1AWXA

Sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
b'GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRUTON'S TYROSINE KINASE
publication title Solution structure of the SH3 domain from Bruton's tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 6
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awxA00
2D0NA 2KT1A 4AFZC 1TUCA 1NLOC 2MIOA 2C0OA 3UF4A 1NEGA 1PRLC 2YUQA 2B86A 2EYZA 4GLMA 1AD5A 2RMOA 4FSSA 2VWFA 3TSZA 3M0TA 2NUZA 3GBQA 4OMOA 2BZYA 4J9FA 2EBPA 1JEGA 2W0ZA 3CQTA 4KRTA 1IO6A 1GBQA 2YT6A 3I5RA 2C0TA 2HCKA 2F2VA 5IHIA 1K0SA 1YWPA 3EG1A 2LJ1A 1I07A 2KYBA 2LQWA 4RTUA 2D8HA 4OMMA 4F14A 1OEBA 2BZXA 4OMQA 4OMLA 1PHTA 2RQWA 2DX1A 3LH5A 1T3SA 1WXTA 1M8MA 2O2OA 2DRMA 5I22A 2YSQA 4RTTA 1UFFA 2DE0X 4AFQC 2L0AA 2MCNA 1NYGA 4LN2A 1AWJA 2O31A 4J9BA 4HXJA 1MV3A 1SRLA 2ED0A 2JT4A 1VYTA 2PZ1A 4A63B 2FRWA 1JXMA 4F16A 2RQUA 2E5KA 1U3OA 4OMNA 1X6BA 3U23A 2RQVA 3TVTA 2AZSA 4RTXA 2J6FA 4Y92A 1WA7A 2CDTA 1HJDA 3NGPA 2DMOA 4CC7A 2SRCA 2EKHA 2HDAA 2K9GA 3VS4A 4J9HA 2ENMA 1JXOA 1Y0MA 1TG0A 1ZUUA 4ESRA 1G83A 2DF6A 2KXDA 1WXUA 2L3SA 2CH4W 1QLYA 3H41A 5ECAA 2DJQA 4DEXA 2FPFA 5GJWB 2P4RA 2JS2A 2M0YA 1ZBJA 1UE9A 2FG0A 4RTVA 2QDLA 5FWCA 2IIMA 4RTYA 1GL5A 1HD3A 1TUDA 4HVUA 4R0KA 1AWWA 2O9VA 2A08A 4LUEA 2ABLA 3VS5A 3SEMA 2EW3A 3EG3A 2L3PA 1M30A 3QWYA 2ECZA 3UATA 1XOVA 1BU1A 3H0FA 2JM9A 1UDLA 2X3XD 3VRZA 3VS6A 1M3AA 1I0CA 4OMPA 3JV3A 2K7AA 2DL8A 2W10A 4AFSC 1AEYA 3A98A 1SHFA 2DL3A 4JPBW 5L23A 2LJ3A 1UHFA 1YWOA 4Z8AA 2LX7A 2EQIA 2M51A 1K1ZA 1QCFA 2EGCA 1GCQA 1X43A 3H0HA 2GNCA 2V1QA 3VRYA 2JTEA 2F2WA 2FEIA 3I35A 1PWTA 1YP5A 2J7IA 2JXBA 2AZVA 2FPEA 1FMKA 2CSQA 5I11A 2DM1A 4Z88A 2KYMA 4CC3A 3QWXX 4AG2C 1N5ZA 3VS2A 1WLPB 2ESWA 5GJVB 1YNZA 1ZUYA 3RBBB 1BB9A 2YDLA 4HVWA 1PKTA 4D8DA 2O9SA 3VS0A 2LNHB 5EC7A 2KE9A 2J6OA 1X2KA 5IH2A 1GBRA 1VYVA 2KRNA 2J6KA 2V1RA 2LP5A 1SRMA 4ZNXA 1X69A 1JO8A 3C0CA 2D8JA 1HSQA 1OOTA 2EGAA 2VKNA 3O5ZA 2DBKA 1H3HA 2RQTA 3FJ5A 3H0IA 1WI7A 1PNJA 2LCSA 2GQIA 5FWBA 2XMFA 2A28A 1E7OA 1W1FA 1A0NB 2CSIA 2LJ0A 1NEBA 1K9AA 1AWXA 3M0QA 2KGTA 2BZ8A 3PE0A 2F2XA 2JMAA 2KRSA 1OPLA 1GCPA 2RQRA 2LZ6B 5HCKA 2X3WD 1BBZA 1JU5C 2JMCA 2DL5A 1RLPC 2O88A 4EIKA 4J9CA 3ULRB 1SSHA 2G6FX 3THKA 1KFZA 2K79A 1CKAA 3REAB 1SEMA 1EFNA 2K6DA 2AKKA 1UJYA 1M3BA 3ZL7C 1WXBA 2H8HA 2J06A 1SPKA 2OJ2A 4Z89A 3M0RA 2DA9A 4QT7A 3NMZC 1GRIA 1NLPC 3NPFA 4JJBA 2C0IA 2KBTA 2ROTA 4AFUC 1QKXA 2PTKA 1AOJA 3M0PA 2ROLA 2FRYA 3KFVA 1E6HA 4WCIA 1W6XA 2KROA 1NM7A 1SHGA 2AKLA 1RLQC 2KEAA 1JQQA 3M0SA 2YUPA 2JM8A 4ORZA 1UJ0A 1S1NA 2DRKA 4JZ4A 1M3CA 1WIEA 1ZLMA 2YUOA 2EYXA 1AZEA 1WFWA 2HBWA 1I1JA 1WYXA 4DEYA 1FYNA 4M4ZA 2MOXA 2CUDA 1KIKA 3EG2A 4J9GA 3R6NA 4E6RA 4RUGA 1ARKA 1Z9QA 2KXCA 3M0UA 2DYBA 2K2MA 1MUZA 1NG2A 1UGVA 2YUNA 1ABQA 2J05A 1QWEA 2KT8A 3PVLA 1MV0B 3EGUA 4IIMA 2RN8A 2HSPA 1LCKA 1GCQC 2A37A 2KNBB 5IHNA 1U06A 2KRMA 1X6GA 2DBMA 2GGRA 3VS3A 1K76A 2FPDA 2DL4A 2NWMA 2D1XA 3EHRA 1QKWA 3EHQA 2CT3A 1WDXA 3NHNA 1ABOA 1K4US 1UHCA 1Z9ZA 1CSKA 2CH4A 1T0HA 1E6GA 1B3QA 5IHKA 2RF0A 2RPNA 4RTZA 1H92A 1CKBA 1PRMC 2DNUA 1ZSGA 5FW9A 2EGEA 1X27A 4RTWA 4GBQA 3REBB 4CC4B 3VS1A 1KSWA 2PNIA 2EYYA 1YCSB 3UA7A 4AG1C 1K0XA 4JJCA 2FO0A 2ED1A 3VS7A 1RUWA 2CREA 2BTTA 1GFCA 4CC2A 2EVRA 4LE9A 1GFDA 3SHWA 2AK5A 2SEMA 2A36A 2JW4A 1OPKA 4HCKA 2JS0A 1VA7A 2I0NA 1W70A 1T0JA 2GBQA 2LMJA 2DL7A 4HVVA 1Y57A 2LQNA 5IXFA 1G2BA 2EYWA 2L3QA 1RI9A 2RNAA 1QWFA 3RNJA 1AVZC 2OAWA 1T3LA 1KJWA 3I9QA 4J9EA 3PVQA 2DILA 4IIOA 1UG1A 4D8KA 1H8KA 2GTJA 2CUBA 1PKSA 3EG0A 1UECA 2K3BA 4JJDA 2DVJA 2VVKA 1WX6A 2L2PA 1U5SA 4J9DA 2EPDA 1AZGB 1YN8A 2KR3A 2GTOA 1OV3A 3I5SA 1ZUKA 1AWOA 3IQLA 1UTIA 1UUEA 1M27C 1ZX6A 1BK2A 4LNPA 1V1CA 4JZ3A 3TSWA 5IXBA 4LUDA 4F17A 1NYFA 2HEQA 2DLPA 1B07A 4J9IA 4K11A 1VYUA 2CT4A 2OI3A 1X2QA 1J3TA 4X1VA 3UA6A
chains in the Genus database with same CATH superfamily
2D0NA 4E7LA 5EG2A 4AFZC 3HRTA 3I55A 2MIOA 2XG8D 3JB9D 4C92E 1K8AU 1ZSZB 2WACA 4C5IA 5A0LA 3RKWA 1TU0B 4IUQA 4FSSA 3VUBA 5GAN2 2OTLA 3TSZA 3S3OA 3DLMA 1KD1R 4J9FA 2PQWA 1WQ7A 5LJ5f 2F5TX 1VQ5A 1TH7A 1AT1B 2W0ZA 1NJIU 3CQTA 4BE2A 1GBQA 4M75F 2HCKA 4C0ZA 3M59A 4LD6A 1B34B 1Y96A 3SWNC 4J7IA 1YHQT 4PFPA 1UB4A 2LJ1A 2LQWA 2NUPB 4OMMA 2A3LA 4OMLA 1KQ2A 1OQKA 2RQWA 1BI1A 2DFUA 2AHJB 1HK9A 4C92C 3LH5A 3CC4Q 2DYIA 4RTTA 1OZ2A 3G4SA 5GAOr 4RCCA 2DE0X 4AFQC 5KCOA 3V8LA 2QQRA 2HL3A 1N27A 4J9BA 3CCUT 4HXJA 1R0BG 1FMWA 3EG9A 3NTHA 2PZ1A 4A63B 4C8QF 2FRWA 5KYNA 1JXMA 3SDZA 2COWA 2VV5A 1JJ2P 1TS9A 2OAUA 4M7AB 1D1AA 4Y92A 4R55A 2P4TA 1XQHA 2RH2A 4J7FA 4E2FB 4ME7A 2DZ9A 2SRCA 2K9GA 2JVVA 5A0GA 2OTJQ 3E9GA 4ESRA 3L2VA 4BB7A 3A8LB 4ELZC 1QLYA 1TWBA 3TU4K 2EJFA 5GANj 5GJWB 4BI3A 5CKEA 2VXFA 1ZBJA 4HCZA 2FG0A 3CEYA 2RD1A 5FWCA 1IZ6A 3OBYA 5GAN6 2L3RA 5I2SA 1Q7YR 5KYUB 2KI7A 2K2VA 2FL7A 5GMKe 3UATA 2BUDA 1WHMA 1KG1A 1BU1A 4PLLA 4YTLA 1M5Q1 1VQMQ 4E7ZA 1K73U 4B6MA 5C6SA 1I0CA 3CCRT 5D6WA 2JJ9A 1NZ9A 2DXUA 3LWIA 3DKMA 1UHFA 3CCVT 1YWOA 1GCQA 2XDBA 5KYWA 3VRYA 3CCQQ 2FEIA 3FDRA 1YITA 1V76A 2X35A 4JS5A 1VQ9Q 2G3RA 4FT2A 4XAXB 1S72Q 3GLXA 4N0AC 3HRSA 4M75B 4CC3A 2E41A 4AG2C 2E3IA 2E70A 2EQKA 4B9XA 4EMKB 3OYMA 1ZUYA 2VGMA 1BB9A 3CMAT 1PM3A 3C94A 5GAN3 3VS0A 2LNHB 4XK8E 5EC7A 2J6OA 1UGPB 2V1RA 4ZTJA 4L6V5 4M78E 2D9TA 4N4GA 2NUTA 3EGDA 2EGAA 1KC8U 2DBKA 3GP8A 3QG1A 1H3HA 2RQTA 3CC7Q 3H0IA 1PNJA 1YJ9T 1B34A 4C8QB 2ZCFB 1M1KU 1A0NB 3L2WA 1K9AA 2NUPA 1JB0E 5D7UA 3QDFA 1AWXA 1HYOA 4J8OA 3JB9G 3M0QA 1O9SA 2LCLA 3MP6A 2GF7A 2KGTA 2CZ1B 3CCEQ 4M77D 4J6XA 5DLOA 1OPLA 1GCPA 2RQRA 5FU6B 5LJ3g 4FIBA 1BBZA 1JU5C 2YWWA 4M78C 4PJOD 2O88A 4EIKA 3N5BB 3CC4A 4JRIA 1Q81C 1RAIB 4E7IA 4LDWA 2H8HA 4F7UE 2YLBA 3M0RA 2DA9A 1VQ7Q 2RJEA 3FLGA 3VYGA 4JJBA 3F70A 3E9FA 2PTKA 5GAMh 3KFVA 3DB4A 4WCIA 1W6XA 2AKLA 2E12A 2JN0A 1M2VB 2F1LA 3JB9J 1UJ0A 4PJLA 4EPCA 1OULA 1M1GA 1ZLMA 2OTJA 4PL6A 1KD1U 3OSSC 2FYKA 4A54A 4D6WA 4DEYA 1KHCA 1VQNT 1OZ3A 4M4ZA 2CUDA 2RB6A 4J9GA 3OB9A 3R6NA 4C8QD 4RUGA 4E6RA 1Z9QA 3M0UA 2DYBA 4JRQA 1QWEA 4HT8A 1QVGA 1NJIR 2EKOA 1M9SA 2CZ6B 2LDMA 3I56Q 1O75A 2RN8A 3CD6T 3JCMb 3T9NA 2QEXQ 2GGRA 3VS3A 1K76A 3EHQA 2CT3A 1C0MA 3WXMB 