1RLQC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (signal transduction/peptide)
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1rlqC00
3SHWA 2B86A 5I22A 1WXBA 4ESRA 1T0HA 1U5SA 3I9QA 1V1CA 2W0ZA 2NWMA 2FRYA 2GBQA 2YUQA 1UUEA 2H8HA 2EKHA 2KGTA 3TVTA 5IHNA 2CREA 4Y92A 5IXFA 2FO0A 3M0SA 4J9DA 2RQWA 1ABQA 1NYGA 2EYYA 2F2WA 1K76A 2BZ8A 1PRLC 1WYXA 2RMOA 3VS0A 1U3OA 2RPNA 2ESWA 1AWXA 1W1FA 3GBQA 1CKBA 4RTXA 1VYUA 4DEXA 2EQIA 2O9SA 2IIMA 1CKAA 2DBMA 3VS1A 1QLYA 1UTIA 2X3XD 4IIOA 1U06A 1GCQA 2CUBA 4J9GA 2RQRA 2DL4A 3UF4A 1AOJA 1I0CA 1LCKA 1QKWA 2JXBA 2KT8A 4Z89A 1PNJA 1WI7A 1E6HA 2LZ6B 1X6BA 2A36A 2YSQA 2HDAA 2J7IA 4HVUA 2RF0A 2DLPA 1BK2A 4AFZC 2D8JA 2KE9A 2KXDA 4OMQA 3PVQA 1YP5A 1I1JA 1BB9A 1W70A 2BZYA 2RQUA 2FEIA 4LNPA 1MV0B 3O5ZA 1K4US 4Z8AA 2CH4A 3VS5A 5GJVB 2C0TA 2C0IA 1ARKA 2LQWA 4OMMA 1HJDA 2FG0A 1E7OA 2MOXA 1EFNA 1UFFA 2D0NA 2DRMA 3VRYA 1QWEA 2LMJA 1MUZA 1ZLMA 2MIOA 1UG1A 2L0AA 4GBQA 2RN8A 1OEBA 4M4ZA 2PTKA 2DE0X 4HVVA 3REBB 2CSQA 2A28A 2KRNA 1BU1A 4J9HA 1JXMA 2JM9A 2LP5A 1SEMA 2RQTA 1TUCA 2OJ2A 2LJ1A 3SEMA 1SHGA 1WIEA 2YDLA 3VS3A 5I11A 2K6DA 2OAWA 1J3TA 1GBQA 2SEMA 1SSHA 4RUGA 4F17A 4AFSC 2KRMA 1AEYA 3VS7A 2D1XA 3FJ5A 2J6OA 2FPEA 4RTVA 1UJYA 5IHIA 3ULRB 2DILA 3EGUA 1AWJA 4D8KA 2KNBB 4AFQC 2ECZA 3IQLA 1NM7A 2DF6A 3M0PA 2HBWA 2DYBA 1T3LA 1UGVA 1WX6A 5GJWB 2OI3A 4J9EA 2DMOA 4CC2A 4Z88A 1KFZA 1NG2A 1ABOA 2DA9A 3UA6A 1ZSGA 2YUNA 2KRSA 2KBTA 1W6XA 2F2VA 1Y0MA 2X3WD 2YT6A 1YWOA 1M30A 2AKKA 4RTUA 1K1ZA 1UE9A 4FSSA 4JZ4A 2DL7A 2MCNA 1PRMC 2KR3A 1VYVA 1CSKA 2EGCA 1QWFA 1WLPB 1X69A 2V1RA 4GLMA 3M0RA 1ZUYA 2KT1A 1T3SA 2EGAA 2AK5A 3RNJA 2QDLA 4K11A 1OV3A 2XMFA 4X1VA 2KYBA 3C0CA 2EGEA 2KXCA 3EG0A 4HVWA 1G83A 2HEQA 2EW3A 5EC7A 2BTTA 3EG1A 3REAB 3H41A 1WXTA 2GQIA 3EHQA 2DRKA 2O88A 2JS0A 1PKSA 1X6GA 1AVZC 4A63B 2DNUA 4OMPA 2A37A 2A08A 1K0SA 4JZ3A 2VWFA 4F14A 4RTTA 1YNZA 3R6NA 1ZUKA 2LQNA 1SRMA 3H0HA 2M51A 2GTJA 2K9GA 2PZ1A 4AG1C 2HSPA 2VVKA 2J6FA 4LUEA 1K0XA 3QWXX 1N5ZA 2EPDA 3I35A 2LNHB 5ECAA 2J05A 3KFVA 1OOTA 1RLQC 2GTOA 2RNAA 2K3BA 5L23A 1AZEA 1X2QA 3PVLA 3M0QA 2DVJA 4LN2A 1M27C 1NLPC 1AD5A 3EG3A 2FPFA 2KYMA 2LJ3A 3JV3A 2YUPA 3CQTA 1H3HA 1PKTA 2RQVA 1KIKA 4DEYA 1PHTA 2JW4A 3EHRA 2DM1A 1FMKA 2I0NA 2VKNA 5IH2A 2C0OA 3I5RA 1QKXA 4QT7A 2M0YA 3H0IA 1GBRA 3U23A 1T0JA 1M3CA 1KJWA 3RBBB 3TSWA 1JEGA 1GCPA 1ZBJA 4JPBW 4ORZA 2SRCA 1I07A 1E6GA 2AKLA 2EYZA 1AWOA 2DL3A 3PE0A 1XOVA 2GNCA 2LX7A 1X2KA 2J6KA 1Z9ZA 3QWYA 2KROA 3I5SA 4ZNXA 1NLOC 1RLPC 1Z9QA 2ROTA 2JMAA 1NEGA 1HD3A 3VRZA 1NYFA 1B3QA 1M8MA 4J9CA 1UHCA 1VA7A 1UECA 1PWTA 1YN8A 1WFWA 2JTEA 3EG2A 2JS2A 3UA7A 4EIKA 4AG2C 4CC4B 2LCSA 1RUWA 2L3PA 4KRTA 1H92A 4JJCA 2HCKA 4RTWA 5IHKA 1JQQA 2PNIA 1JO8A 4R0KA 1SRLA 1Y57A 2JMCA 2NUZA 4LUDA 2O31A 4WCIA 1GL5A 2DL8A 3NGPA 1UHFA 2E5KA 4RTYA 2EBPA 3NHNA 3ZL7C 1NEBA 1K9AA 3VS6A 1IO6A 1GFDA 1KSWA 2CUDA 2CT4A 1FYNA 1UJ0A 1TG0A 2FPDA 2GGRA 3NMZC 2DL5A 2ED1A 2K7AA 1X27A 2EYXA 2YUOA 4RTZA 1YWPA 2EVRA 2D8HA 2F2XA 2KEAA 5FWBA 2EYWA 1A0NB 1WXUA 2L2PA 3TSZA 2JT4A 3M0TA 2K2MA 4E6RA 4OMNA 4LE9A 1S1NA 1YCSB 2DJQA 1ZUUA 4CC3A 2CSIA 1AZGB 3UATA 2DX1A 5IXBA 1GCQC 1JU5C 4JJDA 2L3QA 4D8DA 2FRWA 3M0UA 4HXJA 2LJ0A 4J9BA 5HCKA 4OMOA 2L3SA 1WA7A 1H8KA 1M3BA 2K79A 2ROLA 2V1QA 2P4RA 2BZXA 1WDXA 3NPFA 2AZSA 1RI9A 2DBKA 5FW9A 1GFCA 1X43A 3H0FA 1OPKA 3A98A 3VS2A 3VS4A 1M3AA 2CDTA 1SPKA 1TUDA 4JJBA 2J06A 2W10A 3THKA 4J9FA 2ED0A 1VYTA 1JXOA 1HSQA 2G6FX 1BBZA 1MV3A 4F16A 2AZVA 1SHFA 2ABLA 1UDLA 1OPLA 5FWCA 3LH5A 2ENMA 1GRIA 2O9VA 4IIMA 2O2OA 4CC7A 2CT3A 1B07A 1G2BA 2CH4W 1AWWA 4HCKA 4J9IA 1QCFA 4AFUC 1ZX6A 4OMLA 2JM8A
chains in the Genus database with same CATH superfamily
2RI5A 4ESRA 2WSFE 2ZAEA 1U5SA 2DD5A 2NWMA 2GBQA 3CCUQ 1UUEA 3JCMc 2KGTA 4ZTJA 3CCLQ 1KC8R 4FW2A 4J7IA 4Y92A 2FO0A 3CCUT 1YJNA 3M0SA 4J9DA 3CCLT 2PVGB 2F2WA 1N6AA 1PRLC 3PT9A 3LGLA 1UGPB 2LQ8A 2RPNA 1YI2A 1NJIC 2ESWA 4FL6A 4YTLA 4M7DG 1AWXA 1W1FA 4JS4A 1K8AR 4DEXA 5DLOA 4KUDK 4LDYA 2RJEA 1UTIA 5FROA 3RR6A 3MEUA 2RQRA 3ZFJA 3CCSA 3OBYA 1AOJA 1E6HA 3CCSQ 2LZ6B 2YSQA 2DTIA 3CCST 4XU3A 3BDUA 4OMQA 2CZ6B 3RMSA 1I1JA 3HKSA 2RQUA 1VQ5A 4PJOD 5HK0A 3MP8A 3JAME 2BKDN 5A0DA 2C0TA 2C0IA 1ARKA 5GAN2 1OI1A 1VQ5T 2FG0A 1E7OA 4M7DF 1UFFA 3UDCA 3LWHA 3VRYA 1C6VX 1QWEA 4NL3A 1MUZA 2MIOA 1W2BS 3C95A 3REBB 2D6FA 4PJLA 2QASA 2KRNA 3WVEB 4J9HA 4RG8A 3CC7Q 2LP5A 4OF1A 4PK4A 5GMKl 3RKXA 3CC7T 2LJ1A 1C1AA 3MP6A 4MMLA 3BW1A 3M54A 4C0ZA 4PJOB 2K6DA 1GBQA 1P92A 1M1KC 2QTVA 3CMAQ 1KD1C 3OYMA 4AMCA 2A0FB 2HKQB 3CMAT 3FC3A 2MYSA 2DXUA 4MDXA 1UJYA 5IN1A 3ULRB 1F1BB 3X25B 1QP3A 4D8KA 2X51A 4M78A 3IQLA 3R6OA 3GNGA 1T3LA 4JRPA 5GAMf 4FW1A 3PMIA 4J9EA 3FRNA 5GAOl 2RHZA 2K4YA 2HKNA 4DOVA 3L2RA 2FZKB 1ABOA 2XHCA 3DB3A 2DA9A 4BI3A 3EH2A 2EWNA 2YT6A 4LD6A 2YLBA 1UE9A 2OX7A 3A8OB 2DTHA 4C92A 1VYVA 1N9SA 1ZSZB 2G3RA 1WLPB 2V1RA 4GLMA 3M0RA 1ZUYA 1B34B 1G3WA 3DKMA 1T3SA 2RH2A 2AK5A 1D3BB 2HSEB 4HCZA 3MJXA 4A4HA 3KBGA 1JJ2S 3CCJQ 2OTJA 4BDYA 5EC7A 1RABB 3TCJA 4EMKB 1FMWA 2QQAA 4RCCA 1IHVA 5FRNA 5HY6A 4ZGJB 3M4YA 1I8FA 1D09B 4JZ3A 2MWOA 1RAEB 5CKBA 1BI3A 3G6EA 1YNZA 4KULA 1ZUKA 3R6NA 5GAN7 1W4SA 4JDSA 3G6ET 2QYZA 1N5ZA 1OU8A 3CBMA 3KUFA 1YIJA 3SWNC 3OYCA 3VUZA 2D0QB 4M77G 1AZEA 1U1SA 3PVLA 3NTKA 2DVJA 5J26A 4IUUA 1NLPC 1AD5A 3EG3A 4L6V5 4GY5A 4F7UG 3VV0A 1MMNA 3CCMA 4E7SA 1UGRB 3JSCA 3JV3A 2YUPA 4MZTA 5J39A 3G71Q 3M57A 4DEYA 1IZ6A 3H9NA 1BI0A 3G71T 4QQDA 2DM1A 1FMKA 2I0NA 1FWZA 2F5KA 2EKOA 3ME9A 3I5RA 1QKXA 2M0YA 4ZGEB 1VIFA 2CKKA 1KJWA 3M59A 5DM7R 1GCPA 2GQVA 2R5AA 2KI7A 2AKLA 1AWOA 2E12A 1XOVA 2GNCA 2J6KA 2K3XA 1M4ZA 1M2VA 2PUKB 3MEVA 4OVAA 2MWPA 2ROTA 3VRZA 5GAOr 2KMTA 4J9CA 2EYQA 4XTYA 3S6WA 4EIKA 3M4GA 4M7AA 1D1CA 4CC4B 1RUWA 1MNEA 1YJWA 4JJCA 3I55A 2L8DA 2DEQA 3P8DA 1IGQA 1YJWQ 5D7UA 4LUDA 3MEAA 1YJWT 1GL5A 3NGPA 2E5KA 4BE0A 3EFOB 4RTYA 2EBPA 2QXFA 3ZL7C 2CP7A 1IO6A 2PVOB 5CKHA 2CT4A 4A4KA 3QXEB 4PNOA 2JVVA 1V29B 1FYNA 1TG0A 2FPDA 4LXCA 2I2LA 3EH1A 4QVZA 5GAMj 3X28B 3JRZA 1PD0A 2NUTB 1B7TA 2LDMA 4M78F 2HBPA 2F2XA 2KEAA 2EQMA 2EYWA 1A0NB 1WXUA 4BACA 2L2PA 2E3HA 2JOYA 2K2MA 4C92C 