1AWXA

Sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain from Bruton's tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BRUTON'S TYROSINE KINASE
total genus 6
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awxA00
1AEYA 1X2KA 1KIKA 2LJ0A 2BZ8A 3VS4A 1MUZA 2JTEA 2LNHB 3QWYA 1HD3A 1W70A 2CT4A 1AOJA 2L3PA 1AD5A 3THKA 2J6OA 4Y92A 2AKLA 2KGTA 2KROA 3H0IA 1OEBA 2RF0A 2JMCA 1SHFA 2ED0A 3VRYA 2BTTA 5IHIA 4OMQA 1YN8A 2EYXA 4RTTA 2EYYA 2OAWA 1B3QA 1UGVA 4IIOA 1AZGB 2HCKA 5ECAA 4LUDA 2DRKA 2DL3A 4JZ4A 1JU5C 2J7IA 4AG2C 1RI9A 5GJWB 3ULRB 2V1RA 2DL8A 4HXJA 4K11A 3FJ5A 2FEIA 1GCPA 2DJQA 1GRIA 4CC7A 2KYMA 1E6HA 2JS2A 4RTYA 3EG2A 2YDLA 2SRCA 2DMOA 2P4RA 4Z88A 2KRNA 1ZSGA 4HVUA 1JXMA 3VRZA 2LQWA 1M30A 2ESWA 3PVLA 2YSQA 2EGCA 2OJ2A 1Y57A 2AZSA 4CC4B 1U3OA 2HBWA 2RQTA 4R0KA 4Z89A 4RTVA 3TVTA 1CKBA 4HCKA 2CSQA 3A98A 2A28A 2NWMA 2LCSA 2KT1A 1M3CA 2D8JA 1OPKA 2AZVA 2FPFA 4OMNA 1H92A 4QT7A 4RTZA 1PNJA 2X3WD 2KYBA 2EYZA 1RLPC 2F2VA 5IH2A 2HSPA 1GBQA 1ZUYA 1CSKA 2LJ3A 1ARKA 1T0JA 1MV3A 2F2XA 2DL5A 2YT6A 2OI3A 4IIMA 4OMLA 1VYTA 4JJDA 1PRMC 5IHNA 2LZ6B 2I0NA 2DNUA 3EG3A 1UFFA 4LN2A 4Z8AA 4J9GA 2IIMA 2SEMA 2JMAA 4FSSA 1OV3A 4OMPA 1V1CA 2KE9A 2RN8A 4LUEA 2PNIA 4ESRA 2EQIA 1EFNA 2F2WA 3PVQA 2RQUA 1UJ0A 4RUGA 1KSWA 2W10A 1K9AA 4JJBA 4DEXA 1QCFA 2PZ1A 4J9HA 1ZLMA 4J9IA 3EHRA 1VYUA 1GBRA 1E7OA 2ROLA 4AFSC 1UUEA 1X6BA 1BB9A 1SPKA 3VS2A 4CC3A 5IXFA 2FRWA 1JO8A 3NHNA 2H8HA 2ED1A 1K4US 2EW3A 2M0YA 2KBTA 4ZNXA 2HEQA 1AVZC 1OOTA 2DVJA 1K0XA 1AWOA 1Z9QA 1M27C 4KRTA 1W1FA 3H0HA 1BBZA 2YUOA 2CUBA 2GBQA 5IHKA 2CREA 2PTKA 2VKNA 1PKTA 1NLOC 2EGAA 1UTIA 2B86A 1T3LA 3GBQA 1JEGA 4GLMA 1T3SA 3I5RA 3EG1A 3JV3A 1GFCA 1ABQA 2X3XD 1AWJA 1WXUA 2LX7A 3KFVA 1SSHA 2J05A 2O9VA 1HSQA 1PHTA 2KXCA 1LCKA 3M0PA 2J6FA 2K2MA 3REBB 1Y0MA 1X69A 2JS0A 3H0FA 5EC7A 2RQWA 2JM9A 2EYWA 1WLPB 1YCSB 1WX6A 1SHGA 2HDAA 2ROTA 5FWBA 1CKAA 3R6NA 2JT4A 1GCQA 1JXOA 4AFQC 1ZBJA 2K9GA 2BZYA 5GJVB 1UECA 4LE9A 1N5ZA 4ORZA 2EGEA 3REAB 1WXTA 1AZEA 2YUQA 1NEBA 3VS0A 1YNZA 1VYVA 1XOVA 1E6GA 1M8MA 2KRSA 3M0UA 1SEMA 2DX1A 1WA7A 1Z9ZA 1A0NB 1UJYA 2O9SA 1AWWA 2YUNA 2AKKA 2DILA 5I11A 3M0TA 1WI7A 1K0SA 3RBBB 4HVVA 2J06A 1FYNA 1QKXA 3M0SA 4M4ZA 1QWEA 1RLQC 1AWXA 3VS1A 1I0CA 2GGRA 3M0RA 1X43A 3EG0A 1GCQC 1PKSA 2CH4A 4AG1C 2C0IA 1NM7A 2DBKA 2O2OA 3UA7A 2BZXA 5FW9A 2ENMA 3QWXX 2K3BA 1JQQA 3UATA 3C0CA 4LNPA 2DRMA 1G2BA 2GNCA 5IXBA 4F16A 1NYFA 2DE0X 3NPFA 2YUPA 4F14A 3NGPA 3EGUA 1TUDA 2RMOA 1G83A 2FPDA 2KT8A 1UG1A 1X2QA 1GFDA 4CC2A 2KXDA 2J6KA 2D1XA 1I1JA 1I07A 3EHQA 1GL5A 3UF4A 2DYBA 1KFZA 1PRLC 1WDXA 4AFZC 2CDTA 3TSZA 1ZUKA 2LQNA 3NMZC 2D0NA 1NYGA 4EIKA 1H3HA 2MCNA 4A63B 1ZX6A 2CT3A 2L3QA 1X27A 2M51A 1QLYA 3SHWA 1UDLA 2DBMA 2W0ZA 1SRMA 1UHCA 3ZL7C 1U5SA 2JXBA 2VWFA 2ABLA 2CUDA 2C0OA 4RTUA 4J9CA 1H8KA 1NG2A 1UE9A 2LJ1A 2QDLA 4WCIA 1PWTA 2A08A 2DM1A 1ABOA 3M0QA 5I22A 2A36A 2EBPA 2DF6A 5HCKA 1FMKA 3VS6A 4AFUC 1HJDA 1QKWA 3SEMA 4OMOA 2RPNA 1WIEA 4J9DA 2MOXA 2K6DA 1BK2A 3VS5A 1BU1A 4E6RA 1YWOA 1K76A 2JW4A 2ECZA 2DL4A 1ZUUA 4JZ3A 2EPDA 1J3TA 2L2PA 3H41A 3IQLA 2G6FX 1U06A 2LMJA 2FO0A 1MV0B 4RTXA 2O31A 2L0AA 2VVKA 1KJWA 1M3BA 2RQVA 3I9QA 4JPBW 3VS7A 3VS3A 1NLPC 1TG0A 1NEGA 2D8HA 4HVWA 1T0HA 4D8DA 4OMMA 1SRLA 1B07A 3O5ZA 3I5SA 1UHFA 2C0TA 2DLPA 4GBQA 1K1ZA 2E5KA 1S1NA 1WYXA 2CSIA 2GTJA 2FRYA 4J9FA 4RTWA 1TUCA 2L3SA 2O88A 1WFWA 2RQRA 2RNAA 4D8KA 2JM8A 2EKHA 2K7AA 1OPLA 3RNJA 1X6GA 4J9BA 2LP5A 1VA7A 2KNBB 2K79A 1YWPA 2A37A 3UA6A 2KEAA 3LH5A 1RUWA 2MIOA 1QWFA 1IO6A 4DEYA 3CQTA 2FPEA 2KR3A 1WXBA 3I35A 2NUZA 2DL7A 2GTOA 4J9EA 4X1VA 2AK5A 2DA9A 5FWCA 2FG0A 1YP5A 2XMFA 5L23A 2GQIA 4F17A 2V1QA 2CH4W 3TSWA 4JJCA 2KRMA 2EVRA 1M3AA 3U23A 1W6XA 3PE0A
chains in the Genus database with same CATH superfamily
4C0ZA 3I56T 3CPWA 2QYZA 1HD3A 1W70A 1N8RU 1AD5A 3EH2A 4LDUA 2COZA 1OEBA 1IREB 2WSCE 1ZA2B 2JMCA 5D6WA 3CXCP 5GAOp 2EYXA 4RTTA 4PJMA 3LWIA 1S72A 1UGVA 2PVGB 4IIOA 4F7UG 5CCAA 2KQWA 1Q81U 2BUDA 1IRXA 1RI9A 2V1RA 3BDLA 5KCOA 3LGFA 3QZ5B 3FJ5A 1OZ3A 1M1KC 2FEIA 3V8KA 1FMVA 3OS2A 2E3IA 2DEUA 4JDSA 2E6NA 4KBMB 1Q82U 4CC7A 4C8QF 2EQKA 4M78D 2NUTA 4RTYA 4E7KA 2DMOA 2ZAEA 1K73R 3OSSC 3M57A 3M59A 4HVUA 2FB7A 2LQWA 2YSQA 4N0AA 1U3OA 1UGPB 2RQTA 3EAEA 3M56A 4J8OA 3OYCA 5KYXB 2CSQA 3LWHA 1TXQA 2KT1A 4OMNA 2FPFA 1H92A 4QT7A 1PNJA 2O4XA 2X3WD 1YJ9A 3MO8A 3SWNA 2EYZA 2F2VA 3EGDB 4EMKA 1ZUYA 2DTIA 4Q5WA 4JRPA 5J3BA 3G71A 1T0JA 3M4GA 4FYWB 2BIVA 1RAIB 4IIMA 4OMLA 4M77B 3X24B 5GANj 4M78F 3EG3A 1WQ7A 4LN2A 4Z8AA 5FU7B 4J9GA 2SEMA 4FSSA 3G71T 4OMPA 3HFOA 3CC4A 2F2WA 3PVQA 1R0CB 4RUGA 3F70A 4HA8A 3JCMQ 3L42A 5IT9E 3RKWA 1M90C 5HKCA 4M75C 4FCYA 5KYUA 4J9HA 1ZLMA 4HKEA 3JSCA 3QDFA 3CPWP 3P8HA 3CC4T 2M9UA 3EFOB 1RAFB 3FIFA 3RDVA 1VQ8A 2ZGWA 3GIBA 4KGZB 2L8DA 1JO8A 2JN0A 2ED1A 1K4US 4KULA 2M0YA 1AVZC 1YHQT 1K0XA 1AWOA 1M27C 3H0HA 2M16A 5KYWB 3E1SA 1M5Q1 2CREA 2FZCB 3OYDA 1B7TA 3QJYA 1UTIA 4A4KA 1VQLT 1Q95G 3A8MB 3GBQA 3P8BB 4II1A 1JEGA 4GLMA 3I5RA 1TH7A 2L5QA 3EG1A 3JV3A 1WXUA 5GMKj 1I4K1 1K9MR 1QVFA 1Y07A 2J05A 2O9VA 2NLUA 4O6JA 1N6AA 4X9DA 5LJ3e 1LCKA 5C6SA 3ZEHA 1VQLA 2J6FA 3UT1A 4J6WA 1S72Q 4CRIA 3H0FA 3RKXA 3EFRA 2RQWA 1G3TA 2V8KA 4MMKA 1PC0A 1X6OA 3GP8A 2ROTA 2RM4A 4C92C 1TWBA 2JT4A 1GCQA 1JXOA 2HSEB 1Q81C 4ZN3A 3L2WA 2ZPHB 3V8JA 1Q82R 1F1BB 4LE9A 1VQ5A 4ORZA 1YI2T 3BDUA 4J6XA 5GAMj 3CMAQ 1YNZA 4OB0B 1E6GA 3M0UA 4LD9K 3BW1A 2IPOB 2PUKB 3HTRA 1MMGA 3TREA 1PSFA 1VQKT 4X9CA 2XHCA 3JCMJ 2J06A 1QKXA 4C92G 2MYSA 4M7AA 1XNIA 1RLQC 2CZ0B 2GFUA 3QDRB 1YJWA 3I55Q 4V2SA 1UGQB 3PNWC 4ZGJB 3X26B 2CH4A 1IHWA 2BZXA 4BACA 5FRMA 1VQ4A 4C0DC 4EMGA 5FW9A 2ENMA 3QWXX 2K2VA 2LTOA 4M7DA 4LNPA 2DRMA 1G2BA 5IXBA 5GMKi 2DE0X 1M90U 4M7DF 5GAOr 4F14A 1V76A 1WJQA 1MGQA 2DO3A 3CC2Q 2KMTA 1G83A 3AHUA 3OMGA 2PVOB 1WHMA 1NJIU 1I1JA 1I07A 1M1KU 4JRKA 1NE8A 2F5TX 3QYGB 4ZGDB 1WDXA 1YITQ 2CDTA 4EPCA 4WTOB 3TSZA 2D0NA 3DB3A 1NYGA 4OGCA 1KK7A 3G6ET 4J7FA 3CCET 3KBGA 2RD1A 4PLLA 1TU0B 4N4HA 2DBMA 1UHCA 2JXBA 5LJ3g 2VWFA 2BE9B 2C0OA 3G6EA 2JTMA 1UE9A 1K8AR 3CD6T 1PWTA 4KUDK 1ABOA 1UGSB 3M0QA 1N8RR 2DF6A 4C92A 1HK9A 4M7AG 2FHDA 