1AWXA

Sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BRUTON'S TYROSINE KINASE
publication title Solution structure of the SH3 domain from Bruton's tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awxA00
3UF4A 1SHFA 3QWXX 1AEYA 1TUDA 2JW4A 2RQRA 4Z8AA 2L2PA 3VRYA 1U06A 2RN8A 1WI7A 1SPKA 5IXFA 4J9GA 1UJ0A 2CUDA 2EQIA 2EYYA 1RLPC 4HCKA 2DMOA 2CUBA 2C0OA 4HVWA 2KXCA 3U23A 2EKHA 3GBQA 4CC7A 1PRMC 5GJWB 3C0CA 2F2VA 3ULRB 1IO6A 4QT7A 2ECZA 4J9FA 1RI9A 2NUZA 1M30A 2RNAA 4A63B 2OAWA 2BZXA 1ZSGA 4J9BA 4RTUA 4OMLA 3EG0A 1FYNA 2JS0A 4AFSC 2DF6A 2MOXA 2B86A 1SSHA 2IIMA 2A08A 5HCKA 2KXDA 1YNZA 2EPDA 4FSSA 2JT4A 3THKA 2GTJA 3NHNA 5L23A 2KT8A 2M0YA 4AG2C 1MV0B 2AKKA 4J9IA 2KRSA 2JM8A 1Y57A 3RBBB 1WYXA 3M0UA 1GCPA 1QKXA 4WCIA 2K7AA 2FRWA 3PE0A 1BU1A 1QCFA 4JPBW 4Z88A 2NWMA 1H3HA 4LUEA 2ED0A 1WA7A 1UE9A 2E5KA 2JS2A 2MIOA 1UJYA 2MCNA 1UUEA 1WX6A 2F2WA 4DEYA 2A28A 4D8KA 2A36A 1SRLA 2DA9A 2EGEA 1CKAA 1TUCA 3I35A 2GNCA 2ABLA 1MV3A 2KYBA 2EGAA 1AWOA 3H0IA 2D8JA 3TVTA 1GCQA 5EC7A 1UTIA 2LQNA 3CQTA 2D8HA 2LP5A 1X43A 2LJ1A 2ROLA 4IIMA 3FJ5A 3UA6A 2DE0X 2HDAA 1PNJA 2L3QA 1NM7A 5FW9A 1KJWA 1GFCA 1ARKA 1YN8A 1EFNA 4J9HA 1SHGA 2YT6A 2L3SA 1WDXA 4LNPA 2LQWA 3ZL7C 3VS6A 2D0NA 2P4RA 3EG2A 1VYUA 1ZUUA 2KT1A 1ABQA 4DEXA 1WXBA 2K79A 2EGCA 1GRIA 2O9VA 1YP5A 2GBQA 2DL7A 2J6OA 3EHQA 3NPFA 3H41A 2DL4A 1M3AA 2K6DA 1YWPA 4M4ZA 1UFFA 1I1JA 4JZ4A 2KRMA 3VS5A 1FMKA 1SRMA 3PVQA 2CH4A 1VYTA 2DILA 1UHFA 1NLPC 1AWXA 1Y0MA 1YWOA 2YDLA 4ESRA 2ED1A 1QKWA 3REBB 2DM1A 2HCKA 2KNBB 4J9EA 3EG3A 1WFWA 2F2XA 1PKTA 4JJDA 4R0KA 4F16A 1PKSA 4RTXA 2BZ8A 4RTZA 4AG1C 1MUZA 1OOTA 1VYVA 1OEBA 1OPKA 2ROTA 3I5RA 4EIKA 5IH2A 2RQUA 1RUWA 2OI3A 3RNJA 2FEIA 2C0TA 3REAB 1AZEA 4GBQA 4JJBA 2DRMA 3VS7A 1UECA 3VS4A 1KIKA 2FPFA 2RQWA 1WIEA 1I0CA 2JM9A 2LNHB 1GBQA 1QWFA 1GL5A 2XMFA 2YUNA 4D8DA 4JZ3A 1BK2A 2A37A 2O88A 3I5SA 4OMOA 1OV3A 2VKNA 2J6FA 2DNUA 1B07A 3M0RA 1UG1A 1T3SA 4E6RA 1W1FA 3SHWA 5IXBA 1G83A 1GCQC 1JU5C 1RLQC 2OJ2A 4GLMA 1W70A 1X6BA 1AOJA 2CREA 5IHNA 1AWWA 2RQVA 1I07A 1UGVA 1GBRA 2GGRA 2J05A 1WXTA 1QLYA 1NYFA 2LZ6B 1NYGA 2J6KA 4IIOA 1AZGB 1E7OA 1KFZA 2M51A 1XOVA 3IQLA 2O2OA 4RTYA 1JXOA 2EVRA 4ORZA 3UATA 2DX1A 4LUDA 1N5ZA 1JXMA 2AZVA 1ZBJA 4AFUC 4AFZC 1ABOA 4AFQC 2LCSA 1X2QA 3H0HA 2KE9A 2SRCA 3VS3A 1GFDA 3KFVA 3SEMA 1J3TA 1LCKA 2KBTA 2PZ1A 2JMCA 3QWYA 2W10A 2YUQA 3O5ZA 3VS0A 3VRZA 1KSWA 1W6XA 2YUOA 1M27C 1NEBA 4Z89A 2CH4W 1NEGA 4KRTA 4CC4B 4RUGA 1H92A 2K2MA 4J9CA 2X3XD 2DRKA 4LN2A 1ZX6A 2K3BA 2DBMA 2GQIA 5IHKA 1T3LA 4HVUA 2DVJA 2KROA 1X2KA 1B3QA 2EBPA 1JQQA 1A0NB 2BZYA 1BB9A 2DBKA 1CKBA 2EYZA 2FO0A 1YCSB 1SEMA 1K9AA 2DJQA 5GJVB 4OMMA 1Z9ZA 2FPEA 1T0HA 1TG0A 1ZLMA 3I9QA 3TSZA 1ZUYA 1WXUA 2L0AA 2EYWA 1AVZC 4RTVA 2JXBA 2PTKA 1M3BA 4ZNXA 1PWTA 2DL5A 2G6FX 2HBWA 3M0TA 2ESWA 2FPDA 2J06A 1HD3A 2CSQA 2JTEA 2V1RA 3R6NA 1HJDA 1AD5A 1UDLA 1G2BA 3VS1A 3EG1A 2DLPA 4OMNA 1WLPB 1X6GA 2DYBA 1ZUKA 4RTTA 2HSPA 4HVVA 4F17A 1PRLC 3EGUA 1K4US 4J9DA 2FRYA 1CSKA 2DL8A 2KEAA 3PVLA 2O31A 2LJ0A 1QWEA 3LH5A 2RPNA 1H8KA 2H8HA 4HXJA 2LMJA 1X27A 3H0FA 2L3PA 5ECAA 3M0QA 2ENMA 2QDLA 4K11A 2KGTA 2C0IA 2X3WD 2YUPA 5I11A 1BBZA 2KYMA 1K1ZA 1V1CA 1K0SA 3VS2A 1K76A 3JV3A 3M0PA 2PNIA 2HEQA 1S1NA 4CC2A 2CT4A 1NLOC 2GTOA 2D1XA 2JMAA 2RQTA 2VVKA 2I0NA 1U3OA 2AZSA 3M0SA 4X1VA 4CC3A 1AWJA 2J7IA 3A98A 2RF0A 1X69A 2BTTA 2YSQA 5FWCA 1PHTA 2VWFA 4OMPA 1JEGA 2V1QA 1U5SA 2CT3A 2K9GA 1JO8A 2SEMA 3UA7A 1M3CA 1NG2A 3TSWA 1E6HA 4JJCA 1VA7A 5FWBA 2W0ZA 1UHCA 2RMOA 1M8MA 2EYXA 2EW3A 2LX7A 2AKLA 2CDTA 2CSIA 4F14A 4OMQA 4LE9A 1K0XA 1OPLA 5I22A 2LJ3A 2O9SA 1Z9QA 2DL3A 2AK5A 1T0JA 2FG0A 2KRNA 4RTWA 5IHIA 1HSQA 3EHRA 2KR3A 4Y92A 3NGPA 3NMZC 1E6GA
chains in the Genus database with same CATH superfamily
3P8HA 4JRPA 1KQSP 1AEYA 4PLIA 5KCHA 3OYHA 1TUDA 4R56A 3UT1A 5L8RE 2JW4A 2RQRA 3HP9A 1XJWB 2PVGB 3JCMb 1SPKA 1M1GA 2JZ2A 1M5Q1 3I55A 1PSEA 4HCKA 3LGFA 2MPXC 3NFCA 3G71Q 1YJWT 3L42A 2KDSA 5GAMf 5GJWB 1N6AA 2DXTA 2DXUA 3C0CA 1VQ9T 3HRUA 1M2VA 2DZCA 4C92F 3M59A 1MMAA 2RM4A 2NUZA 4D6WA 5CKHA 1RADB 4C92E 3V7RA 2JTFA 1TXQA 2ATCB 4JLGA 1OX8A 5LJ5j 1KQSA 3VUZA 1BKBA 1FYNA 2H3EB 2JS0A 4AFSC 2LQKA 1QP2A 1KQSS 2KXDA 3J7AF 2EPDA 5KE3A 2JVVA 3M57A 4FSSA 1N8RU 8ATCB 4II1A 1X75C 4J9IA 2JM8A 2FZGB 4C5IA 1S72T 3RBBB 3M0UA 1GCPA 1VQMQ 4OGEA 4WCIA 1VQ7Q 2FRWA 1K8AU 1BU1A 2BUDA 1QCFA 2NWMA 4LUEA 1UE9A 4BUGA 2E5KA 4Y91A 4PJMA 4VUBA 2MIOA 4F7UA 1UUEA 3UWNA 1MNEA 3QXEB 4D8KA 2GNCA 3GNGA 4EPCA 2KYBA 3HRTA 2EGAA 2YXYA 3G6EQ 3V7SA 3JB9G 3CPWP 3HTRA 3TVTA 1K9MU 1GCQA 2HQXA 1UB4A 1UTIA 3CQTA 1Q82U 2ZPEB 2LJ1A 4M77C 4M7AF 1JB0E 5FW9A 1GFCA 4M7AE 4ZTJA 1EFNA 4J9HA 1IGQA 4KULA 4KUDK 3RMQA 3MPUB 1VQ8Q 2EJFA 2CZ7B 9ATCB 5HK0A 3N5BB 4JRQA 4DQ2A 4JS4A 5GANj 1BCMA 3RKYA 1ZUUA 2EQMA 4DEXA 3HL8A 1WHLA 2K79A 2EGCA 2Y4YA 1KHIA 4J5YA 2DL7A 2QG9B 1IXDA 4RMOA 3EHQA 3RUXA 3ZFJA 5CKEA 3CPWA 5KYUB 3VKIA 2DL4A 2JOYA 4FIBA 2K6DA 1I1JA 4N0AC 2KRMA 1FMKA 4IUQA 3PVQA 5AYFA 3SD4A 5A0LA 3CPWS 4EMHA 1VYTA 4F7UG 1UHFA 4C8QB 8AT1B 2EIFA 1G3SA 3FC3A 4J9EA 3EG3A 1I4K1 1PKSA 4ZN3A 4DBQA 2V26A 3QZ9B 4L59A 4BY6B 2P0QA 2PUOB 5DLQE 4FW1A 1V29B 1YIJA 1OEBA 3EFOA 4EIKA 4C5GA 5IH2A 4A4FA 3CCJT 2RQUA 2YRVA 2FEIA 4QW2A 1C0MA 2DRMA 2WSCE 1EX4A 1UECA 1ZSZA 2GQVA 1I0CA 3GIBA 4M78B 1EZZB 2JM9A 4OF1A 1QWFA 1GL5A 4HA8A 3M53A 1YI2A 1YHQA 2KK4A 5GAMe 3E9FA 4HCCA 3A8MB 4ELYC 3CCVA 4OMOA 2VKNA 5LJ5h 1B07A 3AHUA 1HYOA 3CCLQ 1T3SA 1Y07A 4RCBA 3SHWA 1G83A 2LCLA 1G3YA 1N8RR 1AOJA 3CCMA 5IHNA 2RQVA 1GBRA 4MZPA 2GGRA 4JRIA 5KYXA 5KE2A 2J05A 1QLYA 1TWBA 2LZ6B 5HY6A 3LW5E 4MZTA 1PC0A 2EQUA 2RHZA 2M51A 1WHHA 3IQLA 1YJNA 3A8OB 1UGPB 1N9RA 1JXOA 4ORZA 1K8AR 2DX1A 3I56T 4LUDA 4M78F 1JXMA 3GP8A 1HXDA 2AIRB 4IUVA 3URGA 2WACA 1HK9A 3AT1B 2OTLQ 5C6SA 1VQOT 4XU1A 4A4EA 1Q81U 3KFVA 1OI1A 2RO0A 3S3NA 1UEBA 4M7AD 1K9MR 2PZ1A 1O75A 2JMCA 2W10A 3VS0A 1Q82R 1Q7YC 1W6XA 3CXCS 5IAYA 4C0ZA 2CH4W 4KRTA 2X3XD 3OS2A 2ZPBB 4E2FB 4A4HA 3JCMe 3X20B 1B34B 2E3HA 3NTHA 2MI6A 1BI1A 4WF2A 1MHNA 4QVZA 5KCOA 1NPPA 3TQ7P 4PFOA 1BB9A 2DBKA 1CKBA 2EYZA 2DTHA 1WQ7A 3G71A 2FO0A 2QA4A 1YJ9T 1VQNT 3JCMc 2DJQA 