4C92E

Crystal structure of the yeast lsm1-7 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
84
structure length
84
Chain Sequence
PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92E00
2E41A 4F7UA 4M7AG 3JB9G 3JCMd 1U1SA 2EJFA 2QTXA 2E64A 5LJ3f 3JB9J 2DTIA 2RM4A 3BDUA 1M5Q1 5GMKe 2DEQA 5LJ5g 5GAOn 1I5LA 3V8JA 4EMHA 3EFSA 3JCMg 1H641 4PJOG 4HA8A 4EMKA 4NOYA 3L2ZA 4XU3A 2ZGWA 4C8QD 5GMKj 2RB6A 3BFMA 4JLIA 4PJOD 5GAMe 5GAN2 3GIBA 4M77G 4M78G 5LJ3h 4M7DF 4M75G 4F7UE 4NL3A 4J5YA 3QSUA 1I81A 2FB7A 3JCMf 1KQ2A 4A54A 2JN0A 3RKWA 4C92G 1LNXA 3AHUA 2E10A 1LJOA 4XTXA 4A53A 4JRIA 1I8FA 3M4GA 4EMKC 5LJ3g 2E1HA 1MGQA 5LJ5j 1KQ1A 2I2LA 4J6XA 3RKXA 1B34B 1B34A 4EMGA 2EWNA 4F7UB 3JCMh 3JB9F 4M7AF 1Y96A 2DJZA 5GAOm 4M7AA 4X9CA 5GAN3 3BY7A 1WQ7A 4C8QG 4DQ2A 3FB9A 5LJ3e 3V7SA 4EMKB 5GAOp 4X9DA 3JCMJ 4M77F 4M78F 2DTOA 3QO3A 4OP0A 5LJ3j 4M75F 5CAIA 3JCMc 5GMKi 1YCYA 4HT8A 1M8VA 4M7AC 4M78A 2EJGA 3SWNA 4C92F 5LJ5e 1WNLA 1HK9A 2HNIA 1D3BA 4M7AE 4M7DB 5GANd 4M7DA 4Y91A 4XQ3A 4C92A 1HXDA 3JCMe 1TH7A 3RESA 1I4K1 5GANg 4NL2A 5GAOl 2YLCA 2YLBA 3HFOA 3HFNA 3VU3C 3FJPA 1Y96B 4M78C 2DZ9A 4M77C 3SWNC 3JCMW 4M7AB 4RCBA 4XTZA 4M77E 2VC8A 4M78E 5GAMf 4M7DC 4C8QF 4C92C 1JRIA 3FIFA 5GANf 4PJOF 3RERA 3V7CA 4M7DE 1LOJA 4C92E 2VXFA 2EJ9A 3SB2A 4C8QA 2DTHA 3HSBA 1U1TA 4JUVA 4MMKA 4N0AA 5GAN5 4PJOA 4XTUA 5GAN4 3JCMV 3JCMP 5GMKl 1N9SA 5GAMh 2CGHA 4M7DD 4M77B 2E65A 4M77A 4M78B 3SWNB 3V7RA 5GAMd 5GANh 4M75B 4HT9A 4M75A 4V2SA 1D3BB 5GMKm 4XTWA 2RD1A 3JB9I 3QUIA 4PJOB 4C92B 3BW1A 4F7UG 2EAYA 1WQWA 4C8QC 5GAMg 2Y90A 4N0AC 4PJOC 3QHSA 4C8QE 5GAN8 3RUXA 2VXEA 4PJOE 5I21A 4M7AD 3JB9D 3EFRA 4QVCA 4MMLA 3V8KA 4QVDA 3JCMX 3JB9H 2YHTA 2DXUA 4M75C 5GAN7 3PGGA 1WPYA 1BIAA 2FYKA 3INZA 4M75E 1BIBA 2DKGA 2DZCA 5GMKh 4PNOA 3RIRA 1N9RA 3L1AA 2DVEA 4XTYA 4XU1A 4XTVA 3RKYA 4C8QB 5LJ5f 5GAOq 5GANe 1X01A 4J6YA 4WF2A 1JBMA 5LJ3d 5GAN6 4M7DG 2DXTA 2RA2A 4M77D 4M78D 4XU0A 3JCMQ 5GAMj 4RCCA 5GAOr 5DY9A 4M75D 4JRKA 3JCMb 4XU2A 5GANj 4C92D 2K57A 3V8LA 4J6WA 4F7UF 5LJ5h 5LJ5d
chains in the Genus database with same CATH superfamily
4F7UA 2WSCE 1C6VX 1UFFA 3MO8A 1VQ5T 4OMOA 1M2OA 4HCZA 1N5ZA 4C0ZA 1MV3A 4XAXB 3M56A 1UEBA 1SHGA 1K76A 4C0GA 2VWFA 3QWXX 2JXBA 4RTYA 1I81A 4HKEA 4OMLA 4JJNK 2F2XA 2O31A 2J6OA 4KUIA 1U5SA 2GFAA 1GL5A 1BI1A 5FRMA 2EYWA 1K8AC 1B34A 4E7ZA 3C0CA 4A4EA 3OW2P 2O4XB 2EPDA 2IPOB 1T3LA 4FM4B 2EKHA 1KC8U 3GPLA 2MI6A 2M0OA 5LJ5e 1WNLA 1JO8A 4IUVA 5J3BA 1HYOA 2FRYA 2OAUA 3META 4Y91A 2K4YA 3UA6A 4M7DA 3ZL7C 2CZ0B 1OI1A 1Y0MA 3MEVA 3FJPA 1C1AA 1GCQA 3HPWA 3KXTA 3CCLA 1WZOA 4AMCA 4IIOA 3FIFA 4IUPA 2HZYA 4C5IA 4C0FA 1VQOA 2ECZA 5CKDA 1X2QA 3JCMV 3T9NA 2DE0X 1K0XA 4CC2A 2CT3A 5GANh 2FZKB 1KK7A 3CCQQ 4F7UG 3QYHB 4JZ3A 2LTOA 1QVGP 1RLPC 3QG1A 4IKFA 1K4US 2NYSA 4QVZA 5LL6S 4II1A 5KYUA 3CCRQ 1R0BG 1GCPA 3TCJA 3ULRB 2J06A 1ZSGA 2KRSA 1OYXA 3VS0A 1OV3A 3QXEB 1VQNA 4JLGA 3R6OA 2X4WA 4GLKA 5KE2A 3QKJA 4UC4A 3UATA 2X4YA 2QTXA 1YNZA 2GCXA 5LJ5g 1WFWA 2HCKA 1RABB 3GLXA 1KD1R 4VUBA 2RH2A 1OQKA 2YRVA 4PFPA 5J39A 4N4HA 1VQ4A 3QSUA 3M57A 2L89A 1ZSZA 1SHFA 2RI5A 2AK5A 3GP8A 2QASA 3RKXA 1HD3A 4C5HA 2HBPA 2LCLA 2RQTA 5D6WA 3CMEQ 1T3SA 1NLOC 4DBRA 3ER0A 2DTOA 1ZA1B 1K9MR 1ARKA 1YCYA 2QEXT 1VQ6T 4M7AC 2QK0A 2HEQA 2XHCA 3CCSQ 1MMNA 1AT1B 3MEWA 2YLBA 3CBOA 5AYFA 3OYAA 2YWWA 2KXCA 2O88A 1AVZC 3CCJA 4L5GA 2YSQA 1Z9ZA 3A98A 1AWJA 3I55T 1UDLA 4QT7A 3G71A 4M77A 1IGQA 3PMIA 1G2BA 3BE3A 2DL8A 2X4XA 4ELYC 2F1LA 2YUOA 1E7OA 2KYBA 1QCOA 1UGQB 3CD6Q 4BUGA 1YJNQ 4E7JA 3EGUA 4ELZC 3JCMX 4M75C 2M16A 2DKGA 3RIRA 4OB0B 2A28A 2DVEA 5GAOq 4DBHA 1YITQ 1IB8A 2NUPB 1V76A 1D1BA 1M3CA 3JCMb 3L2WA 5EC7A 2K3XA 4C92D 1RAEB 2JTEA 5LJ5h 4R56A 1YJ9A 4OMQA 2LX9A 8ATCB 1M5Q1 2CH4W 2DL5A 1I5LA 4JS5A 3UA7A 3M0PA 3MP1A 3L2ZA 1UECA 3M0RA 1UUEA 5L23A 5HY6A 1VQ7Q 4NL3A 3PFSA 1VQ8Q 1KQ2A 3RKWA 2WSFE 3EFOB 1GBQA 1K8AU 4OMPA 2LMJA 4ME7A 1I0CA 3H0FA 4C0DB 1GRIA 4DEYA 2XIDA 4EMKB 4FSXA 3I56T 1YJWQ 2QDYB 4FYWB 3JCMc 4C5GA 1PM3A 4C92F 2YUPA 4RMOA 4BI8B 5DLQE 3TVTA 3RESA 5KCOA 2LT4A 3HFOA 2DVJA 4KH1B 1YFNA 5GANf 4C92E 1MNDA 1TOVA 2QA4Q 3X24B 4M7DD 4M78B 5GAMd 1WHLA 3JB9I 3M0QA 2OTJQ 4KUDK 4ANJA 2L3RA 4N0AC 3P8DA 2VXEA 2YUNA 3RDVA 3VS7A 3ME9A 2KMTA 3THKA 2R58A 2XDDA 1UE9A 1WJSA 1BKBA 5KYXB 1M4ZA 3UDCA 2LNHB 4GBQA 3EAEA 1UGRB 1G3TA 2GF7A 1OZ2A 3H8ZA 1VYUA 2ABLA 2EQUA 3MKDA 2E70A 1TUGB 2DTIA 2KRMA 3M5AA 3S3OA 2RI3A 2M0YA 4PJJA 4WTOB 3E9GA 2KQWA 4E7SA 5GMKj 3BFMA 1KJWA 4M7DF 4J5YA 2HD0A 3DB4A 4J9EA 1NEGA 4A54A 3AHUA 1X6BA 1QVFS 1PSEA 3D7SB 2RJEA 3VRYA 1GFCA 1VOMA 1O75A 4J9DA 5LJ3g 2F5TX 1KSWA 1D1AA 3PIPA 1DJ7B 2AHJB 2L3QA 4J7IA 2OI3A 1PG5B 1N27A 4C5EA 4M7AA 4X9CA 3CXCA 1KQSA 1WQ7A 2DL4A 1B3QA 5CO7A 1BBZA 3CCQT 3OSVA 3NMZC 1VQMA 4A4GA 1T0JA 4DBFA 1RADB 5GMKi 3G4SA 2J6KA 3VS4A 1ZHIA 4BE1A 3CCRT 3REAB 2ROTA 3MHXA 4ZTJA 1PD0A 2CT4A 2P84A 3EH1A 1X2KA 3I9QA 1M2VB 4FIBA 4XK8E 3EG9A 3M54A 1AWXA 1NG2A 2RK2A 4QQDA 4LDVA 3WVDB 4M75A 2EYXA 4XTWA 3X25B 1X69A 2K3BA 3SD4A 1M30A 4DA4A 1U8RA 1Q82U 1K73C 1ZQ1A 4BI3A 3RBBB 5LJ5f 1LCKA 5FROA 1ABQA 1NBEB 4M77D 1MMAA 3O8VA 5GANj 2HSEB 1OU8A 1YIJQ 2CKKA 1B7TA 3LGFA 2DEUA 3CMET 3MPUB 4M7AG 2NUTA 4B9XA 3HRTA 1MUZA 1VQ5A 2YXYA 4AG1C 4C8QD 3CCST 2QGFB 1RUWA 3P8HA 1UHCA 5GAMe 4PJOD 2HKNA 5LJ3h 1SPKA 2FL7A 5IAYA 1NPRA 2D9TA 4RTTA 1MGQA 4RTUA 3OW2S 1AHJB 1Y07A 2ENMA 2XMFA 3VRZA 2ZCFB 2DBMA 1N8RC 4AFSC 3SHWA 1K0SA 4OB3B 4M77F 1VQKQ 3QDRB 5CAIA 2A08A 2YUQA 3CD6T 2HNIA 1YJNT 3OY9A 4XQ3A 1VQLA 1QVFP 2PU9B 1K1ZA 1MMGA 3PE0A 5A0DA 2LCCA 3OYMA 2JMAA 1CKAA 1OULA 2COZA 4KGVB 4M77E 1OX8A 2KAFA 4C8QF 3UT1A 4PJOF 2XU8A 1AZEA 5I2MA 1QLYA 1OZ3A 4N0AA 1VQOQ 1U3OA 2H3EB 2EGEA 3CC4Q 3QDFA 3VUBA 2PQWA 2EQMA 2A0FB 4HCBA 1QVGA 3G7ZA 5GAMg 4BI4A 1BB9A 4C8QE 3M0TA 4PJOE 2JJ9A 4RTVA 1SSFA 1VQ7T 2YHTA 1S72T 1VQ8T 3EG3A 3INZA 2DIQA 2JS0A 4PNOA 4F16A 4J6YA 1WXTA 2OTLT 5M9OA 4DOVA 1WX6A 2KYMA 3EHQA 4A4FA 2V8IA 2OX7A 4ZGDB 1VQNQ 2E41A 2Y4YA 2K3YA 2X3XD 3JCMd 3QJ6A 1WA7A 2G6FX 2O4XA 3O5ZA 3QJYA 2CZ6B 2QQBA 2CREA 4AFUC 2QXFA 4LDXA 3VJPA 3E1SA 1HSQA 4LDUA 1LJOA 2WACA 5KYYA 4J9GA 4EMKC 5LJ5j 2A37A 2K79A 1M3AA 4R55A 5A0LA 2QA4T 2HQXA 4JS4A 1Q86C 4FL6A 5KYWB 3QO3A 2DJQA 2RN8A 2QEXA 1VQ6A 3OS5A 4KBMB 4JDSA 1YHQA 2K7AA 1WHGA 1NM7A 2B8AA 1OPLA 1D0YA 3VU3C 5D7UA 1Y96B 4M78C 2KT8A 3CCJQ 2EBPA 1LOJA 4KGZB 2EJ9A 4Z8AA 5CR2A 1M1GA 1KG1A 3NTKA 3HHTB 1YWOA 5GAMh 1PD1A 2BZXA 3V7RA 3CCUT 3G71Q 4C92B 2FHDA 2HL3A 1VQ9A 3OYEA 1WQWA 2COYA 1KFZA 5J26A 4M4ZA 2EQJA 1BCOA 3JB9D 4MMLA 5I2SA 2ZPIB 2CSQA 1AOJA 5GAN7 2FYKA 3GNGA 1K73R 1BYMA 2BZ8A 4QKUA 2QQRA 3OYBA 2R57A 5GAN6 4J9CA 1IO6A 3OMGA 4AG2C 4M75D 4LXCA 3VKIA 1NPPA 1SRMA 4TVRA 3RR6A 1WHMA 1YJ9Q 4E7HA 2DX1A 5LJ3f 