3VS6A 3JCMc 1Q86U 1HJDA 4RG2A 1QKWA 3UWNA 2E1HA 1WIEA 2R5MA 5KE3A 2QI2A 3M4YA 3VS5A 4E6RA 4PJNA 1G3SA 4VUBA 3TQ7P 4C0DB 3VYHB 1ZUUA 4JZ3A 2EPDA 1J3TA 3H41A 4M77E 5LJ5g 2CGHA 4FW1A 5LJ5d 4BY6B 2E10A 3MP6A 3V8LA 4E7HA 2LNVA 3OYMA 4JUVA 4PFZA 2RQVA 4JPBW 3VS3A 1NLPC 1LJOA 8AT1B 3MHXA 2FYKA 3EH1A 3SWNB 3PGGA 2O4XB 4C8QE 4R56A 1VQPQ 3JB9G 5EG2A 2X4YA 3CPWS 1RADB 4OMMA 1SRLA 1RAHB 3DKMA 1VQ6T 4CI0C 1WHLA 4Z02A 1S1NA 3OSVA 1IXDA 2GTJA 2EKOA 4QQ6A 2L3SA 4FW2A 1WFWA 3CBPA 2IVWA 5LJ3d 2RNAA 2RB6A 2X4WA 3N5BB 5AYFA 2RO0A 4J9BA 3TCJA 4BD3A 1VA7A 3M54A 4M75D 3WVDB 2A37A 2M0OA 1RUWA 3PMTA 3KUFA 1IO6A 2FPEA 1WXBA 5KE2A 2DL7A 2V8JA 5GMKl 4J9EA 2DA9A 3A5ZB 4M77F 1YP5A 3OYJA 1WHKA 1N27A 3HFNA 4MMLA 3TSWA 2K3YA 4UC4A 2RHZA 1KC8U 3OYIA 1AEYA 2CZ1B 4KH0B 3CC4Q 3FJPA 4FM4B 3CC2A 1RI0A 1MUZA 2CP5A 4KGXB 1I81A 2LNHB 2CT4A 2J6OA 4M7DE 1M2VA 3H0IA 2A0FB 2DEQA 3I56A 3CCJA 2BTTA 1YN8A 2D9TA 4ME7A 2E12A 2DKGA 3SWNC 2K3XA 2Y4XA 4LUDA 4DBQA 2LC4A 5GANh 1JU5C 2HBPA 2YRVA 5GJWB 3QXEB 4ANJA 4ZGEB 2DL8A 4HXJA 4K11A 5HK0A 2H3JA 1YJWQ 1GCPA 2RI5A 1PG5B 1KD1R 2MMPA 1YCYA 2DYIA 5FRNA 1G5VA 1E6HA 4BI4A 3EG2A 2XI9A 2SRCA 1K73U 1U1TA 2KRNA 1XTDA 1VQ7Q 1ZSGA 2Y90A 2LCCA 3HRSA 1BI0A 3JAME 5GMKh 2ESWA 3OYBA 2EGCA 2OJ2A 1KQ1A 2AZSA 3TEEA 1KQSP 4CC4B 2HBWA 2DIGA 1R77A 4E7ZA 4Z89A 2P84A 1CKBA 2MPXC 5J26A 1MMAA 2K57A 1M3CA 3M58A 1WHHA 4FYXB 3QIIA 4ELYC 2KYBA 1RLPC 3HRUA 5IH2A 4HCBA 2QQBA 1M1GA 2LJ3A 1ARKA 4PJOB 4RG8A 1KQ2A 2EFIA 2YT6A 1OZ2A 1VYTA 4JJDA 2P0PA 4F7UF 1YJ9T 4FL6A 4LDWA 2I0NA 2DTOA 2OTLA 1Q7YU 2DERA 4PJOG 4M7DC 2IIMA 3J80E 2JMAA 1EZZB 4PLIA 5D6XA 3LH0A 2RN8A 1QP3A 4LD6A 4PKCC 4DA4A 2P0QA 1YIJA 4PJOC 3CMEQ 2CP6A 1QCFA 1QMCA 4WF2A 3V7RA 3G6EQ 3QSUA 1Q81R 3FEOA 1GXIE 2DJZA 4AFSC 1UUEA 2HKQB 1X6BA 3CCVT 3PTAA 5IXFA 3CEYA 3OYYA 5J39A 1FX7A 7AT1B 4HT9A 4C92D 4GY5A 2E65A 4B6MA 4KRTA 3S3NA 1W1FA 2EJ9A 2JVVA 1BBZA 1VQOT 1VQ8T 1VQ7A 3QKJA 2EAYA 3C12A 5IHKA 1O75A 1PKTA 3EFSA 1NLOC 2F69A 3HL8A 4ELZC 3GPLA 1VQ9A 3MPUB 2RJFA 1RACB 4LDVA 2XDPA 4BDZA 1QCOA 2RJEA 2KVQG 2X3XD 1AWJA 2LX7A 3DLMA 3VYGA 4B9XA 1HSQA 1PHTA 1KG1A 3NTIA 1FWZA 2COWA 1X75C 1ZSZA 2QA4A 3A8HB 3RKYA 2CZ6B 4BE2A 2DXBA 3REBB 2QQ9A 5GAOq 1Y0MA 2LQKA 4XAXB 1N9SA 5CKBA 5DY9A 2EYWA 3CCRQ 1WGSA 1VQNA 1WLPB 1WX6A 4BDYA 2OAUA 3OW2P 1SHGA 2HDAA 3OBWA 4XU1A 2DVEA 1XQHA 2K9GA 2QGFB 3RERA 2CYZB 1VQNT 2EGEA 1D0XA 3DB4A 1WXTA 1VYVA 1M8MA 3OYGA 2KK4A 1VQMT 1A0NB 3MCAB 1YHQA 5CKEA 4MDWA 3HHTB 2DILA 1VQKQ 2NYSA 4XTXA 1WI7A 3CCQT 3RBBB 1JRIA 3QO3A 2YLBA 5LL6S 1KC8C 4ATOA 5LJ5h 3M9QA 2LCLA 1VQ9T 5HK3A 4JRIA 4NS5A 5GMKe 1KHIA 1VQ6Q 4M75G 3EG0A 1N9RA 1PKSA 1D3BA 3UA7A 3OS1A 3WXMB 3L1AA 2GFAA 1KD1U 2XKOC 3UATA 1JQQA 1WZOA 4BUGA 3C0CA 3GNFB 2GNCA 4M75B 4F16A 1NYFA 2DZ9A 3C94A 5LJ5f 2X35A 4PFOA 3E9GA 3WVEB 3EGUA 3H8ZA 1BIAA 4J5YA 4C8QA 2KT8A 2RJCA 3CXCA 2KXDA 2J6KA 2D1XA 3EHQA 1GL5A 1ACMB 2DYBA 5M9OA 1PRLC 2EIFA 5LJ3j 1VQ5T 2DXUA 1YI2A 1KHCA 4C8QD 2LQNA 2QQRA 3NMZC 4FSXA 1W2BP 5D7UA 3VU3C 4EIKA 3CCRT 1H3HA 2MF2A 1ZX6A 3J7AF 2VC8A 3EG9A 1TUGB 2A3LA 2VASA 1D0ZA 1G8XA 3V7CA 1QLYA 3OYEA 1AT1B 1UDLA 3HSBA 1VQKA 4C5EA 2ABLA 4FYVB 2V8IA 4J9CA 1MHNA 3MP1A 1NG2A 6AT1B 5GAMg 2HL5C 2VGNA 4XK8E 3H9NA 1DJ7B 5I22A 1VQMQ 4OVAA 4DQ2A 4C92F 3SEMA 4OMOA 1S72T 1YIJT 4J9DA 2MOXA 1JBMA 5GAMe 4PFPA 2JOYA 5D6YA 1YWOA 1LOJA 3J81E 4D6WA 2QAZA 1WHGA 2I2LA 2HL3A 1U06A 4QKUA 2LMJA 5HY6A 1OI1A 5GAN2 1MV0B 2O31A 2C06A 3CC7A 1BCMA 2VVKA 3G7ZA 1YITT 1M3BA 3I9QA 3PIOA 4M77A 1TG0A 1NEGA 5DLQE 4LXCA 2VXEA 2LT1A 2ZPBB 3JCMP 1VQOA 1VQ7T 2Y4YA 2EWNA 2VV5A 2C0TA 4GBQA 4A4FA 2QXFA 1UB4A 4IURA 4J9FA 2JNGA 2O88A 3JCMV 2E70A 3EFOA 1OX9A 4B9WA 3JCMb 2GCXA 3RNJA 1QP2A 3X20B 3GNGA 1YJ9Q 4PJJA 4J7IA 2KNBB 1Q86R 3UA6A 2MWOA 3G4SQ 3CMET 2KEAA 2DXCA 2LRQA 2XIDA 4OB3B 2NUZA 4KT0E 1YI2Q 4OB2B 4X1VA 4C5IA 3GOXA 2FG0A 1LPLA 3RR6A 2MI6A 2GQIA 1D0YA 3EGDA 2V1QA 4F17A 2R57A 3OQ5A 4A54A 4JJCA 4BE0A 2EVRA 3QG1A 1X2KA 2O01E 3QBYA 1BI3A 2QEXA 2KY9A 3QWYA 3CCUQ 1AOJA 2L3PA 4ZN1A 2X4XA 3THKA 4Y92A 3CC7T 2AHJB 2AKLA 2KROA 2DK3A 2RF0A 3FRNA 1SHFA 1M1KR 1RAGB 1EX4A 1K8AU 3JB9D 5IHIA 1RABB 4OMQA 1YJNT 4FT2A 4FYYB 4F7UE 2OAWA 3S3OA 1B3QA 1AZGB 1WNLA 1Y96B 5ECAA 4A4HA 2FZKB 1VQ6A 2DRKA 2ATCB 2DL3A 4JZ4A 2DTHA 1TS9A 4AG2C 2MAMA 3MEWA 3OYNA 1YFNA 3E19A 4C0GA 1H641 2K5LA 3QHSA 4PJOF 3M5AA 1UGRB 3JCMe 1OU8A 2M02A 1P92A 1YHQQ 2KYMA 2QK0A 2JS2A 4NL3A 2YDLA 4MDXA 1ZBXA 1JXMA 5CQYA 3VRZA 3OW2A 3G4ST 1M30A 3PVLA 4RMOA 3CCJQ 1Q7YC 3S3MA 3PT9A 3UDCA 4PJOD 4R0KA 4RTVA 2RK2A 2NWMA 2LCSA 1VQOQ 1IZ6A 2PQWA 2AZVA 3CCLT 3JCMh 4KGVB 3QZ9B 1VQNQ 5GAMf 3E9FA 2HSPA 1GBQA 2VB6A 1FXXA 4ZTFA 5A2QE 3CCRA 4C92B 2QA4Q 2F2XA 4OF1A 4F04B 1PRMC 3CBOA 5IHNA 3ZFJA 2OTJQ 3ZBDA 1M4ZA 5GAN5 1OV3A 1W2BA 3BY7A 4M78B 2KE9A 2XU8A 5A0GA 4LUEA 2PNIA 4MZMA 2RHXA 2EQIA 4LDYA 1PM3A 2VUBA 1D1AA 1UJ0A 4X34A 1KSWA 2W10A 1K9AA 4PJLA 3SB2A 3L2UA 4M78G 4BY6C 2PZ1A 1D3BB 4XTWA 3CCEQ 1OQKA 1K9MU 1XJWB 5IAYA 5KCHA 4XU0A 1VYUA 2ZZDA 1ZA1B 3L2ZA 2KDSA 9ATCB 2L3RA 4QVCA 4CC3A 2PUOB 4RCCA 5A0DA 3OYKA 3NHNA 2H8HA 1TSFA 5KYYB 1VQ4T 4L59A 1VUBA 5KYWA 2E64A 2YLCA 2KBTA 4ZNXA 2HEQA 1OOTA 4DOWA 2DVJA 1C0MA 1Z9QA 1C6VX 2WACA 2P0KA 4E7JA 1NPPA 3RMQA 2YUOA 2CUBA 4PL6A 4BE1A 2PTKA 2VKNA 1NZ9A 1OU9A 2EGAA 5GAN8 3OB9A 5CK9A 2QTXA 2B86A 1T3LA 5GAN3 2FL7A 1MMNA 2LQ8A 4QQDA 3A8GB 1R0BG 1QVGS 1QVFP 3LGLA 1ABQA 2P4TA 3P8DA 2X51A 1IGUA 4JRQA 4Y28E 4IKFA 1R8OB 5CO7A 2OTLQ 2MWPA 1HYOA 1X69A 3OA6A 2JS0A 5EC7A 2ZPEB 4MZPA 2JM9A 1EIFA 5LJ5j 1ZSZB 3O8VA 5GMKm 1K9MC 4XTVA 3GLXA 4C8QG 2RI2A 3V7SA 2BZYA 1UECA 1W2BS 5GAMh 4ZTJA 3JCMf 3REAB 3FC3A 4M7DD 1AZEA 2GQVA 2YUQA 1NEBA 3JRZA 3T9NA 5GAOn 3KXTA 1KQSS 4KUIA 3EGXB 5CQXA 1WA7A 2O9SA 1AWWA 3CCQQ 2GF7A 1K0SA 3JB9F 2RHUA 5GAOl 1H3ZA 3M0SA 4M4ZA 1QWEA 4EDUA 2YHTA 4C92E 3MP8A 1G3WA 3VUBA 4M77G 3VS1A 4MZTA 2G3RA 1TTHB 3M0RA 4HCZA 2PU9B 4IUPA 1M2VB 2QASA 4XU2A 3ME9A 4AG1C 2AIRB 2AT1B 2VYTA 1IHVA 1NM7A 2DBKA 2O2OA 2NUPB 4EMHA 3JB9J 2K3BA 2E3HA 4JS5A 1BYMA 3OY9A 1ZSZC 2YUPA 4JS4A 3NGPA 3Q1JA 1TUDA 2RMOA 3AT1B 2HQXA 3EG9B 4XTZA 1QW1A 1GFDA 3JCMg 4CC2A 3OW2S 5GAN4 3X28B 3JB9H 2M1HA 2HAXA 2DAQA 