2OI3A

Nmr structure analysis of the hematopoetic cell kinase sh3 domain complexed with an artificial high affinity ligand (pd1)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
GPLGSPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase HCK
publication title Solution Structure of a Hck SH3 Domain Ligand Complex Reveals Novel Interaction Modes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 86
sequence length 86
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2oi3A01
1OV3A 2HDAA 2YUPA 2IIMA 5IHKA 5L23A 2KT8A 3PVQA 2FO0A 4J9CA 3PE0A 1GCPA 4HVWA 1I0CA 1JXOA 1ZUYA 4RTWA 2EGAA 1JQQA 2CDTA 2LMJA 3VS4A 4AFZC 3VS6A 1NYFA 1ABQA 4KRTA 2DL7A 1UE9A 2KEAA 4LNPA 4CC7A 2SRCA 2RMOA 4M4ZA 2KR3A 2EYWA 3I35A 2M51A 1SSHA 2OI3A 1T3SA 4J9BA 2M0YA 2K9GA 3QWXX 1AWXA 3EG3A 1T0HA 1QLYA 1M30A 1I07A 2AKLA 2ESWA 2ROLA 2KT1A 2JMCA 4X1VA 1WA7A 2PTKA 2V1RA 1X2QA 1K0XA 2KROA 1NM7A 3EHRA 1ZSGA 1K4US 2LQNA 1PNJA 4AFSC 1OEBA 2CT3A 4GBQA 3TSWA 3M0PA 1AEYA 3TVTA 4LN2A 4OMNA 5FW9A 2FPDA 1UUEA 3NHNA 4AG2C 1K76A 4RTTA 4RTYA 3THKA 1IO6A 1GCQA 5GJWB 3JV3A 1VYUA 2FPEA 2O31A 1GFDA 3REBB 2FEIA 2XMFA 4JJBA 2D8HA 2LP5A 4F16A 1BU1A 3NGPA 4JZ3A 1NG2A 1ZUUA 2F2XA 2J6KA 1FYNA 2DYBA 2KGTA 1BB9A 1MV3A 1SHFA 1YN8A 2PZ1A 1SHGA 2O2OA 2FRYA 1PKTA 2GNCA 1N5ZA 1JXMA 1RLPC 4GLMA 3PVLA 2DRKA 2VVKA 1GBRA 2L3QA 3EHQA 2AZVA 3CQTA 2JXBA 2L0AA 2DL5A 3ULRB 2C0IA 5I11A 1BK2A 1KSWA 1X6BA 1M3BA 1U5SA 1CSKA 5IXFA 2ECZA 1PHTA 4HVUA 2A28A 3R6NA 1Z9QA 2DJQA 3H0IA 2F2VA 4J9GA 2EGEA 1TUDA 3H0FA 4RTUA 1H3HA 2K6DA 4RUGA 4ZNXA 2EQIA 3QWYA 2CH4A 2DILA 1M8MA 2J6FA 1XOVA 1YP5A 3LH5A 1UJYA 2FPFA 4JJCA 2GTOA 2VWFA 1NYGA 3M0UA 2BTTA 1ZUKA 3VS7A 2KE9A 2EYXA 2LJ1A 2CT4A 1M27C 1ZLMA 2KBTA 4RTXA 2HCKA 1UHFA 2KRMA 1RUWA 2C0TA 4Y92A 2EKHA 1TUCA 2ENMA 2RNAA 4OMPA 2CSQA 3RBBB 3UATA 2OJ2A 1NEGA 1WXTA 3M0RA 3RNJA 2KYBA 3REAB 2YSQA 1W1FA 3O5ZA 1MUZA 2GBQA 2EPDA 4AFUC 1JU5C 2H8HA 1PWTA 1OOTA 1QKWA 1OPKA 1G2BA 1X43A 2DF6A 3EG1A 1AD5A 4IIMA 4EIKA 2LQWA 3H41A 2RQTA 2DX1A 3FJ5A 5FWBA 1FMKA 2HSPA 2CH4W 2AKKA 2J05A 2L2PA 2QDLA 3EG0A 1G83A 1KIKA 2FG0A 1HSQA 1WX6A 2JM8A 1YWPA 1GFCA 2SEMA 2D8JA 3M0TA 2DBKA 2DL3A 3KFVA 2ROTA 1UTIA 1UDLA 1LCKA 2ABLA 1H8KA 2KNBB 5IHIA 2J06A 2RQVA 3M0SA 3VS3A 3H0HA 3UA6A 1AWOA 1WI7A 2LNHB 1UHCA 5IXBA 2VKNA 1ARKA 4J9DA 3ZL7C 1B07A 1WDXA 1K0SA 3I5RA 4ORZA 1W70A 2K2MA 2C0OA 3VRYA 2DE0X 1U06A 2CUDA 1AOJA 1GCQC 1TG0A 1CKBA 1PRLC 4IIOA 3SEMA 1VYVA 2LCSA 2DL8A 1HJDA 4JZ4A 2NWMA 1Y57A 2W10A 2YUQA 1NLOC 2ED0A 1YCSB 2NUZA 1QCFA 2A36A 2LJ0A 4DEYA 1GBQA 4Z8AA 1U3OA 2MIOA 2L3PA 3IQLA 1W6XA 1S1NA 2EVRA 2D1XA 1SEMA 2CUBA 1AWJA 4R0KA 1VYTA 1K1ZA 2JM9A 4OMOA 5I22A 2J7IA 4CC4B 1UGVA 5FWCA 2KRNA 4J9IA 4E6RA 5IHNA 1Z9ZA 4HCKA 1ZX6A 2W0ZA 2CREA 1M3CA 3EG2A 1VA7A 1QWFA 2JS2A 3U23A 4LUDA 1YNZA 2K3BA 2JT4A 4Z89A 1ZBJA 2PNIA 3VS0A 4FSSA 1V1CA 4AFQC 4LUEA 2K7AA 3NPFA 2BZYA 4J9EA 1MV0B 1NEBA 2RN8A 4JJDA 2DLPA 1WXBA 2RQWA 2EW3A 2O9SA 1X27A 2MCNA 3SHWA 3VS2A 1QWEA 1UFFA 2KYMA 3UA7A 1QKXA 2EYYA 2JTEA 2LX7A 2YDLA 2A08A 1SRLA 1X6GA 2I0NA 4J9FA 2RPNA 1PRMC 4F17A 2V1QA 1Y0MA 2AK5A 1WLPB 4HVVA 4HXJA 2ED1A 1X69A 1E7OA 1K9AA 4CC3A 1E6HA 2J6OA 3M0QA 1J3TA 1B3QA 1WYXA 1RI9A 1UECA 2DBMA 2EBPA 1EFNA 2JMAA 2CSIA 1ABOA 2JS0A 1AZEA 4Z88A 2GGRA 2O9VA 1SRMA 1AVZC 1T0JA 1A0NB 1BBZA 4D8KA 2P4RA 4LE9A 2YUOA 4DEXA 1YWOA 1H92A 2YT6A 1X2KA 2DMOA 4K11A 1GRIA 1JO8A 2DVJA 2FRWA 5EC7A 2DM1A 4A63B 1JEGA 4AG1C 5GJVB 2EYZA 2A37A 3UF4A 2RQUA 4WCIA 4JPBW 2AZSA 4OMMA 1AWWA 1WIEA 1KJWA 2G6FX 2DL4A 3A98A 3VRZA 1HD3A 2JW4A 3VS5A 5HCKA 2K79A 4CC2A 1WFWA 2X3XD 1NLPC 1E6GA 2X3WD 5IH2A 2HBWA 2KRSA 4QT7A 2DRMA 2B86A 5ECAA 4OMQA 2KXCA 4D8DA 2F2WA 1OPLA 4J9HA 1WXUA 2KXDA 1GL5A 1SPKA 2EGCA 1UJ0A 3GBQA 4RTVA 2MOXA 3EGUA 2L3SA 2DA9A 2RQRA 3TSZA 2OAWA 2HEQA 3I9QA 3C0CA 1I1JA 2O88A 1UG1A 2BZXA 4F14A 1PKSA 2E5KA 1T3LA 1CKAA 2D0NA 2LZ6B 3VS1A 2GQIA 2DNUA 3NMZC 2GTJA 3I5SA 1M3AA 4OMLA 1RLQC 1KFZA 1AZGB 2BZ8A 2RF0A 4ESRA 2LJ3A 4RTZA 2YUNA
chains in the Genus database with same CATH superfamily
2XDDA 1R77A 1OV3A 2IIMA 2XIDA 1LNXA 3PE0A 1I0CA 1JXOA 3KXTA 4RTWA 5GANf 2K57A 4AFZC 2EYQA 4M78F 5KE3A 1JJ2P 3M56A 4BUGA 4FIBA 2DL7A 4LNPA 2SRCA 3BFMA 3GOXA 2KR3A 4L6V5 4M78E 3G6EQ 3RR6A 1NJIC 1M90R 1SSHA 4BE0A 3OSVA 4XTYA 1W4SA 2M02A 2K9GA 1AWXA 1T0HA 5GMKl 3RKYA 3MP8A 2YLCA 4X1VA 3X20B 4QVCA 1QMCA 4RKUE 4LDWA 2V1RA 1C0MA 1ZSGA 1TTHB 2PUKB 4M78A 3A5ZB 3J80E 4Z02A 1FWZA 3E1SA 2CT3A 5LJ5h 4GBQA 2CZ6B 3CBMA 1AEYA 2AT1B 3TVTA 5FROA 2VXEA 3OY9A 2WACA 4AG2C 4RTTA 3THKA 1GCQA 5GJWB 1M90C 2FPEA 3EFOA 2E6ZA 2AIRB 2VYTA 3RESA 3SWNC 3V8LA 4F16A 1Q86R 1BU1A 1O75A 2F2XA 2DYBA 1YJ9T 3E2UA 2RI5A 1QVPA 1YN8A 2PZ1A 2O2OA 2FRYA 1RLPC 4GLMA 3I56A 4PJOD 1M9SA 1MMDA 2JZ2A 2L89A 2Y90A 4HKEA 1GBRA 2L3QA 3EAEA 1PC0A 4F04B 2L0AA 4BI4A 1F1BB 2C0IA 2HMAA 1QVFA 1U5SA 2A28A 3UPUA 2QDYB 1ZHIA 2DJQA 3H0IA 1TUDA 3JCMV 3WVEB 1Q86C 1G3YA 2VUBA 4C5HA 2RHZA 4RUGA 4ZNXA 2OX7A 4ELZC 4M7AC 1YIJT 2IVWA 1M1KR 4KH0B 1UJYA 4JJCA 1U8RA 2GTOA 2MMPA 1NYGA 3M0UA 2BIVA 1K9MU 2BTTA 4NOYA 4OB1B 4JS4A 1UHFA 3KUFA 3HRSA 1RUWA 2LVMA 4Y92A 2EKHA 1FMVA 2CSQA 5KYXA 3CMEA 3PMIA 3LX7A 3VYGA 3RKWA 2GBQA 2ZCFB 2EPDA 2QA4A 1JU5C 2CZ7B 4A54A 1OOTA 3CCSQ 2DK3A 4EDUA 2Y4XA 4PJLA 1M1KC 3EG1A 4EIKA 4II1A 2LQWA 3H41A 5FWBA 4M77G 2QDLA 3G4SQ 4OGEA 1YJWT 4PFPA 2JM8A 1Q81R 1QVFS 2DBKA 2E4HA 1UTIA 1D1CA 1UDLA 1LCKA 2ABLA 4QVDA 3QUIA 1BIBA 4PJJA 3CCJA 4PK4A 4E7SA 5GANh 2QTXA 1PG5B 2E5QA 2LNHB 3OS2A 4M78B 4X9CA 3FRNA 5LJ3f 4E2FB 1ARKA 3ZL7C 2DZCA 1B07A 3RIRA 1K0SA 2MI6A 4N0AA 2K2MA 3CCUQ 2JN0A 3QZ5B 4PLIA 1AOJA 3JB9H 4KGXB 1CKBA 3EFOB 3ZFJA 4IIOA 1Q81C 1VQLT 4N0AC 2DL8A 4FYVB 2IG0A 2YUQA 2ED0A 1YBYA 2NUZA 1QCFA 1IRXA 1GBQA 3UDCA 3CPWP 2MWPA 3L2UA 3OMGA 3M55A 2WSEE 1WNLA 1AWJA 2MPXC 4R0KA 1VYTA 1W2BS 2KY9A 4C92C 1VQ4T 2QQSA 2J7IA 1TSFA 1UGVA 1RAFB 2HNIA 1VQOT 2W0ZA 1MMGA 1DJ7B 1M3CA 3F70A 1K8AR 4LDUA 4M7AD 2JS2A 1EIFA 2HD0A 5AT1B 2PNIA 3VS0A 1IHVA 1YITT 1C1AA 1K73R 1MMNA 2BZYA 3INZA 1LPLA 3JB9F 1H641 1BIAA 2EW3A 1VIEA 4BY6C 4F7UF 3J7AF 2MWOA 7AT1B 3SHWA 1YJNA 3G6ET 3VS2A 2K4YA 3QG1A 3UA7A 3H9NA 1QCOA 4F7UE 2EYYA 4HCCA 2LX7A 