3BDUA 5GAOn 3NFCA 2KROA 2EQIA 2RJCA 1H641 3C4SA 2DBKA 4DOWA 1XQHA 1WHKA 5IXFA 2JT4A 3OQ5A 2FG0A 2MOXA 2PNIA 1PNJA 3H0IA 3CPWS 1QP2A 1W6XA 3M4YA 4AT1B 2YRDA 2ATCB 1KQ1A 2X9HA 2C0TA 1B34B 2ED1A 1KD1U 2V8JA 3JB9F 3QWYA 2OAWA 1UGVA 2PVGB 1OU9A 3VUZA 3BDLA 1VYVA 5A2QE 2VGMA 1RAIB 2QQ9A 1N8RU 1O9SA 1G5VA 2YT6A 4PLLA 3VYGA 3ASKA 1QVPA 4M75F 2RI2A 3GBQA 3I56A 1N8RR 3KUFA 4M7DB 2DLPA 2Z0WA 3JCMe 3U23A 2K6DA 1JJ2S 2HL5C 3EGXA 3HKSA 2L8DA 2JUFA 1UHFA 2DZ9A 3CC7A 3CBMA 1ZLMA 3CQTA 1K9MU 2RK1A 2RMOA 1Q7YC 1BCMA 2GGRA 2QTVA 2RF0A 1FXXA 4JUVA 1YIJT 5GJVB 3CMAA 1CSKA 5GAN4 2HMAA 2O01E 4FT2A 3MP8A 3MCAB 2E65A 4PFOA 5GMKm 2RD1A 2R5AA 3BW1A 1R77A 1BI3A 3H6ZA 4O6JA 3OYFA 3NPFA 5GAN8 5IHIA 1LPLA 2XICA 5DLOA 4J7FA 4QVCA 3L2QA 2VYTA 5CKEA 3RKYA 2COWA 4XU1A 2E3HA 3OYDA 3M9QA 1M3BA 4MZMA 3EFOA 4ORZA 1WXBA 2AT1B 5KE3A 1M9SA 3AT1B 2I0NA 4Q5WA 3FLGA 4A63B 1PKSA 5DM7R 2J6FA 1VQKT 3EFSA 1JQQA 2AKKA 3JCMg 3OYKA 4EMKA 4NOYA 1WHJA 1IGUA 4CC7A 4LN2A 1GFDA 1QCNA 2MMPA 3FDRA 3VV0A 2RJFA 2XI9A 1H3ZA 3TEEA 4J6XA 3CCVT 1RL2A 5GAN3 2PUOB 2DM1A 3CC4T 4IIMA 4BE0A 2M51A 1Q86U 4X1VA 4CI0C 1VQPT 4OGEA 4OP0A 5LJ3j 3CCMQ 1QKWA 4LUEA 1VQMQ 1Q86R 4M78A 3CCQA 3H9NA 4F14A 4FCYA 1M1KC 1WJRA 6AT1B 1HXDA 3MEAA 2ZPFB 3CPWP 4BDYA 3TU4K 2CP0A 2IVWA 3J80E 1JEGA 1ABOA 3HFNA 4F17A 1NLPC 5GAMf 1WIEA 4LNPA 1JRIA 2SRCA 4DEXA 3RERA 3SB2A 2FEIA 1KHIA 3CBPA 1YI2A 2DF6A 2CUDA 3M0SA 5KYXA 1VQNT 1N9SA 4M77B 3SWNB 2MAMA 4JRQA 2H3JA 2QDLA 1V29B 4X34A 1WHHA 4LDYA 2MWPA 9ATCB 2GTJA 4AFZC 3OYIA 2DRMA 4JPBW 1JJ2P 3JB9H 1Z9QA 4OB2B 4PLIA 4E7LA 2L2PA 1X27A 4CC3A 2FPDA 4JJDA 4XTYA 4C8QB 1D1CA 4BE2A 4PJOB 3J7AF 5I11A 2BZYA 3JCMQ 4D6WA 5FU7B 2KSSA 3A1PA 2X35A 4HVVA 1XNIA 4F7UF 1LVKA 4MZPA 2DYIA 2W0ZA 4QQGA 4Y92A 5CCAA 3G6EQ 2KY9A 5EG2A 2LNVA 4PJOG 2OJ2A 3TQ7P 2FRWA 3CC2A 4B6MA 1VQ5Q 2V26A 2QQSA 4JLIA 1VIFA 2KI7A 5GAN2 1VA7A 4M78G 4F7UE 1IREB 3L2UA 3X26B 3CCSA 2JN0A 2EYYA 4ZN1A 1FYNA 1ACMB 2VVKA 2HBWA 4A53A 2LC4A 1QWFA 4OF1A 2XG8D 1WYXA 3HRUA 3FRNA 5GAOm 3BY7A 2QAZA 1UB4A 2D0QB 2JVVA 4PJNA 2IIMA 1M2VA 2DIGA 4X9DA 3SEMA 2CP7A 2YDLA 2O9SA 5FWCA 3MEUA 2XK0A 2PTKA 5GANd 2L3SA 1NE8A 1QVFA 1W1FA 1TUCA 3EG2A 3CD6A 4PL6A 2E5QA 1NYFA 3CCEQ 3GF5A 1VQLQ 1PKTA 2QGGA 2AIRB 1X6OA 3NTIA 2ZPEB 3JCMW 4XTZA 1PSFA 3M59A 4C92C 2CYZB 2F69A 2GQIA 2KXDA 4A4HA 4ATOA 4M7DE 1VIEA 1RLQC 1W70A 1U1TA 5GAN5 2A3LA 2X51A 1Q7YR 5GMKl 3H41A 3NHNA 1T0HA 4J9HA 1X6GA 3CXCS 1KQSS 2E6NA 3RUXA 5CKBA 2G3RA 4AFQC 3EFRA 2EGCA 4RTWA 3V8KA 1E6GA 2DXBA 8AT1B 3L1AA 5FU6B 1S72A 1Q81C 3A8OB 4RG8A 1G3YA 5GAMj 5DY9A 4HVWA 4MDWA 2OTLA 5L8RE 2KGTA 2M02A 3E2UA 3A8GB 3EGDB 5CQYA 4ZGEB 3MJXA 3UWNA 3E9FA 2DEQA 5GMKe 1M90R 4FU6A 4FYVB 1PC0A 1IHWA 2VV5A 1KC8C 2ZPHB 2F5KA 3GOXA 2LQ8A 5IT9E 1JB0E 5CK9A 4EMGA 2EWNA 2K5IA 2DJZA 3QZ9B 4KGXB 3M55A 4FYXB 2VUBA 2GQVA 2VASA 3FJ5A 2QA4A 2MYSA 2DAQA 2KDSA 1SRLA 1GCQC 2EJGA 1M1KU 3QYGB 1FMWA 1AD5A 2RO0A 1VQ6Q 4Z89A 4CC4B 1M1KR 3OW2A 1YHQQ 1OPKA 1FWZA 3EH2A 1RAHB 2BIVA 4LDWA 2L0AA 1Y57A 3VS3A 1TXQA 1XTDA 2RHZA 2LQKA 1YP5A 4BD3A 1QWEA 5ECAA 2J05A 4M75B 2B86A 2PVDB 4HVUA 2EYZA 5C6SA 3QUIA 1MNEA 4P5NA 2D8JA 3CCUA 2Y90A 1VQ9Q 1GXIE 1J3TA 3CPFA 3OYCA 1E6HA 2NLUA 3LH0A 3ZBDA 4QVDA 1WXUA 1YITT 2DXUA 3OYNA 1QCFA 3CCLQ 4OVAA 2YRCA 2L3PA 4XTVA 1RACB 5GANe 2A36A 2P4RA 1VUBA 3OS2A 1NEBA 2D1XA 3LLRA 2QQAA 4PFZA 1TG0A 5CKHA 5IHKA 1BI2A 2EIFA 3JB9J 1FX7A 3CXCP 1KQSP 3CCMT 1VQMT 4BY6B 3HL8A 3QIIA 1W2BS 2AZSA 5KYWA 4HXJA 3GIBA 2ZZDA 3QBYA 2FB7A 1HJDA 5D6YA 4ZTFA 1BK2A 1I8FA 2CUBA 2BTTA 4OMNA 2I2LA 3A5ZB 5GJWB 3RNJA 2CDTA 5CKFA 1Y96A 4QW2A 1OOTA 4OMMA 1YJWT 4PKCC 2ROLA 3VS1A 3DLMA 2JNGA 4FT4A 3JCMJ 3P8BB 1B07A 4E7KA 2W10A 1UG1A 3OS0A 2JTMA 2ZPBB 4HT8A 3PTAA 5CIUA 4L6V5 1VQ4Q 4C0DC 3I56Q 2H8HA 4C92A 1TWBA 5HK3A 2K9GA 5AT1B 3TREA 5GANg 1FMKA 2FPFA 4M77C 3SWNC 2DILA 3NGPA 1JU5C 3CC7Q 2E4HA 2FPEA 3S3NA 1M8MA 2GNCA 5IH2A 1EX4A 1BU1A 5KYNA 1NYGA 2A7YA 4MMKA 3JCMP 2OTJT 2XD0A 3CMAQ 3G6ET 2LQWA 2FZCB 1D3BB 2RQUA 2D8HA 1SSHA 4C8QC 4BACA 4PJOC 2C0IA 2HAXA 4M7AD 5FU7C 3LGLA 1Q81U 1IZ6A 2V1RA 1I5OB 2DXTA 1MV0B 3F70A 4L59A 4RCCA 3FEOA 3HRSA 2LQNA 2DNUA 3I55A 1Q81R 3OA6A 1SF9A 2BKDN 3Q1JA 2HDAA 4ZN3A 2QG9B 1K73U 2PVOB 2CP6A 4D8DA 1AWOA 2V1QA 1VQKA 4HCKA 4PJLA 1KIKA 3C94A 1H92A 3OYGA 4IUQA 3C95A 2HQEA 3RMSA 3CCET 4C92G 1VQLT 2E10A 2KVQG 4JJBA 1M1FA 3JV3A 5KYYB 1KC8R 1ZUUA 4JRIA 2KT1A 1X43A 4JJCA 1A0NB 1ZUKA 4M7AF 5D6XA 4F7UB 2DRKA 2EFIA 3ZEHA 3PNWC 3CCVA 1WDXA 2CSIA 3DLLA 2ZAEA 2C0OA 3CC4A 3HTRA 1W2BP 1M8VA 1VQPA 1RI9A 4F04B 3J81E 4M7AE 3OB9A 2RJDA 2L5QA 4EPCA 3CPWA 1YCSB 3LH5A 1M27C 2KRNA 4MDXA 3UPUA 2YLCA 1ZBXA 5FWBA 2MWOA 1U06A 4GLMA 4MZTA 1WI7A 1I1JA 2XKOC 2HSPA 2LJ1A 3DKMA 2CP2A 1YI2Q 2RNAA 2CGHA 3I35A 2DFUA 4LE9A 3LWHA 1PCXA 1UJYA 3QPHA 2LCSA 5FU6C 3A8HB 3FC3A 1UGSB 1JJ2A 2DO3A 2KBTA 3SDZA 5I21A 3PT9A 2E3IA 1OEBA 1MHNA 4KH0B 4BB7A 4M75E 1KHCA 4WCIA 2RHIA 2QYZA 1JBMA 5LJ3d 4M7DG 2DD4A 2JOYA 4XU0A 2NUPA 2JMCA 3C12A 2RHUA 2E6ZA 1R0CB 2KEAA 1H8KA 4KULA 1QMCA 3LW5E 2EJFA 3H0HA 2E64A 2K5LA 4QQ6A 5KYUB 2LDMA 3CC2Q 3I5RA 2ZPGB 5HK0A 1AZGB 2E5KA 3S3MA 1G83A 1YHQT 1N6AA 3EHRA 2FZGB 1WLPB 1M90C 2RQWA 4EDUA 4E2FB 4ZGJB 2K2MA 2DL3A 3FB9A 4ZNXA 4RKUE 4ESRA 5GAOp 4GY5A 2PZ1A 3CEYA 2NUZA 1F1BB 3SWNA 1VQ9T 1AEYA 2JW4A 1ZSZB 1C0MA 4R0KA 3JSCA 2AZVA 2LX7A 4NL2A 1Q82C 3L2VA 4RTXA 3CCLT 3EGXB 1D0XA 1P92A 3G1JA 1PWTA 5FW9A 2F2VA 1VQOT 2KR3A 2GBQA 2K2VA 4C8QA 3S6WA 2DTHA 3OYJA 4JRPA 4PJOA 2K5FA 2VGNA 2AKLA 4PK4A 2XDBA 2JM8A 4KRTA 2EGAA 3G4SQ 3R6NA 4RTZA 2MIOA 3SFMA 2RHXA 2XDPA 3CCRA 1RAAB 1QKXA 3PVLA 2DK3A 1BIBA 1ZX6A 2P0PA 4PJMA 3LYIA 1NJIC 3RMQA 1S72Q 5HCKA 3OSSC 5I22A 4BY6C 2K57A 3PVQA 3V8LA 3L42A 2OTLQ 2CZ1B 1QW1A 2FVUA 2JZ2A 1U1SA 3PIOA 1S1NA 4RG2A 1K8AR 2HQHA 5A0GA 1XOVA 1VQ4T 3VYHB 4M77G 4LUDA 4N4IA 1IHVA 1TS9A 1Y7XA 5FRNA 2MF2A 2E1HA 2PUKB 4FSSA 3CC7T 2BE9B 3JCMh 4LD9K 2SEMA 1EZZB 1TU0B 2ED0A 2EW3A 4IUUA 1MMDA 3CMEA 2KNBB 4C8QG 4DQ2A 4E47A 3CMAT 5LJ3e 1W4SA 1RAFB 1UTIA 2CH4A 3NTHA 3KFVA 4N4GA 3REBB 1TH7A 2MK5A 4J83A 1G3WA 3OMCA 2D0NA 1TSFA 3TSWA 3CCJT 3WVEB 4RCBA 2D6FA 3E19A 2CZ7B 2IG0A 4E7IA 2VXFA 2CS7A 3G71T 4XTUA 3IQLA 2M9UA 2JTFA 4V2SA 3URGA 1WJQA 3JAME 1D0ZA 1R8OB 1AWWA 1YJNA 3MP6A 1EFNA 3QHSA 2JM9A 4IURA 5HKCA 3CCUQ 3EGDA 1Q7YU 1WPYA 2NWMA 1CKBA 1YITA 4WF2A 2LP5A 4E6RA 4B9WA 4HCCA 3OYHA 4J9FA 4RUGA 2ESWA 4XU2A 2CP3A 1YJ9T 4A4KA 4J6WA 2Y4XA 1RI0A 1YBYA 2RM4A 4BDZA 2WSEE 2JS2A 4XU3A 2ZGWA 1IRXA 4Z02A 4EIKA 2M1HA 2RB6A 3CCMA 1VQ7A 3OS1A 2DD5A 1VQ8A 2RPNA 1H3HA 4OMFB 3OYYA 1SG5A 5FLXE 5CQXA 2F2WA 2RHYA 1PHTA 4FW1A 1JXOA 1RAGB 4YTLA 1SKUB 1M90U 1OX9A 2X4JA 1YI2T 3N5BB 4OGCA 1YJWA 1Q95G 1TTHB 2DPPB 2EVRA 3GNFB 3X28B 1ZBJA 4IUTA 5IN1A 1YN8A 3TSZA 