4C92E

Crystal structure of the yeast lsm1-7 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
84
structure length
84
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92E00
3RIRA 3QHSA 4C92C 3V7RA 3SWNC 2EJFA 3V7CA 3M4GA 3JB9D 4M77F 3RKXA 5GAN8 1BIAA 4EMKC 4M7AA 3EFRA 3RKYA 4QVCA 4Y91A 4M7AE 4M78D 5GAMh 4M77G 5GMKi 4NL2A 4C8QD 2DTOA 1LOJA 4XTWA 4C8QC 4A54A 4M7DA 1B34B 2DJZA 3BW1A 1I5LA 4MMLA 4MMKA 4X9CA 4JRKA 4M75C 3JCMV 4PJOF 4J6XA 4M77E 4J6WA 5GAMe 5GMKm 4F7UF 4PJOB 4M78A 1KQ2A 2K57A 4M7AF 1JRIA 2E65A 4PJOG 3HSBA 5GAMd 4XTUA 5CAIA 2DEQA 4XQ3A 1LNXA 4F7UG 5GAMj 4M7AD 4M7AC 1WQ7A 1JBMA 4C92B 5GAN5 3JCMP 3SWNB 2RA2A 1LJOA 1X01A 3V7SA 4EMKB 4M7DD 4N0AA 4M7DC 1D3BB 2DZCA 3RUXA 4HA8A 3JCMb 5GAMf 2HNIA 4XTYA 5GANg 5GAOq 3FB9A 3JCMc 4C8QB 3L2ZA 3VU3C 3PGGA 1I4K1 4M78C 4M75F 5GAOm 1Y96B 4M75B 1WNLA 2DKGA 3L1AA 1HK9A 4M77A 5DY9A 4XU3A 4M75G 4XTVA 4J6YA 4HT9A 1I8FA 2DZ9A 4XU0A 4EMHA 3QO3A 5GANh 1TH7A 2DXTA 4RCCA 3JCMQ 3HFNA 1MGQA 5GAOr 4X9DA 4M7AB 4N0AC 4C92F 3QSUA 2CGHA 4HT8A 3FIFA 3QUIA 4PJOA 5GANe 5LJ3e 3V8JA 3INZA 1HXDA 4XU2A 4C92G 4F7UA 3JB9F 3JB9H 4PJOE 2EJ9A 4M7DB 2RM4A 2EWNA 1I81A 4F7UE 3V8LA 5LJ3d 5GANd 5GMKl 4M77D 5GANj 4JLIA 2VC8A 4M77C 5LJ5g 3JB9G 2DXUA 2E41A 4C92E 4C8QF 5LJ3g 4M78B 5GAN4 3GIBA 4WF2A 2E64A 4M78G 3JCMJ 4C8QG 1WQWA 4EMGA 5GMKe 1KQ1A 3RKWA 3JB9I 5GAOp 3JCMh 4PJOD 5GANf 5LJ3f 4PJOC 5LJ5h 1Y96A 5I21A 5LJ3h 4M75A 1YCYA 4JUVA 1B34A 1N9RA 2JN0A 4J5YA 2I2LA 1M5Q1 5GAN7 3RERA 4C92D 4M75E 3BFMA 2FB7A 3JCMe 1BIBA 5GAOn 4OP0A 4M7AG 4XTXA 2RB6A 5LJ5e 1H641 1N9SA 5GAN3 4A53A 5GAOl 4M7DF 4V2SA 3EFSA 3JCMd 4PNOA 3FJPA 5LJ5d 2YLBA 4QVDA 4M77B 5LJ5j 3JCMg 4M7DG 2VXFA 2Y90A 3BDUA 4C92A 3BY7A 1U1TA 5LJ3j 4M78F 5GAN6 5GMKh 3JCMX 2VXEA 3SWNA 3V8KA 3JB9J 2DTIA 2QTXA 1U1SA 4DQ2A 4RCBA 4M75D 4EMKA 4XU1A 1WPYA 3JCMW 4NOYA 4XTZA 1D3BA 4M7DE 1M8VA 2YHTA 3AHUA 3JCMf 3SB2A 5GAN2 2RD1A 5LJ5f 2EJGA 4JRIA 4C8QA 2DTHA 2EAYA 3HFOA 4F7UB 2ZGWA 2E1HA 4M78E 4NL3A 2FYKA 4C8QE 5GMKj 2E10A 3RESA 5GAMg 2YLCA 2DVEA
chains in the Genus database with same CATH superfamily
2NUTB 1F1BB 3GBQA 3CCQA 1BBZA 1QQJA 8ATCB 1Q81U 2WSEE 1ABQA 2DE0X 3RKXA 2FPEA 4NS5A 1GFDA 4Y91A 1M8MA 3CC2T 3N5BB 4LDYA 2OX7A 2JXBA 4J7IA 4RTTA 5CVIA 4M75C 5GMKm 2COZA 3PFSA 1VQ6A 2PVDB 4CC4B 5GAMd 1E6GA 4EDUA 1WQ7A 2ZPEB 2QEXT 2HQHA 2DK3A 3IQLA 1K9MU 1WHHA 4RTYA 2RJDA 1UB4A 1FMWA 1O75A 2VGNA 4OB0B 1NZ9A 3PMIA 2JVVA 4O6JA 1K9AA 3CBMA 3L2VA 1I8FA 2DL8A 4N0AC 3ER0A 2C0TA 4F7UA 4L6V5 2NUPB 4LDWA 1A0NB 1WHLA 3EG3A 1S72A 4GBQA 5I11A 2RQRA 3CCRT 4N4IA 2RQVA 2LCCA 2L3PA 3MP8A 2DMOA 1R0CB 3EGXB 5FU7C 3GPLA 1JJ2A 3I56T 5GANf 3CCJA 5I2SA 1RL2A 3CMAQ 2PU9B 2CH4W 3M56A 5CKHA 4Z88A 2XD0A 2ED1A 5KYWA 4C92D 1M1GA 2FB7A 1YJNA 4RUGA 3OS5A 4PJNA 3QKJA 2A28A 2IG0A 2ATCB 4C92A 3JCMX 2O9VA 1PG5B 1U1TA 1GCQA 1SF9A 3M4YA 2ROLA 1RABB 1NE8A 5IAYA 1GXIE 1RAIB 1WJRA 2DTHA 2ZGWA 2RHUA 5HKCA 1N8RC 4ELYC 1T3LA 1IRXA 1VQ6Q 2LX9A 3RIRA 2MOXA 1OQKA 1OYXA 2V8IA 1QVFA 4MDXA 3MJXA 3OBWA 4AFZC 1NLPC 1NJIC 4M78D 1XNIA 2L3RA 1NPRA 4OMQA 4GLMA 3BW1A 4CRIA 3OSSC 1UDLA 1G5VA 3QJ6A 3EGDB 4M78A 1JRIA 2E65A 3X24B 2X4WA 1P92A 2HAXA 1QVPA 2COWA 1UECA 1G3SA 1NM7A 3MP6A 2FPDA 2XDPA 3LW5E 1JXOA 5KYXA 5CK9A 2CKKA 1U5SA 1WHJA 1S72Q 1WGSA 5GAOm 1BI0A 3RDVA 2E6NA 4M77A 3RBBB 2YUPA 3OYNA 2GGRA 2NLUA 2ZAEA 3CCJQ 4WTOB 3NFCA 3FIFA 5LJ3e 3Q1JA 3JB9F 3ASKA 1PD1A 3A1PA 3G4ST 1TUGB 3VS6A 1SEMA 2V1RA 3CMET 3RR6A 3QXEB 2QA4A 1SSHA 4JUVA 4KGXB 3TREA 4DBFA 1C0MA 2EYQA 1H641 1K8AC 2JUFA 2PZ1A 3M55A 3FJPA 3QDRB 3QIIA 4JRPA 1YWPA 3OS0A 4BI3A 1ZSZA 2F1LA 4FYYB 2YRDA 1S1NA 4RG8A 2I0NA 3LYIA 1MMAA 5DLOA 1D1CA 3C94A 3EFOB 1M1KC 2RQTA 3OYCA 3G6ET 2K5IA 3A5ZB 4C92C 5D6YA 3V7RA 1GCQC 3X25B 5IHKA 5FU6B 4JJCA 1KSWA 1WHKA 2DL7A 4IUUA 4C0DC 3EH1A 3LH0A 4BI8B 3KUFA 4QVCA 1ARKA 1M3CA 4M7AE 5CIUA 4LDXA 2YUNA 1G83A 3I5RA 3OMCA 3MEAA 4FT4A 2DBMA 1QVGS 2KR3A 5HK3A 4HVUA 2MWPA 4FYXB 1X43A 1EX4A 1YIJA 1KHIA 3A8GB 3REAB 2K5LA 1EZZB 4HA8A 3OYDA 5GAOq 1VQMA 3PGGA 4M78C 2DLPA 3G4SQ 2DKGA 2HSPA 2ZCFB 4FSSA 3CMEQ 4DOWA 2PNIA 2HQEA 1X2QA 4M7AB 2KRMA 2OTLT 2YUQA 5GANe 3CPWS 1K73R 4XAXB 3VUZA 4WCIA 4BE0A 2QDLA 5KH6A 1VYVA 2G3RA 1IREB 4M77C 2M0OA 4PJLA 1K76A 2RHIA 1VQ9A 2PVGB 1M2VB 3JRZA 5AYFA 2DIQA 2LP5A 1OX8A 2PQWA 4PFOA 2DXBA 3G6EQ 2JN0A 2I2LA 2VASA 2HMAA 4CC2A 5GAOn 3CCLA 4ZNXA 2JMAA 3DLLA 3MEUA 4R56A 2GCXA 2BUDA 4J9BA 2MF2A 6AT1B 2DTIA 2LQWA 3EG9B 1KC8U 1Q86R 4XTZA 1VQOA 4RMOA 2RI5A 2XK0A 3META 5HY6A 1AT1B 4MDWA 3CCEA 3WVDB 1M90U 3SEMA 3OW2P 3QHSA 2DYIA 4C5GA 1YHQT 1ZSZC 3NMZC 1YI2T 4ZN3A 2KYMA 3LGLA 1YIJQ 4ELZC 2WSFE 5GJWB 2D0NA 3CD6T 4C5HA 4R0KA 3OYMA 1D1BA 2W0ZA 1VQMQ 3E19A 3JCMV 1B7TA 1R8OB 1AWOA 1FXXA 4Z8AA 2WACA 1IZ6A 1RI9A 5GAMj 2DEQA 2K79A 4F7UG 4RTVA 5A0GA 4Y92A 2X51A 3CEYA 4J9FA 1LJOA 1D3BB 4ATOA 2CZ7B 1GFCA 1QCOA 4JJBA 2F69A 1M3BA 3MO8A 1VQ9Q 2KY9A 3BDLA 4XU0A 4LD9K 1UTIA 3QO3A 1TH7A 3EHRA 1TTHB 2JM9A 1SSFA 1KHCA 2EYXA 3QSUA 2XI9A 1WHGA 3HP9A 2RN8A 4ZGDB 2DFUA 3M0SA 4C92G 3UATA 3H6ZA 2KGTA 3H0IA 2QGGA 2JS2A 2KQWA 3CCLQ 1IGUA 2P4TA 3H41A 2GTOA 2LJ3A 5FWCA 4WF2A 3OA6A 3HKSA 4EIKA 4LE9A 3G1JA 1ACMB 1BI1A 2FRYA 4FW2A 4KULA 4A4EA 3I9QA 4M7AF 2KXCA 2XU8A 1CKBA 2PVOB 4FL6A 3CCEQ 1QVGA 2HDAA 2YSQA 1YHQQ 1Y7XA 3I5SA 3CCMT 2X4JA 2RO0A 3CD6Q 1AHJB 1QWEA 2O4XB 2DX1A 3A8HB 3QYGB 1M8VA 3NTHA 2RD1A 3CCVA 3KBGA 1TUDA 1OZ3A 2E1HA 1OULA 2DETA 4LXCA 3QBYA 3RESA 3CCSA 2BTTA 2EJFA 4FIBA 1Z9ZA 3A8OB 4M77G 3EG0A 3CPWA 2NUPA 2GNCA 1MNDA 4E7KA 3WVEB 4AFQC 2RH2A 4J6XA 2EYYA 2EYWA 2X4YA 2ZZDA 5A2QE 3PVQA 1ZBJA 3A8MB 1QCFA 2E12A 5EG2A 3EG2A 1X01A 2E3IA 1RAAB 3RUXA 1UGSB 1EIFA 4MZPA 4XTYA 2LC4A 2LQKA 1FYNA 3PIOA 1WNLA 1VQ7A 3TU4K 7AT1B 1W2BP 4Z89A 5GANh 1K73C 2KNBB 3NGPA 1E6HA 3E9FA 4IURA 1Y0MA 1DJ7B 2HQXA 4M7DB 2EWNA 2D1XA 5LJ3d 4PL6A 2M02A 1RAEB 1PHTA 3LH5A 1WQWA 2MWOA 1YJ9T 1BI2A 2MI6A 4OMNA 5IH2A 3ZEHA 1M5Q1 3CCVQ 4J8OA 1Q81R 3EGDA 2E6ZA 2GQIA 3EFSA 2LT4A 4KGVB 4RTWA 2F5TX 2Y90A 2EYZA 5CKEA 4KH1B 1YITA 5GMKh 2VXEA 5J39A 3CQTA 4J9IA 4NOYA 5GAN2 2PTKA 1QWFA 5LJ5f 1N5ZA 4GY5A 4O5VA 4AG1C 4NL3A 3MCAB 4FYWB 3DB4A 3CCUA 2L3QA 3TQ7P 3OYLA 2KDSA 1JEGA 3VUBA 3GOXA 2QQRA 1N8RU 1VQPA 2CP6A 2ENMA 1H8KA 1SG5A 2KRSA 4GLKA 5L23A 2BZ8A 3RMSA 1NJIU 2KBTA 1UFFA 2DIGA 2GTJA 1VQ7Q 1PRLC 2LX7A 3RMQA 1VQ4T 2OAWA 2EBPA 1NYFA 2CUDA 3V7SA 3VRYA 1ABOA 3FRNA 3UDCA 3JCMb 2CDTA 3CCQT 1CKAA 3JCMc 4PLLA 2BZYA 4PJMA 2CZ6B 2YDLA 1YJ9Q 2J6FA 2CZ0B 5L8RE 4OGCA 4DBHA 1ZX6A 2JTEA 1VQNA 1VQ6T 2R5AA 3EFOA 3CC4A 3E1SA 2K3BA 4RTZA 3JB9H 4PJOE 1WXBA 4PK4A 2IPOB 1C6VX 3S6WA 5GANd 5GMKl 4R55A 1VOMA 1QVGP 1YITQ 2E3HA 5A0LA 2K2VA 2OAUA 5IN1A 2LQ8A 5FWBA 3ULRB 2QYZA 3HHTB 1JXMA 3RERA 4M75E 4IUTA 3CCUQ 4M7DF 