4C92E

Crystal structure of the yeast lsm1-7 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
84
structure length
84
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 14
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92E00
4MMKA 2E65A 4C8QE 5GAN6 5LJ3g 4MMLA 3SWNB 4XTYA 2I2LA 4NL2A 1WPYA 2K57A 2EJGA 4M75E 2FB7A 4PJOF 4RCCA 2YLCA 4M75B 2RB6A 4M75G 1B34B 1WQWA 3V8KA 5CAIA 4F7UE 5LJ5g 3JCMQ 1JBMA 4OP0A 2DXUA 3SB2A 3VU3C 2DTOA 4QVCA 5GAMf 1LNXA 4JRKA 2VXEA 1X01A 2CGHA 4M78E 3JB9J 4EMHA 4JRIA 4PNOA 5GAN5 1YCYA 3RKWA 2E10A 4XU1A 4C8QB 2DXTA 4C92F 5GMKe 1KQ2A 4M75A 4M7AA 4M78D 4XTZA 3PGGA 3FIFA 1LJOA 4XTVA 5I21A 1TH7A 2DTIA 3RERA 5GMKj 2QTXA 2RD1A 5GAMg 3JB9D 3RIRA 4M7AF 3JCMg 4PJOE 5LJ3d 5LJ3j 3BY7A 5GANf 3RUXA 3V7SA 4A53A 3FJPA 4M78A 3JCMe 2DTHA 4M7AC 2FYKA 4M7DB 4F7UF 2DZCA 4PJOD 1N9SA 3QO3A 1BIBA 2EAYA 2JN0A 4M7AG 5GAOq 3RESA 5GANd 5GANj 3JB9F 2DZ9A 1BIAA 2RM4A 5LJ5j 4XTWA 5LJ5d 2E41A 4M77E 5GAOm 4N0AA 4M77B 2E1HA 4HT8A 4HT9A 4NL3A 2ZGWA 1U1SA 3HFOA 4M78C 3SWNC 5LJ5e 5GAN3 4M7DD 1Y96B 4DQ2A 1I4K1 1KQ1A 3HSBA 1U1TA 4M77D 3JCMV 3V8LA 1I5LA 3BW1A 2Y90A 4XU2A 3GIBA 4C8QF 4M7DE 1JRIA 4C92B 3JCMc 4PJOG 2DJZA 4WF2A 4C92E 3JCMJ 4C92A 4J6WA 3SWNA 5GAMe 5LJ3e 5GAMh 4M75F 5GMKi 4M7DA 4M7AD 4PJOB 2EWNA 1M5Q1 4V2SA 1MGQA 5GAMj 4M78G 5GAMd 3BFMA 5GAN2 1Y96A 2E64A 3JCMX 4NOYA 1WQ7A 4C8QG 5GAN4 4M7AE 3M4GA 4HA8A 5GMKh 3JCMd 3JCMP 4XU3A 4J6YA 5GAOl 4M77G 4C92C 4JLIA 4M7DC 4EMKC 4PJOC 3V8JA 4M78F 3L2ZA 2YHTA 2DKGA 4C92G 5GMKl 3BDUA 5GANg 5GAOn 4N0AC 4QVDA 1B34A 3AHUA 3V7RA 4M7DF 3JCMh 4M77F 3QSUA 3JCMf 4C8QC 4M75D 5GAOp 1I81A 1H641 4PJOA 2HNIA 4M77C 3QUIA 4JUVA 5GAN8 3HFNA 3V7CA 4A54A 3RKYA 4M7DG 4X9CA 4EMGA 2DVEA 2YLBA 3JCMb 4M7AB 4F7UG 1WNLA 5LJ5h 4XTUA 5LJ5f 1HK9A 4C8QA 4XQ3A 4C92D 4F7UB 4X9DA 4Y91A 1D3BB 4EMKB 1I8FA 4M77A 2EJFA 2RA2A 2VC8A 3EFRA 4RCBA 4XU0A 5DY9A 3FB9A 1M8VA 5GMKm 5LJ3h 4J5YA 3JB9I 1HXDA 5LJ3f 5GANh 3JCMW 5GAOr 5GANe 4C8QD 3L1AA 3JB9G 1D3BA 2VXFA 4M75C 4EMKA 3QHSA 1LOJA 4J6XA 4M78B 1N9RA 4F7UA 3EFSA 3JB9H 4XTXA 3INZA 5GAN7 2DEQA 2EJ9A 3RKXA
chains in the Genus database with same CATH superfamily
2BKDN 2CH4W 2DL4A 2HQEA 1WIEA 3NTIA 4RCCA 3CCRA 3EGDA 1QQJA 5IHKA 3CCLQ 3M59A 2DD4A 4RG8A 3A8OB 2LP5A 3PIPA 2O31A 1PKSA 4C8QB 3OYDA 1YHQQ 4BD3A 3OYMA 2DTIA 3CC7Q 2K3YA 2LMJA 1Y7XA 2QQAA 3CCQA 1PD1A 1UGQB 3RUXA 4L5GA 5HK0A 1SHFA 4J9CA 1SRLA 3MEWA 1RADB 2RH2A 3E2UA 4DOVA 2ZGWA 5GAN3 4EDUA 2JS0A 4OMQA 4OMMA 1M4ZA 4KH1B 4JRQA 1QVPA 2D6FA 1M8MA 3VV0A 1ZUKA 2LNHB 5AT1B 2RHXA 3G1JA 1KD1R 1VQNA 3G7ZA 3P8HA 1OI1A 2G3RA 2FZGB 3AHUA 3NGPA 2LT1A 5FRMA 4M77F 4ZGEB 3I5RA 3CXCA 1H641 2DPPB 1K73U 4M7DG 1ZSZA 5FU6B 1S72T 2MAMA 1X43A 1GBQA 2C0TA 2DXBA 5AYFA 1VQNQ 1IRXA 4AT1B 2EKHA 3NTHA 3UWNA 4ZTFA 1YI2T 3JSCA 2VVKA 3LYIA 1SRMA 3VS7A 1E6GA 2OAWA 2MIOA 3X28B 3JB9G 3L1AA 3HRUA 3PIOA 4M78B 2MF2A 1X2KA 3WXMB 4AFQC 2VUBA 5KE3A 2O88A 3DB4A 1VQ6A 4XTYA 2I2LA 5HK3A 2OTJQ 1JEGA 2PUKB 2ZPHB 2ZPFB 3CCVQ 2HAXA 3EHRA 3PFSA 2DNUA 1YITT 4BE2A 1K8AR 1TOVA 2JTFA 3EAEA 3MO8A 5DLQE 2OI3A 2ROLA 5KYUA 3EG9B 5IN1A 3REBB 1M2OA 4R0KA 2FPDA 1TH7A 4N4GA 4D6WA 3EHQA 3C12A 3REAB 2HQXA 2X3XD 3QYHB 1M90R 4DBHA 5GANf 2DL3A 4FYWB 4A53A 4M78A 2DTHA 1VQMQ 4IURA 3CBOA 1KD1C 4C5IA 3RESA 4M77E 2DF6A 4N0AA 3OW2P 2CZ0B 2J05A 3CCJT 1UGRB 1QKXA 1IZ6A 1K9MU 4HCZA 2OTJA 2MOXA 2NUZA 3JCMc 3JCMJ 2COYA 1LVKA 2CP5A 4V2SA 1G5VA 3OA6A 4J9GA 3CCSQ 4XAXB 1ZA2B 4JLIA 2KROA 3CMET 4M7DC 1Q7YU 1AHJB 1ZBXA 1RI9A 3HRSA 5A0GA 2CT3A 3VRYA 1WJSA 1TTHB 2NLUA 1G3TA 2A08A 4M7AB 3AT1B 5LJ5f 4F7UB 1WHJA 3A98A 1N6AA 3M0QA 2K79A 1WXUA 4BI4A 5C0MA 2C0IA 4PJMA 4F04B 4RCBA 3E1SA 4JZ4A 4XU0A 2JW4A 5LL6S 3BDLA 3FB9A 4DEYA 2H3EB 4ME7A 5LJ3f 4CC2A 2L3QA 3CPWS 4J6XA 4F7UA 3VS3A 3I55A 1OQKA 1SHGA 3TCJA 3CBMA 2CSIA 2JM9A 1KJWA 2QQRA 1R0CB 1M90C 1SF9A 2NWMA 2DXUA 2NUTB 2CZ6B 1IO6A 4HVWA 3GBQA 2X51A 4C0DC 2D8HA 3TVTA 1C6VX 2K2MA 3CEYA 3VS1A 1BI0A 3CQTA 3TSZA 2L2PA 2MI6A 3PGGA 2KDSA 5I21A 1VQ4Q 4IIMA 1YWOA 2RHZA 1XOVA 3VUBA 1QP3A 2O9SA 8ATCB 2LT4A 2KVQG 2QYZA 4R55A 3QO3A 2GQVA 1NLPC 4HT8A 4NL3A 2PVDB 3SWNC 2AZSA 2EGCA 3VYHB 4DQ2A 4ESRA 1P92A 2YRVA 2P84A 2RQUA 4C92B 1JXOA 3PVLA 2HBWA 3DLMA 3VS0A 1JJ2P 2ATCB 1DJ7B 1TWBA 1EFNA 2EGEA 4C92C 1WLPB 2V1RA 3QJYA 1O9SA 3PE0A 1S1NA 1H3ZA 2BE9B 4FT4A 2X4JA 3FC3A 4F7UG 1GRIA 1HK9A 4C8QA 4X9DA 1D3BB 4EMKB 5CO7A 3J7AF 1PC0A 4QT7A 1G83A 2F5KA 4BDZA 1YJ9T 4FU6A 2J7IA 2W10A 2J6OA 3SHWA 1N9RA 3INZA 4LDYA 2P0PA 3M54A 4MMKA 4C8QE 5GAN6 4MMLA 3NMZC 2A0FB 4NL2A 2QGFB 1BKBA 4PFZA 1N27A 2HDAA 3RMSA 2NUPA 4M75G 1B34B 1M27C 4A4EA 5LJ5g 2PTKA 5D7UA 4EMHA 3ER0A 3L2VA 2RPNA 4L6V5 2ZCFB 1TU0B 3JCMg 3CCEQ 2V8JA 3CCLA 3JCMe 1WXTA 4JJNK 1PSFA 1N9SA 4HVUA 2KT1A 4QQGA 3UT1A 3FRNA 2PU9B 5FWCA 1UECA 2KRNA 4FW2A 4C5EA 3OSSC 1MNEA 1YIJQ 3LGFA 4HCKA 5CQXA 2O4XA 3GNGA 2CP3A 4AFSC 2DLPA 5GJWB 2CDTA 2EVRA 2JZ2A 2QK0A 4BE1A 3UPUA 2EYQA 5J39A 1S72A 4XK8E 3BE3A 4M78F 2DM1A 2X35A 3O8VA 2QGGA 3UF4A 5IXFA 3R6NA 1LPLA 4M75D 3M56A 3CPFA 2J6FA 1I5OB 2GFUA 3VS2A 2F2VA 2VGMA 2DD5A 1JJ2S 5CKEA 4PLLA 3KUFA 4AMCA 1Q82U 2MK5A 1T3SA 2JTEA 3ZFJA 3QHSA 3CC4A 2O01E 2L3RA 2DYIA 2RHYA 2DL8A 1M2VA 4PLIA 1RL2A 3CCMT 2E65A 5CR2A 2D0QB 3CC2T 3G4ST 1UE9A 2Y4XA 4M75E 2FB7A 2YLCA 1UB4A 2OAUA 4J7IA 5KH6A 2DBKA 2MPXC 3RKWA 2XDPA 1VQMA 3EH1A 4OMNA 4XTZA 2FHDA 3RNJA 3H9NA 5CQYA 2JMAA 4PJOE 3CD6A 2COWA 2MCNA 3S3MA 1VQPQ 2QQBA 1VQKQ 4N4HA 2LNVA 5M9OA 3NFCA 1N5ZA 4BI8B 4IKFA 1NBEB 1OU8A 3OS2A 1W2BP 2ROTA 1E7OA 3QJ6A 1CKBA 1QCNA 4IUPA 4D8KA 5CK9A 2MYSA 1QVGP 4C92E 1Q7YC 2WSEE 3A5ZB 2C06A 3CCSA 3CCUT 3EG3A 3L2QA 1IGUA 2DO3A 2FG0A 3HTRA 3CD6T 2L3SA 4AG2C 1TUDA 3UA6A 3V7RA 2KMTA 4RTXA 4OVAA 1BK2A 5KYWB 5GAOp 1U5SA 3M0TA 4OMFB 4VUBA 4PJOA 3OMCA 3EG0A 3HFNA 3RKYA 1SSHA 2Z0WA 2JS2A 5LJ5h 4BDYA 3RR6A 1D0ZA 4C92D 2SRCA 3KXTA 1HD3A 4M77A 1M1KC 3X25B 4RTYA 2RA2A 1ZSGA 3UDCA 3G71Q 1G8XA 1VIFA 5LJ3h 2HL5C 3GLXA 2H3JA 4BY6C 3EH2A 3M58A 2EQUA 3SWNB 3I56Q 2DVJA 2QEXA 3M4YA 1M1KR 4PJNA 4E7KA 1W2BS 5CAIA 2VASA 4QQ6A 2RI2A 2PZ1A 4QVCA 1GBRA 5GAMf 2VWFA 4C0DB 1CKAA 2DETA 3G4SQ 1KD1U 5CKHA 4PNOA 1KQ2A 4C92F 3CCLT 1LJOA 4OF1A 5KCOA 2KRSA 5KYYB 1A0NB 1WHMA 1QP2A 2FO0A 4KGXB 3RIRA 5FU7C 1EIFA 5LJ3j 2HBPA 3FJPA 4MZTA 3HL8A 2FYKA 3LX7A 1Y57A 2CZ1B 1NLOC 4JRPA 2E6ZA 4C5HA 3QWXX 4F17A 1U1SA 4K11A 4RG2A 2CH4A 1QWFA 2LCCA 4M7AD 5GAMh 2QA4A 4PJOB 5GMKi 1AD5A 1X75C 2X9HA 5KYXB 3CPWP 1WX6A 1MV3A 5CKDA 5FROA 1YHQT 2VV5A 3OYKA 3JCMP 3MP8A 4JPBW 4XU3A 4J6YA 4B9WA 1J3TA 5A0DA 1LCKA 3V8JA 5KCHA 3BDUA 4IUQA 2E5QA 1U3OA 2FZCB 2AK5A 2CUDA 3MEUA 3G6ET 3MEVA 2DE0X 3OYEA 4RUGA 1QVGS 2DVEA 3M55A 1WHLA 1KK7A 4XTUA 1Y71A 3CCJA 1YJWA 2M0YA 5KE2A 1VYVA 2RK2A 1OPKA 3OYYA 4J9BA 2E5KA 