2GTOA 1G8XA 4M7AB 4J9IA 4M7DC 1Q82R 4D8KA 3V7CA 7AT1B 5C0MA 3M53A 3OYLA 1D09B 3OBWA 2MCNA 4HT9A 3EG0A 2OTJA 2DA9A 2P4TA 3G6EA 2EAYA 2QEXQ 5CVIA 2RQVA 5IXBA 1FMVA 3CC2T 1JXMA 2GFUA 2E12A 1I07A 1NJIU 2DZCA 4OB1B 2DL7A 1X75C 3EG9B 2KK4A 2RA2A 4M78D 3A8MB 1XJWB 1NJIR 4KT0E 3M58A 2LVMA 3ZFJA 3I55Q 2DMOA 5KCHA 5LJ5d 1KD1C 3KBGA 1IXDA 3JB9G 2QI2A 3QZ5B 3HP9A 3X20B 3V8JA 4EMHA 2X3WD 4HA8A 2EQKA 2C06A 2J7IA 4M75G 4J8OA 2DYBA 1YWPA 4FW2A 4LD6A 2VB6A 3JCMf 1LNXA 1PRMC 4JZ4A 1EIFA 4XTXA 2LT1A 3CCEA 3M4GA 2RQRA 2KE9A 2DETA 2NUTB 1ZUYA 1ZSZC 1UJ0A 4Y28E 1K9MC 3CCVQ 2EKOA 3M0UA 1PRLC 3V7SA 2BE7D 4J9BA 1W2BA 4M78F 1WGSA 3G4ST 4DBQA 5KH6A 1QVGS 2HKQB 3JRZA 3L2RA 1HK9A 1TUDA 2P0QA 1D3BA 1SEMA 2O9VA 3OBYA 2LJ3A 1VQPQ 4K11A 3VS6A 2EYQA 2O2OA 4CRIA 2LZ6B 1I4K1 2LRQA 5GAOl 3EG1A 4O5VA 4M78E 2DXCA 2VC8A 2LJ0A 3PMTA 1K9AA 1VYTA 2BUDA 3HSBA 3LWIA 1GBRA 1ZA2B 1G3SA 2DERA 2MPXC 4NS5A 2P0KA 1Y71A 5IHNA 3UF4A 3DB3A 4FYYB 2VKNA 1V1CA 2CP5A 3PGGA 3VS5A 1BIAA 5GMKh 1N9RA 3A8LB 2V8KA 1X01A 1BI0A 1NZ9A 5GAOr 1QQJA 3LX7A 4JRKA 3WXMB 3VS2A 3I5SA 2FO0A 1YIJA 2R5MA 4Z88A 1UGPB 1QP3A
chains in the Genus database with same CATH topology
4QQGA 5CCAA 4F7UA 3LW5E 4M7AG 2KY9A 2WSCE 2EJFA 4B9XA 5EG2A 2E64A 2K5LA 3MO8A 1VQ5T 2LNVA 3HRTA 4HCZA 4C0ZA 4XAXB 4QQ6A 4PJOG 3M56A 1VQ5A 1UEBA 2LDMA 4C8QD 3CC2A 4JLIA 2QQSA 4C0GA 3CCST 4PJOD 1VIFA 3P8HA 5GAMe 5GAN2 4M78G 5LJ3h 5HK0A 2ZPGB 4F7UE 1IREB 3L2UA 2FL7A 3S3MA 5IAYA 1I81A 3X26B 4HKEA 3CCSA 2JN0A 4JJNK 4ZN1A 4KUIA 1YHQT 4A53A 2GFAA 1N6AA 1NPRA 2D9TA 2LC4A 1MGQA 1BI1A 5FRMA 1K8AC 4OF1A 3OW2S 1B34A 2XG8D 1M90C 1AHJB 1Y07A 4EDUA 3HRUA 3FRNA 4A4EA 4ZGJB 5GAOm 3BY7A 2O4XB 1UB4A 2D0QB 2JVVA 3FB9A 2ZCFB 4RKUE 5GAOp 1N8RC 4GY5A 2DIGA 4FM4B 4X9DA 3CEYA 1KC8U 4OB3B 4M77F 3GPLA 2MI6A 3QDRB 5CAIA 3SWNA 1VQ9T 3MEUA 2M0OA 5LJ5e 1WNLA 2HNIA 2XK0A 3CD6T 4IUVA 5J3BA 5GANd 3OY9A 2OAUA 1NE8A 3META 2K4YA 4XQ3A 4Y91A 1QVFA 4M7DA 3CD6A 3JSCA 2CZ0B 1VQLA 4PL6A 2E5QA 1OI1A 2PU9B 3GF5A 4NL2A 3MEVA 5A0DA 3L2VA 2LCCA 3OYMA 3CCLT 1Q82C 1X6OA 3NTIA 3FJPA 1P92A 2ZPEB 3JCMW 3HPWA 4XTZA 4M77E 1PSFA 2KAFA 3KXTA 3M59A 4C8QF 1VQOT 4C92C 3CCLA 2CYZB 2F69A 3UT1A 3FIFA 4IUPA 4A4HA 4PJOF 2XU8A 4C5IA 4ATOA 1VIEA 5I2MA 4M7DE 2K2VA 4C0FA 3S6WA 2DTHA 4C8QA 5CKDA 3OYJA 1U1TA 4JRPA 1VQOA 1OZ3A 4N0AA 5GAN5 4PJOA 2A3LA 3JCMV 3T9NA 2K5FA 5GMKl 2VGNA 3VUBA 2PQWA 2XDBA 2EQMA 5GANh 4HCBA 1QVGA 3G7ZA 4PJOB 1VQMT 4F7UG 3QYHB 2LTOA 5GAMg 4BI4A 3CXCS 4C8QE 3QG1A 1KQSS 4IKFA 2E6NA 3RUXA 5CKBA 2G3RA 3SFMA 4PJOE 4QVZA 2RHXA 3EFRA 5LL6S 2XDPA 3V8KA 3CCRA 1SSFA 1VQ7T 2YHTA 4II1A 1S72T 1VQ8T 2DK3A 2DXBA 3INZA 2DIQA 1BIBA 2P0PA 3LYIA 4PNOA 3TCJA 3L1AA 5FU6B 1S72A 1Q81C 1NJIC 3A8OB 3RMQA 4RG8A 4J6YA 1G3YA 2OTLT 5M9OA 3OSSC 1OYXA 5GAMj 4DOVA 5DY9A 3QXEB 4MDWA 4A4FA 2K57A 3V8LA 5L8RE 4BY6C 2OTLA 2V8IA 3L42A 4JLGA 4ZGDB 1VQNA 3R6OA 2X4WA 4GLKA 5KE2A 2E41A 2CZ1B 3QKJA 1QW1A 2Y4YA 2K3YA 2FVUA 4UC4A 2JZ2A 3JCMd 3QJ6A 1U1SA 2X4YA 2QTXA 3A8GB 5CQYA 2GCXA 4ZGEB 3PIOA 2O4XA 5LJ5g 3QJYA 3E9FA 2DEQA 4RG2A 3UWNA 2CZ6B 5GMKe 3GLXA 5A0GA 4FU6A 4VUBA 2QQBA 1XOVA 2RH2A 2YRVA 1VQ4T 2QXFA 3VYHB 2VV5A 1KC8C 4LDXA 4M77G 3VJPA 5J39A 2ZPHB 3E1SA 4N4HA 1VQ4A 4N4IA 3QSUA 1Y7XA 3M57A 2F5KA 4LDUA 5FRNA 2L89A 2MF2A 3GOXA 2LQ8A 1LJOA 5IT9E 2RI5A 2WACA 4EMKC 1JB0E 5LJ5j 2E1HA 3GP8A 5CK9A 2PUKB 3CC7T 3RKXA 4EMGA 2EWNA 2K5IA 3JCMh 4LD9K 4C5HA 2HBPA 2DJZA 2LCLA 4IUUA 3QZ9B 3CMEA 4R55A 5D6WA 3M55A 5A0LA 2QA4T 4C8QG 4DQ2A 4E47A 3CMAT 5LJ3e 2HQXA 2GQVA 2VUBA 4JS4A 4FL6A 1Q86C 1YJNT 2QA4A 1W4SA 2DAQA 2KDSA 3ER0A 2DTOA 3QO3A 1YCYA 2QEXT 1VQ6T 3NTHA 2EJGA 4N4GA 4M7AC 1M1KU 3QYGB 2QEXA 2XHCA 1VQ6A 3OS5A 1TH7A 2RO0A 4J83A 1G3WA 4KBMB 4JDSA 1YHQA 3OMCA 3CCJT 2B8AA 2YLBA 3CBOA 3MEWA 5AYFA 3VU3C 3OYAA 3OW2A 1Y96B 4M78C 3WVEB 4RCBA 1FWZA 3CCJA 2D6FA 4L5GA 3E19A 2CZ7B 2IG0A 2BIVA 4LDWA 1LOJA 4E7IA 2VXFA 2EJ9A 5CR2A 2CS7A 1M1GA 1KG1A 3I55T 1XTDA 3NTKA 3G71T 2RHZA 2LQKA 4XTUA 3HHTB 4BD3A 5GAMh 3G71A 4M77A 3V7RA 3PMIA 2M9UA 4M75B 2JTFA 2PVDB 3CCUT 4V2SA 5C6SA 3QUIA 3URGA 4C92B 2FHDA 2X4XA 4P5NA 4ELYC 1VQ9A 1WJQA 1WQWA 3JAME 3OYEA 3CCUA 1R8OB 2Y90A 1YJNA 1UGQB 3MP6A 3QHSA 4IURA 5HKCA 1GXIE 5J26A 4BUGA 2EQJA 3CPFA 3OYCA 4E7JA 3JB9D 2NLUA 3LH0A 4MMLA 2ZPIB 3ZBDA 4ELZC 4QVDA 5I2SA 3JCMX 1YITT 2DXUA 4M75C 5GAN7 1Q7YU 1WPYA 2M16A 2FYKA 3OYNA 3GNGA 1BYMA 2DKGA 3RIRA 4OB0B 4OVAA 1YITA 2DVEA 4XTVA 5GAOq 2QQRA 3OYBA 5GANe 4WF2A 2R57A 5GAN6 4B9WA 1VUBA 3OMGA 4HCCA 3OS2A 3OYHA 4M75D 3JCMb 3L2WA 4XU2A 3LLRA 2K3XA 4C92D 1YJ9T 2QQAA 4A4KA 4J6WA 5LJ5h 3VKIA 2Y4XA 4R56A 1NPPA 1YJ9A 4TVRA 5CKHA 2LX9A 4E7HA 1BI2A 1RI0A 1YBYA 2EIFA 5LJ3f 3JB9J 2RM4A 1FX7A 3BDUA 1M5Q1 5GAOn 4BDZA 1I5LA 3CCMT 4JS5A 3NFCA 2RJCA 2WSEE 1H641 3C4SA 3HL8A 3QIIA 3MP1A 4BY6B 3L2ZA 4XU3A 1W2BS 2ZGWA 4Z02A 2M1HA 2RB6A 3CCMA 4DOWA 1VQ7A 1XQHA 3OS1A 2DD5A 3GIBA 3OQ5A 1VQ8A 2ZZDA 5HY6A 4NL3A 4OMFB 3PFSA 3QBYA 2FB7A 1KQ2A 3OYYA 3RKWA 5FLXE 2WSFE 5CQXA 5D6YA 2RHYA 1QP2A 3CPWS 4ZTFA 3M4YA 1I8FA 4YTLA 1K8AU 1KQ1A 3OYDA 2I2LA 4ME7A 1M90U 1KD1U 1B34B 3A5ZB 2V8JA 3JB9F 5CKFA 2X4JA 1Y96A 2PVGB 4QW2A 3VUZA 3BDLA 5A2QE 1YJWT 2VGMA 4PKCC 4C0DB 2QQ9A 1YI2T 1N8RU 1O9SA 1G5VA 3N5BB 4OGCA 2XIDA 3DLMA 2JNGA 4FSXA 4EMKB 1YJWA 4FT4A 3JCMJ 2DPPB 3P8BB 4PLLA 3VYGA 3ASKA 3GNFB 2QDYB 3I56T 1QVPA 4E7KA 3OS0A 3X28B 4M75F 4C5GA 2JTMA 3JCMc 2RI2A 2ZPBB 4HT8A 4C92F 3I56A 3PTAA 3KUFA 4RMOA 4BI8B 5CIUA 4L6V5 4M7DB 4C0DC 5DLQE 4C92A 5HK3A 3JCMe 4IUTA 5IN1A 3RESA 1JJ2S 3TREA 5KCOA 5GANg 2LT4A 3HFOA 3HKSA 2L8DA 4M77C 2JUFA 2DZ9A 3SWNC 3CC7A 3CBMA 4M7AB 1K9MU 4M7DC 2RK1A 1Q7YC 3S3NA 5GANf 3V7CA 4C92E 5C0MA 3M53A 2A7YA 1FXXA 4JUVA 4MMKA 1YIJT 3CMAA 5GAN4 3OYLA 3JCMP 2O01E 4FT2A 2OTJT 3OBWA 3X24B 3MP8A 2XD0A 3MCAB 3G6ET 2E65A 4M78B 4M7DD 5GAMd 4HT9A 1D3BB 5GMKm 3JB9I 2RD1A 2OTJA 2R5AA 2P4TA 3BW1A 1BI3A 3G6EA 3H6ZA 4O6JA 2EAYA 4C8QC 3OYFA 4KUDK 2L3RA 4BACA 4N0AC 3P8DA 5CVIA 5GAN8 4PJOC 2VXEA 2HAXA 2XICA 4M7AD 5FU7C 5DLOA 3CC2T 4J7FA 4QVCA 3L2QA 2GFUA 3ME9A 2E12A 2KMTA 2VYTA 3LGLA 5CKEA 1NJIU 1Q81U 2DZCA 2R58A 4OB1B 1IZ6A 3RKYA 4XU1A 2XDDA 1X75C 1WJSA 2KK4A 1BKBA 2DXTA 2RA2A 3F70A 1M4ZA 4L59A 3A8MB 4M78D 3M9QA 4RCCA 3FEOA 4MZMA 3UDCA 3EAEA 3HRSA 1UGRB 1G3TA 2GF7A 3M58A 1OZ2A 4KT0E 3H8ZA 2BKDN 5KE3A 3Q1JA 2LVMA 3ZFJA 1M9SA 2EQUA 4ZN3A 5LJ5d 5KCHA 4Q5WA 3KBGA 3FLGA 1KD1C 3JB9G 2E70A 5DM7R 1K73U 2QI2A 2PVOB 3HP9A 3QZ5B 2DTIA 3M5AA 1VQKT 3S3OA 2RI3A 3X20B 3I55A 3V8JA 4EMHA 3EFSA 3OYKA 3JCMg 3OA6A 4HA8A 4EMKA 4NOYA 2EQKA 1VQKA 3E9GA 2C06A 2KQWA 5GMKj 3BFMA 3C94A 3OYGA 4IUQA 3C95A 2MMPA 4M7DF 4J8OA 4LD6A 2HQEA 4M75G 3FDRA 2HD0A 3DB4A 4J5YA 3RMSA 2RJFA 3JCMf 3VV0A 4A54A 4C92G 1VQLT 3CCET 1LNXA 1QVFS 2E10A 1PSEA 