1KIKA

Sh3 domain of lymphocyte specific kinase (lck)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
NLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
publication title Structure determination of human Lck unique and SH3 domains by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 8
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kikA00
2L3QA 3NMZC 1I0CA 2EVRA 1NEGA 5GJWB 1IO6A 1AWXA 1RUWA 1CSKA 2FG0A 3M0QA 3RNJA 2A37A 1OEBA 2RNAA 2KRMA 2V1QA 4J9DA 1UG1A 2FEIA 4JJBA 1ZBJA 3H0HA 1JEGA 4OMQA 2KGTA 1SRMA 2DBKA 2J6OA 2MCNA 1T3LA 2BTTA 1XOVA 2A36A 3I35A 1Y0MA 3TSZA 2DM1A 1X6BA 2AKKA 2EKHA 2A08A 2HSPA 4JJDA 2H8HA 2DA9A 1UFFA 2SRCA 2RQRA 4RTUA 2W10A 2D8JA 2DJQA 1AEYA 2J05A 2DMOA 2KE9A 2DL7A 2DRKA 1PNJA 2EYZA 1ABOA 2DILA 2KT1A 2GBQA 2M51A 3O5ZA 2D0NA 3EG2A 3I5SA 2SEMA 1T0JA 1BBZA 1M3BA 1JQQA 3H0IA 2ED1A 1PRLC 3VS1A 2W0ZA 1QKWA 1SHFA 2M0YA 1E6HA 2G6FX 2VVKA 3NGPA 4AFQC 4AFUC 3FJ5A 4CC3A 1T3SA 1VYVA 3LH5A 1LCKA 2RF0A 2C0TA 1MV3A 2DL5A 3M0PA 4RTTA 5FWCA 2NUZA 3RBBB 1M30A 1HJDA 2X3XD 2L3PA 3IQLA 2DLPA 2LP5A 1GCQC 1X43A 2O9VA 2LZ6B 2EYYA 4OMOA 1AZGB 1WIEA 1H92A 2ABLA 5IXFA 2PNIA 2MOXA 2DL3A 2O88A 1NLPC 1BB9A 1GBRA 1BU1A 5IHKA 1HD3A 2EW3A 2YDLA 1TUDA 3REBB 1AWWA 2JMAA 2JXBA 2LQWA 1T0HA 4FSSA 1YWOA 2AZSA 2GGRA 3EG1A 1HSQA 1SSHA 3A98A 3UATA 2VWFA 5ECAA 1AOJA 4HXJA 1FYNA 2DL4A 2RPNA 2RMOA 2YT6A 2KBTA 4OMMA 1G83A 2GTOA 1S1NA 2KRSA 4J9HA 1RLQC 1I07A 2AZVA 4LNPA 1VYTA 1VYUA 2ROLA 1ZUKA 1E7OA 2DBMA 2CREA 3I9QA 3C0CA 3QWXX 2FPDA 1RLPC 1KJWA 4EIKA 3JV3A 2K3BA 1GRIA 2RN8A 3UA7A 2JW4A 5IH2A 2MIOA 4HVWA 1ZUUA 2L0AA 1M3CA 1M27C 1AWJA 2FPFA 3U23A 1UGVA 2CT3A 5HCKA 1B3QA 2EYWA 3VS5A 2J7IA 1BK2A 4J9CA 2AK5A 3EG3A 4F16A 2KT8A 1K0SA 2LNHB 1QWFA 4Z89A 2KYMA 4CC4B 2YSQA 1ARKA 2EQIA 2GNCA 3M0SA 4K11A 4LN2A 2ESWA 1QWEA 1WDXA 2LX7A 2XMFA 1ZSGA 2DF6A 1PKSA 1K1ZA 4IIOA 5FW9A 1JXOA 3VS7A 1B07A 3VS6A 1SHGA 1K76A 4CC7A 1OPLA 2B86A 2FO0A 1E6GA 1GCQA 3NPFA 4LE9A 1QLYA 1GFDA 2J6FA 1UECA 4JJCA 4M4ZA 2CUDA 3VRZA 4DEXA 3UA6A 2EPDA 4Z8AA 5I11A 4JZ4A 1X69A 1YNZA 3EHQA 1H8KA 2C0OA 2HCKA 1V1CA 4HVUA 2K79A 1NLOC 2ENMA 1G2BA 2JS2A 2CSQA 4JPBW 1NM7A 1PHTA 1GL5A 1PRMC 1KFZA 1WYXA 2LJ0A 3PE0A 1X27A 2DX1A 2KYBA 2CUBA 3SEMA 1I1JA 4RTZA 4RTYA 1M3AA 5GJVB 2FRYA 1MV0B 1ZUYA 4HCKA 4IIMA 1X6GA 5I22A 2KXDA 4HVVA 1GBQA 1SPKA 2DYBA 2I0NA 4ZNXA 3ULRB 2JTEA 1WX6A 1AWOA 2BZ8A 1UDLA 3EGUA 1K0XA 1TUCA 2HBWA 3PVLA 1W1FA 2CDTA 5IHNA 3M0RA 2JM9A 1WA7A 2O9SA 4F17A 2F2WA 2LQNA 4LUEA 2GTJA 2KR3A 2OAWA 4QT7A 2DL8A 4J9FA 2K2MA 1X2KA 3TSWA 3H41A 4CC2A 2FRWA 2PZ1A 4LUDA 3R6NA 2EGAA 2HEQA 2DRMA 1JO8A 2KROA 1UE9A 1YWPA 2OJ2A 1CKBA 2EGEA 2X3WD 2LJ3A 3REAB 2F2XA 5IXBA 1M8MA 4DEYA 2J6KA 3KFVA 2J06A 2ROTA 3VS2A 1JXMA 1SRLA 2GQIA 2VKNA 3UF4A 2LMJA 2EBPA 4JZ3A 1ZLMA 1PWTA 3NHNA 1OPKA 1EFNA 2DE0X 1Z9QA 4RTXA 4AFZC 1K4US 1U5SA 1WXTA 2YUOA 4E6RA 2YUPA 2HDAA 2L2PA 4D8KA 2EYXA 3M0UA 1X2QA 2V1RA 1WFWA 2K6DA 1QKXA 4J9EA 4J9BA 1CKAA 2IIMA 2CH4A 4OMPA 2O31A 4OMLA 1OOTA 1NYGA 1Y57A 2PTKA 4D8DA 5EC7A 2JMCA 4RTWA 2QDLA 4J9IA 3H0FA 1NYFA 2RQUA 4A63B 2RQTA 3ZL7C 3PVQA 2CSIA 4OMNA 2JM8A 3EHRA 3QWYA 2ED0A 1UUEA 1K9AA 3CQTA 2P4RA 4GBQA 5FWBA 1YP5A 4AG1C 1U06A 2NWMA 1KSWA 1NEBA 5L23A 2KEAA 1W6XA 2AKLA 2E5KA 4WCIA 3VS4A 4F14A 5IHIA 2C0IA 1GFCA 2D8HA 2KXCA 1SEMA 4J9GA 1PKTA 1WXUA 2K9GA 1NG2A 1A0NB 1AZEA 1YN8A 2KRNA 2CT4A 2O2OA 4RUGA 2BZYA 1N5ZA 3SHWA 1ZX6A 1J3TA 1ABQA 3GBQA 1RI9A 4RTVA 2DVJA 2K7AA 3M0TA 1TG0A 2DNUA 2CH4W 3VS0A 1WLPB 1KIKA 4GLMA 1OV3A 1FMKA 1WXBA 2F2VA 1MUZA 2LCSA 2L3SA 2LJ1A 2RQWA 1UTIA 2RQVA 1AD5A 1UJ0A 2YUNA 3EG0A 1VA7A 2KNBB 4AG2C 1UJYA 1H3HA 2ECZA 1WI7A 4AFSC 1AVZC 4Y92A 2BZXA 2A28A 1Z9ZA 1U3OA 2D1XA 2OI3A 1W70A 4ESRA 1UHCA 4R0KA 3I5RA 1QCFA 4ORZA 3VRYA 3TVTA 2EGCA 4Z88A 1UHFA 4KRTA 2YUQA 3THKA 1JU5C 1YCSB 1GCPA 3VS3A 2JT4A 4X1VA 2JS0A 2FPEA
chains in the Genus database with same CATH superfamily
5LJ5g 2L3QA 3CCST 2L8DA 2F69A 1I0CA 4EMGA 2NLUA 2KDSA 2JZ2A 2KRMA 4ZN3A 1UG1A 4HT8A 1ZBJA 3M56A 1VQ8Q 4QW2A 4M77D 3JSCA 2J6OA 3QDFA 4FCYA 3OY9A 5GAMh 2QEXA 2EKHA 1RAIB 3CC4Q 4JJDA 4M7DC 5DM7R 1YJWA 3ZFJA 4ZTJA 3CCUT 1B7TA 3JB9F 4N4HA 2DERA 5GANd 4DOVA 4JUVA 1RADB 1AEYA 1VQNQ 1K8AR 4KUDK 2EYZA 4BE0A 2MAMA 3BE3A 2M51A 2CZ6B 3EG2A 4ATOA 4QVDA 4II1A 4NL2A 2R5AA 4FU6A 3L1AA 2I2LA 3VJPA 4PJOA 2Y4XA 1PRLC 2LT1A 2RJFA 2W0ZA 2R58A 2K5FA 1BI3A 5CAIA 3EG9B 4AFUC 3M57A 1VQ9T 4CC3A 2QEXT 2RI5A 1OQKA 3HFOA 1WNLA 4RTTA 1X01A 3RBBB 1YJWT 1M30A 1H3ZA 3CD6Q 2X3XD 4M7AB 2M0OA 4MMLA 3LYIA 5GMKm 1AZGB 2VXEA 1PSFA 5IXFA 2MOXA 4C0FA 5L8RE 1TSFA 1NLPC 1RAHB 5FU7B 1YFNA 2L89A 1GBRA 4C8QB 2JXBA 2EWNA 3QJ6A 3H8ZA 1AOJA 4HXJA 1Q82U 3C95A 2D0QB 2QA4T 2RMOA 2YT6A 2K57A 2GTOA 2KRSA 5D6XA 3UPUA 4J9HA 1I07A 3V7CA 4ELZC 1C0MA 5CKFA 4YTLA 1K73U 4ZN1A 1ZUKA 1OULA 2VUBA 3I9QA 1Q81R 3C0CA 3HRTA 4C92D 1G3WA 4KT0E 1JBMA 1RAAB 2GFUA 1GRIA 1IB8A 2RN8A 3CCRA 4PJMA 1N6AA 2D6FA 5IH2A 2MIOA 4HVWA 2XHCA 1M3CA 3JCMh 2M1HA 4EMKC 4M78E 4M77A 4HCBA 5LJ3e 2ZPIB 2R57A 1Q7YU 2EYWA 1XNIA 1N8RU 2VASA 1BK2A 2P0PA 4BD3A 4FL6A 3BY7A 2ZPEB 1VQKQ 1K0SA 3E9FA 2YRCA 2ZGWA 3WVEB 2YSQA 5LJ3f 3M0SA 1ZA1B 5CCAA 2LX7A 4EMHA 4OF1A 4IIOA 2DF6A 1JXOA 3KBGA 5LJ5d 3I56Q 2LCLA 3CCRT 5D6WA 1LJOA 1SHGA 1K76A 4CC7A 1KC8U 2FO0A 1GCQA 1UECA 2QQRA 3QIIA 2L3RA 3UA6A 2CZ1B 1SKUB 2EJ9A 3CBOA 1I4K1 3EHQA 5GAN7 1N27A 4C5HA 1NLOC 1Y71A 1O9SA 2CSQA 4JPBW 1NM7A 1PRMC 1BYMA 1WYXA 2RA2A 2BKDN 4P5NA 4ANJA 2VB6A 4M75B 1Q86R 2KYBA 2OTJQ 4PJNA 2DXTA 3HPWA 3SWNC 3RKYA 5GJVB 2F5KA 3JRZA 1ZSZA 3X24B 4E7SA 4HVVA 2LCCA 1GBQA 1YJ9A 4A54A 3OYYA 1AWOA 4LDWA 4M7DE 5GANe 5EG2A 5CK9A 3M55A 1D0YA 2HBWA 2HAXA 2X4XA 2CZ0B 4PJOB 4F17A 2LQNA 2LVMA 4M7AG 4C92A 4CC2A 2K2MA 1X2KA 1M9SA 3CPWS 2DIQA 2FRWA 5FRNA 4LDVA 5GANf 3R6NA 2HEQA 1UGRB 4WF2A 1JO8A 4DOWA 1WPYA 1UE9A 1CKBA 4OB0B 2X3WD 2O4XA 1YJ9T 4C8QG 2J6KA 5I21A 3VS2A 4BACA 1JXMA 3UDCA 4EPCA 5KYYA 4MDXA 2EBPA 5AYFA 3NHNA 1TS9A 2EQUA 2DK3A 4RTXA 5FLXE 1K4US 1U5SA 1WXTA 1UGPB 2YUOA 5CR2A 1KK7A 3OYJA 4D8KA 2EYXA 4MZMA 2V1RA 1I8FA 1WFWA 2K6DA 5GMKj 4FW1A 4JRIA 2X51A 3CPWP 4OMPA 5KYUA 4C0DC 5IN1A 3HKSA 1OOTA 3CMEA 3CC7A 2M9UA 