4J9IA 4LUDA 1QCOA 1LOJA 4FT2A 1G3SA 5GAN7 1Q81R 9ATCB 4PJOF 1KQSS 1GCQA 1YBYA 4C0FA 2RJCA 1BCOA 3EFOB 4GLKA 2EQIA 2CSQA 2DRMA 3MP1A 2CT4A 4R56A 1YIJT 2BZXA 5KYXA 1YI2Q 4M75A 1K8AU 2W0ZA 2DILA 2DAQA 2M0OA 3JRZA 4Y92A 3S6WA 2DIQA 5LJ3d 1M2VB 1M1FA 3CCJQ 2BE7D 3T9NA 4CRIA 3CCET 2A7YA 2IVWA 2FL7A 1K76A 3SD4A 4M7AG 4E7IA 1BBZA 5LJ5d 2RM4A 1X2QA 4ZGDB 1ZLMA 4D8DA 1VQ7T 1KC8R 3CCVT 2NUPB 1KQ1A 1ZUUA 3OBWA 1YJ9A 1S72Q 2YUPA 4RTTA 1VQ9A 1VQOT 4M7DA 3SEMA 1MGQA 4KGVB 4C8QG 2L3PA 2X3WD 2WSCE 4YTLA 3MPUB 2QQSA 3N5BB 5FU7B 3CCST 3CCUA 1E6HA 2HZYA 1FX7A 2RI3A 3VS5A 3JCMf 1JJ2A 3C95A 1VQ5Q 2P4TA 2HNIA 4M77C 3X20B 1TS9A 4HXJA 3OYJA 2A3LA 1W1FA 4QW2A 4C5GA 7AT1B 3CCVA 3CC2A 1BI2A 3PT9A 1ABQA 2EYYA 3L2RA 3ME9A 4J5YA 1X6GA 2P0QA 3JCMW 2JOYA 1ABOA 3VS4A 2QA4Q 3P8DA 3MP6A 5CKFA 2DXCA 2K57A 2CKKA 1TUGB 1MHNA 1IREB 1WGSA 5FWBA 2QEXQ 3SB2A 4FYVB 3VU3C 2RK1A 1VA7A 1X27A 4E6RA 1M1KU 2K3XA 3OYFA 1VQPA 1RABB 4XU1A 1VQ8Q 3CC4Q 5IHIA 1NPRA 1HYOA 2GGRA 2ZPEB 4A4GA 1GXIE 1MMNA 3RBBB 3LWHA 3M53A 4RMOA 4FL6A 1WYXA 3X24B 4A4FA 2FRWA 3PTAA 1GL5A 5CKBA 1KG1A 1VQNT 2EYWA 1I4K1 3QBYA 2J06A 1OX8A 2K6DA 2ZPIB 4J9DA 2DYBA 4JJBA 3A8HB 3OB9A 5GAMj 2COZA 1XTDA 3DKMA 2HQHA 2BUDA 4O6JA 2YRDA 1PD0A 2AHJB 2KT8A 2DFUA 1VQ9T 1UTIA 3LH5A 4M7DF 1HSQA 1QMCA 3QSUA 1GFDA 3LLRA 2F1LA 2EW3A 2J6KA 3OY9A 4LD9K 4X9CA 4AFZC 3QZ5B 1AVZC 1M3CA 1YP5A 1B7TA 3FDRA 2KR3A 3SDZA 3I5SA 3L2WA 1M8VA 1FMKA 5GMKm 1Q81U 4GLMA 1Z9ZA 1I1JA 4FW1A 3JB9I 4Q5WA 1WHHA 3P8BB 2LJ3A 2RI5A 1WHGA 3GF5A 4IUUA 3L42A 4JDSA 4OGCA 1WPYA 4C0ZA 4MZMA 1AT1B 1C1AA 3OYIA 5EC7A 4CC3A 1M90U 4OP0A 4MDWA 2DMOA 1IGQA 3WVEB 5FU6C 2EPDA 2HL3A 2JT4A 4E7HA 1VQKA 1H3HA 2P4RA 1PRLC 1JU5C 2F2XA 3JB9D 2CZ7B 1D1BA 1UEBA 3QXEB 3BY7A 3OYHA 4CI0C 1KQSA 5KYUB 1WZOA 2RMOA 1IB8A 3OS1A 5GAOq 4DBQA 1UJYA 2DZ9A 2EYXA 5GAOm 2F69A 4M78C 1MUZA 1VQ4T 4LE9A 2JM8A 2Y90A 1KC8C 1ZSZC 4M7DE 4OGEA 2VYTA 3H0HA 4C92A 4J6WA 5GAMe 1Y07A 1BB9A 4ANJA 5GAMd 2KI7A 4NOYA 3GNFB 3KBGA 3M4GA 4EIKA 1TUCA 4KULA 2A28A 3OMGA 5IH2A 1W70A 2X4WA 2RQWA 2X4XA 4LDVA 3ULRB 5GANg 2E6NA 1B34A 2MWPA 3E9GA 3DB3A 2V8IA 1OZ2A 4C8QC 1Z9QA 2O9VA 2YUNA 4PFPA 2KK4A 1WNLA 3HP9A 4XQ3A 3TEEA 1U06A 1M30A 2VC8A 2QDLA 5EG2A 1RACB 1NM7A 2NUTA 1K0SA 4J7FA 1D3BA 2EIFA 4EMKA 4II1A 1VQ8A 4CC4B 1UGSB 1NJIR 4RTUA 2O2OA 1XQHA 1JB0E 1VQ5A 1OU9A 2IPOB 3EG9A 4ELYC 3V8KA 3S3OA 1UG1A 2KQWA 1NYFA 2OTJT 4X1VA 2WSFE 1VQ6Q 1LNXA 2VXEA 1GCQC 2QA4T 2M16A 3OBYA 1ARKA 1PRMC 4ELZC 2EQJA 1IXDA 4JJCA 3THKA 2PUOB 1Q82C 4M7AA 2GF7A 3CMAA 4FM4B 1YWPA 2RD1A 1FXXA 1OULA 3META 4OB2B 3TU4K 1NJIU 2XICA 1V29B 2DZCA 3M0RA 2K9GA 5D6YA 4XTWA 5I11A 1VUBA 2E1HA 4KBMB 4HVVA 3EG1A 1U1TA 1YJWT 1OYXA 2K2VA 2HEQA 2LVMA 3EG2A 2DJZA 1OOTA 1UHFA 4M75F 2EWNA 1UGVA 5GAN4 2RQTA 2AKKA 2OX7A 4E7ZA 1VQ7Q 2HMAA 2L5QA 3J80E 3M0UA 4PFOA 1B3QA 3M5AA 1AWOA 3QZ9B 2ZZDA 2EQMA 2AZVA 4B6MA 2CYZB 2YHTA 1R77A 4C92G 2BZ8A 3SFMA 3QYGB 4FYXB 2M51A 3FEOA 4E7JA 1FYNA 1D0XA 1AEYA 1VOMA 3V7CA 4PK4A 3IQLA 1PHTA 4BI3A 1D09B 3MKDA 3EFRA 2B86A 3CCMA 3CC7A 2K3BA 2ECZA 2V26A 1CSKA 5IHNA 4C8QD 1YHQA 1YFNA 3PNWC 1EX4A 3EGUA 4XTXA 4C0GA 3UATA 3MCAB 2VB6A 5DLOA 1G2BA 4RTVA 2R57A 4DOWA 1V1CA 2QQ9A 3CCMQ 1M3AA 1WDXA 2P0KA 3CCRQ 4OMPA 5DM7R 4JLGA 1Q86R 1VQOQ 3EGXA 2CGHA 1HJDA 2YRCA 4ZNXA 1M9SA 2PNIA 2ZPGB 2D1XA 2DJQA 4M78D 3FIFA 1ZSZB 2LJ0A 5J26A 2RN8A 4JZ3A 1T3LA 4OB1B 3QKJA 3O5ZA 1VQMT 2HKQB 5L23A 4KUIA 3OYBA 1YJWQ 3OYNA 3I55T 5I2SA 3CMAT 2DEUA 4Y28E 3LW5E 4HT9A 4QKUA 3S3NA 1U8RA 2DK3A 6AT1B 3BW1A 1PNJA 4UC4A 4DBFA 3M0PA 2YUOA 1M5Q1 3PMTA 4BACA 3E19A 1WQ7A 2LCSA 2KSSA 5GAOl 4M77G 5HCKA 4AFUC 3PMIA 4KGZB 3L2ZA 4BUGA 2XKOC 4N0AC 4PKCC 4P5NA 2MMPA 2C0OA 1D1AA 3CCUQ 1SEMA 2BTTA 1AZEA 4Z88A 2HKNA 3A8MB 4HCBA 2HSEB 1TSFA 4Y91A 2IIMA 3A1PA 3CD6Q 4WTOB 2E12A 2FZKB 3U23A 2MWOA 1FWZA 2HCKA 5GAOr 4KT0E 4LDUA 1T0JA 2CP0A 1PWTA 3EGDB 1KQSP 1I81A 3RKXA 4M7DB 1M3BA 2B8AA 3E9FA 2PVGB 2XK0A 1IHWA 2KYMA 2EJGA 3CC2Q 3F70A 4J8OA 3JCMQ 4F7UE 4TVRA 4BY6B 2JNGA 1QVGA 1X01A 1KIKA 2K5LA 2YT6A 1ACMB 3OYGA 1N8RU 2DXTA 3X26B 2LQ8A 4XTVA 2EGAA 1JQQA 2QTXA 3MHXA 2LQKA 4CC7A 2NYSA 1BCMA 3VJPA 4IIOA 1I0CA 5HY6A 4N4IA 2RNAA 2FEIA 2LQWA 2LRQA 2EAYA 3L2UA 2RJDA 1BIAA 2KGTA 5LJ5j 3I55Q 1ZUYA 1D0YA 2OTLQ 1Y96B 2EYZA 4OMOA 1BI3A 2GQIA 2RQVA 1B07A 1YJNT 3H6ZA 1QW1A 2ED1A 1PCXA 2FPEA 5GAN2 1QLYA 3Q1JA 4FSSA 2XDBA 2K7AA 1ZBJA 1JXMA 3J81E 2E3IA 4Z02A 1W2BA 2QDYB 1KC8U 1RUWA 3WVDB 2FPFA 1PKTA 4F14A 3NHNA 5IAYA 5GAN8 2LZ6B 3NPFA 2G6FX 1RAGB 2X4YA 2CP6A 3NTKA 3H0IA 4PL6A 1WXBA 4MDXA 2VGNA 2A36A 1VQ5T 2KXDA 1AWXA 5FRNA 5GANh 5FW9A 4FSXA 3OYCA 2L89A 2QTVA 3GPLA 4ORZA 2XG8D 3C0CA 1KHCA 2DX1A 2PVOB 1WJRA 2CUBA 5FLXE 4LDXA 4M75B 1WQWA 1VIEA 5CCAA 1X69A 5C6SA 3KFVA 2DIGA 2YWWA 1VQLT 1X6OA 1RLPC 3EFOA 4LNPA 2JMCA 1UUEA 2KYBA 1UFFA 2E10A 4GBQA 4J83A 3RERA 1NZ9A 1XNIA 1PM3A 2RF0A 1YJ9Q 1YIJA 1D1CA 2D9TA 2YSQA 4M7AC 4ZTJA 3CC4T 2A37A 3G4SA 2FRYA 3H41A 5GANj 3JB9F 1AOJA 2GTJA 2EKOA 3JV3A 4X34A 1K1ZA 2JXBA 3V8LA 2JJ9A 2AKLA 3CCQQ 5IT9E 5J3BA 1K4US 2EBPA 3SWNA 3OSVA 1VQLA 3VYGA 5A2QE 3CXCS 2OTLT 3BFMA 3JCMX 4OMLA 1VQ8T 5GMKh 1WFWA 3JCMd 3DLLA 3ZL7C 2KY9A 4EMKC 2KE9A 4OB0B 2CREA 4QVDA 3JCMh 4F16A 2RHUA 2L0AA 3QPHA 4J9HA 3LH0A 4DEXA 3HHTB 1MNDA 1YITA 3QUIA 2XI9A 3G71T 2V8KA 2YLBA 3JCMb 2E4HA 1Q86C 4JS4A 1UJ0A 3QWYA 4BE0A 1ZX6A 1SKUB 5IXBA 1PG5B 1BI1A 1HXDA 1ZHIA 4RTZA 1OZ3A 2KEAA 1AZGB 3JB9H 3EFSA 1Q95G 1G3YA 3OQ5A 4E2FB 5LJ3g 4FYYB 4BB7A 2GFAA 1VYTA 1KSWA 4LDWA 4ATOA 2LTOA 4DBRA 4A4HA 3I56T 1V76A 1T0HA 3RDVA 1Q82R 4QQDA 1WHKA 4JRIA 5GAN5 1NE8A 3ZBDA 3CXCP 2LJ1A 5CVIA 3I35A 4E7LA 2VKNA 1VQPT 3HPWA 2LCLA 1VQKT 1RAAB 4PJOD 1Q81C 2EQKA 4OB3B 4KUDK 5GANd 1VQOA 1YNZA 2D0NA 2DL7A 4M77B 3TREA 2JUFA 1C0MA 2GBQA 1TG0A 1Y0MA 1X6BA 4M77D 3JCMV 1I5LA 1RLQC 2EFIA 3I56A 2E70A 4C8QF 1JRIA 3CC7T 5KYWA 3CMEQ 2XHCA 1IHVA 3VUZA 4MZPA 1RAFB 4M78G 4O5VA 3A8LB 1RAEB 2E64A 1I07A 5HKCA 2LDMA 2CP2A 4HCCA 2DA9A 4PJOC 4L59A 4LN2A 5GAOn 2KAFA 2RO0A 1KFZA 2OTLA 1ZA1B 2V1QA 3URGA 3GOXA 1PSEA 3HRTA 1K73C 3M9QA 4A54A 3MEAA 1K8AC 2KXCA 2SEMA 3C4SA 3LWIA 2K5IA 2K4YA 1WA7A 2XIDA 3FLGA 1YCSB 4RKUE 1N8RR 3G6EQ 2EJFA 2QG9B 4IUVA 5DY9A 4HKEA 5I2MA 1BU1A 1QKWA 1K0XA 2DERA 5GANe 1NG2A 2VXFA 4M75C 1K9MR 4ZGJB 2XU8A 2DEQA 2EJ9A 2KNBB 2O4XB 1R0BG 3CMEA 4DA4A 4J9FA 1N8RC 2LX7A 3M57A 1JBMA 5ECAA 2R5AA 3HKSA 2DTOA 3TSWA 3CCRT 4M78E 2BIVA 3JB9J 3VKIA 2KRMA 3CCQT 2YDLA 5GMKe 2PQWA 3CBPA 5GMKj 1WI7A 3V7SA 1MMDA 4F7UF 1BIBA 1QCFA 3C94A 4Z89A 4B9XA 1YITQ 2E41A 2BZYA 2M1HA 2KBTA 2QXFA 4EPCA 2RJEA 3HFOA 1BYMA 1QVFA 5LJ5e 1YN8A 1K9MC 1AWWA 1W4SA 1R8OB 3OS5A 3LGLA 2CS7A 3OS0A 4XU2A 3GIBA 4PJOG 4WF2A 1WJQA 5LJ3e 5KYYA 2QI2A 1JO8A 2DRKA 5CIUA 4M7AE 4HA8A 2Y4YA 2E3HA 1NEBA 