1ABOA 4E7JA 2ATCB 1VQMA 5LJ3h 1VQLQ 1PRMC 3GPLA 2MF2A 5FW9A 2EGEA 4GBQA 3REBB 4CC4B 1YI2T 2HZYA 3VS1A 4NL2A 3JB9I 1YCSB 4GY5A 3C95A 3TEEA 2ED1A 2VXEA 1RUWA 4M75A 3CCQA 3EH2A 2E6NA 1XNIA 4CC2A 2EVRA 3BW1A 1WHHA 3H8ZA 4IUVA 3P8BB 1VQ9A 2SEMA 4FYXB 4EMKA 2JS0A 2XK0A 1S72A 2LMJA 1M2OA 2RHZA 1KQSP 5GMKj 3HP9A 2M1HA 2P0PA 2LQNA 1K9MU 2BE7D 4O5VA 1QWFA 3QZ5B 1TUGB 2OAWA 3I9QA 1KJWA 4J9EA 4IIOA 4MDWA 1XTDA 4RCBA 4D8KA 1JJ2A 4M7AG 4QQ6A 1VIFA 3JCMh 1QVFS 2VB6A 1UECA 5CKBA 4KGZB 5GMKi 3FIFA 3RDVA 2JNGA 4C8QA 3CXCA 1AWOA 2JTFA 1UTIA 1R8OB 5CVIA 4C92F 1NBEB 5J26A 3ZFJA 6AT1B 3CC7A 4KULA 4TVRA 8AT1B 4Q5WA 1VYUA 2CT4A 1G8XA 1X2QA 4PJNA 1K73R 4OF1A 3QJ6A 4QKUA 2E64A 2KT1A 1TUCA 1NLOC 1EX4A 3CCEA 1NEGA 2YUQA 4B9WA 3OYIA 4CRIA 1D0XA 2P84A 5KE2A 3OYJA 2RMOA 1VQ6Q 5IT9E 4RG2A 2BZYA 1JEGA 1PC0A 3WVEB 2EJ9A 2ZPHB 1VQ7A 4RKUE 2CP5A 3EG1A 3G7ZA 3LH0A 1PCXA 1M2VA 4RTUA 2BE9B 2I2LA 2DVEA 1C6VX 4FYWB 2DEQA 3KBGA 4UC4A 2EJGA 3LW5E 5CQXA 2DRMA 4OP0A 5I22A 5I21A 2YSQA 3J7AF 2QQBA 3QJYA 4M75G 2XICA 2L0AA 5GAMe 1Q95G 1AWJA 3CC2T 1YIJT 5HK3A 1KC8R 1SRLA 3QDRB 4KH1B 3PMIA 2JT4A 3QYHB 2F5KA 4C0GA 1FWZA 1NPPA 4F16A 4OMNA 4MMLA 2M9UA 3U23A 1M1KR 2RQVA 1RAEB 4RTXA 1MGQA 2EWNA 2COYA 5C0MA 3CCRQ 3HPWA 4XU0A 3NGPA 2DMOA 2YRCA 3VS4A 4J9HA 2ENMA 3I56A 2ZPBB 3L1AA 4C0DC 2KXDA 1X01A 5CKDA 3MO8A 4PFOA 1WXUA 4C8QG 5CK9A 2QEXA 4FT4A 2DJQA 5ECAA 1PSEA 1NPRA 1KHIA 2E3HA 2FPFA 5KYWB 2JS2A 1VQ8Q 1B7TA 4FL6A 3JAME 1BIBA 2M0YA 3SFMA 3ZEHA 3VU3C 1MNEA 2IIMA 1VQLA 1GL5A 1MHNA 1TUDA 4HVUA 3ME9A 3EFOA 3X28B 2A08A 4LUEA 4M7DE 2HKNA 5CKFA 1W4SA 2CZ7B 3KUFA 2EW3A 2K3XA 3VUZA 4IURA 2KQWA 3MEAA 3QWYA 3BY7A 3CMAQ 3FJPA 3RKYA 4XU3A 2HNIA 3H0FA 2JM9A 3OW2A 2L89A 2HMAA 2X3XD 4M77F 1RADB 1QVGP 4JUVA 4OMPA 3JV3A 1M90C 1SHFA 2DL3A 5M9OA 5GAN5 3MCAB 4PJOF 5L23A 4IUPA 3QPHA 2P0QA 3CCLT 3D7SB 5CCAA 4RMOA 2X4YA 2M51A 2D6FA 2NUTB 3EGDB 1MMDA 1YJ9Q 2RO0A 2L5QA 4M7DC 2AIRB 3I35A 2KDSA 3OYHA 2L8DA 1Q7YC 4BY6B 4OB0B 1SSFA 3QIIA 2FPEA 4A4HA 3RERA 5I11A 3RESA 2DM1A 4JLGA 1ZHIA 4M78F 2EFIA 5LJ5h 1WLPB 4O6JA 5GJVB 1RL2A 3JCMe 1RAHB 1YNZA 1H641 3RBBB 3SB2A 2CKKA 4L59A 1PKTA 2O9SA 3G6ET 2KE9A 5A0DA 5IH2A 2J6KA 2QQAA 1YJNT 4ZNXA 1X69A 4R56A 1JO8A 2M16A 1ACMB 3CPWA 1HSQA 3H6ZA 3META 2QDYB 2RJDA 5CQYA 3FJ5A 2GCXA 4C92D 2LCSA 2GQIA 3L2ZA 1VQ6A 2XMFA 3HL8A 3JCMQ 1P92A 2H3EB 3OYYA 1ZSZC 5CR2A 3CXCP 2QGGA 2HAXA 4VUBA 3V7SA 3NTIA 2BZ8A 2F69A 1OU9A 2JMAA 4XQ3A 3L2UA 1WJQA 2LZ6B 8ATCB 2ZPGB 1K9MR 4A4GA 1OX8A 2JMCA 1VQNQ 2CP7A 2HQXA 1ZBXA 2XDDA 1SSHA 2G6FX 2K79A 1CKAA 4JLIA 4M7AE 1EFNA 5IN1A 2EIFA 1M3BA 2LQKA 2QYZA 3ZL7C 4Z89A 3R6OA 5GANg 1KQSA 3NMZC 1YJWT 4LDXA 3NPFA 3OS2A 1MMNA 2XHCA 2EYQA 3FRNA 3M0PA 4ZGJB 3HHTB 5J3BA 3CCJT 1NM7A 1I4K1 1RLQC 4M77B 1D0ZA 4OB3B 4QQDA 3CMET 1JQQA 4HA8A 4KT0E 3L42A 2K57A 3CCRA 2WSCE 2JM8A 3FB9A 1G5VA 4HCCA 4E7HA 1U1TA 2IPOB 4JZ4A 4PJOB 1BYMA 4M7AC 4PK4A 1AZEA 1WFWA 2HBWA 2LTOA 3GF5A 1I1JA 1WYXA 2MOXA 3EG2A 3AT1B 1VQ8A 1MUZA 1NG2A 1YITT 1UGVA 4C92A 5GAMj 1PSFA 4PJJA 4KUIA 2QAZA 2KT8A 4XTXA 2V8KA 2KY9A 4IIMA 3JCMV 3OBWA 5GAN4 2NYSA 1V29B 2DL4A 1MMAA 2NWMA 7AT1B 3CMAA 1Q82C 3OYEA 4LD9K 5GANf 1H3ZA 3Q1JA 1CSKA 2CH4A 1T0HA 1KQ1A 3C12A 2RF0A 1K8AC 1CKBA 1ZSGA 5FRMA 1D09B 3OYFA 4M75E 4JDSA 1ZQ1A 2EYYA 3RMSA 1WHGA 4AG1C 1K0XA 4JJCA 2ZGWA 4J83A 2KMTA 1YJ9A 3M55A 1NJIC 4LE9A 4LXCA 2LX9A 3SHWA 3EFRA 2AK5A 3VJPA 1OPKA 2I0NA 4F04B 1RAAB 1W70A 5GAOp 2GBQA 2JZ2A 1LVKA 2X51A 1VQOT 5LJ3j 1EIFA 1G2BA 5AYFA 2EYWA 2L3QA 1WPYA 1AVZC 3NTKA 3OW2P 2DTIA 4M75C 3URGA 4C8QE 1VUBA 2PVDB 2Y4YA 1D1CA 4EMKC 2K3BA 3CC4T 1N9SA 2VVKA 1WX6A 5LJ5e 3BE3A 2PUOB 2JOYA 1N8RU 4EDUA 1WGSA 3I5SA 2RHUA 1ZX6A 4JRPA 1BK2A 3M56A 3LWHA 4M78D 2LVMA 1W2BS 4F17A 2HEQA 3NFCA 1B07A 4X1VA 4XTWA 1IB8A 2OI3A 1U1SA 1J3TA 1D3BA 1QW1A 2VC8A 3M4GA 5GANd 2Z0WA 2EQJA 5I2MA 3UA6A 4C8QC 4E7SA 2C0OA 1PRLC 5DY9A 2HQHA 4N0AA 3CC2Q 4C92G 3CBMA 2QQSA 1YIJQ 2DJZA 1D0YA 1RAGB 4FYVB 2YHTA 4II1A 2GFAA 4GLMA 1AD5A 3MKDA 3MEWA 2C06A 1BI2A 1VQNA 1QP2A 2NUZA 3GBQA 3RR6A 2R57A 2RHYA 2EBPA 2QXFA 2FHDA 4HKEA 5AT1B 3M4YA 3CPWP 5FU6C 1M1FA 1IHVA 5GMKl 1IO6A 4BI8B 3I5RA 2C0TA 2F2VA 3ASKA 5FU7B 4QVDA 1K0SA 1YWPA 4M77A 4QVZA 1WQWA 2D8HA 1OEBA 2BZXA 4OGEA 3KXTA 1SF9A 3JB9H 4PJOA 2K5FA 1Y71A 1T3SA 4QVCA 2O2OA 1M8MA 2E5QA 2VGNA 3QO3A 1UFFA 3MPUB 2ZPEB 1BI0A 1YBYA 2MCNA 2DZCA 1NYGA 3PMTA 4LN2A 2O31A 5GAMd 3EFOB 1WNLA 2QA4T 4ZGEB 3FC3A 2RQUA 3GOXA 2JUFA 4M78A 2R5AA 5D6XA 1RABB 1X6BA 1Y07A 3RKXA 3TVTA 1RI0A 2AZSA 3PTAA 3QSUA 2CP3A 2J6FA 2CP2A 1N6AA 2CDTA 2EQMA 2QTVA 3X24B 1VQ9T 1HJDA 2HDAA 2XDPA 1VIEA 5FROA 1TG0A 3CCLQ 1G83A 2DF6A 2X4JA 3HFOA 2X4XA 2RK2A 4M7DF 3CBOA 2CH4W 3H41A 4DEXA 2RK1A 3LGLA 4ZTFA 3OYGA 2FVUA 1M4ZA 2O01E 3X26B 1EZZB 5GAOl 1UE9A 1Q86C 4RTVA 1FXXA 1KC8C 3OS1A 2LNVA 1IGQA 4FSXA 1U8RA 1YHQQ 3J81E 4R0KA 2CYZB 4QQGA 3EH1A 2ABLA 3EG3A 1WHKA 1M1KC 1X6OA 1TTHB 3GNFB 1BCOA 2E10A 3VRZA 3G6EQ 4A4FA 3HSBA 1M3AA 3X20B 2DD5A 1YJNQ 2DL8A 2W10A 3CCUQ 1AEYA 3A98A 3CCST 4JPBW 3OMCA 4JS4A 2MPXC 4A4EA 3JSCA 2COZA 3OMGA 5KYXB 4Z8AA 2LX7A 1K1ZA 1QCFA 1X43A 1R77A 3H0HA 2V1QA 4C5EA 2JTEA 1MMGA 2MK5A 2X4WA 4M77G 1DJ7B 1PWTA 1FX7A 2XU8A 3FEOA 4LDYA 3GIBA 3OYAA 2AZVA 1FMKA 2CSQA 4PJOG 2DIQA 5J39A 2LCCA 3JCMJ 2KYMA 1YCYA 4NL3A 3V7RA 2R5MA 3JCMW 3CBPA 3VS2A 1VQ7T 3PIOA 4Y91A 4WTOB 3M58A 1QCOA 3JCMd 2YDLA 1VQKT 4HVWA 4KGXB 3RMQA 1GBRA 1VYVA 2KRNA 1VQ4T 2HBPA 2LP5A 2FZCB 2CS7A 2E6ZA 1MNDA 1KD1C 4A53A 2D8JA 5GMKh 2VKNA 4MZTA 1YJWQ 3O5ZA 2HL5C 3CC2A 1YIJA 2RI3A 1I5OB 1BCMA 1G3SA 3MEVA 4XTYA 1R0CB 3GNGA 1E7OA 1W1FA 5LJ5j 3CCJQ 1I81A 2CSIA 2LJ0A 1NEBA 1QQJA 2V8JA 3OYDA 3PNWC 3CMEQ 3CCVQ 2HKQB 3OYCA 3CPFA 5LL6S 3TQ7P 2F2XA 3A8GB 3OYLA 2KRSA 3X25B 1QVFA 2R58A 5HCKA 3PIPA 1FMVA 3G71T 3JCMP 3CCMT 3MJXA 3HRUA 1RLPC 2QEXT 3THKA 1KFZA 3VYHB 3REAB 1SEMA 2K6DA 3BFMA 1UJYA 1LJOA 2J06A 1SPKA 3V7CA 2K4YA 4C92B 2V26A 1N8RR 5LJ3e 2EQUA 1NLPC 3LX7A 2C0IA 2KBTA 1VOMA 4BDYA 1QKXA 1VQPT 1AOJA 4OGCA 5FRNA 5HY6A 4JJNK 2KROA 3LLRA 5IAYA 2DPPB 2QGFB 3PFSA 2KEAA 3HTRA 4V2SA 4FW2A 3M0SA 2YUPA 4BI4A 3I55T 1K9MC 4XTZA 1WIEA 3CCLA 2EYXA 2JTMA 3S6WA 3DB3A 3UDCA 2IVWA 3MP1A 2OTLT 