5I22A 4RG2A 1WIEA 1BCOA 1UGVA 2QI2A 4B6MA 3BY7A 1S72T 1K8AU 2EQKA 1TSFA 4ESRA 2NYSA 4PFZA 2L89A 1K4US 2K4YA 1I1JA 2ABLA 5D6WA 4C8QE 1NEBA 3CPWP 4BI4A 2KVQG 5GAMg 1VQ4Q 3CCJT 2VB6A 2QG9B 1M1KU 1MMDA 1ZA2B 1YJNT 4M7AA 4BY6B 3CCQQ 1V29B 4E6RA 2LCLA 3OSVA 3TEEA 3SFMA 4MMKA 4YTLA 1SRLA 4IIOA 1Q7YR 3TSWA 1VQLA 2YXYA 1M2VA 4UC4A 4E7IA 1W2BS 9ATCB 2QQSA 1D09B 1Y71A 2CSIA 5KYUA 4EMKB 1YJWA 1Z9QA 4ZTFA 1M3AA 3H8ZA 4LUEA 2DL3A 4C8QB 2KE9A 3E2UA 1JQQA 1G3TA 1AVZC 3OW2A 4XU3A 4IUVA 2VWFA 1K0SA 3EG9A 1KD1R 4XK8E 3QDFA 4AFUC 3G71A 2ZPGB 1X27A 3D7SB 4M77D 2KAFA 5FROA 3JB9G 4P5NA 2E41A 1WJSA 1SHFA 2EW3A 1AWJA 2EKOA 2F2WA 1OU8A 5CQYA 1M1FA 1G3WA 3NTIA 2VYTA 1BYMA 2DRKA 2FO0A 3OYYA 2JNGA 2LTOA 2VV5A 2KSSA 3LX7A 1WYXA 3R6OA 5LJ5e 2P0PA 5GAN3 4A53A 5GAOl 5FU6C 2QDYB 2CZ1B 4ZN1A 5CR2A 1YJNQ 2FRWA 1OPKA 4DQ2A 3JCMW 1HSQA 1D3BA 1QCNA 2VKNA 5LL6S 3PE0A 5KYNA 1T3SA 4JLGA 4JRIA 3HFOA 1OZ2A 2AKKA 1PC0A 2F5KA 2MAMA 1VQLQ 2DVJA 1YCSB 4JJNK 2QA4T 3HRTA 3V7CA 4B9WA 1U06A 5GAN8 1GBRA 2RK2A 1Q95G 5IT9E 5D7UA 3CPFA 1BB9A 2DILA 3QWXX 2JTMA 3DB3A 4PJOF 2DPPB 3J7AF 2LRQA 4JDSA 4HCBA 4M7AC 2BZXA 2COYA 3QG1A 3OS1A 3OYIA 1N27A 2RQUA 4EPCA 1BKBA 1WHMA 3I55A 4M75F 1HJDA 5CKFA 3QJYA 1ZBXA 3J81E 1HK9A 3UF4A 2DEUA 2M1HA 2O4XA 1IB8A 2RNAA 3L42A 2CH4A 2QASA 3VS2A 3QUIA 3VJPA 3OQ5A 3L2WA 2RM4A 1H3ZA 3VYGA 2OI3A 2XHCA 2DD5A 1YIJT 4C92E 4C8QF 4JPBW 1VQMT 3R6NA 1ZUYA 3CC7A 2IVWA 2ZPHB 1RAHB 1AOJA 2QAZA 3RNJA 4ORZA 1RAGB 3PTAA 4PFPA 2FZKB 2QA4Q 3VS0A 3CXCP 2LCSA 2OTJA 2YLBA 3FC3A 2EIFA 2WSCE 1W2BA 1AD5A 4BDYA 2EGAA 3OYAA 2ZPFB 4D8DA 3UT1A 2YHTA 4BDZA 5KCOA 2EJGA 1VQ9T 4M78E 2BIVA 5KYUB 2HL5C 2CS7A 1VQ8A 4AG2C 5IHNA 4IKFA 2RI3A 1PSEA 4F14A 3CCLT 2DA9A 2E5QA 4NL2A 4XTWA 2B86A 1NPPA 1Q7YC 4M7DA 3I55Q 2LQNA 4MMLA 4M77E 1VQOT 3SD4A 3CCET 1UGRB 4A63B 2R58A 3VKIA 2A3LA 4ZGJB 5AT1B 3VS4A 4CC7A 5IXBA 1KD1C 3NTKA 1QP2A 2XICA 1U3OA 5DM7R 3CC7Q 3MPUB 4E7JA 1AZEA 1N6AA 2RJFA 1HXDA 1D1AA 2K5FA 2C0IA 2CP7A 1K73U 2QQAA 2DF6A 3OYJA 3X26B 4BACA 5GANj 2FPFA 2OTJQ 2E64A 1XOVA 2PUKB 2RK1A 2OJ2A 2CP3A 4EMGA 3U23A 2DL5A 2NUZA 5LJ5h 1NEGA 1IO6A 5LJ3h 4ZTJA 1VIFA 5KE2A 2EQUA 4M7AG 1N9SA 1RADB 1YWOA 3CBOA 2JZ2A 3LGFA 2K6DA 2V8KA 3OYKA 4RCBA 4XU1A 1NLOC 2VUBA 1Q86U 3HL8A 3FLGA 2HEQA 4QQGA 2MIOA 1VA7A 3HRUA 2MYSA 3ZFJA 1VQOQ 2FZCB 5GMKj 2LNVA 3VV0A 2QQBA 4KT0E 4M4ZA 1X75C 3JB9D 1T0HA 2R5MA 2W10A 3EFRA 4IUPA 3LLRA 1Q82R 2BE9B 3GLXA 2R57A 2FHDA 2P0QA 1TUCA 1B34B 3ZBDA 1OEBA 5M9OA 5FLXE 4J6WA 1SKUB 1PM3A 4OMLA 2X9HA 3GP8A 3KXTA 3FJ5A 5FW9A 5FRNA 3CCVT 2HBPA 1PWTA 2MPXC 3C95A 3SWNB 2MMPA 2NWMA 3M0PA 2RI2A 4HVVA 3I35A 4M7DC 1ZUKA 3SDZA 2CREA 3CCST 2DAQA 1PKTA 3OBYA 2K2MA 2J7IA 1TU0B 2IIMA 4OB1B 4J6YA 3L2QA 2XDBA 5KYYB 1VQKA 3EH2A 4PJOA 3V8JA 1AWWA 2D6FA 4N4GA 3CXCS 2JT4A 3AT1B 3GIBA 3UWNA 3JCMJ 1YNZA 4C0ZA 1KQ1A 3JB9I 4TVRA 4M75A 4LN2A 1VQ7T 4J5YA 3NPFA 2FVUA 1D0YA 3C0CA 4PNOA 5LJ5d 1C1AA 1G2BA 1JJ2S 3JCMg 1BI3A 4QVZA 3DLMA 1M9SA 4VUBA 4EMKA 1PRMC 1K1ZA 4OMOA 2EQJA 4RTXA 3JCMf 1FMVA 4AMCA 4C8QA 1XJWB 2L8DA 3P8DA 2LZ6B 1VQ5A 4KUIA 2E10A 2ZPBB 4J83A 3OYGA 1G8XA 2BE7D 4QQDA 2KK4A 3M4GA 2X3WD 4AT1B 4HCKA 1Q86C 3CCSQ 3OMGA 4FYVB 1SRMA 2EKHA 5GMKi 2DTOA 2GF7A 4A54A 2DJZA 1YITT 4JRKA 2GFAA 1MUZA 1U8RA 2K57A 4X1VA 2HBWA 5ECAA 5CAIA 4IIMA 1JBMA 2ROTA 2AZSA 1UE9A 2ED0A 3JCMP 1M30A 1VYTA 1VQKQ 2H8HA 3CCUT 1H92A 1K9MR 2A7YA 3M59A 1KIKA 2QXFA 4J9EA 2RHXA 4BUGA 1GBQA 2H3EB 2YUOA 4A4FA 1VQPT 5DY9A 1NBEB 4PLIA 3NHNA 2V26A 1PD0A 3HFNA 3PIPA 4RTUA 2O9SA 2CT3A 4KUDK 3INZA 4A4GA 1CSKA 4X34A 2FZGB 5J26A 2CP0A 2K3XA 8AT1B 1HD3A 2DL4A 1WFWA 2DXUA 2DRMA 4E7LA 1QMCA 2B8AA 2E5KA 3CMAA 3H0HA 1SPKA 4PJOC 1T0JA 5I21A 2LJ0A 1UGQB 2HKNA 3UA7A 1VQ5Q 1IXDA 4Z02A 3CC2A 1VQNT 2MCNA 1TG0A 3G7ZA 3CC4T 4M7DG 4E2FB 4KH0B 3V8KA 4BY6C 1I5OB 1E7OA 4L59A 1U1SA 3SHWA 3JSCA 1Y07A 4J9DA 4F17A 2DVEA 2QEXA 4C0GA 4ME7A 1Q82C 4A4KA 3QPHA 1RI0A 2RQWA 4CI0C 4EMKC 4JZ4A 4BE2A 1LOJA 4C8QC 2RHYA 1BCMA 1NG2A 4X9CA 1VQPQ 2YT6A 3CXCA 4PJOB 4Q5WA 1G3YA 5CKBA 2CUBA 4KBMB 4LUDA 4ANJA 4M7AD 3VS7A 3CCRA 4E7ZA 2DXCA 2AHJB 5GANg 5GAMf 3L2ZA 3VU3C 3I56A 1X6GA 4BD3A 1X2KA 2DJQA 4M75B 1XQHA 2XDDA 3C12A 1IHWA 1W4SA 1O9SA 4C0FA 1W70A 3QWYA 1BU1A 3HTRA 4KRTA 4OB3B 1VQLT 1VQNQ 1I81A 1PSFA 3CC4Q 2O31A 3CC2Q 2A08A 3TCJA 1YJWT 1Y57A 3PVLA 2V8JA 4D8KA 1WDXA 3TVTA 2QK0A 1IHVA 3TSZA 4FT2A 4IUQA 3O5ZA 2XMFA 1N9RA 1V76A 5GJVB 2Z0WA 3JCMe 1PCXA 2RB6A 1FMKA 3X28B 1LPLA 3OYHA 1YFNA 2QEXQ 3G71T 3OS2A 4DA4A 2DBKA 2L0AA 5FRMA 5FU7B 2H3JA 3AHUA 1UJYA 1Q81C 2EAYA 1OV3A 1OU9A 2FYKA 3MP1A 3A8LB 1WX6A 2RHZA 2YLCA 5J3BA 1ZQ1A 3OYBA 1TOVA 1SHGA 1TS9A 2DNUA 3MHXA 2O88A 4DEXA 4B9XA 1K0XA 5KE3A 3CCRQ 2CSQA 1H3HA 1AZGB 2Y4YA 3I56Q 4RKUE 1AWXA 1KQ2A 4BE1A 4PJOG 1Q7YU 2A36A 4XQ3A 4II1A 4FSXA 1K9MC 5GAN5 1HYOA 2D8HA 5CKDA 3KFVA 3X20B 3G4SA 3EAEA 4OVAA 3GNFB 1OI1A 3CMEA 5A0DA 1PNJA 1YJWQ 2O2OA 4DBQA 1RAFB 3M58A 2AZVA 5CQXA 4M75G 4XTVA 3O8VA 4QT7A 4HT9A 2DZ9A 5HK0A 2AIRB 4EMHA 4HCCA 1KK7A 1KD1U 2HD0A 1UJ0A 2CGHA 3S3NA 2JM8A 3M0TA 2EJ9A 1KQSP 1ZHIA 4OB2B 4F7UE 3V8LA 5DLQE 2HCKA 2KYBA 2KXDA 1WXUA 3G71Q 1X6BA 4J9GA 4DOVA 1NYGA 4C8QG 3I55T 3G6EA 4PKCC 1RLPC 5C0MA 2QQ9A 2CT4A 1UHFA 1JB0E 1B34A 2O01E 4OF1A 3OYFA 3BFMA 3M9QA 4XTXA 3P8BB 1ZUUA 4E7HA 1YN8A 2KROA 5LJ5j 2VXFA 3BDUA 5LJ3j 2YRCA 1KC8R 3SWNA 2FG0A 4J9CA 2LT1A 3JAME 3P8HA 2DYBA 3M57A 1LCKA 2QGFB 4F7UB 3F70A 1M90R 3M53A 3FEOA 3CC7T 1MV3A 4Y28E 1W1FA 2LVMA 5KYYA 2ZPIB 3RKYA 2GBQA 1ZLMA 2D8JA 3M0UA 2OTJT 3HPWA 5KYWB 5IXFA 5GAMe 2JS0A 2OTLA 2M51A 3HSBA 3H9NA 1D0ZA 5EC7A 4C92B 2AK5A 1JJ2P 3M5AA 4M7DD 1FX7A 4C0DB 2DZCA 2EPDA 1VQ8T 2HNIA 2L5QA 3FB9A 1J3TA 4JZ3A 3L1AA 3S3OA 2RF0A 2XG8D 1X69A 4F04B 2LDMA 1GL5A 5KCHA 4RCCA 1QKXA 4CC3A 2HKQB 1KFZA 5GAOr 4HKEA 4DEYA 3THKA 2YWWA 4MZTA 4AFSC 2JW4A 1RACB 2KMTA 1RUWA 3PNWC 2L2PA 1JO8A 4E7SA 4JLIA 2VC8A 2K3YA 2ESWA 4M78B 3UPUA 1MMNA 1ZSGA 2E70A 1QVFP 3WXMB 5GMKe 2MK5A 5HCKA 3JCMh 1X6OA 1QP3A 4BB7A 1Y96A 2SRCA 4JRQA 1YCYA 1I0CA 5KYXB 4JS5A 5GAN7 1YHQA 3CBPA 1YI2A 1BIBA 1LVKA 5I2MA 1UEBA 2D9TA 2Y4XA 2YRVA 4PJJA 5CO7A 1I07A 4V2SA 3CD6A 2J6KA 1V1CA 2K7AA 1ZA1B 2KT1A 4M77B 4A4HA 4QVDA 3LWHA 3H0FA 2J6OA 3M0QA 2QTXA 2G6FX 2F2XA 3PMTA 3L2UA 2J05A 2K9GA 1TXQA 2J06A 2RJEA 2OTLQ 3ZL7C 2C06A 3SWNC 1WXTA 1R77A 3M54A 1VQ8Q 4LD6A 1MHNA 3MKDA 4J9HA 4N4HA 4C5EA 3EHQA 4F7UF 4LNPA 3GF5A 2PUOB 4XTUA 1YP5A 1LNXA 5D6XA 2QTVA 2X4XA 2KEAA 1ZSZB 3QYHB 2A37A 2JJ9A 2X35A 2NUTA 4ZGEB 2KRNA 4FM4B 1OPLA 4J7FA 1KQSS 3PT9A 4OGEA 3M0RA 2JOYA 1MV0B 3OYEA 2A0FB 2XIDA 5IHIA 3QZ5B 4DBRA 1VIEA 2DM1A 1JU5C 3OB9A 3JCMQ 1MGQA 2DO3A 1WLPB 4X9DA 4C92F 1OX9A 3JV3A 2BKDN 2CP2A 4HT8A 3CCMA 2HZYA 4HVWA 4FU6A 1R0BG 4HXJA 4XU2A 1YI2Q 4JS4A 3HRSA 4F16A 