4C92E

Crystal structure of the yeast lsm1-7 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
84
structure length
84
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 14
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92E00
4J6YA 4Y91A 2DVEA 2E10A 1LOJA 5LJ3g 1B34A 3V8LA 4XTXA 1I8FA 3JCMV 5CAIA 2EJGA 4C92F 2E41A 2VXFA 5GMKi 4J6WA 4XTYA 4M75C 2I2LA 2RA2A 2Y90A 4M75B 2E1HA 1D3BA 1N9SA 2HNIA 3FB9A 1JBMA 4MMKA 4MMLA 2K57A 4XU3A 1LJOA 4PJOF 5I21A 4M75G 5LJ3d 3SB2A 4M7DE 4XTWA 3BFMA 4M7DA 1D3BB 2YLCA 3BY7A 4F7UA 1N9RA 2DXTA 4X9CA 1M8VA 2DTOA 5GANj 4F7UB 2ZGWA 3RKXA 2RD1A 5LJ5h 4JLIA 4M7DB 3RIRA 1B34B 5GAMd 3SWNB 1I5LA 4M7AA 4PJOC 2QTXA 4EMHA 1WNLA 3JCMe 2E64A 5GAN7 5GAN5 4M7AE 4M75A 4JRIA 2DZ9A 3JB9H 4M78E 4C92C 1WQWA 1Y96B 3INZA 2RM4A 3JCMc 3VU3C 3RUXA 3PGGA 4M77F 1HK9A 1WQ7A 2VXEA 4WF2A 3M4GA 3QO3A 2FB7A 4M75D 4XU0A 5GAOq 3HSBA 2JN0A 3V7CA 4M78G 3RKYA 5GAMf 1JRIA 1M5Q1 2DZCA 4M78A 4JRKA 4N0AC 4M75E 3JCMh 1TH7A 3FIFA 1YCYA 5GANg 2EJ9A 5GAOp 4NL3A 5GAMh 5GAOm 5LJ3f 3SWNC 4M7AF 1KQ2A 4M78C 4XTZA 3EFSA 2DXUA 4C8QE 4EMKB 4M78F 2DKGA 2EJFA 2YHTA 4A54A 4EMGA 4EMKA 4QVCA 4C8QB 4QVDA 2RB6A 3V8KA 4M77E 3BW1A 5LJ3h 4M77A 5GAN6 4N0AA 4XQ3A 2YLBA 4M78D 5GANe 1WPYA 5LJ5e 3JCMX 2DTHA 4C8QA 3GIBA 1MGQA 4J6XA 2CGHA 5LJ5f 4M78B 5GANf 4M7AC 4PJOA 3BDUA 4PJOB 3JB9F 2DJZA 1I4K1 1H641 1LNXA 4M75F 1BIAA 1U1TA 5GMKh 5GAN4 3AHUA 4C92A 1X01A 4M7DD 4C92B 3L1AA 4HT8A 4M77G 5GAOr 3RKWA 4F7UE 3JCMP 5LJ3j 4M7AD 5LJ3e 4C8QF 1Y96A 3RESA 3QHSA 4C92D 4PNOA 3JCMW 5GMKl 4C8QC 1BIBA 4XTVA 3JCMQ 3JB9D 1HXDA 4NOYA 5GANd 3QSUA 4V2SA 4C8QG 4M7AB 5GMKm 2DTIA 3JB9I 4XU2A 4PJOD 5GAMj 3FJPA 5GAOn 3JCMd 4M77B 4XTUA 5LJ5g 5GAMe 3JCMb 4JUVA 5DY9A 1I81A 4C92E 5GMKe 3EFRA 5LJ5d 4F7UG 2FYKA 4NL2A 5GAOl 3HFOA 4J5YA 4M7DG 4DQ2A 4RCBA 4XU1A 3SWNA 3HFNA 3QUIA 4M77D 5GAN3 4PJOE 4A53A 1KQ1A 4RCCA 3JCMg 4M7AG 4EMKC 3V7SA 4M7DF 5LJ5j 3L2ZA 1U1SA 4OP0A 4HT9A 4F7UF 5GANh 5GAN8 5GAMg 4C92G 2EAYA 2DEQA 3JCMf 3V8JA 5GAN2 3JB9G 3JB9J 2VC8A 5GMKj 4M77C 2E65A 4X9DA 4C8QD 2EWNA 4M7DC 3RERA 4PJOG 3V7RA 4HA8A 3JCMJ
chains in the Genus database with same CATH superfamily
1UHCA 4XTXA 3MJXA 1SPKA 1VQ6A 3EG0A 1K4US 2DL5A 3GOXA 2BKDN 1OU9A 1I1JA 4AMCA 4AFQC 2O4XA 1D3BB 2M02A 3G71A 1Q82R 1VQLA 4Z89A 1WNLA 3P8BB 4OMLA 2MPXC 3EAEA 2XHCA 3U23A 1Q7YC 3CC4A 2QAZA 2C0IA 4BI8B 5CKDA 1M1FA 1B3QA 1QP3A 2MWOA 4M78A 2V26A 1RI0A 3FRNA 1GXIE 1MHNA 1MV3A 1MMAA 2E6NA 1UHFA 1K8AR 1NM7A 3SWNC 4M7AF 5I2MA 2CH4W 4M78F 2E5QA 2RB6A 3HRUA 4FYWB 3CMET 2XKOC 5DLOA 2NLUA 4DEYA 4GLMA 2X51A 2DL3A 1AOJA 1NLPC 2FPEA 1ZUKA 2DMOA 4F7UE 4RTZA 1UUEA 5IHIA 1UGPB 4KBMB 3M0TA 1HXDA 2FPDA 4C8QG 2QQBA 4D8KA 3FJPA 3JCMd 3J80E 2X4JA 4E7HA 1YJ9Q 1BYMA 4LUDA 1Q82U 4PJJA 1D1AA 2DERA 3JCMJ 1BI1A 2MYSA 1TSFA 2DVEA 3MEUA 3OYDA 5KCOA 4JJCA 4C92F 2I2LA 2L89A 1W1FA 1YI2A 1VQMA 1N5ZA 2K57A 3L2VA 2V8KA 1QKXA 4DBFA 4UC4A 1VIEA 2JUFA 2FO0A 4DA4A 2RD1A 4HCZA 2L3SA 4OMQA 1I5LA 3CD6T 2OAUA 4OMFB 5A0GA 3QJYA 3JAME 3OYGA 2L3QA 2JNGA 3CCST 4M75D 4FU6A 1UG1A 2DK3A 2NUTA 2ZPBB 1VQKA 1GCPA 2FZCB 4ZN1A 1JJ2P 2QI2A 4N0AC 1SHGA 2JZ2A 4BY6C 2QQ9A 2EKOA 5GAOp 3CCEQ 5FWCA 4RTYA 2JTFA 2JW4A 3H0IA 2PUOB 1VQ6T 4PJNA 4L5GA 4AG2C 5GANe 2KYMA 1XTDA 5KYUA 2PTKA 4KUIA 5EG2A 1T0HA 4RMOA 2ZAEA 4QQGA 2CSQA 2GTJA 2KMTA 4M77G 2KXCA 1VYVA 1PCXA 4YTLA 4CC4B 1VQ9T 2YUQA 3A8OB 4HVVA 3CCRQ 1RUWA 1T3SA 4LDXA 4VUBA 1IB8A 1I81A 1Q95G 1GRIA 1ZA1B 2LP5A 4RUGA 4KRTA 2QXFA 4EIKA 2XDPA 3VS1A 2O9VA 2XK0A 1HD3A 4ORZA 3KBGA 2EBPA 4C0DC 2E41A 2VGMA 3N5BB 4J6WA 2XIDA 1NLOC 1Q86R 1AD5A 2BZYA 2MI6A 3BE3A 1AWOA 4M4ZA 4J83A 3CCMA 4E7IA 2LCCA 3LH5A 1N9RA 2QQSA 1QP2A 1ZSGA 3L2WA 1AWWA 4JJNK 5M9OA 4OMOA 3JCMe 5GAN5 3QKJA 4PFZA 3OB9A 4ESRA 3VU3C 4TVRA 1GBQA 2COZA 4L59A 3CCMQ 5I21A 2CP3A 5GAOq 1VYUA 3ZFJA 3LWIA 1KC8U 3PMIA 3TSZA 1NBEB 1ZSZA 2OTLT 1JRIA 3CPFA 1PG5B 2B8AA 4JRKA 2LNHB 3JCMh 3M55A 3EFOA 1NYGA 3HHTB 1S72A 2RK1A 1QWEA 2EJFA 2RMOA 2GGRA 2RQVA 4RG2A 1YCSB 4L6V5 1R0CB 4M77A 1M2VB 1BB9A 2Z0WA 1WPYA 1VQMT 3X26B 1JJ2S 3X25B 1WJSA 5LJ5f 2COYA 4PL6A 5FWBA 4LDUA 4GLKA 3VS3A 1H641 4R55A 2DF6A 5GAN4 1YI2T 3OSVA 2CT3A 1VQOT 4FW2A 2A08A 1PD0A 1RAAB 2YDLA 2LQKA 3RESA 3L2QA 1OX9A 2MAMA 5GMKl 4J7IA 1BIBA 2L0AA 2V1QA 2HKQB 4N4IA 1PSFA 5GANd 3HP9A 3UPUA 3G6EQ 1N8RR 1E7OA 4WTOB 1M2OA 2VWFA 2LX7A 3CMAT 2RHYA 1QCOA 2AHJB 5GMKe 4XU1A 4AG1C 4PJOE 4OB1B 1NEBA 4A53A 1Q81U 3CD6A 1UGVA 3V7SA 2YRCA 2DEQA 3UA7A 2F5TX 3V8JA 5FU6C 4ATOA 4J9BA 4C8QD 3CCLQ 3RERA 1WJRA 5IN1A 4MDWA 3I55A 4J6YA 4LNPA 5I11A 2PVGB 4F17A 2DPPB 3IQLA 4AFZC 2L8DA 2P0KA 1N9SA 1BU1A 4MMKA 2DL7A 3PVQA 3UWNA 1VQ7T 4JPBW 2FZKB 3G71T 3QWYA 3EG2A 1M8VA 3NTIA 2K9GA 4C5IA 5LJ5h 1D0XA 3SWNB 2RJCA 4EMHA 1QKWA 4A4HA 3S3MA 3M57A 1IRXA 3MPUB 3JCMc 2DFUA 4DEXA 3E9GA 4C0FA 2LC4A 1WQ7A 1VQ9A 4HKEA 1WGSA 2JM8A 4C0GA 1M90U 1BI2A 2D1XA 2CYZB 2H8HA 4M75E 2ED1A 3TQ7P 1K8AC 1YJWQ 4DOVA 1DJ7B 4LN2A 4XAXB 5GANg 5GAMh 4JS4A 1VQ4A 1K9MU 2AZSA 2QDYB 4M78C 2YXYA 3CCRA 5D6XA 1OZ3A 2NUPB 4BI4A 1VQ4T 3R6NA 2XDBA 2JJ9A 2H3JA 2HL3A 3PIPA 1MGQA 3TVTA 4M78B 3GLXA 1QCFA 3JB9F 2HBPA 4OVAA 3URGA 2JTEA 2EVRA 2LCSA 4C8QF 1Y96A 1K0SA 4PNOA 4QW2A 3MEWA 3RNJA 3RMSA 2DO3A 3H8ZA 2PU9B 3HFOA 1G5VA 4RCBA 2DXBA 3I56Q 5LJ5j 3JV3A 2K5FA 3JB9G 5GMKj 3NMZC 2E65A 4PJOG 4BDZA 4JRQA 2CP7A 2LDMA 2HSEB 3HKSA 4ZNXA 1RAGB 5AYFA 3FC3A 5KCHA 3JCMV 1G83A 1LPLA 2CZ0B 2VXFA 1UJYA 3T9NA 2ATCB 2RJDA 3M56A 5HCKA 1VIFA 5EC7A 2RA2A 3FB9A 8ATCB 4PFOA 1KD1R 4FYXB 4O5VA 3S3NA 4KH0B 1YFNA 4F7UB 2ZGWA 4M7DB 3QZ5B 4PJOC 4HVWA 3M0SA 1NG2A 1F1BB 4C92C 2MK5A 3MO8A 1H8KA 4XK8E 1HK9A 1R77A 3M4GA 2HD0A 1VQKT 4KUDK 2QA4T 2CKKA 4J9CA 2VKNA 4M78G 2YT6A 2DD4A 1M5Q1 2SEMA 4RTVA 4LDWA 1M90C 1RAFB 1ZQ1A 3FIFA 3OYIA 1JXMA 5LJ3f 1E6GA 3P8HA 1WHJA 3M0PA 2DIQA 3LWHA 4A54A 2EGEA 3A8HB 2HQXA 4M77E 1XQHA 2QDLA 2YLBA 2VVKA 4OB2B 3CD6Q 4JS5A 4DBHA 2OTLA 2RH2A 2CREA 4PJOA 4QQ6A 2GQIA 1KHIA 2J06A 2GF7A 1M1GA 4D8DA 2OX7A 2FRWA 2XDDA 1PNJA 1Y57A 2FVUA 2FHDA 2LJ1A 5FU7B 5LJ3j 1YITA 2DYIA 2O9SA 5FU6B 1QCNA 2O01E 3JCMW 1YHQT 3M4YA 2D6FA 2RQWA 1ZUYA 2CP6A 3E19A 1UGQB 2DAQA 2HQEA 1XJWB 1QVGP 3I35A 1X43A 3OS0A 2CS7A 1W2BA 4FCYA 4JRPA 2JTMA 5J3BA 3OBWA 2DBMA 1W2BS 1NJIC 3OBYA 4J9HA 3GF5A 3OMGA 1K0XA 2YRDA 3QYHB 3EG9B 3CQTA 1SSHA 2JMCA 1QLYA 2W10A 2O88A 1AEYA 1J3TA 2RHZA 1QVFS 4AFUC 5HK0A 1FMVA 2C0OA 1W70A 2Y4XA 2LNVA 4FIBA 1UTIA 2GNCA 4RTUA 2DX1A 4ZTFA 3NFCA 2RM4A 3ZEHA 4OGEA 2YWWA 3QO3A 2BZ8A 2XMFA 3VUBA 2MWPA 4RTTA 4X1VA 3UATA 1U8RA 2F2VA 4DOWA 1VQMQ 2VUBA 1EIFA 2E5KA 2DXUA 1VA7A 1WHHA 1TXQA 3MP1A 5KYUB 4C8QB 1YI2Q 2E4HA 5DLQE 1A0NB 1JXOA 4LDYA 3AT1B 2RHIA 1PKTA 1RACB 3OW2A 1UEBA 3TSWA 3OY9A 3CMAQ 2RQRA 4BB7A 4E2FB 3CCVA 3M9QA 2HBWA 2ROTA 