2D0QB 1FYNA 1KIKA 3QKJA 2CGHA 2E4HA 2KXCA 4FM4B 2O4XA 4DBFA 2OX7A 1VQ5T 3G1JA 1ABQA 2J05A 2DERA 1YHQA 3M54A 3PVLA 3EGUA 1VQOQ 1LCKA 2AT1B 1GCQC 4XTVA 2A37A 5IHNA 1TOVA 1U06A 1X6GA 2KRMA 2RHIA 4M7DD 2FPDA 3EGXA 1QKWA 5KYXA 1IRXA 1K4US 3G6EA 1Z9ZA 3G4ST 1B3QA 1E6GA 5IHKA 4EMHA 1YJNA 4RTZA 1H92A 1Q81U 3CCUA 4RTWA 3OA6A 2PNIA 4NS5A 2P0KA 2MI6A 2RI2A 3UA7A 2VYTA 5CAIA 4J6YA 2FO0A 2RI5A 3M53A 2A7YA 1SG5A 2BTTA 2LT4A 4KUDK 2ZPFB 1WZOA 1GFDA 1LOJA 2KVQG 1VQ6T 2A36A 2GQVA 4F7UF 2RHXA 1VA7A 1T0JA 1BI3A 1TSFA 1D3BB 2DL7A 1W2BP 1Y57A 5CO7A 3A5ZB 5IXFA 3ZBDA 5HKCA 1WHJA 3TCJA 4BY6C 3RNJA 1IXDA 2A0FB 2QG9B 5GAOn 4E7KA 1M90R 2YRDA 5D6YA 4ANJA 2MMPA 2GTJA 3A8HB 1ZA1B 2CUBA 1PKSA 2DO3A 4L5GA 3CD6Q 4NOYA 1LNXA 4PNOA 1OU8A 4BUGA 2L2PA 1U5SA 4J9DA 2LQ8A 1PG5B 2CZ0B 1YN8A 2XIDA 3LGFA 2E1HA 5LJ5d 1YJWA 3IQLA 1UEBA 1UUEA 4LNPA 2DEUA 4BACA 4DA4A 2PVGB 3TSWA 1OYXA 4K11A 4J9IA 3CCJA 4KGVB 1NE8A 2E65A 2XD0A 2LC4A 4M7DA 1YI2Q 3CMEA 3CCVA 3SWNA 3UF4A 5GAN7 3VKIA 2B86A 2EYZA 3VV0A 2QI2A 1PD1A 2QA4Q 3OYNA 2VWFA 2PU9B 3M0TA 4OMOA 4MMKA 2XKOC 4IUTA 4M77E 1GXIE 2YXYA 4OB2B 4PLIA 4X9DA 4KRTA 5KYYA 1VQ8T 4M78B 2YT6A 5IHIA 1QMCA 3INZA 4M7AD 2DXTA 4PJOE 1I07A 2KYBA 5GAMg 3SD4A 1QVGS 4F14A 4OMQA 1SKUB 3AHUA 1XJWB 1PHTA 2DX1A 1WXTA 5L8RE 3LYIA 2DXCA 3A8OB 3V8JA 2M02A 4DBRA 2CP6A 1ZSZA 1QVFP 3UT1A 5GANh 2MYSA 1MV3A 4M77C 2ZAEA 5FLXE 2ED0A 1Q86U 1VYTA 2M0OA 2E5KA 1U3OA 3QYGB 4PJOC 1G3WA 3TREA 4F7UB 1WA7A 4AT1B 4CC7A 2EKHA 3CCSQ 2MWOA 4BE1A 1JXOA 2DKGA 3P8HA 2DXBA 1JRIA 1Y0MA 3J80E 1ZUUA 1VQOA 4MZPA 2LT1A 4ATOA 2RA2A 2HSEB 4C5HA 2L3SA 1I5LA 1M8VA 1UGRB 3OYKA 4GLKA 1ZA2B 4X34A 2P4RA 2QDLA 2FZKB 4DOVA 4RTYA 1JJ2S 2YLCA 4A4KA 2KAFA 5GAMf 1HD3A 1AWWA 1WJSA 1IHWA 1N9RA 2O9VA 1I8FA 4FCYA 2VUBA 4M7DG 3VS5A 3SEMA 2RJCA 4OB1B 2L3PA 1M30A 2CP0A 3MEUA 4M75D 3PGGA 4N4HA 4M7AA 3CXCS 2ECZA 4MDXA 3OS0A 1VQKQ 1XOVA 5A2QE 1UDLA 4XU1A 3E19A 3VS6A 3C4SA 1VQ4Q 2K7AA 2B8AA 4AFSC 4C5GA 2LJ3A 1Q82R 4DBHA 2OTJT 2GFUA 2EQIA 2DAQA 2EGCA 4PKCC 2GNCA 1LPLA 2F2WA 3JCMg 1K8AR 5GMKm 2DD4A 4KBMB 3S3NA 3HKSA 1IREB 1QCNA 1F1BB 5KE3A 1YP5A 2J7IA 1HXDA 2JXBA 1TXQA 2BIVA 2KSSA 5KYUA 3CD6A 4C0FA 3QXEB 5KCHA 4N4IA 3QUIA 4Z88A 1G3TA 3QWXX 1K73C 1N5ZA 5DM7R 5LJ3f 2XI9A 2Y4XA 2ESWA 3G71Q 3CCMQ 4OVAA 4FW1A 4BE0A 4AMCA 4HT9A 4D8DA 1VQMT 1X2KA 1YI2A 1SRMA 1KK7A 3JCMc 3JB9F 2KK4A 3C0CA 4P5NA 1Q81R 1OOTA 4FYYB 4QW2A 9ATCB 1WI7A 2QA4A 1VQPQ 3CCQT 3O8VA 4DBQA 5FWBA 2A28A 2QASA 4IUUA 3OSVA 2WSFE 5GAN8 3OY9A 1S72T 3RUXA 5CKHA 2IG0A 2DETA 1Y7XA 2DK3A 1UGSB 4Y28E 3I55Q 3M57A 3PE0A 1M90U 4J6WA 3JCMf 4BDZA 2X3WD 5GAOm 2OTLQ 2DL5A 5FU7C 4J9CA 4Z02A 1D1BA 1QVPA 4ZN3A 3ULRB 3RIRA 2VASA 1VQ5Q 2AKKA 2ZZDA 1WXBA 2K5IA 2OJ2A 4HCBA 1Q7YU 1W2BA 2O4XB 4QT7A 3QHSA 2EAYA 3MP8A 3BDUA 1GRIA 2QK0A 4F7UA 5LJ3d 3CC7T 2ROTA 4AFUC 2ROLA 2FRYA 1E6HA 4ZN1A 2K3YA 2Y90A 1WJRA 1Y96B 1SHGA 4FU6A 2MWPA 3EGXB 3EAEA 3JRZA 3G4SQ 5GANe 4ORZA 4DQ2A 3OW2S 1S1NA 2DRKA 3CCSA 4LDUA 3CCET 1M3CA 1WHLA 5CIUA 2V8IA 4J5YA 2YUOA 1BKBA 4MZMA 3E1SA 2QQ9A 3H9NA 4C0DB 1PD0A 1ARKA 2FB7A 2K2MA 4OMFB 3PT9A 1N8RC 2YUNA 3EG9B 4BD3A 1BIAA 1G3YA 3UWNA 1MV0B 5HK0A 2HSPA 3S3MA 1AHJB 2RM4A 2KNBB 2DTHA 3M5AA 3DLLA 2DBMA 5DLQE 4WF2A 4CI0C 2K5LA 4RG8A 3OQ5A 5GAOq 2LRQA 1YFNA 2D1XA 3QBYA 4IKFA 3EHRA 4PFZA 1VQKA 2YRVA 1WDXA 3NHNA 1UHCA 4M78G 2QTXA 2X9HA 1VQ4A 2RPNA 2DNUA 3QZ9B 2PVOB 3HFNA 1X27A 2WSEE 3A1PA 4ZGDB 1KSWA 3L2QA 4KH0B 1QP3A 2HQEA 1Q86R 3VS7A 3CPWS 2CREA 3BDLA 1GFCA 1RAFB 1UGQB 4M7AF 2MAMA 3MHXA 3P8DA 1OX9A 2JW4A 4PJMA 2DTOA 4HCKA 3E2UA 2ZPIB 3M9QA 3I56T 4M7DB 5LJ5g 1X75C 4HVVA 4X9CA 2FZGB 3SWNB 1RI9A 1JBMA 2RNAA 2H3JA 1T3LA 3G71A 3CCMA 3PVQA 2DILA 3WVDB 1YITQ 1UG1A 1RACB 1H8KA 4XU2A 3V8KA 4ELYC 2HD0A 4F7UG 3OS5A 3EG0A 3JCMX 4E47A 1VQLT 4JJDA 1OI1A 2DVJA 3A8MB 2EPDA 2PUKB 1AZGB 4LDVA 2KR3A 2GTOA 3UPUA 1OV3A 4DOWA 1ZUKA 5KYYB 1M27C 2RJFA 3EFSA 1V1CA 4JZ3A 1KQSS 5IXBA 1VQPA 2BKDN 4LUDA 1NYFA 2DIGA 2DLPA 4XTUA 4JRKA 4EMGA 3L2RA 2NLUA 3ER0A 1Q82U 5KH6A 1C1AA 1IGUA 3OYBA
chains in the Genus database with same CATH topology
2D0NA 2KT1A 4AFZC 1TUCA 1NLOC 2MIOA 2C0OA 3UF4A 1NEGA 1PRLC 2YUQA 2B86A 2EYZA 4GLMA 1AD5A 2RMOA 4FSSA 2VWFA 3TSZA 3M0TA 2NUZA 3GBQA 4OMOA 2BZYA 4J9FA 2EBPA 1JEGA 2W0ZA 3CQTA 4KRTA 1IO6A 1GBQA 2YT6A 3I5RA 2C0TA 2HCKA 2F2VA 5IHIA 1K0SA 1YWPA 3EG1A 2LJ1A 1I07A 2KYBA 2LQWA 4RTUA 2D8HA 4OMMA 4F14A 1OEBA 2BZXA 4OMQA 4OMLA 1PHTA 2RQWA 2DX1A 3LH5A 1T3SA 1WXTA 1M8MA 2O2OA 2DRMA 5I22A 2YSQA 4RTTA 1UFFA 2DE0X 4AFQC 2L0AA 2MCNA 1NYGA 4LN2A 1AWJA 2O31A 4J9BA 4HXJA 1MV3A 1SRLA 2ED0A 2JT4A 1VYTA 2PZ1A 4A63B 2FRWA 1JXMA 4F16A 2RQUA 2E5KA 1U3OA 4OMNA 1X6BA 3U23A 2RQVA 3TVTA 2AZSA 4RTXA 2J6FA 4Y92A 1WA7A 2CDTA 1HJDA 3NGPA 2DMOA 4CC7A 2SRCA 2EKHA 2HDAA 2K9GA 3VS4A 4J9HA 2ENMA 1JXOA 1Y0MA 1TG0A 1ZUUA 4ESRA 1G83A 2DF6A 2KXDA 1WXUA 2L3SA 2CH4W 1QLYA 3H41A 5ECAA 2DJQA 4DEXA 2FPFA 5GJWB 2P4RA 2JS2A 2M0YA 1ZBJA 1UE9A 2FG0A 4RTVA 2QDLA 5FWCA 2IIMA 4RTYA 1GL5A 1HD3A 1TUDA 4HVUA 4R0KA 1AWWA 2O9VA 2A08A 4LUEA 2ABLA 3VS5A 3SEMA 2EW3A 3EG3A 2L3PA 1M30A 3QWYA 2ECZA 3UATA 1XOVA 1BU1A 3H0FA 2JM9A 1UDLA 2X3XD 3VRZA 3VS6A 1M3AA 1I0CA 4OMPA 3JV3A 2K7AA 2DL8A 2W10A 4AFSC 1AEYA 3A98A 1SHFA 2DL3A 4JPBW 5L23A 2LJ3A 1UHFA 1YWOA 4Z8AA 2LX7A 2EQIA 2M51A 1K1ZA 1QCFA 2EGCA 1GCQA 1X43A 3H0HA 2GNCA 2V1QA 3VRYA 2JTEA 2F2WA 2FEIA 3I35A 1PWTA 1YP5A 2J7IA 2JXBA 2AZVA 2FPEA 1FMKA 2CSQA 5I11A 2DM1A 4Z88A 2KYMA 4CC3A 3QWXX 4AG2C 1N5ZA 3VS2A 1WLPB 2ESWA 5GJVB 1YNZA 1ZUYA 3RBBB 1BB9A 2YDLA 4HVWA 1PKTA 4D8DA 2O9SA 3VS0A 2LNHB 5EC7A 2KE9A 2J6OA 1X2KA 5IH2A 1GBRA 1VYVA 2KRNA 2J6KA 2V1RA 2LP5A 1SRMA 4ZNXA 1X69A 1JO8A 3C0CA 2D8JA 1HSQA 1OOTA 2EGAA 2VKNA 3O5ZA 2DBKA 1H3HA 2RQTA 3FJ5A 3H0IA 1WI7A 1PNJA 2LCSA 2GQIA 5FWBA 2XMFA 2A28A 1E7OA 1W1FA 1A0NB 2CSIA 2LJ0A 1NEBA 1K9AA 1AWXA 3M0QA 2KGTA 2BZ8A 3PE0A 2F2XA 2JMAA 2KRSA 1OPLA 1GCPA 2RQRA 2LZ6B 5HCKA 2X3WD 1BBZA 1JU5C 2JMCA 2DL5A 1RLPC 2O88A 4EIKA 4J9CA 3ULRB 1SSHA 2G6FX 3THKA 1KFZA 2K79A 1CKAA 3REAB 1SEMA 1EFNA 2K6DA 2AKKA 1UJYA 1M3BA 3ZL7C 1WXBA 2H8HA 2J06A 1SPKA 2OJ2A 4Z89A 3M0RA 2DA9A 4QT7A 3NMZC 1GRIA 1NLPC 3NPFA 4JJBA 