1KIKA

Sh3 domain of lymphocyte specific kinase (lck)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
NLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
publication title Structure determination of human Lck unique and SH3 domains by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 8
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kikA00
1QLYA 4GLMA 4J9FA 1GCPA 2OAWA 1E6GA 1AZEA 1X69A 2JW4A 2K79A 1MV3A 4KRTA 3QWXX 1M27C 3H0FA 2FPFA 1K76A 1ARKA 2B86A 1ZLMA 2HBWA 1RLPC 2CREA 1T3SA 2C0OA 4OMNA 2FPDA 2IIMA 1SHFA 3ULRB 1K0SA 2FPEA 1GL5A 2LMJA 2I0NA 1OPLA 2CH4A 1CSKA 2J7IA 2RMOA 3UF4A 2JTEA 3EG2A 2KEAA 2PZ1A 1MUZA 1I0CA 2KXCA 5FW9A 1KJWA 4DEXA 1UDLA 3H41A 3VRYA 2LJ3A 2ECZA 4GBQA 2O9VA 2EPDA 3I9QA 1ZX6A 3EG3A 1RI9A 2FO0A 2KYBA 1PWTA 3M0RA 1M30A 2DL8A 4EIKA 2AZSA 4RTXA 3TVTA 3PE0A 2DBMA 2M0YA 1X6GA 2HEQA 1VA7A 2XMFA 1M3BA 2J06A 5FWBA 2GTJA 3C0CA 2A08A 1ZSGA 3I5SA 4OMMA 1GCQC 4CC4B 4AG2C 1GFDA 1BK2A 1TUDA 1PKTA 1VYVA 2V1QA 1YWPA 2A37A 2EVRA 4IIOA 4J9IA 1SHGA 2J6OA 3R6NA 1SSHA 2CSIA 2QDLA 4DEYA 2EGEA 2M51A 3A98A 4LE9A 2K2MA 2AKLA 1NG2A 5IXFA 2JMCA 2EYYA 2RF0A 4IIMA 2C0IA 5IHKA 1HJDA 2ROTA 1X43A 4RTYA 2DX1A 1VYUA 4Z8AA 4FSSA 1PHTA 2J6KA 1U3OA 1QWFA 2KGTA 1B07A 2D8JA 2KYMA 2V1RA 3ZL7C 2BZYA 2J05A 4OMPA 1PNJA 1QCFA 2LP5A 2G6FX 3IQLA 1I07A 2DYBA 4RTWA 1K9AA 4RTZA 5I11A 3THKA 1ZUUA 1ZBJA 3KFVA 2GTOA 2DBKA 2FRYA 1K1ZA 1M3AA 2BZ8A 5GJWB 4JJDA 2DE0X 4J9BA 2LQNA 1QWEA 3NMZC 4RTVA 2YUOA 1MV0B 1Y0MA 1B3QA 2ROLA 4A63B 1AVZC 1TUCA 1E7OA 2RQUA 4HCKA 2W0ZA 4OMQA 2HDAA 1HD3A 3PVQA 2PTKA 5FWCA 2DA9A 2K7AA 1GFCA 4D8KA 1BB9A 1Y57A 2L2PA 4CC3A 2CT3A 1SPKA 2RN8A 3EHRA 2DL3A 4ZNXA 2ENMA 2KRMA 3H0IA 1ZUKA 4M4ZA 3UA7A 3TSWA 3UATA 4D8DA 5IH2A 1SEMA 1CKAA 1AD5A 1NYFA 2O88A 1PRMC 4F17A 4HXJA 1WXTA 2BZXA 3UA6A 4LNPA 3M0TA 4OMLA 4JZ4A 3M0UA 2P4RA 2KT8A 3SEMA 2EKHA 1ZUYA 1WIEA 2KE9A 2LX7A 4Z89A 5IHIA 1E6HA 2KT1A 1YP5A 2CH4W 4AFUC 3GBQA 2YUQA 2L3QA 2AK5A 4RUGA 1X27A 2C0TA 3I5RA 4HVUA 2D1XA 4QT7A 5L23A 4CC7A 2EYXA 1RUWA 2JM8A 2DVJA 1Z9ZA 2H8HA 2AZVA 2CDTA 5EC7A 4WCIA 2MIOA 2YT6A 4K11A 1ABQA 1GRIA 2EYWA 1K0XA 4F14A 2JMAA 3U23A 2FEIA 1AWXA 2DNUA 2OJ2A 2YUPA 2L3PA 3VS6A 3QWYA 3PVLA 1H8KA 5ECAA 3VS2A 2RPNA 5IXBA 2X3WD 1WXUA 2L0AA 2F2WA 3CQTA 2EQIA 1WX6A 2W10A 2KNBB 2HSPA 1NLPC 3M0SA 2GBQA 2DRKA 1UECA 1FYNA 1WYXA 2K9GA 2ED0A 2FRWA 4RTUA 3REAB 1X2QA 1BU1A 4AFSC 1G2BA 2JXBA 2J6FA 2VVKA 1UG1A 4Z88A 1WI7A 1M8MA 2DM1A 4F16A 1H3HA 2DL7A 2CSQA 3I35A 4AFZC 1KIKA 2K6DA 2JS0A 2YSQA 4RTTA 1Z9QA 2O31A 3TSZA 1OV3A 1UE9A 2RQVA 1T0HA 1OOTA 4J9GA 3O5ZA 2LNHB 1RLQC 1UJ0A 1W6XA 1AWJA 1U06A 4Y92A 2LCSA 1LCKA 3VS5A 4ORZA 2JS2A 3EHQA 1YWOA 4J9HA 2LJ0A 4AG1C 2SEMA 4HVVA 1BBZA 1KSWA 3NGPA 1W70A 2ESWA 1N5ZA 3EG0A 2DJQA 1NLOC 2D8HA 1T3LA 1VYTA 4J9CA 2EGAA 2YDLA 1OEBA 1M3CA 1CKBA 1JO8A 1OPKA 1AEYA 2KRNA 2VKNA 1WLPB 3JV3A 5IHNA 3VS7A 4JJCA 2KR3A 4X1VA 1UHCA 2KBTA 2ABLA 2JT4A 1TG0A 1QKXA 1EFNA 1GBQA 1IO6A 1PKSA 1V1CA 1AOJA 2F2XA 1NEBA 2BTTA 4HVWA 3RBBB 1GCQA 2NUZA 1JQQA 1YN8A 1NEGA 1K4US 3VRZA 3RNJA 1HSQA 2X3XD 1ABOA 1WXBA 2DL5A 2LQWA 1WA7A 3EG1A 1I1JA 2FG0A 2AKKA 2D0NA 3LH5A 1H92A 1FMKA 3FJ5A 2SRCA 2GNCA 3REBB 2HCKA 1G83A 4J9EA 2RQTA 1UUEA 1AZGB 1AWOA 2DMOA 3EGUA 1J3TA 2ED1A 1S1NA 1SRLA 3H0HA 3M0QA 1A0NB 1NM7A 2EYZA 2GGRA 2CT4A 4ESRA 1QKWA 2A36A 2DILA 2EW3A 3VS0A 3VS3A 4CC2A 2A28A 4JPBW 2MOXA 4JZ3A 2KRSA 4OMOA 3NHNA 4E6RA 4R0KA 4J9DA 2JM9A 2L3SA 1UJYA 1X6BA 4LN2A 2EBPA 1XOVA 2YUNA 2CUDA 5GJVB 2DF6A 2VWFA 2DLPA 2EGCA 3VS1A 2E5KA 1UFFA 4LUDA 2OI3A 1T0JA 2CUBA 1UTIA 1GBRA 1KFZA 5HCKA 1JU5C 1YCSB 2KXDA 1JXOA 2LZ6B 2O2OA 1WDXA 1NYGA 1WFWA 2RQWA 4AFQC 2O9SA 3VS4A 1AWWA 2KROA 5I22A 1UGVA 2NWMA 1JXMA 2DRMA 2DL4A 2GQIA 2LJ1A 2PNIA 2F2VA 2MCNA 1X2KA 4JJBA 1JEGA 1PRLC 3M0PA 1W1FA 1SRMA 2RQRA 1YNZA 4LUEA 1U5SA 3NPFA 2RNAA 1UHFA 3SHWA 2K3BA
chains in the Genus database with same CATH superfamily
1QLYA 1MNEA 4M7AG 2WSEE 1GCPA 4M77F 1VQOT 2GFUA 2JW4A 4FYWB 3QXEB 2K79A 4KRTA 5KYYB 5FRNA 1ARKA 7AT1B 2CP0A 3NFCA 5KH6A 1JBMA 3ER0A 1VQOQ 4OMNA 5GAOn 1LJOA 1K0SA 1GL5A 3QBYA 2DEUA 2LMJA 1RAGB 2MMPA 3UF4A 3OA6A 1Q86R 2JTEA 3CCVT 1K73C 4Y91A 3SD4A 1V29B 4PJOA 3VRYA 2LJ3A 1TSFA 1WGSA 4JJNK 5GAOr 4QVZA 5IAYA 2XK0A 3CCVQ 2X51A 3BY7A 4F7UA 3OBYA 3I55T 3CD6T 3EG3A 2R5MA 1OX8A 2NLUA 4EIKA 2DXUA 1ZA2B 1KQSA 3JCMf 2DBMA 4XU1A 2M0YA 2X4YA 1X6GA 2JUFA 1VA7A 1JJ2S 2CZ6B 4LD6A 5KYWA 1ZA1B 4M78G 1RADB 2QTVA 1M3BA 4F7UB 1W2BP 4OMFB 4OMMA 4KGZB 1D0YA 1MGQA 3RMQA 4CRIA 1TUDA 1PKTA 2QEXT 4KGVB 2F69A 1YWPA 1M9SA 2A37A 3A8MB 1R0CB 2PUKB 4IIOA 4J9IA 1TU0B 2RK2A 2CSIA 3OYMA 2CP3A 5HK3A 1NPPA 2EQMA 2DXTA 3E9FA 2QQAA 3HFNA 1D0XA 2HZYA 2QA4T 2DX1A 1VYUA 1YJ9T 1VQPT 4F7UF 2KGTA 3S3MA 2L3RA 3TREA 1ACMB 2J05A 4C0DC 3SWNB 2EQUA 2LP5A 2G6FX 3IQLA 2QI2A 2DYBA 4RTWA 3OS2A 2AT1B 2RH2A 4RTZA 2KAFA 2FB7A 3EGDA 3LH0A 1D0ZA 2DBKA 1YCYA 4JLGA 4XQ3A 1IHWA 1B34B 2FRYA 3M4GA 2BZ8A 3MEUA 4M75A 3DKMA 2XIDA 3L1AA 4J9BA 3A8LB 2LQNA 1VQ7Q 2Y4XA 3MP8A 3OW2P 4AMCA 2DO3A 3GF5A 1ZBXA 1QVGP 4A63B 1RAHB 1TUCA 5CAIA 2F5KA 2HDAA 5LJ5g 3G7ZA 4FIBA 2EQJA 1VQ5T 4BI4A 5KE2A 2DA9A 1GFCA 2PQWA 4D8KA 3CCRA 5I2MA 1SPKA 5GMKh 4ZNXA 4E7IA 3OYDA 5D7UA 4HT9A 3TSWA 3UATA 1M1KU 1OZ2A 2DPPB 1DJ7B 1PRMC 5KYNA 3CCUA 3UA6A 2V26A 5LL6S 1Q95G 3M0UA 2X9HA 3MEAA 4KBMB 5GAOq 3QYHB 1Q7YU 4BE0A 2EKHA 5A0LA 1NE8A 2E1HA 3JCMb 4ELYC 3CC4Q 1D3BA 1YITT 4VUBA 1R8OB 5LJ3g 2YUQA 2NUTA 1VQOA 1X27A 2C0TA 2D1XA 3C95A 4CC7A 4M75F 4XTUA 1RUWA 1KQ2A 4LDWA 2DVJA 1M1KR 2P84A 2AZVA 2MIOA 1D3BB 4DBFA 1YJWQ 2PUOB 4K11A 5AYFA 2NUTB 1Q7YR 1C6VX 3CCET 1KG1A 1WNLA 4F14A 5LJ5j 2M1HA 1AT1B 3U23A 2FEIA 3CCVA 4FW1A 2YUPA 1F1BB 2L3PA 2QDYB 2Y90A 3FEOA 3L2RA 5LJ5e 4C8QE 1YIJT 1O9SA 5CKFA 5ECAA 1VQNT 1WXUA 2L0AA 2K5FA 3R6OA 3I55A 3CD6A 2F2WA 2OTJQ 3BDLA 2VGNA 4ZTFA 2EQIA 3OYIA 3EFSA 3QKJA 1NLPC 2HKNA 2KQWA 2GBQA 3M58A 1M90C 2K9GA 2FRWA 1X2QA 2B8AA 5EG2A 3JCMV 5LJ3j 2VV5A 3CMAT 2P4TA 4F16A 2LCLA 4FYXB 2E3HA 2QEXA 3GNFB 5LJ3e 4RTTA 1Z9QA 1UE9A 2RQVA 5GANd 4IUQA 4J9GA 3HL8A 3H8ZA 2ZGWA 2RJFA 4BDZA 1C1AA 1UJ0A 4A54A 4N4IA 1AWJA 3QIIA 3SDZA 3SWNC 3VS5A 2RHXA 2COWA 3EHQA 2LJ0A 