3QJ6A 2OTJQ 4E7LA 3JB9D 5CIUA 2DL8A 2BE9B 2DTIA 2LT1A 2EGAA 3JCMb 5C0MA 2GTOA 4C92E 5IXBA 3F70A 3CMAA 1VQ8T 3GNFB 2XU8A 4RCCA 4M7AG 2JS0A 1HYOA 3VS5A 3I55Q 4FYVB 3LGLA 2KRSA 1G3YA 3G71Q 3D7SB 1FX7A 3CC2A 1B34A 4RTXA 4Y28E 4MDXA 2E1HA 1KFZA 2K4YA 2O4XB 3SB2A 1ARKA 4J9EA 1BCMA 2RI5A 2EYWA 2K2MA 3RKXA 4PLIA 1KG1A 1Q82C 2M1HA 1AZEA 4BY6B 1VOMA 1WQWA 2OTLQ 3CCLT 3NHNA 1RAEB 1KD1U 1BKBA 3M5AA 1IHVA 2EYXA 3A5ZB 1YHQA 1YN8A 5A0LA 3OS5A 1WLPB 3DKMA 5KYXB 4IIOA 2P4RA 5CR2A 4EDUA 3DLMA 4XTZA 3CBMA 1I07A 1C1AA 3OW2P 3QYGB 2DKGA 3WVDB 2YUPA 4ZGDB 2HSPA 2DTHA 2RI2A 4IUUA 2IG0A 1G8XA 1VQNT 1I4K1 2JM9A 3C0CA 1IXDA 3OS2A 3JCMP 1Y71A 2LJ3A 4ZGEB 4HCCA 4C5EA 1BI3A 1TOVA 4XTVA 4B9XA 4FL6A 1TU0B 5KYYA 1Q7YU 1C0MA 3JB9I 3L2RA 4PJOD 1Q81R 2AK5A 1S72Q 1YP5A 4QT7A 2KT8A 1Y07A 2FYKA 5I22A 3CBOA 2G3RA 5GAN3 3H9NA 3CEYA 3JCMg 3HPWA 3JCMf 1O9SA 4F14A 1YIJT 2ZPFB 1M3AA 2KK4A 3SHWA 2J6FA 1FYNA 1VQ7Q 1K9MR 3JRZA 4D6WA 3P8DA 4PLLA 1WHKA 3G4SQ 2EQMA 2R58A 2DRMA 3KXTA 3G7ZA 2HL5C 2F2WA 4E6RA 2D9TA 2KR3A 3OYKA 2EIFA 4X9CA 1W6XA 2QGGA 1MUZA 2VB6A 3VRZA 3I56T 3SDZA 4IUTA 4PKCC 1JB0E 2RN8A 1PWTA 1OEBA 5I2SA 4MZTA 4X34A 4F16A 1TTHB 3A8GB 1WXUA 3RBBB 4BE0A 2XD0A 4Y92A 1IHWA 3NTHA 3EHRA 3LH0A 2DETA 1MMNA 4JLGA 5IXFA 4FSSA 1NEGA 4QVCA 4QQDA 3V8KA 5LJ3h 2VV5A 2I0NA 3GIBA 1WXTA 3LLRA 4B6MA 5GANf 4KGVB 2G6FX 1YITQ 2A36A 1QVGS 2EQUA 3S3OA 1D0ZA 2HMAA 2X4YA 1X01A 5IH2A 5IHKA 2P84A 1R8OB 5LJ3e 1YWPA 4IUVA 2CSIA 3ZBDA 1N27A 3QDRB 2ESWA 2KDSA 4XTUA 3A1PA 3CCJQ 5KYXA 3EFRA 4P5NA 1Q81C 2DLPA 2HZYA 4M77D 2E3IA 4EMKC 1OPKA 4M7DF 2JT4A 4F7UF 5GANh 5GAN8 5GAMg 1IZ6A 1S1NA 1I0CA 3JB9J 1Y0MA 5IAYA 2KRMA 3OYCA 4M7DC 1VYTA 1FMWA 3HTRA 2KYBA 2ROLA 3V8LA 1I8FA 3QG1A 2KROA 5GMKi 3O8VA 1YHQQ 1B07A 1PD1A 3EGDB 1FXXA 2O2OA 1KSWA 4XTWA 3VYGA 1NJIU 2DEUA 1ZA2B 2DTOA 1AWXA 4OMNA 4KGZB 3TCJA 5KYYB 2JVVA 1K8AU 2E64A 2QA4Q 4EPCA 1M9SA 4JRIA 1H92A 3PMTA 3L42A 4E7SA 1UB4A 5CQXA 2CH4A 5CKHA 4XU0A 3CC7T 2FB7A 3HSBA 2RQTA 4E47A 5GAMf 3VS6A 2DZCA 4B9WA 2K3XA 4ANJA 1TWBA 2GBQA 2ENMA 2EQIA 2LX9A 1VQLT 1KQ2A 4O6JA 2O31A 2DXCA 1K1ZA 2F1LA 1U06A 2M0YA 2M51A 2W0ZA 4FT4A 5KYWB 2B86A 3M54A 3JCMX 3X28B 2IIMA 2E70A 3FEOA 3PVLA 3CCQA 1ACMB 3OYNA 2X4WA 2PVOB 3FLGA 4CI0C 3CCUQ 1QW1A 1WXBA 2RHXA 1RAIB 4J9GA 4M7DD 3L1AA 3OW2S 3CCQT 2MCNA 3CC4T 8AT1B 1PSEA 3M0QA 2HDAA 3E2UA 3HRTA 4M7AB 4IUQA 3LGFA 3EFOB 1M4ZA 3UT1A 5LJ5d 1QVFA 1RLQC 2H3EB 1TS9A 1VQNA 3QUIA 2HEQA 6AT1B 1IGQA 2LQ8A 4ZGJB 5D6WA 4HXJA 3SFMA 2KSSA 4AFSC 4J9IA 3V7RA 1JO8A 1ZUUA 4Y91A 3Q1JA 5CAIA 4KH1B 3QPHA 2NWMA 2BUDA 3CCSA 2YUNA 4MMLA 1FMKA 1KJWA 2A37A 1WFWA 2ZZDA 2QEXA 5GANj 4JJDA 1SF9A 4M7AE 3OYMA 2L2PA 4M78E 4PK4A 2RO0A 1WDXA 4WF2A 2OI3A 1YJWT 3I9QA 1ZLMA 2EKHA 2JN0A 2MF2A 2JOYA 2VASA 3VUZA 3A8LB 4CC7A 1V29B 2XI9A 1X6BA 1P92A 2DE0X 2NYSA 2RK2A 4BI3A 2R57A 3VS7A 3CCVT 4N4GA 1X2KA 4C0ZA 4IUPA 2K3BA 2YHTA 5HK3A 4EMKA 2HAXA 1C6VX 2F2XA 2C06A 4M78D 3EG3A 1Q86U 1MNDA 3LX7A 3PE0A 1VQPT 2M16A 4M7AC 4PJOB 2X9HA 4CC2A 2DJZA 4ELYC 3OYBA 4ZTJA 2OTJT 1RAHB 1BIAA 1U1TA 1LCKA 3X24B 1PRMC 3CMEA 1YJNQ 2ZPEB 5A0DA 2COWA 5L8RE 3PNWC 2DJQA 3OYAA 1I5OB 1SKUB 4FYYB 3KFVA 1RADB 3QBYA 4OB0B 2K2VA 5LJ5g 4JUVA 2WACA 1K76A 1GCQA 4F7UG 3I55T 3VS2A 4JZ4A 1QVPA 4DQ2A 3HFNA 1V76A 3CC7A 3M59A 4C5GA 1ZX6A 2NUTB 3CPWP 1ZBJA 1AT1B 4PJLA 2DILA 1VQ7A 3C95A 3EG9A 3H41A 2PZ1A 3OYEA 2GQVA 1OPLA 2NUZA 1LVKA 1ABOA 5D7UA 3QXEB 3H0FA 1YIJA 1JBMA 2VGNA 4RTWA 1RABB 2MMPA 4Z02A 2P0PA 5FRNA 1UECA 5CKFA 1X6GA 2QQRA 5GAN7 1PKSA 2QASA 1TUDA 3JB9H 1G3WA 1YIJQ 2GFAA 2AZVA 3DB3A 3V7CA 3CC2Q 3RKYA 2D8HA 5C6SA 2KT1A 3OYFA 3EGXB 3EH1A 1K9AA 4HCKA 3O5ZA 2KVQG 1M1KR 4N4HA 1RLPC 3GBQA 3H6ZA 1IO6A 4EMKB 2FZGB 4CRIA 3I5RA 3C4SA 3QDFA 2FRYA 4XQ3A 1VQNQ 2KEAA 1TUCA 4KULA 2CGHA 1VQ5Q 1Q86C 2LRQA 1H3ZA 1HJDA 3VS0A 4M75F 2YSQA 5DM7R 1KQSA 1AHJB 2FL7A 1BBZA 1NPPA 4ELZC 1WIEA 1S72T 1KQSS 3QHSA 2YRVA 2DL4A 2QEXT 4NOYA 1WZOA 1VQ5A 5GAMj 1M27C 2BTTA 4J9FA 4NL2A 1ZBXA 3MKDA 4IIMA 1U1SA 1SG5A 3QIIA 4ME7A 1QVFP 1KHCA 1YJ9T 1YITT 1D1CA 4OMPA 2CZ1B 2EFIA 2FG0A 1G2BA 2DD5A 2PNIA 2WSCE 2LCLA 2EJGA 4XTYA 2KE9A 1O75A 3VV0A 1K73U 2HKNA 2KI7A 3KUFA 3M53A 2CZ7B 4A4KA 5LJ3d 2LMJA 5HY6A 1UJ0A 4PFPA 3EGDA 2YLCA 3BY7A 3THKA 2DXTA 2QA4A 2R5MA 5J39A 1Z9QA 3ULRB 3CXCP 3EG1A 4M7AA 4Q5WA 3A98A 1XNIA 1YWOA 1JJ2A 2A7YA 1EX4A 1Y96B 1OYXA 3INZA 2FEIA 1CSKA 2OTJA 2ED0A 2EYZA 5HKCA 2CT4A 2GCXA 3E1SA 5CKEA 1QWFA 2L3PA 9ATCB 3G4SA 2EJ9A 4R0KA 3M0UA 4OB3B 3EFSA 4R56A 1QMCA 3PTAA 2LZ6B 4EMGA 3J81E 1RI9A 5ECAA 3OYJA 3BW1A 3CCET 3CCQQ 1UE9A 2EPDA 2ECZA 3BDUA 1VQ6Q 1OULA 1LNXA 2ZPGB 4J7FA 3MEAA 3PIOA 2X35A 1HSQA 3ME9A 1KK7A 1NE8A 2J05A 1KD1C 1UGSB 4NS5A 1SEMA 1G3TA 3G6EA 4PJMA 2L3RA 2J6KA 4C92D 1W2BP 2RJFA 1KIKA 3QSUA 1VQ8Q 2KBTA 1VQLQ 1SSFA 3RDVA 4BACA 3ZL7C 1WA7A 4LD9K 2V8JA 4MZMA 4FSXA 4ZN3A 5GAOl 1YBYA 3C94A 4J5YA 4BUGA 1N8RC 1TG0A 2ZCFB 2CDTA 3TU4K 3FJ5A 1M90R 3CCRT 5CQYA 1MV0B 1OU8A 1PHTA 2CZ6B 4Z88A 1XOVA 5GAN2 4GY5A 1VQ8A 2ZPHB 1ZSZB 1R0BG 1T0JA 1MMGA 2M9UA 5LJ3g 2CP2A 3CC4Q 3HRSA 2Y90A 2HNIA 4FM4B 2AKLA 2EYYA 1JU5C 3QZ9B 1GCQC 3ER0A 2K3YA 3NGPA 2RPNA 4M75A 3CCJA 1NPRA 1BK2A 1GBRA 2BIVA 4J9DA 1NZ9A 3PGGA 2VXEA 3MP6A 1GL5A 5KE2A 4E7KA 3WVEB 3VKIA 1YJWA 3OMCA 4II1A 3SEMA 1M3BA 2C0TA 1MMDA 3M0RA 1OZ2A 3PT9A 3TREA 2BZXA 5CCAA 1YJ9A 1MNEA 4NL3A 2VYTA 1JEGA 5L23A 1NYFA 2PUKB 2DVJA 4C8QE 1OX8A 1NJIR 3SD4A 5J26A 5GAN6 1M2VA 3E9FA 3EGUA 2KXDA 5LJ5e 3GPLA 3CCUT 2EYQA 2AT1B 4LUEA 4C8QA 3META 5CO7A 1WHGA 3CMEQ 1SRMA 2EW3A 1RL2A 2E3HA 1PC0A 1ZHIA 4AT1B 3MHXA 1M3CA 1M1KU 2HCKA 1PRLC 1WHLA 3CPWS 2RI3A 3CCVQ 3VJPA 1VUBA 4LXCA 2K5LA 4IURA 3OS1A 1CKBA 1KQ1A 2JS2A 1SRLA 4X9DA 1ZSZC 7AT1B 3MEVA 2V8IA 1N6AA 3J7AF 3G4ST 3QWXX 1M1KC 1YJNT 2RJEA 4BD3A 3GNGA 5GJVB 2CP5A 4BE1A 2QTVA 2RNAA 2K6DA 3MP8A 4M75B 2F69A 3CCEA 1AWJA 3BFMA 4M7DA 4F7UA 3NTKA 4OF1A 3EHQA 2MOXA 5AT1B 4JLIA 1B34B 5GAMd 3UF4A 1Z9ZA 2V1RA 3G1JA 4F04B 1Y7XA 3CPWA 4KT0E 5GJWB 2EQJA 4M77F 2P4TA 2J6OA 1VQPA 3H0HA 1U5SA 1G3SA 2QG9B 2D0NA 2KGTA 3PFSA 3CCSQ 3M58A 3CXCS 5CVIA 2BE7D 3OYYA 2D0QB 3DB4A 3CXCA 1VQPQ 1KC8C 4N0AA 1UGRB 2X3XD 1E6HA 1V1CA 4QVZA 2QEXQ 1VQ4Q 2LQWA 1GFCA 4CC3A 3OSSC 4QKUA 1B7TA 4HT8A 3C12A 3RKWA 4FW1A 1JQQA 4A4GA 3CCJT 2WSFE 1D1BA 2WSEE 2LVMA 2SRCA 3ASKA 4XU2A 3REAB 3REBB 3R6OA 1AVZC 5GAOn 2CUDA 2L5QA 4E7JA 5GAMe 1EZZB 3UDCA 1WX6A 4IKFA 4M7DG 1H3HA 1IGUA 2E12A 2KQWA 3OYLA 2AKKA 4C92G 2A0FB 2X3WD 4WCIA 4HCBA 4M77C 1K73R 1KC8R 2K79A 1W4SA 4GBQA 2A3LA 1WYXA 4E7ZA 2LQNA 1WI7A 5KYNA 5FRMA 3EH2A 3I56A 2IPOB 1D3BA 4PJOF 4XU3A 1LJOA 1BI0A 1YNZA 4LDVA 2X4XA 5FROA 2K5IA 4JDSA 3RIRA 1WJQA 3CC7Q 2QTXA 3S6WA 2DZ9A 3CC2T 2LJ0A 5D6YA 1PM3A 3RUXA 1U3OA 2RF0A 2DBKA 2GFUA 3TEEA 1FWZA 1X69A 3CCMT 