2C0IA 2KBTA 2ROTA 4AFUC 1QKXA 2PTKA 1AOJA 3M0PA 2ROLA 2FRYA 3KFVA 1E6HA 4WCIA 1W6XA 2KROA 1NM7A 1SHGA 2AKLA 1RLQC 2KEAA 1JQQA 3M0SA 2YUPA 2JM8A 4ORZA 1UJ0A 1S1NA 2DRKA 4JZ4A 1M3CA 1WIEA 1ZLMA 2YUOA 2EYXA 1AZEA 1WFWA 2HBWA 1I1JA 1WYXA 4DEYA 1FYNA 4M4ZA 2MOXA 2CUDA 1KIKA 3EG2A 4J9GA 3R6NA 4E6RA 4RUGA 1ARKA 1Z9QA 2KXCA 3M0UA 2DYBA 2K2MA 1MUZA 1NG2A 1UGVA 2YUNA 1ABQA 2J05A 1QWEA 2KT8A 3PVLA 1MV0B 3EGUA 4IIMA 2RN8A 2HSPA 1LCKA 1GCQC 2A37A 2KNBB 5IHNA 1U06A 2KRMA 1X6GA 2DBMA 2GGRA 3VS3A 1K76A 2FPDA 2DL4A 2NWMA 2D1XA 3EHRA 1QKWA 3EHQA 2CT3A 1WDXA 3NHNA 1ABOA 1K4US 1UHCA 1Z9ZA 1CSKA 2CH4A 1T0HA 1E6GA 1B3QA 5IHKA 2RF0A 2RPNA 4RTZA 1H92A 1CKBA 1PRMC 2DNUA 1ZSGA 5FW9A 2EGEA 1X27A 4RTWA 4GBQA 3REBB 4CC4B 3VS1A 1KSWA 2PNIA 2EYYA 1YCSB 3UA7A 4AG1C 1K0XA 4JJCA 2FO0A 2ED1A 3VS7A 1RUWA 2CREA 2BTTA 1GFCA 4CC2A 2EVRA 4LE9A 1GFDA 3SHWA 2AK5A 2SEMA 2A36A 2JW4A 1OPKA 4HCKA 2JS0A 1VA7A 2I0NA 1W70A 1T0JA 2GBQA 2LMJA 2DL7A 4HVVA 1Y57A 2LQNA 5IXFA 1G2BA 2EYWA 2L3QA 1RI9A 2RNAA 1QWFA 3RNJA 1AVZC 2OAWA 1T3LA 1KJWA 3I9QA 4J9EA 3PVQA 2DILA 4IIOA 1UG1A 4D8KA 1H8KA 2GTJA 2CUBA 1PKSA 3EG0A 1UECA 2K3BA 4JJDA 2DVJA 2VVKA 1WX6A 2L2PA 1U5SA 4J9DA 2EPDA 1AZGB 1YN8A 2KR3A 2GTOA 1OV3A 3I5SA 1ZUKA 1AWOA 3IQLA 1UTIA 1UUEA 1M27C 1ZX6A 1BK2A 4LNPA 1V1CA 4JZ3A 3TSWA 5IXBA 4LUDA 4F17A 1NYFA 2HEQA 2DLPA 1B07A 4J9IA 4K11A 1VYUA 2CT4A 2OI3A 1X2QA 1J3TA 4X1VA 3UA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0N A;  2KT1 A;  4AFZ C;  1TUC A;  1NLO C;  2MIO A;  2C0O A;  3UF4 A;  1NEG A;  1PRL C;  2YUQ A;  2B86 A;  2EYZ A;  4GLM A;  1AD5 A;  2RMO A;  4FSS A;  2VWF A;  3TSZ A;  3M0T A;  2NUZ A;  3GBQ A;  4OMO A;  2BZY A;  4J9F A;  2EBP A;  1JEG A;  2W0Z A;  3CQT A;  4KRT A;  1IO6 A;  1GBQ A;  2YT6 A;  3I5R A;  2C0T A;  2HCK A;  2F2V A;  5IHI A;  1K0S A;  1YWP A;  3EG1 A;  2LJ1 A;  1I07 A;  2KYB A;  2LQW A;  4RTU A;  2D8H A;  4OMM A;  4F14 A;  1OEB A;  2BZX A;  4OMQ A;  4OML A;  1PHT A;  2RQW A;  2DX1 A;  3LH5 A;  1T3S A;  1WXT A;  1M8M A;  2O2O A;  2DRM A;  5I22 A;  2YSQ A;  4RTT A;  1UFF A;  2DE0 X;  4AFQ C;  2L0A A;  2MCN A;  1NYG A;  4LN2 A;  1AWJ A;  2O31 A;  4J9B A;  4HXJ A;  1MV3 A;  1SRL A;  2ED0 A;  2JT4 A;  1VYT A;  2PZ1 A;  4A63 B;  2FRW A;  1JXM A;  4F16 A;  2RQU A;  2E5K A;  1U3O A;  4OMN A;  1X6B A;  3U23 A;  2RQV A;  3TVT A;  2AZS A;  4RTX A;  2J6F A;  4Y92 A;  1WA7 A;  2CDT A;  1HJD A;  3NGP A;  2DMO A;  4CC7 A;  2SRC A;  2EKH A;  2HDA A;  2K9G A;  3VS4 A;  4J9H A;  2ENM A;  1JXO A;  1Y0M A;  1TG0 A;  1ZUU A;  4ESR A;  1G83 A;  2DF6 A;  2KXD A;  1WXU A;  2L3S A;  2CH4 W;  1QLY A;  3H41 A;  5ECA A;  2DJQ A;  4DEX A;  2FPF A;  5GJW B;  2P4R A;  2JS2 A;  2M0Y A;  1ZBJ A;  1UE9 A;  2FG0 A;  4RTV A;  2QDL A;  5FWC A;  2IIM A;  4RTY A;  1GL5 A;  1HD3 A;  1TUD A;  4HVU A;  4R0K A;  1AWW A;  2O9V A;  2A08 A;  4LUE A;  2ABL A;  3VS5 A;  3SEM A;  2EW3 A;  3EG3 A;  2L3P A;  1M30 A;  3QWY A;  2ECZ A;  3UAT A;  1XOV A;  1BU1 A;  3H0F A;  2JM9 A;  1UDL A;  2X3X D;  3VRZ A;  3VS6 A;  1M3A A;  1I0C A;  4OMP A;  3JV3 A;  2K7A A;  2DL8 A;  2W10 A;  4AFS C;  1AEY A;  3A98 A;  1SHF A;  2DL3 A;  4JPB W;  5L23 A;  2LJ3 A;  1UHF A;  1YWO A;  4Z8A A;  2LX7 A;  2EQI A;  2M51 A;  1K1Z A;  1QCF A;  2EGC A;  1GCQ A;  1X43 A;  3H0H A;  2GNC A;  2V1Q A;  3VRY A;  2JTE A;  2F2W A;  2FEI A;  3I35 A;  1PWT A;  1YP5 A;  2J7I A;  2JXB A;  2AZV A;  2FPE A;  1FMK A;  2CSQ A;  5I11 A;  2DM1 A;  4Z88 A;  2KYM A;  4CC3 A;  3QWX X;  4AG2 C;  1N5Z A;  3VS2 A;  1WLP B;  2ESW A;  5GJV B;  1YNZ A;  1ZUY A;  3RBB B;  1BB9 A;  2YDL A;  4HVW A;  1PKT A;  4D8D A;  2O9S A;  3VS0 A;  2LNH B;  5EC7 A;  2KE9 A;  2J6O A;  1X2K A;  5IH2 A;  1GBR A;  1VYV A;  2KRN A;  2J6K A;  2V1R A;  2LP5 A;  1SRM A;  4ZNX A;  1X69 A;  1JO8 A;  3C0C A;  2D8J A;  1HSQ A;  1OOT A;  2EGA A;  2VKN A;  3O5Z A;  2DBK A;  1H3H A;  2RQT A;  3FJ5 A;  3H0I A;  1WI7 A;  1PNJ A;  2LCS A;  2GQI A;  5FWB A;  2XMF A;  2A28 A;  1E7O A;  1W1F A;  1A0N B;  2CSI A;  2LJ0 A;  1NEB A;  1K9A A;  1AWX A;  3M0Q A;  2KGT A;  2BZ8 A;  3PE0 A;  2F2X A;  2JMA A;  2KRS A;  1OPL A;  1GCP A;  2RQR A;  2LZ6 B;  5HCK A;  2X3W D;  1BBZ A;  1JU5 C;  2JMC A;  2DL5 A;  1RLP C;  2O88 A;  4EIK A;  4J9C A;  3ULR B;  1SSH A;  2G6F X;  3THK A;  1KFZ A;  2K79 A;  1CKA A;  3REA B;  1SEM A;  1EFN A;  2K6D A;  2AKK A;  1UJY A;  1M3B A;  3ZL7 C;  1WXB A;  2H8H A;  2J06 A;  1SPK A;  2OJ2 A;  4Z89 A;  3M0R A;  2DA9 A;  4QT7 A;  3NMZ C;  1GRI A;  1NLP C;  3NPF A;  4JJB A;  2C0I A;  2KBT A;  2ROT A;  4AFU C;  1QKX A;  2PTK A;  1AOJ A;  3M0P A;  2ROL A;  2FRY A;  3KFV A;  1E6H A;  4WCI A;  1W6X A;  2KRO A;  1NM7 A;  1SHG A;  2AKL A;  1RLQ C;  2KEA A;  1JQQ A;  3M0S A;  2YUP A;  2JM8 A;  4ORZ A;  1UJ0 A;  1S1N A;  2DRK A;  4JZ4 A;  1M3C A;  1WIE A;  1ZLM A;  2YUO A;  2EYX A;  1AZE A;  1WFW A;  2HBW A;  1I1J A;  1WYX A;  4DEY A;  1FYN A;  4M4Z A;  2MOX A;  2CUD A;  1KIK A;  3EG2 A;  4J9G A;  3R6N A;  4E6R A;  4RUG A;  1ARK A;  1Z9Q A;  2KXC A;  3M0U A;  2DYB A;  2K2M A;  1MUZ A;  1NG2 A;  1UGV A;  2YUN A;  1ABQ A;  2J05 A;  1QWE A;  2KT8 A;  3PVL A;  1MV0 B;  3EGU A;  4IIM A;  2RN8 A;  2HSP A;  1LCK A;  1GCQ C;  2A37 A;  2KNB B;  5IHN A;  1U06 A;  2KRM A;  1X6G A;  2DBM A;  2GGR A;  3VS3 A;  1K76 A;  2FPD A;  2DL4 A;  2NWM A;  2D1X A;  3EHR A;  1QKW A;  3EHQ A;  2CT3 A;  1WDX A;  3NHN A;  1ABO A;  1K4U S;  1UHC A;  1Z9Z A;  1CSK A;  2CH4 A;  1T0H A;  1E6G A;  1B3Q A;  5IHK A;  2RF0 A;  2RPN A;  4RTZ A;  1H92 A;  1CKB A;  1PRM C;  2DNU A;  1ZSG A;  5FW9 A;  2EGE A;  1X27 A;  4RTW A;  4GBQ A;  3REB B;  4CC4 B;  3VS1 A;  1KSW A;  2PNI A;  2EYY A;  1YCS B;  3UA7 A;  4AG1 C;  1K0X A;  4JJC A;  2FO0 A;  2ED1 A;  3VS7 A;  1RUW A;  2CRE A;  2BTT A;  1GFC A;  4CC2 A;  2EVR A;  4LE9 A;  1GFD A;  3SHW A;  2AK5 A;  2SEM A;  2A36 A;  2JW4 A;  1OPK A;  4HCK A;  2JS0 A;  1VA7 A;  2I0N A;  1W70 A;  1T0J A;  2GBQ A;  2LMJ A;  2DL7 A;  4HVV A;  1Y57 A;  2LQN A;  5IXF A;  1G2B A;  2EYW A;  2L3Q A;  1RI9 A;  2RNA A;  1QWF A;  3RNJ A;  1AVZ C;  2OAW A;  1T3L A;  1KJW A;  3I9Q A;  4J9E A;  3PVQ A;  2DIL A;  4IIO A;  1UG1 A;  4D8K A;  1H8K A;  2GTJ A;  2CUB A;  1PKS A;  3EG0 A;  1UEC A;  2K3B A;  4JJD A;  2DVJ A;  2VVK A;  1WX6 A;  2L2P A;  1U5S A;  4J9D A;  2EPD A;  1AZG B;  1YN8 A;  2KR3 A;  2GTO A;  1OV3 A;  3I5S A;  1ZUK A;  1AWO A;  3IQL A;  1UTI A;  1UUE A;  1M27 C;  1ZX6 A;  1BK2 A;  4LNP A;  1V1C A;  4JZ3 A;  3TSW A;  5IXB A;  4LUD A;  4F17 A;  1NYF A;  2HEQ A;  2DLP A;  1B07 A;  4J9I A;  4K11 A;  1VYU A;  2CT4 A;  2OI3 A;  1X2Q A;  1J3T A;  4X1V A;  3UA6 A; 