1KFZA 4AFZC 2RI3A 1W4SA 3CCMQ 4M7AF 4XTUA 4IUVA 4A63B 2L3QA 3NTKA 1I8FA 2M51A 4FIBA 1VQMA 2CP3A 3C4SA 3DLLA 4M77D 1HXDA 3SHWA 1U5SA 3CCQA 1IB8A 2RH2A 3CC2T 4AMCA 1H8KA 2HNIA 5KH6A 3H6ZA 2LJ1A 5C0MA 2A08A 2DM1A 2EJFA 4C5GA 4BI3A 3CCMT 1Q86C 1JB0E 5FROA 1FMKA 1NJIR 5GANg 1QVGA 2HQHA 4N4GA 2K6DA 1BK2A 4E7IA 1BU1A 4L5GA 3HRTA 1WJSA 2DL4A 2LT4A 2L2PA 4M75F 2NUPA 3IQLA 1M2OA 3OS0A 3A8LB 4E2FB 3CXCS 1C1AA 3A1PA 1YJWT 1PCXA 2L0AA 1V29B 2D8HA 2E41A 2WSEE 4D8DA 5I21A 5AT1B 1B07A 3O5ZA 1UHFA 4PJOE 2DLPA 2QGGA 2ZPFB 1B34B 1YJNQ 3SDZA 1MMDA 1FMWA 2CSIA 4LDXA 2EQJA 4RTWA 1TUCA 2BE7D 4TVRA 2RQRA 3HKSA 2DXTA 2E5QA 2RHYA 3RMSA 2EKHA 2K7AA 4M78E 1X6GA 3JB9I 2LP5A 1I5OB 2CKKA 5KYYA 4J83A 5KYNA 2YRCA 4QQGA 2B8AA 4F7UB 5LJ3f 1YWPA 3VV0A 3LH5A 4EMKB 3CCMA 4DEYA 1M8VA 3HP9A 3I35A 4C8QC 2GTOA 2H3EB 1QVGP 1QVFS 4M75E 3CCEA 5L23A 5CR2A 3CC7Q 2E6ZA 2CH4W 1M1FA 3X25B 4PK4A 1M3AA 3PE0A 5CVIA 1KIKA 1RL2A 2LJ0A 2BZ8A 3VS4A 3I56Q 4IUTA 2JTEA 3MJXA 1O9SA 4M78A 2VGMA 1PD1A 1D1CA 3FDRA 4GLKA 2KGTA 3QPHA 4JLGA 2ED0A 3VRYA 2LVMA 2QTVA 2XICA 2DFUA 1VQ4Q 1KQSA 2EYYA 2HCKA 5KYXA 1AHJB 2WSFE 4E7LA 2J7IA 1IGQA 2RHIA 1VIFA 3BFMA 3ULRB 4A53A 3LX7A 1JJ2P 1BI1A 1QCNA 2DJQA 1M9SA 1GRIA 1BI2A 1Q7YR 3SD4A 1D09B 2RA2A 2XDBA 1RAEB 3L2RA 2P4RA 4Z88A 1UEBA 2PVDB 2RK1A 3D7SB 2CS7A 4M7AE 1WPYA 4M78C 3FLGA 2CP7A 2FZGB 1SSFA 1Y57A 4PNOA 1KD1C 2QA4T 5FU7C 4HCKA 3TVTA 1VQ5Q 3A98A 2A28A 5CKFA 2D8JA 4JJNK 1OPKA 4RTZA 3CCSA 2QEXQ 2F1LA 2HMAA 4IUQA 4BI8B 2D6FA 1CSKA 2E4HA 1ZHIA 3L2QA 3CMEA 1OYXA 4KH1B 3VKIA 1MV3A 2DL5A 2OI3A 5GAOm 3CCLA 1Y71A 5GANe 3CCST 3CPFA 2JTFA 1BCOA 2LZ6B 1YJNA 2YXYA 5GAN6 1ZQ1A 1VQLQ 2DNUA 2EJGA 3M55A 1WQWA 1UFFA 3CD6A 3CD6Q 4Y91A 5I2MA 1V1CA 4BB7A 1K73C 2V26A 2ZPGB 4ESRA 1EFNA 4RKUE 2KSSA 2RQUA 3EGXA 2QEXT 4DBRA 1MNDA 3HPWA 1VIEA 2Z0WA 3URGA 2DETA 3OYLA 3R6OA 4JJBA 2COYA 4DEXA 2VXFA 4J9IA 8ATCB 3EHRA 3CCJT 1GBRA 3CCSQ 1PD0A 1E7OA 2ROLA 4O5VA 2EQMA 1BB9A 4C5HA 1SPKA 3VS2A 2FRWA 3G4SA 2LDMA 4E47A 2X9HA 5I2SA 4J6YA 2EW3A 2QQAA 5A0LA 2QQSA 3MEAA 5LJ5e 1Y7XA 1YITA 2DPPB 2GBQA 4M77C 5CKHA 3PIPA 2R58A 3QYHB 1JJ2A 4F7UA 1U1SA 2OTJT 1T3SA 2CZ7B 1G3YA 1GFCA 3KFVA 4E7SA 1SSHA 3VUZA 5FU6C 2KXCA 1OULA 1M90R 4DBHA 3M0PA 2OTJA 3MEUA 2R5AA 3L2VA 5FLXE 2K2MA 3G71Q 3LLRA 2EQUA 1LVKA 3JCMX 1JJ2S 1YCSB 5FWBA 1CKAA 2L89A 3R6NA 3G1JA 4AFQC 1MNEA 1ZBJA 2YRDA 2RJDA 2JJ9A 5GJVB 1YBYA 3RESA 3M53A 2YWWA 1N5ZA 3NFCA 3MKDA 4M7AC 3VS0A 1XOVA 2KRSA 2XD0A 1SEMA 2DX1A 3TU4K 3ER0A 3FB9A 1Z9ZA 1UJYA 2YUNA 2AKKA 1QQJA 5I11A 3M0TA 3A8OB 4HVVA 1BKBA 2HKNA 3E2UA 3QJ6A 1FYNA 1PSEA 3RUXA 1WHJA 1TOVA 4OMFB 1AWXA 4L6V5 1I0CA 1X01A 1SKUB 2GGRA 1X43A 2DD4A 2KI7A 4M7AB 3S6WA 1GCQC 3BE3A 3CCVA 4NOYA 4OB1B 2C0IA 3META 1KC8R 3CMAA 5GANd 3CCUT 3UPUA 5GAN7 5GANf 1RAAB 2DD5A 5CKDA 2BKDN 3NPFA 2IG0A 3NTHA 4A4GA 4XQ3A 3CCUA 3CMAT 2FPDA 4QVZA 4AT1B 1UG1A 2XK0A 1Q82C 1X2QA 4C8QB 4HT8A 1NBEB 3UF4A 2K5IA 3CCVQ 2JZ2A 3ASKA 2CP2A 3JCMW 1ZUKA 1WJRA 4QVDA 4FT4A 3LYIA 5CIUA 2QDYB 2MCNA 2CT3A 1X27A 2JUFA 4C0FA 3JCMd 2W0ZA 1SRMA 3ZL7C 1NJIC 2OTLT 3I55T 2CUDA 4RTUA 1VOMA 1BIBA 1U8RA 4M7DB 3MEVA 4RCBA 2QDLA 2ZPIB 3OYFA 4WCIA 3CBMA 3PMIA 4OP0A 2K4YA 2A36A 2CP0A 2EBPA 2FVUA 4NL2A 4FU6A 5IN1A 1OX8A 4A4EA 5DLOA 2DZCA 5HCKA 3OS5A 3INZA 3VJPA 4AFUC 4DBFA 4M7DG 3LW5E 2RPNA 2HZYA 1SF9A 4JLIA 1VQ8Q 4M75A 1K76A 3QUIA 2ECZA 2JW4A 4YTLA 5DM7R 1QVPA 1SG5A 1VQ9Q 3RIRA 1B34A 2ZCFB 2G6FX 1NPRA 2EYQA 3PFSA 2FO0A 3OYHA 4RTXA 1KJWA 2HD0A 3VS7A 5KYUB 2D0QB 4HCCA 3OYAA 4HVWA 3SFMA 4M7AD 1T0HA 1D1BA 2HQEA 2NUTB 4P5NA 2A7YA 2K5FA 3GF5A 4R55A 5LJ3h 2OX7A 4EMKC 3I5SA 1K8AC 2LX9A 4OGEA 5GAMd 1K1ZA 2F5KA 2DIQA 1LNXA 2E5KA 1Y96A 1WYXA 4N4IA 2FRYA 1N8RC 3OBYA 4N0AC 2X4JA 4XTYA 1VQPT 4D8KA 3I55A 2JM8A 2XG8D 1OPLA 2XDDA 2MK5A 4XU3A 3C95A 2K79A 2QG9B 2MIOA 1QWFA 5L8RE 3CQTA 1I5LA 2KR3A 1VQPA 3OMCA 2AK5A 4PJOA 4QW2A 5FWCA 4DOVA 2XMFA 3CCLQ 5FU6B 2KAFA 4IUUA 2KRMA 3U23A 1W6XA 5CAIA 1YIJQ
chains in the Genus database with same CATH topology
1AEYA 1X2KA 1KIKA 2LJ0A 2BZ8A 3VS4A 1MUZA 2JTEA 2LNHB 3QWYA 1HD3A 1W70A 2CT4A 1AOJA 2L3PA 1AD5A 3THKA 2J6OA 4Y92A 2AKLA 2KGTA 2KROA 3H0IA 1OEBA 2RF0A 2JMCA 1SHFA 2ED0A 3VRYA 2BTTA 5IHIA 4OMQA 1YN8A 2EYXA 4RTTA 2EYYA 2OAWA 1B3QA 1UGVA 4IIOA 1AZGB 2HCKA 5ECAA 4LUDA 2DRKA 2DL3A 4JZ4A 1JU5C 2J7IA 4AG2C 1RI9A 5GJWB 3ULRB 2V1RA 2DL8A 4HXJA 4K11A 3FJ5A 2FEIA 1GCPA 2DJQA 1GRIA 4CC7A 2KYMA 1E6HA 2JS2A 4RTYA 3EG2A 2YDLA 2SRCA 2DMOA 2P4RA 4Z88A 2KRNA 1ZSGA 4HVUA 1JXMA 3VRZA 2LQWA 1M30A 2ESWA 3PVLA 2YSQA 2EGCA 2OJ2A 1Y57A 2AZSA 4CC4B 1U3OA 2HBWA 2RQTA 4R0KA 4Z89A 4RTVA 3TVTA 1CKBA 4HCKA 2CSQA 3A98A 2A28A 2NWMA 2LCSA 2KT1A 1M3CA 2D8JA 1OPKA 2AZVA 2FPFA 4OMNA 1H92A 4QT7A 4RTZA 1PNJA 2X3WD 2KYBA 2EYZA 1RLPC 2F2VA 5IH2A 2HSPA 1GBQA 1ZUYA 1CSKA 2LJ3A 1ARKA 1T0JA 1MV3A 2F2XA 2DL5A 2YT6A 2OI3A 4IIMA 4OMLA 1VYTA 4JJDA 1PRMC 5IHNA 2LZ6B 2I0NA 2DNUA 3EG3A 1UFFA 4LN2A 4Z8AA 4J9GA 2IIMA 2SEMA 2JMAA 4FSSA 1OV3A 4OMPA 1V1CA 2KE9A 2RN8A 4LUEA 2PNIA 4ESRA 2EQIA 1EFNA 2F2WA 3PVQA 2RQUA 1UJ0A 4RUGA 1KSWA 2W10A 1K9AA 4JJBA 4DEXA 1QCFA 2PZ1A 4J9HA 1ZLMA 4J9IA 3EHRA 1VYUA 1GBRA 1E7OA 2ROLA 4AFSC 1UUEA 1X6BA 1BB9A 1SPKA 3VS2A 4CC3A 5IXFA 2FRWA 1JO8A 3NHNA 2H8HA 2ED1A 1K4US 2EW3A 2M0YA 2KBTA 4ZNXA 2HEQA 1AVZC 1OOTA 2DVJA 1K0XA 1AWOA 1Z9QA 1M27C 4KRTA 1W1FA 3H0HA 1BBZA 2YUOA 2CUBA 2GBQA 5IHKA 2CREA 2PTKA 2VKNA 1PKTA 1NLOC 2EGAA 1UTIA 2B86A 1T3LA 3GBQA 1JEGA 4GLMA 1T3SA 3I5RA 3EG1A 3JV3A 1GFCA 1ABQA 2X3XD 1AWJA 1WXUA 2LX7A 3KFVA 1SSHA 2J05A 2O9VA 1HSQA 1PHTA 2KXCA 1LCKA 3M0PA 2J6FA 2K2MA 3REBB 1Y0MA 1X69A 2JS0A 3H0FA 5EC7A 2RQWA 2JM9A 2EYWA 1WLPB 1YCSB 1WX6A 1SHGA 2HDAA 2ROTA 5FWBA 1CKAA 3R6NA 2JT4A 1GCQA 1JXOA 4AFQC 1ZBJA 2K9GA 2BZYA 5GJVB 1UECA 4LE9A 1N5ZA 4ORZA 2EGEA 3REAB 1WXTA 1AZEA 2YUQA 1NEBA 3VS0A 1YNZA 1VYVA 1XOVA 1E6GA 1M8MA 2KRSA 3M0UA 1SEMA 2DX1A 1WA7A 1Z9ZA 1A0NB 1UJYA 2O9SA 1AWWA 2YUNA 2AKKA 2DILA 5I11A 3M0TA 1WI7A 1K0SA 3RBBB 4HVVA 2J06A 1FYNA 1QKXA 3M0SA 4M4ZA 1QWEA 1RLQC 1AWXA 3VS1A 1I0CA 2GGRA 3M0RA 1X43A 3EG0A 1GCQC 1PKSA 2CH4A 4AG1C 2C0IA 1NM7A 2DBKA 2O2OA 3UA7A 2BZXA 5FW9A 2ENMA 3QWXX 