1KIKA

Sh3 domain of lymphocyte specific kinase (lck)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
NLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure determination of human Lck unique and SH3 domains by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
total genus 8
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kikA00
4JPBW 2KRMA 2P4RA 3TSZA 2JS0A 2FPEA 3VS3A 1JU5C 2LNHB 2LJ0A 3RBBB 1GL5A 3VS6A 2D0NA 4RTTA 2AZVA 2FEIA 3ZL7C 1X6GA 4ORZA 1SHGA 2KXDA 5ECAA 2RPNA 3VRYA 1AWJA 2IIMA 4J9DA 4KRTA 2DL3A 2EGCA 2LMJA 2CT3A 2GTJA 1CKAA 2JMCA 2GBQA 2JW4A 1JEGA 2X3WD 3PVQA 2W10A 3SEMA 2SRCA 4RTZA 1ZUUA 2J7IA 1T0HA 1HSQA 4A63B 2KBTA 2DF6A 3I5SA 1WIEA 1E6GA 1B3QA 2D8JA 2MCNA 1I07A 4IIMA 1W1FA 2EBPA 1GBRA 4ESRA 1EFNA 1NM7A 4AFQC 4GLMA 2JM8A 1RUWA 2CUDA 4HVVA 1K4US 2J06A 1K9AA 2X3XD 1H3HA 2RQTA 2CUBA 1ZBJA 2V1RA 2W0ZA 4LN2A 2DL4A 1SSHA 2MIOA 4RTUA 4EIKA 2LQWA 1M30A 2AKLA 2J6OA 1U5SA 4AG1C 3UA7A 1OV3A 2NWMA 1UG1A 3VS2A 4AFUC 1W70A 2KNBB 1VYTA 1BU1A 2CSIA 1WDXA 3ULRB 1M3AA 2GNCA 4E6RA 2F2VA 2OAWA 4OMPA 2A08A 5FWBA 1QKWA 1I1JA 4WCIA 5GJVB 1VA7A 4LE9A 4AFSC 1H92A 1KSWA 4OMMA 3CQTA 3M0UA 3I35A 3PVLA 2KYMA 3NPFA 2LX7A 3VRZA 4D8DA 4LNPA 1WI7A 4J9IA 3THKA 2DYBA 1NG2A 2PTKA 2YDLA 2AKKA 1FYNA 4JJBA 5L23A 1GFDA 2C0TA 2A28A 2VWFA 1HD3A 2PNIA 1AD5A 2BTTA 1YNZA 1WX6A 2DILA 3FJ5A 3TVTA 1RLPC 2YSQA 2KXCA 1M27C 4HXJA 3QWYA 1E6HA 1VYUA 2ENMA 3KFVA 4DEXA 2JTEA 4J9CA 2K6DA 1RLQC 1YCSB 4JJDA 1B07A 2NUZA 2RF0A 2I0NA 1UHCA 2ED0A 2EYZA 1TUCA 2RQVA 1KIKA 1KJWA 2LJ3A 4J9HA 1U06A 2PZ1A 2SEMA 4K11A 2L3QA 1YWOA 3TSWA 2J6KA 1AWWA 2D8HA 3H41A 1MUZA 2K79A 2DX1A 2LZ6B 2C0IA 2OJ2A 1JO8A 3C0CA 4LUDA 1H8KA 3SHWA 4RTVA 1K76A 4HCKA 1NLOC 2FG0A 1OOTA 1ZX6A 4AFZC 4F16A 2RN8A 2AK5A 1X2QA 1SHFA 3M0RA 2L3SA 4M4ZA 1U3OA 1VYVA 2B86A 4OMQA 3VS7A 4JZ4A 1WXBA 2JMAA 1PRLC 1AZGB 1PNJA 3VS4A 2BZ8A 1WLPB 2EYWA 3EG0A 1WFWA 3NHNA 1BB9A 2K2MA 2ED1A 1Z9QA 2FPDA 2HEQA 2F2WA 2XMFA 3EHRA 1MV3A 2EPDA 3A98A 3EHQA 3EG2A 1A0NB 1ZSGA 1W6XA 2EGAA 2YUNA 4CC3A 1CSKA 2CT4A 2YT6A 1OPLA 1UUEA 4CC2A 5IH2A 1ARKA 4OMNA 3PE0A 2LCSA 1N5ZA 1PKTA 3UF4A 2EVRA 4JZ3A 2YUOA 1K1ZA 2MOXA 1X2KA 1Y57A 2FO0A 2OI3A 1ZUYA 2D1XA 2DM1A 2DLPA 2GGRA 5IHIA 2FRYA 1AVZC 2J6FA 3EG1A 3GBQA 2LP5A 1WXTA 2ROTA 1JQQA 2YUQA 4GBQA 1OPKA 3NMZC 1M3BA 2VVKA 1FMKA 2HCKA 1UECA 2HDAA 1UHFA 2DE0X 5I22A 2KGTA 3QWXX 2O2OA 5IXFA 2ESWA 1NYGA 2DRKA 2JT4A 4Y92A 3VS1A 1XOVA 3UA6A 1SEMA 5FWCA 1PKSA 1NYFA 2KRSA 3I9QA 4JJCA 4CC4B 2CREA 3H0FA 3M0PA 1KFZA 3H0IA 1SRMA 2FRWA 3R6NA 2EYXA 2YUPA 1Y0MA 2L2PA 2RQUA 2EW3A 4Z8AA 2K3BA 1NEBA 2HSPA 1QWEA 2EQIA 1X69A 2HBWA 2EGEA 4X1VA 5IHNA 5IHKA 1UTIA 1TUDA 4AG2C 2LJ1A 1YP5A 1ABOA 2EKHA 1CKBA 1PWTA 1QCFA 1PHTA 2K9GA 1MV0B 1UE9A 2DL8A 3EG3A 1GFCA 3RNJA 2GQIA 2KYBA 2DBKA 2CH4A 1BK2A 3M0QA 1K0XA 4RTWA 1M3CA 3JV3A 1X27A 2O31A 1T3LA 1AOJA 2DL7A 2ECZA 2KT1A 2G6FX 3M0TA 4LUEA 2JXBA 1OEBA 1ZLMA 2H8HA 2DVJA 2BZYA 2RQWA 3M0SA 3VS0A 2DMOA 2RQRA 1SRLA 2F2XA 3I5RA 4CC7A 1K0SA 1GCQC 1NLPC 3EGUA 2JM9A 1NEGA 1G83A 5EC7A 1AWOA 4DEYA 1AWXA 2KT8A 2DA9A 2FPFA 2KRNA 1X6BA 4ZNXA 4QT7A 1QWFA 2QDLA 1V1CA 1WYXA 1UJ0A 1T0JA 5GJWB 2L0AA 1S1NA 2E5KA 1WXUA 2K7AA 2CSQA 1T3SA 2KEAA 4RTXA 1QKXA 1SPKA 4F14A 4R0KA 4J9GA 4D8KA 4F17A 1PRMC 2J05A 3U23A 4J9EA 1UGVA 1LCKA 4FSSA 3REBB 3VS5A 4HVUA 4OMOA 2VKNA 2KR3A 1E7OA 2O9VA 1UDLA 2A37A 1YWPA 1ZUKA 1YN8A 1RI9A 2C0OA 1TG0A 4J9FA 4RUGA 3IQLA 2DBMA 2KROA 2O88A 2RNAA 2CH4W 5HCKA 1AZEA 4OMLA 1AEYA 3LH5A 1I0CA 2CDTA 1UJYA 1GRIA 2ABLA 2DL5A 1HJDA 2M51A 2LQNA 5IXBA 5FW9A 1JXOA 2A36A 2JS2A 2DJQA 4J9BA 1M8MA 1IO6A 4IIOA 1GBQA 3O5ZA 2BZXA 3H0HA 3REAB 4HVWA 4RTYA 2EYYA 1UFFA 1QLYA 2ROLA 2DNUA 1GCQA 1J3TA 2RMOA 3UATA 2KE9A 1JXMA 1X43A 1Z9ZA 2AZSA 2O9SA 5I11A 1WA7A 1BBZA 4Z88A 2V1QA 2M0YA 2L3PA 1GCPA 4Z89A 1G2BA 2GTOA 1ABQA 2DRMA 3NGPA
chains in the Genus database with same CATH superfamily
1WPYA 4EMGA 3VS3A 2YWWA 3MEUA 3VS6A 4C92D 2D0NA 1M2VB 4ORZA 2KXDA 1NPPA 1AWJA 1WHKA 4KULA 3OYJA 2EGCA 2LMJA 5LJ5j 3OW2P 1CKAA 2E6ZA 3TEEA 3T9NA 3PVQA 2W10A 1P92A 1UEBA 2DYIA 3OA6A 3SEMA 1VQMA 4RTZA 3J80E 3NTIA 1ZUUA 2XDBA 3O8VA 5GAOr 1YI2T 1VQPA 3G71T 2YXYA 1I07A 4IIMA 1GBRA 3CCEA 4ESRA 4RG2A 4EPCA 5KCHA 4JUVA 4C8QF 1WZOA 3JCMh 4M75A 2HAXA 1K4US 5FU7B 1K9AA 3DB3A 1OX9A 3INZA 4X9DA 2H3JA 5GAN3 7AT1B 1QCOA 1SSHA 4RKUE 4EIKA 4M78G 2AKLA 3OYYA 3META 4AG1C 1NBEB 4HKEA 2NWMA 3HPWA 1OZ3A 4J5YA 3KXTA 4LD6A 4XTZA 2KNBB 1QP3A 1PCXA 5LJ3j 4QQGA 4DA4A 2GNCA 1Q82C 3X28B 1N8RC 1RADB 4M7DE 4QVDA 2A08A 5FWBA 2A3LA 2X4XA 5KYWB 3CQTA 5GANe 3UDCA 4OB1B 3NPFA 2CZ6B 3C95A 3VRZA 1H641 1YJWQ 4OMFB 1WI7A 3CPFA 3CMET 3EGXB 4XK8E 6AT1B 3MP6A 3NTHA 3EG9B 1FYNA 2C0TA 2EWNA 3VYGA 1N9SA 2ZPEB 2B8AA 1AD5A 4KT0E 3ZBDA 2BTTA 4M78F 1WX6A 2DILA 3FC3A 1RLPC 4M7AF 4RCBA 2KXCA 2DKGA 5GAN5 3EFOA 2ENMA 4DEXA 3RMQA 2JTEA 2K6DA 2MI6A 1RLQC 3OMCA 2RF0A 2M02A 1W4SA 1UHCA 2ED0A 1N8RU 2KDSA 1OZ2A 2RQVA 3ER0A 1U06A 3WXMB 1H3ZA 3ZFJA 3CCRT 2PZ1A 2RD1A 3A8LB 2L3QA 1YI2Q 3RR6A 2WSEE 2C0IA 1LPLA 2P0PA 4LUDA 1M90U 1H8KA 2DXBA 4KGXB 2JVVA 3CC4A 4O6JA 4M75D 1VQNA 5GAN4 2FG0A 4J83A 1VQ7T 2RN8A 2X51A 3M0RA 4M4ZA 2PUOB 5GAOn 1VYVA 2B86A 1D1CA 3VS7A 3CCLQ 1RAIB 4JZ4A 3QBYA 1MMAA 5DM7R 4M78C 1YJNQ 1Y96B 1AZGB 3JB9J 4KUDK 3VS4A 1WLPB 1TWBA 2K2MA 2RI2A 1RAAB 2XI9A 1BI2A 2XMFA 4J6YA 1VQLT 3I55Q 3CCVA 2RJDA 2CYZB 4E7SA 2P0KA 2DXCA 2EPDA 5AYFA 3EFOB 3CMAA 4DOVA 3HRUA 3JRZA 2QXFA 3MP1A 2YT6A 1OPLA 1UUEA 3VYHB 4CC2A 3CCSQ 1Y07A 4OMNA 5GMKe 2YLBA 3UF4A 3CCVT 2YUOA 2I2LA 1N9RA 3CXCA 1AVZC 1YHQQ 3M59A 5D6XA 3OYKA 5LJ3f 4PJOB 3NMZC 3JB9G 1N6AA 4Y28E 1RAEB 2NUTA 2DE0X 3QXEB 3OYHA 3OY9A 5GAMd 3QYGB 3CCMT 2L5QA 1VQLQ 5CKDA 5GAN6 3ME9A 4FYWB 4DBFA 1PKSA 3CD6A 3I9QA 3OBWA 5GANf 4QKUA 3H9NA 2E3IA 3M0PA 1MNEA 1SRMA 2JTMA 2OTLA 3R6NA 2YUPA 2CS7A 5FU6B 1QMCA 3L2QA 2HSPA 4XTXA 2HBWA 1UTIA 1R77A 4AG2C 4Q5WA 2LRQA 1CKBA 3M9QA 2V8KA 1MV0B 3E2UA 2VB6A 2VGMA 3EG3A 4LDXA 4PLIA 2H3EB 1PM3A 4JRKA 3RNJA 2GQIA 4MZPA 2QA4Q 4F7UF 2Y4XA 3OS1A 2CP7A 1D0YA 2R5MA 3RMSA 2K4YA 2D0QB 4M75E 1T3LA 3M0TA 3M5AA 2H8HA 1V76A 2BZYA 2DMOA 5CKHA 2F2XA 2VASA 4CC7A 2YHTA 3OYCA 2X35A 