1RLQC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1rlqC00
2MCNA 1W6XA 2L3SA 4CC3A 2M0YA 2JM8A 4RTXA 2KYBA 1X2QA 3UATA 3FJ5A 3ULRB 2HEQA 4OMNA 2P4RA 3M0RA 1WX6A 1RLPC 2YUQA 1I1JA 2RQWA 2J6KA 1Z9QA 1OPLA 2KGTA 2GQIA 3M0QA 5GJWB 1RLQC 1TUDA 2X3XD 3VS4A 2LCSA 2DBMA 2KRMA 1N5ZA 4GBQA 4RTUA 1X6GA 1NLOC 4AG2C 3RBBB 3I9QA 2CDTA 2ROLA 4LN2A 3SEMA 1W1FA 1W70A 1ZSGA 1TUCA 3REAB 4OMQA 1WLPB 4JZ4A 4A63B 3IQLA 1K9AA 4HVVA 2EYYA 2VVKA 4CC7A 1HJDA 1MUZA 1KJWA 2CSIA 2DJQA 2VKNA 2FO0A 1TG0A 2CSQA 4DEYA 1ZX6A 1UG1A 1SEMA 1SRLA 2K3BA 5I11A 5IHNA 1ARKA 1CKAA 4E6RA 3KFVA 2YUNA 4D8DA 3LH5A 2C0OA 1NYFA 2A28A 4CC2A 1Y0MA 2C0IA 3ZL7C 1QCFA 1VYVA 1AZGB 1T3LA 2BTTA 4D8KA 3PVLA 2AZVA 1UJYA 3UA7A 4EIKA 4IIMA 3A98A 1XOVA 2I0NA 3M0PA 1K4US 5GJVB 2RNAA 2FPDA 2KXDA 1GL5A 2RN8A 1QLYA 4R0KA 1LCKA 3NHNA 3TSWA 4F14A 5L23A 3VS7A 1M8MA 1UFFA 2A37A 2EYZA 1K0XA 1A0NB 1PKSA 2GTOA 5IHIA 2F2XA 1ZUKA 3RNJA 1NEGA 2KT8A 1MV3A 1OV3A 5I22A 3NGPA 1KFZA 5IXFA 3SHWA 1T0HA 2ED0A 2J06A 2LMJA 2EKHA 4RTVA 2DNUA 5FW9A 1ZUYA 2YUPA 2FRWA 1OOTA 1UDLA 1YCSB 1E6GA 2J6FA 1UTIA 4HVWA 1I07A 1U06A 2BZYA 4M4ZA 4RUGA 2RQUA 3EGUA 2O31A 2A08A 1OEBA 1U3OA 2CH4A 3R6NA 2LJ0A 1AWJA 1WIEA 3H0IA 2OI3A 2M51A 1AZEA 1H92A 4HVUA 2KR3A 1JXOA 2J7IA 3VS1A 4OMOA 4J9IA 1VYUA 4AFUC 2DM1A 1UHFA 3VS2A 3VRZA 1GBRA 2FPEA 2DL4A 1SPKA 2RMOA 1B07A 2G6FX 3EG0A 1JXMA 1PRMC 2JXBA 2FG0A 2CH4W 1M3CA 1ZUUA 3M0SA 4RTYA 1V1CA 1ZLMA 2GGRA 2QDLA 2A36A 3REBB 1PWTA 2EBPA 2LNHB 1PRLC 1QWFA 2J6OA 4Z8AA 1M27C 2PZ1A 1AWXA 1WDXA 5IH2A 2GBQA 2B86A 3EG1A 5FWBA 1AOJA 2KE9A 2NWMA 4JPBW 2CUBA 2CREA 1NYGA 4J9CA 4ORZA 1KSWA 2NUZA 1BU1A 3NMZC 3H0HA 1G2BA 1GCPA 2V1QA 2K7AA 2D0NA 2JMAA 4ESRA 3U23A 2DLPA 1UHCA 1K1ZA 2KNBB 4DEXA 1HD3A 2DL5A 2JTEA 1RI9A 1GFDA 2CUDA 2HBWA 2OAWA 1AD5A 1IO6A 2DRMA 1EFNA 3JV3A 1FYNA 1VA7A 2L3PA 2HDAA 3UF4A 2O9SA 2DRKA 3VRYA 3H41A 1QKXA 1BK2A 2DILA 2RPNA 2CT4A 2AZSA 4LUEA 2KYMA 1WI7A 2W10A 1AVZC 2FEIA 3TSZA 2HSPA 4HCKA 3M0TA 2SEMA 1NM7A 1JU5C 1ABOA 1OPKA 1KIKA 3I35A 2JT4A 4JZ3A 1YWPA 1BB9A 2EPDA 4AG1C 3PVQA 4RTWA 2J05A 2C0TA 1GCQC 2ESWA 1YP5A 2DE0X 1SSHA 4OMLA 2LX7A 2ABLA 1T0JA 1X43A 1GRIA 1K76A 2AK5A 1SHFA 2LP5A 2EGEA 4AFZC 1RUWA 2EW3A 4KRTA 2IIMA 1WA7A 4LNPA 2DVJA 2K6DA 1MV0B 3M0UA 3EG2A 2ED1A 2MIOA 1E7OA 4OMMA 2JW4A 1NLPC 1ZBJA 1WFWA 1PHTA 1WXTA 4RTZA 1K0SA 1ABQA 1Z9ZA 1UJ0A 3I5SA 2EGAA 4CC4B 2GTJA 1E6HA 4F17A 2FPFA 2LZ6B 1PNJA 2JMCA 5FWCA 3THKA 4JJBA 4F16A 2DA9A 4J9BA 4GLMA 4Z89A 2DF6A 1M30A 2YUOA 4WCIA 2K79A 4LE9A 2KT1A 2SRCA 4JJCA 1HSQA 1NEBA 2JS2A 2JM9A 2KEAA 2DMOA 2EVRA 2L2PA 1Y57A 2O9VA 1JEGA 2DL7A 4J9DA 1AEYA 5EC7A 1NG2A 1SRMA 3C0CA 2EGCA 1I0CA 1VYTA 1U5SA 2W0ZA 2DYBA 2O88A 1B3QA 2V1RA 1AWOA 4J9GA 2CT3A 4J9FA 2KXCA 2EYXA 1GCQA 2KBTA 3O5ZA 3VS0A 2D1XA 1X69A 2RQRA 2MOXA 1JQQA 2DL8A 3VS5A 2AKLA 4FSSA 3TVTA 3VS3A 1UECA 2D8JA 4K11A 1UGVA 3GBQA 4HXJA 1QKWA 4Y92A 4J9EA 1H3HA 5IXBA 2KRSA 4J9HA 2F2VA 1X27A 1WXBA 3PE0A 1GBQA 3NPFA 2D8HA 2L3QA 5IHKA 1UUEA 1SHGA 2E5KA 2BZXA 2LQWA 2RQTA 2LQNA 4OMPA 2VWFA 4ZNXA 2RF0A 2DX1A 2ROTA 1WXUA 3EG3A 1CSKA 1YWOA 1YNZA 1J3TA 1CKBA 3EHQA 1PKTA 3QWXX 2FRYA 2H8HA 2DL3A 2L0AA 2LJ3A 5ECAA 2AKKA 4AFSC 1WYXA 3QWYA 1M3BA 2OJ2A 2KRNA 2EYWA 2YSQA 1S1NA 2XMFA 2K9GA 1QWEA 4X1VA 1YN8A 4RTTA 4JJDA 1BBZA 1T3SA 1X2KA 4LUDA 2YT6A 2BZ8A 2GNCA 2DBKA 2O2OA 2RQVA 2LJ1A 2ENMA 1H8KA 5HCKA 4IIOA 1GFCA 1AWWA 1JO8A 3VS6A 4Z88A 2YDLA 2HCKA 1G83A 2K2MA 3H0FA 3CQTA 1UE9A 3EHRA 2F2WA 4QT7A 2ECZA 2KROA 1M3AA 2JS0A 2PTKA 3I5RA 2X3WD 3UA6A 4AFQC 2EQIA 2PNIA 1X6BA 1FMKA
chains in the Genus database with same CATH superfamily
2VUBA 5GMKh 4A53A 2OTJA 1X2QA 3QJYA 3UATA 3CCLQ 4EMHA 3JCMd 3HHTB 3M0RA 3UT1A 1RLPC 2DTIA 1Z9QA 3CCRT 1OPLA 3SWNC 2GQIA 3KBGA 1FMWA 2RI2A 3H8ZA 4RTUA 2HQEA 4LDWA 1X6GA 1YBYA 3JCMQ 1NLOC 4OP0A 3QSUA 5D6WA 2F5KA 4LN2A 4Y28E 2QEXQ 1QP3A 4X9DA 1W2BP 1VQMT 4WTOB 3REAB 5LJ5d 1VQ8A 1WLPB 4XTYA 4FYVB 1C0MA 2EYYA 3OYHA 2HSEB 2VVKA 3PGGA 4FIBA 5D6XA 1NPPA 4QW2A 5CK9A 1KJWA 2CSIA 5DY9A 2VKNA 1Y96B 1TG0A 1SEMA 5J39A 5IHNA 1U1SA 2XICA 5D6YA 1YJNQ 4D8DA 3LH5A 4M78G 1YJ9A 2C0OA 4M78E 1WJRA 3TREA 2C0IA 3G71A 1T3LA 3ZEHA 5CAIA 5A0DA 1D3BB 4DBHA 2HQXA 2VASA 1K4US 3M57A 2RNAA 2FPDA 4BY6C 3L1AA 3EFOB 1Q7YR 3JB9J 1LCKA 1YITA 4F14A 2KAFA 3VYHB 1M8MA 2EYZA 3QDFA 1A0NB 1PKSA 1YI2T 5CIUA 5IHIA 2RJDA 3RNJA 4C0DB 3E9FA 5I22A 2QDYB 3NGPA 1KFZA 3CCEA 3CCQT 3LX7A 3SHWA 4L6V5 2E1HA 1KQ1A 2FHDA 4OGCA 2J06A 4BUGA 4CRIA 2LMJA 1PSFA 1DJ7B 2LTOA 1QP2A 1M2VB 5FW9A 1Q82R 1D0YA 1VQ9Q 1UDLA 4HVWA 3I55A 3EAEA 1I07A 1YIJQ 1U06A 1B34A 4M4ZA 2DVEA 4D6WA 1U3OA 4J8OA 4KBMB 3R6NA 4XU2A 1SF9A 1AWJA 2QQAA 2CP5A 2OI3A 1EIFA 1H92A 4HVUA 2J7IA 1PD0A 3VS1A 1VYUA 1UHFA 2GQVA 1KK7A 2HAXA 1UB4A 2LT1A 3EH2A 1QW1A 1M3CA 4RTYA 4BE2A 3OY9A 1AHJB 3CCJA 5A0GA 2COZA 1RAIB 1S72Q 5IT9E 4PJOC 1PWTA 2LNHB 1GXIE 2QGGA 1M8VA 1QWFA 5HK3A 1VQ5A 1AWXA 4QVDA 2GBQA 2RH2A 2JVVA 5FWBA 3FB9A 4QKUA 3EG9B 4B6MA 3MEUA 4JPBW 3CEYA 1WGSA 2NUZA 3NTKA 2KSSA 3OYBA 1BU1A 2RHYA 3P8BB 2HL5C 4YTLA 3NMZC 4J6XA 2GFUA 4XQ3A 5LJ3f 4NL3A 3BY7A 4DEXA 4OGEA 4KH0B 1HD3A 2M16A 3G4SA 2MK5A 3AT1B 4C0FA 5DLOA 2V8IA 1OYXA 4BY6B 1D0XA 4E7HA 2O4XA 2EQUA 3PFSA 1FYNA 4V2SA 2HDAA 2LDMA 4M77F 3UF4A 1YJWA 1XQHA 2K5LA 4M7AC 4KGZB 3H41A 4L5GA 2QQRA 4II1A 5KYYA 4M77B 5A2QE 3CC2A 3OA6A 4HCKA 4PJJA 1OX8A 3FIFA 2KMTA 4JZ3A 2A0FB 4AG1C 3QIIA 4C5EA 5C0MA 1TOVA 4JS5A 4XTZA 3P8DA 2M0OA 1GCQC 4OMLA 3EGDA 2M02A 2FZGB 4M7DF 3S3OA 1K76A 2AK5A 1SHFA 2LP5A 5A0LA 2IIMA 4LNPA 5J26A 2OTLA 1MV0B 5AT1B 3CMET 2K5IA 1PHTA 1Q7YU 3GOXA 1WXTA 1SG5A 1Z9ZA 2QASA 1VQ7A 2GFAA 4FYYB 4PJOF 5HY6A 2MI6A 3SD4A 4BE0A 4F17A 3F70A 4M75F 1FMVA 5FWCA 4PJOB 4C0GA 4F16A 4J9BA 3BE3A 3MCAB 2EWNA 3OYKA 3MJXA 4Z89A 3HL8A 3C95A 2LNVA 4WCIA 1ZHIA 1IHWA 4MDWA 4LE9A 2KT1A 1G5VA 2SRCA 4KUIA 1VQNA 2JS2A 2KEAA 3QZ9B 1HYOA 3CC4Q 3HKSA 8ATCB 2EVRA 1Y57A 1D1BA 3RMSA 4M77D 4KH1B 3X24B 1Q82U 1U5SA 4XTVA 2DYBA 3JCMc 3G6EA 2V1RA 1I5OB 5DM7R 3ZFJA 1WHLA 2MF2A 1YHQQ 1WHKA 4J9GA 4J6WA 3JCMP 3OYYA 2KBTA 4GY5A 2D1XA 2EQKA 4HCBA 4M7AF 2MOXA 4DBRA 2AKLA 3LGLA 4JRQA 3Q1JA 3TVTA 5AYFA 4M7AB 