3HPWA 2XG8D 4LE9A 1YCSB 5GAOq 2CSIA 3UATA 2DX1A 3UT1A 5IXBA 2E4HA 1GCQC 3I56A 2ATCB 4XTUA 4MMKA 4N4GA 3L2UA 1D3BA 1I5LA 1MGQA 3RUXA 2FRWA 5GANg 1ACMB 5FU7B 3OYJA 4OMOA 2L3SA 2ROLA 4BY6B 1WDXA 2NLUA 1RI9A 2V8KA 1RI0A 1NZ9A 1X43A 1OPKA 2H3JA 3OSSC 3A98A 2AIRB 3VS4A 3GNFB 1M3AA 2HQXA 4M78E 1VQMA 2JTFA 3HFOA 5GMKj 3GIBA 5M9OA 4ME7A 6AT1B 2DK3A 2ED0A 2G6FX 1HSQA 2AZVA 3QHSA 4RG2A 1M90U 2CZ0B 2K5IA 4FYYB 1UDLA 1OPLA 2RHXA 5KYYA 2XK0A 4ZGDB 4FYWB 1DJ7B 4HA8A 4NOYA 2DERA 2O2OA 4RKUE 5A2QE 2DIGA 2QGGA 5LL6S 4CC7A 1G2BA 1AT1B 1AWWA 4C0GA 4QVCA 3QDRB 1M8VA 1QCFA 2E64A 1ZA2B 1WQWA 4OMLA 4QW2A 2B86A 3CXCA 3F70A 3QSUA 4M7DA 4PJMA 5DLQE 2YUQA 3V7SA 2H8HA 3TVTA 5IHNA 4QQGA 3JB9G 2LVMA 4XTWA 2RQWA 2WACA 4RMOA 1ABQA 4II1A 4KT0E 1D0XA 5LJ5g 1Y07A 2EYYA 4E47A 1QVGP 8AT1B 4JRIA 3OBWA 1VQ8A 2DTOA 3QKJA 1U3OA 4IURA 1CKBA 1NJIR 1MHNA 4IUTA 1R0CB 2XDDA 1CKAA 2DBMA 4ANJA 1QLYA 2JNGA 2X3XD 1IHWA 1U06A 1VQ4A 3G4SA 4OGCA 4M78D 3UF4A 1WJRA 1QKWA 1S72Q 4Z89A 1PNJA 4M7AC 4L59A 1S72T 3G4ST 2J7IA 4HVUA 2DLPA 4E7IA 4MDWA 4N0AC 1M1KU 4OMFB 3OYFA 1LPLA 5IAYA 3PVQA 5KYXA 4FCYA 1XQHA 3JB9F 1QVFA 4J6YA 3CCVQ 1BB9A 4DA4A 2FEIA 3TREA 1K4US 4Z8AA 3CCVT 3VS5A 5CR2A 3EFOA 3DB4A 4M78B 1EFNA 3HRUA 4C92D 2HL3A 1HXDA 2DRMA 2VXFA 2L0AA 2EJ9A 3CCQA 2DE0X 2A28A 5GMKm 1PSEA 5LJ3j 1VQLQ 2X35A 3LWIA 1JXMA 3QJ6A 1VQLT 2JM9A 4FT4A 3CCQT 1ZSZC 3CC2Q 3FEOA 1VQOA 2YDLA 3VS3A 3CC2T 2OAWA 3OQ5A 1TS9A 1VQOQ 2L89A 2VYTA 2SEMA 5J3BA 3E2UA 1VQOT 4F17A 4EMHA 1AEYA 3OYHA 3M58A 2QQ9A 1M1KR 3HL8A 2D1XA 2QA4A 4HT9A 5LJ3g 1KD1R 5IHIA 1PC0A 2QG9B 1NM7A 3T9NA 4M7AE 4O5VA 2HBWA 2H3EB 3TQ7P 2DMOA 3EFSA 3MHXA 4CC2A 2OTLA 1KFZA 2M1HA 3QJYA 4BI8B 2KAFA 3GPLA 3UA6A 2YUNA 1OULA 2KBTA 1U8RA 1HK9A 1Y0MA 1YJNQ 1MMAA 2LX9A 2AKKA 1YJNT 4RTUA 1K1ZA 1M90C 1YHQA 3RESA 1I81A 1YI2Q 2KR3A 2MPXC 3M56A 2EGCA 2V26A 2YRVA 1YI2T 4MZPA 4A4GA 1X69A 3OYAA 3JCMg 4VUBA 4WTOB 4NS5A 1U1TA 2HAXA 1X6OA 5FRMA 3PIPA 2A3LA 1WHMA 3RNJA 4C8QG 1D1AA 2HD0A 4A53A 2EJGA 4M7DC 5CK9A 1G83A 2EW3A 1PSFA 1C0MA 1BCMA 3H41A 4J83A 1I5OB 2O88A 2JS0A 3QO3A 4KH1B 1PKSA 1AVZC 1XTDA 1KG1A 1JB0E 1O75A 1K9MU 2LQKA 1K0SA 2VWFA 1KQSP 1YCYA 1QQJA 4F14A 1VQ5Q 3L42A 2LQNA 2NYSA 2CP5A 4M77A 4C5HA 2M51A 3J80E 3V8JA 4M7AD 4AG1C 2LT4A 1K0XA 3HRTA 4XAXB 2EPDA 3LYIA 3ER0A 2CZ1B 1OOTA 2YXYA 1K73C 1Q7YU 4PFZA 1N9RA 4C8QF 5C0MA 3INZA 5GAMe 1M2VB 3C12A 3M0QA 3ZBDA 3CBOA 1QVGA 4GLKA 4JJNK 2KYMA 2LJ3A 3V7RA 4M7AB 1PKTA 3NTIA 1Q95G 1Y71A 4C5GA 2YLCA 2Y90A 2CYZB 2JW4A 4DBQA 2GCXA 1ZA1B 4M7DE 1VQ6A 1WHLA 1GBRA 3U23A 1T0JA 3RBBB 2RB6A 4O6JA 1HYOA 2AT1B 1E6GA 1XJWB 5GANf 2DPPB 2CP2A 1YBYA 2LT1A 3QWYA 2YRDA 3I5SA 2KDSA 3A8LB 1NLOC 1Z9QA 1OZ2A 2BE9B 1NEGA 1NYFA 5GAN4 1KHIA 1PWTA 1YN8A 1KC8C 3UA7A 2EIFA 5FU7C 4AG2C 1FMVA 4BY6C 1G8XA 2Y4XA 4RTWA 2X4XA 3JCMP 5KE3A 1JO8A 4R0KA 2NUZA 1Y57A 4X34A 2O31A 1G5VA 2JUFA 1UHFA 4KUIA 3JCMW 3NTHA 3VS6A 4X9DA 3OYKA 3OYYA 2DYIA 1GFDA 2QEXA 1KSWA 2CUDA 1BYMA 2OTJQ 1UJ0A 4LDWA 2QEXQ 3DLLA 4E7ZA 2OTJT 1X27A 2QEXT 5KE2A 3CXCP 2CGHA 3OS1A 4JRQA 5GAMh 3A5ZB 2O4XA 1FXXA 3CCEA 4M7DD 2DJQA 3G6EQ 3PTAA 1ZUUA 4B9WA 3UWNA 2L3RA 1O9SA 3FIFA 5CKDA 4DOWA 3QG1A 5LJ5f 4LDUA 5KYYB 2DAQA 3V8LA 3LH0A 4JJDA 2L3QA 3RIRA 4D8DA 3RKWA 2FZGB 3M0UA 2LJ0A 1YIJQ 4EMGA 1MMGA 1H8KA 1M3BA 3BY7A 4LDXA 3FB9A 1YIJT 3FDRA 2BZXA 4CI0C 2HQHA 3MEWA 2AZSA 3OMCA 5FW9A 4HKEA 3QPHA 1GFCA 2DO3A 1WPYA 5L8RE 1D0ZA 4M7DB 3VU3C 1RAGB 1KQ2A 1SPKA 2RK2A 2D9TA 2E3IA 3Q1JA 3CCMQ 1H3ZA 3MKDA 3TEEA 1K9MC 2J06A 2W10A 4M75G 2ZZDA 3CCMT 1JXOA 3QDFA 4OP0A 1SHFA 3E19A 3HSBA 2ZPEB 1QVFP 5GAMd 1TUGB 5GMKh 1WQ7A 3LH5A 1WJQA 2O9VA 4IIMA 1Q82U 2EQJA 1BKBA 1LJOA 1Q7YC 4M77F 1UEBA 5CO7A 4AFUC 2XU8A 3VUBA 4D6WA 5I22A 3BFMA 1WXBA 5LJ5h 3J7AF 3I9QA 1X01A 4F7UF 1KQSA 2EKHA 2CREA 5IXFA 2QQRA 4M78C 3L2QA 2M9UA 4PKCC 5KYXB 4M75F 3I55Q 2RMOA 3VS0A 1Q86U 1RADB 3I55T 3DLMA 4FSXA 3BE3A 3OS2A 1TU0B 4RTXA 3AHUA 2O9SA 5LJ3f 5KYNA 3BDLA 2XD0A 5HK3A 4EPCA 1N8RU 3JCMJ 2E41A 5AYFA 1QVGS 3CC4A 3X24B 3G7ZA 4OB2B 5A0GA 4IIOA 2KQWA 1VQ7A 5GANj 4M77E 1I0CA 4KBMB 1LCKA 3S3OA 1NE8A 1VQ7Q 4C92G 4L5GA 2A36A 2HDAA 2A7YA 1VQ7T 2GFUA 3M9QA 2VASA 1BK2A 3EAEA 4AFZC 2D8JA 1WGSA 2FYKA 2KXDA 5LJ5d 4C5IA 5I2MA 3LX7A 1W70A 2BZYA 4PFOA 3I56Q 2RO0A 1MV0B 3O5ZA 2CH4A 3I56T 3EFRA 1YJ9A 3CD6A 5KH6A 2D0NA 1X75C 3JCMf 2FZCB 4XTXA 1YJ9Q 2LMJA 4PFPA 5CKEA 1ZLMA 1UG1A 1D1BA 1YJ9T 1OEBA 2CZ7B 2CP6A 2CSQA 2P4TA 4JUVA 4CRIA 1V76A 1UB4A 3V7CA 1WZOA 2OJ2A 1BCOA 1VQMQ 3SEMA 1SHGA 3SDZA 3VJPA 4A4FA 2ZCFB 1BI1A 5LJ3h 1VQMT 2EFIA 2VC8A 1J3TA 1IREB 4DQ2A 9ATCB 4A54A 1BIBA 4AFSC 3JCMQ 2KRMA 3VS7A 3FJ5A 2J6OA 2FPEA 4RTVA 1KK7A 5I2SA 4ZN1A 5LJ5j 3EGUA 1AWJA 2KNBB 4AFQC 2ECZA 2E10A 4M77D 2DF6A 2GFAA 2YHTA 3M0PA 2RK1A 1JRIA 4LD9K 1WX6A 1PM3A 2DFUA 1BIAA 1QVPA 1NG2A 1WJSA 4J6WA 1ZSGA 2M02A 2KRSA 5KYWB 1YITA 2X3WD 2K5LA 4FT2A 4DBFA 1YWOA 3JCMh 1YITQ 1M30A 3OYGA 2EJFA 4C8QA 1Q81U 1Y96A 1YITT 1W2BA 4FSSA 4JZ4A 4JLGA 4N4HA 1VQ8Q 4BB7A 5LJ3d 4FYVB 4M77B 1CSKA 1VQ8T 1QWFA 2RI2A 1M90R 3JB9I 5CQXA 2K57A 2WSCE 1EZZB 4KGZB 4R55A 1Q82C 4PJOG 4F7UB 1SF9A 1RAAB 1K73U 4K11A 2XMFA 1VQ4Q 4X1VA 3G4SQ 3C0CA 2EGEA 2LNVA 1VQNA 1VQ4T 1D0YA 2HEQA 2BTTA 1UGQB 3M53A 2GQIA 3EHQA 1X6GA 4F04B 3OW2P 2CS7A 4OMPA 3CBPA 1LVKA 4MZMA 5FU6B 4R56A 4FIBA 1Q86C 1SRMA 3JCMd 3OS5A 2GTJA 2K9GA 5GAOp 2PZ1A 1PCXA 2HSPA 2VVKA 4LUEA 3QWXX 3I35A 3JCMb 1N8RC 2DZCA 2J05A 4PJOF 4E2FB 4FM4B 1KQSS 1TSFA 3CCQQ 1RLQC 3L2ZA 2RNAA 5L23A 3QBYA 1G3YA 2K5FA 3SB2A 5GAN3 4LN2A 1M27C 1EIFA 1KC8U 2CP0A 1FX7A 3QYHB 1M9SA 2KVQG 3ASKA 3M55A 3PGGA 3OYBA 3CQTA 1QCOA 2P0QA 1KIKA 2B8AA 1PHTA 4PJJA 1G3TA 5IH2A 2QA4Q 1LOJA 1K8AU 2QA4T 4QT7A 2ZPBB 3H0IA 2QQBA 2BIVA 5GAOm 1M3CA 2ZPFB 3TSWA 1JEGA 1ZBJA 2DXBA 2DD4A 1LNXA 2SRCA 1I07A 2EQKA 2F1LA 2EYZA 1QMCA 3RMQA 2LX7A 4XU1A 2RHUA 1OU9A 2JN0A 2XIDA 4C0DB 2OTLQ 1Z9ZA 2KROA 2F5TX 1RLPC 2OTLT 2QGFB 4PLLA 2RD1A 1IB8A 4IKFA 2JMAA 7AT1B 1OYXA 4UC4A 1B3QA 1M8MA 1WFWA 3CCUA 2O4XB 3CCLA 3O8VA 1YHQQ 3CPWP 4QVDA 1TWBA 3NFCA 2PUOB 1RACB 2LCSA 1YHQT 3J81E 1ZQ1A 2L5QA 4XU2A 2HCKA 2VXEA 5FLXE 2PNIA 3CMEA 1SRLA 1VUBA 2GF7A 2JMCA 5D6WA 2DL8A 3CMEQ 