2KRNA 1UDLA 2JMAA 1VQKQ 1YCYA 2PQWA 5IT9E 4HVUA 4DBQA 5FU7C 3GP8A 2DYBA 2DIGA 4BDYA 4LE9A 4QVDA 1VQ5T 3CCLA 2DA9A 5KYWA 2OJ2A 1BCOA 1OV3A 3DLLA 2PVDB 2XG8D 1D0YA 5GMKh 3AHUA 1WHMA 1GFDA 4C92B 2KAFA 4RG8A 5KH6A 3OQ5A 3JCMQ 4C8QC 2M0OA 4V2SA 3X20B 5GMKm 2KNBB 4DBRA 4M77B 5DY9A 4LD6A 1AZGB 3G6ET 3SWNA 1OI1A 1VQ9Q 5KE3A 1N8RU 4HT9A 4Z8AA 2DNUA 2EAYA 3EGXA 3HL8A 2VC8A 1QVGA 1CKAA 4RKUE 2P0QA 5IHNA 3UA6A 2DRKA 4KGXB 2E10A 1LOJA 4C0DB 2EQKA 2XICA 3JSCA 2RHUA 4OGCA 4M75C 1T3LA 3RMQA 2RQUA 4M75G 4M7DE 5LL6S 2YUOA 2A28A 2HQHA 4FT2A 2QYZA 2MIOA 4BE2A 1YJNA 4K11A 1Q7YR 1IREB 3BDLA 3LYIA 1QQJA 3OA6A 2F5KA 4C5HA 2CUBA 1VQOQ 3CBPA 1OOTA 4J8OA 2LT4A 2LTOA 4A4FA 1TH7A 5GAOm 1K9MC 1X27A 3VYHB 2QGFB 1D09B 1M8MA 1VQOA 1KQSP 1EFNA 1OQKA 3VS4A 3L2UA 4JJBA 1TUGB 3FDRA 2OAWA 2EGCA 4A63B 4J6XA 5CK9A 1X6OA 3OYHA 2J7IA 5A2QE 1ABQA 4OMMA 2D8JA 4C92A 2CP0A 5GAOr 3NPFA 4M7AD 3CCUA 2K7AA 3I5SA 3A8MB 2Y4YA 2E6ZA 5FW9A 2NUPA 1SHFA 1M30A 1UFFA 2KY9A 2ABLA 5CKBA 3WXMB 2AIRB 1X75C 3LW5E 3MCAB 1K73C 4MZPA 3VRYA 2QK0A 1X2QA 3L2ZA 4OP0A 5FLXE 2R5AA 2DM1A 2QQAA 2JXBA 2IVWA 2EWNA 2FPFA 2ZPIB 3RR6A 4HA8A 4A4EA 4JZ3A
chains in the Genus database with same CATH topology
2LDMA 3HKSA 2M9UA 5LJ3g 5AYFA 3V8LA 4XTXA 1I8FA 3JCMV 5KCHA 3HRSA 3QG1A 3FC3A 2CZ0B 2VXFA 3T9NA 5GMKi 3O8VA 1VQ6A 2RJDA 3M56A 1VIFA 3GOXA 4D6WA 2BKDN 2RA2A 2Y90A 3FB9A 2HNIA 4FM4B 1FXXA 2O4XA 4XTWA 3VYGA 1NJIU 1D3BB 3G71A 3QZ9B 4O5VA 3S3NA 2DTOA 3ER0A 4F7UB 2ZGWA 3JCMQ 4M7DB 3TCJA 2K3YA 1VQLA 3QZ5B 4PJOC 1K8AU 1WNLA 2JVVA 2E64A 4M75A 4EPCA 3P8BB 3CCJA 1M9SA 1NPRA 4JRIA 3PMTA 3L42A 4C92C 3MO8A 1UB4A 5CQXA 3EAEA 4XK8E 2BIVA 1NZ9A 3PGGA 1HK9A 2VXEA 2XHCA 5CKHA 3M4GA 3MP6A 2FB7A 2HD0A 4XU0A 1VQKT 3CC7T 5KE2A 2QA4T 4E7KA 4KUDK 4ATOA 3WVEB 4E47A 2CKKA 1Q7YC 3CC4A 3VKIA 4M78G 5GAMf 3OMCA 2DD4A 1YJWA 1M5Q1 2DZCA 4II1A 4B9WA 4BI8B 2K3XA 1M1FA 1QP3A 2MWOA 4M78A 5CKDA 1GXIE 1RI0A 3FRNA 3TREA 1MHNA 1OZ2A 3PT9A 4LDWA 5CCAA 1YJ9A 1M90C 1ZQ1A 3FIFA 4NL3A 3OYIA 2E6NA 2VYTA 5LJ3f 2LX9A 3SWNC 1VQLT 1KQ2A 4M7AF 4O6JA 2DXCA 2PUKB 3P8HA 5I2MA 2DIQA 3LWHA 4C8QE 4M78F 4A54A 3A8HB 2E5QA 2HQXA 2RB6A 3HRUA 5J26A 4FT4A 4M77E 3SD4A 1XQHA 3CMET 5GAN6 2XKOC 2YLBA 3E9FA 3M54A 2NLUA 4OB2B 5DLOA 5LJ5e 2EYQA 3JCMX 4C8QA 3GPLA 3X28B 3CCUT 3META 4JS5A 5CO7A 2E70A 3FEOA 2OTLA 2RH2A 3CCQA 4PJOA 4QQ6A 1KHIA 1RL2A 3OYNA 1ZHIA 2X4WA 2GF7A 2PVOB 3FLGA 4CI0C 3MHXA 1M1GA 1QW1A 2RHXA 4M7DD 1M1KU 3L1AA 3OW2S 2XDDA 3CCQT 4F7UE 5FU7B 2FVUA 2FHDA 4C8QC 5LJ3j 3CC4T 1YITA 1PSEA 1UGPB 5FU6B 4KBMB 3CPWS 2O01E 3HRTA 3JCMW 1YHQT 2RI3A 3M4YA 2D6FA 1HXDA 4C8QG 3E19A 2QQBA 1VUBA 4M7AB 3VJPA 1UGQB 2DAQA 3FJPA 4IUQA 2HQEA 3LGFA 3JCMd 2K5LA 1M4ZA 3J80E 3UT1A 2X4JA 5LJ5d 1QVFA 4E7HA 4IURA 2CS7A 3OS0A 1W2BA 1BYMA 3OS1A 1VQNA 4JRPA 3QUIA 2JTMA 1Q82U 1KQ1A 5J3BA 3OBWA 2LQ8A 4ZGJB 5D6WA 3SFMA 1W2BS 2KSSA 1NJIC 3OBYA 4X9DA 3GF5A 3MEVA 3OMGA 2V8IA 3V7RA 1N6AA 3JCMJ 1BI1A 3J7AF 3G4ST 3QYHB 1M1KC 4Y91A 2DVEA 3Q1JA 1YJNT 3MEUA 2RJEA 4BD3A 3GNGA 5CAIA 4BE1A 3OYDA 3QPHA 5KCOA 4C92F 2BUDA 3MP8A 3CCSA 2I2LA 2L89A 1YI2A 4M75B 1VQMA 4MMLA 2K57A 2F69A 3L2VA 3CCEA 2RHZA 3BFMA 4M7DA 1QVFS 2V8KA 4F7UA 2ZZDA 5HK0A 4UC4A 1VIEA 2JUFA 3NTKA 2QEXA 4OF1A 2Y4XA 5GANj 4DA4A 2LNVA 2RD1A 4JLIA 4HCZA 4FIBA 1B34B 5GAMd 1I5LA 4M7AE 3OYMA 4ZTFA 3CD6T 3NFCA 2OAUA 4OMFB 1Y7XA 4M78E 5A0GA 3CPWA 2RM4A 3QJYA 3JAME 2RO0A 4KT0E 3OYGA 2EQJA 4M77F 2JNGA 4OGEA 4WF2A 3ZEHA 3CCST 3QO3A 4M75D 2P4TA 1YJWT 4FU6A 2JN0A 2DK3A 2ZPBB 1VQPA 2MF2A 3VUBA 1VQKA 2JOYA 1G3SA 2MWPA 3VUZA 3A8LB 4ZN1A 3PFSA 2QI2A 1V29B 2XI9A 4N0AC 3M58A 3CXCS 2JZ2A 5CVIA 4BY6C 4DOWA 2QQ9A 1P92A 1U8RA 2RK2A 2VUBA 1EIFA 2R57A 3OYYA 4BI3A 2EKOA 5GAOp 3CCVT 2D0QB 4N4GA 4C0ZA 3DB4A 3CXCA 2JTFA 4IUPA 2DXUA 2YHTA 3MP1A 4EMKA 5HK3A 2PUOB 4C8QB 2HAXA 1VQ6T 2C06A 4L5GA 1KC8C 5DLQE 4N0AA 4M78D 5GANe 4LDYA 1UGRB 1Q86U 1XTDA 2RHIA 3LX7A 4KUIA 4QVZA 2QEXT 3OW2A 1VQPT 2M16A 1UEBA 4M7AC 4PJOB 2DJZA 5EG2A 4ELYC 4RMOA 3OY9A 4QQGA 3OYBA 4ZTJA 2OTJT 1BIAA 1U1TA 3OSSC 3X24B 2KMTA 4HT8A 3CMEA 4M77G 3C12A 4BB7A 3RKWA 2ZPEB 5A0DA 3CCVA 3M9QA 4A4GA 3CCJT 3QJ6A 3PNWC 4YTLA 2WSFE 5L8RE 4E7LA 2WSEE 1VQ9T 2LVMA 3OYAA 3JB9D 5CIUA 3QBYA 4OB0B 3ASKA 2K2VA 3A8OB 2DTIA 2LT1A 4XU2A 3R6OA 1K9MU 5GAOn 2L5QA 5LJ5g 5GAMe 3JCMb 4E7JA 4VUBA 4JUVA 3UDCA 1I81A 2WACA 5C0MA 4LDXA 4C92E 3F70A 4F7UG 3I55T 3CMAA 4IKFA 4M7DG 2E12A 1QVPA 4DQ2A 3HFNA 1VQ8T 3GNFB 2XU8A 4RCCA 3M59A 4C5GA 3CC7A 2KQWA 3OYLA 4M7AG 2QXFA 4C92G 2XDPA 3LGLA 1VQ7A 2XK0A 4HCBA 4M77C 3C95A 1W4SA 1G3YA 2A3LA 3OYEA 3KBGA 2GQVA 1FX7A 3CC2A 1B34A 4Y28E 4C0DC 4MDXA 2E41A 2VGMA 3N5BB 5FRMA 3QXEB 4J6WA 2XIDA 3I56A 2MI6A 2E1HA 1D3BA 1YIJA 4PJOF 1JBMA 2K4YA 4XU3A 1LJOA 4J83A 2VGNA 2O4XB 1BI0A 3CCMA 3SB2A 4E7IA 2LCCA 1N9RA 2MMPA 2QQSA 2RI5A 4LDVA 2X4XA 5FROA 4Z02A 1QP2A 3L2WA 3RKXA 2K5IA 2P0PA 4JDSA 5FRNA 4JJNK 5CKFA 3RIRA 1WJQA 5M9OA 2QQRA 4PLIA 2QTXA 3JCMe 5GAN5 5GAN7 1KG1A 1Q82C 2M1HA 3QKJA 3S6WA 4BY6B 2DZ9A 3JB9H 1G3WA 3CC2T 3OB9A 1WQWA 5D6YA 3VU3C 4TVRA 3RUXA 4L59A 3CCLT 5I21A 2GFAA 5GAOq 3ZFJA 2GFUA 3LWIA 1KC8U 3PMIA 3TEEA 3DB3A 3V7CA 1KD1U 1FWZA 3RKYA 5C6SA 2OTLT 1BKBA 1JRIA 3M5AA 3CPFA 3OYFA 3A5ZB 3CCMT 1YHQA 2B8AA 4JRKA 5A0LA 3JCMh 3M55A 3OS5A 3DKMA 1YCYA 2PQWA 5CR2A 5IT9E 2KVQG 4N4HA 4EDUA 3DLMA 4XTZA 3CBMA 5FU7C 3H6ZA 3HHTB 3GP8A 1S72A 2RK1A 3QYGB 2DIGA 2DKGA 2EJFA 3WVDB 4EMKB 4BDYA 4ZGDB 4QVDA 4CRIA 1VQ5T 3C4SA 4RG2A 4L6V5 3CCLA 4M77A 4XQ3A 1WPYA 1VQMT 2DTHA 4KULA 3X26B 1JJ2S 3X25B 1WJSA 2CGHA 2RI2A 5LJ5f 4IUUA 4PL6A 2IG0A 2PVDB 3DLLA 2LRQA 2XG8D 1Q86C 1H3ZA 4LDUA 4GLKA 4M75F 1I4K1 1H641 1VQNT 5DM7R 4R55A 5GMKh 1AHJB 1KQSA 5GAN4 3AHUA 1YI2T 3OSVA 4C92B 3OS2A 1VQOT 2FL7A 2KAFA 3JCMP 1Y71A 4RG8A 5KH6A 3OQ5A 1NPPA 4ELZC 4HCCA 4ZGEB 4C5EA 1BI3A 2LQKA 3RESA 3L2QA 1S72T 3QHSA 1KQSS 2MAMA 5GMKl 4J7IA 1BIBA 2YRVA 4N4IA 4XTVA 4NOYA 1PSFA 4FL6A 2M0OA 3HP9A 4B9XA 5GANd 3X20B 3UPUA 5GMKm 1Q7YU 4V2SA 3JB9I 3L2RA 1VQ5A 4PJOD 5GAMj 4M77B 3CMAT 2RHYA 5DY9A 2AHJB 5GMKe 1Y07A 2FYKA 4NL2A 3HSBA 3CBOA 4LD6A 2G3RA 5GAN3 4XU1A 1ZBXA 3SWNA 1OI1A 3G6ET 4PJOE 4OB1B 4A53A 5KE3A 3CEYA 1Q81U 3JCMg 1N8RU 3CD6A 3V7SA 1U1SA 4HT9A 3HPWA 2EAYA 2DEQA 2F5TX 3JCMf 1O9SA 3HL8A 3QIIA 4ME7A 1KHCA 2VC8A 5FU6C 2ZPFB 3V8JA 1YIJT 4C8QD 1YITT 1YJ9T 1QVGA 4RKUE 3RERA 1WJRA 2P0QA 5IN1A 4MDWA 2KK4A 3I55A 4J6YA 2CZ1B 2EFIA 2E10A 1LOJA 2PVGB 2DD5A 4C0DB 4BDZA 2WSCE 2EQKA 2DPPB 3JRZA 2LCLA 2EJGA 2XICA 3JSCA 2RHUA 1O75A 3P8DA 4M75C 4OGCA 4PLLA 4XTYA 3VV0A 1K73U 2L8DA 2P0KA 1N9SA 4MMKA 2EQMA 2R58A 3UWNA 3RMQA 1VQ7T 3KUFA 3M53A 2CZ7B 4M75G 5LJ3d 5HY6A 4A4KA 3KXTA 3G7ZA 5LL6S 3G71T 4M7DE 2D9TA 2YLCA 3BY7A 3OYKA 2EIFA 2DXTA 4X9CA 1M8VA 2QA4A 3NTIA 2R5MA 4C5IA 