4C8QA 5GANg 1UECA 2D8JA 3GBQA 1QKWA 1PM3A 4Y92A 4J9EA 2MPXC 4C5HA 4M7DD 2KRSA 2RI3A 1X27A 1WXBA 4E2FB 4HT8A 3A1PA 1SHGA 1VQPA 2QTVA 2VWFA 5FU6B 1K73C 4XTUA 2LCLA 2L3RA 4PJOD 1YWOA 2R57A 3M5AA 3JCMW 1RAFB 3JB9I 1QVFA 4M75D 1N6AA 3SFMA 5I2MA 2DL3A 3A8MB 3L2QA 2L0AA 5GAN3 3JCMg 3OMCA 4IUTA 2LJ3A 2H3JA 3CCLT 2AKKA 5LJ3e 1M3BA 2EYWA 1M5Q1 2YSQA 4X1VA 3FJPA 4RTTA 4KUDK 1ZA2B 3MP8A 4J83A 1T3SA 1Q86C 4AMCA 5CQYA 3CCRA 2YT6A 2GNCA 1RI0A 2RQVA 2LJ1A 2ENMA 3PNWC 3C94A 3OQ5A 5LJ5g 1QVFS 2V8JA 3RESA 1GFCA 1AWWA 3RERA 1RAEB 3CXCS 2X4YA 4ZTFA 1BCMA 1VQMA 2K2MA 4PJNA 1N27A 1MHNA 4FYXB 2PTKA 4M7AD 1G3TA 2PU9B 2EQIA 3CBPA 1W6XA 2L3SA 2VC8A 2M0YA 4ATOA 1BIAA 4RTXA 1YJNT 2HL3A 4M77G 2HEQA 4M77E 4FT4A 4RKUE 3FLGA 1WX6A 2GCXA 2RQWA 2J6KA 3HSBA 2KGTA 1WQWA 2ZZDA 5GJWB 4F7UG 2ZPHB 1RLQC 1TSFA 1WZOA 4F7UE 5GAN4 1M1KR 2LCSA 4RCBA 1N5ZA 1K8AR 4C92C 4AG2C 2YHTA 3OYCA 4RG2A 2ROLA 4B9WA 3SEMA 3MHXA 3CCVT 1W70A 5FROA 5GAN6 1ZSGA 4E7JA 4OMQA 5KYNA 1IHVA 4A63B 4HT9A 2NUPA 4HVVA 3E9GA 4CC7A 2PUKB 4R56A 1MUZA 4ZGEB 1ZX6A 1I8FA 2K3BA 2HQHA 1ARKA 1YI2A 2MYSA 1Q95G 2ZPGB 5GMKe 2YUNA 4FW2A 1LJOA 1Q7YC 1VIEA 3CXCP 1W2BA 2A28A 3CCQA 4HCCA 3PMIA 4M78D 3JSCA 1VYVA 7AT1B 1AZGB 1UGPB 4PJOG 4TVRA 4D8KA 1VQKQ 1LOJA 4PJOE 2EYQA 3PVLA 2KK4A 1MMAA 4P5NA 1VQ9T 4IIMA 1BI1A 1IXDA 3A98A 3GIBA 2I0NA 1KG1A 4X34A 2KXDA 1QVPA 5GMKi 1QLYA 3GPLA 3WVDB 1OZ3A 1Q82C 4VUBA 1UFFA 2DO3A 2DPPB 1K0XA 1WJQA 4JDSA 2GTOA 2QQSA 2V26A 4NL2A 2DXUA 1K73R 4BE1A 2YLBA 5LJ3j 2IPOB 3OYLA 2XHCA 1VQLQ 1T0HA 2ED0A 4M75A 2K4YA 2CP7A 4QVCA 1S72T 4OF1A 3GLXA 2DIGA 1OQKA 4M7AG 1D1CA 4RMOA 4M7AE 1PCXA 3I56Q 3CCJQ 2PVDB 4RTVA 4C8QC 5GAN2 3S3NA 2M1HA 2YUPA 2FRWA 1OOTA 1KQSP 2RI5A 1E6GA 1UTIA 3M55A 3QG1A 1Q86R 2BZYA 3QPHA 1SKUB 2B8AA 3DLMA 5L8RE 2L5QA 2LJ0A 4C92B 1AZEA 2XD0A 2XIDA 3FC3A 4R55A 2NUTB 3META 4FYWB 4J9IA 3VS2A 2DL4A 3AHUA 1B07A 1D1AA 2G6FX 3HFNA 1JXMA 1P92A 2JXBA 2YXYA 2CP6A 1ZUUA 1V1CA 1ZLMA 3CCUQ 2A36A 5M9OA 3MO8A 3LLRA 5KH6A 2CZ6B 1NJIR 2HKNA 1VQOQ 2CP0A 3X20B 3EG1A 2NYSA 3GP8A 1IREB 2JJ9A 2E41A 5GANh 1AOJA 2Y4YA 3OSSC 2E64A 2CREA 1NYGA 2DTHA 2K2VA 3VV0A 4J6YA 2V1QA 1QCNA 2DD4A 2CP3A 2K7AA 3LGFA 2D0NA 3MP1A 5GAOn 1UHCA 1NBEB 1M1KU 4QVZA 5GMKj 2HBWA 2OAWA 1K8AU 5KYUA 2DRMA 4DBQA 2DRKA 2Z0WA 5GAOp 1QKXA 4EMGA 3QZ5B 2DILA 4FT2A 3HRSA 2ZPEB 1TXQA 2AZSA 3CMEA 4EDUA 2W10A 4OMFB 3JCMh 1AVZC 4ZN3A 2E12A 2OAUA 4XK8E 2FEIA 2QK0A 4M78A 2SEMA 1I4K1 1ABOA 1ZQ1A 1OPKA 4PJLA 4LDXA 2JT4A 4E7IA 3PVQA 3VUBA 4RTWA 1TS9A 2J05A 3NTIA 3RMQA 3LYIA 4XAXB 5LJ5h 2JTFA 3LWHA 1SSHA 3CC4T 2HNIA 3DKMA 2ABLA 3CPWA 3CMAQ 1TH7A 2EGEA 4AFZC 4BDZA 2EW3A 1WA7A 2DJZA 3JB9H 4IURA 4QQ6A 1E7OA 1YHQT 3SWNB 2JW4A 4ZGJB 1U1TA 4ELZC 1ZBJA 2E5QA 3VKIA 1G3SA 1VQ6Q 4RTZA 5KCHA 1ABQA 2EGAA 3QYHB 1KD1R 3LW5E 2LZ6B 3CPWS 3M4YA 4C5IA 1K73U 4JJBA 3JB9F 2DETA 2HKQB 4NOYA 5KYWA 2RA2A 2A7YA 2YUOA 2KVQG 2XDPA 3A8OB 1RAAB 1ZSZA 1H3ZA 2JM9A 3CBOA 2DMOA 3EGXA 2O9VA 3J81E 2DL7A 5CCAA 3CCST 4N4HA 5DLQE 4ZN1A 2QYZA 3M4GA 4JUVA 1Q86U 5FU7C 1MMGA 5LJ5j 1LNXA 1XNIA 2CT3A 2P0PA 4LD6A 3V7CA 2EYXA 3UPUA 3H9NA 2VGMA 3O5ZA 2QQ9A 3D7SB 1N8RR 4N0AA 3QXEB 1X69A 5KYXB 3HRUA 5I2SA 3VS5A 3CBMA 5HK0A 1V29B 2LVMA 2EFIA 3CCMQ 3E19A 1QMCA 2CZ1B 2VGNA 3VS3A 3CCLA 1Y71A 4PKCC 1UGVA 1RL2A 4HXJA 5GMKl 2COWA 5IXBA 3OYIA 4J9HA 2F2VA 2XI9A 4A4KA 2CYZB 1NJIU 1BI0A 2AIRB 3NPFA 1JJ2A 5CKHA 4J7FA 4BDYA 4C92G 4C92E 2E5KA 3CPWP 4F7UF 2LQWA 4OMPA 2LQNA 4ZNXA 2RF0A 2OX7A 4F7UB 3QUIA 2YWWA 3GNFB 1WXUA 3EG3A 1CSKA 2QA4Q 3OS1A 1YNZA 2YLCA 1PKTA 3C4SA 1YFNA 2H8HA 2C06A 1X75C 2P0KA 3JB9D 2DD5A 1JJ2S 4EPCA 1WYXA 3QWYA 2YRDA 5GAN7 4PLIA 1RABB 2OJ2A 2KRNA 1S1NA 1YJNA 2X4JA 3BDUA 1G8XA 1Q81R 2MMPA 3A8HB 4JJDA 4N4GA 3OYEA 4LUDA 2YRVA 2DBKA 1H8KA 2JTMA 4IIOA 3CCVA 2HCKA 2FZKB 3E1SA 2QI2A 1M1KC 4HCZA 3EHRA 4QT7A 2QAZA 1K8AC 1IB8A 2LT4A 3I5RA 4E7ZA 3UA6A 2E3HA 4JLGA 1X6BA 2G3RA 1VIFA 2K3XA 1O75A 1Y96A 4CC3A 3OYGA 4FL6A 3FJ5A 3ULRB 4OMNA 3OBWA 5CR2A 2JOYA 1AT1B 2LQKA 2DZ9A 2X3XD 3VS4A 2BE7D 1VQKT 2KRMA 4GBQA 4EMKA 3QYGB 4PJMA 4OB3B 3CCQQ 2EQJA 2CDTA 1WNLA 1W1FA 1JJ2P 1R77A 4C8QG 1D3BA 4C8QE 2JN0A 2Y90A 1VQ9A 4JZ4A 5GMKm 2KI7A 1KD1U 1HJDA 3EFOA 9ATCB 3R6OA 4CI0C 5D7UA 3RKYA 2CSQA 3CC7T 3CD6Q 1UG1A 1SRLA 3V8KA 5GANf 1UEBA 3NTHA 4E6RA 3M59A 1OI1A 3TEEA 3DB3A 3KFVA 5GAMd 1WPYA 3G7ZA 1NYFA 1VQLT 2AT1B 4X9CA 1MNDA 1Y0MA 4LDUA 4PNOA 1QCFA 4MZTA 2DEUA 1VQ4Q 4FSXA 3J80E 1BI2A 3OS2A 1S72A 3I56T 1TWBA 2AZVA 2RK1A 1UJYA 2K3YA 3UA7A 2FL7A 3JB9G 1M2VA 3M0PA 4DQ2A 3UWNA 5GJVB 1N8RU 2RN8A 4R0KA 3CXCA 3NHNA 3JCMf 4XU1A 2A37A 2OTJQ 3PT9A 2F2XA 1NEGA 2KT8A 1N9RA 2MAMA 2X51A 5HKCA 1MV3A 3PIPA 2WSCE 5IXFA 2QEXT 3EH1A 5LJ3d 3CCUT 2DTOA 4N0AC 5LJ5f 1KHIA 1VQOT 3GNGA 4A4HA 1ZUYA 2XDDA 5CQXA 4LD9K 1VQ8Q 1YCSB 2X4XA 2J6FA 1QQJA 3EG9A 4XTWA 3PMTA 5GAMh 1NJIC 3EGUA 2O31A 2A08A 1TTHB 1D09B 2RB6A 1PC0A 3OYNA 1WIEA 3H0IA 1KQ2A 2EQMA 1IZ6A 1JXOA 2KR3A 4ZGDB 3HFOA 4RG8A 4OMOA 1Q81U 4AFUC 2CKKA 3V7SA 4AT1B 3OW2P 2FPEA 5IN1A 2LC4A 1YJ9Q 1NZ9A 3M54A 1PRMC 1WJSA 1G3YA 2CH4W 3URGA 4IUUA 2ZAEA 1KQSA 3G71Q 2LQ8A 2QDLA 4OB1B 3INZA 3REBB 1WHMA 2E65A 2J6OA 1M27C 3BW1A 3L2UA 3MP6A 5IH2A 4FW1A 2QXFA 2PQWA 4M77A 1SSFA 1IGQA 1B34B 3V7RA 1HXDA 4FCYA 2NWMA 4BI3A 2CUBA 4J9CA 4BD3A 4QQGA 1KSWA 1I5LA 3FDRA 3TQ7P 1YITQ 5CKBA 3OB9A 1LVKA 3EFRA 1G2BA 1GCPA 2VB6A 1X6OA 1KQSS 3JCMJ 2QG9B 3U23A 4GLKA 3V8JA 2DLPA 1PSEA 5KYWB 2CZ0B 1N9SA 2DL5A 2JTEA 1Y07A 3M58A 4JRIA 3CCEQ 3CMAT 2DK3A 3DLLA 3CC4A 1IO6A 4A4EA 3JV3A 1VA7A 2DZCA 1OU9A 4BB7A 2ZGWA 2O9SA 3VRYA 1YIJT 5CKEA 4M7DA 1BK2A 2RPNA 3A5ZB 3N5BB 2ATCB 2EJ9A 5FLXE 1YHQA 1VQ6T 4PFPA 4FU6A 2HSPA 2DKGA 3I55Q 4ZTJA 1NM7A 1KC8R 2R58A 5GANe 3I35A 5IAYA 4EMKC 5KE2A 1YWPA 1BB9A 2EPDA 2F69A 4PJOA 2WSEE 2PVGB 2DXTA 1M9SA 4DBFA 2C0TA 1VUBA 1KD1C 3QJ6A 2ESWA 1YP5A 3GF5A 4BI8B 2O4XB 1T0JA 1GRIA 2LRQA 1EZZB 2O01E 1RUWA 4KRTA 4O5VA 2K6DA 5KYYB 3M0UA 1VQ5Q 3EG2A 2ED1A 2MIOA 3CCSA 4OMMA 5J3BA 2A3LA 1H641 1NLPC 4C92F 1WFWA 4KGXB 2DERA 1UJ0A 3I5SA 2EJGA 4MZPA 3QO3A 3JCMe 4CC4B 3QDRB 3CCMT 1IRXA 1PNJA 2RK2A 2RM4A 2E4HA 5FRNA 1R0CB 2DA9A 1BKBA 4GLMA 4M7AA 