5D6XA 3NHNA 2DETA 1NEBA 1VOMA 3CMET 1M2OA 2V8JA 4V2SA 2E65A 2X9HA 3NMZC 5CQYA 2DZ9A 2DL5A 3D7SB 2ED1A 2K7AA 5KYWA 4J5YA 3JB9D 1YWPA 2EVRA 2D8HA 4B9XA 4C8QC 1IGUA 2LTOA 5FWBA 4IUVA 3TSZA 4E6RA 4OMNA 3SWNA 3H8ZA 2R5MA 1Q81C 2FVUA 1S1NA 4CC3A 1AZGB 3EGDB 3SD4A 3OY9A 2CP3A 1R77A 3WVDB 1JU5C 3GP8A 5GAN8 3CXCS 2XDPA 4F7UA 3OSVA 2X4YA 2M16A 3URGA 3M5AA 3C94A 4J9BA 1I4K1 1R8OB 4M75A 2V1QA 2K79A 5I21A 1XNIA 5CCAA 2ZPIB 3NPFA 2XI9A 5GANe 3EGXA 1JBMA 3VS2A 3CC7A 2RM4A 1RAFB 2CDTA 1TUDA 3C4SA 3EG9B 5AT1B 3THKA 4J9FA 3JCMX 5EG2A 1GXIE 1BBZA 4F16A 1K9MR 3CMAA 2DEUA 5CVIA 1SSFA 1VQPA 4DBRA 3OYNA 4HT8A 4NL2A 2FL7A 1VQ6Q 3V8KA 1VQPQ 2IVWA 1OQKA 2ENMA 1TXQA 1GRIA 1VQ6T 3PIOA 1VQPT 1IRXA 3N5BB 2RJFA 3ZEHA 3OMGA 4Z02A 5GAOn 4KGVB 2QK0A 2CH4W 4C8QE 2QI2A 5GAN5 3GF5A 1QVFS 4J9IA 4ELYC 3HHTB 4E7HA 2C06A 3OW2A 1Q7YR 3SHWA 2WSEE 2COYA 1T0HA 2K2VA 5GMKe 1V1CA 2W0ZA 3E9FA 3L2WA 2FRYA 3MPUB 1RL2A 3OS0A 2RHIA 4PL6A 2ZPGB 3LLRA 4QQ6A 1NYGA 1K76A 1NBEB 2BZ8A 2M0OA 1WYXA 1K8AC 3L2VA 1YFNA 3JCMV 3VYHB 3QYGB 3GBQA 1AHJB 2RJDA 3PFSA 5LJ5e 1VYUA 5KYUA 3UPUA 2EQIA 2BE7D 3VKIA 2FHDA 4JS5A 2IIMA 2NUPA 4OB3B 3VS1A 4ZTFA 5IT9E 4J9GA 1GCQA 2CUBA 2V8IA 2DL4A 1WNLA 3CCJA 2JXBA 2KT8A 1WI7A 1X6BA 3CPFA 3PNWC 4RCBA 3JB9J 2RF0A 2Z0WA 1SKUB 3CCJT 3FJPA 5GANh 1H641 2KE9A 3OYDA 3CCEQ 2LC4A 1YP5A 3RKYA 3CCET 3MCAB 3MO8A 1W2BP 4LNPA 4QKUA 1NPPA 4KGXB 5GJVB 4C8QD 1ZBXA 2LQWA 4OMMA 4BE2A 5CIUA 1HJDA 4XQ3A 2MOXA 2E1HA 2X4WA 4GBQA 2EAYA 2RN8A 4M4ZA 2PTKA 4HVVA 1OX8A 3OYLA 2E70A 1BU1A 1KQ1A 1SEMA 2RQTA 1TUCA 4M77C 4ATOA 1N27A 3CPWA 4IUQA 1WIEA 5I11A 3HTRA 2DXTA 3EGDA 4C8QB 1SSHA 1Y96B 4RUGA 2PVDB 3GLXA 1EX4A 2LCCA 3G71A 1KHCA 2MI6A 1OX9A 5GANd 2QDYB 4M75C 3GOXA 3JB9H 4PJNA 1PG5B 1QW1A 2DILA 3RERA 1VQKA 2PU9B 3A1PA 1VQKQ 1M1GA 5LJ3e 2JTMA 1VQKT 2DYBA 3WXMB 1UGVA 5GJWB 2QAZA 2OI3A 3HFNA 5FU6C 4Z88A 2BUDA 2DJZA 3EG9A 3TU4K 4M78G 1W6XA 2F2VA 2Y4YA 2E6NA 4PJOA 3QZ5B 5CKFA 1MNDA 2DL7A 2MCNA 1PRMC 3S3MA 4PLIA 1JJ2P 1WHKA 4ELZC 4J8OA 1NPRA 3OA6A 4N0AA 2KT1A 1TH7A 2EGAA 4XTZA 3RDVA 2VV5A 3CC4Q 2ZPHB 1Q82R 2QDLA 1OV3A 3P8HA 3JCMe 1SG5A 2KYBA 2DIQA 3CC4T 2KXCA 4Y28E 3EG0A 3VYGA 4FU6A 4HVWA 5A0LA 5KCHA 2JJ9A 3EG1A 3REAB 2MMPA 3QUIA 4F7UE 1WXTA 2DRKA 2XDBA 4N4IA 1WHHA 3OYEA 4A63B 2RJCA 2DNUA 4M75E 2A37A 2A08A 2OAUA 4E7KA 4RTTA 2KK4A 4OB1B 1MMDA 1ZSZA 2XKOC 3H0HA 5HKCA 4C0DC 1TOVA 1Y7XA 2PQWA 3OW2S 2J6FA 1Q86R 2DXCA 2HL5C 2HNIA 3CD6Q 1B34A 3X20B 8ATCB 1VQ9A 4BUGA 4XU0A 2LNHB 5GAMg 3CD6T 2JZ2A 5ECAA 3CEYA 1QP2A 1VQ9Q 3KFVA 1N8RR 2GTOA 1VQ9T 2LRQA 2K3BA 1X2QA 2QTXA 3FLGA 4E7LA 4OB0B 2DVEA 4C92F 3X26B 4EMKA 1IXDA 2FPFA 4KH0B 2HZYA 1H3HA 2R58A 2RQVA 3EHRA 4JRKA 3L1AA 2VKNA 4JLIA 1TTHB 2C0OA 1NJIU 4TVRA 2DKGA 4C0FA 1G3SA 2MK5A 2VUBA 1WHGA 2KSSA 2YRCA 4JPBW 2E6ZA 4ORZA 1RAHB 2HMAA 2LCLA 2DL3A 3PE0A 1X2KA 2HQEA 3P8BB 2XICA 4HCCA 4M75D 3META 4ZNXA 2RA2A 3A8GB 3A8HB 4C92E 3OYIA 1HD3A 3QIIA 4DBHA 1QCNA 1UHCA 1UECA 1VA7A 2JTEA 3SWNB 4E7JA 3EG2A 2E5QA 2JS2A 4Y91A 2P84A 5C6SA 1WHJA 4C5EA 2L3PA 4KRTA 1H92A 5IHKA 1JQQA 1RAIB 2COZA 2YWWA 4AT1B 2FB7A 4WCIA 2MAMA 4BI4A 2RI3A 2O01E 3CPWS 1K9AA 4M7AG 4M75B 4OGEA 3H6ZA 1VQNQ 2GGRA 1VQNT 3A8MB 4BD3A 5KCOA 4PJOC 1VIEA 3EGXB 4FYXB 4Q5WA 2EYXA 2YUOA 4RTZA 2ZGWA 1S72A 4X9CA 1ZHIA 3HP9A 5CAIA 2QQSA 2JT4A 3M0TA 2COWA 4P5NA 1PD1A 4BDZA 4IUPA 1M1FA 1M5Q1 2F69A 3HRSA 1Q81R 3E1SA 1KD1U 2EQUA 3CCVA 4XTVA 2P0KA 3AT1B 4BE1A 2VGNA 2P0PA 2R57A 4HXJA 5DY9A 5HCKA 2RHYA 1WA7A 3CCRA 2P4RA 4ZN3A 1K73R 4M7AF 3CCRQ 4WF2A 2DBKA 1BI2A 3QZ9B 2VGMA 4B6MA 2K3YA 1VQLA 3CCRT 4HCBA 3H0FA 2NUTA 2IPOB 4A4EA 2KY9A 3CC2A 4LDVA 3SFMA 5GMKi 4JJBA 1UGSB 3LGFA 4XK8E 1JJ2A 1VYTA 1MV3A 4J6XA 2X4JA 3MP1A 2ABLA 4EDUA 3G1JA 4J7FA 3LW5E 2VB6A 5FWCA 3E9GA 4C92B 5KYUB 3PMTA 2NUPB 3KXTA 4PJOE 5D6YA 2CT3A 1B07A 2MF2A 4EMKC 3S3NA 1R0BG 1OZ3A 2AHJB 4HCKA 5GAN6 1ZX6A 3OB9A 2IG0A 2JM8A
chains in the Genus database with same CATH topology
3SHWA 2B86A 5I22A 1WXBA 4ESRA 1T0HA 1U5SA 3I9QA 1V1CA 2W0ZA 2NWMA 2FRYA 2GBQA 2YUQA 1UUEA 2H8HA 2EKHA 2KGTA 3TVTA 5IHNA 2CREA 4Y92A 5IXFA 2FO0A 3M0SA 4J9DA 2RQWA 1ABQA 1NYGA 2EYYA 2F2WA 1K76A 2BZ8A 1PRLC 1WYXA 2RMOA 3VS0A 1U3OA 2RPNA 2ESWA 1AWXA 1W1FA 3GBQA 1CKBA 4RTXA 1VYUA 4DEXA 2EQIA 2O9SA 2IIMA 1CKAA 2DBMA 3VS1A 1QLYA 1UTIA 2X3XD 4IIOA 1U06A 1GCQA 2CUBA 4J9GA 2RQRA 2DL4A 3UF4A 1AOJA 1I0CA 1LCKA 1QKWA 2JXBA 2KT8A 4Z89A 1PNJA 1WI7A 1E6HA 2LZ6B 1X6BA 2A36A 2YSQA 2HDAA 2J7IA 4HVUA 2RF0A 2DLPA 1BK2A 4AFZC 2D8JA 2KE9A 2KXDA 4OMQA 3PVQA 1YP5A 1I1JA 1BB9A 1W70A 2BZYA 2RQUA 2FEIA 4LNPA 1MV0B 3O5ZA 1K4US 4Z8AA 2CH4A 3VS5A 5GJVB 2C0TA 2C0IA 1ARKA 2LQWA 4OMMA 1HJDA 2FG0A 1E7OA 2MOXA 1EFNA 1UFFA 2D0NA 2DRMA 3VRYA 1QWEA 2LMJA 1MUZA 1ZLMA 2MIOA 1UG1A 2L0AA 4GBQA 2RN8A 1OEBA 4M4ZA 2PTKA 2DE0X 4HVVA 3REBB 2CSQA 2A28A 2KRNA 1BU1A 4J9HA 1JXMA 2JM9A 2LP5A 1SEMA 2RQTA 1TUCA 2OJ2A 2LJ1A 3SEMA 1SHGA 1WIEA 2YDLA 3VS3A 5I11A 2K6DA 2OAWA 1J3TA 1GBQA 2SEMA 1SSHA 4RUGA 4F17A 4AFSC 2KRMA 1AEYA 3VS7A 2D1XA 3FJ5A 2J6OA 2FPEA 4RTVA 1UJYA 5IHIA 3ULRB 2DILA 3EGUA 1AWJA 4D8KA 2KNBB 4AFQC 2ECZA 3IQLA 1NM7A 2DF6A 3M0PA 2HBWA 2DYBA 1T3LA 1UGVA 1WX6A 5GJWB 2OI3A 4J9EA 2DMOA 4CC2A 4Z88A 1KFZA 1NG2A 1ABOA 2DA9A 3UA6A 1ZSGA 2YUNA 2KRSA 2KBTA 1W6XA 2F2VA 1Y0MA 2X3WD 2YT6A 1YWOA 1M30A 2AKKA 4RTUA 1K1ZA 1UE9A 4FSSA 4JZ4A 2DL7A 2MCNA 1PRMC 2KR3A 1VYVA 1CSKA 2EGCA 1QWFA 1WLPB 1X69A 2V1RA 4GLMA 3M0RA 1ZUYA 2KT1A 1T3SA 2EGAA 2AK5A 3RNJA 2QDLA 4K11A 1OV3A 2XMFA 4X1VA 2KYBA 3C0CA 2EGEA 2KXCA 3EG0A 4HVWA 1G83A 2HEQA 2EW3A 5EC7A 2BTTA 3EG1A 3REAB 3H41A 1WXTA 2GQIA 3EHQA 2DRKA 2O88A 2JS0A 1PKSA 1X6GA 1AVZC 4A63B 2DNUA 4OMPA 2A37A 2A08A 1K0SA 4JZ3A 2VWFA 4F14A 4RTTA 1YNZA 3R6NA 1ZUKA 2LQNA 1SRMA 3H0HA 2M51A 2GTJA 2K9GA 2PZ1A 4AG1C 2HSPA 2VVKA 2J6FA 4LUEA 1K0XA 3QWXX 1N5ZA 2EPDA 3I35A 2LNHB 5ECAA 2J05A 3KFVA 1OOTA 1RLQC 2GTOA 2RNAA 2K3BA 5L23A 1AZEA 1X2QA 3PVLA 3M0QA 2DVJA 4LN2A 1M27C 1NLPC 1AD5A 3EG3A 2FPFA 2KYMA 2LJ3A 3JV3A 2YUPA 3CQTA 1H3HA 1PKTA 2RQVA 1KIKA 4DEYA 1PHTA 2JW4A 3EHRA 2DM1A 1FMKA 2I0NA 2VKNA 5IH2A 2C0OA 3I5RA 1QKXA 4QT7A 2M0YA 3H0IA 1GBRA 3U23A 1T0JA 1M3CA 