2KVQG 3AHUA 2XI9A 1EIFA 4XTXA 1M1FA 2RJEA 2LT1A 4JRIA 3M4GA 3CCEA 5LJ3g 1H3ZA 1O75A 2F5TX 3TEEA 4J6XA 3PIPA 1DJ7B 2AHJB 3CCVT 4J7IA 5D6XA 4F7UB 4M7AF 1N27A 2EFIA 4C5EA 3ZEHA 1RL2A 3PNWC 4X9CA 5GAN3 3CXCA 3CCVA 2PUOB 1KQSA 4M7AA 1WQ7A 4Y28E 3CC4T 1K9MC 1Q86U 4BE0A 2EKOA 3DLLA 3V7SA 5CO7A 4CI0C 3CC4A 1W2BA 3CCQT 3OSVA 4M78F 1WGSA 4OP0A 4OGEA 4A4GA 5LJ3j 1VQPT 3G4ST 1VQMA 5GMKi 5KH6A 1M8VA 4M78A 3CCQA 1QVGS 1VQPA 3JRZA 3L2RA 1HK9A 2P0QA 1D3BA 3OBYA 3J81E 3G4SA 1WJRA 1M1KC 3OB9A 4M7AE 1HXDA 1ZHIA 2L5QA 2RJDA 3MEAA 4EPCA 3CPWA 2EYQA 4CRIA 2ZPFB 4BDYA 1I4K1 4BE1A 3CCRT 2IVWA 3J80E 3UPUA 3TU4K 2LRQA 2YLCA 5GAOl 4MDXA 3HFNA 1ZBXA 3MHXA 2MWOA 4O5VA 2DXCA 2VC8A 4M78E 5GAMf 3PMTA 4ZTJA 4MZTA 2BUDA 1JRIA 3RERA 3HSBA 3SB2A 3LWIA 4FIBA 1KHIA 2XKOC 4XK8E 3CBPA 1YI2A 3DKMA 3M54A 1VQNT 1N9SA 2CGHA 3LWHA 4M77B 3SWNB 2RK2A 2MAMA 4QQDA 4LDVA 3WVDB 2H3JA 4M75A 4JRQA 1G3SA 4XTWA 3X25B 3QPHA 1V29B 5FU6C 4X34A 3SD4A 3A8HB 4NS5A 3FC3A 2P0KA 4DA4A 1U8RA 1UGSB 2MWPA 4LDYA 1Q82U 1JJ2A 1Y71A 2DO3A 1K73C 3OYIA 1ZQ1A 3SDZA 5I21A 3PT9A 3DB3A 3JB9H 4OB2B 4PLIA 1MHNA 4BI3A 4E7LA 3PGGA 4BB7A 1BIAA 4M75E 5GMKh 1N9RA 1KHCA 4XTYA 4C8QB 3A8LB 2V8KA 5LJ5f 4M7DG 2RHIA 4BE2A 1X01A 1BI0A 1NZ9A 1JBMA 5LJ3d 5FROA 2DD4A 3J7AF 2JOYA 4M77D 3LX7A 4XU0A 4D6WA 3JCMQ 5GAOr 5FU7B 4JRKA 3C12A 3WXMB 3O8VA 2KSSA 5GANj 2X35A 1YIJA 2R5MA 1UGPB 1XNIA 4F7UF 2RHUA 4MZPA 2E6ZA 2CKKA 3LGFA 1QP3A 3CMET 4KULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E41 A;  4F7U A;  4M7A G;  3JB9 G;  3JCM d;  1U1S A;  2EJF A;  2QTX A;  2E64 A;  5LJ3 f;  3JB9 J;  2DTI A;  2RM4 A;  3BDU A;  1M5Q 1;  5GMK e;  2DEQ A;  5LJ5 g;  5GAO n;  1I5L A;  3V8J A;  4EMH A;  3EFS A;  3JCM g;  1H64 1;  4PJO G;  4HA8 A;  4EMK A;  4NOY A;  3L2Z A;  4XU3 A;  2ZGW A;  4C8Q D;  5GMK j;  2RB6 A;  3BFM A;  4JLI A;  4PJO D;  5GAM e;  5GAN 2;  3GIB A;  4M77 G;  4M78 G;  5LJ3 h;  4M7D F;  4M75 G;  4F7U E;  4NL3 A;  4J5Y A;  3QSU A;  1I81 A;  2FB7 A;  3JCM f;  1KQ2 A;  4A54 A;  2JN0 A;  3RKW A;  4C92 G;  1LNX A;  3AHU A;  2E10 A;  1LJO A;  4XTX A;  4A53 A;  4JRI A;  1I8F A;  3M4G A;  4EMK C;  5LJ3 g;  2E1H A;  1MGQ A;  5LJ5 j;  1KQ1 A;  2I2L A;  4J6X A;  3RKX A;  1B34 B;  1B34 A;  4EMG A;  2EWN A;  4F7U B;  3JCM h;  3JB9 F;  4M7A F;  1Y96 A;  2DJZ A;  5GAO m;  4M7A A;  4X9C A;  5GAN 3;  3BY7 A;  1WQ7 A;  4C8Q G;  4DQ2 A;  3FB9 A;  5LJ3 e;  3V7S A;  4EMK B;  5GAO p;  4X9D A;  3JCM J;  4M77 F;  4M78 F;  2DTO A;  3QO3 A;  4OP0 A;  5LJ3 j;  4M75 F;  5CAI A;  3JCM c;  5GMK i;  1YCY A;  4HT8 A;  1M8V A;  4M7A C;  4M78 A;  2EJG A;  3SWN A;  4C92 F;  5LJ5 e;  1WNL A;  1HK9 A;  2HNI A;  1D3B A;  4M7A E;  4M7D B;  5GAN d;  4M7D A;  4Y91 A;  4XQ3 A;  4C92 A;  1HXD A;  3JCM e;  1TH7 A;  3RES A;  1I4K 1;  5GAN g;  4NL2 A;  5GAO l;  2YLC A;  2YLB A;  3HFO A;  3HFN A;  3VU3 C;  3FJP A;  1Y96 B;  4M78 C;  2DZ9 A;  4M77 C;  3SWN C;  3JCM W;  4M7A B;  4RCB A;  4XTZ A;  4M77 E;  2VC8 A;  4M78 E;  5GAM f;  4M7D C;  4C8Q F;  4C92 C;  1JRI A;  3FIF A;  5GAN f;  4PJO F;  3RER A;  3V7C A;  4M7D E;  1LOJ A;  4C92 E;  2VXF A;  2EJ9 A;  3SB2 A;  4C8Q A;  2DTH A;  3HSB A;  1U1T A;  4JUV A;  4MMK A;  4N0A A;  5GAN 5;  4PJO A;  4XTU A;  5GAN 4;  3JCM V;  3JCM P;  5GMK l;  1N9S A;  5GAM h;  2CGH A;  4M7D D;  4M77 B;  2E65 A;  4M77 A;  4M78 B;  3SWN B;  3V7R A;  5GAM d;  5GAN h;  4M75 B;  4HT9 A;  4M75 A;  4V2S A;  1D3B B;  5GMK m;  4XTW A;  2RD1 A;  3JB9 I;  3QUI A;  4PJO B;  4C92 B;  3BW1 A;  4F7U G;  2EAY A;  1WQW A;  4C8Q C;  5GAM g;  2Y90 A;  4N0A C;  4PJO C;  3QHS A;  4C8Q E;  5GAN 8;  3RUX A;  2VXE A;  4PJO E;  5I21 A;  4M7A D;  3JB9 D;  3EFR A;  4QVC A;  4MML A;  3V8K A;  4QVD A;  3JCM X;  3JB9 H;  2YHT A;  2DXU A;  4M75 C;  5GAN 7;  3PGG A;  1WPY A;  1BIA A;  2FYK A;  3INZ A;  4M75 E;  1BIB A;  2DKG A;  2DZC A;  5GMK h;  4PNO A;  3RIR A;  1N9R A;  3L1A A;  2DVE A;  4XTY A;  4XU1 A;  4XTV A;  3RKY A;  4C8Q B;  5LJ5 f;  5GAO q;  5GAN e;  1X01 A;  4J6Y A;  4WF2 A;  1JBM A;  5LJ3 d;  5GAN 6;  4M7D G;  2DXT A;  2RA2 A;  4M77 D;  4M78 D;  4XU0 A;  3JCM Q;  5GAM j;  4RCC A;  5GAO r;  5DY9 A;  4M75 D;  4JRK A;  3JCM b;  4XU2 A;  5GAN j;  4C92 D;  2K57 A;  3V8L A;  4J6W A;  4F7U F;  5LJ5 h;  5LJ5 d; 
#chains in the Genus database with same CATH topology
 4F7U A;  2WSC E;  1C6V X;  1UFF A;  3MO8 A;  1VQ5 T;  4OMO A;  1M2O A;  4HCZ A;  1N5Z A;  4C0Z A;  1MV3 A;  4XAX B;  3M56 A;  1UEB A;  1SHG A;  1K76 A;  4C0G A;  2VWF A;  3QWX X;  2JXB A;  4RTY A;  1I81 A;  4HKE A;  4OML A;  4JJN K;  2F2X A;  2O31 A;  2J6O A;  4KUI A;  1U5S A;  2GFA A;  1GL5 A;  1BI1 A;  5FRM A;  2EYW A;  1K8A C;  1B34 A;  4E7Z A;  3C0C A;  4A4E A;  3OW2 P;  2O4X B;  2EPD A;  2IPO B;  1T3L A;  4FM4 B;  2EKH A;  1KC8 U;  3GPL A;  2MI6 A;  2M0O A;  5LJ5 e;  1WNL A;  1JO8 A;  4IUV A;  5J3B A;  1HYO A;  2FRY A;  2OAU A;  3MET A;  4Y91 A;  2K4Y A;  3UA6 A;  4M7D A;  3ZL7 C;  2CZ0 B;  1OI1 A;  1Y0M A;  3MEV A;  3FJP A;  1C1A A;  1GCQ A;  3HPW A;  3KXT A;  3CCL A;  1WZO A;  4AMC A;  4IIO A;  3FIF A;  4IUP A;  2HZY A;  4C5I A;  4C0F A;  1VQO A;  2ECZ A;  5CKD A;  1X2Q A;  3JCM V;  3T9N A;  2DE0 X;  1K0X A;  4CC2 A;  2CT3 A;  5GAN h;  2FZK B;  1KK7 A;  3CCQ Q;  4F7U G;  3QYH B;  4JZ3 A;  2LTO A;  1QVG P;  1RLP C;  3QG1 A;  4IKF A;  1K4U S;  2NYS A;  4QVZ A;  5LL6 S;  4II1 A;  5KYU A;  3CCR Q;  1R0B G;  1GCP A;  3TCJ A;  3ULR B;  2J06 A;  1ZSG A;  2KRS A;  1OYX A;  3VS0 A;  1OV3 A;  3QXE B;  1VQN A;  4JLG A;  3R6O A;  2X4W A;  4GLK A;  5KE2 A;  3QKJ A;  4UC4 A;  3UAT A;  2X4Y A;  2QTX A;  1YNZ A;  2GCX A;  5LJ5 g;  1WFW A;  2HCK A;  1RAB B;  3GLX A;  1KD1 R;  4VUB A;  2RH2 A;  1OQK A;  2YRV A;  4PFP A;  5J39 A;  4N4H A;  1VQ4 A;  3QSU A;  3M57 A;  2L89 A;  1ZSZ A;  1SHF A;  2RI5 A;  2AK5 A;  3GP8 A;  2QAS A;  3RKX A;  1HD3 A;  4C5H A;  2HBP A;  2LCL A;  2RQT A;  5D6W A;  3CME Q;  1T3S A;  1NLO C;  4DBR A;  3ER0 A;  2DTO A;  1ZA1 B;  1K9M R;  1ARK A;  1YCY A;  2QEX T;  1VQ6 T;  4M7A C;  2QK0 A;  2HEQ A;  2XHC A;  3CCS Q;  1MMN A;  1AT1 B;  3MEW A;  2YLB A;  3CBO A;  5AYF A;  3OYA A;  2YWW A;  2KXC A;  2O88 A;  1AVZ C;  3CCJ A;  4L5G A;  2YSQ A;  1Z9Z A;  3A98 A;  1AWJ A;  3I55 T;  1UDL A;  4QT7 A;  3G71 A;  4M77 A;  1IGQ A;  3PMI A;  1G2B A;  3BE3 A;  2DL8 A;  2X4X A;  4ELY C;  2F1L A;  2YUO A;  1E7O A;  2KYB A;  1QCO A;  1UGQ B;  3CD6 Q;  4BUG A;  1YJN Q;  4E7J A;  3EGU A;  4ELZ C;  3JCM X;  4M75 C;  2M16 A;  2DKG A;  3RIR A;  4OB0 B;  2A28 A;  2DVE A;  5GAO q;  4DBH A;  1YIT Q;  1IB8 A;  2NUP B;  1V76 A;  1D1B A;  1M3C A;  3JCM b;  3L2W A;  5EC7 A;  2K3X A;  4C92 D;  1RAE B;  2JTE A;  