2DF6A 2DXCA 4A4FA 3L2RA 1N8RC 3EGDB 1RAHB 3G4SQ 3A8GB 1HSQA 4MZMA 1MNEA 2FVUA 4JRPA 1JEGA 2L2PA 5LJ5e 1M90R 4J9DA 1AEYA 1Y7XA 1NG2A 1SRMA 3C0CA 1YJWQ 3M56A 4PLLA 2O88A 3RUXA 2WACA 3VU3C 2QQBA 3CC2Q 2K57A 2QA4T 5LL6S 3DB4A 5CO7A 2KXCA 1GCQA 3X26B 1I81A 3VS0A 3PTAA 1M4ZA 1JQQA 2DL8A 2P84A 3L2VA 2KY9A 3BDLA 4KULA 2PUOB 4J7IA 1XTDA 4K11A 4IUPA 2ZPFB 3RKXA 3OSVA 2VYTA 4QQDA 3T9NA 4A4GA 2LX9A 3MEWA 3PE0A 4JRKA 1GBQA 2IVWA 3MKDA 5IHKA 1UUEA 4EMKB 2BZXA 2COYA 1Q81C 2OTLQ 3QBYA 2DEQA 1BI3A 4C92D 4XU3A 2DX1A 1C6VX 2E70A 1OULA 2BIVA 2ROTA 3CCVQ 1VQ7Q 4C8QF 1J3TA 3EHQA 3X25B 3SB2A 2FRYA 4C8QB 2XK0A 5ECAA 4AFSC 1O9SA 5GANj 3A8LB 2XMFA 2K9GA 1QWEA 3E2UA 5KCOA 3EFSA 3CPFA 1RACB 4M77C 1X2KA 1VQNQ 2FZCB 2BZ8A 3BFMA 1U8RA 3OMGA 2CP2A 1M1FA 1VQKA 4N4IA 4J5YA 1BYMA 2K5FA 1JRIA 2AHJB 4ELYC 3JAME 3G6EQ 4JS4A 1G83A 4JJNK 2ZPIB 3H0FA 2D6FA 1UE9A 1KC8U 1WQ7A 2KROA 3X28B 1M3AA 2JS0A 1YCYA 4E7SA 4AFQC 3CD6T 2PNIA 3C12A 2QTXA 2MCNA 5GAMg 3TU4K 3OYDA 4XTXA 3CC7A 1V76A 2JM8A 2KYBA 5GAMf 3M53A 4M7DC 2JUFA 2P4RA 3LWIA 3QKJA 2RJCA 2YUQA 1I1JA 3MEVA 3PIOA 2BUDA 5CKFA 4UC4A 3UDCA 2CZ7B 1ZA1B 1VQLA 3M0QA 1VQ4T 1PD1A 1TUDA 2XKOC 2DBMA 5GAOq 3L42A 3HTRA 3RBBB 6AT1B 3I9QA 3I56A 1VQPQ 2P0QA 2DAQA 4MMLA 4OB0B 4LXCA 1TUCA 3HP9A 3ER0A 3IQLA 4M75C 4KT0E 1K9AA 4C8QD 1B7TA 1MMNA 1C1AA 1UGQB 2DJQA 2YRCA 2FO0A 4DEYA 2OTJT 1JB0E 1K9MC 5I11A 3OYMA 1CKAA 4O6JA 2R5MA 2F5TX 5LJ3g 2RHIA 2DFUA 5GAN8 1IGUA 1M90U 5GAOl 4CC2A 3CCRQ 3RKWA 4KGVB 3ZL7C 2QEXA 3CCUA 2BTTA 2JNGA 8AT1B 1VQOA 1VOMA 2RO0A 2XU8A 4EIKA 1VQ8T 2NUPB 1XOVA 1VQMQ 2D0QB 2D9TA 1GL5A 4IUVA 3G1JA 3TSWA 5L23A 3VS7A 1TU0B 2RHZA 3FEOA 3L2WA 1OZ2A 4C92A 1ZUKA 2HBPA 2NUTA 1YJ9T 1OV3A 4NS5A 5FU6C 3G71T 2VXEA 1WHJA 2EKHA 3O8VA 2DNUA 4DOVA 1UGRB 4M7DB 2JZ2A 2M9UA 4PFOA 1MGQA 2RHXA 3ME9A 4RUGA 1YITT 4Y91A 2RQUA 4MMKA 1OEBA 2CH4A 1FX7A 2M51A 4OB2B 3VJPA 5FU7B 3FRNA 4IKFA 3JRZA 1YI2Q 3HRTA 2DM1A 3VRZA 1GBRA 4MDXA 4BACA 5FRMA 3CCET 1SPKA 4M78C 2RMOA 2DXBA 4WF2A 4M75B 5I21A 3EG0A 3NFCA 2NLUA 2E6ZA 2FG0A 3M0SA 3CMAA 4PK4A 2GGRA 2RJEA 2GF7A 2EBPA 1QVGA 1PRLC 4B9XA 4Z8AA 2PZ1A 5EG2A 1WDXA 2RJFA 1YIJA 2B86A 2EJFA 4DOWA 2ZCFB 3I55T 1VQ6A 4L59A 5CKDA 4RCCA 3OYJA 2KE9A 5GAOm 4ORZA 2WSFE 3OW2A 2L8DA 3P8HA 3H0HA 5GAMe 1OU8A 2JMAA 4ESRA 1NE8A 1R0BG 3MPUB 3S3MA 1QVGS 2EKOA 1K1ZA 2KNBB 4E7LA 2LCCA 3OYFA 1KC8C 1F1BB 2KDSA 3TCJA 1RI9A 1GFDA 4Q5WA 1RADB 2I2LA 2CUDA 1AD5A 3CCJT 1EX4A 1EFNA 2L3PA 3OW2S 4XU0A 1VQ5T 1K9MR 1M1GA 4HA8A 4A54A 2CT4A 2BKDN 2FYKA 3ASKA 4LUEA 2KYMA 1WI7A 4IUQA 3SWNA 4C5GA 1ZSZC 3TSZA 3CCSQ 3M0TA 1X01A 1JU5C 2ZPBB 4Z02A 3SDZA 3CCMA 1KIKA 4LDYA 1D0ZA 1OX9A 1BCOA 2EAYA 3RIRA 3V8LA 4BI4A 3OS0A 3G4ST 5C6SA 2DE0X 5KYUB 2XG8D 2LX7A 4ANJA 3S6WA 1X43A 3ZBDA 1W4SA 1YJWT 5GAOr 2MWOA 1XJWB 2DVJA 1WHHA 3L2ZA 3HPWA 4DA4A 4M78F 2RHUA 3CC2T 2E3IA 1QVGP 2VV5A 4M78B 1M90C 4JLIA 2QA4A 1K0SA 1MMDA 3H6ZA 2GTJA 1E6HA 2HD0A 2FPFA 5KYXA 2JMCA 3THKA 2L89A 2EIFA 2FB7A 1FWZA 1KHCA 1ACMB 1M30A 1M2OA 2K79A 4JJCA 2XDBA 1NEBA 4C0ZA 2RD1A 4PL6A 2F1LA 2CGHA 3J7AF 5EC7A 4PFZA 2EGCA 2OTLT 1I0CA 1LPLA 1VYTA 2W0ZA 1B3QA 3CMEQ 2DYIA 1AWOA 2BE9B 1VQ7T 1FXXA 4F7UA 3MEAA 4J9FA 5GAN5 2X4WA 5LJ3h 2HZYA 2RQRA 3JCMX 4LDVA 1QCOA 2X35A 4FSSA 4M7DG 2E6NA 3KUFA 1TUGB 4FM4B 5GAMj 4M7DE 1QVFP 1VQNT 1JBMA 1ZSZB 1NPRA 1H3HA 2KQWA 3VYGA 3EGXB 4E7KA 3M9QA 3JCMV 2QGFB 2V8KA 2PVOB 2D8HA 2L3QA 2MWPA 2R5AA 3LH0A 2RQTA 3G6ET 1HK9A 3RDVA 1R8OB 2P4TA 4M75G 1PG5B 4M75E 5CVIA 4ME7A 4HKEA 2E10A 3OYAA 1ZBXA 3KXTA 1CKBA 3QWXX 2H3EB 3CD6A 3WXMB 5KE3A 1W2BS 2X9HA 4OVAA 2CS7A 2IG0A 1YN8A 3CC7Q 1RAGB 5GANd 1BBZA 1UGSB 3VUZA 1VQ4A 1K9MU 3JCMb 2O2OA 1WHGA 2VXFA 5HCKA 2HMAA 1VQPT 3OBYA 1G3WA 4F04B 4C0DC 1JO8A 3RR6A 3VS6A 4Z88A 2YDLA 3QHSA 3CQTA 2F2WA 2Y4XA 3OS5A 2ECZA 1BIBA 2X3WD 4E47A 2DIQA 3WVEB 1FMKA
chains in the Genus database with same CATH topology
2MCNA 1W6XA 2L3SA 4CC3A 2M0YA 2JM8A 4RTXA 2KYBA 1X2QA 3UATA 3FJ5A 3ULRB 2HEQA 4OMNA 2P4RA 3M0RA 1WX6A 1RLPC 2YUQA 1I1JA 2RQWA 2J6KA 1Z9QA 1OPLA 2KGTA 2GQIA 3M0QA 5GJWB 1RLQC 1TUDA 2X3XD 3VS4A 2LCSA 2DBMA 2KRMA 1N5ZA 4GBQA 4RTUA 1X6GA 1NLOC 4AG2C 3RBBB 3I9QA 2CDTA 2ROLA 4LN2A 3SEMA 1W1FA 1W70A 1ZSGA 1TUCA 3REAB 4OMQA 1WLPB 4JZ4A 4A63B 3IQLA 1K9AA 4HVVA 2EYYA 2VVKA 4CC7A 1HJDA 1MUZA 1KJWA 2CSIA 2DJQA 2VKNA 2FO0A 1TG0A 2CSQA 4DEYA 1ZX6A 1UG1A 1SEMA 1SRLA 2K3BA 5I11A 5IHNA 1ARKA 1CKAA 4E6RA 3KFVA 2YUNA 4D8DA 3LH5A 2C0OA 1NYFA 2A28A 4CC2A 1Y0MA 2C0IA 3ZL7C 1QCFA 1VYVA 1AZGB 1T3LA 2BTTA 4D8KA 3PVLA 2AZVA 1UJYA 3UA7A 4EIKA 4IIMA 3A98A 1XOVA 2I0NA 3M0PA 1K4US 5GJVB 2RNAA 2FPDA 2KXDA 1GL5A 2RN8A 1QLYA 4R0KA 1LCKA 3NHNA 3TSWA 4F14A 5L23A 3VS7A 1M8MA 1UFFA 2A37A 2EYZA 1K0XA 1A0NB 1PKSA 2GTOA 5IHIA 2F2XA 1ZUKA 3RNJA 1NEGA 2KT8A 1MV3A 1OV3A 5I22A 3NGPA 1KFZA 5IXFA 3SHWA 1T0HA 2ED0A 2J06A 2LMJA 2EKHA 4RTVA 2DNUA 5FW9A 1ZUYA 2YUPA 2FRWA 1OOTA 1UDLA 1YCSB 1E6GA 2J6FA 1UTIA 4HVWA 1I07A 1U06A 2BZYA 4M4ZA 4RUGA 2RQUA 3EGUA 2O31A 2A08A 1OEBA 1U3OA 2CH4A 3R6NA 2LJ0A 1AWJA 1WIEA 3H0IA 2OI3A 2M51A 1AZEA 1H92A 4HVUA 2KR3A 1JXOA 2J7IA 3VS1A 4OMOA 4J9IA 1VYUA 4AFUC 2DM1A 1UHFA 3VS2A 3VRZA 1GBRA 2FPEA 2DL4A 1SPKA 2RMOA 1B07A 2G6FX 3EG0A 1JXMA 1PRMC 2JXBA 2FG0A 2CH4W 1M3CA 1ZUUA 3M0SA 4RTYA 1V1CA 1ZLMA 2GGRA 2QDLA 2A36A 3REBB 1PWTA 2EBPA 2LNHB 1PRLC 1QWFA 2J6OA 4Z8AA 1M27C 2PZ1A 1AWXA 1WDXA 5IH2A 2GBQA 2B86A 3EG1A 5FWBA 1AOJA 2KE9A 2NWMA 4JPBW 2CUBA 2CREA 1NYGA 4J9CA 4ORZA 1KSWA 2NUZA 1BU1A 3NMZC 3H0HA 1G2BA 1GCPA 2V1QA 2K7AA 2D0NA 2JMAA 4ESRA 3U23A 2DLPA 1UHCA 1K1ZA 2KNBB 4DEXA 1HD3A 2DL5A 2JTEA 1RI9A 1GFDA 2CUDA 2HBWA 2OAWA 1AD5A 1IO6A 2DRMA 1EFNA 3JV3A 1FYNA 1VA7A 2L3PA 2HDAA 3UF4A 2O9SA 2DRKA 3VRYA 3H41A 1QKXA 1BK2A 2DILA 2RPNA 2CT4A 2AZSA 4LUEA 2KYMA 1WI7A 2W10A 1AVZC 2FEIA 3TSZA 2HSPA 4HCKA 3M0TA 2SEMA 1NM7A 1JU5C 1ABOA 1OPKA 1KIKA 3I35A 2JT4A 4JZ3A 1YWPA 1BB9A 2EPDA 4AG1C 3PVQA 4RTWA 2J05A 2C0TA 1GCQC 2ESWA 1YP5A 2DE0X 1SSHA 4OMLA 2LX7A 2ABLA 1T0JA 1X43A 1GRIA 1K76A 2AK5A 1SHFA 2LP5A 2EGEA 4AFZC 1RUWA 2EW3A 4KRTA 2IIMA 1WA7A 4LNPA 2DVJA 2K6DA 1MV0B 3M0UA 3EG2A 2ED1A 2MIOA 1E7OA 4OMMA 2JW4A 