2QA4A 2E12A 1YBYA 2SEMA 1H3ZA 2ZPHB 1KSWA 1YJ9A 4JS5A 1OU8A 1VQPA 1XTDA 1T3LA 4JDSA 3RKWA 2RJEA 1OEBA 1D09B 2E10A 2GF7A 1M3CA 1CKBA 1JO8A 3A8OB 5D6YA 2VKNA 4OB2B 4FYYB 2L89A 1WLPB 3VS7A 4ZGEB 2KR3A 2KBTA 2JT4A 2VGMA 3CCMQ 4HA8A 5GMKm 3A5ZB 1VQ6Q 1PD1A 4CI0C 3VV0A 4X34A 1V1CA 1AOJA 5KYUB 3VYHB 4JRQA 4M77E 3OYGA 4E7ZA 1RL2A 2NUZA 3GLXA 1NEGA 1K4US 4QQ6A 4EDUA 1HSQA 4XTYA 2DL5A 2XDDA 4M7DA 1WA7A 2D0NA 4DOVA 2BE9B 5GAOl 4MZTA 1M1GA 1VQ5A 5HK0A 3QUIA 1VQKT 3REBB 3OYKA 4N4HA 2BE7D 1NZ9A 1VQ8Q 2ED1A 3GOXA 1WZOA 3OMCA 3M0QA 3OS0A 4L6V5 1WHHA 3LGLA 3TQ7P 2DILA 2EWNA 2A7YA 1N6AA 1YITA 2FZGB 4M7AD 1X6BA 4LN2A 1XOVA 3JB9H 4HCZA 2A0FB 3GNGA 2DF6A 2VWFA 3TU4K 5DM7R 4LUDA 3FJPA 2VUBA 1BIBA 3OSVA 2CUBA 4M7DF 3PFSA 2X4JA 3MKDA 3M9QA 5FRMA 5GAN7 4OGCA 2CYZB 5HCKA 3CCEA 2EJGA 3WXMB 2O2OA 1WDXA 2KVQG 3JB9F 2KDSA 1C0MA 1WHKA 3OYNA 1FXXA 4AFQC 1YIJA 3FRNA 5I22A 4F7UG 2NWMA 1N27A 1VQNA 1JXMA 2LJ1A 2QTXA 4RKUE 1IGQA 4PJOE 3OS1A 3D7SB 4QVCA 5CKDA 1JEGA 1PRLC 3M0PA 3M5AA 4E7KA 4XTWA 4FL6A 4F7UE 3CC7T 8ATCB 1M90U 1YNZA 2QAZA 1SSFA 4FT4A 1U5SA 1UHFA 2CGHA 2LCCA 3V7SA 4M78D 4C8QB 3AHUA 3S3NA 1N8RC 4J9FA 4BUGA 1X69A 3JAME 3CMAA 4AT1B 3QWXX 2AIRB 3H0FA 1K76A 2E4HA 2HKQB 1Q82U 2HBWA 2JVVA 4KGXB 5GANg 3CPWP 1EZZB 1TXQA 2C0OA 2DTIA 4JLIA 2IIMA 3G4ST 1JRIA 1SHFA 4LDUA 5LJ3h 2FPEA 4DQ2A 1M90R 3DLMA 1OPLA 2CH4A 1N9RA 2RMOA 3G4SQ 3NTHA 3EG2A 5J26A 5FW9A 4NOYA 5DLQE 3CCJT 2HSEB 3H41A 4PNOA 2HL3A 5HY6A 1X75C 2YLBA 4HCCA 2CZ1B 1Q82R 3Q1JA 3I9QA 1ZX6A 1UGRB 3KXTA 1OULA 3MP1A 3M0RA 1PWTA 1I81A 2YWWA 2HBPA 1M8VA 1VQ6A 2L8DA 4PJMA 2HEQA 5A2QE 2QGGA 2J06A 3HRSA 2XKOC 2GTJA 4IUUA 3I5SA 1RAFB 4CC4B 1M1FA 4AG2C 4A4EA 1BK2A 3KBGA 4FW2A 4LXCA 5GANj 2DTHA 5GAN3 4M75E 2EVRA 4PFOA 3X28B 1YHQT 1I5LA 4YTLA 1I8FA 1Y96A 4DA4A 1RAEB 2MI6A 1UGQB 1SHGA 5GANe 2BIVA 1N9SA 2K5IA 1O75A 2DXBA 1VQ8A 3WVEB 2M51A 1M5Q1 4II1A 1KHCA 1PM3A 3J7AF 4M77B 2FHDA 1VQKA 4PLLA 4IIMA 2ROTA 1X43A 3RESA 2J6KA 1U3OA 1QWFA 1B07A 1VUBA 3E1SA 4BDYA 2P0KA 1W2BS 4MZPA 2LNVA 4ELZC 3CXCP 3CBPA 4OMPA 1QCFA 4BY6B 3FC3A 2V8IA 4FCYA 3OMGA 3KFVA 2FZKB 1K1ZA 4MMLA 5GAN2 4BD3A 2Y4YA 1XQHA 1PD0A 2KI7A 1QW1A 3CCUQ 2DE0X 3EH1A 3G71T 1K9MC 1JJ2A 1B3QA 2ROLA 1S72T 1E7OA 1QVFP 3RERA 4XTVA 3CCST 2D6FA 3PVQA 3JB9I 3HTRA 3CC2T 1S72Q 1Y57A 4CC3A 2CT3A 4C8QC 4BE1A 3EHRA 3CCSQ 4V2SA 4D8DA 3BW1A 3FLGA 3H9NA 4F17A 5LJ3f 1I4K1 1WXTA 2QGFB 2BZXA 2QASA 3M0TA 3CC7A 4JZ4A 3RDVA 1ZUYA 1GXIE 4C5EA 1RABB 2KT1A 3JCMd 4LD9K 1YP5A 5KE3A 4C5HA 1JB0E 3OW2S 2L3QA 3EH2A 3I5RA 2ZPFB 3I55Q 2HNIA 4FT2A 4PJOB 3CD6Q 4C92E 3LX7A 1M4ZA 2EYXA 1IB8A 4WTOB 4FYVB 4DOWA 2H8HA 2K3XA 3BDUA 2QYZA 5CCAA 3G4SA 2YT6A 2NUPA 3CCQT 1ABQA 2QG9B 3LWIA 2IG0A 1Y7XA 2QQSA 1GRIA 4QVDA 2XHCA 1WQ7A 2EYWA 5CQXA 3M59A 3V8LA 2PVDB 5KYWB 5I2SA 1AWXA 2DNUA 4B9WA 2AHJB 3UPUA 3PVLA 3CCJA 1H8KA 2QEXQ 2NUPB 1G3YA 5IXBA 2PVGB 2X3WD 3DB3A 1FWZA 3CQTA 1WX6A 4MDWA 2HSPA 1NJIC 4PJOF 3MEVA 2EAYA 2ZCFB 2M16A 2D9TA 2J6FA 2QA4Q 1VOMA 2VVKA 1IREB 1YJ9Q 2GCXA 1VQPQ 1H3HA 4M77C 2CSQA 3I35A 4Y28E 1UB4A 2M02A 5GAN5 2YSQA 2O31A 3OBWA 2MYSA 1OOTA 2ZZDA 1YHQA 1NPRA 1YJNT 4RMOA 1RLQC 2OX7A 1W6XA 4M7DE 1U06A 4Y92A 4E2FB 4BY6C 1LCKA 3JB9G 5GANh 3HRUA 3PMIA 3EGDB 4J9HA 2XDPA 5A0GA 2G3RA 1BBZA 3NGPA 4M75B 2X4XA 4JRIA 2LDMA 2EGAA 2YDLA 5KYXA 2DD5A 5GAMh 1VQ5Q 2KRNA 1TOVA 1OX9A 1QCOA 4JJCA 1PSFA 4KT0E 1X6OA 4IUTA 1GBQA 1Q81C 4PJLA 4XAXB 4HT8A 5FU6B 5KYXB 3RBBB 4J83A 1GCQA 5KCOA 3OQ5A 2E70A 1G5VA 3G71A 3VRZA 1U1TA 3JCMc 2R58A 1ABOA 2OAUA 4XTXA 2H3EB 1S72A 1I1JA 2FG0A 1WJRA 2AKKA 3BFMA 3SFMA 3M57A 1YITQ 3CCSA 1TTHB 1H92A 5CQYA 3FJ5A 2CZ7B 2RHYA 2SRCA 2GNCA 3CC2A 1SF9A 4C8QG 1UUEA 3A1PA 2DMOA 5CVIA 2LX9A 4EMKA 3O8VA 1S1NA 4PJOC 1KQSP 4IUVA 1K73U 2RM4A 4RCBA 2EYZA 3CCEQ 2EW3A 3VS0A 3VS3A 4CC2A 3HPWA 5DLOA 4JZ3A 2HMAA 3PGGA 5CK9A 1FMWA 1KD1C 3NHNA 1HYOA 4EMKB 1YIJQ 1VQNQ 1UJYA 4JUVA 4O6JA 4A4KA 3QHSA 2CUDA 1X01A 2E5KA 4C92A 1K73R 1IRXA 1B7TA 1RAIB 1BYMA 1AHJB 1KC8C 3CCQA 1ZSZA 2ZPEB 1GBRA 2RD1A 3MCAB 1IXDA 1JU5C 1JXOA 2DERA 2F1LA 5A0DA 3E9GA 2DIQA 4C92B 3CMAQ 2COZA 1ZQ1A 3PMTA 2O9SA 3EFRA 4BACA 2ZPBB 2DRMA 4XU2A 4LDXA 4RCCA 4M78A 1NJIU 4O5VA 2CKKA 3OYAA 3A8HB 4E7JA 1VQ4T 2RNAA 4BB7A 3AT1B 1WJQA 3G1JA 1OI1A 1RAAB 4GLMA 2JTFA 3META 3INZA 1XNIA 4BI8B 4MDXA 1VQ4Q 2M0OA 3X20B 2HQHA 2B86A 1ZLMA 4M77G 4C92F 1MMDA 2LC4A 2CREA 4M75C 1T3SA 5GAMf 4P5NA 2FPDA 1NJIR 3QDFA 2YRCA 3ULRB 3OYLA 1YJNA 3E19A 4E7SA 3HHTB 2JNGA 2I0NA 2YRVA 2LT1A 3QSUA 3L2ZA 2KEAA 2PZ1A 4J8OA 1UDLA 1FX7A 2ECZA 1YFNA 2EPDA 4ZGDB 2F5TX 5FU6C 3JB9J 4EMHA 2KSSA 1BCOA 1RI9A 2FO0A 3L2VA 4M78F 2DL8A 4M7DB 4RTXA 4EMGA 1IHVA 1BIAA 3C12A 5KCHA 3UDCA 1VQKQ 3CPWS 3C0CA 5FROA 1EIFA 2A08A 1ZSGA 4FM4B 3ZBDA 5D6XA 1Q81U 2E5QA 2FYKA 1GCQC 1I5OB 5GAN8 3RIRA 1GFDA 2ATCB 2CP7A 4J6YA 1TS9A 2DFUA 1PG5B 1MMGA 2GFAA 1M2OA 1PC0A 1QQJA 2HQEA 2J6OA 3MHXA 1YI2T 1P92A 2ZAEA 3R6NA 1SSHA 1VIEA 2GQVA 2EJ9A 4DEYA 2K5LA 3OYFA 3OYYA 2DAQA 4LE9A 2K2MA 2MWOA 1Q81R 2AKLA 1NG2A 2JMCA 1VQMT 2RF0A 1YI2Q 2CP5A 1HJDA 3PNWC 1KK7A 1MMNA 4Z8AA 2KYMA 1VQ9T 4PJOG 3V8KA 4IKFA 3ZL7C 2BZYA 4NS5A 3L42A 3VJPA 1PNJA 5LJ5h 1VQ9Q 1I07A 1KD1U 1LVKA 2XICA 5I11A 2O01E 2GTOA 1WPYA 4OF1A 2YRDA 3RUXA 2DTOA 4C92C 1OZ3A 3QYGB 3PIPA 4JJDA 4PJNA 3GP8A 3CC7Q 1QWEA 2RJDA 2QQBA 4L59A 1OQKA 1MV0B 4A4HA 4HCKA 2RQUA 3CCLT 3G6ET 1OU9A 3QZ5B 3JCMQ 1KD1R 1QP3A 1QMCA 1QVPA 3FIFA 2PTKA 5FWCA 1D1CA 3S6WA 5J39A 2RN8A 3CCLQ 3G6EQ 4MMKA 4M4ZA 2E3IA 1QP2A 8AT1B 1NYFA 4OVAA 5D6WA 3HKSA 3CMET 4HXJA 3P8BB 2EIFA 4OMLA 2P4RA 1VQ4A 1WIEA 2DEQA 5AT1B 5IHIA 2QK0A 4X9CA 3CCJQ 2CH4W 3GBQA 4RUGA 3EFOA 2Z0WA 4F04B 4HVUA 5M9OA 1D1AA 2EYQA 5L23A 3J80E 1W2BA 4J7IA 2KK4A 5EC7A 4M75G 4QQGA 2RI3A 2DJZA 3EFOB 4M7DC 2JMAA 2L5QA 5J3BA 2OJ2A 3JB9D 2D0QB 1M2VA 3VS6A 2YHTA 3QWYA 3VS2A 2LRQA 4RG8A 5CR2A 2P0PA 4ME7A 2QQ9A 3MJXA 1YHQQ 2C06A 3I56T 2W10A 2P0QA 3M0SA 2DRKA 1Y96B 1VQLT 3JCMX 1WYXA 3RR6A 4RTUA 5CKBA 4JRKA 4ATOA 5GMKl 2FVUA 1G8XA 2JXBA 2X4WA 4BE2A 1VQLQ 2JJ9A 1WI7A 4C0FA 1M8MA 5GMKj 2DL7A 1KIKA 3PT9A 4JS4A 3QJ6A 1LNXA 1VIFA 1HXDA 3OSSC 1OV3A 1T0HA 2JOYA 3O5ZA 2LVMA 2LNHB 5LJ5f 3OW2A 1YI2A 2OTLT 4N4GA 3NTKA 3HP9A 