1KJWA 3RBBB 3TSWA 1JEGA 1GCPA 1ZBJA 4JPBW 4ORZA 2SRCA 1I07A 1E6GA 2AKLA 2EYZA 1AWOA 2DL3A 3PE0A 1XOVA 2GNCA 2LX7A 1X2KA 2J6KA 1Z9ZA 3QWYA 2KROA 3I5SA 4ZNXA 1NLOC 1RLPC 1Z9QA 2ROTA 2JMAA 1NEGA 1HD3A 3VRZA 1NYFA 1B3QA 1M8MA 4J9CA 1UHCA 1VA7A 1UECA 1PWTA 1YN8A 1WFWA 2JTEA 3EG2A 2JS2A 3UA7A 4EIKA 4AG2C 4CC4B 2LCSA 1RUWA 2L3PA 4KRTA 1H92A 4JJCA 2HCKA 4RTWA 5IHKA 1JQQA 2PNIA 1JO8A 4R0KA 1SRLA 1Y57A 2JMCA 2NUZA 4LUDA 2O31A 4WCIA 1GL5A 2DL8A 3NGPA 1UHFA 2E5KA 4RTYA 2EBPA 3NHNA 3ZL7C 1NEBA 1K9AA 3VS6A 1IO6A 1GFDA 1KSWA 2CUDA 2CT4A 1FYNA 1UJ0A 1TG0A 2FPDA 2GGRA 3NMZC 2DL5A 2ED1A 2K7AA 1X27A 2EYXA 2YUOA 4RTZA 1YWPA 2EVRA 2D8HA 2F2XA 2KEAA 5FWBA 2EYWA 1A0NB 1WXUA 2L2PA 3TSZA 2JT4A 3M0TA 2K2MA 4E6RA 4OMNA 4LE9A 1S1NA 1YCSB 2DJQA 1ZUUA 4CC3A 2CSIA 1AZGB 3UATA 2DX1A 5IXBA 1GCQC 1JU5C 4JJDA 2L3QA 4D8DA 2FRWA 3M0UA 4HXJA 2LJ0A 4J9BA 5HCKA 4OMOA 2L3SA 1WA7A 1H8KA 1M3BA 2K79A 2ROLA 2V1QA 2P4RA 2BZXA 1WDXA 3NPFA 2AZSA 1RI9A 2DBKA 5FW9A 1GFCA 1X43A 3H0FA 1OPKA 3A98A 3VS2A 3VS4A 1M3AA 2CDTA 1SPKA 1TUDA 4JJBA 2J06A 2W10A 3THKA 4J9FA 2ED0A 1VYTA 1JXOA 1HSQA 2G6FX 1BBZA 1MV3A 4F16A 2AZVA 1SHFA 2ABLA 1UDLA 1OPLA 5FWCA 3LH5A 2ENMA 1GRIA 2O9VA 4IIMA 2O2OA 4CC7A 2CT3A 1B07A 1G2BA 2CH4W 1AWWA 4HCKA 4J9IA 1QCFA 4AFUC 1ZX6A 4OMLA 2JM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHW A;  2B86 A;  5I22 A;  1WXB A;  4ESR A;  1T0H A;  1U5S A;  3I9Q A;  1V1C A;  2W0Z A;  2NWM A;  2FRY A;  2GBQ A;  2YUQ A;  1UUE A;  2H8H A;  2EKH A;  2KGT A;  3TVT A;  5IHN A;  2CRE A;  4Y92 A;  5IXF A;  2FO0 A;  3M0S A;  4J9D A;  2RQW A;  1ABQ A;  1NYG A;  2EYY A;  2F2W A;  1K76 A;  2BZ8 A;  1PRL C;  1WYX A;  2RMO A;  3VS0 A;  1U3O A;  2RPN A;  2ESW A;  1AWX A;  1W1F A;  3GBQ A;  1CKB A;  4RTX A;  1VYU A;  4DEX A;  2EQI A;  2O9S A;  2IIM A;  1CKA A;  2DBM A;  3VS1 A;  1QLY A;  1UTI A;  2X3X D;  4IIO A;  1U06 A;  1GCQ A;  2CUB A;  4J9G A;  2RQR A;  2DL4 A;  3UF4 A;  1AOJ A;  1I0C A;  1LCK A;  1QKW A;  2JXB A;  2KT8 A;  4Z89 A;  1PNJ A;  1WI7 A;  1E6H A;  2LZ6 B;  1X6B A;  2A36 A;  2YSQ A;  2HDA A;  2J7I A;  4HVU A;  2RF0 A;  2DLP A;  1BK2 A;  4AFZ C;  2D8J A;  2KE9 A;  2KXD A;  4OMQ A;  3PVQ A;  1YP5 A;  1I1J A;  1BB9 A;  1W70 A;  2BZY A;  2RQU A;  2FEI A;  4LNP A;  1MV0 B;  3O5Z A;  1K4U S;  4Z8A A;  2CH4 A;  3VS5 A;  5GJV B;  2C0T A;  2C0I A;  1ARK A;  2LQW A;  4OMM A;  1HJD A;  2FG0 A;  1E7O A;  2MOX A;  1EFN A;  1UFF A;  2D0N A;  2DRM A;  3VRY A;  1QWE A;  2LMJ A;  1MUZ A;  1ZLM A;  2MIO A;  1UG1 A;  2L0A A;  4GBQ A;  2RN8 A;  1OEB A;  4M4Z A;  2PTK A;  2DE0 X;  4HVV A;  3REB B;  2CSQ A;  2A28 A;  2KRN A;  1BU1 A;  4J9H A;  1JXM A;  2JM9 A;  2LP5 A;  1SEM A;  2RQT A;  1TUC A;  2OJ2 A;  2LJ1 A;  3SEM A;  1SHG A;  1WIE A;  2YDL A;  3VS3 A;  5I11 A;  2K6D A;  2OAW A;  1J3T A;  1GBQ A;  2SEM A;  1SSH A;  4RUG A;  4F17 A;  4AFS C;  2KRM A;  1AEY A;  3VS7 A;  2D1X A;  3FJ5 A;  2J6O A;  2FPE A;  4RTV A;  1UJY A;  5IHI A;  3ULR B;  2DIL A;  3EGU A;  1AWJ A;  4D8K A;  2KNB B;  4AFQ C;  2ECZ A;  3IQL A;  1NM7 A;  2DF6 A;  3M0P A;  2HBW A;  2DYB A;  1T3L A;  1UGV A;  1WX6 A;  5GJW B;  2OI3 A;  4J9E A;  2DMO A;  4CC2 A;  4Z88 A;  1KFZ A;  1NG2 A;  1ABO A;  2DA9 A;  3UA6 A;  1ZSG A;  2YUN A;  2KRS A;  2KBT A;  1W6X A;  2F2V A;  1Y0M A;  2X3W D;  2YT6 A;  1YWO A;  1M30 A;  2AKK A;  4RTU A;  1K1Z A;  1UE9 A;  4FSS A;  4JZ4 A;  2DL7 A;  2MCN A;  1PRM C;  2KR3 A;  1VYV A;  1CSK A;  2EGC A;  1QWF A;  1WLP B;  1X69 A;  2V1R A;  4GLM A;  3M0R A;  1ZUY A;  2KT1 A;  1T3S A;  2EGA A;  2AK5 A;  3RNJ A;  2QDL A;  4K11 A;  1OV3 A;  2XMF A;  4X1V A;  2KYB A;  3C0C A;  2EGE A;  2KXC A;  3EG0 A;  4HVW A;  1G83 A;  2HEQ A;  2EW3 A;  5EC7 A;  2BTT A;  3EG1 A;  3REA B;  3H41 A;  1WXT A;  2GQI A;  3EHQ A;  2DRK A;  2O88 A;  2JS0 A;  1PKS A;  1X6G A;  1AVZ C;  4A63 B;  2DNU A;  4OMP A;  2A37 A;  2A08 A;  1K0S A;  4JZ3 A;  2VWF A;  4F14 A;  4RTT A;  1YNZ A;  3R6N A;  1ZUK A;  2LQN A;  1SRM A;  3H0H A;  2M51 A;  2GTJ A;  2K9G A;  2PZ1 A;  4AG1 C;  2HSP A;  2VVK A;  2J6F A;  4LUE A;  1K0X A;  3QWX X;  1N5Z A;  2EPD A;  3I35 A;  2LNH B;  5ECA A;  2J05 A;  3KFV A;  1OOT A;  1RLQ C;  2GTO A;  2RNA A;  2K3B A;  5L23 A;  1AZE A;  1X2Q A;  3PVL A;  3M0Q A;  2DVJ A;  4LN2 A;  1M27 C;  1NLP C;  1AD5 A;  3EG3 A;  2FPF A;  2KYM A;  2LJ3 A;  3JV3 A;  2YUP A;  3CQT A;  1H3H A;  1PKT A;  2RQV A;  1KIK A;  4DEY A;  1PHT A;  2JW4 A;  3EHR A;  2DM1 A;  1FMK A;  2I0N A;  2VKN A;  5IH2 A;  2C0O A;  3I5R A;  1QKX A;  4QT7 A;  2M0Y A;  3H0I A;  1GBR A;  3U23 A;  1T0J A;  1M3C A;  1KJW A;  3RBB B;  3TSW A;  1JEG A;  1GCP A;  1ZBJ A;  4JPB W;  4ORZ A;  2SRC A;  1I07 A;  1E6G A;  2AKL A;  2EYZ A;  1AWO A;  2DL3 A;  3PE0 A;  1XOV A;  2GNC A;  2LX7 A;  1X2K A;  2J6K A;  1Z9Z A;  3QWY A;  2KRO A;  3I5S A;  4ZNX A;  1NLO C;  1RLP C;  1Z9Q A;  2ROT A;  2JMA A;  1NEG A;  1HD3 A;  3VRZ A;  1NYF A;  1B3Q A;  1M8M A;  4J9C A;  1UHC A;  1VA7 A;  1UEC A;  1PWT A;  1YN8 A;  1WFW A;  2JTE A;  3EG2 A;  2JS2 A;  3UA7 A;  4EIK A;  4AG2 C;  4CC4 B;  2LCS A;  1RUW A;  2L3P A;  4KRT A;  1H92 A;  4JJC A;  2HCK A;  4RTW A;  5IHK A;  1JQQ A;  2PNI A;  1JO8 A;  4R0K A;  1SRL A;  1Y57 A;  2JMC A;  2NUZ A;  4LUD A;  2O31 A;  4WCI A;  1GL5 A;  2DL8 A;  3NGP A;  1UHF A;  2E5K A;  4RTY A;  2EBP A;  3NHN A;  3ZL7 C;  1NEB A;  1K9A A;  3VS6 A;  1IO6 A;  1GFD A;  1KSW A;  2CUD A;  2CT4 A;  1FYN A;  1UJ0 A;  1TG0 A;  2FPD A;  2GGR A;  3NMZ C;  2DL5 A;  2ED1 A;  2K7A A;  1X27 A;  2EYX A;  2YUO A;  4RTZ A;  1YWP A;  2EVR A;  2D8H A;  2F2X A;  2KEA A;  5FWB A;  2EYW A;  1A0N B;  1WXU A;  2L2P A;  3TSZ A;  2JT4 A;  3M0T A;  2K2M A;  4E6R A;  4OMN A;  4LE9 A;  1S1N A;  1YCS B;  2DJQ A;  1ZUU A;  4CC3 A;  2CSI A;  1AZG B;  3UAT A;  2DX1 A;  5IXB A;  1GCQ C;  1JU5 C;  4JJD A;  2L3Q A;  4D8D A;  2FRW A;  3M0U A;  4HXJ A;  2LJ0 A;  4J9B A;  5HCK A;  4OMO A;  2L3S A;  1WA7 A;  1H8K A;  1M3B A;  2K79 A;  2ROL A;  2V1Q A;  2P4R A;  2BZX A;  1WDX A;  3NPF A;  2AZS A;  1RI9 A;  2DBK A;  5FW9 A;  1GFC A;  1X43 A;  3H0F A;  1OPK A;  3A98 A;  3VS2 A;  3VS4 A;  1M3A A;  2CDT A;  1SPK A;  1TUD A;  4JJB A;  2J06 A;  2W10 A;  3THK A;  4J9F A;  2ED0 A;  1VYT A;  1JXO A;  1HSQ A;  2G6F X;  1BBZ A;  1MV3 A;  4F16 A;  2AZV A;  1SHF A;  2ABL A;  1UDL A;  1OPL A;  5FWC A;  3LH5 A;  2ENM A;  1GRI A;  2O9V A;  4IIM A;  2O2O A;  4CC7 A;  2CT3 A;  1B07 A;  1G2B A;  2CH4 W;  1AWW A;  4HCK A;  4J9I A;  1QCF A;  4AFU C;  1ZX6 A;  4OML A;  2JM8 A; 