1NYGA 5J39A 2PTKA 1Y07A 2QDLA 3MP8A 3H0FA 3LWIA 5I2MA 2HL3A 4KGVB 4Y91A 2JM8A 3EHRA 3OYEA 1BCOA 2ED0A 1UUEA 1K9AA 3E19A 2P4RA 3X28B 1VQLQ 2LQ8A 4M77B 3CCLQ 1QVPA 1Y96A 3TQ7P 4JRQA 5LJ3h 3G4SQ 2KXCA 1IREB 3CMET 1AZEA 3I55A 1YN8A 2RHUA 4QQDA 2K4YA 3OS5A 2BZYA 2CP0A 3T9NA 1ZX6A 4OMFB 4IUVA 4C5GA 3GPLA 1M90R 1VQPQ 3EAEA 1RI9A 3GNGA 3M0TA 1TG0A 2FZCB 1X6OA 3TREA 3VS0A 1NJIR 4BB7A 3EH1A 1C1AA 1V76A 1EZZB 1FMKA 5LJ5e 2F2VA 1R0BG 2XICA 2LJ1A 1YI2T 3OMGA 2QTVA 3JCMX 1K9MR 1UJ0A 4F7UA 1VA7A 1XTDA 2KNBB 2DVEA 4OB1B 2NUPB 1H3HA 4AFSC 2V8JA 2D1XA 5GAMj 4KH1B 4RKUE 3L2QA 4ESRA 3I55T 4M75G 2V26A 4ORZA 3VRYA 1FX7A 2EGCA 2HL5C 5LJ5f 5GAOl 3OBWA 3M4GA 1KHCA 1K8AU 3L2UA 1YCYA 3HFNA 3VYGA 6AT1B 1YBYA 1SF9A 1PG5B 2FYKA 4BE2A 3OSVA 1QMCA 4MMKA 2EVRA 3NTKA 3P8DA 5FU6B 2OX7A 4M7DD 2FG0A 4N0AA 1YHQA 3M0QA 1OEBA 3CCSQ 3V8KA 2FEIA 4JJBA 4PJOG 1ZSZB 2QXFA 3RKXA 2ZPFB 3X26B 1VQ4Q 2MCNA 2KVQG 1XOVA 3TSZA 1TU0B 2X4JA 2AKKA 1OYXA 4DBHA 4C0GA 1QCOA 5GMKi 4OP0A 1UB4A 5GANh 1M1KR 2H8HA 1H641 2F5TX 2DA9A 4C5EA 4C8QA 4GLKA 1S72T 2SRCA 5GAOr 4C92B 3EFOA 2BIVA 3OYIA 3HTRA 2J05A 2DMOA 2KE9A 2X35A 1PNJA 1OI1A 1KHIA 1ABOA 2DILA 2D0NA 3OB9A 1XJWB 5HK3A 1YHQT 1T0JA 2EIFA 2IVWA 1BBZA 3C12A 4XU1A 2DEQA 3QSUA 1M3BA 4ZTFA 1MMNA 4BUGA 4LXCA 4E47A 2E1HA 1QKWA 2O4XB 5IAYA 1WHLA 1D1AA 3PT9A 3H9NA 1VQMQ 4M78C 3S3OA 5KYYB 4AFQC 2DXUA 2LNVA 1VYVA 2DD4A 2COZA 5DLQE 2DL5A 4JLGA 5FWCA 3CCJA 2GQVA 2ZPHB 1SG5A 1Q81U 5GAOm 1VQ9Q 1HK9A 3IQLA 1ZHIA 1QVFA 4IUUA 3TEEA 1YIJQ 4R55A 2O9VA 2LZ6B 2AIRB 2EYYA 4OMOA 2PNIA 2EJFA 5KYUB 3G6EA 4LD9K 1PCXA 3X20B 2YHTA 4M77F 1TUDA 1AWWA 4FT4A 1T0HA 3CMAA 4M77G 4QVZA 2E41A 3CXCA 1SSHA 3UATA 4E7HA 5ECAA 2E3IA 2RPNA 3LGFA 2KBTA 2RHXA 3L42A 4OMMA 1G83A 3CCJT 3PMTA 2JUFA 1RLQC 2E6ZA 2HKNA 4HCZA 4D6WA 3OYHA 2AZVA 3M53A 1VYTA 2VC8A 2XG8D 2QA4Q 1VYUA 2ROLA 2A3LA 1E7OA 1Y96B 3QZ9B 1C6VX 5CQXA 4M7DA 2FPDA 5GAOq 2E65A 4MZPA 1QVFP 4C5IA 2QTXA 2V8KA 3L2RA 4KBMB 1ZUUA 2L0AA 4DBRA 2FPFA 4XAXB 1NPPA 3CC2A 2VXFA 4B9WA 2CT3A 3CMAT 1B3QA 3O8VA 2LRQA 3MEWA 5GAN2 4JLIA 4M75A 4J9CA 2XD0A 1EIFA 2RK2A 4F16A 2KI7A 3FRNA 3CCMA 1FMVA 1NE8A 4R56A 3CXCP 2L5QA 4Z89A 5HKCA 3OYKA 4KH0B 2HQXA 1Q86U 5LJ5h 5KE2A 1WDXA 4F7UB 2KK4A 3R6OA 5HY6A 3QZ5B 1TH7A 7AT1B 1KD1C 3VS6A 3FB9A 2MYSA 1OPLA 3M59A 2B86A 1KQ2A 4JS4A 3NPFA 3CC2T 3URGA 2X4WA 4J83A 1KQSS 4JJCA 3FJPA 1WHGA 3OS0A 3VRZA 2QQBA 4DEXA 2DO3A 4QKUA 3DLMA 3CCVA 4LDYA 3OS2A 4Z8AA 3EH2A 5I11A 4JZ4A 1X69A 2PQWA 3MP6A 2HCKA 2K79A 2ENMA 1G3YA 1JJ2S 1G2BA 1G5VA 2JS2A 2JJ9A 4C92F 3FC3A 4C92G 2ZCFB 3PE0A 1OX9A 2CGHA 1WGSA 3CCQQ 2CUBA 3SEMA 1I1JA 3HL8A 4RTYA 5CO7A 4HCKA 4IIMA 5I22A 5GAN5 2KXDA 2DYBA 4XU0A 3EFOB 3M9QA 2RI2A 2JTEA 1WX6A 1P92A 1WZOA 3CCVT 4IURA 3JB9D 1KQSP 3S6WA 3NFCA 1UDLA 4X9DA 4C0ZA 3EGUA 4EMKA 1W1FA 1VQ8A 1ZQ1A 2O9SA 3J81E 2GTJA 4Y28E 2KR3A 4QT7A 2QAZA 3CCEQ 4DQ2A 3TSWA 3H41A 4KULA 5A0LA 2DZ9A 3CC4A 1JJ2P 3JAME 3N5BB 2DTOA 2JN0A 2PZ1A 4BY6B 2DRMA 5CVIA 4BI4A 2XI9A 2FZKB 3MO8A 2DEUA 1VQNA 3QJYA 2H3EB 2PUOB 2XDDA 1M8MA 4DEYA 1BI0A 2PVOB 1SRLA 2VKNA 3UF4A 3UWNA 4JZ3A 8ATCB 1PWTA 1VQ6Q 4FSXA 4HKEA 2DE0X 2X9HA 3MEUA 1Z9QA 4VUBA 4HA8A 2BE9B 1VQ8T 4AFZC 4J7FA 4E6RA 2L2PA 1X2QA 2F1LA 3CC4T 3ZBDA 4AT1B 4O5VA 3ASKA 1QKXA 4IUTA 4A4HA 3CD6A 5CKBA 4J9EA 1CKAA 1U1SA 4J6YA 4OMLA 4WTOB 1Y7XA 1VQNT 1Y57A 4J5YA 5AT1B 2RHZA 3FEOA 1M90U 2H3JA 3SB2A 2K5IA 2RQUA 3G71Q 3ZL7C 3PVQA 2NUPA 2CSIA 4OMNA 4QVCA 1NJIU 3L2VA 3QWYA 4UC4A 4M7DB 3SWNA 2ZPGB 2DXBA 3CBPA 1QVGS 1N9RA 1K9MU 4E7ZA 1YP5A 3PNWC 1U06A 1RI0A 2QASA 1VQ7Q 1WHHA 2CP2A 3OW2S 4F7UF 2CYZB 3NTIA 3CD6T 2E5KA 3FIFA 1Q7YC 3VS4A 3TCJA 4F7UG 5IHIA 1GFCA 1OU8A 1SEMA 4J9GA 3JB9J 5FROA 4PLIA 2X4YA 1O75A 4RUGA 4RMOA 4FYWB 3OYGA 2RB6A 3PIPA 4PFPA 1OZ3A 2DVJA 3EFSA 3A8GB 2DPPB 3JCMc 1IXDA 4GLMA 1BI2A 3LGLA 4PL6A 1WXBA 4M7AF 2LCSA 1IZ6A 2RQWA 1WHJA 1UTIA 1QVGP 3CPWA 4XU3A 1VQKA 3EGXA 5D6YA 4OGEA 1TOVA 2YRDA 4AG2C 4XU2A 1M1KU 3RESA 2BZXA 1YI2Q 2DETA 1SSFA 1Z9ZA 3LW5E 3F70A 1W70A 3BDUA 2QDYB 4J8OA 5GANj 2EJGA 4C8QF 3THKA 3E2UA 2OTLQ 2RHIA 3I56A 1YCSB 2FB7A 1M5Q1 3VS3A 1BIBA 3RKWA 2JS0A 2OAUA 4JJNK 2PU9B 1XQHA 4A4GA 1NEGA 5GJWB 1IO6A 1VIEA 3RNJA 2A37A 2RNAA 2V1QA 3DKMA 5GMKe 3H0HA 1VQKT 5GAN6 1VQ5Q 4J6WA 2KGTA 1SRMA 1BKBA 1MNEA 1D1BA 4PKCC 3I35A 1YJNQ 3JCMQ 1Y0MA 3OYCA 4PFZA 5M9OA 2DM1A 4LDUA 2D9TA 1X6BA 3RIRA 4EMKB 2HSPA 3BFMA 3I56T 1QW1A 1UFFA 2RH2A 2OTJA 4E7JA 4RTUA 1BIAA 2W10A 2DJQA 4M78D 5KYXA 2E70A 5D7UA 2DXCA 2WACA 2JVVA 2KT1A 1MNDA 3I5SA 1S72Q 4OB3B 3VS1A 2XDPA 3LWHA 1SHFA 3OYLA 1TWBA 1WHMA 2EFIA 3OMCA 3FJ5A 4DBFA 1IGQA 1IRXA 4A4KA 3DLLA 1RACB 1Q7YR 3LH5A 1LCKA 2C0TA 3CC7T 3L2WA 4DA4A 1MV3A 2NUZA 4E7LA 3PTAA 4L6V5 4PNOA 1W2BS 3M58A 1HJDA 1R77A 1FMWA 2L3PA 2DLPA 2LP5A 1RAFB 2QYZA 1X43A 3PMIA 1DJ7B 2DL3A 4BI8B 1VQOQ 4M7DG 2O88A 3QYHB 1BB9A 2IG0A 1BU1A 1HD3A 2EW3A 1M1GA 2B8AA 4OGCA 2G3RA 2JMAA 2EQJA 2LQWA 2QQ9A 2VV5A 3EG1A 2GF7A 4CRIA 3TU4K 3J7AF 4M75F 3SWNB 3JB9H 2XKOC 3FDRA 1S1NA 3KUFA 1R8OB 2HZYA 4LNPA 4M77E 5J26A 3QUIA 3QDRB 1W2BP 4A53A 2QG9B 1NBEB 2DBMA 2CREA 2LTOA 3QWXX 2RK1A 2CP5A 2AHJB 2VGMA 4EIKA 3EFRA 2K3BA 1OZ2A 4TVRA 4X9CA 2JW4A 9ATCB 4PJOF 3OBYA 1WJRA 3U23A 1BCMA 1UGVA 3MEVA 1LVKA 3PIOA 3VS5A 2J7IA 1VQLA 3X25B 1QQJA 3OYFA 3A1PA 3CCLA 5A0GA 3A5ZB 3QYGB 2MK5A 1TUGB 3DB4A 2KYMA 4CC4B 4M78A 3A8HB 2R5MA 1ARKA 2EQIA 1VUBA 1G3TA 3C4SA 3G4SA 2ESWA 3EGXB 4JDSA 5GAN3 2XMFA 1K1ZA 5FW9A 1GXIE 2DZCA 3CCUQ 3JCMP 2Y4YA 2WSEE 2LC4A 3VS7A 2XK0A 2MF2A 3HP9A 2LDMA 4LE9A 1QLYA 1VQPA 2DIGA 1K8AC 5IT9E 2CUDA 1VQLT 4M7AC 4C0DB 2NUTB 3CCLT 4QQGA 2EPDA 2RJEA 4MDWA 2JTMA 1YNZA 1M2VB 1H8KA 4V2SA 1B34A 4ZGEB 3CBMA 4F04B 3G4ST 3GLXA 2QEXQ 1PHTA 4BI3A 1GL5A 5FU7C 1KFZA 5J3BA 4C8QC 1YJWQ 5GMKh 3HRSA 2LJ0A 2K3YA 1M4ZA 3A8OB 3M5AA 1BI1A 5GAOn 3SFMA 3M54A 3FLGA 5A0DA 2AT1B 2CKKA 2HQEA 3RUXA 1WQWA 1VQPT 1M3AA 4RG8A 1MV0B 3QPHA 1X6GA 1SPKA 1R0CB 4ZNXA 5KYXB 3CCSA 2BZ8A 2BUDA 1EX4A 2ZPBB 3QXEB 3PVLA 3QO3A 2CDTA 2DFUA 3M0RA 3UT1A 1VQ4A 2F2WA 2YLCA 2OAWA 2MWPA 2JNGA 4PLLA 4J9FA 5CQYA 4XTVA 2VYTA 4BE1A 3WXMB 3WVDB 3G6ET 4E7IA 3S3NA 5GAMg 1YWPA 2OJ2A 4B6MA 3REAB 2DKGA 5IXBA 1Q81C 4MZTA 2J06A 