5J39A 5LJ5h 4FT2A 3SWNB 2RJCA 4M7AA 3I56T 4EMHA 3SDZA 4IUTA 4Q5WA 4PKCC 4A4HA 1JB0E 1XNIA 4BE2A 3S3MA 3M57A 1JJ2A 1YJNA 2A7YA 1Y96B 1OYXA 3INZA 3JCMc 5I2SA 4MZTA 1IREB 3BDLA 2OTJA 3E9GA 4C0FA 4X34A 2LC4A 1WQ7A 1VQ9A 3LYIA 5HKCA 4HKEA 3OA6A 2F5KA 2GCXA 4C5HA 3A8GB 3E1SA 3CBPA 1WGSA 4BE0A 2XD0A 4J8OA 2LT4A 4C0GA 1M90U 5CKEA 3NTHA 1BI2A 2LTOA 4A4FA 2CYZB 4M75E 3G4SA 1TH7A 1K8AC 4DOVA 1DJ7B 2EJ9A 4XAXB 3LH0A 5GAMh 5GANg 5GAOm 4JS4A 4JLGA 1VQ4A 2QDYB 4M78C 1K9MC 4OB3B 3EFSA 4R56A 3CCRA 3VYHB 5D6XA 1OZ3A 3PTAA 4QVCA 4EMGA 4QQDA 4BI4A 3J81E 1VQ4T 3V8KA 1VQOA 3OYJA 3BW1A 5LJ3h 2XDBA 3CCET 2VV5A 3L2UA 2H3JA 3FDRA 3PIPA 3GIBA 1MGQA 3LLRA 4ZN3A 4J6XA 5CK9A 1X6OA 3OYHA 4M78B 3GLXA 5GANf 3BDUA 5A2QE 1QVGS 2EQUA 1LNXA 3JB9F 3S3OA 2HBPA 2ZPGB 4J7FA 3MEAA 3PIOA 2X35A 2X4YA 1X01A 4C92A 4OVAA 3ME9A 3URGA 5GAOr 1NE8A 4M7AD 1R8OB 1KD1C 1UGSB 3WXMB 4NS5A 5LJ3e 1G3TA 4C8QF 3G6EA 1Y96A 3CCUA 2L3RA 3A8MB 4IUVA 4C92D 4PNOA 2Y4YA 2E6ZA 2RJFA 4QW2A 3ZBDA 3QSUA 1N27A 3QDRB 2KDSA 1SSFA 3MEWA 4XTUA 4BACA 4LD9K 2KY9A 2V8JA 2DO3A 3EFRA 4FSXA 4MZMA 3H8ZA 5CKBA 3RMSA 1YBYA 2PU9B 3C94A 3HFOA 4J5YA 4P5NA 4BUGA 2ZCFB 5GAOl 1X75C 4RCBA 1Q81C 1N8RC 3LW5E 2DXBA 3MCAB 4M77D 1G5VA 1K73C 4MZPA 3TU4K 4EMKC 3CCRT 4M7DF 5CQYA 5LJ5j 3L2ZA 4OP0A 5FLXE 2CZ6B 2R5AA 4F7UF 5GANh 5GAN8 5GAMg 1XOVA 1IZ6A 2K5FA 2QQAA 5GAN2 3JB9G 3JB9J 4GY5A 5GMKj 5IAYA 1VQ8A 2ZPHB 2E65A 2IVWA 3OYCA 2EWNA 4M7DC 2ZPIB 4PJOG 4HA8A 4JRQA 4A4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6Y A;  4Y91 A;  2DVE A;  2E10 A;  1LOJ A;  5LJ3 g;  1B34 A;  3V8L A;  4XTX A;  1I8F A;  3JCM V;  5CAI A;  2EJG A;  4C92 F;  2E41 A;  2VXF A;  5GMK i;  4J6W A;  4XTY A;  4M75 C;  2I2L A;  2RA2 A;  2Y90 A;  4M75 B;  2E1H A;  1D3B A;  1N9S A;  2HNI A;  3FB9 A;  1JBM A;  4MMK A;  4MML A;  2K57 A;  4XU3 A;  1LJO A;  4PJO F;  5I21 A;  4M75 G;  5LJ3 d;  3SB2 A;  4M7D E;  4XTW A;  3BFM A;  4M7D A;  1D3B B;  2YLC A;  3BY7 A;  4F7U A;  1N9R A;  2DXT A;  4X9C A;  1M8V A;  2DTO A;  5GAN j;  4F7U B;  2ZGW A;  3RKX A;  2RD1 A;  5LJ5 h;  4JLI A;  4M7D B;  3RIR A;  1B34 B;  5GAM d;  3SWN B;  1I5L A;  4M7A A;  4PJO C;  2QTX A;  4EMH A;  1WNL A;  3JCM e;  2E64 A;  5GAN 7;  5GAN 5;  4M7A E;  4M75 A;  4JRI A;  2DZ9 A;  3JB9 H;  4M78 E;  4C92 C;  1WQW A;  1Y96 B;  3INZ A;  2RM4 A;  3JCM c;  3VU3 C;  3RUX A;  3PGG A;  4M77 F;  1HK9 A;  1WQ7 A;  2VXE A;  4WF2 A;  3M4G A;  3QO3 A;  2FB7 A;  4M75 D;  4XU0 A;  5GAO q;  3HSB A;  2JN0 A;  3V7C A;  4M78 G;  3RKY A;  5GAM f;  1JRI A;  1M5Q 1;  2DZC A;  4M78 A;  4JRK A;  4N0A C;  4M75 E;  3JCM h;  1TH7 A;  3FIF A;  1YCY A;  5GAN g;  2EJ9 A;  5GAO p;  4NL3 A;  5GAM h;  5GAO m;  5LJ3 f;  3SWN C;  4M7A F;  1KQ2 A;  4M78 C;  4XTZ A;  3EFS A;  2DXU A;  4C8Q E;  4EMK B;  4M78 F;  2DKG A;  2EJF A;  2YHT A;  4A54 A;  4EMG A;  4EMK A;  4QVC A;  4C8Q B;  4QVD A;  2RB6 A;  3V8K A;  4M77 E;  3BW1 A;  5LJ3 h;  4M77 A;  5GAN 6;  4N0A A;  4XQ3 A;  2YLB A;  4M78 D;  5GAN e;  1WPY A;  5LJ5 e;  3JCM X;  2DTH A;  4C8Q A;  3GIB A;  1MGQ A;  4J6X A;  2CGH A;  5LJ5 f;  4M78 B;  5GAN f;  4M7A C;  4PJO A;  3BDU A;  4PJO B;  3JB9 F;  2DJZ A;  1I4K 1;  1H64 1;  1LNX A;  4M75 F;  1BIA A;  1U1T A;  5GMK h;  5GAN 4;  3AHU A;  4C92 A;  1X01 A;  4M7D D;  4C92 B;  3L1A A;  4HT8 A;  4M77 G;  5GAO r;  3RKW A;  4F7U E;  3JCM P;  5LJ3 j;  4M7A D;  5LJ3 e;  4C8Q F;  1Y96 A;  3RES A;  3QHS A;  4C92 D;  4PNO A;  3JCM W;  5GMK l;  4C8Q C;  1BIB A;  4XTV A;  3JCM Q;  3JB9 D;  1HXD A;  4NOY A;  5GAN d;  3QSU A;  4V2S A;  4C8Q G;  4M7A B;  5GMK m;  2DTI A;  3JB9 I;  4XU2 A;  4PJO D;  5GAM j;  3FJP A;  5GAO n;  3JCM d;  4M77 B;  4XTU A;  5LJ5 g;  5GAM e;  3JCM b;  4JUV A;  5DY9 A;  1I81 A;  4C92 E;  5GMK e;  3EFR A;  5LJ5 d;  4F7U G;  2FYK A;  4NL2 A;  5GAO l;  3HFO A;  4J5Y A;  4M7D G;  4DQ2 A;  4RCB A;  4XU1 A;  3SWN A;  3HFN A;  3QUI A;  4M77 D;  5GAN 3;  4PJO E;  4A53 A;  1KQ1 A;  4RCC A;  3JCM g;  4M7A G;  4EMK C;  3V7S A;  4M7D F;  5LJ5 j;  3L2Z A;  1U1S A;  4OP0 A;  4HT9 A;  4F7U F;  5GAN h;  5GAN 8;  5GAM g;  4C92 G;  2EAY A;  2DEQ A;  3JCM f;  3V8J A;  5GAN 2;  3JB9 G;  3JB9 J;  2VC8 A;  5GMK j;  4M77 C;  2E65 A;  4X9D A;  4C8Q D;  2EWN A;  4M7D C;  3RER A;  4PJO G;  3V7R A;  4HA8 A;  3JCM J; 
#chains in the Genus database with same CATH topology
 1UHC A;  4XTX A;  3MJX A;  1SPK A;  1VQ6 A;  3EG0 A;  1K4U S;  2DL5 A;  3GOX A;  2BKD N;  1OU9 A;  1I1J A;  4AMC A;  4AFQ C;  2O4X A;  1D3B B;  2M02 A;  3G71 A;  1Q82 R;  1VQL A;  4Z89 A;  1WNL A;  3P8B B;  4OML A;  2MPX C;  3EAE A;  2XHC A;  3U23 A;  1Q7Y C;  3CC4 A;  2QAZ A;  2C0I A;  4BI8 B;  5CKD A;  1M1F A;  1B3Q A;  1QP3 A;  2MWO A;  4M78 A;  2V26 A;  1RI0 A;  3FRN A;  1GXI E;  1MHN A;  1MV3 A;  1MMA A;  2E6N A;  1UHF A;  1K8A R;  1NM7 A;  3SWN C;  4M7A F;  5I2M A;  2CH4 W;  4M78 F;  2E5Q A;  2RB6 A;  3HRU A;  4FYW B;  3CME T;  2XKO C;  5DLO A;  2NLU A;  4DEY A;  4GLM A;  2X51 A;  2DL3 A;  1AOJ A;  1NLP C;  2FPE A;  1ZUK A;  2DMO A;  4F7U E;  4RTZ A;  1UUE A;  5IHI A;  1UGP B;  4KBM B;  3M0T A;  1HXD A;  2FPD A;  4C8Q G;  2QQB A;  4D8K A;  3FJP A;  3JCM d;  3J80 E;  2X4J A;  4E7H A;  1YJ9 Q;  1BYM A;  4LUD A;  1Q82 U;  4PJJ A;  1D1A A;  2DER A;  3JCM J;  1BI1 A;  2MYS A;  1TSF A;  2DVE A;  3MEU A;  3OYD A;  5KCO A;  4JJC A;  4C92 F;  2I2L A;  2L89 A;  1W1F A;  1YI2 A;  1VQM A;  1N5Z A;  2K57 A;  3L2V A;  2V8K A;  1QKX A;  4DBF A;  4UC4 A;  1VIE A;  2JUF A;  2FO0 A;  4DA4 A;  2RD1 A;  4HCZ A;  2L3S A;  4OMQ A;  1I5L A;  3CD6 T;  2OAU A;  4OMF B;  5A0G A;  3QJY A;  3JAM E;  3OYG A;  2L3Q A;  2JNG A;  3CCS T;  4M75 D;  4FU6 A;  1UG1 A;  2DK3 A;  2NUT A;  2ZPB B;  1VQK A;  1GCP A;  2FZC B;  4ZN1 A;  1JJ2 P;  2QI2 A;  4N0A C;  1SHG A;  2JZ2 A;  4BY6 C;  2QQ9 A;  2EKO A;  5GAO p;  3CCE Q;  5FWC A;  4RTY A;  2JTF A;  2JW4 A;  3H0I A;  2PUO B;  1VQ6 T;  4PJN A;  4L5G A;  4AG2 C;  5GAN e;  2KYM A;  1XTD A;  5KYU A;  2PTK A;  4KUI A;  5EG2 A;  1T0H A;  4RMO A;  2ZAE A;  4QQG A;  2CSQ A;  2GTJ A;  2KMT A;  4M77 G;  2KXC A;  1VYV A;  1PCX A;  4YTL A;  4CC4 B;  1VQ9 T;  2YUQ A;  3A8O B;  4HVV A;  3CCR Q;  1RUW A;  1T3S A;  4LDX A;  4VUB A;  1IB8 A;  1I81 A;  1Q95 G;  1GRI A;  1ZA1 B;  2LP5 A;  4RUG A;  4KRT A;  2QXF A;  4EIK A;  2XDP A;  3VS1 A;  2O9V A;  2XK0 A;  1HD3 A;  4ORZ A;  3KBG A;  2EBP A;  4C0D C;  2E41 A;  2VGM A;  3N5B B;  4J6W A;  2XID A;  1NLO C;  1Q86 R;  1AD5 A;  2BZY A;  2MI6 A;  3BE3 A;  1AWO A;  4M4Z A;  4J83 A;  3CCM A;  4E7I A;  2LCC A;  3LH5 A;  1N9R A;  2QQS A;  1QP2 A;  1ZSG A;  3L2W A;  1AWW A;  4JJN K;  5M9O A;  4OMO A;  3JCM e;  5GAN 5;  3QKJ A;  4PFZ A;  3OB9 A;  4ESR A;  3VU3 C;  4TVR A;  1GBQ A;  2COZ A;  4L59 A;  3CCM Q;  5I21 A;  2CP3 A;  5GAO q;  1VYU A;  3ZFJ A;  3LWI A;  1KC8 U;  3PMI A;  3TSZ A;  1NBE B;  1ZSZ A;  2OTL T;  1JRI A;  3CPF A;  1PG5 B;  2B8A A;  4JRK A;  2LNH B;  3JCM h;  3M55 A;  3EFO A;  1NYG A;  3HHT B;  1S72 A;  2RK1 A;  1QWE A;  2EJF A;  2RMO A;  2GGR A;  2RQV A;  4RG2 A;  1YCS B;  4L6V 5;  1R0C B;  4M77 A;  1M2V B;  1BB9 A;  2Z0W A;  1WPY A;  1VQM T;  3X26 B;  1JJ2 S;  3X25 B;  1WJS A;  5LJ5 f;  2COY A;  4PL6 A;  5FWB A;  4LDU A;  4GLK A;  3VS3 A;  1H64 1;  4R55 A;  2DF6 A;  5GAN 4;  1YI2 T;  3OSV A;  2CT3 A;  1VQO T;  4FW2 A;  2A08 A;  1PD0 A;  1RAA B;  2YDL A;  2LQK A;  3RES A;  3L2Q A;  1OX9 A;  2MAM A;  5GMK l;  4J7I A;  1BIB A;  2L0A A;  2V1Q A;  2HKQ B;  4N4I A;  1PSF A;  5GAN d;  3HP9 A;  3UPU A;  3G6E Q;  1N8R R;  1E7O A;  4WTO B;  1M2O A;  2VWF A;  2LX7 A;  3CMA T;  2RHY A;  1QCO A;  2AHJ B;  5GMK e;  4XU1 A;  4AG1 C;  4PJO E;  4OB1 B;  1NEB A;  4A53 A;  1Q81 U;  3CD6 A;  1UGV A;  3V7S A;  2YRC A;  2DEQ A;  3UA7 A;  2F5T X;  3V8J A;  5FU6 C;  4ATO A;  4J9B A;  4C8Q D;  3CCL Q;  3RER A;  1WJR A;  5IN1 A;  4MDW A;  3I55 A;  4J6Y A;  4LNP A;  5I11 A;  2PVG B;  4F17 A;  2DPP B;  3IQL A;  4AFZ C;  2L8D A;  2P0K A;  1N9S A;  1BU1 A;  4MMK A;  2DL7 A;  3PVQ A;  3UWN A;  1VQ7 T;  4JPB W;  2FZK B;  3G71 T;  3QWY A;  3EG2 A;  1M8V A;  3NTI A;  2K9G A;  4C5I A;  5LJ5 h;  1D0X A;  3SWN B;  2RJC A;  4EMH A;  1QKW A;  4A4H A;  3S3M A;  3M57 A;  1IRX A;  3MPU B;  3JCM c;  2DFU A;  4DEX A;  3E9G A;  4C0F A;  2LC4 A;  1WQ7 A;  1VQ9 A;  4HKE A;  1WGS A;  2JM8 A;  4C0G A;  1M90 U;  1BI2 A;  2D1X A;  2CYZ B;  2H8H A;  4M75 E;  2ED1 A;  3TQ7 P;  1K8A C;  1YJW Q;  4DOV A;  1DJ7 B;  4LN2 A;  4XAX B;  5GAN g;  5GAM h;  4JS4 A;  1VQ4 A;  1K9M U;  2AZS A;  2QDY B;  4M78 C;  2YXY A;  3CCR A;  5D6X A;  1OZ3 A;  2NUP B;  4BI4 A;  1VQ4 T;  3R6N A;  2XDB A;  2JJ9 A;  2H3J A;  2HL3 A;  3PIP A;  1MGQ A;  3TVT A;  4M78 B;  3GLX A;  1QCF A;  3JB9 F;  2HBP A;  4OVA A;  3URG A;  2JTE A;  2EVR A;  2LCS A;  4C8Q F;  1Y96 A;  1K0S A;  4PNO A;  4QW2 A;  3MEW A;  3RNJ A;  3RMS A;  2DO3 A;  3H8Z A;  2PU9 B;  3HFO A;  1G5V A;  4RCB A;  2DXB A;  3I56 Q;  5LJ5 j;  3JV3 A;  2K5F A;  3JB9 G;  5GMK j;  3NMZ C;  2E65 A;  4PJO G;  4BDZ A;  4JRQ A;  2CP7 A;  2LDM A;  2HSE B;  3HKS A;  4ZNX A;  1RAG B;  5AYF A;  3FC3 A;  5KCH A;  3JCM V;  1G83 A;  1LPL A;  2CZ0 B;  2VXF A;  1UJY A;  3T9N A;  2ATC B;  2RJD A;  3M56 A;  5HCK A;  1VIF A;  5EC7 A;  2RA2 A;  3FB9 A;  8ATC B;  4PFO A;  1KD1 R;  4FYX B;  4O5V A;  3S3N A;  4KH0 B;  1YFN A;  4F7U B;  2ZGW A;  4M7D B;  3QZ5 B;  4PJO C;  4HVW A;  3M0S A;  1NG2 A;  1F1B B;  4C92 C;  2MK5 A;  3MO8 A;  1H8K A;  4XK8 E;  1HK9 A;  1R77 A;  3M4G A;  2HD0 A;  1VQK T;  4KUD K;  2QA4 T;  2CKK A;  4J9C A;  2VKN A;  4M78 G;  2YT6 A;  2DD4 A;  1M5Q 1;  2SEM A;  4RTV A;  4LDW A;  1M90 C;  1RAF B;  1ZQ1 A;  3FIF A;  3OYI A;  1JXM A;  5LJ3 f;  1E6G A;  3P8H A;  1WHJ A;  3M0P A;  2DIQ A;  3LWH A;  4A54 A;  2EGE A;  3A8H B;  2HQX A;  4M77 E;  1XQH A;  2QDL A;  2YLB A;  2VVK A;  4OB2 B;  3CD6 Q;  4JS5 A;  4DBH A;  2OTL A;  2RH2 A;  2CRE A;  4PJO A;  4QQ6 A;  2GQI A;  1KHI A;  2J06 A;  2GF7 A;  1M1G A;  4D8D A;  2OX7 A;  2FRW A;  2XDD A;  1PNJ A;  1Y57 A;  2FVU A;  2FHD A;  2LJ1 A;  5FU7 B;  5LJ3 j;  1YIT A;  2DYI A;  2O9S A;  5FU6 B;  1QCN A;  2O01 E;  3JCM W;  1YHQ T;  3M4Y A;  2D6F A;  2RQW A;  1ZUY A;  2CP6 A;  3E19 A;  1UGQ B;  2DAQ A;  2HQE A;  1XJW B;  1QVG P;  3I35 A;  1X43 A;  3OS0 A;  2CS7 A;  1W2B A;  4FCY A;  4JRP A;  2JTM A;  5J3B A;  3OBW A;  2DBM A;  1W2B S;  1NJI C;  3OBY A;  4J9H A;  3GF5 A;  3OMG A;  1K0X A;  2YRD A;  3QYH B;  3EG9 B;  3CQT A;  1SSH A;  2JMC A;  1QLY A;  2W10 A;  2O88 A;  1AEY A;  1J3T A;  2RHZ A;  1QVF S;  4AFU C;  5HK0 A;  1FMV A;  2C0O A;  1W70 A;  2Y4X A;  2LNV A;  4FIB A;  1UTI A;  2GNC A;  4RTU A;  2DX1 A;  4ZTF A;  3NFC A;  2RM4 A;  3ZEH A;  4OGE A;  2YWW A;  3QO3 A;  2BZ8 A;  2XMF A;  3VUB A;  2MWP A;  4RTT A;  4X1V A;  3UAT A;  1U8R A;  2F2V A;  4DOW A;  1VQM Q;  2VUB A;  1EIF A;  2E5K A;  2DXU A;  1VA7 A;  1WHH A;  1TXQ A;  3MP1 A;  5KYU B;  4C8Q B;  1YI2 Q;  2E4H A;  5DLQ E;  1A0N B;  1JXO A;  4LDY A;  3AT1 B;  2RHI A;  1PKT A;  1RAC B;  3OW2 A;  1UEB A;  3TSW A;  3OY9 A;  3CMA Q;  2RQR A;  4BB7 A;  4E2F B;  3CCV A;  3M9Q A;  2HBW A;  2ROT A;  3QJ6 A;  2OTJ Q;  4E7L A;  3JB9 D;  5CIU A;  2DL8 A;  2BE9 B;  2DTI A;  2LT1 A;  2EGA A;  3JCM b;  5C0M A;  2GTO A;  4C92 E;  5IXB A;  3F70 A;  3CMA A;  1VQ8 T;  3GNF B;  2XU8 A;  4RCC A;  4M7A G;  2JS0 A;  1HYO A;  3VS5 A;  3I55 Q;  4FYV B;  3LGL A;  2KRS A;  1G3Y A;  3G71 Q;  3D7S B;  1FX7 A;  3CC2 A;  1B34 A;  4RTX A;  4Y28 E;  4MDX A;  2E1H A;  1KFZ A;  2K4Y A;  2O4X B;  3SB2 A;  1ARK A;  4J9E A;  1BCM A;  2RI5 A;  2EYW A;  2K2M A;  3RKX A;  4PLI A;  1KG1 A;  1Q82 C;  2M1H A;  1AZE A;  4BY6 B;  1VOM A;  1WQW A;  2OTL Q;  3CCL T;  3NHN A;  1RAE B;  1KD1 U;  1BKB A;  3M5A A;  1IHV A;  2EYX A;  3A5Z B;  1YHQ A;  1YN8 A;  5A0L A;  3OS5 A;  1WLP B;  3DKM A;  5KYX B;  4IIO A;  2P4R A;  5CR2 A;  4EDU A;  3DLM A;  4XTZ A;  3CBM A;  1I07 A;  1C1A A;  3OW2 P;  3QYG B;  2DKG A;  3WVD B;  2YUP A;  4ZGD B;  2HSP A;  2DTH A;  2RI2 A;  4IUU A;  2IG0 A;  1G8X A;  1VQN T;  1I4K 1;  2JM9 A;  3C0C A;  1IXD A;  3OS2 A;  3JCM P;  1Y71 A;  2LJ3 A;  4ZGE B;  4HCC A;  4C5E A;  1BI3 A;  1TOV A;  4XTV A;  4B9X A;  4FL6 A;  1TU0 B;  5KYY A;  1Q7Y U;  1C0M A;  3JB9 I;  3L2R A;  4PJO D;  1Q81 R;  2AK5 A;  1S72 Q;  1YP5 A;  4QT7 A;  2KT8 A;  1Y07 A;  2FYK A;  5I22 A;  3CBO A;  2G3R A;  5GAN 3;  3H9N A;  3CEY A;  3JCM g;  3HPW A;  3JCM f;  1O9S A;  4F14 A;  1YIJ T;  2ZPF B;  1M3A A;  2KK4 A;  3SHW A;  2J6F A;  1FYN A;  1VQ7 Q;  1K9M R;  3JRZ A;  4D6W A;  3P8D A;  4PLL A;  1WHK A;  3G4S Q;  2EQM A;  2R58 A;  2DRM A;  3KXT A;  3G7Z A;  2HL5 C;  2F2W A;  4E6R A;  2D9T A;  2KR3 A;  3OYK A;  2EIF A;  4X9C A;  1W6X A;  2QGG A;  1MUZ A;  2VB6 A;  3VRZ A;  3I56 T;  3SDZ A;  4IUT A;  4PKC C;  1JB0 E;  2RN8 A;  1PWT A;  1OEB A;  5I2S A;  4MZT A;  4X34 A;  4F16 A;  1TTH B;  3A8G B;  1WXU A;  3RBB B;  4BE0 A;  2XD0 A;  4Y92 A;  1IHW A;  3NTH A;  3EHR A;  3LH0 A;  2DET A;  1MMN A;  4JLG A;  5IXF A;  4FSS A;  1NEG A;  4QVC A;  4QQD A;  3V8K A;  5LJ3 h;  2VV5 A;  2I0N A;  3GIB A;  1WXT A;  3LLR A;  4B6M A;  5GAN f;  4KGV B;  2G6F X;  1YIT Q;  2A36 A;  1QVG S;  2EQU A;  3S3O A;  1D0Z A;  2HMA A;  2X4Y A;  1X01 A;  5IH2 A;  5IHK A;  2P84 A;  1R8O B;  5LJ3 e;  1YWP A;  4IUV A;  2CSI A;  3ZBD A;  1N27 A;  3QDR B;  2ESW