1QVGA 2LCSA 1XJWB 1G3WA 3C94A 1VQMA 2COYA 2RHIA 4AG1C 5KYYA 4C8QD 3G71Q 2ESWA 2DJQA 1NLOC 2D8HA 1VQ9A 2VYTA 2E6ZA 4J9CA 2EFIA 4FU6A 1OPKA 1AEYA 2DETA 3JV3A 5LJ3d 3CC2Q 2ABLA 2KY9A 3MEWA 2R57A 3NTIA 1QKXA 4M7AE 1D1BA 4IUPA 1IO6A 2MAMA 4XTZA 1PKSA 3WVDB 2F2XA 2HD0A 4HVWA 4C92G 3JCMJ 3RMSA 1N8RU 3RNJA 2X3XD 1WXBA 3CBMA 2LQWA 1QVGS 3GIBA 1PCXA 2PVOB 3M56A 4LDVA 2QXFA 5CIUA 1QCNA 3CCLA 3G6EA 3LH5A 1BKBA 1FMKA 5DY9A 4BI3A 3GPLA 3CEYA 4J6WA 3JCMW 2HCKA 1G83A 2RQTA 3EG9A 3EAEA 5FLXE 3HRTA 4TVRA 1SRLA 3H0HA 1N8RR 3CMEA 3CCQQ 1RI0A 2GGRA 3HFOA 3H6ZA 2CT4A 4ESRA 2A36A 2RI5A 2E41A 3EG9B 2WSCE 4M78E 2KRSA 2RO0A 4OMOA 1TWBA 2JM9A 4MZMA 2L3SA 3E2UA 2MWPA 2RK1A 4C0GA 3ASKA 3MPUB 4M77D 2OI3A 4RG2A 1T0JA 4PLIA 1UEBA 4FSXA 3OYEA 5C6SA 3SWNA 5GAN4 2WACA 1YCSB 2KXDA 1BI0A 3ZEHA 5GAOm 3V7RA 2DVEA 4M7DG 1KQSS 4KH1B 3N5BB 5IN1A 3PTAA 1NYGA 1B34A 4N0AA 3VS4A 1AWWA 3CPFA 3S3OA 2DL4A 2PNIA 2YXYA 2JN0A 1X2KA 3V7CA 1YJNQ 3I56A 2BKDN 1VQ7T 1SRMA 1VQLA 3MO8A 4LUEA 2VC8A 3NPFA 2VXEA 2LQ8A 1KQ1A 2XG8D 2XU8A 3SHWA 2K3BA 4QQDA 2OAWA 1E6GA 1AZEA 9ATCB 1MV3A 2V8KA 1JJ2P 4R55A 1M27C 2FPFA 3DB4A 2IVWA 2JTMA 4ZGJB 1RLPC 3JSCA 1WJSA 4QW2A 2K4YA 3DLLA 3TCJA 2OTLA 2CS7A 1CSKA 2J7IA 3VKIA 1K9MU 6AT1B 3QDRB 1MUZA 1I0CA 2KXCA 4PJJA 2RI2A 1KJWA 3CC4T 4DEXA 3P8HA 4GBQA 2O9VA 2E6NA 2VXFA 1LOJA 4XK8E 3OYHA 4L5GA 2KYBA 1K8AC 4PJOD 1M30A 2DZ9A 2AZSA 3TVTA 3PE0A 2EQKA 3J81E 2DIGA 2VASA 2CP6A 3JCMP 4OB0B 1MNDA 1YJWT 1WHJA 2XMFA 3X26B 1K9MR 5FWBA 1ZHIA 4M7AA 5CKHA 3JCMg 4NL3A 2K3YA 2R5AA 3OS5A 2HAXA 3QJYA 1VYVA 2V1QA 4KUDK 1EX4A 4E47A 4A4FA 1HK9A 1Y71A 2E64A 2OTJT 3LGFA 1SKUB 3QZ9B 4KUIA 4DBHA 4M7AB 3VUBA 2LT4A 2QDLA 3OB9A 3BE3A 3VYGA 2EGEA 5CO7A 2HL5C 3PIOA 3VUZA 2DK3A 3A98A 2K57A 4XU0A 3VU3C 2DXCA 5IXFA 4IURA 2EYYA 4ZN3A 4KULA 2C0IA 5IHKA 3L2UA 4RTYA 3LW5E 1U1SA 4FSSA 1PHTA 2M9UA 2D8JA 2V1RA 2HQXA 1G3TA 3A8GB 1ZSZB 1WHMA 1MHNA 1Q82C 1K9AA 4WF2A 3THKA 2EKOA 1ZUUA 1ZBJA 1NBEB 4M7AF 2MPXC 1M3AA 3L2WA 4LDYA 5GANf 1BI3A 2CZ0B 1U8RA 3OYJA 5GJWB 2VB6A 3OYBA 3NMZC 5HKCA 2K2VA 4RTVA 3JCMe 2YUOA 4M78B 1Y0MA 4M75D 3CPWA 1AVZC 2MK5A 2W0ZA 4OMQA 4Z02A 5GAMd 3KUFA 1HD3A 2RB6A 4N0AC 4E7HA 2K7AA 1BB9A 3QG1A 2L2PA 2E65A 3CCMT 3T9NA 2DL3A 5KYUA 2JZ2A 2ENMA 2A3LA 2KRMA 3H0IA 1VQ6T 1ZUKA 3UA7A 3F70A 2KMTA 5IH2A 1SEMA 1CKAA 1AD5A 2O88A 2ZPIB 1RACB 2LQKA 4LNPA 1VQ7A 3QPHA 4GY5A 2KT8A 3SEMA 4ZTJA 3QO3A 1V76A 2KE9A 2LX7A 4OGEA 4Z89A 1WHLA 1E6HA 4PFZA 2H3JA 3M4YA 4AFUC 2AK5A 2DYIA 2O4XA 4QT7A 4DBQA 2JM8A 1LPLA 1Z9ZA 2WSFE 1VQ8T 2CDTA 4WCIA 3EGXA 1R0BG 2LTOA 2O4XB 1G3SA 3HSBA 1K0XA 1WQWA 5IT9E 3LWHA 4OB1B 4ANJA 3OYCA 4Q5WA 3CC4A 4HKEA 4OP0A 3EGXB 3LLRA 5FU7B 3L2QA 2RPNA 4ZN1A 1Y07A 5C0MA 1K8AU 4EMKC 2KNBB 2PU9B 4XU3A 4KH0B 1UECA 5I21A 1FYNA 1YJWA 4HCBA 3JRZA 2ED0A 1IZ6A 3REAB 1OYXA 1BU1A 4M7AC 1KHIA 4AFSC 3CXCA 1VQMQ 1G2BA 1Q86C 1UG1A 3OY9A 4Z88A 3RKXA 2DM1A 2XD0A 4C92D 4AFZC 2K6DA 3MP6A 2JS0A 3TEEA 4C5IA 3TSZA 1K8AR 4J5YA 4QKUA 2OTJA 4NL2A 1SG5A 4UC4A 3ME9A 1ZSZC 1UGSB 4C8QA 2DZCA 4A53A 1QVFA 4ORZA 2JS2A 1KC8U 1YWOA 1UGPB 2RJCA 4HVVA 1W70A 1N5ZA 3EG0A 4PKCC 1VYTA 3CXCS 2MF2A 2QQRA 5IHNA 1R77A 4M78C 4X1VA 1UHCA 2ZPGB 2DKGA 4EPCA 1TG0A 1KC8R 4DBRA 1EFNA 1BCMA 4B9XA 2XI9A 1NEBA 2BTTA 3CMEQ 1JQQA 1YN8A 4X9DA 3EG1A 5GAMg 1QVFS 3M54A 4JRPA 3JCMh 4J6XA 4C8QF 4PK4A 4OB3B 4M7DD 1TH7A 4GLKA 1FMVA 3CCMA 4R56A 4J9EA 3SB2A 4D6WA 3X24B 5GAN6 1AZGB 1AWOA 1J3TA 3EGUA 3FDRA 1PSEA 3V8JA 5CKEA 1A0NB 1BI1A 1NM7A 4PFPA 1W4SA 2CP2A 1QKWA 2IPOB 2EJFA 2A28A 4JPBW 2MOXA 3M53A 1TUGB 2FL7A 1H641 4E6RA 4R0KA 2RHUA 4J9DA 4M77A 3UT1A 1M2VB 3CBOA 4B6MA 2EBPA 2YUNA 5GJVB 4C0ZA 2DLPA 2EGCA 5FU7C 3VS1A 3I56Q 1UFFA 3RKYA 3URGA 3M55A 4C0DB 2RA2A 3FB9A 2X35A 4PL6A 2V8JA 1UTIA 5GAMj 2XDBA 5L8RE 1KFZA 3X25B 5GMKi 2LZ6B 2BUDA 5GMKe 5LJ5d 5GAOp 3UWNA 5GAMe 1WFWA 3CCRT 2RQWA 4J7FA 1IGUA 4E7LA 2KROA 3C4SA 1UGVA 4A4GA 1M1KC 1MMAA 2GQIA 2F2VA 2FZCB 2MCNA 3CCRQ 2YLCA 4JJBA 3P8DA 2RHZA 3CCUT 1W1FA 2OTLQ 2RQRA 2I2LA 3LYIA 1Q7YC 3ZFJA 1BI2A 2DD4A 1WHGA 2NYSA 4C5GA 1Q86U
chains in the Genus database with same CATH topology
1QLYA 4GLMA 4J9FA 1GCPA 2OAWA 1E6GA 1AZEA 1X69A 2JW4A 2K79A 1MV3A 4KRTA 3QWXX 1M27C 3H0FA 2FPFA 1K76A 1ARKA 2B86A 1ZLMA 2HBWA 1RLPC 2CREA 1T3SA 2C0OA 4OMNA 2FPDA 2IIMA 1SHFA 3ULRB 1K0SA 2FPEA 1GL5A 2LMJA 2I0NA 1OPLA 2CH4A 1CSKA 2J7IA 2RMOA 3UF4A 2JTEA 3EG2A 2KEAA 2PZ1A 1MUZA 1I0CA 2KXCA 5FW9A 1KJWA 4DEXA 1UDLA 3H41A 3VRYA 2LJ3A 2ECZA 4GBQA 2O9VA 2EPDA 3I9QA 1ZX6A 3EG3A 1RI9A 2FO0A 2KYBA 1PWTA 3M0RA 1M30A 2DL8A 4EIKA 2AZSA 4RTXA 3TVTA 3PE0A 2DBMA 2M0YA 1X6GA 2HEQA 1VA7A 2XMFA 1M3BA 2J06A 5FWBA 2GTJA 3C0CA 2A08A 1ZSGA 3I5SA 4OMMA 1GCQC 4CC4B 4AG2C 1GFDA 1BK2A 1TUDA 1PKTA 1VYVA 2V1QA 1YWPA 2A37A 2EVRA 4IIOA 4J9IA 1SHGA 2J6OA 3R6NA 1SSHA 2CSIA 2QDLA 4DEYA 2EGEA 2M51A 3A98A 4LE9A 2K2MA 2AKLA 1NG2A 5IXFA 2JMCA 2EYYA 2RF0A 4IIMA 2C0IA 5IHKA 1HJDA 2ROTA 1X43A 4RTYA 2DX1A 1VYUA 4Z8AA 4FSSA 1PHTA 2J6KA 1U3OA 1QWFA 2KGTA 1B07A 2D8JA 2KYMA 2V1RA 3ZL7C 2BZYA 2J05A 4OMPA 1PNJA 1QCFA 2LP5A 2G6FX 3IQLA 1I07A 2DYBA 4RTWA 1K9AA 4RTZA 5I11A 3THKA 1ZUUA 1ZBJA 3KFVA 2GTOA 2DBKA 2FRYA 1K1ZA 1M3AA 2BZ8A 5GJWB 4JJDA 2DE0X 4J9BA 2LQNA 1QWEA 3NMZC 4RTVA 2YUOA 1MV0B 1Y0MA 1B3QA 2ROLA 4A63B 1AVZC 1TUCA 1E7OA 2RQUA 4HCKA 2W0ZA 4OMQA 2HDAA 1HD3A 3PVQA 2PTKA 5FWCA 2DA9A 2K7AA 1GFCA 4D8KA 1BB9A 1Y57A 2L2PA 4CC3A 2CT3A 1SPKA 2RN8A 3EHRA 2DL3A 4ZNXA 2ENMA 2KRMA 3H0IA 1ZUKA 4M4ZA 3UA7A 3TSWA 3UATA 4D8DA 5IH2A 1SEMA 1CKAA 1AD5A 1NYFA 2O88A 1PRMC 4F17A 4HXJA 1WXTA 2BZXA 3UA6A 4LNPA 3M0TA 4OMLA 4JZ4A 3M0UA 2P4RA 2KT8A 3SEMA 2EKHA 1ZUYA 1WIEA 2KE9A 2LX7A 4Z89A 5IHIA 1E6HA 2KT1A 1YP5A 2CH4W 4AFUC 3GBQA 2YUQA 2L3QA 2AK5A 4RUGA 1X27A 2C0TA 3I5RA 4HVUA 2D1XA 4QT7A 5L23A 4CC7A 2EYXA 1RUWA 2JM8A 2DVJA 1Z9ZA 2H8HA 2AZVA 2CDTA 5EC7A 4WCIA 2MIOA 2YT6A 4K11A 1ABQA 1GRIA 2EYWA 1K0XA 4F14A 2JMAA 3U23A 2FEIA 1AWXA 2DNUA 2OJ2A 2YUPA 2L3PA 3VS6A 3QWYA 3PVLA 1H8KA 5ECAA 3VS2A 2RPNA 5IXBA 2X3WD 1WXUA 2L0AA 2F2WA 3CQTA 2EQIA 1WX6A 2W10A 2KNBB 2HSPA 1NLPC 3M0SA 2GBQA 2DRKA 1UECA 1FYNA 1WYXA 2K9GA 2ED0A 2FRWA 4RTUA 3REAB 1X2QA 1BU1A 4AFSC 1G2BA 2JXBA 