4KUIA 2DTIA 1PM3A 1ZLMA 2O01E 2QI2A 1OPKA 2M16A 1D0XA 1VQ4T 1VQMA 3HSBA 1M2OA 2HDAA 3P8BB 2QQAA 3MP1A 5KE3A 3M0UA 3G1JA 5KCHA 3GIBA 4ME7A 5CIUA 4J9BA 5CKHA 1NPRA 1VQ9A 2KMTA 1MMAA 4Q5WA 1UEBA 1YIJA 3MKDA 5EC7A 1KQSA 3MEAA 3VUBA 3JCMW 1WJSA 3CCRQ 3JB9G 2KQWA 3E9GA 1QP2A 3CCMT 3RMQA 3GNFB 4GBQA 5C0MA 1VQMT 5FWBA 1JJ2A 4M75C 4AG1C 5I2SA 2FVUA 1IHWA 4FW2A 4F14A 1ACMB 3OA6A 1WXUA 2K9GA 2QA4A 1A0NB 1I5LA 1YIJT 1M8VA 2KRNA 1YITA 2CT4A 3BDLA 4M78B 1N5ZA 2RJCA 4PJOC 3NTHA 3SHWA 1J3TA 1Q86C 4F7UE 3VU3C 1U1TA 4OVAA 3V7SA 3GBQA 4RG2A 4RTVA 2A7YA 5KYWA 2DNUA 2CH4W 1WLPB 3OYDA 1OV3A 4NS5A 8AT1B 3OS1A 3SDZA 3JCMg 3P8HA 1AD5A 2DD5A 1VIFA 2YUNA 3EG0A 1UJYA 1WI7A 1AVZC 2YRVA 2OI3A 1U3OA 2QGGA 1QCFA 1YITT 3ZEHA 3L2ZA 2ATCB 1JB0E 1B34B 4NOYA 4M7AE 1WQ7A 3OQ5A 3SD4A 3NMZC 1AWXA 1RUWA 4LDXA 1CSKA 1YJ9Q 2P4TA 4CI0C 4C8QE 4J9DA 4GY5A 1JEGA 3V8JA 2EKOA 4OMQA 2ZAEA 4FIBA 4DBQA 4O6JA 1I5OB 2DBKA 5LJ3j 1T3LA 2BTTA 2A36A 4KGZB 4RCCA 1Q82C 2A08A 1FXXA 1PD0A 2A0FB 2CP6A 1KD1R 5GAMd 3CCQA 2RQRA 2D8JA 2E6NA 3LH0A 5CKEA 1K73C 4N4IA 2QK0A 2DRKA 2DL7A 2MMPA 4M77C 1IHVA 4FT2A 1RAEB 2ZZDA 3O5ZA 2GBQA 1QVGA 4X34A 2XDBA 4XTUA 1D09B 2SEMA 4BDZA 4QQ6A 1JQQA 2K5LA 3H0IA 2ED1A 3OW2A 2YLBA 2C06A 2M0YA 1E6HA 2G6FX 2RO0A 2VVKA 3NGPA 1D3BA 5GAN8 3CPFA 1N8RC 1T3SA 3OYAA 2RF0A 3V8LA 3CCEA 3M0PA 2RD1A 1AT1B 2DYIA 2GCXA 2MPXC 5DLOA 3CCQT 4L5GA 1D0ZA 3OYMA 3CMEQ 3CC7Q 1GCQC 4XTXA 4ZGDB 3AHUA 1H92A 1WIEA 2ABLA 3OSSC 3QKJA 4XK8E 2E12A 2FHDA 3DB3A 1U8RA 2RI3A 2PVDB 2P84A 5IHKA 2YDLA 1KC8C 1VQ6A 3REBB 4FSSA 1LOJA 1YWOA 3QBYA 3ER0A 1M90C 2AZSA 2GGRA 2MI6A 1HSQA 3A98A 3D7SB 2VWFA 1F1BB 1FYNA 3OW2P 1NJIC 2DL4A 2KY9A 3CCET 2HSEB 4XTWA 3MCAB 3VUZA 2CS7A 2WSCE 4M78F 5FU6C 4ELYC 1K9MC 2RM4A 3VV0A 5KYNA 2VGNA 1G3SA 4M78G 3I55Q 1ZBXA 3MPUB 2NUTA 4HCCA 1ZSZC 1D1CA 1RLPC 4M75E 1KJWA 3JV3A 3EGDA 1PD1A 5DY9A 1N9SA 3UA7A 1MGQA 1M2VA 3G71A 2QQSA 1AHJB 2E3HA 1M27C 2P0QA 1AWJA 3RDVA 1VQ6T 5HCKA 1UGSB 3JCMd 4IUQA 5GAOp 1PSEA 3S3MA 2EAYA 1VQ7A 4C92C 2FZGB 3GF5A 2AK5A 3EG3A 5KYWB 2KT8A 1Q95G 2LNHB 4XTYA 1Q82R 1QWFA 4PJOE 2HKQB 4FYXB 1VOMA 2GNCA 2BE7D 2PVGB 3A8LB 1JRIA 4K11A 4A4FA 4LN2A 3QHSA 1QWEA 4M7AD 4JS5A 2E4HA 3GP8A 1ZSGA 1K73R 1PKSA 2LQKA 2IPOB 1M1KC 5LJ3g 1B07A 3HHTB 3G71T 2P0KA 3KXTA 1TTHB 3VKIA 2E5QA 1E6GA 2CZ7B 3ME9A 4L59A 2KSSA 3OYBA 5CKDA 4FM4B 1GFDA 2J6FA 2EQMA 4M4ZA 5C6SA 4C8QD 1YHQQ 1M1FA 3CEYA 4OB2B 1VQ7T 4PFOA 4EDUA 3J80E 1W2BA 2DTHA 1N8RR 3JCMb 2C0OA 4J6XA 1V1CA 4HVUA 3MJXA 2DJZA 1HYOA 2DAQA 1QCNA 1YI2A 2OTJT 1G8XA 1TXQA 3PGGA 1I81A 5FRMA 1LNXA 2HBPA 2MWOA 3M4YA 4M7DF 5KCOA 1X27A 2DX1A 2OTLA 2HD0A 1QP3A 2FL7A 2Z0WA 1PC0A 4RTZA 2Y90A 2FRYA 1ZUYA 1RL2A 2XU8A 3G7ZA 3OYNA 1KC8R 2I0NA 1NZ9A 3ULRB 5GAMe 2LX9A 1MMGA 2RJDA 3V7RA 1K0XA 1TUCA 1W4SA 3JCMJ 1VQ5A 5IHNA 4JRKA 2JM9A 1WA7A 2E10A 4LUEA 1YJNA 1FWZA 1OX8A 2HMAA 1KQ1A 2EQKA 1MMDA 5LJ5j 2DL8A 5GAMf 3CCJQ 3JB9I 1D3BB 4PJLA 2OTLT 4LUDA 2EGAA 4RCBA 3HRUA 3E1SA 2KROA 2JOYA 5KH6A 4IUPA 2XIDA 2EGEA 2GFAA 3QG1A 2LJ3A 5GANg 2F2XA 1S72A 3KFVA 3G6EQ 2ROTA 2GQIA 3EG9A 2LMJA 4IKFA 2HNIA 5A2QE 3META 1EFNA 3CMAQ 1VQ5T 1IGUA 4XTZA 2QGFB 1YJNT 4M7AA 2YUPA 2JTFA 4N4GA 1V29B 4PK4A 2COWA 2E64A 3AT1B 1WHKA 2IIMA 2CH4A 2COYA 2NYSA 4A4EA 1OU9A 2K3XA 2O31A 2HQHA 4M75D 3LX7A 2CP3A 5LL6S 4D8DA 2JMCA 4RTWA 2YWWA 3JCMV 4J9IA 4XQ3A 1VQOA 3GOXA 4N0AC 1NYFA 2K2VA 4A63B 2RQTA 1X75C 2LT4A 3H6ZA 3CC2Q 3VYHB 3CQTA 3EGDB 2PUKB 1WJQA 2NWMA 1KSWA 4B9XA 1NEBA 1LPLA 2KAFA 4PJOD 3CCMQ 4KGXB 3A8MB 3PFSA 5L23A 2KEAA 1W6XA 2AKLA 4E7KA 4WCIA 4FYYB 2M02A 1KG1A 1HXDA 4AMCA 3LLRA 2C0IA 1MHNA 2D8HA 3INZA 4Z02A 1PKTA 2YXYA 3JCMe 1NG2A 2CP7A 5LJ3d 3RMSA 2O2OA 1UGQB 2V8IA 2WSFE 1VQOT 1RABB 3MHXA 2RHYA 2EYQA 4C92E 1ABQA 1QVFS 4BDYA 1ZA2B 4J7IA 4PJJA 3JCMf 2K7AA 1KIKA 4E2FB 3BW1A 4BY6C 3CCVQ 1MUZA 2L3SA 5HK0A 3Q1JA 2RQVA 4JRPA 5GAN4 3RR6A 3C94A 2ECZA 3RERA 1RAGB 3CXCS 4Y92A 1KD1U 2A28A 1UHCA 4R0KA 3I5RA 3TVTA 4Z88A 4ZGJB 1UHFA 4FYVB 4KRTA 2YUQA 3CCUA 4LD6A 5GMKl 1JU5C 1GCPA 2JT4A 4NL3A 4X1VA 4HT9A 2FPEA 1YITQ
chains in the Genus database with same CATH topology
2L3QA 3NMZC 1I0CA 2EVRA 1NEGA 5GJWB 1IO6A 1AWXA 1RUWA 1CSKA 2FG0A 3M0QA 3RNJA 2A37A 1OEBA 2RNAA 2KRMA 2V1QA 4J9DA 1UG1A 2FEIA 4JJBA 1ZBJA 3H0HA 1JEGA 4OMQA 2KGTA 1SRMA 2DBKA 2J6OA 2MCNA 1T3LA 2BTTA 1XOVA 2A36A 3I35A 1Y0MA 3TSZA 2DM1A 1X6BA 2AKKA 2EKHA 2A08A 2HSPA 4JJDA 2H8HA 2DA9A 1UFFA 2SRCA 2RQRA 4RTUA 2W10A 2D8JA 2DJQA 1AEYA 2J05A 2DMOA 2KE9A 2DL7A 2DRKA 1PNJA 2EYZA 1ABOA 2DILA 2KT1A 2GBQA 2M51A 3O5ZA 2D0NA 3EG2A 3I5SA 2SEMA 1T0JA 1BBZA 1M3BA 1JQQA 3H0IA 2ED1A 1PRLC 3VS1A 2W0ZA 1QKWA 1SHFA 2M0YA 1E6HA 2G6FX 2VVKA 3NGPA 4AFQC 4AFUC 3FJ5A 4CC3A 1T3SA 1VYVA 3LH5A 1LCKA 2RF0A 2C0TA 1MV3A 2DL5A 3M0PA 4RTTA 5FWCA 2NUZA 3RBBB 1M30A 1HJDA 2X3XD 2L3PA 3IQLA 2DLPA 2LP5A 1GCQC 1X43A 2O9VA 2LZ6B 2EYYA 4OMOA 1AZGB 1WIEA 1H92A 2ABLA 5IXFA 2PNIA 2MOXA 2DL3A 2O88A 1NLPC 1BB9A 1GBRA 1BU1A 5IHKA 1HD3A 2EW3A 2YDLA 1TUDA 3REBB 1AWWA 2JMAA 2JXBA 2LQWA 1T0HA 4FSSA 1YWOA 2AZSA 2GGRA 3EG1A 1HSQA 1SSHA 3A98A 3UATA 2VWFA 5ECAA 1AOJA 4HXJA 1FYNA 2DL4A 2RPNA 2RMOA 2YT6A 2KBTA 4OMMA 1G83A 2GTOA 1S1NA 2KRSA 4J9HA 1RLQC 1I07A 2AZVA 4LNPA 1VYTA 1VYUA 2ROLA 1ZUKA 1E7OA 2DBMA 2CREA 3I9QA 3C0CA 3QWXX 2FPDA 1RLPC 1KJWA 4EIKA 3JV3A 2K3BA 1GRIA 2RN8A 3UA7A 2JW4A 5IH2A 2MIOA 4HVWA 1ZUUA 2L0AA 1M3CA 1M27C 1AWJA 2FPFA 3U23A 1UGVA 2CT3A 5HCKA 1B3QA 2EYWA 3VS5A 2J7IA 1BK2A 4J9CA 2AK5A 3EG3A 4F16A 2KT8A 1K0SA 2LNHB 1QWFA 4Z89A 2KYMA 4CC4B 2YSQA 1ARKA 2EQIA 2GNCA 3M0SA 4K11A 4LN2A 2ESWA 1QWEA 1WDXA 2LX7A 2XMFA 1ZSGA 2DF6A 1PKSA 1K1ZA 4IIOA 5FW9A 1JXOA 3VS7A 1B07A 3VS6A 1SHGA 1K76A 4CC7A 1OPLA 2B86A 2FO0A 1E6GA 1GCQA 3NPFA 4LE9A 1QLYA 1GFDA 2J6FA 1UECA 4JJCA 4M4ZA 2CUDA 3VRZA 4DEXA 3UA6A 2EPDA 4Z8AA 5I11A 4JZ4A 1X69A 1YNZA 3EHQA 1H8KA 2C0OA 2HCKA 1V1CA 4HVUA 2K79A 1NLOC 2ENMA 1G2BA 2JS2A 2CSQA 4JPBW 1NM7A 1PHTA 1GL5A 1PRMC 1KFZA 1WYXA 2LJ0A 3PE0A 1X27A 2DX1A 2KYBA 2CUBA 3SEMA 1I1JA 4RTZA 4RTYA 1M3AA 5GJVB 2FRYA 1MV0B 1ZUYA 4HCKA 4IIMA 1X6GA 5I22A 2KXDA 4HVVA 1GBQA 1SPKA 2DYBA 2I0NA 4ZNXA 3ULRB 2JTEA 1WX6A 1AWOA 2BZ8A 1UDLA 3EGUA 1K0XA 