1NLPC 1ZBJA 1WFWA 1PHTA 1WXTA 4RTZA 1K0SA 1ABQA 1Z9ZA 1UJ0A 3I5SA 2EGAA 4CC4B 2GTJA 1E6HA 4F17A 2FPFA 2LZ6B 1PNJA 2JMCA 5FWCA 3THKA 4JJBA 4F16A 2DA9A 4J9BA 4GLMA 4Z89A 2DF6A 1M30A 2YUOA 4WCIA 2K79A 4LE9A 2KT1A 2SRCA 4JJCA 1HSQA 1NEBA 2JS2A 2JM9A 2KEAA 2DMOA 2EVRA 2L2PA 1Y57A 2O9VA 1JEGA 2DL7A 4J9DA 1AEYA 5EC7A 1NG2A 1SRMA 3C0CA 2EGCA 1I0CA 1VYTA 1U5SA 2W0ZA 2DYBA 2O88A 1B3QA 2V1RA 1AWOA 4J9GA 2CT3A 4J9FA 2KXCA 2EYXA 1GCQA 2KBTA 3O5ZA 3VS0A 2D1XA 1X69A 2RQRA 2MOXA 1JQQA 2DL8A 3VS5A 2AKLA 4FSSA 3TVTA 3VS3A 1UECA 2D8JA 4K11A 1UGVA 3GBQA 4HXJA 1QKWA 4Y92A 4J9EA 1H3HA 5IXBA 2KRSA 4J9HA 2F2VA 1X27A 1WXBA 3PE0A 1GBQA 3NPFA 2D8HA 2L3QA 5IHKA 1UUEA 1SHGA 2E5KA 2BZXA 2LQWA 2RQTA 2LQNA 4OMPA 2VWFA 4ZNXA 2RF0A 2DX1A 2ROTA 1WXUA 3EG3A 1CSKA 1YWOA 1YNZA 1J3TA 1CKBA 3EHQA 1PKTA 3QWXX 2FRYA 2H8HA 2DL3A 2L0AA 2LJ3A 5ECAA 2AKKA 4AFSC 1WYXA 3QWYA 1M3BA 2OJ2A 2KRNA 2EYWA 2YSQA 1S1NA 2XMFA 2K9GA 1QWEA 4X1VA 1YN8A 4RTTA 4JJDA 1BBZA 1T3SA 1X2KA 4LUDA 2YT6A 2BZ8A 2GNCA 2DBKA 2O2OA 2RQVA 2LJ1A 2ENMA 1H8KA 5HCKA 4IIOA 1GFCA 1AWWA 1JO8A 3VS6A 4Z88A 2YDLA 2HCKA 1G83A 2K2MA 3H0FA 3CQTA 1UE9A 3EHRA 2F2WA 4QT7A 2ECZA 2KROA 1M3AA 2JS0A 2PTKA 3I5RA 2X3WD 3UA6A 4AFQC 2EQIA 2PNIA 1X6BA 1FMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCN A;  1W6X A;  2L3S A;  4CC3 A;  2M0Y A;  2JM8 A;  4RTX A;  2KYB A;  1X2Q A;  3UAT A;  3FJ5 A;  3ULR B;  2HEQ A;  4OMN A;  2P4R A;  3M0R A;  1WX6 A;  1RLP C;  2YUQ A;  1I1J A;  2RQW A;  2J6K A;  1Z9Q A;  1OPL A;  2KGT A;  2GQI A;  3M0Q A;  5GJW B;  1RLQ C;  1TUD A;  2X3X D;  3VS4 A;  2LCS A;  2DBM A;  2KRM A;  1N5Z A;  4GBQ A;  4RTU A;  1X6G A;  1NLO C;  4AG2 C;  3RBB B;  3I9Q A;  2CDT A;  2ROL A;  4LN2 A;  3SEM A;  1W1F A;  1W70 A;  1ZSG A;  1TUC A;  3REA B;  4OMQ A;  1WLP B;  4JZ4 A;  4A63 B;  3IQL A;  1K9A A;  4HVV A;  2EYY A;  2VVK A;  4CC7 A;  1HJD A;  1MUZ A;  1KJW A;  2CSI A;  2DJQ A;  2VKN A;  2FO0 A;  1TG0 A;  2CSQ A;  4DEY A;  1ZX6 A;  1UG1 A;  1SEM A;  1SRL A;  2K3B A;  5I11 A;  5IHN A;  1ARK A;  1CKA A;  4E6R A;  3KFV A;  2YUN A;  4D8D A;  3LH5 A;  2C0O A;  1NYF A;  2A28 A;  4CC2 A;  1Y0M A;  2C0I A;  3ZL7 C;  1QCF A;  1VYV A;  1AZG B;  1T3L A;  2BTT A;  4D8K A;  3PVL A;  2AZV A;  1UJY A;  3UA7 A;  4EIK A;  4IIM A;  3A98 A;  1XOV A;  2I0N A;  3M0P A;  1K4U S;  5GJV B;  2RNA A;  2FPD A;  2KXD A;  1GL5 A;  2RN8 A;  1QLY A;  4R0K A;  1LCK A;  3NHN A;  3TSW A;  4F14 A;  5L23 A;  3VS7 A;  1M8M A;  1UFF A;  2A37 A;  2EYZ A;  1K0X A;  1A0N B;  1PKS A;  2GTO A;  5IHI A;  2F2X A;  1ZUK A;  3RNJ A;  1NEG A;  2KT8 A;  1MV3 A;  1OV3 A;  5I22 A;  3NGP A;  1KFZ A;  5IXF A;  3SHW A;  1T0H A;  2ED0 A;  2J06 A;  2LMJ A;  2EKH A;  4RTV A;  2DNU A;  5FW9 A;  1ZUY A;  2YUP A;  2FRW A;  1OOT A;  1UDL A;  1YCS B;  1E6G A;  2J6F A;  1UTI A;  4HVW A;  1I07 A;  1U06 A;  2BZY A;  4M4Z A;  4RUG A;  2RQU A;  3EGU A;  2O31 A;  2A08 A;  1OEB A;  1U3O A;  2CH4 A;  3R6N A;  2LJ0 A;  1AWJ A;  1WIE A;  3H0I A;  2OI3 A;  2M51 A;  1AZE A;  1H92 A;  4HVU A;  2KR3 A;  1JXO A;  2J7I A;  3VS1 A;  4OMO A;  4J9I A;  1VYU A;  4AFU C;  2DM1 A;  1UHF A;  3VS2 A;  3VRZ A;  1GBR A;  2FPE A;  2DL4 A;  1SPK A;  2RMO A;  1B07 A;  2G6F X;  3EG0 A;  1JXM A;  1PRM C;  2JXB A;  2FG0 A;  2CH4 W;  1M3C A;  1ZUU A;  3M0S A;  4RTY A;  1V1C A;  1ZLM A;  2GGR A;  2QDL A;  2A36 A;  3REB B;  1PWT A;  2EBP A;  2LNH B;  1PRL C;  1QWF A;  2J6O A;  4Z8A A;  1M27 C;  2PZ1 A;  1AWX A;  1WDX A;  5IH2 A;  2GBQ A;  2B86 A;  3EG1 A;  5FWB A;  1AOJ A;  2KE9 A;  2NWM A;  4JPB W;  2CUB A;  2CRE A;  1NYG A;  4J9C A;  4ORZ A;  1KSW A;  2NUZ A;  1BU1 A;  3NMZ C;  3H0H A;  1G2B A;  1GCP A;  2V1Q A;  2K7A A;  2D0N A;  2JMA A;  4ESR A;  3U23 A;  2DLP A;  1UHC A;  1K1Z A;  2KNB B;  4DEX A;  1HD3 A;  2DL5 A;  2JTE A;  1RI9 A;  1GFD A;  2CUD A;  2HBW A;  2OAW A;  1AD5 A;  1IO6 A;  2DRM A;  1EFN A;  3JV3 A;  1FYN A;  1VA7 A;  2L3P A;  2HDA A;  3UF4 A;  2O9S A;  2DRK A;  3VRY A;  3H41 A;  1QKX A;  1BK2 A;  2DIL A;  2RPN A;  2CT4 A;  2AZS A;  4LUE A;  2KYM A;  1WI7 A;  2W10 A;  1AVZ C;  2FEI A;  3TSZ A;  2HSP A;  4HCK A;  3M0T A;  2SEM A;  1NM7 A;  1JU5 C;  1ABO A;  1OPK A;  1KIK A;  3I35 A;  2JT4 A;  4JZ3 A;  1YWP A;  1BB9 A;  2EPD A;  4AG1 C;  3PVQ A;  4RTW A;  2J05 A;  2C0T A;  1GCQ C;  2ESW A;  1YP5 A;  2DE0 X;  1SSH A;  4OML A;  2LX7 A;  2ABL A;  1T0J A;  1X43 A;  1GRI A;  1K76 A;  2AK5 A;  1SHF A;  2LP5 A;  2EGE A;  4AFZ C;  1RUW A;  2EW3 A;  4KRT A;  2IIM A;  1WA7 A;  4LNP A;  2DVJ A;  2K6D A;  1MV0 B;  3M0U A;  3EG2 A;  2ED1 A;  2MIO A;  1E7O A;  4OMM A;  2JW4 A;  1NLP C;  1ZBJ A;  1WFW A;  1PHT A;  1WXT A;  4RTZ A;  1K0S A;  1ABQ A;  1Z9Z A;  1UJ0 A;  3I5S A;  2EGA A;  4CC4 B;  2GTJ A;  1E6H A;  4F17 A;  2FPF A;  2LZ6 B;  1PNJ A;  2JMC A;  5FWC A;  3THK A;  4JJB A;  4F16 A;  2DA9 A;  4J9B A;  4GLM A;  4Z89 A;  2DF6 A;  1M30 A;  2YUO A;  4WCI A;  2K79 A;  4LE9 A;  2KT1 A;  2SRC A;  4JJC A;  1HSQ A;  1NEB A;  2JS2 A;  2JM9 A;  2KEA A;  2DMO A;  2EVR A;  2L2P A;  1Y57 A;  2O9V A;  1JEG A;  2DL7 A;  4J9D A;  1AEY A;  5EC7 A;  1NG2 A;  1SRM A;  3C0C A;  2EGC A;  1I0C A;  1VYT A;  1U5S A;  2W0Z A;  2DYB A;  2O88 A;  1B3Q A;  2V1R A;  1AWO A;  4J9G A;  2CT3 A;  4J9F A;  2KXC A;  2EYX A;  1GCQ A;  2KBT A;  3O5Z A;  3VS0 A;  2D1X A;  1X69 A;  2RQR A;  2MOX A;  1JQQ A;  2DL8 A;  3VS5 A;  2AKL A;  4FSS A;  3TVT A;  3VS3 A;  1UEC A;  2D8J A;  4K11 A;  1UGV A;  3GBQ A;  4HXJ A;  1QKW A;  4Y92 A;  4J9E A;  1H3H A;  5IXB A;  2KRS A;  4J9H A;  2F2V A;  1X27 A;  1WXB A;  3PE0 A;  1GBQ A;  3NPF A;  2D8H A;  2L3Q A;  5IHK A;  1UUE A;  1SHG A;  2E5K A;  2BZX A;  2LQW A;  2RQT A;  2LQN A;  4OMP A;  2VWF A;  4ZNX A;  2RF0 A;  2DX1 A;  2ROT A;  1WXU A;  3EG3 A;  1CSK A;  1YWO A;  1YNZ A;  1J3T A;  1CKB A;  3EHQ A;  1PKT A;  3QWX X;  2FRY A;  2H8H A;  2DL3 A;  2L0A A;  2LJ3 A;  5ECA A;  2AKK A;  4AFS C;  1WYX A;  3QWY A;  1M3B A;  2OJ2 A;  2KRN A;  2EYW A;  2YSQ A;  1S1N A;  2XMF A;  2K9G A;  1QWE A;  4X1V A;  1YN8 A;  4RTT A;  4JJD A;  1BBZ A;  1T3S A;  1X2K A;  4LUD A;  2YT6 A;  2BZ8 A;  2GNC A;  2DBK A;  2O2O A;  2RQV A;  2LJ1 A;  2ENM A;  1H8K A;  5HCK A;  4IIO A;  1GFC A;  1AWW A;  1JO8 A;  3VS6 A;  4Z88 A;  2YDL A;  2HCK A;  1G83 A;  2K2M A;  3H0F A;  3CQT A;  1UE9 A;  3EHR A;  2F2W A;  4QT7 A;  2ECZ A;  2KRO A;  1M3A A;  2JS0 A;  2PTK A;  3I5R A;  2X3W D;  3UA6 A;  4AFQ C;  2EQI A;  2PNI A;  1X6B A;  1FMK A; 
