1KIKA

Sh3 domain of lymphocyte specific kinase (lck)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
NLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure determination of human Lck unique and SH3 domains by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
total genus 8
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kikA00
2JW4A 1UFFA 3A98A 2DL3A 1GBQA 2EQIA 1UUEA 4HVVA 3THKA 1J3TA 3M0PA 3UA7A 2KGTA 2VWFA 3I35A 2GTJA 2ROLA 2BZYA 3EG3A 2A08A 3O5ZA 3VS5A 3PVLA 1GL5A 4LUEA 1ZUYA 1WIEA 3RBBB 1M3AA 2JM8A 2BZXA 5I11A 3U23A 2GQIA 4A63B 1K4US 1OEBA 1BBZA 2HBWA 2LJ0A 2EKHA 4HVWA 1UGVA 2KXDA 1HD3A 1AOJA 3H0HA 2I0NA 1UE9A 1SSHA 1I07A 1YP5A 2KNBB 2O9VA 3UF4A 1ZUUA 5GJWB 4X1VA 1E6HA 3M0UA 1W1FA 2KROA 3ZL7C 3UA6A 2JMCA 4RTZA 5FWCA 2DMOA 1QWFA 2CUBA 5FWBA 1W70A 1JQQA 1AZGB 2A28A 1WDXA 1S1NA 2DBMA 4IIMA 4JPBW 1UG1A 2K79A 1V1CA 1TG0A 2LNHB 4J9IA 2EPDA 1I0CA 1MV0B 1VYVA 2JS2A 2RMOA 1YNZA 2D8HA 3KFVA 2CT3A 4AFSC 2YUPA 2KR3A 1PRLC 2P4RA 2HCKA 3VRZA 2G6FX 1SEMA 3NHNA 2ROTA 1HJDA 2ESWA 3EG1A 2NWMA 4RTYA 1ZX6A 1PWTA 1IO6A 1NYFA 2D1XA 2EYZA 2LCSA 1ARKA 2K9GA 1NEGA 5I22A 4AG1C 1T3LA 1OOTA 3PE0A 4ZNXA 1QWEA 1WXBA 2JT4A 3SHWA 2RQUA 1FMKA 2MCNA 4AFQC 2MOXA 2CDTA 4LN2A 1K0SA 5ECAA 1U5SA 1X2KA 4RTWA 2C0TA 1AVZC 2A37A 1N5ZA 2DRMA 3QWXX 3NPFA 1K1ZA 1YN8A 3QWYA 2HSPA 2XMFA 2CT4A 4HCKA 2FPFA 2CSQA 2CH4W 1AD5A 4F17A 2KYMA 1PKSA 1TUCA 2EGAA 1X6BA 2DJQA 2YSQA 3M0SA 4Z8AA 3H0IA 1M3BA 3VS3A 2J6FA 4OMPA 1WXUA 1U06A 1ABQA 2DL5A 2HDAA 4RTVA 4FSSA 4DEXA 4LNPA 2O9SA 2NUZA 1PKTA 3TSZA 2PNIA 1Y0MA 3EHQA 3TVTA 1HSQA 2DLPA 3M0TA 5IXFA 1I1JA 2J6OA 4OMQA 4R0KA 4AFZC 2SRCA 2F2VA 2W10A 1WI7A 2DBKA 2GBQA 2GGRA 3M0RA 1WA7A 1JEGA 2RPNA 1AWOA 1YWPA 4J9EA 1RUWA 4CC7A 2M51A 4IIOA 1UDLA 1PNJA 2AZVA 3PVQA 3RNJA 2O88A 4OMOA 1TUDA 2OI3A 3VS6A 1UECA 1SRMA 1H8KA 3VS1A 1UJYA 2AKLA 1QKWA 2RQVA 3EHRA 2D0NA 4JJBA 1BB9A 1AEYA 1WFWA 4ESRA 1GCQA 2DNUA 1LCKA 2OJ2A 1X6GA 4RUGA 4EIKA 1GCPA 1T3SA 2JS0A 2K7AA 4J9GA 2KRMA 2EBPA 4OMNA 1GCQC 2C0OA 4CC4B 3TSWA 2FPDA 2D8JA 4D8KA 1H92A 1XOVA 4KRTA 2FRWA 5L23A 4OMLA 4J9DA 1E7OA 2RF0A 2VVKA 2KRNA 1OV3A 2ENMA 1FYNA 1BK2A 1W6XA 2EYYA 1E6GA 4D8DA 1BU1A 1ZUKA 2PZ1A 2YUQA 3NGPA 3VS7A 1WLPB 1X43A 2YDLA 1MUZA 5FW9A 1CSKA 1RLQC 2JMAA 1JU5C 2LQNA 2RN8A 1RLPC 2GNCA 4J9HA 2KEAA 5IHIA 3VS0A 1OPLA 2QDLA 2L3QA 2AKKA 3VS2A 4CC2A 4HXJA 4AG2C 4GBQA 3SEMA 2IIMA 2DL8A 4RTXA 1MV3A 1WYXA 2EYWA 2CREA 2RQTA 4JJCA 2J7IA 2K2MA 3LH5A 1X2QA 2KYBA 4RTTA 1CKBA 1RI9A 4OMMA 2DX1A 2M0YA 1QCFA 1EFNA 2F2XA 2L3PA 3GBQA 4JJDA 1NLOC 1PHTA 2FRYA 3EG0A 1WXTA 1SHFA 1GRIA 4JZ3A 1CKAA 2LX7A 2B86A 2KT1A 4RTUA 1SPKA 3H41A 1KSWA 2KE9A 3UATA 3EG2A 2RNAA 2DYBA 2EGCA 3R6NA 4JZ4A 4Z89A 1QKXA 2KT8A 1JO8A 3H0FA 4F14A 3EGUA 2BTTA 1K76A 1M30A 3JV3A 2H8HA 3CQTA 3NMZC 4CC3A 2FO0A 2EYXA 1U3OA 2CH4A 4E6RA 1UHFA 2DILA 1AWXA 2FG0A 1NLPC 1NYGA 2RQRA 2V1QA 1UJ0A 4DEYA 2K6DA 1B07A 2W0ZA 4HVUA 1GFDA 1X69A 4K11A 5IH2A 2DVJA 2C0IA 2O2OA 1VYTA 3I9QA 3IQLA 1NEBA 2LQWA 4J9FA 1H3HA 2LJ1A 2E5KA 2LMJA 1AWJA 1X27A 1GBRA 1YCSB 5IHKA 1Z9QA 4WCIA 4ORZA 4J9BA 2VKNA 2V1RA 3FJ5A 1PRMC 1ZBJA 2X3WD 4LE9A 1G2BA 3I5SA 4AFUC 1AZEA 2J05A 1OPKA 2DRKA 3VRYA 2EGEA 2J6KA 2O31A 1Z9ZA 1WX6A 1KIKA 2DL4A 4Z88A 2AK5A 1VA7A 1G83A 1A0NB 2KBTA 1T0JA 1UTIA 1AWWA 3REBB 2MIOA 2OAWA 2DA9A 1M8MA 5EC7A 5GJVB 2BZ8A 4M4ZA 2KRSA 2JM9A 5IXBA 2YUNA 1KFZA 3ULRB 1ZLMA 2DE0X 2ED0A 3C0CA 3VS4A 5HCKA 2CSIA 3REAB 2HEQA 2SEMA 2EW3A 4GLMA 2X3XD 1B3QA 1KJWA 1ZSGA 1SHGA 4J9CA 2KXCA 2F2WA 2DM1A 2L0AA 4F16A 1UHCA 2PTKA 5IHNA 1K9AA 2AZSA 2ED1A 2GTOA 2YT6A 1JXOA 4QT7A 1GFCA 1T0HA 1K0XA 1NG2A 2J06A 2LZ6B 2YUOA 2DF6A 2FPEA 1M3CA 2ECZA 2RQWA 1SRLA 2L3SA 1M27C 3I5RA 2FEIA 2LJ3A 1JXMA 1YWOA 1NM7A 1QLYA 3M0QA 2JTEA 4Y92A 2K3BA 1Y57A 2JXBA 4LUDA 2A36A 2LP5A 1ABOA 2DL7A 2EVRA 2L2PA 2ABLA 2CUDA 1VYUA
chains in the Genus database with same CATH superfamily
3OB9A 3A98A 1TU0B 2EQIA 1UUEA 2P0KA 4HVVA 4E7JA 1K8AC 2EKOA 3EG9B 2KQWA 3M0PA 3UA7A 2GTJA 1Y96A 1NZ9A 1M90C 3EG3A 5LL6S 2A08A 5D6WA 4JRPA 1GL5A 4HCBA 1HYOA 4FYXB 2QA4T 3RBBB 3QUIA 2BZXA 3M5AA 3L2WA 1K4US 2EJFA 2HBWA 1Y96B 3V8KA 4MZPA 4E7LA 1SSHA 2QI2A 2YRDA 1BI0A 2X4JA 2XIDA 1ZSZB 3CC7T 1W1FA 1VQOQ 3ZL7C 1IHWA 2JMCA 3QYHB 4RTZA 6AT1B 5KH6A 3C94A 2DMOA 2FHDA 3A8HB 3MPUB 4KGVB 4XK8E 1B34B 1JQQA 4F04B 1VQ8Q 1ZSZA 2QQRA 2A28A 4QKUA 2YXYA 5A0GA 5KCOA 1G3WA 2DBMA 1G3TA 5A0LA 2QK0A 3MEWA 1MV0B 1R8OB 3KFVA 2D8HA 1ZBXA 2LQ8A 2YUPA 1YI2A 3CCLQ 2KR3A 1PRLC 2H3JA 4BDZA 1YITQ 3NHNA 2CS7A 2PVDB 3EG1A 2NWMA 1D0YA 5DLOA 1ZX6A 1V76A 4HT9A 1Q7YU 1NYFA 4ME7A 2EYZA 4PJOF 2QGGA 2LCSA 1D0ZA 4IUVA 3CBOA 1NEGA 5I22A 4FT4A 1OOTA 1QWEA 5HKCA 3HFOA 2RQUA 4DA4A 1FMKA 3NTHA 2MOXA 5GAMh 4LN2A 3E2UA 1VQNQ 1U5SA 3MJXA 9ATCB 4RTWA 1VQ6T 1AVZC 4NS5A 2Y90A 1I4K1 4AT1B 2C06A 2HQHA 3NPFA 2EFIA 3C4SA 3TQ7P 2HSPA 1M1GA 2XMFA 1RAIB 4ZN3A 3RERA 2FPFA 1VQ5T 2OTLA 2KYMA 3ZFJA 2DJQA 5CK9A 1MGQA 1Q95G 3RIRA 4Y91A 3VS3A 2LT4A 3LWHA 1ABQA 2RJFA 2HDAA 2ZPGB 4FSSA 3E9FA 2NUZA 1B34A 3CCVA 2DLPA 1AT1B 2J6OA 1VQ6A 4OMQA 4R0KA 4ATOA 4AFZC 2NUTA 3M59A 3CPWA 2ZPFB 4LDXA 1WA7A 2JTMA 2R5MA 1PCXA 1UGSB 4C8QE 2RPNA 3F70A 1YWPA 4CC7A 1VQ4A 2X9HA 2M51A 1VQMQ 4IIOA 3BE3A 3H8ZA 1YJ9Q 2OI3A 4C92D 2EWNA 2AKLA 1FWZA 1AHJB 4JJBA 1VQOT 1WHGA 1PM3A 2A0FB 2OAUA 4D6WA 3QJYA 5GANh 2XD0A 2OJ2A 1X6GA 4FSXA 5KYYB 3L2ZA 4J9GA 2KRMA 4KT0E 2EBPA 3L2UA 4OMNA 1S72Q 5CKDA 5GAN4 2C0OA 1IGQA 2MF2A 3CC4Q 3OYJA 3OSVA 2OTJA 2QA4Q 3CD6T 4J9DA 2RF0A 3HSBA 2VVKA 2KRNA 1FYNA 1BK2A 1E6GA 1BU1A 3LWIA 2PZ1A 2YDLA 4A54A 2IVWA 3VV0A 3I56A 4MMKA 5KYUB 1VIFA 4PJMA 2GNCA 2R57A 2ZPIB 5GANe 3CCQT 1KC8U 3OS2A 4LD6A 2AKKA 2RHXA 4V2SA 4LDWA 4XU3A 4E2FB 3PMIA 4HXJA 4RCCA 4GBQA 3SEMA 4ELZC 4RTXA 1N9SA 2MWOA 3ZEHA 2EYWA 5A0DA 2QEXQ 2K2MA 3PTAA 2BIVA 2KYBA 3CMAQ 3CCJT 1Q82R 1CKBA 1RI9A 1ZA1B 2EQJA 3JCMW 3VUBA 1D1CA 2M0YA 3RKYA 1EFNA 3GBQA 4C8QB 4BDYA 1NLOC 2XK0A 1KD1C 2M9UA 1QP2A 2FRYA 3EG0A 1GRIA 4J7IA 4JZ3A 1VQ8T 2OTLQ 2B86A 1YFNA 3CCST 4RTUA 5IT9E 1JB0E 3QXEB 3UATA 2KE9A 2DXCA 3EG2A 5KYXA 1VQPQ 3CC2A 2EGCA 2DZ9A 3R6NA 4JZ4A 1TOVA 2GQVA 4Z89A 3LX7A 4M75D 3GOXA 4F14A 3CC7Q 3EFSA 