1TUCA 2HBWA 3PVLA 1W1FA 2CDTA 5IHNA 3M0RA 2JM9A 1WA7A 2O9SA 4F17A 2F2WA 2LQNA 4LUEA 2GTJA 2KR3A 2OAWA 4QT7A 2DL8A 4J9FA 2K2MA 1X2KA 3TSWA 3H41A 4CC2A 2FRWA 2PZ1A 4LUDA 3R6NA 2EGAA 2HEQA 2DRMA 1JO8A 2KROA 1UE9A 1YWPA 2OJ2A 1CKBA 2EGEA 2X3WD 2LJ3A 3REAB 2F2XA 5IXBA 1M8MA 4DEYA 2J6KA 3KFVA 2J06A 2ROTA 3VS2A 1JXMA 1SRLA 2GQIA 2VKNA 3UF4A 2LMJA 2EBPA 4JZ3A 1ZLMA 1PWTA 3NHNA 1OPKA 1EFNA 2DE0X 1Z9QA 4RTXA 4AFZC 1K4US 1U5SA 1WXTA 2YUOA 4E6RA 2YUPA 2HDAA 2L2PA 4D8KA 2EYXA 3M0UA 1X2QA 2V1RA 1WFWA 2K6DA 1QKXA 4J9EA 4J9BA 1CKAA 2IIMA 2CH4A 4OMPA 2O31A 4OMLA 1OOTA 1NYGA 1Y57A 2PTKA 4D8DA 5EC7A 2JMCA 4RTWA 2QDLA 4J9IA 3H0FA 1NYFA 2RQUA 4A63B 2RQTA 3ZL7C 3PVQA 2CSIA 4OMNA 2JM8A 3EHRA 3QWYA 2ED0A 1UUEA 1K9AA 3CQTA 2P4RA 4GBQA 5FWBA 1YP5A 4AG1C 1U06A 2NWMA 1KSWA 1NEBA 5L23A 2KEAA 1W6XA 2AKLA 2E5KA 4WCIA 3VS4A 4F14A 5IHIA 2C0IA 1GFCA 2D8HA 2KXCA 1SEMA 4J9GA 1PKTA 1WXUA 2K9GA 1NG2A 1A0NB 1AZEA 1YN8A 2KRNA 2CT4A 2O2OA 4RUGA 2BZYA 1N5ZA 3SHWA 1ZX6A 1J3TA 1ABQA 3GBQA 1RI9A 4RTVA 2DVJA 2K7AA 3M0TA 1TG0A 2DNUA 2CH4W 3VS0A 1WLPB 1KIKA 4GLMA 1OV3A 1FMKA 1WXBA 2F2VA 1MUZA 2LCSA 2L3SA 2LJ1A 2RQWA 1UTIA 2RQVA 1AD5A 1UJ0A 2YUNA 3EG0A 1VA7A 2KNBB 4AG2C 1UJYA 1H3HA 2ECZA 1WI7A 4AFSC 1AVZC 4Y92A 2BZXA 2A28A 1Z9ZA 1U3OA 2D1XA 2OI3A 1W70A 4ESRA 1UHCA 4R0KA 3I5RA 1QCFA 4ORZA 3VRYA 3TVTA 2EGCA 4Z88A 1UHFA 4KRTA 2YUQA 3THKA 1JU5C 1YCSB 1GCPA 3VS3A 2JT4A 4X1VA 2JS0A 2FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3Q A;  3NMZ C;  1I0C A;  2EVR A;  1NEG A;  5GJW B;  1IO6 A;  1AWX A;  1RUW A;  1CSK A;  2FG0 A;  3M0Q A;  3RNJ A;  2A37 A;  1OEB A;  2RNA A;  2KRM A;  2V1Q A;  4J9D A;  1UG1 A;  2FEI A;  4JJB A;  1ZBJ A;  3H0H A;  1JEG A;  4OMQ A;  2KGT A;  1SRM A;  2DBK A;  2J6O A;  2MCN A;  1T3L A;  2BTT A;  1XOV A;  2A36 A;  3I35 A;  1Y0M A;  3TSZ A;  2DM1 A;  1X6B A;  2AKK A;  2EKH A;  2A08 A;  2HSP A;  4JJD A;  2H8H A;  2DA9 A;  1UFF A;  2SRC A;  2RQR A;  4RTU A;  2W10 A;  2D8J A;  2DJQ A;  1AEY A;  2J05 A;  2DMO A;  2KE9 A;  2DL7 A;  2DRK A;  1PNJ A;  2EYZ A;  1ABO A;  2DIL A;  2KT1 A;  2GBQ A;  2M51 A;  3O5Z A;  2D0N A;  3EG2 A;  3I5S A;  2SEM A;  1T0J A;  1BBZ A;  1M3B A;  1JQQ A;  3H0I A;  2ED1 A;  1PRL C;  3VS1 A;  2W0Z A;  1QKW A;  1SHF A;  2M0Y A;  1E6H A;  2G6F X;  2VVK A;  3NGP A;  4AFQ C;  4AFU C;  3FJ5 A;  4CC3 A;  1T3S A;  1VYV A;  3LH5 A;  1LCK A;  2RF0 A;  2C0T A;  1MV3 A;  2DL5 A;  3M0P A;  4RTT A;  5FWC A;  2NUZ A;  3RBB B;  1M30 A;  1HJD A;  2X3X D;  2L3P A;  3IQL A;  2DLP A;  2LP5 A;  1GCQ C;  1X43 A;  2O9V A;  2LZ6 B;  2EYY A;  4OMO A;  1AZG B;  1WIE A;  1H92 A;  2ABL A;  5IXF A;  2PNI A;  2MOX A;  2DL3 A;  2O88 A;  1NLP C;  1BB9 A;  1GBR A;  1BU1 A;  5IHK A;  1HD3 A;  2EW3 A;  2YDL A;  1TUD A;  3REB B;  1AWW A;  2JMA A;  2JXB A;  2LQW A;  1T0H A;  4FSS A;  1YWO A;  2AZS A;  2GGR A;  3EG1 A;  1HSQ A;  1SSH A;  3A98 A;  3UAT A;  2VWF A;  5ECA A;  1AOJ A;  4HXJ A;  1FYN A;  2DL4 A;  2RPN A;  2RMO A;  2YT6 A;  2KBT A;  4OMM A;  1G83 A;  2GTO A;  1S1N A;  2KRS A;  4J9H A;  1RLQ C;  1I07 A;  2AZV A;  4LNP A;  1VYT A;  1VYU A;  2ROL A;  1ZUK A;  1E7O A;  2DBM A;  2CRE A;  3I9Q A;  3C0C A;  3QWX X;  2FPD A;  1RLP C;  1KJW A;  4EIK A;  3JV3 A;  2K3B A;  1GRI A;  2RN8 A;  3UA7 A;  2JW4 A;  5IH2 A;  2MIO A;  4HVW A;  1ZUU A;  2L0A A;  1M3C A;  1M27 C;  1AWJ A;  2FPF A;  3U23 A;  1UGV A;  2CT3 A;  5HCK A;  1B3Q A;  2EYW A;  3VS5 A;  2J7I A;  1BK2 A;  4J9C A;  2AK5 A;  3EG3 A;  4F16 A;  2KT8 A;  1K0S A;  2LNH B;  1QWF A;  4Z89 A;  2KYM A;  4CC4 B;  2YSQ A;  1ARK A;  2EQI A;  2GNC A;  3M0S A;  4K11 A;  4LN2 A;  2ESW A;  1QWE A;  1WDX A;  2LX7 A;  2XMF A;  1ZSG A;  2DF6 A;  1PKS A;  1K1Z A;  4IIO A;  5FW9 A;  1JXO A;  3VS7 A;  1B07 A;  3VS6 A;  1SHG A;  1K76 A;  4CC7 A;  1OPL A;  2B86 A;  2FO0 A;  1E6G A;  1GCQ A;  3NPF A;  4LE9 A;  1QLY A;  1GFD A;  2J6F A;  1UEC A;  4JJC A;  4M4Z A;  2CUD A;  3VRZ A;  4DEX A;  3UA6 A;  2EPD A;  4Z8A A;  5I11 A;  4JZ4 A;  1X69 A;  1YNZ A;  3EHQ A;  1H8K A;  2C0O A;  2HCK A;  1V1C A;  4HVU A;  2K79 A;  1NLO C;  2ENM A;  1G2B A;  2JS2 A;  2CSQ A;  4JPB W;  1NM7 A;  1PHT A;  1GL5 A;  1PRM C;  1KFZ A;  1WYX A;  2LJ0 A;  3PE0 A;  1X27 A;  2DX1 A;  2KYB A;  2CUB A;  3SEM A;  1I1J A;  4RTZ A;  4RTY A;  1M3A A;  5GJV B;  2FRY A;  1MV0 B;  1ZUY A;  4HCK A;  4IIM A;  1X6G A;  5I22 A;  2KXD A;  4HVV A;  1GBQ A;  1SPK A;  2DYB A;  2I0N A;  4ZNX A;  3ULR B;  2JTE A;  1WX6 A;  1AWO A;  2BZ8 A;  1UDL A;  3EGU A;  1K0X A;  1TUC A;  2HBW A;  3PVL A;  1W1F A;  2CDT A;  5IHN A;  3M0R A;  2JM9 A;  1WA7 A;  2O9S A;  4F17 A;  2F2W A;  2LQN A;  4LUE A;  2GTJ A;  2KR3 A;  2OAW A;  4QT7 A;  2DL8 A;  4J9F A;  2K2M A;  1X2K A;  3TSW A;  3H41 A;  4CC2 A;  2FRW A;  2PZ1 A;  4LUD A;  3R6N A;  2EGA A;  2HEQ A;  2DRM A;  1JO8 A;  2KRO A;  1UE9 A;  1YWP A;  2OJ2 A;  1CKB A;  2EGE A;  2X3W D;  2LJ3 A;  3REA B;  2F2X A;  5IXB A;  1M8M A;  4DEY A;  2J6K A;  3KFV A;  2J06 A;  2ROT A;  3VS2 A;  1JXM A;  1SRL A;  2GQI A;  2VKN A;  3UF4 A;  2LMJ A;  2EBP A;  4JZ3 A;  1ZLM A;  1PWT A;  3NHN A;  1OPK A;  1EFN A;  2DE0 X;  1Z9Q A;  4RTX A;  4AFZ C;  1K4U S;  1U5S A;  1WXT A;  2YUO A;  4E6R A;  2YUP A;  2HDA A;  2L2P A;  4D8K A;  2EYX A;  3M0U A;  1X2Q A;  2V1R A;  1WFW A;  2K6D A;  1QKX A;  4J9E A;  4J9B A;  1CKA A;  2IIM A;  2CH4 A;  4OMP A;  2O31 A;  4OML A;  1OOT A;  1NYG A;  1Y57 A;  2PTK A;  4D8D A;  5EC7 A;  2JMC A;  4RTW A;  2QDL A;  4J9I A;  3H0F A;  1NYF A;  2RQU A;  4A63 B;  2RQT A;  3ZL7 C;  3PVQ A;  2CSI A;  4OMN A;  2JM8 A;  3EHR A;  3QWY A;  2ED0 A;  1UUE A;  1K9A A;  3CQT A;  2P4R A;  4GBQ A;  5FWB A;  1YP5 A;  4AG1 C;  1U06 A;  2NWM A;  1KSW A;  1NEB A;  5L23 A;  2KEA A;  1W6X A;  2AKL A;  2E5K A;  4WCI A;  3VS4 A;  4F14 A;  5IHI A;  2C0I A;  1GFC A;  2D8H A;  2KXC A;  1SEM A;  4J9G A;  1PKT A;  1WXU A;  2K9G A;  1NG2 A;  1A0N B;  1AZE A;  1YN8 A;  2KRN A;  2CT4 A;  2O2O A;  4RUG A;  2BZY A;  1N5Z A;  3SHW A;  1ZX6 A;  1J3T A;  1ABQ A;  3GBQ A;  1RI9 A;  4RTV A;  2DVJ A;  2K7A A;  3M0T A;  1TG0 A;  2DNU A;  2CH4 W;  3VS0 A;  1WLP B;  1KIK A;  4GLM A;  1OV3 A;  1FMK A;  1WXB A;  2F2V A;  1MUZ A;  2LCS A;  2L3S A;  2LJ1 A;  2RQW A;  1UTI A;  2RQV A;  1AD5 A;  1UJ0 A;  2YUN A;  3EG0 A;  1VA7 A;  2KNB B;  4AG2 C;  1UJY A;  1H3H A;  2ECZ A;  1WI7 A;  4AFS C;  1AVZ C;  4Y92 A;  2BZX A;  2A28 A;  1Z9Z A;  1U3O A;  2D1X A;  2OI3 A;  1W70 A;  4ESR A;  1UHC A;  4R0K A;  3I5R A;  1QCF A;  4ORZ A;  3VRY A;  3TVT A;  2EGC A;  4Z88 A;  1UHF A;  4KRT A;  2YUQ A;  3THK A;  1JU5 C;  1YCS B;  1GCP A;  3VS3 A;  2JT4 A;  4X1V A;  2JS0 A;  2FPE A; 