5LJ5 h;  4R56 A;  1YJ9 A;  4OMQ A;  2LX9 A;  8ATC B;  1M5Q 1;  2CH4 W;  2DL5 A;  1I5L A;  4JS5 A;  3UA7 A;  3M0P A;  3MP1 A;  3L2Z A;  1UEC A;  3M0R A;  1UUE A;  5L23 A;  5HY6 A;  1VQ7 Q;  4NL3 A;  3PFS A;  1VQ8 Q;  1KQ2 A;  3RKW A;  2WSF E;  3EFO B;  1GBQ A;  1K8A U;  4OMP A;  2LMJ A;  4ME7 A;  1I0C A;  3H0F A;  4C0D B;  1GRI A;  4DEY A;  2XID A;  4EMK B;  4FSX A;  3I56 T;  1YJW Q;  2QDY B;  4FYW B;  3JCM c;  4C5G A;  1PM3 A;  4C92 F;  2YUP A;  4RMO A;  4BI8 B;  5DLQ E;  3TVT A;  3RES A;  5KCO A;  2LT4 A;  3HFO A;  2DVJ A;  4KH1 B;  1YFN A;  5GAN f;  4C92 E;  1MND A;  1TOV A;  2QA4 Q;  3X24 B;  4M7D D;  4M78 B;  5GAM d;  1WHL A;  3JB9 I;  3M0Q A;  2OTJ Q;  4KUD K;  4ANJ A;  2L3R A;  4N0A C;  3P8D A;  2VXE A;  2YUN A;  3RDV A;  3VS7 A;  3ME9 A;  2KMT A;  3THK A;  2R58 A;  2XDD A;  1UE9 A;  1WJS A;  1BKB A;  5KYX B;  1M4Z A;  3UDC A;  2LNH B;  4GBQ A;  3EAE A;  1UGR B;  1G3T A;  2GF7 A;  1OZ2 A;  3H8Z A;  1VYU A;  2ABL A;  2EQU A;  3MKD A;  2E70 A;  1TUG B;  2DTI A;  2KRM A;  3M5A A;  3S3O A;  2RI3 A;  2M0Y A;  4PJJ A;  4WTO B;  3E9G A;  2KQW A;  4E7S A;  5GMK j;  3BFM A;  1KJW A;  4M7D F;  4J5Y A;  2HD0 A;  3DB4 A;  4J9E A;  1NEG A;  4A54 A;  3AHU A;  1X6B A;  1QVF S;  1PSE A;  3D7S B;  2RJE A;  3VRY A;  1GFC A;  1VOM A;  1O75 A;  4J9D A;  5LJ3 g;  2F5T X;  1KSW A;  1D1A A;  3PIP A;  1DJ7 B;  2AHJ B;  2L3Q A;  4J7I A;  2OI3 A;  1PG5 B;  1N27 A;  4C5E A;  4M7A A;  4X9C A;  3CXC A;  1KQS A;  1WQ7 A;  2DL4 A;  1B3Q A;  5CO7 A;  1BBZ A;  3CCQ T;  3OSV A;  3NMZ C;  1VQM A;  4A4G A;  1T0J A;  4DBF A;  1RAD B;  5GMK i;  3G4S A;  2J6K A;  3VS4 A;  1ZHI A;  4BE1 A;  3CCR T;  3REA B;  2ROT A;  3MHX A;  4ZTJ A;  1PD0 A;  2CT4 A;  2P84 A;  3EH1 A;  1X2K A;  3I9Q A;  1M2V B;  4FIB A;  4XK8 E;  3EG9 A;  3M54 A;  1AWX A;  1NG2 A;  2RK2 A;  4QQD A;  4LDV A;  3WVD B;  4M75 A;  2EYX A;  4XTW A;  3X25 B;  1X69 A;  2K3B A;  3SD4 A;  1M30 A;  4DA4 A;  1U8R A;  1Q82 U;  1K73 C;  1ZQ1 A;  4BI3 A;  3RBB B;  5LJ5 f;  1LCK A;  5FRO A;  1ABQ A;  1NBE B;  4M77 D;  1MMA A;  3O8V A;  5GAN j;  2HSE B;  1OU8 A;  1YIJ Q;  2CKK A;  1B7T A;  3LGF A;  2DEU A;  3CME T;  3MPU B;  4M7A G;  2NUT A;  4B9X A;  3HRT A;  1MUZ A;  1VQ5 A;  2YXY A;  4AG1 C;  4C8Q D;  3CCS T;  2QGF B;  1RUW A;  3P8H A;  1UHC A;  5GAM e;  4PJO D;  2HKN A;  5LJ3 h;  1SPK A;  2FL7 A;  5IAY A;  1NPR A;  2D9T A;  4RTT A;  1MGQ A;  4RTU A;  3OW2 S;  1AHJ B;  1Y07 A;  2ENM A;  2XMF A;  3VRZ A;  2ZCF B;  2DBM A;  1N8R C;  4AFS C;  3SHW A;  1K0S A;  4OB3 B;  4M77 F;  1VQK Q;  3QDR B;  5CAI A;  2A08 A;  2YUQ A;  3CD6 T;  2HNI A;  1YJN T;  3OY9 A;  4XQ3 A;  1VQL A;  1QVF P;  2PU9 B;  1K1Z A;  1MMG A;  3PE0 A;  5A0D A;  2LCC A;  3OYM A;  2JMA A;  1CKA A;  1OUL A;  2COZ A;  4KGV B;  4M77 E;  1OX8 A;  2KAF A;  4C8Q F;  3UT1 A;  4PJO F;  2XU8 A;  1AZE A;  5I2M A;  1QLY A;  1OZ3 A;  4N0A A;  1VQO Q;  1U3O A;  2H3E B;  2EGE A;  3CC4 Q;  3QDF A;  3VUB A;  2PQW A;  2EQM A;  2A0F B;  4HCB A;  1QVG A;  3G7Z A;  5GAM g;  4BI4 A;  1BB9 A;  4C8Q E;  3M0T A;  4PJO E;  2JJ9 A;  4RTV A;  1SSF A;  1VQ7 T;  2YHT A;  1S72 T;  1VQ8 T;  3EG3 A;  3INZ A;  2DIQ A;  2JS0 A;  4PNO A;  4F16 A;  4J6Y A;  1WXT A;  2OTL T;  5M9O A;  4DOV A;  1WX6 A;  2KYM A;  3EHQ A;  4A4F A;  2V8I A;  2OX7 A;  4ZGD B;  1VQN Q;  2E41 A;  2Y4Y A;  2K3Y A;  2X3X D;  3JCM d;  3QJ6 A;  1WA7 A;  2G6F X;  2O4X A;  3O5Z A;  3QJY A;  2CZ6 B;  2QQB A;  2CRE A;  4AFU C;  2QXF A;  4LDX A;  3VJP A;  3E1S A;  1HSQ A;  4LDU A;  1LJO A;  2WAC A;  5KYY A;  4J9G A;  4EMK C;  5LJ5 j;  2A37 A;  2K79 A;  1M3A A;  4R55 A;  5A0L A;  2QA4 T;  2HQX A;  4JS4 A;  1Q86 C;  4FL6 A;  5KYW B;  3QO3 A;  2DJQ A;  2RN8 A;  2QEX A;  1VQ6 A;  3OS5 A;  4KBM B;  4JDS A;  1YHQ A;  2K7A A;  1WHG A;  1NM7 A;  2B8A A;  1OPL A;  1D0Y A;  3VU3 C;  5D7U A;  1Y96 B;  4M78 C;  2KT8 A;  3CCJ Q;  2EBP A;  1LOJ A;  4KGZ B;  2EJ9 A;  4Z8A A;  5CR2 A;  1M1G A;  1KG1 A;  3NTK A;  3HHT B;  1YWO A;  5GAM h;  1PD1 A;  2BZX A;  3V7R A;  3CCU T;  3G71 Q;  4C92 B;  2FHD A;  2HL3 A;  1VQ9 A;  3OYE A;  1WQW A;  2COY A;  1KFZ A;  5J26 A;  4M4Z A;  2EQJ A;  1BCO A;  3JB9 D;  4MML A;  5I2S A;  2ZPI B;  2CSQ A;  1AOJ A;  5GAN 7;  2FYK A;  3GNG A;  1K73 R;  1BYM A;  2BZ8 A;  4QKU A;  2QQR A;  3OYB A;  2R57 A;  5GAN 6;  4J9C A;  1IO6 A;  3OMG A;  4AG2 C;  4M75 D;  4LXC A;  3VKI A;  1NPP A;  1SRM A;  4TVR A;  3RR6 A;  1WHM A;  1YJ9 Q;  4E7H A;  2DX1 A;  5LJ3 f;  3BDU A;  5GAO n;  3NFC A;  2KRO A;  2EQI A;  2RJC A;  1H64 1;  3C4S A;  2DBK A;  4DOW A;  1XQH A;  1WHK A;  5IXF A;  2JT4 A;  3OQ5 A;  2FG0 A;  2MOX A;  2PNI A;  1PNJ A;  3H0I A;  3CPW S;  1QP2 A;  1W6X A;  3M4Y A;  4AT1 B;  2YRD A;  2ATC B;  1KQ1 A;  2X9H A;  2C0T A;  1B34 B;  2ED1 A;  1KD1 U;  2V8J A;  3JB9 F;  3QWY A;  2OAW A;  1UGV A;  2PVG B;  1OU9 A;  3VUZ A;  3BDL A;  1VYV A;  5A2Q E;  2VGM A;  1RAI B;  2QQ9 A;  1N8R U;  1O9S A;  1G5V A;  2YT6 A;  4PLL A;  3VYG A;  3ASK A;  1QVP A;  4M75 F;  2RI2 A;  3GBQ A;  3I56 A;  1N8R R;  3KUF A;  4M7D B;  2DLP A;  2Z0W A;  3JCM e;  3U23 A;  2K6D A;  1JJ2 S;  2HL5 C;  3EGX A;  3HKS A;  2L8D A;  2JUF A;  1UHF A;  2DZ9 A;  3CC7 A;  3CBM A;  1ZLM A;  3CQT A;  1K9M U;  2RK1 A;  2RMO A;  1Q7Y C;  1BCM A;  2GGR A;  2QTV A;  2RF0 A;  1FXX A;  4JUV A;  1YIJ T;  5GJV B;  3CMA A;  1CSK A;  5GAN 4;  2HMA A;  2O01 E;  4FT2 A;  3MP8 A;  3MCA B;  2E65 A;  4PFO A;  5GMK m;  2RD1 A;  2R5A A;  3BW1 A;  1R77 A;  1BI3 A;  3H6Z A;  4O6J A;  3OYF A;  3NPF A;  5GAN 8;  5IHI A;  1LPL A;  2XIC A;  5DLO A;  4J7F A;  4QVC A;  3L2Q A;  2VYT A;  5CKE A;  3RKY A;  2COW A;  4XU1 A;  2E3H A;  3OYD A;  3M9Q A;  1M3B A;  4MZM A;  3EFO A;  4ORZ A;  1WXB A;  2AT1 B;  5KE3 A;  1M9S A;  3AT1 B;  2I0N A;  4Q5W A;  3FLG A;  4A63 B;  1PKS A;  5DM7 R;  2J6F A;  1VQK T;  3EFS A;  1JQQ A;  2AKK A;  3JCM g;  3OYK A;  4EMK A;  4NOY A;  1WHJ A;  1IGU A;  4CC7 A;  4LN2 A;  1GFD A;  1QCN A;  2MMP A;  3FDR A;  3VV0 A;  2RJF A;  2XI9 A;  1H3Z A;  3TEE A;  4J6X A;  3CCV T;  1RL2 A;  5GAN 3;  2PUO B;  2DM1 A;  3CC4 T;  4IIM A;  4BE0 A;  2M51 A;  1Q86 U;  4X1V A;  4CI0 C;  1VQP T;  4OGE A;  4OP0 A;  5LJ3 j;  3CCM Q;  1QKW A;  4LUE A;  1VQM Q;  1Q86 R;  4M78 A;  3CCQ A;  3H9N A;  4F14 A;  4FCY A;  1M1K C;  1WJR A;  6AT1 B;  1HXD A;  3MEA A;  2ZPF B;  3CPW P;  4BDY A;  3TU4 K;  2CP0 A;  2IVW A;  3J80 E;  1JEG A;  1ABO A;  3HFN A;  4F17 A;  1NLP C;  5GAM f;  1WIE A;  4LNP A;  1JRI A;  2SRC A;  4DEX A;  3RER A;  3SB2 A;  2FEI A;  1KHI A;  3CBP A;  1YI2 A;  2DF6 A;  2CUD A;  3M0S A;  5KYX A;  1VQN T;  1N9S A;  4M77 B;  3SWN B;  2MAM A;  4JRQ A;  