4OMMA 5GANh 1D0XA 2CKKA 1BCOA 1ZUYA 3M54A 4LDXA 1AVZC 2EKOA 2PTKA 5GAMd 3ME9A 2HBWA 2VASA 2H3JA 3M0TA 5GAOm 1HD3A 1RAAB 3R6OA 1G2BA 1VQKA 2X4XA 4X9CA 4C92A 4XU3A 2HSPA 4J9DA 2JN0A 3CC4T 3OYGA 2QEXT 3G1JA 3M58A 3M56A 4E7SA 4EDUA 5LJ3f 2H8HA 2CP2A 2LMJA 2QQ9A 3L2VA 5ECAA 2DD4A 3M0QA 2QDLA 3E2UA 2KGTA 5FU6C 1Q86C 2C0IA 1VQMA 1YBYA 1BBZA 1K1ZA 1VQ7A 5C0MA 3M0PA 4KBMB 3CCSA 3OYLA 3RDVA 2JMAA 2RQTA 1U3OA 2RI2A 2J7IA 4ZGJB 2RF0A 4M7AC 3X24B 2E12A 2R5MA 4OMPA 1JEGA 3VYGA 4PNOA 4OB1B 2SEMA 1RAFB 3UA7A 4BB7A 4JS5A 3TSWA 1E6HA 2O4XB 3JCMd 2FYKA 3MCAB 2QK0A 3SDZA 2HL3A 1M8MA 4M77F 2EW3A 2LX7A 4E7KA 4KGVB 2AKLA 4F14A 3RKWA 4M77E 3CCET 1C6VX 1Z9QA 2O9SA 2AK5A 2HAXA 1IHVA 4C92G 3CMET 3PTAA 3NMZC 4FT4A 3A8GB 3UF4A 5AT1B 1SHFA 3QWXX 4B9WA 1FMWA 1OQKA 2X4JA 4FYVB 1WHGA 4PJOD 2XG8D 2DAQA 1OU8A 1IREB 3LGLA 3VRYA 1PM3A 3BFMA 1UJ0A 2A3LA 1LJOA 2CUDA 2EQKA 3QZ5B 1Q81R 5GAN4 5D7UA 4HVWA 4CC7A 3GBQA 2LVMA 1PRMC 3CMAQ 1QVFP 3JCMW 2VUBA 4L5GA 2F2VA 3ULRB 1IO6A 1NJIU 4J9FA 1YIJQ 1RI9A 2DXBA 4NL3A 3MHXA 3C95A 2B8AA 2XDPA 4J9BA 3G7ZA 4RTUA 2RHXA 1BIAA 3FJPA 4OMLA 4DOVA 3EG0A 3QKJA 5GMKm 2DF6A 2MOXA 1S72Q 2RA2A 1SSHA 2OTJA 5HCKA 1YNZA 1Y96A 1RAGB 2CGHA 4M7DE 1YI2Q 2GTJA 5L23A 5M9OA 2R57A 3MEVA 5CVIA 3CCVQ 2M0YA 1XTDA 3V8JA 1OZ2A 2KRSA 1WYXA 3GOXA 3SWNC 1JRIA 1ACMB 3LWIA 1QVFA 5FRMA 5KYUA 2K5LA 3CCMQ 1KC8U 3QPHA 1H3HA 3BDLA 2ED0A 5FROA 1BI2A 1WA7A 2A0FB 1QVFS 3CD6A 2F2WA 4QVCA 4P5NA 4A54A 2A28A 3CC2Q 1SRLA 1CKAA 1TUCA 4C8QA 5GAN5 2HMAA 1YJNQ 2K3XA 1D1CA 3E1SA 2LP5A 1X43A 4IIMA 5GAMg 3UA6A 2HDAA 2EYQA 4PJOC 5LJ3e 1NM7A 1KJWA 2NUTB 4C92B 1ARKA 4NS5A 2RHUA 5D6WA 2WSEE 1SHGA 2YT6A 2L3SA 4FSXA 1WDXA 4OVAA 3L2WA 4M75F 1M2OA 2RI3A 3VS6A 4M75E 2FHDA 1Q81C 2XD0A 3CC7T 3EG2A 4M78A 1VYUA 3CCRT 2VXEA 4M77D 2OAUA 1VQ4A 1TSFA 4EMKA 3PFSA 1YP5A 2GBQA 3LX7A 3MP6A 1C1AA 2J6OA 3VYHB 2VXFA 1K73C 2ZCFB 2F5KA 2K57A 3DLMA 4J6WA 2KMTA 2QA4Q 4GY5A 2COZA 3VS5A 3A8HB 2DIGA 5DLOA 1VQLA 5GAOp 1W2BP 2YDLA 1Y0MA 2K5FA 2ED1A 5CQYA 2K5IA 2LTOA 5FU6B 1ZQ1A 4C8QG 1WFWA 1PKTA 3BE3A 4XTYA 3QDFA 4RG2A 1MMDA 2QAZA 4YTLA 3L2RA 3JCMg 1OOTA 1OPKA 2DKGA 1VQKQ 3I5RA 3X28B 3WVEB 1WJQA 4LXCA 4M7AB 4A4GA 1YITA 2C0TA 1AZEA 4GBQA 4JJBA 1KIKA 3G4SQ 1WIEA 2JNGA 1NJIR 1GBQA 1AT1B 2RH2A 1Q86U 1M90C 1U8RA 4M78G 4D8DA 4E7LA 2A37A 1W2BA 4M7DD 2EJGA 1OV3A 5LJ3d 2PVOB 3OYJA 1B34A 1UG1A 2EFIA 2CP3A 2GCXA 2E10A 2E41A 1W2BS 1D09B 3CCSQ 5IXBA 3KUFA 1GCQC 3OYCA 2OJ2A 4GLMA 3CCQT 3META 4BE0A 1FWZA 2X4WA 2CREA 2HZYA 3JCMf 2HQHA 5GMKl 3KXTA 1NYFA 2J6KA 4IIOA 1AZGB 1E7OA 4DBRA 2DVEA 1KFZA 3MO8A 1X01A 3SB2A 3DB4A 4F04B 2DTIA 5GAN3 3UPUA 3VJPA 4AFUC 3JCMX 1Y96B 5DY9A 1ABOA 4WTOB 4AFQC 5CQXA 2E70A 2KE9A 2SRCA 2LCCA 3VS3A 1GFDA 2M16A 3SEMA 5I2SA 2CP7A 1LCKA 3S3OA 3QWYA 4LDUA 1Y71A 3O5ZA 3VRZA 1N27A 4DBHA 1WJRA 1M27C 1NEBA 1YJWA 1LVKA 2VC8A 2X35A 2KQWA 1M1KC 4RUGA 1H92A 4J9CA 2D0QB 2DRKA 4M75D 1PG5B 2K3BA 2GQIA 1VQ9A 3J81E 5DM7R 1VQ5T 3LWHA 4HVUA 4X9DA 3TEEA 1VQ6T 2KROA 1Q7YR 3OSSC 1B3QA 5GAOr 2EBPA 4E47A 2K3YA 2BZYA 2CP0A 2L8DA 1SEMA 4O6JA 4HT9A 2FPEA 1RAHB 1R0CB 3TSZA 1WNLA 1MNDA 4PJNA 2LC4A 3CMAA 1WXUA 5HK3A 3X26B 4RTVA 2JXBA 2I2LA 4ZNXA 3EGXB 1PWTA 2G6FX 1NJIC 2ESWA 5GMKh 2J06A 1OZ3A 4M7DC 2JTEA 3R6NA 2O4XA 4N0AA 5CIUA 3MP8A 1EIFA 1I5LA 1AD5A 1OU9A 3FEOA 2OTJQ 3OSVA 2DERA 2DD5A 2D6FA 2DLPA 4OMNA 2XICA 1WGSA 3EAEA 1X6GA 5CKBA 2VGNA 1S72A 1QP3A 1H3ZA 2C06A 4N4HA 2DETA 4F17A 3EGUA 2LX9A 1K4US 3VU3C 3PIOA 2CP6A 2DL8A 3PVLA 4EMKB 2XDDA 1M4ZA 4QQ6A 1G8XA 2LT4A 2ZPHB 4FYYB 3RERA 2RJEA 2L3PA 3CXCP 1ZBXA 2F5TX 2X3WD 2EWNA 1XQHA 5I11A 1K0SA 4XU0A 3JV3A 3OQ5A 3CD6Q 1M1FA 2PNIA 2E6NA 1BI0A 5GMKi 4NOYA 4C0FA 1KC8C 1ZA1B 2F69A 4ZGDB 3CC2A 5CKDA 5EG2A 2D1XA 2I0NA 1Q86R 5FU7C 2K2VA 2BTTA 5FWCA 3JSCA 4ZTFA 1FMVA 1KHCA 2VWFA 2XKOC 3MJXA 1JO8A 1NG2A 5CR2A 4ANJA 4M75C 1VA7A 3CEYA 2RMOA 4MMKA 2CDTA 2Y90A 4PJOF 1SF9A 4LE9A 4JRKA 3CXCA 1ZA2B 1K0XA 1D3BB 5I22A 2LJ3A 3LYIA 4PJOE 3ER0A 2DL3A 1LPLA 3G6ET 4BE1A 2FG0A 1VQ4Q 3O8VA 3NTIA 2RJDA 2XK0A 3NGPA 3M9QA 3FDRA 1E6GA 1YCYA 1K73U 4QVDA 3CCUT 4GLKA 3QDRB 2FL7A 4B9XA 1VQPQ 2L2PA 2QASA 5LJ3g 3OB9A 1WI7A 1SSFA 3JB9F 1PD1A 5J26A 1IZ6A 2EYYA 1VQ8T 1VQLQ 3DKMA 4RG8A 2DMOA 2CUBA 2M1HA 2C0OA 4BI4A 2LRQA 3CCJA 2EKHA 5GAMj 1MGQA 3C94A 3UDCA 1PCXA 2XHCA 3ASKA 1JJ2P 4QT7A 2ECZA 3QYGB 1D0YA 2RHIA 1M30A 2QTXA 3DLLA 2VV5A 2BZXA 1ZSGA 2Z0WA 2QI2A 2HBPA 5LJ5f 2DFUA 2NUTA 3TREA 1YITQ 3OMGA 2G3RA 1U1TA 2HNIA 4IUUA 2DJZA 2MF2A 1KG1A 1QVGS 2B86A 3LLRA 2IIMA 2A08A 1M90U 3F70A 4M77B 4PFZA 3MEWA 2YRDA 3G4SA 2A7YA 3L2UA 3THKA 2EQJA 4Q5WA 3FIFA 4KH0B 3EFRA 2KY9A 3OYYA 3EGDA 4AG2C 1QCNA 3OY9A 5GAN7 4J7FA 3MEAA 1Y57A 4DBFA 4F7UF 1QKXA 4XTXA 4HCZA 3JCMV 5GAN6 1JJ2A 3PE0A 2YHTA 4F7UE 4Z88A 4OGCA 3T9NA 2JS2A 1UJYA 2MCNA 2E3IA 2QGFB 1WX6A 1FX7A 1JJ2S 3NTKA 1KD1U 4OB2B 1D1BA 1PD0A 2DA9A 2EGEA 3I35A 2ABLA 1WPYA 4KUIA 1UGSB 3H0IA 2PU9B 3D7SB 3L2QA 5EC7A 1VQOA 2LQNA 3OYMA 5D6XA 3S6WA 3OS0A 3CCLT 2ZZDA 3CC7Q 1PNJA 2L3QA 2P0PA 3CPFA 1V76A 3A5ZB 2X4YA 2CS7A 4M7AA 4ZGEB 1WHMA 4ELZC 5GANf 1M1KU 2DIQA 1YJWQ 2P4RA 4M7DB 2NYSA 1SKUB 2CZ6B 2KT1A 1VQNA 3C12A 2O9VA 4C5EA 5GAOn 4BACA 1VQ9Q 2M9UA 5A0DA 2PQWA 3NPFA 3BY7A 3H41A 2IG0A 5A0GA 3RKXA 2OTLT 3CBOA 3JB9I 1SRMA 2CH4A 3PMIA 2XI9A 4E7ZA 3OYKA 2DILA 3P8BB 4ESRA 2XDBA 1YWOA 1K73R 1QKWA 1JBMA 4FCYA 2PUKB 2F2XA 2FB7A 4R0KA 3JB9D 1KQ2A 3HPWA 3TU4K 4RTXA 2BZ8A 3I55T 2QEXA 4IURA 4AG1C 4Y28E 1VYVA 3M4YA 4M7DF 2DTOA 2Y4XA 2D9TA 3P8DA 1RUWA 1I81A 2OI3A 3RNJA 4LD6A 3VS7A 1WHKA 3VS4A 4M7AG 5GAMh 3BW1A 2QXFA 4M75B 2QQBA 4JZ3A 3L1AA 2RD1A 6AT1B 3OA6A 2J6FA 4HKEA 5GAOl 4C8QC 4OB3B 1W1FA 4PFPA 2QQAA 4NL2A 1M90R 5CAIA 1JU5C 4KT0E 5CCAA 1W70A 2X9HA 4X34A 4BY6C 5LJ5e 3QG1A 3H9NA 3RMSA 1AWWA 1UGVA 4TVRA 1VIFA 1IB8A 2NUPB 1TOVA 3CCEA 1H641 3SWNA 2HKQB 3OYFA 1NYGA 4JUVA 2JUFA 4QKUA 3EGXA 4XTWA 3RR6A 3OS5A 3CMEA 3H6ZA 1D0ZA 4RTYA 3OYBA 3H8ZA 3UATA 5A2QE 5J3BA 1QVPA 1R8OB 1ZBJA 1Y7XA 3L2ZA 3RIRA 3EG9B 4LDWA 4BE2A 3GPLA 3EGDB 3JAME 1QMCA 1M9SA 1UGQB 3JCMh 4J6XA 4N4IA 3JCMJ 5GMKj 1FXXA 1VOMA 1NEGA 3JCMP 4CC4B 1VQPA 2DYIA 4ZN1A 5IHKA 1G3TA 4MMLA 1JQQA 2P0KA 3CCJQ 