#chains in the Genus database with same CATH topology
 2RI5 A;  4ESR A;  2WSF E;  2ZAE A;  1U5S A;  2DD5 A;  2NWM A;  2GBQ A;  3CCU Q;  1UUE A;  3JCM c;  2KGT A;  4ZTJ A;  3CCL Q;  1KC8 R;  4FW2 A;  4J7I A;  4Y92 A;  2FO0 A;  3CCU T;  1YJN A;  3M0S A;  4J9D A;  3CCL T;  2PVG B;  2F2W A;  1N6A A;  1PRL C;  3PT9 A;  3LGL A;  1UGP B;  2LQ8 A;  2RPN A;  1YI2 A;  1NJI C;  2ESW A;  4FL6 A;  4YTL A;  4M7D G;  1AWX A;  1W1F A;  4JS4 A;  1K8A R;  4DEX A;  5DLO A;  4KUD K;  4LDY A;  2RJE A;  1UTI A;  5FRO A;  3RR6 A;  3MEU A;  2RQR A;  3ZFJ A;  3CCS A;  3OBY A;  1AOJ A;  1E6H A;  3CCS Q;  2LZ6 B;  2YSQ A;  2DTI A;  3CCS T;  4XU3 A;  3BDU A;  4OMQ A;  2CZ6 B;  3RMS A;  1I1J A;  3HKS A;  2RQU A;  1VQ5 A;  4PJO D;  5HK0 A;  3MP8 A;  3JAM E;  2BKD N;  5A0D A;  2C0T A;  2C0I A;  1ARK A;  5GAN 2;  1OI1 A;  1VQ5 T;  2FG0 A;  1E7O A;  4M7D F;  1UFF A;  3UDC A;  3LWH A;  3VRY A;  1C6V X;  1QWE A;  4NL3 A;  1MUZ A;  2MIO A;  1W2B S;  3C95 A;  3REB B;  2D6F A;  4PJL A;  2QAS A;  2KRN A;  3WVE B;  4J9H A;  4RG8 A;  3CC7 Q;  2LP5 A;  4OF1 A;  4PK4 A;  5GMK l;  3RKX A;  3CC7 T;  2LJ1 A;  1C1A A;  3MP6 A;  4MML A;  3BW1 A;  3M54 A;  4C0Z A;  4PJO B;  2K6D A;  1GBQ A;  1P92 A;  1M1K C;  2QTV A;  3CMA Q;  1KD1 C;  3OYM A;  4AMC A;  2A0F B;  2HKQ B;  3CMA T;  3FC3 A;  2MYS A;  2DXU A;  4MDX A;  1UJY A;  5IN1 A;  3ULR B;  1F1B B;  3X25 B;  1QP3 A;  4D8K A;  2X51 A;  4M78 A;  3IQL A;  3R6O A;  3GNG A;  1T3L A;  4JRP A;  5GAM f;  4FW1 A;  3PMI A;  4J9E A;  3FRN A;  5GAO l;  2RHZ A;  2K4Y A;  2HKN A;  4DOV A;  3L2R A;  2FZK B;  1ABO A;  2XHC A;  3DB3 A;  2DA9 A;  4BI3 A;  3EH2 A;  2EWN A;  2YT6 A;  4LD6 A;  2YLB A;  1UE9 A;  2OX7 A;  3A8O B;  2DTH A;  4C92 A;  1VYV A;  1N9S A;  1ZSZ B;  2G3R A;  1WLP B;  2V1R A;  4GLM A;  3M0R A;  1ZUY A;  1B34 B;  1G3W A;  3DKM A;  1T3S A;  2RH2 A;  2AK5 A;  1D3B B;  2HSE B;  4HCZ A;  3MJX A;  4A4H A;  3KBG A;  1JJ2 S;  3CCJ Q;  2OTJ A;  4BDY A;  5EC7 A;  1RAB B;  3TCJ A;  4EMK B;  1FMW A;  2QQA A;  4RCC A;  1IHV A;  5FRN A;  5HY6 A;  4ZGJ B;  3M4Y A;  1I8F A;  1D09 B;  4JZ3 A;  2MWO A;  1RAE B;  5CKB A;  1BI3 A;  3G6E A;  1YNZ A;  4KUL A;  1ZUK A;  3R6N A;  5GAN 7;  1W4S A;  4JDS A;  3G6E T;  2QYZ A;  1N5Z A;  1OU8 A;  3CBM A;  3KUF A;  1YIJ A;  3SWN C;  3OYC A;  3VUZ A;  2D0Q B;  4M77 G;  1AZE A;  1U1S A;  3PVL A;  3NTK A;  2DVJ A;  5J26 A;  4IUU A;  1NLP C;  1AD5 A;  3EG3 A;  4L6V 5;  4GY5 A;  4F7U G;  3VV0 A;  1MMN A;  3CCM A;  4E7S A;  1UGR B;  3JSC A;  3JV3 A;  2YUP A;  4MZT A;  5J39 A;  3G71 Q;  3M57 A;  4DEY A;  1IZ6 A;  3H9N A;  1BI0 A;  3G71 T;  4QQD A;  2DM1 A;  1FMK A;  2I0N A;  1FWZ A;  2F5K A;  2EKO A;  3ME9 A;  3I5R A;  1QKX A;  2M0Y A;  4ZGE B;  1VIF A;  2CKK A;  1KJW A;  3M59 A;  5DM7 R;  1GCP A;  2GQV A;  2R5A A;  2KI7 A;  2AKL A;  1AWO A;  2E12 A;  1XOV A;  2GNC A;  2J6K A;  2K3X A;  1M4Z A;  1M2V A;  2PUK B;  3MEV A;  4OVA A;  2MWP A;  2ROT A;  3VRZ A;  5GAO r;  2KMT A;  4J9C A;  2EYQ A;  4XTY A;  3S6W A;  4EIK A;  3M4G A;  4M7A A;  1D1C A;  4CC4 B;  1RUW A;  1MNE A;  1YJW A;  4JJC A;  3I55 A;  2L8D A;  2DEQ A;  3P8D A;  1IGQ A;  1YJW Q;  5D7U A;  4LUD A;  3MEA A;  1YJW T;  1GL5 A;  3NGP A;  2E5K A;  4BE0 A;  3EFO B;  4RTY A;  2EBP A;  2QXF A;  3ZL7 C;  2CP7 A;  1IO6 A;  2PVO B;  5CKH A;  2CT4 A;  4A4K A;  3QXE B;  4PNO A;  2JVV A;  1V29 B;  1FYN A;  1TG0 A;  2FPD A;  4LXC A;  2I2L A;  3EH1 A;  4QVZ A;  5GAM j;  3X28 B;  3JRZ A;  1PD0 A;  2NUT B;  1B7T A;  2LDM A;  4M78 F;  2HBP A;  2F2X A;  2KEA A;  2EQM A;  2EYW A;  1A0N B;  1WXU A;  4BAC A;  2L2P A;  2E3H A;  2JOY A;  2K2M A;  4C92 C;  3HPW A;  2XG8 D;  4LE9 A;  1YCS B;  5GAO q;  2CSI A;  3UAT A;  2DX1 A;  3UT1 A;  5IXB A;  2E4H A;  1GCQ C;  3I56 A;  2ATC B;  4XTU A;  4MMK A;  4N4G A;  3L2U A;  1D3B A;  1I5L A;  1MGQ A;  3RUX A;  2FRW A;  5GAN g;  1ACM B;  5FU7 B;  3OYJ A;  4OMO A;  2L3S A;  2ROL A;  4BY6 B;  1WDX A;  2NLU A;  1RI9 A;  2V8K A;  1RI0 A;  1NZ9 A;  1X43 A;  1OPK A;  2H3J A;  3OSS C;  3A98 A;  2AIR B;  3VS4 A;  3GNF B;  1M3A A;  2HQX A;  4M78 E;  1VQM A;  2JTF A;  3HFO A;  5GMK j;  3GIB A;  5M9O A;  4ME7 A;  6AT1 B;  2DK3 A;  2ED0 A;  2G6F X;  1HSQ A;  2AZV A;  3QHS A;  4RG2 A;  1M90 U;  2CZ0 B;  2K5I A;  4FYY B;  1UDL A;  1OPL A;  2RHX A;  5KYY A;  2XK0 A;  4ZGD B;  4FYW B;  1DJ7 B;  4HA8 A;  4NOY A;  2DER A;  2O2O A;  4RKU E;  5A2Q E;  2DIG A;  2QGG A;  5LL6 S;  4CC7 A;  1G2B A;  1AT1 B;  1AWW A;  4C0G A;  4QVC A;  3QDR B;  1M8V A;  1QCF A;  2E64 A;  1ZA2 B;  1WQW A;  4OML A;  4QW2 A;  2B86 A;  3CXC A;  3F70 A;  3QSU A;  4M7D A;  4PJM A;  5DLQ E;  2YUQ A;  3V7S A;  2H8H A;  3TVT A;  5IHN A;  4QQG A;  3JB9 G;  2LVM A;  4XTW A;  2RQW A;  2WAC A;  4RMO A;  1ABQ A;  4II1 A;  4KT0 E;  1D0X A;  5LJ5 g;  1Y07 A;  2EYY A;  4E47 A;  1QVG P;  8AT1 B;  4JRI A;  3OBW A;  1VQ8 A;  2DTO A;  3QKJ A;  1U3O A;  4IUR A;  1CKB A;  1NJI R;  1MHN A;  4IUT A;  1R0C B;  2XDD A;  1CKA A;  2DBM A;  4ANJ A;  1QLY A;  2JNG A;  2X3X D;  1IHW A;  1U06 A;  1VQ4 A;  3G4S A;  4OGC A;  4M78 D;  3UF4 A;  1WJR A;  1QKW A;  1S72 Q;  4Z89 A;  1PNJ A;  4M7A C;  4L59 A;  1S72 T;  3G4S T;  2J7I A;  4HVU A;  2DLP A;  4E7I A;  4MDW A;  4N0A C;  1M1K U;  4OMF B;  3OYF A;  1LPL A;  5IAY A;  3PVQ A;  5KYX A;  4FCY A;  1XQH A;  3JB9 F;  1QVF A;  4J6Y A;  3CCV Q;  1BB9 A;  4DA4 A;  2FEI A;  3TRE A;  1K4U S;  4Z8A A;  3CCV T;  3VS5 A;  5CR2 A;  3EFO A;  3DB4 A;  4M78 B;  1EFN A;  3HRU A;  4C92 D;  2HL3 A;  1HXD A;  2DRM A;  2VXF A;  2L0A A;  2EJ9 A;  3CCQ A;  2DE0 X;  2A28 A;  5GMK m;  1PSE A;  5LJ3 