4JLGA 2BTTA 1IZ6A 5FROA 2FO0A 5KYXB 1M4ZA 5CQXA 2XICA 2KI7A 3VYHB 3QHSA 1YHQT 4HCZA 1NYGA 2QEXA 2VB6A 1M90U 2DTIA 2JN0A 4E47A 3OYBA 2W0ZA 4FT2A 3DLMA 4C5HA 2E41A 5IH2A 3CXCS 3OYEA 2GFAA 4JUVA 4J6YA 4RKUE 1BYMA 3CCUQ 3CCUA 4PL6A 3A8MB 3OYDA 1K9MR 1I81A 1FXXA 1Z9QA 3PIPA 3CMET 4JRKA 2ZPEB 3LGFA 5KYNA 2ZCFB 3G6ET 1UB4A 4EMKB 2J05A 1OI1A 2BUDA 5GAOn 3VRYA 4L59A 2EGEA 1WNLA 2J6KA 3HFNA 4C92G 5LJ5h 2KK4A 5CQYA 4Z88A 2BKDN 4C0GA 4E7IA 1VQPT 1G83A 2KBTA 1UTIA 3REBB 2X51A 2HQEA 1D0XA 2EIFA 3CCSQ 2OAWA 5LJ5d 2K3YA 4KULA 4L6V5 2LVMA 2Y4XA 4M7AC 2YUNA 1KFZA 3ULRB 1QVFP 1ZLMA 2DE0X 3G71Q 1QMCA 3C0CA 4OMFB 5HCKA 1Q81U 2SEMA 4X34A 3EFOA 2M02A 1B3QA 4QVDA 5LJ5f 2QXFA 3EAEA 2RHIA 2K5LA 2R58A 3L1AA 2GTOA 2ED1A 2YT6A 4A4FA 1JXOA 1KQ1A 2RJCA 3HL8A 4QT7A 4EMGA 3OBWA 4FW1A 4OF1A 1W2BS 4C0ZA 2LZ6B 2DF6A 3OS1A 2VXEA 4C5EA 2FPEA 1NJIR 1M3CA 2RQWA 3CMAA 3CCQQ 1YWOA 2LJ3A 2XDPA 2NLUA 4E7ZA 5DM7R 4EMKC 2JTEA 1BI1A 1Y57A 4LDVA 2LP5A 5GJVB 2DL7A 2L2PA 3CPWS 2NYSA 1UFFA 2HL5C 1GBQA 5I21A 3I55T 2HSEB 2ROLA 3S6WA 1M90R 2XHCA 1PSFA 3PVLA 5KYWA 2ATCB 4LUEA 1Q82C 1LOJA 3KUFA 4XTUA 2JM8A 4A4KA 3GP8A 2GQIA 4A63B 5KYYA 1PG5B 5CCAA 2KXDA 3CCMT 1OYXA 2MPXC 4HKEA 4Q5WA 3WVEB 1YP5A 1UGPB 2KNBB 2O9VA 4A4EA 4PJOB 3NTIA 2OTJT 4M78E 1E6HA 1Y71A 3M0UA 1NBEB 5EG2A 1QVGS 4QQDA 3JCMb 5FWCA 1YBYA 4PKCC 2FVUA 1VQKT 2CUBA 5GMKl 1YJ9T 5GMKh 2E6ZA 2YLBA 4R56A 4N4IA 2LX9A 4R55A 3M57A 2PQWA 2RM4A 1HK9A 1UG1A 2K79A 1V1CA 4AMCA 4DBRA 3RESA 2EQKA 2V8IA 1VYVA 2RK1A 2Y4YA 2E6NA 2P4RA 1VUBA 3VRZA 2G6FX 4ZGJB 2OX7A 2FB7A 3LLRA 2PU9B 2P0QA 1SEMA 1JJ2A 2ROTA 1YJNQ 3TCJA 1W4SA 2ESWA 2QAZA 5GAOq 4DQ2A 2V8KA 3X20B 1K8AR 4PLLA 4Y28E 3OA6A 1N8RU 1ARKA 4DBHA 1VQLA 3L2QA 1T3LA 2CZ1B 4F7UA 5HK3A 1RAFB 1VQ5Q 2LCCA 4KH1B 3SHWA 3JCMP 3UPUA 2DD4A 2DERA 1D09B 4AFQC 2XG8D 1FX7A 3ZBDA 1K0SA 2DTOA 5CAIA 1VQ7Q 3CMEQ 5KE3A 5GANj 1JJ2S 1IRXA 2AHJB 4M7AE 1N5ZA 5CKFA 4QQGA 2CP6A 1C1AA 2RH2A 4M7AG 1Y7XA 3NFCA 3G71A 4EPCA 5DLQE 5GAOm 2CSQA 2CH4W 1AD5A 2GCXA 4RMOA 1HXDA 3CXCA 4M78B 2X4XA 5GMKe 3G71T 1R0BG 2VGNA 1R77A 1XJWB 3SB2A 3X28B 1U06A 2PUOB 2WSCE 2YWWA 4RTVA 5CVIA 4DEXA 3X24B 4KBMB 1V29B 2MAMA 4QVZA 2PNIA 4MDWA 3EHQA 4BI4A 3M0TA 3J81E 1I1JA 3OYIA 2X4WA 2CYZB 3EH1A 3QKJA 4PJOD 2LRQA 3M0RA 2I2LA 4M77F 1KC8C 3PVQA 3RNJA 2O88A 4IUPA 1M1KU 1TUDA 3JAME 1H8KA 2KAFA 3VS1A 1UJYA 4XTYA 2YRCA 3BDLA 1BB9A 3WVDB 3OYFA 4ESRA 1GCQA 1RADB 3EGDB 4EIKA 2JS0A 2G3RA 2K7AA 1OX9A 2FPDA 1MMAA 4D8KA 1YHQQ 4OMLA 4OB3B 3NTKA 4B6MA 1K73U 4ELYC 3FEOA 3SWNC 3NGPA 4TVRA 4NL2A 4XU0A 1WLPB 1X43A 1D1BA 2CP0A 5FW9A 1CSKA 1YJ9A 2JNGA 4ZGDB 1K9MC 1RLQC 4EDUA 2LQNA 3EFOB 2DTHA 1EX4A 2RHUA 2E64A 3V8JA 3HRSA 1WZOA 2L3RA 2QQAA 4FYYB 4AG2C 1VOMA 3CC4T 2EAYA 3I56T 1WYXA 2RQTA 4JJCA 2J7IA 2XKOC 2DVEA 3LH5A 1X2QA 1PC0A 5GAMf 5IN1A 2VV5A 1QVFS 3ME9A 1M2VA 1PD0A 4OMMA 4M7DD 1KQSA 2D0QB 4JRQA 1QVGA 5GAMe 1TWBA 1N6AA 1WXTA 1Q86R 1CKAA 2KT1A 5GAMg 3JCMf 4EMHA 3G7ZA 4C0DB 1W2BP 2RHZA 2DEQA 2DKGA 1JO8A 3HPWA 2QA4A 4C8QD 4XQ3A 3CCRA 2RHYA 3OYAA 1WQWA 2QTVA 1S72A 2DILA 4M77D 3INZA 4M7DF 2LC4A 2FG0A 3DKMA 4PJOC 2PVOB 4J5YA 3G4SA 2V1QA 3L42A 2DFUA 1B07A 3FB9A 4PJNA 2DD5A 1KQ2A 1R0CB 3OYMA 1X69A 3MP6A 3CCQA 3JCMd 3OW2A 4M78D 4JLIA 2CZ7B 1VQLT 3OW2P 1VYTA 1KK7A 3I9QA 4IURA 2EQMA 1NEBA 1MMNA 5LJ3j 3C12A 4J9FA 2LJ1A 2E5KA 3V7SA 1IREB 2GFUA 3RUXA 3Q1JA 1VQMT 1UGRB 2BE7D 1NE8A 4ORZA 3I55A 1VQ6Q 4BACA 2COYA 4PNOA 4JS5A 4AFUC 2LDMA 4C8QA 4KUIA 1WX6A 1KIKA 2AK5A 4C5GA 2AT1B 2EQUA 1T0JA 1MNDA 1AWWA 2E1HA 4MZTA 2L8DA 1WHHA 3OBYA 2H3EB 5CKBA 4KUDK 3E1SA 5EC7A 3JSCA 2HL3A 4BD3A 2CP3A 2ED0A 2DXBA 4NL3A 2CSIA 2MWPA 5A2QE 3REAB 4M78A 4GLMA 3OYLA 3S3OA 1OZ2A 4J9CA 2KXCA 2XU8A 2L0AA 3JCMg 3CCLT 5GAN6 4MMLA 5IHNA 4M7AB 1K9AA 3JCMQ 3FDRA 5GANf 4M7AF 3RKWA 2HQXA 5FLXE 3CCLA 3JCMX 1M27C 3RDVA 1NM7A 2JVVA 2FZGB 1M2VB 4M7DC 3M0QA 4M7DE 4LUDA 2K3BA 2JXBA 3DB4A 2A36A 2DAQA 1VYUA 5KYWB 3QJ6A 1Q81C 5D6XA 1BKBA 3C95A 2V8JA 2OTJQ 2COZA 5GMKj 3THKA 1VQ8A 2NUPA 3OYCA 2A3LA 1YITA 3VJPA 3EGXB 4II1A 3VS5A 5GANg 4WTOB 2FZCB 4OP0A 1ZUYA 2P0PA 1W2BA 1OEBA 1BBZA 1YITT 2DIGA 2EKHA 1N8RR 1N27A 1AOJA 5GAOp 2F69A 2I0NA 4M77C 1I07A 2YHTA 1QVFA 2KVQG 2K3XA 1SKUB 3META 1TH7A 1JJ2P 3UA6A 3M55A 3FIFA 4GLKA 1QWFA 3HRUA 3CCMA 1AZGB 4FL6A 3CCVT 5LJ3e 3JB9I 3EFRA 4BE2A 5LJ3d 1VQPA 2P84A 1WHJA 4JPBW 2R5AA 1TG0A 2F5KA 2LQKA 3A8OB 2LNHB 1I0CA 2QGFB 1IB8A 3GLXA 4PJOG 2CT3A 1U1SA 4OB2B 1VQ9A 2HNIA 3CPFA 1Q7YC 4HT8A 1TXQA 3VYGA 4J83A 4RG8A 3M4GA 3PIOA 3OMCA 1KD1U 2MYSA 3PNWC 2FYKA 4PJLA 1IO6A 4FU6A 3QG1A 2D1XA 3VUZA 3MP8A 3QIIA 2K9GA 2QQ9A 5AT1B 4AG1C 1FMWA 1BCOA 1VQ4T 4ZNXA 1YIJT 4QQ6A 4F7UE 3QO3A 2CDTA 2QG9B 3VKIA 2C0TA 2CGHA 4XTVA 3OYKA 3OYYA 2A37A 2DRMA 4C92C 3QWXX 1K1ZA 3S3NA 2ZGWA 5LJ3g 2LT1A 4B9XA 5LJ5e 1ZHIA 1QCNA 3MEVA 3P8BB 2XDDA 4HCKA 3P8HA 2MMPA 2XI9A 1WHMA 3DB3A 5GAN5 3OY9A 4BI8B 3CCSA 1PKSA 1TUCA 2EGAA 3M0SA 4Z8AA 3H0IA 3JRZA 4NOYA 1KG1A 1LNXA 1KHIA 1M3BA 4L5GA 2J6FA 2JJ9A 3RMSA 2DL5A 1UGQB 4XTWA 4FCYA 1QVPA 1YJWT 4LNPA 3URGA 1PKTA 4FW2A 3TSZA 1Y0MA 3RKXA 3TVTA 3QZ5B 1HSQA 5IXFA 2F2VA 3A8LB 2W10A 2DBKA 2GBQA 2GGRA 2WSFE 1KQSP 3G6EA 1OQKA 2O01E 1RUWA 1YJWQ 5J3BA 2DYIA 1PNJA 2AZVA 3EGDA 4OMOA 3OQ5A 2COWA 3VS6A 1M2OA 4KH0B 1IXDA 3CCRT 1P92A 2LNVA 3CCUT 4OB1B 4N0AA 3PMTA 3EHRA 4RG2A 1WJRA 5GMKm 4F7UG 2VC8A 1WFWA 2F5TX 1BIAA 5LJ3f 1LCKA 4RUGA 3JCMc 3JB9G 1VQ7A 2K57A 4M77G 1T3SA 3J80E 1MHNA 1GCQC 4F7UB 2LTOA 4CC4B 4OGCA 2D8JA 4JS4A 2FRWA 5L23A 1I8FA 1E7OA 4IUQA 3GPLA 1OV3A 5GAMd 2EYYA 3L2RA 5CR2A 5FU7C 1ZUKA 2YUQA 3VS7A 3X25B 3FLGA 1TSFA 4J7FA 3UWNA 2QTXA 3J7AF 4DBQA 1QW1A 2KEAA 1VQNA 4JJNK 4E7SA 2QDLA 8ATCB 3QZ9B 2DO3A 2IPOB 2JTFA 1BI2A 3VS2A 4CC2A 3G1JA 2A7YA 2IIMA 3E19A 3MKDA 3OSSC 1SSFA 1S72T 5FU6B 1Q86U 2RO0A 3CMAT 5CIUA 5FRMA 2JZ2A 1KC8R 5D6YA 1G3SA 4PFPA 3LYIA 4XAXB 2DX1A 2KDSA 2L3PA 2L5QA 3KXTA 3M54A 1PHTA 1YI2Q 3OS0A 2LX7A 2WACA 2AIRB 2RB6A 1NJIU 4MDXA 1H641 1F1BB 1KSWA 4FYVB 1NPRA 1UEBA 3BDUA 4M77E 3M4YA 3TREA 3H0FA 4BE0A 1U1TA 1M30A 3JV3A 4F7UF 2H8HA 4HA8A 3KBGA 1U3OA 2CH4A 2VYTA 1UHFA 1VQOA 3CD6Q 4LD9K 2X4YA 4UC4A 2O4XA 3LH0A 2RQRA 4PJOE 5LJ5j 2PUKB 4M77A 