5KCHA 3OMCA 2EQKA 5GAN4 2DD5A 5KYXB 3Q1JA 4PJOG 4B9XA 2JUFA 1K8AC 3CCLT 3SD4A 2V1QA 3BY7A 1N6AA 1M90U 1OYXA 1Y0MA 9ATCB 1N8RR 4JRQA 1K73C 2YLBA 3L42A 5LL6S 1NPPA 2DD4A 4A4KA 5A0GA 3QHSA 4CC3A 4F7UA 1RI9A 5HKCA 2RI3A 2EBPA 2E12A 4M75F 3RMSA 3DLMA 4Z88A 2FHDA 2FL7A 1SRMA 3CEYA 1AVZC 2COZA 1A0NB 3D7SB 3OBWA 4XU0A 1YFNA 2P4RA 4K11A 1KQ1A 2QASA 2PVOB 1KQSS 3FLGA 4XTVA 1R0CB 2O4XB 1LJOA 4ZGJB 1N8RC 1MMAA 3EFRA 2EYZA 4KUIA 3PGGA 1VQ5A 1S72Q 2G6FX 2RI2A 3TREA 1JJ2A 2K79A 2ZGWA 3URGA 4CC2A 3L2RA 1B34A 2FB7A 4M75A 1QQJA 3H8ZA 3RUXA 2X3WD 4QT7A 2DRMA 1VQ7Q 3QKJA 2VV5A 2DXUA 1YI2Q 3A8LB 4M75C 2M1HA 4IUVA 1BKBA 1OPLA 4IUQA 4QQGA 2KXDA 4JRPA 1GL5A 2OTLA 3VYHB 2QI2A 3EGXA 1SSFA 4IUUA 5FU6C 4C92D 5FRMA 3RMQA 2OAWA 2RJCA 1BI0A 1Y07A 2KK4A 3C0CA 5CIUA 4JS5A 1UG1A 3EG9B 1PKSA 1M1KU 2E5KA 1CKAA 4ZGDB 4M7DF 3VS1A 4OF1A 2DNUA 4BE1A 3NMZC 2GTJA 2LX9A 3CCEQ 4OB3B 5KYYB 2BZ8A 4BY6B 2RF0A 4BI8B 4C8QF 4M7DE 3OW2S 4ESRA 2YUNA 1SKUB 2HDAA 2K5FA 4C8QE 2GF7A 3LGLA 1RAIB 4J9CA 1NPRA 1WHJA 3OYAA 1I5LA 3V7SA 3VS4A 2ZZDA 1D0ZA 3CC7Q 4XK8E 2RK1A 4MDWA 1NYFA 4EMHA 4KRTA 4MMLA 4M7DA 2LTOA 5A0DA 3JCMJ 4OMFB 5CKFA 4M4ZA 1VQ5Q 3I56T 2HQXA 2DTHA 1Y96A 2DYIA 1T3SA 4C8QA 4OB0B 3CC2Q 3JCMb 3EG3A 1Q81U 1KD1R 4M7DC 4LDYA 1M30A 2I2LA 2AKLA 3BE3A 2ROLA 3OBYA 1VQKQ 2AHJB 3QXEB 4F7UB 4C8QC 4M7AG 2KROA 2DEUA 2LQNA 3RERA 8AT1B 3M0PA 3JCMh 1OI1A 2E41A 5FW9A 1K76A 3G6EA 5D6YA 2V8KA 3JV3A 3LW5E 2FYKA 2O31A 2QEXA 4JJBA 4KBMB 2D8HA 4OB2B 1HXDA 4RG2A 2BUDA 2LP5A 1KD1C 3PMTA 2YRCA 2E64A 2K5IA 1HK9A 4JZ3A 2O01E 2J6KA 1FYNA 1D09B 1BB9A 1MV3A 5EG2A 1SHFA 3CMET 3L2QA 2GNCA 4M75B 4P5NA 1VQ6Q 2DXTA 2DRKA 2HL3A 2VVKA 1XTDA 2QA4T 1QP2A 3V7CA 2L5QA 3EH2A 2DL5A 4Y91A 4J8OA 2D6FA 5GAMh 5I11A 4J6XA 1M3BA 3P8BB 3QYGB 4HVUA 4MZTA 3R6NA 1Z9QA 2GCXA 4RTUA 1D1BA 3EGXB 1H3HA 2CP0A 3CXCP 1K8AU 2DILA 1IGUA 1V76A 5DM7R 1K73U 1XOVA 4KT0E 2DTIA 3RKXA 1V29B 1PD0A 2E65A 2D9TA 3CCJT 1D3BB 4FCYA 2X4YA 2ZPGB 1M27C 4KGZB 2CZ0B 2LC4A 2HZYA 2KRMA 2C0TA 1TUCA 4XU3A 3RBBB 3UATA 4E7KA 2RHIA 3MHXA 4N4HA 3REAB 2RHUA 3CPWA 1UGRB 1MUZA 2EWNA 3CC4Q 3N5BB 4BE2A 2NUPB 3HL8A 2H8HA 3QDRB 2DIGA 1N8RU 1OULA 2QEXQ 3TCJA 1N9SA 2M9UA 2RQTA 1VQPA 3FC3A 2DX1A 4A4HA 3M4GA 1FMKA 4M7DB 3X24B 2J05A 4C92G 2OTJQ 5GAN7 1KIKA 2FG0A 2F5KA 5A0LA 1Y96B 3VU3C 1WX6A 4C8QB 1VQ9Q 5GMKj 3OYEA 1YWPA 2SEMA 1TS9A 3DB4A 3M0TA 3MJXA 1M1FA 3V8JA 1G5VA 1H8KA 5FLXE 4Y28E 3S3OA 2X9HA 3CPFA 3M57A 5D6XA 3CCSA 1OU9A 1SG5A 1AWOA 1WI7A 4M78C 2MAMA 3BDLA 2X51A 1UHCA 1WDXA 3A8MB 1W70A 2C0OA 1ZQ1A 3G4SA 1U06A 2COYA 1GCQC 3MCAB 2ZPBB 1PRLC 2HQHA 3JCMQ 1QVGP 1YJNT 2DJZA 2L3RA 2XICA 4QKUA 1PCXA 2LCSA 1VQMQ 3TU4K 1HJDA 1YCYA 1I8FA 2W10A 4PLLA 3ER0A 1U3OA 3FB9A 2MIOA 4AT1B 1VQ8Q 1S1NA 2EVRA 1RABB 2NYSA 2G3RA 3CCRQ 3CCUA 4OMOA 5I22A 5FWCA 2KRNA 2DO3A 2QGGA 4XAXB 2KVQG 2QQBA 5CKDA 4JDSA 3O8VA 4LDVA 3UWNA 2A3LA 3GLXA 1VA7A 1VQPQ 1G3TA 4XU2A 2K3BA 4IUPA 3M9QA 4FSSA 3OQ5A 4MZMA 2R57A 2DPPB 2A0FB 4AFQC 3TQ7P 1N9RA 1NEBA 1OZ2A 2MYSA 5GAMj 2LRQA 1WZOA 2RQWA 1KHIA 2EIFA 2RM4A 2MCNA 1WJSA 1VQ5T 3QIIA 3HSBA 1QWEA 3JCMX 2VC8A 2E3IA 1YHQQ 2KMTA 2E10A 3CCQA 2XK0A 2P4TA 1X6GA 3MP6A 1BI3A 4EMKA 2EQMA 5GAOl 2RPNA 3GPLA 1VUBA 3HKSA 2QTVA 2AK5A 3MO8A 3V8KA 1WLPB 5GAOm 2QAZA 3OS1A 2CP7A 1KD1U 2JTFA 2ED1A 4EMKC 5GMKe 2K5LA 2RO0A 1K9AA 4FL6A 2OTLT 1J3TA 1UECA 2DBMA 2GFAA 5KYWA 3S3NA 2JMAA 2L8DA 2JS0A 2DZ9A 2LQKA 2GGRA 2O4XA 2O9VA 1BI2A 2WSCE 5C6SA 1IGQA 1YWOA 1H92A 4GY5A 2DXBA 2DIQA 1GRIA 1Q82U 1KHCA 2EJGA 5FRNA 2RA2A 3JCMP 3GNFB 2BKDN 5CQXA 1JEGA 4C0ZA 4M78D 2WSFE 4AG1C 5GJVB 2ZPEB 2RQUA 4WCIA 2AZSA 4OMMA 1AWWA 1AHJB 3MP1A 1VOMA 2DL4A 3VRZA 5GAN6 3VS5A 3QPHA 5I2SA 1D0YA 1E6GA 3BDUA 3SB2A 1IZ6A 5LJ5j 5GAN2 3DKMA 4IURA 3JCMe 1XNIA 4TVRA 3M54A 4A4GA 1WXUA 5CR2A 1UGPB 2HL5C 1SPKA 1UJ0A 3GBQA 3EG9A 4RTVA 1S72A 4IUTA 4O6JA 3CCQQ 2L3SA 2V8IA 2DA9A 8ATCB 5L8RE 4C0GA 5KYYA 1I1JA 2O88A 3GNGA 3CD6Q 4C0FA 1VQ7A 1I5OB 4J83A 2D0NA 1YI2A 2LZ6B 2GQIA 3G71Q 1M3AA 3JAME 5GAMe 4DBQA 1PD1A 3EFSA 1KFZA 1G3WA 4PJNA 2LJ3A 3EGDA 3C94A 5M9OA 2DAQA 2HAXA 1GXIE 2YUPA 2QEXT 2CP6A 5IHKA 5L23A 4E7JA 5GANd 3PVQA 2COWA 2MK5A 4HVWA 3SDZA 1NZ9A 4ATOA 2P0QA 2DKGA 2EGAA 2RJEA 1JQQA 2CDTA 2LMJA 4PNOA 4R55A 1ZSZA 4MDXA 3VS6A 3HP9A 4NL3A 4HT8A 3OYHA 1BI1A 1UE9A 4CC7A 3OB9A 2R5MA 5CKHA 4EMKB 3CCEA 2K3YA 3LLRA 2M51A 2OI3A 3MKDA 2LCCA 4J9BA 1X6OA 2A7YA 3HPWA 3QWXX 3ME9A 3OYLA 4FW1A 3HFOA 3AHUA 4JRKA 2ESWA 1VIFA 1WQ7A 2LQ8A 5KE2A 1UGQB 4NL2A 5KYWB 3NTIA 2K3XA 3EHRA 4FW2A 2XU8A 1M2VA 1WHHA 3CC7A 4AFSC 4M77F 3TSWA 4LN2A 1H3ZA 1UUEA 3NHNA 1WJQA 4ZTFA 3DB3A 4L5GA 1VYUA 2X35A 4PFOA 4M77E 1GFDA 4ELYC 2CZ1B 3CC2A 1AT1B 3EH1A 1Y71A 1JB0E 2JVVA 1NG2A 1ZUUA 5GAN3 2KGTA 5LJ5e 1VQKA 1SHGA 2GQVA 1PKTA 1N5ZA 5GANj 3OYIA 1RAGB 2AZVA 4M77A 2JXBA 4LD6A 4BI3A 3OYFA 1BK2A 1KSWA 1WQWA 1VQPT 2FZCB 5LJ3h 5IXFA 2DEQA 1M4ZA 4OVAA 4M77C 2F2VA 4J9GA 2EGEA 3H0FA 1W2BP 3AT1B 3C95A 2DERA 2CYZB 1R0BG 1D3BA 2B8AA 2CH4A 2YWWA 2EQUA 1M8MA 1U1TA 1VQ6A 2J6FA 3CCMA 2FZKB 2RH2A 2X4XA 2XKOC 4M78G 3LH5A 4RMOA 3M5AA 2FPFA 3CCST 2VWFA 3J81E 1ZUKA 4JUVA 1QVGA 3VS7A 1EZZB 4C0DC 3GIBA 2KE9A 2LJ1A 3JRZA 2CT4A 2KBTA 3LH0A 4RTXA 2NUPA 4BDZA 3G4ST 4KUDK 3EGDB 1JJ2S 5AYFA 2OJ2A 1WXTA 3M0RA 1YIJQ 2EAYA 2YSQA 2H3JA 2HQEA 5FU7C 4CRIA 4E7LA 3O5ZA 4AFUC 1PWTA 4B9WA 1ZSZB 1MNDA 1G2BA 1X43A 1AD5A 3MPUB 5KH6A 3FJ5A 3JCMc 2L2PA 2LT4A 3VUBA 1G83A 2DTOA 1HSQA 1O9SA 4J7FA 3JB9D 1WHGA 3QO3A 3CCUT 1GFCA 2ZPFB 4N4IA 4A53A 4PJOF 2DL3A 3KFVA 2ROTA 4DQ2A 3P8DA 4ZGEB 1Q82R 4ZTJA 2E70A 4PJOE 5IHIA 4DOWA 3CC4A 1RL2A 2RQVA 3VS3A 2V8JA 4MMKA 3ZEHA 4IKFA 3X26B 1M2VB 2FZGB 2KAFA 1C6VX 3CBOA 3JSCA 2VKNA 1I4K1 2E6NA 3PFSA 1KQSP 3I5RA 4ORZA 2EFIA 2JOYA 5CKEA 2DE0X 4FT2A 2YXYA 3VRYA 2CUDA 2OTJA 2RK2A 3OYKA 4L59A 1VQ9A 2QQRA 1ZA1B 3GP8A 4EMGA 4QVZA 2EJFA 3CCMQ 4PJOA 4KH1B 5GANe 1UB4A 3PIPA 3CCQT 4HT9A 1X75C 4LD9K 1Q82C 4M75D 4Q5WA 1KC8C 2A36A 1XJWB 2LJ0A 4DEYA 4Z8AA 1OU8A 3CMAA 4E7HA 3IQLA 1W6XA 1SEMA 2JJ9A 3OA6A 4M77B 2BE9B 2OAUA 3LGFA 3G71T 1K1ZA 2X4JA 4CC4B 1VQLQ 4J9IA 1KG1A 5IHNA 3L2WA 5J3BA 1Z9ZA 4HCKA 1ZX6A 4UC4A 1VQMA 3ZBDA 3EG2A 1RACB 2HKQB 1QWFA 3OYGA 1YNZA 2P84A 4Z89A 5CCAA 1WHLA 