B;  4BE0 A;  3RER A;  3CEY A;  4C92 A;  3GLX A;  3UDC A;  1S72 A;  2DXC A;  3WVD B;  3CCM A;  1KHI A;  3Q1J A;  4C8Q D;  3JB9 F;  2LQK A;  3BDL A;  3OW2 A;  3E9G A;  1NPP A;  1VIF A;  1VQO T;  2RHU A;  4FSX A;  4RCC A;  2KAF A;  5CQX A;  1P92 A;  4C8Q G;  3CCJ T;  5FRN A;  3DLM A;  3CC2 A;  4M7D D;  3OBY A;  4A4F A;  3ASK A;  1FX7 A;  5KH6 A;  2WSE E;  5GAN d;  2R58 A;  5DLO A;  3MP1 A;  5CO7 A;  2QI2 A;  5IAY A;  3OYA A;  4QVD A;  2K57 A;  4F7U G;  1M8V A;  1KG1 A;  4M7D G;  5J26 A;  2X4J A;  5CKE A;  5GMK i;  1O9S A;  5KE2 A;  2XD0 A;  4BDZ A;  1BI1 A;  2E1H A;  4LDY A;  4C92 D;  5CCA A;  4A4G A;  4HKE A;  5GMK m;  5I2S A;  4HCZ A;  1M1F A;  3HHT B;  2E6Z A;  4PJO F;  3OYH A;  3FRN A;  4JS4 A;  4XU3 A;  4C92 G;  1YHQ A;  3L42 A;  1K73 C;  5EG2 A;  4WF2 A;  2DO3 A;  1YI2 A;  5DY9 A;  4XU2 A;  1W4S A;  3OQ5 A;  2VUB A;  3OYJ A;  1WGS A;  2LC4 A;  3OS2 A;  4PL6 A;  4EMK C;  3OB9 A;  3ZBD A;  3CC7 A;  1JJ2 S;  3OYG A;  4QW2 A;  1QW1 A;  1BIA A;  3TEE A;  3JB9 D;  3MEA A;  1H64 1;  4QVC A;  3OA6 A;  3JCM c;  1VQL A;  4O5V A;  1XOV A;  2RI3 A;  1OZ3 A;  4JUV A;  5GAM d;  3CCE A;  2MWO A;  1VQM T;  4M7A A;  3JB9 G;  2XKO C;  2EJF A;  2F69 A;  2EYQ A;  2RD1 A;  4BI8 B;  3CC2 T;  5I21 A;  4LDX A;  4M77 C;  4M7A C;  2RHZ A;  3QYH B;  2NLU A;  2G3R A;  2RO0 A;  4P5N A;  3GOX A;  4GY5 A;  5GAO q;  4M77 E;  3KXT A;  3V7C A;  3V8J A;  4E7I A;  1I8F A;  5J3B A;  4M7A E;  1VQ8 A;  3HKS A;  3JCM h;  1K9M U;  1PSE A;  4PJO D;  3SB2 A;  1N6A A;  5GAN f;  1VQK A;  3BY7 A;  3NTH A;  5M9O A;  3CMA A;  3FC3 A;  2JTF A;  1YHQ T;  4EMH A;  4R55 A;  2QTX A;  4PJO G;  4M7A F;  1YI2 T;  4PJO B;  4DOW A;  3P8D A;  3CC4 A;  3SDZ A;  1Y7X A;  3PFS A;  4YTL A;  2KQW A;  2CS7 A;  2LRQ A;  1IRE B;  4OB2 B;  3QZ5 B;  1U1S A;  3TCJ A;  3I55 A;  2K3Y A;  3O8V A;  4BE2 A;  5LJ5 d;  3SFM A;  4MML A;  3UPU A;  1O75 A;  2X4Y A;  4M77 A;  3NFC A;  4FT4 A;  2DIG A;  3I56 T;  3JAM E;  1VQL T;  4JLI A;  4LD9 K;  1M1K U;  2EFI A;  3CCE T;  3J7A F;  1M9S A;  3MHX A;  3NTK A;  4MZM A;  4XTZ A;  3GPL A;  4M75 C;  2P0P A;  4OVA A;  3HL8 A;  4IUQ A;  4MZP A;  3S3M A;  1VQN T;  3LGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...