2J6FA 2VVKA 1UG1A 4Z88A 1WI7A 1M8MA 2DM1A 4F16A 1H3HA 2DL7A 2CSQA 3I35A 4AFZC 1KIKA 2K6DA 2JS0A 2YSQA 4RTTA 1Z9QA 2O31A 3TSZA 1OV3A 1UE9A 2RQVA 1T0HA 1OOTA 4J9GA 3O5ZA 2LNHB 1RLQC 1UJ0A 1W6XA 1AWJA 1U06A 4Y92A 2LCSA 1LCKA 3VS5A 4ORZA 2JS2A 3EHQA 1YWOA 4J9HA 2LJ0A 4AG1C 2SEMA 4HVVA 1BBZA 1KSWA 3NGPA 1W70A 2ESWA 1N5ZA 3EG0A 2DJQA 1NLOC 2D8HA 1T3LA 1VYTA 4J9CA 2EGAA 2YDLA 1OEBA 1M3CA 1CKBA 1JO8A 1OPKA 1AEYA 2KRNA 2VKNA 1WLPB 3JV3A 5IHNA 3VS7A 4JJCA 2KR3A 4X1VA 1UHCA 2KBTA 2ABLA 2JT4A 1TG0A 1QKXA 1EFNA 1GBQA 1IO6A 1PKSA 1V1CA 1AOJA 2F2XA 1NEBA 2BTTA 4HVWA 3RBBB 1GCQA 2NUZA 1JQQA 1YN8A 1NEGA 1K4US 3VRZA 3RNJA 1HSQA 2X3XD 1ABOA 1WXBA 2DL5A 2LQWA 1WA7A 3EG1A 1I1JA 2FG0A 2AKKA 2D0NA 3LH5A 1H92A 1FMKA 3FJ5A 2SRCA 2GNCA 3REBB 2HCKA 1G83A 4J9EA 2RQTA 1UUEA 1AZGB 1AWOA 2DMOA 3EGUA 1J3TA 2ED1A 1S1NA 1SRLA 3H0HA 3M0QA 1A0NB 1NM7A 2EYZA 2GGRA 2CT4A 4ESRA 1QKWA 2A36A 2DILA 2EW3A 3VS0A 3VS3A 4CC2A 2A28A 4JPBW 2MOXA 4JZ3A 2KRSA 4OMOA 3NHNA 4E6RA 4R0KA 4J9DA 2JM9A 2L3SA 1UJYA 1X6BA 4LN2A 2EBPA 1XOVA 2YUNA 2CUDA 5GJVB 2DF6A 2VWFA 2DLPA 2EGCA 3VS1A 2E5KA 1UFFA 4LUDA 2OI3A 1T0JA 2CUBA 1UTIA 1GBRA 1KFZA 5HCKA 1JU5C 1YCSB 2KXDA 1JXOA 2LZ6B 2O2OA 1WDXA 1NYGA 1WFWA 2RQWA 4AFQC 2O9SA 3VS4A 1AWWA 2KROA 5I22A 1UGVA 2NWMA 1JXMA 2DRMA 2DL4A 2GQIA 2LJ1A 2PNIA 2F2VA 2MCNA 1X2KA 4JJBA 1JEGA 1PRLC 3M0PA 1W1FA 1SRMA 2RQRA 1YNZA 4LUEA 1U5SA 3NPFA 2RNAA 1UHFA 3SHWA 2K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLY A;  4GLM A;  4J9F A;  1GCP A;  2OAW A;  1E6G A;  1AZE A;  1X69 A;  2JW4 A;  2K79 A;  1MV3 A;  4KRT A;  3QWX X;  1M27 C;  3H0F A;  2FPF A;  1K76 A;  1ARK A;  2B86 A;  1ZLM A;  2HBW A;  1RLP C;  2CRE A;  1T3S A;  2C0O A;  4OMN A;  2FPD A;  2IIM A;  1SHF A;  3ULR B;  1K0S A;  2FPE A;  1GL5 A;  2LMJ A;  2I0N A;  1OPL A;  2CH4 A;  1CSK A;  2J7I A;  2RMO A;  3UF4 A;  2JTE A;  3EG2 A;  2KEA A;  2PZ1 A;  1MUZ A;  1I0C A;  2KXC A;  5FW9 A;  1KJW A;  4DEX A;  1UDL A;  3H41 A;  3VRY A;  2LJ3 A;  2ECZ A;  4GBQ A;  2O9V A;  2EPD A;  3I9Q A;  1ZX6 A;  3EG3 A;  1RI9 A;  2FO0 A;  2KYB A;  1PWT A;  3M0R A;  1M30 A;  2DL8 A;  4EIK A;  2AZS A;  4RTX A;  3TVT A;  3PE0 A;  2DBM A;  2M0Y A;  1X6G A;  2HEQ A;  1VA7 A;  2XMF A;  1M3B A;  2J06 A;  5FWB A;  2GTJ A;  3C0C A;  2A08 A;  1ZSG A;  3I5S A;  4OMM A;  1GCQ C;  4CC4 B;  4AG2 C;  1GFD A;  1BK2 A;  1TUD A;  1PKT A;  1VYV A;  2V1Q A;  1YWP A;  2A37 A;  2EVR A;  4IIO A;  4J9I A;  1SHG A;  2J6O A;  3R6N A;  1SSH A;  2CSI A;  2QDL A;  4DEY A;  2EGE A;  2M51 A;  3A98 A;  4LE9 A;  2K2M A;  2AKL A;  1NG2 A;  5IXF A;  2JMC A;  2EYY A;  2RF0 A;  4IIM A;  2C0I A;  5IHK A;  1HJD A;  2ROT A;  1X43 A;  4RTY A;  2DX1 A;  1VYU A;  4Z8A A;  4FSS A;  1PHT A;  2J6K A;  1U3O A;  1QWF A;  2KGT A;  1B07 A;  2D8J A;  2KYM A;  2V1R A;  3ZL7 C;  2BZY A;  2J05 A;  4OMP A;  1PNJ A;  1QCF A;  2LP5 A;  2G6F X;  3IQL A;  1I07 A;  2DYB A;  4RTW A;  1K9A A;  4RTZ A;  5I11 A;  3THK A;  1ZUU A;  1ZBJ A;  3KFV A;  2GTO A;  2DBK A;  2FRY A;  1K1Z A;  1M3A A;  2BZ8 A;  5GJW B;  4JJD A;  2DE0 X;  4J9B A;  2LQN A;  1QWE A;  3NMZ C;  4RTV A;  2YUO A;  1MV0 B;  1Y0M A;  1B3Q A;  2ROL A;  4A63 B;  1AVZ C;  1TUC A;  1E7O A;  2RQU A;  4HCK A;  2W0Z A;  4OMQ A;  2HDA A;  1HD3 A;  3PVQ A;  2PTK A;  5FWC A;  2DA9 A;  2K7A A;  1GFC A;  4D8K A;  1BB9 A;  1Y57 A;  2L2P A;  4CC3 A;  2CT3 A;  1SPK A;  2RN8 A;  3EHR A;  2DL3 A;  4ZNX A;  2ENM A;  2KRM A;  3H0I A;  1ZUK A;  4M4Z A;  3UA7 A;  3TSW A;  3UAT A;  4D8D A;  5IH2 A;  1SEM A;  1CKA A;  1AD5 A;  1NYF A;  2O88 A;  1PRM C;  4F17 A;  4HXJ A;  1WXT A;  2BZX A;  3UA6 A;  4LNP A;  3M0T A;  4OML A;  4JZ4 A;  3M0U A;  2P4R A;  2KT8 A;  3SEM A;  2EKH A;  1ZUY A;  1WIE A;  2KE9 A;  2LX7 A;  4Z89 A;  5IHI A;  1E6H A;  2KT1 A;  1YP5 A;  2CH4 W;  4AFU C;  3GBQ A;  2YUQ A;  2L3Q A;  2AK5 A;  4RUG A;  1X27 A;  2C0T A;  3I5R A;  4HVU A;  2D1X A;  4QT7 A;  5L23 A;  4CC7 A;  2EYX A;  1RUW A;  2JM8 A;  2DVJ A;  1Z9Z A;  2H8H A;  2AZV A;  2CDT A;  5EC7 A;  4WCI A;  2MIO A;  2YT6 A;  4K11 A;  1ABQ A;  1GRI A;  2EYW A;  1K0X A;  4F14 A;  2JMA A;  3U23 A;  2FEI A;  1AWX A;  2DNU A;  2OJ2 A;  2YUP A;  2L3P A;  3VS6 A;  3QWY A;  3PVL A;  1H8K A;  5ECA A;  3VS2 A;  2RPN A;  5IXB A;  2X3W D;  1WXU A;  2L0A A;  2F2W A;  3CQT A;  2EQI A;  1WX6 A;  2W10 A;  2KNB B;  2HSP A;  1NLP C;  3M0S A;  2GBQ A;  2DRK A;  1UEC A;  1FYN A;  1WYX A;  2K9G A;  2ED0 A;  2FRW A;  4RTU A;  3REA B;  1X2Q A;  1BU1 A;  4AFS C;  1G2B A;  2JXB A;  2J6F A;  2VVK A;  1UG1 A;  4Z88 A;  1WI7 A;  1M8M A;  2DM1 A;  4F16 A;  1H3H A;  2DL7 A;  2CSQ A;  3I35 A;  4AFZ C;  1KIK A;  2K6D A;  2JS0 A;  2YSQ A;  4RTT A;  1Z9Q A;  2O31 A;  3TSZ A;  1OV3 A;  1UE9 A;  2RQV A;  1T0H A;  1OOT A;  4J9G A;  3O5Z A;  2LNH B;  1RLQ C;  1UJ0 A;  1W6X A;  1AWJ A;  1U06 A;  4Y92 A;  2LCS A;  1LCK A;  3VS5 A;  4ORZ A;  2JS2 A;  3EHQ A;  1YWO A;  4J9H A;  2LJ0 A;  4AG1 C;  2SEM A;  4HVV A;  1BBZ A;  1KSW A;  3NGP A;  1W70 A;  2ESW A;  1N5Z A;  3EG0 A;  2DJQ A;  1NLO C;  2D8H A;  1T3L A;  1VYT A;  4J9C A;  2EGA A;  2YDL A;  1OEB A;  1M3C A;  1CKB A;  1JO8 A;  1OPK A;  1AEY A;  2KRN A;  2VKN A;  1WLP B;  3JV3 A;  5IHN A;  3VS7 A;  4JJC A;  2KR3 A;  4X1V A;  1UHC A;  2KBT A;  2ABL A;  2JT4 A;  1TG0 A;  1QKX A;  1EFN A;  1GBQ A;  1IO6 A;  1PKS A;  1V1C A;  1AOJ A;  2F2X A;  1NEB A;  2BTT A;  4HVW A;  3RBB B;  1GCQ A;  2NUZ A;  1JQQ A;  1YN8 A;  1NEG A;  1K4U S;  3VRZ A;  3RNJ A;  1HSQ A;  2X3X D;  1ABO A;  1WXB A;  2DL5 A;  2LQW A;  1WA7 A;  3EG1 A;  1I1J A;  2FG0 A;  2AKK A;  2D0N A;  3LH5 A;  1H92 A;  1FMK A;  3FJ5 A;  2SRC A;  2GNC A;  3REB B;  2HCK A;  1G83 A;  4J9E A;  2RQT A;  1UUE A;  1AZG B;  1AWO A;  2DMO A;  3EGU A;  1J3T A;  2ED1 A;  1S1N A;  1SRL A;  3H0H A;  3M0Q A;  1A0N B;  1NM7 A;  2EYZ A;  2GGR A;  2CT4 A;  4ESR A;  1QKW A;  2A36 A;  2DIL A;  2EW3 A;  3VS0 A;  3VS3 A;  4CC2 A;  2A28 A;  4JPB W;  2MOX A;  4JZ3 A;  2KRS A;  4OMO A;  3NHN A;  4E6R A;  4R0K A;  4J9D A;  2JM9 A;  2L3S A;  1UJY A;  1X6B A;  4LN2 A;  2EBP A;  1XOV A;  2YUN A;  2CUD A;  5GJV B;  2DF6 A;  2VWF A;  2DLP A;  2EGC A;  3VS1 A;  2E5K A;  1UFF A;  4LUD A;  2OI3 A;  1T0J A;  2CUB A;  1UTI A;  1GBR A;  1KFZ A;  5HCK A;  1JU5 C;  1YCS B;  2KXD A;  1JXO A;  2LZ6 B;  2O2O A;  1WDX A;  1NYG A;  1WFW A;  2RQW A;  4AFQ C;  2O9S A;  3VS4 A;  1AWW A;  2KRO A;  5I22 A;  1UGV A;  2NWM A;  1JXM A;  2DRM A;  2DL4 A;  2GQI A;  2LJ1 A;  2PNI A;  2F2V A;  2MCN A;  1X2K A;  4JJB A;  1JEG A;  1PRL C;  3M0P A;  1W1F A;  1SRM A;  2RQR A;  1YNZ A;  4LUE A;  1U5S A;  3NPF A;  2RNA A;  1UHF A;  3SHW A;  2K3B A; 