#chains in the Genus database with same CATH topology
 5LJ5 g;  2L3Q A;  3CCS T;  2L8D A;  2F69 A;  1I0C A;  4EMG A;  2NLU A;  2KDS A;  2JZ2 A;  2KRM A;  4ZN3 A;  1UG1 A;  4HT8 A;  1ZBJ A;  3M56 A;  1VQ8 Q;  4QW2 A;  4M77 D;  3JSC A;  2J6O A;  3QDF A;  4FCY A;  3OY9 A;  5GAM h;  2QEX A;  2EKH A;  1RAI B;  3CC4 Q;  4JJD A;  4M7D C;  5DM7 R;  1YJW A;  3ZFJ A;  4ZTJ A;  3CCU T;  1B7T A;  3JB9 F;  4N4H A;  2DER A;  5GAN d;  4DOV A;  4JUV A;  1RAD B;  1AEY A;  1VQN Q;  1K8A R;  4KUD K;  2EYZ A;  4BE0 A;  2MAM A;  3BE3 A;  2M51 A;  2CZ6 B;  3EG2 A;  4ATO A;  4QVD A;  4II1 A;  4NL2 A;  2R5A A;  4FU6 A;  3L1A A;  2I2L A;  3VJP A;  4PJO A;  2Y4X A;  1PRL C;  2LT1 A;  2RJF A;  2W0Z A;  2R58 A;  2K5F A;  1BI3 A;  5CAI A;  3EG9 B;  4AFU C;  3M57 A;  1VQ9 T;  4CC3 A;  2QEX T;  2RI5 A;  1OQK A;  3HFO A;  1WNL A;  4RTT A;  1X01 A;  3RBB B;  1YJW T;  1M30 A;  1H3Z A;  3CD6 Q;  2X3X D;  4M7A B;  2M0O A;  4MML A;  3LYI A;  5GMK m;  1AZG B;  2VXE A;  1PSF A;  5IXF A;  2MOX A;  4C0F A;  5L8R E;  1TSF A;  1NLP C;  1RAH B;  5FU7 B;  1YFN A;  2L89 A;  1GBR A;  4C8Q B;  2JXB A;  2EWN A;  3QJ6 A;  3H8Z A;  1AOJ A;  4HXJ A;  1Q82 U;  3C95 A;  2D0Q B;  2QA4 T;  2RMO A;  2YT6 A;  2K57 A;  2GTO A;  2KRS A;  5D6X A;  3UPU A;  4J9H A;  1I07 A;  3V7C A;  4ELZ C;  1C0M A;  5CKF A;  4YTL A;  1K73 U;  4ZN1 A;  1ZUK A;  1OUL A;  2VUB A;  3I9Q A;  1Q81 R;  3C0C A;  3HRT A;  4C92 D;  1G3W A;  4KT0 E;  1JBM A;  1RAA B;  2GFU A;  1GRI A;  1IB8 A;  2RN8 A;  3CCR A;  4PJM A;  1N6A A;  2D6F A;  5IH2 A;  2MIO A;  4HVW A;  2XHC A;  1M3C A;  3JCM h;  2M1H A;  4EMK C;  4M78 E;  4M77 A;  4HCB A;  5LJ3 e;  2ZPI B;  2R57 A;  1Q7Y U;  2EYW A;  1XNI A;  1N8R U;  2VAS A;  1BK2 A;  2P0P A;  4BD3 A;  4FL6 A;  3BY7 A;  2ZPE B;  1VQK Q;  1K0S A;  3E9F A;  2YRC A;  2ZGW A;  3WVE B;  2YSQ A;  5LJ3 f;  3M0S A;  1ZA1 B;  5CCA A;  2LX7 A;  4EMH A;  4OF1 A;  4IIO A;  2DF6 A;  1JXO A;  3KBG A;  5LJ5 d;  3I56 Q;  2LCL A;  3CCR T;  5D6W A;  1LJO A;  1SHG A;  1K76 A;  4CC7 A;  1KC8 U;  2FO0 A;  1GCQ A;  1UEC A;  2QQR A;  3QII A;  2L3R A;  3UA6 A;  2CZ1 B;  1SKU B;  2EJ9 A;  3CBO A;  1I4K 1;  3EHQ A;  5GAN 7;  1N27 A;  4C5H A;  1NLO C;  1Y71 A;  1O9S A;  2CSQ A;  4JPB W;  1NM7 A;  1PRM C;  1BYM A;  1WYX A;  2RA2 A;  2BKD N;  4P5N A;  4ANJ A;  2VB6 A;  4M75 B;  1Q86 R;  2KYB A;  2OTJ Q;  4PJN A;  2DXT A;  3HPW A;  3SWN C;  3RKY A;  5GJV B;  2F5K A;  3JRZ A;  1ZSZ A;  3X24 B;  4E7S A;  4HVV A;  2LCC A;  1GBQ A;  1YJ9 A;  4A54 A;  3OYY A;  1AWO A;  4LDW A;  4M7D E;  5GAN e;  5EG2 A;  5CK9 A;  3M55 A;  1D0Y A;  2HBW A;  2HAX A;  2X4X A;  2CZ0 B;  4PJO B;  4F17 A;  2LQN A;  2LVM A;  4M7A G;  4C92 A;  4CC2 A;  2K2M A;  1X2K A;  1M9S A;  3CPW S;  2DIQ A;  2FRW A;  5FRN A;  4LDV A;  5GAN f;  3R6N A;  2HEQ A;  1UGR B;  4WF2 A;  1JO8 A;  4DOW A;  1WPY A;  1UE9 A;  1CKB A;  4OB0 B;  2X3W D;  2O4X A;  1YJ9 T;  4C8Q G;  2J6K A;  5I21 A;  3VS2 A;  4BAC A;  1JXM A;  3UDC A;  4EPC A;  5KYY A;  4MDX A;  2EBP A;  5AYF A;  3NHN A;  1TS9 A;  2EQU A;  2DK3 A;  4RTX A;  5FLX E;  1K4U S;  1U5S A;  1WXT A;  1UGP B;  2YUO A;  5CR2 A;  1KK7 A;  3OYJ A;  4D8K A;  2EYX A;  4MZM A;  2V1R A;  1I8F A;  1WFW A;  2K6D A;  5GMK j;  4FW1 A;  4JRI A;  2X51 A;  3CPW P;  4OMP A;  5KYU A;  4C0D C;  5IN1 A;  3HKS A;  1OOT A;  3CME A;  3CC7 A;  2M9U A;  1NYG A;  5J39 A;  2PTK A;  1Y07 A;  2QDL A;  3MP8 A;  3H0F A;  3LWI A;  5I2M A;  2HL3 A;  4KGV B;  4Y91 A;  2JM8 A;  3EHR A;  3OYE A;  1BCO A;  2ED0 A;  1UUE A;  1K9A A;  3E19 A;  2P4R A;  3X28 B;  1VQL Q;  2LQ8 A;  4M77 B;  3CCL Q;  1QVP A;  1Y96 A;  3TQ7 P;  4JRQ A;  5LJ3 h;  3G4S Q;  2KXC A;  1IRE B;  3CME T;  1AZE A;  3I55 A;  1YN8 A;  2RHU A;  4QQD A;  2K4Y A;  3OS5 A;  2BZY A;  2CP0 A;  3T9N A;  1ZX6 A;  4OMF B;  4IUV A;  4C5G A;  3GPL A;  1M90 R;  1VQP Q;  3EAE A;  1RI9 A;  3GNG A;  3M0T A;  1TG0 A;  2FZC B;  1X6O A;  3TRE A;  3VS0 A;  1NJI R;  4BB7 A;  3EH1 A;  1C1A A;  1V76 A;  1EZZ B;  1FMK A;  5LJ5 e;  2F2V A;  1R0B G;  2XIC A;  2LJ1 A;  1YI2 T;  3OMG A;  2QTV A;  3JCM X;  1K9M R;  1UJ0 A;  4F7U A;  1VA7 A;  1XTD A;  2KNB B;  2DVE A;  4OB1 B;  2NUP B;  1H3H A;  4AFS C;  2V8J A;  2D1X A;  5GAM j;  4KH1 B;  4RKU E;  3L2Q A;  4ESR A;  3I55 T;  4M75 G;  2V26 A;  4ORZ A;  3VRY A;  1FX7 A;  2EGC A;  2HL5 C;  5LJ5 f;  5GAO l;  3OBW A;  3M4G A;  1KHC A;  1K8A U;  3L2U A;  1YCY A;  3HFN A;  3VYG A;  6AT1 B;  1YBY A;  1SF9 A;  1PG5 B;  2FYK A;  4BE2 A;  3OSV A;  1QMC A;  4MMK A;  2EVR A;  3NTK A;  3P8D A;  5FU6 B;  2OX7 A;  4M7D D;  2FG0 A;  4N0A A;  1YHQ A;  3M0Q A;  1OEB A;  3CCS Q;  3V8K A;  2FEI A;  4JJB A;  4PJO G;  1ZSZ B;  2QXF A;  3RKX A;  2ZPF B;  3X26 B;  1VQ4 Q;  2MCN A;  2KVQ G;  1XOV A;  3TSZ A;  1TU0 B;  2X4J A;  2AKK A;  1OYX A;  4DBH A;  4C0G A;  1QCO A;  5GMK i;  4OP0 A;  1UB4 A;  5GAN h;  1M1K R;  2H8H A;  1H64 1;  2F5T X;  2DA9 A;  4C5E A;  4C8Q A;  4GLK A;  1S72 T;  2SRC A;  5GAO r;  4C92 B;  3EFO A;  2BIV A;  3OYI A;  3HTR A;  2J05 A;  2DMO A;  2KE9 A;  2X35 A;  1PNJ A;  1OI1 A;  1KHI A;  1ABO A;  2DIL A;  2D0N A;  3OB9 A;  1XJW B;  5HK3 A;  1YHQ T;  1T0J A;  2EIF A;  2IVW A;  1BBZ A;  3C12 A;  4XU1 A;  2DEQ A;  3QSU A;  1M3B A;  4ZTF A;  1MMN A;  4BUG A;  4LXC A;  4E47 A;  2E1H A;  1QKW A;  2O4X B;  5IAY A;  1WHL A;  1D1A A;  3PT9 A;  3H9N A;  1VQM Q;  4M78 C;  3S3O A;  5KYY B;  4AFQ C;  2DXU A;  2LNV A;  1VYV A;  2DD4 A;  2COZ A;  5DLQ E;  2DL5 A;  4JLG A;  5FWC A;  3CCJ A;  2GQV A;  2ZPH B;  1SG5 