A;  2KDS A;  4XTU A;  3A1P A;  3CCJ Q;  5KYX A;  3EFR A;  4P5N A;  1Q81 C;  2DLP A;  2HZY A;  4M77 D;  2E3I A;  4EMK C;  1OPK A;  4M7D F;  2JT4 A;  4F7U F;  5GAN h;  5GAN 8;  5GAM g;  1IZ6 A;  1S1N A;  1I0C A;  3JB9 J;  1Y0M A;  5IAY A;  2KRM A;  3OYC A;  4M7D C;  1VYT A;  1FMW A;  3HTR A;  2KYB A;  2ROL A;  3V8L A;  1I8F A;  3QG1 A;  2KRO A;  5GMK i;  3O8V A;  1YHQ Q;  1B07 A;  1PD1 A;  3EGD B;  1FXX A;  2O2O A;  1KSW A;  4XTW A;  3VYG A;  1NJI U;  2DEU A;  1ZA2 B;  2DTO A;  1AWX A;  4OMN A;  4KGZ B;  3TCJ A;  5KYY B;  2JVV A;  1K8A U;  2E64 A;  2QA4 Q;  4EPC A;  1M9S A;  4JRI A;  1H92 A;  3PMT A;  3L42 A;  4E7S A;  1UB4 A;  5CQX A;  2CH4 A;  5CKH A;  4XU0 A;  3CC7 T;  2FB7 A;  3HSB A;  2RQT A;  4E47 A;  5GAM f;  3VS6 A;  2DZC A;  4B9W A;  2K3X A;  4ANJ A;  1TWB A;  2GBQ A;  2ENM A;  2EQI A;  2LX9 A;  1VQL T;  1KQ2 A;  4O6J A;  2O31 A;  2DXC A;  1K1Z A;  2F1L A;  1U06 A;  2M0Y A;  2M51 A;  2W0Z A;  4FT4 A;  5KYW B;  2B86 A;  3M54 A;  3JCM X;  3X28 B;  2IIM A;  2E70 A;  3FEO A;  3PVL A;  3CCQ A;  1ACM B;  3OYN A;  2X4W A;  2PVO B;  3FLG A;  4CI0 C;  3CCU Q;  1QW1 A;  1WXB A;  2RHX A;  1RAI B;  4J9G A;  4M7D D;  3L1A A;  3OW2 S;  3CCQ T;  2MCN A;  3CC4 T;  8AT1 B;  1PSE A;  3M0Q A;  2HDA A;  3E2U A;  3HRT A;  4M7A B;  4IUQ A;  3LGF A;  3EFO B;  1M4Z A;  3UT1 A;  5LJ5 d;  1QVF A;  1RLQ C;  2H3E B;  1TS9 A;  1VQN A;  3QUI A;  2HEQ A;  6AT1 B;  1IGQ A;  2LQ8 A;  4ZGJ B;  5D6W A;  4HXJ A;  3SFM A;  2KSS A;  4AFS C;  4J9I A;  3V7R A;  1JO8 A;  1ZUU A;  4Y91 A;  3Q1J A;  5CAI A;  4KH1 B;  3QPH A;  2NWM A;  2BUD A;  3CCS A;  2YUN A;  4MML A;  1FMK A;  1KJW A;  2A37 A;  1WFW A;  2ZZD A;  2QEX A;  5GAN j;  4JJD A;  1SF9 A;  4M7A E;  3OYM A;  2L2P A;  4M78 E;  4PK4 A;  2RO0 A;  1WDX A;  4WF2 A;  2OI3 A;  1YJW T;  3I9Q A;  1ZLM A;  2EKH A;  2JN0 A;  2MF2 A;  2JOY A;  2VAS A;  3VUZ A;  3A8L B;  4CC7 A;  1V29 B;  2XI9 A;  1X6B A;  1P92 A;  2DE0 X;  2NYS A;  2RK2 A;  4BI3 A;  2R57 A;  3VS7 A;  3CCV T;  4N4G A;  1X2K A;  4C0Z A;  4IUP A;  2K3B A;  2YHT A;  5HK3 A;  4EMK A;  2HAX A;  1C6V X;  2F2X A;  2C06 A;  4M78 D;  3EG3 A;  1Q86 U;  1MND A;  3LX7 A;  3PE0 A;  1VQP T;  2M16 A;  4M7A C;  4PJO B;  2X9H A;  4CC2 A;  2DJZ A;  4ELY C;  3OYB A;  4ZTJ A;  2OTJ T;  1RAH B;  1BIA A;  1U1T A;  1LCK A;  3X24 B;  1PRM C;  3CME A;  1YJN Q;  2ZPE B;  5A0D A;  2COW A;  5L8R E;  3PNW C;  2DJQ A;  3OYA A;  1I5O B;  1SKU B;  4FYY B;  3KFV A;  1RAD B;  3QBY A;  4OB0 B;  2K2V A;  5LJ5 g;  4JUV A;  2WAC A;  1K76 A;  1GCQ A;  4F7U G;  3I55 T;  3VS2 A;  4JZ4 A;  1QVP A;  4DQ2 A;  3HFN A;  1V76 A;  3CC7 A;  3M59 A;  4C5G A;  1ZX6 A;  2NUT B;  3CPW P;  1ZBJ A;  1AT1 B;  4PJL A;  2DIL A;  1VQ7 A;  3C95 A;  3EG9 A;  3H41 A;  2PZ1 A;  3OYE A;  2GQV A;  1OPL A;  2NUZ A;  1LVK A;  1ABO A;  5D7U A;  3QXE B;  3H0F A;  1YIJ A;  1JBM A;  2VGN A;  4RTW A;  1RAB B;  2MMP A;  4Z02 A;  2P0P A;  5FRN A;  1UEC A;  5CKF A;  1X6G A;  2QQR A;  5GAN 7;  1PKS A;  2QAS A;  1TUD A;  3JB9 H;  1G3W A;  1YIJ Q;  2GFA A;  2AZV A;  3DB3 A;  3V7C A;  3CC2 Q;  3RKY A;  2D8H A;  5C6S A;  2KT1 A;  3OYF A;  3EGX B;  3EH1 A;  1K9A A;  4HCK A;  3O5Z A;  2KVQ G;  1M1K R;  4N4H A;  1RLP C;  3GBQ A;  3H6Z A;  1IO6 A;  4EMK B;  2FZG B;  4CRI A;  3I5R A;  3C4S A;  3QDF A;  2FRY A;  4XQ3 A;  1VQN Q;  2KEA A;  1TUC A;  4KUL A;  2CGH A;  1VQ5 Q;  1Q86 C;  2LRQ A;  1H3Z A;  1HJD A;  3VS0 A;  4M75 F;  2YSQ A;  5DM7 R;  1KQS A;  1AHJ B;  2FL7 A;  1BBZ A;  1NPP A;  4ELZ C;  1WIE A;  1S72 T;  1KQS S;  3QHS A;  2YRV A;  2DL4 A;  2QEX T;  4NOY A;  1WZO A;  1VQ5 A;  5GAM j;  1M27 C;  2BTT A;  4J9F A;  4NL2 A;  1ZBX A;  3MKD A;  4IIM A;  1U1S A;  1SG5 A;  3QII A;  4ME7 A;  1QVF P;  1KHC A;  1YJ9 T;  1YIT T;  1D1C A;  4OMP A;  2CZ1 B;  2EFI A;  2FG0 A;  1G2B A;  2DD5 A;  2PNI A;  2WSC E;  2LCL A;  2EJG A;  4XTY A;  2KE9 A;  1O75 A;  3VV0 A;  1K73 U;  2HKN A;  2KI7 A;  3KUF A;  3M53 A;  2CZ7 B;  4A4K A;  5LJ3 d;  2LMJ A;  5HY6 A;  1UJ0 A;  4PFP A;  3EGD A;  2YLC A;  3BY7 A;  3THK A;  2DXT A;  2QA4 A;  2R5M A;  5J39 A;  1Z9Q A;  3ULR B;  3CXC P;  3EG1 A;  4M7A A;  4Q5W A;  3A98 A;  1XNI A;  1YWO A;  1JJ2 A;  2A7Y A;  1EX4 A;  1Y96 B;  1OYX A;  3INZ A;  2FEI A;  1CSK A;  2OTJ A;  2ED0 A;  2EYZ A;  5HKC A;  2CT4 A;  2GCX A;  3E1S A;  5CKE A;  1QWF A;  2L3P A;  9ATC B;  3G4S A;  2EJ9 A;  4R0K A;  3M0U A;  4OB3 B;  3EFS A;  4R56 A;  1QMC A;  3PTA A;  2LZ6 B;  4EMG A;  3J81 E;  1RI9 A;  5ECA A;  3OYJ A;  3BW1 A;  3CCE T;  3CCQ Q;  1UE9 A;  2EPD A;  2ECZ A;  3BDU A;  1VQ6 Q;  1OUL A;  1LNX A;  2ZPG B;  4J7F A;  3MEA A;  3PIO A;  2X35 A;  1HSQ A;  3ME9 A;  1KK7 A;  1NE8 A;  2J05 A;  1KD1 C;  1UGS B;  4NS5 A;  1SEM A;  1G3T A;  3G6E A;  4PJM A;  2L3R A;  2J6K A;  4C92 D;  1W2B P;  2RJF A;  1KIK A;  3QSU A;  1VQ8 Q;  2KBT A;  1VQL Q;  1SSF A;  3RDV A;  4BAC A;  3ZL7 C;  1WA7 A;  4LD9 K;  2V8J A;  4MZM A;  4FSX A;  4ZN3 A;  5GAO l;  1YBY A;  3C94 A;  4J5Y A;  4BUG A;  1N8R C;  1TG0 A;  2ZCF B;  2CDT A;  3TU4 K;  3FJ5 A;  1M90 R;  3CCR T;  5CQY A;  1MV0 B;  1OU8 A;  1PHT A;  2CZ6 B;  4Z88 A;  1XOV A;  5GAN 2;  4GY5 A;  1VQ8 A;  2ZPH B;  1ZSZ B;  1R0B G;  1T0J A;  1MMG A;  2M9U A;  5LJ3 g;  2CP2 A;  3CC4 Q;  3HRS A;  2Y90 A;  2HNI A;  4FM4 B;  2AKL A;  2EYY A;  1JU5 C;  3QZ9 B;  1GCQ C;  3ER0 A;  2K3Y A;  3NGP A;  2RPN A;  4M75 A;  3CCJ A;  1NPR A;  1BK2 A;  1GBR A;  2BIV A;  4J9D A;  1NZ9 A;  3PGG A;  2VXE A;  3MP6 A;  1GL5 A;  5KE2 A;  4E7K A;  3WVE B;  3VKI A;  1YJW A;  3OMC A;  4II1 A;  3SEM A;  1M3B A;  2C0T A;  1MMD A;  3M0R A;  1OZ2 A;  3PT9 A;  3TRE A;  2BZX A;  5CCA A;  1YJ9 A;  1MNE A;  4NL3 A;  2VYT A;  1JEG A;  5L23 A;  1NYF A;  2PUK B;  2DVJ A;  4C8Q E;  1OX8 A;  1NJI R;  3SD4 A;  5J26 A;  5GAN 6;  1M2V A;  3E9F A;  3EGU A;  2KXD A;  5LJ5 e;  3GPL A;  3CCU T;  2EYQ A;  2AT1 B;  4LUE A;  4C8Q A;  3MET A;  5CO7 A;  1WHG A;  3CME Q;  1SRM A;  2EW3 A;  1RL2 A;  2E3H A;  1PC0 A;  1ZHI A;  4AT1 B;  3MHX A;  1M3C A;  1M1K U;  2HCK A;  1PRL C;  1WHL A;  3CPW S;  2RI3 A;  3CCV Q;  3VJP A;  1VUB A;  4LXC A;  2K5L A;  4IUR A;  3OS1 A;  1CKB A;  1KQ1 A;  2JS2 A;  1SRL A;  4X9D A;  1ZSZ C;  7AT1 B;  3MEV A;  2V8I A;  1N6A A;  3J7A F;  3G4S T;  3QWX X;  1M1K C;  1YJN T;  2RJE A;  4BD3 A;  3GNG A;  5GJV B;  2CP5 A;  4BE1 A;  2QTV A;  2RNA A;  2K6D A;  3MP8 A;  4M75 B;  2F69 A;  3CCE A;  1AWJ A;  3BFM A;  4M7D A;  4F7U A;  3NTK A;  4OF1 A;  3EHQ A;  2MOX A;  5AT1 B;  4JLI A;  1B34 B;  5GAM d;  3UF4 A;  1Z9Z A;  2V1R A;  3G1J A;  4F04 B;  1Y7X A;  3CPW A;  4KT0 E;  5GJW B;  2EQJ A;  4M77 F;  2P4T A;  2J6O A;  1VQP A;  