#chains in the Genus database with same CATH topology
 2D0N A;  4E7L A;  5EG2 A;  4AFZ C;  3HRT A;  3I55 A;  2MIO A;  2XG8 D;  3JB9 D;  4C92 E;  1K8A U;  1ZSZ B;  2WAC A;  4C5I A;  5A0L A;  3RKW A;  1TU0 B;  4IUQ A;  4FSS A;  3VUB A;  5GAN 2;  2OTL A;  3TSZ A;  3S3O A;  3DLM A;  1KD1 R;  4J9F A;  2PQW A;  1WQ7 A;  5LJ5 f;  2F5T X;  1VQ5 A;  1TH7 A;  1AT1 B;  2W0Z A;  1NJI U;  3CQT A;  4BE2 A;  1GBQ A;  4M75 F;  2HCK A;  4C0Z A;  3M59 A;  4LD6 A;  1B34 B;  1Y96 A;  3SWN C;  4J7I A;  1YHQ T;  4PFP A;  1UB4 A;  2LJ1 A;  2LQW A;  2NUP B;  4OMM A;  2A3L A;  4OML A;  1KQ2 A;  1OQK A;  2RQW A;  1BI1 A;  2DFU A;  2AHJ B;  1HK9 A;  4C92 C;  3LH5 A;  3CC4 Q;  2DYI A;  4RTT A;  1OZ2 A;  3G4S A;  5GAO r;  4RCC A;  2DE0 X;  4AFQ C;  5KCO A;  3V8L A;  2QQR A;  2HL3 A;  1N27 A;  4J9B A;  3CCU T;  4HXJ A;  1R0B G;  1FMW A;  3EG9 A;  3NTH A;  2PZ1 A;  4A63 B;  4C8Q F;  2FRW A;  5KYN A;  1JXM A;  3SDZ A;  2COW A;  2VV5 A;  1JJ2 P;  1TS9 A;  2OAU A;  4M7A B;  1D1A A;  4Y92 A;  4R55 A;  2P4T A;  1XQH A;  2RH2 A;  4J7F A;  4E2F B;  4ME7 A;  2DZ9 A;  2SRC A;  2K9G A;  2JVV A;  5A0G A;  2OTJ Q;  3E9G A;  4ESR A;  3L2V A;  4BB7 A;  3A8L B;  4ELZ C;  1QLY A;  1TWB A;  3TU4 K;  2EJF A;  5GAN j;  5GJW B;  4BI3 A;  5CKE A;  2VXF A;  1ZBJ A;  4HCZ A;  2FG0 A;  3CEY A;  2RD1 A;  5FWC A;  1IZ6 A;  3OBY A;  5GAN 6;  2L3R A;  5I2S A;  1Q7Y R;  5KYU B;  2KI7 A;  2K2V A;  2FL7 A;  5GMK e;  3UAT A;  2BUD A;  1WHM A;  1KG1 A;  1BU1 A;  4PLL A;  4YTL A;  1M5Q 1;  1VQM Q;  4E7Z A;  1K73 U;  4B6M A;  5C6S A;  1I0C A;  3CCR T;  5D6W A;  2JJ9 A;  1NZ9 A;  2DXU A;  3LWI A;  3DKM A;  1UHF A;  3CCV T;  1YWO A;  1GCQ A;  2XDB A;  5KYW A;  3VRY A;  3CCQ Q;  2FEI A;  3FDR A;  1YIT A;  1V76 A;  2X35 A;  4JS5 A;  1VQ9 Q;  2G3R A;  4FT2 A;  4XAX B;  1S72 Q;  3GLX A;  4N0A C;  3HRS A;  4M75 B;  4CC3 A;  2E41 A;  4AG2 C;  2E3I A;  2E70 A;  2EQK A;  4B9X A;  4EMK B;  3OYM A;  1ZUY A;  2VGM A;  1BB9 A;  3CMA T;  1PM3 A;  3C94 A;  5GAN 3;  3VS0 A;  2LNH B;  4XK8 E;  5EC7 A;  2J6O A;  1UGP B;  2V1R A;  4ZTJ A;  4L6V 5;  4M78 E;  2D9T A;  4N4G A;  2NUT A;  3EGD A;  2EGA A;  1KC8 U;  2DBK A;  3GP8 A;  3QG1 A;  1H3H A;  2RQT A;  3CC7 Q;  3H0I A;  1PNJ A;  1YJ9 T;  1B34 A;  4C8Q B;  2ZCF B;  1M1K U;  1A0N B;  3L2W A;  1K9A A;  2NUP A;  1JB0 E;  5D7U A;  3QDF A;  1AWX A;  1HYO A;  4J8O A;  3JB9 G;  3M0Q A;  1O9S A;  2LCL A;  3MP6 A;  2GF7 A;  2KGT A;  2CZ1 B;  3CCE Q;  4M77 D;  4J6X A;  5DLO A;  1OPL A;  1GCP A;  2RQR A;  5FU6 B;  5LJ3 g;  4FIB A;  1BBZ A;  1JU5 C;  2YWW A;  4M78 C;  4PJO D;  2O88 A;  4EIK A;  3N5B B;  3CC4 A;  4JRI A;  1Q81 C;  1RAI B;  4E7I A;  4LDW A;  2H8H A;  4F7U E;  2YLB A;  3M0R A;  2DA9 A;  1VQ7 Q;  2RJE A;  3FLG A;  3VYG A;  4JJB A;  3F70 A;  3E9F A;  2PTK A;  5GAM h;  3KFV A;  3DB4 A;  4WCI A;  1W6X A;  2AKL A;  2E12 A;  2JN0 A;  1M2V B;  2F1L A;  3JB9 J;  1UJ0 A;  4PJL A;  4EPC A;  1OUL A;  1M1G A;  1ZLM A;  2OTJ A;  4PL6 A;  1KD1 U;  3OSS C;  2FYK A;  4A54 A;  4D6W A;  4DEY A;  1KHC A;  1VQN T;  1OZ3 A;  4M4Z A;  2CUD A;  2RB6 A;  4J9G A;  3OB9 A;  3R6N A;  4C8Q D;  4RUG A;  4E6R A;  1Z9Q A;  3M0U A;  2DYB A;  4JRQ A;  1QWE A;  4HT8 A;  1QVG A;  1NJI R;  2EKO A;  1M9S A;  2CZ6 B;  2LDM A;  3I56 Q;  1O75 A;  2RN8 A;  3CD6 T;  3JCM b;  3T9N A;  2QEX Q;  2GGR A;  3VS3 A;  1K76 A;  3EHQ A;  2CT3 A;  1C0M A;  3WXM B;  1ABO A;  4E7J A;  2ATC B;  1VQM A;  5LJ3 h;  1VQL Q;  1PRM C;  3GPL A;  2MF2 A;  5FW9 A;  2EGE A;  4GBQ A;  3REB B;  4CC4 B;  1YI2 T;  2HZY A;  3VS1 A;  4NL2 A;  3JB9 I;  1YCS B;  4GY5 A;  3C95 A;  3TEE A;  2ED1 A;  2VXE A;  1RUW A;  4M75 A;  3CCQ A;  3EH2 A;  2E6N A;  1XNI A;  4CC2 A;  2EVR A;  3BW1 A;  1WHH A;  3H8Z A;  4IUV A;  3P8B B;  1VQ9 A;  2SEM A;  4FYX B;  4EMK A;  2JS0 A;  2XK0 A;  1S72 A;  2LMJ A;  1M2O A;  2RHZ A;  1KQS P;  5GMK j;  3HP9 A;  2M1H A;  2P0P A;  2LQN A;  1K9M U;  2BE7 D;  4O5V A;  1QWF A;  3QZ5 B;  1TUG B;  2OAW A;  3I9Q A;  1KJW A;  4J9E A;  4IIO A;  4MDW A;  1XTD A;  4RCB A;  4D8K A;  1JJ2 A;  4M7A G;  4QQ6 A;  1VIF A;  3JCM h;  1QVF S;  2VB6 A;  1UEC A;  5CKB A;  4KGZ B;  5GMK i;  3FIF A;  3RDV A;  2JNG A;  4C8Q A;  3CXC A;  1AWO A;  2JTF A;  1UTI A;  1R8O B;  5CVI A;  4C92 F;  1NBE B;  5J26 A;  3ZFJ A;  6AT1 B;  3CC7 A;  4KUL A;  4TVR A;  8AT1 B;  4Q5W A;  1VYU A;  2CT4 A;  1G8X A;  1X2Q A;  4PJN A;  1K73 R;  4OF1 A;  3QJ6 A;  4QKU A;  2E64 A;  2KT1 A;  1TUC A;  1NLO C;  1EX4 A;  3CCE A;  1NEG A;  2YUQ A;  4B9W A;  3OYI A;  4CRI A;  1D0X A;  2P84 A;  5KE2 A;  3OYJ A;  2RMO A;  1VQ6 Q;  5IT9 E;  4RG2 A;  2BZY A;  1JEG A;  1PC0 A;  3WVE B;  2EJ9 A;  2ZPH B;  1VQ7 A;  4RKU E;  2CP5 A;  3EG1 A;  3G7Z A;  3LH0 A;  1PCX A;  1M2V A;  4RTU A;  2BE9 B;  2I2L A;  2DVE A;  1C6V X;  4FYW B;  2DEQ A;  3KBG A;  4UC4 A;  2EJG A;  3LW5 E;  5CQX A;  2DRM A;  4OP0 A;  5I22 A;  5I21 A;  2YSQ A;  3J7A F;  2QQB A;  3QJY A;  4M75 G;  2XIC A;  2L0A A;  5GAM e;  1Q95 G;  1AWJ A;  3CC2 T;  1YIJ T;  5HK3 A;  1KC8 R;  1SRL A;  3QDR B;  4KH1 B;  3PMI A;  2JT4 A;  3QYH B;  2F5K A;  4C0G A;  1FWZ A;  1NPP A;  4F16 A;  4OMN A;  4MML A;  2M9U A;  3U23 A;  1M1K R;  2RQV A;  1RAE B;  4RTX A;  1MGQ A;  2EWN A;  2COY A;  5C0M A;  3CCR Q;  3HPW A;  4XU0 A;  3NGP A;  2DMO A;  2YRC A;  3VS4 A;  4J9H A;  2ENM A;  3I56 A;  2ZPB B;  3L1A A;  4C0D C;  2KXD A;  1X01 A;  5CKD A;  3MO8 A;  4PFO A;  1WXU A;  4C8Q G;  5CK9 A;  2QEX A;  4FT4 A;  2DJQ A;  5ECA A;  1PSE A;  1NPR A;  1KHI A;  2E3H A;  2FPF A;  5KYW B;  