1N27A

Solution structure of the pwwp domain of mouse hepatoma-derived growth factor, related protein 3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
GSSGSSGEYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Hepatoma-derived growth factor, related protein 3
publication title Solution structure of the PWWP domain of the hepatoma-derived growth factor family.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n27A00
1WGSA 3OS2A 4PLLA 3H8ZA 4PLIA 3S6WA 4LD6A 4N4HA 4QQ6A 4E7JA 2X4YA 3DLMA 4E7KA 2BKDN 5FROA 3QBYA 4QVZA 2R58A 5KE2A 3OYAA 3OYEA 2E5QA 2X35A 3NTIA 4RG2A 4QQDA 1XNIA 2L89A 2WACA 2X4WA 3MEAA 3MEVA 3OB9A 2RJDA 2QQSA 3FDRA 3QIIA 3OMCA 2RJEA 3LGLA 4A4HA 3OYNA 3OYLA 3O8VA 3CEYA 4GY5A 1OZ2A 2GFUA 4FL6A 5IN1A 2BIVA 1WJQA 1MHNA 2K3XA 2P0KA 3OS1A 4BE0A 3OYHA 3OYFA 4FU6A 2GF7A 3OYCA 2EQKA 4EDUA 3GOXA 5FRNA 1WJRA 2BUDA 3S3NA 2NLUA 3OYMA 4ZTJA 1OYXA 2M16A 1G5VA 2DIQA 3MEWA 3P8DA 3DB4A 3QJ6A 4IKFA 2RHXA 4Z02A 1OZ3A 2LDMA 2LCCA 4X34A 2X4XA 3PMIA 3ASKA 3OYJA 4E7IA 3KUFA 5CIUA 3F70A 2M1HA 2L3RA 2MWOA 2PQWA 4BD3A 3OYDA 4L59A 4II1A 3H6ZA 1WJSA 3MP6A 4PL6A 3L2VA 4E7LA 1H3ZA 4BE2A 3S3OA 4IURA 3OQ5A 2LVMA 2RO0A 4B9XA 5FRMA 3OY9A 3PMTA 2F5KA 2RHUA 3E9FA 3L2QA 2DIGA 4BACA 2RHYA 2RHZA 2RHIA 1N27A 4IUTA 3OYGA 2YRVA 4C5IA 5C6SA 3OYKA 3LH0A 4IUVA 2LTOA 4ZTFA 3L2RA 3ME9A 3E9GA 3PNWC 3LYIA 4C5HA 3MP1A 5D6XA 2JTFA 2R5AA 5D6WA 4N4IA 3OYIA 4A4EA 4NS5A 1SSFA 2RI5A 2RI3A 4A4FA 4BDZA 2EQMA 2EFIA 4IUUA 4CRIA 2HQXA 2RJFA 4E7HA 3S3MA 4QQGA 5KH6A 5KCHA 3FEOA 2HQEA 2XK0A 5M9OA 3OMGA 2EQUA 3L42A 3PFSA 2MWPA 2O4XA 4HCZA 5D6YA 2L8DA 3LGFA 2GFAA 3FC3A 3OYBA 3FLGA 2FHDA 2RI2A 4C5GA 4C5EA 2RJCA 4BDYA 2QQRA 2E6NA 3C4SA 3LX7A 3EAEA 3ZEHA 5KCOA 2G3RA 2R5MA 2D9TA 3DB3A 3BDLA 4Q5WA 4BE1A 4A4GA 3M9QA 3OS0A 2M0OA 1KHCA 3LLRA 2EKOA 2R57A 3MO8A 3UWNA 3L2UA 3META 4IUPA 2EQJA 1RI0A 3MEUA 4QW2A 3QKJA 4B9WA 4UC4A 2LRQA 2DAQA 2IG0A 2K3YA 2O4XB 2XDPA 3NTKA 3Q1JA 4OVAA 5IAYA 5J26A 5J39A 3OA6A 3NTHA 2JZ2A 3P8HA 3SD4A 5C0MA 3MP8A 3L2WA 5KE3A 2VYTA 2B8AA 2CKKA 4IUQA 1OI1A 3UT1A 4N4GA
chains in the Genus database with same CATH superfamily
1W6XA 2RMOA 1WXUA 4M77E 1NM7A 2DPPB 1IHWA 2DXCA 2OTLT 4FT2A 3RKYA 4MMLA 5KYUA 1K0SA 2RQVA 3OYNA 3VKIA 5AT1B 1OZ2A 2F1LA 5LJ3j 3S3NA 1OYXA 2EYQA 3H41A 2VC8A 3A1PA 3SDZA 1KIKA 4CC2A 5GANj 2CREA 2XU8A 2CZ0B 2HEQA 4F04B 3HSBA 3HTRA 3OYDA 2LJ1A 1ZUYA 4JS5A 1WJSA 4J5YA 4KULA 2DJZA 4OP0A 2YT6A 3OBWA 1WYXA 2YUOA 3JCMW 1KD1C 2SEMA 1TTHB 1CKBA 3H0FA 2QEXQ 1BIBA 3E2UA 1ZX6A 1WFWA 2DD4A 4M78D 2OAWA 1JJ2P 1UTIA 1ZBJA 1JB0E 2EFIA 1YITA 1M90R 2YUPA 2E4HA 5GAN5 4VUBA 5D6YA 4ZN1A 2H3EB 5LJ5h 2VVKA 2RJCA 3MCAB 2YXYA 1KC8R 2E6NA 1KQSP 1D0ZA 3HFOA 2PVDB 2K5FA 2RK1A 3CCRT 3MO8A 3UWNA 4AG2C 4M78B 3CCEQ 3SD4A 4BI3A 2CYZB 1NYFA 3REAB 5GAMf 1OI1A 1QWEA 1U8RA 4PLLA 1Y96A 1C6VX 4AG1C 1Q86U 4LD6A 1NBEB 2YWWA 2QDYB 1C0MA 4D8DA 5I2SA 5LJ5d 1QVFS 4RG2A 3R6NA 3CMEQ 4A53A 1YN8A 4M77G 1VQ5T 4EMGA 4F7UE 2EYXA 5CKDA 3E19A 2KT8A 2BIVA 2K3XA 1ABQA 5HKCA 2CDTA 3TREA 2JTMA 4C8QF 4FCYA 2QAZA 1PNJA 1G3SA 5GAOm 1X6OA 1ACMB 1N9RA 3THKA 2WSFE 3ASKA 2DE0X 3CCET 5CKFA 3KBGA 3HRTA 5CIUA 1H3HA 1M4ZA 3KXTA 1WPYA 2HBPA 2MYSA 4C8QB 4MZMA 2P84A 3EHRA 4M7DF 1RADB 2EYWA 3VYHB 2DIGA 3CMET 3SFMA 3J80E 5GAOr 3A8MB 3QPHA 3VRZA 1Z9ZA 1Q86C 3MP1A 4LDWA 2FO0A 5D6WA 