1UJ0A 2K6DA 2GF7A 3JCMh 4C92A 3MEUA 1K9MU 1M1KR 4JRIA 4O5VA 2C0IA 1WJQA 5CKHA 1YJNA 3IQLA 4C92B 1H3HA 2LMJA 2DZCA 4M7DA 1RI0A 1YCSB 5IHKA 1FMVA 1IGUA 1Q81R 4WCIA 3S3MA 1NPPA 4C92E 2MK5A 1X75C 2V1RA 3FJ5A 2RD1A 4B9WA 2X3WD 5FU6C 2FL7A 1OPKA 2DRKA 1WPYA 3HTRA 4M75E 1Q86C 3LW5E 1YHQA 4M75C 2DL4A 2D9TA 1KQSS 5D7UA 2VASA 2K5IA 5KCHA 1N9RA 4J6WA 2DA9A 1M8MA 2BZ8A 2JM9A 3VU3C 5GMKi 4JDSA 2HMAA 4M7AA 2WSEE 3O8VA 2EW3A 4WF2A 2RA2A 1KJWA 1SHGA 3MP1A 2F2WA 2RI2A 3CBMA 2HZYA 3EGXA 4F16A 5GAN3 1RAGB 4PK4A 4ZGEB 2CP5A 3N5BB 3G6EQ 3GNGA 2DXUA 2HKNA 1K0XA 1PD1A 1NG2A 1SF9A 2PVGB 3JCMV 4EMKA 2E5QA 2KMTA 5KYUA 2L3SA 1JXMA 3OW2S 1X01A 1RACB 2X35A 5GAOr 1N8RC 4DOVA 4CRIA 3HKSA 4XTXA 4Y92A 4C8QG 1ABOA 2ABLA 2CUDA 4BY6B 2JW4A 2O4XB 2DL3A 1ACMB 4PFOA 1J3TA 4M78F 2KGTA 2VWFA 3I35A 2BZYA 4BE1A 3O5ZA 4LXCA 1G5VA 2HD0A 4M7AD 2L89A 1WIEA 2DPPB 3PFSA 4N4GA 1M3AA 3SFMA 3E9GA 5I11A 3JB9J 3U23A 3MEAA 2LJ0A 4M75G 4M78G 2KSSA 4HVWA 1UGVA 3JCMJ 1HD3A 1YCYA 1KD1R 3H0HA 1UE9A 3CCEA 2E70A 4BI3A 3CMEA 3UF4A 5J26A 1ZUUA 5GJWB 4X1VA 5HY6A 3EH2A 4Z02A 1D3BB 2KROA 3GNFB 2VUBA 3OS5A 1WHLA 5FWBA 1ZQ1A 3QPHA 1W70A 1VQ5A 2OTLT 2KY9A 3SD4A 1WDXA 1RAAB 1S1NA 4C0DC 1I5OB 2DK3A 4IIMA 1M8VA 4P5NA 2DEUA 3PT9A 1Q82U 1K8AU 1VIEA 4J9IA 2EPDA 3H9NA 1XNIA 2JS2A 2RMOA 1YNZA 4AFSC 3RMQA 4X9CA 1WHKA 2HCKA 2RI5A 1EZZB 1XTDA 2ZPHB 2DJZA 1H3ZA 5M9OA 3JB9H 3I56Q 1HJDA 4RTYA 1M5Q1 5CO7A 1YIJA 1PWTA 2EYQA 1QVGP 5AYFA 3UT1A 2QQBA 2NUPB 4E7KA 3PE0A 2E4HA 3V7CA 1M9SA 3CD6A 1WXBA 2JT4A 3CC4A 2JUFA 2LCLA 4IUUA 3G4ST 2MCNA 3M9QA 4DBFA 4M75F 5ECAA 3GIBA 1X2KA 3X26B 3CCJA 2BE9B 1VQ7T 3TU4K 5FRNA 1YN8A 3AT1B 3CC2Q 4OB0B 4FYWB 3QWYA 2CT4A 2RJEA 1EIFA 3AHUA 1YIJQ 2DIQA 3OMGA 4F17A 1VQ4Q 5C0MA 3MHXA 1SG5A 2DXTA 1LPLA 2YSQA 1X6BA 4IUTA 2E3IA 4XTZA 2CP2A 4FM4B 4C0FA 4A53A 1MNEA 1U8RA 4PFZA 4OMPA 3V8LA 1WXUA 3M58A 5FU7B 4YTLA 1YJNT 3QYGB 2VGMA 2O9SA 1RAHB 5KE2A 1LJOA 1VQKA 2SRCA 4ANJA 1WI7A 5HK0A 1RAEB 5I2MA 3MO8A 1JEGA 4C5IA 2E3HA 1AWOA 3OYGA 4DOWA 3HRTA 4J9EA 3CXCP 3CCET 2NUTB 2ZAEA 1UDLA 1VQ9T 1VQKQ 4FIBA 1UECA 1SRMA 4XU1A 4MZMA 2QQSA 1I5LA 1QKWA 2RQVA 2D0NA 3TEEA 4CI0C 1AEYA 3ASKA 4E7HA 3UDCA 2HAXA 1MMDA 4M7DB 1OU8A 2DNUA 2K4YA 2DETA 4BB7A 1GCPA 3CCMQ 5C6SA 1G8XA 1RL2A 2RK2A 1ZA2B 2K2VA 2B8AA 3TSWA 2QYZA 2JOYA 1H92A 1XOVA 4KRTA 4LDUA 3JB9F 4KGZB 4BY6C 3QBYA 1WGSA 2ENMA 4QVCA 1W6XA 1QCOA 4D8DA 4PLIA 4M75A 1VQNT 2Z0WA 5GAN7 4PJJA 5LJ5g 3I55Q 1MUZA 1BI3A 2IG0A 3T9NA 5IAYA 3OYNA 2JMAA 1JU5C 2RN8A 2MI6A 4C92F 1O9SA 1RLPC 4J9HA 5IHIA 3BW1A 3VS0A 1OPLA 2P4TA 4PJOA 2L3QA 1C0MA 1YI2T 1M1KC 5GAN8 1X6OA 3QDRB 5GAOl 2DL8A 1MV3A 3P8DA 3JB9D 2CREA 1K73R 1JBMA 1OULA 2HKQB 3QSUA 4M77B 4RTTA 4A4HA 3L2VA 3BFMA 5J39A 4XU2A 1QCFA 2F2XA 3A1PA 3H6ZA 4JJDA 3CCRQ 3LGLA 3CC7A 1SHFA 3QDFA 3FRNA 4OGEA 8AT1B 1SPKA 3CCEQ 3H41A 3OYHA 4KGXB 2E12A 1O75A 2DYBA 2RNAA 1QQJA 5GANd 1QKXA 4X9DA 2KT8A 2EJ9A 1NJIC 3SWNA 4C8QF 3EGUA 3BY7A 2QASA 1K76A 1TS9A 3R6OA 3JCMe 3V7RA 2EJGA 1BIBA 3CQTA 1KHCA 5L8RE 3NMZC 4CC3A 2EYXA 4E6RA 1IHVA 1PSEA 1AWXA 2M0OA 3SWNB 3RR6A 3D7SB 4ZN1A 1NLPC 2YLCA 1K73C 4GY5A 4BUGA 4DEYA 1G3YA 4QW2A 4HVUA 2E10A 1VQLQ 1GFDA 4K11A 1QP3A 1LVKA 2DVJA 2V26A 4M7DG 2O2OA 4M75B 4N4HA 4HCCA 1YJWA 2K5FA 2LQWA 1ZSZC 1Y07A 2CZ6B 3CC2T 3FC3A 1C6VX 3WXMB 1AWJA 2QDYB 1VQ9Q 1X27A 4A4GA 2CP7A 3GF5A 1GBRA 1WQ7A 4RCBA 3HP9A 3DLLA 4J9BA 2M16A 2VKNA 2CZ0B 2VXFA 1PRMC 1ZBJA 4LE9A 1G2BA 2FZKB 3I5SA 1AZEA 3M53A 4ZTJA 2CKKA 2M1HA 1RABB 2O31A 1Z9ZA 3G4SQ 3M56A 3SDZA 3CPWP 7AT1B 1VA7A 1A0NB 1Q7YR 4C8QC 1TUGB 2F1LA 4J6XA 4ZTFA 3MCAB 1WJSA 1D1AA 1GXIE 2MIOA 4VUBA 1M1FA 4M4ZA 2KRSA 5IXBA 2RI3A 3VS4A 4IKFA 1OU9A 2HBPA 2ZZDA 2HEQA 1JRIA 2X3XD 1OX8A 1ZSGA 2E65A 3A5ZB 3CCJQ 2DM1A 5GAN2 4N0AC 2XDBA 3HHTB 4OVAA 1VQMA 2YRVA 2ZPBB 4M78C 3PGGA 1OZ3A 2QEXT 1UHCA 2PTKA 5DY9A 2AZSA 3ER0A 5LJ3h 1XQHA 1DJ7B 1GFCA 1T0HA 3FJPA 4O6JA 5GAMj 2D6FA 2RJDA 1B7TA 3CBPA 2J06A 4J8OA 1D3BA 2YUOA 5I2SA 1TTHB 2ECZA 3CCVQ 1SRLA 1MMGA 3I5RA 1BCMA 2FEIA 4LDYA 3EG9A 3CEYA 1QLYA 5CKEA 2EVRA 3A8GB
chains in the Genus database with same CATH topology
2JW4A 1UFFA 3A98A 2DL3A 1GBQA 2EQIA 1UUEA 4HVVA 3THKA 1J3TA 3M0PA 3UA7A 2KGTA 2VWFA 3I35A 2GTJA 2ROLA 2BZYA 3EG3A 2A08A 3O5ZA 3VS5A 3PVLA 1GL5A 4LUEA 1ZUYA 1WIEA 3RBBB 1M3AA 2JM8A 2BZXA 5I11A 3U23A 2GQIA 4A63B 1K4US 1OEBA 1BBZA 2HBWA 2LJ0A 2EKHA 4HVWA 1UGVA 2KXDA 1HD3A 1AOJA 3H0HA 2I0NA 1UE9A 1SSHA 1I07A 1YP5A 2KNBB 2O9VA 3UF4A 1ZUUA 5GJWB 4X1VA 1E6HA 3M0UA 1W1FA 2KROA 3ZL7C 3UA6A 2JMCA 4RTZA 5FWCA 2DMOA 1QWFA 2CUBA 5FWBA 1W70A 1JQQA 1AZGB 2A28A 1WDXA 1S1NA 2DBMA 4IIMA 4JPBW 1UG1A 2K79A 1V1CA 1TG0A 2LNHB 4J9IA 2EPDA 1I0CA 1MV0B 1VYVA 2JS2A 2RMOA 1YNZA 2D8HA 3KFVA 2CT3A 4AFSC 2YUPA 2KR3A 1PRLC 2P4RA 2HCKA 3VRZA 2G6FX 1SEMA 3NHNA 2ROTA 1HJDA 2ESWA 3EG1A 2NWMA 4RTYA 1ZX6A 1PWTA 1IO6A 1NYFA 2D1XA 2EYZA 2LCSA 1ARKA 2K9GA 1NEGA 5I22A 4AG1C 1T3LA 1OOTA 3PE0A 4ZNXA 1QWEA 1WXBA 2JT4A 3SHWA 2RQUA 1FMKA 2MCNA 4AFQC 2MOXA 2CDTA 4LN2A 1K0SA 5ECAA 1U5SA 1X2KA 4RTWA 2C0TA 1AVZC 2A37A 1N5ZA 2DRMA 3QWXX 3NPFA 1K1ZA 1YN8A 3QWYA 2HSPA 2XMFA 2CT4A 4HCKA 2FPFA 2CSQA 2CH4W 1AD5A 4F17A 2KYMA 1PKSA 1TUCA 2EGAA 1X6BA 2DJQA 2YSQA 3M0SA 4Z8AA 3H0IA 1M3BA 3VS3A 2J6FA 4OMPA 1WXUA 1U06A 1ABQA 2DL5A 2HDAA 4RTVA 4FSSA 4DEXA 4LNPA 2O9SA 2NUZA 1PKTA 3TSZA 2PNIA 1Y0MA 3EHQA 3TVTA 1HSQA 2DLPA 3M0TA 5IXFA 1I1JA 2J6OA 4OMQA 4R0KA 4AFZC 2SRCA 2F2VA 2W10A 1WI7A 2DBKA 2GBQA 2GGRA 3M0RA 1WA7A 1JEGA 2RPNA 1AWOA 1YWPA 4J9EA 1RUWA 4CC7A 2M51A 4IIOA 1UDLA 1PNJA 2AZVA 3PVQA 3RNJA 2O88A 4OMOA 1TUDA 2OI3A 3VS6A 1UECA 1SRMA 1H8KA 3VS1A 1UJYA 2AKLA 1QKWA 2RQVA 3EHRA 2D0NA 4JJBA 1BB9A 1AEYA 1WFWA 4ESRA 1GCQA 2DNUA 1LCKA 2OJ2A 1X6GA 4RUGA 4EIKA 1GCPA 1T3SA 2JS0A 2K7AA 4J9GA 2KRMA 2EBPA 4OMNA 1GCQC 2C0OA 4CC4B 3TSWA 2FPDA 2D8JA 4D8KA 1H92A 1XOVA 4KRTA 2FRWA 5L23A 4OMLA 4J9DA 1E7OA 2RF0A 2VVKA 2KRNA 1OV3A 2ENMA 1FYNA 1BK2A 1W6XA 2EYYA 1E6GA 4D8DA 1BU1A 1ZUKA 2PZ1A 2YUQA 3NGPA 3VS7A 1WLPB 1X43A 2YDLA 1MUZA 5FW9A 1CSKA 1RLQC 2JMAA 1JU5C 2LQNA 2RN8A 1RLPC 2GNCA 4J9HA 2KEAA 5IHIA 3VS0A 1OPLA 2QDLA 2L3QA 2AKKA 3VS2A 4CC2A 4HXJA 4AG2C 4GBQA 3SEMA 2IIMA 2DL8A 