#chains in the Genus database with same CATH topology
 2VUB A;  5GMK h;  4A53 A;  2OTJ A;  1X2Q A;  3QJY A;  3UAT A;  3CCL Q;  4EMH A;  3JCM d;  3HHT B;  3M0R A;  3UT1 A;  1RLP C;  2DTI A;  1Z9Q A;  3CCR T;  1OPL A;  3SWN C;  2GQI A;  3KBG A;  1FMW A;  2RI2 A;  3H8Z A;  4RTU A;  2HQE A;  4LDW A;  1X6G A;  1YBY A;  3JCM Q;  1NLO C;  4OP0 A;  3QSU A;  5D6W A;  2F5K A;  4LN2 A;  4Y28 E;  2QEX Q;  1QP3 A;  4X9D A;  1W2B P;  1VQM T;  4WTO B;  3REA B;  5LJ5 d;  1VQ8 A;  1WLP B;  4XTY A;  4FYV B;  1C0M A;  2EYY A;  3OYH A;  2HSE B;  2VVK A;  3PGG A;  4FIB A;  5D6X A;  1NPP A;  4QW2 A;  5CK9 A;  1KJW A;  2CSI A;  5DY9 A;  2VKN A;  1Y96 B;  1TG0 A;  1SEM A;  5J39 A;  5IHN A;  1U1S A;  2XIC A;  5D6Y A;  1YJN Q;  4D8D A;  3LH5 A;  4M78 G;  1YJ9 A;  2C0O A;  4M78 E;  1WJR A;  3TRE A;  2C0I A;  3G71 A;  1T3L A;  3ZEH A;  5CAI A;  5A0D A;  1D3B B;  4DBH A;  2HQX A;  2VAS A;  1K4U S;  3M57 A;  2RNA A;  2FPD A;  4BY6 C;  3L1A A;  3EFO B;  1Q7Y R;  3JB9 J;  1LCK A;  1YIT A;  4F14 A;  2KAF A;  3VYH B;  1M8M A;  2EYZ A;  3QDF A;  1A0N B;  1PKS A;  1YI2 T;  5CIU A;  5IHI A;  2RJD A;  3RNJ A;  4C0D B;  3E9F A;  5I22 A;  2QDY B;  3NGP A;  1KFZ A;  3CCE A;  3CCQ T;  3LX7 A;  3SHW A;  4L6V 5;  2E1H A;  1KQ1 A;  2FHD A;  4OGC A;  2J06 A;  4BUG A;  4CRI A;  2LMJ A;  1PSF A;  1DJ7 B;  2LTO A;  1QP2 A;  1M2V B;  5FW9 A;  1Q82 R;  1D0Y A;  1VQ9 Q;  1UDL A;  4HVW A;  3I55 A;  3EAE A;  1I07 A;  1YIJ Q;  1U06 A;  1B34 A;  4M4Z A;  2DVE A;  4D6W A;  1U3O A;  4J8O A;  4KBM B;  3R6N A;  4XU2 A;  1SF9 A;  1AWJ A;  2QQA A;  2CP5 A;  2OI3 A;  1EIF A;  1H92 A;  4HVU A;  2J7I A;  1PD0 A;  3VS1 A;  1VYU A;  1UHF A;  2GQV A;  1KK7 A;  2HAX A;  1UB4 A;  2LT1 A;  3EH2 A;  1QW1 A;  1M3C A;  4RTY A;  4BE2 A;  3OY9 A;  1AHJ B;  3CCJ A;  5A0G A;  2COZ A;  1RAI B;  1S72 Q;  5IT9 E;  4PJO C;  1PWT A;  2LNH B;  1GXI E;  2QGG A;  1M8V A;  1QWF A;  5HK3 A;  1VQ5 A;  1AWX A;  4QVD A;  2GBQ A;  2RH2 A;  2JVV A;  5FWB A;  3FB9 A;  4QKU A;  3EG9 B;  4B6M A;  3MEU A;  4JPB W;  3CEY A;  1WGS A;  2NUZ A;  3NTK A;  2KSS A;  3OYB A;  1BU1 A;  2RHY A;  3P8B B;  2HL5 C;  4YTL A;  3NMZ C;  4J6X A;  2GFU A;  4XQ3 A;  5LJ3 f;  4NL3 A;  3BY7 A;  4DEX A;  4OGE A;  4KH0 B;  1HD3 A;  2M16 A;  3G4S A;  2MK5 A;  3AT1 B;  4C0F A;  5DLO A;  2V8I A;  1OYX A;  4BY6 B;  1D0X A;  4E7H A;  2O4X A;  2EQU A;  3PFS A;  1FYN A;  4V2S A;  2HDA A;  2LDM A;  4M77 F;  3UF4 A;  1YJW A;  1XQH A;  2K5L A;  4M7A C;  4KGZ B;  3H41 A;  4L5G A;  2QQR A;  4II1 A;  5KYY A;  4M77 B;  5A2Q E;  3CC2 A;  3OA6 A;  4HCK A;  4PJJ A;  1OX8 A;  3FIF A;  2KMT A;  4JZ3 A;  2A0F B;  4AG1 C;  3QII A;  4C5E A;  5C0M A;  1TOV A;  4JS5 A;  4XTZ A;  3P8D A;  2M0O A;  1GCQ C;  4OML A;  3EGD A;  2M02 A;  2FZG B;  4M7D F;  3S3O A;  1K76 A;  2AK5 A;  1SHF A;  2LP5 A;  5A0L A;  2IIM A;  4LNP A;  5J26 A;  2OTL A;  1MV0 B;  5AT1 B;  3CME T;  2K5I A;  1PHT A;  1Q7Y U;  3GOX A;  1WXT A;  1SG5 A;  1Z9Z A;  2QAS A;  1VQ7 A;  2GFA A;  4FYY B;  4PJO F;  5HY6 A;  2MI6 A;  3SD4 A;  4BE0 A;  4F17 A;  3F70 A;  4M75 F;  1FMV A;  5FWC A;  4PJO B;  4C0G A;  4F16 A;  4J9B A;  3BE3 A;  3MCA B;  2EWN A;  3OYK A;  3MJX A;  4Z89 A;  3HL8 A;  3C95 A;  2LNV A;  4WCI A;  1ZHI A;  1IHW A;  4MDW A;  4LE9 A;  2KT1 A;  1G5V A;  2SRC A;  4KUI A;  1VQN A;  2JS2 A;  2KEA A;  3QZ9 B;  1HYO A;  3CC4 Q;  3HKS A;  8ATC B;  2EVR A;  1Y57 A;  1D1B A;  3RMS A;  4M77 D;  4KH1 B;  3X24 B;  1Q82 U;  1U5S A;  4XTV A;  2DYB A;  3JCM c;  3G6E A;  2V1R A;  1I5O B;  5DM7 R;  3ZFJ A;  1WHL A;  2MF2 A;  1YHQ Q;  1WHK A;  4J9G A;  4J6W A;  3JCM P;  3OYY A;  2KBT A;  4GY5 A;  2D1X A;  2EQK A;  4HCB A;  4M7A F;  2MOX A;  4DBR A;  2AKL A;  3LGL A;  4JRQ A;  3Q1J A;  3TVT A;  5AYF A;  4M7A B;  4C8Q A;  5GAN g;  1UEC A;  2D8J A;  3GBQ A;  1QKW A;  1PM3 A;  4Y92 A;  4J9E A;  2MPX C;  4C5H A;  4M7D D;  2KRS A;  2RI3 A;  1X27 A;  1WXB A;  4E2F B;  4HT8 A;  3A1P A;  1SHG A;  1VQP A;  2QTV A;  2VWF A;  5FU6 B;  1K73 C;  4XTU A;  2LCL A;  2L3R A;  4PJO D;  1YWO A;  2R57 A;  3M5A A;  3JCM W;  1RAF B;  3JB9 I;  1QVF A;  4M75 D;  1N6A A;  3SFM A;  5I2M A;  2DL3 A;  3A8M B;  3L2Q A;  2L0A A;  5GAN 3;  3JCM g;  3OMC A;  4IUT A;  2LJ3 A;  2H3J A;  3CCL T;  2AKK A;  5LJ3 e;  1M3B A;  2EYW A;  1M5Q 1;  2YSQ A;  4X1V A;  3FJP A;  4RTT A;  4KUD K;  1ZA2 B;  3MP8 A;  4J83 A;  1T3S A;  1Q86 C;  4AMC A;  5CQY A;  3CCR A;  2YT6 A;  2GNC A;  1RI0 A;  2RQV A;  2LJ1 A;  2ENM A;  3PNW C;  3C94 A;  3OQ5 A;  5LJ5 g;  1QVF S;  2V8J A;  3RES A;  1GFC A;  1AWW A;  3RER A;  1RAE B;  3CXC S;  2X4Y A;  4ZTF A;  1BCM A;  1VQM A;  2K2M A;  4PJN A;  1N27 A;  1MHN A;  4FYX B;  2PTK A;  4M7A D;  1G3T A;  2PU9 B;  2EQI A;  3CBP A;  1W6X A;  2L3S A;  2VC8 A;  2M0Y A;  4ATO A;  1BIA A;  4RTX A;  1YJN T;  2HL3 A;  4M77 G;  2HEQ A;  4M77 E;  4FT4 A;  4RKU E;  3FLG A;  1WX6 A;  2GCX A;  2RQW A;  2J6K A;  3HSB A;  2KGT A;  1WQW A;  2ZZD A;  5GJW B;  4F7U G;  2ZPH B;  1RLQ C;  1TSF A;  1WZO A;  4F7U E;  5GAN 4;  1M1K R;  2LCS A;  4RCB A;  1N5Z A;  1K8A R;  4C92 C;  4AG2 C;  2YHT A;  3OYC A;  4RG2 A;  2ROL A;  4B9W A;  3SEM A;  3MHX A;  3CCV T;  1W70 A;  5FRO A;  5GAN 6;  1ZSG A;  4E7J A;  4OMQ A;  5KYN A;  1IHV A;  4A63 B;  4HT9 A;  2NUP A;  4HVV A;  3E9G A;  4CC7 A;  2PUK B;  4R56 A;  1MUZ A;  4ZGE B;  1ZX6 A;  1I8F A;  2K3B A;  2HQH A;  1ARK A;  1YI2 A;  2MYS A;  1Q95 G;  2ZPG B;  5GMK e;  2YUN A;  4FW2 A;  1LJO A;  1Q7Y C;  1VIE A;  3CXC P;  1W2B A;  2A28 A;  3CCQ A;  4HCC A;  3PMI A;  4M78 D;  3JSC A;  1VYV A;  7AT1 B;  1AZG B;  1UGP B;  4PJO G;  4TVR A;  4D8K A;  1VQK Q;  1LOJ A;  