2H3J A;  2QDL A;  1V29 B;  4X34 A;  1WHH A;  4LDY A;  2MWP A;  9ATC B;  2GTJ A;  4AFZ C;  3OYI A;  2DRM A;  4JPB W;  1JJ2 P;  3JB9 H;  1Z9Q A;  4OB2 B;  4PLI A;  4E7L A;  2L2P A;  1X27 A;  4CC3 A;  2FPD A;  4JJD A;  4XTY A;  4C8Q B;  1D1C A;  4BE2 A;  4PJO B;  3J7A F;  5I11 A;  2BZY A;  3JCM Q;  4D6W A;  5FU7 B;  2KSS A;  3A1P A;  2X35 A;  4HVV A;  1XNI A;  4F7U F;  1LVK A;  4MZP A;  2DYI A;  2W0Z A;  4QQG A;  4Y92 A;  5CCA A;  3G6E Q;  2KY9 A;  5EG2 A;  2LNV A;  4PJO G;  2OJ2 A;  3TQ7 P;  2FRW A;  3CC2 A;  4B6M A;  1VQ5 Q;  2V26 A;  2QQS A;  4JLI A;  1VIF A;  2KI7 A;  5GAN 2;  1VA7 A;  4M78 G;  4F7U E;  1IRE B;  3L2U A;  3X26 B;  3CCS A;  2JN0 A;  2EYY A;  4ZN1 A;  1FYN A;  1ACM B;  2VVK A;  2HBW A;  4A53 A;  2LC4 A;  1QWF A;  4OF1 A;  2XG8 D;  1WYX A;  3HRU A;  3FRN A;  5GAO m;  3BY7 A;  2QAZ A;  1UB4 A;  2D0Q B;  2JVV A;  4PJN A;  2IIM A;  1M2V A;  2DIG A;  4X9D A;  3SEM A;  2CP7 A;  2YDL A;  2O9S A;  5FWC A;  3MEU A;  2XK0 A;  2PTK A;  5GAN d;  2L3S A;  1NE8 A;  1QVF A;  1W1F A;  1TUC A;  3EG2 A;  3CD6 A;  4PL6 A;  2E5Q A;  1NYF A;  3CCE Q;  3GF5 A;  1VQL Q;  1PKT A;  2QGG A;  2AIR B;  1X6O A;  3NTI A;  2ZPE B;  3JCM W;  4XTZ A;  1PSF A;  3M59 A;  4C92 C;  2CYZ B;  2F69 A;  2GQI A;  2KXD A;  4A4H A;  4ATO A;  4M7D E;  1VIE A;  1RLQ C;  1W70 A;  1U1T A;  5GAN 5;  2A3L A;  2X51 A;  1Q7Y R;  5GMK l;  3H41 A;  3NHN A;  1T0H A;  4J9H A;  1X6G A;  3CXC S;  1KQS S;  2E6N A;  3RUX A;  5CKB A;  2G3R A;  4AFQ C;  3EFR A;  2EGC A;  4RTW A;  3V8K A;  1E6G A;  2DXB A;  8AT1 B;  3L1A A;  5FU6 B;  1S72 A;  1Q81 C;  3A8O B;  4RG8 A;  1G3Y A;  5GAM j;  5DY9 A;  4HVW A;  4MDW A;  2OTL A;  5L8R E;  2KGT A;  2M02 A;  3E2U A;  3A8G B;  3EGD B;  5CQY A;  4ZGE B;  3MJX A;  3UWN A;  3E9F A;  2DEQ A;  5GMK e;  1M90 R;  4FU6 A;  4FYV B;  1PC0 A;  1IHW A;  2VV5 A;  1KC8 C;  2ZPH B;  2F5K A;  3GOX A;  2LQ8 A;  5IT9 E;  1JB0 E;  5CK9 A;  4EMG A;  2EWN A;  2K5I A;  2DJZ A;  3QZ9 B;  4KGX B;  3M55 A;  4FYX B;  2VUB A;  2GQV A;  2VAS A;  3FJ5 A;  2QA4 A;  2MYS A;  2DAQ A;  2KDS A;  1SRL A;  1GCQ C;  2EJG A;  1M1K U;  3QYG B;  1FMW A;  1AD5 A;  2RO0 A;  1VQ6 Q;  4Z89 A;  4CC4 B;  1M1K R;  3OW2 A;  1YHQ Q;  1OPK A;  1FWZ A;  3EH2 A;  1RAH B;  2BIV A;  4LDW A;  2L0A A;  1Y57 A;  3VS3 A;  1TXQ A;  1XTD A;  2RHZ A;  2LQK A;  1YP5 A;  4BD3 A;  1QWE A;  5ECA A;  2J05 A;  4M75 B;  2B86 A;  2PVD B;  4HVU A;  2EYZ A;  5C6S A;  3QUI A;  1MNE A;  4P5N A;  2D8J A;  3CCU A;  2Y90 A;  1VQ9 Q;  1GXI E;  1J3T A;  3CPF A;  3OYC A;  1E6H A;  2NLU A;  3LH0 A;  3ZBD A;  4QVD A;  1WXU A;  1YIT T;  2DXU A;  3OYN A;  1QCF A;  3CCL Q;  4OVA A;  2YRC A;  2L3P A;  4XTV A;  1RAC B;  5GAN e;  2A36 A;  2P4R A;  1VUB A;  3OS2 A;  1NEB A;  2D1X A;  3LLR A;  2QQA A;  4PFZ A;  1TG0 A;  5CKH A;  5IHK A;  1BI2 A;  2EIF A;  3JB9 J;  1FX7 A;  3CXC P;  1KQS P;  3CCM T;  1VQM T;  4BY6 B;  3HL8 A;  3QII A;  1W2B S;  2AZS A;  5KYW A;  4HXJ A;  3GIB A;  2ZZD A;  3QBY A;  2FB7 A;  1HJD A;  5D6Y A;  4ZTF A;  1BK2 A;  1I8F A;  2CUB A;  2BTT A;  4OMN A;  2I2L A;  3A5Z B;  5GJW B;  3RNJ A;  2CDT A;  5CKF A;  1Y96 A;  4QW2 A;  1OOT A;  4OMM A;  1YJW T;  4PKC C;  2ROL A;  3VS1 A;  3DLM A;  2JNG A;  4FT4 A;  3JCM J;  3P8B B;  1B07 A;  4E7K A;  2W10 A;  1UG1 A;  3OS0 A;  2JTM A;  2ZPB B;  4HT8 A;  3PTA A;  5CIU A;  4L6V 5;  1VQ4 Q;  4C0D C;  3I56 Q;  2H8H A;  4C92 A;  1TWB A;  5HK3 A;  2K9G A;  5AT1 B;  3TRE A;  5GAN g;  1FMK A;  2FPF A;  4M77 C;  3SWN C;  2DIL A;  3NGP A;  1JU5 C;  3CC7 Q;  2E4H A;  2FPE A;  3S3N A;  1M8M A;  2GNC A;  5IH2 A;  1EX4 A;  1BU1 A;  5KYN A;  1NYG A;  2A7Y A;  4MMK A;  3JCM P;  2OTJ T;  2XD0 A;  3CMA Q;  3G6E T;  2LQW A;  2FZC B;  1D3B B;  2RQU A;  2D8H A;  1SSH A;  4C8Q C;  4BAC A;  4PJO C;  2C0I A;  2HAX A;  4M7A D;  5FU7 C;  3LGL A;  1Q81 U;  1IZ6 A;  2V1R A;  1I5O B;  2DXT A;  1MV0 B;  3F70 A;  4L59 A;  4RCC A;  3FEO A;  3HRS A;  2LQN A;  2DNU A;  3I55 A;  1Q81 R;  3OA6 A;  1SF9 A;  2BKD N;  3Q1J A;  2HDA A;  4ZN3 A;  2QG9 B;  1K73 U;  2PVO B;  2CP6 A;  4D8D A;  1AWO A;  2V1Q A;  1VQK A;  4HCK A;  4PJL A;  1KIK A;  3C94 A;  1H92 A;  3OYG A;  4IUQ A;  3C95 A;  2HQE A;  3RMS A;  3CCE T;  4C92 G;  1VQL T;  2E10 A;  2KVQ G;  4JJB A;  1M1F A;  3JV3 A;  5KYY B;  1KC8 R;  1ZUU A;  4JRI A;  2KT1 A;  1X43 A;  4JJC A;  1A0N B;  1ZUK A;  4M7A F;  5D6X A;  4F7U B;  2DRK A;  2EFI A;  3ZEH A;  3PNW C;  3CCV A;  1WDX A;  2CSI A;  3DLL A;  2ZAE A;  2C0O A;  3CC4 A;  3HTR A;  1W2B P;  1M8V A;  1VQP A;  1RI9 A;  4F04 B;  3J81 E;  4M7A E;  3OB9 A;  2RJD A;  2L5Q A;  4EPC A;  3CPW A;  1YCS B;  3LH5 A;  1M27 C;  2KRN A;  4MDX A;  3UPU A;  2YLC A;  1ZBX A;  5FWB A;  2MWO A;  1U06 A;  4GLM A;  4MZT A;  1WI7 A;  1I1J A;  2XKO C;  2HSP A;  2LJ1 A;  3DKM A;  2CP2 A;  1YI2 Q;  2RNA A;  2CGH A;  3I35 A;  2DFU A;  4LE9 A;  3LWH A;  1PCX A;  1UJY A;  3QPH A;  2LCS A;  5FU6 C;  3A8H B;  3FC3 A;  1UGS B;  1JJ2 A;  2DO3 A;  2KBT A;  3SDZ A;  5I21 A;  3PT9 A;  2E3I A;  1OEB A;  1MHN A;  4KH0 B;  4BB7 A;  4M75 E;  1KHC A;  4WCI A;  2RHI A;  2QYZ A;  1JBM A;  5LJ3 d;  4M7D G;  2DD4 A;  2JOY A;  4XU0 A;  2NUP A;  2JMC A;  3C12 A;  2RHU A;  2E6Z A;  1R0C B;  2KEA A;  1H8K A;  4KUL A;  1QMC A;  3LW5 E;  2EJF A;  3H0H A;  2E64 A;  2K5L A;  4QQ6 A;  5KYU B;  2LDM A;  3CC2 Q;  3I5R A;  2ZPG B;  5HK0 A;  1AZG B;  2E5K A;  3S3M A;  1G83 A;  1YHQ T;  1N6A A;  3EHR A;  2FZG B;  1WLP B;  1M90 C;  2RQW A;  4EDU A;  4E2F B;  4ZGJ B;  2K2M A;  2DL3 A;  3FB9 A;  4ZNX A;  4RKU E;  4ESR A;  5GAO p;  4GY5 A;  2PZ1 A;  3CEY A;  2NUZ A;  1F1B B;  3SWN A;  1VQ9 T;  1AEY A;  2JW4 A;  1ZSZ B;  1C0M A;  4R0K A;  3JSC A;  2AZV A;  2LX7 A;  4NL2 A;  1Q82 C;  3L2V A;  4RTX A;  3CCL T;  3EGX B;  1D0X A;  1P92 A;  3G1J A;  1PWT A;  5FW9 A;  2F2V A;  1VQO T;  2KR3 A;  2GBQ A;  2K2V A;  4C8Q A;  3S6W A;  2DTH A;  3OYJ A;  4JRP A;  4PJO A;  2K5F A;  2VGN A;  2AKL A;  4PK4 A;  2XDB A;  2JM8 A;  4KRT A;  2EGA A;  3G4S Q;  3R6N A;  4RTZ A;  2MIO A;  3SFM A;  2RHX A;  2XDP A;  3CCR A;  1RAA B;  1QKX A;  3PVL A;  2DK3 A;  1BIB A;  1ZX6 A;  2P0P A;  4PJM A;  3LYI A;  1NJI C;  3RMQ A;  1S72 Q;  5HCK A;  3OSS C;  5I22 A;  4BY6 C;  2K57 A;  3PVQ A;  3V8L A;  3L42 A;  2OTL Q;  2CZ1 B;  1QW1 A;  2FVU A;  2JZ2 A;  1U1S A;  3PIO A;  1S1N A;  4RG2 A;  1K8A R;  2HQH A;  5A0G A;  1XOV A;  1VQ4 T;  3VYH B;  4M77 G;  4LUD A;  4N4I A;  1IHV A;  1TS9 A;  1Y7X A;  5FRN A;  2MF2 A;  2E1H A;  2PUK B;  4FSS A;  3CC7 T;  2BE9 B;  3JCM h;  4LD9 K;  2SEM A;  1EZZ B;  1TU0 B;  2ED0 A;  2EW3 A;  4IUU A;  1MMD A;  3CME A;  2KNB B;  4C8Q G;  4DQ2 A;  