5D6WA 2HD0A 1K73R 3TQ7P 4E7SA 3H8ZA 2AT1B 2DKGA 8AT1B 1M1GA 3A8GB 3M0SA 3QIIA 3VRZA 3ASKA 3JAME 1RI0A 4FIBA 1UGPB 2JTMA 4JUVA 3OW2A 1K9AA 5GJVB 1MV0B 1MMGA 2GNCA 3QDRB 1OEBA 1QWEA 1TXQA 1KHIA 1I8FA 1OPLA 4IUTA 2LC4A 1QVFS 4PJLA 2GTOA 3G71A 1FMWA 2LQNA 3G6EA 2ZAEA 3I9QA 1OV3A 4JS5A 2XDDA 1YI2A 2F5TX 2IG0A 2M9UA 2AIRB 2R5MA 3CPWA 4FCYA 3GP8A 4A4KA 4LUEA 5D6XA 2H8HA 2CP7A 4WCIA 4ZN1A 1XJWB 2YXYA 2GCXA 4QVZA 2RB6A 4AG1C 1Q86U 3UA7A 1VQ6T 3OYAA 4JRKA 2QEXT 1UHCA 1YJNA 4J9EA 2M02A 4A63B 1EZZB 1YCYA 2RJFA 3MJXA 2DL5A 1GCPA 3FJ5A 4KH0B 2JVVA 1SG5A 4LD6A 5L8RE 2XD0A 3QDFA 5GAMg 2I0NA 2LX9A 4M7AF 3CMAQ 1RAHB 1VQ4A 3VS6A 1O75A 1NYGA 1OX9A 1SSFA 2JN0A 3EGXB 2XMFA 1GFCA 3H0FA 1Q7YR 1AWJA 1UDLA 4M7DD 2ESWA 3ZEHA 2DBMA 3HSBA 3CCEA 3RMQA 1QVFP 3QG1A 4LXCA 3PVQA 1Y96A 1VQ7A 3R6OA 1VYUA 1H92A 3OW2S 4M4ZA 2ENMA 1YJNQ 1VQ9Q 1H8KA 1NPPA 4PJJA 2ABLA 4GY5A 5KYNA 5GMKl 2QASA 1RAIB 1SPKA 2D8JA 4Z8AA 2FVUA 2F2WA 1G3WA 2ED0A 4NS5A 4ZN3A 1NEGA 1MMAA 2HSPA 2RQRA 4EMGA 3D7SB 4KRTA 2YUQA 1W6XA 1FMVA 5I22A 2WACA 5A0LA 3OYLA 4RTWA 2L8DA 2K5FA 4JJDA 2RHIA 2R58A 2ZPBB 1ZQ1A 4E47A 1NJIC 2QAZA 2OJ2A 1F1BB 1VQLQ
chains in the Genus database with same CATH topology
2E65A 2XG8D 1KHCA 3GF5A 3L42A 2BKDN 4IUUA 2D0QB 2PVOB 4JDSA 4OGCA 5CR2A 1WJRA 3CC2T 1WPYA 3G4ST 4C0ZA 2HQEA 4MZMA 2Y4XA 4M75E 2FB7A 3NTIA 4RCCA 2YLCA 4M75B 5FLXE 3CCRA 4LDXA 3OYIA 1UB4A 1WQWA 2OAUA 4J7IA 1M90U 1VIEA 4OP0A 4MDWA 5CCAA 3M59A 5C6SA 2DD4A 2DIGA 4RG8A 5KH6A 3WVEB 5FU6C 3A8OB 1VQLT 1X6OA 3PIPA 4E7HA 1VQKA 3RKWA 2XDPA 1VQMA 2E10A 4C8QB 3OYDA 4BD3A 4J83A 4XTZA 3OYMA 2FHDA 3RERA 2DTIA 1NZ9A 1XNIA 2K3YA 5CQYA 3JB9D 2CZ7B 1Y7XA 1UEBA 3QXEB 4PJOE 1YIJA 2QQAA 3CCQA 3BY7A 3CD6A 3OYHA 4CI0C 1UGQB 2D9TA 3RUXA 1KQSA 4M7AC 4L5GA 3S3MA 4ZTJA 2QQBA 3CC4T 5HK0A 4N4HA 3OS1A 2LNVA 5GAOq 5M9OA 3G4SA 3MEWA 5GANj 3JB9F 3NFCA 2DZ9A 5GAOm 2RH2A 4BI8B 2EKOA 2F69A 4IKFA 4DOVA 2ZGWA 4M78C 5GAN3 3OS2A 1VQ4T 4X34A 3QJ6A 3V8LA 4EDUA 2Y90A 4IUPA 3CPWA 5CK9A 1M4ZA 1KC8C 4M7DE 4OGEA 5IT9E 4JRQA 5J3BA 1QVPA 2VYTA 4C92E 2WSEE 3VV0A 1Q7YC 4C92A 4J6WA 3SWNA 5GAMe 1Y07A 3OSVA 3A5ZB 2RHXA 1VQLA 2C06A 3CCSA 3CCUT 3VYGA 5A2QE 5GAMd 3CXCS 2OTLT 3BFMA 3L2QA 3JCMX 4NOYA 1VQNA 1VQ8T 3GNFB 3KBGA 3M4GA 5GMKh 3JCMd 3DLLA 3CCMT 2KY9A 4KULA 3G7ZA 3OMGA 3P8HA 4EMKC 2DO3A 1OI1A 2X4WA 3CD6T 2G3RA 2X4XA 4LDVA 4OB0B 5GANg 2E6NA 4QVDA 1B34A 3AHUA 2LT1A 2KMTA 2MWPA 3DB3A 3E9GA 4M77F 3JCMh 3V7RA 5FRMA 2RHUA 1OZ2A 2V8IA 4OVAA 4C8QC 4ZGEB 5GAOp 3CXCA 3QPHA 3LH0A 1H641 3HHTB 4OMFB 4VUBA 2DPPB 4PJOA 3OMCA 1YITA 3QUIA 1K73U 3HFNA 4M7DG 3RKYA 2KK4A 2XI9A 3G71T 2V8KA 5FU6B 1S72T 2MAMA 2YLBA 3JCMb 2DXBA 5AYFA 1WNLA 4JS4A 1Q86C 5LJ5h 3HP9A 4BDYA 4BE0A 3NTHA 4XQ3A 3TEEA 3UWNA 4C92D 4ZTFA 1YI2T 3KXTA 3JSCA 4M77A 1M1KC 3LYIA 3X25B 2RA2A 2VC8A 5EG2A 3UDCA 1BI1A 1VIFA 5LJ3h 1HXDA 1ZHIA 4J7FA 3JB9G 3X28B 3L1AA 1D3BA 2EIFA 4EMKA 4II1A 3HRUA 1OZ3A 1VQ8A 3PIOA 4M78B 3GLXA 2MF2A 3EFSA 3WXMB 3JB9H 2H3JA 1UGSB 1G3YA 2VUBA 4BY6C 3OQ5A 5KE3A 3M58A 2EQUA 3DB4A 5LJ3g 1XQHA 1JB0E 3SWNB 1VQ6A 4XTYA 2I2LA 5HK3A 1VQ5A 4BB7A 2GFAA 2PUKB 2ZPHB 2QEXA 3M4YA 2ZPFB 4E7KA 4ELYC 3V8KA 1W2BS 5CAIA 3PFSA 2HAXA 4LDWA 4ATOA 2LTOA 3S3OA 4QQ6A 1YITT 2KQWA 2RI2A 4A4HA 4BE2A 4QVCA 3I56T 5GAMf 2WSFE 2OTJT 1LNXA 4C0DB 2D6FA 2VXEA 1KD1U 4QQDA 2JTFA 3EAEA 3MO8A 5CKHA 5DLQE 4JRIA 4PNOA 5GAN5 2QA4T 2M16A 1NE8A 3OBYA 3ZBDA 4ELZC 2EQJA 1KQ2A 4C92F 3CCLT 2PUOB 1Q82C 5IN1A 4M7AA 2GF7A 1LJOA 4OF1A 5KCOA 4FM4B 1TH7A 3CMAA 4N4GA 5CVIA 1QP2A 4D6WA 2RD1A 1FXXA 3C12A 3RIRA 2HQXA 3META 3QYHB 4OB2B 4E7LA 5FU7C 1EIFA 5LJ3j 3TU4K 1VQPT 3HPWA 2LCLA 5GANf 2HBPA 1VQKT 1NJIU 4A53A 4M7DB 3FJPA 2XICA 4M78A 2DTHA 1V29B 2FYKA 3HL8A 4MZTA 2DZCA 4IURA 3CBOA 1KD1C 4PJOD 3LX7A 1Q81C 2EQKA 4C5IA 4OB3B 3RESA 4KUDK 5GANd 1VQOA 2CZ1B 5D6YA 4XTWA 4M77E 4JRPA 1VUBA 4N0AA 2E6ZA 4C5HA 4M77B 2E1HA 4KBMB 3TREA 2CZ0B 3CCJT 1U1SA 1UGRB 2JUFA 1IZ6A 1K9MU 1U1TA 4M77D 4RG2A 3JCMV 1YJWT 1I5LA 1OYXA 2EFIA 4HCZA 3I56A 2K2VA 2E70A 2OTJA 4C8QF 1JRIA 3JCMc 2LVMA 2DJZA 3JCMJ 2LCCA 4M7AD 5GAMh 2QA4A 4PJOB 4M75F 5GMKi 3CC7T 2EWNA 2XHCA 1X75C 4V2SA 1G5VA 3VUZA 4MZPA 3OA6A 4M78G 4O5VA 5CKDA 3A8LB 5GAN4 2E64A 5FROA 1YHQT 2VV5A 3OYKA 3J80E 2L5QA 3JCMP 3MP8A 4XU3A 5HKCA 2LDMA 4J6YA 4XAXB 3M5AA 4HCCA 3QZ9B 4B9WA 4JLIA 3CMET 4M7DC 2ZZDA 2EQMA 4PJOC 5A0DA 3V8JA 2CYZB 2YHTA 1Q7YU 5KCHA 4L59A 4C92G 3SFMA 1AHJB 3BDUA 1ZBXA 3QYGB 4IUQA 5GAOn 2KAFA 2RO0A 2E5QA 3FEOA 3HRSA 5A0GA 4E7JA 2OTLA 3URGA 3GOXA 1WJSA 1PSEA 3HRTA 1K73C 3MEUA 2NLUA 3M9QA 3G6ET 3MEVA 3V7CA 1G3TA 3MEAA 4A54A 3OYEA 1QVGS 2DVEA 1K8AC 3C4SA 3M55A 3LWIA 4M7AB 4XTUA 1Y71A 2K5IA 3RKXA 4F7UB 5LJ5f 3CCJA 2K4YA 4BI3A 5KE2A 1YJWA 1N6AA 3FLGA 2XIDA 4BI4A 5C0MA 2RK2A 4RKUE 3OYYA 2EJFA 4RCBA 3E1SA 3EFRA 4XU0A 4IUVA 3BDLA 3FB9A 5DY9A 5LL6S 3CC7A 3CCMA 4HKEA 5I2MA 4ME7A 5LJ3f 5GANe 4C8QD 2VXFA 4M75C 3CPWS 1YHQA 4FT2A 1LOJA 3PNWC 4J6XA 1G3SA 2XU8A 4F7UA 4ZGJB 4XTXA 4C0GA 5GAN7 3MCAB 3I55A 2DEQA 2EJ9A 5DLOA 2O4XB 3CMEA 2R57A 3TCJA 4DOWA 2QQ9A 3CBMA 4DA4A 2QQRA 4PJOF 1KQSS 1N8RC 2P0KA 1YBYA 4C0FA 1M90C 2RJCA 3M57A 1JBMA 4GLKA 2DXUA 5DM7R 4JLGA 2R5AA 3HKSA 2CZ6B 2DTOA 3CCRT 2CGHA 4M78E 2BIVA 3MP1A 4C0DC 3JB9J 3VKIA 1M9SA 4R56A 1YIJT 2ZPGB 3CCQT 3CEYA 5GMKe 1BI0A 4M75A 2PQWA 4M78D 2MI6A 3FIFA 3PGGA 2KDSA 3CBPA 5I21A 1K8AU 5GMKj 2DAQA 5J26A 2M0OA 3JRZA 4OB1B 2RHZA 1XOVA 3S6WA 3VUBA 2DIQA 3QKJA 5LJ3d 1VQMT 1QP3A 4KUIA 3OYBA 1M1FA 3V7SA 3T9NA 4CRIA 2LT4A 2A7YA 2KVQG 3CCET 4F7UF 2IVWA 2FL7A 3QO3A 4R55A 1BIBA 3C94A 3SD4A 2GQVA 3OYNA 3I55T 4E7IA 4M7AG 4B9XA 5I2SA 3CMAT 5LJ5d 2RM4A 1Q86U 4ZGDB 2E41A 4Y28E 3LW5E 2M1HA 4HT9A 4HT8A 2QXFA 4EPCA 4NL3A 2PVDB 2RJEA 3HFOA 3SWNC 3S3NA 5LJ5e 1U8RA 1K9MC 1VQ7T 1W4SA 3VYHB 2DK3A 3CCVT 1R8OB 3OS5A 4DQ2A 3LGLA 1KQ1A 1P92A 2CS7A 2YRVA 3BW1A 3OS0A 4XU2A 3GIBA 4C92B 3OBWA 1YJ9A 4PJOG 4UC4A 4WF2A 1WJQA 5LJ3e 1VQOT 1VQ9A 2QI2A 4M7DA 3DLMA 1M5Q1 3PMTA 1MGQA 4BACA 5CIUA 1DJ7B 3E19A 1WQ7A 4C8QG 4M7AE 4HA8A 2WSCE 2Y4YA 4YTLA 2KSSA 5D6WA 2HD0A 5GAOl 4M77G 4C92C 2QQSA 3N5BB 3PMIA 5FU7B 3H8ZA 3QJYA 3CCST 3CCUA 3L2ZA 2DKGA 4BUGA 1M1GA 1O9SA 2XKOC 4N0AC 4P5NA 1FX7A 2MMPA 2RI3A 3A8GB 4PKCC 3QIIA 3JCMf 1JJ2A 3ASKA 1H3ZA 3C95A 3JAME 1RI0A 4FIBA 1UGPB 2P4TA 4FT4A 2HNIA 4M77C 2JTMA 4JUVA 2X4JA 3OW2A 3X20B 3FC3A 3OYJA 3A8MB 4F7UG 4HCBA 2A3LA 1HK9A 4C8QA 3QDRB 4QW2A 4C5GA 4X9DA 4Y91A 3CCVA 1D3BB 4EMKB 5CO7A 1KHIA 1I8FA 3J7AF 2E12A 3CC2A 1BI2A 3PT9A 4IUTA 2LC4A 2MWOA 2F5KA 1QVFS 4BDZA 1FWZA 3G71A 1YJ9T 4FU6A 3L2RA 3ME9A 4J5YA 3JCMW 2P0QA 3G6EA 5GAOr 2JOYA 4KT0E 4JS5A 2XDDA 1YI2A 4LDUA 2F5TX 1N9RA 2IG0A 3INZA 2M9UA 4LDYA 1I81A 2R5MA 2P0PA 3M54A 3P8DA 4MMKA 3MP6A 2B8AA 4MMLA 3E9FA 2PVGB 4C8QE 