2RHYA 1M1KR 1DJ7B 1YCSB 1K9AA 1WHJA 1Z9ZA 3GNFB 1ZLMA 3GLXA 4PKCC 2RK1A 2L0AA 1MMGA 2EYWA 2CYZB 1M3BA 4JJNK 2RB6A 5IN1A 2DL5A 2IVWA 2O01E 5GANe 3X25B 3OYNA 5GAOq 5I21A 3QYHB 2CSQA 2V1RA 1TUGB 1RL2A 5J39A 3MP1A 2EAYA 2R5AA 1UDLA 3V8LA 2QQRA 4R55A 4L6V5 3VS1A 3OYEA 3ZEHA 1BYMA 2DZ9A 4B6MA 1D3BA 5LJ5d 2E6ZA 2GFAA 3CMAT 1KQ1A 2FRYA 7AT1B 1QCOA 1QWEA 3LH5A 2RPNA 4FYXB 1YIJT 5LJ3j 3H0FA 4KH1B 3MEUA 1ZHIA 4BD3A 3JB9H 3JRZA 4PJOG 3HSBA 2P4TA 5CK9A 2ENMA 1RAEB 1NE8A 2KYMA 4OMFB 4PK4A 1V1CA 3QBYA 3OYAA 1K76A 3EH1A 3HHTB 2K4YA 3I56Q 2HEQA 4E7IA 1M8VA 2DO3A 2RI5A 5LL6S 4CC2A 1YI2T 1NLOC 1YHQT 4CC3A 2COWA 3M0SA 1KD1C 3A98A 3CCVT 5KYYB 1X69A 2YSQA 2VB6A 1VQOQ 3OS1A 1PHTA 2V1QA 5D6YA 1KC8R 1U5SA 2CT3A 2P84A 3CC7A 4A53A 4JJCA 3A1PA 3CCRA 3HRSA 1IGUA 2W0ZA 1UHCA 4J8OA 3CCMT 3CCUQ 2EYXA 5GAN2 3WVDB 4OMQA 3SFMA 2X51A 4O5VA 3CC2T 1OPLA 2R58A 1T0JA 1U1SA 2LDMA 4M77A 4RKUE 4E7JA 2KRNA 4RTWA 2MMPA 3A8LB 5IHIA 2KR3A 1YJ9Q 1YJNT 3OBWA 1VQNQ 4AMCA 1TH7A 4IUTA 1NPRA 2ZAEA 4FT2A 4Z02A 4LDYA 1R77A 5GANd 5IT9E 4RCCA 3LH0A 4Z8AA 3FB9A 2M0OA 2RK2A 2QDYB 2COYA 4FL6A 1VUBA 1U06A 2KAFA 2RN8A 4OB0B 4DOWA 3OYDA 5IXFA 4J9GA 3RESA 2JJ9A 3QHSA 2EQIA 2QGGA 1RLPC 1RACB 2KXCA 3U23A 1SG5A 3QJYA 2FVUA 3SWNB 3J80E 2LT1A 2PVDB 1QW1A 3CC4Q 1ZSZC 2QEXQ 2VGMA 2QYZA 1QQJA 3PMTA 3E9GA 4E7HA 5KYWB 2RNAA 4OP0A 4LDVA 4A63B 2OAWA 3OBYA 4A4KA 5HKCA 3G71T 4KGZB 2QA4T 1W4SA 4CRIA 2DEQA 3Q1JA 3EH2A 1I5OB 2LNVA 4PJOB 2JT4A 2E1HA 1PSFA 3NHNA 4M77G 4C92D 3CCQA 1P92A 4C0DC 4EMGA 1XNIA 4M7DA 1WQWA 2KT8A 3EFSA 3MKDA 4XQ3A 1MV0B 2XIDA 2AKKA 1VQKT 3PNWC 1G5VA 5KH6A 2ZPGB 4MDWA 1I8FA 2K7AA 2BKDN 2QQSA 2BIVA 4JPBW 4C8QF 4MDXA 4DA4A 4XTZA 3G4ST 5FRNA 4XAXB 4DEYA 2AT1B 4C8QE 2A36A 2GFUA 1OX9A 3CCEQ 1MV3A 1AWOA 5LJ3h 1VQMT 2MWOA 1M2VB 2D8JA 3CMEQ 3BDUA 1VQ7T 2D8HA 2ROLA 2V8KA 3C4SA 2GF7A 1IHWA 3FJ5A 3OMCA 2DE0X 4FU6A 2OX7A 2ZPIB 4FYWB 3CCST 4CI0C 2FZCB 1YN8A 1TS9A 3QUIA 4IKFA 2ZGWA 4LNPA 2LQWA 1VQ5A 5LJ5g 1QVGP 2E64A 3ZL7C 1VQ6A 4M78E 2AHJB 3CBPA 2D0NA 4C0GA 3V7CA 4C5HA 1ABQA 4M75A 2CZ0B 2RJCA 1WXBA 2MK5A 4M7DG 1GRIA 1RI0A 2HL5C 1NZ9A 4ATOA 1LOJA 4JDSA 3INZA 4N4GA 3WXMB 4QQGA 4UC4A 1M3AA 2WSFE 3M4GA 1YWPA 4M4ZA 3I55Q 3OW2P 1UFFA 4JZ4A 4AT1B 4F7UB 2L5QA 3M5AA 2HSEB 1AHJB 1NLPC 1AWXA 4PL6A 3REBB 2DM1A 2HCKA 2YRCA 2NUPA 4C92C 2KNBB 3CBMA 4JJDA 4F16A 3GF5A 2YLBA 1WJSA 2DEUA 1QVGA 3V8KA 4RTZA 1MUZA 2ROTA 3JCMQ 2F1LA 2KSSA 1F1BB 1RAIB 2NLUA 3REAB 3PIPA 3EG9A 2KVQG 2FPFA 2DK3A 1BI3A 2RQWA 2CZ1B 2MAMA 3OW2A 3OYIA 2XMFA 2VYTA 2YUNA 1WZOA 2V8IA 2CP5A 1N8RC 4M75G 1BK2A 3QO3A 2ZPFB 4HT8A 5GANg 2O88A 3I5SA 5FLXE 3OW2S 3FLGA 2FZKB 1RABB 4FM4B 1MMNA 2DNUA 2OTJT 3M0RA 4E6RA 2L89A 2MYSA 2BE7D 3I56A 1RLQC 3VV0A 1GXIE 1G3WA 5GAN8 1X6BA 2YLCA 1I07A 1K8AC 1IRXA 3HKSA 4JLIA 1WXTA 2HQEA 1OULA 2DXCA 3HFOA 5I2MA 3G6EA 4C8QD 3CCRQ 1BIBA 1XOVA 2O2OA 2EVRA 1K9MC 3CD6T 3EFOB 2E65A 3CCUA 1N5ZA 1Q82C 2AZVA 4AFZC 1R0BG 3DB3A 1X2QA 3H0HA 2LCSA 1ZSZB 1J3TA 2XU8A 2KBTA 1YJ9A 1VQ8A 2YUQA 1KSWA 2QTVA 1KK7A 4J7IA 3S3MA 2YUOA 4Z89A 4BDYA 4M78D 4BDZA 3QSUA 2M02A 2K2MA 4LN2A 1ZX6A 2DBMA 4HCBA 1T3LA 2KI7A 2DVJA 5CO7A 4XU2A 1X2KA 4FW2A 1A0NB 2V8JA 2JTMA 4C0DB 2LQ8A 1VQ4T 4IUPA 5GJVB 1TG0A 1T0HA 2HD0A 4V2SA 5KYXB 3I9QA 2L3RA 5KYYA 2BE9B 3CC4A 4ME7A 2MWPA 1VQPT 4J6YA 3E19A 2FPDA 3PGGA 2EJ9A 1HJDA 1TU0B 5FU7B 1VQLT 3EG1A 5GMKe 1WLPB 4KGXB 2DYBA 1ZUKA 4RTTA 4HVVA 2DPPB 1PRLC 2RJFA 3CCQQ 4BI8B 3FRNA 1CSKA 1UGRB 1LNXA 2KEAA 1N9SA 3PT9A 2HKNA 2LJ0A 2O31A 1H8KA 2E5QA 4HXJA 4LD9K 3HFNA 1YHQQ 1X27A 4PJJA 4K11A 3KBGA 1YITT 2YUPA 1D1AA 4XTUA 1NBEB 4PJLA 3VUBA 3VS2A 4BI3A 3CCLA 1X6OA 4QQDA 1S1NA 1TTHB 3M55A 2CT4A 2GTOA 4PLLA 2VVKA 4XK8E 2AZSA 4X1VA 1AWJA 1B7TA 4XTVA 1YFNA 2E4HA 5KYNA 3ZBDA 1OYXA 3QIIA 2IPOB 4MZMA 2K9GA 4M78C 1M3CA 1Q95G 2YWWA 3JB9J 5KYWA 5FWBA 1KD1R 4EMKC 2CSIA 1VQ5Q 3QJ6A 5CKFA 1VQ6Q 1O9SA 4J83A 3TCJA 4PJOA 1HSQA 3EHRA 1Q7YU 2OTLA 1VIEA 4Y92A 2LNHB
chains in the Genus database with same CATH topology
3UF4A 1SHFA 3QWXX 1AEYA 1TUDA 2JW4A 2RQRA 4Z8AA 2L2PA 3VRYA 1U06A 2RN8A 1WI7A 1SPKA 5IXFA 4J9GA 1UJ0A 2CUDA 2EQIA 2EYYA 1RLPC 4HCKA 2DMOA 2CUBA 2C0OA 4HVWA 2KXCA 3U23A 2EKHA 3GBQA 4CC7A 1PRMC 5GJWB 3C0CA 2F2VA 3ULRB 1IO6A 4QT7A 2ECZA 4J9FA 1RI9A 2NUZA 1M30A 2RNAA 4A63B 2OAWA 2BZXA 1ZSGA 4J9BA 4RTUA 4OMLA 3EG0A 1FYNA 2JS0A 4AFSC 2DF6A 2MOXA 2B86A 1SSHA 2IIMA 2A08A 5HCKA 2KXDA 1YNZA 2EPDA 4FSSA 2JT4A 3THKA 2GTJA 3NHNA 5L23A 2KT8A 2M0YA 4AG2C 1MV0B 2AKKA 4J9IA 2KRSA 2JM8A 1Y57A 3RBBB 1WYXA 3M0UA 1GCPA 1QKXA 4WCIA 2K7AA 2FRWA 3PE0A 1BU1A 1QCFA 4JPBW 4Z88A 2NWMA 1H3HA 4LUEA 2ED0A 1WA7A 1UE9A 2E5KA 2JS2A 2MIOA 1UJYA 2MCNA 1UUEA 1WX6A 2F2WA 4DEYA 2A28A 4D8KA 2A36A 1SRLA 2DA9A 2EGEA 1CKAA 1TUCA 3I35A 2GNCA 2ABLA 1MV3A 2KYBA 2EGAA 1AWOA 3H0IA 2D8JA 3TVTA 1GCQA 5EC7A 1UTIA 2LQNA 3CQTA 2D8HA 2LP5A 1X43A 2LJ1A 2ROLA 4IIMA 3FJ5A 3UA6A 2DE0X 2HDAA 1PNJA 2L3QA 1NM7A 5FW9A 1KJWA 1GFCA 1ARKA 1YN8A 1EFNA 4J9HA 1SHGA 2YT6A 2L3SA 1WDXA 4LNPA 2LQWA 3ZL7C 3VS6A 2D0NA 2P4RA 3EG2A 1VYUA 1ZUUA 2KT1A 1ABQA 4DEXA 1WXBA 2K79A 2EGCA 1GRIA 2O9VA 1YP5A 2GBQA 2DL7A 2J6OA 3EHQA 3NPFA 3H41A 2DL4A 1M3AA 2K6DA 1YWPA 4M4ZA 1UFFA 1I1JA 4JZ4A 2KRMA 3VS5A 1FMKA 1SRMA 3PVQA 2CH4A 1VYTA 2DILA 1UHFA 1NLPC 1AWXA 1Y0MA 1YWOA 2YDLA 4ESRA 2ED1A 1QKWA 3REBB 2DM1A 2HCKA 2KNBB 4J9EA 3EG3A 1WFWA 2F2XA 1PKTA 4JJDA 4R0KA 4F16A 1PKSA 4RTXA 2BZ8A 4RTZA 4AG1C 1MUZA 1OOTA 1VYVA 1OEBA 1OPKA 2ROTA 3I5RA 4EIKA 5IH2A 2RQUA 1RUWA 2OI3A 3RNJA 2FEIA 2C0TA 3REAB 1AZEA 4GBQA 4JJBA 2DRMA 3VS7A 1UECA 3VS4A 1KIKA 2FPFA 2RQWA 1WIEA 1I0CA 2JM9A 2LNHB 1GBQA 1QWFA 1GL5A 2XMFA 2YUNA 4D8DA 4JZ3A 1BK2A 2A37A 2O88A 3I5SA 4OMOA 1OV3A 2VKNA 2J6FA 2DNUA 1B07A 3M0RA 1UG1A 1T3SA 4E6RA 1W1FA 3SHWA 5IXBA 1G83A 1GCQC 1JU5C 1RLQC 2OJ2A 4GLMA 1W70A 1X6BA 1AOJA 2CREA 5IHNA 1AWWA 2RQVA 1I07A 1UGVA 1GBRA 2GGRA 2J05A 1WXTA 1QLYA 1NYFA 2LZ6B 1NYGA 2J6KA 4IIOA 1AZGB 1E7OA 1KFZA 2M51A 1XOVA 3IQLA 2O2OA 4RTYA 1JXOA 2EVRA 4ORZA 3UATA 2DX1A 4LUDA 1N5ZA 1JXMA 2AZVA 1ZBJA 4AFUC 4AFZC 1ABOA 4AFQC 2LCSA 1X2QA 3H0HA 2KE9A 2SRCA 3VS3A 1GFDA 3KFVA 3SEMA 1J3TA 1LCKA 2KBTA 2PZ1A 2JMCA 