2JS2 A;  1VQ8 Q;  1B7T A;  4FL6 A;  3JAM E;  1BIB A;  2M0Y A;  3SFM A;  3ZEH A;  3VU3 C;  1MNE A;  2IIM A;  1VQL A;  1GL5 A;  1MHN A;  1TUD A;  4HVU A;  3ME9 A;  3EFO A;  3X28 B;  2A08 A;  4LUE A;  4M7D E;  2HKN A;  5CKF A;  1W4S A;  2CZ7 B;  3KUF A;  2EW3 A;  2K3X A;  3VUZ A;  4IUR A;  2KQW A;  3MEA A;  3QWY A;  3BY7 A;  3CMA Q;  3FJP A;  3RKY A;  4XU3 A;  2HNI A;  3H0F A;  2JM9 A;  3OW2 A;  2L89 A;  2HMA A;  2X3X D;  4M77 F;  1RAD B;  1QVG P;  4JUV A;  4OMP A;  3JV3 A;  1M90 C;  1SHF A;  2DL3 A;  5M9O A;  5GAN 5;  3MCA B;  4PJO F;  5L23 A;  4IUP A;  3QPH A;  2P0Q A;  3CCL T;  3D7S B;  5CCA A;  4RMO A;  2X4Y A;  2M51 A;  2D6F A;  2NUT B;  3EGD B;  1MMD A;  1YJ9 Q;  2RO0 A;  2L5Q A;  4M7D C;  2AIR B;  3I35 A;  2KDS A;  3OYH A;  2L8D A;  1Q7Y C;  4BY6 B;  4OB0 B;  1SSF A;  3QII A;  2FPE A;  4A4H A;  3RER A;  5I11 A;  3RES A;  2DM1 A;  4JLG A;  1ZHI A;  4M78 F;  2EFI A;  5LJ5 h;  1WLP B;  4O6J A;  5GJV B;  1RL2 A;  3JCM e;  1RAH B;  1YNZ A;  1H64 1;  3RBB B;  3SB2 A;  2CKK A;  4L59 A;  1PKT A;  2O9S A;  3G6E T;  2KE9 A;  5A0D A;  5IH2 A;  2J6K A;  2QQA A;  1YJN T;  4ZNX A;  1X69 A;  4R56 A;  1JO8 A;  2M16 A;  1ACM B;  3CPW A;  1HSQ A;  3H6Z A;  3MET A;  2QDY B;  2RJD A;  5CQY A;  3FJ5 A;  2GCX A;  4C92 D;  2LCS A;  2GQI A;  3L2Z A;  1VQ6 A;  2XMF A;  3HL8 A;  3JCM Q;  1P92 A;  2H3E B;  3OYY A;  1ZSZ C;  5CR2 A;  3CXC P;  2QGG A;  2HAX A;  4VUB A;  3V7S A;  3NTI A;  2BZ8 A;  2F69 A;  1OU9 A;  2JMA A;  4XQ3 A;  3L2U A;  1WJQ A;  2LZ6 B;  8ATC B;  2ZPG B;  1K9M R;  4A4G A;  1OX8 A;  2JMC A;  1VQN Q;  2CP7 A;  2HQX A;  1ZBX A;  2XDD A;  1SSH A;  2G6F X;  2K79 A;  1CKA A;  4JLI A;  4M7A E;  1EFN A;  5IN1 A;  2EIF A;  1M3B A;  2LQK A;  2QYZ A;  3ZL7 C;  4Z89 A;  3R6O A;  5GAN g;  1KQS A;  3NMZ C;  1YJW T;  4LDX A;  3NPF A;  3OS2 A;  1MMN A;  2XHC A;  2EYQ A;  3FRN A;  3M0P A;  4ZGJ B;  3HHT B;  5J3B A;  3CCJ T;  1NM7 A;  1I4K 1;  1RLQ C;  4M77 B;  1D0Z A;  4OB3 B;  4QQD A;  3CME T;  1JQQ A;  4HA8 A;  4KT0 E;  3L42 A;  2K57 A;  3CCR A;  2WSC E;  2JM8 A;  3FB9 A;  1G5V A;  4HCC A;  4E7H A;  1U1T A;  2IPO B;  4JZ4 A;  4PJO B;  1BYM A;  4M7A C;  4PK4 A;  1AZE A;  1WFW A;  2HBW A;  2LTO A;  3GF5 A;  1I1J A;  1WYX A;  2MOX A;  3EG2 A;  3AT1 B;  1VQ8 A;  1MUZ A;  1NG2 A;  1YIT T;  1UGV A;  4C92 A;  5GAM j;  1PSF A;  4PJJ A;  4KUI A;  2QAZ A;  2KT8 A;  4XTX A;  2V8K A;  2KY9 A;  4IIM A;  3JCM V;  3OBW A;  5GAN 4;  2NYS A;  1V29 B;  2DL4 A;  1MMA A;  2NWM A;  7AT1 B;  3CMA A;  1Q82 C;  3OYE A;  4LD9 K;  5GAN f;  1H3Z A;  3Q1J A;  1CSK A;  2CH4 A;  1T0H A;  1KQ1 A;  3C12 A;  2RF0 A;  1K8A C;  1CKB A;  1ZSG A;  5FRM A;  1D09 B;  3OYF A;  4M75 E;  4JDS A;  1ZQ1 A;  2EYY A;  3RMS A;  1WHG A;  4AG1 C;  1K0X A;  4JJC A;  2ZGW A;  4J83 A;  2KMT A;  1YJ9 A;  3M55 A;  1NJI C;  4LE9 A;  4LXC A;  2LX9 A;  3SHW A;  3EFR A;  2AK5 A;  3VJP A;  1OPK A;  2I0N A;  4F04 B;  1RAA B;  1W70 A;  5GAO p;  2GBQ A;  2JZ2 A;  1LVK A;  2X51 A;  1VQO T;  5LJ3 j;  1EIF A;  1G2B A;  5AYF A;  2EYW A;  2L3Q A;  1WPY A;  1AVZ C;  3NTK A;  3OW2 P;  2DTI A;  4M75 C;  3URG A;  4C8Q E;  1VUB A;  2PVD B;  2Y4Y A;  1D1C A;  4EMK C;  2K3B A;  3CC4 T;  1N9S A;  2VVK A;  1WX6 A;  5LJ5 e;  3BE3 A;  2PUO B;  2JOY A;  1N8R U;  4EDU A;  1WGS A;  3I5S A;  2RHU A;  1ZX6 A;  4JRP A;  1BK2 A;  3M56 A;  3LWH A;  4M78 D;  2LVM A;  1W2B S;  4F17 A;  2HEQ A;  3NFC A;  1B07 A;  4X1V A;  4XTW A;  1IB8 A;  2OI3 A;  1U1S A;  1J3T A;  1D3B A;  1QW1 A;  2VC8 A;  3M4G A;  5GAN d;  2Z0W A;  2EQJ A;  5I2M A;  3UA6 A;  4C8Q C;  4E7S A;  2C0O A;  1PRL C;  5DY9 A;  2HQH A;  4N0A A;  3CC2 Q;  4C92 G;  3CBM A;  2QQS A;  1YIJ Q;  2DJZ A;  1D0Y A;  1RAG B;  4FYV B;  2YHT A;  4II1 A;  2GFA A;  4GLM A;  1AD5 A;  3MKD A;  3MEW A;  2C06 A;  1BI2 A;  1VQN A;  1QP2 A;  2NUZ A;  3GBQ A;  3RR6 A;  2R57 A;  2RHY A;  2EBP A;  2QXF A;  2FHD A;  4HKE A;  5AT1 B;  3M4Y A;  3CPW P;  5FU6 C;  1M1F A;  1IHV A;  5GMK l;  1IO6 A;  4BI8 B;  3I5R A;  2C0T A;  2F2V A;  3ASK A;  5FU7 B;  4QVD A;  1K0S A;  1YWP A;  4M77 A;  4QVZ A;  1WQW A;  2D8H A;  1OEB A;  2BZX A;  4OGE A;  3KXT A;  1SF9 A;  3JB9 H;  4PJO A;  2K5F A;  1Y71 A;  1T3S A;  4QVC A;  2O2O A;  1M8M A;  2E5Q A;  2VGN A;  3QO3 A;  1UFF A;  3MPU B;  2ZPE B;  1BI0 A;  1YBY A;  2MCN A;  2DZC A;  1NYG A;  3PMT A;  4LN2 A;  2O31 A;  5GAM d;  3EFO B;  1WNL A;  2QA4 T;  4ZGE B;  3FC3 A;  2RQU A;  3GOX A;  2JUF A;  4M78 A;  2R5A A;  5D6X A;  1RAB B;  1X6B A;  1Y07 A;  3RKX A;  3TVT A;  1RI0 A;  2AZS A;  3PTA A;  3QSU A;  2CP3 A;  2J6F A;  2CP2 A;  1N6A A;  2CDT A;  2EQM A;  2QTV A;  3X24 B;  1VQ9 T;  1HJD A;  2HDA A;  2XDP A;  1VIE A;  5FRO A;  1TG0 A;  3CCL Q;  1G83 A;  2DF6 A;  2X4J A;  3HFO A;  2X4X A;  2RK2 A;  4M7D F;  3CBO A;  2CH4 W;  3H41 A;  4DEX A;  2RK1 A;  3LGL A;  4ZTF A;  3OYG A;  2FVU A;  1M4Z A;  2O01 E;  3X26 B;  1EZZ B;  5GAO l;  1UE9 A;  1Q86 C;  4RTV A;  1FXX A;  1KC8 C;  3OS1 A;  2LNV A;  1IGQ A;  4FSX A;  1U8R A;  1YHQ Q;  3J81 E;  4R0K A;  2CYZ B;  4QQG A;  3EH1 A;  2ABL A;  3EG3 A;  1WHK A;  1M1K C;  1X6O A;  1TTH B;  3GNF B;  1BCO A;  2E10 A;  3VRZ A;  3G6E Q;  4A4F A;  3HSB A;  1M3A A;  3X20 B;  2DD5 A;  1YJN Q;  2DL8 A;  2W10 A;  3CCU Q;  1AEY A;  3A98 A;  3CCS T;  4JPB W;  3OMC A;  4JS4 A;  2MPX C;  4A4E A;  3JSC A;  2COZ A;  3OMG A;  5KYX B;  4Z8A A;  2LX7 A;  1K1Z A;  1QCF A;  1X43 A;  1R77 A;  3H0H A;  2V1Q A;  4C5E A;  2JTE A;  1MMG A;  2MK5 A;  2X4W A;  4M77 G;  1DJ7 B;  1PWT A;  1FX7 A;  2XU8 A;  3FEO A;  4LDY A;  3GIB A;  3OYA A;  2AZV A;  1FMK A;  2CSQ A;  4PJO G;  2DIQ A;  5J39 A;  2LCC A;  3JCM J;  2KYM A;  1YCY A;  4NL3 A;  3V7R A;  2R5M A;  3JCM W;  3CBP A;  3VS2 A;  1VQ7 T;  3PIO A;  4Y91 A;  4WTO B;  3M58 A;  1QCO A;  3JCM d;  2YDL A;  1VQK T;  4HVW A;  4KGX B;  3RMQ A;  1GBR A;  1VYV A;  2KRN A;  1VQ4 T;  2HBP A;  2LP5 A;  2FZC B;  2CS7 A;  2E6Z A;  1MND A;  1KD1 C;  4A53 A;  2D8J A;  5GMK h;  2VKN A;  4MZT A;  1YJW Q;  3O5Z A;  2HL5 C;  3CC2 A;  1YIJ A;  2RI3 A;  1I5O B;  1BCM A;  1G3S A;  3MEV