2XK0A 5GAN6 3GP8A 4NL2A 2DXCA 5CKFA 4A4KA 1BKBA 2K57A 5D6XA 4ZN1A 2EJGA 1N27A 2CKKA 2GCXA 3F70A 4QVZA 2RB6A 4M75G 1B34B 1IREB 1MHNA 1WGSA 4J8OA 3RMSA 4A4EA 4TVRA 4BY6B 4F7UE 5LJ5g 3SB2A 1VQ6T 3VU3C 2JNGA 3OYAA 4JRKA 2QEXT 1QVGA 1X01A 2RK1A 1QVFA 1YJNA 1M1KU 4EMHA 3ER0A 2K5LA 3L2VA 2K3XA 1YCYA 2RJFA 3OYFA 1VQPA 3OYGA 4L6V5 4XU1A 2DXTA 3X26B 1N8RU 2JVVA 5L8RE 4LD6A 1NPRA 2LQ8A 4XTVA 2XD0A 2ZPEB 4A4GA 2QTXA 5GAMg 2ZCFB 2LX9A 1GXIE 3MHXA 2LQKA 4M7AF 3JCMg 1VQ4A 3LWHA 1O75A 3VJPA 2V8JA 3CCLA 3M53A 5HY6A 3JCMe 4N4IA 4JJNK 1PSFA 1N9SA 2LRQA 3UT1A 2EAYA 1SSFA 2JN0A 4FL6A 3FRNA 4QQGA 3L2UA 2RJDA 1BIAA 3X24B 2PU9B 4A4FA 5LJ5j 3PTAA 4C5EA 5CKBA 1KG1A 1VQNT 4M7DD 3ZEHA 3OSSC 1Y96B 1I4K1 3HSBA 3CCEA 3QBYA 3RMQA 1BI3A 3LGFA 5CQXA 2ZPIB 3H6ZA 1YJNT 1QW1A 3A8HB 2O4XA 3QG1A 3GNGA 3OB9A 4RMOA 5GAMj 5GAN2 1Y96A 1VQ7A 3Q1JA 2XDBA 3R6OA 1XTDA 3OW2S 3DKMA 2JZ2A 3J81E 4BE1A 3UPUA 2BUDA 2EYQA 1BYMA 5J39A 1S72A 1NPPA 4O6JA 4XK8E 4GY5A 4M78F 4Z02A 2AHJB 2X35A 3O8VA 5GMKl 1W2BA 1VQ9T 2QDYB 1KC8U 3WVDB 4M7DF 3QSUA 2FVUA 4M75D 3LLRA 4NS5A 1G3WA 3M56A 3CPFA 5IAYA 2GFUA 5GAN8 4ZN3A 3OY9A 4LD9K 2X4YA 4X9CA 4EMGA 3JCMQ 2WACA 3NTKA 2VGMA 3QZ5B 4PL6A 5A0LA 2DD5A 3OYLA 3GPLA 1JJ2S 4MDXA 5CKEA 3FDRA 4PLLA 3KUFA 2VGNA 3SDZA 2L8DA 1VQ5T 3L2WA 2K5FA 1M8VA 5GMKm 1Q81U 1Q82U 2RHIA 2R58A 2ZPBB 5GANh 3JB9I 5FRNA 1ZQ1A 3ZFJA 4FSXA 4Q5WA 3QHSA 4E47A 3CC4A 2O01E 3OYCA 2L3RA 1NJIC 2RHYA 3P8BB 2L89A 2RI5A 4PLIA 1RL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMK A;  2E65 A;  4C8Q E;  5GAN 6;  5LJ3 g;  4MML A;  3SWN B;  4XTY A;  2I2L A;  4NL2 A;  1WPY A;  2K57 A;  2EJG A;  4M75 E;  2FB7 A;  4PJO F;  4RCC A;  2YLC A;  4M75 B;  2RB6 A;  4M75 G;  1B34 B;  1WQW A;  3V8K A;  5CAI A;  4F7U E;  5LJ5 g;  3JCM Q;  1JBM A;  4OP0 A;  2DXU A;  3SB2 A;  3VU3 C;  2DTO A;  4QVC A;  5GAM f;  1LNX A;  4JRK A;  2VXE A;  1X01 A;  2CGH A;  4M78 E;  3JB9 J;  4EMH A;  4JRI A;  4PNO A;  5GAN 5;  1YCY A;  3RKW A;  2E10 A;  4XU1 A;  4C8Q B;  2DXT A;  4C92 F;  5GMK e;  1KQ2 A;  4M75 A;  4M7A A;  4M78 D;  4XTZ A;  3PGG A;  3FIF A;  1LJO A;  4XTV A;  5I21 A;  1TH7 A;  2DTI A;  3RER A;  5GMK j;  2QTX A;  2RD1 A;  5GAM g;  3JB9 D;  3RIR A;  4M7A F;  3JCM g;  4PJO E;  5LJ3 d;  5LJ3 j;  3BY7 A;  5GAN f;  3RUX A;  3V7S A;  4A53 A;  3FJP A;  4M78 A;  3JCM e;  2DTH A;  4M7A C;  2FYK A;  4M7D B;  4F7U F;  2DZC A;  4PJO D;  1N9S A;  3QO3 A;  1BIB A;  2EAY A;  2JN0 A;  4M7A G;  5GAO q;  3RES A;  5GAN d;  5GAN j;  3JB9 F;  2DZ9 A;  1BIA A;  2RM4 A;  5LJ5 j;  4XTW A;  5LJ5 d;  2E41 A;  4M77 E;  5GAO m;  4N0A A;  4M77 B;  2E1H A;  4HT8 A;  4HT9 A;  4NL3 A;  2ZGW A;  1U1S A;  3HFO A;  4M78 C;  3SWN C;  5LJ5 e;  5GAN 3;  4M7D D;  1Y96 B;  4DQ2 A;  1I4K 1;  1KQ1 A;  3HSB A;  1U1T A;  4M77 D;  3JCM V;  3V8L A;  1I5L A;  3BW1 A;  2Y90 A;  4XU2 A;  3GIB A;  4C8Q F;  4M7D E;  1JRI A;  4C92 B;  3JCM c;  4PJO G;  2DJZ A;  4WF2 A;  4C92 E;  3JCM J;  4C92 A;  4J6W A;  3SWN A;  5GAM e;  5LJ3 e;  5GAM h;  4M75 F;  5GMK i;  4M7D A;  4M7A D;  4PJO B;  2EWN A;  1M5Q 1;  4V2S A;  1MGQ A;  5GAM j;  4M78 G;  5GAM d;  3BFM A;  5GAN 2;  1Y96 A;  2E64 A;  3JCM X;  4NOY A;  1WQ7 A;  4C8Q G;  5GAN 4;  4M7A E;  3M4G A;  4HA8 A;  5GMK h;  3JCM d;  3JCM P;  4XU3 A;  4J6Y A;  5GAO l;  4M77 G;  4C92 C;  4JLI A;  4M7D C;  4EMK C;  4PJO C;  3V8J A;  4M78 F;  3L2Z A;  2YHT A;  2DKG A;  4C92 G;  5GMK l;  3BDU A;  5GAN g;  5GAO n;  4N0A C;  4QVD A;  1B34 A;  3AHU A;  3V7R A;  4M7D F;  3JCM h;  4M77 F;  3QSU A;  3JCM f;  4C8Q C;  4M75 D;  5GAO p;  1I81 A;  1H64 1;  4PJO A;  2HNI A;  4M77 C;  3QUI A;  4JUV A;  5GAN 8;  3HFN A;  3V7C A;  4A54 A;  3RKY A;  4M7D G;  4X9C A;  4EMG A;  2DVE A;  2YLB A;  3JCM b;  4M7A B;  4F7U G;  1WNL A;  5LJ5 h;  4XTU A;  5LJ5 f;  1HK9 A;  4C8Q A;  4XQ3 A;  4C92 D;  4F7U B;  4X9D A;  4Y91 A;  1D3B B;  4EMK B;  1I8F A;  4M77 A;  2EJF A;  2RA2 A;  2VC8 A;  3EFR A;  4RCB A;  4XU0 A;  5DY9 A;  3FB9 A;  1M8V A;  5GMK m;  5LJ3 h;  4J5Y A;  3JB9 I;  1HXD A;  5LJ3 f;  5GAN h;  3JCM W;  5GAO r;  5GAN e;  4C8Q D;  3L1A A;  3JB9 G;  1D3B A;  2VXF A;  4M75 C;  4EMK A;  3QHS A;  1LOJ A;  4J6X A;  4M78 B;  1N9R A;  4F7U A;  3EFS A;  3JB9 H;  4XTX A;  3INZ A;  5GAN 7;  2DEQ A;  2EJ9 A;  3RKX A; 
#chains in the Genus database with same CATH topology
 2BKD N;  2CH4 W;  2DL4 A;  2HQE A;  1WIE A;  3NTI A;  4RCC A;  3CCR A;  3EGD A;  1QQJ A;  5IHK A;  3CCL Q;  3M59 A;  2DD4 A;  4RG8 A;  3A8O B;  2LP5 A;  3PIP A;  2O31 A;  1PKS A;  4C8Q B;  3OYD A;  1YHQ Q;  4BD3 A;  3OYM A;  2DTI A;  3CC7 Q;  2K3Y A;  2LMJ A;  1Y7X A;  2QQA A;  3CCQ A;  1PD1 A;  1UGQ B;  3RUX A;  4L5G A;  5HK0 A;  1SHF A;  4J9C A;  1SRL A;  3MEW A;  1RAD B;  2RH2 A;  3E2U A;  4DOV A;  2ZGW A;  5GAN 3;  4EDU A;  2JS0 A;  4OMQ A;  4OMM A;  1M4Z A;  4KH1 B;  4JRQ A;  1QVP A;  2D6F A;  1M8M A;  3VV0 A;  1ZUK A;  2LNH B;  5AT1 B;  2RHX A;  3G1J A;  1KD1 R;  1VQN A;  3G7Z A;  3P8H A;  1OI1 A;  2G3R A;  2FZG B;  3AHU A;  3NGP A;  2LT1 A;  5FRM A;  4M77 F;  4ZGE B;  3I5R A;  3CXC A;  1H64 1;  2DPP B;  1K73 U;  4M7D G;  1ZSZ A;  5FU6 B;  1S72 T;  2MAM A;  1X43 A;  1GBQ A;  2C0T A;  2DXB A;  5AYF A;  1VQN Q;  1IRX A;  4AT1 B;  2EKH A;  3NTH A;  3UWN A;  4ZTF A;  1YI2 T;  3JSC A;  2VVK A;  3LYI A;  1SRM A;  3VS7 A;  1E6G A;  2OAW A;  2MIO A;  3X28 B;  3JB9 G;  3L1A A;  3HRU A;  3PIO A;  4M78 B;  2MF2 A;  1X2K A;  3WXM B;  4AFQ C;  2VUB A;  5KE3 A;  2O88 A;  3DB4 A;  1VQ6 A;  4XTY A;  2I2L A;  5HK3 A;  2OTJ Q;  1JEG A;  2PUK B;  2ZPH B;  2ZPF B;  3CCV Q;  2HAX A;  3EHR A;  3PFS A;  2DNU A;  1YIT T;  4BE2 A;  1K8A R;  1TOV A;  2JTF A;  3EAE A;  3MO8 A;  5DLQ E;  2OI3 A;  2ROL A;  5KYU A;  3EG9 B;  5IN1 A;  3REB B;  1M2O A;  4R0K A;  2FPD A;  1TH7 A;  4N4G A;  4D6W A;  3EHQ A;  3C12 A;  3REA B;  2HQX A;  2X3X D;  3QYH B;  1M90 R;  4DBH A;  5GAN f;  2DL3 A;  4FYW B;  4A53 A;  4M78 A;  2DTH A;  1VQM Q;  4IUR A;  3CBO A;  1KD1 C;  4C5I A;  3RES A;  4M77 E;  2DF6 A;  4N0A A;  3OW2 P;  2CZ0 B;  2J05 A;  3CCJ T;  1UGR B;  1QKX A;  1IZ6 A;  1K9M U;  4HCZ A;  2OTJ A;  2MOX A;  2NUZ A;  3JCM c;  3JCM J;  2COY A;  1LVK A;  2CP5 A;  4V2S A;  1G5V A;  3OA6 A;  4J9G A;  3CCS Q;  4XAX B;  1ZA2 B;  4JLI A;  2KRO A;  3CME T;  4M7D C;  1Q7Y U;  1AHJ B;  1ZBX A;  1RI9 A;  3HRS A;  5A0G A;  2CT3 A;  3VRY A;  1WJS A;  1TTH B;  2NLU A;  1G3T A;  2A08 A;  4M7A B;  3AT1 B;  5LJ5 f;  4F7U B;  1WHJ A;  3A98 A;  1N6A A;  3M0Q A;  2K79 A;  1WXU A;  4BI4 A;  5C0M A;  2C0I A;  4PJM A;  4F04 B;  4RCB A;  3E1S A;  4JZ4 A;  4XU0 A;  2JW4 A;  5LL6 S;  3BDL A;  3FB9 A;  4DEY A;  2H3E B;  4ME7 A;  5LJ3 