4RTXA 1MV3A 1WYXA 2EYWA 2CREA 2RQTA 4JJCA 2J7IA 2K2MA 3LH5A 1X2QA 2KYBA 4RTTA 1CKBA 1RI9A 4OMMA 2DX1A 2M0YA 1QCFA 1EFNA 2F2XA 2L3PA 3GBQA 4JJDA 1NLOC 1PHTA 2FRYA 3EG0A 1WXTA 1SHFA 1GRIA 4JZ3A 1CKAA 2LX7A 2B86A 2KT1A 4RTUA 1SPKA 3H41A 1KSWA 2KE9A 3UATA 3EG2A 2RNAA 2DYBA 2EGCA 3R6NA 4JZ4A 4Z89A 1QKXA 2KT8A 1JO8A 3H0FA 4F14A 3EGUA 2BTTA 1K76A 1M30A 3JV3A 2H8HA 3CQTA 3NMZC 4CC3A 2FO0A 2EYXA 1U3OA 2CH4A 4E6RA 1UHFA 2DILA 1AWXA 2FG0A 1NLPC 1NYGA 2RQRA 2V1QA 1UJ0A 4DEYA 2K6DA 1B07A 2W0ZA 4HVUA 1GFDA 1X69A 4K11A 5IH2A 2DVJA 2C0IA 2O2OA 1VYTA 3I9QA 3IQLA 1NEBA 2LQWA 4J9FA 1H3HA 2LJ1A 2E5KA 2LMJA 1AWJA 1X27A 1GBRA 1YCSB 5IHKA 1Z9QA 4WCIA 4ORZA 4J9BA 2VKNA 2V1RA 3FJ5A 1PRMC 1ZBJA 2X3WD 4LE9A 1G2BA 3I5SA 4AFUC 1AZEA 2J05A 1OPKA 2DRKA 3VRYA 2EGEA 2J6KA 2O31A 1Z9ZA 1WX6A 1KIKA 2DL4A 4Z88A 2AK5A 1VA7A 1G83A 1A0NB 2KBTA 1T0JA 1UTIA 1AWWA 3REBB 2MIOA 2OAWA 2DA9A 1M8MA 5EC7A 5GJVB 2BZ8A 4M4ZA 2KRSA 2JM9A 5IXBA 2YUNA 1KFZA 3ULRB 1ZLMA 2DE0X 2ED0A 3C0CA 3VS4A 5HCKA 2CSIA 3REAB 2HEQA 2SEMA 2EW3A 4GLMA 2X3XD 1B3QA 1KJWA 1ZSGA 1SHGA 4J9CA 2KXCA 2F2WA 2DM1A 2L0AA 4F16A 1UHCA 2PTKA 5IHNA 1K9AA 2AZSA 2ED1A 2GTOA 2YT6A 1JXOA 4QT7A 1GFCA 1T0HA 1K0XA 1NG2A 2J06A 2LZ6B 2YUOA 2DF6A 2FPEA 1M3CA 2ECZA 2RQWA 1SRLA 2L3SA 1M27C 3I5RA 2FEIA 2LJ3A 1JXMA 1YWOA 1NM7A 1QLYA 3M0QA 2JTEA 4Y92A 2K3BA 1Y57A 2JXBA 4LUDA 2A36A 2LP5A 1ABOA 2DL7A 2EVRA 2L2PA 2ABLA 2CUDA 1VYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JW4 A;  1UFF A;  3A98 A;  2DL3 A;  1GBQ A;  2EQI A;  1UUE A;  4HVV A;  3THK A;  1J3T A;  3M0P A;  3UA7 A;  2KGT A;  2VWF A;  3I35 A;  2GTJ A;  2ROL A;  2BZY A;  3EG3 A;  2A08 A;  3O5Z A;  3VS5 A;  3PVL A;  1GL5 A;  4LUE A;  1ZUY A;  1WIE A;  3RBB B;  1M3A A;  2JM8 A;  2BZX A;  5I11 A;  3U23 A;  2GQI A;  4A63 B;  1K4U S;  1OEB A;  1BBZ A;  2HBW A;  2LJ0 A;  2EKH A;  4HVW A;  1UGV A;  2KXD A;  1HD3 A;  1AOJ A;  3H0H A;  2I0N A;  1UE9 A;  1SSH A;  1I07 A;  1YP5 A;  2KNB B;  2O9V A;  3UF4 A;  1ZUU A;  5GJW B;  4X1V A;  1E6H A;  3M0U A;  1W1F A;  2KRO A;  3ZL7 C;  3UA6 A;  2JMC A;  4RTZ A;  5FWC A;  2DMO A;  1QWF A;  2CUB A;  5FWB A;  1W70 A;  1JQQ A;  1AZG B;  2A28 A;  1WDX A;  1S1N A;  2DBM A;  4IIM A;  4JPB W;  1UG1 A;  2K79 A;  1V1C A;  1TG0 A;  2LNH B;  4J9I A;  2EPD A;  1I0C A;  1MV0 B;  1VYV A;  2JS2 A;  2RMO A;  1YNZ A;  2D8H A;  3KFV A;  2CT3 A;  4AFS C;  2YUP A;  2KR3 A;  1PRL C;  2P4R A;  2HCK A;  3VRZ A;  2G6F X;  1SEM A;  3NHN A;  2ROT A;  1HJD A;  2ESW A;  3EG1 A;  2NWM A;  4RTY A;  1ZX6 A;  1PWT A;  1IO6 A;  1NYF A;  2D1X A;  2EYZ A;  2LCS A;  1ARK A;  2K9G A;  1NEG A;  5I22 A;  4AG1 C;  1T3L A;  1OOT A;  3PE0 A;  4ZNX A;  1QWE A;  1WXB A;  2JT4 A;  3SHW A;  2RQU A;  1FMK A;  2MCN A;  4AFQ C;  2MOX A;  2CDT A;  4LN2 A;  1K0S A;  5ECA A;  1U5S A;  1X2K A;  4RTW A;  2C0T A;  1AVZ C;  2A37 A;  1N5Z A;  2DRM A;  3QWX X;  3NPF A;  1K1Z A;  1YN8 A;  3QWY A;  2HSP A;  2XMF A;  2CT4 A;  4HCK A;  2FPF A;  2CSQ A;  2CH4 W;  1AD5 A;  4F17 A;  2KYM A;  1PKS A;  1TUC A;  2EGA A;  1X6B A;  2DJQ A;  2YSQ A;  3M0S A;  4Z8A A;  3H0I A;  1M3B A;  3VS3 A;  2J6F A;  4OMP A;  1WXU A;  1U06 A;  1ABQ A;  2DL5 A;  2HDA A;  4RTV A;  4FSS A;  4DEX A;  4LNP A;  2O9S A;  2NUZ A;  1PKT A;  3TSZ A;  2PNI A;  1Y0M A;  3EHQ A;  3TVT A;  1HSQ A;  2DLP A;  3M0T A;  5IXF A;  1I1J A;  2J6O A;  4OMQ A;  4R0K A;  4AFZ C;  2SRC A;  2F2V A;  2W10 A;  1WI7 A;  2DBK A;  2GBQ A;  2GGR A;  3M0R A;  1WA7 A;  1JEG A;  2RPN A;  1AWO A;  1YWP A;  4J9E A;  1RUW A;  4CC7 A;  2M51 A;  4IIO A;  1UDL A;  1PNJ A;  2AZV A;  3PVQ A;  3RNJ A;  2O88 A;  4OMO A;  1TUD A;  2OI3 A;  3VS6 A;  1UEC A;  1SRM A;  1H8K A;  3VS1 A;  1UJY A;  2AKL A;  1QKW A;  2RQV A;  3EHR A;  2D0N A;  4JJB A;  1BB9 A;  1AEY A;  1WFW A;  4ESR A;  1GCQ A;  2DNU A;  1LCK A;  2OJ2 A;  1X6G A;  4RUG A;  4EIK A;  1GCP A;  1T3S A;  2JS0 A;  2K7A A;  4J9G A;  2KRM A;  2EBP A;  4OMN A;  1GCQ C;  2C0O A;  4CC4 B;  3TSW A;  2FPD A;  2D8J A;  4D8K A;  1H92 A;  1XOV A;  4KRT A;  2FRW A;  5L23 A;  4OML A;  4J9D A;  1E7O A;  2RF0 A;  2VVK A;  2KRN A;  1OV3 A;  2ENM A;  1FYN A;  1BK2 A;  1W6X A;  2EYY A;  1E6G A;  4D8D A;  1BU1 A;  1ZUK A;  2PZ1 A;  2YUQ A;  3NGP A;  3VS7 A;  1WLP B;  1X43 A;  2YDL A;  1MUZ A;  5FW9 A;  1CSK A;  1RLQ C;  2JMA A;  1JU5 C;  2LQN A;  2RN8 A;  1RLP C;  2GNC A;  4J9H A;  2KEA A;  5IHI A;  3VS0 A;  1OPL A;  2QDL A;  2L3Q A;  2AKK A;  3VS2 A;  4CC2 A;  4HXJ A;  4AG2 C;  4GBQ A;  3SEM A;  2IIM A;  2DL8 A;  4RTX A;  1MV3 A;  1WYX A;  2EYW A;  2CRE A;  2RQT A;  4JJC A;  2J7I A;  2K2M A;  3LH5 A;  1X2Q A;  2KYB A;  4RTT A;  1CKB A;  1RI9 A;  4OMM A;  2DX1 A;  2M0Y A;  1QCF A;  1EFN A;  2F2X A;  2L3P A;  3GBQ A;  4JJD A;  1NLO C;  1PHT A;  2FRY A;  3EG0 A;  1WXT A;  1SHF A;  1GRI A;  4JZ3 A;  1CKA A;  2LX7 A;  2B86 A;  2KT1 A;  4RTU A;  1SPK A;  3H41 A;  1KSW A;  2KE9 A;  3UAT A;  3EG2 A;  2RNA A;  2DYB A;  2EGC A;  3R6N A;  4JZ4 A;  4Z89 A;  1QKX A;  2KT8 A;  1JO8 A;  3H0F A;  4F14 A;  3EGU A;  2BTT A;  1K76 A;  1M30 A;  3JV3 A;  2H8H A;  3CQT A;  3NMZ C;  4CC3 A;  2FO0 A;  2EYX A;  1U3O A;  2CH4 A;  4E6R A;  1UHF A;  2DIL A;  1AWX A;  2FG0 A;  1NLP C;  1NYG A;  2RQR A;  2V1Q A;  1UJ0 A;  4DEY A;  2K6D A;  1B07 A;  2W0Z A;  4HVU A;  1GFD A;  1X69 A;  4K11 A;  5IH2 A;  2DVJ A;  2C0I A;  2O2O A;  1VYT A;  3I9Q A;  3IQL A;  1NEB A;  2LQW A;  4J9F A;  1H3H A;  2LJ1 A;  2E5K A;  2LMJ A;  1AWJ A;  1X27 A;  1GBR A;  1YCS B;  5IHK A;  1Z9Q A;  4WCI A;  4ORZ A;  4J9B A;  2VKN A;  2V1R A;  3FJ5 A;  1PRM C;  1ZBJ A;  2X3W D;  4LE9 A;  1G2B A;  3I5S A;  4AFU C;  1AZE A;  2J05 A;  1OPK A;  2DRK A;  3VRY A;  2EGE A;  2J6K A;  2O31 A;  1Z9Z A;  1WX6 A;  1KIK A;  2DL4 A;  4Z88 A;  2AK5 A;  1VA7 A;  1G83 A;  1A0N B;  2KBT A;  1T0J A;  1UTI A;  1AWW A;  3REB B;  2MIO A;  2OAW A;  2DA9 A;  1M8M A;  5EC7 A;  5GJV B;  2BZ8 A;  4M4Z A;  2KRS A;  2JM9 A;  5IXB A;  2YUN A;  1KFZ A;  3ULR B;  1ZLM A;  2DE0 X;  2ED0 A;  3C0C A;  3VS4 A;  5HCK A;  2CSI A;  3REA B;  2HEQ A;  2SEM A;  2EW3 A;  4GLM A;  2X3X D;  1B3Q A;  1KJW A;  1ZSG A;  1SHG A;  4J9C A;  2KXC A;  2F2W A;  2DM1 A;  2L0A A;  4F16 A;  1UHC A;  2PTK A;  5IHN A;  1K9A A;  2AZS A;  2ED1 A;  2GTO A;  2YT6 A;  1JXO A;  4QT7 A;  1GFC A;  1T0H A;  1K0X A;  1NG2 A;  2J06 A;  2LZ6 B;  2YUO A;  2DF6 A;  2FPE A;  1M3C A;  2ECZ A;  2RQW A;  1SRL A;  2L3S A;  1M27 C;  3I5R A;  2FEI A;  2LJ3 A;  1JXM A;  1YWO A;  1NM7 A;  1QLY A;  3M0Q A;  2JTE A;  4Y92 A;  2K3B A;  1Y57 A;  2JXB A;  4LUD A;  2A36 A;  2LP5 A;  1ABO A;  2DL7 A;  2EVR A;  2L2P A;  2ABL A;  2CUD A;  1VYU A; 