2P0PA 3L2ZA 2K7AA 4J9EA 3NPFA 4C0DB 1MV0B 1U1SA 3NTHA 2RN8A 4JJDA 5GAN8 1VQ8A 3PIOA 3CCVA 1B7TA 1WXBA 3E19A 3LWHA 2O9SA 1X27A 3CCRA 1VQOQ 3OW2P 3JCMd 3QJ6A 2KYMA 4RCCA 1QKXA 5FU7B 3OSSC 2YDLA 2A08A 5CQYA 1SRLA 3T9NA 1YITQ 5GMKi 2R5AA 2I0NA 4J9FA 3SFMA 1PRMC 3VJPA 3PTAA 1IREB 2CS7A 2FVUA 4V2SA 4HXJA 4M7DD 2CP3A 2CKKA 1B3QA 1WYXA 2CP2A 2EQJA 1EFNA 1S72T 4C8QD 2CSIA 4QQ6A 5IT9E 1AZEA 4RCBA 3A8OB 5GAMd 1YHQA 5HK0A 1OQKA 3CCLQ 3OYBA 4D8KA 4LE9A 2YUOA 4ME7A 4DEXA 4LXCA 5DY9A 1X2KA 2XI9A 5GMKm 3QDFA 3CMAQ 3OS5A 1XQHA 2DVJA 4DA4A 1R8OB 3VUZA 1VQ7T 2DM1A 3QBYA 3UT1A 1YI2T 2BE7D 5D6WA 2QQAA 5KCOA 4X9DA 3SWNA 2QG9B 3UF4A 4RG8A 1HD3A 1RADB 1M2OA 4M7AF 3FIFA 1WFWA 2X3XD 1X01A 4PFZA 2HBWA 2RD1A 3JCMg 2DETA 4M7AE 1MGQA 1NE8A 3CPWS 4PJOB 5HY6A 3M4YA 3X25B 4D8DA 4E47A 2F2WA 1VQNA 3CCVQ 4ZN1A 3A1PA 4J9HA 4C5IA 1JBMA 3CCET 2KSSA 3JB9G 4JJNK 2VGMA 3EGUA 5C0MA 1NBEB 2RQRA 4M7AA 4F7UG 3META 4XTUA 4R56A 2BZXA 5CKBA 4F14A 3I55A 1T3LA 5GAMg 2DXCA 2NUTA 1LVKA 3CC7T 1UGSB 4OMLA 1IXDA 1RLQC 5LJ3e 1AZGB 2QQ9A 4DBHA 2ZPHB 5LJ5d 4RTZA 3H6ZA 2M16A 5A2QE 3R6OA 1TXQA 1OX8A 4KULA 3CC2T 2KT8A 4CI0C 2FO0A 1GCPA 4YTLA 1ZUYA 4FYYB 4M75G 1VQKT 3A8HB 3CD6A 3X28B 2VGNA 1ABQA 4XU1A 4WF2A 2KEAA 3G71A 2RMOA 3L1AA 3NFCA 2EYWA 2XD0A 3I35A 4E7IA 1WGSA 1W2BA 4HCZA 2M0YA 3NTKA 2RHXA 4XQ3A 3A8GB 1Q7YU 1QLYA 3OYDA 1I07A 3FDRA 2KT1A 2JMCA 4QQDA 1IHWA 5KYUA 4NS5A 1WA7A 2PTKA 1KC8U 1VQNQ 4HA8A 1X2QA 1K0XA 1NM7A 1K4US 3G7ZA 3I56Q 1PNJA 1OEBA 1QCNA 1IB8A 1VQ6T 3CCMT 4OMNA 2FPDA 4C92F 3PNWC 1N27A 5CAIA 4RTYA 3CBPA 1G8XA 1IO6A 3JB9I 4HCBA 3C12A 3QZ9B 3REBB 2FEIA 5CO7A 4C92E 2XMFA 2GFUA 5GAOq 2XDPA 3SWNB 5LJ5g 2ZAEA 3NGPA 3OS0A 4J5YA 3JB9J 3I55Q 2P0KA 1FX7A 4FM4B 3RDVA 2LCLA 3VKIA 4FT4A 1JXMA 3PVLA 4C5EA 1G3SA 3EHQA 3CQTA 3E9GA 1ZBXA 2H3EB 4C92A 3ULRB 2LNVA 4M7DG 2K2VA 2KQWA 1X6BA 3OYYA 1CSKA 2ECZA 1PHTA 5J39A 4C8QG 2Z0WA 2RB6A 4WTOB 2ZPIB 3CMEQ 4AMCA 4PL6A 2NLUA 2K6DA 2PU9B 3QJYA 2EQIA 3QWYA 2EJ9A 2QXFA 4LDXA 4M7AB 4BDYA 2QA4Q 3L2VA 2Y4YA 3TEEA 1KQSA 1YP5A 5GAOp 3CC4T 3MEUA 5GAOr 2DFUA 3OYMA 1NJIU 2NUTB 5IAYA 2EYXA 2D0QB 1ZLMA 2HCKA 1YJ9A 5J26A 2OTJT 2RNAA 4OMPA 2ENMA 4XTWA 3S6WA 3ASKA 2MF2A 1NEGA 3FJPA 3M53A 4XTXA 3RNJA 1VQ9T 2KYBA 1W1FA 2KDSA 4FYXB 5HK3A 3JCMf 1QKWA 4C5GA 3CCJQ 4PJMA 1ZSZC 1OPKA 3OYJA 2LT1A 4BD3A 2RJFA 5GAOn 2DF6A 4IIMA 4ANJA 3OYNA 3OYCA 3CXCA 4JLGA 2HSPA 2CH4W 2AKKA 3CMAT 3EG0A 1P92A 3MEVA 2QGFB 1M1GA 4JLIA 1TOVA 4JRIA 4O5VA 5DLQE 2HSEB 3P8HA 1QVFP 2D8JA 1Y7XA 1YIJA 2YRDA 3V7RA 2IPOB 5KYUB 4FYWB 2KNBB 4J6WA 1EX4A 1VQMT 1PSEA 2J06A 5GAN5 3M0SA 3WVDB 1BCOA 3H0HA 4M75E 3UA6A 1LOJA 5GAMf 2PVDB 3OW2A 1Q95G 5IXBA 4B6MA 1PM3A 4J9DA 1WPYA 2VASA 1VQ8T 1RAEB 1TG0A 3CCVT 5GANg 3CCRT 3SEMA 1Q86U 1VYVA 4ZN3A 4A4EA 4JZ4A 2NWMA 2EKOA 1Y57A 1NLOC 5IN1A 1YCSB 2R58A 4OP0A 1I81A 2QYZA 3G1JA 2VB6A 2L3PA 2CP5A 3WXMB 2D1XA 1YJ9Q 2CUBA 4EPCA 1WHKA 1YJWA 2E3HA 4C92B 2JM9A 1YJNQ 3CXCS 1JRIA 5KYNA 3QSUA 5DLOA 2ATCB 4BB7A 4E6RA 1ACMB 2CREA 5D7UA 4DBRA 2X4WA 1YHQT 3HRTA 3U23A 4LUDA 4KGVB 2JT4A 1ZBJA 1TH7A 1M5Q1 1V1CA 4LUEA 1WHMA 2M0OA 1SF9A 2DLPA 2C06A 1TUGB 1K9MR 4A4FA 1M8VA 1WJRA 2YHTA 1UEBA 1VQLA 1UFFA 5I2MA 2JTEA 5GMKh 5LJ5f 2RHYA 1BYMA 3PT9A 4N4GA 4F17A 2F69A 1RAHB 3LYIA 3HFNA 2XDBA 2JTMA 3M58A 3VV0A 3JCMW 1VQNT 4HVVA 1VQ4A 1X69A 1Q7YR 1E7OA 1K9MC 1E6HA 2J6OA 3M0QA 3S3MA 1ZA2B 1HYOA 1VQOA 4FSXA 4X34A 3GF5A 1D1AA 2LDMA 1ABOA 4FU6A 2YRVA 1KC8R 2RJDA 1T0JA 5CVIA 1BBZA 5LJ3d 2QK0A 4J7IA 4GLKA 4PKCC 2YT6A 1YITA 2DMOA 5CK9A 3MEWA 4E7ZA 2F1LA 1JO8A 4XTZA 3I55T 2FRWA 3E9FA 5EC7A 1OZ3A 2HKNA 1YJWQ 4A63B 2JNGA 1RI0A 3MEAA 3C4SA 2OTLQ 1FMWA 1MNEA 1TU0B 2A37A 1KQ2A 4JPBW 1WIEA 1FXXA 1KJWA 1QVGS 1Q7YC 3A98A 2JW4A 2VXFA 2CGHA 5HCKA 3M59A 1QW1A 3LWIA 1NLPC 3FEOA 5IH2A 3CCLA 2KRSA 4MZPA 2B86A 5ECAA 1OX9A 3HHTB 4VUBA 4PJOC 4OMQA 2V26A 1MHNA 2KXCA 1B34B 3CD6T 1TWBA 2F5TX 2XG8D 4BACA 3KBGA 1KK7A 2DVEA 3QYHB 4QW2A 4OGCA 2EGCA 4DBFA 1D0XA 1BCMA 4M77D 5FU6B 2MOXA 3BW1A 3DLLA 1PSFA 3TSZA 4J6YA 4DOVA 2HEQA 3HRUA 3I9QA 2E1HA 1QP3A 2PQWA 2XHCA 6AT1B 3HTRA 1VQ4Q 3I5SA 5I21A 5LJ3g 2HBPA 4D6WA 1NJIR 2KI7A 5LJ3j 2PVGB 2PUOB 1RAAB
chains in the Genus database with same CATH topology
1OV3A 2HDAA 2YUPA 2IIMA 5IHKA 5L23A 2KT8A 3PVQA 2FO0A 4J9CA 3PE0A 1GCPA 4HVWA 1I0CA 1JXOA 1ZUYA 4RTWA 2EGAA 1JQQA 2CDTA 2LMJA 3VS4A 4AFZC 3VS6A 1NYFA 1ABQA 4KRTA 2DL7A 1UE9A 2KEAA 4LNPA 4CC7A 2SRCA 2RMOA 4M4ZA 2KR3A 2EYWA 3I35A 2M51A 1SSHA 2OI3A 1T3SA 4J9BA 2M0YA 2K9GA 3QWXX 1AWXA 3EG3A 1T0HA 1QLYA 1M30A 1I07A 2AKLA 2ESWA 2ROLA 2KT1A 2JMCA 4X1VA 1WA7A 2PTKA 2V1RA 1X2QA 1K0XA 2KROA 1NM7A 3EHRA 1ZSGA 1K4US 2LQNA 1PNJA 4AFSC 1OEBA 2CT3A 4GBQA 3TSWA 3M0PA 1AEYA 3TVTA 4LN2A 4OMNA 5FW9A 2FPDA 1UUEA 3NHNA 4AG2C 1K76A 4RTTA 4RTYA 3THKA 1IO6A 1GCQA 5GJWB 3JV3A 1VYUA 2FPEA 2O31A 1GFDA 3REBB 2FEIA 2XMFA 4JJBA 2D8HA 2LP5A 4F16A 1BU1A 3NGPA 4JZ3A 1NG2A 1ZUUA 2F2XA 2J6KA 1FYNA 2DYBA 2KGTA 1BB9A 1MV3A 1SHFA 1YN8A 2PZ1A 1SHGA 2O2OA 2FRYA 1PKTA 2GNCA 1N5ZA 1JXMA 1RLPC 4GLMA 3PVLA 2DRKA 2VVKA 1GBRA 2L3QA 3EHQA 2AZVA 3CQTA 2JXBA 2L0AA 2DL5A 3ULRB 2C0IA 5I11A 1BK2A 1KSWA 1X6BA 1M3BA 1U5SA 1CSKA 5IXFA 2ECZA 1PHTA 4HVUA 2A28A 3R6NA 1Z9QA 2DJQA 3H0IA 2F2VA 4J9GA 2EGEA 1TUDA 3H0FA 4RTUA 1H3HA 2K6DA 4RUGA 4ZNXA 2EQIA 3QWYA 2CH4A 2DILA 1M8MA 2J6FA 1XOVA 1YP5A 3LH5A 1UJYA 2FPFA 4JJCA 2GTOA 2VWFA 1NYGA 3M0UA 2BTTA 1ZUKA 3VS7A 2KE9A 2EYXA 2LJ1A 2CT4A 1M27C 1ZLMA 2KBTA 4RTXA 2HCKA 1UHFA 2KRMA 1RUWA 2C0TA 4Y92A 2EKHA 1TUCA 2ENMA 2RNAA 4OMPA 2CSQA 3RBBB 3UATA 2OJ2A 1NEGA 1WXTA 3M0RA 3RNJA 2KYBA 3REAB 2YSQA 1W1FA 3O5ZA 1MUZA 2GBQA 2EPDA 4AFUC 1JU5C 2H8HA 1PWTA 1OOTA 1QKWA 1OPKA 1G2BA 1X43A 2DF6A 3EG1A 1AD5A 4IIMA 4EIKA 2LQWA 3H41A 2RQTA 2DX1A 3FJ5A 5FWBA 1FMKA 2HSPA 2CH4W 2AKKA 2J05A 2L2PA 2QDLA 3EG0A 1G83A 1KIKA 2FG0A 1HSQA 1WX6A 2JM8A 1YWPA 1GFCA 2SEMA 2D8JA 3M0TA 2DBKA 2DL3A 3KFVA 2ROTA 1UTIA 1UDLA 1LCKA 2ABLA 1H8KA 2KNBB 5IHIA 2J06A 2RQVA 3M0SA 3VS3A 3H0HA 3UA6A 1AWOA 1WI7A 2LNHB 1UHCA 5IXBA 2VKNA 1ARKA 4J9DA 3ZL7C 1B07A 1WDXA 1K0SA 3I5RA 4ORZA 1W70A 2K2MA 2C0OA 3VRYA 2DE0X 1U06A 2CUDA 1AOJA 1GCQC 1TG0A 1CKBA 1PRLC 4IIOA 3SEMA 1VYVA 2LCSA 