4F04B 1NLPC 4FSXA 4J8OA 3OYEA 4IURA 1VQ5A 4L5GA 2JM9A 3PGGA 3CC7A 2AIRB 1AWOA 3LW5E 3OYIA 4DEYA 1IREB 2M1HA 3JB9F 3V7RA 2KRNA 3OYBA 1W2BS 4QT7A 3VV0A 3G6EA 3JCMf 1WYXA 3M55A 4II1A 2CZ0B 2XU8A 4C8QB 1GXIE 4ZN3A 4PJLA 1XQHA 3SWNC 1QKXA 2RJFA 4R0KA 2XG8D 1MMNA 4D8KA 1KQ1A 2MPXC 3U23A 4JRPA 3REBB 3VS5A 4FYVB 1K8AR 1D3BB 1KC8C 1VQPQ 1ZUKA 2FZGB 2XDDA 3RESA 4PJNA 2AT1B 1BCOA 3IQLA 1Y7XA 3CBMA 4XU0A 1M5Q1 3E1SA 2QTVA 3CXCS 3CCET 1M90C 1I0CA 3EGDA 1UJYA 3NTKA 3G71A 2QQBA 2M51A 1M1KU 4HT9A 4Y91A 1YI2A 2E41A 3OS5A 4ZGEB 3GPLA 1IO6A 3CCUA 3BDUA 1GBQA 3H0HA 4RTYA 4MDXA 3CCUQ 2CZ1B 4M77F 2DAQA 1J3TA 3GP8A 1G3TA 1X43A 2AZSA 5I11A 3LX7A 1BBZA 2JZ2A 4BY6C 5LJ3d 2M0YA 3JAME 2E65A 2L3PA 2NYSA 1D1AA 4RTTA 4JZ3A 2DRMA 5GAN7 4KGZB 3PTAA 1C0MA 5AT1B 2KRMA 3TSZA 2JS0A 2FPEA 5GAOp 1JU5C 4XQ3A 2E4HA 2M0OA 1RI0A 1X75C 1M8VA 1JRIA 1WHMA 1X6GA 3VRYA 2E70A 2A0FB 2LX9A 4M77B 2DL3A 2X3WD 1WHJA 2CGHA 3OYFA 1KG1A 1NPRA 2HKNA 4A63B 2KBTA 3I5SA 5GANg 3SD4A 1WIEA 1OI1A 2MCNA 1EFNA 2GFAA 4JRQA 2JM8A 1YITA 2CUDA 2PVOB 4FYXB 2NUPA 2JUFA 1FX7A 4PJJA 2CKKA 3PIOA 1S72T 3QJ6A 1YIJT 2ATCB 4RTUA 1WGSA 1VQ4A 1KQSP 1QP2A 1OV3A 4KH0B 3JSCA 4NL2A 4BY6B 3CMEQ 1UG1A 2ZPIB 4AFUC 4ZGDB 5LJ3e 1BU1A 3ULRB 5KYYB 2WACA 4C92A 1M3AA 3EFSA 5CVIA 1VQNQ 3CCEQ 2DERA 2QEXT 3AT1B 3MHXA 3MCAB 4WCIA 4Z02A 5GJVB 3CCUT 2BE7D 4LE9A 1OULA 4AFSC 2OTJT 3M58A 2DZ9A 4MMLA 1KSWA 4PL6A 3JCMP 5LJ3h 1U8RA 2NUPB 3CPWP 1WHHA 4BE0A 1IB8A 4LNPA 1KQSA 4J9IA 2IPOB 2BUDA 1QQJA 3CCJQ 1NG2A 3M57A 2K5FA 1ZA2B 4E47A 2AKKA 1N8RR 4M75C 3GOXA 3E19A 1GFDA 4X34A 2DFUA 2F5TX 1TS9A 2VWFA 4F7UG 3OYLA 1TTHB 2KK4A 5KYUB 5KE3A 2PNIA 3JCMe 2P84A 3FJ5A 4C5IA 5CO7A 2X9HA 1NZ9A 5KE2A 3MP8A 4XTVA 4C92B 4HXJA 3UWNA 4M78D 3R6OA 1VUBA 3KFVA 2QQ9A 4J9CA 2VXEA 2MAMA 2HL3A 1NJIU 1MMDA 3RUXA 3DKMA 2CP5A 5FRNA 1TUCA 1KIKA 1KJWA 2LJ3A 3I56Q 1K9MU 2SEMA 1Q81U 4K11A 3OYDA 5D6YA 1AWWA 2J6KA 2D8HA 4C0DC 1XTDA 4J7FA 2ZAEA 3SHWA 4FT2A 4RTVA 2R57A 4IUTA 1C6VX 1RAGB 4C92F 4HCKA 1BYMA 3CC7T 5CQXA 2HBPA 1VQ5T 1ZX6A 1VQ8T 3CCQA 5KYXA 2EJGA 4PJMA 4AFZC 1BKBA 4F16A 5LJ3g 3A8HB 3JCMQ 1U3OA 1WJQA 2L8DA 1TXQA 4HA8A 4V2SA 2E1HA 4X9CA 1TU0B 2PQWA 3RDVA 4M75B 2COZA 1HYOA 4ANJA 3QPHA 2QQSA 3EG0A 1WFWA 4IUUA 3J7AF 5I21A 3SFMA 4P5NA 2GF7A 2ED1A 4OGCA 2FPDA 3HFOA 3A98A 3EG2A 1A0NB 1ZSGA 3MEVA 2EGAA 4CC3A 1IHWA 1CSKA 2PU9B 5KCOA 3SWNA 1VIEA 2QK0A 1ARKA 1VQ6T 1PKTA 2VV5A 4N0AA 4ZGJB 5HY6A 4N4HA 1X2KA 3A8GB 3WVDB 2CP6A 2DLPA 5IHIA 4NL3A 3LLRA 3G7ZA 2KI7A 3ASKA 3BW1A 3C12A 2J6FA 4PKCC 3CC4Q 4PJOA 2YRCA 2LP5A 4RG8A 3OW2A 2DEQA 1QVPA 2OTLT 5L8RE 1UECA 5J39A 1LOJA 5GANd 2KGTA 1VQ9Q 1UGRB 5GAMh 2CP3A 3L2WA 3BDLA 4B9XA 5IXFA 2ESWA 1NYGA 2DRKA 2JT4A 4Y92A 3VS1A 2COWA 4JJCA 3CCMA 4R56A 2FB7A 3M53A 1WQ7A 1C1AA 1AHJB 4BDYA 1KFZA 4MMKA 2LNVA 3V8LA 2QYZA 2L2PA 2QTXA 2RQUA 4J7IA 3VUZA 4BI8B 4OF1A 1UGQB 8ATCB 3LWHA 1QVFP 1NEBA 4CI0C 2EQIA 1X69A 5IHKA 1FMVA 4E7JA 2CP0A 1SG5A 3L2RA 4XTWA 1YP5A 1DJ7B 3M56A 4E2FB 2DL8A 3CC2T 3CMAT 1VQ7Q 3P8DA 4DOWA 4M7AA 4ZTJA 2RM4A 2EIFA 2MK5A 3M0QA 3MO8A 4ATOA 2Y4YA 3QYHB 1HXDA 1YJWA 1VQ8Q 2G6FX 2JN0A 2JXBA 4KBMB 2DD5A 4E7ZA 3OSVA 2LCCA 4JS5A 3M0SA 2MWPA 4A4HA 4OGEA 2BKDN 4FIBA 5GMKl 4RMOA 2E64A 4R55A 3I5RA 2K57A 1PSFA 3FIFA 3G4SQ 1K0SA 1GCQC 2QGFB 1VQ7A 1Q81C 3G4SA 1VQOT 2LCLA 1G83A 2RJEA 2L89A 4QVZA 2K2VA 1M1KC 1MNDA 1VQ8A 2O4XA 1UJ0A 5C6SA 5CCAA 1Y71A 1T0JA 4AMCA 1U1SA 1S1NA 2QAZA 4M77D 4AT1B 1WXUA 2K7AA 1NJIC 3CPWS 3AHUA 1MHNA 4F14A 2IVWA 4DBRA 1WQWA 4J9GA 1PRMC 2J05A 1VQOQ 3JCMg 4FSSA 3GNFB 4YTLA 2VKNA 4ELZC 3EH2A 1UDLA 2RA2A 5GMKi 4J6WA 3OQ5A 4C0GA 4LD9K 4WTOB 1K73R 4C8QE 4J9FA 3CBOA 5CIUA 3RKXA 5GANh 2R58A 4XU3A 2CZ7B 2DBMA 2L3RA 2KROA 1FWZA 3TU4K 3OSSC 4QQDA 4GLKA 5HCKA 2KMTA 5GAOq 2KVQG 1AEYA 3LH5A 2DXUA 1HJDA 2Z0WA 2K5LA 5I2SA 2R5AA 2JS2A 4J9BA 1M8MA 2P0QA 3X20B 1XNIA 1Q82U 1YJ9A 2BZXA 5DLOA 4DBHA 2FL7A 2EYYA 4A4FA 2EQUA 3OYMA 1I8FA 3C94A 2YRDA 4A54A 3CCJT 5FRMA 4L6V5 3UATA 2KE9A 1QVFA 1JXMA 4A4EA 2OTJA 3F70A 2V1QA 2QEXA 3CC7Q 3V8JA 4XU1A 1ABQA 1M1FA 5C0MA 2P4RA 3H8ZA 2EQMA 5FROA 3RBBB 2LJ0A 1GL5A 3BFMA 2AZVA 3SB2A 3ZL7C 4ZN1A 2KQWA 1SHGA 2RPNA 2IIMA 2JJ9A 4KRTA 1VQ4T 2E12A 3JCMb 1WNLA 4UC4A 1JEGA 2RK2A 1FXXA 1QW1A 4E7KA 1ACMB 2J7IA 1HSQA 1TUGB 1YITT 3FDRA 1BI0A 3EGDB 2VGNA 1B3QA 1OU8A 2D8JA 3A1PA 4E7LA 1NM7A 4AFQC 3JCMJ 4GLMA 1RUWA 5D7UA 1K9MC 1FMWA 3VJPA 2X3XD 2RQTA 3HL8A 2CUBA 4M7DD 3FB9A 2V1RA 3A8OB 2MWOA 1YHQT 2W0ZA 4LN2A 2DL4A 2MIOA 2GFUA 4A4KA 2LQWA 1M30A 3QIIA 3JB9D 2OTLQ 3ZEHA 3E9FA 3VS2A 3NFCA 3HRTA 1VYTA 1I5OB 2CSIA 1WDXA 3CCLT 1PC0A 3OW2S 3CXCP 4E6RA 1VIFA 2F2VA 4C8QA 2WSCE 3QSUA 5IT9E 1QKWA 4B6MA 3S3MA 1H92A 4OMMA 5A0GA 5FLXE 3I35A 3PVLA 2MYSA 2KYMA 1KD1R 4M7AB 3VU3C 4RCCA 2HL5C 2LX7A 4B9WA 2HQXA 2X4JA 1ZBXA 3EGXA 1I4K1 3THKA 2DYBA 1LVKA 1ZQ1A 3V7CA 1EX4A 1RL2A 3RIRA 4OB2B 1IHVA 1O9SA 1OU9A 2GCXA 4PFZA 1Q86R 1HD3A 1K9MR 3CC2Q 4XAXB 3HHTB 2DTIA 1M90R 1G8XA 1VQKA 1RACB 3P8BB 2VUBA 1M27C 3HTRA 4C8QD 3QWYA 1VYUA 4ELYC 1QVFS 1BIBA 4FU6A 4JJDA 1B07A 2NUZA 4IUPA 3A5ZB 1YBYA 2EJ9A 2I0NA 2RJCA 2XIDA 1BI1A 1YJ9Q 2DO3A 2EYZA 2CP2A 4IUVA 4J9HA 2QQAA 3OMGA 2YRVA 4N4GA 3TSWA 1IZ6A 5GAMe 3H41A 5J26A 2K79A 1M9SA 2K3YA 2LZ6B 2RHZA 3C0CA 4M7DA 2QQRA 2DJZA 5J3BA 1RAFB 2F69A 4PFPA 1KQSS 3JB9H 3LH0A 1NLOC 4N4IA 3BY7A 2HQHA 1LNXA 2AK5A 2QDYB 1X2QA 1RAHB 2L3SA 1R8OB 4OB3B 5IAYA 4OMQA 4BB7A 3I56A 4E7IA 2RI3A 1WXBA 4C8QC 2JMAA 5FU6C 1PRLC 1PNJA 2BZ8A 2KY9A 3E9GA 1BB9A 4M7AD 3L42A 3EHRA 2HKQB 3VUBA 4VUBA 3EHQA 4L59A 5GMKh 3N5BB 2BIVA 1W6XA 2YUNA 1X6OA 3CCRQ 4JJNK 3CD6Q 5IH2A 1N5ZA 2JOYA 4C5GA 2MOXA 2LDMA 2EKOA 2OI3A 1ZUYA 1WHGA 2D1XA 4ZTFA 3URGA 3OYAA 3QZ5B 2FRYA 4EMHA 2HSEB 4FYYB 3GBQA 2QI2A 2ROTA 1WXTA 2RO0A 4GBQA 1M3BA 1FMKA 2HCKA 4A4GA 1UHFA 5I22A 4MZTA 3QG1A 2EJFA 3EG9A 3I56T 2AHJB 2O2OA 1XOVA 3UA6A 1SEMA 5FWCA 3PT9A 4M7AC 3EAEA 2CREA 3H0FA 4PJOD 1VQOA 3H0IA 3G4ST 1WJRA 3GNGA 1KC8U 2EYXA 5GAMj 3JCMc 1QCNA 2V8IA 1HK9A 1K8AC 2C06A 3L2VA 4DQ2A 1LJOA 3FEOA 2RI5A 4X1VA 4PJOF 5GAN2 2EGEA 5IHNA 1TUDA 3HRSA 3OS0A 2LJ1A 1TH7A 1ABOA 2EKHA 1YJWT 9ATCB 2HMAA 3OYNA 1QCFA 1PHTA 4EMKA 5LJ5e 2EAYA 4BD3A 2XICA 4LDVA 