4PJO E;  2EYQ A;  3PVL A;  2KK4 A;  1MMA A;  4P5N A;  1VQ9 T;  4IIM A;  1BI1 A;  1IXD A;  3A98 A;  3GIB A;  2I0N A;  1KG1 A;  4X34 A;  2KXD A;  1QVP A;  5GMK i;  1QLY A;  3GPL A;  3WVD B;  1OZ3 A;  1Q82 C;  4VUB A;  1UFF A;  2DO3 A;  2DPP B;  1K0X A;  1WJQ A;  4JDS A;  2GTO A;  2QQS A;  2V26 A;  4NL2 A;  2DXU A;  1K73 R;  4BE1 A;  2YLB A;  5LJ3 j;  2IPO B;  3OYL A;  2XHC A;  1VQL Q;  1T0H A;  2ED0 A;  4M75 A;  2K4Y A;  2CP7 A;  4QVC A;  1S72 T;  4OF1 A;  3GLX A;  2DIG A;  1OQK A;  4M7A G;  1D1C A;  4RMO A;  4M7A E;  1PCX A;  3I56 Q;  3CCJ Q;  2PVD B;  4RTV A;  4C8Q C;  5GAN 2;  3S3N A;  2M1H A;  2YUP A;  2FRW A;  1OOT A;  1KQS P;  2RI5 A;  1E6G A;  1UTI A;  3M55 A;  3QG1 A;  1Q86 R;  2BZY A;  3QPH A;  1SKU B;  2B8A A;  3DLM A;  5L8R E;  2L5Q A;  2LJ0 A;  4C92 B;  1AZE A;  2XD0 A;  2XID A;  3FC3 A;  4R55 A;  2NUT B;  3MET A;  4FYW B;  4J9I A;  3VS2 A;  2DL4 A;  3AHU A;  1B07 A;  1D1A A;  2G6F X;  3HFN A;  1JXM A;  1P92 A;  2JXB A;  2YXY A;  2CP6 A;  1ZUU A;  1V1C A;  1ZLM A;  3CCU Q;  2A36 A;  5M9O A;  3MO8 A;  3LLR A;  5KH6 A;  2CZ6 B;  1NJI R;  2HKN A;  1VQO Q;  2CP0 A;  3X20 B;  3EG1 A;  2NYS A;  3GP8 A;  1IRE B;  2JJ9 A;  2E41 A;  5GAN h;  1AOJ A;  2Y4Y A;  3OSS C;  2E64 A;  2CRE A;  1NYG A;  2DTH A;  2K2V A;  3VV0 A;  4J6Y A;  2V1Q A;  1QCN A;  2DD4 A;  2CP3 A;  2K7A A;  3LGF A;  2D0N A;  3MP1 A;  5GAO n;  1UHC A;  1NBE B;  1M1K U;  4QVZ A;  5GMK j;  2HBW A;  2OAW A;  1K8A U;  5KYU A;  2DRM A;  4DBQ A;  2DRK A;  2Z0W A;  5GAO p;  1QKX A;  4EMG A;  3QZ5 B;  2DIL A;  4FT2 A;  3HRS A;  2ZPE B;  1TXQ A;  2AZS A;  3CME A;  4EDU A;  2W10 A;  4OMF B;  3JCM h;  1AVZ C;  4ZN3 A;  2E12 A;  2OAU A;  4XK8 E;  2FEI A;  2QK0 A;  4M78 A;  2SEM A;  1I4K 1;  1ABO A;  1ZQ1 A;  1OPK A;  4PJL A;  4LDX A;  2JT4 A;  4E7I A;  3PVQ A;  3VUB A;  4RTW A;  1TS9 A;  2J05 A;  3NTI A;  3RMQ A;  3LYI A;  4XAX B;  5LJ5 h;  2JTF A;  3LWH A;  1SSH A;  3CC4 T;  2HNI A;  3DKM A;  2ABL A;  3CPW A;  3CMA Q;  1TH7 A;  2EGE A;  4AFZ C;  4BDZ A;  2EW3 A;  1WA7 A;  2DJZ A;  3JB9 H;  4IUR A;  4QQ6 A;  1E7O A;  1YHQ T;  3SWN B;  2JW4 A;  4ZGJ B;  1U1T A;  4ELZ C;  1ZBJ A;  2E5Q A;  3VKI A;  1G3S A;  1VQ6 Q;  4RTZ A;  5KCH A;  1ABQ A;  2EGA A;  3QYH B;  1KD1 R;  3LW5 E;  2LZ6 B;  3CPW S;  3M4Y A;  4C5I A;  1K73 U;  4JJB A;  3JB9 F;  2DET A;  2HKQ B;  4NOY A;  5KYW A;  2RA2 A;  2A7Y A;  2YUO A;  2KVQ G;  2XDP A;  3A8O B;  1RAA B;  1ZSZ A;  1H3Z A;  2JM9 A;  3CBO A;  2DMO A;  3EGX A;  2O9V A;  3J81 E;  2DL7 A;  5CCA A;  3CCS T;  4N4H A;  5DLQ E;  4ZN1 A;  2QYZ A;  3M4G A;  4JUV A;  1Q86 U;  5FU7 C;  1MMG A;  5LJ5 j;  1LNX A;  1XNI A;  2CT3 A;  2P0P A;  4LD6 A;  3V7C A;  2EYX A;  3UPU A;  3H9N A;  2VGM A;  3O5Z A;  2QQ9 A;  3D7S B;  1N8R R;  4N0A A;  3QXE B;  1X69 A;  5KYX B;  3HRU A;  5I2S A;  3VS5 A;  3CBM A;  5HK0 A;  1V29 B;  2LVM A;  2EFI A;  3CCM Q;  3E19 A;  1QMC A;  2CZ1 B;  2VGN A;  3VS3 A;  3CCL A;  1Y71 A;  4PKC C;  1UGV A;  1RL2 A;  4HXJ A;  5GMK l;  2COW A;  5IXB A;  3OYI A;  4J9H A;  2F2V A;  2XI9 A;  4A4K A;  2CYZ B;  1NJI U;  1BI0 A;  2AIR B;  3NPF A;  1JJ2 A;  5CKH A;  4J7F A;  4BDY A;  4C92 G;  4C92 E;  2E5K A;  3CPW P;  4F7U F;  2LQW A;  4OMP A;  2LQN A;  4ZNX A;  2RF0 A;  2OX7 A;  4F7U B;  3QUI A;  2YWW A;  3GNF B;  1WXU A;  3EG3 A;  1CSK A;  2QA4 Q;  3OS1 A;  1YNZ A;  2YLC A;  1PKT A;  3C4S A;  1YFN A;  2H8H A;  2C06 A;  1X75 C;  2P0K A;  3JB9 D;  2DD5 A;  1JJ2 S;  4EPC A;  1WYX A;  3QWY A;  2YRD A;  5GAN 7;  4PLI A;  1RAB B;  2OJ2 A;  2KRN A;  1S1N A;  1YJN A;  2X4J A;  3BDU A;  1G8X A;  1Q81 R;  2MMP A;  3A8H B;  4JJD A;  4N4G A;  3OYE A;  4LUD A;  2YRV A;  2DBK A;  1H8K A;  2JTM A;  4IIO A;  3CCV A;  2HCK A;  2FZK B;  3E1S A;  2QI2 A;  1M1K C;  4HCZ A;  3EHR A;  4QT7 A;  2QAZ A;  1K8A C;  1IB8 A;  2LT4 A;  3I5R A;  4E7Z A;  3UA6 A;  2E3H A;  4JLG A;  1X6B A;  2G3R A;  1VIF A;  2K3X A;  1O75 A;  1Y96 A;  4CC3 A;  3OYG A;  4FL6 A;  3FJ5 A;  3ULR B;  4OMN A;  3OBW A;  5CR2 A;  2JOY A;  1AT1 B;  2LQK A;  2DZ9 A;  2X3X D;  3VS4 A;  2BE7 D;  1VQK T;  2KRM A;  4GBQ A;  4EMK A;  3QYG B;  4PJM A;  4OB3 B;  3CCQ Q;  2EQJ A;  2CDT A;  1WNL A;  1W1F A;  1JJ2 P;  1R77 A;  4C8Q G;  1D3B A;  4C8Q E;  2JN0 A;  2Y90 A;  1VQ9 A;  4JZ4 A;  5GMK m;  2KI7 A;  1KD1 U;  1HJD A;  3EFO A;  9ATC B;  3R6O A;  4CI0 C;  5D7U A;  3RKY A;  2CSQ A;  3CC7 T;  3CD6 Q;  1UG1 A;  1SRL A;  3V8K A;  5GAN f;  1UEB A;  3NTH A;  4E6R A;  3M59 A;  1OI1 A;  3TEE A;  3DB3 A;  3KFV A;  5GAM d;  1WPY A;  3G7Z A;  1NYF A;  1VQL T;  2AT1 B;  4X9C A;  1MND A;  1Y0M A;  4LDU A;  4PNO A;  1QCF A;  4MZT A;  2DEU A;  1VQ4 Q;  4FSX A;  3J80 E;  1BI2 A;  3OS2 A;  1S72 A;  3I56 T;  1TWB A;  2AZV A;  2RK1 A;  1UJY A;  2K3Y A;  3UA7 A;  2FL7 A;  3JB9 G;  1M2V A;  3M0P A;  4DQ2 A;  3UWN A;  5GJV B;  1N8R U;  2RN8 A;  4R0K A;  3CXC A;  3NHN A;  3JCM f;  4XU1 A;  2A37 A;  2OTJ Q;  3PT9 A;  2F2X A;  1NEG A;  2KT8 A;  1N9R A;  2MAM A;  2X51 A;  5HKC A;  1MV3 A;  3PIP A;  2WSC E;  5IXF A;  2QEX T;  3EH1 A;  5LJ3 d;  3CCU T;  2DTO A;  4N0A C;  5LJ5 f;  1KHI A;  1VQO T;  3GNG A;  4A4H A;  1ZUY A;  2XDD A;  5CQX A;  4LD9 K;  1VQ8 Q;  1YCS B;  2X4X A;  2J6F A;  1QQJ A;  3EG9 A;  4XTW A;  3PMT A;  5GAM h;  1NJI C;  3EGU A;  2O31 A;  2A08 A;  1TTH B;  1D09 B;  2RB6 A;  1PC0 A;  3OYN A;  1WIE A;  3H0I A;  1KQ2 A;  2EQM A;  1IZ6 A;  1JXO A;  2KR3 A;  4ZGD B;  3HFO A;  4RG8 A;  4OMO A;  1Q81 U;  4AFU C;  2CKK A;  3V7S A;  4AT1 B;  3OW2 P;  2FPE A;  5IN1 A;  2LC4 A;  1YJ9 Q;  1NZ9 A;  3M54 A;  1PRM C;  1WJS A;  1G3Y A;  2CH4 W;  3URG A;  4IUU A;  2ZAE A;  1KQS A;  3G71 Q;  2LQ8 A;  2QDL A;  4OB1 B;  3INZ A;  3REB B;  1WHM A;  2E65 A;  2J6O A;  1M27 C;  3BW1 A;  3L2U A;  3MP6 A;  5IH2 A;  4FW1 A;  2QXF A;  2PQW A;  4M77 A;  1SSF A;  1IGQ A;  1B34 B;  3V7R A;  1HXD A;  4FCY A;  2NWM A;  4BI3 A;  2CUB A;  4J9C A;  4BD3 A;  4QQG A;  1KSW A;  1I5L A;  3FDR A;  3TQ7 P;  1YIT Q;  5CKB A;  3OB9 A;  1LVK A;  3EFR A;  1G2B A;  1GCP A;  2VB6 A;  1X6O A;  