2GQVA 4MZMA 2KT8A 5GAN4 4M78G 3VS5A 1WJQA 4D6WA 3DKMA 4C5IA 1MMGA 3RKWA 3MEVA 4PJOD 3OY9A 1GCPA 2LMJA 2M9UA 1VYUA 2E4HA 4QQ6A 1WI7A 2V1QA 2LJ1A 1VQKT 1KC8C 3JCMd 3ME9A 1XTDA 4M78F 5GAN6 2HL3A 1W6XA 4M75D 3J80E 1WPYA 2XKOC 4M7DE 1M90C 3SB2A 2LNHB 3VRZA 1WZOA 1M4ZA 1QKWA 2GFUA 1EFNA 1QW1A 1OOTA 5C6SA 3EGUA 3EGXA 1WA7A 4OMFB 4K11A 2DD4A 1UUEA 2EQIA 4FW1A 2FEIA 1M27C 2SEMA 1B07A 3GNGA 1N8RR 4LDUA 2AKLA 4M77F 2VGMA 1BIAA 2DERA 5GAMh 3VYHB 1Q82U 4C8QD 1I5LA 1NJIR 3LWIA 1GRIA 2M0YA 2JTFA 4QKUA 5CCAA 2F2VA 1KG1A 1M2OA 2RA2A 1VQ5T 2EFIA 3MEWA 4N0AA 4KGZB 1VUBA 2RJCA 3CCMQ 3S3MA 2EGEA 1MNEA 4E47A 2ECZA 4OMMA 1I4K1 1YJ9A 1Y96B 2VVKA 3VS3A 4HCZA 2C0OA 3REBB 1TWBA 3C4SA 3QZ9B 2M16A 2DXTA 3VS1A 3L2RA 1QVFS 2KI7A 2JMCA 4L5GA 2EGCA 2CYZB 4FCYA 3OW2S 3URGA 5LJ5g 1QLYA 5LJ3g 3FDRA 3E9GA 4JJDA 3A98A 1B3QA 2P0KA 5GAOp 1KJWA 2EQMA 5LJ3f 1UGPB 1IGQA 2D0QB 1BK2A 3EG1A 1UG1A 2RMOA 3UA6A 2AT1B 1D0XA 2CP5A 4OP0A 4LDVA 1PKSA 2EVRA 2L3SA 3T9NA 4OMPA 3BE3A 2HSEB 1YBYA 1K8AR 1FWZA 2P84A 1UHCA 3JB9J 1RLQC 2P4RA 2X3XD 4QW2A 1VQ4A 2RPNA 1KQSA 3CMAT 2FL7A 1AEYA 1M1KR
chains in the Genus database with same CATH topology
2CS7A 3CCSA 1VQ8A 3CCQA 1Q81U 2EJFA 3MHXA 4IKFA 2WSEE 4FIBA 2RI3A 3RKXA 1PSEA 4B9XA 5KE3A 3CCLT 4NS5A 4Y91A 5FROA 3A8OB 4M77G 3CC2T 3N5BB 2E5QA 4NL2A 3CPWA 4XTWA 1NPPA 1Q7YC 4E7KA 4M7DA 4LDYA 4J7IA 2Y4YA 4MMLA 5CVIA 4M75C 3WVEB 2RH2A 4J6XA 4M77E 4RKUE 5GMKm 2X4YA 2ZZDA 3PFSA 1VQ6A 1KQ2A 2PVDB 5A2QE 4BE1A 4PJOG 1Q7YU 1VQOT 3A8MB 2E12A 5GAMd 4XQ3A 5EG2A 4II1A 4FSXA 1K9MC 4EDUA 1WQ7A 5GAN5 2ZPEB 3SD4A 3CCET 1UGRB 5CKDA 1X01A 3X20B 3G4SA 2R58A 3EAEA 3VKIA 2QEXT 4OVAA 3RUXA 2DK3A 1UGSB 3GNFB 1K9MU 1EIFA 4MZPA 4XTYA 1OI1A 3CMEA 2RJDA 2LC4A 2A3LA 2LQKA 1UB4A 5A0DA 1O75A 2VGNA 4ZGJB 3PIOA 4OB0B 1NZ9A 3PMIA 2JVVA 4O6JA 3M58A 1WNLA 5CQXA 1KD1C 1VQ7A 4M75G 4XTVA 3NTKA 3O8VA 3TU4K 4HT9A 3CBMA 3L2VA 1I8FA 1QP2A 2DZ9A 2XICA 4EMHA 5HK0A 5GANh 5DM7R 1K73C 4HCCA 4N0AC 3E9FA 3ER0A 1KD1U 2HD0A 2CGHA 4IURA 4E7JA 3S3NA 1N6AA 1DJ7B 2RJFA 1HXDA 2HQXA 2K5FA 4F7UA 4L6V5 2EJ9A 4M7DB 4LDWA 1ZHIA 2EWNA 1K73U 1S72A 2QQAA 4OB2B 3V8LA 5LJ3d 4F7UE 5DLQE 3X26B 3OYJA 4BACA 5GANj 4PL6A 3CCRT 4N4IA 4DOVA 2LCCA 3MP8A 2E64A 1XOVA 2PUKB 2RK1A 4C8QG 1WQWA 2MWOA 4EMGA 5FU7C 3I55T 3G6EA 4PKCC 3GPLA 1JJ2A 3I56T 5GANf 3CCJA 5C0MA 2QQ9A 5I2SA 5LJ5h 1YJ9T 1RL2A 1BI2A 2MI6A 5LJ3h 2PU9B 5CKHA 3M56A 2O01E 1JB0E 1B34A 1VIFA 3ZEHA 4ZTJA 1M5Q1 4OF1A 2XD0A 4J8OA 1M1GA 2EQUA 3BFMA 3M9QA 4C92D 2FB7A 5KE2A 3OYFA 3OS5A 1YJNA 4M7AG 4XTXA 1N9SA 2E6ZA 3CBOA 3EFSA 3P8BB 3QKJA 2LT4A 4E7HA 2JZ2A 3LGFA 2F5TX 2IG0A 5LJ5j 3OYBA 2VXFA 2Y90A 3BDUA 5CKEA 4C92A 1U1TA 5LJ3j 3JCMX 5GMKh 1YITA 2VXEA 3M4YA 3SWNA 2V8KA 3OYKA 4RCBA 5J39A 1NE8A 4XU1A 2VUBA 4NOYA 5IAYA 1GXIE 1Q86U 3HL8A 2LT1A 3FLGA 5GAN2 4QQGA 3P8HA 1WJRA 3JAME 5LJ5f 4GY5A 4O5VA 3M57A 2DTHA 3HRUA 3MCAB 3ZFJA 2ZGWA 4F7UB 4NL3A 3F70A 2RHUA 5GMKj 3DB4A 3M53A 3FEOA 5HKCA 4ELYC 3CCUA 1N8RC 2LNVA 3CC7T 2LX9A 4Y28E 3RIRA 3OYLA 3VV0A 2QQBA 4KT0E 1OYXA 2KDSA 2LVMA 2V8IA 3VUBA 1X75C 3GOXA 1QVFA 3JB9D 2QQRA 2R5MA 1N8RU 4MDXA 3EFRA 3OBWA 2ZPIB 4IUPA 3LLRA 3RKYA 1NJIC 1VQPA 4M78D 1XNIA 2L3RA 3GLXA 2R57A 2FHDA 2P0QA 2OTJT 1NPRA 1B34B 3ZBDA 4GLKA 3BW1A 3HPWA 4CRIA 3OSSC 3RMSA 5M9OA 5FLXE 4J6WA 5GAMe 1NJIU 1G5VA 3QJ6A 2DIGA 2OTLA 4M78A 3GP8A 3KXTA 1JRIA 2E65A 3X24B 3HSBA 2X4WA 1P92A 2HAXA 3RMQA 5FRNA 1VQ4T 3CCVT 1QVPA 2HBPA 4C92B 1G3SA 3MP6A 2XDPA 3C95A 3SWNB 2MMPA 3LW5E 3M5AA 2RI2A 3V7SA 4M7DD 1FX7A 4C0DB 3FRNA 3SDZA 5CK9A 2DZCA 4M7DC 3UDCA 3CCST 2CKKA 3JCMb 2HNIA 1VQ8T 2DAQA 2L5QA 3FB9A 3CCQT 3JCMc 4PLLA 3OBYA 1WGSA 5GAOm 1BI0A 2E6NA 3L1AA 3S3OA 4M77A 4OB1B 2CZ6B 2XG8D 4J6YA 2LDMA 3L2QA 3OYNA 2CZ0B 2NLUA 5L8RE 4RCCA 5KCHA 2XDBA 4OGCA 5GAOr 4HKEA 1VQKA 1VQNA 1VQ6T 3NFCA 2R5AA 4MZTA 3FIFA 3CC4A 4PJOA 5LJ3e 3E1SA 3Q1JA 3V8JA 2KMTA 3JB9H 2D6FA 4PJOE 3JB9F 3PNWC 3ASKA 3S6WA 5GANd 5GMKl 4R55A 4JLIA 2VC8A 4N4GA 2K3YA 3CXCS 4M78B 3UPUA 3G4ST 3GIBA 3UWNA 3JCMJ 2E70A 3WXMB 4C0ZA 5GMKe 3CMET 1KQ1A 5A0LA 2K2VA 3JB9I 2OAUA 3JCMh 1X6OA 5IN1A 1QP3A 2LQ8A 3QXEB 1Y96A 4TVRA 4BB7A 2QA4A 4M75A 1YCYA 4JUVA 4JRQA 4J5YA 3HHTB 5GAN7 4JS5A 1YHQA 1VQ7T 3RERA 3CBPA 1YI2A 4M75E 3TREA 4IUTA 1BIBA 5I2MA 1UEBA 2D9TA 2EYQA 1H641 2FVUA 2Y4XA 2YRVA 5CO7A 4M7DF 1K8AC 4V2SA 2JUFA 4RG2A 3CD6A 3M55A 4PNOA 3FJPA 5LJ5d 4A4HA 4M77B 4QVDA 3LWHA 1JJ2S 3JCMg 2QI2A 3QDRB 3QIIA 3BY7A 1BI3A 3OS0A 4QVZA 4JRPA 4BI3A 3DLMA 1M9SA 2QTXA 1S72T 1K8AU 2EQKA 4VUBA 4EMKA 4RG8A 3LYIA 2EQJA 2L89A 3JCMf 2K4YA 5DLOA 3C94A 3PMTA 3L2UA 1M1KC 4C8QA 3OYCA 2L8DA 3G6ET 2K5IA 3A5ZB 3P8DA 5D6WA 4C8QE 1VQ5A 4KUIA 2E10A 4BI4A 2KVQG 2RJEA 5GAMg 2ZPBB 3CCJT 4J83A 4C92C 3OYGA 1M1KU 5D6YA 3V7RA 2C06A 3X25B 3SWNC 4QQDA 5FU6B 2KK4A 3M4GA 1YJNT 4M7AA 4IUUA 4C0DC 3LH0A 4BI8B 1Q86C 3KUFA 3M54A 3OMGA 4QVCA 4M7AE 4BY6B 1V29B 5CIUA 5GMKi 4LDXA 2DTOA 3OMCA 2LCLA 2GF7A 3MEAA 3OSVA 4A54A 2DJZA 3TEEA 4FT4A 3SFMA 4LD6A 1MHNA 4MMKA 1YITT 4JRKA 4YTLA 4N4HA 4C5EA 2GFAA 4F7UF 1QVGS 1U8RA 2K57A 1VQLA 5HK3A 3GF5A 2PUOB 4UC4A 4XTUA 5CAIA 4E7IA 1LNXA 2MWPA 5D6XA 1JBMA 1W2BS 2X4XA 3JCMP 2QQSA 1KHIA 1YIJA 3A8GB 3QYHB 1Y71A 3CCUT 2K5LA 4EMKB 1YJWA 2A7YA 3M59A 4ZTFA 3H8ZA 2QXFA 2X35A 4HA8A 3OYDA 5GAOq 4ZGEB 1VQMA 4FM4B 4C8QB 2RHXA 4J7FA 4BUGA 3PGGA 1KQSS 4M78C 1G3TA 3PT9A 4OGEA 4A4FA 2DKGA 3OW2A 2JOYA 3OYEA 1VQPT 2ZCFB 4XU3A 5DY9A 4PLIA 4DOWA 2XIDA 4IUVA 3QZ5B 1VIEA 3OB9A 3JCMQ 3HFNA 2HQEA 1MGQA 2DO3A 4X9DA 4M7AB 4C92F 3PIPA 2BKDN 4XK8E 2OTLT 4HT8A 3CCMA 5GANe 4KUDK 3G71A 3INZA 4FU6A 4XU2A 3CPWS 4XAXB 2ZPGB 4A4GA 3VUZA 4X34A 4JS4A 3HRSA 5J26A 4BE0A 2K3XA 5KH6A 4M77D 2KAFA 2GQVA 4M77C 2G3RA 1IREB 4P5NA 2M0OA 2DXUA 2E41A 4MZMA 3JB9G 1WJSA 4E7LA 5GAN4 2B8AA 2RHIA 1VQ9A 2EKOA 4M78G 2PVGB 1WJQA 4D6WA 3CMAA 3DKMA 5CQYA 3JRZA 5AYFA 1M1FA 1G3WA 3NTIA 4C5IA 2VYTA 3RKWA 2DIQA 2PQWA 3MEVA 4PJOD 3OY9A 1BYMA 4PJOC 3OYYA 2DXBA 5I21A 2M9UA 1UGQB 2JN0A 2JNGA 2I2LA 2LTOA 2VV5A 2KSSA 4QQ6A 3LX7A 5GAOn 3R6OA 3CCLA 5LJ5e 2P0PA 5GAN3 4A53A 5GAOl 1VQKT 1KC8C 4Z02A 3CC2A 3JCMd 3DLLA 3ME9A 1VQNT 1XTDA 5FU6C 2QDYB 3MEUA 2CZ1B 3G7ZA 4ZN1A 5CR2A 4R56A 2GCXA 3CC4T 2BUDA 4M7DG 2MF2A 4M78F 5GAN6 3V8KA 4BY6C 2DTIA 4L59A 1U1SA 1KC8U 4DQ2A 4M75D 3J80E 1WPYA 2XKOC 3JCMW 3JSCA 1D3BA 4XTZA 5LL6S 1VQOA 1M90C 4M7DE 3SB2A 4RMOA 1Y07A 2RI5A 4JLGA 2XK0A 4JRIA 1M4ZA 3HFOA 3META 5HY6A 1OZ2A 2GFUA 4MDWA 1QW1A 3CCEA 5C6SA 3WVDB 2F5KA 1M90U 2MAMA 2DVEA 4OMFB 2QEXA 3QHSA 2DD4A 4C0GA 4ME7A 4C5GA 2QA4T 4JJNK 1Q82C 1YHQT 4A4KA 3HRTA 3GNGA 3QPHA 1RI0A 3V7CA 4B9WA 1YI2T 4LDUA 4CI0C 4M77F 2VGMA 4ZN3A 1BIAA 2RK2A 4EMKC 5GAN8 3LGLA 5IT9E 3CPFA 2WSFE 4ELZC 5GAMh 3CD6T 3VYHB 4BE2A 4C8QD 1Q82U 1LOJA 4C5HA 