3M4GA 3JB9I 1R0BG 3D7SB 4XU2A 3L1AA 1GFCA 3LGLA 3OB9A 2KYBA 2DBKA 2CH4A 3CC2A 4M77C 2QA4A 1B34B 4RTWA 1JBMA 1M3CA 1X27A 4M77A 1AOJA 3PNWC 3QO3A 2DVJA 2RQWA 3VS0A 1Q7YC 4PJOC 4OP0A 4C92E 4M75G 1G3WA 1B34A 5EC7A 5CKBA 3MKDA 3FJPA 4C0ZA 3OYGA 1ZSZC 2DK3A 1JJ2A 2KT8A 1K8AU 2X4YA 4QVCA 2LQKA 2FPFA 1QWFA 3L2ZA 5GAOl 1VQNT 3QHSA 3CC4T 1VQ9A 2L0AA 3QKJA 4C5EA 2DTOA 1OYXA 2E5KA 4J6XA 3JCMV 1T3SA 1O75A 2PVDB 1SSFA 3CCMQ 4IUQA 1N27A 1VQ6A 4A53A 1D0XA 5A0DA 4F17A 3JCMX 2ZPFB 4BE1A 3S3OA 4WF2A 4J9EA 4QQ6A 2ZCFB 1TSFA 2KR3A 5FU7C 2O9VA 2ZPBB 1B7TA 1RI9A 1YHQA 2C0OA 1Q82R 1Q7YU 1TG0A 1XJWB 4HCBA 4BDZA 3PMIA 4RUGA 2BE9B 3I55T 2FZKB 2RNAA 2CH4W 1D3BA 1G3YA 1OQKA 4TVRA 3Q1JA 4OMLA 2CDTA 3M4YA 5LJ5f 1GRIA 2DL5A 5CAIA 4LDWA 1W2BP 5FW9A 1JXOA 2A36A 3CCVQ 4NS5A 3CMEA 2DJQA 5HK0A 2LVMA 2F1LA 2XHCA 2D9TA 2XD0A 2F5KA 3O5ZA 5CKEA 4FT4A 3CCQQ 3REAB 4HVWA 4HCZA 5M9OA 1GCQA 2RMOA 2FZCB 5CQYA 5DY9A 1Z9ZA 2DIGA 2KSSA 1WA7A 5GAMg 4M78B 1GCPA 4Z89A 3RKWA 1G2BA 2GTOA 4JPBW 4M7DC 1IRXA 2K5IA 2HQEA 3GIBA 3EFRA 2LNHB 3JCMd 2V8JA 4PJOG 1W2BA 2OX7A 2FEIA 5GAN8 5ECAA 1RABB 4GY5A 3CCJA 4OB0B 4J9DA 2NLUA 4PLLA 2VC8A 1M1GA 2CT3A 2GTJA 3RKYA 2JMCA 1VQ5Q 2GBQA 2JW4A 1YJ9T 5A2QE 3TQ7P 4KH1B 2SRCA 4IKFA 2X4WA 4JDSA 1T0HA 1D1BA 2DF6A 2GQVA 3LWIA 1E6GA 3LYIA 4XTYA 3J81E 1W1FA 2EBPA 4M7DF 4JLIA 1VQPT 1SKUB 4HVVA 4N0AC 2DVEA 2J06A 4HCCA 1VQMT 1H3HA 4BACA 5LJ5d 1JB0E 1ZBJA 3VKIA 4OVAA 2E5QA 4C92C 2J6OA 1U5SA 1KD1U 2MF2A 3UA7A 4M7AG 4MDWA 3CBPA 5CR2A 1V29B 4C92G 1W70A 1PSEA 4M7DB 4LDYA 2JTFA 3SWNB 1I5LA 1X01A 4E7HA 3HFNA 2OAWA 4OMPA 2ZPHB 4PNOA 2EQJA 1I1JA 4JS4A 1Q86U 1VA7A 2FVUA 4BI4A 3M0UA 1YCYA 2XKOC 3L2UA 1PD0A 1M2VA 3PMTA 5KH6A 4HT8A 1MMGA 1KHCA 4D8DA 3CEYA 1I81A 4M78E 4M7DG 5EG2A 2DXTA 3CMAQ 3PFSA 1NJIR 1QVGS 2PTKA 3I55A 2YDLA 2V26A 4JJBA 5L23A 4LXCA 5KYXB 2E3HA 2A28A 2JNGA 3MJXA 4JLGA 1QVGA 1YNZA 3TVTA 3MEWA 4BI3A 3G6EQ 1ZSZB 2YSQA 4PFOA 1IXDA 1E6HA 4O5VA 1VOMA 4C8QG 1EIFA 1YCSB 4C5HA 2NUTB 5CK9A 5LL6S 5IN1A 2FYKA 3TREA 1PD1A 2DTHA 1VQ9T 3H6ZA 1D0ZA 1VQMQ 1YWOA 2RHIA 1MUZA 2DX1A 3GF5A 2OJ2A 1JO8A 1K76A 5I2MA 5KYUA 2LT1A 3C4SA 1OOTA 1QVGP 1TOVA 4C0FA 1SHFA 2P4TA 4D6WA 2K3XA 3KUFA 4EMKB 2QASA 1Q81R 3FRNA 4BE2A 2DZCA 3HKSA 2EYWA 1Y96A 3NHNA 1MGQA 3G1JA 3V8KA 2IG0A 2QA4T 1Z9QA 1D09B 3X24B 2EQKA 2HEQA 4DBQA 2F2WA 5KYYA 2ZGWA 1MV3A 3QJYA 1R0CB 3DB4A 3A8MB 4ME7A 4XTUA 3V7SA 2A7YA 2ZPGB 5CKFA 2CT4A 2DIQA 3OBYA 2QGGA 4M78A 3PE0A 2LCSA 2EVRA 1K1ZA 3S3NA 4M75F 1Y57A 2M16A 2FO0A 1KC8R 4KGVB 2DM1A 2GGRA 5GMKj 3M54A 5KYWA 3EH1A 1YJNT 3EG1A 1S72Q 3S6WA 1JQQA 2YUQA 3FLGA 4C0DB 4M7AE 1OPKA 1YFNA 1VQKQ 2VVKA 3G6ET 2HDAA 2MMPA 3QWXX 4LDUA 3HSBA 1KQ2A 4M77G 1WJSA 2RK1A 3GLXA 3CPWA 2DPPB 4FL6A 3RERA 3CCSA 1NYFA 5HKCA 1BCMA 2KRSA 5LJ5h 2RHYA 2RH2A 4CC4B 3CCQT 3KBGA 1UGSB 2FRWA 2LT4A 2LC4A 3CCST 4EMKC 5GANj 1Y0MA 2EW3A 4Z8AA 1G3SA 4FM4B 4FW1A 1BIAA 2K3BA 2OAUA 3OS2A 2DETA 1QWEA 2G3RA 1JJ2S 2COYA 2KAFA 2DEUA 1K73C 2EFIA 3UT1A 1YJNA 1PWTA 2K9GA 4QW2A 5GAOm 1VQ6Q 1UE9A 2PUKB 4PJOE 3MEAA 1KD1C 1BK2A 1Q86C 2YLCA 3P8HA 1K0XA 4JRIA 1PG5B 3BE3A 3JV3A 2O01E 5HK3A 2O31A 2DL7A 2ECZA 2KT1A 1BI3A 4LUEA 1OEBA 1ZLMA 2XK0A 5A0LA 1NE8A 2HZYA 3QZ9B 1WHLA 3DLMA 2PVGB 1EZZB 1U1TA 8AT1B 2RQRA 1SRLA 1KHIA 3LGFA 3TCJA 2RHXA 1SF9A 3EGUA 4CRIA 1NEGA 2E10A 3QDRB 3CD6T 2LTOA 2HNIA 1AWXA 2DA9A 2O4XB 2DD4A 4ZNXA 1X6BA 4FW2A 3WVEB 2QDLA 1V1CA 3SDZA 1UGPB 5D6WA 2Y90A 1K73U 2VYTA 1Q7YR 4PK4A 5GJWB 4BUGA 1IGQA 2CSQA 2KEAA 4RTXA 3PIPA 2QG9B 2FHDA 1SPKA 2VXFA 3UPUA 1UB4A 1UGVA 1LCKA 1VQKT 4HVUA 1ZHIA 4OMOA 4KUIA 1E7OA 4MZMA 5GAMf 2A37A 1YWPA 2RHUA 3MPUB 5LJ5g 1YN8A 1KK7A 1YIJA 1S72A 1VQLA 1YITQ 1G5VA 2ZZDA 4M77E 3X26B 1YIJQ 2O88A 1JJ2P 5KYNA 2WSFE 4NOYA 1OX8A 1AZEA 1VQ4Q 1IGUA 1M4ZA 2ABLA 4F7UE 5DLQE 4F7UA 2LQNA 5IXBA 1F1BB 2M9UA 1Q95G 3QDFA 3JCMW 1ZA1B 3QUIA 5GMKm 2D6FA 1ZSZA 2EYQA 4IIOA 3DLLA 1UFFA 1M2OA 2OTJQ 2E6NA 1QLYA 2RB6A 2ROLA 2DNUA 4EDUA 3X25B 3CCLA 3CCRA 2O9SA 2HD0A 4F7UB 4Z88A 4FCYA 3HP9A 3G71Q 1AT1B 2QEXQ 2LQ8A 2XDPA 1M1KR 3NGPA
chains in the Genus database with same CATH topology
4JPBW 2KRMA 2P4RA 3TSZA 2JS0A 2FPEA 3VS3A 1JU5C 2LNHB 2LJ0A 3RBBB 1GL5A 3VS6A 2D0NA 4RTTA 2AZVA 2FEIA 3ZL7C 1X6GA 4ORZA 1SHGA 2KXDA 5ECAA 2RPNA 3VRYA 1AWJA 2IIMA 4J9DA 4KRTA 2DL3A 2EGCA 2LMJA 2CT3A 2GTJA 1CKAA 2JMCA 2GBQA 2JW4A 1JEGA 2X3WD 3PVQA 2W10A 3SEMA 2SRCA 4RTZA 1ZUUA 2J7IA 1T0HA 1HSQA 4A63B 2KBTA 2DF6A 3I5SA 1WIEA 1E6GA 1B3QA 2D8JA 2MCNA 1I07A 4IIMA 1W1FA 2EBPA 1GBRA 4ESRA 1EFNA 1NM7A 4AFQC 4GLMA 2JM8A 1RUWA 2CUDA 4HVVA 1K4US 2J06A 1K9AA 2X3XD 1H3HA 2RQTA 2CUBA 1ZBJA 2V1RA 2W0ZA 4LN2A 2DL4A 1SSHA 2MIOA 4RTUA 4EIKA 2LQWA 1M30A 2AKLA 2J6OA 1U5SA 4AG1C 3UA7A 1OV3A 2NWMA 1UG1A 3VS2A 4AFUC 1W70A 2KNBB 1VYTA 1BU1A 2CSIA 1WDXA 3ULRB 1M3AA 2GNCA 4E6RA 2F2VA 2OAWA 4OMPA 2A08A 5FWBA 1QKWA 1I1JA 4WCIA 5GJVB 1VA7A 4LE9A 4AFSC 1H92A 1KSWA 4OMMA 3CQTA 3M0UA 3I35A 3PVLA 2KYMA 3NPFA 2LX7A 3VRZA 4D8DA 4LNPA 1WI7A 4J9IA 3THKA 2DYBA 1NG2A 2PTKA 2YDLA 2AKKA 1FYNA 4JJBA 5L23A 1GFDA 2C0TA 2A28A 2VWFA 1HD3A 2PNIA 1AD5A 2BTTA 1YNZA 1WX6A 2DILA 3FJ5A 3TVTA 1RLPC 2YSQA 2KXCA 1M27C 4HXJA 3QWYA 1E6HA 1VYUA 2ENMA 3KFVA 4DEXA 2JTEA 4J9CA 2K6DA 1RLQC 1YCSB 4JJDA 1B07A 2NUZA 2RF0A 2I0NA 1UHCA 2ED0A 2EYZA 1TUCA 2RQVA 1KIKA 1KJWA 2LJ3A 4J9HA 1U06A 2PZ1A 2SEMA 4K11A 2L3QA 1YWOA 3TSWA 2J6KA 1AWWA 2D8HA 3H41A 1MUZA 2K79A 2DX1A 2LZ6B 2C0IA 2OJ2A 1JO8A 3C0CA 4LUDA 1H8KA 3SHWA 4RTVA 1K76A 4HCKA 1NLOC 2FG0A 1OOTA 1ZX6A 4AFZC 4F16A 2RN8A 2AK5A 1X2QA 1SHFA 3M0RA 2L3SA 4M4ZA 1U3OA 1VYVA 2B86A 4OMQA 3VS7A 4JZ4A 1WXBA 2JMAA 1PRLC 1AZGB 1PNJA 3VS4A 2BZ8A 1WLPB 2EYWA 3EG0A 1WFWA 3NHNA 1BB9A 2K2MA 2ED1A 1Z9QA 2FPDA 2HEQA 2F2WA 2XMFA 3EHRA 1MV3A 2EPDA 3A98A 3EHQA 3EG2A 1A0NB 1ZSGA 1W6XA 2EGAA 2YUNA 4CC3A 1CSKA 2CT4A 2YT6A 1OPLA 1UUEA 4CC2A 5IH2A 1ARKA 4OMNA 3PE0A 2LCSA 1N5ZA 1PKTA 3UF4A 2EVRA 4JZ3A 2YUOA 1K1ZA 2MOXA 1X2KA 1Y57A 2FO0A 2OI3A 1ZUYA 2D1XA 2DM1A 2DLPA 2GGRA 5IHIA 2FRYA 1AVZC 2J6FA 3EG1A 3GBQA 2LP5A 1WXTA 2ROTA 1JQQA 2YUQA 4GBQA 1OPKA 3NMZC 1M3BA 2VVKA 1FMKA 2HCKA 1UECA 2HDAA 1UHFA 2DE0X 5I22A 2KGTA 3QWXX 2O2OA 5IXFA 2ESWA 1NYGA 