f;  4CC2 A;  2L3Q A;  3CPW S;  4J6X A;  4F7U A;  3VS3 A;  3I55 A;  1OQK A;  1SHG A;  3TCJ A;  3CBM A;  2CSI A;  2JM9 A;  1KJW A;  2QQR A;  1R0C B;  1M90 C;  1SF9 A;  2NWM A;  2DXU A;  2NUT B;  2CZ6 B;  1IO6 A;  4HVW A;  3GBQ A;  2X51 A;  4C0D C;  2D8H A;  3TVT A;  1C6V X;  2K2M A;  3CEY A;  3VS1 A;  1BI0 A;  3CQT A;  3TSZ A;  2L2P A;  2MI6 A;  3PGG A;  2KDS A;  5I21 A;  1VQ4 Q;  4IIM A;  1YWO A;  2RHZ A;  1XOV A;  3VUB A;  1QP3 A;  2O9S A;  8ATC B;  2LT4 A;  2KVQ G;  2QYZ A;  4R55 A;  3QO3 A;  2GQV A;  1NLP C;  4HT8 A;  4NL3 A;  2PVD B;  3SWN C;  2AZS A;  2EGC A;  3VYH B;  4DQ2 A;  4ESR A;  1P92 A;  2YRV A;  2P84 A;  2RQU A;  4C92 B;  1JXO A;  3PVL A;  2HBW A;  3DLM A;  3VS0 A;  1JJ2 P;  2ATC B;  1DJ7 B;  1TWB A;  1EFN A;  2EGE A;  4C92 C;  1WLP B;  2V1R A;  3QJY A;  1O9S A;  3PE0 A;  1S1N A;  1H3Z A;  2BE9 B;  4FT4 A;  2X4J A;  3FC3 A;  4F7U G;  1GRI A;  1HK9 A;  4C8Q A;  4X9D A;  1D3B B;  4EMK B;  5CO7 A;  3J7A F;  1PC0 A;  4QT7 A;  1G83 A;  2F5K A;  4BDZ A;  1YJ9 T;  4FU6 A;  2J7I A;  2W10 A;  2J6O A;  3SHW A;  1N9R A;  3INZ A;  4LDY A;  2P0P A;  3M54 A;  4MMK A;  4C8Q E;  5GAN 6;  4MML A;  3NMZ C;  2A0F B;  4NL2 A;  2QGF B;  1BKB A;  4PFZ A;  1N27 A;  2HDA A;  3RMS A;  2NUP A;  4M75 G;  1B34 B;  1M27 C;  4A4E A;  5LJ5 g;  2PTK A;  5D7U A;  4EMH A;  3ER0 A;  3L2V A;  2RPN A;  4L6V 5;  2ZCF B;  1TU0 B;  3JCM g;  3CCE Q;  2V8J A;  3CCL A;  3JCM e;  1WXT A;  4JJN K;  1PSF A;  1N9S A;  4HVU A;  2KT1 A;  4QQG A;  3UT1 A;  3FRN A;  2PU9 B;  5FWC A;  1UEC A;  2KRN A;  4FW2 A;  4C5E A;  3OSS C;  1MNE A;  1YIJ Q;  3LGF A;  4HCK A;  5CQX A;  2O4X A;  3GNG A;  2CP3 A;  4AFS C;  2DLP A;  5GJW B;  2CDT A;  2EVR A;  2JZ2 A;  2QK0 A;  4BE1 A;  3UPU A;  2EYQ A;  5J39 A;  1S72 A;  4XK8 E;  3BE3 A;  4M78 F;  2DM1 A;  2X35 A;  3O8V A;  2QGG A;  3UF4 A;  5IXF A;  3R6N A;  1LPL A;  4M75 D;  3M56 A;  3CPF A;  2J6F A;  1I5O B;  2GFU A;  3VS2 A;  2F2V A;  2VGM A;  2DD5 A;  1JJ2 S;  5CKE A;  4PLL A;  3KUF A;  4AMC A;  1Q82 U;  2MK5 A;  1T3S A;  2JTE A;  3ZFJ A;  3QHS A;  3CC4 A;  2O01 E;  2L3R A;  2DYI A;  2RHY A;  2DL8 A;  1M2V A;  4PLI A;  1RL2 A;  3CCM T;  2E65 A;  5CR2 A;  2D0Q B;  3CC2 T;  3G4S T;  1UE9 A;  2Y4X A;  4M75 E;  2FB7 A;  2YLC A;  1UB4 A;  2OAU A;  4J7I A;  5KH6 A;  2DBK A;  2MPX C;  3RKW A;  2XDP A;  1VQM A;  3EH1 A;  4OMN A;  4XTZ A;  2FHD A;  3RNJ A;  3H9N A;  5CQY A;  2JMA A;  4PJO E;  3CD6 A;  2COW A;  2MCN A;  3S3M A;  1VQP Q;  2QQB A;  1VQK Q;  4N4H A;  2LNV A;  5M9O A;  3NFC A;  1N5Z A;  4BI8 B;  4IKF A;  1NBE B;  1OU8 A;  3OS2 A;  1W2B P;  2ROT A;  1E7O A;  3QJ6 A;  1CKB A;  1QCN A;  4IUP A;  4D8K A;  5CK9 A;  2MYS A;  1QVG P;  4C92 E;  1Q7Y C;  2WSE E;  3A5Z B;  2C06 A;  3CCS A;  3CCU T;  3EG3 A;  3L2Q A;  1IGU A;  2DO3 A;  2FG0 A;  3HTR A;  3CD6 T;  2L3S A;  4AG2 C;  1TUD A;  3UA6 A;  3V7R A;  2KMT A;  4RTX A;  4OVA A;  1BK2 A;  5KYW B;  5GAO p;  1U5S A;  3M0T A;  4OMF B;  4VUB A;  4PJO A;  3OMC A;  3EG0 A;  3HFN A;  3RKY A;  1SSH A;  2Z0W A;  2JS2 A;  5LJ5 h;  4BDY A;  3RR6 A;  1D0Z A;  4C92 D;  2SRC A;  3KXT A;  1HD3 A;  4M77 A;  1M1K C;  3X25 B;  4RTY A;  2RA2 A;  1ZSG A;  3UDC A;  3G71 Q;  1G8X A;  1VIF A;  5LJ3 h;  2HL5 C;  3GLX A;  2H3J A;  4BY6 C;  3EH2 A;  3M58 A;  2EQU A;  3SWN B;  3I56 Q;  2DVJ A;  2QEX A;  3M4Y A;  1M1K R;  4PJN A;  4E7K A;  1W2B S;  5CAI A;  2VAS A;  4QQ6 A;  2RI2 A;  2PZ1 A;  4QVC A;  1GBR A;  5GAM f;  2VWF A;  4C0D B;  1CKA A;  2DET A;  3G4S Q;  1KD1 U;  5CKH A;  4PNO A;  1KQ2 A;  4C92 F;  3CCL T;  1LJO A;  4OF1 A;  5KCO A;  2KRS A;  5KYY B;  1A0N B;  1WHM A;  1QP2 A;  2FO0 A;  4KGX B;  3RIR A;  5FU7 C;  1EIF A;  5LJ3 j;  2HBP A;  3FJP A;  4MZT A;  3HL8 A;  2FYK A;  3LX7 A;  1Y57 A;  2CZ1 B;  1NLO C;  4JRP A;  2E6Z A;  4C5H A;  3QWX X;  4F17 A;  1U1S A;  4K11 A;  4RG2 A;  2CH4 A;  1QWF A;  2LCC A;  4M7A D;  5GAM h;  2QA4 A;  4PJO B;  5GMK i;  1AD5 A;  1X75 C;  2X9H A;  5KYX B;  3CPW P;  1WX6 A;  1MV3 A;  5CKD A;  5FRO A;  1YHQ T;  2VV5 A;  3OYK A;  3JCM P;  3MP8 A;  4JPB W;  4XU3 A;  4J6Y A;  4B9W A;  1J3T A;  5A0D A;  1LCK A;  3V8J A;  5KCH A;  3BDU A;  4IUQ A;  2E5Q A;  1U3O A;  2FZC B;  2AK5 A;  2CUD A;  3MEU A;  3G6E T;  3MEV A;  2DE0 X;  3OYE A;  4RUG A;  1QVG S;  2DVE A;  3M55 A;  1WHL A;  1KK7 A;  4XTU A;  1Y71 A;  3CCJ A;  1YJW A;  2M0Y A;  5KE2 A;  1VYV A;  2RK2 A;  1OPK A;  3OYY A;  4J9B A;  2E5K A;  4J9I A;  4LUD A;  1QCO A;  1LOJ A;  4FT2 A;  1G3S A;  5GAN 7;  1Q81 R;  9ATC B;  4PJO F;  1KQS S;  1GCQ A;  1YBY A;  4C0F A;  2RJC A;  1BCO A;  3EFO B;  4GLK A;  2EQI A;  2CSQ A;  2DRM A;  3MP1 A;  2CT4 A;  4R56 A;  1YIJ T;  2BZX A;  5KYX A;  1YI2 Q;  4M75 A;  1K8A U;  2W0Z A;  2DIL A;  2DAQ A;  2M0O A;  3JRZ A;  4Y92 A;  3S6W A;  2DIQ A;  5LJ3 d;  1M2V B;  1M1F A;  3CCJ Q;  2BE7 D;  3T9N A;  4CRI A;  3CCE T;  2A7Y A;  2IVW A;  2FL7 A;  1K76 A;  3SD4 A;  4M7A G;  4E7I A;  1BBZ A;  5LJ5 d;  2RM4 A;  1X2Q A;  4ZGD B;  1ZLM A;  4D8D A;  1VQ7 T;  1KC8 R;  3CCV T;  2NUP B;  1KQ1 A;  1ZUU A;  3OBW A;  1YJ9 A;  1S72 Q;  2YUP A;  4RTT A;  1VQ9 A;  1VQO T;  4M7D A;  3SEM A;  1MGQ A;  4KGV B;  4C8Q G;  2L3P A;  2X3W D;  2WSC E;  4YTL A;  3MPU B;  2QQS A;  3N5B B;  5FU7 B;  3CCS T;  3CCU A;  1E6H A;  2HZY A;  1FX7 A;  2RI3 A;  3VS5 A;  3JCM f;  1JJ2 A;  3C95 A;  1VQ5 Q;  2P4T A;  2HNI A;  4M77 C;  3X20 B;  1TS9 A;  4HXJ A;  3OYJ A;  2A3L A;  1W1F A;  4QW2 A;  4C5G A;  7AT1 B;  3CCV A;  3CC2 A;  1BI2 A;  3PT9 A;  1ABQ A;  2EYY A;  3L2R A;  3ME9 A;  4J5Y A;  1X6G A;  2P0Q A;  3JCM W;  2JOY A;  1ABO A;  3VS4 A;  2QA4 Q;  3P8D A;  3MP6 A;  5CKF A;  2DXC A;  2K57 A;  2CKK A;  1TUG B;  1MHN A;  1IRE B;  1WGS A;  5FWB A;  2QEX Q;  3SB2 A;  4FYV B;  3VU3 C;  2RK1 A;  1VA7 A;  1X27 A;  4E6R A;  1M1K U;  2K3X A;  3OYF A;  1VQP A;  1RAB B;  4XU1 A;  1VQ8 Q;  3CC4 Q;  5IHI A;  1NPR A;  1HYO A;  2GGR A;  2ZPE B;  4A4G A;  1GXI E;  1MMN A;  3RBB B;  3LWH A;  3M53 A;  4RMO A;  4FL6 A;  1WYX A;  3X24 B;  4A4F A;  2FRW A;  3PTA A;  1GL5 A;  5CKB A;  1KG1 A;  1VQN T;  2EYW A;  1I4K 1;  3QBY A;  2J06 A;  1OX8 A;  2K6D A;  2ZPI B;  4J9D A;  2DYB A;  4JJB A;  3A8H B;  3OB9 A;  5GAM j;  2COZ A;  1XTD A;  3DKM A;  2HQH A;  2BUD A;  4O6J A;  2YRD A;  1PD0 A;  2AHJ B;  2KT8 A;  2DFU A;  1VQ9 T;  1UTI A;  3LH5 A;  4M7D F;  1HSQ A;  1QMC A;  3QSU A;  1GFD A;  3LLR A;  2F1L A;  2EW3 A;  2J6K A;  3OY9 A;  4LD9 K;  4X9C A;  4AFZ C;  3QZ5 B;  1AVZ C;  1M3C A;  1YP5 A;  1B7T A;  3FDR A;  2KR3 A;  3SDZ A;  3I5S A;  3L2W A;  1M8V A;  1FMK A;  5GMK m;  1Q81 U;  4GLM A;  1Z9Z A;  1I1J A;  4FW1 A;  3JB9 I;  4Q5W A;  1WHH