4C8QC 2RHYA 3OYMA 3E19A 1I5LA 2JTMA 3DB3A 3LWIA 4X9CA 3JCMV 4PJOF 1R8OB 2DPPB 3J7AF 1FXXA 2JTFA 3CXCA 2WACA 4PJOB 1IZ6A 5CCAA 4Q5WA 1G3YA 5CKBA 2LRQA 5GAMj 2DEQA 1KG1A 4F7UG 4KBMB 4JDSA 4M7AD 4HCBA 4M7AC 5A0GA 3QG1A 3OS1A 2RA2A 3CEYA 3OYIA 1LJOA 3CCRA 1VQ5T 1N27A 2AHJB 2DXCA 2EFIA 4EPCA 1BKBA 3MEWA 4N0AA 1D3BB 1VUBA 2RJCA 3S3MA 5GANg 5GAMf 4ATOA 2CZ7B 3I55A 4E47A 3L2ZA 3VU3C 3I56A 1I4K1 4M75F 1YJ9A 1Y96B 4BD3A 5CKFA 3QJYA 4M75B 1XQHA 1ZBXA 3J81E 1HK9A 2F69A 4HCZA 3C12A 2XDDA 2M1HA 3MO8A 2KY9A 3BDLA 4XU0A 3C4SA 4LD9K 3QO3A 3QZ9B 1TH7A 1W4SA 2M16A 2O4XA 2DXTA 1O9SA 3L2RA 1SSFA 1QVFS 4C0FA 1KHCA 3L42A 3QSUA 2XI9A 3HP9A 4L5GA 4ZGDB 3QUIA 1VQLT 4OB3B 3VJPA 2CYZB 3OQ5A 3L2WA 4C92G 3H6ZA 2RM4A 3OW2S 1I81A 2KQWA 1PSFA 3VYGA 2P4TA 3URGA 2XHCA 1H3ZA 5LJ5g 2DD5A 1YIJT 4C92E 4C8QF 5LJ3g 3TCJA 1YJWT 3FDRA 4WF2A 3E9GA 3OA6A 3HKSA 2P0KA 1VQMT 2V8JA 1BI1A 5GAOp 4KULA 2EQMA 5LJ3f 3CC7A 2IVWA 1UGPB 2ZPHB 4FT2A 4IUQA 2D0QB 4A4EA 4M7AF 1N9RA 2XU8A 3PTAA 3JCMe 2PVOB 4FL6A 4OP0A 4LDVA 2RB6A 1QVGA 3X28B 3OYHA 1Y7XA 3T9NA 2OTJA 2YLBA 3FC3A 2EIFA 2WSCE 3CCMT 1W2BA 3G71T 1YBYA 2X4JA 3OS2A 2RO0A 4BDYA 4DA4A 1FWZA 3JB9J 1AHJB 2O4XB 5FRMA 3OYAA 3A8HB 2ZPFB 5FU7B 3QYGB 3UT1A 3NTHA 1M8VA 2YHTA 2H3JA 3AHUA 4BDZA 2RD1A 4QW2A 5KCOA 2EJGA 3CCVA 1VQ4A 1VQ9T 3KBGA 1Q81C 2EAYA 1OZ3A 1KQSA 3CMAT 2E1HA 4M78E 2FYKA 3MP1A 2FL7A 3A8LB 2BIVA 3QBYA 2RHZA 3RESA 2YLCA 5J3BA 1ZQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIR A;  3QHS A;  4C92 C;  3V7R A;  3SWN C;  2EJF A;  3V7C A;  3M4G A;  3JB9 D;  4M77 F;  3RKX A;  5GAN 8;  1BIA A;  4EMK C;  4M7A A;  3EFR A;  3RKY A;  4QVC A;  4Y91 A;  4M7A E;  4M78 D;  5GAM h;  4M77 G;  5GMK i;  4NL2 A;  4C8Q D;  2DTO A;  1LOJ A;  4XTW A;  4C8Q C;  4A54 A;  4M7D A;  1B34 B;  2DJZ A;  3BW1 A;  1I5L A;  4MML A;  4MMK A;  4X9C A;  4JRK A;  4M75 C;  3JCM V;  4PJO F;  4J6X A;  4M77 E;  4J6W A;  5GAM e;  5GMK m;  4F7U F;  4PJO B;  4M78 A;  1KQ2 A;  2K57 A;  4M7A F;  1JRI A;  2E65 A;  4PJO G;  3HSB A;  5GAM d;  4XTU A;  5CAI A;  2DEQ A;  4XQ3 A;  1LNX A;  4F7U G;  5GAM j;  4M7A D;  4M7A C;  1WQ7 A;  1JBM A;  4C92 B;  5GAN 5;  3JCM P;  3SWN B;  2RA2 A;  1LJO A;  1X01 A;  3V7S A;  4EMK B;  4M7D D;  4N0A A;  4M7D C;  1D3B B;  2DZC A;  3RUX A;  4HA8 A;  3JCM b;  5GAM f;  2HNI A;  4XTY A;  5GAN g;  5GAO q;  3FB9 A;  3JCM c;  4C8Q B;  3L2Z A;  3VU3 C;  3PGG A;  1I4K 1;  4M78 C;  4M75 F;  5GAO m;  1Y96 B;  4M75 B;  1WNL A;  2DKG A;  3L1A A;  1HK9 A;  4M77 A;  5DY9 A;  4XU3 A;  4M75 G;  4XTV A;  4J6Y A;  4HT9 A;  1I8F A;  2DZ9 A;  4XU0 A;  4EMH A;  3QO3 A;  5GAN h;  1TH7 A;  2DXT A;  4RCC A;  3JCM Q;  3HFN A;  1MGQ A;  5GAO r;  4X9D A;  4M7A B;  4N0A C;  4C92 F;  3QSU A;  2CGH A;  4HT8 A;  3FIF A;  3QUI A;  4PJO A;  5GAN e;  5LJ3 e;  3V8J A;  3INZ A;  1HXD A;  4XU2 A;  4C92 G;  4F7U A;  3JB9 F;  3JB9 H;  4PJO E;  2EJ9 A;  4M7D B;  2RM4 A;  2EWN A;  1I81 A;  4F7U E;  3V8L A;  5LJ3 d;  5GAN d;  5GMK l;  4M77 D;  5GAN j;  4JLI A;  2VC8 A;  4M77 C;  5LJ5 g;  3JB9 G;  2DXU A;  2E41 A;  4C92 E;  4C8Q F;  5LJ3 g;  4M78 B;  5GAN 4;  3GIB A;  4WF2 A;  2E64 A;  4M78 G;  3JCM J;  4C8Q G;  1WQW A;  4EMG A;  5GMK e;  1KQ1 A;  3RKW A;  3JB9 I;  5GAO p;  3JCM h;  4PJO D;  5GAN f;  5LJ3 f;  4PJO C;  5LJ5 h;  1Y96 A;  5I21 A;  5LJ3 h;  4M75 A;  1YCY A;  4JUV A;  1B34 A;  1N9R A;  2JN0 A;  4J5Y A;  2I2L A;  1M5Q 1;  5GAN 7;  3RER A;  4C92 D;  4M75 E;  3BFM A;  2FB7 A;  3JCM e;  1BIB A;  5GAO n;  4OP0 A;  4M7A G;  4XTX A;  2RB6 A;  5LJ5 e;  1H64 1;  1N9S A;  5GAN 3;  4A53 A;  5GAO l;  4M7D F;  4V2S A;  3EFS A;  3JCM d;  4PNO A;  3FJP A;  5LJ5 d;  2YLB A;  4QVD A;  4M77 B;  5LJ5 j;  3JCM g;  4M7D G;  2VXF A;  2Y90 A;  3BDU A;  4C92 A;  3BY7 A;  1U1T A;  5LJ3 j;  4M78 F;  5GAN 6;  5GMK h;  3JCM X;  2VXE A;  3SWN A;  3V8K A;  3JB9 J;  2DTI A;  2QTX A;  1U1S A;  4DQ2 A;  4RCB A;  4M75 D;  4EMK A;  4XU1 A;  1WPY A;  3JCM W;  4NOY A;  4XTZ A;  1D3B A;  4M7D E;  1M8V A;  2YHT A;  3AHU A;  3JCM f;  3SB2 A;  5GAN 2;  2RD1 A;  5LJ5 f;  2EJG A;  4JRI A;  4C8Q A;  2DTH A;  2EAY A;  3HFO A;  4F7U B;  2ZGW A;  2E1H A;  4M78 E;  4NL3 A;  2FYK A;  4C8Q E;  5GMK j;  2E10 A;  3RES A;  5GAM g;  2YLC A;  2DVE A; 
#chains in the Genus database with same CATH topology
 2NUT B;  1F1B B;  3GBQ A;  3CCQ A;  1BBZ A;  1QQJ A;  8ATC B;  1Q81 U;  2WSE E;  1ABQ A;  2DE0 X;  3RKX A;  2FPE A;  4NS5 A;  1GFD A;  4Y91 A;  1M8M A;  3CC2 T;  3N5B B;  4LDY A;  2OX7 A;  2JXB A;  4J7I A;  4RTT A;  5CVI A;  4M75 C;  5GMK m;  2COZ A;  3PFS A;  1VQ6 A;  2PVD B;  4CC4 B;  5GAM d;  1E6G A;  4EDU A;  1WQ7 A;  2ZPE B;  2QEX T;  2HQH A;  2DK3 A;  3IQL A;  1K9M U;  1WHH A;  4RTY A;  2RJD A;  1UB4 A;  1FMW A;  1O75 A;  2VGN A;  4OB0 B;  1NZ9 A;  3PMI A;  2JVV A;  4O6J A;  1K9A A;  3CBM A;  3L2V A;  1I8F A;  2DL8 A;  4N0A C;  3ER0 A;  2C0T A;  4F7U A;  4L6V 5;  2NUP B;  4LDW A;  1A0N B;  1WHL A;  3EG3 A;  1S72 A;  4GBQ A;  5I11 A;  2RQR A;  3CCR T;  4N4I A;  2RQV A;  2LCC A;  2L3P A;  3MP8 A;  2DMO A;  1R0C B;  3EGX B;  5FU7 C;  3GPL A;  1JJ2 A;  3I56 T;  5GAN f;  3CCJ A;  5I2S A;  1RL2 A;  3CMA Q;  2PU9 B;  2CH4 W;  3M56 A;  5CKH A;  4Z88 A;  2XD0 A;  2ED1 A;  5KYW A;  4C92 D;  1M1G A;  2FB7 A;  1YJN A;  4RUG A;  3OS5 A;  4PJN A;  3QKJ A;  2A28 A;  2IG0 A;  2ATC B;  4C92 A;  3JCM X;  2O9V A;  1PG5 B;  1U1T A;  1GCQ A;  1SF9 A;  3M4Y A;  2ROL A;  1RAB B;  1NE8 A;  5IAY A;  1GXI E;  1RAI B;  1WJR A;  2DTH A;  2ZGW A;  2RHU A;  5HKC A;  1N8R C;  4ELY C;  1T3L A;  1IRX A;  1VQ6 Q;  2LX9 A;  3RIR A;  2MOX A;  1OQK A;  1OYX A;  2V8I A;  1QVF A;  4MDX A;  3MJX A;  3OBW A;  4AFZ C;  1NLP C;  1NJI C;  4M78 D;  1XNI A;  2L3R A;  1NPR A;  4OMQ A;  4GLM A;  3BW1 A;  4CRI A;  3OSS C;  1UDL A;  1G5V A;  3QJ6 A;  3EGD B;  4M78 A;  1JRI A;  2E65 A;  3X24 B;  2X4W A;  1P92 A;  2HAX A;  1QVP A;  2COW A;  1UEC A;  1G3S A;  1NM7 A;  3MP6 A;  2FPD A;  2XDP A;  3LW5 E;  1JXO A;  5KYX A;  5CK9 A;  2CKK A;  1U5S A;  1WHJ A;  1S72 Q;  1WGS A;  5GAO m;  1BI0 A;  3RDV A;  2E6N A;  4M77 A;  3RBB B;  2YUP A;  3OYN A;  2GGR A;  2NLU A;  2ZAE A;  3CCJ Q;  4WTO B;  3NFC A;  3FIF A;  5LJ3 e;  3Q1J A;  3JB9 F;  3ASK A;  1PD1 A;  3A1P A;  3G4S T;  1TUG B;  3VS6 A;  1SEM A;  2V1R A;  3CME T;  3RR6 A;  3QXE B;  2QA4 A;  1SSH A;  4JUV A;  4KGX B;  3TRE A;  4DBF A;  1C0M A;  2EYQ A;  1H64 1;  1K8A C;  2JUF A;  2PZ1 A;  3M55 A;  3FJP A;  3QDR B;  3QII A;  4JRP A;  1YWP A;  3OS0 A;  4BI3 A;  1ZSZ A;  2F1L A;  4FYY B;  2YRD A;  1S1N A;  4RG8 A;  2I0N A;  3LYI A;  1MMA A;  5DLO A;  1D1C A;  3C94 A;  3EFO B;  1M1K C;  2RQT A;  3OYC A;  