3H0H A;  1U5S A;  1G3S A;  2QG9 B;  2D0N A;  2KGT A;  3PFS A;  3CCS Q;  3M58 A;  3CXC S;  5CVI A;  2BE7 D;  3OYY A;  2D0Q B;  3DB4 A;  3CXC A;  1VQP Q;  1KC8 C;  4N0A A;  1UGR B;  2X3X D;  1E6H A;  1V1C A;  4QVZ A;  2QEX Q;  1VQ4 Q;  2LQW A;  1GFC A;  4CC3 A;  3OSS C;  4QKU A;  1B7T A;  4HT8 A;  3C12 A;  3RKW A;  4FW1 A;  1JQQ A;  4A4G A;  3CCJ T;  2WSF E;  1D1B A;  2WSE E;  2LVM A;  2SRC A;  3ASK A;  4XU2 A;  3REA B;  3REB B;  3R6O A;  1AVZ C;  5GAO n;  2CUD A;  2L5Q A;  4E7J A;  5GAM e;  1EZZ B;  3UDC A;  1WX6 A;  4IKF A;  4M7D G;  1H3H A;  1IGU A;  2E12 A;  2KQW A;  3OYL A;  2AKK A;  4C92 G;  2A0F B;  2X3W D;  4WCI A;  4HCB A;  4M77 C;  1K73 R;  1KC8 R;  2K79 A;  1W4S A;  4GBQ A;  2A3L A;  1WYX A;  4E7Z A;  2LQN A;  1WI7 A;  5KYN A;  5FRM A;  3EH2 A;  3I56 A;  2IPO B;  1D3B A;  4PJO F;  4XU3 A;  1LJO A;  1BI0 A;  1YNZ A;  4LDV A;  2X4X A;  5FRO A;  2K5I A;  4JDS A;  3RIR A;  1WJQ A;  3CC7 Q;  2QTX A;  3S6W A;  2DZ9 A;  3CC2 T;  2LJ0 A;  5D6Y A;  1PM3 A;  3RUX A;  1U3O A;  2RF0 A;  2DBK A;  2GFU A;  3TEE A;  1FWZ A;  1X69 A;  3CCM T;  2KRN A;  1UDL A;  2JMA A;  1VQK Q;  1YCY A;  2PQW A;  5IT9 E;  4HVU A;  4DBQ A;  5FU7 C;  3GP8 A;  2DYB A;  2DIG A;  4BDY A;  4LE9 A;  4QVD A;  1VQ5 T;  3CCL A;  2DA9 A;  5KYW A;  2OJ2 A;  1BCO A;  1OV3 A;  3DLL A;  2PVD B;  2XG8 D;  1D0Y A;  5GMK h;  3AHU A;  1WHM A;  1GFD A;  4C92 B;  2KAF A;  4RG8 A;  5KH6 A;  3OQ5 A;  3JCM Q;  4C8Q C;  2M0O A;  4V2S A;  3X20 B;  5GMK m;  2KNB B;  4DBR A;  4M77 B;  5DY9 A;  4LD6 A;  1AZG B;  3G6E T;  3SWN A;  1OI1 A;  1VQ9 Q;  5KE3 A;  1N8R U;  4HT9 A;  4Z8A A;  2DNU A;  2EAY A;  3EGX A;  3HL8 A;  2VC8 A;  1QVG A;  1CKA A;  4RKU E;  2P0Q A;  5IHN A;  3UA6 A;  2DRK A;  4KGX B;  2E10 A;  1LOJ A;  4C0D B;  2EQK A;  2XIC A;  3JSC A;  2RHU A;  4OGC A;  4M75 C;  1T3L A;  3RMQ A;  2RQU A;  4M75 G;  4M7D E;  5LL6 S;  2YUO A;  2A28 A;  2HQH A;  4FT2 A;  2QYZ A;  2MIO A;  4BE2 A;  1YJN A;  4K11 A;  1Q7Y R;  1IRE B;  3BDL A;  3LYI A;  1QQJ A;  3OA6 A;  2F5K A;  4C5H A;  2CUB A;  1VQO Q;  3CBP A;  1OOT A;  4J8O A;  2LT4 A;  2LTO A;  4A4F A;  1TH7 A;  5GAO m;  1K9M C;  1X27 A;  3VYH B;  2QGF B;  1D09 B;  1M8M A;  1VQO A;  1KQS P;  1EFN A;  1OQK A;  3VS4 A;  3L2U A;  4JJB A;  1TUG B;  3FDR A;  2OAW A;  2EGC A;  4A63 B;  4J6X A;  5CK9 A;  1X6O A;  3OYH A;  2J7I A;  5A2Q E;  1ABQ A;  4OMM A;  2D8J A;  4C92 A;  2CP0 A;  5GAO r;  3NPF A;  4M7A D;  3CCU A;  2K7A A;  3I5S A;  3A8M B;  2Y4Y A;  2E6Z A;  5FW9 A;  2NUP A;  1SHF A;  1M30 A;  1UFF A;  2KY9 A;  2ABL A;  5CKB A;  3WXM B;  2AIR B;  1X75 C;  3LW5 E;  3MCA B;  1K73 C;  4MZP A;  3VRY A;  2QK0 A;  1X2Q A;  3L2Z A;  4OP0 A;  5FLX E;  2R5A A;  2DM1 A;  2QQA A;  2JXB A;  2IVW A;  2EWN A;  2FPF A;  2ZPI B;  3RR6 A;  4HA8 A;  4A4E A;  4JZ3 A; 
#chains in the Genus database with same CATH homology
 2LDM A;  3HKS A;  2M9U A;  5LJ3 g;  5AYF A;  3V8L A;  4XTX A;  1I8F A;  3JCM V;  5KCH A;  3HRS A;  3QG1 A;  3FC3 A;  2CZ0 B;  2VXF A;  3T9N A;  5GMK i;  3O8V A;  1VQ6 A;  2RJD A;  3M56 A;  1VIF A;  3GOX A;  4D6W A;  2BKD N;  2RA2 A;  2Y90 A;  3FB9 A;  2HNI A;  4FM4 B;  1FXX A;  2O4X A;  4XTW A;  3VYG A;  1NJI U;  1D3B B;  3G71 A;  3QZ9 B;  4O5V A;  3S3N A;  2DTO A;  3ER0 A;  4F7U B;  2ZGW A;  3JCM Q;  4M7D B;  3TCJ A;  2K3Y A;  1VQL A;  3QZ5 B;  4PJO C;  1K8A U;  1WNL A;  2JVV A;  2E64 A;  4M75 A;  4EPC A;  3P8B B;  3CCJ A;  1M9S A;  1NPR A;  4JRI A;  3PMT A;  3L42 A;  4C92 C;  3MO8 A;  1UB4 A;  5CQX A;  3EAE A;  4XK8 E;  2BIV A;  1NZ9 A;  3PGG A;  1HK9 A;  2VXE A;  2XHC A;  5CKH A;  3M4G A;  3MP6 A;  2FB7 A;  2HD0 A;  4XU0 A;  1VQK T;  3CC7 T;  5KE2 A;  2QA4 T;  4E7K A;  4KUD K;  4ATO A;  3WVE B;  4E47 A;  2CKK A;  1Q7Y C;  3CC4 A;  3VKI A;  4M78 G;  5GAM f;  3OMC A;  2DD4 A;  1YJW A;  1M5Q 1;  2DZC A;  4II1 A;  4B9W A;  4BI8 B;  2K3X A;  1M1F A;  1QP3 A;  2MWO A;  4M78 A;  5CKD A;  1GXI E;  1RI0 A;  3FRN A;  3TRE A;  1MHN A;  1OZ2 A;  3PT9 A;  4LDW A;  5CCA A;  1YJ9 A;  1M90 C;  1ZQ1 A;  3FIF A;  4NL3 A;  3OYI A;  2E6N A;  2VYT A;  5LJ3 f;  2LX9 A;  3SWN C;  1VQL T;  1KQ2 A;  4M7A F;  4O6J A;  2DXC A;  2PUK B;  3P8H A;  5I2M A;  2DIQ A;  3LWH A;  4C8Q E;  4M78 F;  4A54 A;  3A8H B;  2E5Q A;  2HQX A;  2RB6 A;  3HRU A;  5J26 A;  4FT4 A;  4M77 E;  3SD4 A;  1XQH A;  3CME T;  5GAN 6;  2XKO C;  2YLB A;  3E9F A;  3M54 A;  2NLU A;  4OB2 B;  5DLO A;  5LJ5 e;  2EYQ A;  3JCM X;  4C8Q A;  3GPL A;  3X28 B;  3CCU T;  3MET A;  4JS5 A;  5CO7 A;  2E70 A;  3FEO A;  2OTL A;  2RH2 A;  3CCQ A;  4PJO A;  4QQ6 A;  1KHI A;  1RL2 A;  3OYN A;  1ZHI A;  2X4W A;  2GF7 A;  2PVO B;  3FLG A;  4CI0 C;  3MHX A;  1M1G A;  1QW1 A;  2RHX A;  4M7D D;  1M1K U;  3L1A A;  3OW2 S;  2XDD A;  3CCQ T;  4F7U E;  5FU7 B;  2FVU A;  2FHD A;  4C8Q C;  5LJ3 j;  3CC4 T;  1YIT A;  1PSE A;  1UGP B;  5FU6 B;  4KBM B;  3CPW S;  2O01 E;  3HRT A;  3JCM W;  1YHQ T;  2RI3 A;  3M4Y A;  2D6F A;  1HXD A;  4C8Q G;  3E19 A;  2QQB A;  1VUB A;  4M7A B;  3VJP A;  1UGQ B;  2DAQ A;  3FJP A;  4IUQ A;  2HQE A;  3LGF A;  3JCM d;  2K5L A;  1M4Z A;  3J80 E;  3UT1 A;  2X4J A;  5LJ5 d;  1QVF A;  4E7H A;  4IUR A;  2CS7 A;  3OS0 A;  1W2B A;  1BYM A;  3OS1 A;  1VQN A;  4JRP A;  3QUI A;  2JTM A;  1Q82 U;  1KQ1 A;  5J3B A;  3OBW A;  2LQ8 A;  4ZGJ B;  5D6W A;  3SFM A;  1W2B S;  2KSS A;  1NJI C;  3OBY A;  4X9D A;  3GF5 A;  3MEV A;  3OMG A;  2V8I A;  3V7R A;  1N6A A;  3JCM J;  1BI1 A;  3J7A F;  3G4S T;  3QYH B;  1M1K C;  4Y91 A;  2DVE A;  3Q1J A;  1YJN T;  3MEU A;  2RJE A;  4BD3 A;  3GNG A;  5CAI A;  4BE1 A;  3OYD A;  3QPH A;  5KCO A;  4C92 F;  2BUD A;  3MP8 A;  3CCS A;  2I2L A;  2L89 A;  1YI2 A;  4M75 B;  1VQM A;  4MML A;  2K57 A;  2F69 A;  3L2V A;  3CCE A;  2RHZ A;  3BFM A;  4M7D A;  1QVF S;  2V8K A;  4F7U A;  2ZZD A;  5HK0 A;  4UC4 A;  1VIE A;  2JUF A;  3NTK A;  2QEX A;  4OF1 A;  2Y4X A;  5GAN j;  4DA4 A;  2LNV A;  2RD1 A;  4JLI A;  4HCZ A;  4FIB A;  1B34 B;  5GAM d;  1I5L A;  4M7A E;  3OYM A;  4ZTF A;  3CD6 T;  3NFC A;  2OAU A;  4OMF B;  1Y7X A;  4M78 E;  5A0G A;  3CPW A;  2RM4 A;  3QJY A;  3JAM E;  2RO0 A;  4KT0 E;  3OYG A;  2EQJ A;  4M77 F;  2JNG A;  4OGE A;  4WF2 A;  3ZEH A;  3CCS T;  3QO3 A;  4M75 D;  2P4T A;  1YJW T;  4FU6 A;  2JN0 A;  2DK3 A;  2ZPB B;  1VQP A;  2MF2 A;  3VUB A;  1VQK A;  2JOY A;  1G3S A;  2MWP A;  3VUZ A;  3A8L B;  4ZN1 A;  3PFS A;  2QI2 A;  1V29 B;  2XI9 A;  4N0A C;  3M58 A;  3CXC S;  2JZ2 A;  5CVI A;  4BY6 C;  4DOW A;  2QQ9 A;  1P92 A;  1U8R A;  2RK2 A;  2VUB A;  1EIF A;  2R57 A;  3OYY A;  4BI3 A;  2EKO A;  5GAO p;  3CCV T;  2D0Q B;  4N4G A;  4C0Z A;  3DB4 A;  3CXC A;  2JTF A;  