2DRKA 2JT4A 4Y92A 3VS1A 1XOVA 3UA6A 1SEMA 5FWCA 1PKSA 1NYFA 2KRSA 3I9QA 4JJCA 4CC4B 2CREA 3H0FA 3M0PA 1KFZA 3H0IA 1SRMA 2FRWA 3R6NA 2EYXA 2YUPA 1Y0MA 2L2PA 2RQUA 2EW3A 4Z8AA 2K3BA 1NEBA 2HSPA 1QWEA 2EQIA 1X69A 2HBWA 2EGEA 4X1VA 5IHNA 5IHKA 1UTIA 1TUDA 4AG2C 2LJ1A 1YP5A 1ABOA 2EKHA 1CKBA 1PWTA 1QCFA 1PHTA 2K9GA 1MV0B 1UE9A 2DL8A 3EG3A 1GFCA 3RNJA 2GQIA 2KYBA 2DBKA 2CH4A 1BK2A 3M0QA 1K0XA 4RTWA 1M3CA 3JV3A 1X27A 2O31A 1T3LA 1AOJA 2DL7A 2ECZA 2KT1A 2G6FX 3M0TA 4LUEA 2JXBA 1OEBA 1ZLMA 2H8HA 2DVJA 2BZYA 2RQWA 3M0SA 3VS0A 2DMOA 2RQRA 1SRLA 2F2XA 3I5RA 4CC7A 1K0SA 1GCQC 1NLPC 3EGUA 2JM9A 1NEGA 1G83A 5EC7A 1AWOA 4DEYA 1AWXA 2KT8A 2DA9A 2FPFA 2KRNA 1X6BA 4ZNXA 4QT7A 1QWFA 2QDLA 1V1CA 1WYXA 1UJ0A 1T0JA 5GJWB 2L0AA 1S1NA 2E5KA 1WXUA 2K7AA 2CSQA 1T3SA 2KEAA 4RTXA 1QKXA 1SPKA 4F14A 4R0KA 4J9GA 4D8KA 4F17A 1PRMC 2J05A 3U23A 4J9EA 1UGVA 1LCKA 4FSSA 3REBB 3VS5A 4HVUA 4OMOA 2VKNA 2KR3A 1E7OA 2O9VA 1UDLA 2A37A 1YWPA 1ZUKA 1YN8A 1RI9A 2C0OA 1TG0A 4J9FA 4RUGA 3IQLA 2DBMA 2KROA 2O88A 2RNAA 2CH4W 5HCKA 1AZEA 4OMLA 1AEYA 3LH5A 1I0CA 2CDTA 1UJYA 1GRIA 2ABLA 2DL5A 1HJDA 2M51A 2LQNA 5IXBA 5FW9A 1JXOA 2A36A 2JS2A 2DJQA 4J9BA 1M8MA 1IO6A 4IIOA 1GBQA 3O5ZA 2BZXA 3H0HA 3REAB 4HVWA 4RTYA 2EYYA 1UFFA 1QLYA 2ROLA 2DNUA 1GCQA 1J3TA 2RMOA 3UATA 2KE9A 1JXMA 1X43A 1Z9ZA 2AZSA 2O9SA 5I11A 1WA7A 1BBZA 4Z88A 2V1QA 2M0YA 2L3PA 1GCPA 4Z89A 1G2BA 2GTOA 1ABQA 2DRMA 3NGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPB W;  2KRM A;  2P4R A;  3TSZ A;  2JS0 A;  2FPE A;  3VS3 A;  1JU5 C;  2LNH B;  2LJ0 A;  3RBB B;  1GL5 A;  3VS6 A;  2D0N A;  4RTT A;  2AZV A;  2FEI A;  3ZL7 C;  1X6G A;  4ORZ A;  1SHG A;  2KXD A;  5ECA A;  2RPN A;  3VRY A;  1AWJ A;  2IIM A;  4J9D A;  4KRT A;  2DL3 A;  2EGC A;  2LMJ A;  2CT3 A;  2GTJ A;  1CKA A;  2JMC A;  2GBQ A;  2JW4 A;  1JEG A;  2X3W D;  3PVQ A;  2W10 A;  3SEM A;  2SRC A;  4RTZ A;  1ZUU A;  2J7I A;  1T0H A;  1HSQ A;  4A63 B;  2KBT A;  2DF6 A;  3I5S A;  1WIE A;  1E6G A;  1B3Q A;  2D8J A;  2MCN A;  1I07 A;  4IIM A;  1W1F A;  2EBP A;  1GBR A;  4ESR A;  1EFN A;  1NM7 A;  4AFQ C;  4GLM A;  2JM8 A;  1RUW A;  2CUD A;  4HVV A;  1K4U S;  2J06 A;  1K9A A;  2X3X D;  1H3H A;  2RQT A;  2CUB A;  1ZBJ A;  2V1R A;  2W0Z A;  4LN2 A;  2DL4 A;  1SSH A;  2MIO A;  4RTU A;  4EIK A;  2LQW A;  1M30 A;  2AKL A;  2J6O A;  1U5S A;  4AG1 C;  3UA7 A;  1OV3 A;  2NWM A;  1UG1 A;  3VS2 A;  4AFU C;  1W70 A;  2KNB B;  1VYT A;  1BU1 A;  2CSI A;  1WDX A;  3ULR B;  1M3A A;  2GNC A;  4E6R A;  2F2V A;  2OAW A;  4OMP A;  2A08 A;  5FWB A;  1QKW A;  1I1J A;  4WCI A;  5GJV B;  1VA7 A;  4LE9 A;  4AFS C;  1H92 A;  1KSW A;  4OMM A;  3CQT A;  3M0U A;  3I35 A;  3PVL A;  2KYM A;  3NPF A;  2LX7 A;  3VRZ A;  4D8D A;  4LNP A;  1WI7 A;  4J9I A;  3THK A;  2DYB A;  1NG2 A;  2PTK A;  2YDL A;  2AKK A;  1FYN A;  4JJB A;  5L23 A;  1GFD A;  2C0T A;  2A28 A;  2VWF A;  1HD3 A;  2PNI A;  1AD5 A;  2BTT A;  1YNZ A;  1WX6 A;  2DIL A;  3FJ5 A;  3TVT A;  1RLP C;  2YSQ A;  2KXC A;  1M27 C;  4HXJ A;  3QWY A;  1E6H A;  1VYU A;  2ENM A;  3KFV A;  4DEX A;  2JTE A;  4J9C A;  2K6D A;  1RLQ C;  1YCS B;  4JJD A;  1B07 A;  2NUZ A;  2RF0 A;  2I0N A;  1UHC A;  2ED0 A;  2EYZ A;  1TUC A;  2RQV A;  1KIK A;  1KJW A;  2LJ3 A;  4J9H A;  1U06 A;  2PZ1 A;  2SEM A;  4K11 A;  2L3Q A;  1YWO A;  3TSW A;  2J6K A;  1AWW A;  2D8H A;  3H41 A;  1MUZ A;  2K79 A;  2DX1 A;  2LZ6 B;  2C0I A;  2OJ2 A;  1JO8 A;  3C0C A;  4LUD A;  1H8K A;  3SHW A;  4RTV A;  1K76 A;  4HCK A;  1NLO C;  2FG0 A;  1OOT A;  1ZX6 A;  4AFZ C;  4F16 A;  2RN8 A;  2AK5 A;  1X2Q A;  1SHF A;  3M0R A;  2L3S A;  4M4Z A;  1U3O A;  1VYV A;  2B86 A;  4OMQ A;  3VS7 A;  4JZ4 A;  1WXB A;  2JMA A;  1PRL C;  1AZG B;  1PNJ A;  3VS4 A;  2BZ8 A;  1WLP B;  2EYW A;  3EG0 A;  1WFW A;  3NHN A;  1BB9 A;  2K2M A;  2ED1 A;  1Z9Q A;  2FPD A;  2HEQ A;  2F2W A;  2XMF A;  3EHR A;  1MV3 A;  2EPD A;  3A98 A;  3EHQ A;  3EG2 A;  1A0N B;  1ZSG A;  1W6X A;  2EGA A;  2YUN A;  4CC3 A;  1CSK A;  2CT4 A;  2YT6 A;  1OPL A;  1UUE A;  4CC2 A;  5IH2 A;  1ARK A;  4OMN A;  3PE0 A;  2LCS A;  1N5Z A;  1PKT A;  3UF4 A;  2EVR A;  4JZ3 A;  2YUO A;  1K1Z A;  2MOX A;  1X2K A;  1Y57 A;  2FO0 A;  2OI3 A;  1ZUY A;  2D1X A;  2DM1 A;  2DLP A;  2GGR A;  5IHI A;  2FRY A;  1AVZ C;  2J6F A;  3EG1 A;  3GBQ A;  2LP5 A;  1WXT A;  2ROT A;  1JQQ A;  2YUQ A;  4GBQ A;  1OPK A;  3NMZ C;  1M3B A;  2VVK A;  1FMK A;  2HCK A;  1UEC A;  2HDA A;  1UHF A;  2DE0 X;  5I22 A;  2KGT A;  3QWX X;  2O2O A;  5IXF A;  2ESW A;  1NYG A;  2DRK A;  2JT4 A;  4Y92 A;  3VS1 A;  1XOV A;  3UA6 A;  1SEM A;  5FWC A;  1PKS A;  1NYF A;  2KRS A;  3I9Q A;  4JJC A;  4CC4 B;  2CRE A;  3H0F A;  3M0P A;  1KFZ A;  3H0I A;  1SRM A;  2FRW A;  3R6N A;  2EYX A;  2YUP A;  1Y0M A;  2L2P A;  2RQU A;  2EW3 A;  4Z8A A;  2K3B A;  1NEB A;  2HSP A;  1QWE A;  2EQI A;  1X69 A;  2HBW A;  2EGE A;  4X1V A;  5IHN A;  5IHK A;  1UTI A;  1TUD A;  4AG2 C;  2LJ1 A;  1YP5 A;  1ABO A;  2EKH A;  1CKB A;  1PWT A;  1QCF A;  1PHT A;  2K9G A;  1MV0 B;  1UE9 A;  2DL8 A;  3EG3 A;  1GFC A;  3RNJ A;  2GQI A;  2KYB A;  2DBK A;  2CH4 A;  1BK2 A;  3M0Q A;  1K0X A;  4RTW A;  1M3C A;  3JV3 A;  1X27 A;  2O31 A;  1T3L A;  1AOJ A;  2DL7 A;  2ECZ A;  2KT1 A;  2G6F X;  3M0T A;  4LUE A;  2JXB A;  1OEB A;  1ZLM A;  2H8H A;  2DVJ A;  2BZY A;  2RQW A;  3M0S A;  3VS0 A;  2DMO A;  2RQR A;  1SRL A;  2F2X A;  3I5R A;  4CC7 A;  1K0S A;  1GCQ C;  1NLP C;  3EGU A;  2JM9 A;  1NEG A;  1G83 A;  5EC7 A;  1AWO A;  4DEY A;  1AWX A;  2KT8 A;  2DA9 A;  2FPF A;  2KRN A;  1X6B A;  4ZNX A;  4QT7 A;  1QWF A;  2QDL A;  1V1C A;  1WYX A;  1UJ0 A;  1T0J A;  5GJW B;  2L0A A;  1S1N A;  2E5K A;  1WXU A;  2K7A A;  2CSQ A;  1T3S A;  2KEA A;  4RTX A;  1QKX A;  1SPK A;  4F14 A;  4R0K A;  4J9G A;  4D8K A;  4F17 A;  1PRM C;  2J05 A;  3U23 A;  4J9E A;  1UGV A;  1LCK A;  4FSS A;  3REB B;  3VS5 A;  4HVU A;  4OMO A;  2VKN A;  2KR3 A;  1E7O A;  2O9V A;  1UDL A;  2A37 A;  1YWP A;  1ZUK A;  1YN8 A;  1RI9 A;  2C0O A;  1TG0 A;  4J9F A;  4RUG A;  3IQL A;  2DBM A;  2KRO A;  2O88 A;  2RNA A;  2CH4 W;  5HCK A;  1AZE A;  4OML A;  1AEY A;  3LH5 A;  1I0C A;  2CDT A;  1UJY A;  1GRI A;  2ABL A;  2DL5 A;  1HJD A;  2M51 A;  2LQN A;  5IXB A;  5FW9 A;  1JXO A;  2A36 A;  2JS2 A;  2DJQ A;  4J9B A;  1M8M A;  1IO6 A;  4IIO A;  1GBQ A;  3O5Z A;  2BZX A;  3H0H A;  3REA B;  4HVW A;  4RTY A;  2EYY A;  1UFF A;  1QLY A;  2ROL A;  2DNU A;  1GCQ A;  1J3T A;  2RMO A;  3UAT A;  2KE9 A;  1JXM A;  1X43 A;  1Z9Z A;  2AZS A;  2O9S A;  5I11 A;  1WA7 A;  1BBZ A;  4Z88 A;  2V1Q A;  2M0Y A;  2L3P A;  1GCP A;  4Z89 A;  1G2B A;  2GTO A;  1ABQ A;  2DRM A;  3NGP A; 