A;  3P8B B;  2LJ3 A;  2RI5 A;  1WHG A;  3GF5 A;  4IUU A;  3L42 A;  4JDS A;  4OGC A;  1WPY A;  4C0Z A;  4MZM A;  1AT1 B;  1C1A A;  3OYI A;  5EC7 A;  4CC3 A;  1M90 U;  4OP0 A;  4MDW A;  2DMO A;  1IGQ A;  3WVE B;  5FU6 C;  2EPD A;  2HL3 A;  2JT4 A;  4E7H A;  1VQK A;  1H3H A;  2P4R A;  1PRL C;  1JU5 C;  2F2X A;  3JB9 D;  2CZ7 B;  1D1B A;  1UEB A;  3QXE B;  3BY7 A;  3OYH A;  4CI0 C;  1KQS A;  5KYU B;  1WZO A;  2RMO A;  1IB8 A;  3OS1 A;  5GAO q;  4DBQ A;  1UJY A;  2DZ9 A;  2EYX A;  5GAO m;  2F69 A;  4M78 C;  1MUZ A;  1VQ4 T;  4LE9 A;  2JM8 A;  2Y90 A;  1KC8 C;  1ZSZ C;  4M7D E;  4OGE A;  2VYT A;  3H0H A;  4C92 A;  4J6W A;  5GAM e;  1Y07 A;  1BB9 A;  4ANJ A;  5GAM d;  2KI7 A;  4NOY A;  3GNF B;  3KBG A;  3M4G A;  4EIK A;  1TUC A;  4KUL A;  2A28 A;  3OMG A;  5IH2 A;  1W70 A;  2X4W A;  2RQW A;  2X4X A;  4LDV A;  3ULR B;  5GAN g;  2E6N A;  1B34 A;  2MWP A;  3E9G A;  3DB3 A;  2V8I A;  1OZ2 A;  4C8Q C;  1Z9Q A;  2O9V A;  2YUN A;  4PFP A;  2KK4 A;  1WNL A;  3HP9 A;  4XQ3 A;  3TEE A;  1U06 A;  1M30 A;  2VC8 A;  2QDL A;  5EG2 A;  1RAC B;  1NM7 A;  2NUT A;  1K0S A;  4J7F A;  1D3B A;  2EIF A;  4EMK A;  4II1 A;  1VQ8 A;  4CC4 B;  1UGS B;  1NJI R;  4RTU A;  2O2O A;  1XQH A;  1JB0 E;  1VQ5 A;  1OU9 A;  2IPO B;  3EG9 A;  4ELY C;  3V8K A;  3S3O A;  1UG1 A;  2KQW A;  1NYF A;  2OTJ T;  4X1V A;  2WSF E;  1VQ6 Q;  1LNX A;  2VXE A;  1GCQ C;  2QA4 T;  2M16 A;  3OBY A;  1ARK A;  1PRM C;  4ELZ C;  2EQJ A;  1IXD A;  4JJC A;  3THK A;  2PUO B;  1Q82 C;  4M7A A;  2GF7 A;  3CMA A;  4FM4 B;  1YWP A;  2RD1 A;  1FXX A;  1OUL A;  3MET A;  4OB2 B;  3TU4 K;  1NJI U;  2XIC A;  1V29 B;  2DZC A;  3M0R A;  2K9G A;  5D6Y A;  4XTW A;  5I11 A;  1VUB A;  2E1H A;  4KBM B;  4HVV A;  3EG1 A;  1U1T A;  1YJW T;  1OYX A;  2K2V A;  2HEQ A;  2LVM A;  3EG2 A;  2DJZ A;  1OOT A;  1UHF A;  4M75 F;  2EWN A;  1UGV A;  5GAN 4;  2RQT A;  2AKK A;  2OX7 A;  4E7Z A;  1VQ7 Q;  2HMA A;  2L5Q A;  3J80 E;  3M0U A;  4PFO A;  1B3Q A;  3M5A A;  1AWO A;  3QZ9 B;  2ZZD A;  2EQM A;  2AZV A;  4B6M A;  2CYZ B;  2YHT A;  1R77 A;  4C92 G;  2BZ8 A;  3SFM A;  3QYG B;  4FYX B;  2M51 A;  3FEO A;  4E7J A;  1FYN A;  1D0X A;  1AEY A;  1VOM A;  3V7C A;  4PK4 A;  3IQL A;  1PHT A;  4BI3 A;  1D09 B;  3MKD A;  3EFR A;  2B86 A;  3CCM A;  3CC7 A;  2K3B A;  2ECZ A;  2V26 A;  1CSK A;  5IHN A;  4C8Q D;  1YHQ A;  1YFN A;  3PNW C;  1EX4 A;  3EGU A;  4XTX A;  4C0G A;  3UAT A;  3MCA B;  2VB6 A;  5DLO A;  1G2B A;  4RTV A;  2R57 A;  4DOW A;  1V1C A;  2QQ9 A;  3CCM Q;  1M3A A;  1WDX A;  2P0K A;  3CCR Q;  4OMP A;  5DM7 R;  4JLG A;  1Q86 R;  1VQO Q;  3EGX A;  2CGH A;  1HJD A;  2YRC A;  4ZNX A;  1M9S A;  2PNI A;  2ZPG B;  2D1X A;  2DJQ A;  4M78 D;  3FIF A;  1ZSZ B;  2LJ0 A;  5J26 A;  2RN8 A;  4JZ3 A;  1T3L A;  4OB1 B;  3QKJ A;  3O5Z A;  1VQM T;  2HKQ B;  5L23 A;  4KUI A;  3OYB A;  1YJW Q;  3OYN A;  3I55 T;  5I2S A;  3CMA T;  2DEU A;  4Y28 E;  3LW5 E;  4HT9 A;  4QKU A;  3S3N A;  1U8R A;  2DK3 A;  6AT1 B;  3BW1 A;  1PNJ A;  4UC4 A;  4DBF A;  3M0P A;  2YUO A;  1M5Q 1;  3PMT A;  4BAC A;  3E19 A;  1WQ7 A;  2LCS A;  2KSS A;  5GAO l;  4M77 G;  5HCK A;  4AFU C;  3PMI A;  4KGZ B;  3L2Z A;  4BUG A;  2XKO C;  4N0A C;  4PKC C;  4P5N A;  2MMP A;  2C0O A;  1D1A A;  3CCU Q;  1SEM A;  2BTT A;  1AZE A;  4Z88 A;  2HKN A;  3A8M B;  4HCB A;  2HSE B;  1TSF A;  4Y91 A;  2IIM A;  3A1P A;  3CD6 Q;  4WTO B;  2E12 A;  2FZK B;  3U23 A;  2MWO A;  1FWZ A;  2HCK A;  5GAO r;  4KT0 E;  4LDU A;  1T0J A;  2CP0 A;  1PWT A;  3EGD B;  1KQS P;  1I81 A;  3RKX A;  4M7D B;  1M3B A;  2B8A A;  3E9F A;  2PVG B;  2XK0 A;  1IHW A;  2KYM A;  2EJG A;  3CC2 Q;  3F70 A;  4J8O A;  3JCM Q;  4F7U E;  4TVR A;  4BY6 B;  2JNG A;  1QVG A;  1X01 A;  1KIK A;  2K5L A;  2YT6 A;  1ACM B;  3OYG A;  1N8R U;  2DXT A;  3X26 B;  2LQ8 A;  4XTV A;  2EGA A;  1JQQ A;  2QTX A;  3MHX A;  2LQK A;  4CC7 A;  2NYS A;  1BCM A;  3VJP A;  4IIO A;  1I0C A;  5HY6 A;  4N4I A;  2RNA A;  2FEI A;  2LQW A;  2LRQ A;  2EAY A;  3L2U A;  2RJD A;  1BIA A;  2KGT A;  5LJ5 j;  3I55 Q;  1ZUY A;  1D0Y A;  2OTL Q;  1Y96 B;  2EYZ A;  4OMO A;  1BI3 A;  2GQI A;  2RQV A;  1B07 A;  1YJN T;  3H6Z A;  1QW1 A;  2ED1 A;  1PCX A;  2FPE A;  5GAN 2;  1QLY A;  3Q1J A;  4FSS A;  2XDB A;  2K7A A;  1ZBJ A;  1JXM A;  3J81 E;  2E3I A;  4Z02 A;  1W2B A;  2QDY B;  1KC8 U;  1RUW A;  3WVD B;  2FPF A;  1PKT A;  4F14 A;  3NHN A;  5IAY A;  5GAN 8;  2LZ6 B;  3NPF A;  2G6F X;  1RAG B;  2X4Y A;  2CP6 A;  3NTK A;  3H0I A;  4PL6 A;  1WXB A;  4MDX A;  2VGN A;  2A36 A;  1VQ5 T;  2KXD A;  1AWX A;  5FRN A;  5GAN h;  5FW9 A;  4FSX A;  3OYC A;  2L89 A;  2QTV A;  3GPL A;  4ORZ A;  2XG8 D;  3C0C A;  1KHC A;  2DX1 A;  2PVO B;  1WJR A;  2CUB A;  5FLX E;  4LDX A;  4M75 B;  1WQW A;  1VIE A;  5CCA A;  1X69 A;  5C6S A;  3KFV A;  2DIG A;  2YWW A;  1VQL T;  1X6O A;  1RLP C;  3EFO A;  4LNP A;  2JMC A;  1UUE A;  2KYB A;  1UFF A;  2E10 A;  4GBQ A;  4J83 A;  3RER A;  1NZ9 A;  1XNI A;  1PM3 A;  2RF0 A;  1YJ9 Q;  1YIJ A;  1D1C A;  2D9T A;  2YSQ A;  4M7A C;  4ZTJ A;  3CC4 T;  2A37 A;  3G4S A;  2FRY A;  3H41 A;  5GAN j;  3JB9 F;  1AOJ A;  2GTJ A;  2EKO A;  3JV3 A;  4X34 A;  1K1Z A;  2JXB A;  3V8L A;  2JJ9 A;  2AKL A;  3CCQ Q;  5IT9 E;  5J3B A;  1K4U S;  2EBP A;  3SWN A;  3OSV A;  1VQL A;  3VYG A;  5A2Q E;  3CXC S;  2OTL T;  3BFM A;  3JCM X;  4OML A;  1VQ8 T;  5GMK h;  1WFW A;  3JCM d;  3DLL A;  3ZL7 C;  2KY9 A;  4EMK C;  2KE9 A;  4OB0 B;  2CRE A;  4QVD A;  3JCM h;  4F16 A;  2RHU A;  2L0A A;  3QPH A;  4J9H A;  3LH0 A;  4DEX A;  3HHT B;  1MND A;  1YIT A;  3QUI A;  2XI9 A;  3G71 T;  2V8K A;  2YLB A;  3JCM b;  2E4H A;  1Q86 C;  4JS4 A;  1UJ0 A;  3QWY A;  4BE0 A;  1ZX6 A;  1SKU B;  5IXB A;  1PG5 B;  1BI1 A;  1HXD A;  1ZHI A;  4RTZ A;  1OZ3 A;  2KEA A;  1AZG B;  3JB9 H;  3EFS A;  1Q95 G;  1G3Y A;  3OQ5 A;  4E2F B;  5LJ3 g;  4FYY B;  4BB7 A;  2GFA A;  1VYT A;  1KSW A;  4LDW A;  4ATO A;  2LTO A;  4DBR A;  4A4H A;  3I56 T;  1V76 A;  1T0H A;  3RDV A;  1Q82 R;  4QQD A;  1WHK A;  4JRI A;  5GAN 5;  1NE8 A;  3ZBD A;  3CXC P;  2LJ1 A;  5CVI A;  3I35 A;  4E7L A;  2VKN A;  1VQP T;  3HPW A;  2LCL A;  1VQK T;  1RAA B;  4PJO D;  1Q81 C;  2EQK A;  4OB3 B;  4KUD K;  5GAN d;  1VQO A;  1YNZ A;  2D0N A;  2DL7 A;  4M77 B;  3TRE A;  2JUF A;  1C0M A;  2GBQ A;  1TG0 A;  1Y0M A;  1X6B A;  4M77 D;  3JCM V;  1I5L A;  1RLQ C;  2EFI A;  3I56 A;  2E70 A;  4C8Q F;  1JRI A;  3CC7 T;  5KYW A;  3CME Q;  2XHC A;  1IHV A;  3VUZ A;  4MZP A;  1RAF B;  4M78 G;  4O5V A;  3A8L B;  1RAE B;  2E64 A;  1I07 A;  5HKC A;  2LDM A;  2CP2 A;  4HCC A;  2DA9 A;  4PJO C;  4L59 A;  4LN2 A;  5GAO n;  2KAF A;  2RO0 A;  1KFZ A;  2OTL A;  1ZA1 B;  2V1Q A;  3URG A;  3GOX A;  1PSE A;  3HRT A;  1K73 C;  3M9Q A;  4A54 A;  3MEA A;  1K8A C;  2KXC A;  2SEM A;  3C4S A;  3LWI A;  2K5I A;  2K4Y A;  1WA7 A;  2XID A;  3FLG A;  1YCS B;  4RKU E;  1N8R R;  3G6E Q;  2EJF A;  2QG9 B;  4IUV A;  5DY9 A;  4HKE A;  5I2M A;  1BU1 A;  1QKW A;  1K0X A;  2DER A;  5GAN e;  1NG2 A;  2VXF A;  4M75 C;  1K9M R;  4ZGJ B;  2XU8 A;  2DEQ A;  2EJ9 A;  2KNB B;  2O4X B;  1R0B G;  3CME A;  4DA4 A;  4J9F A;  1N8R C;  2LX7 A;  3M57 A;  1JBM A;  5ECA A;  2R5A A;  3HKS A;  2DTO A;  3TSW A;  3CCR T;  4M78 E;  2BIV A;  3JB9 J;  3VKI A;  2KRM A;  3CCQ T;  2YDL A;  5GMK e;  2PQW A;  3CBP A;  5GMK j;  1WI7 A;  3V7S A;  1MMD A;  4F7U F;  1BIB A;  1QCF A;  3C94 A;  4Z89 A;  4B9X A;  1YIT Q;  2E41 A;  2BZY A;  2M1H A;  2KBT A;  2QXF A;  4EPC A;  2RJE A;  3HFO A;  1BYM A;  1QVF A;  5LJ5 e;  1YN8 A;  1K9M C;  1AWW A;  1W4S A;  1R8O B;  3OS5 A;  3LGL A;  2CS7 A;  3OS0 A;  4XU2 A;  3GIB A;  4PJO G;  4WF2 A;  1WJQ A;  5LJ3 e;  5KYY A;  2QI2 A;  1JO8 A;  2DRK A;  5CIU A;  4M7A E;  4HA8 A;  2Y4Y A;  2E3H A;  1NEB A;  5D6W A;  2HD0 A;  1K73 R;  3TQ7 P;  4E7S A;  3H8Z A;  2AT1 B;  2DKG A;  8AT1 B;  1M1G A;  3A8G B;  3M0S A;  3QII A;  3VRZ A;  3ASK A;  3JAM E;  1RI0 A;  4FIB A;  1UGP B;  2JTM A;  4JUV A;  3OW2 A;  1K9A A;  5GJV B;  1MV0 B;  1MMG A;  2GNC A;  3QDR B;  1OEB A;  1QWE A;  1TXQ A;  1KHI A;  1I8F A;  1OPL A;  4IUT A;  2LC4 A;  1QVF S;  4PJL A;  2GTO A;  3G71 A;  1FMW A;  2LQN A;  3G6E A;  2ZAE A;  3I9Q A;  1OV3 A;  4JS5 A;  2XDD A;  1YI2 A;  2F5T X;  2IG0 A;  2M9U A;  2AIR B;  2R5M A;  3CPW A;  4FCY A;  3GP8 A;  4A4K A;  4LUE A;  5D6X A;  2H8H A;  2CP7 A;  4WCI A;  4ZN1 A;  1XJW B;  2YXY A;  2GCX A;  4QVZ A;  2RB6 A;  4AG1 C;  1Q86 U;  3UA7 A;  1VQ6 T;  3OYA A;  4JRK A;  2QEX T;  1UHC A;  1YJN A;  4J9E A;  2M02 A;  4A63 B;  1EZZ B;  1YCY A;  2RJF A;  3MJX A;  2DL5 A;  1GCP A;  3FJ5 A;  4KH0 B;  2JVV A;  1SG5 A;  4LD6 A;  5L8R E;  2XD0 A;  3QDF A;  5GAM g;  2I0N A;  2LX9 A;  4M7A F;  3CMA Q;  1RAH B;  1VQ4 A;  3VS6 A;  1O75 A;  1NYG A;  1OX9 A;  1SSF A;  2JN0 A;  3EGX B;  2XMF A;  1GFC A;  3H0F A;  1Q7Y R;  1AWJ A;  1UDL A;  4M7D D;  2ESW A;  3ZEH A;  2DBM A;  3HSB A;  3CCE A;  3RMQ A;  1QVF P;  3QG1 A;  4LXC A;  3PVQ A;  1Y96 A;  1VQ7 A;  3R6O A;  1VYU A;  1H92 A;  3OW2 S;  4M4Z A;  2ENM A;  1YJN Q;  1VQ9 Q;  1H8K A;  1NPP A;  4PJJ A;  2ABL A;  4GY5 A;  5KYN A;  5GMK l;  2QAS A;  1RAI B;  1SPK A;  2D8J A;  4Z8A A;  2FVU A;  2F2W A;  1G3W A;  2ED0 A;  4NS5 A;  4ZN3 A;  1NEG A;  1MMA A;  2HSP A;  2RQR A;  4EMG A;  3D7S B;  4KRT A;  2YUQ A;  1W6X A;  1FMV A;  5I22 A;  2WAC A;  5A0L A;  3OYL A;  4RTW A;  2L8D A;  2K5F A;  4JJD A;  2RHI A;  2R58 A;  2ZPB B;  1ZQ1 A;  4E47 A;  1NJI C;  2QAZ A;  2OJ2 A;  1F1B B;  1VQL Q; 
#chains in the Genus database with same CATH homology
 2E65 A;  2XG8 D;  1KHC A;  3GF5 A;  3L42 A;  2BKD N;  4IUU A;  2D0Q B;  2PVO B;  4JDS A;  4OGC A;  5CR2 A;  1WJR A;  3CC2 T;  1WPY A;  3G4S T;  4C0Z A;  2HQE A;  4MZM A;  2Y4X A;  4M75 E;  2FB7 A;  3NTI A;  4RCC A;  2YLC A;  4M75 B;  5FLX E;  3CCR A;  4LDX A;  3OYI A;  1UB4 A;  1WQW A;  2OAU A;  4J7I A;  1M90 U;  1VIE A;  4OP0 A;  4MDW A;  5CCA A;  3M59 A;  5C6S A;  2DD4 A;  2DIG A;  4RG8 A;  5KH6 A;  3WVE B;  5FU6 C;  3A8O B;  1VQL T;  1X6O A;  3PIP A;  4E7H A;  1VQK A;  3RKW A;  2XDP A;  1VQM A;  2E10 A;  4C8Q B;  3OYD A;  4BD3 A;  4J83 A;  4XTZ A;  3OYM A;  2FHD A;  3RER A;  2DTI A;  1NZ9 A;  1XNI A;  2K3Y A;  5CQY A;  3JB9 D;  2CZ7 B;  1Y7X A;  1UEB A;  3QXE B;  4PJO E;  1YIJ A;  2QQA A;  3CCQ A;  3BY7 A;  3CD6 A;  3OYH A;  4CI0 C;  1UGQ B;  2D9T A;  3RUX A;  1KQS A;  4M7A C;  4L5G A;  3S3M A;  4ZTJ A;  2QQB A;  3CC4 T;  5HK0 A;  4N4H A;  3OS1 A;  2LNV A;  5GAO q;  5M9O A;  3G4S A;  3MEW A;  5GAN j;  3JB9 F;  3NFC A;  2DZ9 A;  5GAO m;  2RH2 A;  4BI8 B;  2EKO A;  2F69 A;  4IKF A;  4DOV A;  2ZGW A;  4M78 C;  5GAN 3;  3OS2 A;  1VQ4 T;  4X34 A;  3QJ6 A;  3V8L A;  4EDU A;  2Y90 A;  4IUP A;  3CPW A;  5CK9 A;  1M4Z A;  1KC8 C;  4M7D E;  4OGE A;  5IT9 E;  4JRQ A;  5J3B A;  1QVP A;  2VYT A;  4C92 E;  2WSE E;  3VV0 A;  1Q7Y C;  4C92 A;  4J6W A;  3SWN A;  5GAM e;  1Y07 A;  3OSV A;  3A5Z B;  2RHX A;  1VQL A;  2C06 A;  3CCS A;  3CCU T;  3VYG A;  5A2Q E;  5GAM d;  3CXC S;  2OTL T;  3BFM A;  3L2Q A;  3JCM X;  4NOY A;  1VQN A;  1VQ8 T;  3GNF B;  3KBG A;  3M4G A;  5GMK h;  3JCM d;  3DLL A;  3CCM T;  2KY9 A;  4KUL A;  3G7Z A;  3OMG A;  3P8H A;  4EMK C;  2DO3 A;  1OI1 A;  2X4W A;  3CD6 T;  2G3R A;  2X4X A;  4LDV A;  4OB0 B;  5GAN g;  2E6N A;  4QVD A;  1B34 A;  3AHU A;  2LT1 A;  2KMT A;  2MWP A;  3DB3 A;  3E9G A;  4M77 F;  3JCM h;  3V7R A;  5FRM A;  2RHU A;  1OZ2 A;  2V8I A;  4OVA A;  4C8Q C;  4ZGE B;  5GAO p;  3CXC A;  3QPH A;  3LH0 A;  1H64 1;  3HHT B;  4OMF B;  4VUB A;  2DPP B;  4PJO A;  3OMC A;  1YIT A;  3QUI A;  1K73 U;  3HFN A;  4M7D G;  3RKY A;  2KK4 A;  2XI9 A;  3G71 T;  2V8K A;  5FU6 B;  1S72 T;  2MAM A;  2YLB A;  3JCM b;  2DXB A;  5AYF A;  1WNL A;  4JS4 A;  1Q86 C;  5LJ5 h;  3HP9 A;  4BDY A;  4BE0 A;  3NTH A;  4XQ3 A;  3TEE A;  3UWN A;  4C92 D;  4ZTF A;  1YI2 T;  3KXT A;  3JSC A;  4M77 A;  1M1K C;  3LYI A;  3X25 B;  2RA2 A;  2VC8 A;  5EG2 A;  3UDC A;  1BI1 A;  1VIF A;  5LJ3 h;  1HXD A;  1ZHI A;  4J7F A;  3JB9 G;  3X28 B;  3L1A A;  1D3B A;  2EIF A;  4EMK A;  4II1 A;  3HRU A;  1OZ3 A;  1VQ8 A;  3PIO A;  4M78 B;  3GLX A;  2MF2 A;  3EFS A;  3WXM B;  3JB9 H;  2H3J A;  1UGS B;  1G3Y A;  2VUB A;  4BY6 C;  3OQ5 A;  5KE3 A;  3M58 A;  2EQU A;  3DB4 A;  5LJ3 g;  1XQH A;  1JB0 E;  3SWN B;  1VQ6 A;  4XTY A;  2I2L A;  5HK3 A;  1VQ5 A;  4BB7 A;  2GFA A;  2PUK B;  2ZPH B;  2QEX A;  3M4Y A;  2ZPF B;  4E7K A;  4ELY C;  3V8K A;  1W2B S;  5CAI A;  3PFS A;  2HAX A;  4LDW A;  4ATO A;  2LTO A;  3S3O A;  4QQ6 A;  1YIT T;  2KQW A;  2RI2 A;  4A4H A;  4BE2 A;  4QVC A;  3I56 T;  5GAM f;  2WSF E;  2OTJ T;  1LNX A;  4C0D B;  2D6F A;  2VXE A;  1KD1 U;  4QQD A;  2JTF A;  3EAE A;  3MO8 A;  5CKH A;  5DLQ E;  4JRI A;  4PNO A;  5GAN 5;  2QA4 T;  2M16 A;  1NE8 A;  3OBY A;  3ZBD A;  4ELZ C;  2EQJ A;  1KQ2 A;  4C92 F;  3CCL T;  2PUO B;  1Q82 C;  5IN1 A;  4M7A A;  2GF7 A;  1LJO A;  4OF1 A;  5KCO A;  4FM4 B;  1TH7 A;  3CMA A;  4N4G A;  5CVI A;  1QP2 A;  4D6W A;  2RD1 A;  1FXX A;  3C12 A;  3RIR A;  2HQX A;  3MET A;  3QYH B;  4OB2 B;  4E7L A;  5FU7 C;  1EIF A;  5LJ3 j;  3TU4 K;  1VQP T;  3HPW A;  2LCL A;  5GAN f;  2HBP A;  1VQK T;  1NJI U;  4A53 A;  4M7D B;  3FJP A;  2XIC A;  4M78 A;  2DTH A;  1V29 B;  2FYK A;  3HL8 A;  4MZT A;  2DZC A;  4IUR A;  3CBO A;  1KD1 C;  4PJO D;  