A;  4XTY A;  1R0C B;  3GNG A;  1E7O A;  1W1F A;  5LJ5 j;  3CCJ Q;  1I81 A;  2CSI A;  2LJ0 A;  1NEB A;  1QQJ A;  2V8J A;  3OYD A;  3PNW C;  3CME Q;  3CCV Q;  2HKQ B;  3OYC A;  3CPF A;  5LL6 S;  3TQ7 P;  2F2X A;  3A8G B;  3OYL A;  2KRS A;  3X25 B;  1QVF A;  2R58 A;  5HCK A;  3PIP A;  1FMV A;  3G71 T;  3JCM P;  3CCM T;  3MJX A;  3HRU A;  1RLP C;  2QEX T;  3THK A;  1KFZ A;  3VYH B;  3REA B;  1SEM A;  2K6D A;  3BFM A;  1UJY A;  1LJO A;  2J06 A;  1SPK A;  3V7C A;  2K4Y A;  4C92 B;  2V26 A;  1N8R R;  5LJ3 e;  2EQU A;  1NLP C;  3LX7 A;  2C0I A;  2KBT A;  1VOM A;  4BDY A;  1QKX A;  1VQP T;  1AOJ A;  4OGC A;  5FRN A;  5HY6 A;  4JJN K;  2KRO A;  3LLR A;  5IAY A;  2DPP B;  2QGF B;  3PFS A;  2KEA A;  3HTR A;  4V2S A;  4FW2 A;  3M0S A;  2YUP A;  4BI4 A;  3I55 T;  1K9M C;  4XTZ A;  1WIE A;  3CCL A;  2EYX A;  2JTM A;  3S6W A;  3DB3 A;  3UDC A;  2IVW A;  3MP1 A;  2OTL T;  2D0Q B;  1FYN A;  1KIK A;  3QKJ A;  2CGH A;  2E4H A;  2KXC A;  4FM4 B;  2O4X A;  4DBF A;  2OX7 A;  1VQ5 T;  3G1J A;  1ABQ A;  2J05 A;  2DER A;  1YHQ A;  3M54 A;  3PVL A;  3EGU A;  1VQO Q;  1LCK A;  2AT1 B;  1GCQ C;  4XTV A;  2A37 A;  5IHN A;  1TOV A;  1U06 A;  1X6G A;  2KRM A;  2RHI A;  4M7D D;  2FPD A;  3EGX A;  1QKW A;  5KYX A;  1IRX A;  1K4U S;  3G6E A;  1Z9Z A;  3G4S T;  1B3Q A;  1E6G A;  5IHK A;  4EMH A;  1YJN A;  4RTZ A;  1H92 A;  1Q81 U;  3CCU A;  4RTW A;  3OA6 A;  2PNI A;  4NS5 A;  2P0K A;  2MI6 A;  2RI2 A;  3UA7 A;  2VYT A;  5CAI A;  4J6Y A;  2FO0 A;  2RI5 A;  3M53 A;  2A7Y A;  1SG5 A;  2BTT A;  2LT4 A;  4KUD K;  2ZPF B;  1WZO A;  1GFD A;  1LOJ A;  2KVQ G;  1VQ6 T;  2A36 A;  2GQV A;  4F7U F;  2RHX A;  1VA7 A;  1T0J A;  1BI3 A;  1TSF A;  1D3B B;  2DL7 A;  1W2B P;  1Y57 A;  5CO7 A;  3A5Z B;  5IXF A;  3ZBD A;  5HKC A;  1WHJ A;  3TCJ A;  4BY6 C;  3RNJ A;  1IXD A;  2A0F B;  2QG9 B;  5GAO n;  4E7K A;  1M90 R;  2YRD A;  5D6Y A;  4ANJ A;  2MMP A;  2GTJ A;  3A8H B;  1ZA1 B;  2CUB A;  1PKS A;  2DO3 A;  4L5G A;  3CD6 Q;  4NOY A;  1LNX A;  4PNO A;  1OU8 A;  4BUG A;  2L2P A;  1U5S A;  4J9D A;  2LQ8 A;  1PG5 B;  2CZ0 B;  1YN8 A;  2XID A;  3LGF A;  2E1H A;  5LJ5 d;  1YJW A;  3IQL A;  1UEB A;  1UUE A;  4LNP A;  2DEU A;  4BAC A;  4DA4 A;  2PVG B;  3TSW A;  1OYX A;  4K11 A;  4J9I A;  3CCJ A;  4KGV B;  1NE8 A;  2E65 A;  2XD0 A;  2LC4 A;  4M7D A;  1YI2 Q;  3CME A;  3CCV A;  3SWN A;  3UF4 A;  5GAN 7;  3VKI A;  2B86 A;  2EYZ A;  3VV0 A;  2QI2 A;  1PD1 A;  2QA4 Q;  3OYN A;  2VWF A;  2PU9 B;  3M0T A;  4OMO A;  4MMK A;  2XKO C;  4IUT A;  4M77 E;  1GXI E;  2YXY A;  4OB2 B;  4PLI A;  4X9D A;  4KRT A;  5KYY A;  1VQ8 T;  4M78 B;  2YT6 A;  5IHI A;  1QMC A;  3INZ A;  4M7A D;  2DXT A;  4PJO E;  1I07 A;  2KYB A;  5GAM g;  3SD4 A;  1QVG S;  4F14 A;  4OMQ A;  1SKU B;  3AHU A;  1XJW B;  1PHT A;  2DX1 A;  1WXT A;  5L8R E;  3LYI A;  2DXC A;  3A8O B;  3V8J A;  2M02 A;  4DBR A;  2CP6 A;  1ZSZ A;  1QVF P;  3UT1 A;  5GAN h;  2MYS A;  1MV3 A;  4M77 C;  2ZAE A;  5FLX E;  2ED0 A;  1Q86 U;  1VYT A;  2M0O A;  2E5K A;  1U3O A;  3QYG B;  4PJO C;  1G3W A;  3TRE A;  4F7U B;  1WA7 A;  4AT1 B;  4CC7 A;  2EKH A;  3CCS Q;  2MWO A;  4BE1 A;  1JXO A;  2DKG A;  3P8H A;  2DXB A;  1JRI A;  1Y0M A;  3J80 E;  1ZUU A;  1VQO A;  4MZP A;  2LT1 A;  4ATO A;  2RA2 A;  2HSE B;  4C5H A;  2L3S A;  1I5L A;  1M8V A;  1UGR B;  3OYK A;  4GLK A;  1ZA2 B;  4X34 A;  2P4R A;  2QDL A;  2FZK B;  4DOV A;  4RTY A;  1JJ2 S;  2YLC A;  4A4K A;  2KAF A;  5GAM f;  1HD3 A;  1AWW A;  1WJS A;  1IHW A;  1N9R A;  2O9V A;  1I8F A;  4FCY A;  2VUB A;  4M7D G;  3VS5 A;  3SEM A;  2RJC A;  4OB1 B;  2L3P A;  1M30 A;  2CP0 A;  3MEU A;  4M75 D;  3PGG A;  4N4H A;  4M7A A;  3CXC S;  2ECZ A;  4MDX A;  3OS0 A;  1VQK Q;  1XOV A;  5A2Q E;  1UDL A;  4XU1 A;  3E19 A;  3VS6 A;  3C4S A;  1VQ4 Q;  2K7A A;  2B8A A;  4AFS C;  4C5G A;  2LJ3 A;  1Q82 R;  4DBH A;  2OTJ T;  2GFU A;  2EQI A;  2DAQ A;  2EGC A;  4PKC C;  2GNC A;  1LPL A;  2F2W A;  3JCM g;  1K8A R;  5GMK m;  2DD4 A;  4KBM B;  3S3N A;  3HKS A;  1IRE B;  1QCN A;  1F1B B;  5KE3 A;  1YP5 A;  2J7I A;  1HXD A;  2JXB A;  1TXQ A;  2BIV A;  2KSS A;  5KYU A;  3CD6 A;  4C0F A;  3QXE B;  5KCH A;  4N4I A;  3QUI A;  4Z88 A;  1G3T A;  3QWX X;  1K73 C;  1N5Z A;  5DM7 R;  5LJ3 f;  2XI9 A;  2Y4X A;  2ESW A;  3G71 Q;  3CCM Q;  4OVA A;  4FW1 A;  4BE0 A;  4AMC A;  4HT9 A;  4D8D A;  1VQM T;  1X2K A;  1YI2 A;  1SRM A;  1KK7 A;  3JCM c;  3JB9 F;  2KK4 A;  3C0C A;  4P5N A;  1Q81 R;  1OOT A;  4FYY B;  4QW2 A;  9ATC B;  1WI7 A;  2QA4 A;  1VQP Q;  3CCQ T;  3O8V A;  4DBQ A;  5FWB A;  2A28 A;  2QAS A;  4IUU A;  3OSV A;  2WSF E;  5GAN 8;  3OY9 A;  1S72 T;  3RUX A;  5CKH A;  2IG0 A;  2DET A;  1Y7X A;  2DK3 A;  1UGS B;  4Y28 E;  3I55 Q;  3M57 A;  3PE0 A;  1M90 U;  4J6W A;  3JCM f;  4BDZ A;  2X3W D;  5GAO m;  2OTL Q;  2DL5 A;  5FU7 C;  4J9C A;  4Z02 A;  1D1B A;  1QVP A;  4ZN3 A;  3ULR B;  3RIR A;  2VAS A;  1VQ5 Q;  2AKK A;  2ZZD A;  1WXB A;  2K5I A;  2OJ2 A;  4HCB A;  1Q7Y U;  1W2B A;  2O4X B;  4QT7 A;  3QHS A;  2EAY A;  3MP8 A;  3BDU A;  1GRI A;  2QK0 A;  4F7U A;  5LJ3 d;  3CC7 T;  2ROT A;  4AFU C;  2ROL A;  2FRY A;  1E6H A;  4ZN1 A;  2K3Y A;  2Y90 A;  1WJR A;  1Y96 B;  1SHG A;  4FU6 A;  2MWP A;  3EGX B;  3EAE A;  3JRZ A;  3G4S Q;  5GAN e;  4ORZ A;  4DQ2 A;  3OW2 S;  1S1N A;  2DRK A;  3CCS A;  4LDU A;  3CCE T;  1M3C A;  1WHL A;  5CIU A;  2V8I A;  4J5Y A;  2YUO A;  1BKB A;  4MZM A;  3E1S A;  2QQ9 A;  3H9N A;  4C0D B;  1PD0 A;  1ARK A;  2FB7 A;  2K2M A;  4OMF B;  3PT9 A;  1N8R C;  2YUN A;  3EG9 B;  4BD3 A;  1BIA A;  1G3Y A;  3UWN A;  1MV0 B;  5HK0 A;  2HSP A;  3S3M A;  1AHJ B;  2RM4 A;  2KNB B;  2DTH A;  3M5A A;  3DLL A;  2DBM A;  5DLQ E;  4WF2 A;  4CI0 C;  2K5L A;  4RG8 A;  3OQ5 A;  5GAO q;  2LRQ A;  1YFN A;  2D1X A;  3QBY A;  4IKF A;  3EHR A;  4PFZ A;  1VQK A;  2YRV A;  1WDX A;  3NHN A;  1UHC A;  4M78 G;  2QTX A;  2X9H A;  1VQ4 A;  2RPN A;  2DNU A;  3QZ9 B;  2PVO B;  3HFN A;  1X27 A;  2WSE E;  3A1P A;  4ZGD B;  1KSW A;  3L2Q A;  4KH0 B;  1QP3 A;  2HQE A;  1Q86 R;  3VS7 A;  3CPW S;  2CRE A;  3BDL A;  1GFC A;  1RAF B;  1UGQ B;  4M7A F;  2MAM A;  3MHX A;  3P8D A;  1OX9 A;  2JW4 A;  4PJM A;  2DTO A;  4HCK A;  3E2U A;  2ZPI B;  3M9Q A;  3I56 T;  4M7D B;  5LJ5 g;  1X75 C;  4HVV A;  4X9C A;  2FZG B;  3SWN B;  1RI9 A;  1JBM A;  2RNA A;  2H3J A;  1T3L A;  3G71 A;  3CCM A;  3PVQ A;  2DIL A;  3WVD B;  1YIT Q;  1UG1 A;  1RAC B;  1H8K A;  4XU2 A;  3V8K A;  4ELY C;  2HD0 A;  4F7U G;  3OS5 A;  3EG0 A;  3JCM X;  4E47 A;  1VQL T;  4JJD A;  1OI1 A;  2DVJ A;  3A8M B;  2EPD A;  2PUK B;  1AZG B;  4LDV A;  2KR3 A;  2GTO A;  3UPU A;  1OV3 A;  4DOW A;  1ZUK A;  5KYY B;  1M27 C;  2RJF A;  3EFS A;  1V1C A;  4JZ3 A;  1KQS S;  5IXB A;  1VQP A;  2BKD N;  4LUD A;  1NYF A;  2DIG A;  2DLP A;  4XTU A;  4JRK A;  4EMG A;  3L2R A;  2NLU A;  3ER0 A;  1Q82 U;  5KH6 A;  1C1A A;  1IGU A;  3OYB A; 