2K3BA 1JQQA 3UATA 3C0CA 4LNPA 2DRMA 1G2BA 2GNCA 5IXBA 4F16A 1NYFA 2DE0X 3NPFA 2YUPA 4F14A 3NGPA 3EGUA 1TUDA 2RMOA 1G83A 2FPDA 2KT8A 1UG1A 1X2QA 1GFDA 4CC2A 2KXDA 2J6KA 2D1XA 1I1JA 1I07A 3EHQA 1GL5A 3UF4A 2DYBA 1KFZA 1PRLC 1WDXA 4AFZC 2CDTA 3TSZA 1ZUKA 2LQNA 3NMZC 2D0NA 1NYGA 4EIKA 1H3HA 2MCNA 4A63B 1ZX6A 2CT3A 2L3QA 1X27A 2M51A 1QLYA 3SHWA 1UDLA 2DBMA 2W0ZA 1SRMA 1UHCA 3ZL7C 1U5SA 2JXBA 2VWFA 2ABLA 2CUDA 2C0OA 4RTUA 4J9CA 1H8KA 1NG2A 1UE9A 2LJ1A 2QDLA 4WCIA 1PWTA 2A08A 2DM1A 1ABOA 3M0QA 5I22A 2A36A 2EBPA 2DF6A 5HCKA 1FMKA 3VS6A 4AFUC 1HJDA 1QKWA 3SEMA 4OMOA 2RPNA 1WIEA 4J9DA 2MOXA 2K6DA 1BK2A 3VS5A 1BU1A 4E6RA 1YWOA 1K76A 2JW4A 2ECZA 2DL4A 1ZUUA 4JZ3A 2EPDA 1J3TA 2L2PA 3H41A 3IQLA 2G6FX 1U06A 2LMJA 2FO0A 1MV0B 4RTXA 2O31A 2L0AA 2VVKA 1KJWA 1M3BA 2RQVA 3I9QA 4JPBW 3VS7A 3VS3A 1NLPC 1TG0A 1NEGA 2D8HA 4HVWA 1T0HA 4D8DA 4OMMA 1SRLA 1B07A 3O5ZA 3I5SA 1UHFA 2C0TA 2DLPA 4GBQA 1K1ZA 2E5KA 1S1NA 1WYXA 2CSIA 2GTJA 2FRYA 4J9FA 4RTWA 1TUCA 2L3SA 2O88A 1WFWA 2RQRA 2RNAA 4D8KA 2JM8A 2EKHA 2K7AA 1OPLA 3RNJA 1X6GA 4J9BA 2LP5A 1VA7A 2KNBB 2K79A 1YWPA 2A37A 3UA6A 2KEAA 3LH5A 1RUWA 2MIOA 1QWFA 1IO6A 4DEYA 3CQTA 2FPEA 2KR3A 1WXBA 3I35A 2NUZA 2DL7A 2GTOA 4J9EA 4X1VA 2AK5A 2DA9A 5FWCA 2FG0A 1YP5A 2XMFA 5L23A 2GQIA 4F17A 2V1QA 2CH4W 3TSWA 4JJCA 2KRMA 2EVRA 1M3AA 3U23A 1W6XA 3PE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEY A;  1X2K A;  1KIK A;  2LJ0 A;  2BZ8 A;  3VS4 A;  1MUZ A;  2JTE A;  2LNH B;  3QWY A;  1HD3 A;  1W70 A;  2CT4 A;  1AOJ A;  2L3P A;  1AD5 A;  3THK A;  2J6O A;  4Y92 A;  2AKL A;  2KGT A;  2KRO A;  3H0I A;  1OEB A;  2RF0 A;  2JMC A;  1SHF A;  2ED0 A;  3VRY A;  2BTT A;  5IHI A;  4OMQ A;  1YN8 A;  2EYX A;  4RTT A;  2EYY A;  2OAW A;  1B3Q A;  1UGV A;  4IIO A;  1AZG B;  2HCK A;  5ECA A;  4LUD A;  2DRK A;  2DL3 A;  4JZ4 A;  1JU5 C;  2J7I A;  4AG2 C;  1RI9 A;  5GJW B;  3ULR B;  2V1R A;  2DL8 A;  4HXJ A;  4K11 A;  3FJ5 A;  2FEI A;  1GCP A;  2DJQ A;  1GRI A;  4CC7 A;  2KYM A;  1E6H A;  2JS2 A;  4RTY A;  3EG2 A;  2YDL A;  2SRC A;  2DMO A;  2P4R A;  4Z88 A;  2KRN A;  1ZSG A;  4HVU A;  1JXM A;  3VRZ A;  2LQW A;  1M30 A;  2ESW A;  3PVL A;  2YSQ A;  2EGC A;  2OJ2 A;  1Y57 A;  2AZS A;  4CC4 B;  1U3O A;  2HBW A;  2RQT A;  4R0K A;  4Z89 A;  4RTV A;  3TVT A;  1CKB A;  4HCK A;  2CSQ A;  3A98 A;  2A28 A;  2NWM A;  2LCS A;  2KT1 A;  1M3C A;  2D8J A;  1OPK A;  2AZV A;  2FPF A;  4OMN A;  1H92 A;  4QT7 A;  4RTZ A;  1PNJ A;  2X3W D;  2KYB A;  2EYZ A;  1RLP C;  2F2V A;  5IH2 A;  2HSP A;  1GBQ A;  1ZUY A;  1CSK A;  2LJ3 A;  1ARK A;  1T0J A;  1MV3 A;  2F2X A;  2DL5 A;  2YT6 A;  2OI3 A;  4IIM A;  4OML A;  1VYT A;  4JJD A;  1PRM C;  5IHN A;  2LZ6 B;  2I0N A;  2DNU A;  3EG3 A;  1UFF A;  4LN2 A;  4Z8A A;  4J9G A;  2IIM A;  2SEM A;  2JMA A;  4FSS A;  1OV3 A;  4OMP A;  1V1C A;  2KE9 A;  2RN8 A;  4LUE A;  2PNI A;  4ESR A;  2EQI A;  1EFN A;  2F2W A;  3PVQ A;  2RQU A;  1UJ0 A;  4RUG A;  1KSW A;  2W10 A;  1K9A A;  4JJB A;  4DEX A;  1QCF A;  2PZ1 A;  4J9H A;  1ZLM A;  4J9I A;  3EHR A;  1VYU A;  1GBR A;  1E7O A;  2ROL A;  4AFS C;  1UUE A;  1X6B A;  1BB9 A;  1SPK A;  3VS2 A;  4CC3 A;  5IXF A;  2FRW A;  1JO8 A;  3NHN A;  2H8H A;  2ED1 A;  1K4U S;  2EW3 A;  2M0Y A;  2KBT A;  4ZNX A;  2HEQ A;  1AVZ C;  1OOT A;  2DVJ A;  1K0X A;  1AWO A;  1Z9Q A;  1M27 C;  4KRT A;  1W1F A;  3H0H A;  1BBZ A;  2YUO A;  2CUB A;  2GBQ A;  5IHK A;  2CRE A;  2PTK A;  2VKN A;  1PKT A;  1NLO C;  2EGA A;  1UTI A;  2B86 A;  1T3L A;  3GBQ A;  1JEG A;  4GLM A;  1T3S A;  3I5R A;  3EG1 A;  3JV3 A;  1GFC A;  1ABQ A;  2X3X D;  1AWJ A;  1WXU A;  2LX7 A;  3KFV A;  1SSH A;  2J05 A;  2O9V A;  1HSQ A;  1PHT A;  2KXC A;  1LCK A;  3M0P A;  2J6F A;  2K2M A;  3REB B;  1Y0M A;  1X69 A;  2JS0 A;  3H0F A;  5EC7 A;  2RQW A;  2JM9 A;  2EYW A;  1WLP B;  1YCS B;  1WX6 A;  1SHG A;  2HDA A;  2ROT A;  5FWB A;  1CKA A;  3R6N A;  2JT4 A;  1GCQ A;  1JXO A;  4AFQ C;  1ZBJ A;  2K9G A;  2BZY A;  5GJV B;  1UEC A;  4LE9 A;  1N5Z A;  4ORZ A;  2EGE A;  3REA B;  1WXT A;  1AZE A;  2YUQ A;  1NEB A;  3VS0 A;  1YNZ A;  1VYV A;  1XOV A;  1E6G A;  1M8M A;  2KRS A;  3M0U A;  1SEM A;  2DX1 A;  1WA7 A;  1Z9Z A;  1A0N B;  1UJY A;  2O9S A;  1AWW A;  2YUN A;  2AKK A;  2DIL A;  5I11 A;  3M0T A;  1WI7 A;  1K0S A;  3RBB B;  4HVV A;  2J06 A;  1FYN A;  1QKX A;  3M0S A;  4M4Z A;  1QWE A;  1RLQ C;  1AWX A;  3VS1 A;  1I0C A;  2GGR A;  3M0R A;  1X43 A;  3EG0 A;  1GCQ C;  1PKS A;  2CH4 A;  4AG1 C;  2C0I A;  1NM7 A;  2DBK A;  2O2O A;  3UA7 A;  2BZX A;  5FW9 A;  2ENM A;  3QWX X;  2K3B A;  1JQQ A;  3UAT A;  3C0C A;  4LNP A;  2DRM A;  1G2B A;  2GNC A;  5IXB A;  4F16 A;  1NYF A;  2DE0 X;  3NPF A;  2YUP A;  4F14 A;  3NGP A;  3EGU A;  1TUD A;  2RMO A;  1G83 A;  2FPD A;  2KT8 A;  1UG1 A;  1X2Q A;  1GFD A;  4CC2 A;  2KXD A;  2J6K A;  2D1X A;  1I1J A;  1I07 A;  3EHQ A;  1GL5 A;  3UF4 A;  2DYB A;  1KFZ A;  1PRL C;  1WDX A;  4AFZ C;  2CDT A;  3TSZ A;  1ZUK A;  2LQN A;  3NMZ C;  2D0N A;  1NYG A;  4EIK A;  1H3H A;  2MCN A;  4A63 B;  1ZX6 A;  2CT3 A;  2L3Q A;  1X27 A;  2M51 A;  1QLY A;  3SHW A;  1UDL A;  2DBM A;  2W0Z A;  1SRM A;  1UHC A;  3ZL7 C;  1U5S A;  2JXB A;  2VWF A;  2ABL A;  2CUD A;  2C0O A;  4RTU A;  4J9C A;  1H8K A;  1NG2 A;  1UE9 A;  2LJ1 A;  2QDL A;  4WCI A;  1PWT A;  2A08 A;  2DM1 A;  1ABO A;  3M0Q A;  5I22 A;  2A36 A;  2EBP A;  2DF6 A;  5HCK A;  1FMK A;  3VS6 A;  4AFU C;  1HJD A;  1QKW A;  3SEM A;  4OMO A;  2RPN A;  1WIE A;  4J9D A;  2MOX A;  2K6D A;  1BK2 A;  3VS5 A;  1BU1 A;  4E6R A;  1YWO A;  1K76 A;  2JW4 A;  2ECZ A;  2DL4 A;  1ZUU A;  4JZ3 A;  2EPD A;  1J3T A;  2L2P A;  3H41 A;  3IQL A;  2G6F X;  1U06 A;  2LMJ A;  2FO0 A;  1MV0 B;  4RTX A;  2O31 A;  2L0A A;  2VVK A;  1KJW A;  1M3B A;  2RQV A;  3I9Q A;  4JPB W;  3VS7 A;  3VS3 A;  1NLP C;  1TG0 A;  1NEG A;  2D8H A;  4HVW A;  1T0H A;  4D8D A;  4OMM A;  1SRL A;  1B07 A;  3O5Z A;  3I5S A;  1UHF A;  2C0T A;  2DLP A;  4GBQ A;  1K1Z A;  2E5K A;  1S1N A;  1WYX A;  2CSI A;  2GTJ A;  2FRY A;  4J9F A;  4RTW A;  1TUC A;  2L3S A;  2O88 A;  1WFW A;  2RQR A;  2RNA A;  4D8K A;  2JM8 A;  2EKH A;  2K7A A;  1OPL A;  3RNJ A;  1X6G A;  4J9B A;  2LP5 A;  1VA7 A;  2KNB B;  2K79 A;  1YWP A;  2A37 A;  3UA6 A;  2KEA A;  3LH5 A;  1RUW A;  2MIO A;  1QWF A;  1IO6 A;  4DEY A;  3CQT A;  2FPE A;  2KR3 A;  1WXB A;  3I35 A;  2NUZ A;  2DL7 A;  2GTO A;  4J9E A;  4X1V A;  2AK5 A;  2DA9 A;  5FWC A;  2FG0 A;  1YP5 A;  2XMF A;  5L23 A;  2GQI A;  4F17 A;  2V1Q A;  2CH4 W;  3TSW A;  4JJC A;  2KRM A;  2EVR A;  1M3A A;  3U23 A;  1W6X A;  3PE0 A; 