3QWYA 2W10A 2YUQA 3O5ZA 3VS0A 3VRZA 1KSWA 1W6XA 2YUOA 1M27C 1NEBA 4Z89A 2CH4W 1NEGA 4KRTA 4CC4B 4RUGA 1H92A 2K2MA 4J9CA 2X3XD 2DRKA 4LN2A 1ZX6A 2K3BA 2DBMA 2GQIA 5IHKA 1T3LA 4HVUA 2DVJA 2KROA 1X2KA 1B3QA 2EBPA 1JQQA 1A0NB 2BZYA 1BB9A 2DBKA 1CKBA 2EYZA 2FO0A 1YCSB 1SEMA 1K9AA 2DJQA 5GJVB 4OMMA 1Z9ZA 2FPEA 1T0HA 1TG0A 1ZLMA 3I9QA 3TSZA 1ZUYA 1WXUA 2L0AA 2EYWA 1AVZC 4RTVA 2JXBA 2PTKA 1M3BA 4ZNXA 1PWTA 2DL5A 2G6FX 2HBWA 3M0TA 2ESWA 2FPDA 2J06A 1HD3A 2CSQA 2JTEA 2V1RA 3R6NA 1HJDA 1AD5A 1UDLA 1G2BA 3VS1A 3EG1A 2DLPA 4OMNA 1WLPB 1X6GA 2DYBA 1ZUKA 4RTTA 2HSPA 4HVVA 4F17A 1PRLC 3EGUA 1K4US 4J9DA 2FRYA 1CSKA 2DL8A 2KEAA 3PVLA 2O31A 2LJ0A 1QWEA 3LH5A 2RPNA 1H8KA 2H8HA 4HXJA 2LMJA 1X27A 3H0FA 2L3PA 5ECAA 3M0QA 2ENMA 2QDLA 4K11A 2KGTA 2C0IA 2X3WD 2YUPA 5I11A 1BBZA 2KYMA 1K1ZA 1V1CA 1K0SA 3VS2A 1K76A 3JV3A 3M0PA 2PNIA 2HEQA 1S1NA 4CC2A 2CT4A 1NLOC 2GTOA 2D1XA 2JMAA 2RQTA 2VVKA 2I0NA 1U3OA 2AZSA 3M0SA 4X1VA 4CC3A 1AWJA 2J7IA 3A98A 2RF0A 1X69A 2BTTA 2YSQA 5FWCA 1PHTA 2VWFA 4OMPA 1JEGA 2V1QA 1U5SA 2CT3A 2K9GA 1JO8A 2SEMA 3UA7A 1M3CA 1NG2A 3TSWA 1E6HA 4JJCA 1VA7A 5FWBA 2W0ZA 1UHCA 2RMOA 1M8MA 2EYXA 2EW3A 2LX7A 2AKLA 2CDTA 2CSIA 4F14A 4OMQA 4LE9A 1K0XA 1OPLA 5I22A 2LJ3A 2O9SA 1Z9QA 2DL3A 2AK5A 1T0JA 2FG0A 2KRNA 4RTWA 5IHIA 1HSQA 3EHRA 2KR3A 4Y92A 3NGPA 3NMZC 1E6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UF4 A;  1SHF A;  3QWX X;  1AEY A;  1TUD A;  2JW4 A;  2RQR A;  4Z8A A;  2L2P A;  3VRY A;  1U06 A;  2RN8 A;  1WI7 A;  1SPK A;  5IXF A;  4J9G A;  1UJ0 A;  2CUD A;  2EQI A;  2EYY A;  1RLP C;  4HCK A;  2DMO A;  2CUB A;  2C0O A;  4HVW A;  2KXC A;  3U23 A;  2EKH A;  3GBQ A;  4CC7 A;  1PRM C;  5GJW B;  3C0C A;  2F2V A;  3ULR B;  1IO6 A;  4QT7 A;  2ECZ A;  4J9F A;  1RI9 A;  2NUZ A;  1M30 A;  2RNA A;  4A63 B;  2OAW A;  2BZX A;  1ZSG A;  4J9B A;  4RTU A;  4OML A;  3EG0 A;  1FYN A;  2JS0 A;  4AFS C;  2DF6 A;  2MOX A;  2B86 A;  1SSH A;  2IIM A;  2A08 A;  5HCK A;  2KXD A;  1YNZ A;  2EPD A;  4FSS A;  2JT4 A;  3THK A;  2GTJ A;  3NHN A;  5L23 A;  2KT8 A;  2M0Y A;  4AG2 C;  1MV0 B;  2AKK A;  4J9I A;  2KRS A;  2JM8 A;  1Y57 A;  3RBB B;  1WYX A;  3M0U A;  1GCP A;  1QKX A;  4WCI A;  2K7A A;  2FRW A;  3PE0 A;  1BU1 A;  1QCF A;  4JPB W;  4Z88 A;  2NWM A;  1H3H A;  4LUE A;  2ED0 A;  1WA7 A;  1UE9 A;  2E5K A;  2JS2 A;  2MIO A;  1UJY A;  2MCN A;  1UUE A;  1WX6 A;  2F2W A;  4DEY A;  2A28 A;  4D8K A;  2A36 A;  1SRL A;  2DA9 A;  2EGE A;  1CKA A;  1TUC A;  3I35 A;  2GNC A;  2ABL A;  1MV3 A;  2KYB A;  2EGA A;  1AWO A;  3H0I A;  2D8J A;  3TVT A;  1GCQ A;  5EC7 A;  1UTI A;  2LQN A;  3CQT A;  2D8H A;  2LP5 A;  1X43 A;  2LJ1 A;  2ROL A;  4IIM A;  3FJ5 A;  3UA6 A;  2DE0 X;  2HDA A;  1PNJ A;  2L3Q A;  1NM7 A;  5FW9 A;  1KJW A;  1GFC A;  1ARK A;  1YN8 A;  1EFN A;  4J9H A;  1SHG A;  2YT6 A;  2L3S A;  1WDX A;  4LNP A;  2LQW A;  3ZL7 C;  3VS6 A;  2D0N A;  2P4R A;  3EG2 A;  1VYU A;  1ZUU A;  2KT1 A;  1ABQ A;  4DEX A;  1WXB A;  2K79 A;  2EGC A;  1GRI A;  2O9V A;  1YP5 A;  2GBQ A;  2DL7 A;  2J6O A;  3EHQ A;  3NPF A;  3H41 A;  2DL4 A;  1M3A A;  2K6D A;  1YWP A;  4M4Z A;  1UFF A;  1I1J A;  4JZ4 A;  2KRM A;  3VS5 A;  1FMK A;  1SRM A;  3PVQ A;  2CH4 A;  1VYT A;  2DIL A;  1UHF A;  1NLP C;  1AWX A;  1Y0M A;  1YWO A;  2YDL A;  4ESR A;  2ED1 A;  1QKW A;  3REB B;  2DM1 A;  2HCK A;  2KNB B;  4J9E A;  3EG3 A;  1WFW A;  2F2X A;  1PKT A;  4JJD A;  4R0K A;  4F16 A;  1PKS A;  4RTX A;  2BZ8 A;  4RTZ A;  4AG1 C;  1MUZ A;  1OOT A;  1VYV A;  1OEB A;  1OPK A;  2ROT A;  3I5R A;  4EIK A;  5IH2 A;  2RQU A;  1RUW A;  2OI3 A;  3RNJ A;  2FEI A;  2C0T A;  3REA B;  1AZE A;  4GBQ A;  4JJB A;  2DRM A;  3VS7 A;  1UEC A;  3VS4 A;  1KIK A;  2FPF A;  2RQW A;  1WIE A;  1I0C A;  2JM9 A;  2LNH B;  1GBQ A;  1QWF A;  1GL5 A;  2XMF A;  2YUN A;  4D8D A;  4JZ3 A;  1BK2 A;  2A37 A;  2O88 A;  3I5S A;  4OMO A;  1OV3 A;  2VKN A;  2J6F A;  2DNU A;  1B07 A;  3M0R A;  1UG1 A;  1T3S A;  4E6R A;  1W1F A;  3SHW A;  5IXB A;  1G83 A;  1GCQ C;  1JU5 C;  1RLQ C;  2OJ2 A;  4GLM A;  1W70 A;  1X6B A;  1AOJ A;  2CRE A;  5IHN A;  1AWW A;  2RQV A;  1I07 A;  1UGV A;  1GBR A;  2GGR A;  2J05 A;  1WXT A;  1QLY A;  1NYF A;  2LZ6 B;  1NYG A;  2J6K A;  4IIO A;  1AZG B;  1E7O A;  1KFZ A;  2M51 A;  1XOV A;  3IQL A;  2O2O A;  4RTY A;  1JXO A;  2EVR A;  4ORZ A;  3UAT A;  2DX1 A;  4LUD A;  1N5Z A;  1JXM A;  2AZV A;  1ZBJ A;  4AFU C;  4AFZ C;  1ABO A;  4AFQ C;  2LCS A;  1X2Q A;  3H0H A;  2KE9 A;  2SRC A;  3VS3 A;  1GFD A;  3KFV A;  3SEM A;  1J3T A;  1LCK A;  2KBT A;  2PZ1 A;  2JMC A;  3QWY A;  2W10 A;  2YUQ A;  3O5Z A;  3VS0 A;  3VRZ A;  1KSW A;  1W6X A;  2YUO A;  1M27 C;  1NEB A;  4Z89 A;  2CH4 W;  1NEG A;  4KRT A;  4CC4 B;  4RUG A;  1H92 A;  2K2M A;  4J9C A;  2X3X D;  2DRK A;  4LN2 A;  1ZX6 A;  2K3B A;  2DBM A;  2GQI A;  5IHK A;  1T3L A;  4HVU A;  2DVJ A;  2KRO A;  1X2K A;  1B3Q A;  2EBP A;  1JQQ A;  1A0N B;  2BZY A;  1BB9 A;  2DBK A;  1CKB A;  2EYZ A;  2FO0 A;  1YCS B;  1SEM A;  1K9A A;  2DJQ A;  5GJV B;  4OMM A;  1Z9Z A;  2FPE A;  1T0H A;  1TG0 A;  1ZLM A;  3I9Q A;  3TSZ A;  1ZUY A;  1WXU A;  2L0A A;  2EYW A;  1AVZ C;  4RTV A;  2JXB A;  2PTK A;  1M3B A;  4ZNX A;  1PWT A;  2DL5 A;  2G6F X;  2HBW A;  3M0T A;  2ESW A;  2FPD A;  2J06 A;  1HD3 A;  2CSQ A;  2JTE A;  2V1R A;  3R6N A;  1HJD A;  1AD5 A;  1UDL A;  1G2B A;  3VS1 A;  3EG1 A;  2DLP A;  4OMN A;  1WLP B;  1X6G A;  2DYB A;  1ZUK A;  4RTT A;  2HSP A;  4HVV A;  4F17 A;  1PRL C;  3EGU A;  1K4U S;  4J9D A;  2FRY A;  1CSK A;  2DL8 A;  2KEA A;  3PVL A;  2O31 A;  2LJ0 A;  1QWE A;  3LH5 A;  2RPN A;  1H8K A;  2H8H A;  4HXJ A;  2LMJ A;  1X27 A;  3H0F A;  2L3P A;  5ECA A;  3M0Q A;  2ENM A;  2QDL A;  4K11 A;  2KGT A;  2C0I A;  2X3W D;  2YUP A;  5I11 A;  1BBZ A;  2KYM A;  1K1Z A;  1V1C A;  1K0S A;  3VS2 A;  1K76 A;  3JV3 A;  3M0P A;  2PNI A;  2HEQ A;  1S1N A;  4CC2 A;  2CT4 A;  1NLO C;  2GTO A;  2D1X A;  2JMA A;  2RQT A;  2VVK A;  2I0N A;  1U3O A;  2AZS A;  3M0S A;  4X1V A;  4CC3 A;  1AWJ A;  2J7I A;  3A98 A;  2RF0 A;  1X69 A;  2BTT A;  2YSQ A;  5FWC A;  1PHT A;  2VWF A;  4OMP A;  1JEG A;  2V1Q A;  1U5S A;  2CT3 A;  2K9G A;  1JO8 A;  2SEM A;  3UA7 A;  1M3C A;  1NG2 A;  3TSW A;  1E6H A;  4JJC A;  1VA7 A;  5FWB A;  2W0Z A;  1UHC A;  2RMO A;  1M8M A;  2EYX A;  2EW3 A;  2LX7 A;  2AKL A;  2CDT A;  2CSI A;  4F14 A;  4OMQ A;  4LE9 A;  1K0X A;  1OPL A;  5I22 A;  2LJ3 A;  2O9S A;  1Z9Q A;  2DL3 A;  2AK5 A;  1T0J A;  2FG0 A;  2KRN A;  4RTW A;  5IHI A;  1HSQ A;  3EHR A;  2KR3 A;  4Y92 A;  3NGP A;  3NMZ C;  1E6G A; 