j;  1VQL Q;  2X35 A;  3LWI A;  1JXM A;  3QJ6 A;  1VQL T;  2JM9 A;  4FT4 A;  3CCQ T;  1ZSZ C;  3CC2 Q;  3FEO A;  1VQO A;  2YDL A;  3VS3 A;  3CC2 T;  2OAW A;  3OQ5 A;  1TS9 A;  1VQO Q;  2L89 A;  2VYT A;  2SEM A;  5J3B A;  3E2U A;  1VQO T;  4F17 A;  4EMH A;  1AEY A;  3OYH A;  3M58 A;  2QQ9 A;  1M1K R;  3HL8 A;  2D1X A;  2QA4 A;  4HT9 A;  5LJ3 g;  1KD1 R;  5IHI A;  1PC0 A;  2QG9 B;  1NM7 A;  3T9N A;  4M7A E;  4O5V A;  2HBW A;  2H3E B;  3TQ7 P;  2DMO A;  3EFS A;  3MHX A;  4CC2 A;  2OTL A;  1KFZ A;  2M1H A;  3QJY A;  4BI8 B;  2KAF A;  3GPL A;  3UA6 A;  2YUN A;  1OUL A;  2KBT A;  1U8R A;  1HK9 A;  1Y0M A;  1YJN Q;  1MMA A;  2LX9 A;  2AKK A;  1YJN T;  4RTU A;  1K1Z A;  1M90 C;  1YHQ A;  3RES A;  1I81 A;  1YI2 Q;  2KR3 A;  2MPX C;  3M56 A;  2EGC A;  2V26 A;  2YRV A;  1YI2 T;  4MZP A;  4A4G A;  1X69 A;  3OYA A;  3JCM g;  4VUB A;  4WTO B;  4NS5 A;  1U1T A;  2HAX A;  1X6O A;  5FRM A;  3PIP A;  2A3L A;  1WHM A;  3RNJ A;  4C8Q G;  1D1A A;  2HD0 A;  4A53 A;  2EJG A;  4M7D C;  5CK9 A;  1G83 A;  2EW3 A;  1PSF A;  1C0M A;  1BCM A;  3H41 A;  4J83 A;  1I5O B;  2O88 A;  2JS0 A;  3QO3 A;  4KH1 B;  1PKS A;  1AVZ C;  1XTD A;  1KG1 A;  1JB0 E;  1O75 A;  1K9M U;  2LQK A;  1K0S A;  2VWF A;  1KQS P;  1YCY A;  1QQJ A;  4F14 A;  1VQ5 Q;  3L42 A;  2LQN A;  2NYS A;  2CP5 A;  4M77 A;  4C5H A;  2M51 A;  3J80 E;  3V8J A;  4M7A D;  4AG1 C;  2LT4 A;  1K0X A;  3HRT A;  4XAX B;  2EPD A;  3LYI A;  3ER0 A;  2CZ1 B;  1OOT A;  2YXY A;  1K73 C;  1Q7Y U;  4PFZ A;  1N9R A;  4C8Q F;  5C0M A;  3INZ A;  5GAM e;  1M2V B;  3C12 A;  3M0Q A;  3ZBD A;  3CBO A;  1QVG A;  4GLK A;  4JJN K;  2KYM A;  2LJ3 A;  3V7R A;  4M7A B;  1PKT A;  3NTI A;  1Q95 G;  1Y71 A;  4C5G A;  2YLC A;  2Y90 A;  2CYZ B;  2JW4 A;  4DBQ A;  2GCX A;  1ZA1 B;  4M7D E;  1VQ6 A;  1WHL A;  1GBR A;  3U23 A;  1T0J A;  3RBB B;  2RB6 A;  4O6J A;  1HYO A;  2AT1 B;  1E6G A;  1XJW B;  5GAN f;  2DPP B;  2CP2 A;  1YBY A;  2LT1 A;  3QWY A;  2YRD A;  3I5S A;  2KDS A;  3A8L B;  1NLO C;  1Z9Q A;  1OZ2 A;  2BE9 B;  1NEG A;  1NYF A;  5GAN 4;  1KHI A;  1PWT A;  1YN8 A;  1KC8 C;  3UA7 A;  2EIF A;  5FU7 C;  4AG2 C;  1FMV A;  4BY6 C;  1G8X A;  2Y4X A;  4RTW A;  2X4X A;  3JCM P;  5KE3 A;  1JO8 A;  4R0K A;  2NUZ A;  1Y57 A;  4X34 A;  2O31 A;  1G5V A;  2JUF A;  1UHF A;  4KUI A;  3JCM W;  3NTH A;  3VS6 A;  4X9D A;  3OYK A;  3OYY A;  2DYI A;  1GFD A;  2QEX A;  1KSW A;  2CUD A;  1BYM A;  2OTJ Q;  1UJ0 A;  4LDW A;  2QEX Q;  3DLL A;  4E7Z A;  2OTJ T;  1X27 A;  2QEX T;  5KE2 A;  3CXC P;  2CGH A;  3OS1 A;  4JRQ A;  5GAM h;  3A5Z B;  2O4X A;  1FXX A;  3CCE A;  4M7D D;  2DJQ A;  3G6E Q;  3PTA A;  1ZUU A;  4B9W A;  3UWN A;  2L3R A;  1O9S A;  3FIF A;  5CKD A;  4DOW A;  3QG1 A;  5LJ5 f;  4LDU A;  5KYY B;  2DAQ A;  3V8L A;  3LH0 A;  4JJD A;  2L3Q A;  3RIR A;  4D8D A;  3RKW A;  2FZG B;  3M0U A;  2LJ0 A;  1YIJ Q;  4EMG A;  1MMG A;  1H8K A;  1M3B A;  3BY7 A;  4LDX A;  3FB9 A;  1YIJ T;  3FDR A;  2BZX A;  4CI0 C;  2HQH A;  3MEW A;  2AZS A;  3OMC A;  5FW9 A;  4HKE A;  3QPH A;  1GFC A;  2DO3 A;  1WPY A;  5L8R E;  1D0Z A;  4M7D B;  3VU3 C;  1RAG B;  1KQ2 A;  1SPK A;  2RK2 A;  2D9T A;  2E3I A;  3Q1J A;  3CCM Q;  1H3Z A;  3MKD A;  3TEE A;  1K9M C;  2J06 A;  2W10 A;  4M75 G;  2ZZD A;  3CCM T;  1JXO A;  3QDF A;  4OP0 A;  1SHF A;  3E19 A;  3HSB A;  2ZPE B;  1QVF P;  5GAM d;  1TUG B;  5GMK h;  1WQ7 A;  3LH5 A;  1WJQ A;  2O9V A;  4IIM A;  1Q82 U;  2EQJ A;  1BKB A;  1LJO A;  1Q7Y C;  4M77 F;  1UEB A;  5CO7 A;  4AFU C;  2XU8 A;  3VUB A;  4D6W A;  5I22 A;  3BFM A;  1WXB A;  5LJ5 h;  3J7A F;  3I9Q A;  1X01 A;  4F7U F;  1KQS A;  2EKH A;  2CRE A;  5IXF A;  2QQR A;  4M78 C;  3L2Q A;  2M9U A;  4PKC C;  5KYX B;  4M75 F;  3I55 Q;  2RMO A;  3VS0 A;  1Q86 U;  1RAD B;  3I55 T;  3DLM A;  4FSX A;  3BE3 A;  3OS2 A;  1TU0 B;  4RTX A;  3AHU A;  2O9S A;  5LJ3 f;  5KYN A;  3BDL A;  2XD0 A;  5HK3 A;  4EPC A;  1N8R U;  3JCM J;  2E41 A;  5AYF A;  1QVG S;  3CC4 A;  3X24 B;  3G7Z A;  4OB2 B;  5A0G A;  4IIO A;  2KQW A;  1VQ7 A;  5GAN j;  4M77 E;  1I0C A;  4KBM B;  1LCK A;  3S3O A;  1NE8 A;  1VQ7 Q;  4C92 G;  4L5G A;  2A36 A;  2HDA A;  2A7Y A;  1VQ7 T;  2GFU A;  3M9Q A;  2VAS A;  1BK2 A;  3EAE A;  4AFZ C;  2D8J A;  1WGS A;  2FYK A;  2KXD A;  5LJ5 d;  4C5I A;  5I2M A;  3LX7 A;  1W70 A;  2BZY A;  4PFO A;  3I56 Q;  2RO0 A;  1MV0 B;  3O5Z A;  2CH4 A;  3I56 T;  3EFR A;  1YJ9 A;  3CD6 A;  5KH6 A;  2D0N A;  1X75 C;  3JCM f;  2FZC B;  4XTX A;  1YJ9 Q;  2LMJ A;  4PFP A;  5CKE A;  1ZLM A;  1UG1 A;  1D1B A;  1YJ9 T;  1OEB A;  2CZ7 B;  2CP6 A;  2CSQ A;  2P4T A;  4JUV A;  4CRI A;  1V76 A;  1UB4 A;  3V7C A;  1WZO A;  2OJ2 A;  1BCO A;  1VQM Q;  3SEM A;  1SHG A;  3SDZ A;  3VJP A;  4A4F A;  2ZCF B;  1BI1 A;  5LJ3 h;  1VQM T;  2EFI A;  2VC8 A;  1J3T A;  1IRE B;  4DQ2 A;  9ATC B;  4A54 A;  1BIB A;  4AFS C;  3JCM Q;  2KRM A;  3VS7 A;  3FJ5 A;  2J6O A;  2FPE A;  4RTV A;  1KK7 A;  5I2S A;  4ZN1 A;  5LJ5 j;  3EGU A;  1AWJ A;  2KNB B;  4AFQ C;  2ECZ A;  2E10 A;  4M77 D;  2DF6 A;  2GFA A;  2YHT A;  3M0P A;  2RK1 A;  1JRI A;  4LD9 K;  1WX6 A;  1PM3 A;  2DFU A;  1BIA A;  1QVP A;  1NG2 A;  1WJS A;  4J6W A;  1ZSG A;  2M02 A;  2KRS A;  5KYW B;  1YIT A;  2X3W D;  2K5L A;  4FT2 A;  4DBF A;  1YWO A;  3JCM h;  1YIT Q;  1M30 A;  3OYG A;  2EJF A;  4C8Q A;  1Q81 U;  1Y96 A;  1YIT T;  1W2B A;  4FSS A;  4JZ4 A;  4JLG A;  4N4H A;  1VQ8 Q;  4BB7 A;  5LJ3 d;  4FYV B;  4M77 B;  1CSK A;  1VQ8 T;  1QWF A;  2RI2 A;  1M90 R;  3JB9 I;  5CQX A;  2K57 A;  2WSC E;  1EZZ B;  4KGZ B;  4R55 A;  1Q82 C;  4PJO G;  4F7U B;  1SF9 A;  1RAA B;  1K73 U;  4K11 A;  2XMF A;  1VQ4 Q;  4X1V A;  3G4S Q;  3C0C A;  2EGE A;  2LNV A;  1VQN A;  1VQ4 T;  1D0Y A;  2HEQ A;  2BTT A;  1UGQ B;  3M53 A;  2GQI A;  3EHQ A;  1X6G A;  4F04 B;  3OW2 P;  2CS7 A;  4OMP A;  3CBP A;  1LVK A;  4MZM A;  5FU6 B;  4R56 A;  4FIB A;  1Q86 C;  1SRM A;  3JCM d;  3OS5 A;  2GTJ A;  2K9G A;  5GAO p;  2PZ1 A;  1PCX A;  2HSP A;  2VVK A;  4LUE A;  3QWX X;  3I35 A;  3JCM b;  1N8R C;  2DZC A;  2J05 A;  4PJO F;  4E2F B;  4FM4 