#chains in the Genus database with same CATH topology
 3OB9 A;  3A98 A;  1TU0 B;  2EQI A;  1UUE A;  2P0K A;  4HVV A;  4E7J A;  1K8A C;  2EKO A;  3EG9 B;  2KQW A;  3M0P A;  3UA7 A;  2GTJ A;  1Y96 A;  1NZ9 A;  1M90 C;  3EG3 A;  5LL6 S;  2A08 A;  5D6W A;  4JRP A;  1GL5 A;  4HCB A;  1HYO A;  4FYX B;  2QA4 T;  3RBB B;  3QUI A;  2BZX A;  3M5A A;  3L2W A;  1K4U S;  2EJF A;  2HBW A;  1Y96 B;  3V8K A;  4MZP A;  4E7L A;  1SSH A;  2QI2 A;  2YRD A;  1BI0 A;  2X4J A;  2XID A;  1ZSZ B;  3CC7 T;  1W1F A;  1VQO Q;  3ZL7 C;  1IHW A;  2JMC A;  3QYH B;  4RTZ A;  6AT1 B;  5KH6 A;  3C94 A;  2DMO A;  2FHD A;  3A8H B;  3MPU B;  4KGV B;  4XK8 E;  1B34 B;  1JQQ A;  4F04 B;  1VQ8 Q;  1ZSZ A;  2QQR A;  2A28 A;  4QKU A;  2YXY A;  5A0G A;  5KCO A;  1G3W A;  2DBM A;  1G3T A;  5A0L A;  2QK0 A;  3MEW A;  1MV0 B;  1R8O B;  3KFV A;  2D8H A;  1ZBX A;  2LQ8 A;  2YUP A;  1YI2 A;  3CCL Q;  2KR3 A;  1PRL C;  2H3J A;  4BDZ A;  1YIT Q;  3NHN A;  2CS7 A;  2PVD B;  3EG1 A;  2NWM A;  1D0Y A;  5DLO A;  1ZX6 A;  1V76 A;  4HT9 A;  1Q7Y U;  1NYF A;  4ME7 A;  2EYZ A;  4PJO F;  2QGG A;  2LCS A;  1D0Z A;  4IUV A;  3CBO A;  1NEG A;  5I22 A;  4FT4 A;  1OOT A;  1QWE A;  5HKC A;  3HFO A;  2RQU A;  4DA4 A;  1FMK A;  3NTH A;  2MOX A;  5GAM h;  4LN2 A;  3E2U A;  1VQN Q;  1U5S A;  3MJX A;  9ATC B;  4RTW A;  1VQ6 T;  1AVZ C;  4NS5 A;  2Y90 A;  1I4K 1;  4AT1 B;  2C06 A;  2HQH A;  3NPF A;  2EFI A;  3C4S A;  3TQ7 P;  2HSP A;  1M1G A;  2XMF A;  1RAI B;  4ZN3 A;  3RER A;  2FPF A;  1VQ5 T;  2OTL A;  2KYM A;  3ZFJ A;  2DJQ A;  5CK9 A;  1MGQ A;  1Q95 G;  3RIR A;  4Y91 A;  3VS3 A;  2LT4 A;  3LWH A;  1ABQ A;  2RJF A;  2HDA A;  2ZPG B;  4FSS A;  3E9F A;  2NUZ A;  1B34 A;  3CCV A;  2DLP A;  1AT1 B;  2J6O A;  1VQ6 A;  4OMQ A;  4R0K A;  4ATO A;  4AFZ C;  2NUT A;  3M59 A;  3CPW A;  2ZPF B;  4LDX A;  1WA7 A;  2JTM A;  2R5M A;  1PCX A;  1UGS B;  4C8Q E;  2RPN A;  3F70 A;  1YWP A;  4CC7 A;  1VQ4 A;  2X9H A;  2M51 A;  1VQM Q;  4IIO A;  3BE3 A;  3H8Z A;  1YJ9 Q;  2OI3 A;  4C92 D;  2EWN A;  2AKL A;  1FWZ A;  1AHJ B;  4JJB A;  1VQO T;  1WHG A;  1PM3 A;  2A0F B;  2OAU A;  4D6W A;  3QJY A;  5GAN h;  2XD0 A;  2OJ2 A;  1X6G A;  4FSX A;  5KYY B;  3L2Z A;  4J9G A;  2KRM A;  4KT0 E;  2EBP A;  3L2U A;  4OMN A;  1S72 Q;  5CKD A;  5GAN 4;  2C0O A;  1IGQ A;  2MF2 A;  3CC4 Q;  3OYJ A;  3OSV A;  2OTJ A;  2QA4 Q;  3CD6 T;  4J9D A;  2RF0 A;  3HSB A;  2VVK A;  2KRN A;  1FYN A;  1BK2 A;  1E6G A;  1BU1 A;  3LWI A;  2PZ1 A;  2YDL A;  4A54 A;  2IVW A;  3VV0 A;  3I56 A;  4MMK A;  5KYU B;  1VIF A;  4PJM A;  2GNC A;  2R57 A;  2ZPI B;  5GAN e;  3CCQ T;  1KC8 U;  3OS2 A;  4LD6 A;  2AKK A;  2RHX A;  4V2S A;  4LDW A;  4XU3 A;  4E2F B;  3PMI A;  4HXJ A;  4RCC A;  4GBQ A;  3SEM A;  4ELZ C;  4RTX A;  1N9S A;  2MWO A;  3ZEH A;  2EYW A;  5A0D A;  2QEX Q;  2K2M A;  3PTA A;  2BIV A;  2KYB A;  3CMA Q;  3CCJ T;  1Q82 R;  1CKB A;  1RI9 A;  1ZA1 B;  2EQJ A;  3JCM W;  3VUB A;  1D1C A;  2M0Y A;  3RKY A;  1EFN A;  3GBQ A;  4C8Q B;  4BDY A;  1NLO C;  2XK0 A;  1KD1 C;  2M9U A;  1QP2 A;  2FRY A;  3EG0 A;  1GRI A;  4J7I A;  4JZ3 A;  1VQ8 T;  2OTL Q;  2B86 A;  1YFN A;  3CCS T;  4RTU A;  5IT9 E;  1JB0 E;  3QXE B;  3UAT A;  2KE9 A;  2DXC A;  3EG2 A;  5KYX A;  1VQP Q;  3CC2 A;  2EGC A;  2DZ9 A;  3R6N A;  4JZ4 A;  1TOV A;  2GQV A;  4Z89 A;  3LX7 A;  4M75 D;  3GOX A;  4F14 A;  3CC7 Q;  3EFS A;  4JLG A;  2BTT A;  1IZ6 A;  5FRO A;  2FO0 A;  5KYX B;  1M4Z A;  5CQX A;  2XIC A;  2KI7 A;  3VYH B;  3QHS A;  1YHQ T;  4HCZ A;  1NYG A;  2QEX A;  2VB6 A;  1M90 U;  2DTI A;  2JN0 A;  4E47 A;  3OYB A;  2W0Z A;  4FT2 A;  3DLM A;  4C5H A;  2E41 A;  5IH2 A;  3CXC S;  3OYE A;  2GFA A;  4JUV A;  4J6Y A;  4RKU E;  1BYM A;  3CCU Q;  3CCU A;  4PL6 A;  3A8M B;  3OYD A;  1K9M R;  1I81 A;  1FXX A;  1Z9Q A;  3PIP A;  3CME T;  4JRK A;  2ZPE B;  3LGF A;  5KYN A;  2ZCF B;  3G6E T;  1UB4 A;  4EMK B;  2J05 A;  1OI1 A;  2BUD A;  5GAO n;  3VRY A;  4L59 A;  2EGE A;  1WNL A;  2J6K A;  3HFN A;  4C92 G;  5LJ5 h;  2KK4 A;  5CQY A;  4Z88 A;  2BKD N;  4C0G A;  4E7I A;  1VQP T;  1G83 A;  2KBT A;  1UTI A;  3REB B;  2X51 A;  2HQE A;  1D0X A;  2EIF A;  3CCS Q;  2OAW A;  5LJ5 d;  2K3Y A;  4KUL A;  4L6V 5;  2LVM A;  2Y4X A;  4M7A C;  2YUN A;  1KFZ A;  3ULR B;  1QVF P;  1ZLM A;  2DE0 X;  3G71 Q;  1QMC A;  3C0C A;  4OMF B;  5HCK A;  1Q81 U;  2SEM A;  4X34 A;  3EFO A;  2M02 A;  1B3Q A;  4QVD A;  5LJ5 f;  2QXF A;  3EAE A;  2RHI A;  2K5L A;  2R58 A;  3L1A A;  2GTO A;  2ED1 A;  2YT6 A;  4A4F A;  1JXO A;  1KQ1 A;  2RJC A;  3HL8 A;  4QT7 A;  4EMG A;  3OBW A;  4FW1 A;  4OF1 A;  1W2B S;  4C0Z A;  2LZ6 B;  2DF6 A;  3OS1 A;  2VXE A;  4C5E A;  2FPE A;  1NJI R;  1M3C A;  2RQW A;  3CMA A;  3CCQ Q;  1YWO A;  2LJ3 A;  2XDP A;  2NLU A;  4E7Z A;  5DM7 R;  4EMK C;  2JTE A;  1BI1 A;  1Y57 A;  4LDV A;  2LP5 A;  5GJV B;  2DL7 A;  2L2P A;  3CPW S;  2NYS A;  1UFF A;  2HL5 C;  1GBQ A;  5I21 A;  3I55 T;  2HSE B;  2ROL A;  3S6W A;  1M90 R;  2XHC A;  1PSF A;  3PVL A;  5KYW A;  2ATC B;  4LUE A;  1Q82 C;  1LOJ A;  3KUF A;  4XTU A;  2JM8 A;  4A4K A;  3GP8 A;  2GQI A;  4A63 B;  5KYY A;  1PG5 B;  5CCA A;  2KXD A;  3CCM T;  1OYX A;  2MPX C;  4HKE A;  4Q5W A;  3WVE B;  1YP5 A;  1UGP B;  2KNB B;  2O9V A;  4A4E A;  4PJO B;  3NTI A;  2OTJ T;  4M78 E;  1E6H A;  1Y71 A;  3M0U A;  1NBE B;  5EG2 A;  1QVG S;  4QQD A;  3JCM b;  5FWC A;  1YBY A;  4PKC C;  2FVU A;  1VQK T;  2CUB A;  5GMK l;  1YJ9 T;  5GMK h;  2E6Z A;  2YLB A;  4R56 A;  4N4I A;  2LX9 A;  4R55 A;  3M57 A;  2PQW A;  2RM4 A;  