3LX7 A;  1Q81 C;  2EQK A;  4C5I A;  4OB3 B;  3RES A;  4KUD K;  5GAN d;  1VQO A;  2CZ1 B;  5D6Y A;  4XTW A;  4M77 E;  4JRP A;  1VUB A;  4N0A A;  2E6Z A;  4C5H A;  4M77 B;  2E1H A;  4KBM B;  3TRE A;  2CZ0 B;  3CCJ T;  1U1S A;  1UGR B;  2JUF A;  1IZ6 A;  1K9M U;  1U1T A;  4M77 D;  4RG2 A;  3JCM V;  1YJW T;  1I5L A;  1OYX A;  2EFI A;  4HCZ A;  3I56 A;  2K2V A;  2E70 A;  2OTJ A;  4C8Q F;  1JRI A;  3JCM c;  2LVM A;  2DJZ A;  3JCM J;  2LCC A;  4M7A D;  5GAM h;  2QA4 A;  4PJO B;  4M75 F;  5GMK i;  3CC7 T;  2EWN A;  2XHC A;  1X75 C;  4V2S A;  1G5V A;  3VUZ A;  4MZP A;  3OA6 A;  4M78 G;  4O5V A;  5CKD A;  3A8L B;  5GAN 4;  2E64 A;  5FRO A;  1YHQ T;  2VV5 A;  3OYK A;  3J80 E;  2L5Q A;  3JCM P;  3MP8 A;  4XU3 A;  5HKC A;  2LDM A;  4J6Y A;  4XAX B;  3M5A A;  4HCC A;  3QZ9 B;  4B9W A;  4JLI A;  3CME T;  4M7D C;  2ZZD A;  2EQM A;  4PJO C;  5A0D A;  3V8J A;  2CYZ B;  2YHT A;  1Q7Y U;  5KCH A;  4L59 A;  4C92 G;  3SFM A;  1AHJ B;  3BDU A;  1ZBX A;  3QYG B;  4IUQ A;  5GAO n;  2KAF A;  2RO0 A;  2E5Q A;  3FEO A;  3HRS A;  5A0G A;  4E7J A;  2OTL A;  3URG A;  3GOX A;  1WJS A;  1PSE A;  3HRT A;  1K73 C;  3MEU A;  2NLU A;  3M9Q A;  3G6E T;  3MEV A;  3V7C A;  1G3T A;  3MEA A;  4A54 A;  3OYE A;  1QVG S;  2DVE A;  1K8A C;  3C4S A;  3M55 A;  3LWI A;  4M7A B;  4XTU A;  1Y71 A;  2K5I A;  3RKX A;  4F7U B;  5LJ5 f;  3CCJ A;  2K4Y A;  4BI3 A;  5KE2 A;  1YJW A;  1N6A A;  3FLG A;  2XID A;  4BI4 A;  5C0M A;  2RK2 A;  4RKU E;  3OYY A;  2EJF A;  4RCB A;  3E1S A;  3EFR A;  4XU0 A;  4IUV A;  3BDL A;  3FB9 A;  5DY9 A;  5LL6 S;  3CC7 A;  3CCM A;  4HKE A;  5I2M A;  4ME7 A;  5LJ3 f;  5GAN e;  4C8Q D;  2VXF A;  4M75 C;  3CPW S;  1YHQ A;  4FT2 A;  1LOJ A;  3PNW C;  4J6X A;  1G3S A;  2XU8 A;  4F7U A;  4ZGJ B;  4XTX A;  4C0G A;  5GAN 7;  3MCA B;  3I55 A;  2DEQ A;  2EJ9 A;  5DLO A;  2O4X B;  3CME A;  2R57 A;  3TCJ A;  4DOW A;  2QQ9 A;  3CBM A;  4DA4 A;  2QQR A;  4PJO F;  1KQS S;  1N8R C;  2P0K A;  1YBY A;  4C0F A;  1M90 C;  2RJC A;  3M57 A;  1JBM A;  4GLK A;  2DXU A;  5DM7 R;  4JLG A;  2R5A A;  3HKS A;  2CZ6 B;  2DTO A;  3CCR T;  2CGH A;  4M78 E;  2BIV A;  3MP1 A;  4C0D C;  3JB9 J;  3VKI A;  1M9S A;  4R56 A;  1YIJ T;  2ZPG B;  3CCQ T;  3CEY A;  5GMK e;  1BI0 A;  4M75 A;  2PQW A;  4M78 D;  2MI6 A;  3FIF A;  3PGG A;  2KDS A;  3CBP A;  5I21 A;  1K8A U;  5GMK j;  2DAQ A;  5J26 A;  2M0O A;  3JRZ A;  4OB1 B;  2RHZ A;  1XOV A;  3S6W A;  3VUB A;  2DIQ A;  3QKJ A;  5LJ3 d;  1VQM T;  1QP3 A;  4KUI A;  3OYB A;  1M1F A;  3V7S A;  3T9N A;  4CRI A;  2LT4 A;  2A7Y A;  2KVQ G;  3CCE T;  4F7U F;  2IVW A;  2FL7 A;  3QO3 A;  4R55 A;  1BIB A;  3C94 A;  3SD4 A;  2GQV A;  3OYN A;  3I55 T;  4E7I A;  4M7A G;  4B9X A;  5I2S A;  3CMA T;  5LJ5 d;  2RM4 A;  1Q86 U;  4ZGD B;  2E41 A;  4Y28 E;  3LW5 E;  2M1H A;  4HT9 A;  4HT8 A;  2QXF A;  4EPC A;  4NL3 A;  2PVD B;  2RJE A;  3HFO A;  3SWN C;  3S3N A;  5LJ5 e;  1U8R A;  1K9M C;  1VQ7 T;  1W4S A;  3VYH B;  2DK3 A;  3CCV T;  1R8O B;  3OS5 A;  4DQ2 A;  3LGL A;  1KQ1 A;  1P92 A;  2CS7 A;  2YRV A;  3BW1 A;  3OS0 A;  4XU2 A;  3GIB A;  4C92 B;  3OBW A;  1YJ9 A;  4PJO G;  4UC4 A;  4WF2 A;  1WJQ A;  5LJ3 e;  1VQO T;  1VQ9 A;  2QI2 A;  4M7D A;  3DLM A;  1M5Q 1;  3PMT A;  1MGQ A;  4BAC A;  5CIU A;  1DJ7 B;  3E19 A;  1WQ7 A;  4C8Q G;  4M7A E;  4HA8 A;  2WSC E;  2Y4Y A;  4YTL A;  2KSS A;  5D6W A;  2HD0 A;  5GAO l;  4M77 G;  4C92 C;  2QQS A;  3N5B B;  3PMI A;  5FU7 B;  3H8Z A;  3QJY A;  3CCS T;  3CCU A;  3L2Z A;  2DKG A;  4BUG A;  1M1G A;  1O9S A;  2XKO C;  4N0A C;  4P5N A;  1FX7 A;  2MMP A;  2RI3 A;  3A8G B;  4PKC C;  3QII A;  3JCM f;  1JJ2 A;  3ASK A;  1H3Z A;  3C95 A;  3JAM E;  1RI0 A;  4FIB A;  1UGP B;  2P4T A;  4FT4 A;  2HNI A;  4M77 C;  2JTM A;  4JUV A;  2X4J A;  3OW2 A;  3X20 B;  3FC3 A;  3OYJ A;  3A8M B;  4F7U G;  4HCB A;  2A3L A;  1HK9 A;  4C8Q A;  3QDR B;  4QW2 A;  4C5G A;  4X9D A;  4Y91 A;  3CCV A;  1D3B B;  4EMK B;  5CO7 A;  1KHI A;  1I8F A;  3J7A F;  2E12 A;  3CC2 A;  1BI2 A;  3PT9 A;  4IUT A;  2LC4 A;  2MWO A;  2F5K A;  1QVF S;  4BDZ A;  1FWZ A;  3G71 A;  1YJ9 T;  4FU6 A;  3L2R A;  3ME9 A;  4J5Y A;  3JCM W;  2P0Q A;  3G6E A;  5GAO r;  2JOY A;  4KT0 E;  4JS5 A;  2XDD A;  1YI2 A;  4LDU A;  2F5T X;  1N9R A;  2IG0 A;  3INZ A;  2M9U A;  4LDY A;  1I81 A;  2R5M A;  2P0P A;  3M54 A;  3P8D A;  4MMK A;  3MP6 A;  2B8A A;  4MML A;  3E9F A;  2PVG B;  4C8Q E;  2XK0 A;  5GAN 6;  3GP8 A;  4NL2 A;  2DXC A;  5CKF A;  4A4K A;  1BKB A;  2K57 A;  5D6X A;  4ZN1 A;  2EJG A;  1N27 A;  2CKK A;  2GCX A;  3F70 A;  4QVZ A;  2RB6 A;  4M75 G;  1B34 B;  1IRE B;  1MHN A;  1WGS A;  4J8O A;  3RMS A;  4A4E A;  4TVR A;  4BY6 B;  4F7U E;  5LJ5 g;  3SB2 A;  1VQ6 T;  3VU3 C;  2JNG A;  3OYA A;  4JRK A;  2QEX T;  1QVG A;  1X01 A;  2RK1 A;  1QVF A;  1YJN A;  1M1K U;  4EMH A;  3ER0 A;  2K5L A;  3L2V A;  2K3X A;  1YCY A;  2RJF A;  3OYF A;  1VQP A;  3OYG A;  4L6V 5;  4XU1 A;  2DXT A;  3X26 B;  1N8R U;  2JVV A;  5L8R E;  4LD6 A;  1NPR A;  2LQ8 A;  4XTV A;  2XD0 A;  2ZPE B;  4A4G A;  2QTX A;  5GAM g;  2ZCF B;  2LX9 A;  1GXI E;  3MHX A;  2LQK A;  4M7A F;  3JCM g;  1VQ4 A;  3LWH A;  1O75 A;  3VJP A;  2V8J A;  3CCL A;  3M53 A;  5HY6 A;  3JCM e;  4N4I A;  4JJN K;  1PSF A;  1N9S A;  2LRQ A;  3UT1 A;  2EAY A;  1SSF A;  2JN0 A;  4FL6 A;  3FRN A;  4QQG A;  3L2U A;  2RJD A;  1BIA A;  3X24 B;  2PU9 B;  4A4F A;  5LJ5 j;  3PTA A;  4C5E A;  5CKB A;  1KG1 A;  1VQN T;  4M7D D;  3ZEH A;  3OSS C;  1Y96 B;  1I4K 1;  3HSB A;  3CCE A;  3QBY A;  3RMQ A;  1BI3 A;  3LGF A;  5CQX A;  2ZPI B;  3H6Z A;  1YJN T;  1QW1 A;  3A8H B;  2O4X A;  3QG1 A;  3GNG A;  3OB9 A;  4RMO A;  5GAM j;  5GAN 2;  1Y96 A;  1VQ7 A;  3Q1J A;  2XDB A;  3R6O A;  1XTD A;  3OW2 S;  3DKM A;  2JZ2 A;  3J81 E;  4BE1 A;  3UPU A;  2BUD A;  2EYQ A;  1BYM A;  5J39 A;  1S72 A;  1NPP A;  4O6J A;  4XK8 E;  4GY5 A;  4M78 F;  4Z02 A;  2AHJ B;  2X35 A;  3O8V A;  5GMK l;  1W2B A;  1VQ9 T;  2QDY B;  1KC8 U;  3WVD B;  4M7D F;  3QSU A;  2FVU A;  4M75 D;  3LLR A;  4NS5 A;  1G3W A;  3M56 A;  3CPF A;  5IAY A;  2GFU A;  5GAN 8;  4ZN3 A;  3OY9 A;  4LD9 K;  2X4Y A;  4X9C A;  4EMG A;  3JCM Q;  2WAC A;  3NTK A;  2VGM A;  3QZ5 B;  4PL6 A;  5A0L A;  2DD5 A;  3OYL A;  3GPL A;  1JJ2 S;  4MDX A;  5CKE A;  3FDR A;  4PLL A;  3KUF A;  2VGN A;  3SDZ A;  2L8D A;  1VQ5 T;  3L2W A;  2K5F A;  1M8V A;  5GMK m;  1Q81 U;  1Q82 U;  2RHI A;  2R58 A;  2ZPB B;  5GAN h;  3JB9 I;  5FRN A;  1ZQ1 A;  3ZFJ A;  4FSX A;  4Q5W A;  3QHS A;  4E47 A;  3CC4 A;  2O01 E;  3OYC A;  2L3R A;  1NJI C;  2RHY A;  3P8B B;  2L89 A;  2RI5 A;  4PLI A;  1RL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...