#chains in the Genus database with same CATH homology
 2D0N A;  2KT1 A;  4AFZ C;  1TUC A;  1NLO C;  2MIO A;  2C0O A;  3UF4 A;  1NEG A;  1PRL C;  2YUQ A;  2B86 A;  2EYZ A;  4GLM A;  1AD5 A;  2RMO A;  4FSS A;  2VWF A;  3TSZ A;  3M0T A;  2NUZ A;  3GBQ A;  4OMO A;  2BZY A;  4J9F A;  2EBP A;  1JEG A;  2W0Z A;  3CQT A;  4KRT A;  1IO6 A;  1GBQ A;  2YT6 A;  3I5R A;  2C0T A;  2HCK A;  2F2V A;  5IHI A;  1K0S A;  1YWP A;  3EG1 A;  2LJ1 A;  1I07 A;  2KYB A;  2LQW A;  4RTU A;  2D8H A;  4OMM A;  4F14 A;  1OEB A;  2BZX A;  4OMQ A;  4OML A;  1PHT A;  2RQW A;  2DX1 A;  3LH5 A;  1T3S A;  1WXT A;  1M8M A;  2O2O A;  2DRM A;  5I22 A;  2YSQ A;  4RTT A;  1UFF A;  2DE0 X;  4AFQ C;  2L0A A;  2MCN A;  1NYG A;  4LN2 A;  1AWJ A;  2O31 A;  4J9B A;  4HXJ A;  1MV3 A;  1SRL A;  2ED0 A;  2JT4 A;  1VYT A;  2PZ1 A;  4A63 B;  2FRW A;  1JXM A;  4F16 A;  2RQU A;  2E5K A;  1U3O A;  4OMN A;  1X6B A;  3U23 A;  2RQV A;  3TVT A;  2AZS A;  4RTX A;  2J6F A;  4Y92 A;  1WA7 A;  2CDT A;  1HJD A;  3NGP A;  2DMO A;  4CC7 A;  2SRC A;  2EKH A;  2HDA A;  2K9G A;  3VS4 A;  4J9H A;  2ENM A;  1JXO A;  1Y0M A;  1TG0 A;  1ZUU A;  4ESR A;  1G83 A;  2DF6 A;  2KXD A;  1WXU A;  2L3S A;  2CH4 W;  1QLY A;  3H41 A;  5ECA A;  2DJQ A;  4DEX A;  2FPF A;  5GJW B;  2P4R A;  2JS2 A;  2M0Y A;  1ZBJ A;  1UE9 A;  2FG0 A;  4RTV A;  2QDL A;  5FWC A;  2IIM A;  4RTY A;  1GL5 A;  1HD3 A;  1TUD A;  4HVU A;  4R0K A;  1AWW A;  2O9V A;  2A08 A;  4LUE A;  2ABL A;  3VS5 A;  3SEM A;  2EW3 A;  3EG3 A;  2L3P A;  1M30 A;  3QWY A;  2ECZ A;  3UAT A;  1XOV A;  1BU1 A;  3H0F A;  2JM9 A;  1UDL A;  2X3X D;  3VRZ A;  3VS6 A;  1M3A A;  1I0C A;  4OMP A;  3JV3 A;  2K7A A;  2DL8 A;  2W10 A;  4AFS C;  1AEY A;  3A98 A;  1SHF A;  2DL3 A;  4JPB W;  5L23 A;  2LJ3 A;  1UHF A;  1YWO A;  4Z8A A;  2LX7 A;  2EQI A;  2M51 A;  1K1Z A;  1QCF A;  2EGC A;  1GCQ A;  1X43 A;  3H0H A;  2GNC A;  2V1Q A;  3VRY A;  2JTE A;  2F2W A;  2FEI A;  3I35 A;  1PWT A;  1YP5 A;  2J7I A;  2JXB A;  2AZV A;  2FPE A;  1FMK A;  2CSQ A;  5I11 A;  2DM1 A;  4Z88 A;  2KYM A;  4CC3 A;  3QWX X;  4AG2 C;  1N5Z A;  3VS2 A;  1WLP B;  2ESW A;  5GJV B;  1YNZ A;  1ZUY A;  3RBB B;  1BB9 A;  2YDL A;  4HVW A;  1PKT A;  4D8D A;  2O9S A;  3VS0 A;  2LNH B;  5EC7 A;  2KE9 A;  2J6O A;  1X2K A;  5IH2 A;  1GBR A;  1VYV A;  2KRN A;  2J6K A;  2V1R A;  2LP5 A;  1SRM A;  4ZNX A;  1X69 A;  1JO8 A;  3C0C A;  2D8J A;  1HSQ A;  1OOT A;  2EGA A;  2VKN A;  3O5Z A;  2DBK A;  1H3H A;  2RQT A;  3FJ5 A;  3H0I A;  1WI7 A;  1PNJ A;  2LCS A;  2GQI A;  5FWB A;  2XMF A;  2A28 A;  1E7O A;  1W1F A;  1A0N B;  2CSI A;  2LJ0 A;  1NEB A;  1K9A A;  1AWX A;  3M0Q A;  2KGT A;  2BZ8 A;  3PE0 A;  2F2X A;  2JMA A;  2KRS A;  1OPL A;  1GCP A;  2RQR A;  2LZ6 B;  5HCK A;  2X3W D;  1BBZ A;  1JU5 C;  2JMC A;  2DL5 A;  1RLP C;  2O88 A;  4EIK A;  4J9C A;  3ULR B;  1SSH A;  2G6F X;  3THK A;  1KFZ A;  2K79 A;  1CKA A;  3REA B;  1SEM A;  1EFN A;  2K6D A;  2AKK A;  1UJY A;  1M3B A;  3ZL7 C;  1WXB A;  2H8H A;  2J06 A;  1SPK A;  2OJ2 A;  4Z89 A;  3M0R A;  2DA9 A;  4QT7 A;  3NMZ C;  1GRI A;  1NLP C;  3NPF A;  4JJB A;  2C0I A;  2KBT A;  2ROT A;  4AFU C;  1QKX A;  2PTK A;  1AOJ A;  3M0P A;  2ROL A;  2FRY A;  3KFV A;  1E6H A;  4WCI A;  1W6X A;  2KRO A;  1NM7 A;  1SHG A;  2AKL A;  1RLQ C;  2KEA A;  1JQQ A;  3M0S A;  2YUP A;  2JM8 A;  4ORZ A;  1UJ0 A;  1S1N A;  2DRK A;  4JZ4 A;  1M3C A;  1WIE A;  1ZLM A;  2YUO A;  2EYX A;  1AZE A;  1WFW A;  2HBW A;  1I1J A;  1WYX A;  4DEY A;  1FYN A;  4M4Z A;  2MOX A;  2CUD A;  1KIK A;  3EG2 A;  4J9G A;  3R6N A;  4E6R A;  4RUG A;  1ARK A;  1Z9Q A;  2KXC A;  3M0U A;  2DYB A;  2K2M A;  1MUZ A;  1NG2 A;  1UGV A;  2YUN A;  1ABQ A;  2J05 A;  1QWE A;  2KT8 A;  3PVL A;  1MV0 B;  3EGU A;  4IIM A;  2RN8 A;  2HSP A;  1LCK A;  1GCQ C;  2A37 A;  2KNB B;  5IHN A;  1U06 A;  2KRM A;  1X6G A;  2DBM A;  2GGR A;  3VS3 A;  1K76 A;  2FPD A;  2DL4 A;  2NWM A;  2D1X A;  3EHR A;  1QKW A;  3EHQ A;  2CT3 A;  1WDX A;  3NHN A;  1ABO A;  1K4U S;  1UHC A;  1Z9Z A;  1CSK A;  2CH4 A;  1T0H A;  1E6G A;  1B3Q A;  5IHK A;  2RF0 A;  2RPN A;  4RTZ A;  1H92 A;  1CKB A;  1PRM C;  2DNU A;  1ZSG A;  5FW9 A;  2EGE A;  1X27 A;  4RTW A;  4GBQ A;  3REB B;  4CC4 B;  3VS1 A;  1KSW A;  2PNI A;  2EYY A;  1YCS B;  3UA7 A;  4AG1 C;  1K0X A;  4JJC A;  2FO0 A;  2ED1 A;  3VS7 A;  1RUW A;  2CRE A;  2BTT A;  1GFC A;  4CC2 A;  2EVR A;  4LE9 A;  1GFD A;  3SHW A;  2AK5 A;  2SEM A;  2A36 A;  2JW4 A;  1OPK A;  4HCK A;  2JS0 A;  1VA7 A;  2I0N A;  1W70 A;  1T0J A;  2GBQ A;  2LMJ A;  2DL7 A;  4HVV A;  1Y57 A;  2LQN A;  5IXF A;  1G2B A;  2EYW A;  2L3Q A;  1RI9 A;  2RNA A;  1QWF A;  3RNJ A;  1AVZ C;  2OAW A;  1T3L A;  1KJW A;  3I9Q A;  4J9E A;  3PVQ A;  2DIL A;  4IIO A;  1UG1 A;  4D8K A;  1H8K A;  2GTJ A;  2CUB A;  1PKS A;  3EG0 A;  1UEC A;  2K3B A;  4JJD A;  2DVJ A;  2VVK A;  1WX6 A;  2L2P A;  1U5S A;  4J9D A;  2EPD A;  1AZG B;  1YN8 A;  2KR3 A;  2GTO A;  1OV3 A;  3I5S A;  1ZUK A;  1AWO A;  3IQL A;  1UTI A;  1UUE A;  1M27 C;  1ZX6 A;  1BK2 A;  4LNP A;  1V1C A;  4JZ3 A;  3TSW A;  5IXB A;  4LUD A;  4F17 A;  1NYF A;  2HEQ A;  2DLP A;  1B07 A;  4J9I A;  4K11 A;  1VYU A;  2CT4 A;  2OI3 A;  1X2Q A;  1J3T A;  4X1V A;  3UA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...