#chains in the Genus database with same CATH topology
 1WPY A;  4EMG A;  3VS3 A;  2YWW A;  3MEU A;  3VS6 A;  4C92 D;  2D0N A;  1M2V B;  4ORZ A;  2KXD A;  1NPP A;  1AWJ A;  1WHK A;  4KUL A;  3OYJ A;  2EGC A;  2LMJ A;  5LJ5 j;  3OW2 P;  1CKA A;  2E6Z A;  3TEE A;  3T9N A;  3PVQ A;  2W10 A;  1P92 A;  1UEB A;  2DYI A;  3OA6 A;  3SEM A;  1VQM A;  4RTZ A;  3J80 E;  3NTI A;  1ZUU A;  2XDB A;  3O8V A;  5GAO r;  1YI2 T;  1VQP A;  3G71 T;  2YXY A;  1I07 A;  4IIM A;  1GBR A;  3CCE A;  4ESR A;  4RG2 A;  4EPC A;  5KCH A;  4JUV A;  4C8Q F;  1WZO A;  3JCM h;  4M75 A;  2HAX A;  1K4U S;  5FU7 B;  1K9A A;  3DB3 A;  1OX9 A;  3INZ A;  4X9D A;  2H3J A;  5GAN 3;  7AT1 B;  1QCO A;  1SSH A;  4RKU E;  4EIK A;  4M78 G;  2AKL A;  3OYY A;  3MET A;  4AG1 C;  1NBE B;  4HKE A;  2NWM A;  3HPW A;  1OZ3 A;  4J5Y A;  3KXT A;  4LD6 A;  4XTZ A;  2KNB B;  1QP3 A;  1PCX A;  5LJ3 j;  4QQG A;  4DA4 A;  2GNC A;  1Q82 C;  3X28 B;  1N8R C;  1RAD B;  4M7D E;  4QVD A;  2A08 A;  5FWB A;  2A3L A;  2X4X A;  5KYW B;  3CQT A;  5GAN e;  3UDC A;  4OB1 B;  3NPF A;  2CZ6 B;  3C95 A;  3VRZ A;  1H64 1;  1YJW Q;  4OMF B;  1WI7 A;  3CPF A;  3CME T;  3EGX B;  4XK8 E;  6AT1 B;  3MP6 A;  3NTH A;  3EG9 B;  1FYN A;  2C0T A;  2EWN A;  3VYG A;  1N9S A;  2ZPE B;  2B8A A;  1AD5 A;  4KT0 E;  3ZBD A;  2BTT A;  4M78 F;  1WX6 A;  2DIL A;  3FC3 A;  1RLP C;  4M7A F;  4RCB A;  2KXC A;  2DKG A;  5GAN 5;  3EFO A;  2ENM A;  4DEX A;  3RMQ A;  2JTE A;  2K6D A;  2MI6 A;  1RLQ C;  3OMC A;  2RF0 A;  2M02 A;  1W4S A;  1UHC A;  2ED0 A;  1N8R U;  2KDS A;  1OZ2 A;  2RQV A;  3ER0 A;  1U06 A;  3WXM B;  1H3Z A;  3ZFJ A;  3CCR T;  2PZ1 A;  2RD1 A;  3A8L B;  2L3Q A;  1YI2 Q;  3RR6 A;  2WSE E;  2C0I A;  1LPL A;  2P0P A;  4LUD A;  1M90 U;  1H8K A;  2DXB A;  4KGX B;  2JVV A;  3CC4 A;  4O6J A;  4M75 D;  1VQN A;  5GAN 4;  2FG0 A;  4J83 A;  1VQ7 T;  2RN8 A;  2X51 A;  3M0R A;  4M4Z A;  2PUO B;  5GAO n;  1VYV A;  2B86 A;  1D1C A;  3VS7 A;  3CCL Q;  1RAI B;  4JZ4 A;  3QBY A;  1MMA A;  5DM7 R;  4M78 C;  1YJN Q;  1Y96 B;  1AZG B;  3JB9 J;  4KUD K;  3VS4 A;  1WLP B;  1TWB A;  2K2M A;  2RI2 A;  1RAA B;  2XI9 A;  1BI2 A;  2XMF A;  4J6Y A;  1VQL T;  3I55 Q;  3CCV A;  2RJD A;  2CYZ B;  4E7S A;  2P0K A;  2DXC A;  2EPD A;  5AYF A;  3EFO B;  3CMA A;  4DOV A;  3HRU A;  3JRZ A;  2QXF A;  3MP1 A;  2YT6 A;  1OPL A;  1UUE A;  3VYH B;  4CC2 A;  3CCS Q;  1Y07 A;  4OMN A;  5GMK e;  2YLB A;  3UF4 A;  3CCV T;  2YUO A;  2I2L A;  1N9R A;  3CXC A;  1AVZ C;  1YHQ Q;  3M59 A;  5D6X A;  3OYK A;  5LJ3 f;  4PJO B;  3NMZ C;  3JB9 G;  1N6A A;  4Y28 E;  1RAE B;  2NUT A;  2DE0 X;  3QXE B;  3OYH A;  3OY9 A;  5GAM d;  3QYG B;  3CCM T;  2L5Q A;  1VQL Q;  5CKD A;  5GAN 6;  3ME9 A;  4FYW B;  4DBF A;  1PKS A;  3CD6 A;  3I9Q A;  3OBW A;  5GAN f;  4QKU A;  3H9N A;  2E3I A;  3M0P A;  1MNE A;  1SRM A;  2JTM A;  2OTL A;  3R6N A;  2YUP A;  2CS7 A;  5FU6 B;  1QMC A;  3L2Q A;  2HSP A;  4XTX A;  2HBW A;  1UTI A;  1R77 A;  4AG2 C;  4Q5W A;  2LRQ A;  1CKB A;  3M9Q A;  2V8K A;  1MV0 B;  3E2U A;  2VB6 A;  2VGM A;  3EG3 A;  4LDX A;  4PLI A;  2H3E B;  1PM3 A;  4JRK A;  3RNJ A;  2GQI A;  4MZP A;  2QA4 Q;  4F7U F;  2Y4X A;  3OS1 A;  2CP7 A;  1D0Y A;  2R5M A;  3RMS A;  2K4Y A;  2D0Q B;  4M75 E;  1T3L A;  3M0T A;  3M5A A;  2H8H A;  1V76 A;  2BZY A;  2DMO A;  5CKH A;  2F2X A;  2VAS A;  4CC7 A;  2YHT A;  3OYC A;  2X35 A;  4F04 B;  1NLP C;  4FSX A;  4J8O A;  3OYE A;  4IUR A;  1VQ5 A;  4L5G A;  2JM9 A;  3PGG A;  3CC7 A;  2AIR B;  1AWO A;  3LW5 E;  3OYI A;  4DEY A;  1IRE B;  2M1H A;  3JB9 F;  3V7R A;  2KRN A;  3OYB A;  1W2B S;  4QT7 A;  3VV0 A;  3G6E A;  3JCM f;  1WYX A;  3M55 A;  4II1 A;  2CZ0 B;  2XU8 A;  4C8Q B;  1GXI E;  4ZN3 A;  4PJL A;  1XQH A;  3SWN C;  1QKX A;  2RJF A;  4R0K A;  2XG8 D;  1MMN A;  4D8K A;  1KQ1 A;  2MPX C;  3U23 A;  4JRP A;  3REB B;  3VS5 A;  4FYV B;  1K8A R;  1D3B B;  1KC8 C;  1VQP Q;  1ZUK A;  2FZG B;  2XDD A;  3RES A;  4PJN A;  2AT1 B;  1BCO A;  3IQL A;  1Y7X A;  3CBM A;  4XU0 A;  1M5Q 1;  3E1S A;  2QTV A;  3CXC S;  3CCE T;  1M90 C;  1I0C A;  3EGD A;  1UJY A;  3NTK A;  3G71 A;  2QQB A;  2M51 A;  1M1K U;  4HT9 A;  4Y91 A;  1YI2 A;  2E41 A;  3OS5 A;  4ZGE B;  3GPL A;  1IO6 A;  3CCU A;  3BDU A;  1GBQ A;  3H0H A;  4RTY A;  4MDX A;  3CCU Q;  2CZ1 B;  4M77 F;  2DAQ A;  1J3T A;  3GP8 A;  1G3T A;  1X43 A;  2AZS A;  5I11 A;  3LX7 A;  1BBZ A;  2JZ2 A;  4BY6 C;  5LJ3 d;  2M0Y A;  3JAM E;  2E65 A;  2L3P A;  2NYS A;  1D1A A;  4RTT A;  4JZ3 A;  2DRM A;  5GAN 7;  4KGZ B;  3PTA A;  1C0M A;  5AT1 B;  2KRM A;  3TSZ A;  2JS0 A;  2FPE A;  5GAO p;  1JU5 C;  4XQ3 A;  2E4H A;  2M0O A;  1RI0 A;  1X75 C;  1M8V A;  1JRI A;  1WHM A;  1X6G A;  3VRY A;  2E70 A;  2A0F B;  2LX9 A;  4M77 B;  2DL3 A;  2X3W D;  1WHJ A;  2CGH A;  3OYF A;  1KG1 A;  1NPR A;  2HKN A;  4A63 B;  2KBT A;  3I5S A;  5GAN g;  3SD4 A;  1WIE A;  1OI1 A;  2MCN A;  1EFN A;  2GFA A;  4JRQ A;  2JM8 A;  1YIT A;  2CUD A;  2PVO B;  4FYX B;  2NUP A;  2JUF A;  1FX7 A;  4PJJ A;  2CKK A;  3PIO A;  1S72 T;  3QJ6 A;  1YIJ T;  2ATC B;  4RTU A;  1WGS A;  1VQ4 A;  1KQS P;  1QP2 A;  1OV3 A;  4KH0 B;  3JSC A;  4NL2 A;  4BY6 B;  3CME Q;  1UG1 A;  2ZPI B;  4AFU C;  4ZGD B;  5LJ3 e;  1BU1 A;  3ULR B;  5KYY B;  2WAC A;  4C92 A;  1M3A A;  3EFS A;  5CVI A;  1VQN Q;  3CCE Q;  2DER A;  2QEX T;  3AT1 B;  3MHX A;  3MCA B;  4WCI A;  4Z02 A;  5GJV B;  3CCU T;  2BE7 D;  4LE9 A;  1OUL A;  4AFS C;  2OTJ T;  3M58 A;  2DZ9 A;  4MML A;  1KSW A;  4PL6 A;  3JCM P;  5LJ3 h;  1U8R A;  2NUP B;  3CPW P;  1WHH