A;  1Q81 U;  5GAO m;  1VQ9 Q;  1HK9 A;  3IQL A;  1ZHI A;  1QVF A;  4IUU A;  3TEE A;  1YIJ Q;  4R55 A;  2O9V A;  2LZ6 B;  2AIR B;  2EYY A;  4OMO A;  2PNI A;  2EJF A;  5KYU B;  3G6E A;  4LD9 K;  1PCX A;  3X20 B;  2YHT A;  4M77 F;  1TUD A;  1AWW A;  4FT4 A;  1T0H A;  3CMA A;  4M77 G;  4QVZ A;  2E41 A;  3CXC A;  1SSH A;  3UAT A;  4E7H A;  5ECA A;  2E3I A;  2RPN A;  3LGF A;  2KBT A;  2RHX A;  3L42 A;  4OMM A;  1G83 A;  3CCJ T;  3PMT A;  2JUF A;  1RLQ C;  2E6Z A;  2HKN A;  4HCZ A;  4D6W A;  3OYH A;  2AZV A;  3M53 A;  1VYT A;  2VC8 A;  2XG8 D;  2QA4 Q;  1VYU A;  2ROL A;  2A3L A;  1E7O A;  1Y96 B;  3QZ9 B;  1C6V X;  5CQX A;  4M7D A;  2FPD A;  5GAO q;  2E65 A;  4MZP A;  1QVF P;  4C5I A;  2QTX A;  2V8K A;  3L2R A;  4KBM B;  1ZUU A;  2L0A A;  4DBR A;  2FPF A;  4XAX B;  1NPP A;  3CC2 A;  2VXF A;  4B9W A;  2CT3 A;  3CMA T;  1B3Q A;  3O8V A;  2LRQ A;  3MEW A;  5GAN 2;  4JLI A;  4M75 A;  4J9C A;  2XD0 A;  1EIF A;  2RK2 A;  4F16 A;  2KI7 A;  3FRN A;  3CCM A;  1FMV A;  1NE8 A;  4R56 A;  3CXC P;  2L5Q A;  4Z89 A;  5HKC A;  3OYK A;  4KH0 B;  2HQX A;  1Q86 U;  5LJ5 h;  5KE2 A;  1WDX A;  4F7U B;  2KK4 A;  3R6O A;  5HY6 A;  3QZ5 B;  1TH7 A;  7AT1 B;  1KD1 C;  3VS6 A;  3FB9 A;  2MYS A;  1OPL A;  3M59 A;  2B86 A;  1KQ2 A;  4JS4 A;  3NPF A;  3CC2 T;  3URG A;  2X4W A;  4J83 A;  1KQS S;  4JJC A;  3FJP A;  1WHG A;  3OS0 A;  3VRZ A;  2QQB A;  4DEX A;  2DO3 A;  4QKU A;  3DLM A;  3CCV A;  4LDY A;  3OS2 A;  4Z8A A;  3EH2 A;  5I11 A;  4JZ4 A;  1X69 A;  2PQW A;  3MP6 A;  2HCK A;  2K79 A;  2ENM A;  1G3Y A;  1JJ2 S;  1G2B A;  1G5V A;  2JS2 A;  2JJ9 A;  4C92 F;  3FC3 A;  4C92 G;  2ZCF B;  3PE0 A;  1OX9 A;  2CGH A;  1WGS A;  3CCQ Q;  2CUB A;  3SEM A;  1I1J A;  3HL8 A;  4RTY A;  5CO7 A;  4HCK A;  4IIM A;  5I22 A;  5GAN 5;  2KXD A;  2DYB A;  4XU0 A;  3EFO B;  3M9Q A;  2RI2 A;  2JTE A;  1WX6 A;  1P92 A;  1WZO A;  3CCV T;  4IUR A;  3JB9 D;  1KQS P;  3S6W A;  3NFC A;  1UDL A;  4X9D A;  4C0Z A;  3EGU A;  4EMK A;  1W1F A;  1VQ8 A;  1ZQ1 A;  2O9S A;  3J81 E;  2GTJ A;  4Y28 E;  2KR3 A;  4QT7 A;  2QAZ A;  3CCE Q;  4DQ2 A;  3TSW A;  3H41 A;  4KUL A;  5A0L A;  2DZ9 A;  3CC4 A;  1JJ2 P;  3JAM E;  3N5B B;  2DTO A;  2JN0 A;  2PZ1 A;  4BY6 B;  2DRM A;  5CVI A;  4BI4 A;  2XI9 A;  2FZK B;  3MO8 A;  2DEU A;  1VQN A;  3QJY A;  2H3E B;  2PUO B;  2XDD A;  1M8M A;  4DEY A;  1BI0 A;  2PVO B;  1SRL A;  2VKN A;  3UF4 A;  3UWN A;  4JZ3 A;  8ATC B;  1PWT A;  1VQ6 Q;  4FSX A;  4HKE A;  2DE0 X;  2X9H A;  3MEU A;  1Z9Q A;  4VUB A;  4HA8 A;  2BE9 B;  1VQ8 T;  4AFZ C;  4J7F A;  4E6R A;  2L2P A;  1X2Q A;  2F1L A;  3CC4 T;  3ZBD A;  4AT1 B;  4O5V A;  3ASK A;  1QKX A;  4IUT A;  4A4H A;  3CD6 A;  5CKB A;  4J9E A;  1CKA A;  1U1S A;  4J6Y A;  4OML A;  4WTO B;  1Y7X A;  1VQN T;  1Y57 A;  4J5Y A;  5AT1 B;  2RHZ A;  3FEO A;  1M90 U;  2H3J A;  3SB2 A;  2K5I A;  2RQU A;  3G71 Q;  3ZL7 C;  3PVQ A;  2NUP A;  2CSI A;  4OMN A;  4QVC A;  1NJI U;  3L2V A;  3QWY A;  4UC4 A;  4M7D B;  3SWN A;  2ZPG B;  2DXB A;  3CBP A;  1QVG S;  1N9R A;  1K9M U;  4E7Z A;  1YP5 A;  3PNW C;  1U06 A;  1RI0 A;  2QAS A;  1VQ7 Q;  1WHH A;  2CP2 A;  3OW2 S;  4F7U F;  2CYZ B;  3NTI A;  3CD6 T;  2E5K A;  3FIF A;  1Q7Y C;  3VS4 A;  3TCJ A;  4F7U G;  5IHI A;  1GFC A;  1OU8 A;  1SEM A;  4J9G A;  3JB9 J;  5FRO A;  4PLI A;  2X4Y A;  1O75 A;  4RUG A;  4RMO A;  4FYW B;  3OYG A;  2RB6 A;  3PIP A;  4PFP A;  1OZ3 A;  2DVJ A;  3EFS A;  3A8G B;  2DPP B;  3JCM c;  1IXD A;  4GLM A;  1BI2 A;  3LGL A;  4PL6 A;  1WXB A;  4M7A F;  2LCS A;  1IZ6 A;  2RQW A;  1WHJ A;  1UTI A;  1QVG P;  3CPW A;  4XU3 A;  1VQK A;  3EGX A;  5D6Y A;  4OGE A;  1TOV A;  2YRD A;  4AG2 C;  4XU2 A;  1M1K U;  3RES A;  2BZX A;  1YI2 Q;  2DET A;  1SSF A;  1Z9Z A;  3LW5 E;  3F70 A;  1W70 A;  3BDU A;  2QDY B;  4J8O A;  5GAN j;  2EJG A;  4C8Q F;  3THK A;  3E2U A;  2OTL Q;  2RHI A;  3I56 A;  1YCS B;  2FB7 A;  1M5Q 1;  3VS3 A;  1BIB A;  3RKW A;  2JS0 A;  2OAU A;  4JJN K;  2PU9 B;  1XQH A;  4A4G A;  1NEG A;  5GJW B;  1IO6 A;  1VIE A;  3RNJ A;  2A37 A;  2RNA A;  2V1Q A;  3DKM A;  5GMK e;  3H0H A;  1VQK T;  5GAN 6;  1VQ5 Q;  4J6W A;  2KGT A;  1SRM A;  1BKB A;  1MNE A;  1D1B A;  4PKC C;  3I35 A;  1YJN Q;  3JCM Q;  1Y0M A;  3OYC A;  4PFZ A;  5M9O A;  2DM1 A;  4LDU A;  2D9T A;  1X6B A;  3RIR A;  4EMK B;  2HSP A;  3BFM A;  3I56 T;  1QW1 A;  1UFF A;  2RH2 A;  2OTJ A;  4E7J A;  4RTU A;  1BIA A;  2W10 A;  2DJQ A;  4M78 D;  5KYX A;  2E70 A;  5D7U A;  2DXC A;  2WAC A;  2JVV A;  2KT1 A;  1MND A;  3I5S A;  1S72 Q;  4OB3 B;  3VS1 A;  2XDP A;  3LWH A;  1SHF A;  3OYL A;  1TWB A;  1WHM A;  2EFI A;  3OMC A;  3FJ5 A;  4DBF A;  1IGQ A;  1IRX A;  4A4K A;  3DLL A;  1RAC B;  1Q7Y R;  3LH5 A;  1LCK A;  2C0T A;  3CC7 T;  3L2W A;  4DA4 A;  1MV3 A;  2NUZ A;  4E7L A;  3PTA A;  4L6V 5;  4PNO A;  1W2B S;  3M58 A;  1HJD A;  1R77 A;  1FMW A;  2L3P A;  2DLP A;  2LP5 A;  1RAF B;  2QYZ A;  1X43 A;  3PMI A;  1DJ7 B;  2DL3 A;  4BI8 B;  1VQO Q;  4M7D G;  2O88 A;  3QYH B;  1BB9 A;  2IG0 A;  1BU1 A;  1HD3 A;  2EW3 A;  1M1G A;  2B8A A;  4OGC A;  2G3R A;  2JMA A;  2EQJ A;  2LQW A;  2QQ9 A;  2VV5 A;  3EG1 A;  2GF7 A;  4CRI A;  3TU4 K;  3J7A F;  4M75 F;  3SWN B;  3JB9 H;  2XKO C;  3FDR A;  1S1N A;  3KUF A;  1R8O B;  2HZY A;  4LNP A;  4M77 E;  5J26 A;  3QUI A;  3QDR B;  1W2B P;  4A53 A;  2QG9 B;  1NBE B;  2DBM A;  2CRE A;  2LTO A;  3QWX X;  2RK1 A;  2CP5 A;  2AHJ B;  2VGM A;  4EIK A;  3EFR A;  2K3B A;  1OZ2 A;  4TVR A;  4X9C A;  2JW4 A;  9ATC B;  4PJO F;  3OBY A;  1WJR A;  3U23 A;  1BCM A;  1UGV A;  3MEV A;  1LVK A;  3PIO A;  3VS5 A;  2J7I A;  1VQL A;  3X25 B;  1QQJ A;  3OYF A;  3A1P A;  3CCL A;  5A0G A;  3A5Z B;  3QYG B;  2MK5 A;  1TUG B;  3DB4 A;  2KYM A;  4CC4 B;  4M78 A;  3A8H B;  2R5M A;  1ARK A;  2EQI A;  1VUB A;  1G3T A;  3C4S A;  3G4S A;  2ESW A;  3EGX B;  4JDS A;  5GAN 3;  2XMF A;  1K1Z A;  5FW9 A;  1GXI E;  2DZC A;  3CCU Q;  3JCM P;  2Y4Y A;  2WSE E;  2LC4 A;  3VS7 A;  2XK0 A;  2MF2 A;  3HP9 A;  2LDM A;  4LE9 A;  1QLY A;  1VQP A;  2DIG A;  1K8A C;  5IT9 E;  2CUD A;  1VQL T;  4M7A C;  4C0D