4J6YA 3AT1B 2CSQA 3QHSA 4A63B 9ATCB 2DXUA 1W2BP 1MMAA 3VUZA 4M7AE 4RG8A 1YJ9A 2K5LA 5L8RE 1Y7XA 3HHTB 1OQKA 2LX9A 1MNDA 3JB9I 3NGPA 3BDLA 3I55Q 4JZ3A 3LLRA 2D8HA 4LUDA 1JU5C 4QVCA 1ZSZC 2KY9A 4FT4A 2RD1A 4V2SA 1VQ9Q 2F2WA 1M5Q1 4R55A 2XDPA 2DAQA 3LW5E 3OA6A 1V76A 4FYVB 1JJ2S 1PC0A 3RKWA 1RLQC 2C0IA 1AZGB 2DFUA 4L5GA 3CC7Q 3I5SA 2Y4YA 2PUOB 4JPBW 4A4KA 5IHKA 2CP6A 2FG0A 2R58A 2LNVA 4GLKA 3X24B 1KQSS 3MEVA 4FW1A 1ZUKA 4RCBA 1NJIC 1LPLA 1VYVA 2NUTA 3OYFA 4JLGA 3OYHA 3I55T 2Y4XA 1PD0A 4RTVA 4KH0B 1UE9A 2DIQA 4F7UG 2B86A 1OZ3A 4C92D 1NEBA 3G71Q 3V7CA 4ANJA 1VQ6T 3WVEB 2VXEA 4D8KA 1LJOA 3EGDA 1JO8A 2JT4A 3CC7T 1OOTA 1QVGS 1PM3A 3G7ZA 2C0TA 1WHKA 2VUBA 1BI2A 4PKCC 3PMTA 5GJVB 3J81E 4M77A 2L3PA 2OTLA 1RAIB 1U06A 2DMOA 1UFFA 4KBMB 1VA7A 2H3JA 2OTJT 5KYXB 5ECAA 5D7UA 1D1BA 1ARKA 1X2KA 2RI5A 2ROTA 1TU0B 3TVTA 3RMSA 1VQ8Q 1HSQA 4OGEA 4QKUA 2K2VA 4QQGA 3N5BB 4XU0A 4KRTA 1YCYA 2KROA 2Y90A 3EG9B 4RMOA 4M7AG 3REBB 2DL4A 3RNJA 2G3RA 2DTOA 1MMNA 1I81A 3SB2A 4BE1A 1TXQA 3M9QA 1QVFA 1AHJB 1KHCA 2DVEA 3META 4E7ZA 1IREB 2LQNA 1WQ7A 3QKJA 2O4XB 2DZCA 3ZBDA 2K6DA 3P8HA 3RR6A 2KAFA 5GANh 1W2BS 2DJQA 2HD0A 2LQ8A 2QYZA 3M57A 4CC3A 2KMTA 2HDAA 4ZTJA 2NUPA 3OMCA 2JW4A 1WA7A 1BCOA 1M3BA 3QJYA 1SHFA 1MHNA 3CCQQ 4FU6A 3ULRB 1M8VA 3QWYA 3CCSQ 1VQMA 3GF5A 1SPKA 2MF2A 1WHMA 5KYNA 1G5VA 2DKGA 3CCRA 4XU3A 3JCMh 2JS2A 4OMPA 4FYWB 2EBPA 4M75C 1YJNT 2J05A 2KRNA 2ENMA 4FYYB 5LJ5j 2JM9A 3SWNB 1X27A 4E7LA 5FU7C 3CCJA 4J9CA 5LJ5e 2RHYA 1UUEA 1VQ5A 3QUIA 2AHJB 3VS3A 4ZGDB 5KYWA 3CCQT 3CC2Q 2FZKB 3CCST 1ZQ1A 1TWBA 1SSFA 1U3OA 4Z8AA 3CMAQ 3FB9A 1JJ2A 1WXBA 1KD1R 2CP2A 1G3YA 2DETA 1JEGA 2DXBA 2D0QB 1VQ7Q 5GAN2 2COWA 1B34B 3QXEB 3L2ZA 2QQAA 5GAN6 1D1CA 3EHQA 1NLPC 5FLXE 2E41A 3CMEA 1BK2A 2GBQA 1KQSA 4IUPA 2O9SA 1QVPA 1VQPQ 3EH2A 4NL3A 2V1RA 2VASA 5J26A 3FJPA 4ZN3A 2DL8A 5CCAA 1Q81U 4M78E 1Q82U 4E7JA 2FPFA 4OB2B 2EGCA 5IHIA 4EMKB 8AT1B 3LWHA 3TCJA 3QIIA 2KT1A 2LZ6B 4J9EA 1QVGA 4HVWA 3CCVA 4XQ3A 1BCMA 2WSEE 4ME7A 4EDUA 2ZCFB 1J3TA 1VQ4A 3CBMA 4Z02A 4MDXA 1O75A 1UJYA 1W1FA 3PVQA 2E3IA 5GAN7 5LJ3g 1G8XA 4JRPA 4QT7A 3GLXA 4WF2A 1D0XA 2HL5C 1UHCA 2DF6A 5GANg 1WNLA 1AEYA 3TSWA 5FRMA 2W0ZA 1K8AC 3URGA 1ZSZB 4WCIA 2P0QA 3I56Q 1GXIE 1D09B 4HVVA 5HK3A 2QQBA 3GPLA 3JB9D 1Q81C 3SHWA 3PNWC 1Q82C 4XK8E 2O2OA 1RI9A 2A37A 1X6GA 3CC4Q 2KYMA 2RQTA 1RAAB 3I55A 3DLLA 2HQXA 5FWCA 2NUZA 5KCHA 5A2QE 1QLYA 1ZA1B 1VQOQ 1K1ZA 1TH7A 2NWMA 1VQ6A 2RQWA 1VQNQ 1W2BA 1T0HA 4OB3B 3JCMg 1Q86R 4PJOD 4BDYA 2XI9A 1AT1B 2DERA 3EAEA 3NFCA 3ZEHA 3DB3A 4FSSA 1AD5A 3OS0A 1PCXA 3I56T 2EKOA 2JOYA 4O6JA 3L2UA 4J9BA 1X75C 1JXOA 3OYYA 4A54A 4CI0C 2OTJA 1K0XA 4DEYA 1YJWQ 3VS4A 5IT9E 3EGXA 3G6EQ 1UDLA 3OS2A 4N4HA 1I4K1 2K4YA 3X25B 5GMKh 5GAN4 1QVFP 2E3HA 3PIOA 1VQOT 4EIKA 4M77C 4PJOB 1VQNT 2ECZA 4M78G 1F1BB 2XDBA 1QCOA 3VYGA 1NEGA 1VQLQ 2DXTA 2ED0A 4GY5A 3LH5A 1WJQA 1XOVA 2D8JA 1A0NB 2NLUA 1YNZA 2LP5A 1U5SA 2X3WD 3QDRB 2LCCA 3PMIA 4L6V5 4RCCA 5KYUB 2P4RA 2ZPBB 1X43A 1H8KA 3G6ET 1QMCA 5KYYA 1NJIR 1GCQA 2LJ0A 2CZ6B 2E65A 5CQYA 1M1GA 3L2QA 3CCUA 2J6KA 2E10A 4E47A 2AT1B 1VQLT 2GTOA 4KUDK 4ELYC 4M4ZA 3HFNA 3QSUA 2FEIA 2XD0A 2DBKA 2PNIA 2KXCA 5LJ3e 3VU3C 4JZ4A 2COYA 1ZSGA 1BIAA 5M9OA 2EQUA 4HCZA 4DQ2A 2E5KA 4C92E 5GANe 1YHQQ 3VS0A 1YWPA 1YJNA 2K2MA 1PRMC 2MPXC 1IGUA 3A8GB 4M75F 4DBHA 2HNIA 2LCSA 