A;  4BE0 A;  1IB8 A;  4LNP A;  1KQS A;  4J9I A;  2IPO B;  2BUD A;  1QQJ A;  3CCJ Q;  1NG2 A;  3M57 A;  2K5F A;  1ZA2 B;  4E47 A;  2AKK A;  1N8R R;  4M75 C;  3GOX A;  3E19 A;  1GFD A;  4X34 A;  2DFU A;  2F5T X;  1TS9 A;  2VWF A;  4F7U G;  3OYL A;  1TTH B;  2KK4 A;  5KYU B;  5KE3 A;  2PNI A;  3JCM e;  2P84 A;  3FJ5 A;  4C5I A;  5CO7 A;  2X9H A;  1NZ9 A;  5KE2 A;  3MP8 A;  4XTV A;  4C92 B;  4HXJ A;  3UWN A;  4M78 D;  3R6O A;  1VUB A;  3KFV A;  2QQ9 A;  4J9C A;  2VXE A;  2MAM A;  2HL3 A;  1NJI U;  1MMD A;  3RUX A;  3DKM A;  2CP5 A;  5FRN A;  1TUC A;  1KIK A;  1KJW A;  2LJ3 A;  3I56 Q;  1K9M U;  2SEM A;  1Q81 U;  4K11 A;  3OYD A;  5D6Y A;  1AWW A;  2J6K A;  2D8H A;  4C0D C;  1XTD A;  4J7F A;  2ZAE A;  3SHW A;  4FT2 A;  4RTV A;  2R57 A;  4IUT A;  1C6V X;  1RAG B;  4C92 F;  4HCK A;  1BYM A;  3CC7 T;  5CQX A;  2HBP A;  1VQ5 T;  1ZX6 A;  1VQ8 T;  3CCQ A;  5KYX A;  2EJG A;  4PJM A;  4AFZ C;  1BKB A;  4F16 A;  5LJ3 g;  3A8H B;  3JCM Q;  1U3O A;  1WJQ A;  2L8D A;  1TXQ A;  4HA8 A;  4V2S A;  2E1H A;  4X9C A;  1TU0 B;  2PQW A;  3RDV A;  4M75 B;  2COZ A;  1HYO A;  4ANJ A;  3QPH A;  2QQS A;  3EG0 A;  1WFW A;  4IUU A;  3J7A F;  5I21 A;  3SFM A;  4P5N A;  2GF7 A;  2ED1 A;  4OGC A;  2FPD A;  3HFO A;  3A98 A;  3EG2 A;  1A0N B;  1ZSG A;  3MEV A;  2EGA A;  4CC3 A;  1IHW A;  1CSK A;  2PU9 B;  5KCO A;  3SWN A;  1VIE A;  2QK0 A;  1ARK A;  1VQ6 T;  1PKT A;  2VV5 A;  4N0A A;  4ZGJ B;  5HY6 A;  4N4H A;  1X2K A;  3A8G B;  3WVD B;  2CP6 A;  2DLP A;  5IHI A;  4NL3 A;  3LLR A;  3G7Z A;  2KI7 A;  3ASK A;  3BW1 A;  3C12 A;  2J6F A;  4PKC C;  3CC4 Q;  4PJO A;  2YRC A;  2LP5 A;  4RG8 A;  3OW2 A;  2DEQ A;  1QVP A;  2OTL T;  5L8R E;  1UEC A;  5J39 A;  1LOJ A;  5GAN d;  2KGT A;  1VQ9 Q;  1UGR B;  5GAM h;  2CP3 A;  3L2W A;  3BDL A;  4B9X A;  5IXF A;  2ESW A;  1NYG A;  2DRK A;  2JT4 A;  4Y92 A;  3VS1 A;  2COW A;  4JJC A;  3CCM A;  4R56 A;  2FB7 A;  3M53 A;  1WQ7 A;  1C1A A;  1AHJ B;  4BDY A;  1KFZ A;  4MMK A;  2LNV A;  3V8L A;  2QYZ A;  2L2P A;  2QTX A;  2RQU A;  4J7I A;  3VUZ A;  4BI8 B;  4OF1 A;  1UGQ B;  8ATC B;  3LWH A;  1QVF P;  1NEB A;  4CI0 C;  2EQI A;  1X69 A;  5IHK A;  1FMV A;  4E7J A;  2CP0 A;  1SG5 A;  3L2R A;  4XTW A;  1YP5 A;  1DJ7 B;  3M56 A;  4E2F B;  2DL8 A;  3CC2 T;  3CMA T;  1VQ7 Q;  3P8D A;  4DOW A;  4M7A A;  4ZTJ A;  2RM4 A;  2EIF A;  2MK5 A;  3M0Q A;  3MO8 A;  4ATO A;  2Y4Y A;  3QYH B;  1HXD A;  1YJW A;  1VQ8 Q;  2G6F X;  2JN0 A;  2JXB A;  4KBM B;  2DD5 A;  4E7Z A;  3OSV A;  2LCC A;  4JS5 A;  3M0S A;  2MWP A;  4A4H A;  4OGE A;  2BKD N;  4FIB A;  5GMK l;  4RMO A;  2E64 A;  4R55 A;  3I5R A;  2K57 A;  1PSF A;  3FIF A;  3G4S Q;  1K0S A;  1GCQ C;  2QGF B;  1VQ7 A;  1Q81 C;  3G4S A;  1VQO T;  2LCL A;  1G83 A;  2RJE A;  2L89 A;  4QVZ A;  2K2V A;  1M1K C;  1MND A;  1VQ8 A;  2O4X A;  1UJ0 A;  5C6S A;  5CCA A;  1Y71 A;  1T0J A;  4AMC A;  1U1S A;  1S1N A;  2QAZ A;  4M77 D;  4AT1 B;  1WXU A;  2K7A A;  1NJI C;  3CPW S;  3AHU A;  1MHN A;  4F14 A;  2IVW A;  4DBR A;  1WQW A;  4J9G A;  1PRM C;  2J05 A;  1VQO Q;  3JCM g;  4FSS A;  3GNF B;  4YTL A;  2VKN A;  4ELZ C;  3EH2 A;  1UDL A;  2RA2 A;  5GMK i;  4J6W A;  3OQ5 A;  4C0G A;  4LD9 K;  4WTO B;  1K73 R;  4C8Q E;  4J9F A;  3CBO A;  5CIU A;  3RKX A;  5GAN h;  2R58 A;  4XU3 A;  2CZ7 B;  2DBM A;  2L3R A;  2KRO A;  1FWZ A;  3TU4 K;  3OSS C;  4QQD A;  4GLK A;  5HCK A;  2KMT A;  5GAO q;  2KVQ G;  1AEY A;  3LH5 A;  2DXU A;  1HJD A;  2Z0W A;  2K5L A;  5I2S A;  2R5A A;  2JS2 A;  4J9B A;  1M8M A;  2P0Q A;  3X20 B;  1XNI A;  1Q82 U;  1YJ9 A;  2BZX A;  5DLO A;  4DBH A;  2FL7 A;  2EYY A;  4A4F A;  2EQU A;  3OYM A;  1I8F A;  3C94 A;  2YRD A;  4A54 A;  3CCJ T;  5FRM A;  4L6V 5;  3UAT A;  2KE9 A;  1QVF A;  1JXM A;  4A4E A;  2OTJ A;  3F70 A;  2V1Q A;  2QEX A;  3CC7 Q;  3V8J A;  4XU1 A;  1ABQ A;  1M1F A;  5C0M A;  2P4R A;  3H8Z A;  2EQM A;  5FRO A;  3RBB B;  2LJ0 A;  1GL5 A;  3BFM A;  2AZV A;  3SB2 A;  3ZL7 C;  4ZN1 A;  2KQW A;  1SHG A;  2RPN A;  2IIM A;  2JJ9 A;  4KRT A;  1VQ4 T;  2E12 A;  3JCM b;  1WNL A;  4UC4 A;  1JEG A;  2RK2 A;  1FXX A;  1QW1 A;  4E7K A;  1ACM B;  2J7I A;  1HSQ A;  1TUG B;  1YIT T;  3FDR A;  1BI0 A;  3EGD B;  2VGN A;  1B3Q A;  1OU8 A;  2D8J A;  3A1P A;  4E7L A;  1NM7 A;  4AFQ C;  3JCM J;  4GLM A;  1RUW A;  5D7U A;  1K9M C;  1FMW A;  3VJP A;  2X3X D;  2RQT A;  3HL8 A;  2CUB A;  4M7D D;  3FB9 A;  2V1R A;  3A8O B;  2MWO A;  1YHQ T;  2W0Z A;  4LN2 A;  2DL4 A;  2MIO A;  2GFU A;  4A4K A;  2LQW A;  1M30 A;  3QII A;  3JB9 D;  2OTL Q;  3ZEH A;  3E9F A;  3VS2 A;  3NFC A;  3HRT A;  1VYT A;  1I5O B;  2CSI A;  1WDX A;  3CCL T;  1PC0 A;  3OW2 S;  3CXC P;  4E6R A;  1VIF A;  2F2V A;  4C8Q A;  2WSC E;  3QSU A;  5IT9 E;  1QKW A;  4B6M A;  3S3M A;  1H92 A;  4OMM A;  5A0G A;  5FLX E;  3I35 A;  3PVL A;  2MYS A;  2KYM A;  1KD1 R;  4M7A B;  3VU3 C;  4RCC A;  2HL5 C;  2LX7 A;  4B9W A;  2HQX A;  2X4J A;  1ZBX A;  3EGX A;  1I4K 1;  3THK A;  2DYB A;  1LVK A;  1ZQ1 A;  3V7C A;  1EX4 A;  1RL2 A;  3RIR A;  4OB2 B;  1IHV A;  1O9S A;  1OU9 A;  2GCX A;  4PFZ A;  1Q86 R;  1HD3 A;  1K9M R;  3CC2 Q;  4XAX B;  3HHT B;  2DTI A;  1M90 R;  1G8X A;  1VQK A;  1RAC B;  3P8B B;  2VUB A;  1M27 C;  3HTR A;  4C8Q D;  3QWY A;  1VYU A;  4ELY C;  1QVF S;  1BIB A;  4FU6 A;  4JJD A;  1B07 A;  2NUZ A;  4IUP A;  3A5Z B;  1YBY A;  2EJ9 A;  2I0N A;  2RJC A;  2XID A;  1BI1 A;  1YJ9 Q;  2DO3 A;  2EYZ A;  2CP2 A;  4IUV A;  4J9H A;  2QQA A;  3OMG A;  2YRV A;  4N4G A;  3TSW A;  1IZ6 A;  5GAM e;  3H41 A;  5J26 A;  2K79 A;  1M9S A;  2K3Y A;  2LZ6 B;  2RHZ A;  3C0C A;  4M7D A;  2QQR A;  2DJZ A;  5J3B A;  1RAF B;  2F69 A;  4PFP A;  1KQS S;  3JB9 H;  3LH0 A;  1NLO C;  4N4I A;  3BY7 A;  2HQH A;  1LNX A;  2AK5 A;  2QDY B;  1X2Q A;  1RAH B;  2L3S A;  1R8O B;  4OB3 B;  5IAY A;  4OMQ A;  4BB7 A;  3I56 A;  4E7I A;  2RI3 A;  1WXB A;  4C8Q C;  2JMA A;  5FU6 C;  1PRL C;  1PNJ A;  2BZ8 A;  2KY9 A;  3E9G A;  1BB9 A;  4M7A D;  3L42 A;  3EHR A;  2HKQ B;  3VUB A;  4VUB A;  3EHQ A;  4L59 A;  5GMK h;  3N5B B;  2BIV A;  1W6X A;  2YUN A;  1X6O A;  