4E47 A;  3CMA T;  5LJ3 e;  1W4S A;  1RAF B;  1UTI A;  2CH4 A;  3NTH A;  3KFV A;  4N4G A;  3REB B;  1TH7 A;  2MK5 A;  4J83 A;  1G3W A;  3OMC A;  2D0N A;  1TSF A;  3TSW A;  3CCJ T;  3WVE B;  4RCB A;  2D6F A;  3E19 A;  2CZ7 B;  2IG0 A;  4E7I A;  2VXF A;  2CS7 A;  3G71 T;  4XTU A;  3IQL A;  2M9U A;  2JTF A;  4V2S A;  3URG A;  1WJQ A;  3JAM E;  1D0Z A;  1R8O B;  1AWW A;  1YJN A;  3MP6 A;  1EFN A;  3QHS A;  2JM9 A;  4IUR A;  5HKC A;  3CCU Q;  3EGD A;  1Q7Y U;  1WPY A;  2NWM A;  1CKB A;  1YIT A;  4WF2 A;  2LP5 A;  4E6R A;  4B9W A;  4HCC A;  3OYH A;  4J9F A;  4RUG A;  2ESW A;  4XU2 A;  2CP3 A;  1YJ9 T;  4A4K A;  4J6W A;  2Y4X A;  1RI0 A;  1YBY A;  2RM4 A;  4BDZ A;  2WSE E;  2JS2 A;  4XU3 A;  2ZGW A;  1IRX A;  4Z02 A;  4EIK A;  2M1H A;  2RB6 A;  3CCM A;  1VQ7 A;  3OS1 A;  2DD5 A;  1VQ8 A;  2RPN A;  1H3H A;  4OMF B;  3OYY A;  1SG5 A;  5FLX E;  5CQX A;  2F2W A;  2RHY A;  1PHT A;  4FW1 A;  1JXO A;  1RAG B;  4YTL A;  1SKU B;  1M90 U;  1OX9 A;  2X4J A;  1YI2 T;  3N5B B;  4OGC A;  1YJW A;  1Q95 G;  1TTH B;  2DPP B;  2EVR A;  3GNF B;  3X28 B;  1ZBJ A;  4IUT A;  5IN1 A;  1YN8 A;  3TSZ A;  2GTO A;  1G8X A;  4M7A B;  4J9I A;  4M7D C;  1Q82 R;  4D8K A;  3V7C A;  7AT1 B;  5C0M A;  3M53 A;  3OYL A;  1D09 B;  3OBW A;  2MCN A;  4HT9 A;  3EG0 A;  2OTJ A;  2DA9 A;  2P4T A;  3G6E A;  2EAY A;  2QEX Q;  5CVI A;  2RQV A;  5IXB A;  1FMV A;  3CC2 T;  1JXM A;  2GFU A;  2E12 A;  1I07 A;  1NJI U;  2DZC A;  4OB1 B;  2DL7 A;  1X75 C;  3EG9 B;  2KK4 A;  2RA2 A;  4M78 D;  3A8M B;  1XJW B;  1NJI R;  4KT0 E;  3M58 A;  2LVM A;  3ZFJ A;  3I55 Q;  2DMO A;  5KCH A;  5LJ5 d;  1KD1 C;  3KBG A;  1IXD A;  3JB9 G;  2QI2 A;  3QZ5 B;  3HP9 A;  3X20 B;  3V8J A;  4EMH A;  2X3W D;  4HA8 A;  2EQK A;  2C06 A;  2J7I A;  4M75 G;  4J8O A;  2DYB A;  1YWP A;  4FW2 A;  4LD6 A;  2VB6 A;  3JCM f;  1LNX A;  1PRM C;  4JZ4 A;  1EIF A;  4XTX A;  2LT1 A;  3CCE A;  3M4G A;  2RQR A;  2KE9 A;  2DET A;  2NUT B;  1ZUY A;  1ZSZ C;  1UJ0 A;  4Y28 E;  1K9M C;  3CCV Q;  2EKO A;  3M0U A;  1PRL C;  3V7S A;  2BE7 D;  4J9B A;  1W2B A;  4M78 F;  1WGS A;  3G4S T;  4DBQ A;  5KH6 A;  1QVG S;  2HKQ B;  3JRZ A;  3L2R A;  1HK9 A;  1TUD A;  2P0Q A;  1D3B A;  1SEM A;  2O9V A;  3OBY A;  2LJ3 A;  1VQP Q;  4K11 A;  3VS6 A;  2EYQ A;  2O2O A;  4CRI A;  2LZ6 B;  1I4K 1;  2LRQ A;  5GAO l;  3EG1 A;  4O5V A;  4M78 E;  2DXC A;  2VC8 A;  2LJ0 A;  3PMT A;  1K9A A;  1VYT A;  2BUD A;  3HSB A;  3LWI A;  1GBR A;  1ZA2 B;  1G3S A;  2DER A;  2MPX C;  4NS5 A;  2P0K A;  1Y71 A;  5IHN A;  3UF4 A;  3DB3 A;  4FYY B;  2VKN A;  1V1C A;  2CP5 A;  3PGG A;  3VS5 A;  1BIA A;  5GMK h;  1N9R A;  3A8L B;  2V8K A;  1X01 A;  1BI0 A;  1NZ9 A;  5GAO r;  1QQJ A;  3LX7 A;  4JRK A;  3WXM B;  3VS2 A;  3I5S A;  2FO0 A;  1YIJ A;  2R5M A;  4Z88 A;  1UGP B;  1QP3 A; 
#chains in the Genus database with same CATH homology
 4QQG A;  5CCA A;  4F7U A;  3LW5 E;  4M7A G;  2KY9 A;  2WSC E;  2EJF A;  4B9X A;  5EG2 A;  2E64 A;  2K5L A;  3MO8 A;  1VQ5 T;  2LNV A;  3HRT A;  4HCZ A;  4C0Z A;  4XAX B;  4QQ6 A;  4PJO G;  3M56 A;  1VQ5 A;  1UEB A;  2LDM A;  4C8Q D;  3CC2 A;  4JLI A;  2QQS A;  4C0G A;  3CCS T;  4PJO D;  1VIF A;  3P8H A;  5GAM e;  5GAN 2;  4M78 G;  5LJ3 h;  5HK0 A;  2ZPG B;  4F7U E;  1IRE B;  3L2U A;  2FL7 A;  3S3M A;  5IAY A;  1I81 A;  3X26 B;  4HKE A;  3CCS A;  2JN0 A;  4JJN K;  4ZN1 A;  4KUI A;  1YHQ T;  4A53 A;  2GFA A;  1N6A A;  1NPR A;  2D9T A;  2LC4 A;  1MGQ A;  1BI1 A;  5FRM A;  1K8A C;  4OF1 A;  3OW2 S;  1B34 A;  2XG8 D;  1M90 C;  1AHJ B;  1Y07 A;  4EDU A;  3HRU A;  3FRN A;  4A4E A;  4ZGJ B;  5GAO m;  3BY7 A;  2O4X B;  1UB4 A;  2D0Q B;  2JVV A;  3FB9 A;  2ZCF B;  4RKU E;  5GAO p;  1N8R C;  4GY5 A;  2DIG A;  4FM4 B;  4X9D A;  3CEY A;  1KC8 U;  4OB3 B;  4M77 F;  3GPL A;  2MI6 A;  3QDR B;  5CAI A;  3SWN A;  1VQ9 T;  3MEU A;  2M0O A;  5LJ5 e;  1WNL A;  2HNI A;  2XK0 A;  3CD6 T;  4IUV A;  5J3B A;  5GAN d;  3OY9 A;  2OAU A;  1NE8 A;  3MET A;  2K4Y A;  4XQ3 A;  4Y91 A;  1QVF A;  4M7D A;  3CD6 A;  3JSC A;  2CZ0 B;  1VQL A;  4PL6 A;  2E5Q A;  1OI1 A;  2PU9 B;  3GF5 A;  4NL2 A;  3MEV A;  5A0D A;  3L2V A;  2LCC A;  3OYM A;  3CCL T;  1Q82 C;  1X6O A;  3NTI A;  3FJP A;  1P92 A;  2ZPE B;  3JCM W;  3HPW A;  4XTZ A;  4M77 E;  1PSF A;  2KAF A;  3KXT A;  3M59 A;  4C8Q F;  1VQO T;  4C92 C;  3CCL A;  2CYZ B;  2F69 A;  3UT1 A;  3FIF A;  4IUP A;  4A4H A;  4PJO F;  2XU8 A;  4C5I A;  4ATO A;  1VIE A;  5I2M A;  4M7D E;  2K2V A;  4C0F A;  3S6W A;  2DTH A;  4C8Q A;  5CKD A;  3OYJ A;  1U1T A;  4JRP A;  1VQO A;  1OZ3 A;  4N0A A;  5GAN 5;  4PJO A;  2A3L A;  3JCM V;  3T9N A;  2K5F A;  5GMK l;  2VGN A;  3VUB A;  2PQW A;  2XDB A;  2EQM A;  5GAN h;  4HCB A;  1QVG A;  3G7Z A;  4PJO B;  1VQM T;  4F7U G;  3QYH B;  2LTO A;  5GAM g;  4BI4 A;  3CXC S;  4C8Q E;  3QG1 A;  1KQS S;  4IKF A;  2E6N A;  3RUX A;  5CKB A;  2G3R A;  3SFM A;  4PJO E;  4QVZ A;  2RHX A;  3EFR A;  5LL6 S;  2XDP A;  3V8K A;  3CCR A;  1SSF A;  1VQ7 T;  2YHT A;  4II1 A;  1S72 T;  1VQ8 T;  2DK3 A;  2DXB A;  3INZ A;  2DIQ A;  1BIB A;  2P0P A;  3LYI A;  4PNO A;  3TCJ A;  3L1A A;  5FU6 B;  1S72 A;  1Q81 C;  1NJI C;  3A8O B;  3RMQ A;  4RG8 A;  4J6Y A;  1G3Y A;  2OTL T;  5M9O A;  3OSS C;  1OYX A;  5GAM j;  4DOV A;  5DY9 A;  3QXE B;  4MDW A;  4A4F A;  2K57 A;  3V8L A;  5L8R E;  4BY6 C;  2OTL A;  2V8I A;  3L42 A;  4JLG A;  4ZGD B;  1VQN A;  3R6O A;  2X4W A;  4GLK A;  5KE2 A;  2E41 A;  2CZ1 B;  3QKJ A;  1QW1 A;  2Y4Y A;  2K3Y A;  2FVU A;  4UC4 A;  2JZ2 A;  3JCM d;  3QJ6 A;  1U1S A;  2X4Y A;  2QTX A;  3A8G B;  5CQY A;  2GCX A;  4ZGE B;  3PIO A;  2O4X A;  5LJ5 g;  3QJY A;  3E9F A;  2DEQ A;  4RG2 A;  3UWN A;  2CZ6 B;  5GMK e;  3GLX A;  5A0G A;  4FU6 A;  4VUB A;  2QQB A;  1XOV A;  2RH2 A;  2YRV A;  1VQ4 T;  2QXF A;  3VYH B;  2VV5 A;  1KC8 C;  4LDX A;  4M77 G;  3VJP A;  5J39 A;  2ZPH B;  3E1S A;  4N4H A;  1VQ4 A;  4N4I A;  3QSU A;  1Y7X A;  3M57 A;  2F5K A;  4LDU A;  5FRN A;  2L89 A;  2MF2 A;  3GOX A;  2LQ8 A;  1LJO A;  5IT9 E;  2RI5 A;  2WAC A;  4EMK C;  1JB0 E;  5LJ5 j;  2E1H A;  3GP8 A;  5CK9 A;  2PUK B;  3CC7 T;  3RKX A;  4EMG A;  2EWN A;  2K5I A;  3JCM h;  4LD9 K;  4C5H A;  2HBP A;  2DJZ A;  2LCL A;  4IUU A;  3QZ9 B;  3CME A;  4R55 A;  5D6W A;  3M55 A;  5A0L A;  2QA4 T;  4C8Q G;  4DQ2 A;  4E47 A;  3CMA T;  5LJ3 e;  2HQX A;  2GQV A;  2VUB A;  4JS4 A;  4FL6 A;  1Q86 C;  1YJN T;  2QA4 A;  1W4S A;  2DAQ A;  2KDS A;  3ER0 A;  2DTO A;  3QO3 A;  1YCY A;  2QEX T;  1VQ6 T;  3NTH A;  2EJG A;  4N4G A;  4M7A C;  1M1K U;  3QYG B;  2QEX A;  2XHC A;  1VQ6 A;  3OS5 A;  1TH7 A;  2RO0 A;  4J83 A;  1G3W A;  4KBM B;  4JDS A;  1YHQ A;  3OMC