#chains in the Genus database with same CATH topology
 4C0Z A;  3I56 T;  3CPW A;  2QYZ A;  1HD3 A;  1W70 A;  1N8R U;  1AD5 A;  3EH2 A;  4LDU A;  2COZ A;  1OEB A;  1IRE B;  2WSC E;  1ZA2 B;  2JMC A;  5D6W A;  3CXC P;  5GAO p;  2EYX A;  4RTT A;  4PJM A;  3LWI A;  1S72 A;  1UGV A;  2PVG B;  4IIO A;  4F7U G;  5CCA A;  2KQW A;  1Q81 U;  2BUD A;  1IRX A;  1RI9 A;  2V1R A;  3BDL A;  5KCO A;  3LGF A;  3QZ5 B;  3FJ5 A;  1OZ3 A;  1M1K C;  2FEI A;  3V8K A;  1FMV A;  3OS2 A;  2E3I A;  2DEU A;  4JDS A;  2E6N A;  4KBM B;  1Q82 U;  4CC7 A;  4C8Q F;  2EQK A;  4M78 D;  2NUT A;  4RTY A;  4E7K A;  2DMO A;  2ZAE A;  1K73 R;  3OSS C;  3M57 A;  3M59 A;  4HVU A;  2FB7 A;  2LQW A;  2YSQ A;  4N0A A;  1U3O A;  1UGP B;  2RQT A;  3EAE A;  3M56 A;  4J8O A;  3OYC A;  5KYX B;  2CSQ A;  3LWH A;  1TXQ A;  2KT1 A;  4OMN A;  2FPF A;  1H92 A;  4QT7 A;  1PNJ A;  2O4X A;  2X3W D;  1YJ9 A;  3MO8 A;  3SWN A;  2EYZ A;  2F2V A;  3EGD B;  4EMK A;  1ZUY A;  2DTI A;  4Q5W A;  4JRP A;  5J3B A;  3G71 A;  1T0J A;  3M4G A;  4FYW B;  2BIV A;  1RAI B;  4IIM A;  4OML A;  4M77 B;  3X24 B;  5GAN j;  4M78 F;  3EG3 A;  1WQ7 A;  4LN2 A;  4Z8A A;  5FU7 B;  4J9G A;  2SEM A;  4FSS A;  3G71 T;  4OMP A;  3HFO A;  3CC4 A;  2F2W A;  3PVQ A;  1R0C B;  4RUG A;  3F70 A;  4HA8 A;  3JCM Q;  3L42 A;  5IT9 E;  3RKW A;  1M90 C;  5HKC A;  4M75 C;  4FCY A;  5KYU A;  4J9H A;  1ZLM A;  4HKE A;  3JSC A;  3QDF A;  3CPW P;  3P8H A;  3CC4 T;  2M9U A;  3EFO B;  1RAF B;  3FIF A;  3RDV A;  1VQ8 A;  2ZGW A;  3GIB A;  4KGZ B;  2L8D A;  1JO8 A;  2JN0 A;  2ED1 A;  1K4U S;  4KUL A;  2M0Y A;  1AVZ C;  1YHQ T;  1K0X A;  1AWO A;  1M27 C;  3H0H A;  2M16 A;  5KYW B;  3E1S A;  1M5Q 1;  2CRE A;  2FZC B;  3OYD A;  1B7T A;  3QJY A;  1UTI A;  4A4K A;  1VQL T;  1Q95 G;  3A8M B;  3GBQ A;  3P8B B;  4II1 A;  1JEG A;  4GLM A;  3I5R A;  1TH7 A;  2L5Q A;  3EG1 A;  3JV3 A;  1WXU A;  5GMK j;  1I4K 1;  1K9M R;  1QVF A;  1Y07 A;  2J05 A;  2O9V A;  2NLU A;  4O6J A;  1N6A A;  4X9D A;  5LJ3 e;  1LCK A;  5C6S A;  3ZEH A;  1VQL A;  2J6F A;  3UT1 A;  4J6W A;  1S72 Q;  4CRI A;  3H0F A;  3RKX A;  3EFR A;  2RQW A;  1G3T A;  2V8K A;  4MMK A;  1PC0 A;  1X6O A;  3GP8 A;  2ROT A;  2RM4 A;  4C92 C;  1TWB A;  2JT4 A;  1GCQ A;  1JXO A;  2HSE B;  1Q81 C;  4ZN3 A;  3L2W A;  2ZPH B;  3V8J A;  1Q82 R;  1F1B B;  4LE9 A;  1VQ5 A;  4ORZ A;  1YI2 T;  3BDU A;  4J6X A;  5GAM j;  3CMA Q;  1YNZ A;  4OB0 B;  1E6G A;  3M0U A;  4LD9 K;  3BW1 A;  2IPO B;  2PUK B;  3HTR A;  1MMG A;  3TRE A;  1PSF A;  1VQK T;  4X9C A;  2XHC A;  3JCM J;  2J06 A;  1QKX A;  4C92 G;  2MYS A;  4M7A A;  1XNI A;  1RLQ C;  2CZ0 B;  2GFU A;  3QDR B;  1YJW A;  3I55 Q;  4V2S A;  1UGQ B;  3PNW C;  4ZGJ B;  3X26 B;  2CH4 A;  1IHW A;  2BZX A;  4BAC A;  5FRM A;  1VQ4 A;  4C0D C;  4EMG A;  5FW9 A;  2ENM A;  3QWX X;  2K2V A;  2LTO A;  4M7D A;  4LNP A;  2DRM A;  1G2B A;  5IXB A;  5GMK i;  2DE0 X;  1M90 U;  4M7D F;  5GAO r;  4F14 A;  1V76 A;  1WJQ A;  1MGQ A;  2DO3 A;  3CC2 Q;  2KMT A;  1G83 A;  3AHU A;  3OMG A;  2PVO B;  1WHM A;  1NJI U;  1I1J A;  1I07 A;  1M1K U;  4JRK A;  1NE8 A;  2F5T X;  3QYG B;  4ZGD B;  1WDX A;  1YIT Q;  2CDT A;  4EPC A;  4WTO B;  3TSZ A;  2D0N A;  3DB3 A;  1NYG A;  4OGC A;  1KK7 A;  3G6E T;  4J7F A;  3CCE T;  3KBG A;  2RD1 A;  4PLL A;  1TU0 B;  4N4H A;  2DBM A;  1UHC A;  2JXB A;  5LJ3 g;  2VWF A;  2BE9 B;  2C0O A;  3G6E A;  2JTM A;  1UE9 A;  1K8A R;  3CD6 T;  1PWT A;  4KUD K;  1ABO A;  1UGS B;  3M0Q A;  1N8R R;  2DF6 A;  4C92 A;  1HK9 A;  4M7A G;  2FHD A;  3VS6 A;  3JCM c;  1Q86 U;  1HJD A;  4RG2 A;  1QKW A;  3UWN A;  2E1H A;  1WIE A;  2R5M A;  5KE3 A;  2QI2 A;  3M4Y A;  3VS5 A;  4E6R A;  4PJN A;  1G3S A;  4VUB A;  3TQ7 P;  4C0D B;  3VYH B;  1ZUU A;  4JZ3 A;  2EPD A;  1J3T A;  3H41 A;  4M77 E;  5LJ5 g;  2CGH A;  4FW1 A;  5LJ5 d;  4BY6 B;  2E10 A;  3MP6 A;  3V8L A;  4E7H A;  2LNV A;  3OYM A;  4JUV A;  4PFZ A;  2RQV A;  4JPB W;  3VS3 A;  1NLP C;  1LJO A;  8AT1 B;  3MHX A;  2FYK A;  3EH1 A;  3SWN B;  3PGG A;  2O4X B;  4C8Q E;  4R56 A;  1VQP Q;  3JB9 G;  5EG2 A;  2X4Y A;  3CPW S;  1RAD B;  4OMM A;  1SRL A;  1RAH B;  3DKM A;  1VQ6 T;  4CI0 C;  1WHL A;  4Z02 A;  1S1N A;  3OSV A;  1IXD A;  2GTJ A;  2EKO A;  4QQ6 A;  2L3S A;  4FW2 A;  1WFW A;  3CBP A;  2IVW A;  5LJ3 d;  2RNA A;  2RB6 A;  2X4W A;  3N5B B;  5AYF A;  2RO0 A;  4J9B A;  3TCJ A;  4BD3 A;  1VA7 A;  3M54 A;  4M75 D;  3WVD B;  2A37 A;  2M0O A;  1RUW A;  3PMT A;  3KUF A;  1IO6 A;  2FPE A;  1WXB A;  5KE2 A;  2DL7 A;  2V8J A;  5GMK l;  4J9E A;  2DA9 A;  3A5Z B;  4M77 F;  1YP5 A;  3OYJ A;  1WHK A;  1N27 A;  3HFN A;  4MML A;  3TSW A;  2K3Y A;  4UC4 A;  2RHZ A;  1KC8 U;  3OYI A;  1AEY A;  2CZ1 B;  4KH0 B;  3CC4 Q;  3FJP A;  4FM4 B;  3CC2 A;  1RI0 A;  1MUZ A;  2CP5 A;  4KGX B;  1I81 A;  2LNH B;  2CT4 A;  2J6O A;  4M7D E;  1M2V A;  3H0I A;  2A0F B;  2DEQ A;  3I56 A;  3CCJ A;  2BTT A;  1YN8 A;  2D9T A;  4ME7 A;  2E12 A;  2DKG A;  3SWN C;  2K3X A;  2Y4X A;  4LUD A;  4DBQ A;  2LC4 A;  5GAN h;  1JU5 C;  2HBP A;  2YRV A;  5GJW B;  3QXE B;  4ANJ A;  4ZGE B;  2DL8 A;  4HXJ A;  4K11 A;  5HK0 A;  2H3J A;  1YJW Q;  1GCP A;  2RI5 A;  1PG5 B;  1KD1 R;  2MMP A;  1YCY A;  2DYI A;  5FRN A;  1G5V A;  1E6H A;  4BI4 A;  3EG2 A;  2XI9 A;  2SRC A;  1K73 U;  1U1T A;  2KRN A;  1XTD A;  1VQ7 Q;  1ZSG A;  2Y90 A;  2LCC A;  3HRS A;  1BI0 A;  3JAM E;  5GMK h;  2ESW A;  3OYB A;  2EGC A;  2OJ2 A;  1KQ1 A;  2AZS A;  3TEE A;  1KQS P;  4CC4 B;  2HBW A;  2DIG A;  1R77 A;  4E7Z A;  4Z89 A;  2P84 A;  1CKB A;  2MPX C;  5J26 A;  1MMA A;  2K57 A;  1M3C A;  