#chains in the Genus database with same CATH topology
 1QLY A;  1MNE A;  4M7A G;  2WSE E;  1GCP A;  4M77 F;  1VQO T;  2GFU A;  2JW4 A;  4FYW B;  3QXE B;  2K79 A;  4KRT A;  5KYY B;  5FRN A;  1ARK A;  7AT1 B;  2CP0 A;  3NFC A;  5KH6 A;  1JBM A;  3ER0 A;  1VQO Q;  4OMN A;  5GAO n;  1LJO A;  1K0S A;  1GL5 A;  3QBY A;  2DEU A;  2LMJ A;  1RAG B;  2MMP A;  3UF4 A;  3OA6 A;  1Q86 R;  2JTE A;  3CCV T;  1K73 C;  4Y91 A;  3SD4 A;  1V29 B;  4PJO A;  3VRY A;  2LJ3 A;  1TSF A;  1WGS A;  4JJN K;  5GAO r;  4QVZ A;  5IAY A;  2XK0 A;  3CCV Q;  2X51 A;  3BY7 A;  4F7U A;  3OBY A;  3I55 T;  3CD6 T;  3EG3 A;  2R5M A;  1OX8 A;  2NLU A;  4EIK A;  2DXU A;  1ZA2 B;  1KQS A;  3JCM f;  2DBM A;  4XU1 A;  2M0Y A;  2X4Y A;  1X6G A;  2JUF A;  1VA7 A;  1JJ2 S;  2CZ6 B;  4LD6 A;  5KYW A;  1ZA1 B;  4M78 G;  1RAD B;  2QTV A;  1M3B A;  4F7U B;  1W2B P;  4OMF B;  4OMM A;  4KGZ B;  1D0Y A;  1MGQ A;  3RMQ A;  4CRI A;  1TUD A;  1PKT A;  2QEX T;  4KGV B;  2F69 A;  1YWP A;  1M9S A;  2A37 A;  3A8M B;  1R0C B;  2PUK B;  4IIO A;  4J9I A;  1TU0 B;  2RK2 A;  2CSI A;  3OYM A;  2CP3 A;  5HK3 A;  1NPP A;  2EQM A;  2DXT A;  3E9F A;  2QQA A;  3HFN A;  1D0X A;  2HZY A;  2QA4 T;  2DX1 A;  1VYU A;  1YJ9 T;  1VQP T;  4F7U F;  2KGT A;  3S3M A;  2L3R A;  3TRE A;  1ACM B;  2J05 A;  4C0D C;  3SWN B;  2EQU A;  2LP5 A;  2G6F X;  3IQL A;  2QI2 A;  2DYB A;  4RTW A;  3OS2 A;  2AT1 B;  2RH2 A;  4RTZ A;  2KAF A;  2FB7 A;  3EGD A;  3LH0 A;  1D0Z A;  2DBK A;  1YCY A;  4JLG A;  4XQ3 A;  1IHW A;  1B34 B;  2FRY A;  3M4G A;  2BZ8 A;  3MEU A;  4M75 A;  3DKM A;  2XID A;  3L1A A;  4J9B A;  3A8L B;  2LQN A;  1VQ7 Q;  2Y4X A;  3MP8 A;  3OW2 P;  4AMC A;  2DO3 A;  3GF5 A;  1ZBX A;  1QVG P;  4A63 B;  1RAH B;  1TUC A;  5CAI A;  2F5K A;  2HDA A;  5LJ5 g;  3G7Z A;  4FIB A;  2EQJ A;  1VQ5 T;  4BI4 A;  5KE2 A;  2DA9 A;  1GFC A;  2PQW A;  4D8K A;  3CCR A;  5I2M A;  1SPK A;  5GMK h;  4ZNX A;  4E7I A;  3OYD A;  5D7U A;  4HT9 A;  3TSW A;  3UAT A;  1M1K U;  1OZ2 A;  2DPP B;  1DJ7 B;  1PRM C;  5KYN A;  3CCU A;  3UA6 A;  2V26 A;  5LL6 S;  1Q95 G;  3M0U A;  2X9H A;  3MEA A;  4KBM B;  5GAO q;  3QYH B;  1Q7Y U;  4BE0 A;  2EKH A;  5A0L A;  1NE8 A;  2E1H A;  3JCM b;  4ELY C;  3CC4 Q;  1D3B A;  1YIT T;  4VUB A;  1R8O B;  5LJ3 g;  2YUQ A;  2NUT A;  1VQO A;  1X27 A;  2C0T A;  2D1X A;  3C95 A;  4CC7 A;  4M75 F;  4XTU A;  1RUW A;  1KQ2 A;  4LDW A;  2DVJ A;  1M1K R;  2P84 A;  2AZV A;  2MIO A;  1D3B B;  4DBF A;  1YJW Q;  2PUO B;  4K11 A;  5AYF A;  2NUT B;  1Q7Y R;  1C6V X;  3CCE T;  1KG1 A;  1WNL A;  4F14 A;  5LJ5 j;  2M1H A;  1AT1 B;  3U23 A;  2FEI A;  3CCV A;  4FW1 A;  2YUP A;  1F1B B;  2L3P A;  2QDY B;  2Y90 A;  3FEO A;  3L2R A;  5LJ5 e;  4C8Q E;  1YIJ T;  1O9S A;  5CKF A;  5ECA A;  1VQN T;  1WXU A;  2L0A A;  2K5F A;  3R6O A;  3I55 A;  3CD6 A;  2F2W A;  2OTJ Q;  3BDL A;  2VGN A;  4ZTF A;  2EQI A;  3OYI A;  3EFS A;  3QKJ A;  1NLP C;  2HKN A;  2KQW A;  2GBQ A;  3M58 A;  1M90 C;  2K9G A;  2FRW A;  1X2Q A;  2B8A A;  5EG2 A;  3JCM V;  5LJ3 j;  2VV5 A;  3CMA T;  2P4T A;  4F16 A;  2LCL A;  4FYX B;  2E3H A;  2QEX A;  3GNF B;  5LJ3 e;  4RTT A;  1Z9Q A;  1UE9 A;  2RQV A;  5GAN d;  4IUQ A;  4J9G A;  3HL8 A;  3H8Z A;  2ZGW A;  2RJF A;  4BDZ A;  1C1A A;  1UJ0 A;  4A54 A;  4N4I A;  1AWJ A;  3QII A;  3SDZ A;  3SWN C;  3VS5 A;  2RHX A;  2COW A;  3EHQ A;  2LJ0 A;  2QA4 A;  2E12 A;  1YBY A;  2SEM A;  1H3Z A;  2ZPH B;  1KSW A;  1YJ9 A;  4JS5 A;  1OU8 A;  1VQP A;  1XTD A;  1T3L A;  4JDS A;  3RKW A;  2RJE A;  1OEB A;  1D09 B;  2E10 A;  2GF7 A;  1M3C A;  1CKB A;  1JO8 A;  3A8O B;  5D6Y A;  2VKN A;  4OB2 B;  4FYY B;  2L89 A;  1WLP B;  3VS7 A;  4ZGE B;  2KR3 A;  2KBT A;  2JT4 A;  2VGM A;  3CCM Q;  4HA8 A;  5GMK m;  3A5Z B;  1VQ6 Q;  1PD1 A;  4CI0 C;  3VV0 A;  4X34 A;  1V1C A;  1AOJ A;  5KYU B;  3VYH B;  4JRQ A;  4M77 E;  3OYG A;  4E7Z A;  1RL2 A;  2NUZ A;  3GLX A;  1NEG A;  1K4U S;  4QQ6 A;  4EDU A;  1HSQ A;  4XTY A;  2DL5 A;  2XDD A;  4M7D A;  1WA7 A;  2D0N A;  4DOV A;  2BE9 B;  5GAO l;  4MZT A;  1M1G A;  1VQ5 A;  5HK0 A;  3QUI A;  1VQK T;  3REB B;  3OYK A;  4N4H A;  2BE7 D;  1NZ9 A;  1VQ8 Q;  2ED1 A;  3GOX A;  1WZO A;  3OMC A;  3M0Q A;  3OS0 A;  4L6V 5;  1WHH A;  3LGL A;  3TQ7 P;  2DIL A;  2EWN A;  2A7Y A;  1N6A A;  1YIT A;  2FZG B;  4M7A D;  1X6B A;  4LN2 A;  1XOV A;  3JB9 H;  4HCZ A;  2A0F B;  3GNG A;  2DF6 A;  2VWF A;  3TU4 K;  5DM7 R;  4LUD A;  3FJP A;  2VUB A;  1BIB A;  3OSV A;  2CUB A;  4M7D F;  3PFS A;  2X4J A;  3MKD A;  3M9Q A;  5FRM A;  5GAN 7;  4OGC A;  2CYZ B;  5HCK A;  3CCE A;  2EJG A;  3WXM B;  2O2O A;  1WDX A;  2KVQ G;  3JB9 F;  2KDS A;  1C0M A;  1WHK A;  3OYN A;  1FXX A;  4AFQ C;  1YIJ A;  3FRN A;  5I22 A;  4F7U G;  2NWM A;  1N27 A;  1VQN A;  1JXM A;  2LJ1 A;  2QTX A;  4RKU E;  1IGQ A;  4PJO E;  3OS1 A;  3D7S B;  4QVC A;  5CKD A;  1JEG A;  1PRL C;  3M0P A;  3M5A A;  4E7K A;  4XTW A;  4FL6 A;  4F7U E;  3CC7 T;  8ATC B;  1M90 U;  1YNZ A;  2QAZ A;  1SSF A;  4FT4 A;  1U5S A;  1UHF A;  2CGH A;  2LCC A;  3V7S A;  4M78 D;  4C8Q B;  3AHU A;  3S3N A;  1N8R C;  4J9F A;  4BUG A;  1X69 A;  3JAM E;  3CMA A;  4AT1 B;  3QWX X;  2AIR B;  3H0F A;  1K76 A;  2E4H A;  2HKQ B;  1Q82 U;  2HBW A;  2JVV A;  4KGX B;  5GAN g;  3CPW P;  1EZZ B;  1TXQ A;  2C0O A;  2DTI A;  4JLI A;  2IIM A;  3G4S T;  1JRI A;  1SHF A;  4LDU A;  5LJ3 h;  2FPE A;  4DQ2 A;  1M90 R;  3DLM A;  1OPL A;  2CH4 A;  1N9R A;  2RMO A;  3G4S Q;  3NTH A;  3EG2 A;  5J26 A;  5FW9 A;  4NOY A;  5DLQ E;  3CCJ T;  2HSE B;  3H41 A;  4PNO