2DL8A 1HJDA 4JZ4A 2NWMA 1Y57A 2W10A 2YUQA 1NLOC 2ED0A 1YCSB 2NUZA 1QCFA 2A36A 2LJ0A 4DEYA 1GBQA 4Z8AA 1U3OA 2MIOA 2L3PA 3IQLA 1W6XA 1S1NA 2EVRA 2D1XA 1SEMA 2CUBA 1AWJA 4R0KA 1VYTA 1K1ZA 2JM9A 4OMOA 5I22A 2J7IA 4CC4B 1UGVA 5FWCA 2KRNA 4J9IA 4E6RA 5IHNA 1Z9ZA 4HCKA 1ZX6A 2W0ZA 2CREA 1M3CA 3EG2A 1VA7A 1QWFA 2JS2A 3U23A 4LUDA 1YNZA 2K3BA 2JT4A 4Z89A 1ZBJA 2PNIA 3VS0A 4FSSA 1V1CA 4AFQC 4LUEA 2K7AA 3NPFA 2BZYA 4J9EA 1MV0B 1NEBA 2RN8A 4JJDA 2DLPA 1WXBA 2RQWA 2EW3A 2O9SA 1X27A 2MCNA 3SHWA 3VS2A 1QWEA 1UFFA 2KYMA 3UA7A 1QKXA 2EYYA 2JTEA 2LX7A 2YDLA 2A08A 1SRLA 1X6GA 2I0NA 4J9FA 2RPNA 1PRMC 4F17A 2V1QA 1Y0MA 2AK5A 1WLPB 4HVVA 4HXJA 2ED1A 1X69A 1E7OA 1K9AA 4CC3A 1E6HA 2J6OA 3M0QA 1J3TA 1B3QA 1WYXA 1RI9A 1UECA 2DBMA 2EBPA 1EFNA 2JMAA 2CSIA 1ABOA 2JS0A 1AZEA 4Z88A 2GGRA 2O9VA 1SRMA 1AVZC 1T0JA 1A0NB 1BBZA 4D8KA 2P4RA 4LE9A 2YUOA 4DEXA 1YWOA 1H92A 2YT6A 1X2KA 2DMOA 4K11A 1GRIA 1JO8A 2DVJA 2FRWA 5EC7A 2DM1A 4A63B 1JEGA 4AG1C 5GJVB 2EYZA 2A37A 3UF4A 2RQUA 4WCIA 4JPBW 2AZSA 4OMMA 1AWWA 1WIEA 1KJWA 2G6FX 2DL4A 3A98A 3VRZA 1HD3A 2JW4A 3VS5A 5HCKA 2K79A 4CC2A 1WFWA 2X3XD 1NLPC 1E6GA 2X3WD 5IH2A 2HBWA 2KRSA 4QT7A 2DRMA 2B86A 5ECAA 4OMQA 2KXCA 4D8DA 2F2WA 1OPLA 4J9HA 1WXUA 2KXDA 1GL5A 1SPKA 2EGCA 1UJ0A 3GBQA 4RTVA 2MOXA 3EGUA 2L3SA 2DA9A 2RQRA 3TSZA 2OAWA 2HEQA 3I9QA 3C0CA 1I1JA 2O88A 1UG1A 2BZXA 4F14A 1PKSA 2E5KA 1T3LA 1CKAA 2D0NA 2LZ6B 3VS1A 2GQIA 2DNUA 3NMZC 2GTJA 3I5SA 1M3AA 4OMLA 1RLQC 1KFZA 1AZGB 2BZ8A 2RF0A 4ESRA 2LJ3A 4RTZA 2YUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OV3 A;  2HDA A;  2YUP A;  2IIM A;  5IHK A;  5L23 A;  2KT8 A;  3PVQ A;  2FO0 A;  4J9C A;  3PE0 A;  1GCP A;  4HVW A;  1I0C A;  1JXO A;  1ZUY A;  4RTW A;  2EGA A;  1JQQ A;  2CDT A;  2LMJ A;  3VS4 A;  4AFZ C;  3VS6 A;  1NYF A;  1ABQ A;  4KRT A;  2DL7 A;  1UE9 A;  2KEA A;  4LNP A;  4CC7 A;  2SRC A;  2RMO A;  4M4Z A;  2KR3 A;  2EYW A;  3I35 A;  2M51 A;  1SSH A;  2OI3 A;  1T3S A;  4J9B A;  2M0Y A;  2K9G A;  3QWX X;  1AWX A;  3EG3 A;  1T0H A;  1QLY A;  1M30 A;  1I07 A;  2AKL A;  2ESW A;  2ROL A;  2KT1 A;  2JMC A;  4X1V A;  1WA7 A;  2PTK A;  2V1R A;  1X2Q A;  1K0X A;  2KRO A;  1NM7 A;  3EHR A;  1ZSG A;  1K4U S;  2LQN A;  1PNJ A;  4AFS C;  1OEB A;  2CT3 A;  4GBQ A;  3TSW A;  3M0P A;  1AEY A;  3TVT A;  4LN2 A;  4OMN A;  5FW9 A;  2FPD A;  1UUE A;  3NHN A;  4AG2 C;  1K76 A;  4RTT A;  4RTY A;  3THK A;  1IO6 A;  1GCQ A;  5GJW B;  3JV3 A;  1VYU A;  2FPE A;  2O31 A;  1GFD A;  3REB B;  2FEI A;  2XMF A;  4JJB A;  2D8H A;  2LP5 A;  4F16 A;  1BU1 A;  3NGP A;  4JZ3 A;  1NG2 A;  1ZUU A;  2F2X A;  2J6K A;  1FYN A;  2DYB A;  2KGT A;  1BB9 A;  1MV3 A;  1SHF A;  1YN8 A;  2PZ1 A;  1SHG A;  2O2O A;  2FRY A;  1PKT A;  2GNC A;  1N5Z A;  1JXM A;  1RLP C;  4GLM A;  3PVL A;  2DRK A;  2VVK A;  1GBR A;  2L3Q A;  3EHQ A;  2AZV A;  3CQT A;  2JXB A;  2L0A A;  2DL5 A;  3ULR B;  2C0I A;  5I11 A;  1BK2 A;  1KSW A;  1X6B A;  1M3B A;  1U5S A;  1CSK A;  5IXF A;  2ECZ A;  1PHT A;  4HVU A;  2A28 A;  3R6N A;  1Z9Q A;  2DJQ A;  3H0I A;  2F2V A;  4J9G A;  2EGE A;  1TUD A;  3H0F A;  4RTU A;  1H3H A;  2K6D A;  4RUG A;  4ZNX A;  2EQI A;  3QWY A;  2CH4 A;  2DIL A;  1M8M A;  2J6F A;  1XOV A;  1YP5 A;  3LH5 A;  1UJY A;  2FPF A;  4JJC A;  2GTO A;  2VWF A;  1NYG A;  3M0U A;  2BTT A;  1ZUK A;  3VS7 A;  2KE9 A;  2EYX A;  2LJ1 A;  2CT4 A;  1M27 C;  1ZLM A;  2KBT A;  4RTX A;  2HCK A;  1UHF A;  2KRM A;  1RUW A;  2C0T A;  4Y92 A;  2EKH A;  1TUC A;  2ENM A;  2RNA A;  4OMP A;  2CSQ A;  3RBB B;  3UAT A;  2OJ2 A;  1NEG A;  1WXT A;  3M0R A;  3RNJ A;  2KYB A;  3REA B;  2YSQ A;  1W1F A;  3O5Z A;  1MUZ A;  2GBQ A;  2EPD A;  4AFU C;  1JU5 C;  2H8H A;  1PWT A;  1OOT A;  1QKW A;  1OPK A;  1G2B A;  1X43 A;  2DF6 A;  3EG1 A;  1AD5 A;  4IIM A;  4EIK A;  2LQW A;  3H41 A;  2RQT A;  2DX1 A;  3FJ5 A;  5FWB A;  1FMK A;  2HSP A;  2CH4 W;  2AKK A;  2J05 A;  2L2P A;  2QDL A;  3EG0 A;  1G83 A;  1KIK A;  2FG0 A;  1HSQ A;  1WX6 A;  2JM8 A;  1YWP A;  1GFC A;  2SEM A;  2D8J A;  3M0T A;  2DBK A;  2DL3 A;  3KFV A;  2ROT A;  1UTI A;  1UDL A;  1LCK A;  2ABL A;  1H8K A;  2KNB B;  5IHI A;  2J06 A;  2RQV A;  3M0S A;  3VS3 A;  3H0H A;  3UA6 A;  1AWO A;  1WI7 A;  2LNH B;  1UHC A;  5IXB A;  2VKN A;  1ARK A;  4J9D A;  3ZL7 C;  1B07 A;  1WDX A;  1K0S A;  3I5R A;  4ORZ A;  1W70 A;  2K2M A;  2C0O A;  3VRY A;  2DE0 X;  1U06 A;  2CUD A;  1AOJ A;  1GCQ C;  1TG0 A;  1CKB A;  1PRL C;  4IIO A;  3SEM A;  1VYV A;  2LCS A;  2DL8 A;  1HJD A;  4JZ4 A;  2NWM A;  1Y57 A;  2W10 A;  2YUQ A;  1NLO C;  2ED0 A;  1YCS B;  2NUZ A;  1QCF A;  2A36 A;  2LJ0 A;  4DEY A;  1GBQ A;  4Z8A A;  1U3O A;  2MIO A;  2L3P A;  3IQL A;  1W6X A;  1S1N A;  2EVR A;  2D1X A;  1SEM A;  2CUB A;  1AWJ A;  4R0K A;  1VYT A;  1K1Z A;  2JM9 A;  4OMO A;  5I22 A;  2J7I A;  4CC4 B;  1UGV A;  5FWC A;  2KRN A;  4J9I A;  4E6R A;  5IHN A;  1Z9Z A;  4HCK A;  1ZX6 A;  2W0Z A;  2CRE A;  1M3C A;  3EG2 A;  1VA7 A;  1QWF A;  2JS2 A;  3U23 A;  4LUD A;  1YNZ A;  2K3B A;  2JT4 A;  4Z89 A;  1ZBJ A;  2PNI A;  3VS0 A;  4FSS A;  1V1C A;  4AFQ C;  4LUE A;  2K7A A;  3NPF A;  2BZY A;  4J9E A;  1MV0 B;  1NEB A;  2RN8 A;  4JJD A;  2DLP A;  1WXB A;  2RQW A;  2EW3 A;  2O9S A;  1X27 A;  2MCN A;  3SHW A;  3VS2 A;  1QWE A;  1UFF A;  2KYM A;  3UA7 A;  1QKX A;  2EYY A;  2JTE A;  2LX7 A;  2YDL A;  2A08 A;  1SRL A;  1X6G A;  2I0N A;  4J9F A;  2RPN A;  1PRM C;  4F17 A;  2V1Q A;  1Y0M A;  2AK5 A;  1WLP B;  4HVV A;  4HXJ A;  2ED1 A;  1X69 A;  1E7O A;  1K9A A;  4CC3 A;  1E6H A;  2J6O A;  3M0Q A;  1J3T A;  1B3Q A;  1WYX A;  1RI9 A;  1UEC A;  2DBM A;  2EBP A;  1EFN A;  2JMA A;  2CSI A;  1ABO A;  2JS0 A;  1AZE A;  4Z88 A;  2GGR A;  2O9V A;  1SRM A;  1AVZ C;  1T0J A;  1A0N B;  1BBZ A;  4D8K A;  2P4R A;  4LE9 A;  2YUO A;  4DEX A;  1YWO A;  1H92 A;  2YT6 A;  1X2K A;  2DMO A;  4K11 A;  1GRI A;  1JO8 A;  2DVJ A;  2FRW A;  5EC7 A;  2DM1 A;  4A63 B;  1JEG A;  4AG1 C;  5GJV B;  2EYZ A;  2A37 A;  3UF4 A;  2RQU A;  4WCI A;  4JPB W;  2AZS A;  4OMM A;  1AWW A;  1WIE A;  1KJW A;  2G6F X;  2DL4 A;  3A98 A;  3VRZ A;  1HD3 A;  2JW4 A;  3VS5 A;  5HCK A;  2K79 A;  4CC2 A;  1WFW A;  2X3X D;  1NLP C;  1E6G A;  2X3W D;  5IH2 A;  2HBW A;  2KRS A;  4QT7 A;  2DRM A;  2B86 A;  5ECA A;  4OMQ A;  2KXC A;  4D8D A;  2F2W A;  1OPL A;  4J9H A;  1WXU A;  2KXD A;  1GL5 A;  1SPK A;  2EGC A;  1UJ0 A;  3GBQ A;  4RTV A;  2MOX A;  3EGU A;  2L3S A;  2DA9 A;  2RQR A;  3TSZ A;  2OAW A;  2HEQ A;  3I9Q A;  3C0C A;  1I1J A;  2O88 A;  1UG1 A;  2BZX A;  4F14 A;  1PKS A;  2E5K A;  1T3L A;  1CKA A;  2D0N A;  2LZ6 B;  3VS1 A;  2GQI A;  2DNU A;  3NMZ C;  2GTJ A;  3I5S A;  1M3A A;  4OML A;  1RLQ C;  1KFZ A;  1AZG B;  2BZ8 A;  2RF0 A;  4ESR A;  2LJ3 A;  4RTZ A;  2YUN A; 