1B7TA 2KQWA 2OAUA 3X28B 1NYGA 3E1SA 5I11A 4CC7A 2LNHB 1R8OB 3HP9A 3SEMA 1SKUB 2EGEA 1WIEA 3Q1JA 2HL3A 1E6HA 1BI3A 3NTHA 4NL2A 4M75A 2CKKA 2ZPIB 4QVDA 3GNGA 1S1NA 5FU7B 1ZHIA 2QA4Q 5FROA 3JCMe 2V8JA 3OYAA 3C0CA 4J9GA 4J9DA 2QEXT 3RMQA 4FL6A 4LD9K 1VYUA 3RERA 1Y96B 3JCMb 1JBMA 4OB0B 1ZUUA 4JDSA 4Z88A 4DBFA 1R0BG 3QJ6A 4XAXB 2X4XA 2L2PA 1FMKA 4C8QD 2A36A 1QVGP 3F70A 2RH2A 1YBYA 3CPWP 4AMCA 1B3QA 4RUGA 4JJNK 1V1CA 3H6ZA 3JCMJ 2XKOC 1M30A 1YIJQ 2EPDA 1VQKQ 4B9XA 2YRCA 4N0AA 2KSSA 4XTWA 1IXDA 4ZGEB 1XJWB 2C06A 2BE9B 4IUTA 2FZGB 2EJGA 2EVRA 4M7DD 1UGQB 1K76A 2JTFA 1K9MU 3D7SB 4HT8A 1CKAA 3VS5A 3VV0A 2XICA 2DEQA 2HQEA 4FYXB 3L42A 2J6FA 3G4SQ 1IHVA 4M7AC 3HRUA 1UEBA 1YI2A 1YIJT 1QKWA 1VQKT 4C92G 2E6ZA 5KCOA 1PHTA 4M7DB 1WHJA 5GMKi 1HXDA 2EYYA 4EMHA 4BB7A 4BY6C 3RUXA 2JXBA 3MP8A 3CCLQ 4E7SA 3H8ZA 3S6WA 1N8RR 2GGRA 3VS6A 2BKDN 2ZPGB 4QVZA 5KE2A 1RABB 4FM4B 3G4ST 2BTTA 3RIRA 5LL6S 3JB9H 2HSEB 3CCMQ 1K9MC 3A8OB 3L2VA 2RJEA 3LGLA 2K5IA 2QI2A 2SRCA 1NLOC 1K73R 2HBWA 2ZPFB 5GAMh 1M2VA 4LN2A 3M59A 4GBQA 2FPDA 3CD6Q 2LCLA 1JRIA 2RHXA 2JNGA 2CP0A 2CUDA 3JCMV 2M9UA 4R56A 2FPEA 4XU2A 3I5RA 2ZZDA 2KRSA 1N5ZA 5LJ3f 1UJ0A 3CCLT 2MWOA 2PQWA 4LDVA 1VIFA 1OU8A 1NG2A 2IPOB 2FYKA 2NUTB 4OB1B 2K9GA 2PUKB 2KI7A 2CSIA 5LJ5g 4FSXA 4JJBA 2RHUA 5GANf 3CXCS 1AVZC 1T0JA 3CCMT 3QO3A 2COZA 4M77F 3HRSA 1VQ9T 2O9VA 5GAMd 3EGDB 4C0FA 3CD6T 4A4FA 5CAIA 3JSCA 2EQMA 4CRIA 2RJFA 3INZA 2AK5A 1EZZB 2XIDA 1WHGA 2BZYA 1K8AR 1M90U 5GMKj 2EWNA 2EJFA 3CPWS 4M77B 1MV0B 4J6XA 1Z9QA 3FC3A 1GFCA 1Q81R 3C12A 2CUBA 2DL7A 5A0DA 5GMKe 1KC8U 4E2FB 2D0NA 4C0DB 3BFMA 3JCMf 4RKUE 1X6BA 2JMAA 2PVGB 5HK0A 4A4GA 2M0OA 1UHFA 5GMKl 5CQXA 2DLPA 2F2VA 4RTYA 4OVAA 3PGGA 5KE3A 3G71T 3I35A 4IUQA 4DEXA 2E1HA 4C0GA 3UT1A 2VWFA 5EC7A 5FU6C 1GCQC 1KHIA 3PT9A 1O9SA 4LE9A 1OEBA 2RNAA 1M1KR 4Y91A 3FDRA 2OX7A 4C92A 1QP2A 1GBRA 3VUBA 4HXJA 5IN1A 2EW3A 2QDLA 4PJOE 4J9HA 5L23A 3VS2A 2JN0A 2KRMA 2LMJA 3EG2A 4KGVB 1HYOA 3EG9A 3M4GA 3DB4A 1VQ8T 2LDMA 2JS0A 4X34A 1EIFA 3OYJA 1MMGA 5FWBA 1KC8C 1BYMA 2M0YA 1BI1A 2NUPB 1KSWA 2C0OA 3J7AF 2ZAEA 3PIPA 3UATA 1ABOA 3QYHB 3L2RA 1KJWA 1WI7A 2M02A 2GQIA 2QEXA 4D6WA 3EFSA 3JRZA 4BI4A 4A4EA 3EG0A 4BDZA 4F7UF 1GBQA 2XK0A 2CP7A 4XTZA 2MAMA 3MKDA 2HQHA 4AFUC 1C1AA 2DYIA 3JCMP 1UGPB 1M3CA 5KYWB 1UG1A 4MMKA 1KQ1A 2K7AA 3M55A 1OV3A 3WVDB 4F7UA 4XU1A 1Y0MA 2R57A 3P8BB 1SHGA 4GLMA 3MEUA 1KG1A 4F16A 3UA7A 2CS7A 1OU9A 2JZ2A 3CCEA 3JAME 2VYTA 5GAOp 4DA4A 2LQKA 2DL3A 3OS5A 4PLIA 4QQ6A 3DLMA 2EGAA 3OW2P 3NMZC 3QBYA 4DOVA 3JB9G 1M3AA 2FRWA 4EPCA 4M78C 4N0AC 2VGMA 3RDVA 4YTLA 2X4WA 2RJDA 4KUIA 3OYLA 4ZGJB 4M7AF 2A08A 5GJWB 3CC2T 4LUEA 3CXCA 2XG8D 2JVVA 3OSSC 2CZ7B 4IKFA 3MEWA 1PSFA 1AWOA 4PJOG 3EG1A 2HMAA 3CMAT 5IXFA 4XTYA 2EKHA 3KUFA 2V8IA 3IQLA 2K79A 2JJ9A 3UA6A 3PTAA 2KEAA 4M7AA 1PKSA 1VQ7T 4II1A 5DM7R 1RAEB 1NE8A 1UGVA 3S3OA 3CPWA 2QK0A 3QZ9B 2LVMA 1MUZA 2I2LA 2F5KA 4AT1B 3PE0A 4J6WA 3G4SA 1LOJA 1Y71A 2YRVA 4C5IA 5C6SA 3LH0A 2KNBB 4ZTFA 4BY6B 4WTOB 1VQPT 3OBYA 1KQ2A 2XMFA 4OMMA 2W10A 2CH4W 1QW1A 3BY7A 2DVJA 4KGXB 4JUVA 7AT1B 2RI3A 5IXBA 2PZ1A 3S3MA 4LDYA 1TOVA 6AT1B 1YJ9Q 2JMCA 1D0YA 1I5LA 1LNXA 4C8QE 1G83A 3A8HB 1DJ7B 1E6GA 1HK9A 2YUNA 5CO7A 5GAMj 2PVOB 3A5ZB 2ESWA 1OPLA 3LWIA 3FIFA 2ED1A 3CCMA 4P5NA 2MMPA 2AIRB 1VQ9A 5IAYA 3CPFA 4KH1B 5GAMe 1WHLA 1Y57A 