A;  2HL3 A;  5HY6 A;  1X75 C;  2YLB A;  4HCC A;  2CZ1 B;  1Q82 R;  3Q1J A;  3I9Q A;  1ZX6 A;  1UGR B;  3KXT A;  1OUL A;  3MP1 A;  3M0R A;  1PWT A;  1I81 A;  2YWW A;  2HBP A;  1M8V A;  1VQ6 A;  2L8D A;  4PJM A;  2HEQ A;  5A2Q E;  2QGG A;  2J06 A;  3HRS A;  2XKO C;  2GTJ A;  4IUU A;  3I5S A;  1RAF B;  4CC4 B;  1M1F A;  4AG2 C;  4A4E A;  1BK2 A;  3KBG A;  4FW2 A;  4LXC A;  5GAN j;  2DTH A;  5GAN 3;  4M75 E;  2EVR A;  4PFO A;  3X28 B;  1YHQ T;  1I5L A;  4YTL A;  1I8F A;  1Y96 A;  4DA4 A;  1RAE B;  2MI6 A;  1UGQ B;  1SHG A;  5GAN e;  2BIV A;  1N9S A;  2K5I A;  1O75 A;  2DXB A;  1VQ8 A;  3WVE B;  2M51 A;  1M5Q 1;  4II1 A;  1KHC A;  1PM3 A;  3J7A F;  4M77 B;  2FHD A;  1VQK A;  4PLL A;  4IIM A;  2ROT A;  1X43 A;  3RES A;  2J6K A;  1U3O A;  1QWF A;  1B07 A;  1VUB A;  3E1S A;  4BDY A;  2P0K A;  1W2B S;  4MZP A;  2LNV A;  4ELZ C;  3CXC P;  3CBP A;  4OMP A;  1QCF A;  4BY6 B;  3FC3 A;  2V8I A;  4FCY A;  3OMG A;  3KFV A;  2FZK B;  1K1Z A;  4MML A;  5GAN 2;  4BD3 A;  2Y4Y A;  1XQH A;  1PD0 A;  2KI7 A;  1QW1 A;  3CCU Q;  2DE0 X;  3EH1 A;  3G71 T;  1K9M C;  1JJ2 A;  1B3Q A;  2ROL A;  1S72 T;  1E7O A;  1QVF P;  3RER A;  4XTV A;  3CCS T;  2D6F A;  3PVQ A;  3JB9 I;  3HTR A;  3CC2 T;  1S72 Q;  1Y57 A;  4CC3 A;  2CT3 A;  4C8Q C;  4BE1 A;  3EHR A;  3CCS Q;  4V2S A;  4D8D A;  3BW1 A;  3FLG A;  3H9N A;  4F17 A;  5LJ3 f;  1I4K 1;  1WXT A;  2QGF B;  2BZX A;  2QAS A;  3M0T A;  3CC7 A;  4JZ4 A;  3RDV A;  1ZUY A;  1GXI E;  4C5E A;  1RAB B;  2KT1 A;  3JCM d;  4LD9 K;  1YP5 A;  5KE3 A;  4C5H A;  1JB0 E;  3OW2 S;  2L3Q A;  3EH2 A;  3I5R A;  2ZPF B;  3I55 Q;  2HNI A;  4FT2 A;  4PJO B;  3CD6 Q;  4C92 E;  3LX7 A;  1M4Z A;  2EYX A;  1IB8 A;  4WTO B;  4FYV B;  4DOW A;  2H8H A;  2K3X A;  3BDU A;  2QYZ A;  5CCA A;  3G4S A;  2YT6 A;  2NUP A;  3CCQ T;  1ABQ A;  2QG9 B;  3LWI A;  2IG0 A;  1Y7X A;  2QQS A;  1GRI A;  4QVD A;  2XHC A;  1WQ7 A;  2EYW A;  5CQX A;  3M59 A;  3V8L A;  2PVD B;  5KYW B;  5I2S A;  1AWX A;  2DNU A;  4B9W A;  2AHJ B;  3UPU A;  3PVL A;  3CCJ A;  1H8K A;  2QEX Q;  2NUP B;  1G3Y A;  5IXB A;  2PVG B;  2X3W D;  3DB3 A;  1FWZ A;  3CQT A;  1WX6 A;  4MDW A;  2HSP A;  1NJI C;  4PJO F;  3MEV A;  2EAY A;  2ZCF B;  2M16 A;  2D9T A;  2J6F A;  2QA4 Q;  1VOM A;  2VVK A;  1IRE B;  1YJ9 Q;  2GCX A;  1VQP Q;  1H3H A;  4M77 C;  2CSQ A;  3I35 A;  4Y28 E;  1UB4 A;  2M02 A;  5GAN 5;  2YSQ A;  2O31 A;  3OBW A;  2MYS A;  1OOT A;  2ZZD A;  1YHQ A;  1NPR A;  1YJN T;  4RMO A;  1RLQ C;  2OX7 A;  1W6X A;  4M7D E;  1U06 A;  4Y92 A;  4E2F B;  4BY6 C;  1LCK A;  3JB9 G;  5GAN h;  3HRU A;  3PMI A;  3EGD B;  4J9H A;  2XDP A;  5A0G A;  2G3R A;  1BBZ A;  3NGP A;  4M75 B;  2X4X A;  4JRI A;  2LDM A;  2EGA A;  2YDL A;  5KYX A;  2DD5 A;  5GAM h;  1VQ5 Q;  2KRN A;  1TOV A;  1OX9 A;  1QCO A;  4JJC A;  1PSF A;  4KT0 E;  1X6O A;  4IUT A;  1GBQ A;  1Q81 C;  4PJL A;  4XAX B;  4HT8 A;  5FU6 B;  5KYX B;  3RBB B;  4J83 A;  1GCQ A;  5KCO A;  3OQ5 A;  2E70 A;  1G5V A;  3G71 A;  3VRZ A;  1U1T A;  3JCM c;  2R58 A;  1ABO A;  2OAU A;  4XTX A;  2H3E B;  1S72 A;  1I1J A;  2FG0 A;  1WJR A;  2AKK A;  3BFM A;  3SFM A;  3M57 A;  1YIT Q;  3CCS A;  1TTH B;  1H92 A;  5CQY A;  3FJ5 A;  2CZ7 B;  2RHY A;  2SRC A;  2GNC A;  3CC2 A;  1SF9 A;  4C8Q G;  1UUE A;  3A1P A;  2DMO A;  5CVI A;  2LX9 A;  4EMK A;  3O8V A;  1S1N A;  4PJO C;  1KQS P;  4IUV A;  1K73 U;  2RM4 A;  4RCB A;  2EYZ A;  3CCE Q;  2EW3 A;  3VS0 A;  3VS3 A;  4CC2 A;  3HPW A;  5DLO A;  4JZ3 A;  2HMA A;  3PGG A;  5CK9 A;  1FMW A;  1KD1 C;  3NHN A;  1HYO A;  4EMK B;  1YIJ Q;  1VQN Q;  1UJY A;  4JUV A;  4O6J A;  4A4K A;  3QHS A;  2CUD A;  1X01 A;  2E5K A;  4C92 A;  1K73 R;  1IRX A;  1B7T A;  1RAI B;  1BYM A;  1AHJ B;  1KC8 C;  3CCQ A;  1ZSZ A;  2ZPE B;  1GBR A;  2RD1 A;  3MCA B;  1IXD A;  1JU5 C;  1JXO A;  2DER A;  2F1L A;  5A0D A;  3E9G A;  2DIQ A;  4C92 B;  3CMA Q;  2COZ A;  1ZQ1 A;  3PMT A;  2O9S A;  3EFR A;  4BAC A;  2ZPB B;  2DRM A;  4XU2 A;  4LDX A;  4RCC A;  4M78 A;  1NJI U;  4O5V A;  2CKK A;  3OYA A;  3A8H B;  4E7J A;  1VQ4 T;  2RNA A;  4BB7 A;  3AT1 B;  1WJQ A;  3G1J A;  1OI1 A;  1RAA B;  4GLM A;  2JTF A;  3MET A;  3INZ A;  1XNI A;  4BI8 B;  4MDX A;  1VQ4 Q;  2M0O A;  3X20 B;  2HQH A;  2B86 A;  1ZLM A;  4M77 G;  4C92 F;  1MMD A;  2LC4 A;  2CRE A;  4M75 C;  1T3S A;  5GAM f;  4P5N A;  2FPD A;  1NJI R;  3QDF A;  2YRC A;  3ULR B;  3OYL A;  1YJN A;  3E19 A;  4E7S A;  3HHT B;  2JNG A;  2I0N A;  2YRV A;  2LT1 A;  3QSU A;  3L2Z A;  2KEA A;  2PZ1 A;  4J8O A;  1UDL A;  1FX7 A;  2ECZ A;  1YFN A;  2EPD A;  4ZGD B;  2F5T X;  5FU6 C;  3JB9 J;  4EMH A;  2KSS A;  1BCO A;  1RI9 A;  2FO0 A;  3L2V A;  4M78 F;  2DL8 A;  4M7D B;  4RTX A;  4EMG A;  1IHV A;  1BIA A;  3C12 A;  5KCH A;  3UDC A;  1VQK Q;  3CPW S;  3C0C A;  5FRO A;  1EIF A;  2A08 A;  1ZSG A;  4FM4 B;  3ZBD A;  5D6X A;  1Q81 U;  2E5Q A;  2FYK A;  1GCQ C;  1I5O B;  5GAN 8;  3RIR A;  1GFD A;  2ATC B;  2CP7 A;  4J6Y A;  1TS9 A;  2DFU A;  1PG5 B;  1MMG A;  2GFA A;  1M2O A;  1PC0 A;  1QQJ A;  2HQE A;  2J6O A;  3MHX A;  1YI2 T;  1P92 A;  2ZAE A;  3R6N A;  1SSH A;  1VIE A;  2GQV A;  2EJ9 A;  4DEY A;  2K5L A;  3OYF A;  3OYY A;  2DAQ A;  4LE9 A;  2K2M A;  2MWO A;  1Q81 R;  2AKL A;  1NG2 A;  2JMC A;  1VQM T;  2RF0 A;  1YI2 Q;  2CP5 A;  1HJD A;  3PNW C;  1KK7 A;  1MMN A;  4Z8A A;  2KYM A;  1VQ9 T;  4PJO G;  3V8K A;  4IKF A;  3ZL7 C;  2BZY A;  4NS5 A;  3L42 A;  3VJP A;  1PNJ A;  5LJ5 h;  1VQ9 Q;  1I07 A;  1KD1 U;  1LVK A;  2XIC A;  5I11 A;  2O01 E;  2GTO A;  1WPY A;  4OF1 A;  2YRD A;  3RUX A;  2DTO A;  4C92 C;  1OZ3 A;  3QYG B;  3PIP A;  4JJD A;  4PJN A;  3GP8 A;  3CC7 Q;  1QWE A;  2RJD A;  2QQB A;  4L59 A;  1OQK A;  1MV0 B;  4A4H A;  4HCK A;  2RQU A;  3CCL T;  3G6E T;  1OU9 A;  3QZ5 B;  3JCM Q;  1KD1 R;  1QP3 A;  1QMC A;  1QVP A;  3FIF A;  2PTK A;  5FWC A;  1D1C A;  3S6W A;  5J39 A;  2RN8 A;  3CCL Q;  3G6E Q;  4MMK A;  4M4Z A;  2E3I A;  1QP2 A;  8AT1 B;  1NYF A;  4OVA A;  5D6W A;  3HKS A;  3CME T;  4HXJ A;  3P8B B;  2EIF A;  4OML A;  2P4R A;  1VQ4 A;  1WIE A;  2DEQ A;  5AT1 B;  5IHI