A;  3CCJ T;  2B8A A;  2YLB A;  3CBO A;  3MEW A;  5AYF A;  3VU3 C;  3OYA A;  3OW2 A;  1Y96 B;  4M78 C;  3WVE B;  4RCB A;  1FWZ A;  3CCJ A;  2D6F A;  4L5G A;  3E19 A;  2CZ7 B;  2IG0 A;  2BIV A;  4LDW A;  1LOJ A;  4E7I A;  2VXF A;  2EJ9 A;  5CR2 A;  2CS7 A;  1M1G A;  1KG1 A;  3I55 T;  1XTD A;  3NTK A;  3G71 T;  2RHZ A;  2LQK A;  4XTU A;  3HHT B;  4BD3 A;  5GAM h;  3G71 A;  4M77 A;  3V7R A;  3PMI A;  2M9U A;  4M75 B;  2JTF A;  2PVD B;  3CCU T;  4V2S A;  5C6S A;  3QUI A;  3URG A;  4C92 B;  2FHD A;  2X4X A;  4P5N A;  4ELY C;  1VQ9 A;  1WJQ A;  1WQW A;  3JAM E;  3OYE A;  3CCU A;  1R8O B;  2Y90 A;  1YJN A;  1UGQ B;  3MP6 A;  3QHS A;  4IUR A;  5HKC A;  1GXI E;  5J26 A;  4BUG A;  2EQJ A;  3CPF A;  3OYC A;  4E7J A;  3JB9 D;  2NLU A;  3LH0 A;  4MML A;  2ZPI B;  3ZBD A;  4ELZ C;  4QVD A;  5I2S A;  3JCM X;  1YIT T;  2DXU A;  4M75 C;  5GAN 7;  1Q7Y U;  1WPY A;  2M16 A;  2FYK A;  3OYN A;  3GNG A;  1BYM A;  2DKG A;  3RIR A;  4OB0 B;  4OVA A;  1YIT A;  2DVE A;  4XTV A;  5GAO q;  2QQR A;  3OYB A;  5GAN e;  4WF2 A;  2R57 A;  5GAN 6;  4B9W A;  1VUB A;  3OMG A;  4HCC A;  3OS2 A;  3OYH A;  4M75 D;  3JCM b;  3L2W A;  4XU2 A;  3LLR A;  2K3X A;  4C92 D;  1YJ9 T;  2QQA A;  4A4K A;  4J6W A;  5LJ5 h;  3VKI A;  2Y4X A;  4R56 A;  1NPP A;  1YJ9 A;  4TVR A;  5CKH A;  2LX9 A;  4E7H A;  1BI2 A;  1RI0 A;  1YBY A;  2EIF A;  5LJ3 f;  3JB9 J;  2RM4 A;  1FX7 A;  3BDU A;  1M5Q 1;  5GAO n;  4BDZ A;  1I5L A;  3CCM T;  4JS5 A;  3NFC A;  2RJC A;  2WSE E;  1H64 1;  3C4S A;  3HL8 A;  3QII A;  3MP1 A;  4BY6 B;  3L2Z A;  4XU3 A;  1W2B S;  2ZGW A;  4Z02 A;  2M1H A;  2RB6 A;  3CCM A;  4DOW A;  1VQ7 A;  1XQH A;  3OS1 A;  2DD5 A;  3GIB A;  3OQ5 A;  1VQ8 A;  2ZZD A;  5HY6 A;  4NL3 A;  4OMF B;  3PFS A;  3QBY A;  2FB7 A;  1KQ2 A;  3OYY A;  3RKW A;  5FLX E;  2WSF E;  5CQX A;  5D6Y A;  2RHY A;  1QP2 A;  3CPW S;  4ZTF A;  3M4Y A;  1I8F A;  4YTL A;  1K8A U;  1KQ1 A;  3OYD A;  2I2L A;  4ME7 A;  1M90 U;  1KD1 U;  1B34 B;  3A5Z B;  2V8J A;  3JB9 F;  5CKF A;  2X4J A;  1Y96 A;  2PVG B;  4QW2 A;  3VUZ A;  3BDL A;  5A2Q E;  1YJW T;  2VGM A;  4PKC C;  4C0D B;  2QQ9 A;  1YI2 T;  1N8R U;  1O9S A;  1G5V A;  3N5B B;  4OGC A;  2XID A;  3DLM A;  2JNG A;  4FSX A;  4EMK B;  1YJW A;  4FT4 A;  3JCM J;  2DPP B;  3P8B B;  4PLL A;  3VYG A;  3ASK A;  3GNF B;  2QDY B;  3I56 T;  1QVP A;  4E7K A;  3OS0 A;  3X28 B;  4M75 F;  4C5G A;  2JTM A;  3JCM c;  2RI2 A;  2ZPB B;  4HT8 A;  4C92 F;  3I56 A;  3PTA A;  3KUF A;  4RMO A;  4BI8 B;  5CIU A;  4L6V 5;  4M7D B;  4C0D C;  5DLQ E;  4C92 A;  5HK3 A;  3JCM e;  4IUT A;  5IN1 A;  3RES A;  1JJ2 S;  3TRE A;  5KCO A;  5GAN g;  2LT4 A;  3HFO A;  3HKS A;  2L8D A;  4M77 C;  2JUF A;  2DZ9 A;  3SWN C;  3CC7 A;  3CBM A;  4M7A B;  1K9M U;  4M7D C;  2RK1 A;  1Q7Y C;  3S3N A;  5GAN f;  3V7C A;  4C92 E;  5C0M A;  3M53 A;  2A7Y A;  1FXX A;  4JUV A;  4MMK A;  1YIJ T;  3CMA A;  5GAN 4;  3OYL A;  3JCM P;  2O01 E;  4FT2 A;  2OTJ T;  3OBW A;  3X24 B;  3MP8 A;  2XD0 A;  3MCA B;  3G6E T;  2E65 A;  4M78 B;  4M7D D;  5GAM d;  4HT9 A;  1D3B B;  5GMK m;  3JB9 I;  2RD1 A;  2OTJ A;  2R5A A;  2P4T A;  3BW1 A;  1BI3 A;  3G6E A;  3H6Z A;  4O6J A;  2EAY A;  4C8Q C;  3OYF A;  4KUD K;  2L3R A;  4BAC A;  4N0A C;  3P8D A;  5CVI A;  5GAN 8;  4PJO C;  2VXE A;  2HAX A;  2XIC A;  4M7A D;  5FU7 C;  5DLO A;  3CC2 T;  4J7F A;  4QVC A;  3L2Q A;  2GFU A;  3ME9 A;  2E12 A;  2KMT A;  2VYT A;  3LGL A;  5CKE A;  1NJI U;  1Q81 U;  2DZC A;  2R58 A;  4OB1 B;  1IZ6 A;  3RKY A;  4XU1 A;  2XDD A;  1X75 C;  1WJS A;  2KK4 A;  1BKB A;  2DXT A;  2RA2 A;  3F70 A;  1M4Z A;  4L59 A;  3A8M B;  4M78 D;  3M9Q A;  4RCC A;  3FEO A;  4MZM A;  3UDC A;  3EAE A;  3HRS A;  1UGR B;  1G3T A;  2GF7 A;  3M58 A;  1OZ2 A;  4KT0 E;  3H8Z A;  2BKD N;  5KE3 A;  3Q1J A;  2LVM A;  3ZFJ A;  1M9S A;  2EQU A;  4ZN3 A;  5LJ5 d;  5KCH A;  4Q5W A;  3KBG A;  3FLG A;  1KD1 C;  3JB9 G;  2E70 A;  5DM7 R;  1K73 U;  2QI2 A;  2PVO B;  3HP9 A;  3QZ5 B;  2DTI A;  3M5A A;  1VQK T;  3S3O A;  2RI3 A;  3X20 B;  3I55 A;  3V8J A;  4EMH A;  3EFS A;  3OYK A;  3JCM g;  3OA6 A;  4HA8 A;  4EMK A;  4NOY A;  2EQK A;  1VQK A;  3E9G A;  2C06 A;  2KQW A;  5GMK j;  3BFM A;  3C94 A;  3OYG A;  4IUQ A;  3C95 A;  2MMP A;  4M7D F;  4J8O A;  4LD6 A;  2HQE A;  4M75 G;  3FDR A;  2HD0 A;  3DB4 A;  4J5Y A;  3RMS A;  2RJF A;  3JCM f;  3VV0 A;  4A54 A;  4C92 G;  1VQL T;  3CCE T;  1LNX A;  1QVF S;  2E10 A;  1PSE A;  2KVQ G;  3AHU A;  2XI9 A;  1EIF A;  4XTX A;  1M1F A;  2RJE A;  2LT1 A;  4JRI A;  3M4G A;  3CCE A;  5LJ3 g;  1H3Z A;  1O75 A;  2F5T X;  3TEE A;  4J6X A;  3PIP A;  1DJ7 B;  2AHJ B;  3CCV T;  4J7I A;  5D6X A;  4F7U B;  4M7A F;  1N27 A;  2EFI A;  4C5E A;  3ZEH A;  1RL2 A;  3PNW C;  4X9C A;  5GAN 3;  3CXC A;  3CCV A;  2PUO B;  1KQS A;  4M7A A;  1WQ7 A;  4Y28 E;  3CC4 T;  1K9M C;  1Q86 U;  4BE0 A;  2EKO A;  3DLL A;  3V7S A;  5CO7 A;  4CI0 C;  3CC4 A;  1W2B A;  3CCQ T;  3OSV A;  4M78 F;  1WGS A;  4OP0 A;  4OGE A;  4A4G A;  5LJ3 j;  1VQP T;  3G4S T;  1VQM A;  5GMK i;  5KH6 A;  1M8V A;  4M78 A;  3CCQ A;  1QVG S;  1VQP A;  3JRZ A;  3L2R A;  1HK9 A;  2P0Q A;  1D3B A;  3OBY A;  3J81 E;  3G4S A;  1WJR A;  1M1K C;  3OB9 A;  4M7A E;  1HXD A;  1ZHI A;  2L5Q A;  2RJD A;  3MEA A;  4EPC A;  3CPW A;  2EYQ A;  4CRI A;  2ZPF B;  4BDY A;  1I4K 1;  4BE1 A;  3CCR T;  2IVW A;  3J80 E;  3UPU A;  3TU4 K;  2LRQ A;  2YLC A;  5GAO l;  4MDX A;  3HFN A;  1ZBX A;  3MHX A;  2MWO A;  4O5V A;  2DXC A;  2VC8 A;  4M78 E;  5GAM f;  3PMT A;  4ZTJ A;  4MZT A;  2BUD A;  1JRI A;  3RER A;  3HSB A;  3SB2 A;  3LWI A;  4FIB A;  1KHI A;  2XKO C;  4XK8 E;  3CBP A;  1YI2 A;  3DKM A;  3M54 A;  1VQN T;  1N9S A;  2CGH A;  3LWH A;  4M77 B;  3SWN B;  2RK2 A;  2MAM A;  4QQD A;  4LDV A;  3WVD B;  2H3J A;  4M75 A;  4JRQ A;  1G3S A;  4XTW A;  3X25 B;  3QPH A;  1V29 B;  5FU6 C;  4X34 A;  3SD4 A;  3A8H B;  4NS5 A;  3FC3 A;  2P0K A;  4DA4 A;  1U8R A;  1UGS B;  2MWP A;  4LDY A;  1Q82 U;  1JJ2 A;  1Y71 A;  2DO3 A;  1K73 C;  3OYI A;  1ZQ1 A;  3SDZ A;  5I21 A;  3PT9 A;  3DB3 A;  3JB9 H;  4OB2 B;  4PLI A;  1MHN A;  4BI3 A;  4E7L A;  3PGG A;  4BB7 A;  1BIA A;  4M75 E;  5GMK h;  1N9R A;  1KHC A;  4XTY A;  4C8Q B;  3A8L B;  2V8K A;  5LJ5 f;  4M7D G;  2RHI A;  4BE2 A;  1X01 A;  1BI0 A;  1NZ9 A;  1JBM A;  5LJ3 d;  5FRO A;  2DD4 A;  3J7A F;  2JOY A;  4M77 D;  3LX7 A;  4XU0 A;  4D6W A;  3JCM Q;  5GAO r;  5FU7 B;  4JRK A;  3C12 A;  3WXM B;  3O8V A;  2KSS A;  5GAN j;  2X35 A;  1YIJ A;  2R5M A;  1UGP B;  1XNI A;  4F7U F;  2RHU A;  4MZP A;  2E6Z A;  2CKK A;  3LGF A;  1QP3 A;  3CME T;  4KUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...