B;  1KQS S;  1TSF A;  3CCQ Q;  1RLQ C;  3L2Z A;  2RNA A;  5L23 A;  3QBY A;  1G3Y A;  2K5F A;  3SB2 A;  5GAN 3;  4LN2 A;  1M27 C;  1EIF A;  1KC8 U;  2CP0 A;  1FX7 A;  3QYH B;  1M9S A;  2KVQ G;  3ASK A;  3M55 A;  3PGG A;  3OYB A;  3CQT A;  1QCO A;  2P0Q A;  1KIK A;  2B8A A;  1PHT A;  4PJJ A;  1G3T A;  5IH2 A;  2QA4 Q;  1LOJ A;  1K8A U;  2QA4 T;  4QT7 A;  2ZPB B;  3H0I A;  2QQB A;  2BIV A;  5GAO m;  1M3C A;  2ZPF B;  3TSW A;  1JEG A;  1ZBJ A;  2DXB A;  2DD4 A;  1LNX A;  2SRC A;  1I07 A;  2EQK A;  2F1L A;  2EYZ A;  1QMC A;  3RMQ A;  2LX7 A;  4XU1 A;  2RHU A;  1OU9 A;  2JN0 A;  2XID A;  4C0D B;  2OTL Q;  1Z9Z A;  2KRO A;  2F5T X;  1RLP C;  2OTL T;  2QGF B;  4PLL A;  2RD1 A;  1IB8 A;  4IKF A;  2JMA A;  7AT1 B;  1OYX A;  4UC4 A;  1B3Q A;  1M8M A;  1WFW A;  3CCU A;  2O4X B;  3CCL A;  3O8V A;  1YHQ Q;  3CPW P;  4QVD A;  1TWB A;  3NFC A;  2PUO B;  1RAC B;  2LCS A;  1YHQ T;  3J81 E;  1ZQ1 A;  2L5Q A;  4XU2 A;  2HCK A;  2VXE A;  5FLX E;  2PNI A;  3CME A;  1SRL A;  1VUB A;  2GF7 A;  2JMC A;  5D6W A;  2DL8 A;  3CME Q;  5D6X A;  3NHN A;  2DET A;  1NEB A;  1VOM A;  3CME T;  1M2O A;  2V8J A;  4V2S A;  2E65 A;  2X9H A;  3NMZ C;  5CQY A;  2DZ9 A;  2DL5 A;  3D7S B;  2ED1 A;  2K7A A;  5KYW A;  4J5Y A;  3JB9 D;  1YWP A;  2EVR A;  2D8H A;  4B9X A;  4C8Q C;  1IGU A;  2LTO A;  5FWB A;  4IUV A;  3TSZ A;  4E6R A;  4OMN A;  3SWN A;  3H8Z A;  2R5M A;  1Q81 C;  2FVU A;  1S1N A;  4CC3 A;  1AZG B;  3EGD B;  3SD4 A;  3OY9 A;  2CP3 A;  1R77 A;  3WVD B;  1JU5 C;  3GP8 A;  5GAN 8;  3CXC S;  2XDP A;  4F7U A;  3OSV A;  2X4Y A;  2M16 A;  3URG A;  3M5A A;  3C94 A;  4J9B A;  1I4K 1;  1R8O B;  4M75 A;  2V1Q A;  2K79 A;  5I21 A;  1XNI A;  5CCA A;  2ZPI B;  3NPF A;  2XI9 A;  5GAN e;  3EGX A;  1JBM A;  3VS2 A;  3CC7 A;  2RM4 A;  1RAF B;  2CDT A;  1TUD A;  3C4S A;  3EG9 B;  5AT1 B;  3THK A;  4J9F A;  3JCM X;  5EG2 A;  1GXI E;  1BBZ A;  4F16 A;  1K9M R;  3CMA A;  2DEU A;  5CVI A;  1SSF A;  1VQP A;  4DBR A;  3OYN A;  4HT8 A;  4NL2 A;  2FL7 A;  1VQ6 Q;  3V8K A;  1VQP Q;  2IVW A;  1OQK A;  2ENM A;  1TXQ A;  1GRI A;  1VQ6 T;  3PIO A;  1VQP T;  1IRX A;  3N5B B;  2RJF A;  3ZEH A;  3OMG A;  4Z02 A;  5GAO n;  4KGV B;  2QK0 A;  2CH4 W;  4C8Q E;  2QI2 A;  5GAN 5;  3GF5 A;  1QVF S;  4J9I A;  4ELY C;  3HHT B;  4E7H A;  2C06 A;  3OW2 A;  1Q7Y R;  3SHW A;  2WSE E;  2COY A;  1T0H A;  2K2V A;  5GMK e;  1V1C A;  2W0Z A;  3E9F A;  3L2W A;  2FRY A;  3MPU B;  1RL2 A;  3OS0 A;  2RHI A;  4PL6 A;  2ZPG B;  3LLR A;  4QQ6 A;  1NYG A;  1K76 A;  1NBE B;  2BZ8 A;  2M0O A;  1WYX A;  1K8A C;  3L2V A;  1YFN A;  3JCM V;  3VYH B;  3QYG B;  3GBQ A;  1AHJ B;  2RJD A;  3PFS A;  5LJ5 e;  1VYU A;  5KYU A;  3UPU A;  2EQI A;  2BE7 D;  3VKI A;  2FHD A;  4JS5 A;  2IIM A;  2NUP A;  4OB3 B;  3VS1 A;  4ZTF A;  5IT9 E;  4J9G A;  1GCQ A;  2CUB A;  2V8I A;  2DL4 A;  1WNL A;  3CCJ A;  2JXB A;  2KT8 A;  1WI7 A;  1X6B A;  3CPF A;  3PNW C;  4RCB A;  3JB9 J;  2RF0 A;  2Z0W A;  1SKU B;  3CCJ T;  3FJP A;  5GAN h;  1H64 1;  2KE9 A;  3OYD A;  3CCE Q;  2LC4 A;  1YP5 A;  3RKY A;  3CCE T;  3MCA B;  3MO8 A;  1W2B P;  4LNP A;  4QKU A;  1NPP A;  4KGX B;  5GJV B;  4C8Q D;  1ZBX A;  2LQW A;  4OMM A;  4BE2 A;  5CIU A;  1HJD A;  4XQ3 A;  2MOX A;  2E1H A;  2X4W A;  4GBQ A;  2EAY A;  2RN8 A;  4M4Z A;  2PTK A;  4HVV A;  1OX8 A;  3OYL A;  2E70 A;  1BU1 A;  1KQ1 A;  1SEM A;  2RQT A;  1TUC A;  4M77 C;  4ATO A;  1N27 A;  3CPW A;  4IUQ A;  1WIE A;  5I11 A;  3HTR A;  2DXT A;  3EGD A;  4C8Q B;  1SSH A;  1Y96 B;  4RUG A;  2PVD B;  3GLX A;  1EX4 A;  2LCC A;  3G71 A;  1KHC A;  2MI6 A;  1OX9 A;  5GAN d;  2QDY B;  4M75 C;  3GOX A;  3JB9 H;  4PJN A;  1PG5 B;  1QW1 A;  2DIL A;  3RER A;  1VQK A;  2PU9 B;  3A1P A;  1VQK Q;  1M1G A;  5LJ3 e;  2JTM A;  1VQK T;  2DYB A;  3WXM B;  1UGV A;  5GJW B;  2QAZ A;  2OI3 A;  3HFN A;  5FU6 C;  4Z88 A;  2BUD A;  2DJZ A;  3EG9 A;  3TU4 K;  4M78 G;  1W6X A;  2F2V A;  2Y4Y A;  2E6N A;  4PJO A;  3QZ5 B;  5CKF A;  1MND A;  2DL7 A;  2MCN A;  1PRM C;  3S3M A;  4PLI A;  1JJ2 P;  1WHK A;  4ELZ C;  4J8O A;  1NPR A;  3OA6 A;  4N0A A;  2KT1 A;  1TH7 A;  2EGA A;  4XTZ A;  3RDV A;  2VV5 A;  3CC4 Q;  2ZPH B;  1Q82 R;  2QDL A;  1OV3 A;  3P8H A;  3JCM e;  1SG5 A;  2KYB A;  2DIQ A;  3CC4 T;  2KXC A;  4Y28 E;  3EG0 A;  3VYG A;  4FU6 A;  4HVW A;  5A0L A;  5KCH A;  2JJ9 A;  3EG1 A;  3REA B;  2MMP A;  3QUI A;  4F7U E;  1WXT A;  2DRK A;  2XDB A;  4N4I A;  1WHH A;  3OYE A;  4A63 B;  2RJC A;  2DNU A;  4M75 E;  2A37 A;  2A08 A;  2OAU A;  4E7K A;  4RTT A;  2KK4 A;  4OB1 B;  1MMD A;  1ZSZ A;  2XKO C;  3H0H A;  5HKC A;  4C0D C;  1TOV A;  1Y7X A;  2PQW A;  3OW2 S;  2J6F A;  1Q86 R;  2DXC A;  2HL5 C;  2HNI A;  3CD6 Q;  1B34 A;  3X20 B;  8ATC B;  1VQ9 A;  4BUG A;  4XU0 A;  2LNH B;  5GAM g;  3CD6 T;  2JZ2 A;  5ECA A;  3CEY A;  1QP2 A;  1VQ9 Q;  3KFV A;  1N8R R;  2GTO A;  1VQ9 T;  2LRQ A;  2K3B A;  1X2Q A;  2QTX A;  3FLG A;  4E7L A;  4OB0 B;  2DVE A;  4C92 F;  3X26 B;  4EMK A;  1IXD A;  2FPF A;  4KH0 B;  2HZY A;  1H3H A;  2R58 A;  2RQV A;  3EHR A;  4JRK A;  3L1A A;  2VKN A;  4JLI A;  1TTH B;  2C0O A;  1NJI U;  4TVR A;  2DKG A;  4C0F A;  1G3S A;  2MK5 A;  2VUB A;  1WHG A;  2KSS A;  2YRC A;  4JPB W;  2E6Z A;  4ORZ A;  1RAH B;  2HMA A;  2LCL A;  2DL3 A;  3PE0 A;  1X2K A;  2HQE A;  3P8B B;  2XIC A;  4HCC A;  4M75 D;  3MET A;  4ZNX A;  2RA2 A;  3A8G B;  3A8H B;  4C92 E;  3OYI A;  1HD3 A;  3QII A;  4DBH A;  1QCN A;  1UHC A;  1UEC A;  1VA7 A;  2JTE A;  3SWN B;  4E7J A;  3EG2 A;  2E5Q A;  2JS2 A;  4Y91 A;  2P84 A;  5C6S A;  1WHJ A;  4C5E A;  2L3P A;  4KRT A;  1H92 A;  5IHK A;  1JQQ A;  1RAI B;  2COZ A;  2YWW A;  4AT1 B;  2FB7 A;  4WCI A;  2MAM A;  4BI4 A;  2RI3 A;  2O01 E;  3CPW S;  1K9A A;  4M7A G;  4M75 B;  4OGE A;  3H6Z A;  1VQN Q;  2GGR A;  1VQN T;  3A8M B;  4BD3 A;  5KCO A;  4PJO C;  1VIE A;  3EGX B;  4FYX B;  4Q5W A;  2EYX A;  2YUO A;  4RTZ A;  2ZGW A;  1S72 A;  4X9C A;  1ZHI A;  3HP9 A;  5CAI A;  2QQS A;  2JT4 A;  3M0T A;  2COW A;  4P5N A;  1PD1 A;  4BDZ A;  4IUP A;  1M1F A;  1M5Q 1;  2F69 A;  3HRS A;  1Q81 R;  3E1S A;  1KD1 U;  2EQU A;  3CCV A;  4XTV A;  2P0K A;  3AT1 B;  4BE1 A;  2VGN A;  2P0P A;  2R57 A;  4HXJ A;  5DY9 A;  5HCK A;  2RHY A;  1WA7 A;  3CCR A;  2P4R A;  4ZN3 A;  1K73 R;  4M7A F;  3CCR Q;  4WF2 A;  2DBK A;  1BI2 A;  3QZ9 B;  2VGM A;  4B6M A;  2K3Y A;  1VQL A;  3CCR T;  4HCB A;  3H0F A;  2NUT A;  2IPO B;  4A4E A;  2KY9 A;  3CC2 A;  4LDV A;  3SFM A;  5GMK i;  4JJB A;  1UGS B;  3LGF A;  4XK8 E;  1JJ2 A;  1VYT A;  1MV3 A;  4J6X A;  2X4J A;  3MP1 A;  2ABL A;  4EDU A;  3G1J A;  4J7F A;  3LW5 E;  2VB6 A;  5FWC A;  3E9G A;  4C92 B;  5KYU B;  3PMT A;  2NUP B;  3KXT A;  4PJO E;  5D6Y A;  2CT3 A;  1B07 A;  2MF2 A;  4EMK C;  3S3N A;  1R0B G;  1OZ3 A;  2AHJ B;  4HCK A;  5GAN 6;  1ZX6 A;  3OB9 A;  2IG0 A;  2JM8 A; 