A;  2QK0 A;  4X9C A;  3CCJ Q;  2CH4 W;  3GBQ A;  4RUG A;  3EFO A;  2Z0W A;  4F04 B;  4HVU A;  5M9O A;  1D1A A;  2EYQ A;  5L23 A;  3J80 E;  1W2B A;  4J7I A;  2KK4 A;  5EC7 A;  4M75 G;  4QQG A;  2RI3 A;  2DJZ A;  3EFO B;  4M7D C;  2JMA A;  2L5Q A;  5J3B A;  2OJ2 A;  3JB9 D;  2D0Q B;  1M2V A;  3VS6 A;  2YHT A;  3QWY A;  3VS2 A;  2LRQ A;  4RG8 A;  5CR2 A;  2P0P A;  4ME7 A;  2QQ9 A;  3MJX A;  1YHQ Q;  2C06 A;  3I56 T;  2W10 A;  2P0Q A;  3M0S A;  2DRK A;  1Y96 B;  1VQL T;  3JCM X;  1WYX A;  3RR6 A;  4RTU A;  5CKB A;  4JRK A;  4ATO A;  5GMK l;  2FVU A;  1G8X A;  2JXB A;  2X4W A;  4BE2 A;  1VQL Q;  2JJ9 A;  1WI7 A;  4C0F A;  1M8M A;  5GMK j;  2DL7 A;  1KIK A;  3PT9 A;  4JS4 A;  3QJ6 A;  1LNX A;  1VIF A;  1HXD A;  3OSS C;  1OV3 A;  1T0H A;  2JOY A;  3O5Z A;  2LVM A;  2LNH B;  5LJ5 f;  3OW2 A;  1YI2 A;  2OTL T;  4N4G A;  3NTK A;  3HP9 A;  1QVG A;  2LCS A;  1XJW B;  1G3W A;  3C94 A;  1VQM A;  2COY A;  2RHI A;  4AG1 C;  5KYY A;  4C8Q D;  3G71 Q;  2ESW A;  2DJQ A;  1NLO C;  2D8H A;  1VQ9 A;  2VYT A;  2E6Z A;  4J9C A;  2EFI A;  4FU6 A;  1OPK A;  1AEY A;  2DET A;  3JV3 A;  5LJ3 d;  3CC2 Q;  2ABL A;  2KY9 A;  3MEW A;  2R57 A;  3NTI A;  1QKX A;  4M7A E;  1D1B A;  4IUP A;  1IO6 A;  2MAM A;  4XTZ A;  1PKS A;  3WVD B;  2F2X A;  2HD0 A;  4HVW A;  4C92 G;  3JCM J;  3RMS A;  1N8R U;  3RNJ A;  2X3X D;  1WXB A;  3CBM A;  2LQW A;  1QVG S;  3GIB A;  1PCX A;  2PVO B;  3M56 A;  4LDV A;  2QXF A;  5CIU A;  1QCN A;  3CCL A;  3G6E A;  3LH5 A;  1BKB A;  1FMK A;  5DY9 A;  4BI3 A;  3GPL A;  3CEY A;  4J6W A;  3JCM W;  2HCK A;  1G83 A;  2RQT A;  3EG9 A;  3EAE A;  5FLX E;  3HRT A;  4TVR A;  1SRL A;  3H0H A;  1N8R R;  3CME A;  3CCQ Q;  1RI0 A;  2GGR A;  3HFO A;  3H6Z A;  2CT4 A;  4ESR A;  2A36 A;  2RI5 A;  2E41 A;  3EG9 B;  2WSC E;  4M78 E;  2KRS A;  2RO0 A;  4OMO A;  1TWB A;  2JM9 A;  4MZM A;  2L3S A;  3E2U A;  2MWP A;  2RK1 A;  4C0G A;  3ASK A;  3MPU B;  4M77 D;  2OI3 A;  4RG2 A;  1T0J A;  4PLI A;  1UEB A;  4FSX A;  3OYE A;  5C6S A;  3SWN A;  5GAN 4;  2WAC A;  1YCS B;  2KXD A;  1BI0 A;  3ZEH A;  5GAO m;  3V7R A;  2DVE A;  4M7D G;  1KQS S;  4KH1 B;  3N5B B;  5IN1 A;  3PTA A;  1NYG A;  1B34 A;  4N0A A;  3VS4 A;  1AWW A;  3CPF A;  3S3O A;  2DL4 A;  2PNI A;  2YXY A;  2JN0 A;  1X2K A;  3V7C A;  1YJN Q;  3I56 A;  2BKD N;  1VQ7 T;  1SRM A;  1VQL A;  3MO8 A;  4LUE A;  2VC8 A;  3NPF A;  2VXE A;  2LQ8 A;  1KQ1 A;  2XG8 D;  2XU8 A;  3SHW A;  2K3B A;  4QQD A;  2OAW A;  1E6G A;  1AZE A;  9ATC B;  1MV3 A;  2V8K A;  1JJ2 P;  4R55 A;  1M27 C;  2FPF A;  3DB4 A;  2IVW A;  2JTM A;  4ZGJ B;  1RLP C;  3JSC A;  1WJS A;  4QW2 A;  2K4Y A;  3DLL A;  3TCJ A;  2OTL A;  2CS7 A;  1CSK A;  2J7I A;  3VKI A;  1K9M U;  6AT1 B;  3QDR B;  1MUZ A;  1I0C A;  2KXC A;  4PJJ A;  2RI2 A;  1KJW A;  3CC4 T;  4DEX A;  3P8H A;  4GBQ A;  2O9V A;  2E6N A;  2VXF A;  1LOJ A;  4XK8 E;  3OYH A;  4L5G A;  2KYB A;  1K8A C;  4PJO D;  1M30 A;  2DZ9 A;  2AZS A;  3TVT A;  3PE0 A;  2EQK A;  3J81 E;  2DIG A;  2VAS A;  2CP6 A;  3JCM P;  4OB0 B;  1MND A;  1YJW T;  1WHJ A;  2XMF A;  3X26 B;  1K9M R;  5FWB A;  1ZHI A;  4M7A A;  5CKH A;  3JCM g;  4NL3 A;  2K3Y A;  2R5A A;  3OS5 A;  2HAX A;  3QJY A;  1VYV A;  2V1Q A;  4KUD K;  1EX4 A;  4E47 A;  4A4F A;  1HK9 A;  1Y71 A;  2E64 A;  2OTJ T;  3LGF A;  1SKU B;  3QZ9 B;  4KUI A;  4DBH A;  4M7A B;  3VUB A;  2LT4 A;  2QDL A;  3OB9 A;  3BE3 A;  3VYG A;  2EGE A;  5CO7 A;  2HL5 C;  3PIO A;  3VUZ A;  2DK3 A;  3A98 A;  2K57 A;  4XU0 A;  3VU3 C;  2DXC A;  5IXF A;  4IUR A;  2EYY A;  4ZN3 A;  4KUL A;  2C0I A;  5IHK A;  3L2U A;  4RTY A;  3LW5 E;  1U1S A;  4FSS A;  1PHT A;  2M9U A;  2D8J A;  2V1R A;  2HQX A;  1G3T A;  3A8G B;  1ZSZ B;  1WHM A;  1MHN A;  1Q82 C;  1K9A A;  4WF2 A;  3THK A;  2EKO A;  1ZUU A;  1ZBJ A;  1NBE B;  4M7A F;  2MPX C;  1M3A A;  3L2W A;  4LDY A;  5GAN f;  1BI3 A;  2CZ0 B;  1U8R A;  3OYJ A;  5GJW B;  2VB6 A;  3OYB A;  3NMZ C;  5HKC A;  2K2V A;  4RTV A;  3JCM e;  2YUO A;  4M78 B;  1Y0M A;  4M75 D;  3CPW A;  1AVZ C;  2MK5 A;  2W0Z A;  4OMQ A;  4Z02 A;  5GAM d;  3KUF A;  1HD3 A;  2RB6 A;  4N0A C;  4E7H A;  2K7A A;  1BB9 A;  3QG1 A;  2L2P A;  2E65 A;  3CCM T;  3T9N A;  2DL3 A;  5KYU A;  2JZ2 A;  2ENM A;  2A3L A;  2KRM A;  3H0I A;  1VQ6 T;  1ZUK A;  3UA7 A;  3F70 A;  2KMT A;  5IH2 A;  1SEM A;  1CKA A;  1AD5 A;  2O88 A;  2ZPI B;  1RAC B;  2LQK A;  4LNP A;  1VQ7 A;  3QPH A;  4GY5 A;  2KT8 A;  3SEM A;  4ZTJ A;  3QO3 A;  1V76 A;  2KE9 A;  2LX7 A;  4OGE A;  4Z89 A;  1WHL A;  1E6H A;  4PFZ A;  2H3J A;  3M4Y A;  4AFU C;  2AK5 A;  2DYI A;  2O4X A;  4QT7 A;  4DBQ A;  2JM8 A;  1LPL A;  1Z9Z A;  2WSF E;  1VQ8 T;  2CDT A;  4WCI A;  3EGX A;  1R0B G;  2LTO A;  2O4X B;  1G3S A;  3HSB A;  1K0X A;  1WQW A;  5IT9 E;  3LWH A;  4OB1 B;  4ANJ A;  3OYC A;  4Q5W A;  3CC4 A;  4HKE A;  4OP0 A;  3EGX B;  3LLR A;  5FU7 B;  3L2Q A;  2RPN A;  4ZN1 A;  1Y07 A;  5C0M A;  1K8A U;  4EMK C;  2KNB B;  2PU9 B;  4XU3 A;  4KH0 B;  1UEC A;  5I21 A;  1FYN A;  1YJW A;  4HCB A;  3JRZ A;  2ED0 A;  1IZ6 A;  3REA B;  1OYX A;  1BU1 A;  4M7A C;  1KHI A;  4AFS C;  3CXC A;  1VQM Q;  1G2B A;  1Q86 C;  1UG1 A;  3OY9 A;  4Z88 A;  3RKX A;  2DM1 A;  2XD0 A;  4C92 D;  4AFZ C;  2K6D A;  3MP6 A;  2JS0 A;  3TEE A;  4C5I A;  3TSZ A;  1K8A R;  4J5Y A;  4QKU A;  2OTJ A;  4NL2 A;  1SG5 A;  4UC4 A;  3ME9 A;  1ZSZ C;  1UGS B;  4C8Q A;  2DZC A;  4A53 A;  1QVF A;  4ORZ A;  2JS2 A;  1KC8 U;  1YWO A;  1UGP B;  2RJC A;  4HVV A;  1W70 A;  1N5Z A;  3EG0 A;  4PKC C;  1VYT A;  3CXC S;  2MF2 A;  2QQR A;  5IHN A;  1R77 A;  4M78 C;  4X1V A;  1UHC A;  2ZPG B;  2DKG A;  4EPC A;  1TG0 A;  1KC8 R;  4DBR A;  1EFN A;  1BCM A;  4B9X A;  2XI9 A;  1NEB A;  2BTT A;  3CME Q;  1JQQ A;  1YN8 A;  4X9D A;  3EG1 A;  5GAM g;  1QVF S;  3M54 A;  4JRP A;  3JCM h;  4J6X A;  4C8Q F;  4PK4 A;  4OB3 B;  4M7D D;  1TH7 A;  4GLK A;  1FMV A;  3CCM A;  4R56 A;  4J9E A;  3SB2 A;  4D6W A;  3X24 B;  5GAN 6;  1AZG B;  1AWO A;  1J3T A;  3EGU A;  3FDR A;  1PSE A;  3V8J A;  5CKE A;  1A0N B;  1BI1 A;  1NM7 A;  4PFP A;  1W4S A;  2CP2 A;  1QKW A;  2IPO B;  2EJF A;  2A28 A;  4JPB W;  2MOX A;  3M53 A;  1TUG B;  2FL7 A;  1H64 1;  4E6R A;  4R0K A;  2RHU A;  4J9D A;  4M77 A;  3UT1 A;  1M2V B;  3CBO A;  4B6M A;  2EBP A;  2YUN A;  5GJV B;  4C0Z A;  2DLP A;  2EGC A;  5FU7 C;  3VS1 A;  3I56 Q;  1UFF A;  3RKY A;  3URG A;  3M55 A;  4C0D B;  2RA2 A;  3FB9 A;  2X35 A;  4PL6 A;  2V8J A;  1UTI A;  5GAM j;  2XDB A;  5L8R E;  1KFZ A;  3X25 B;  5GMK i;  2LZ6 B;  2BUD A;  5GMK e;  5LJ5 d;  5GAO p;  3UWN A;  5GAM e;  1WFW A;  3CCR T;  2RQW A;  4J7F A;  1IGU A;  4E7L A;  2KRO A;  3C4S A;  1UGV A;  4A4G A;  1M1K C;  1MMA A;  2GQI A;  2F2V A;  2FZC B;  2MCN A;  3CCR Q;  2YLC A;  4JJB A;  3P8D A;  2RHZ A;  3CCU T;  1W1F A;  2OTL Q;  2RQR A;  2I2L A;  3LYI A;  1Q7Y C;  3ZFJ A;  1BI2 A;  2DD4 A;  1WHG A;  2NYS A;  4C5G A;  1Q86 U; 