1HK9 A;  1UG1 A;  2K79 A;  1V1C A;  4AMC A;  4DBR A;  3RES A;  2EQK A;  2V8I A;  1VYV A;  2RK1 A;  2Y4Y A;  2E6N A;  2P4R A;  1VUB A;  3VRZ A;  2G6F X;  4ZGJ B;  2OX7 A;  2FB7 A;  3LLR A;  2PU9 B;  2P0Q A;  1SEM A;  1JJ2 A;  2ROT A;  1YJN Q;  3TCJ A;  1W4S A;  2ESW A;  2QAZ A;  5GAO q;  4DQ2 A;  2V8K A;  3X20 B;  1K8A R;  4PLL A;  4Y28 E;  3OA6 A;  1N8R U;  1ARK A;  4DBH A;  1VQL A;  3L2Q A;  1T3L A;  2CZ1 B;  4F7U A;  5HK3 A;  1RAF B;  1VQ5 Q;  2LCC A;  4KH1 B;  3SHW A;  3JCM P;  3UPU A;  2DD4 A;  2DER A;  1D09 B;  4AFQ C;  2XG8 D;  1FX7 A;  3ZBD A;  1K0S A;  2DTO A;  5CAI A;  1VQ7 Q;  3CME Q;  5KE3 A;  5GAN j;  1JJ2 S;  1IRX A;  2AHJ B;  4M7A E;  1N5Z A;  5CKF A;  4QQG A;  2CP6 A;  1C1A A;  2RH2 A;  4M7A G;  1Y7X A;  3NFC A;  3G71 A;  4EPC A;  5DLQ E;  5GAO m;  2CSQ A;  2CH4 W;  1AD5 A;  2GCX A;  4RMO A;  1HXD A;  3CXC A;  4M78 B;  2X4X A;  5GMK e;  3G71 T;  1R0B G;  2VGN A;  1R77 A;  1XJW B;  3SB2 A;  3X28 B;  1U06 A;  2PUO B;  2WSC E;  2YWW A;  4RTV A;  5CVI A;  4DEX A;  3X24 B;  4KBM B;  1V29 B;  2MAM A;  4QVZ A;  2PNI A;  4MDW A;  3EHQ A;  4BI4 A;  3M0T A;  3J81 E;  1I1J A;  3OYI A;  2X4W A;  2CYZ B;  3EH1 A;  3QKJ A;  4PJO D;  2LRQ A;  3M0R A;  2I2L A;  4M77 F;  1KC8 C;  3PVQ A;  3RNJ A;  2O88 A;  4IUP A;  1M1K U;  1TUD A;  3JAM E;  1H8K A;  2KAF A;  3VS1 A;  1UJY A;  4XTY A;  2YRC A;  3BDL A;  1BB9 A;  3WVD B;  3OYF A;  4ESR A;  1GCQ A;  1RAD B;  3EGD B;  4EIK A;  2JS0 A;  2G3R A;  2K7A A;  1OX9 A;  2FPD A;  1MMA A;  4D8K A;  1YHQ Q;  4OML A;  4OB3 B;  3NTK A;  4B6M A;  1K73 U;  4ELY C;  3FEO A;  3SWN C;  3NGP A;  4TVR A;  4NL2 A;  4XU0 A;  1WLP B;  1X43 A;  1D1B A;  2CP0 A;  5FW9 A;  1CSK A;  1YJ9 A;  2JNG A;  4ZGD B;  1K9M C;  1RLQ C;  4EDU A;  2LQN A;  3EFO B;  2DTH A;  1EX4 A;  2RHU A;  2E64 A;  3V8J A;  3HRS A;  1WZO A;  2L3R A;  2QQA A;  4FYY B;  4AG2 C;  1VOM A;  3CC4 T;  2EAY A;  3I56 T;  1WYX A;  2RQT A;  4JJC A;  2J7I A;  2XKO C;  2DVE A;  3LH5 A;  1X2Q A;  1PC0 A;  5GAM f;  5IN1 A;  2VV5 A;  1QVF S;  3ME9 A;  1M2V A;  1PD0 A;  4OMM A;  4M7D D;  1KQS A;  2D0Q B;  4JRQ A;  1QVG A;  5GAM e;  1TWB A;  1N6A A;  1WXT A;  1Q86 R;  1CKA A;  2KT1 A;  5GAM g;  3JCM f;  4EMH A;  3G7Z A;  4C0D B;  1W2B P;  2RHZ A;  2DEQ A;  2DKG A;  1JO8 A;  3HPW A;  2QA4 A;  4C8Q D;  4XQ3 A;  3CCR A;  2RHY A;  3OYA A;  1WQW A;  2QTV A;  1S72 A;  2DIL A;  4M77 D;  3INZ A;  4M7D F;  2LC4 A;  2FG0 A;  3DKM A;  4PJO C;  2PVO B;  4J5Y A;  3G4S A;  2V1Q A;  3L42 A;  2DFU A;  1B07 A;  3FB9 A;  4PJN A;  2DD5 A;  1KQ2 A;  1R0C B;  3OYM A;  1X69 A;  3MP6 A;  3CCQ A;  3JCM d;  3OW2 A;  4M78 D;  4JLI A;  2CZ7 B;  1VQL T;  3OW2 P;  1VYT A;  1KK7 A;  3I9Q A;  4IUR A;  2EQM A;  1NEB A;  1MMN A;  5LJ3 j;  3C12 A;  4J9F A;  2LJ1 A;  2E5K A;  3V7S A;  1IRE B;  2GFU A;  3RUX A;  3Q1J A;  1VQM T;  1UGR B;  2BE7 D;  1NE8 A;  4ORZ A;  3I55 A;  1VQ6 Q;  4BAC A;  2COY A;  4PNO A;  4JS5 A;  4AFU C;  2LDM A;  4C8Q A;  4KUI A;  1WX6 A;  1KIK A;  2AK5 A;  4C5G A;  2AT1 B;  2EQU A;  1T0J A;  1MND A;  1AWW A;  2E1H A;  4MZT A;  2L8D A;  1WHH A;  3OBY A;  2H3E B;  5CKB A;  4KUD K;  3E1S A;  5EC7 A;  3JSC A;  2HL3 A;  4BD3 A;  2CP3 A;  2ED0 A;  2DXB A;  4NL3 A;  2CSI A;  2MWP A;  5A2Q E;  3REA B;  4M78 A;  4GLM A;  3OYL A;  3S3O A;  1OZ2 A;  4J9C A;  2KXC A;  2XU8 A;  2L0A A;  3JCM g;  3CCL T;  5GAN 6;  4MML A;  5IHN A;  4M7A B;  1K9A A;  3JCM Q;  3FDR A;  5GAN f;  4M7A F;  3RKW A;  2HQX A;  5FLX E;  3CCL A;  3JCM X;  1M27 C;  3RDV A;  1NM7 A;  2JVV A;  2FZG B;  1M2V B;  4M7D C;  3M0Q A;  4M7D E;  4LUD A;  2K3B A;  2JXB A;  3DB4 A;  2A36 A;  2DAQ A;  1VYU A;  5KYW B;  3QJ6 A;  1Q81 C;  5D6X A;  1BKB A;  3C95 A;  2V8J A;  2OTJ Q;  2COZ A;  5GMK j;  3THK A;  1VQ8 A;  2NUP A;  3OYC A;  2A3L A;  1YIT A;  3VJP A;  3EGX B;  4II1 A;  3VS5 A;  5GAN g;  4WTO B;  2FZC B;  4OP0 A;  1ZUY A;  2P0P A;  1W2B A;  1OEB A;  1BBZ A;  1YIT T;  2DIG A;  2EKH A;  1N8R R;  1N27 A;  1AOJ A;  5GAO p;  2F69 A;  2I0N A;  4M77 C;  1I07 A;  2YHT A;  1QVF A;  2KVQ G;  2K3X A;  1SKU B;  3MET A;  1TH7 A;  1JJ2 P;  3UA6 A;  3M55 A;  3FIF A;  4GLK A;  1QWF A;  3HRU A;  3CCM A;  1AZG B;  4FL6 A;  3CCV T;  5LJ3 e;  3JB9 I;  3EFR A;  4BE2 A;  5LJ3 d;  1VQP A;  2P84 A;  1WHJ A;  4JPB W;  2R5A A;  1TG0 A;  2F5K A;  2LQK A;  3A8O B;  2LNH B;  1I0C A;  2QGF B;  1IB8 A;  3GLX A;  4PJO G;  2CT3 A;  1U1S A;  4OB2 B;  1VQ9 A;  2HNI A;  3CPF A;  1Q7Y C;  4HT8 A;  1TXQ A;  3VYG A;  4J83 A;  4RG8 A;  3M4G A;  3PIO A;  3OMC A;  1KD1 U;  2MYS A;  3PNW C;  2FYK A;  4PJL A;  1IO6 A;  4FU6 A;  3QG1 A;  2D1X A;  3VUZ A;  3MP8 A;  3QII A;  2K9G A;  2QQ9 A;  5AT1 B;  4AG1 C;  1FMW A;  1BCO A;  1VQ4 T;  4ZNX A;  1YIJ T;  4QQ6 A;  4F7U E;  3QO3 A;  2CDT A;  2QG9 B;  3VKI A;  2C0T A;  2CGH A;  4XTV A;  3OYK A;  3OYY A;  2A37 A;  2DRM A;  4C92 C;  3QWX X;  1K1Z A;  3S3N A;  2ZGW A;  5LJ3 g;  2LT1 A;  4B9X A;  5LJ5 e;  1ZHI A;  1QCN A;  3MEV A;  3P8B B;  2XDD A;  4HCK A;  3P8H A;  2MMP A;  2XI9 A;  1WHM A;  3DB3 A;  5GAN 5;  3OY9 A;  4BI8 B;  3CCS A;  1PKS A;  1TUC A;  2EGA A;  3M0S A;  4Z8A A;  3H0I A;  3JRZ A;  4NOY A;  1KG1 A;  1LNX A;  1KHI A;  1M3B A;  4L5G A;  2J6F A;  2JJ9 A;  3RMS A;  2DL5 A;  1UGQ B;  4XTW A;  4FCY A;  1QVP A;  1YJW T;  4LNP A;  3URG A;  1PKT A;  4FW2 A;  3TSZ A;  1Y0M A;  3RKX A;  3TVT A;  3QZ5 B;  1HSQ A;  5IXF A;  2F2V A;  3A8L B;  2W10 A;  2DBK A;  2GBQ A;  2GGR A;  2WSF E;  1KQS P;  3G6E A;  1OQK A;  2O01 E;  1RUW A;  1YJW Q;  5J3B A;  2DYI A;  1PNJ A;  2AZV A;  3EGD A;  4OMO A;  3OQ5 A;  2COW A;  3VS6 A;  1M2O A;  4KH0 B;  1IXD A;  3CCR T;  1P92 A;  2LNV A;  3CCU T;  4OB1 B;  4N0A A;  3PMT A;  3EHR A;  4RG2 A;  1WJR A;  5GMK m;  4F7U G;  2VC8 A;  1WFW A;  2F5T X;  1BIA A;  5LJ3 f;  1LCK A;  4RUG A;  3JCM c;  3JB9 G;  1VQ7 A;  2K57 A;  4M77 G;  1T3S A;  3J80 E;  1MHN A;  1GCQ C;  4F7U B;  2LTO A;  4CC4 B;  4OGC A;  2D8J A;  4JS4 A;  2FRW A;  5L23 A;  1I8F A;  1E7O A;  4IUQ A;  3GPL A;  1OV3 A;  5GAM d;  2EYY A;  3L2R A;  5CR2 A;  5FU7 C;  1ZUK A;  2YUQ A;  