5C0MA 2K3BA 3L2WA 4M7DE 1K9AA 4OMFB 2HAXA 4N4GA 1QP3A 2A0FB 1D3BA 3EFOA 3CC7A 4ESRA 3EGUA 4HKEA 4JJCA 2YDLA 3OYEA 3EG3A 3JCMc 2P4TA 1CSKA 4NOYA 1X01A 3MEAA 2ZPEB 2DRKA 4AFSC 2V1QA 1QQJA 2DX1A 1K4US 1BBZA 2DM1A 4ZNXA 4J7FA 4JS4A 2XHCA 3EGXB 1BI0A 3JB9J 3CC4T 5FRNA 2CT4A 2E64A 4LDXA 1MGQA 2EAYA 1EFNA 5GAOn 3G71A 3OW2S 1N6AA 4BD3A 1MNEA 1QKXA 3CBOA 1VOMA 3WXMB 4J8OA 1H3ZA 4BE2A 1Q7YU 2OTLQ 2QGFB 4CC4B 4PJMA 1ZLMA 5LJ5f 4R0KA 3U23A 1UECA 4PJLA 3VS7A 5IH2A 2R5AA 5KYYB 5CVIA 2EYZA 1YJWT 1RAGB 5AYFA 3H0IA 5HCKA 3CBPA 1LCKA 4PNOA 5KH6A 2KBTA 1VQ8A 3AHUA 2VB6A 4PFOA 2KVQG 3UPUA 2LC4A 3A98A 3ER0A 4TVRA 3GIBA 2FHDA 2RI2A 4KGZB 4C92C 2RK2A 1T3SA 1X69A 4C8QG 2JTEA 2L3SA 4M75D 1WDXA 2PU9B 2DTHA 2FZCB 3ZL7C 1Y07A 2IG0A 5J39A 5A0LA 1Q7YC 2DO3A 4PK4A 2MI6A 2ROLA 4IIOA 3MJXA 5GAN3 1BKBA 3M0RA 4M7DG 2QXFA 1IRXA 4RTXA 2H8HA 5FW9A 3M0SA 4HA8A 2L89A 2KGTA 4A4HA 3CEYA 1T3LA 4M75B 3MHXA 4BE0A 2GQVA 4LXCA 2KYBA 1VQMQ 3OYCA 1FMWA 3CCQA 3CCRQ 2BUDA 1XTDA 3CCSA 2ZPHB 2OJ2A 3M53A 1TSFA 1YHQT 3CQTA 3M0TA 4O5VA 2AZVA 4PL6A 2CGHA 1QCNA 3CCJQ 5CKHA 2MCNA 3CXCP 4KT0E 1VUBA 2A28A 1M8MA 5A0GA 2RHZA 4M78F 1VQ5Q 3OYGA 2L5QA 2CT3A 2LTOA 2KDSA 3SWNC 2IVWA 2FVUA 1VQMT 1LVKA 3M4YA 4J9IA 2RPNA 3CC2A 2LJ3A 4JLIA 2M51A 2KXDA 2OI3A 2QA4T 2MIOA 3QG1A 3PFSA 3V8LA 1TG0A 3CMAA 4M78A 2F5TX 2L8DA 1RACB 1NZ9A 4C5GA 2CZ1B 1VQ7A 3CCJT 2RN8A 2YLCA 1YP5A 2KE9A 4OF1A 2WSCE 4Q5WA 4B6MA 1SG5A 2HKQB 1RI0A 1U1TA 1VQPA 2DBMA 2K3YA 1JQQA 1E7OA 1UB4A 1GL5A 2BZ8A 4F17A 2X4YA 3C94A 4DBQA 3OW2A 4QQDA 2CP5A 4DBRA 3M56A 1W70A 3CCVQ 3FJ5A 2LQWA 2KR3A 4C8QA 1S72Q 2GF7A 1VQ4Q 4EMKC 1WJRA 2YHTA 3VS1A 3OYMA 4FIBA 2DD5A 2F69A 2V26A 4LDUA 1OULA 1PG5B 4RTTA 1IB8A 1D1AA 2GCXA 2E70A 1NJIU 1FWZA 4RTZA 2VGNA 4M7DA 3VRYA 3MP6A 1NPRA 4HCCA 1KFZA 1M2VB 2XDDA 1SRLA 4RTWA 1N9SA 4JJDA 1HD3A 3BW1A 5EG2A 4HVUA 3I56A 4HCBA 3CCVT 3GP8A 4X9CA 3QYGB 4ELZC 1S72T 1WQWA 3NPFA 2X4JA 3OYIA 1VQ4T 1M9SA 4NS5A 3CC4A 4M77D 4DOWA 1FXXA 2VXFA 2MWPA 2JM8A 4PJNA 3TU4K 1VQ6Q 4OMQA 2EQIA 1VQOA 2NYSA 1SRMA 3FLGA 1TS9A 4MDWA 1VQNA 1I0CA 2A3LA 1HJDA 2YSQA 3LX7A 1G3TA 1PRLC 2QTXA 3JV3A 2R5MA 2DL5A 3V8KA 3FRNA 4B9WA 4X9DA 2OTJQ 3NTKA 1PKTA 4RTUA 3QZ5B 3NHNA 1SSHA 2O88A 1B07A 1FMVA 1WGSA 1YJWA 1FYNA 2QASA 3G6EA 2LT1A 2A7YA 1Q82R 2AKLA 1R77A 3M0PA 4E7KA 4X1VA 5J3BA 2DYBA 2E5QA 2X35A 2WACA 3HPWA 3OB9A 2QQSA 5IHNA 3RBBB 1VQLA 3A8LB 3X20B 2P0KA 4C92F 3GOXA 1GCPA 1I07A 1AWWA 5I22A 1RL2A 3RKXA 4PJOC 1YCSB 1OPKA 2FL7A 3P8DA 5CR2A 2X51A 3R6OA 2F2XA 2MK5A 4E7IA 5KYXA 4PFZA 3M58A 3GBQA 4C92B 2ABLA 4J9FA 1PD1A 1VYTA 4L59A 1VIEA 2AZSA 1RLPC 2RM4A 1Q95G 2EIFA 3H9NA 3OY9A 3CCUQ 1M90C 1RAFB 3T9NA 1YFNA 1OX8A 4OGCA 4FW2A 1G2BA 3KFVA 3EFRA 5LJ3h 4E6RA 1EX4A 3PVLA 3MPUB 1YWOA 2FRYA 3H0HA 3OMGA 1X2QA 2O4XA 2DRMA 4Y28E 1YJNQ 1H641 1YHQA 3OYBA 1R0CB 1TUGB 4AFQC 4JRKA 2YLBA 2QGGA 4IIMA 3C4SA 3L1AA 3CCUT 2EJ9A 3OSVA 1YITQ 5GAMg 4HCKA 3UF4A 1IO6A 5LJ3d 1RUWA 3X26B 1AOJA 1I8FA 1WX6A 1W4SA 1N8RU 3TEEA 2QA4A 4XTVA 1SEMA 1KK7A 2L3QA 4F7UB 1ZBXA 1TUDA 5GANd 2RA2A 3NTIA 4J7IA 2P0PA 2DEUA 3QWXX 1SF9A 8ATCB 3O8VA 1Q7YR 5I21A 3SWNA 1K73U 3TQ7P 2EQKA 2DILA 3O5ZA 1JXMA 2M16A 1IZ6A 1OX9A 5GAOq 4M7AD 4M75E 1YITT 2O01E 1I1JA 2J06A 2M1HA 3BDUA 1AZEA 2AKKA 2DTIA 4K11A 2GTJA 2FB7A 4XTXA 3JCMd 2O31A 1YIJA 2DK3A 1MMDA 1VQKA 2V8KA 1M2OA 2RHIA 1N27A 