3CCR Q;  4JJN K;  3CD6 Q;  5IH2 A;  1N5Z A;  2JOY A;  4C5G A;  2MOX A;  2LDM A;  2EKO A;  2OI3 A;  1ZUY A;  1WHG A;  2D1X A;  4ZTF A;  3URG A;  3OYA A;  3QZ5 B;  2FRY A;  4EMH A;  2HSE B;  4FYY B;  3GBQ A;  2QI2 A;  2ROT A;  1WXT A;  2RO0 A;  4GBQ A;  1M3B A;  1FMK A;  2HCK A;  4A4G A;  1UHF A;  5I22 A;  4MZT A;  3QG1 A;  2EJF A;  3EG9 A;  3I56 T;  2AHJ B;  2O2O A;  1XOV A;  3UA6 A;  1SEM A;  5FWC A;  3PT9 A;  4M7A C;  3EAE A;  2CRE A;  3H0F A;  4PJO D;  1VQO A;  3H0I A;  3G4S T;  1WJR A;  3GNG A;  1KC8 U;  2EYX A;  5GAM j;  3JCM c;  1QCN A;  2V8I A;  1HK9 A;  1K8A C;  2C06 A;  3L2V A;  4DQ2 A;  1LJO A;  3FEO A;  2RI5 A;  4X1V A;  4PJO F;  5GAN 2;  2EGE A;  5IHN A;  1TUD A;  3HRS A;  3OS0 A;  2LJ1 A;  1TH7 A;  1ABO A;  2EKH A;  1YJW T;  9ATC B;  2HMA A;  3OYN A;  1QCF A;  1PHT A;  4EMK A;  5LJ5 e;  2EAY A;  4BD3 A;  2XIC A;  4LDV A;  3M4G A;  3JB9 I;  1R0B G;  3D7S B;  4XU2 A;  3L1A A;  1GFC A;  3LGL A;  3OB9 A;  2KYB A;  2DBK A;  2CH4 A;  3CC2 A;  4M77 C;  2QA4 A;  1B34 B;  4RTW A;  1JBM A;  1M3C A;  1X27 A;  4M77 A;  1AOJ A;  3PNW C;  3QO3 A;  2DVJ A;  2RQW A;  3VS0 A;  1Q7Y C;  4PJO C;  4OP0 A;  4C92 E;  4M75 G;  1G3W A;  1B34 A;  5EC7 A;  5CKB A;  3MKD A;  3FJP A;  4C0Z A;  3OYG A;  1ZSZ C;  2DK3 A;  1JJ2 A;  2KT8 A;  1K8A U;  2X4Y A;  4QVC A;  2LQK A;  2FPF A;  1QWF A;  3L2Z A;  5GAO l;  1VQN T;  3QHS A;  3CC4 T;  1VQ9 A;  2L0A A;  3QKJ A;  4C5E A;  2DTO A;  1OYX A;  2E5K A;  4J6X A;  3JCM V;  1T3S A;  1O75 A;  2PVD B;  1SSF A;  3CCM Q;  4IUQ A;  1N27 A;  1VQ6 A;  4A53 A;  1D0X A;  5A0D A;  4F17 A;  3JCM X;  2ZPF B;  4BE1 A;  3S3O A;  4WF2 A;  4J9E A;  4QQ6 A;  2ZCF B;  1TSF A;  2KR3 A;  5FU7 C;  2O9V A;  2ZPB B;  1B7T A;  1RI9 A;  1YHQ A;  2C0O A;  1Q82 R;  1Q7Y U;  1TG0 A;  1XJW B;  4HCB A;  4BDZ A;  3PMI A;  4RUG A;  2BE9 B;  3I55 T;  2FZK B;  2RNA A;  2CH4 W;  1D3B A;  1G3Y A;  1OQK A;  4TVR A;  3Q1J A;  4OML A;  2CDT A;  3M4Y A;  5LJ5 f;  1GRI A;  2DL5 A;  5CAI A;  4LDW A;  1W2B P;  5FW9 A;  1JXO A;  2A36 A;  3CCV Q;  4NS5 A;  3CME A;  2DJQ A;  5HK0 A;  2LVM A;  2F1L A;  2XHC A;  2D9T A;  2XD0 A;  2F5K A;  3O5Z A;  5CKE A;  4FT4 A;  3CCQ Q;  3REA B;  4HVW A;  4HCZ A;  5M9O A;  1GCQ A;  2RMO A;  2FZC B;  5CQY A;  5DY9 A;  1Z9Z A;  2DIG A;  2KSS A;  1WA7 A;  5GAM g;  4M78 B;  1GCP A;  4Z89 A;  3RKW A;  1G2B A;  2GTO A;  4JPB W;  4M7D C;  1IRX A;  2K5I A;  2HQE A;  3GIB A;  3EFR A;  2LNH B;  3JCM d;  2V8J A;  4PJO G;  1W2B A;  2OX7 A;  2FEI A;  5GAN 8;  5ECA A;  1RAB B;  4GY5 A;  3CCJ A;  4OB0 B;  4J9D A;  2NLU A;  4PLL A;  2VC8 A;  1M1G A;  2CT3 A;  2GTJ A;  3RKY A;  2JMC A;  1VQ5 Q;  2GBQ A;  2JW4 A;  1YJ9 T;  5A2Q E;  3TQ7 P;  4KH1 B;  2SRC A;  4IKF A;  2X4W A;  4JDS A;  1T0H A;  1D1B A;  2DF6 A;  2GQV A;  3LWI A;  1E6G A;  3LYI A;  4XTY A;  3J81 E;  1W1F A;  2EBP A;  4M7D F;  4JLI A;  1VQP T;  1SKU B;  4HVV A;  4N0A C;  2DVE A;  2J06 A;  4HCC A;  1VQM T;  1H3H A;  4BAC A;  5LJ5 d;  1JB0 E;  1ZBJ A;  3VKI A;  4OVA A;  2E5Q A;  4C92 C;  2J6O A;  1U5S A;  1KD1 U;  2MF2 A;  3UA7 A;  4M7A G;  4MDW A;  3CBP A;  5CR2 A;  1V29 B;  4C92 G;  1W70 A;  1PSE A;  4M7D B;  4LDY A;  2JTF A;  3SWN B;  1I5L A;  1X01 A;  4E7H A;  3HFN A;  2OAW A;  4OMP A;  2ZPH B;  4PNO A;  2EQJ A;  1I1J A;  4JS4 A;  1Q86 U;  1VA7 A;  2FVU A;  4BI4 A;  3M0U A;  1YCY A;  2XKO C;  3L2U A;  1PD0 A;  1M2V A;  3PMT A;  5KH6 A;  4HT8 A;  1MMG A;  1KHC A;  4D8D A;  3CEY A;  1I81 A;  4M78 E;  4M7D G;  5EG2 A;  2DXT A;  3CMA Q;  3PFS A;  1NJI R;  1QVG S;  2PTK A;  3I55 A;  2YDL A;  2V26 A;  4JJB A;  5L23 A;  4LXC A;  5KYX B;  2E3H A;  2A28 A;  2JNG A;  3MJX A;  4JLG A;  1QVG A;  1YNZ A;  3TVT A;  3MEW A;  4BI3 A;  3G6E Q;  1ZSZ B;  2YSQ A;  4PFO A;  1IXD A;  1E6H A;  4O5V A;  1VOM A;  4C8Q G;  1EIF A;  1YCS B;  4C5H A;  2NUT B;  5CK9 A;  5LL6 S;  5IN1 A;  2FYK A;  3TRE A;  1PD1 A;  2DTH A;  1VQ9 T;  3H6Z A;  1D0Z A;  1VQM Q;  1YWO A;  2RHI A;  1MUZ A;  2DX1 A;  3GF5 A;  2OJ2 A;  1JO8 A;  1K76 A;  5I2M A;  5KYU A;  2LT1 A;  3C4S A;  1OOT A;  1QVG P;  1TOV A;  4C0F A;  1SHF A;  2P4T A;  4D6W A;  2K3X A;  3KUF A;  4EMK B;  2QAS A;  1Q81 R;  3FRN A;  4BE2 A;  2DZC A;  3HKS A;  2EYW A;  1Y96 A;  3NHN A;  1MGQ A;  3G1J A;  3V8K A;  2IG0 A;  2QA4 T;  1Z9Q A;  1D09 B;  3X24 B;  2EQK A;  2HEQ A;  4DBQ A;  2F2W A;  5KYY A;  2ZGW A;  1MV3 A;  3QJY A;  1R0C B;  3DB4 A;  3A8M B;  4ME7 A;  4XTU A;  3V7S A;  2A7Y A;  2ZPG B;  5CKF A;  2CT4 A;  2DIQ A;  3OBY A;  2QGG A;  4M78 A;  3PE0 A;  2LCS A;  2EVR A;  1K1Z A;  3S3N A;  4M75 F;  1Y57 A;  2M16 A;  2FO0 A;  1KC8 R;  4KGV B;  2DM1 A;  2GGR A;  5GMK j;  3M54 A;  5KYW A;  3EH1 A;  1YJN T;  3EG1 A;  1S72 Q;  3S6W A;  1JQQ A;  2YUQ A;  3FLG A;  4C0D B;  4M7A E;  1OPK A;  1YFN A;  1VQK Q;  2VVK A;  3G6E T;  2HDA A;  2MMP A;  3QWX X;  4LDU A;  3HSB A;  1KQ2 A;  4M77 G;  1WJS A;  2RK1 A;  3GLX A;  3CPW A;  2DPP B;  4FL6 A;  3RER A;  3CCS A;  1NYF A;  5HKC A;  1BCM A;  2KRS A;  5LJ5 h;  2RHY A;  2RH2 A;  4CC4 B;  3CCQ T;  3KBG A;  1UGS B;  2FRW A;  2LT4 A;  2LC4 A;  3CCS T;  4EMK C;  5GAN j;  1Y0M A;  2EW3 A;  4Z8A A;  1G3S A;  4FM4 B;  4FW1 A;  1BIA A;  2K3B A;  2OAU A;  3OS2 A;  2DET A;  1QWE A;  2G3R A;  1JJ2 S;  2COY A;  2KAF A;  2DEU A;  1K73 C;  2EFI A;  3UT1 A;  1YJN A;  1PWT A;  2K9G A;  4QW2 A;  5GAO m;  1VQ6 Q;  1UE9 A;  2PUK B;  4PJO E;  3MEA A;  1KD1 C;  1BK2 A;  1Q86 C;  2YLC A;  3P8H A;  1K0X A;  4JRI A;  1PG5 B;  3BE3 A;  3JV3 A;  2O01 E;  5HK3 A;  2O31 A;  2DL7 A;  2ECZ A;  2KT1 A;  1BI3 A;  4LUE A;  1OEB A;  1ZLM A;  2XK0 A;  5A0L A;  1NE8 A;  2HZY A;  3QZ9 B;  1WHL A;  3DLM A;  2PVG B;  1EZZ B;  1U1T A;  8AT1 B;  2RQR A;  1SRL A;  1KHI A;  3LGF A;  3TCJ A;  2RHX A;  1SF9 A;  3EGU A;  4CRI A;  1NEG A;  2E10 A;  3QDR B;  3CD6 T;  2LTO A;  2HNI A;  1AWX A;  2DA9 A;  2O4X B;  2DD4 A;  4ZNX A;  1X6B A;  4FW2 A;  3WVE B;  2QDL A;  1V1C A;  3SDZ A;  1UGP B;  5D6W A;  2Y90 A;  1K73 U;  2VYT A;  1Q7Y R;  4PK4 A;  5GJW B;  4BUG A;  1IGQ A;  2CSQ A;  2KEA A;  4RTX A;  3PIP A;  2QG9 B;  2FHD A;  1SPK A;  2VXF A;  3UPU A;  1UB4 A;  1UGV A;  1LCK A;  1VQK T;  4HVU A;  1ZHI A;  4OMO A;  4KUI A;  1E7O A;  4MZM A;  5GAM f;  2A37 A;  1YWP A;  2RHU A;  3MPU B;  5LJ5 g;  1YN8 A;  1KK7 A;  1YIJ A;  1S72 A;  1VQL A;  1YIT Q;  1G5V A;  2ZZD A;  4M77 E;  3X26 B;  1YIJ Q;  2O88 A;  1JJ2 P;  5KYN A;  2WSF E;  4NOY A;  1OX8 A;  1AZE A;  1VQ4 Q;  1IGU A;  1M4Z A;  2ABL A;  4F7U E;  5DLQ E;  4F7U A;  2LQN A;  5IXB A;  1F1B B;  2M9U A;  1Q95 G;  3QDF A;  3JCM W;  1ZA1 B;  3QUI A;  5GMK m;  2D6F A;  1ZSZ A;  2EYQ A;  4IIO A;  3DLL A;  1UFF A;  1M2O A;  2OTJ Q;  2E6N A;  1QLY A;  2RB6 A;  2ROL A;  2DNU A;  4EDU A;  3X25 B;  3CCL A;  3CCR A;  2O9S A;  2HD0 A;  4F7U B;  4Z88 A;  4FCY A;  3HP9 A;  3G71 Q;  1AT1 B;  2QEX Q;  2LQ8 A;  2XDP A;  1M1K R;  3NGP A; 