#chains in the Genus database with same CATH homology
 1QLY A;  4GLM A;  4J9F A;  1GCP A;  2OAW A;  1E6G A;  1AZE A;  1X69 A;  2JW4 A;  2K79 A;  1MV3 A;  4KRT A;  3QWX X;  1M27 C;  3H0F A;  2FPF A;  1K76 A;  1ARK A;  2B86 A;  1ZLM A;  2HBW A;  1RLP C;  2CRE A;  1T3S A;  2C0O A;  4OMN A;  2FPD A;  2IIM A;  1SHF A;  3ULR B;  1K0S A;  2FPE A;  1GL5 A;  2LMJ A;  2I0N A;  1OPL A;  2CH4 A;  1CSK A;  2J7I A;  2RMO A;  3UF4 A;  2JTE A;  3EG2 A;  2KEA A;  2PZ1 A;  1MUZ A;  1I0C A;  2KXC A;  5FW9 A;  1KJW A;  4DEX A;  1UDL A;  3H41 A;  3VRY A;  2LJ3 A;  2ECZ A;  4GBQ A;  2O9V A;  2EPD A;  3I9Q A;  1ZX6 A;  3EG3 A;  1RI9 A;  2FO0 A;  2KYB A;  1PWT A;  3M0R A;  1M30 A;  2DL8 A;  4EIK A;  2AZS A;  4RTX A;  3TVT A;  3PE0 A;  2DBM A;  2M0Y A;  1X6G A;  2HEQ A;  1VA7 A;  2XMF A;  1M3B A;  2J06 A;  5FWB A;  2GTJ A;  3C0C A;  2A08 A;  1ZSG A;  3I5S A;  4OMM A;  1GCQ C;  4CC4 B;  4AG2 C;  1GFD A;  1BK2 A;  1TUD A;  1PKT A;  1VYV A;  2V1Q A;  1YWP A;  2A37 A;  2EVR A;  4IIO A;  4J9I A;  1SHG A;  2J6O A;  3R6N A;  1SSH A;  2CSI A;  2QDL A;  4DEY A;  2EGE A;  2M51 A;  3A98 A;  4LE9 A;  2K2M A;  2AKL A;  1NG2 A;  5IXF A;  2JMC A;  2EYY A;  2RF0 A;  4IIM A;  2C0I A;  5IHK A;  1HJD A;  2ROT A;  1X43 A;  4RTY A;  2DX1 A;  1VYU A;  4Z8A A;  4FSS A;  1PHT A;  2J6K A;  1U3O A;  1QWF A;  2KGT A;  1B07 A;  2D8J A;  2KYM A;  2V1R A;  3ZL7 C;  2BZY A;  2J05 A;  4OMP A;  1PNJ A;  1QCF A;  2LP5 A;  2G6F X;  3IQL A;  1I07 A;  2DYB A;  4RTW A;  1K9A A;  4RTZ A;  5I11 A;  3THK A;  1ZUU A;  1ZBJ A;  3KFV A;  2GTO A;  2DBK A;  2FRY A;  1K1Z A;  1M3A A;  2BZ8 A;  5GJW B;  4JJD A;  2DE0 X;  4J9B A;  2LQN A;  1QWE A;  3NMZ C;  4RTV A;  2YUO A;  1MV0 B;  1Y0M A;  1B3Q A;  2ROL A;  4A63 B;  1AVZ C;  1TUC A;  1E7O A;  2RQU A;  4HCK A;  2W0Z A;  4OMQ A;  2HDA A;  1HD3 A;  3PVQ A;  2PTK A;  5FWC A;  2DA9 A;  2K7A A;  1GFC A;  4D8K A;  1BB9 A;  1Y57 A;  2L2P A;  4CC3 A;  2CT3 A;  1SPK A;  2RN8 A;  3EHR A;  2DL3 A;  4ZNX A;  2ENM A;  2KRM A;  3H0I A;  1ZUK A;  4M4Z A;  3UA7 A;  3TSW A;  3UAT A;  4D8D A;  5IH2 A;  1SEM A;  1CKA A;  1AD5 A;  1NYF A;  2O88 A;  1PRM C;  4F17 A;  4HXJ A;  1WXT A;  2BZX A;  3UA6 A;  4LNP A;  3M0T A;  4OML A;  4JZ4 A;  3M0U A;  2P4R A;  2KT8 A;  3SEM A;  2EKH A;  1ZUY A;  1WIE A;  2KE9 A;  2LX7 A;  4Z89 A;  5IHI A;  1E6H A;  2KT1 A;  1YP5 A;  2CH4 W;  4AFU C;  3GBQ A;  2YUQ A;  2L3Q A;  2AK5 A;  4RUG A;  1X27 A;  2C0T A;  3I5R A;  4HVU A;  2D1X A;  4QT7 A;  5L23 A;  4CC7 A;  2EYX A;  1RUW A;  2JM8 A;  2DVJ A;  1Z9Z A;  2H8H A;  2AZV A;  2CDT A;  5EC7 A;  4WCI A;  2MIO A;  2YT6 A;  4K11 A;  1ABQ A;  1GRI A;  2EYW A;  1K0X A;  4F14 A;  2JMA A;  3U23 A;  2FEI A;  1AWX A;  2DNU A;  2OJ2 A;  2YUP A;  2L3P A;  3VS6 A;  3QWY A;  3PVL A;  1H8K A;  5ECA A;  3VS2 A;  2RPN A;  5IXB A;  2X3W D;  1WXU A;  2L0A A;  2F2W A;  3CQT A;  2EQI A;  1WX6 A;  2W10 A;  2KNB B;  2HSP A;  1NLP C;  3M0S A;  2GBQ A;  2DRK A;  1UEC A;  1FYN A;  1WYX A;  2K9G A;  2ED0 A;  2FRW A;  4RTU A;  3REA B;  1X2Q A;  1BU1 A;  4AFS C;  1G2B A;  2JXB A;  2J6F A;  2VVK A;  1UG1 A;  4Z88 A;  1WI7 A;  1M8M A;  2DM1 A;  4F16 A;  1H3H A;  2DL7 A;  2CSQ A;  3I35 A;  4AFZ C;  1KIK A;  2K6D A;  2JS0 A;  2YSQ A;  4RTT A;  1Z9Q A;  2O31 A;  3TSZ A;  1OV3 A;  1UE9 A;  2RQV A;  1T0H A;  1OOT A;  4J9G A;  3O5Z A;  2LNH B;  1RLQ C;  1UJ0 A;  1W6X A;  1AWJ A;  1U06 A;  4Y92 A;  2LCS A;  1LCK A;  3VS5 A;  4ORZ A;  2JS2 A;  3EHQ A;  1YWO A;  4J9H A;  2LJ0 A;  4AG1 C;  2SEM A;  4HVV A;  1BBZ A;  1KSW A;  3NGP A;  1W70 A;  2ESW A;  1N5Z A;  3EG0 A;  2DJQ A;  1NLO C;  2D8H A;  1T3L A;  1VYT A;  4J9C A;  2EGA A;  2YDL A;  1OEB A;  1M3C A;  1CKB A;  1JO8 A;  1OPK A;  1AEY A;  2KRN A;  2VKN A;  1WLP B;  3JV3 A;  5IHN A;  3VS7 A;  4JJC A;  2KR3 A;  4X1V A;  1UHC A;  2KBT A;  2ABL A;  2JT4 A;  1TG0 A;  1QKX A;  1EFN A;  1GBQ A;  1IO6 A;  1PKS A;  1V1C A;  1AOJ A;  2F2X A;  1NEB A;  2BTT A;  4HVW A;  3RBB B;  1GCQ A;  2NUZ A;  1JQQ A;  1YN8 A;  1NEG A;  1K4U S;  3VRZ A;  3RNJ A;  1HSQ A;  2X3X D;  1ABO A;  1WXB A;  2DL5 A;  2LQW A;  1WA7 A;  3EG1 A;  1I1J A;  2FG0 A;  2AKK A;  2D0N A;  3LH5 A;  1H92 A;  1FMK A;  3FJ5 A;  2SRC A;  2GNC A;  3REB B;  2HCK A;  1G83 A;  4J9E A;  2RQT A;  1UUE A;  1AZG B;  1AWO A;  2DMO A;  3EGU A;  1J3T A;  2ED1 A;  1S1N A;  1SRL A;  3H0H A;  3M0Q A;  1A0N B;  1NM7 A;  2EYZ A;  2GGR A;  2CT4 A;  4ESR A;  1QKW A;  2A36 A;  2DIL A;  2EW3 A;  3VS0 A;  3VS3 A;  4CC2 A;  2A28 A;  4JPB W;  2MOX A;  4JZ3 A;  2KRS A;  4OMO A;  3NHN A;  4E6R A;  4R0K A;  4J9D A;  2JM9 A;  2L3S A;  1UJY A;  1X6B A;  4LN2 A;  2EBP A;  1XOV A;  2YUN A;  2CUD A;  5GJV B;  2DF6 A;  2VWF A;  2DLP A;  2EGC A;  3VS1 A;  2E5K A;  1UFF A;  4LUD A;  2OI3 A;  1T0J A;  2CUB A;  1UTI A;  1GBR A;  1KFZ A;  5HCK A;  1JU5 C;  1YCS B;  2KXD A;  1JXO A;  2LZ6 B;  2O2O A;  1WDX A;  1NYG A;  1WFW A;  2RQW A;  4AFQ C;  2O9S A;  3VS4 A;  1AWW A;  2KRO A;  5I22 A;  1UGV A;  2NWM A;  1JXM A;  2DRM A;  2DL4 A;  2GQI A;  2LJ1 A;  2PNI A;  2F2V A;  2MCN A;  1X2K A;  4JJB A;  1JEG A;  1PRL C;  3M0P A;  1W1F A;  1SRM A;  2RQR A;  1YNZ A;  4LUE A;  1U5S A;  3NPF A;  2RNA A;  1UHF A;  3SHW A;  2K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...