#chains in the Genus database with same CATH topology
 3P8H A;  4JRP A;  1KQS P;  1AEY A;  4PLI A;  5KCH A;  3OYH A;  1TUD A;  4R56 A;  3UT1 A;  5L8R E;  2JW4 A;  2RQR A;  3HP9 A;  1XJW B;  2PVG B;  3JCM b;  1SPK A;  1M1G A;  2JZ2 A;  1M5Q 1;  3I55 A;  1PSE A;  4HCK A;  3LGF A;  2MPX C;  3NFC A;  3G71 Q;  1YJW T;  3L42 A;  2KDS A;  5GAM f;  5GJW B;  1N6A A;  2DXT A;  2DXU A;  3C0C A;  1VQ9 T;  3HRU A;  1M2V A;  2DZC A;  4C92 F;  3M59 A;  1MMA A;  2RM4 A;  2NUZ A;  4D6W A;  5CKH A;  1RAD B;  4C92 E;  3V7R A;  2JTF A;  1TXQ A;  2ATC B;  4JLG A;  1OX8 A;  5LJ5 j;  1KQS A;  3VUZ A;  1BKB A;  1FYN A;  2H3E B;  2JS0 A;  4AFS C;  2LQK A;  1QP2 A;  1KQS S;  2KXD A;  3J7A F;  2EPD A;  5KE3 A;  2JVV A;  3M57 A;  4FSS A;  1N8R U;  8ATC B;  4II1 A;  1X75 C;  4J9I A;  2JM8 A;  2FZG B;  4C5I A;  1S72 T;  3RBB B;  3M0U A;  1GCP A;  1VQM Q;  4OGE A;  4WCI A;  1VQ7 Q;  2FRW A;  1K8A U;  1BU1 A;  2BUD A;  1QCF A;  2NWM A;  4LUE A;  1UE9 A;  4BUG A;  2E5K A;  4Y91 A;  4PJM A;  4VUB A;  2MIO A;  4F7U A;  1UUE A;  3UWN A;  1MNE A;  3QXE B;  4D8K A;  2GNC A;  3GNG A;  4EPC A;  2KYB A;  3HRT A;  2EGA A;  2YXY A;  3G6E Q;  3V7S A;  3JB9 G;  3CPW P;  3HTR A;  3TVT A;  1K9M U;  1GCQ A;  2HQX A;  1UB4 A;  1UTI A;  3CQT A;  1Q82 U;  2ZPE B;  2LJ1 A;  4M77 C;  4M7A F;  1JB0 E;  5FW9 A;  1GFC A;  4M7A E;  4ZTJ A;  1EFN A;  4J9H A;  1IGQ A;  4KUL A;  4KUD K;  3RMQ A;  3MPU B;  1VQ8 Q;  2EJF A;  2CZ7 B;  9ATC B;  5HK0 A;  3N5B B;  4JRQ A;  4DQ2 A;  4JS4 A;  5GAN j;  1BCM A;  3RKY A;  1ZUU A;  2EQM A;  4DEX A;  3HL8 A;  1WHL A;  2K79 A;  2EGC A;  2Y4Y A;  1KHI A;  4J5Y A;  2DL7 A;  2QG9 B;  1IXD A;  4RMO A;  3EHQ A;  3RUX A;  3ZFJ A;  5CKE A;  3CPW A;  5KYU B;  3VKI A;  2DL4 A;  2JOY A;  4FIB A;  2K6D A;  1I1J A;  4N0A C;  2KRM A;  1FMK A;  4IUQ A;  3PVQ A;  5AYF A;  3SD4 A;  5A0L A;  3CPW S;  4EMH A;  1VYT A;  4F7U G;  1UHF A;  4C8Q B;  8AT1 B;  2EIF A;  1G3S A;  3FC3 A;  4J9E A;  3EG3 A;  1I4K 1;  1PKS A;  4ZN3 A;  4DBQ A;  2V26 A;  3QZ9 B;  4L59 A;  4BY6 B;  2P0Q A;  2PUO B;  5DLQ E;  4FW1 A;  1V29 B;  1YIJ A;  1OEB A;  3EFO A;  4EIK A;  4C5G A;  5IH2 A;  4A4F A;  3CCJ T;  2RQU A;  2YRV A;  2FEI A;  4QW2 A;  1C0M A;  2DRM A;  2WSC E;  1EX4 A;  1UEC A;  1ZSZ A;  2GQV A;  1I0C A;  3GIB A;  4M78 B;  1EZZ B;  2JM9 A;  4OF1 A;  1QWF A;  1GL5 A;  4HA8 A;  3M53 A;  1YI2 A;  1YHQ A;  2KK4 A;  5GAM e;  3E9F A;  4HCC A;  3A8M B;  4ELY C;  3CCV A;  4OMO A;  2VKN A;  5LJ5 h;  1B07 A;  3AHU A;  1HYO A;  3CCL Q;  1T3S A;  1Y07 A;  4RCB A;  3SHW A;  1G83 A;  2LCL A;  1G3Y A;  1N8R R;  1AOJ A;  3CCM A;  5IHN A;  2RQV A;  1GBR A;  4MZP A;  2GGR A;  4JRI A;  5KYX A;  5KE2 A;  2J05 A;  1QLY A;  1TWB A;  2LZ6 B;  5HY6 A;  3LW5 E;  4MZT A;  1PC0 A;  2EQU A;  2RHZ A;  2M51 A;  1WHH A;  3IQL A;  1YJN A;  3A8O B;  1UGP B;  1N9R A;  1JXO A;  4ORZ A;  1K8A R;  2DX1 A;  3I56 T;  4LUD A;  4M78 F;  1JXM A;  3GP8 A;  1HXD A;  2AIR B;  4IUV A;  3URG A;  2WAC A;  1HK9 A;  3AT1 B;  2OTL Q;  5C6S A;  1VQO T;  4XU1 A;  4A4E A;  1Q81 U;  3KFV A;  1OI1 A;  2RO0 A;  3S3N A;  1UEB A;  4M7A D;  1K9M R;  2PZ1 A;  1O75 A;  2JMC A;  2W10 A;  3VS0 A;  1Q82 R;  1Q7Y C;  1W6X A;  3CXC S;  5IAY A;  4C0Z A;  2CH4 W;  4KRT A;  2X3X D;  3OS2 A;  2ZPB B;  4E2F B;  4A4H A;  3JCM e;  3X20 B;  1B34 B;  2E3H A;  3NTH A;  2MI6 A;  1BI1 A;  4WF2 A;  1MHN A;  4QVZ A;  5KCO A;  1NPP A;  3TQ7 P;  4PFO A;  1BB9 A;  2DBK A;  1CKB A;  2EYZ A;  2DTH A;  1WQ7 A;  3G71 A;  2FO0 A;  2QA4 A;  1YJ9 T;  1VQN T;  3JCM c;  2DJQ A;  4OMM A;  5GAN h;  1D0X A;  2CKK A;  1BCO A;  1ZUY A;  3M54 A;  4LDX A;  1AVZ C;  2EKO A;  2PTK A;  5GAM d;  3ME9 A;  2HBW A;  2VAS A;  2H3J A;  3M0T A;  5GAO m;  1HD3 A;  1RAA B;  3R6O A;  1G2B A;  1VQK A;  2X4X A;  4X9C A;  4C92 A;  4XU3 A;  2HSP A;  4J9D A;  2JN0 A;  3CC4 T;  3OYG A;  2QEX T;  3G1J A;  3M58 A;  3M56 A;  4E7S A;  4EDU A;  5LJ3 f;  2H8H A;  2CP2 A;  2LMJ A;  2QQ9 A;  3L2V A;  5ECA A;  2DD4 A;  3M0Q A;  2QDL A;  3E2U A;  2KGT A;  5FU6 C;  1Q86 C;  2C0I A;  1VQM A;  1YBY A;  1BBZ A;  1K1Z A;  1VQ7 A;  5C0M A;  3M0P A;  4KBM B;  3CCS A;  3OYL A;  3RDV A;  2JMA A;  2RQT A;  1U3O A;  2RI2 A;  2J7I A;  4ZGJ B;  2RF0 A;  4M7A C;  3X24 B;  2E12 A;  2R5M A;  4OMP A;  1JEG A;  3VYG A;  4PNO A;  4OB1 B;  2SEM A;  1RAF B;  3UA7 A;  4BB7 A;  4JS5 A;  3TSW A;  1E6H A;  2O4X B;  3JCM d;  2FYK A;  3MCA B;  2QK0 A;  3SDZ A;  2HL3 A;  1M8M A;  4M77 F;  2EW3 A;  2LX7 A;  4E7K A;  4KGV B;  2AKL A;  4F14 A;  3RKW A;  4M77 E;  3CCE T;  1C6V X;  1Z9Q A;  2O9S A;  2AK5 A;  2HAX A;  1IHV A;  4C92 G;  3CME T;  3PTA A;  3NMZ C;  4FT4 A;  3A8G B;  3UF4 A;  5AT1 B;  1SHF A;  3QWX X;  4B9W A;  1FMW A;  1OQK A;  2X4J A;  4FYV B;  1WHG A;  4PJO D;  2XG8 D;  2DAQ A;  1OU8 A;  1IRE B;  3LGL A;  3VRY A;  1PM3 A;  3BFM A;  1UJ0 A;  2A3L A;  1LJO A;  2CUD A;  2EQK A;  3QZ5 B;  1Q81 R;  5GAN 4;  5D7U A;  4HVW A;  4CC7 A;  3GBQ A;  2LVM A;  1PRM C;  3CMA Q;  1QVF P;  3JCM W;  2VUB A;  4L5G A;  2F2V A;  3ULR B;  1IO6 A;  1NJI U;  4J9F A;  1YIJ Q;  1RI9 A;  2DXB A;  4NL3 A;  3MHX A;  3C95 A;  2B8A A;  2XDP A;  4J9B A;  3G7Z A;  4RTU A;  2RHX A;  1BIA A;  3FJP A;  4OML A;  4DOV A;  3EG0 A;  3QKJ A;  5GMK m;  2DF6 A;  2MOX A;  1S72 Q;  2RA2 A;  1SSH A;  2OTJ A;  5HCK A;  1YNZ A;  1Y96 A;  1RAG B;  2CGH A;  4M7D E;  1YI2 Q;  2GTJ A;  5L23 A;  5M9O A;  2R57 A;  3MEV A;  5CVI A;  3CCV Q;  2M0Y A;  1XTD A;  3V8J A;  1OZ2 A;  2KRS A;  1WYX A;  3GOX A;  3SWN C;  1JRI A;  1ACM B;  3LWI A;  1QVF A;  5FRM A;  5KYU A;  2K5L