#chains in the Genus database with same CATH topology
 2XDD A;  1R77 A;  1OV3 A;  2IIM A;  2XID A;  1LNX A;  3PE0 A;  1I0C A;  1JXO A;  3KXT A;  4RTW A;  5GAN f;  2K57 A;  4AFZ C;  2EYQ A;  4M78 F;  5KE3 A;  1JJ2 P;  3M56 A;  4BUG A;  4FIB A;  2DL7 A;  4LNP A;  2SRC A;  3BFM A;  3GOX A;  2KR3 A;  4L6V 5;  4M78 E;  3G6E Q;  3RR6 A;  1NJI C;  1M90 R;  1SSH A;  4BE0 A;  3OSV A;  4XTY A;  1W4S A;  2M02 A;  2K9G A;  1AWX A;  1T0H A;  5GMK l;  3RKY A;  3MP8 A;  2YLC A;  4X1V A;  3X20 B;  4QVC A;  1QMC A;  4RKU E;  4LDW A;  2V1R A;  1C0M A;  1ZSG A;  1TTH B;  2PUK B;  4M78 A;  3A5Z B;  3J80 E;  4Z02 A;  1FWZ A;  3E1S A;  2CT3 A;  5LJ5 h;  4GBQ A;  2CZ6 B;  3CBM A;  1AEY A;  2AT1 B;  3TVT A;  5FRO A;  2VXE A;  3OY9 A;  2WAC A;  4AG2 C;  4RTT A;  3THK A;  1GCQ A;  5GJW B;  1M90 C;  2FPE A;  3EFO A;  2E6Z A;  2AIR B;  2VYT A;  3RES A;  3SWN C;  3V8L A;  4F16 A;  1Q86 R;  1BU1 A;  1O75 A;  2F2X A;  2DYB A;  1YJ9 T;  3E2U A;  2RI5 A;  1QVP A;  1YN8 A;  2PZ1 A;  2O2O A;  2FRY A;  1RLP C;  4GLM A;  3I56 A;  4PJO D;  1M9S A;  1MMD A;  2JZ2 A;  2L89 A;  2Y90 A;  4HKE A;  1GBR A;  2L3Q A;  3EAE A;  1PC0 A;  4F04 B;  2L0A A;  4BI4 A;  1F1B B;  2C0I A;  2HMA A;  1QVF A;  1U5S A;  2A28 A;  3UPU A;  2QDY B;  1ZHI A;  2DJQ A;  3H0I A;  1TUD A;  3JCM V;  3WVE B;  1Q86 C;  1G3Y A;  2VUB A;  4C5H A;  2RHZ A;  4RUG A;  4ZNX A;  2OX7 A;  4ELZ C;  4M7A C;  1YIJ T;  2IVW A;  1M1K R;  4KH0 B;  1UJY A;  4JJC A;  1U8R A;  2GTO A;  2MMP A;  1NYG A;  3M0U A;  2BIV A;  1K9M U;  2BTT A;  4NOY A;  4OB1 B;  4JS4 A;  1UHF A;  3KUF A;  3HRS A;  1RUW A;  2LVM A;  4Y92 A;  2EKH A;  1FMV A;  2CSQ A;  5KYX A;  3CME A;  3PMI A;  3LX7 A;  3VYG A;  3RKW A;  2GBQ A;  2ZCF B;  2EPD A;  2QA4 A;  1JU5 C;  2CZ7 B;  4A54 A;  1OOT A;  3CCS Q;  2DK3 A;  4EDU A;  2Y4X A;  4PJL A;  1M1K C;  3EG1 A;  4EIK A;  4II1 A;  2LQW A;  3H41 A;  5FWB A;  4M77 G;  2QDL A;  3G4S Q;  4OGE A;  1YJW T;  4PFP A;  2JM8 A;  1Q81 R;  1QVF S;  2DBK A;  2E4H A;  1UTI A;  1D1C A;  1UDL A;  1LCK A;  2ABL A;  4QVD A;  3QUI A;  1BIB A;  4PJJ A;  3CCJ A;  4PK4 A;  4E7S A;  5GAN h;  2QTX A;  1PG5 B;  2E5Q A;  2LNH B;  3OS2 A;  4M78 B;  4X9C A;  3FRN A;  5LJ3 f;  4E2F B;  1ARK A;  3ZL7 C;  2DZC A;  1B07 A;  3RIR A;  1K0S A;  2MI6 A;  4N0A A;  2K2M A;  3CCU Q;  2JN0 A;  3QZ5 B;  4PLI A;  1AOJ A;  3JB9 H;  4KGX B;  1CKB A;  3EFO B;  3ZFJ A;  4IIO A;  1Q81 C;  1VQL T;  4N0A C;  2DL8 A;  4FYV B;  2IG0 A;  2YUQ A;  2ED0 A;  1YBY A;  2NUZ A;  1QCF A;  1IRX A;  1GBQ A;  3UDC A;  3CPW P;  2MWP A;  3L2U A;  3OMG A;  3M55 A;  2WSE E;  1WNL A;  1AWJ A;  2MPX C;  4R0K A;  1VYT A;  1W2B S;  2KY9 A;  4C92 C;  1VQ4 T;  2QQS A;  2J7I A;  1TSF A;  1UGV A;  1RAF B;  2HNI A;  1VQO T;  2W0Z A;  1MMG A;  1DJ7 B;  1M3C A;  3F70 A;  1K8A R;  4LDU A;  4M7A D;  2JS2 A;  1EIF A;  2HD0 A;  5AT1 B;  2PNI A;  3VS0 A;  1IHV A;  1YIT T;  1C1A A;  1K73 R;  1MMN A;  2BZY A;  3INZ A;  1LPL A;  3JB9 F;  1H64 1;  1BIA A;  2EW3 A;  1VIE A;  4BY6 C;  4F7U F;  3J7A F;  2MWO A;  7AT1 B;  3SHW A;  1YJN A;  3G6E T;  3VS2 A;  2K4Y A;  3QG1 A;  3UA7 A;  3H9N A;  1QCO A;  4F7U E;  2EYY A;  4HCC A;  2LX7 A;  5KCH A;  3OMC A;  2EQK A;  5GAN 4;  2DD5 A;  5KYX B;  3Q1J A;  4PJO G;  4B9X A;  2JUF A;  1K8A C;  3CCL T;  3SD4 A;  2V1Q A;  3BY7 A;  1N6A A;  1M90 U;  1OYX A;  1Y0M A;  9ATC B;  1N8R R;  4JRQ A;  1K73 C;  2YLB A;  3L42 A;  5LL6 S;  1NPP A;  2DD4 A;  4A4K A;  5A0G A;  3QHS A;  4CC3 A;  4F7U A;  1RI9 A;  5HKC A;  2RI3 A;  2EBP A;  2E12 A;  4M75 F;  3RMS A;  3DLM A;  4Z88 A;  2FHD A;  2FL7 A;  1SRM A;  3CEY A;  1AVZ C;  2COZ A;  1A0N B;  3D7S B;  3OBW A;  4XU0 A;  1YFN A;  2P4R A;  4K11 A;  1KQ1 A;  2QAS A;  2PVO B;  1KQS S;  3FLG A;  4XTV A;  1R0C B;  2O4X B;  1LJO A;  4ZGJ B;  1N8R C;  1MMA A;  3EFR A;  2EYZ A;  4KUI A;  3PGG A;  1VQ5 A;  1S72 Q;  2G6F X;  2RI2 A;  3TRE A;  1JJ2 A;  2K79 A;  2ZGW A;  3URG A;  4CC2 A;  3L2R A;  1B34 A;  2FB7 A;  4M75 A;  1QQJ A;  3H8Z A;  3RUX A;  2X3W D;  4QT7 A;  2DRM A;  1VQ7 Q;  3QKJ A;  2VV5 A;  2DXU A;  1YI2 Q;  3A8L B;  4M75 C;  2M1H A;  4IUV A;  1BKB A;  1OPL A;  4IUQ A;  4QQG A;  2KXD A;  4JRP A;  1GL5 A;  2OTL A;  3VYH B;  2QI2 A;  3EGX A;  1SSF A;  4IUU A;  5FU6 C;  4C92 D;  5FRM A;  3RMQ A;  2OAW A;  2RJC A;  1BI0 A;  1Y07 A;  2KK4 A;  3C0C A;  5CIU A;  4JS5 A;  1UG1 A;  3EG9 B;  1PKS A;  1M1K U;  2E5K A;  1CKA A;  4ZGD B;  4M7D F;  3VS1 A;  4OF1 A;  2DNU A;  4BE1 A;  3NMZ C;  2GTJ A;  2LX9 A;  3CCE Q;  4OB3 B;  5KYY B;  2BZ8 A;  4BY6 B;  2RF0 A;  4BI8 B;  4C8Q F;  4M7D E;  3OW2 S;  4ESR A;  2YUN A;  1SKU B;  2HDA A;  2K5F A;  4C8Q E;  2GF7 A;  3LGL A;  1RAI B;  4J9C A;  1NPR A;  1WHJ A;  3OYA A;  1I5L A;  3V7S A;  3VS4 A;  2ZZD A;  1D0Z A;  3CC7 Q;  4XK8 E;  2RK1 A;  4MDW A;  1NYF A;  4EMH A;  4KRT A;  4MML A;  4M7D A;  2LTO A;  5A0D A;  3JCM J;  4OMF B;  5CKF A;  4M4Z A;  1VQ5 Q;  3I56 T;  2HQX A;  2DTH A;  1Y96 A;  2DYI A;  1T3S A;  4C8Q A;  4OB0 B;  3CC2 Q;  3JCM b;  3EG3 A;  1Q81 U;  1KD1 R;  4M7D C;  4LDY A;  1M30 A;  2I2L A;  2AKL A;  3BE3 A;  2ROL A;  3OBY A;  1VQK Q;  2AHJ B;  3QXE B;  4F7U B;  4C8Q C;  4M7A G;  2KRO A;  2DEU A;  2LQN A;  3RER A;  8AT1 B;  3M0P A;  3JCM h;  1OI1 A;  2E41 A;  5FW9 A;  1K76 A;  3G6E A;  5D6Y A;  2V8K A;  3JV3 A;  3LW5 E;  2FYK A;  2O31 A;  2QEX A;  4JJB A;  4KBM B;  2D8H A;  4OB2 B;  1HXD A;  4RG2 A;  2BUD A;  2LP5 A;  1KD1 C;  3PMT A;  2YRC A;  2E64 A;  2K5I