B;  2NUT B;  3CCL T;  4QQG A;  2EPD A;  2RJE A;  4MDW A;  2JTM A;  1YNZ A;  1M2V B;  1H8K A;  4V2S A;  1B34 A;  4ZGE B;  3CBM A;  4F04 B;  3G4S T;  3GLX A;  2QEX Q;  1PHT A;  4BI3 A;  1GL5 A;  5FU7 C;  1KFZ A;  5J3B A;  4C8Q C;  1YJW Q;  5GMK h;  3HRS A;  2LJ0 A;  2K3Y A;  1M4Z A;  3A8O B;  3M5A A;  1BI1 A;  5GAO n;  3SFM A;  3M54 A;  3FLG A;  5A0D A;  2AT1 B;  2CKK A;  2HQE A;  3RUX A;  1WQW A;  1VQP T;  1M3A A;  4RG8 A;  1MV0 B;  3QPH A;  1X6G A;  1SPK A;  1R0C B;  4ZNX A;  5KYX B;  3CCS A;  2BZ8 A;  2BUD A;  1EX4 A;  2ZPB B;  3QXE B;  3PVL A;  3QO3 A;  2CDT A;  2DFU A;  3M0R A;  3UT1 A;  1VQ4 A;  2F2W A;  2YLC A;  2OAW A;  2MWP A;  2JNG A;  4PLL A;  4J9F A;  5CQY A;  4XTV A;  2VYT A;  4BE1 A;  3WXM B;  3WVD B;  3G6E T;  4E7I A;  3S3N A;  5GAM g;  1YWP A;  2OJ2 A;  4B6M A;  3REA B;  2DKG A;  5IXB A;  1Q81 C;  4MZT A;  2J06 A;  4KUI A;  2DTI A;  1PM3 A;  1ZLM A;  2O01 E;  2QI2 A;  1OPK A;  2M16 A;  1D0X A;  1VQ4 T;  1VQM A;  3HSB A;  1M2O A;  2HDA A;  3P8B B;  2QQA A;  3MP1 A;  5KE3 A;  3M0U A;  3G1J A;  5KCH A;  3GIB A;  4ME7 A;  5CIU A;  4J9B A;  5CKH A;  1NPR A;  1VQ9 A;  2KMT A;  1MMA A;  4Q5W A;  1UEB A;  1YIJ A;  3MKD A;  5EC7 A;  1KQS A;  3MEA A;  3VUB A;  3JCM W;  1WJS A;  3CCR Q;  3JB9 G;  2KQW A;  3E9G A;  1QP2 A;  3CCM T;  3RMQ A;  3GNF B;  4GBQ A;  5C0M A;  1VQM T;  5FWB A;  1JJ2 A;  4M75 C;  4AG1 C;  5I2S A;  2FVU A;  1IHW A;  4FW2 A;  4F14 A;  1ACM B;  3OA6 A;  1WXU A;  2K9G A;  2QA4 A;  1A0N B;  1I5L A;  1YIJ T;  1M8V A;  2KRN A;  1YIT A;  2CT4 A;  3BDL A;  4M78 B;  1N5Z A;  2RJC A;  4PJO C;  3NTH A;  3SHW A;  1J3T A;  1Q86 C;  4F7U E;  3VU3 C;  1U1T A;  4OVA A;  3V7S A;  3GBQ A;  4RG2 A;  4RTV A;  2A7Y A;  5KYW A;  2DNU A;  2CH4 W;  1WLP B;  3OYD A;  1OV3 A;  4NS5 A;  8AT1 B;  3OS1 A;  3SDZ A;  3JCM g;  3P8H A;  1AD5 A;  2DD5 A;  1VIF A;  2YUN A;  3EG0 A;  1UJY A;  1WI7 A;  1AVZ C;  2YRV A;  2OI3 A;  1U3O A;  2QGG A;  1QCF A;  1YIT T;  3ZEH A;  3L2Z A;  2ATC B;  1JB0 E;  1B34 B;  4NOY A;  4M7A E;  1WQ7 A;  3OQ5 A;  3SD4 A;  3NMZ C;  1AWX A;  1RUW A;  4LDX A;  1CSK A;  1YJ9 Q;  2P4T A;  4CI0 C;  4C8Q E;  4J9D A;  4GY5 A;  1JEG A;  3V8J A;  2EKO A;  4OMQ A;  2ZAE A;  4FIB A;  4DBQ A;  4O6J A;  1I5O B;  2DBK A;  5LJ3 j;  1T3L A;  2BTT A;  2A36 A;  4KGZ B;  4RCC A;  1Q82 C;  2A08 A;  1FXX A;  1PD0 A;  2A0F B;  2CP6 A;  1KD1 R;  5GAM d;  3CCQ A;  2RQR A;  2D8J A;  2E6N A;  3LH0 A;  5CKE A;  1K73 C;  4N4I A;  2QK0 A;  2DRK A;  2DL7 A;  2MMP A;  4M77 C;  1IHV A;  4FT2 A;  1RAE B;  2ZZD A;  3O5Z A;  2GBQ A;  1QVG A;  4X34 A;  2XDB A;  4XTU A;  1D09 B;  2SEM A;  4BDZ A;  4QQ6 A;  1JQQ A;  2K5L A;  3H0I A;  2ED1 A;  3OW2 A;  2YLB A;  2C06 A;  2M0Y A;  1E6H A;  2G6F X;  2RO0 A;  2VVK A;  3NGP A;  1D3B A;  5GAN 8;  3CPF A;  1N8R C;  1T3S A;  3OYA A;  2RF0 A;  3V8L A;  3CCE A;  3M0P A;  2RD1 A;  1AT1 B;  2DYI A;  2GCX A;  2MPX C;  5DLO A;  3CCQ T;  4L5G A;  1D0Z A;  3OYM A;  3CME Q;  3CC7 Q;  1GCQ C;  4XTX A;  4ZGD B;  3AHU A;  1H92 A;  1WIE A;  2ABL A;  3OSS C;  3QKJ A;  4XK8 E;  2E12 A;  2FHD A;  3DB3 A;  1U8R A;  2RI3 A;  2PVD B;  2P84 A;  5IHK A;  2YDL A;  1KC8 C;  1VQ6 A;  3REB B;  4FSS A;  1LOJ A;  1YWO A;  3QBY A;  3ER0 A;  1M90 C;  2AZS A;  2GGR A;  2MI6 A;  1HSQ A;  3A98 A;  3D7S B;  2VWF A;  1F1B B;  1FYN A;  3OW2 P;  1NJI C;  2DL4 A;  2KY9 A;  3CCE T;  2HSE B;  4XTW A;  3MCA B;  3VUZ A;  2CS7 A;  2WSC E;  4M78 F;  5FU6 C;  4ELY C;  1K9M C;  2RM4 A;  3VV0 A;  5KYN A;  2VGN A;  1G3S A;  4M78 G;  3I55 Q;  1ZBX A;  3MPU B;  2NUT A;  4HCC A;  1ZSZ C;  1D1C A;  1RLP C;  4M75 E;  1KJW A;  3JV3 A;  3EGD A;  1PD1 A;  5DY9 A;  1N9S A;  3UA7 A;  1MGQ A;  1M2V A;  3G71 A;  2QQS A;  1AHJ B;  2E3H A;  1M27 C;  2P0Q A;  1AWJ A;  3RDV A;  1VQ6 T;  5HCK A;  1UGS B;  3JCM d;  4IUQ A;  5GAO p;  1PSE A;  3S3M A;  2EAY A;  1VQ7 A;  4C92 C;  2FZG B;  3GF5 A;  2AK5 A;  3EG3 A;  5KYW B;  2KT8 A;  1Q95 G;  2LNH B;  4XTY A;  1Q82 R;  1QWF A;  4PJO E;  2HKQ B;  4FYX B;  1VOM A;  2GNC A;  2BE7 D;  2PVG B;  3A8L B;  1JRI A;  4K11 A;  4A4F A;  4LN2 A;  3QHS A;  1QWE A;  4M7A D;  4JS5 A;  2E4H A;  3GP8 A;  1ZSG A;  1K73 R;  1PKS A;  2LQK A;  2IPO B;  1M1K C;  5LJ3 g;  1B07 A;  3HHT B;  3G71 T;  2P0K A;  3KXT A;  1TTH B;  3VKI A;  2E5Q A;  1E6G A;  2CZ7 B;  3ME9 A;  4L59 A;  2KSS A;  3OYB A;  5CKD A;  4FM4 B;  1GFD A;  2J6F A;  2EQM A;  4M4Z A;  5C6S A;  4C8Q D;  1YHQ Q;  1M1F A;  3CEY A;  4OB2 B;  1VQ7 T;  4PFO A;  4EDU A;  3J80 E;  1W2B A;  2DTH A;  1N8R R;  3JCM b;  2C0O A;  4J6X A;  1V1C A;  4HVU A;  3MJX A;  2DJZ A;  1HYO A;  2DAQ A;  1QCN A;  1YI2 A;  2OTJ T;  1G8X A;  1TXQ A;  3PGG A;  1I81 A;  5FRM A;  1LNX A;  2HBP A;  2MWO A;  3M4Y A;  4M7D F;  5KCO A;  1X27 A;  2DX1 A;  2OTL A;  2HD0 A;  1QP3 A;  2FL7 A;  2Z0W A;  1PC0 A;  4RTZ A;  2Y90 A;  2FRY A;  1ZUY A;  1RL2 A;  2XU8 A;  3G7Z A;  3OYN A;  1KC8 R;  2I0N A;  1NZ9 A;  3ULR B;  5GAM e;  2LX9 A;  1MMG A;  2RJD A;  3V7R A;  1K0X A;  1TUC A;  1W4S A;  3JCM J;  1VQ5 A;  5IHN A;  4JRK A;  2JM9 A;  1WA7 A;  2E10 A;  4LUE A;  1YJN A;  1FWZ A;  1OX8 A;  2HMA A;  1KQ1 A;  2EQK A;  1MMD A;  5LJ5 j;  2DL8 A;  5GAM f;  3CCJ Q;  3JB9 I;  1D3B B;  4PJL A;  2OTL T;  4LUD A;  2EGA A;  4RCB A;  3HRU A;  3E1S A;  2KRO A;  2JOY A;  5KH6 A;  4IUP A;  2XID A;  2EGE A;  2GFA A;  3QG1 A;  2LJ3 A;  5GAN g;  2F2X A;  1S72 A;  3KFV A;  3G6E Q;  2ROT A;  2GQI A;  3EG9 A;  2LMJ A;  4IKF A;  2HNI A;  5A2Q E;  3MET A;  1EFN A;  3CMA Q;  1VQ5 T;  1IGU A;  4XTZ A;  2QGF B;  1YJN T;  4M7A A;  2YUP A;  2JTF A;  4N4G A;  1V29 B;  4PK4 A;  2COW A;  2E64 A;  3AT1 B;  1WHK A;  2IIM A;  2CH4 A;  2COY A;  2NYS A;  4A4E A;  1OU9 A;  2K3X A;  2O31 A;  2HQH A;  4M75 D;  3LX7 A;  2CP3 A;  5LL6 S;  4D8D A;  2JMC A;  4RTW A;  2YWW A;  3JCM V;  4J9I A;  4XQ3 A;  1VQO A;  3GOX A;  4N0A C;  1NYF A;  2K2V A;  4A63 B;  2RQT A;  1X75 C;  2LT4 A;  3H6Z A;  3CC2 Q;  3VYH B;  3CQT A;  3EGD B;  2PUK B;  1WJQ A;  2NWM A;  1KSW A;  4B9X A;  1NEB A;  1LPL A;  2KAF A;  4PJO D;  3CCM Q;  4KGX B;  3A8M B;  3PFS A;  5L23 A;  2KEA A;  1W6X A;  2AKL A;  4E7K A;  4WCI A;  4FYY B;  2M02 A;  1KG1 A;  1HXD A;  4AMC A;  3LLR A;  2C0I A;  1MHN A;  2D8H A;  3INZ A;  4Z02 A;  1PKT A;  2YXY A;  3JCM e;  1NG2 A;  2CP7 A;  5LJ3 d;  3RMS A;  2O2O A;  1UGQ B;  2V8I A;  2WSF E;  1VQO T;  1RAB B;  3MHX A;  2RHY A;  2EYQ A;  4C92 E;  1ABQ A;  1QVF S;  4BDY A;  1ZA2 B;  4J7I A;  4PJJ A;  3JCM f;  2K7A A;  1KIK A;  4E2F B;  3BW1 A;  4BY6 C;  3CCV Q;  1MUZ A;  2L3S A;  5HK0 A;  3Q1J A;  2RQV A;  4JRP A;  5GAN 4;  3RR6 A;  3C94 A;  2ECZ A;  3RER A;  1RAG B;  3CXC S;  4Y92 A;  1KD1 U;  2A28 A;  1UHC A;  4R0K A;  3I5R A;  3TVT A;  4Z88 A;  4ZGJ B;  1UHF A;  4FYV B;  4KRT A;  2YUQ A;  3CCU A;  4LD6 A;  5GMK l;  1JU5 C;  1GCP A;  2JT4 A;  4NL3 A;  4X1V A;  4HT9 A;  2FPE A;  1YIT Q; 