3M58 A;  1WHH A;  4FYX B;  3QII A;  4ELY C;  2KYB A;  1RLP C;  3HRU A;  5IH2 A;  4HCB A;  2QQB A;  1M1G A;  2LJ3 A;  1ARK A;  4PJO B;  4RG8 A;  1KQ2 A;  2EFI A;  2YT6 A;  1OZ2 A;  1VYT A;  4JJD A;  2P0P A;  4F7U F;  1YJ9 T;  4FL6 A;  4LDW A;  2I0N A;  2DTO A;  2OTL A;  1Q7Y U;  2DER A;  4PJO G;  4M7D C;  2IIM A;  3J80 E;  2JMA A;  1EZZ B;  4PLI A;  5D6X A;  3LH0 A;  2RN8 A;  1QP3 A;  4LD6 A;  4PKC C;  4DA4 A;  2P0Q A;  1YIJ A;  4PJO C;  3CME Q;  2CP6 A;  1QCF A;  1QMC A;  4WF2 A;  3V7R A;  3G6E Q;  3QSU A;  1Q81 R;  3FEO A;  1GXI E;  2DJZ A;  4AFS C;  1UUE A;  2HKQ B;  1X6B A;  3CCV T;  3PTA A;  5IXF A;  3CEY A;  3OYY A;  5J39 A;  1FX7 A;  7AT1 B;  4HT9 A;  4C92 D;  4GY5 A;  2E65 A;  4B6M A;  4KRT A;  3S3N A;  1W1F A;  2EJ9 A;  2JVV A;  1BBZ A;  1VQO T;  1VQ8 T;  1VQ7 A;  3QKJ A;  2EAY A;  3C12 A;  5IHK A;  1O75 A;  1PKT A;  3EFS A;  1NLO C;  2F69 A;  3HL8 A;  4ELZ C;  3GPL A;  1VQ9 A;  3MPU B;  2RJF A;  1RAC B;  4LDV A;  2XDP A;  4BDZ A;  1QCO A;  2RJE A;  2KVQ G;  2X3X D;  1AWJ A;  2LX7 A;  3DLM A;  3VYG A;  4B9X A;  1HSQ A;  1PHT A;  1KG1 A;  3NTI A;  1FWZ A;  2COW A;  1X75 C;  1ZSZ A;  2QA4 A;  3A8H B;  3RKY A;  2CZ6 B;  4BE2 A;  2DXB A;  3REB B;  2QQ9 A;  5GAO q;  1Y0M A;  2LQK A;  4XAX B;  1N9S A;  5CKB A;  5DY9 A;  2EYW A;  3CCR Q;  1WGS A;  1VQN A;  1WLP B;  1WX6 A;  4BDY A;  2OAU A;  3OW2 P;  1SHG A;  2HDA A;  3OBW A;  4XU1 A;  2DVE A;  1XQH A;  2K9G A;  2QGF B;  3RER A;  2CYZ B;  1VQN T;  2EGE A;  1D0X A;  3DB4 A;  1WXT A;  1VYV A;  1M8M A;  3OYG A;  2KK4 A;  1VQM T;  1A0N B;  3MCA B;  1YHQ A;  5CKE A;  4MDW A;  3HHT B;  2DIL A;  1VQK Q;  2NYS A;  4XTX A;  1WI7 A;  3CCQ T;  3RBB B;  1JRI A;  3QO3 A;  2YLB A;  5LL6 S;  1KC8 C;  4ATO A;  5LJ5 h;  3M9Q A;  2LCL A;  1VQ9 T;  5HK3 A;  4JRI A;  4NS5 A;  5GMK e;  1KHI A;  1VQ6 Q;  4M75 G;  3EG0 A;  1N9R A;  1PKS A;  1D3B A;  3UA7 A;  3OS1 A;  3WXM B;  3L1A A;  2GFA A;  1KD1 U;  2XKO C;  3UAT A;  1JQQ A;  1WZO A;  4BUG A;  3C0C A;  3GNF B;  2GNC A;  4M75 B;  4F16 A;  1NYF A;  2DZ9 A;  3C94 A;  5LJ5 f;  2X35 A;  4PFO A;  3E9G A;  3WVE B;  3EGU A;  3H8Z A;  1BIA A;  4J5Y A;  4C8Q A;  2KT8 A;  2RJC A;  3CXC A;  2KXD A;  2J6K A;  2D1X A;  3EHQ A;  1GL5 A;  1ACM B;  2DYB A;  5M9O A;  1PRL C;  2EIF A;  5LJ3 j;  1VQ5 T;  2DXU A;  1YI2 A;  1KHC A;  4C8Q D;  2LQN A;  2QQR A;  3NMZ C;  4FSX A;  1W2B P;  5D7U A;  3VU3 C;  4EIK A;  3CCR T;  1H3H A;  2MF2 A;  1ZX6 A;  3J7A F;  2VC8 A;  3EG9 A;  1TUG B;  2A3L A;  2VAS A;  1D0Z A;  1G8X A;  3V7C A;  1QLY A;  3OYE A;  1AT1 B;  1UDL A;  3HSB A;  1VQK A;  4C5E A;  2ABL A;  4FYV B;  2V8I A;  4J9C A;  1MHN A;  3MP1 A;  1NG2 A;  6AT1 B;  5GAM g;  2HL5 C;  2VGN A;  4XK8 E;  3H9N A;  1DJ7 B;  5I22 A;  1VQM Q;  4OVA A;  4DQ2 A;  4C92 F;  3SEM A;  4OMO A;  1S72 T;  1YIJ T;  4J9D A;  2MOX A;  1JBM A;  5GAM e;  4PFP A;  2JOY A;  5D6Y A;  1YWO A;  1LOJ A;  3J81 E;  4D6W A;  2QAZ A;  1WHG A;  2I2L A;  2HL3 A;  1U06 A;  4QKU A;  2LMJ A;  5HY6 A;  1OI1 A;  5GAN 2;  1MV0 B;  2O31 A;  2C06 A;  3CC7 A;  1BCM A;  2VVK A;  3G7Z A;  1YIT T;  1M3B A;  3I9Q A;  3PIO A;  4M77 A;  1TG0 A;  1NEG A;  5DLQ E;  4LXC A;  2VXE A;  2LT1 A;  2ZPB B;  3JCM P;  1VQO A;  1VQ7 T;  2Y4Y A;  2EWN A;  2VV5 A;  2C0T A;  4GBQ A;  4A4F A;  2QXF A;  1UB4 A;  4IUR A;  4J9F A;  2JNG A;  2O88 A;  3JCM V;  2E70 A;  3EFO A;  1OX9 A;  4B9W A;  3JCM b;  2GCX A;  3RNJ A;  1QP2 A;  3X20 B;  3GNG A;  1YJ9 Q;  4PJJ A;  4J7I A;  2KNB B;  1Q86 R;  3UA6 A;  2MWO A;  3G4S Q;  3CME T;  2KEA A;  2DXC A;  2LRQ A;  2XID A;  4OB3 B;  2NUZ A;  4KT0 E;  1YI2 Q;  4OB2 B;  4X1V A;  4C5I A;  3GOX A;  2FG0 A;  1LPL A;  3RR6 A;  2MI6 A;  2GQI A;  1D0Y A;  3EGD A;  2V1Q A;  4F17 A;  2R57 A;  3OQ5 A;  4A54 A;  4JJC A;  4BE0 A;  2EVR A;  3QG1 A;  1X2K A;  2O01 E;  3QBY A;  1BI3 A;  2QEX A;  2KY9 A;  3QWY A;  3CCU Q;  1AOJ A;  2L3P A;  4ZN1 A;  2X4X A;  3THK A;  4Y92 A;  3CC7 T;  2AHJ B;  2AKL A;  2KRO A;  2DK3 A;  2RF0 A;  3FRN A;  1SHF A;  1M1K R;  1RAG B;  1EX4 A;  1K8A U;  3JB9 D;  5IHI A;  1RAB B;  4OMQ A;  1YJN T;  4FT2 A;  4FYY B;  4F7U E;  2OAW A;  3S3O A;  1B3Q A;  1AZG B;  1WNL A;  1Y96 B;  5ECA A;  4A4H A;  2FZK B;  1VQ6 A;  2DRK A;  2ATC B;  2DL3 A;  4JZ4 A;  2DTH A;  1TS9 A;  4AG2 C;  2MAM A;  3MEW A;  3OYN A;  1YFN A;  3E19 A;  4C0G A;  1H64 1;  2K5L A;  3QHS A;  4PJO F;  3M5A A;  1UGR B;  3JCM e;  1OU8 A;  2M02 A;  1P92 A;  1YHQ Q;  2KYM A;  2QK0 A;  2JS2 A;  4NL3 A;  2YDL A;  4MDX A;  1ZBX A;  1JXM A;  5CQY A;  3VRZ A;  3OW2 A;  3G4S T;  1M30 A;  3PVL A;  4RMO A;  3CCJ Q;  1Q7Y C;  3S3M A;  3PT9 A;  3UDC A;  4PJO D;  4R0K A;  4RTV A;  2RK2 A;  2NWM A;  2LCS A;  1VQO Q;  1IZ6 A;  2PQW A;  2AZV A;  3CCL T;  3JCM h;  4KGV B;  3QZ9 B;  1VQN Q;  5GAM f;  3E9F A;  2HSP A;  1GBQ A;  2VB6 A;  1FXX A;  4ZTF A;  5A2Q E;  3CCR A;  4C92 B;  2QA4 Q;  2F2X A;  4OF1 A;  4F04 B;  1PRM C;  3CBO A;  5IHN A;  3ZFJ A;  2OTJ Q;  3ZBD A;  1M4Z A;  5GAN 5;  1OV3 A;  1W2B A;  3BY7 A;  4M78 B;  2KE9 A;  2XU8 A;  5A0G A;  4LUE A;  2PNI A;  4MZM A;  2RHX A;  2EQI A;  4LDY A;  1PM3 A;  2VUB A;  1D1A A;  1UJ0 A;  4X34 A;  1KSW A;  2W10 A;  1K9A A;  4PJL A;  3SB2 A;  3L2U A;  4M78 G;  4BY6 C;  2PZ1 A;  1D3B B;  4XTW A;  3CCE Q;  1OQK A;  1K9M U;  1XJW B;  5IAY A;  5KCH A;  4XU0 A;  1VYU A;  2ZZD A;  1ZA1 B;  3L2Z A;  2KDS A;  9ATC B;  2L3R A;  4QVC A;  4CC3 A;  2PUO B;  4RCC A;  5A0D A;  3OYK A;  3NHN A;  2H8H A;  1TSF A;  5KYY B;  1VQ4 T;  4L59 A;  1VUB A;  5KYW A;  2E64 A;  2YLC A;  2KBT A;  4ZNX A;  2HEQ A;  1OOT A;  4DOW A;  2DVJ A;  1C0M A;  1Z9Q A;  1C6V X;  2WAC A;  2P0K A;  4E7J A;  1NPP A;  3RMQ A;  2YUO A;  2CUB A;  4PL6 A;  4BE1 A;  2PTK A;  2VKN A;  1NZ9 A;  1OU9 A;  2EGA A;  5GAN 8;  3OB9 A;  5CK9 A;  2QTX A;  2B86 A;  1T3L A;  5GAN 3;  2FL7 A;  1MMN A;  2LQ8 A;  4QQD A;  3A8G B;  1R0B G;  1QVG S;  1QVF P;  3LGL A;  1ABQ A;  2P4T A;  3P8D A;  2X51 A;  1IGU A;  4JRQ A;  4Y28 E;  4IKF A;  1R8O B;  5CO7 A;  2OTL Q;  2MWP A;  1HYO A;  1X69 A;  3OA6 A;  2JS0 A;  