A;  1HK9 A;  4JZ3 A;  2O01 E;  2J6K A;  1FYN A;  1D09 B;  1BB9 A;  1MV3 A;  5EG2 A;  1SHF A;  3CME T;  3L2Q A;  2GNC A;  4M75 B;  4P5N A;  1VQ6 Q;  2DXT A;  2DRK A;  2HL3 A;  2VVK A;  1XTD A;  2QA4 T;  1QP2 A;  3V7C A;  2L5Q A;  3EH2 A;  2DL5 A;  4Y91 A;  4J8O A;  2D6F A;  5GAM h;  5I11 A;  4J6X A;  1M3B A;  3P8B B;  3QYG B;  4HVU A;  4MZT A;  3R6N A;  1Z9Q A;  2GCX A;  4RTU A;  1D1B A;  3EGX B;  1H3H A;  2CP0 A;  3CXC P;  1K8A U;  2DIL A;  1IGU A;  1V76 A;  5DM7 R;  1K73 U;  1XOV A;  4KT0 E;  2DTI A;  3RKX A;  1V29 B;  1PD0 A;  2E65 A;  2D9T A;  3CCJ T;  1D3B B;  4FCY A;  2X4Y A;  2ZPG B;  1M27 C;  4KGZ B;  2CZ0 B;  2LC4 A;  2HZY A;  2KRM A;  2C0T A;  1TUC A;  4XU3 A;  3RBB B;  3UAT A;  4E7K A;  2RHI A;  3MHX A;  4N4H A;  3REA B;  2RHU A;  3CPW A;  1UGR B;  1MUZ A;  2EWN A;  3CC4 Q;  3N5B B;  4BE2 A;  2NUP B;  3HL8 A;  2H8H A;  3QDR B;  2DIG A;  1N8R U;  1OUL A;  2QEX Q;  3TCJ A;  1N9S A;  2M9U A;  2RQT A;  1VQP A;  3FC3 A;  2DX1 A;  4A4H A;  3M4G A;  1FMK A;  4M7D B;  3X24 B;  2J05 A;  4C92 G;  2OTJ Q;  5GAN 7;  1KIK A;  2FG0 A;  2F5K A;  5A0L A;  1Y96 B;  3VU3 C;  1WX6 A;  4C8Q B;  1VQ9 Q;  5GMK j;  3OYE A;  1YWP A;  2SEM A;  1TS9 A;  3DB4 A;  3M0T A;  3MJX A;  1M1F A;  3V8J A;  1G5V A;  1H8K A;  5FLX E;  4Y28 E;  3S3O A;  2X9H A;  3CPF A;  3M57 A;  5D6X A;  3CCS A;  1OU9 A;  1SG5 A;  1AWO A;  1WI7 A;  4M78 C;  2MAM A;  3BDL A;  2X51 A;  1UHC A;  1WDX A;  3A8M B;  1W70 A;  2C0O A;  1ZQ1 A;  3G4S A;  1U06 A;  2COY A;  1GCQ C;  3MCA B;  2ZPB B;  1PRL C;  2HQH A;  3JCM Q;  1QVG P;  1YJN T;  2DJZ A;  2L3R A;  2XIC A;  4QKU A;  1PCX A;  2LCS A;  1VQM Q;  3TU4 K;  1HJD A;  1YCY A;  1I8F A;  2W10 A;  4PLL A;  3ER0 A;  1U3O A;  3FB9 A;  2MIO A;  4AT1 B;  1VQ8 Q;  1S1N A;  2EVR A;  1RAB B;  2NYS A;  2G3R A;  3CCR Q;  3CCU A;  4OMO A;  5I22 A;  5FWC A;  2KRN A;  2DO3 A;  2QGG A;  4XAX B;  2KVQ G;  2QQB A;  5CKD A;  4JDS A;  3O8V A;  4LDV A;  3UWN A;  2A3L A;  3GLX A;  1VA7 A;  1VQP Q;  1G3T A;  4XU2 A;  2K3B A;  4IUP A;  3M9Q A;  4FSS A;  3OQ5 A;  4MZM A;  2R57 A;  2DPP B;  2A0F B;  4AFQ C;  3TQ7 P;  1N9R A;  1NEB A;  1OZ2 A;  2MYS A;  5GAM j;  2LRQ A;  1WZO A;  2RQW A;  1KHI A;  2EIF A;  2RM4 A;  2MCN A;  1WJS A;  1VQ5 T;  3QII A;  3HSB A;  1QWE A;  3JCM X;  2VC8 A;  2E3I A;  1YHQ Q;  2KMT A;  2E10 A;  3CCQ A;  2XK0 A;  2P4T A;  1X6G A;  3MP6 A;  1BI3 A;  4EMK A;  2EQM A;  5GAO l;  2RPN A;  3GPL A;  1VUB A;  3HKS A;  2QTV A;  2AK5 A;  3MO8 A;  3V8K A;  1WLP B;  5GAO m;  2QAZ A;  3OS1 A;  2CP7 A;  1KD1 U;  2JTF A;  2ED1 A;  4EMK C;  5GMK e;  2K5L A;  2RO0 A;  1K9A A;  4FL6 A;  2OTL T;  1J3T A;  1UEC A;  2DBM A;  2GFA A;  5KYW A;  3S3N A;  2JMA A;  2L8D A;  2JS0 A;  2DZ9 A;  2LQK A;  2GGR A;  2O4X A;  2O9V A;  1BI2 A;  2WSC E;  5C6S A;  1IGQ A;  1YWO A;  1H92 A;  4GY5 A;  2DXB A;  2DIQ A;  1GRI A;  1Q82 U;  1KHC A;  2EJG A;  5FRN A;  2RA2 A;  3JCM P;  3GNF B;  2BKD N;  5CQX A;  1JEG A;  4C0Z A;  4M78 D;  2WSF E;  4AG1 C;  5GJV B;  2ZPE B;  2RQU A;  4WCI A;  2AZS A;  4OMM A;  1AWW A;  1AHJ B;  3MP1 A;  1VOM A;  2DL4 A;  3VRZ A;  5GAN 6;  3VS5 A;  3QPH A;  5I2S A;  1D0Y A;  1E6G A;  3BDU A;  3SB2 A;  1IZ6 A;  5LJ5 j;  5GAN 2;  3DKM A;  4IUR A;  3JCM e;  1XNI A;  4TVR A;  3M54 A;  4A4G A;  1WXU A;  5CR2 A;  1UGP B;  2HL5 C;  1SPK A;  1UJ0 A;  3GBQ A;  3EG9 A;  4RTV A;  1S72 A;  4IUT A;  4O6J A;  3CCQ Q;  2L3S A;  2V8I A;  2DA9 A;  8ATC B;  5L8R E;  4C0G A;  5KYY A;  1I1J A;  2O88 A;  3GNG A;  3CD6 Q;  4C0F A;  1VQ7 A;  1I5O B;  4J83 A;  2D0N A;  1YI2 A;  2LZ6 B;  2GQI A;  3G71 Q;  1M3A A;  3JAM E;  5GAM e;  4DBQ A;  1PD1 A;  3EFS A;  1KFZ A;  1G3W A;  4PJN A;  2LJ3 A;  3EGD A;  3C94 A;  5M9O A;  2DAQ A;  2HAX A;  1GXI E;  2YUP A;  2QEX T;  2CP6 A;  5IHK A;  5L23 A;  4E7J A;  5GAN d;  3PVQ A;  2COW A;  2MK5 A;  4HVW A;  3SDZ A;  1NZ9 A;  4ATO A;  2P0Q A;  2DKG A;  2EGA A;  2RJE A;  1JQQ A;  2CDT A;  2LMJ A;  4PNO A;  4R55 A;  1ZSZ A;  4MDX A;  3VS6 A;  3HP9 A;  4NL3 A;  4HT8 A;  3OYH A;  1BI1 A;  1UE9 A;  4CC7 A;  3OB9 A;  2R5M A;  5CKH A;  4EMK B;  3CCE A;  2K3Y A;  3LLR A;  2M51 A;  2OI3 A;  3MKD A;  2LCC A;  4J9B A;  1X6O A;  2A7Y A;  3HPW A;  3QWX X;  3ME9 A;  3OYL A;  4FW1 A;  3HFO A;  3AHU A;  4JRK A;  2ESW A;  1VIF A;  1WQ7 A;  2LQ8 A;  5KE2 A;  1UGQ B;  4NL2 A;  5KYW B;  3NTI A;  2K3X A;  3EHR A;  4FW2 A;  2XU8 A;  1M2V A;  1WHH A;  3CC7 A;  4AFS C;  4M77 F;  3TSW A;  4LN2 A;  1H3Z A;  1UUE A;  3NHN A;  1WJQ A;  4ZTF A;  3DB3 A;  4L5G A;  1VYU A;  2X35 A;  4PFO A;  4M77 E;  1GFD A;  4ELY C;  2CZ1 B;  3CC2 A;  1AT1 B;  3EH1 A;  1Y71 A;  1JB0 E;  2JVV A;  1NG2 A;  1ZUU A;  5GAN 3;  2KGT A;  5LJ5 e;  1VQK A;  1SHG A;  2GQV A;  1PKT A;  1N5Z A;  5GAN j;  3OYI A;  1RAG B;  2AZV A;  4M77 A;  2JXB A;  4LD6 A;  4BI3 A;  3OYF A;  1BK2 A;  1KSW A;  1WQW A;  1VQP T;  2FZC B;  5LJ3 h;  5IXF A;  2DEQ A;  1M4Z A;  4OVA A;  4M77 C;  2F2V A;  4J9G A;  2EGE A;  3H0F A;  1W2B P;  3AT1 B;  3C95 A;  2DER A;  2CYZ B;  1R0B G;  1D3B A;  2B8A A;  2CH4 A;  2YWW A;  2EQU A;  1M8M A;  1U1T A;  1VQ6 A;  2J6F A;  3CCM A;  2FZK B;  2RH2 A;  2X4X A;  2XKO C;  4M78 G;  3LH5 A;  4RMO A;  3M5A A;  2FPF A;  3CCS T;  2VWF A;  3J81 E;  1ZUK A;  4JUV A;  1QVG A;  3VS7 A;  1EZZ B;  4C0D C;  3GIB A;  2KE9 A;  2LJ1 A;  3JRZ A;  2CT4 A;  2KBT A;  3LH0 A;  4RTX A;  2NUP A;  4BDZ A;  3G4S T;  4KUD K;  3EGD B;  1JJ2 S;  5AYF A;  2OJ2 A;  1WXT A;  3M0R A;  1YIJ Q;  2EAY A;  2YSQ A;  2H3J A;  2HQE A;  5FU7 C;  4CRI A;  4E7L A;  3O5Z A;  4AFU C;  1PWT A;  4B9W A;  1ZSZ B;  1MND A;  1G2B A;  1X43 A;  1AD5 A;  3MPU B;  5KH6 A;  3FJ5 A;  3JCM c;  2L2P A;  2LT4 A;  3VUB A;  1G83 A;  2DTO A;  1HSQ A;  1O9S A;  4J7F A;  3JB9 D;  1WHG A;  3QO3 A;  3CCU T;  1GFC A;  2ZPF B;  4N4I A;  4A53 A;  4PJO F;  2DL3 A;  3KFV A;  2ROT A;  4DQ2 A;  3P8D A;  4ZGE B;  1Q82 R;  4ZTJ A;  2E70 A;  4PJO E;  5IHI A;  4DOW A;  3CC4 A;  1RL2 A;  2RQV A;  3VS3 A;  2V8J A;  4MMK A;  3ZEH A;  4IKF A;  3X26 B;  1M2V B;  2FZG B;  2KAF A;  1C6V X;  3CBO A;  3JSC A;  2VKN A;  1I4K 1;  