3VS7 A;  3X25 B;  3FLG A;  1TSF A;  4J7F A;  3UWN A;  2QTX A;  3J7A F;  4DBQ A;  1QW1 A;  2KEA A;  1VQN A;  4JJN K;  4E7S A;  2QDL A;  8ATC B;  3QZ9 B;  2DO3 A;  2IPO B;  2JTF A;  1BI2 A;  3VS2 A;  4CC2 A;  3G1J A;  2A7Y A;  2IIM A;  3E19 A;  3MKD A;  3OSS C;  1SSF A;  1S72 T;  5FU6 B;  1Q86 U;  2RO0 A;  3CMA T;  5CIU A;  5FRM A;  2JZ2 A;  1KC8 R;  5D6Y A;  1G3S A;  4PFP A;  3LYI A;  4XAX B;  2DX1 A;  2KDS A;  2L3P A;  2L5Q A;  3KXT A;  3M54 A;  1PHT A;  1YI2 Q;  3OS0 A;  2LX7 A;  2WAC A;  2AIR B;  2RB6 A;  1NJI U;  4MDX A;  1H64 1;  1F1B B;  1KSW A;  4FYV B;  1NPR A;  1UEB A;  3BDU A;  4M77 E;  3M4Y A;  3TRE A;  3H0F A;  4BE0 A;  1U1T A;  1M30 A;  3JV3 A;  4F7U F;  2H8H A;  4HA8 A;  3KBG A;  1U3O A;  2CH4 A;  2VYT A;  1UHF A;  1VQO A;  3CD6 Q;  4LD9 K;  2X4Y A;  4UC4 A;  2O4X A;  3LH0 A;  2RQR A;  4PJO E;  5LJ5 j;  2PUK B;  4M77 A;  1UJ0 A;  2K6D A;  2GF7 A;  3JCM h;  4C92 A;  3MEU A;  1K9M U;  1M1K R;  4JRI A;  4O5V A;  2C0I A;  1WJQ A;  5CKH A;  1YJN A;  3IQL A;  4C92 B;  1H3H A;  2LMJ A;  2DZC A;  4M7D A;  1RI0 A;  1YCS B;  5IHK A;  1FMV A;  1IGU A;  1Q81 R;  4WCI A;  3S3M A;  1NPP A;  4C92 E;  2MK5 A;  1X75 C;  2V1R A;  3FJ5 A;  2RD1 A;  4B9W A;  2X3W D;  5FU6 C;  2FL7 A;  1OPK A;  2DRK A;  1WPY A;  3HTR A;  4M75 E;  1Q86 C;  3LW5 E;  1YHQ A;  4M75 C;  2DL4 A;  2D9T A;  1KQS S;  5D7U A;  2VAS A;  2K5I A;  5KCH A;  1N9R A;  4J6W A;  2DA9 A;  1M8M A;  2BZ8 A;  2JM9 A;  3VU3 C;  5GMK i;  4JDS A;  2HMA A;  4M7A A;  2WSE E;  3O8V A;  2EW3 A;  4WF2 A;  2RA2 A;  1KJW A;  1SHG A;  3MP1 A;  2F2W A;  2RI2 A;  3CBM A;  2HZY A;  3EGX A;  4F16 A;  5GAN 3;  1RAG B;  4PK4 A;  4ZGE B;  2CP5 A;  3N5B B;  3G6E Q;  3GNG A;  2DXU A;  2HKN A;  1K0X A;  1PD1 A;  1NG2 A;  1SF9 A;  2PVG B;  3JCM V;  4EMK A;  2E5Q A;  2KMT A;  5KYU A;  2L3S A;  1JXM A;  3OW2 S;  1X01 A;  1RAC B;  2X35 A;  5GAO r;  1N8R C;  4DOV A;  4CRI A;  3HKS A;  4XTX A;  4Y92 A;  4C8Q G;  1ABO A;  2ABL A;  2CUD A;  4BY6 B;  2JW4 A;  2O4X B;  2DL3 A;  1ACM B;  4PFO A;  1J3T A;  4M78 F;  2KGT A;  2VWF A;  3I35 A;  2BZY A;  4BE1 A;  3O5Z A;  4LXC A;  1G5V A;  2HD0 A;  4M7A D;  2L89 A;  1WIE A;  2DPP B;  3PFS A;  4N4G A;  1M3A A;  3SFM A;  3E9G A;  5I11 A;  3JB9 J;  3U23 A;  3MEA A;  2LJ0 A;  4M75 G;  4M78 G;  2KSS A;  4HVW A;  1UGV A;  3JCM J;  1HD3 A;  1YCY A;  1KD1 R;  3H0H A;  1UE9 A;  3CCE A;  2E70 A;  4BI3 A;  3CME A;  3UF4 A;  5J26 A;  1ZUU A;  5GJW B;  4X1V A;  5HY6 A;  3EH2 A;  4Z02 A;  1D3B B;  2KRO A;  3GNF B;  2VUB A;  3OS5 A;  1WHL A;  5FWB A;  1ZQ1 A;  3QPH A;  1W70 A;  1VQ5 A;  2OTL T;  2KY9 A;  3SD4 A;  1WDX A;  1RAA B;  1S1N A;  4C0D C;  1I5O B;  2DK3 A;  4IIM A;  1M8V A;  4P5N A;  2DEU A;  3PT9 A;  1Q82 U;  1K8A U;  1VIE A;  4J9I A;  2EPD A;  3H9N A;  1XNI A;  2JS2 A;  2RMO A;  1YNZ A;  4AFS C;  3RMQ A;  4X9C A;  1WHK A;  2HCK A;  2RI5 A;  1EZZ B;  1XTD A;  2ZPH B;  2DJZ A;  1H3Z A;  5M9O A;  3JB9 H;  3I56 Q;  1HJD A;  4RTY A;  1M5Q 1;  5CO7 A;  1YIJ A;  1PWT A;  2EYQ A;  1QVG P;  5AYF A;  3UT1 A;  2QQB A;  2NUP B;  4E7K A;  3PE0 A;  2E4H A;  3V7C A;  1M9S A;  3CD6 A;  1WXB A;  2JT4 A;  3CC4 A;  2JUF A;  2LCL A;  4IUU A;  3G4S T;  2MCN A;  3M9Q A;  4DBF A;  4M75 F;  5ECA A;  3GIB A;  1X2K A;  3X26 B;  3CCJ A;  2BE9 B;  1VQ7 T;  3TU4 K;  5FRN A;  1YN8 A;  3AT1 B;  3CC2 Q;  4OB0 B;  4FYW B;  3QWY A;  2CT4 A;  2RJE A;  1EIF A;  3AHU A;  1YIJ Q;  2DIQ A;  3OMG A;  4F17 A;  1VQ4 Q;  5C0M A;  3MHX A;  1SG5 A;  2DXT A;  1LPL A;  2YSQ A;  1X6B A;  4IUT A;  2E3I A;  4XTZ A;  2CP2 A;  4FM4 B;  4C0F A;  4A53 A;  1MNE A;  1U8R A;  4PFZ A;  4OMP A;  3V8L A;  1WXU A;  3M58 A;  5FU7 B;  4YTL A;  1YJN T;  3QYG B;  2VGM A;  2O9S A;  1RAH B;  5KE2 A;  1LJO A;  1VQK A;  2SRC A;  4ANJ A;  1WI7 A;  5HK0 A;  1RAE B;  5I2M A;  3MO8 A;  1JEG A;  4C5I A;  2E3H A;  1AWO A;  3OYG A;  4DOW A;  3HRT A;  4J9E A;  3CXC P;  3CCE T;  2NUT B;  2ZAE A;  1UDL A;  1VQ9 T;  1VQK Q;  4FIB A;  1UEC A;  1SRM A;  4XU1 A;  4MZM A;  2QQS A;  1I5L A;  1QKW A;  2RQV A;  2D0N A;  3TEE A;  4CI0 C;  1AEY A;  3ASK A;  4E7H A;  3UDC A;  2HAX A;  1MMD A;  4M7D B;  1OU8 A;  2DNU A;  2K4Y A;  2DET A;  4BB7 A;  1GCP A;  3CCM Q;  5C6S A;  1G8X A;  1RL2 A;  2RK2 A;  1ZA2 B;  2K2V A;  2B8A A;  3TSW A;  2QYZ A;  2JOY A;  1H92 A;  1XOV A;  4KRT A;  4LDU A;  3JB9 F;  4KGZ B;  4BY6 C;  3QBY A;  1WGS A;  2ENM A;  4QVC A;  1W6X A;  1QCO A;  4D8D A;  4PLI A;  4M75 A;  1VQN T;  2Z0W A;  5GAN 7;  4PJJ A;  5LJ5 g;  3I55 Q;  1MUZ A;  1BI3 A;  2IG0 A;  3T9N A;  5IAY A;  3OYN A;  2JMA A;  1JU5 C;  2RN8 A;  2MI6 A;  4C92 F;  1O9S A;  1RLP C;  4J9H A;  5IHI A;  3BW1 A;  3VS0 A;  1OPL A;  2P4T A;  4PJO A;  2L3Q A;  1C0M A;  1YI2 T;  1M1K C;  5GAN 8;  1X6O A;  3QDR B;  5GAO l;  2DL8 A;  1MV3 A;  3P8D A;  3JB9 D;  2CRE A;  1K73 R;  1JBM A;  1OUL A;  2HKQ B;  3QSU A;  4M77 B;  4RTT A;  4A4H A;  3L2V A;  3BFM A;  5J39 A;  4XU2 A;  1QCF A;  2F2X A;  3A1P A;  3H6Z A;  4JJD A;  3CCR Q;  3LGL A;  3CC7 A;  1SHF A;  3QDF A;  3FRN A;  4OGE A;  8AT1 B;  1SPK A;  3CCE Q;  3H41 A;  3OYH A;  4KGX B;  2E12 A;  1O75 A;  2DYB A;  2RNA A;  1QQJ A;  5GAN d;  1QKX A;  4X9D A;  2KT8 A;  2EJ9 A;  1NJI C;  3SWN A;  4C8Q F;  3EGU A;  3BY7 A;  2QAS A;  1K76 A;  1TS9 A;  3R6O A;  3JCM e;  3V7R A;  2EJG A;  1BIB A;  3CQT A;  1KHC A;  5L8R E;  3NMZ C;  4CC3 A;  2EYX A;  4E6R A;  1IHV A;  1PSE A;  1AWX A;  2M0O A;  3SWN B;  3RR6 A;  3D7S B;  4ZN1 A;  1NLP C;  2YLC A;  1K73 C;  4GY5 A;  4BUG A;  4DEY A;  1G3Y A;  4QW2 A;  4HVU A;  2E10 A;  1VQL Q;  1GFD A;  4K11 A;  1QP3 A;  1LVK A;  2DVJ A;  2V26 A;  4M7D G;  2O2O A;  4M75 B;  4N4H A;  4HCC A;  1YJW A;  2K5F A;  2LQW A;  1ZSZ C;  1Y07 A;  2CZ6 B;  3CC2 T;  3FC3 A;  1C6V X;  3WXM B;  1AWJ A;  2QDY B;  1VQ9 Q;  1X27 A;  4A4G A;  2CP7 A;  3GF5 A;  1GBR A;  1WQ7 A;  4RCB A;  3HP9 A;  3DLL A;  4J9B A;  2M16 A;  2VKN A;  2CZ0 B;  2VXF A;  1PRM C;  1ZBJ A;  4LE9 A;  1G2B A;  2FZK B;  3I5S A;  1AZE A;  3M53 A;  4ZTJ A;  2CKK A;  2M1H A;  1RAB B;  2O31 A;  1Z9Z A;  3G4S Q;  3M56 A;  3SDZ A;  3CPW P;  7AT1 B;  1VA7 A;  1A0N B;  1Q7Y R;  4C8Q C;  1TUG B;  2F1L A;  4J6X A;  4ZTF A;  3MCA B;  1WJS A;  1D1A A;  1GXI E;  2MIO A;  4VUB A;  1M1F A;  4M4Z A;  2KRS A;  5IXB A;  2RI3 A;  3VS4 A;  4IKF A;  1OU9 A;  2HBP A;  2ZZD A;  2HEQ A;  1JRI A;  2X3X D;  1OX8 A;  1ZSG A;  2E65 A;  3A5Z B;  3CCJ Q;  2DM1 A;  5GAN 2;  4N0A C;  2XDB A;  3HHT B;  4OVA A;  1VQM A;  2YRV A;  2ZPB B;  4M78 C;  3PGG A;  1OZ3 A;  2QEX T;  1UHC A;  2PTK A;  5DY9 A;  2AZS A;  3ER0 A;  5LJ3 h;  1XQH A;  1DJ7 B;  1GFC A;  1T0H A;  3FJP A;  4O6J A;  5GAM j;  2D6F A;  2RJD A;  1B7T A;  3CBP A;  2J06 A;  4J8O A;  1D3B A;  2YUO A;  5I2S A;  1TTH B;  2ECZ A;  3CCV Q;  1SRL A;  1MMG A;  3I5R A;  1BCM A;  2FEI A;  4LDY A;  3EG9 A;  3CEY A;  1QLY A;  5CKE A;  2EVR A;  3A8G B; 