2DNUA 4IUVA 3JCMQ 3ME9A 3E9GA 2GNCA 2HSPA 1N8RC 2QQ9A 3LYIA 1B34A 5D6XA 4M7AB 4J83A 1BU1A 1V29B 1PSEA 4E7HA 1K8AU 4PJJA 3FEOA 1WXTA 2QG9B 3HKSA 1XQHA 2CP3A 3M54A 1I5OB 2HCKA 2G6FX 5CKBA 2HKNA 1K73C 3ZFJA 2X9HA 2J7IA 1YI2Q 3C95A 4C5EA 1P92A 4C8QC 4AFZC 5CK9A 2KK4A 3JCMX 2E12A 2VV5A 1IGQA 4EMKA 3QDFA 3G1JA 1M27C 1RAHB 3VJPA 4QW2A 1UGRB 2D6FA 2Z0WA 5GAOl 2LRQA 1H92A 2HZYA 2MOXA 5GAN8 1AWXA 1S72A 2LX7A 3RESA 3I9QA 3M0UA 3DKMA 1QCFA 3CCLA 1AWJA 2IIMA 4M7DC 4BUGA 1ZA2B 2LT4A 4Z89A 5DLOA 2RF0A 2BE7D 1TUCA 2L0AA 1M1KU 4LNPA 1XNIA 1YI2T 1WHHA 3V8JA 5I2MA 2GFUA 2ZGWA 3OS1A 4ATOA 1D3BB 1NPPA 3EFOB 1ZSZA 4OMNA 3CD6A 3UDCA 3EH1A 1YJ9T 1WZOA 2L3RA 4OMLA 3GNFB 4M75G 5HY6A 2BZXA 4MZTA 2PTKA 4IURA 5CKEA 3OQ5A 3JB9F 2RO0A 2YRDA 1UGSB 3BE3A 2RB6A 3E9FA 4BACA 4XTUA 3HL8A 5GMKm 3OYKA 3M5AA 2YUQA 4OMOA 2I0NA 4HT9A 4C5HA 1MV3A 1GRIA 4N4IA 1GFDA 4BI8B 1K9MR 1BB9A 2CH4A 4IUUA 1M1KC 3V7RA 4C0ZA 1M1FA 2QTVA 3V7SA 1U1SA 4PJOF 4ORZA 4JRIA 5DY9A 2X3XD 3LGFA 2GFAA 1QWFA 2RQRA 3M0QA 2DA9A 2K57A 2QQRA 1G3WA 2DZ9A 2JUFA 4F14A 4Y92A 3TSZA 2D9TA 1PWTA 4MZPA 2J6OA 5DLQE 5FU6B 1WLPB 4PJOA 2EQJA 4JRQA 4UC4A 2ATCB 4PFPA 4C0DC 1KD1U 1FX7A 2B8AA 2VKNA 2RQUA 2D1XA
chains in the Genus database with same CATH topology
5CCAA 4M78E 1Q82U 5FU6C 4E7JA 1KHIA 2X4YA 2DPPB 4M77E 4OB2B 2DXCA 3PT9A 1O9SA 3C94A 4EMKB 2OTLT 4FT2A 3RKYA 4MMLA 3LWHA 3TCJA 3OW2A 4Y91A 4QQDA 3QIIA 3FDRA 3M56A 4C92A 1Q86U 1QP2A 3OYNA 3VKIA 1QVGA 3VUBA 4C8QA 1OZ2A 3CCVA 5IN1A 4PJOE 4XQ3A 2WSEE 2GF7A 4ME7A 4EDUA 4EMKC 2ZCFB 5LJ3j 1WJRA 2JN0A 2YHTA 3S3NA 1VQ4A 3OYMA 4FIBA 1OYXA 2EYQA 3M4GA 2DD5A 2F69A 3DB4A 3CBMA 2VC8A 1VQ8T 4Z02A 2LDMA 3SDZA 1O75A 4LDUA 4X34A 5GAN7 4MDXA 5LJ3g 1EIFA 3OYJA 4JRPA 1KC8C 1BYMA 1BI1A 5GANj 2GCXA 2XU8A 2CZ0B 3GLXA 3HSBA 2E70A 1NJIU 3OYDA 1FWZA 4WF2A 2VGNA 4M7DA 4JS5A 1WJSA 3MP6A 4J5YA 4KULA 5GANg 1WNLA 1NPRA 2DJZA 5FRMA 4HCCA 1K8AC 4OP0A 3URGA 2XDDA 1N9SA 3J7AF 3OBWA 2P0QA 1GXIE 3PIPA 3JCMW 1KD1C 3BW1A 5EG2A 5HK3A 3I56A 4HCBA 3CCVT 2QQBA 4X9CA 3GPLA 3GP8A 3QYHB 3L2RA 3QYGB 1BIBA 3JB9D 3PNWC 2QEXA 1Q81C 4XK8E 1Q82C 4D6WA 4ELZC 1S72T 3EFSA 3JRZA 1WQWA 2DD4A 2X4JA 3OYIA 4BI4A 1M9SA 4M78D 4A4EA 1VQ4T 4NS5A 3CC4A 4M77D 3I55A 3DLLA 4BDZA 1JB0E 2EFIA 2HQXA 4DOWA 4F7UF 3JB9F 1YITA 5KCHA 1FXXA 5A2QE 2XK0A 2VXFA 5GAN5 2MWPA 3TU4K 4VUBA 1TH7A 4XTZA 2MAMA 5D6YA 1VQ6A 4ZN1A 1VQOA 5LJ5h 1W2BA 3FLGA 3JCMP 4OB3B 3JCMg 4MDWA 1VQNA 2A3LA 1UGPB 4PJOD 4BDYA 2RJCA 2XI9A 3MCAB 4MMKA 1KQ1A 2E6NA 3LX7A 1G3TA 3EAEA 3NFCA 3ZEHA 2QTXA 3M55A 2R5MA 3DB3A 3WVDB 3V8KA 4F7UA 3HFOA 4XU1A 3OS0A 2PVDB 2K5FA 2EKOA 2JOYA 2R57A 2RK1A 3MO8A 3I56T 3UWNA 4O6JA 3P8BB 3L2UA 3CCRT 1X75C 3FRNA 3MEUA 4B9WA 4X9DA 1KG1A 3NTKA 4M78B 3OYYA 4A54A 4CI0C 2OTJA 2CS7A 2JZ2A 3QZ5B 3SD4A 4BI3A 3CCEA 3JAME 2CYZB 2VYTA 5GAOp 4DA4A 5GAMf 2LQKA 1OI1A 5IT9E 1WGSA 3OS2A 3OS5A 1YJWA 1U8RA 4PLLA 1Y96A 4PLIA 3G6EA 2LT1A 2A7YA 4LD6A 4N4HA 4QQ6A 1I4K1 3DLMA 2K4YA 5GAOl 3X25B 4E7KA 5GMKh 5GAN4 2QDYB 3QBYA 5J3BA 4DOVA 3PIOA 3JB9G 4EPCA 4M78C 4N0AC 2E5QA 5I2SA 1VQOT 2X35A 4M77C 2VGMA 5LJ5d 1QVFS 4PJOB 1VQNT 4RG2A 4M78G 4YTLA 4A53A 2XDBA 2X4WA 2WACA 3HPWA 4M77G 1VQ5T 3OB9A 2RJDA 2QQSA 4KUIA 4EMGA 3VYGA 3OYLA 2DXTA 4F7UE 5CKDA 3E19A 4GY5A 4ZGJB 1VQLA 4M7AF 3A8LB 2BIVA 1WJQA 2K3XA 2P0KA 3X20B 4C92F 5HKCA 3TREA 3GOXA 