2E6N A;  3PFS A;  1KQS P;  3I5R A;  4ORZ A;  2EFI A;  2JOY A;  5CKE A;  2DE0 X;  4FT2 A;  2YXY A;  3VRY A;  2CUD A;  2OTJ A;  2RK2 A;  3OYK A;  4L59 A;  1VQ9 A;  2QQR A;  1ZA1 B;  3GP8 A;  4EMG A;  4QVZ A;  2EJF A;  3CCM Q;  4PJO A;  4KH1 B;  5GAN e;  1UB4 A;  3PIP A;  3CCQ T;  4HT9 A;  1X75 C;  4LD9 K;  1Q82 C;  4M75 D;  4Q5W A;  1KC8 C;  2A36 A;  1XJW B;  2LJ0 A;  4DEY A;  4Z8A A;  1OU8 A;  3CMA A;  4E7H A;  3IQL A;  1W6X A;  1SEM A;  2JJ9 A;  3OA6 A;  4M77 B;  2BE9 B;  2OAU A;  3LGF A;  3G71 T;  1K1Z A;  2X4J A;  4CC4 B;  1VQL Q;  4J9I A;  1KG1 A;  5IHN A;  3L2W A;  5J3B A;  1Z9Z A;  4HCK A;  1ZX6 A;  4UC4 A;  1VQM A;  3ZBD A;  3EG2 A;  1RAC B;  2HKQ B;  1QWF A;  3OYG A;  1YNZ A;  2P84 A;  4Z89 A;  5CCA A;  1WHL A;  2P0P A;  3L2Z A;  2K7A A;  4J9E A;  3NPF A;  4C0D B;  1MV0 B;  1U1S A;  3NTH A;  2RN8 A;  4JJD A;  5GAN 8;  1VQ8 A;  3PIO A;  3CCV A;  1B7T A;  1WXB A;  3E19 A;  3LWH A;  2O9S A;  1X27 A;  3CCR A;  1VQO Q;  3OW2 P;  3JCM d;  3QJ6 A;  2KYM A;  4RCC A;  1QKX A;  5FU7 B;  3OSS C;  2YDL A;  2A08 A;  5CQY A;  1SRL A;  3T9N A;  1YIT Q;  5GMK i;  2R5A A;  2I0N A;  4J9F A;  3SFM A;  1PRM C;  3VJP A;  3PTA A;  1IRE B;  2CS7 A;  2FVU A;  4V2S A;  4HXJ A;  4M7D D;  2CP3 A;  2CKK A;  1B3Q A;  1WYX A;  2CP2 A;  2EQJ A;  1EFN A;  1S72 T;  4C8Q D;  2CSI A;  4QQ6 A;  5IT9 E;  1AZE A;  4RCB A;  3A8O B;  5GAM d;  1YHQ A;  5HK0 A;  1OQK A;  3CCL Q;  3OYB A;  4D8K A;  4LE9 A;  2YUO A;  4ME7 A;  4DEX A;  4LXC A;  5DY9 A;  1X2K A;  2XI9 A;  5GMK m;  3QDF A;  3CMA Q;  3OS5 A;  1XQH A;  2DVJ A;  4DA4 A;  1R8O B;  3VUZ A;  1VQ7 T;  2DM1 A;  3QBY A;  3UT1 A;  1YI2 T;  2BE7 D;  5D6W A;  2QQA A;  5KCO A;  4X9D A;  3SWN A;  2QG9 B;  3UF4 A;  4RG8 A;  1HD3 A;  1RAD B;  1M2O A;  4M7A F;  3FIF A;  1WFW A;  2X3X D;  1X01 A;  4PFZ A;  2HBW A;  2RD1 A;  3JCM g;  2DET A;  4M7A E;  1MGQ A;  1NE8 A;  3CPW S;  4PJO B;  5HY6 A;  3M4Y A;  3X25 B;  4D8D A;  4E47 A;  2F2W A;  1VQN A;  3CCV Q;  4ZN1 A;  3A1P A;  4J9H A;  4C5I A;  1JBM A;  3CCE T;  2KSS A;  3JB9 G;  4JJN K;  2VGM A;  3EGU A;  5C0M A;  1NBE B;  2RQR A;  4M7A A;  4F7U G;  3MET A;  4XTU A;  4R56 A;  2BZX A;  5CKB A;  4F14 A;  3I55 A;  1T3L A;  5GAM g;  2DXC A;  2NUT A;  1LVK A;  3CC7 T;  1UGS B;  4OML A;  1IXD A;  1RLQ C;  5LJ3 e;  1AZG B;  2QQ9 A;  4DBH A;  2ZPH B;  5LJ5 d;  4RTZ A;  3H6Z A;  2M16 A;  5A2Q E;  3R6O A;  1TXQ A;  1OX8 A;  4KUL A;  3CC2 T;  2KT8 A;  4CI0 C;  2FO0 A;  1GCP A;  4YTL A;  1ZUY A;  4FYY B;  4M75 G;  1VQK T;  3A8H B;  3CD6 A;  3X28 B;  2VGN A;  1ABQ A;  4XU1 A;  4WF2 A;  2KEA A;  3G71 A;  2RMO A;  3L1A A;  3NFC A;  2EYW A;  2XD0 A;  3I35 A;  4E7I A;  1WGS A;  1W2B A;  4HCZ A;  2M0Y A;  3NTK A;  2RHX A;  4XQ3 A;  3A8G B;  1Q7Y U;  1QLY A;  3OYD A;  1I07 A;  3FDR A;  2KT1 A;  2JMC A;  4QQD A;  1IHW A;  5KYU A;  4NS5 A;  1WA7 A;  2PTK A;  1KC8 U;  1VQN Q;  4HA8 A;  1X2Q A;  1K0X A;  1NM7 A;  1K4U S;  3G7Z A;  3I56 Q;  1PNJ A;  1OEB A;  1QCN A;  1IB8 A;  1VQ6 T;  3CCM T;  4OMN A;  2FPD A;  4C92 F;  3PNW C;  1N27 A;  5CAI A;  4RTY A;  3CBP A;  1G8X A;  1IO6 A;  3JB9 I;  4HCB A;  3C12 A;  3QZ9 B;  3REB B;  2FEI A;  5CO7 A;  4C92 E;  2XMF A;  2GFU A;  5GAO q;  2XDP A;  3SWN B;  5LJ5 g;  2ZAE A;  3NGP A;  3OS0 A;  4J5Y A;  3JB9 J;  3I55 Q;  2P0K A;  1FX7 A;  4FM4 B;  3RDV A;  2LCL A;  3VKI A;  4FT4 A;  1JXM A;  3PVL A;  4C5E A;  1G3S A;  3EHQ A;  3CQT A;  3E9G A;  1ZBX A;  2H3E B;  4C92 A;  3ULR B;  2LNV A;  4M7D G;  2K2V A;  2KQW A;  1X6B A;  3OYY A;  1CSK A;  2ECZ A;  1PHT A;  5J39 A;  4C8Q G;  2Z0W A;  2RB6 A;  4WTO B;  2ZPI B;  3CME Q;  4AMC A;  4PL6 A;  2NLU A;  2K6D A;  2PU9 B;  3QJY A;  2EQI A;  3QWY A;  2EJ9 A;  2QXF A;  4LDX A;  4M7A B;  4BDY A;  2QA4 Q;  3L2V A;  2Y4Y A;  3TEE A;  1KQS A;  1YP5 A;  5GAO p;  3CC4 T;  3MEU A;  5GAO r;  2DFU A;  3OYM A;  1NJI U;  2NUT B;  5IAY A;  2EYX A;  2D0Q B;  1ZLM A;  2HCK A;  1YJ9 A;  5J26 A;  2OTJ T;  2RNA A;  4OMP A;  2ENM A;  4XTW A;  3S6W A;  3ASK A;  2MF2 A;  1NEG A;  3FJP A;  3M53 A;  4XTX A;  3RNJ A;  1VQ9 T;  2KYB A;  1W1F A;  2KDS A;  4FYX B;  5HK3 A;  3JCM f;  1QKW A;  4C5G A;  3CCJ Q;  4PJM A;  1ZSZ C;  1OPK A;  3OYJ A;  2LT1 A;  4BD3 A;  2RJF A;  5GAO n;  2DF6 A;  4IIM A;  4ANJ A;  3OYN A;  3OYC A;  3CXC A;  4JLG A;  2HSP A;  2CH4 W;  2AKK A;  3CMA T;  3EG0 A;  1P92 A;  3MEV A;  2QGF B;  1M1G A;  4JLI A;  1TOV A;  4JRI A;  4O5V A;  5DLQ E;  2HSE B;  3P8H A;  1QVF P;  2D8J A;  1Y7X A;  1YIJ A;  2YRD A;  3V7R A;  2IPO B;  5KYU B;  4FYW B;  2KNB B;  4J6W A;  1EX4 A;  1VQM T;  1PSE A;  2J06 A;  5GAN 5;  3M0S A;  3WVD B;  1BCO A;  3H0H A;  4M75 E;  3UA6 A;  1LOJ A;  5GAM f;  2PVD B;  3OW2 A;  1Q95 G;  5IXB A;  4B6M A;  1PM3 A;  4J9D A;  1WPY A;  2VAS A;  1VQ8 T;  1RAE B;  1TG0 A;  3CCV T;  5GAN g;  3CCR T;  3SEM A;  1Q86 U;  1VYV A;  4ZN3 A;  4A4E A;  4JZ4 A;  2NWM A;  2EKO A;  1Y57 A;  1NLO C;  5IN1 A;  1YCS B;  2R58 A;  4OP0 A;  1I81 A;  2QYZ A;  3G1J A;  2VB6 A;  2L3P A;  2CP5 A;  3WXM B;  2D1X A;  1YJ9 Q;  2CUB A;  4EPC A;  1WHK A;  1YJW A;  2E3H A;  4C92 B;  2JM9 A;  1YJN Q;  3CXC S;  1JRI A;  5KYN A;  3QSU A;  5DLO A;  2ATC B;  4BB7 A;  4E6R A;  1ACM B;  2CRE A;  5D7U A;  4DBR A;  2X4W A;  1YHQ T;  3HRT A;  3U23 A;  4LUD A;  4KGV B;  2JT4 A;  1ZBJ A;  1TH7 A;  1M5Q 1;  1V1C A;  4LUE A;  1WHM A;  2M0O A;  1SF9 A;  2DLP A;  2C06 A;  1TUG B;  1K9M R;  4A4F A;  1M8V A;  1WJR A;  2YHT A;  1UEB A;  1VQL A;  1UFF A;  5I2M A;  2JTE A;  5GMK h;  5LJ5 f;  2RHY A;  1BYM A;  3PT9 A;  4N4G A;  4F17 A;  2F69 A;  1RAH B;  3LYI A;  3HFN A;  2XDB A;  2JTM A;  3M58 A;  3VV0 A;  3JCM W;  1VQN T;  4HVV A;  1VQ4 A;  1X69 A;  1Q7Y R;  1E7O A;  1K9M C;  1E6H A;  2J6O A;  3M0Q A;  3S3M A;  1ZA2 B;  1HYO A;  1VQO A;  4FSX A;  4X34 A;  3GF5 A;  1D1A A;  2LDM A;  1ABO A;  4FU6 A;  2YRV A;  1KC8 R;  2RJD A;  1T0J A;  5CVI A;  1BBZ A;  5LJ3 d;  2QK0 A;  4J7I A;  4GLK A;  4PKC C;  2YT6 A;  1YIT A;  2DMO A;  5CK9 A;  3MEW A;  4E7Z A;  2F1L A;  1JO8 A;  4XTZ A;  3I55 T;  2FRW A;  3E9F A;  5EC7 A;  1OZ3 A;  2HKN A;  1YJW Q;  4A63 B;  2JNG A;  1RI0 A;  3MEA A;  3C4S A;  2OTL Q;  1FMW A;  1MNE A;  1TU0 B;  2A37 A;  1KQ2 A;  4JPB W;  1WIE A;  1FXX A;  1KJW A;  1QVG S;  1Q7Y C;  3A98 A;  2JW4 A;  2VXF A;  2CGH A;  5HCK A;  3M59 A;  1QW1 A;  3LWI A;  1NLP C;  3FEO A;  5IH2 A;  3CCL A;  2KRS A;  4MZP A;  2B86 A;  5ECA A;  1OX9 A;  3HHT B;  4VUB A;  4PJO C;  4OMQ A;  2V26 A;  1MHN A;  2KXC A;  1B34 B;  3CD6 T;  1TWB A;  2F5T X;  2XG8 D;  4BAC A;  3KBG A;  1KK7 A;  2DVE A;  3QYH B;  4QW2 A;  4OGC A;  2EGC A;  4DBF A;  1D0X A;  1BCM A;  4M77 D;  5FU6 B;  2MOX A;  3BW1 A;  3DLL A;  1PSF A;  3TSZ A;  4J6Y A;  4DOV A;  2HEQ A;  3HRU A;  3I9Q A;  2E1H A;  1QP3 A;  2PQW A;  2XHC A;  6AT1 B;  3HTR A;  1VQ4 Q;  3I5S A;  5I21 A;  5LJ3 g;  2HBP A;  4D6W A;  1NJI R;  2KI7 A;  5LJ3 j;  2PVG B;  2PUO B;  1RAA B; 