5EC7 A;  2ZPE B;  4MZP A;  2JM9 A;  1EIF A;  5LJ5 j;  1ZSZ B;  3O8V A;  5GMK m;  1K9M C;  4XTV A;  3GLX A;  4C8Q G;  2RI2 A;  3V7S A;  2BZY A;  1UEC A;  1W2B S;  5GAM h;  4ZTJ A;  3JCM f;  3REA B;  3FC3 A;  4M7D D;  1AZE A;  2GQV A;  2YUQ A;  1NEB A;  3JRZ A;  3T9N A;  5GAO n;  3KXT A;  1KQS S;  4KUI A;  3EGX B;  5CQX A;  1WA7 A;  2O9S A;  1AWW A;  3CCQ Q;  2GF7 A;  1K0S A;  3JB9 F;  2RHU A;  5GAO l;  1H3Z A;  3M0S A;  4M4Z A;  1QWE A;  4EDU A;  2YHT A;  4C92 E;  3MP8 A;  1G3W A;  3VUB A;  4M77 G;  3VS1 A;  4MZT A;  2G3R A;  1TTH B;  3M0R A;  4HCZ A;  2PU9 B;  4IUP A;  1M2V B;  2QAS A;  4XU2 A;  3ME9 A;  4AG1 C;  2AIR B;  2AT1 B;  2VYT A;  1IHV A;  1NM7 A;  2DBK A;  2O2O A;  2NUP B;  4EMH A;  3JB9 J;  2K3B A;  2E3H A;  4JS5 A;  1BYM A;  3OY9 A;  1ZSZ C;  2YUP A;  4JS4 A;  3NGP A;  3Q1J A;  1TUD A;  2RMO A;  3AT1 B;  2HQX A;  3EG9 B;  4XTZ A;  1QW1 A;  1GFD A;  3JCM g;  4CC2 A;  3OW2 S;  5GAN 4;  3X28 B;  3JB9 H;  2M1H A;  2HAX A;  2DAQ A;  1KFZ A;  4AFZ C;  2RI3 A;  1W4S A;  3CCM Q;  4M7A F;  4XTU A;  4IUV A;  4A63 B;  2L3Q A;  3NTK A;  1I8F A;  2M51 A;  4FIB A;  1VQM A;  2CP3 A;  3C4S A;  3DLL A;  4M77 D;  1HXD A;  3SHW A;  1U5S A;  3CCQ A;  1IB8 A;  2RH2 A;  3CC2 T;  4AMC A;  1H8K A;  2HNI A;  5KH6 A;  3H6Z A;  2LJ1 A;  5C0M A;  2A08 A;  2DM1 A;  2EJF A;  4C5G A;  4BI3 A;  3CCM T;  1Q86 C;  1JB0 E;  5FRO A;  1FMK A;  1NJI R;  5GAN g;  1QVG A;  2HQH A;  4N4G A;  2K6D A;  1BK2 A;  4E7I A;  1BU1 A;  4L5G A;  3HRT A;  1WJS A;  2DL4 A;  2LT4 A;  2L2P A;  4M75 F;  2NUP A;  3IQL A;  1M2O A;  3OS0 A;  3A8L B;  4E2F B;  3CXC S;  1C1A A;  3A1P A;  1YJW T;  1PCX A;  2L0A A;  1V29 B;  2D8H A;  2E41 A;  2WSE E;  4D8D A;  5I21 A;  5AT1 B;  1B07 A;  3O5Z A;  1UHF A;  4PJO E;  2DLP A;  2QGG A;  2ZPF B;  1B34 B;  1YJN Q;  3SDZ A;  1MMD A;  1FMW A;  2CSI A;  4LDX A;  2EQJ A;  4RTW A;  1TUC A;  2BE7 D;  4TVR A;  2RQR A;  3HKS A;  2DXT A;  2E5Q A;  2RHY A;  3RMS A;  2EKH A;  2K7A A;  4M78 E;  1X6G A;  3JB9 I;  2LP5 A;  1I5O B;  2CKK A;  5KYY A;  4J83 A;  5KYN A;  2YRC A;  4QQG A;  2B8A A;  4F7U B;  5LJ3 f;  1YWP A;  3VV0 A;  3LH5 A;  4EMK B;  3CCM A;  4DEY A;  1M8V A;  3HP9 A;  3I35 A;  4C8Q C;  2GTO A;  2H3E B;  1QVG P;  1QVF S;  4M75 E;  3CCE A;  5L23 A;  5CR2 A;  3CC7 Q;  2E6Z A;  2CH4 W;  1M1F A;  3X25 B;  4PK4 A;  1M3A A;  3PE0 A;  5CVI A;  1KIK A;  1RL2 A;  2LJ0 A;  2BZ8 A;  3VS4 A;  3I56 Q;  4IUT A;  2JTE A;  3MJX A;  1O9S A;  4M78 A;  2VGM A;  1PD1 A;  1D1C A;  3FDR A;  4GLK A;  2KGT A;  3QPH A;  4JLG A;  2ED0 A;  3VRY A;  2LVM A;  2QTV A;  2XIC A;  2DFU A;  1VQ4 Q;  1KQS A;  2EYY A;  2HCK A;  5KYX A;  1AHJ B;  2WSF E;  4E7L A;  2J7I A;  1IGQ A;  2RHI A;  1VIF A;  3BFM A;  3ULR B;  4A53 A;  3LX7 A;  1JJ2 P;  1BI1 A;  1QCN A;  2DJQ A;  1M9S A;  1GRI A;  1BI2 A;  1Q7Y R;  3SD4 A;  1D09 B;  2RA2 A;  2XDB A;  1RAE B;  3L2R A;  2P4R A;  4Z88 A;  1UEB A;  2PVD B;  2RK1 A;  3D7S B;  2CS7 A;  4M7A E;  1WPY A;  4M78 C;  3FLG A;  2CP7 A;  2FZG B;  1SSF A;  1Y57 A;  4PNO A;  1KD1 C;  2QA4 T;  5FU7 C;  4HCK A;  3TVT A;  1VQ5 Q;  3A98 A;  2A28 A;  5CKF A;  2D8J A;  4JJN K;  1OPK A;  4RTZ A;  3CCS A;  2QEX Q;  2F1L A;  2HMA A;  4IUQ A;  4BI8 B;  2D6F A;  1CSK A;  2E4H A;  1ZHI A;  3L2Q A;  3CME A;  1OYX A;  4KH1 B;  3VKI A;  1MV3 A;  2DL5 A;  2OI3 A;  5GAO m;  3CCL A;  1Y71 A;  5GAN e;  3CCS T;  3CPF A;  2JTF A;  1BCO A;  2LZ6 B;  1YJN A;  2YXY A;  5GAN 6;  1ZQ1 A;  1VQL Q;  2DNU A;  2EJG A;  3M55 A;  1WQW A;  1UFF A;  3CD6 A;  3CD6 Q;  4Y91 A;  5I2M A;  1V1C A;  4BB7 A;  1K73 C;  2V26 A;  2ZPG B;  4ESR A;  1EFN A;  4RKU E;  2KSS A;  2RQU A;  3EGX A;  2QEX T;  4DBR A;  1MND A;  3HPW A;  1VIE A;  2Z0W A;  3URG A;  2DET A;  3OYL A;  3R6O A;  4JJB A;  2COY A;  4DEX A;  2VXF A;  4J9I A;  8ATC B;  3EHR A;  3CCJ T;  1GBR A;  3CCS Q;  1PD0 A;  1E7O A;  2ROL A;  4O5V A;  2EQM A;  1BB9 A;  4C5H A;  1SPK A;  3VS2 A;  2FRW A;  3G4S A;  2LDM A;  4E47 A;  2X9H A;  5I2S A;  4J6Y A;  2EW3 A;  2QQA A;  5A0L A;  2QQS A;  3MEA A;  5LJ5 e;  1Y7X A;  1YIT A;  2DPP B;  2GBQ A;  4M77 C;  5CKH A;  3PIP A;  2R58 A;  3QYH B;  1JJ2 A;  4F7U A;  1U1S A;  2OTJ T;  1T3S A;  2CZ7 B;  1G3Y A;  1GFC A;  3KFV A;  4E7S A;  1SSH A;  3VUZ A;  5FU6 C;  2KXC A;  1OUL A;  1M90 R;  4DBH A;  3M0P A;  2OTJ A;  3MEU A;  2R5A A;  3L2V A;  5FLX E;  2K2M A;  3G71 Q;  3LLR A;  2EQU A;  1LVK A;  3JCM X;  1JJ2 S;  1YCS B;  5FWB A;  1CKA A;  2L89 A;  3R6N A;  3G1J A;  4AFQ C;  1MNE A;  1ZBJ A;  2YRD A;  2RJD A;  2JJ9 A;  5GJV B;  1YBY A;  3RES A;  3M53 A;  2YWW A;  1N5Z A;  3NFC A;  3MKD A;  4M7A C;  3VS0 A;  1XOV A;  2KRS A;  2XD0 A;  1SEM A;  2DX1 A;  3TU4 K;  3ER0 A;  3FB9 A;  1Z9Z A;  1UJY A;  2YUN A;  2AKK A;  1QQJ A;  5I11 A;  3M0T A;  3A8O B;  4HVV A;  1BKB A;  2HKN A;  3E2U A;  3QJ6 A;  1FYN A;  1PSE A;  3RUX A;  1WHJ A;  1TOV A;  4OMF B;  1AWX A;  4L6V 5;  1I0C A;  1X01 A;  1SKU B;  2GGR A;  1X43 A;  2DD4 A;  2KI7 A;  4M7A B;  3S6W A;  1GCQ C;  3BE3 A;  3CCV A;  4NOY A;  4OB1 B;  2C0I A;  3MET A;  1KC8 R;  3CMA A;  5GAN d;  3CCU T;  3UPU A;  5GAN 7;  5GAN f;  1RAA B;  2DD5 A;  5CKD A;  2BKD N;  3NPF A;  2IG0 A;  3NTH A;  4A4G A;  4XQ3 A;  3CCU A;  3CMA T;  2FPD A;  4QVZ A;  4AT1 B;  1UG1 A;  2XK0 A;  1Q82 C;  1X2Q A;  4C8Q B;  4HT8 A;  1NBE B;  3UF4 A;  2K5I A;  3CCV Q;  2JZ2 A;  3ASK A;  2CP2 A;  3JCM W;  1ZUK A;  1WJR A;  4QVD A;  4FT4 A;  3LYI A;  5CIU A;  2QDY B;  2MCN A;  2CT3 A;  1X27 A;  2JUF A;  4C0F A;  3JCM d;  2W0Z A;  1SRM A;  3ZL7 C;  1NJI C;  2OTL T;  3I55 T;  2CUD A;  4RTU A;  1VOM A;  1BIB A;  1U8R A;  4M7D B;  3MEV A;  4RCB A;  2QDL A;  2ZPI B;  3OYF A;  4WCI A;  3CBM A;  3PMI A;  4OP0 A;  2K4Y A;  2A36 A;  2CP0 A;  2EBP A;  2FVU A;  4NL2 A;  4FU6 A;  5IN1 A;  1OX8 A;  4A4E A;  5DLO A;  2DZC A;  5HCK A;  3OS5 A;  3INZ A;  3VJP A;  4AFU C;  4DBF A;  4M7D G;  3LW5 E;  2RPN A;  2HZY A;  1SF9 A;  4JLI A;  1VQ8 Q;  4M75 A;  1K76 A;  3QUI A;  2ECZ A;  2JW4 A;  4YTL A;  5DM7 R;  1QVP A;  1SG5 A;  1VQ9 Q;  3RIR A;  1B34 A;  2ZCF B;  2G6F X;  1NPR A;  2EYQ A;  3PFS A;  2FO0 A;  3OYH A;  4RTX A;  1KJW A;  2HD0 A;  3VS7 A;  5KYU B;  2D0Q B;  4HCC A;  3OYA A;  4HVW A;  3SFM A;  4M7A D;  1T0H A;  1D1B A;  2HQE A;  2NUT B;  4P5N A;  2A7Y A;  2K5F A;  3GF5 A;  4R55 A;  5LJ3 h;  2OX7 A;  4EMK C;  3I5S A;  1K8A C;  2LX9 A;  4OGE A;  5GAM d;  1K1Z A;  2F5K A;  2DIQ A;  1LNX A;  2E5K A;  1Y96 A;  1WYX A;  4N4I A;  2FRY A;  1N8R C;  3OBY A;  4N0A C;  2X4J A;  4XTY A;  1VQP T;  4D8K A;  3I55 A;  2JM8 A;  2XG8 D;  1OPL A;  2XDD A;  2MK5 A;  4XU3 A;  3C95 A;  2K79 A;  2QG9 B;  2MIO A;  1QWF A;  5L8R E;  3CQT A;  1I5L A;  2KR3 A;  1VQP A;  3OMC A;  2AK5 A;  4PJO A;  4QW2 A;  5FWC A;  4DOV A;  2XMF A;  3CCL Q;  5FU6 B;  2KAF A;  4IUU A;  2KRM A;  3U23 A;  1W6X A;  5CAI A;  1YIJ Q; 