3CC2T 1XOVA 2JTMA 4C8QF 3CXCA 2XG8D 2JVVA 3OSSC 1RL2A 2CZ7B 2NLUA 3RKXA 4PJOC 4IKFA 3MEWA 3P8DA 2FL7A 1G3SA 5CR2A 3QDRB 5GAOm 1X6OA 1PSFA 2LCCA 1N9RA 4PJOG 2WSFE 3PMIA 4L6V5 3R6OA 3ASKA 4RCCA 3CCET 3CMAT 4E7IA 5CKFA 3KBGA 4XTYA 3KUFA 3HRTA 2V8IA 5CIUA 2ZPBB 1M4ZA 3M58A 3KXTA 4C92B 3PTAA 3G6ET 1WPYA 2HBPA 4M7AA 4L59A 4II1A 5DM7R 1VIEA 4C8QB 4MZMA 1VQ7T 1NE8A 2RM4A 3S3OA 3CPWA 2EIFA 2LVMA 3QZ9B 2CZ6B 3OY9A 4M7DF 2E65A 2I2LA 2F5KA 1M90C 5CQYA 1M1GA 4J6WA 3VYHB 2DIGA 3L2QA 1LOJA 3G4SA 3CMET 3CCUA 1Y71A 2E10A 4E47A 2YRVA 3SFMA 3T9NA 4C5IA 5C6SA 3LH0A 4OGCA 1VQLT 4KUDK 3J80E 4ZTFA 4BY6B 4ELYC 5GAOr 3A8MB 1VQPT 3OBYA 3QPHA 3HFNA 1KQ2A 3EFRA 2XD0A 3QSUA 1Q86C 1QW1A 3BY7A 3MP1A 4LDWA 5D6WA 5LJ3h 4J6YA 5LJ3e 4JUVA 3VU3C 2RI3A 3CPWS 3S3MA 3QHSA 4LDYA 1BIAA 2DXUA 5M9OA 3OMGA 2EQUA 3VUZA 4M7AE 4HCZA 2O4XA 4RG8A 1YJ9A 4Y28E 4DQ2A 1H641 2K5LA 5L8RE 1LNXA 4C92E 5GANe 1I5LA 1Y7XA 3HHTB 1YJNA 1YHQA 3OYBA 4C8QE 3A8GB 2LX9A 4JRKA 2YLBA 4M75F 3A8HB 2HNIA 3C4SA 1DJ7B 3JB9I 3L1AA 1HK9A 2KQWA 2OAUA 3X28B 3BDLA 3CCUT 2EJ9A 5CO7A 3E1SA 5GAMj 2PVOB 3LLRA 3A5ZB 1R8OB 3HP9A 3LWIA 3FIFA 4QVCA 3CCMA 2KY9A 4P5NA 4FT4A 2RD1A 4V2SA 3OSVA 2MMPA 1M5Q1 4R55A 2XDPA 2DAQA 3Q1JA 5GAMg 3LW5E 3OA6A 1VQ9A 5IAYA 1JJ2S 1BI3A 3CPFA 3NTHA 3RKWA 5LJ3d 4NL2A 5GAMe 5C0MA 3L2WA 4M7DE 4M75A 3X26B 4OMFB 2CKKA 2HAXA 2ZPIB 1I8FA 4QVDA 4N4GA 1QP3A 3GNGA 4L5GA 1W4SA 1N8RU 1D3BA 2PUOB 1ZHIA 2Y4YA 5FU7B 4A4KA 3CC7A 4ZN3A 5FROA 3TEEA 3JCMe 2R58A 2V8JA 4HKEA 4XTVA 2LNVA 3OYAA 2QA4A 4F7UB 5GANd 1ZBXA 3OYEA 3JCMc 2RA2A 2P4TA 3NTIA 4J7IA 4NOYA 2P0PA 4GLKA 3X24B 1X01A 3MEAA 1KQSS 3MEVA 2ZPEB 4RCBA 3O8VA 2QEXT 5I21A 1NJIC 3RMQA 4FL6A 3SWNA 4J7FA 4LD9K 1K73U 4JS4A 3RERA 2XHCA 3OYFA 4JLGA 3OYHA 1BI0A 2EQKA 3JB9J 3CC4T 5FRNA 3I55T 1Y96B 2Y4XA 1JBMA 4OB0B 3JCMb 4JDSA 2M16A 1IZ6A 2DIQA 4F7UG 3QJ6A 2E64A 5GAOq 4M7AD 4M75E 1YITT 1OZ3A 4XAXB 4LDXA 2X4XA 4C92D 1MGQA 2O01E 2EAYA 4C8QD 3V7CA 1VQ6T 3WVEB 2VXEA 3F70A 5GAOn 2RH2A 1YBYA 2M1HA 3BDUA 3G71A 1LJOA 2DTIA 3OW2S 1N6AA 4BD3A 3CC7T 3CBOA 4JJNK 3WXMB 3H6ZA 4J8OA 2FB7A 4XTXA 3JCMJ 1QVGS 2XKOC 3JCMd 3G7ZA 4BE2A 1Q7YU 1H3ZA 4B9XA 2VUBA 4N0AA 1YIJA 2DK3A 2KSSA 1BI2A 4PKCC 3PMTA 4XTWA 2V8KA 4M77A 3J81E 1VQKA 2OTLA 4ZGEB 2C06A 2RHIA 1N27A 4IUTA 5LJ5f 4KBMB 4IUVA 2EJGA 3JCMQ 2H3JA 3ME9A 3E9GA 1UGQB 4M7DD 1N8RC 2OTJT 2QQ9A 3LYIA 1B34A 5D6XA 2JTFA 2R5AA 1K9MU 4M7AB 5CVIA 2RI5A 1YJWT 4J83A 4HT8A 1V29B 5AYFA 1PSEA 3RMSA 4E7HA 3CBPA 1K8AU 4PNOA 4OGEA 2K2VA 3VV0A 4QQGA 5KH6A 2XICA 3FEOA 2DEQA 2HQEA 3N5BB 1VQ8A 4XU0A 3AHUA 3HKSA 1XQHA 3L42A 3M54A 2KVQG 1YCYA 3UPUA 2LC4A 2Y90A 5CKBA 1K73C 3ZFJA 3ER0A 4TVRA 3GIBA 4M7AC 2FHDA 2RI2A 3C95A 4C92C 3HRUA 4C5EA 2RK2A 4RMOA 1UEBA 1YI2A 1YIJT 4M7AG 1P92A 1VQKT 4C8QC 4C92G 5CK9A 2KK4A 2E6ZA 2E12A 2G3RA 5KCOA 3JCMX 2VV5A 2DTOA 3SB2A 1I81A 4C8QG 4EMKA 4BE1A 3M9QA 1QVFA 4M75D 1AHJB 1KHCA 2DVEA 4M7DB 2PU9B 3META 2DTHA 5GMKi 3VJPA 1IREB 1UGRB 4QW2A 2D6FA 1WQ7A 1HXDA 1Y07A 3QKJA 2LRQA 2O4XB 2DZCA 2IG0A 3ZBDA 4BB7A 4EMHA 5J39A 5GAN8 4BY6C 3RUXA 3P8HA 5A0LA 1S72A 1Q7YC 3MP8A 3RESA 2KAFA 2DO3A 5GANh 3DKMA 1W2BS 2MI6A 3CCLA 3H8ZA 3S6WA 5GAN3 4M7DC 4BUGA 2BKDN 2LT4A 2ZPGB 4QVZA 1BKBA 5KE2A 4M7DG 2QXFA 2HD0A 2LQ8A 5DLOA 4FM4B 3M57A 3G4ST 3RIRA 5LL6S 1M1KU 3JB9H 4HA8A 2KMTA 1XNIA 2L89A 1K9MC 4ZTJA 3A8OB 