3G6E T;  2K5I A;  3A5Z B;  4C92 C;  5D6Y A;  3V7R A;  1GCQ C;  3X25 B;  5IHK A;  5FU6 B;  4JJC A;  1KSW A;  1WHK A;  2DL7 A;  4IUU A;  4C0D C;  3EH1 A;  3LH0 A;  4BI8 B;  3KUF A;  4QVC A;  1ARK A;  1M3C A;  4M7A E;  5CIU A;  4LDX A;  2YUN A;  1G83 A;  3I5R A;  3OMC A;  3MEA A;  4FT4 A;  2DBM A;  1QVG S;  2KR3 A;  5HK3 A;  4HVU A;  2MWP A;  4FYX B;  1X43 A;  1EX4 A;  1YIJ A;  1KHI A;  3A8G B;  3REA B;  2K5L A;  1EZZ B;  4HA8 A;  3OYD A;  5GAO q;  1VQM A;  3PGG A;  4M78 C;  2DLP A;  3G4S Q;  2DKG A;  2HSP A;  2ZCF B;  4FSS A;  3CME Q;  4DOW A;  2PNI A;  2HQE A;  1X2Q A;  4M7A B;  2KRM A;  2OTL T;  2YUQ A;  5GAN e;  3CPW S;  1K73 R;  4XAX B;  3VUZ A;  4WCI A;  4BE0 A;  2QDL A;  5KH6 A;  1VYV A;  2G3R A;  1IRE B;  4M77 C;  2M0O A;  4PJL A;  1K76 A;  2RHI A;  1VQ9 A;  2PVG B;  1M2V B;  3JRZ A;  5AYF A;  2DIQ A;  2LP5 A;  1OX8 A;  2PQW A;  4PFO A;  2DXB A;  3G6E Q;  2JN0 A;  2I2L A;  2VAS A;  2HMA A;  4CC2 A;  5GAO n;  3CCL A;  4ZNX A;  2JMA A;  3DLL A;  3MEU A;  4R56 A;  2GCX A;  2BUD A;  4J9B A;  2MF2 A;  6AT1 B;  2DTI A;  2LQW A;  3EG9 B;  1KC8 U;  1Q86 R;  4XTZ A;  1VQO A;  4RMO A;  2RI5 A;  2XK0 A;  3MET A;  5HY6 A;  1AT1 B;  4MDW A;  3CCE A;  3WVD B;  1M90 U;  3SEM A;  3OW2 P;  3QHS A;  2DYI A;  4C5G A;  1YHQ T;  1ZSZ C;  3NMZ C;  1YI2 T;  4ZN3 A;  2KYM A;  3LGL A;  1YIJ Q;  4ELZ C;  2WSF E;  5GJW B;  2D0N A;  3CD6 T;  4C5H A;  4R0K A;  3OYM A;  1D1B A;  2W0Z A;  1VQM Q;  3E19 A;  3JCM V;  1B7T A;  1R8O B;  1AWO A;  1FXX A;  4Z8A A;  2WAC A;  1IZ6 A;  1RI9 A;  5GAM j;  2DEQ A;  2K79 A;  4F7U G;  4RTV A;  5A0G A;  4Y92 A;  2X51 A;  3CEY A;  4J9F A;  1LJO A;  1D3B B;  4ATO A;  2CZ7 B;  1GFC A;  1QCO A;  4JJB A;  2F69 A;  1M3B A;  3MO8 A;  1VQ9 Q;  2KY9 A;  3BDL A;  4XU0 A;  4LD9 K;  1UTI A;  3QO3 A;  1TH7 A;  3EHR A;  1TTH B;  2JM9 A;  1SSF A;  1KHC A;  2EYX A;  3QSU A;  2XI9 A;  1WHG A;  3HP9 A;  2RN8 A;  4ZGD B;  2DFU A;  3M0S A;  4C92 G;  3UAT A;  3H6Z A;  2KGT A;  3H0I A;  2QGG A;  2JS2 A;  2KQW A;  3CCL Q;  1IGU A;  2P4T A;  3H41 A;  2GTO A;  2LJ3 A;  5FWC A;  4WF2 A;  3OA6 A;  3HKS A;  4EIK A;  4LE9 A;  3G1J A;  1ACM B;  1BI1 A;  2FRY A;  4FW2 A;  4KUL A;  4A4E A;  3I9Q A;  4M7A F;  2KXC A;  2XU8 A;  1CKB A;  2PVO B;  4FL6 A;  3CCE Q;  1QVG A;  2HDA A;  2YSQ A;  1YHQ Q;  1Y7X A;  3I5S A;  3CCM T;  2X4J A;  2RO0 A;  3CD6 Q;  1AHJ B;  1QWE A;  2O4X B;  2DX1 A;  3A8H B;  3QYG B;  1M8V A;  3NTH A;  2RD1 A;  3CCV A;  3KBG A;  1TUD A;  1OZ3 A;  2E1H A;  1OUL A;  2DET A;  4LXC A;  3QBY A;  3RES A;  3CCS A;  2BTT A;  2EJF A;  4FIB A;  1Z9Z A;  3A8O B;  4M77 G;  3EG0 A;  3CPW A;  2NUP A;  2GNC A;  1MND A;  4E7K A;  3WVE B;  4AFQ C;  2RH2 A;  4J6X A;  2EYY A;  2EYW A;  2X4Y A;  2ZZD A;  5A2Q E;  3PVQ A;  1ZBJ A;  3A8M B;  1QCF A;  2E12 A;  5EG2 A;  3EG2 A;  1X01 A;  2E3I A;  1RAA B;  3RUX A;  1UGS B;  1EIF A;  4MZP A;  4XTY A;  2LC4 A;  2LQK A;  1FYN A;  3PIO A;  1WNL A;  1VQ7 A;  3TU4 K;  7AT1 B;  1W2B P;  4Z89 A;  5GAN h;  1K73 C;  2KNB B;  3NGP A;  1E6H A;  3E9F A;  4IUR A;  1Y0M A;  1DJ7 B;  2HQX A;  4M7D B;  2EWN A;  2D1X A;  5LJ3 d;  4PL6 A;  2M02 A;  1RAE B;  1PHT A;  3LH5 A;  1WQW A;  2MWO A;  1YJ9 T;  1BI2 A;  2MI6 A;  4OMN A;  5IH2 A;  3ZEH A;  1M5Q 1;  3CCV Q;  4J8O A;  1Q81 R;  3EGD A;  2E6Z A;  2GQI A;  3EFS A;  2LT4 A;  4KGV B;  4RTW A;  2F5T X;  2Y90 A;  2EYZ A;  5CKE A;  4KH1 B;  1YIT A;  5GMK h;  2VXE A;  5J39 A;  3CQT A;  4J9I A;  4NOY A;  5GAN 2;  2PTK A;  1QWF A;  5LJ5 f;  1N5Z A;  4GY5 A;  4O5V A;  4AG1 C;  4NL3 A;  3MCA B;  4FYW B;  3DB4 A;  3CCU A;  2L3Q A;  3TQ7 P;  3OYL A;  2KDS A;  1JEG A;  3VUB A;  3GOX A;  2QQR A;  1N8R U;  1VQP A;  2CP6 A;  2ENM A;  1H8K A;  1SG5 A;  2KRS A;  4GLK A;  5L23 A;  2BZ8 A;  3RMS A;  1NJI U;  2KBT A;  1UFF A;  2DIG A;  2GTJ A;  1VQ7 Q;  1PRL C;  2LX7 A;  3RMQ A;  1VQ4 T;  2OAW A;  2EBP A;  1NYF A;  2CUD A;  3V7S A;  3VRY A;  1ABO A;  3FRN A;  3UDC A;  3JCM b;  2CDT A;  3CCQ T;  1CKA A;  3JCM c;  4PLL A;  2BZY A;  4PJM A;  2CZ6 B;  2YDL A;  1YJ9 Q;  2J6F A;  2CZ0 B;  5L8R E;  4OGC A;  4DBH A;  1ZX6 A;  2JTE A;  1VQN A;  1VQ6 T;  2R5A A;  3EFO A;  3CC4 A;  3E1S A;  2K3B A;  4RTZ A;  3JB9 H;  4PJO E;  1WXB A;  4PK4 A;  2IPO B;  1C6V X;  3S6W A;  5GAN d;  5GMK l;  4R55 A;  1VOM A;  1QVG P;  1YIT Q;  2E3H A;  5A0L A;  2K2V A;  2OAU A;  5IN1 A;  2LQ8 A;  5FWB A;  3ULR B;  2QYZ A;  3HHT B;  1JXM A;  3RER A;  4M75 E;  4IUT A;  3CCU Q;  4M7D F;  5I22 A;  4RG2 A;  1WIE A;  1BCO A;  1UGV A;  2QI2 A;  4B6M A;  3BY7 A;  1S72 T;  1K8A U;  2EQK A;  1TSF A;  4ESR A;  2NYS A;  4PFZ A;  2L89 A;  1K4U S;  2K4Y A;  1I1J A;  2ABL A;  5D6W A;  4C8Q E;  1NEB A;  3CPW P;  4BI4 A;  2KVQ G;  5GAM g;  1VQ4 Q;  3CCJ T;  2VB6 A;  2QG9 B;  1M1K U;  1MMD A;  1ZA2 B;  1YJN T;  4M7A A;  4BY6 B;  3CCQ Q;  1V29 B;  4E6R A;  2LCL A;  3OSV A;  3TEE A;  3SFM A;  4MMK A;  4YTL A;  1SRL A;  4IIO A;  1Q7Y R;  3TSW A;  1VQL A;  2YXY A;  1M2V A;  4UC4 A;  4E7I A;  1W2B S;  9ATC B;  2QQS A;  1D09 B;  1Y71 A;  2CSI A;  5KYU A;  4EMK B;  1YJW A;  1Z9Q A;  4ZTF A;  1M3A A;  3H8Z A;  4LUE A;  2DL3 A;  4C8Q B;  2KE9 A;  3E2U A;  1JQQ A;  1G3T A;  1AVZ C;  3OW2 A;  4XU3 A;  4IUV A;  2VWF A;  1K0S A;  3EG9 A;  1KD1 R;  4XK8 E;  3QDF A;  4AFU C;  3G71 A;  2ZPG B;  1X27 A;  3D7S B;  4M77 D;  2KAF A;  5FRO A;  3JB9 G;  4P5N A;  2E41 A;  1WJS A;  1SHF A;  2EW3 A;  1AWJ A;  2EKO A;  2F2W A;  1OU8 A;  5CQY A;  1M1F A;  1G3W A;  3NTI A;  2VYT A;  1BYM A;  2DRK A;  2FO0 A;  3OYY A;  2JNG A;  2LTO A;  2VV5 A;  2KSS A;  3LX7 A;  1WYX A;  3R6O A;  5LJ5 e;  2P0P A;  5GAN 3;  4A53 A;  5GAO l;  5FU6 C;  2QDY B;  2CZ1 B;  4ZN1 A;  5CR2 A;  1YJN Q;  2FRW A;  1OPK A;  4DQ2 A;  3JCM W;  1HSQ A;  1D3B A;  1QCN A;  2VKN A;  5LL6 S;  3PE0 A;  5KYN A;  1T3S A;  4JLG A;  4JRI A;  3HFO A;  1OZ2 A;  2AKK A;  1PC0 A;  2F5K A;  2MAM A;  1VQL Q;  2DVJ A;  1YCS B;  4JJN K;  2QA4 T;  3HRT A;  3V7C A;  4B9W A;  1U06 A;  5GAN 8;  1GBR A;  2RK2 A;  1Q95 G;  5IT9 E;  5D7U A;  3CPF A;  1BB9 A;  2DIL A;  3QWX X;  2JTM A;  3DB3 A;  4PJO F;  2DPP B;  3J7A F;  2LRQ A;  4JDS A;  4HCB A;  4M7A C;  2BZX A;  2COY A;  3QG1 A;  3OS1 A;  3OYI A;  1N27 A;  2RQU A;  4EPC A;  1BKB A;  1WHM A;  3I55 A;  4M75 F;  1HJD A;  5CKF A;  3QJY A;  1ZBX A;  3J81 E;  1HK9 A;  3UF4 A;  2DEU A;  2M1H A;  2O4X A;  1IB8 A;  2RNA A;  3L42 A;  2CH4 A;  2QAS A;  3VS2 A;  3QUI A;  3VJP A;  3OQ5 A;  3L2W A;  2RM4 A;  1H3Z A;  3VYG A;  2OI3 A;  2XHC A;  2DD5 A;  1YIJ T;  4C92 E;  4C8Q F;  4JPB W;  1VQM T;  3R6N A;  1ZUY A;  3CC7 A;  2IVW A;  2ZPH B;  1RAH B;  1AOJ A;  2QAZ A;  