#chains in the Genus database with same CATH homology
 3SHW A;  2B86 A;  5I22 A;  1WXB A;  4ESR A;  1T0H A;  1U5S A;  3I9Q A;  1V1C A;  2W0Z A;  2NWM A;  2FRY A;  2GBQ A;  2YUQ A;  1UUE A;  2H8H A;  2EKH A;  2KGT A;  3TVT A;  5IHN A;  2CRE A;  4Y92 A;  5IXF A;  2FO0 A;  3M0S A;  4J9D A;  2RQW A;  1ABQ A;  1NYG A;  2EYY A;  2F2W A;  1K76 A;  2BZ8 A;  1PRL C;  1WYX A;  2RMO A;  3VS0 A;  1U3O A;  2RPN A;  2ESW A;  1AWX A;  1W1F A;  3GBQ A;  1CKB A;  4RTX A;  1VYU A;  4DEX A;  2EQI A;  2O9S A;  2IIM A;  1CKA A;  2DBM A;  3VS1 A;  1QLY A;  1UTI A;  2X3X D;  4IIO A;  1U06 A;  1GCQ A;  2CUB A;  4J9G A;  2RQR A;  2DL4 A;  3UF4 A;  1AOJ A;  1I0C A;  1LCK A;  1QKW A;  2JXB A;  2KT8 A;  4Z89 A;  1PNJ A;  1WI7 A;  1E6H A;  2LZ6 B;  1X6B A;  2A36 A;  2YSQ A;  2HDA A;  2J7I A;  4HVU A;  2RF0 A;  2DLP A;  1BK2 A;  4AFZ C;  2D8J A;  2KE9 A;  2KXD A;  4OMQ A;  3PVQ A;  1YP5 A;  1I1J A;  1BB9 A;  1W70 A;  2BZY A;  2RQU A;  2FEI A;  4LNP A;  1MV0 B;  3O5Z A;  1K4U S;  4Z8A A;  2CH4 A;  3VS5 A;  5GJV B;  2C0T A;  2C0I A;  1ARK A;  2LQW A;  4OMM A;  1HJD A;  2FG0 A;  1E7O A;  2MOX A;  1EFN A;  1UFF A;  2D0N A;  2DRM A;  3VRY A;  1QWE A;  2LMJ A;  1MUZ A;  1ZLM A;  2MIO A;  1UG1 A;  2L0A A;  4GBQ A;  2RN8 A;  1OEB A;  4M4Z A;  2PTK A;  2DE0 X;  4HVV A;  3REB B;  2CSQ A;  2A28 A;  2KRN A;  1BU1 A;  4J9H A;  1JXM A;  2JM9 A;  2LP5 A;  1SEM A;  2RQT A;  1TUC A;  2OJ2 A;  2LJ1 A;  3SEM A;  1SHG A;  1WIE A;  2YDL A;  3VS3 A;  5I11 A;  2K6D A;  2OAW A;  1J3T A;  1GBQ A;  2SEM A;  1SSH A;  4RUG A;  4F17 A;  4AFS C;  2KRM A;  1AEY A;  3VS7 A;  2D1X A;  3FJ5 A;  2J6O A;  2FPE A;  4RTV A;  1UJY A;  5IHI A;  3ULR B;  2DIL A;  3EGU A;  1AWJ A;  4D8K A;  2KNB B;  4AFQ C;  2ECZ A;  3IQL A;  1NM7 A;  2DF6 A;  3M0P A;  2HBW A;  2DYB A;  1T3L A;  1UGV A;  1WX6 A;  5GJW B;  2OI3 A;  4J9E A;  2DMO A;  4CC2 A;  4Z88 A;  1KFZ A;  1NG2 A;  1ABO A;  2DA9 A;  3UA6 A;  1ZSG A;  2YUN A;  2KRS A;  2KBT A;  1W6X A;  2F2V A;  1Y0M A;  2X3W D;  2YT6 A;  1YWO A;  1M30 A;  2AKK A;  4RTU A;  1K1Z A;  1UE9 A;  4FSS A;  4JZ4 A;  2DL7 A;  2MCN A;  1PRM C;  2KR3 A;  1VYV A;  1CSK A;  2EGC A;  1QWF A;  1WLP B;  1X69 A;  2V1R A;  4GLM A;  3M0R A;  1ZUY A;  2KT1 A;  1T3S A;  2EGA A;  2AK5 A;  3RNJ A;  2QDL A;  4K11 A;  1OV3 A;  2XMF A;  4X1V A;  2KYB A;  3C0C A;  2EGE A;  2KXC A;  3EG0 A;  4HVW A;  1G83 A;  2HEQ A;  2EW3 A;  5EC7 A;  2BTT A;  3EG1 A;  3REA B;  3H41 A;  1WXT A;  2GQI A;  3EHQ A;  2DRK A;  2O88 A;  2JS0 A;  1PKS A;  1X6G A;  1AVZ C;  4A63 B;  2DNU A;  4OMP A;  2A37 A;  2A08 A;  1K0S A;  4JZ3 A;  2VWF A;  4F14 A;  4RTT A;  1YNZ A;  3R6N A;  1ZUK A;  2LQN A;  1SRM A;  3H0H A;  2M51 A;  2GTJ A;  2K9G A;  2PZ1 A;  4AG1 C;  2HSP A;  2VVK A;  2J6F A;  4LUE A;  1K0X A;  3QWX X;  1N5Z A;  2EPD A;  3I35 A;  2LNH B;  5ECA A;  2J05 A;  3KFV A;  1OOT A;  1RLQ C;  2GTO A;  2RNA A;  2K3B A;  5L23 A;  1AZE A;  1X2Q A;  3PVL A;  3M0Q A;  2DVJ A;  4LN2 A;  1M27 C;  1NLP C;  1AD5 A;  3EG3 A;  2FPF A;  2KYM A;  2LJ3 A;  3JV3 A;  2YUP A;  3CQT A;  1H3H A;  1PKT A;  2RQV A;  1KIK A;  4DEY A;  1PHT A;  2JW4 A;  3EHR A;  2DM1 A;  1FMK A;  2I0N A;  2VKN A;  5IH2 A;  2C0O A;  3I5R A;  1QKX A;  4QT7 A;  2M0Y A;  3H0I A;  1GBR A;  3U23 A;  1T0J A;  1M3C A;  1KJW A;  3RBB B;  3TSW A;  1JEG A;  1GCP A;  1ZBJ A;  4JPB W;  4ORZ A;  2SRC A;  1I07 A;  1E6G A;  2AKL A;  2EYZ A;  1AWO A;  2DL3 A;  3PE0 A;  1XOV A;  2GNC A;  2LX7 A;  1X2K A;  2J6K A;  1Z9Z A;  3QWY A;  2KRO A;  3I5S A;  4ZNX A;  1NLO C;  1RLP C;  1Z9Q A;  2ROT A;  2JMA A;  1NEG A;  1HD3 A;  3VRZ A;  1NYF A;  1B3Q A;  1M8M A;  4J9C A;  1UHC A;  1VA7 A;  1UEC A;  1PWT A;  1YN8 A;  1WFW A;  2JTE A;  3EG2 A;  2JS2 A;  3UA7 A;  4EIK A;  4AG2 C;  4CC4 B;  2LCS A;  1RUW A;  2L3P A;  4KRT A;  1H92 A;  4JJC A;  2HCK A;  4RTW A;  5IHK A;  1JQQ A;  2PNI A;  1JO8 A;  4R0K A;  1SRL A;  1Y57 A;  2JMC A;  2NUZ A;  4LUD A;  2O31 A;  4WCI A;  1GL5 A;  2DL8 A;  3NGP A;  1UHF A;  2E5K A;  4RTY A;  2EBP A;  3NHN A;  3ZL7 C;  1NEB A;  1K9A A;  3VS6 A;  1IO6 A;  1GFD A;  1KSW A;  2CUD A;  2CT4 A;  1FYN A;  1UJ0 A;  1TG0 A;  2FPD A;  2GGR A;  3NMZ C;  2DL5 A;  2ED1 A;  2K7A A;  1X27 A;  2EYX A;  2YUO A;  4RTZ A;  1YWP A;  2EVR A;  2D8H A;  2F2X A;  2KEA A;  5FWB A;  2EYW A;  1A0N B;  1WXU A;  2L2P A;  3TSZ A;  2JT4 A;  3M0T A;  2K2M A;  4E6R A;  4OMN A;  4LE9 A;  1S1N A;  1YCS B;  2DJQ A;  1ZUU A;  4CC3 A;  2CSI A;  1AZG B;  3UAT A;  2DX1 A;  5IXB A;  1GCQ C;  1JU5 C;  4JJD A;  2L3Q A;  4D8D A;  2FRW A;  3M0U A;  4HXJ A;  2LJ0 A;  4J9B A;  5HCK A;  4OMO A;  2L3S A;  1WA7 A;  1H8K A;  1M3B A;  2K79 A;  2ROL A;  2V1Q A;  2P4R A;  2BZX A;  1WDX A;  3NPF A;  2AZS A;  1RI9 A;  2DBK A;  5FW9 A;  1GFC A;  1X43 A;  3H0F A;  1OPK A;  3A98 A;  3VS2 A;  3VS4 A;  1M3A A;  2CDT A;  1SPK A;  1TUD A;  4JJB A;  2J06 A;  2W10 A;  3THK A;  4J9F A;  2ED0 A;  1VYT A;  1JXO A;  1HSQ A;  2G6F X;  1BBZ A;  1MV3 A;  4F16 A;  2AZV A;  1SHF A;  2ABL A;  1UDL A;  1OPL A;  5FWC A;  3LH5 A;  2ENM A;  1GRI A;  2O9V A;  4IIM A;  2O2O A;  4CC7 A;  2CT3 A;  1B07 A;  1G2B A;  2CH4 W;  1AWW A;  4HCK A;  4J9I A;  1QCF A;  4AFU C;  1ZX6 A;  4OML A;  2JM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...