A;  3CCM Q;  1KC8 U;  3QPH A;  1H3H A;  3BDL A;  2ED0 A;  5FRO A;  1BI2 A;  1WA7 A;  2A0F B;  1QVF S;  3CD6 A;  2F2W A;  4QVC A;  4P5N A;  4A54 A;  2A28 A;  3CC2 Q;  1SRL A;  1CKA A;  1TUC A;  4C8Q A;  5GAN 5;  2HMA A;  1YJN Q;  2K3X A;  1D1C A;  3E1S A;  2LP5 A;  1X43 A;  4IIM A;  5GAM g;  3UA6 A;  2HDA A;  2EYQ A;  4PJO C;  5LJ3 e;  1NM7 A;  1KJW A;  2NUT B;  4C92 B;  1ARK A;  4NS5 A;  2RHU A;  5D6W A;  2WSE E;  1SHG A;  2YT6 A;  2L3S A;  4FSX A;  1WDX A;  4OVA A;  3L2W A;  4M75 F;  1M2O A;  2RI3 A;  3VS6 A;  4M75 E;  2FHD A;  1Q81 C;  2XD0 A;  3CC7 T;  3EG2 A;  4M78 A;  1VYU A;  3CCR T;  2VXE A;  4M77 D;  2OAU A;  1VQ4 A;  1TSF A;  4EMK A;  3PFS A;  1YP5 A;  2GBQ A;  3LX7 A;  3MP6 A;  1C1A A;  2J6O A;  3VYH B;  2VXF A;  1K73 C;  2ZCF B;  2F5K A;  2K57 A;  3DLM A;  4J6W A;  2KMT A;  2QA4 Q;  4GY5 A;  2COZ A;  3VS5 A;  3A8H B;  2DIG A;  5DLO A;  1VQL A;  5GAO p;  1W2B P;  2YDL A;  1Y0M A;  2K5F A;  2ED1 A;  5CQY A;  2K5I A;  2LTO A;  5FU6 B;  1ZQ1 A;  4C8Q G;  1WFW A;  1PKT A;  3BE3 A;  4XTY A;  3QDF A;  4RG2 A;  1MMD A;  2QAZ A;  4YTL A;  3L2R A;  3JCM g;  1OOT A;  1OPK A;  2DKG A;  1VQK Q;  3I5R A;  3X28 B;  3WVE B;  1WJQ A;  4LXC A;  4M7A B;  4A4G A;  1YIT A;  2C0T A;  1AZE A;  4GBQ A;  4JJB A;  1KIK A;  3G4S Q;  1WIE A;  2JNG A;  1NJI R;  1GBQ A;  1AT1 B;  2RH2 A;  1Q86 U;  1M90 C;  1U8R A;  4M78 G;  4D8D A;  4E7L A;  2A37 A;  1W2B A;  4M7D D;  2EJG A;  1OV3 A;  5LJ3 d;  2PVO B;  3OYJ A;  1B34 A;  1UG1 A;  2EFI A;  2CP3 A;  2GCX A;  2E10 A;  2E41 A;  1W2B S;  1D09 B;  3CCS Q;  5IXB A;  3KUF A;  1GCQ C;  3OYC A;  2OJ2 A;  4GLM A;  3CCQ T;  3MET A;  4BE0 A;  1FWZ A;  2X4W A;  2CRE A;  2HZY A;  3JCM f;  2HQH A;  5GMK l;  3KXT A;  1NYF A;  2J6K A;  4IIO A;  1AZG B;  1E7O A;  4DBR A;  2DVE A;  1KFZ A;  3MO8 A;  1X01 A;  3SB2 A;  3DB4 A;  4F04 B;  2DTI A;  5GAN 3;  3UPU A;  3VJP A;  4AFU C;  3JCM X;  1Y96 B;  5DY9 A;  1ABO A;  4WTO B;  4AFQ C;  5CQX A;  2E70 A;  2KE9 A;  2SRC A;  2LCC A;  3VS3 A;  1GFD A;  2M16 A;  3SEM A;  5I2S A;  2CP7 A;  1LCK A;  3S3O A;  3QWY A;  4LDU A;  1Y71 A;  3O5Z A;  3VRZ A;  1N27 A;  4DBH A;  1WJR A;  1M27 C;  1NEB A;  1YJW A;  1LVK A;  2VC8 A;  2X35 A;  2KQW A;  1M1K C;  4RUG A;  1H92 A;  4J9C A;  2D0Q B;  2DRK A;  4M75 D;  1PG5 B;  2K3B A;  2GQI A;  1VQ9 A;  3J81 E;  5DM7 R;  1VQ5 T;  3LWH A;  4HVU A;  4X9D A;  3TEE A;  1VQ6 T;  2KRO A;  1Q7Y R;  3OSS C;  1B3Q A;  5GAO r;  2EBP A;  4E47 A;  2K3Y A;  2BZY A;  2CP0 A;  2L8D A;  1SEM A;  4O6J A;  4HT9 A;  2FPE A;  1RAH B;  1R0C B;  3TSZ A;  1WNL A;  1MND A;  4PJN A;  2LC4 A;  3CMA A;  1WXU A;  5HK3 A;  3X26 B;  4RTV A;  2JXB A;  2I2L A;  4ZNX A;  3EGX B;  1PWT A;  2G6F X;  1NJI C;  2ESW A;  5GMK h;  2J06 A;  1OZ3 A;  4M7D C;  2JTE A;  3R6N A;  2O4X A;  4N0A A;  5CIU A;  3MP8 A;  1EIF A;  1I5L A;  1AD5 A;  1OU9 A;  3FEO A;  2OTJ Q;  3OSV A;  2DER A;  2DD5 A;  2D6F A;  2DLP A;  4OMN A;  2XIC A;  1WGS A;  3EAE A;  1X6G A;  5CKB A;  2VGN A;  1S72 A;  1QP3 A;  1H3Z A;  2C06 A;  4N4H A;  2DET A;  4F17 A;  3EGU A;  2LX9 A;  1K4U S;  3VU3 C;  3PIO A;  2CP6 A;  2DL8 A;  3PVL A;  4EMK B;  2XDD A;  1M4Z A;  4QQ6 A;  1G8X A;  2LT4 A;  2ZPH B;  4FYY B;  3RER A;  2RJE A;  2L3P A;  3CXC P;  1ZBX A;  2F5T X;  2X3W D;  2EWN A;  1XQH A;  5I11 A;  1K0S A;  4XU0 A;  3JV3 A;  3OQ5 A;  3CD6 Q;  1M1F A;  2PNI A;  2E6N A;  1BI0 A;  5GMK i;  4NOY A;  4C0F A;  1KC8 C;  1ZA1 B;  2F69 A;  4ZGD B;  3CC2 A;  5CKD A;  5EG2 A;  2D1X A;  2I0N A;  1Q86 R;  5FU7 C;  2K2V A;  2BTT A;  5FWC A;  3JSC A;  4ZTF A;  1FMV A;  1KHC A;  2VWF A;  2XKO C;  3MJX A;  1JO8 A;  1NG2 A;  5CR2 A;  4ANJ A;  4M75 C;  1VA7 A;  3CEY A;  2RMO A;  4MMK A;  2CDT A;  2Y90 A;  4PJO F;  1SF9 A;  4LE9 A;  4JRK A;  3CXC A;  1ZA2 B;  1K0X A;  1D3B B;  5I22 A;  2LJ3 A;  3LYI A;  4PJO E;  3ER0 A;  2DL3 A;  1LPL A;  3G6E T;  4BE1 A;  2FG0 A;  1VQ4 Q;  3O8V A;  3NTI A;  2RJD A;  2XK0 A;  3NGP A;  3M9Q A;  3FDR A;  1E6G A;  1YCY A;  1K73 U;  4QVD A;  3CCU T;  4GLK A;  3QDR B;  2FL7 A;  4B9X A;  1VQP Q;  2L2P A;  2QAS A;  5LJ3 g;  3OB9 A;  1WI7 A;  1SSF A;  3JB9 F;  1PD1 A;  5J26 A;  1IZ6 A;  2EYY A;  1VQ8 T;  1VQL Q;  3DKM A;  4RG8 A;  2DMO A;  2CUB A;  2M1H A;  2C0O A;  4BI4 A;  2LRQ A;  3CCJ A;  2EKH A;  5GAM j;  1MGQ A;  3C94 A;  3UDC A;  1PCX A;  2XHC A;  3ASK A;  1JJ2 P;  4QT7 A;  2ECZ A;  3QYG B;  1D0Y A;  2RHI A;  1M30 A;  2QTX A;  3DLL A;  2VV5 A;  2BZX A;  1ZSG A;  2Z0W A;  2QI2 A;  2HBP A;  5LJ5 f;  2DFU A;  2NUT A;  3TRE A;  1YIT Q;  3OMG A;  2G3R A;  1U1T A;  2HNI A;  4IUU A;  2DJZ A;  2MF2 A;  1KG1 A;  1QVG S;  2B86 A;  3LLR A;  2IIM A;  2A08 A;  1M90 U;  3F70 A;  4M77 B;  4PFZ A;  3MEW A;  2YRD A;  3G4S A;  2A7Y A;  3L2U A;  3THK A;  2EQJ A;  4Q5W A;  3FIF A;  4KH0 B;  3EFR A;  2KY9 A;  3OYY A;  3EGD A;  4AG2 C;  1QCN A;  3OY9 A;  5GAN 7;  4J7F A;  3MEA A;  1Y57 A;  4DBF A;  4F7U F;  1QKX A;  4XTX A;  4HCZ A;  3JCM V;  5GAN 6;  1JJ2 A;  3PE0 A;  2YHT A;  4F7U E;  4Z88 A;  4OGC A;  3T9N A;  2JS2 A;  1UJY A;  2MCN A;  2E3I A;  2QGF B;  1WX6 A;  1FX7 A;  1JJ2 S;  3NTK A;  1KD1 U;  4OB2 B;  1D1B A;  1PD0 A;  2DA9 A;  2EGE A;  3I35 A;  2ABL A;  1WPY A;  4KUI A;  1UGS B;  3H0I A;  2PU9 B;  3D7S B;  3L2Q A;  5EC7 A;  1VQO A;  2LQN A;  3OYM A;  5D6X A;  3S6W A;  3OS0 A;  3CCL T;  2ZZD A;  3CC7 Q;  1PNJ A;  2L3Q A;  2P0P A;  3CPF A;  1V76 A;  3A5Z B;  2X4Y A;  2CS7 A;  4M7A A;  4ZGE B;  1WHM A;  4ELZ C;  5GAN f;  1M1K U;  2DIQ A;  1YJW Q;  2P4R A;  4M7D B;  2NYS A;  1SKU B;  2CZ6 B;  2KT1 A;  1VQN A;  3C12 A;  2O9V A;  4C5E A;  5GAO n;  4BAC A;  1VQ9 Q;  2M9U A;  5A0D A;  2PQW A;  3NPF A;  3BY7 A;  3H41 A;  2IG0 A;  5A0G A;  3RKX A;  2OTL T;  3CBO A;  3JB9 I;  1SRM A;  2CH4 A;  3PMI A;  2XI9 A;  4E7Z A;  3OYK A;  2DIL A;  3P8B B;  4ESR A;  2XDB A;  1YWO A;  1K73 R;  1QKW A;  1JBM A;  4FCY A;  2PUK B;  2F2X A;  2FB7 A;  4R0K A;  3JB9 D;  1KQ2 A;  3HPW A;  3TU4 K;  4RTX A;  2BZ8 A;  3I55 T;  2QEX A;  4IUR A;  4AG1 C;  4Y28 E;  1VYV A;  3M4Y A;  4M7D F;  2DTO