1KQS S;  3JCM J;  2QG9 B;  3U23 A;  4GLK A;  3V8J A;  2DLP A;  1PSE A;  5KYW B;  2CZ0 B;  1N9S A;  2DL5 A;  2JTE A;  1Y07 A;  3M58 A;  4JRI A;  3CCE Q;  3CMA T;  2DK3 A;  3DLL A;  3CC4 A;  1IO6 A;  4A4E A;  3JV3 A;  1VA7 A;  2DZC A;  1OU9 A;  4BB7 A;  2ZGW A;  2O9S A;  3VRY A;  1YIJ T;  5CKE A;  4M7D A;  1BK2 A;  2RPN A;  3A5Z B;  3N5B B;  2ATC B;  2EJ9 A;  5FLX E;  1YHQ A;  1VQ6 T;  4PFP A;  4FU6 A;  2HSP A;  2DKG A;  3I55 Q;  4ZTJ A;  1NM7 A;  1KC8 R;  2R58 A;  5GAN e;  3I35 A;  5IAY A;  4EMK C;  5KE2 A;  1YWP A;  1BB9 A;  2EPD A;  2F69 A;  4PJO A;  2WSE E;  2PVG B;  2DXT A;  1M9S A;  4DBF A;  2C0T A;  1VUB A;  1KD1 C;  3QJ6 A;  2ESW A;  1YP5 A;  3GF5 A;  4BI8 B;  2O4X B;  1T0J A;  1GRI A;  2LRQ A;  1EZZ B;  2O01 E;  1RUW A;  4KRT A;  4O5V A;  2K6D A;  5KYY B;  3M0U A;  1VQ5 Q;  3EG2 A;  2ED1 A;  2MIO A;  3CCS A;  4OMM A;  5J3B A;  2A3L A;  1H64 1;  1NLP C;  4C92 F;  1WFW A;  4KGX B;  2DER A;  1UJ0 A;  3I5S A;  2EJG A;  4MZP A;  3QO3 A;  3JCM e;  4CC4 B;  3QDR B;  3CCM T;  1IRX A;  1PNJ A;  2RK2 A;  2RM4 A;  2E4H A;  5FRN A;  1R0C B;  2DA9 A;  1BKB A;  4GLM A;  4M7A A;  2DF6 A;  2DXC A;  4A4F A;  3L2R A;  1N8R C;  3EGD B;  1RAH B;  3G4S Q;  3A8G B;  1HSQ A;  4MZM A;  1MNE A;  2FVU A;  4JRP A;  1JEG A;  2L2P A;  5LJ5 e;  1M90 R;  4J9D A;  1AEY A;  1Y7X A;  1NG2 A;  1SRM A;  3C0C A;  1YJW Q;  3M56 A;  4PLL A;  2O88 A;  3RUX A;  2WAC A;  3VU3 C;  2QQB A;  3CC2 Q;  2K57 A;  2QA4 T;  5LL6 S;  3DB4 A;  5CO7 A;  2KXC A;  1GCQ A;  3X26 B;  1I81 A;  3VS0 A;  3PTA A;  1M4Z A;  1JQQ A;  2DL8 A;  2P84 A;  3L2V A;  2KY9 A;  3BDL A;  4KUL A;  2PUO B;  4J7I A;  1XTD A;  4K11 A;  4IUP A;  2ZPF B;  3RKX A;  3OSV A;  2VYT A;  4QQD A;  3T9N A;  4A4G A;  2LX9 A;  3MEW A;  3PE0 A;  4JRK A;  1GBQ A;  2IVW A;  3MKD A;  5IHK A;  1UUE A;  4EMK B;  2BZX A;  2COY A;  1Q81 C;  2OTL Q;  3QBY A;  2DEQ A;  1BI3 A;  4C92 D;  4XU3 A;  2DX1 A;  1C6V X;  2E70 A;  1OUL A;  2BIV A;  2ROT A;  3CCV Q;  1VQ7 Q;  4C8Q F;  1J3T A;  3EHQ A;  3X25 B;  3SB2 A;  2FRY A;  4C8Q B;  2XK0 A;  5ECA A;  4AFS C;  1O9S A;  5GAN j;  3A8L B;  2XMF A;  2K9G A;  1QWE A;  3E2U A;  5KCO A;  3EFS A;  3CPF A;  1RAC B;  4M77 C;  1X2K A;  1VQN Q;  2FZC B;  2BZ8 A;  3BFM A;  1U8R A;  3OMG A;  2CP2 A;  1M1F A;  1VQK A;  4N4I A;  4J5Y A;  1BYM A;  2K5F A;  1JRI A;  2AHJ B;  4ELY C;  3JAM E;  3G6E Q;  4JS4 A;  1G83 A;  4JJN K;  2ZPI B;  3H0F A;  2D6F A;  1UE9 A;  1KC8 U;  1WQ7 A;  2KRO A;  3X28 B;  1M3A A;  2JS0 A;  1YCY A;  4E7S A;  4AFQ C;  3CD6 T;  2PNI A;  3C12 A;  2QTX A;  2MCN A;  5GAM g;  3TU4 K;  3OYD A;  4XTX A;  3CC7 A;  1V76 A;  2JM8 A;  2KYB A;  5GAM f;  3M53 A;  4M7D C;  2JUF A;  2P4R A;  3LWI A;  3QKJ A;  2RJC A;  2YUQ A;  1I1J A;  3MEV A;  3PIO A;  2BUD A;  5CKF A;  4UC4 A;  3UDC A;  2CZ7 B;  1ZA1 B;  1VQL A;  3M0Q A;  1VQ4 T;  1PD1 A;  1TUD A;  2XKO C;  2DBM A;  5GAO q;  3L42 A;  3HTR A;  3RBB B;  6AT1 B;  3I9Q A;  3I56 A;  1VQP Q;  2P0Q A;  2DAQ A;  4MML A;  4OB0 B;  4LXC A;  1TUC A;  3HP9 A;  3ER0 A;  3IQL A;  4M75 C;  4KT0 E;  1K9A A;  4C8Q D;  1B7T A;  1MMN A;  1C1A A;  1UGQ B;  2DJQ A;  2YRC A;  2FO0 A;  4DEY A;  2OTJ T;  1JB0 E;  1K9M C;  5I11 A;  3OYM A;  1CKA A;  4O6J A;  2R5M A;  2F5T X;  5LJ3 g;  2RHI A;  2DFU A;  5GAN 8;  1IGU A;  1M90 U;  5GAO l;  4CC2 A;  3CCR Q;  3RKW A;  4KGV B;  3ZL7 C;  2QEX A;  3CCU A;  2BTT A;  2JNG A;  8AT1 B;  1VQO A;  1VOM A;  2RO0 A;  2XU8 A;  4EIK A;  1VQ8 T;  2NUP B;  1XOV A;  1VQM Q;  2D0Q B;  2D9T A;  1GL5 A;  4IUV A;  3G1J A;  3TSW A;  5L23 A;  3VS7 A;  1TU0 B;  2RHZ A;  3FEO A;  3L2W A;  1OZ2 A;  4C92 A;  1ZUK A;  2HBP A;  2NUT A;  1YJ9 T;  1OV3 A;  4NS5 A;  5FU6 C;  3G71 T;  2VXE A;  1WHJ A;  2EKH A;  3O8V A;  2DNU A;  4DOV A;  1UGR B;  4M7D B;  2JZ2 A;  2M9U A;  4PFO A;  1MGQ A;  2RHX A;  3ME9 A;  4RUG A;  1YIT T;  4Y91 A;  2RQU A;  4MMK A;  1OEB A;  2CH4 A;  1FX7 A;  2M51 A;  4OB2 B;  3VJP A;  5FU7 B;  3FRN A;  4IKF A;  3JRZ A;  1YI2 Q;  3HRT A;  2DM1 A;  3VRZ A;  1GBR A;  4MDX A;  4BAC A;  5FRM A;  3CCE T;  1SPK A;  4M78 C;  2RMO A;  2DXB A;  4WF2 A;  4M75 B;  5I21 A;  3EG0 A;  3NFC A;  2NLU A;  2E6Z A;  2FG0 A;  3M0S A;  3CMA A;  4PK4 A;  2GGR A;  2RJE A;  2GF7 A;  2EBP A;  1QVG A;  1PRL C;  4B9X A;  4Z8A A;  2PZ1 A;  5EG2 A;  1WDX A;  2RJF A;  1YIJ A;  2B86 A;  2EJF A;  4DOW A;  2ZCF B;  3I55 T;  1VQ6 A;  4L59 A;  5CKD A;  4RCC A;  3OYJ A;  2KE9 A;  5GAO m;  4ORZ A;  2WSF E;  3OW2 A;  2L8D A;  3P8H A;  3H0H A;  5GAM e;  1OU8 A;  2JMA A;  4ESR A;  1NE8 A;  1R0B G;  3MPU B;  3S3M A;  1QVG S;  2EKO A;  1K1Z A;  2KNB B;  4E7L A;  2LCC A;  3OYF A;  1KC8 C;  1F1B B;  2KDS A;  3TCJ A;  1RI9 A;  1GFD A;  4Q5W A;  1RAD B;  2I2L A;  2CUD A;  1AD5 A;  3CCJ T;  1EX4 A;  1EFN A;  2L3P A;  3OW2 S;  4XU0 A;  1VQ5 T;  1K9M R;  1M1G A;  4HA8 A;  4A54 A;  2CT4 A;  2BKD N;  2FYK A;  3ASK A;  4LUE A;  2KYM A;  1WI7 A;  4IUQ A;  3SWN A;  4C5G A;  1ZSZ C;  3TSZ A;  3CCS Q;  3M0T A;  1X01 A;  1JU5 C;  2ZPB B;  4Z02 A;  3SDZ A;  3CCM A;  1KIK A;  4LDY A;  1D0Z A;  1OX9 A;  1BCO A;  2EAY A;  3RIR A;  3V8L A;  4BI4 A;  3OS0 A;  3G4S T;  5C6S A;  2DE0 X;  5KYU B;  2XG8 D;  2LX7 A;  4ANJ A;  3S6W A;  1X43 A;  3ZBD A;  1W4S A;  1YJW T;  5GAO r;  2MWO A;  1XJW B;  2DVJ A;  1WHH A;  3L2Z A;  3HPW A;  4DA4 A;  4M78 F;  2RHU A;  3CC2 T;  2E3I A;  1QVG P;  2VV5 A;  4M78 B;  1M90 C;  4JLI A;  2QA4 A;  1K0S A;  1MMD A;  3H6Z A;  2GTJ A;  1E6H A;  2HD0 A;  2FPF A;  5KYX A;  2JMC A;  3THK A;  2L89 A;  2EIF A;  2FB7 A;  1FWZ A;  1KHC A;  1ACM B;  1M30 A;  1M2O A;  2K79 A;  4JJC A;  2XDB A;  1NEB A;  4C0Z A;  2RD1 A;  4PL6 A;  2F1L A;  2CGH A;  3J7A F;  5EC7 A;  4PFZ A;  2EGC A;  2OTL T;  1I0C A;  1LPL A;  1VYT A;  2W0Z A;  1B3Q A;  3CME Q;  2DYI A;  1AWO A;  2BE9 B;  1VQ7 T;  1FXX A;  4F7U A;  3MEA A;  4J9F A;  5GAN 5;  2X4W A;  5LJ3 h;  2HZY A;  2RQR A;  3JCM X;  4LDV A;  1QCO A;  2X35 A;  4FSS A;  4M7D G;  2E6N A;  3KUF A;  1TUG B;  4FM4 B;  5GAM j;  4M7D E;  1QVF P;  1VQN T;  1JBM A;  1ZSZ B;  1NPR A;  1H3H A;  2KQW A;  3VYG A;  3EGX B;  4E7K A;  3M9Q A;  3JCM V;  2QGF B;  2V8K A;  2PVO B;  2D8H A;  2L3Q A;  2MWP A;  2R5A A;  3LH0 A;  2RQT A;  3G6E T;  1HK9 A;  3RDV A;  1R8O B;  2P4T A;  4M75 G;  1PG5 B;  4M75 E;  5CVI A;  4ME7 A;  4HKE A;  2E10 A;  3OYA A;  1ZBX A;  3KXT A;  1CKB A;  3QWX X;  2H3E B;  3CD6 A;  3WXM B;  5KE3 A;  1W2B S;  2X9H A;  4OVA A;  2CS7 A;  2IG0 A;  1YN8 A;  3CC7 Q;  1RAG B;  5GAN d;  1BBZ A;  1UGS B;  3VUZ A;  1VQ4 A;  1K9M U;  3JCM b;  2O2O A;  1WHG A;  2VXF A;  5HCK A;  2HMA A;  1VQP T;  3OBY A;  1G3W A;  4F04 B;  4C0D C;  1JO8 A;  3RR6 A;  3VS6 A;  4Z88 A;  2YDL A;  3QHS A;  3CQT A;  2F2W A;  2Y4X A;  3OS5 A;  2ECZ A;  1BIB A;  2X3W D;  4E47 A;  2DIQ A;  3WVE B;  1FMK A; 