3RNJ A;  4ORZ A;  1RAG B;  3PTA A;  4PFP A;  2FZK B;  2QA4 Q;  3VS0 A;  3CXC P;  2LCS A;  2OTJ A;  2YLB A;  3FC3 A;  2EIF A;  2WSC E;  1W2B A;  1AD5 A;  4BDY A;  2EGA A;  3OYA A;  2ZPF B;  4D8D A;  3UT1 A;  2YHT A;  4BDZ A;  5KCO A;  2EJG A;  1VQ9 T;  4M78 E;  2BIV A;  5KYU B;  2HL5 C;  2CS7 A;  1VQ8 A;  4AG2 C;  5IHN A;  4IKF A;  2RI3 A;  1PSE A;  4F14 A;  3CCL T;  2DA9 A;  2E5Q A;  4NL2 A;  4XTW A;  2B86 A;  1NPP A;  1Q7Y C;  4M7D A;  3I55 Q;  2LQN A;  4MML A;  4M77 E;  1VQO T;  3SD4 A;  3CCE T;  1UGR B;  4A63 B;  2R58 A;  3VKI A;  2A3L A;  4ZGJ B;  5AT1 B;  3VS4 A;  4CC7 A;  5IXB A;  1KD1 C;  3NTK A;  1QP2 A;  2XIC A;  1U3O A;  5DM7 R;  3CC7 Q;  3MPU B;  4E7J A;  1AZE A;  1N6A A;  2RJF A;  1HXD A;  1D1A A;  2K5F A;  2C0I A;  2CP7 A;  1K73 U;  2QQA A;  2DF6 A;  3OYJ A;  3X26 B;  4BAC A;  5GAN j;  2FPF A;  2OTJ Q;  2E64 A;  1XOV A;  2PUK B;  2RK1 A;  2OJ2 A;  2CP3 A;  4EMG A;  3U23 A;  2DL5 A;  2NUZ A;  5LJ5 h;  1NEG A;  1IO6 A;  5LJ3 h;  4ZTJ A;  1VIF A;  5KE2 A;  2EQU A;  4M7A G;  1N9S A;  1RAD B;  1YWO A;  3CBO A;  2JZ2 A;  3LGF A;  2K6D A;  2V8K A;  3OYK A;  4RCB A;  4XU1 A;  1NLO C;  2VUB A;  1Q86 U;  3HL8 A;  3FLG A;  2HEQ A;  4QQG A;  2MIO A;  1VA7 A;  3HRU A;  2MYS A;  3ZFJ A;  1VQO Q;  2FZC B;  5GMK j;  2LNV A;  3VV0 A;  2QQB A;  4KT0 E;  4M4Z A;  1X75 C;  3JB9 D;  1T0H A;  2R5M A;  2W10 A;  3EFR A;  4IUP A;  3LLR A;  1Q82 R;  2BE9 B;  3GLX A;  2R57 A;  2FHD A;  2P0Q A;  1TUC A;  1B34 B;  3ZBD A;  1OEB A;  5M9O A;  5FLX E;  4J6W A;  1SKU B;  1PM3 A;  4OML A;  2X9H A;  3GP8 A;  3KXT A;  3FJ5 A;  5FW9 A;  5FRN A;  3CCV T;  2HBP A;  1PWT A;  2MPX C;  3C95 A;  3SWN B;  2MMP A;  2NWM A;  3M0P A;  2RI2 A;  4HVV A;  3I35 A;  4M7D C;  1ZUK A;  3SDZ A;  2CRE A;  3CCS T;  2DAQ A;  1PKT A;  3OBY A;  2K2M A;  2J7I A;  1TU0 B;  2IIM A;  4OB1 B;  4J6Y A;  3L2Q A;  2XDB A;  5KYY B;  1VQK A;  3EH2 A;  4PJO A;  3V8J A;  1AWW A;  2D6F A;  4N4G A;  3CXC S;  2JT4 A;  3AT1 B;  3GIB A;  3UWN A;  3JCM J;  1YNZ A;  4C0Z A;  1KQ1 A;  3JB9 I;  4TVR A;  4M75 A;  4LN2 A;  1VQ7 T;  4J5Y A;  3NPF A;  2FVU A;  1D0Y A;  3C0C A;  4PNO A;  5LJ5 d;  1C1A A;  1G2B A;  1JJ2 S;  3JCM g;  1BI3 A;  4QVZ A;  3DLM A;  1M9S A;  4VUB A;  4EMK A;  1PRM C;  1K1Z A;  4OMO A;  2EQJ A;  4RTX A;  3JCM f;  1FMV A;  4AMC A;  4C8Q A;  1XJW B;  2L8D A;  3P8D A;  2LZ6 B;  1VQ5 A;  4KUI A;  2E10 A;  2ZPB B;  4J83 A;  3OYG A;  1G8X A;  2BE7 D;  4QQD A;  2KK4 A;  3M4G A;  2X3W D;  4AT1 B;  4HCK A;  1Q86 C;  3CCS Q;  3OMG A;  4FYV B;  1SRM A;  2EKH A;  5GMK i;  2DTO A;  2GF7 A;  4A54 A;  2DJZ A;  1YIT T;  4JRK A;  2GFA A;  1MUZ A;  1U8R A;  2K57 A;  4X1V A;  2HBW A;  5ECA A;  5CAI A;  4IIM A;  1JBM A;  2ROT A;  2AZS A;  1UE9 A;  2ED0 A;  3JCM P;  1M30 A;  1VYT A;  1VQK Q;  2H8H A;  3CCU T;  1H92 A;  1K9M R;  2A7Y A;  3M59 A;  1KIK A;  2QXF A;  4J9E A;  2RHX A;  4BUG A;  1GBQ A;  2H3E B;  2YUO A;  4A4F A;  1VQP T;  5DY9 A;  1NBE B;  4PLI A;  3NHN A;  2V26 A;  1PD0 A;  3HFN A;  3PIP A;  4RTU A;  2O9S A;  2CT3 A;  4KUD K;  3INZ A;  4A4G A;  1CSK A;  4X34 A;  2FZG B;  5J26 A;  2CP0 A;  2K3X A;  8AT1 B;  1HD3 A;  2DL4 A;  1WFW A;  2DXU A;  2DRM A;  4E7L A;  1QMC A;  2B8A A;  2E5K A;  3CMA A;  3H0H A;  1SPK A;  4PJO C;  1T0J A;  5I21 A;  2LJ0 A;  1UGQ B;  2HKN A;  3UA7 A;  1VQ5 Q;  1IXD A;  4Z02 A;  3CC2 A;  1VQN T;  2MCN A;  1TG0 A;  3G7Z A;  3CC4 T;  4M7D G;  4E2F B;  4KH0 B;  3V8K A;  4BY6 C;  1I5O B;  1E7O A;  4L59 A;  1U1S A;  3SHW A;  3JSC A;  1Y07 A;  4J9D A;  4F17 A;  2DVE A;  2QEX A;  4C0G A;  4ME7 A;  1Q82 C;  4A4K A;  3QPH A;  1RI0 A;  2RQW A;  4CI0 C;  4EMK C;  4JZ4 A;  4BE2 A;  1LOJ A;  4C8Q C;  2RHY A;  1BCM A;  1NG2 A;  4X9C A;  1VQP Q;  2YT6 A;  3CXC A;  4PJO B;  4Q5W A;  1G3Y A;  5CKB A;  2CUB A;  4KBM B;  4LUD A;  4ANJ A;  4M7A D;  3VS7 A;  3CCR A;  4E7Z A;  2DXC A;  2AHJ B;  5GAN g;  5GAM f;  3L2Z A;  3VU3 C;  3I56 A;  1X6G A;  4BD3 A;  1X2K A;  2DJQ A;  4M75 B;  1XQH A;  2XDD A;  3C12 A;  1IHW A;  1W4S A;  1O9S A;  4C0F A;  1W70 A;  3QWY A;  1BU1 A;  3HTR A;  4KRT A;  4OB3 B;  1VQL T;  1VQN Q;  1I81 A;  1PSF A;  3CC4 Q;  2O31 A;  3CC2 Q;  2A08 A;  3TCJ A;  1YJW T;  1Y57 A;  3PVL A;  2V8J A;  4D8K A;  1WDX A;  3TVT A;  2QK0 A;  1IHV A;  3TSZ A;  4FT2 A;  4IUQ A;  3O5Z A;  2XMF A;  1N9R A;  1V76 A;  5GJV B;  2Z0W A;  3JCM e;  1PCX A;  2RB6 A;  1FMK A;  3X28 B;  1LPL A;  3OYH A;  1YFN A;  2QEX Q;  3G71 T;  3OS2 A;  4DA4 A;  2DBK A;  2L0A A;  5FRM A;  5FU7 B;  2H3J A;  3AHU A;  1UJY A;  1Q81 C;  2EAY A;  1OV3 A;  1OU9 A;  2FYK A;  3MP1 A;  3A8L B;  1WX6 A;  2RHZ A;  2YLC A;  5J3B A;  1ZQ1 A;  3OYB A;  1TOV A;  1SHG A;  1TS9 A;  2DNU A;  3MHX A;  2O88 A;  4DEX A;  4B9X A;  1K0X A;  5KE3 A;  3CCR Q;  2CSQ A;  1H3H A;  1AZG B;  2Y4Y A;  3I56 Q;  4RKU E;  1AWX A;  1KQ2 A;  4BE1 A;  4PJO G;  1Q7Y U;  2A36 A;  4XQ3 A;  4II1 A;  4FSX A;  1K9M C;  5GAN 5;  1HYO A;  2D8H A;  5CKD A;  3KFV A;  3X20 B;  3G4S A;  3EAE A;  4OVA A;  3GNF B;  1OI1 A;  3CME A;  5A0D A;  1PNJ A;  1YJW Q;  2O2O A;  4DBQ A;  1RAF B;  3M58 A;  2AZV A;  5CQX A;  4M75 G;  4XTV A;  3O8V A;  4QT7 A;  4HT9 A;  2DZ9 A;  5HK0 A;  2AIR B;  4EMH A;  4HCC A;  1KK7 A;  1KD1 U;  2HD0 A;  1UJ0 A;  2CGH A;  3S3N A;  2JM8 A;  3M0T A;  2EJ9 A;  1KQS P;  1ZHI A;  4OB2 B;  4F7U E;  3V8L A;  5DLQ E;  2HCK A;  2KYB A;  2KXD A;  1WXU A;  3G71 Q;  1X6B A;  4J9G A;  4DOV A;  1NYG A;  4C8Q G;  3I55 T;  3G6E A;  4PKC C;  1RLP C;  5C0M A;  2QQ9 A;  2CT4 A;  1UHF A;  1JB0 E;  1B34 A;  2O01 E;  4OF1 A;  3OYF A;  3BFM A;  3M9Q A;  4XTX A;  3P8B B;  1ZUU A;  4E7H A;  1YN8 A;  2KRO A;  5LJ5 j;  2VXF A;  3BDU A;  5LJ3 j;  2YRC A;  1KC8 R;  3SWN A;  2FG0 A;  4J9C A;  2LT1 A;  3JAM E;  3P8H A;  2DYB A;  3M57 A;  1LCK A;  2QGF B;  4F7U B;  3F70 A;  1M90 R;  3M53 A;  3FEO A;  3CC7 T;  1MV3 A;  4Y28 E;  1W1F A;  2LVM A;  5KYY A;  2ZPI B;  3RKY A;  2GBQ A;  1ZLM A;  2D8J A;  3M0U A;  2OTJ T;  3HPW A;  5KYW B;  5IXF A;  5GAM e;  2JS0 A;  2OTL A;  2M51 A;  3HSB A;  3H9N A;  1D0Z A;  5EC7 A;  4C92 B;  2AK5 A;  1JJ2 P;  3M5A A;  4M7D D;  1FX7 A;  4C0D B;  2DZC A;  2EPD A;  1VQ8 T;  2HNI A;  2L5Q A;  3FB9 A;  1J3T A;  4JZ3 A;  3L1A A;  3S3O A;  2RF0 A;  2XG8 D;  1X69 A;  4F04 B;  2LDM A;  1GL5 A;  5KCH A;  4RCC A;  1QKX A;  4CC3 A;  2HKQ B;  1KFZ A;  5GAO r;  4HKE A;  4DEY A;  3THK A;  2YWW A;  4MZT A;  4AFS C;  2JW4 A;  1RAC B;  2KMT A;  1RUW A;  3PNW C;  2L2P A;  1JO8 A;  4E7S A;  4JLI A;  2VC8 A;  2K3Y A;  2ESW A;  4M78 B;  3UPU A;  1MMN A;  1ZSG A;  2E70 A;  1QVF P;  3WXM B;  5GMK e;  2MK5 A;  5HCK A;  3JCM h;  1X6O