3L2VA 1YI2T 4A4HA 3OMCA 2RJEA 3LGLA 2K5IA 2QI2A 3CEYA 3V8JA 5I2MA 2GFUA 2ZGWA 3OS1A 3QJYA 4M75B 1MHNA 3MHXA 4BE0A 2GQVA 2ZPFB 4FU6A 3OYCA 5GAMh 1M8VA 4ATOA 3CCQA 1VQMA 3M59A 3GF5A 1D3BB 2BUDA 1XTDA 2LCLA 1NPPA 2MF2A 3CCSA 2ZPHB 1G5VA 3CD6A 2DKGA 3CCRA 1JRIA 2RHXA 3UDCA 2JNGA 4XU3A 3JCMV 2M9UA 4R56A 1YJ9T 3JCMh 4XU2A 2ZZDA 3M53A 4M75C 1YJNT 1YHQT 5LJ3f 3CCLT 2L3RA 2MWOA 2PQWA 5LJ5j 3GNFB 4M75G 4O5VA 5HY6A 4LDVA 1VIFA 4PL6A 4MZTA 2CGHA 3SWNB 4E7LA 5CKHA 4IURA 5FU7C 4KT0E 2FYKA 3OQ5A 1VUBA 2RO0A 4OB1B 5CKEA 2PUKB 5LJ5g 1UGSB 3CCJA 4FSXA 2RB6A 5A0GA 2RHUA 3E9FA 5LJ5e 5GANf 4BACA 4XTUA 3CXCS 2RHYA 3HL8A 2RHZA 4M78F 3CCMT 3OYGA 3QO3A 2L5QA 5GMKm 4M77F 3M5AA 3OYKA 1VQ5A 2LTOA 3QUIA 3HRSA 1VQ9T 2AHJB 4ZGDB 2KDSA 4HT9A 3SWNC 4C5HA 2IVWA 2FVUA 3CCQT 1VQMT 5GAMd 4N4IA 3M4YA 4BI8B 3CCST 1ZQ1A 4C0FA 3CC2A 1SSFA 3CD6T 4JLIA 4A4FA 5CAIA 3JSCA 2EQMA 4IUUA 4CRIA 2RJFA 3INZA 1M1KC 3V7RA 2XIDA 1M1FA 4C0ZA 1M90U 3V7SA 2QA4T 5GMKj 1U1SA 2EJFA 2EWNA 4PJOF 3QG1A 4JRIA 4M77B 3FB9A 3PFSA 5DY9A 4J6XA 3V8LA 3CMAA 1JJ2A 4M78A 2F5TX 1G3YA 2L8DA 3LGFA 2GFAA 2DXBA 3FC3A 2D0QB 3C12A 1NZ9A 4C5GA 5A0DA 2CZ1B 5GAN2 1VQ7A 5GMKe 1KC8U 1B34B 4C0DB 3CCJT 2QQRA 2K57A 1G3WA 3BFMA 2DZ9A 2JUFA 3QXEB 3JCMf 2YLCA 4RKUE 2D9TA 2PVGB 3L2ZA 4OF1A 5HK0A 2WSCE 4Q5WA 2QQAA 4MZPA 4A4GA 5GAN6 2M0OA 5FLXE 3CMEA 2E41A 5DLQE 5FU6B 5GMKl 1KQSA 4IUPA 4PJOA 2EQJA 1RI0A 1QVPA 5CQXA 1U1TA 4JRQA 4NL3A 4UC4A 1VQPA 2K3YA 4OVAA 3PGGA 5J26A 4C0DC 1UB4A 1KD1U 3FJPA 5KE3A 3G71T 1FX7A 2B8AA 4IUQA 2E1HA 4C0GA 3UT1A 1Q81U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGS A;  3OS2 A;  4PLL A;  3H8Z A;  4PLI A;  3S6W A;  4LD6 A;  4N4H A;  4QQ6 A;  4E7J A;  2X4Y A;  3DLM A;  4E7K A;  2BKD N;  5FRO A;  3QBY A;  4QVZ A;  2R58 A;  5KE2 A;  3OYA A;  3OYE A;  2E5Q A;  2X35 A;  3NTI A;  4RG2 A;  4QQD A;  1XNI A;  2L89 A;  2WAC A;  2X4W A;  3MEA A;  3MEV A;  3OB9 A;  2RJD A;  2QQS A;  3FDR A;  3QII A;  3OMC A;  2RJE A;  3LGL A;  4A4H A;  3OYN A;  3OYL A;  3O8V A;  3CEY A;  4GY5 A;  1OZ2 A;  2GFU A;  4FL6 A;  5IN1 A;  2BIV A;  1WJQ A;  1MHN A;  2K3X A;  2P0K A;  3OS1 A;  4BE0 A;  3OYH A;  3OYF A;  4FU6 A;  2GF7 A;  3OYC A;  2EQK A;  4EDU A;  3GOX A;  5FRN A;  1WJR A;  2BUD A;  3S3N A;  2NLU A;  3OYM A;  4ZTJ A;  1OYX A;  2M16 A;  1G5V A;  2DIQ A;  3MEW A;  3P8D A;  3DB4 A;  3QJ6 A;  4IKF A;  2RHX A;  4Z02 A;  1OZ3 A;  2LDM A;  2LCC A;  4X34 A;  2X4X A;  3PMI A;  3ASK A;  3OYJ A;  4E7I A;  3KUF A;  5CIU A;  3F70 A;  2M1H A;  2L3R A;  2MWO A;  2PQW A;  4BD3 A;  3OYD A;  4L59 A;  4II1 A;  3H6Z A;  1WJS A;  3MP6 A;  4PL6 A;  3L2V A;  4E7L A;  1H3Z A;  4BE2 A;  3S3O A;  4IUR A;  3OQ5 A;  2LVM A;  2RO0 A;  4B9X A;  5FRM A;  3OY9 A;  3PMT A;  2F5K A;  2RHU A;  3E9F A;  3L2Q A;  2DIG A;  4BAC A;  2RHY A;  2RHZ A;  2RHI A;  1N27 A;  4IUT A;  3OYG A;  2YRV A;  4C5I A;  5C6S A;  3OYK A;  3LH0 A;  4IUV A;  2LTO A;  4ZTF A;  3L2R A;  3ME9 A;  3E9G A;  3PNW C;  3LYI A;  4C5H A;  3MP1 A;  5D6X A;  2JTF A;  2R5A A;  5D6W A;  4N4I A;  3OYI A;  4A4E A;  4NS5 A;  1SSF A;  2RI5 A;  2RI3 A;  4A4F A;  4BDZ A;  2EQM A;  2EFI A;  4IUU A;  4CRI A;  2HQX A;  2RJF A;  4E7H A;  3S3M A;  4QQG A;  5KH6 A;  5KCH A;  3FEO A;  2HQE A;  2XK0 A;  5M9O A;  3OMG A;  2EQU A;  3L42 A;  3PFS A;  2MWP A;  2O4X