#chains in the Genus database with same CATH homology
 2JW4 A;  1UFF A;  3A98 A;  2DL3 A;  1GBQ A;  2EQI A;  1UUE A;  4HVV A;  3THK A;  1J3T A;  3M0P A;  3UA7 A;  2KGT A;  2VWF A;  3I35 A;  2GTJ A;  2ROL A;  2BZY A;  3EG3 A;  2A08 A;  3O5Z A;  3VS5 A;  3PVL A;  1GL5 A;  4LUE A;  1ZUY A;  1WIE A;  3RBB B;  1M3A A;  2JM8 A;  2BZX A;  5I11 A;  3U23 A;  2GQI A;  4A63 B;  1K4U S;  1OEB A;  1BBZ A;  2HBW A;  2LJ0 A;  2EKH A;  4HVW A;  1UGV A;  2KXD A;  1HD3 A;  1AOJ A;  3H0H A;  2I0N A;  1UE9 A;  1SSH A;  1I07 A;  1YP5 A;  2KNB B;  2O9V A;  3UF4 A;  1ZUU A;  5GJW B;  4X1V A;  1E6H A;  3M0U A;  1W1F A;  2KRO A;  3ZL7 C;  3UA6 A;  2JMC A;  4RTZ A;  5FWC A;  2DMO A;  1QWF A;  2CUB A;  5FWB A;  1W70 A;  1JQQ A;  1AZG B;  2A28 A;  1WDX A;  1S1N A;  2DBM A;  4IIM A;  4JPB W;  1UG1 A;  2K79 A;  1V1C A;  1TG0 A;  2LNH B;  4J9I A;  2EPD A;  1I0C A;  1MV0 B;  1VYV A;  2JS2 A;  2RMO A;  1YNZ A;  2D8H A;  3KFV A;  2CT3 A;  4AFS C;  2YUP A;  2KR3 A;  1PRL C;  2P4R A;  2HCK A;  3VRZ A;  2G6F X;  1SEM A;  3NHN A;  2ROT A;  1HJD A;  2ESW A;  3EG1 A;  2NWM A;  4RTY A;  1ZX6 A;  1PWT A;  1IO6 A;  1NYF A;  2D1X A;  2EYZ A;  2LCS A;  1ARK A;  2K9G A;  1NEG A;  5I22 A;  4AG1 C;  1T3L A;  1OOT A;  3PE0 A;  4ZNX A;  1QWE A;  1WXB A;  2JT4 A;  3SHW A;  2RQU A;  1FMK A;  2MCN A;  4AFQ C;  2MOX A;  2CDT A;  4LN2 A;  1K0S A;  5ECA A;  1U5S A;  1X2K A;  4RTW A;  2C0T A;  1AVZ C;  2A37 A;  1N5Z A;  2DRM A;  3QWX X;  3NPF A;  1K1Z A;  1YN8 A;  3QWY A;  2HSP A;  2XMF A;  2CT4 A;  4HCK A;  2FPF A;  2CSQ A;  2CH4 W;  1AD5 A;  4F17 A;  2KYM A;  1PKS A;  1TUC A;  2EGA A;  1X6B A;  2DJQ A;  2YSQ A;  3M0S A;  4Z8A A;  3H0I A;  1M3B A;  3VS3 A;  2J6F A;  4OMP A;  1WXU A;  1U06 A;  1ABQ A;  2DL5 A;  2HDA A;  4RTV A;  4FSS A;  4DEX A;  4LNP A;  2O9S A;  2NUZ A;  1PKT A;  3TSZ A;  2PNI A;  1Y0M A;  3EHQ A;  3TVT A;  1HSQ A;  2DLP A;  3M0T A;  5IXF A;  1I1J A;  2J6O A;  4OMQ A;  4R0K A;  4AFZ C;  2SRC A;  2F2V A;  2W10 A;  1WI7 A;  2DBK A;  2GBQ A;  2GGR A;  3M0R A;  1WA7 A;  1JEG A;  2RPN A;  1AWO A;  1YWP A;  4J9E A;  1RUW A;  4CC7 A;  2M51 A;  4IIO A;  1UDL A;  1PNJ A;  2AZV A;  3PVQ A;  3RNJ A;  2O88 A;  4OMO A;  1TUD A;  2OI3 A;  3VS6 A;  1UEC A;  1SRM A;  1H8K A;  3VS1 A;  1UJY A;  2AKL A;  1QKW A;  2RQV A;  3EHR A;  2D0N A;  4JJB A;  1BB9 A;  1AEY A;  1WFW A;  4ESR A;  1GCQ A;  2DNU A;  1LCK A;  2OJ2 A;  1X6G A;  4RUG A;  4EIK A;  1GCP A;  1T3S A;  2JS0 A;  2K7A A;  4J9G A;  2KRM A;  2EBP A;  4OMN A;  1GCQ C;  2C0O A;  4CC4 B;  3TSW A;  2FPD A;  2D8J A;  4D8K A;  1H92 A;  1XOV A;  4KRT A;  2FRW A;  5L23 A;  4OML A;  4J9D A;  1E7O A;  2RF0 A;  2VVK A;  2KRN A;  1OV3 A;  2ENM A;  1FYN A;  1BK2 A;  1W6X A;  2EYY A;  1E6G A;  4D8D A;  1BU1 A;  1ZUK A;  2PZ1 A;  2YUQ A;  3NGP A;  3VS7 A;  1WLP B;  1X43 A;  2YDL A;  1MUZ A;  5FW9 A;  1CSK A;  1RLQ C;  2JMA A;  1JU5 C;  2LQN A;  2RN8 A;  1RLP C;  2GNC A;  4J9H A;  2KEA A;  5IHI A;  3VS0 A;  1OPL A;  2QDL A;  2L3Q A;  2AKK A;  3VS2 A;  4CC2 A;  4HXJ A;  4AG2 C;  4GBQ A;  3SEM A;  2IIM A;  2DL8 A;  4RTX A;  1MV3 A;  1WYX A;  2EYW A;  2CRE A;  2RQT A;  4JJC A;  2J7I A;  2K2M A;  3LH5 A;  1X2Q A;  2KYB A;  4RTT A;  1CKB A;  1RI9 A;  4OMM A;  2DX1 A;  2M0Y A;  1QCF A;  1EFN A;  2F2X A;  2L3P A;  3GBQ A;  4JJD A;  1NLO C;  1PHT A;  2FRY A;  3EG0 A;  1WXT A;  1SHF A;  1GRI A;  4JZ3 A;  1CKA A;  2LX7 A;  2B86 A;  2KT1 A;  4RTU A;  1SPK A;  3H41 A;  1KSW A;  2KE9 A;  3UAT A;  3EG2 A;  2RNA A;  2DYB A;  2EGC A;  3R6N A;  4JZ4 A;  4Z89 A;  1QKX A;  2KT8 A;  1JO8 A;  3H0F A;  4F14 A;  3EGU A;  2BTT A;  1K76 A;  1M30 A;  3JV3 A;  2H8H A;  3CQT A;  3NMZ C;  4CC3 A;  2FO0 A;  2EYX A;  1U3O A;  2CH4 A;  4E6R A;  1UHF A;  2DIL A;  1AWX A;  2FG0 A;  1NLP C;  1NYG A;  2RQR A;  2V1Q A;  1UJ0 A;  4DEY A;  2K6D A;  1B07 A;  2W0Z A;  4HVU A;  1GFD A;  1X69 A;  4K11 A;  5IH2 A;  2DVJ A;  2C0I A;  2O2O A;  1VYT A;  3I9Q A;  3IQL A;  1NEB A;  2LQW A;  4J9F A;  1H3H A;  2LJ1 A;  2E5K A;  2LMJ A;  1AWJ A;  1X27 A;  1GBR A;  1YCS B;  5IHK A;  1Z9Q A;  4WCI A;  4ORZ A;  4J9B A;  2VKN A;  2V1R A;  3FJ5 A;  1PRM C;  1ZBJ A;  2X3W D;  4LE9 A;  1G2B A;  3I5S A;  4AFU C;  1AZE A;  2J05 A;  1OPK A;  2DRK A;  3VRY A;  2EGE A;  2J6K A;  2O31 A;  1Z9Z A;  1WX6 A;  1KIK A;  2DL4 A;  4Z88 A;  2AK5 A;  1VA7 A;  1G83 A;  1A0N B;  2KBT A;  1T0J A;  1UTI A;  1AWW A;  3REB B;  2MIO A;  2OAW A;  2DA9 A;  1M8M A;  5EC7 A;  5GJV B;  2BZ8 A;  4M4Z A;  2KRS A;  2JM9 A;  5IXB A;  2YUN A;  1KFZ A;  3ULR B;  1ZLM A;  2DE0 X;  2ED0 A;  3C0C A;  3VS4 A;  5HCK A;  2CSI A;  3REA B;  2HEQ A;  2SEM A;  2EW3 A;  4GLM A;  2X3X D;  1B3Q A;  1KJW A;  1ZSG A;  1SHG A;  4J9C A;  2KXC A;  2F2W A;  2DM1 A;  2L0A A;  4F16 A;  1UHC A;  2PTK A;  5IHN A;  1K9A A;  2AZS A;  2ED1 A;  2GTO A;  2YT6 A;  1JXO A;  4QT7 A;  1GFC A;  1T0H A;  1K0X A;  1NG2 A;  2J06 A;  2LZ6 B;  2YUO A;  2DF6 A;  2FPE A;  1M3C A;  2ECZ A;  2RQW A;  1SRL A;  2L3S A;  1M27 C;  3I5R A;  2FEI A;  2LJ3 A;  1JXM A;  1YWO A;  1NM7 A;  1QLY A;  3M0Q A;  2JTE A;  4Y92 A;  2K3B A;  1Y57 A;  2JXB A;  4LUD A;  2A36 A;  2LP5 A;  1ABO A;  2DL7 A;  2EVR A;  2L2P A;  2ABL A;  2CUD A;  1VYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...