A;  2Y4X A;  2D9T A;  3P8D A;  1RUW A;  1I81 A;  2OI3 A;  3RNJ A;  4LD6 A;  3VS7 A;  1WHK A;  3VS4 A;  4M7A G;  5GAM h;  3BW1 A;  2QXF A;  4M75 B;  2QQB A;  4JZ3 A;  3L1A A;  2RD1 A;  6AT1 B;  3OA6 A;  2J6F A;  4HKE A;  5GAO l;  4C8Q C;  4OB3 B;  1W1F A;  4PFP A;  2QQA A;  4NL2 A;  1M90 R;  5CAI A;  1JU5 C;  4KT0 E;  5CCA A;  1W70 A;  2X9H A;  4X34 A;  4BY6 C;  5LJ5 e;  3QG1 A;  3H9N A;  3RMS A;  1AWW A;  1UGV A;  4TVR A;  1VIF A;  1IB8 A;  2NUP B;  1TOV A;  3CCE A;  1H64 1;  3SWN A;  2HKQ B;  3OYF A;  1NYG A;  4JUV A;  2JUF A;  4QKU A;  3EGX A;  4XTW A;  3RR6 A;  3OS5 A;  3CME A;  3H6Z A;  1D0Z A;  4RTY A;  3OYB A;  3H8Z A;  3UAT A;  5A2Q E;  5J3B A;  1QVP A;  1R8O B;  1ZBJ A;  1Y7X A;  3L2Z A;  3RIR A;  3EG9 B;  4LDW A;  4BE2 A;  3GPL A;  3EGD B;  3JAM E;  1QMC A;  1M9S A;  1UGQ B;  3JCM h;  4J6X A;  4N4I A;  3JCM J;  5GMK j;  1FXX A;  1VOM A;  1NEG A;  3JCM P;  4CC4 B;  1VQP A;  2DYI A;  4ZN1 A;  5IHK A;  1G3T A;  4MML A;  1JQQ A;  2P0K A;  3CCJ Q;  2RHY A;  1M1K R;  1DJ7 B;  1YCS B;  1K9A A;  1WHJ A;  1Z9Z A;  3GNF B;  1ZLM A;  3GLX A;  4PKC C;  2RK1 A;  2L0A A;  1MMG A;  2EYW A;  2CYZ B;  1M3B A;  4JJN K;  2RB6 A;  5IN1 A;  2DL5 A;  2IVW A;  2O01 E;  5GAN e;  3X25 B;  3OYN A;  5GAO q;  5I21 A;  3QYH B;  2CSQ A;  2V1R A;  1TUG B;  1RL2 A;  5J39 A;  3MP1 A;  2EAY A;  2R5A A;  1UDL A;  3V8L A;  2QQR A;  4R55 A;  4L6V 5;  3VS1 A;  3OYE A;  3ZEH A;  1BYM A;  2DZ9 A;  4B6M A;  1D3B A;  5LJ5 d;  2E6Z A;  2GFA A;  3CMA T;  1KQ1 A;  2FRY A;  7AT1 B;  1QCO A;  1QWE A;  3LH5 A;  2RPN A;  4FYX B;  1YIJ T;  5LJ3 j;  3H0F A;  4KH1 B;  3MEU A;  1ZHI A;  4BD3 A;  3JB9 H;  3JRZ A;  4PJO G;  3HSB A;  2P4T A;  5CK9 A;  2ENM A;  1RAE B;  1NE8 A;  2KYM A;  4OMF B;  4PK4 A;  1V1C A;  3QBY A;  3OYA A;  1K76 A;  3EH1 A;  3HHT B;  2K4Y A;  3I56 Q;  2HEQ A;  4E7I A;  1M8V A;  2DO3 A;  2RI5 A;  5LL6 S;  4CC2 A;  1YI2 T;  1NLO C;  1YHQ T;  4CC3 A;  2COW A;  3M0S A;  1KD1 C;  3A98 A;  3CCV T;  5KYY B;  1X69 A;  2YSQ A;  2VB6 A;  1VQO Q;  3OS1 A;  1PHT A;  2V1Q A;  5D6Y A;  1KC8 R;  1U5S A;  2CT3 A;  2P84 A;  3CC7 A;  4A53 A;  4JJC A;  3A1P A;  3CCR A;  3HRS A;  1IGU A;  2W0Z A;  1UHC A;  4J8O A;  3CCM T;  3CCU Q;  2EYX A;  5GAN 2;  3WVD B;  4OMQ A;  3SFM A;  2X51 A;  4O5V A;  3CC2 T;  1OPL A;  2R58 A;  1T0J A;  1U1S A;  2LDM A;  4M77 A;  4RKU E;  4E7J A;  2KRN A;  4RTW A;  2MMP A;  3A8L B;  5IHI A;  2KR3 A;  1YJ9 Q;  1YJN T;  3OBW A;  1VQN Q;  4AMC A;  1TH7 A;  4IUT A;  1NPR A;  2ZAE A;  4FT2 A;  4Z02 A;  4LDY A;  1R77 A;  5GAN d;  5IT9 E;  4RCC A;  3LH0 A;  4Z8A A;  3FB9 A;  2M0O A;  2RK2 A;  2QDY B;  2COY A;  4FL6 A;  1VUB A;  1U06 A;  2KAF A;  2RN8 A;  4OB0 B;  4DOW A;  3OYD A;  5IXF A;  4J9G A;  3RES A;  2JJ9 A;  3QHS A;  2EQI A;  2QGG A;  1RLP C;  1RAC B;  2KXC A;  3U23 A;  1SG5 A;  3QJY A;  2FVU A;  3SWN B;  3J80 E;  2LT1 A;  2PVD B;  1QW1 A;  3CC4 Q;  1ZSZ C;  2QEX Q;  2VGM A;  2QYZ A;  1QQJ A;  3PMT A;  3E9G A;  4E7H A;  5KYW B;  2RNA A;  4OP0 A;  4LDV A;  4A63 B;  2OAW A;  3OBY A;  4A4K A;  5HKC A;  3G71 T;  4KGZ B;  2QA4 T;  1W4S A;  4CRI A;  2DEQ A;  3Q1J A;  3EH2 A;  1I5O B;  2LNV A;  4PJO B;  2JT4 A;  2E1H A;  1PSF A;  3NHN A;  4M77 G;  4C92 D;  3CCQ A;  1P92 A;  4C0D C;  4EMG A;  1XNI A;  4M7D A;  1WQW A;  2KT8 A;  3EFS A;  3MKD A;  4XQ3 A;  1MV0 B;  2XID A;  2AKK A;  1VQK T;  3PNW C;  1G5V A;  5KH6 A;  2ZPG B;  4MDW A;  1I8F A;  2K7A A;  2BKD N;  2QQS A;  2BIV A;  4JPB W;  4C8Q F;  4MDX A;  4DA4 A;  4XTZ A;  3G4S T;  5FRN A;  4XAX B;  4DEY A;  2AT1 B;  4C8Q E;  2A36 A;  2GFU A;  1OX9 A;  3CCE Q;  1MV3 A;  1AWO A;  5LJ3 h;  1VQM T;  2MWO A;  1M2V B;  2D8J A;  3CME Q;  3BDU A;  1VQ7 T;  2D8H A;  2ROL A;  2V8K A;  3C4S A;  2GF7 A;  1IHW A;  3FJ5 A;  3OMC A;  2DE0 X;  4FU6 A;  2OX7 A;  2ZPI B;  4FYW B;  3CCS T;  4CI0 C;  2FZC B;  1YN8 A;  1TS9 A;  3QUI A;  4IKF A;  2ZGW A;  4LNP A;  2LQW A;  1VQ5 A;  5LJ5 g;  1QVG P;  2E64 A;  3ZL7 C;  1VQ6 A;  4M78 E;  2AHJ B;  3CBP A;  2D0N A;  4C0G A;  3V7C A;  4C5H A;  1ABQ A;  4M75 A;  2CZ0 B;  2RJC A;  1WXB A;  2MK5 A;  4M7D G;  1GRI A;  1RI0 A;  2HL5 C;  1NZ9 A;  4ATO A;  1LOJ A;  4JDS A;  3INZ A;  4N4G A;  3WXM B;  4QQG A;  4UC4 A;  1M3A A;  2WSF E;  3M4G A;  1YWP A;  4M4Z A;  3I55 Q;  3OW2 P;  1UFF A;  4JZ4 A;  4AT1 B;  4F7U B;  2L5Q A;  3M5A A;  2HSE B;  1AHJ B;  1NLP C;  1AWX A;  4PL6 A;  3REB B;  2DM1 A;  2HCK A;  2YRC A;  2NUP A;  4C92 C;  2KNB B;  3CBM A;  4JJD A;  4F16 A;  3GF5 A;  2YLB A;  1WJS A;  2DEU A;  1QVG A;  3V8K A;  4RTZ A;  1MUZ A;  2ROT A;  3JCM Q;  2F1L A;  2KSS A;  1F1B B;  1RAI B;  2NLU A;  3REA B;  3PIP A;  3EG9 A;  2KVQ G;  2FPF A;  2DK3 A;  1BI3 A;  2RQW A;  2CZ1 B;  2MAM A;  3OW2 A;  3OYI A;  2XMF A;  2VYT A;  2YUN A;  1WZO A;  2V8I A;  2CP5 A;  1N8R C;  4M75 G;  1BK2 A;  3QO3 A;  2ZPF B;  4HT8 A;  5GAN g;  2O88 A;  3I5S A;  5FLX E;  3OW2 S;  3FLG A;  2FZK B;  1RAB B;  4FM4 B;  1MMN A;  2DNU A;  2OTJ T;  3M0R A;  4E6R A;  2L89 A;  2MYS A;  2BE7 D;  3I56 A;  1RLQ C;  3VV0 A;  1GXI E;  1G3W A;  5GAN 8;  1X6B A;  2YLC A;  1I07 A;  1K8A C;  1IRX A;  3HKS A;  4JLI A;  1WXT A;  2HQE A;  1OUL A;  2DXC A;  3HFO A;  5I2M A;  3G6E A;  4C8Q D;  3CCR Q;  1BIB A;  1XOV A;  2O2O A;  2EVR A;  1K9M C;  3CD6 T;  3EFO B;  2E65 A;  3CCU A;  1N5Z A;  1Q82 C;  2AZV A;  4AFZ C;  1R0B G;  3DB3 A;  1X2Q A;  3H0H A;  2LCS A;  1ZSZ B;  1J3T A;  2XU8 A;  2KBT A;  1YJ9 A;  1VQ8 A;  2YUQ A;  1KSW A;  2QTV A;  1KK7 A;  4J7I A;  3S3M A;  2YUO A;  4Z89 A;  4BDY A;  4M78 D;  4BDZ A;  3QSU A;  2M02 A;  2K2M A;  4LN2 A;  1ZX6 A;  2DBM A;  4HCB A;  1T3L A;  2KI7 A;  2DVJ A;  5CO7 A;  4XU2 A;  1X2K A;  4FW2 A;  1A0N B;  2V8J A;  2JTM A;  4C0D B;  2LQ8 A;  1VQ4 T;  4IUP A;  5GJV B;  1TG0 A;  1T0H A;  2HD0 A;  4V2S A;  5KYX B;  3I9Q A;  2L3R A;  5KYY A;  2BE9 B;  3CC4 A;  4ME7 A;  2MWP A;  1VQP T;  4J6Y A;  3E19 A;  2FPD A;  3PGG A;  2EJ9 A;  1HJD A;  1TU0 B;  5FU7 B;  1VQL T;  3EG1 A;  5GMK e;  1WLP B;  4KGX B;  2DYB A;  1ZUK A;  4RTT A;  4HVV A;  2DPP B;  1PRL C;  2RJF A;  3CCQ Q;  4BI8 B;  3FRN A;  1CSK A;  1UGR B;  1LNX A;  2KEA A;  1N9S A;  3PT9 A;  2HKN A;  2LJ0 A;  2O31 A;  1H8K A;  2E5Q A;  4HXJ A;  4LD9 K;  3HFN A;  1YHQ Q;  1X27 A;  4PJJ A;  4K11 A;  3KBG A;  1YIT T;  2YUP A;  1D1A A;  4XTU A;  1NBE B;  4PJL A;  3VUB A;  3VS2 A;  4BI3 A;  3CCL A;  1X6O A;  4QQD A;  1S1N A;  1TTH B;  3M55 A;  2CT4 A;  2GTO A;  4PLL A;  2VVK A;  4XK8 E;  2AZS A;  4X1V A;  1AWJ A;  1B7T A;  4XTV A;  1YFN A;  2E4H A;  5KYN A;  3ZBD A;  1OYX A;  3QII A;  2IPO B;  4MZM A;  2K9G A;  4M78 C;  1M3C A;  1Q95 G;  2YWW A;  3JB9 J;  5KYW A;  5FWB A;  1KD1 R;  4EMK C;  2CSI A;  1VQ5 Q;  3QJ6 A;  5CKF A;  1VQ6 Q;  1O9S A;  4J83 A;  3TCJ A;  4PJO A;  1HSQ A;  3EHR A;  1Q7Y U;  2OTL A;  1VIE A;  4Y92 A;  2LNH B; 