A;  1QP3 A;  4BB7 A;  1Y96 A;  2SRC A;  4JRQ A;  1YCY A;  1I0C A;  5KYX B;  4JS5 A;  5GAN 7;  1YHQ A;  3CBP A;  1YI2 A;  1BIB A;  1LVK A;  5I2M A;  1UEB A;  2D9T A;  2Y4X A;  2YRV A;  4PJJ A;  5CO7 A;  1I07 A;  4V2S A;  3CD6 A;  2J6K A;  1V1C A;  2K7A A;  1ZA1 B;  2KT1 A;  4M77 B;  4A4H A;  4QVD A;  3LWH A;  3H0F A;  2J6O A;  3M0Q A;  2QTX A;  2G6F X;  2F2X A;  3PMT A;  3L2U A;  2J05 A;  2K9G A;  1TXQ A;  2J06 A;  2RJE A;  2OTL Q;  3ZL7 C;  2C06 A;  3SWN C;  1WXT A;  1R77 A;  3M54 A;  1VQ8 Q;  4LD6 A;  1MHN A;  3MKD A;  4J9H A;  4N4H A;  4C5E A;  3EHQ A;  4F7U F;  4LNP A;  3GF5 A;  2PUO B;  4XTU A;  1YP5 A;  1LNX A;  5D6X A;  2QTV A;  2X4X A;  2KEA A;  1ZSZ B;  3QYH B;  2A37 A;  2JJ9 A;  2X35 A;  2NUT A;  4ZGE B;  2KRN A;  4FM4 B;  1OPL A;  4J7F A;  1KQS S;  3PT9 A;  4OGE A;  3M0R A;  2JOY A;  1MV0 B;  3OYE A;  2A0F B;  2XID A;  5IHI A;  3QZ5 B;  4DBR A;  1VIE A;  2DM1 A;  1JU5 C;  3OB9 A;  3JCM Q;  1MGQ A;  2DO3 A;  1WLP B;  4X9D A;  4C92 F;  1OX9 A;  3JV3 A;  2BKD N;  2CP2 A;  4HT8 A;  3CCM A;  2HZY A;  4HVW A;  4FU6 A;  1R0B G;  4HXJ A;  4XU2 A;  1YI2 Q;  4JS4 A;  3HRS A;  4F16 A;  2GQV A;  4MZM A;  2KT8 A;  5GAN 4;  4M78 G;  3VS5 A;  1WJQ A;  4D6W A;  3DKM A;  4C5I A;  1MMG A;  3RKW A;  3MEV A;  4PJO D;  3OY9 A;  1GCP A;  2LMJ A;  2M9U A;  1VYU A;  2E4H A;  4QQ6 A;  1WI7 A;  2V1Q A;  2LJ1 A;  1VQK T;  1KC8 C;  3JCM d;  3ME9 A;  1XTD A;  4M78 F;  5GAN 6;  2HL3 A;  1W6X A;  4M75 D;  3J80 E;  1WPY A;  2XKO C;  4M7D E;  1M90 C;  3SB2 A;  2LNH B;  3VRZ A;  1WZO A;  1M4Z A;  1QKW A;  2GFU A;  1EFN A;  1QW1 A;  1OOT A;  5C6S A;  3EGU A;  3EGX A;  1WA7 A;  4OMF B;  4K11 A;  2DD4 A;  1UUE A;  2EQI A;  4FW1 A;  2FEI A;  1M27 C;  2SEM A;  1B07 A;  3GNG A;  1N8R R;  4LDU A;  2AKL A;  4M77 F;  2VGM A;  1BIA A;  2DER A;  5GAM h;  3VYH B;  1Q82 U;  4C8Q D;  1I5L A;  1NJI R;  3LWI A;  1GRI A;  2M0Y A;  2JTF A;  4QKU A;  5CCA A;  2F2V A;  1KG1 A;  1M2O A;  2RA2 A;  1VQ5 T;  2EFI A;  3MEW A;  4N0A A;  4KGZ B;  1VUB A;  2RJC A;  3CCM Q;  3S3M A;  2EGE A;  1MNE A;  4E47 A;  2ECZ A;  4OMM A;  1I4K 1;  1YJ9 A;  1Y96 B;  2VVK A;  3VS3 A;  4HCZ A;  2C0O A;  3REB B;  1TWB A;  3C4S A;  3QZ9 B;  2M16 A;  2DXT A;  3VS1 A;  3L2R A;  1QVF S;  2KI7 A;  2JMC A;  4L5G A;  2EGC A;  2CYZ B;  4FCY A;  3OW2 S;  3URG A;  5LJ5 g;  1QLY A;  5LJ3 g;  3FDR A;  3E9G A;  4JJD A;  3A98 A;  1B3Q A;  2P0K A;  5GAO p;  1KJW A;  2EQM A;  5LJ3 f;  1UGP B;  1IGQ A;  2D0Q B;  1BK2 A;  3EG1 A;  1UG1 A;  2RMO A;  3UA6 A;  2AT1 B;  1D0X A;  2CP5 A;  4OP0 A;  4LDV A;  1PKS A;  2EVR A;  2L3S A;  3T9N A;  4OMP A;  3BE3 A;  2HSE B;  1YBY A;  1K8A R;  1FWZ A;  2P84 A;  1UHC A;  3JB9 J;  1RLQ C;  2P4R A;  2X3X D;  4QW2 A;  1VQ4 A;  2RPN A;  1KQS A;  3CMA T;  2FL7 A;  1AEY A;  1M1K R; 
#chains in the Genus database with same CATH homology
 2CS7 A;  3CCS A;  1VQ8 A;  3CCQ A;  1Q81 U;  2EJF A;  3MHX A;  4IKF A;  2WSE E;  4FIB A;  2RI3 A;  3RKX A;  1PSE A;  4B9X A;  5KE3 A;  3CCL T;  4NS5 A;  4Y91 A;  5FRO A;  3A8O B;  4M77 G;  3CC2 T;  3N5B B;  2E5Q A;  4NL2 A;  3CPW A;  4XTW A;  1NPP A;  1Q7Y C;  4E7K A;  4M7D A;  4LDY A;  4J7I A;  2Y4Y A;  4MML A;  5CVI A;  4M75 C;  3WVE B;  2RH2 A;  4J6X A;  4M77 E;  4RKU E;  5GMK m;  2X4Y A;  2ZZD A;  3PFS A;  1VQ6 A;  1KQ2 A;  2PVD B;  5A2Q E;  4BE1 A;  4PJO G;  1Q7Y U;  1VQO T;  3A8M B;  2E12 A;  5GAM d;  4XQ3 A;  5EG2 A;  4II1 A;  4FSX A;  1K9M C;  4EDU A;  1WQ7 A;  5GAN 5;  2ZPE B;  3SD4 A;  3CCE T;  1UGR B;  5CKD A;  1X01 A;  3X20 B;  3G4S A;  2R58 A;  3EAE A;  3VKI A;  2QEX T;  4OVA A;  3RUX A;  2DK3 A;  1UGS B;  3GNF B;  1K9M U;  1EIF A;  4MZP A;  4XTY A;  1OI1 A;  3CME A;  2RJD A;  2LC4 A;  2A3L A;  2LQK A;  1UB4 A;  5A0D A;  1O75 A;  2VGN A;  4ZGJ B;  3PIO A;  4OB0 B;  1NZ9 A;  3PMI A;  2JVV A;  4O6J A;  3M58 A;  1WNL A;  5CQX A;  1KD1 C;  1VQ7 A;  4M75 G;  4XTV A;  3NTK A;  3O8V A;  3TU4 K;  4HT9 A;  3CBM A;  3L2V A;  1I8F A;  1QP2 A;  2DZ9 A;  2XIC A;  4EMH A;  5HK0 A;  5GAN h;  5DM7 R;  1K73 C;  4HCC A;  4N0A C;  3E9F A;  3ER0 A;  1KD1 U;  2HD0 A;  2CGH A;  4IUR A;  4E7J A;  3S3N A;  1N6A A;  1DJ7 B;  2RJF A;  1HXD A;  2HQX A;  2K5F A;  4F7U A;  4L6V 5;  2EJ9 A;  4M7D B;  4LDW A;  1ZHI A;  2EWN A;  1K73 U;  1S72 A;  2QQA A;  4OB2 B;  3V8L A;  5LJ3 d;  4F7U E;  5DLQ E;  3X26 B;  3OYJ A;  4BAC A;  5GAN j;  4PL6 A;  3CCR T;  4N4I A;  4DOV A;  2LCC A;  3MP8 A;  2E64 A;  1XOV A;  2PUK B;  2RK1 A;  4C8Q G;  1WQW A;  2MWO A;  4EMG A;  5FU7 C;  3I55 T;  3G6E A;  4PKC C;  3GPL A;  1JJ2 A;  3I56 T;  5GAN f;  3CCJ A;  5C0M A;  2QQ9 A;  5I2S A;  5LJ5 h;  1YJ9 T;  1RL2 A;  1BI2 A;  2MI6 A;  5LJ3 h;  2PU9 B;  5CKH A;  3M56 A;  2O01 E;  1JB0 E;  1B34 A;  1VIF A;  3ZEH A;  4ZTJ A;  1M5Q 1;  4OF1 A;  2XD0 A;  4J8O A;  1M1G A;  2EQU A;  3BFM A;  3M9Q A;  4C92 D;  2FB7 A;  5KE2 A;  3OYF A;  3OS5 A;  1YJN A;  4M7A G;  4XTX A;  1N9S A;  2E6Z A;  3CBO A;  3EFS A;  3P8B B;  3QKJ A;  2LT4 A;  4E7H A;  2JZ2 A;  3LGF A;  2F5T X;  2IG0 A;  5LJ5 j;  3OYB A;  2VXF A;  2Y90 A;  3BDU A;  5CKE A;  4C92 A;  1U1T A;  5LJ3 j;  3JCM X;  5GMK h;  1YIT A;  2VXE A;  3M4Y A;  3SWN A;  2V8K A;  3OYK A;  4RCB A;  5J39 A;  1NE8 A;  4XU1 A;  2VUB A;  4NOY A;  5IAY A;  1GXI E;  1Q86 U;  3HL8 A;  2LT1 A;  3FLG A;  5GAN 2;  4QQG A;  3P8H A;  1WJR A;  3JAM E;  5LJ5 f;  4GY5 A;  4O5V A;  3M57 A;  2DTH A;  3HRU A;  3MCA B;  3ZFJ A;  2ZGW A;  4F7U B;  4NL3 A;  3F70 A;  2RHU A;  5GMK j;  3DB4 A;  3M53 A;  3FEO A;  5HKC A;  4ELY C;  3CCU A;  1N8R C;  2LNV A;  3CC7 T;  2LX9 A;  4Y28 E;  3RIR A;  3OYL A;  3VV0 A;  2QQB A;  4KT0 E;  1OYX A;  2KDS A;  2LVM A;  2V8I A;  3VUB A;  1X75 C;  3GOX A;  1QVF A;  3JB9 D;  2QQR A;  2R5M A;  1N8R U;  4MDX A;  3EFR A;  3OBW A;  2ZPI B;  4IUP A;  3LLR A;  3RKY A;  1NJI C;  1VQP A;  4M78 D;  1XNI A;  2L3R A;  3GLX A;  2R57 A;  2FHD A;  2P0Q A;  2OTJ T;  1NPR A;  1B34 B;  3ZBD A;  4GLK A;  3BW1 A;  3HPW A;  4CRI A;  3OSS C;  3RMS A;  5M9O A;  5FLX E;  4J6W A;  5GAM e;  1NJI U;  1G5V A;  3QJ6 A;  2DIG A;  2OTL A;  4M78 A;  3GP8 A;  3KXT A;  1JRI A;  2E65 A;  3X24 B;  3HSB A;  2X4W A;  1P92 A;  2HAX A;  3RMQ A;  5FRN A;  1VQ4 T;  3CCV T;  1QVP A;  2HBP A;  4C92 B;  1G3S A;  3MP6 A;  2XDP A;  3C95 A;  3SWN B;  2MMP A;  3LW5 E;  3M5A A;  2RI2 A;  3V7S A;  4M7D D;  1FX7 A;  4C0D B;  3FRN A;  3SDZ A;  5CK9 A;  2DZC A;  4M7D C;  3UDC A;  3CCS T;  2CKK A;  3JCM b;  2HNI A;  1VQ8 T;  2DAQ A;  2L5Q A;  3FB9 A;  3CCQ T;  3JCM c;  4PLL A;  3OBY A;  1WGS A;  5GAO m;  1BI0 A;  2E6N A;  3L1A A;  3S3O A;  4M77 A;  4OB1 B;  2CZ6 B;  2XG8 D;  4J6Y A;  2LDM