#chains in the Genus database with same CATH homology
 1OV3 A;  2HDA A;  2YUP A;  2IIM A;  5IHK A;  5L23 A;  2KT8 A;  3PVQ A;  2FO0 A;  4J9C A;  3PE0 A;  1GCP A;  4HVW A;  1I0C A;  1JXO A;  1ZUY A;  4RTW A;  2EGA A;  1JQQ A;  2CDT A;  2LMJ A;  3VS4 A;  4AFZ C;  3VS6 A;  1NYF A;  1ABQ A;  4KRT A;  2DL7 A;  1UE9 A;  2KEA A;  4LNP A;  4CC7 A;  2SRC A;  2RMO A;  4M4Z A;  2KR3 A;  2EYW A;  3I35 A;  2M51 A;  1SSH A;  2OI3 A;  1T3S A;  4J9B A;  2M0Y A;  2K9G A;  3QWX X;  1AWX A;  3EG3 A;  1T0H A;  1QLY A;  1M30 A;  1I07 A;  2AKL A;  2ESW A;  2ROL A;  2KT1 A;  2JMC A;  4X1V A;  1WA7 A;  2PTK A;  2V1R A;  1X2Q A;  1K0X A;  2KRO A;  1NM7 A;  3EHR A;  1ZSG A;  1K4U S;  2LQN A;  1PNJ A;  4AFS C;  1OEB A;  2CT3 A;  4GBQ A;  3TSW A;  3M0P A;  1AEY A;  3TVT A;  4LN2 A;  4OMN A;  5FW9 A;  2FPD A;  1UUE A;  3NHN A;  4AG2 C;  1K76 A;  4RTT A;  4RTY A;  3THK A;  1IO6 A;  1GCQ A;  5GJW B;  3JV3 A;  1VYU A;  2FPE A;  2O31 A;  1GFD A;  3REB B;  2FEI A;  2XMF A;  4JJB A;  2D8H A;  2LP5 A;  4F16 A;  1BU1 A;  3NGP A;  4JZ3 A;  1NG2 A;  1ZUU A;  2F2X A;  2J6K A;  1FYN A;  2DYB A;  2KGT A;  1BB9 A;  1MV3 A;  1SHF A;  1YN8 A;  2PZ1 A;  1SHG A;  2O2O A;  2FRY A;  1PKT A;  2GNC A;  1N5Z A;  1JXM A;  1RLP C;  4GLM A;  3PVL A;  2DRK A;  2VVK A;  1GBR A;  2L3Q A;  3EHQ A;  2AZV A;  3CQT A;  2JXB A;  2L0A A;  2DL5 A;  3ULR B;  2C0I A;  5I11 A;  1BK2 A;  1KSW A;  1X6B A;  1M3B A;  1U5S A;  1CSK A;  5IXF A;  2ECZ A;  1PHT A;  4HVU A;  2A28 A;  3R6N A;  1Z9Q A;  2DJQ A;  3H0I A;  2F2V A;  4J9G A;  2EGE A;  1TUD A;  3H0F A;  4RTU A;  1H3H A;  2K6D A;  4RUG A;  4ZNX A;  2EQI A;  3QWY A;  2CH4 A;  2DIL A;  1M8M A;  2J6F A;  1XOV A;  1YP5 A;  3LH5 A;  1UJY A;  2FPF A;  4JJC A;  2GTO A;  2VWF A;  1NYG A;  3M0U A;  2BTT A;  1ZUK A;  3VS7 A;  2KE9 A;  2EYX A;  2LJ1 A;  2CT4 A;  1M27 C;  1ZLM A;  2KBT A;  4RTX A;  2HCK A;  1UHF A;  2KRM A;  1RUW A;  2C0T A;  4Y92 A;  2EKH A;  1TUC A;  2ENM A;  2RNA A;  4OMP A;  2CSQ A;  3RBB B;  3UAT A;  2OJ2 A;  1NEG A;  1WXT A;  3M0R A;  3RNJ A;  2KYB A;  3REA B;  2YSQ A;  1W1F A;  3O5Z A;  1MUZ A;  2GBQ A;  2EPD A;  4AFU C;  1JU5 C;  2H8H A;  1PWT A;  1OOT A;  1QKW A;  1OPK A;  1G2B A;  1X43 A;  2DF6 A;  3EG1 A;  1AD5 A;  4IIM A;  4EIK A;  2LQW A;  3H41 A;  2RQT A;  2DX1 A;  3FJ5 A;  5FWB A;  1FMK A;  2HSP A;  2CH4 W;  2AKK A;  2J05 A;  2L2P A;  2QDL A;  3EG0 A;  1G83 A;  1KIK A;  2FG0 A;  1HSQ A;  1WX6 A;  2JM8 A;  1YWP A;  1GFC A;  2SEM A;  2D8J A;  3M0T A;  2DBK A;  2DL3 A;  3KFV A;  2ROT A;  1UTI A;  1UDL A;  1LCK A;  2ABL A;  1H8K A;  2KNB B;  5IHI A;  2J06 A;  2RQV A;  3M0S A;  3VS3 A;  3H0H A;  3UA6 A;  1AWO A;  1WI7 A;  2LNH B;  1UHC A;  5IXB A;  2VKN A;  1ARK A;  4J9D A;  3ZL7 C;  1B07 A;  1WDX A;  1K0S A;  3I5R A;  4ORZ A;  1W70 A;  2K2M A;  2C0O A;  3VRY A;  2DE0 X;  1U06 A;  2CUD A;  1AOJ A;  1GCQ C;  1TG0 A;  1CKB A;  1PRL C;  4IIO A;  3SEM A;  1VYV A;  2LCS A;  2DL8 A;  1HJD A;  4JZ4 A;  2NWM A;  1Y57 A;  2W10 A;  2YUQ A;  1NLO C;  2ED0 A;  1YCS B;  2NUZ A;  1QCF A;  2A36 A;  2LJ0 A;  4DEY A;  1GBQ A;  4Z8A A;  1U3O A;  2MIO A;  2L3P A;  3IQL A;  1W6X A;  1S1N A;  2EVR A;  2D1X A;  1SEM A;  2CUB A;  1AWJ A;  4R0K A;  1VYT A;  1K1Z A;  2JM9 A;  4OMO A;  5I22 A;  2J7I A;  4CC4 B;  1UGV A;  5FWC A;  2KRN A;  4J9I A;  4E6R A;  5IHN A;  1Z9Z A;  4HCK A;  1ZX6 A;  2W0Z A;  2CRE A;  1M3C A;  3EG2 A;  1VA7 A;  1QWF A;  2JS2 A;  3U23 A;  4LUD A;  1YNZ A;  2K3B A;  2JT4 A;  4Z89 A;  1ZBJ A;  2PNI A;  3VS0 A;  4FSS A;  1V1C A;  4AFQ C;  4LUE A;  2K7A A;  3NPF A;  2BZY A;  4J9E A;  1MV0 B;  1NEB A;  2RN8 A;  4JJD A;  2DLP A;  1WXB A;  2RQW A;  2EW3 A;  2O9S A;  1X27 A;  2MCN A;  3SHW A;  3VS2 A;  1QWE A;  1UFF A;  2KYM A;  3UA7 A;  1QKX A;  2EYY A;  2JTE A;  2LX7 A;  2YDL A;  2A08 A;  1SRL A;  1X6G A;  2I0N A;  4J9F A;  2RPN A;  1PRM C;  4F17 A;  2V1Q A;  1Y0M A;  2AK5 A;  1WLP B;  4HVV A;  4HXJ A;  2ED1 A;  1X69 A;  1E7O A;  1K9A A;  4CC3 A;  1E6H A;  2J6O A;  3M0Q A;  1J3T A;  1B3Q A;  1WYX A;  1RI9 A;  1UEC A;  2DBM A;  2EBP A;  1EFN A;  2JMA A;  2CSI A;  1ABO A;  2JS0 A;  1AZE A;  4Z88 A;  2GGR A;  2O9V A;  1SRM A;  1AVZ C;  1T0J A;  1A0N B;  1BBZ A;  4D8K A;  2P4R A;  4LE9 A;  2YUO A;  4DEX A;  1YWO A;  1H92 A;  2YT6 A;  1X2K A;  2DMO A;  4K11 A;  1GRI A;  1JO8 A;  2DVJ A;  2FRW A;  5EC7 A;  2DM1 A;  4A63 B;  1JEG A;  4AG1 C;  5GJV B;  2EYZ A;  2A37 A;  3UF4 A;  2RQU A;  4WCI A;  4JPB W;  2AZS A;  4OMM A;  1AWW A;  1WIE A;  1KJW A;  2G6F X;  2DL4 A;  3A98 A;  3VRZ A;  1HD3 A;  2JW4 A;  3VS5 A;  5HCK A;  2K79 A;  4CC2 A;  1WFW A;  2X3X D;  1NLP C;  1E6G A;  2X3W D;  5IH2 A;  2HBW A;  2KRS A;  4QT7 A;  2DRM A;  2B86 A;  5ECA A;  4OMQ A;  2KXC A;  4D8D A;  2F2W A;  1OPL A;  4J9H A;  1WXU A;  2KXD A;  1GL5 A;  1SPK A;  2EGC A;  1UJ0 A;  3GBQ A;  4RTV A;  2MOX A;  3EGU A;  2L3S A;  2DA9 A;  2RQR A;  3TSZ A;  2OAW A;  2HEQ A;  3I9Q A;  3C0C A;  1I1J A;  2O88 A;  1UG1 A;  2BZX A;  4F14 A;  1PKS A;  2E5K A;  1T3L A;  1CKA A;  2D0N A;  2LZ6 B;  3VS1 A;  2GQI A;  2DNU A;  3NMZ C;  2GTJ A;  3I5S A;  1M3A A;  4OML A;  1RLQ C;  1KFZ A;  1AZG B;  2BZ8 A;  2RF0 A;  4ESR A;  2LJ3 A;  4RTZ A;  2YUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...