#chains in the Genus database with same CATH homology
 3UF4 A;  1SHF A;  3QWX X;  1AEY A;  1TUD A;  2JW4 A;  2RQR A;  4Z8A A;  2L2P A;  3VRY A;  1U06 A;  2RN8 A;  1WI7 A;  1SPK A;  5IXF A;  4J9G A;  1UJ0 A;  2CUD A;  2EQI A;  2EYY A;  1RLP C;  4HCK A;  2DMO A;  2CUB A;  2C0O A;  4HVW A;  2KXC A;  3U23 A;  2EKH A;  3GBQ A;  4CC7 A;  1PRM C;  5GJW B;  3C0C A;  2F2V A;  3ULR B;  1IO6 A;  4QT7 A;  2ECZ A;  4J9F A;  1RI9 A;  2NUZ A;  1M30 A;  2RNA A;  4A63 B;  2OAW A;  2BZX A;  1ZSG A;  4J9B A;  4RTU A;  4OML A;  3EG0 A;  1FYN A;  2JS0 A;  4AFS C;  2DF6 A;  2MOX A;  2B86 A;  1SSH A;  2IIM A;  2A08 A;  5HCK A;  2KXD A;  1YNZ A;  2EPD A;  4FSS A;  2JT4 A;  3THK A;  2GTJ A;  3NHN A;  5L23 A;  2KT8 A;  2M0Y A;  4AG2 C;  1MV0 B;  2AKK A;  4J9I A;  2KRS A;  2JM8 A;  1Y57 A;  3RBB B;  1WYX A;  3M0U A;  1GCP A;  1QKX A;  4WCI A;  2K7A A;  2FRW A;  3PE0 A;  1BU1 A;  1QCF A;  4JPB W;  4Z88 A;  2NWM A;  1H3H A;  4LUE A;  2ED0 A;  1WA7 A;  1UE9 A;  2E5K A;  2JS2 A;  2MIO A;  1UJY A;  2MCN A;  1UUE A;  1WX6 A;  2F2W A;  4DEY A;  2A28 A;  4D8K A;  2A36 A;  1SRL A;  2DA9 A;  2EGE A;  1CKA A;  1TUC A;  3I35 A;  2GNC A;  2ABL A;  1MV3 A;  2KYB A;  2EGA A;  1AWO A;  3H0I A;  2D8J A;  3TVT A;  1GCQ A;  5EC7 A;  1UTI A;  2LQN A;  3CQT A;  2D8H A;  2LP5 A;  1X43 A;  2LJ1 A;  2ROL A;  4IIM A;  3FJ5 A;  3UA6 A;  2DE0 X;  2HDA A;  1PNJ A;  2L3Q A;  1NM7 A;  5FW9 A;  1KJW A;  1GFC A;  1ARK A;  1YN8 A;  1EFN A;  4J9H A;  1SHG A;  2YT6 A;  2L3S A;  1WDX A;  4LNP A;  2LQW A;  3ZL7 C;  3VS6 A;  2D0N A;  2P4R A;  3EG2 A;  1VYU A;  1ZUU A;  2KT1 A;  1ABQ A;  4DEX A;  1WXB A;  2K79 A;  2EGC A;  1GRI A;  2O9V A;  1YP5 A;  2GBQ A;  2DL7 A;  2J6O A;  3EHQ A;  3NPF A;  3H41 A;  2DL4 A;  1M3A A;  2K6D A;  1YWP A;  4M4Z A;  1UFF A;  1I1J A;  4JZ4 A;  2KRM A;  3VS5 A;  1FMK A;  1SRM A;  3PVQ A;  2CH4 A;  1VYT A;  2DIL A;  1UHF A;  1NLP C;  1AWX A;  1Y0M A;  1YWO A;  2YDL A;  4ESR A;  2ED1 A;  1QKW A;  3REB B;  2DM1 A;  2HCK A;  2KNB B;  4J9E A;  3EG3 A;  1WFW A;  2F2X A;  1PKT A;  4JJD A;  4R0K A;  4F16 A;  1PKS A;  4RTX A;  2BZ8 A;  4RTZ A;  4AG1 C;  1MUZ A;  1OOT A;  1VYV A;  1OEB A;  1OPK A;  2ROT A;  3I5R A;  4EIK A;  5IH2 A;  2RQU A;  1RUW A;  2OI3 A;  3RNJ A;  2FEI A;  2C0T A;  3REA B;  1AZE A;  4GBQ A;  4JJB A;  2DRM A;  3VS7 A;  1UEC A;  3VS4 A;  1KIK A;  2FPF A;  2RQW A;  1WIE A;  1I0C A;  2JM9 A;  2LNH B;  1GBQ A;  1QWF A;  1GL5 A;  2XMF A;  2YUN A;  4D8D A;  4JZ3 A;  1BK2 A;  2A37 A;  2O88 A;  3I5S A;  4OMO A;  1OV3 A;  2VKN A;  2J6F A;  2DNU A;  1B07 A;  3M0R A;  1UG1 A;  1T3S A;  4E6R A;  1W1F A;  3SHW A;  5IXB A;  1G83 A;  1GCQ C;  1JU5 C;  1RLQ C;  2OJ2 A;  4GLM A;  1W70 A;  1X6B A;  1AOJ A;  2CRE A;  5IHN A;  1AWW A;  2RQV A;  1I07 A;  1UGV A;  1GBR A;  2GGR A;  2J05 A;  1WXT A;  1QLY A;  1NYF A;  2LZ6 B;  1NYG A;  2J6K A;  4IIO A;  1AZG B;  1E7O A;  1KFZ A;  2M51 A;  1XOV A;  3IQL A;  2O2O A;  4RTY A;  1JXO A;  2EVR A;  4ORZ A;  3UAT A;  2DX1 A;  4LUD A;  1N5Z A;  1JXM A;  2AZV A;  1ZBJ A;  4AFU C;  4AFZ C;  1ABO A;  4AFQ C;  2LCS A;  1X2Q A;  3H0H A;  2KE9 A;  2SRC A;  3VS3 A;  1GFD A;  3KFV A;  3SEM A;  1J3T A;  1LCK A;  2KBT A;  2PZ1 A;  2JMC A;  3QWY A;  2W10 A;  2YUQ A;  3O5Z A;  3VS0 A;  3VRZ A;  1KSW A;  1W6X A;  2YUO A;  1M27 C;  1NEB A;  4Z89 A;  2CH4 W;  1NEG A;  4KRT A;  4CC4 B;  4RUG A;  1H92 A;  2K2M A;  4J9C A;  2X3X D;  2DRK A;  4LN2 A;  1ZX6 A;  2K3B A;  2DBM A;  2GQI A;  5IHK A;  1T3L A;  4HVU A;  2DVJ A;  2KRO A;  1X2K A;  1B3Q A;  2EBP A;  1JQQ A;  1A0N B;  2BZY A;  1BB9 A;  2DBK A;  1CKB A;  2EYZ A;  2FO0 A;  1YCS B;  1SEM A;  1K9A A;  2DJQ A;  5GJV B;  4OMM A;  1Z9Z A;  2FPE A;  1T0H A;  1TG0 A;  1ZLM A;  3I9Q A;  3TSZ A;  1ZUY A;  1WXU A;  2L0A A;  2EYW A;  1AVZ C;  4RTV A;  2JXB A;  2PTK A;  1M3B A;  4ZNX A;  1PWT A;  2DL5 A;  2G6F X;  2HBW A;  3M0T A;  2ESW A;  2FPD A;  2J06 A;  1HD3 A;  2CSQ A;  2JTE A;  2V1R A;  3R6N A;  1HJD A;  1AD5 A;  1UDL A;  1G2B A;  3VS1 A;  3EG1 A;  2DLP A;  4OMN A;  1WLP B;  1X6G A;  2DYB A;  1ZUK A;  4RTT A;  2HSP A;  4HVV A;  4F17 A;  1PRL C;  3EGU A;  1K4U S;  4J9D A;  2FRY A;  1CSK A;  2DL8 A;  2KEA A;  3PVL A;  2O31 A;  2LJ0 A;  1QWE A;  3LH5 A;  2RPN A;  1H8K A;  2H8H A;  4HXJ A;  2LMJ A;  1X27 A;  3H0F A;  2L3P A;  5ECA A;  3M0Q A;  2ENM A;  2QDL A;  4K11 A;  2KGT A;  2C0I A;  2X3W D;  2YUP A;  5I11 A;  1BBZ A;  2KYM A;  1K1Z A;  1V1C A;  1K0S A;  3VS2 A;  1K76 A;  3JV3 A;  3M0P A;  2PNI A;  2HEQ A;  1S1N A;  4CC2 A;  2CT4 A;  1NLO C;  2GTO A;  2D1X A;  2JMA A;  2RQT A;  2VVK A;  2I0N A;  1U3O A;  2AZS A;  3M0S A;  4X1V A;  4CC3 A;  1AWJ A;  2J7I A;  3A98 A;  2RF0 A;  1X69 A;  2BTT A;  2YSQ A;  5FWC A;  1PHT A;  2VWF A;  4OMP A;  1JEG A;  2V1Q A;  1U5S A;  2CT3 A;  2K9G A;  1JO8 A;  2SEM A;  3UA7 A;  1M3C A;  1NG2 A;  3TSW A;  1E6H A;  4JJC A;  1VA7 A;  5FWB A;  2W0Z A;  1UHC A;  2RMO A;  1M8M A;  2EYX A;  2EW3 A;  2LX7 A;  2AKL A;  2CDT A;  2CSI A;  4F14 A;  4OMQ A;  4LE9 A;  1K0X A;  1OPL A;  5I22 A;  2LJ3 A;  2O9S A;  1Z9Q A;  2DL3 A;  2AK5 A;  1T0J A;  2FG0 A;  2KRN A;  4RTW A;  5IHI A;  1HSQ A;  3EHR A;  2KR3 A;  4Y92 A;  3NGP A;  3NMZ C;  1E6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...