A;  3L2Q A;  3OYN A;  2CZ0 B;  2NLU A;  5L8R E;  4RCC A;  5KCH A;  2XDB A;  4OGC A;  5GAO r;  4HKE A;  1VQK A;  1VQN A;  1VQ6 T;  3NFC A;  2R5A A;  4MZT A;  3FIF A;  3CC4 A;  4PJO A;  5LJ3 e;  3E1S A;  3Q1J A;  3V8J A;  2KMT A;  3JB9 H;  2D6F A;  4PJO E;  3JB9 F;  3PNW C;  3ASK A;  3S6W A;  5GAN d;  5GMK l;  4R55 A;  4JLI A;  2VC8 A;  4N4G A;  2K3Y A;  3CXC S;  4M78 B;  3UPU A;  3G4S T;  3GIB A;  3UWN A;  3JCM J;  2E70 A;  3WXM B;  4C0Z A;  5GMK e;  3CME T;  1KQ1 A;  5A0L A;  2K2V A;  3JB9 I;  2OAU A;  3JCM h;  1X6O A;  5IN1 A;  1QP3 A;  2LQ8 A;  3QXE B;  1Y96 A;  4TVR A;  4BB7 A;  2QA4 A;  4M75 A;  1YCY A;  4JUV A;  4JRQ A;  4J5Y A;  3HHT B;  5GAN 7;  4JS5 A;  1YHQ A;  1VQ7 T;  3RER A;  3CBP A;  1YI2 A;  4M75 E;  3TRE A;  4IUT A;  1BIB A;  5I2M A;  1UEB A;  2D9T A;  2EYQ A;  1H64 1;  2FVU A;  2Y4X A;  2YRV A;  5CO7 A;  4M7D F;  1K8A C;  4V2S A;  2JUF A;  4RG2 A;  3CD6 A;  3M55 A;  4PNO A;  3FJP A;  5LJ5 d;  4A4H A;  4M77 B;  4QVD A;  3LWH A;  1JJ2 S;  3JCM g;  2QI2 A;  3QDR B;  3QII A;  3BY7 A;  1BI3 A;  3OS0 A;  4QVZ A;  4JRP A;  4BI3 A;  3DLM A;  1M9S A;  2QTX A;  1S72 T;  1K8A U;  2EQK A;  4VUB A;  4EMK A;  4RG8 A;  3LYI A;  2EQJ A;  2L89 A;  3JCM f;  2K4Y A;  5DLO A;  3C94 A;  3PMT A;  3L2U A;  1M1K C;  4C8Q A;  3OYC A;  2L8D A;  3G6E T;  2K5I A;  3A5Z B;  3P8D A;  5D6W A;  4C8Q E;  1VQ5 A;  4KUI A;  2E10 A;  4BI4 A;  2KVQ G;  2RJE A;  5GAM g;  2ZPB B;  3CCJ T;  4J83 A;  4C92 C;  3OYG A;  1M1K U;  5D6Y A;  3V7R A;  2C06 A;  3X25 B;  3SWN C;  4QQD A;  5FU6 B;  2KK4 A;  3M4G A;  1YJN T;  4M7A A;  4IUU A;  4C0D C;  3LH0 A;  4BI8 B;  1Q86 C;  3KUF A;  3M54 A;  3OMG A;  4QVC A;  4M7A E;  4BY6 B;  1V29 B;  5CIU A;  5GMK i;  4LDX A;  2DTO A;  3OMC A;  2LCL A;  2GF7 A;  3MEA A;  3OSV A;  4A54 A;  2DJZ A;  3TEE A;  4FT4 A;  3SFM A;  4LD6 A;  1MHN A;  4MMK A;  1YIT T;  4JRK A;  4YTL A;  4N4H A;  4C5E A;  2GFA A;  4F7U F;  1QVG S;  1U8R A;  2K57 A;  1VQL A;  5HK3 A;  3GF5 A;  2PUO B;  4UC4 A;  4XTU A;  5CAI A;  4E7I A;  1LNX A;  2MWP A;  5D6X A;  1JBM A;  1W2B S;  2X4X A;  3JCM P;  2QQS A;  1KHI A;  1YIJ A;  3A8G B;  3QYH B;  1Y71 A;  3CCU T;  2K5L A;  4EMK B;  1YJW A;  2A7Y A;  3M59 A;  4ZTF A;  3H8Z A;  2QXF A;  2X35 A;  4HA8 A;  3OYD A;  5GAO q;  4ZGE B;  1VQM A;  4FM4 B;  4C8Q B;  2RHX A;  4J7F A;  4BUG A;  3PGG A;  1KQS S;  4M78 C;  1G3T A;  3PT9 A;  4OGE A;  4A4F A;  2DKG A;  3OW2 A;  2JOY A;  3OYE A;  1VQP T;  2ZCF B;  4XU3 A;  5DY9 A;  4PLI A;  4DOW A;  2XID A;  4IUV A;  3QZ5 B;  1VIE A;  3OB9 A;  3JCM Q;  3HFN A;  2HQE A;  1MGQ A;  2DO3 A;  4X9D A;  4M7A B;  4C92 F;  3PIP A;  2BKD N;  4XK8 E;  2OTL T;  4HT8 A;  3CCM A;  5GAN e;  4KUD K;  3G71 A;  3INZ A;  4FU6 A;  4XU2 A;  3CPW S;  4XAX B;  2ZPG B;  4A4G A;  3VUZ A;  4X34 A;  4JS4 A;  3HRS A;  5J26 A;  4BE0 A;  2K3X A;  5KH6 A;  4M77 D;  2KAF A;  2GQV A;  4M77 C;  2G3R A;  1IRE B;  4P5N A;  2M0O A;  2DXU A;  2E41 A;  4MZM A;  3JB9 G;  1WJS A;  4E7L A;  5GAN 4;  2B8A A;  2RHI A;  1VQ9 A;  2EKO A;  4M78 G;  2PVG B;  1WJQ A;  4D6W A;  3CMA A;  3DKM A;  5CQY A;  3JRZ A;  5AYF A;  1M1F A;  1G3W A;  3NTI A;  4C5I A;  2VYT A;  3RKW A;  2DIQ A;  2PQW A;  3MEV A;  4PJO D;  3OY9 A;  1BYM A;  4PJO C;  3OYY A;  2DXB A;  5I21 A;  2M9U A;  1UGQ B;  2JN0 A;  2JNG A;  2I2L A;  2LTO A;  2VV5 A;  2KSS A;  4QQ6 A;  3LX7 A;  5GAO n;  3R6O A;  3CCL A;  5LJ5 e;  2P0P A;  5GAN 3;  4A53 A;  5GAO l;  1VQK T;  1KC8 C;  4Z02 A;  3CC2 A;  3JCM d;  3DLL A;  3ME9 A;  1VQN T;  1XTD A;  5FU6 C;  2QDY B;  3MEU A;  2CZ1 B;  3G7Z A;  4ZN1 A;  5CR2 A;  4R56 A;  2GCX A;  3CC4 T;  2BUD A;  4M7D G;  2MF2 A;  4M78 F;  5GAN 6;  3V8K A;  4BY6 C;  2DTI A;  4L59 A;  1U1S A;  1KC8 U;  4DQ2 A;  4M75 D;  3J80 E;  1WPY A;  2XKO C;  3JCM W;  3JSC A;  1D3B A;  4XTZ A;  5LL6 S;  1VQO A;  1M90 C;  4M7D E;  3SB2 A;  4RMO A;  1Y07 A;  2RI5 A;  4JLG A;  2XK0 A;  4JRI A;  1M4Z A;  3HFO A;  3MET A;  5HY6 A;  1OZ2 A;  2GFU A;  4MDW A;  1QW1 A;  3CCE A;  5C6S A;  3WVD B;  2F5K A;  1M90 U;  2MAM A;  2DVE A;  4OMF B;  2QEX A;  3QHS A;  2DD4 A;  4C0G A;  4ME7 A;  4C5G A;  2QA4 T;  4JJN K;  1Q82 C;  1YHQ T;  4A4K A;  3HRT A;  3GNG A;  3QPH A;  1RI0 A;  3V7C A;  4B9W A;  1YI2 T;  4LDU A;  4CI0 C;  4M77 F;  2VGM A;  4ZN3 A;  1BIA A;  2RK2 A;  4EMK C;  5GAN 8;  3LGL A;  5IT9 E;  3CPF A;  2WSF E;  4ELZ C;  5GAM h;  3CD6 T;  3VYH B;  4BE2 A;  4C8Q D;  1Q82 U;  1LOJ A;  4C5H A;  4C8Q C;  2RHY A;  3OYM A;  3E19 A;  1I5L A;  2JTM A;  3DB3 A;  3LWI A;  4X9C A;  3JCM V;  4PJO F;  1R8O B;  2DPP B;  3J7A F;  1FXX A;  2JTF A;  3CXC A;  2WAC A;  4PJO B;  1IZ6 A;  5CCA A;  4Q5W A;  1G3Y A;  5CKB A;  2LRQ A;  5GAM j;  2DEQ A;  1KG1 A;  4F7U G;  4KBM B;  4JDS A;  4M7A D;  4HCB A;  4M7A C;  5A0G A;  3QG1 A;  3OS1 A;  2RA2 A;  3CEY A;  3OYI A;  1LJO A;  3CCR A;  1VQ5 T;  1N27 A;  2AHJ B;  2DXC A;  2EFI A;  4EPC A;  1BKB A;  3MEW A;  4N0A A;  1D3B B;  1VUB A;  2RJC A;  3S3M A;  5GAN g;  5GAM f;  4ATO A;  2CZ7 B;  3I55 A;  4E47 A;  3L2Z A;  3VU3 C;  3I56 A;  1I4K 1;  4M75 F;  1YJ9 A;  1Y96 B;  4BD3 A;  5CKF A;  3QJY A;  4M75 B;  1XQH A;  1ZBX A;  3J81 E;  1HK9 A;  2F69 A;  4HCZ A;  3C12 A;  2XDD A;  2M1H A;  3MO8 A;  2KY9 A;  3BDL A;  4XU0 A;  3C4S A;  4LD9 K;  3QO3 A;  3QZ9 B;  1TH7 A;  1W4S A;  2M16 A;  2O4X A;  2DXT A;  1O9S A;  3L2R A;  1SSF A;  1QVF S;  4C0F A;  1KHC A;  3L42 A;  3QSU A;  2XI9 A;  3HP9 A;  4L5G A;  4ZGD B;  3QUI A;  1VQL T;  4OB3 B;  3VJP A;  2CYZ B;  3OQ5 A;  3L2W A;  4C92 G;  3H6Z A;  2RM4 A;  3OW2 S;  1I81 A;  2KQW A;  1PSF A;  3VYG A;  2P4T A;  3URG A;  2XHC A;  1H3Z A;  5LJ5 g;  2DD5 A;  1YIJ T;  4C92 E;  4C8Q F;  5LJ3 g;  3TCJ A;  1YJW T;  3FDR A;  4WF2 A;  3E9G A;  3OA6 A;  3HKS A;  2P0K A;  1VQM T;  2V8J A;  1BI1 A;  5GAO p;  4KUL A;  2EQM A;  5LJ3 f;  3CC7 A;  2IVW A;  1UGP B;  2ZPH B;  4FT2 A;  4IUQ A;  2D0Q B;  4A4E A;  4M7A F;  1N9R A;  2XU8 A;  3PTA A;  3JCM e;  2PVO B;  4FL6 A;  4OP0 A;  4LDV A;  2RB6 A;  1QVG A;  3X28 B;  3OYH A;  1Y7X A;  3T9N A;  2OTJ A;  2YLB A;  3FC3 A;  2EIF A;  2WSC E;  3CCM T;  1W2B A;  3G71 T;  1YBY A;  2X4J A;  3OS2 A;  2RO0 A;  4BDY A;  4DA4 A;  1FWZ A;  3JB9 J;  1AHJ B;  2O4X B;  5FRM A;  3OYA A;  3A8H B;  2ZPF B;  5FU7 B;  3QYG B;  3UT1 A;  3NTH A;  1M8V A;  2YHT A;  2H3J A;  3AHU A;  4BDZ A;  2RD1 A;  4QW2 A;  5KCO A;  2EJG A;  3CCV A;  1VQ4 A;  1VQ9 T;  3KBG A;  1Q81 C;  2EAY A;  1OZ3 A;  1KQS A;  3CMA T;  2E1H A;  4M78 E;  2FYK A;  3MP1 A;  2FL7 A;  3A8L B;  2BIV A;  3QBY A;  2RHZ A;  3RES A;  2YLC A;  5J3B A;  1ZQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...