4IUP A;  2DXU A;  2YHT A;  3MP1 A;  4EMK A;  5HK3 A;  2PUO B;  4C8Q B;  2HAX A;  1VQ6 T;  2C06 A;  4L5G A;  1KC8 C;  5DLQ E;  4N0A A;  4M78 D;  5GAN e;  4LDY A;  1UGR B;  1Q86 U;  1XTD A;  2RHI A;  3LX7 A;  4KUI A;  4QVZ A;  2QEX T;  3OW2 A;  1VQP T;  2M16 A;  1UEB A;  4M7A C;  4PJO B;  2DJZ A;  5EG2 A;  4ELY C;  4RMO A;  3OY9 A;  4QQG A;  3OYB A;  4ZTJ A;  2OTJ T;  1BIA A;  1U1T A;  3OSS C;  3X24 B;  2KMT A;  4HT8 A;  3CME A;  4M77 G;  3C12 A;  4BB7 A;  3RKW A;  2ZPE B;  5A0D A;  3CCV A;  3M9Q A;  4A4G A;  3CCJ T;  3QJ6 A;  3PNW C;  4YTL A;  2WSF E;  5L8R E;  4E7L A;  2WSE E;  1VQ9 T;  2LVM A;  3OYA A;  3JB9 D;  5CIU A;  3QBY A;  4OB0 B;  3ASK A;  2K2V A;  3A8O B;  2DTI A;  2LT1 A;  4XU2 A;  3R6O A;  1K9M U;  5GAO n;  2L5Q A;  5LJ5 g;  5GAM e;  3JCM b;  4E7J A;  4VUB A;  4JUV A;  3UDC A;  1I81 A;  2WAC A;  5C0M A;  4LDX A;  4C92 E;  3F70 A;  4F7U G;  3I55 T;  3CMA A;  4IKF A;  4M7D G;  2E12 A;  1QVP A;  4DQ2 A;  3HFN A;  1VQ8 T;  3GNF B;  2XU8 A;  4RCC A;  3M59 A;  4C5G A;  3CC7 A;  2KQW A;  3OYL A;  4M7A G;  2QXF A;  4C92 G;  2XDP A;  3LGL A;  1VQ7 A;  2XK0 A;  4HCB A;  4M77 C;  3C95 A;  1W4S A;  1G3Y A;  2A3L A;  3OYE A;  3KBG A;  2GQV A;  1FX7 A;  3CC2 A;  1B34 A;  4Y28 E;  4C0D C;  4MDX A;  2E41 A;  2VGM A;  3N5B B;  5FRM A;  3QXE B;  4J6W A;  2XID A;  3I56 A;  2MI6 A;  2E1H A;  1D3B A;  1YIJ A;  4PJO F;  1JBM A;  2K4Y A;  4XU3 A;  1LJO A;  4J83 A;  2VGN A;  2O4X B;  1BI0 A;  3CCM A;  3SB2 A;  4E7I A;  2LCC A;  1N9R A;  2MMP A;  2QQS A;  2RI5 A;  4LDV A;  2X4X A;  5FRO A;  4Z02 A;  1QP2 A;  3L2W A;  3RKX A;  2K5I A;  2P0P A;  4JDS A;  5FRN A;  4JJN K;  5CKF A;  3RIR A;  1WJQ A;  5M9O A;  2QQR A;  4PLI A;  2QTX A;  3JCM e;  5GAN 5;  5GAN 7;  1KG1 A;  1Q82 C;  2M1H A;  3QKJ A;  3S6W A;  4BY6 B;  2DZ9 A;  3JB9 H;  1G3W A;  3CC2 T;  3OB9 A;  1WQW A;  5D6Y A;  3VU3 C;  4TVR A;  3RUX A;  4L59 A;  3CCL T;  5I21 A;  2GFA A;  5GAO q;  3ZFJ A;  2GFU A;  3LWI A;  1KC8 U;  3PMI A;  3TEE A;  3DB3 A;  3V7C A;  1KD1 U;  1FWZ A;  3RKY A;  5C6S A;  2OTL T;  1BKB A;  1JRI A;  3M5A A;  3CPF A;  3OYF A;  3A5Z B;  3CCM T;  1YHQ A;  2B8A A;  4JRK A;  5A0L A;  3JCM h;  3M55 A;  3OS5 A;  3DKM A;  1YCY A;  2PQW A;  5CR2 A;  5IT9 E;  2KVQ G;  4N4H A;  4EDU A;  3DLM A;  4XTZ A;  3CBM A;  5FU7 C;  3H6Z A;  3HHT B;  3GP8 A;  1S72 A;  2RK1 A;  3QYG B;  2DIG A;  2DKG A;  2EJF A;  3WVD B;  4EMK B;  4BDY A;  4ZGD B;  4QVD A;  4CRI A;  1VQ5 T;  3C4S A;  4RG2 A;  4L6V 5;  3CCL A;  4M77 A;  4XQ3 A;  1WPY A;  1VQM T;  2DTH A;  4KUL A;  3X26 B;  1JJ2 S;  3X25 B;  1WJS A;  2CGH A;  2RI2 A;  5LJ5 f;  4IUU A;  4PL6 A;  2IG0 A;  2PVD B;  3DLL A;  2LRQ A;  2XG8 D;  1Q86 C;  1H3Z A;  4LDU A;  4GLK A;  4M75 F;  1I4K 1;  1H64 1;  1VQN T;  5DM7 R;  4R55 A;  5GMK h;  1AHJ B;  1KQS A;  5GAN 4;  3AHU A;  1YI2 T;  3OSV A;  4C92 B;  3OS2 A;  1VQO T;  2FL7 A;  2KAF A;  3JCM P;  1Y71 A;  4RG8 A;  5KH6 A;  3OQ5 A;  1NPP A;  4ELZ C;  4HCC A;  4ZGE B;  4C5E A;  1BI3 A;  2LQK A;  3RES A;  3L2Q A;  1S72 T;  3QHS A;  1KQS S;  2MAM A;  5GMK l;  4J7I A;  1BIB A;  2YRV A;  4N4I A;  4XTV A;  4NOY A;  1PSF A;  4FL6 A;  2M0O A;  3HP9 A;  4B9X A;  5GAN d;  3X20 B;  3UPU A;  5GMK m;  1Q7Y U;  4V2S A;  3JB9 I;  3L2R A;  1VQ5 A;  4PJO D;  5GAM j;  4M77 B;  3CMA T;  2RHY A;  5DY9 A;  2AHJ B;  5GMK e;  1Y07 A;  2FYK A;  4NL2 A;  3HSB A;  3CBO A;  4LD6 A;  2G3R A;  5GAN 3;  4XU1 A;  1ZBX A;  3SWN A;  1OI1 A;  3G6E T;  4PJO E;  4OB1 B;  4A53 A;  5KE3 A;  3CEY A;  1Q81 U;  3JCM g;  1N8R U;  3CD6 A;  3V7S A;  1U1S A;  4HT9 A;  3HPW A;  2EAY A;  2DEQ A;  2F5T X;  3JCM f;  1O9S A;  3HL8 A;  3QII A;  4ME7 A;  1KHC A;  2VC8 A;  5FU6 C;  2ZPF B;  3V8J A;  1YIJ T;  4C8Q D;  1YIT T;  1YJ9 T;  1QVG A;  4RKU E;  3RER A;  1WJR A;  2P0Q A;  5IN1 A;  4MDW A;  2KK4 A;  3I55 A;  4J6Y A;  2CZ1 B;  2EFI A;  2E10 A;  1LOJ A;  2PVG B;  2DD5 A;  4C0D B;  4BDZ A;  2WSC E;  2EQK A;  2DPP B;  3JRZ A;  2LCL A;  2EJG A;  2XIC A;  3JSC A;  2RHU A;  1O75 A;  3P8D A;  4M75 C;  4OGC A;  4PLL A;  4XTY A;  3VV0 A;  1K73 U;  2L8D A;  2P0K A;  1N9S A;  4MMK A;  2EQM A;  2R58 A;  3UWN A;  3RMQ A;  1VQ7 T;  3KUF A;  3M53 A;  2CZ7 B;  4M75 G;  5LJ3 d;  5HY6 A;  4A4K A;  3KXT A;  3G7Z A;  5LL6 S;  3G71 T;  4M7D E;  2D9T A;  2YLC A;  3BY7 A;  3OYK A;  2EIF A;  2DXT A;  4X9C A;  1M8V A;  2QA4 A;  3NTI A;  2R5M A;  4C5I A;  5J39 A;  5LJ5 h;  4FT2 A;  3SWN B;  2RJC A;  4M7A A;  3I56 T;  4EMH A;  3SDZ A;  4IUT A;  4Q5W A;  4PKC C;  4A4H A;  1JB0 E;  1XNI A;  4BE2 A;  3S3M A;  3M57 A;  1JJ2 A;  1YJN A;  2A7Y A;  1Y96 B;  1OYX A;  3INZ A;  3JCM c;  5I2S A;  4MZT A;  1IRE B;  3BDL A;  2OTJ A;  3E9G A;  4C0F A;  4X34 A;  2LC4 A;  1WQ7 A;  1VQ9 A;  3LYI A;  5HKC A;  4HKE A;  3OA6 A;  2F5K A;  2GCX A;  4C5H A;  3A8G B;  3E1S A;  3CBP A;  1WGS A;  4BE0 A;  2XD0 A;  4J8O A;  2LT4 A;  4C0G A;  1M90 U;  5CKE A;  3NTH A;  1BI2 A;  2LTO A;  4A4F A;  2CYZ B;  4M75 E;  3G4S A;  1TH7 A;  1K8A C;  4DOV A;  1DJ7 B;  2EJ9 A;  4XAX B;  3LH0 A;  5GAM h;  5GAN g;  5GAO m;  4JS4 A;  4JLG A;  1VQ4 A;  2QDY B;  4M78 C;  1K9M C;  4OB3 B;  3EFS A;  4R56 A;  3CCR A;  3VYH B;  5D6X A;  1OZ3 A;  3PTA A;  4QVC A;  4EMG A;  4QQD A;  4BI4 A;  3J81 E;  1VQ4 T;  3V8K A;  1VQO A;  3OYJ A;  3BW1 A;  5LJ3 h;  2XDB A;  3CCE T;  2VV5 A;  3L2U A;  2H3J A;  3FDR A;  3PIP A;  3GIB A;  1MGQ A;  3LLR A;  4ZN3 A;  4J6X A;  5CK9 A;  1X6O A;  3OYH A;  4M78 B;  3GLX A;  5GAN f;  3BDU A;  5A2Q E;  1QVG S;  2EQU A;  1LNX A;  3JB9 F;  3S3O A;  2HBP A;  2ZPG B;  4J7F A;  3MEA A;  3PIO A;  2X35 A;  2X4Y A;  1X01 A;  4C92 A;  4OVA A;  3ME9 A;  3URG A;  5GAO r;  1NE8 A;  4M7A D;  1R8O B;  1KD1 C;  1UGS B;  3WXM B;  4NS5 A;  5LJ3 e;  1G3T A;  4C8Q F;  3G6E A;  1Y96 A;  3CCU A;  2L3R A;  3A8M B;  4IUV A;  4C92 D;  4PNO A;  2Y4Y A;  2E6Z A;  2RJF A;  4QW2 A;  3ZBD A;  3QSU A;  1N27 A;  3QDR B;  2KDS A;  1SSF A;  3MEW A;  4XTU A;  4BAC A;  4LD9 K;  2KY9 A;  2V8J A;  2DO3 A;  3EFR A;  4FSX A;  4MZM A;  3H8Z A;  5CKB A;  3RMS A;  1YBY A;  2PU9 B;  3C94 A;  3HFO A;  4J5Y A;  4P5N A;  4BUG A;  2ZCF B;  5GAO l;  1X75 C;  4RCB A;  1Q81 C;  1N8R C;  3LW5 E;  2DXB A;  3MCA B;  4M77 D;  1G5V A;  1K73 C;  4MZP A;  3TU4 K;  4EMK C;  3CCR T;  4M7D F;  5CQY A;  5LJ5 j;  3L2Z A;  4OP0 A;  5FLX E;  2CZ6 B;  2R5A A;  4F7U F;  5GAN h;  5GAN 8;  5GAM g;  1XOV A;  1IZ6 A;  2K5F A;  2QQA A;  5GAN 2;  3JB9 G;  3JB9 J;  4GY5 A;  5GMK j;  5IAY A;  1VQ8 A;  2ZPH B;  2E65 A;  2IVW A;  3OYC A;  2EWN A;  4M7D C;  2ZPI B;  4PJO G;  4HA8 A;  4JRQ A;  4A4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...