#chains in the Genus database with same CATH homology
 4JPB W;  2KRM A;  2P4R A;  3TSZ A;  2JS0 A;  2FPE A;  3VS3 A;  1JU5 C;  2LNH B;  2LJ0 A;  3RBB B;  1GL5 A;  3VS6 A;  2D0N A;  4RTT A;  2AZV A;  2FEI A;  3ZL7 C;  1X6G A;  4ORZ A;  1SHG A;  2KXD A;  5ECA A;  2RPN A;  3VRY A;  1AWJ A;  2IIM A;  4J9D A;  4KRT A;  2DL3 A;  2EGC A;  2LMJ A;  2CT3 A;  2GTJ A;  1CKA A;  2JMC A;  2GBQ A;  2JW4 A;  1JEG A;  2X3W D;  3PVQ A;  2W10 A;  3SEM A;  2SRC A;  4RTZ A;  1ZUU A;  2J7I A;  1T0H A;  1HSQ A;  4A63 B;  2KBT A;  2DF6 A;  3I5S A;  1WIE A;  1E6G A;  1B3Q A;  2D8J A;  2MCN A;  1I07 A;  4IIM A;  1W1F A;  2EBP A;  1GBR A;  4ESR A;  1EFN A;  1NM7 A;  4AFQ C;  4GLM A;  2JM8 A;  1RUW A;  2CUD A;  4HVV A;  1K4U S;  2J06 A;  1K9A A;  2X3X D;  1H3H A;  2RQT A;  2CUB A;  1ZBJ A;  2V1R A;  2W0Z A;  4LN2 A;  2DL4 A;  1SSH A;  2MIO A;  4RTU A;  4EIK A;  2LQW A;  1M30 A;  2AKL A;  2J6O A;  1U5S A;  4AG1 C;  3UA7 A;  1OV3 A;  2NWM A;  1UG1 A;  3VS2 A;  4AFU C;  1W70 A;  2KNB B;  1VYT A;  1BU1 A;  2CSI A;  1WDX A;  3ULR B;  1M3A A;  2GNC A;  4E6R A;  2F2V A;  2OAW A;  4OMP A;  2A08 A;  5FWB A;  1QKW A;  1I1J A;  4WCI A;  5GJV B;  1VA7 A;  4LE9 A;  4AFS C;  1H92 A;  1KSW A;  4OMM A;  3CQT A;  3M0U A;  3I35 A;  3PVL A;  2KYM A;  3NPF A;  2LX7 A;  3VRZ A;  4D8D A;  4LNP A;  1WI7 A;  4J9I A;  3THK A;  2DYB A;  1NG2 A;  2PTK A;  2YDL A;  2AKK A;  1FYN A;  4JJB A;  5L23 A;  1GFD A;  2C0T A;  2A28 A;  2VWF A;  1HD3 A;  2PNI A;  1AD5 A;  2BTT A;  1YNZ A;  1WX6 A;  2DIL A;  3FJ5 A;  3TVT A;  1RLP C;  2YSQ A;  2KXC A;  1M27 C;  4HXJ A;  3QWY A;  1E6H A;  1VYU A;  2ENM A;  3KFV A;  4DEX A;  2JTE A;  4J9C A;  2K6D A;  1RLQ C;  1YCS B;  4JJD A;  1B07 A;  2NUZ A;  2RF0 A;  2I0N A;  1UHC A;  2ED0 A;  2EYZ A;  1TUC A;  2RQV A;  1KIK A;  1KJW A;  2LJ3 A;  4J9H A;  1U06 A;  2PZ1 A;  2SEM A;  4K11 A;  2L3Q A;  1YWO A;  3TSW A;  2J6K A;  1AWW A;  2D8H A;  3H41 A;  1MUZ A;  2K79 A;  2DX1 A;  2LZ6 B;  2C0I A;  2OJ2 A;  1JO8 A;  3C0C A;  4LUD A;  1H8K A;  3SHW A;  4RTV A;  1K76 A;  4HCK A;  1NLO C;  2FG0 A;  1OOT A;  1ZX6 A;  4AFZ C;  4F16 A;  2RN8 A;  2AK5 A;  1X2Q A;  1SHF A;  3M0R A;  2L3S A;  4M4Z A;  1U3O A;  1VYV A;  2B86 A;  4OMQ A;  3VS7 A;  4JZ4 A;  1WXB A;  2JMA A;  1PRL C;  1AZG B;  1PNJ A;  3VS4 A;  2BZ8 A;  1WLP B;  2EYW A;  3EG0 A;  1WFW A;  3NHN A;  1BB9 A;  2K2M A;  2ED1 A;  1Z9Q A;  2FPD A;  2HEQ A;  2F2W A;  2XMF A;  3EHR A;  1MV3 A;  2EPD A;  3A98 A;  3EHQ A;  3EG2 A;  1A0N B;  1ZSG A;  1W6X A;  2EGA A;  2YUN A;  4CC3 A;  1CSK A;  2CT4 A;  2YT6 A;  1OPL A;  1UUE A;  4CC2 A;  5IH2 A;  1ARK A;  4OMN A;  3PE0 A;  2LCS A;  1N5Z A;  1PKT A;  3UF4 A;  2EVR A;  4JZ3 A;  2YUO A;  1K1Z A;  2MOX A;  1X2K A;  1Y57 A;  2FO0 A;  2OI3 A;  1ZUY A;  2D1X A;  2DM1 A;  2DLP A;  2GGR A;  5IHI A;  2FRY A;  1AVZ C;  2J6F A;  3EG1 A;  3GBQ A;  2LP5 A;  1WXT A;  2ROT A;  1JQQ A;  2YUQ A;  4GBQ A;  1OPK A;  3NMZ C;  1M3B A;  2VVK A;  1FMK A;  2HCK A;  1UEC A;  2HDA A;  1UHF A;  2DE0 X;  5I22 A;  2KGT A;  3QWX X;  2O2O A;  5IXF A;  2ESW A;  1NYG A;  2DRK A;  2JT4 A;  4Y92 A;  3VS1 A;  1XOV A;  3UA6 A;  1SEM A;  5FWC A;  1PKS A;  1NYF A;  2KRS A;  3I9Q A;  4JJC A;  4CC4 B;  2CRE A;  3H0F A;  3M0P A;  1KFZ A;  3H0I A;  1SRM A;  2FRW A;  3R6N A;  2EYX A;  2YUP A;  1Y0M A;  2L2P A;  2RQU A;  2EW3 A;  4Z8A A;  2K3B A;  1NEB A;  2HSP A;  1QWE A;  2EQI A;  1X69 A;  2HBW A;  2EGE A;  4X1V A;  5IHN A;  5IHK A;  1UTI A;  1TUD A;  4AG2 C;  2LJ1 A;  1YP5 A;  1ABO A;  2EKH A;  1CKB A;  1PWT A;  1QCF A;  1PHT A;  2K9G A;  1MV0 B;  1UE9 A;  2DL8 A;  3EG3 A;  1GFC A;  3RNJ A;  2GQI A;  2KYB A;  2DBK A;  2CH4 A;  1BK2 A;  3M0Q A;  1K0X A;  4RTW A;  1M3C A;  3JV3 A;  1X27 A;  2O31 A;  1T3L A;  1AOJ A;  2DL7 A;  2ECZ A;  2KT1 A;  2G6F X;  3M0T A;  4LUE A;  2JXB A;  1OEB A;  1ZLM A;  2H8H A;  2DVJ A;  2BZY A;  2RQW A;  3M0S A;  3VS0 A;  2DMO A;  2RQR A;  1SRL A;  2F2X A;  3I5R A;  4CC7 A;  1K0S A;  1GCQ C;  1NLP C;  3EGU A;  2JM9 A;  1NEG A;  1G83 A;  5EC7 A;  1AWO A;  4DEY A;  1AWX A;  2KT8 A;  2DA9 A;  2FPF A;  2KRN A;  1X6B A;  4ZNX A;  4QT7 A;  1QWF A;  2QDL A;  1V1C A;  1WYX A;  1UJ0 A;  1T0J A;  5GJW B;  2L0A A;  1S1N A;  2E5K A;  1WXU A;  2K7A A;  2CSQ A;  1T3S A;  2KEA A;  4RTX A;  1QKX A;  1SPK A;  4F14 A;  4R0K A;  4J9G A;  4D8K A;  4F17 A;  1PRM C;  2J05 A;  3U23 A;  4J9E A;  1UGV A;  1LCK A;  4FSS A;  3REB B;  3VS5 A;  4HVU A;  4OMO A;  2VKN A;  2KR3 A;  1E7O A;  2O9V A;  1UDL A;  2A37 A;  1YWP A;  1ZUK A;  1YN8 A;  1RI9 A;  2C0O A;  1TG0 A;  4J9F A;  4RUG A;  3IQL A;  2DBM A;  2KRO A;  2O88 A;  2RNA A;  2CH4 W;  5HCK A;  1AZE A;  4OML A;  1AEY A;  3LH5 A;  1I0C A;  2CDT A;  1UJY A;  1GRI A;  2ABL A;  2DL5 A;  1HJD A;  2M51 A;  2LQN A;  5IXB A;  5FW9 A;  1JXO A;  2A36 A;  2JS2 A;  2DJQ A;  4J9B A;  1M8M A;  1IO6 A;  4IIO A;  1GBQ A;  3O5Z A;  2BZX A;  3H0H A;  3REA B;  4HVW A;  4RTY A;  2EYY A;  1UFF A;  1QLY A;  2ROL A;  2DNU A;  1GCQ A;  1J3T A;  2RMO A;  3UAT A;  2KE9 A;  1JXM A;  1X43 A;  1Z9Z A;  2AZS A;  2O9S A;  5I11 A;  1WA7 A;  1BBZ A;  4Z88 A;  2V1Q A;  2M0Y A;  2L3P A;  1GCP A;  4Z89 A;  1G2B A;  2GTO A;  1ABQ A;  2DRM A;  3NGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...