#chains in the Genus database with same CATH homology
 1AEY A;  1X2K A;  1KIK A;  2LJ0 A;  2BZ8 A;  3VS4 A;  1MUZ A;  2JTE A;  2LNH B;  3QWY A;  1HD3 A;  1W70 A;  2CT4 A;  1AOJ A;  2L3P A;  1AD5 A;  3THK A;  2J6O A;  4Y92 A;  2AKL A;  2KGT A;  2KRO A;  3H0I A;  1OEB A;  2RF0 A;  2JMC A;  1SHF A;  2ED0 A;  3VRY A;  2BTT A;  5IHI A;  4OMQ A;  1YN8 A;  2EYX A;  4RTT A;  2EYY A;  2OAW A;  1B3Q A;  1UGV A;  4IIO A;  1AZG B;  2HCK A;  5ECA A;  4LUD A;  2DRK A;  2DL3 A;  4JZ4 A;  1JU5 C;  2J7I A;  4AG2 C;  1RI9 A;  5GJW B;  3ULR B;  2V1R A;  2DL8 A;  4HXJ A;  4K11 A;  3FJ5 A;  2FEI A;  1GCP A;  2DJQ A;  1GRI A;  4CC7 A;  2KYM A;  1E6H A;  2JS2 A;  4RTY A;  3EG2 A;  2YDL A;  2SRC A;  2DMO A;  2P4R A;  4Z88 A;  2KRN A;  1ZSG A;  4HVU A;  1JXM A;  3VRZ A;  2LQW A;  1M30 A;  2ESW A;  3PVL A;  2YSQ A;  2EGC A;  2OJ2 A;  1Y57 A;  2AZS A;  4CC4 B;  1U3O A;  2HBW A;  2RQT A;  4R0K A;  4Z89 A;  4RTV A;  3TVT A;  1CKB A;  4HCK A;  2CSQ A;  3A98 A;  2A28 A;  2NWM A;  2LCS A;  2KT1 A;  1M3C A;  2D8J A;  1OPK A;  2AZV A;  2FPF A;  4OMN A;  1H92 A;  4QT7 A;  4RTZ A;  1PNJ A;  2X3W D;  2KYB A;  2EYZ A;  1RLP C;  2F2V A;  5IH2 A;  2HSP A;  1GBQ A;  1ZUY A;  1CSK A;  2LJ3 A;  1ARK A;  1T0J A;  1MV3 A;  2F2X A;  2DL5 A;  2YT6 A;  2OI3 A;  4IIM A;  4OML A;  1VYT A;  4JJD A;  1PRM C;  5IHN A;  2LZ6 B;  2I0N A;  2DNU A;  3EG3 A;  1UFF A;  4LN2 A;  4Z8A A;  4J9G A;  2IIM A;  2SEM A;  2JMA A;  4FSS A;  1OV3 A;  4OMP A;  1V1C A;  2KE9 A;  2RN8 A;  4LUE A;  2PNI A;  4ESR A;  2EQI A;  1EFN A;  2F2W A;  3PVQ A;  2RQU A;  1UJ0 A;  4RUG A;  1KSW A;  2W10 A;  1K9A A;  4JJB A;  4DEX A;  1QCF A;  2PZ1 A;  4J9H A;  1ZLM A;  4J9I A;  3EHR A;  1VYU A;  1GBR A;  1E7O A;  2ROL A;  4AFS C;  1UUE A;  1X6B A;  1BB9 A;  1SPK A;  3VS2 A;  4CC3 A;  5IXF A;  2FRW A;  1JO8 A;  3NHN A;  2H8H A;  2ED1 A;  1K4U S;  2EW3 A;  2M0Y A;  2KBT A;  4ZNX A;  2HEQ A;  1AVZ C;  1OOT A;  2DVJ A;  1K0X A;  1AWO A;  1Z9Q A;  1M27 C;  4KRT A;  1W1F A;  3H0H A;  1BBZ A;  2YUO A;  2CUB A;  2GBQ A;  5IHK A;  2CRE A;  2PTK A;  2VKN A;  1PKT A;  1NLO C;  2EGA A;  1UTI A;  2B86 A;  1T3L A;  3GBQ A;  1JEG A;  4GLM A;  1T3S A;  3I5R A;  3EG1 A;  3JV3 A;  1GFC A;  1ABQ A;  2X3X D;  1AWJ A;  1WXU A;  2LX7 A;  3KFV A;  1SSH A;  2J05 A;  2O9V A;  1HSQ A;  1PHT A;  2KXC A;  1LCK A;  3M0P A;  2J6F A;  2K2M A;  3REB B;  1Y0M A;  1X69 A;  2JS0 A;  3H0F A;  5EC7 A;  2RQW A;  2JM9 A;  2EYW A;  1WLP B;  1YCS B;  1WX6 A;  1SHG A;  2HDA A;  2ROT A;  5FWB A;  1CKA A;  3R6N A;  2JT4 A;  1GCQ A;  1JXO A;  4AFQ C;  1ZBJ A;  2K9G A;  2BZY A;  5GJV B;  1UEC A;  4LE9 A;  1N5Z A;  4ORZ A;  2EGE A;  3REA B;  1WXT A;  1AZE A;  2YUQ A;  1NEB A;  3VS0 A;  1YNZ A;  1VYV A;  1XOV A;  1E6G A;  1M8M A;  2KRS A;  3M0U A;  1SEM A;  2DX1 A;  1WA7 A;  1Z9Z A;  1A0N B;  1UJY A;  2O9S A;  1AWW A;  2YUN A;  2AKK A;  2DIL A;  5I11 A;  3M0T A;  1WI7 A;  1K0S A;  3RBB B;  4HVV A;  2J06 A;  1FYN A;  1QKX A;  3M0S A;  4M4Z A;  1QWE A;  1RLQ C;  1AWX A;  3VS1 A;  1I0C A;  2GGR A;  3M0R A;  1X43 A;  3EG0 A;  1GCQ C;  1PKS A;  2CH4 A;  4AG1 C;  2C0I A;  1NM7 A;  2DBK A;  2O2O A;  3UA7 A;  2BZX A;  5FW9 A;  2ENM A;  3QWX X;  2K3B A;  1JQQ A;  3UAT A;  3C0C A;  4LNP A;  2DRM A;  1G2B A;  2GNC A;  5IXB A;  4F16 A;  1NYF A;  2DE0 X;  3NPF A;  2YUP A;  4F14 A;  3NGP A;  3EGU A;  1TUD A;  2RMO A;  1G83 A;  2FPD A;  2KT8 A;  1UG1 A;  1X2Q A;  1GFD A;  4CC2 A;  2KXD A;  2J6K A;  2D1X A;  1I1J A;  1I07 A;  3EHQ A;  1GL5 A;  3UF4 A;  2DYB A;  1KFZ A;  1PRL C;  1WDX A;  4AFZ C;  2CDT A;  3TSZ A;  1ZUK A;  2LQN A;  3NMZ C;  2D0N A;  1NYG A;  4EIK A;  1H3H A;  2MCN A;  4A63 B;  1ZX6 A;  2CT3 A;  2L3Q A;  1X27 A;  2M51 A;  1QLY A;  3SHW A;  1UDL A;  2DBM A;  2W0Z A;  1SRM A;  1UHC A;  3ZL7 C;  1U5S A;  2JXB A;  2VWF A;  2ABL A;  2CUD A;  2C0O A;  4RTU A;  4J9C A;  1H8K A;  1NG2 A;  1UE9 A;  2LJ1 A;  2QDL A;  4WCI A;  1PWT A;  2A08 A;  2DM1 A;  1ABO A;  3M0Q A;  5I22 A;  2A36 A;  2EBP A;  2DF6 A;  5HCK A;  1FMK A;  3VS6 A;  4AFU C;  1HJD A;  1QKW A;  3SEM A;  4OMO A;  2RPN A;  1WIE A;  4J9D A;  2MOX A;  2K6D A;  1BK2 A;  3VS5 A;  1BU1 A;  4E6R A;  1YWO A;  1K76 A;  2JW4 A;  2ECZ A;  2DL4 A;  1ZUU A;  4JZ3 A;  2EPD A;  1J3T A;  2L2P A;  3H41 A;  3IQL A;  2G6F X;  1U06 A;  2LMJ A;  2FO0 A;  1MV0 B;  4RTX A;  2O31 A;  2L0A A;  2VVK A;  1KJW A;  1M3B A;  2RQV A;  3I9Q A;  4JPB W;  3VS7 A;  3VS3 A;  1NLP C;  1TG0 A;  1NEG A;  2D8H A;  4HVW A;  1T0H A;  4D8D A;  4OMM A;  1SRL A;  1B07 A;  3O5Z A;  3I5S A;  1UHF A;  2C0T A;  2DLP A;  4GBQ A;  1K1Z A;  2E5K A;  1S1N A;  1WYX A;  2CSI A;  2GTJ A;  2FRY A;  4J9F A;  4RTW A;  1TUC A;  2L3S A;  2O88 A;  1WFW A;  2RQR A;  2RNA A;  4D8K A;  2JM8 A;  2EKH A;  2K7A A;  1OPL A;  3RNJ A;  1X6G A;  4J9B A;  2LP5 A;  1VA7 A;  2KNB B;  2K79 A;  1YWP A;  2A37 A;  3UA6 A;  2KEA A;  3LH5 A;  1RUW A;  2MIO A;  1QWF A;  1IO6 A;  4DEY A;  3CQT A;  2FPE A;  2KR3 A;  1WXB A;  3I35 A;  2NUZ A;  2DL7 A;  2GTO A;  4J9E A;  4X1V A;  2AK5 A;  2DA9 A;  5FWC A;  2FG0 A;  1YP5 A;  2XMF A;  5L23 A;  2GQI A;  4F17 A;  2V1Q A;  2CH4 W;  3TSW A;  4JJC A;  2KRM A;  2EVR A;  1M3A A;  3U23 A;  1W6X A;  3PE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...