#chains in the Genus database with same CATH homology
 2MCN A;  1W6X A;  2L3S A;  4CC3 A;  2M0Y A;  2JM8 A;  4RTX A;  2KYB A;  1X2Q A;  3UAT A;  3FJ5 A;  3ULR B;  2HEQ A;  4OMN A;  2P4R A;  3M0R A;  1WX6 A;  1RLP C;  2YUQ A;  1I1J A;  2RQW A;  2J6K A;  1Z9Q A;  1OPL A;  2KGT A;  2GQI A;  3M0Q A;  5GJW B;  1RLQ C;  1TUD A;  2X3X D;  3VS4 A;  2LCS A;  2DBM A;  2KRM A;  1N5Z A;  4GBQ A;  4RTU A;  1X6G A;  1NLO C;  4AG2 C;  3RBB B;  3I9Q A;  2CDT A;  2ROL A;  4LN2 A;  3SEM A;  1W1F A;  1W70 A;  1ZSG A;  1TUC A;  3REA B;  4OMQ A;  1WLP B;  4JZ4 A;  4A63 B;  3IQL A;  1K9A A;  4HVV A;  2EYY A;  2VVK A;  4CC7 A;  1HJD A;  1MUZ A;  1KJW A;  2CSI A;  2DJQ A;  2VKN A;  2FO0 A;  1TG0 A;  2CSQ A;  4DEY A;  1ZX6 A;  1UG1 A;  1SEM A;  1SRL A;  2K3B A;  5I11 A;  5IHN A;  1ARK A;  1CKA A;  4E6R A;  3KFV A;  2YUN A;  4D8D A;  3LH5 A;  2C0O A;  1NYF A;  2A28 A;  4CC2 A;  1Y0M A;  2C0I A;  3ZL7 C;  1QCF A;  1VYV A;  1AZG B;  1T3L A;  2BTT A;  4D8K A;  3PVL A;  2AZV A;  1UJY A;  3UA7 A;  4EIK A;  4IIM A;  3A98 A;  1XOV A;  2I0N A;  3M0P A;  1K4U S;  5GJV B;  2RNA A;  2FPD A;  2KXD A;  1GL5 A;  2RN8 A;  1QLY A;  4R0K A;  1LCK A;  3NHN A;  3TSW A;  4F14 A;  5L23 A;  3VS7 A;  1M8M A;  1UFF A;  2A37 A;  2EYZ A;  1K0X A;  1A0N B;  1PKS A;  2GTO A;  5IHI A;  2F2X A;  1ZUK A;  3RNJ A;  1NEG A;  2KT8 A;  1MV3 A;  1OV3 A;  5I22 A;  3NGP A;  1KFZ A;  5IXF A;  3SHW A;  1T0H A;  2ED0 A;  2J06 A;  2LMJ A;  2EKH A;  4RTV A;  2DNU A;  5FW9 A;  1ZUY A;  2YUP A;  2FRW A;  1OOT A;  1UDL A;  1YCS B;  1E6G A;  2J6F A;  1UTI A;  4HVW A;  1I07 A;  1U06 A;  2BZY A;  4M4Z A;  4RUG A;  2RQU A;  3EGU A;  2O31 A;  2A08 A;  1OEB A;  1U3O A;  2CH4 A;  3R6N A;  2LJ0 A;  1AWJ A;  1WIE A;  3H0I A;  2OI3 A;  2M51 A;  1AZE A;  1H92 A;  4HVU A;  2KR3 A;  1JXO A;  2J7I A;  3VS1 A;  4OMO A;  4J9I A;  1VYU A;  4AFU C;  2DM1 A;  1UHF A;  3VS2 A;  3VRZ A;  1GBR A;  2FPE A;  2DL4 A;  1SPK A;  2RMO A;  1B07 A;  2G6F X;  3EG0 A;  1JXM A;  1PRM C;  2JXB A;  2FG0 A;  2CH4 W;  1M3C A;  1ZUU A;  3M0S A;  4RTY A;  1V1C A;  1ZLM A;  2GGR A;  2QDL A;  2A36 A;  3REB B;  1PWT A;  2EBP A;  2LNH B;  1PRL C;  1QWF A;  2J6O A;  4Z8A A;  1M27 C;  2PZ1 A;  1AWX A;  1WDX A;  5IH2 A;  2GBQ A;  2B86 A;  3EG1 A;  5FWB A;  1AOJ A;  2KE9 A;  2NWM A;  4JPB W;  2CUB A;  2CRE A;  1NYG A;  4J9C A;  4ORZ A;  1KSW A;  2NUZ A;  1BU1 A;  3NMZ C;  3H0H A;  1G2B A;  1GCP A;  2V1Q A;  2K7A A;  2D0N A;  2JMA A;  4ESR A;  3U23 A;  2DLP A;  1UHC A;  1K1Z A;  2KNB B;  4DEX A;  1HD3 A;  2DL5 A;  2JTE A;  1RI9 A;  1GFD A;  2CUD A;  2HBW A;  2OAW A;  1AD5 A;  1IO6 A;  2DRM A;  1EFN A;  3JV3 A;  1FYN A;  1VA7 A;  2L3P A;  2HDA A;  3UF4 A;  2O9S A;  2DRK A;  3VRY A;  3H41 A;  1QKX A;  1BK2 A;  2DIL A;  2RPN A;  2CT4 A;  2AZS A;  4LUE A;  2KYM A;  1WI7 A;  2W10 A;  1AVZ C;  2FEI A;  3TSZ A;  2HSP A;  4HCK A;  3M0T A;  2SEM A;  1NM7 A;  1JU5 C;  1ABO A;  1OPK A;  1KIK A;  3I35 A;  2JT4 A;  4JZ3 A;  1YWP A;  1BB9 A;  2EPD A;  4AG1 C;  3PVQ A;  4RTW A;  2J05 A;  2C0T A;  1GCQ C;  2ESW A;  1YP5 A;  2DE0 X;  1SSH A;  4OML A;  2LX7 A;  2ABL A;  1T0J A;  1X43 A;  1GRI A;  1K76 A;  2AK5 A;  1SHF A;  2LP5 A;  2EGE A;  4AFZ C;  1RUW A;  2EW3 A;  4KRT A;  2IIM A;  1WA7 A;  4LNP A;  2DVJ A;  2K6D A;  1MV0 B;  3M0U A;  3EG2 A;  2ED1 A;  2MIO A;  1E7O A;  4OMM A;  2JW4 A;  1NLP C;  1ZBJ A;  1WFW A;  1PHT A;  1WXT A;  4RTZ A;  1K0S A;  1ABQ A;  1Z9Z A;  1UJ0 A;  3I5S A;  2EGA A;  4CC4 B;  2GTJ A;  1E6H A;  4F17 A;  2FPF A;  2LZ6 B;  1PNJ A;  2JMC A;  5FWC A;  3THK A;  4JJB A;  4F16 A;  2DA9 A;  4J9B A;  4GLM A;  4Z89 A;  2DF6 A;  1M30 A;  2YUO A;  4WCI A;  2K79 A;  4LE9 A;  2KT1 A;  2SRC A;  4JJC A;  1HSQ A;  1NEB A;  2JS2 A;  2JM9 A;  2KEA A;  2DMO A;  2EVR A;  2L2P A;  1Y57 A;  2O9V A;  1JEG A;  2DL7 A;  4J9D A;  1AEY A;  5EC7 A;  1NG2 A;  1SRM A;  3C0C A;  2EGC A;  1I0C A;  1VYT A;  1U5S A;  2W0Z A;  2DYB A;  2O88 A;  1B3Q A;  2V1R A;  1AWO A;  4J9G A;  2CT3 A;  4J9F A;  2KXC A;  2EYX A;  1GCQ A;  2KBT A;  3O5Z A;  3VS0 A;  2D1X A;  1X69 A;  2RQR A;  2MOX A;  1JQQ A;  2DL8 A;  3VS5 A;  2AKL A;  4FSS A;  3TVT A;  3VS3 A;  1UEC A;  2D8J A;  4K11 A;  1UGV A;  3GBQ A;  4HXJ A;  1QKW A;  4Y92 A;  4J9E A;  1H3H A;  5IXB A;  2KRS A;  4J9H A;  2F2V A;  1X27 A;  1WXB A;  3PE0 A;  1GBQ A;  3NPF A;  2D8H A;  2L3Q A;  5IHK A;  1UUE A;  1SHG A;  2E5K A;  2BZX A;  2LQW A;  2RQT A;  2LQN A;  4OMP A;  2VWF A;  4ZNX A;  2RF0 A;  2DX1 A;  2ROT A;  1WXU A;  3EG3 A;  1CSK A;  1YWO A;  1YNZ A;  1J3T A;  1CKB A;  3EHQ A;  1PKT A;  3QWX X;  2FRY A;  2H8H A;  2DL3 A;  2L0A A;  2LJ3 A;  5ECA A;  2AKK A;  4AFS C;  1WYX A;  3QWY A;  1M3B A;  2OJ2 A;  2KRN A;  2EYW A;  2YSQ A;  1S1N A;  2XMF A;  2K9G A;  1QWE A;  4X1V A;  1YN8 A;  4RTT A;  4JJD A;  1BBZ A;  1T3S A;  1X2K A;  4LUD A;  2YT6 A;  2BZ8 A;  2GNC A;  2DBK A;  2O2O A;  2RQV A;  2LJ1 A;  2ENM A;  1H8K A;  5HCK A;  4IIO A;  1GFC A;  1AWW A;  1JO8 A;  3VS6 A;  4Z88 A;  2YDL A;  2HCK A;  1G83 A;  2K2M A;  3H0F A;  3CQT A;  1UE9 A;  3EHR A;  2F2W A;  4QT7 A;  2ECZ A;  2KRO A;  1M3A A;  2JS0 A;  2PTK A;  3I5R A;  2X3W D;  3UA6 A;  4AFQ C;  2EQI A;  2PNI A;  1X6B A;  1FMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...