#chains in the Genus database with same CATH homology
 2L3Q A;  3NMZ C;  1I0C A;  2EVR A;  1NEG A;  5GJW B;  1IO6 A;  1AWX A;  1RUW A;  1CSK A;  2FG0 A;  3M0Q A;  3RNJ A;  2A37 A;  1OEB A;  2RNA A;  2KRM A;  2V1Q A;  4J9D A;  1UG1 A;  2FEI A;  4JJB A;  1ZBJ A;  3H0H A;  1JEG A;  4OMQ A;  2KGT A;  1SRM A;  2DBK A;  2J6O A;  2MCN A;  1T3L A;  2BTT A;  1XOV A;  2A36 A;  3I35 A;  1Y0M A;  3TSZ A;  2DM1 A;  1X6B A;  2AKK A;  2EKH A;  2A08 A;  2HSP A;  4JJD A;  2H8H A;  2DA9 A;  1UFF A;  2SRC A;  2RQR A;  4RTU A;  2W10 A;  2D8J A;  2DJQ A;  1AEY A;  2J05 A;  2DMO A;  2KE9 A;  2DL7 A;  2DRK A;  1PNJ A;  2EYZ A;  1ABO A;  2DIL A;  2KT1 A;  2GBQ A;  2M51 A;  3O5Z A;  2D0N A;  3EG2 A;  3I5S A;  2SEM A;  1T0J A;  1BBZ A;  1M3B A;  1JQQ A;  3H0I A;  2ED1 A;  1PRL C;  3VS1 A;  2W0Z A;  1QKW A;  1SHF A;  2M0Y A;  1E6H A;  2G6F X;  2VVK A;  3NGP A;  4AFQ C;  4AFU C;  3FJ5 A;  4CC3 A;  1T3S A;  1VYV A;  3LH5 A;  1LCK A;  2RF0 A;  2C0T A;  1MV3 A;  2DL5 A;  3M0P A;  4RTT A;  5FWC A;  2NUZ A;  3RBB B;  1M30 A;  1HJD A;  2X3X D;  2L3P A;  3IQL A;  2DLP A;  2LP5 A;  1GCQ C;  1X43 A;  2O9V A;  2LZ6 B;  2EYY A;  4OMO A;  1AZG B;  1WIE A;  1H92 A;  2ABL A;  5IXF A;  2PNI A;  2MOX A;  2DL3 A;  2O88 A;  1NLP C;  1BB9 A;  1GBR A;  1BU1 A;  5IHK A;  1HD3 A;  2EW3 A;  2YDL A;  1TUD A;  3REB B;  1AWW A;  2JMA A;  2JXB A;  2LQW A;  1T0H A;  4FSS A;  1YWO A;  2AZS A;  2GGR A;  3EG1 A;  1HSQ A;  1SSH A;  3A98 A;  3UAT A;  2VWF A;  5ECA A;  1AOJ A;  4HXJ A;  1FYN A;  2DL4 A;  2RPN A;  2RMO A;  2YT6 A;  2KBT A;  4OMM A;  1G83 A;  2GTO A;  1S1N A;  2KRS A;  4J9H A;  1RLQ C;  1I07 A;  2AZV A;  4LNP A;  1VYT A;  1VYU A;  2ROL A;  1ZUK A;  1E7O A;  2DBM A;  2CRE A;  3I9Q A;  3C0C A;  3QWX X;  2FPD A;  1RLP C;  1KJW A;  4EIK A;  3JV3 A;  2K3B A;  1GRI A;  2RN8 A;  3UA7 A;  2JW4 A;  5IH2 A;  2MIO A;  4HVW A;  1ZUU A;  2L0A A;  1M3C A;  1M27 C;  1AWJ A;  2FPF A;  3U23 A;  1UGV A;  2CT3 A;  5HCK A;  1B3Q A;  2EYW A;  3VS5 A;  2J7I A;  1BK2 A;  4J9C A;  2AK5 A;  3EG3 A;  4F16 A;  2KT8 A;  1K0S A;  2LNH B;  1QWF A;  4Z89 A;  2KYM A;  4CC4 B;  2YSQ A;  1ARK A;  2EQI A;  2GNC A;  3M0S A;  4K11 A;  4LN2 A;  2ESW A;  1QWE A;  1WDX A;  2LX7 A;  2XMF A;  1ZSG A;  2DF6 A;  1PKS A;  1K1Z A;  4IIO A;  5FW9 A;  1JXO A;  3VS7 A;  1B07 A;  3VS6 A;  1SHG A;  1K76 A;  4CC7 A;  1OPL A;  2B86 A;  2FO0 A;  1E6G A;  1GCQ A;  3NPF A;  4LE9 A;  1QLY A;  1GFD A;  2J6F A;  1UEC A;  4JJC A;  4M4Z A;  2CUD A;  3VRZ A;  4DEX A;  3UA6 A;  2EPD A;  4Z8A A;  5I11 A;  4JZ4 A;  1X69 A;  1YNZ A;  3EHQ A;  1H8K A;  2C0O A;  2HCK A;  1V1C A;  4HVU A;  2K79 A;  1NLO C;  2ENM A;  1G2B A;  2JS2 A;  2CSQ A;  4JPB W;  1NM7 A;  1PHT A;  1GL5 A;  1PRM C;  1KFZ A;  1WYX A;  2LJ0 A;  3PE0 A;  1X27 A;  2DX1 A;  2KYB A;  2CUB A;  3SEM A;  1I1J A;  4RTZ A;  4RTY A;  1M3A A;  5GJV B;  2FRY A;  1MV0 B;  1ZUY A;  4HCK A;  4IIM A;  1X6G A;  5I22 A;  2KXD A;  4HVV A;  1GBQ A;  1SPK A;  2DYB A;  2I0N A;  4ZNX A;  3ULR B;  2JTE A;  1WX6 A;  1AWO A;  2BZ8 A;  1UDL A;  3EGU A;  1K0X A;  1TUC A;  2HBW A;  3PVL A;  1W1F A;  2CDT A;  5IHN A;  3M0R A;  2JM9 A;  1WA7 A;  2O9S A;  4F17 A;  2F2W A;  2LQN A;  4LUE A;  2GTJ A;  2KR3 A;  2OAW A;  4QT7 A;  2DL8 A;  4J9F A;  2K2M A;  1X2K A;  3TSW A;  3H41 A;  4CC2 A;  2FRW A;  2PZ1 A;  4LUD A;  3R6N A;  2EGA A;  2HEQ A;  2DRM A;  1JO8 A;  2KRO A;  1UE9 A;  1YWP A;  2OJ2 A;  1CKB A;  2EGE A;  2X3W D;  2LJ3 A;  3REA B;  2F2X A;  5IXB A;  1M8M A;  4DEY A;  2J6K A;  3KFV A;  2J06 A;  2ROT A;  3VS2 A;  1JXM A;  1SRL A;  2GQI A;  2VKN A;  3UF4 A;  2LMJ A;  2EBP A;  4JZ3 A;  1ZLM A;  1PWT A;  3NHN A;  1OPK A;  1EFN A;  2DE0 X;  1Z9Q A;  4RTX A;  4AFZ C;  1K4U S;  1U5S A;  1WXT A;  2YUO A;  4E6R A;  2YUP A;  2HDA A;  2L2P A;  4D8K A;  2EYX A;  3M0U A;  1X2Q A;  2V1R A;  1WFW A;  2K6D A;  1QKX A;  4J9E A;  4J9B A;  1CKA A;  2IIM A;  2CH4 A;  4OMP A;  2O31 A;  4OML A;  1OOT A;  1NYG A;  1Y57 A;  2PTK A;  4D8D A;  5EC7 A;  2JMC A;  4RTW A;  2QDL A;  4J9I A;  3H0F A;  1NYF A;  2RQU A;  4A63 B;  2RQT A;  3ZL7 C;  3PVQ A;  2CSI A;  4OMN A;  2JM8 A;  3EHR A;  3QWY A;  2ED0 A;  1UUE A;  1K9A A;  3CQT A;  2P4R A;  4GBQ A;  5FWB A;  1YP5 A;  4AG1 C;  1U06 A;  2NWM A;  1KSW A;  1NEB A;  5L23 A;  2KEA A;  1W6X A;  2AKL A;  2E5K A;  4WCI A;  3VS4 A;  4F14 A;  5IHI A;  2C0I A;  1GFC A;  2D8H A;  2KXC A;  1SEM A;  4J9G A;  1PKT A;  1WXU A;  2K9G A;  1NG2 A;  1A0N B;  1AZE A;  1YN8 A;  2KRN A;  2CT4 A;  2O2O A;  4RUG A;  2BZY A;  1N5Z A;  3SHW A;  1ZX6 A;  1J3T A;  1ABQ A;  3GBQ A;  1RI9 A;  4RTV A;  2DVJ A;  2K7A A;  3M0T A;  1TG0 A;  2DNU A;  2CH4 W;  3VS0 A;  1WLP B;  1KIK A;  4GLM A;  1OV3 A;  1FMK A;  1WXB A;  2F2V A;  1MUZ A;  2LCS A;  2L3S A;  2LJ1 A;  2RQW A;  1UTI A;  2RQV A;  1AD5 A;  1UJ0 A;  2YUN A;  3EG0 A;  1VA7 A;  2KNB B;  4AG2 C;  1UJY A;  1H3H A;  2ECZ A;  1WI7 A;  4AFS C;  1AVZ C;  4Y92 A;  2BZX A;  2A28 A;  1Z9Z A;  1U3O A;  2D1X A;  2OI3 A;  1W70 A;  4ESR A;  1UHC A;  4R0K A;  3I5R A;  1QCF A;  4ORZ A;  3VRY A;  3TVT A;  2EGC A;  4Z88 A;  1UHF A;  4KRT A;  2YUQ A;  3THK A;  1JU5 C;  1YCS B;  1GCP A;  3VS3 A;  2JT4 A;  4X1V A;  2JS0 A;  2FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...