A;  4HCZ A;  5D6Y A;  2L8D A;  3LGF A;  2GFA A;  3FC3 A;  3OYB A;  3FLG A;  2FHD A;  2RI2 A;  4C5G A;  4C5E A;  2RJC A;  4BDY A;  2QQR A;  2E6N A;  3C4S A;  3LX7 A;  3EAE A;  3ZEH A;  5KCO A;  2G3R A;  2R5M A;  2D9T A;  3DB3 A;  3BDL A;  4Q5W A;  4BE1 A;  4A4G A;  3M9Q A;  3OS0 A;  2M0O A;  1KHC A;  3LLR A;  2EKO A;  2R57 A;  3MO8 A;  3UWN A;  3L2U A;  3MET A;  4IUP A;  2EQJ A;  1RI0 A;  3MEU A;  4QW2 A;  3QKJ A;  4B9W A;  4UC4 A;  2LRQ A;  2DAQ A;  2IG0 A;  2K3Y A;  2O4X B;  2XDP A;  3NTK A;  3Q1J A;  4OVA A;  5IAY A;  5J26 A;  5J39 A;  3OA6 A;  3NTH A;  2JZ2 A;  3P8H A;  3SD4 A;  5C0M A;  3MP8 A;  3L2W A;  5KE3 A;  2VYT A;  2B8A A;  2CKK A;  4IUQ A;  1OI1 A;  3UT1 A;  4N4G A; 
#chains in the Genus database with same CATH topology
 1W6X A;  2RMO A;  1WXU A;  4M77 E;  1NM7 A;  2DPP B;  1IHW A;  2DXC A;  2OTL T;  4FT2 A;  3RKY A;  4MML A;  5KYU A;  1K0S A;  2RQV A;  3OYN A;  3VKI A;  5AT1 B;  1OZ2 A;  2F1L A;  5LJ3 j;  3S3N A;  1OYX A;  2EYQ A;  3H41 A;  2VC8 A;  3A1P A;  3SDZ A;  1KIK A;  4CC2 A;  5GAN j;  2CRE A;  2XU8 A;  2CZ0 B;  2HEQ A;  4F04 B;  3HSB A;  3HTR A;  3OYD A;  2LJ1 A;  1ZUY A;  4JS5 A;  1WJS A;  4J5Y A;  4KUL A;  2DJZ A;  4OP0 A;  2YT6 A;  3OBW A;  1WYX A;  2YUO A;  3JCM W;  1KD1 C;  2SEM A;  1TTH B;  1CKB A;  3H0F A;  2QEX Q;  1BIB A;  3E2U A;  1ZX6 A;  1WFW A;  2DD4 A;  4M78 D;  2OAW A;  1JJ2 P;  1UTI A;  1ZBJ A;  1JB0 E;  2EFI A;  1YIT A;  1M90 R;  2YUP A;  2E4H A;  5GAN 5;  4VUB A;  5D6Y A;  4ZN1 A;  2H3E B;  5LJ5 h;  2VVK A;  2RJC A;  3MCA B;  2YXY A;  1KC8 R;  2E6N A;  1KQS P;  1D0Z A;  3HFO A;  2PVD B;  2K5F A;  2RK1 A;  3CCR T;  3MO8 A;  3UWN A;  4AG2 C;  4M78 B;  3CCE Q;  3SD4 A;  4BI3 A;  2CYZ B;  1NYF A;  3REA B;  5GAM f;  1OI1 A;  1QWE A;  1U8R A;  4PLL A;  1Y96 A;  1C6V X;  4AG1 C;  1Q86 U;  4LD6 A;  1NBE B;  2YWW A;  2QDY B;  1C0M A;  4D8D A;  5I2S A;  5LJ5 d;  1QVF S;  4RG2 A;  3R6N A;  3CME Q;  4A53 A;  1YN8 A;  4M77 G;  1VQ5 T;  4EMG A;  4F7U E;  2EYX A;  5CKD A;  3E19 A;  2KT8 A;  2BIV A;  2K3X A;  1ABQ A;  5HKC A;  2CDT A;  3TRE A;  2JTM A;  4C8Q F;  4FCY A;  2QAZ A;  1PNJ A;  1G3S A;  5GAO m;  1X6O A;  1ACM B;  1N9R A;  3THK A;  2WSF E;  3ASK A;  2DE0 X;  3CCE T;  5CKF A;  3KBG A;  3HRT A;  5CIU A;  1H3H A;  1M4Z A;  3KXT A;  1WPY A;  2HBP A;  2MYS A;  4C8Q B;  4MZM A;  2P84 A;  3EHR A;  4M7D F;  1RAD B;  2EYW A;  3VYH B;  2DIG A;  3CME T;  3SFM A;  3J80 E;  5GAO r;  3A8M B;  3QPH A;  3VRZ A;  1Z9Z A;  1Q86 C;  3MP1 A;  4LDW A;  2FO0 A;  5D6W A;  4J6Y A;  3AT1 B;  2CSQ A;  3QHS A;  4A63 B;  9ATC B;  2DXU A;  1W2B P;  1MMA A;  3VUZ A;  4M7A E;  4RG8 A;  1YJ9 A;  2K5L A;  5L8R E;  1Y7X A;  3HHT B;  1OQK A;  2LX9 A;  1MND A;  3JB9 I;  3NGP A;  3BDL A;  3I55 Q;  4JZ3 A;  3LLR A;  2D8H A;  4LUD A;  1JU5 C;  4QVC A;  1ZSZ C;  2KY9 A;  4FT4 A;  2RD1 A;  4V2S A;  1VQ9 Q;  2F2W A;  1M5Q 1;  4R55 A;  2XDP A;  2DAQ A;  3LW5 E;  3OA6 A;  1V76 A;  4FYV B;  1JJ2 S;  1PC0 A;  3RKW A;  1RLQ C;  2C0I A;  1AZG B;  2DFU A;  4L5G A;  3CC7 Q;  3I5S A;  2Y4Y A;  2PUO B;  4JPB W;  4A4K A;  5IHK A;  2CP6 A;  2FG0 A;  2R58 A;  2LNV A;  4GLK A;  3X24 B;  1KQS S;  3MEV A;  4FW1 A;  1ZUK A;  4RCB A;  1NJI C;  1LPL A;  1VYV A;  2NUT A;  3OYF A;  4JLG A;  3OYH A;  3I55 T;  2Y4X A;  1PD0 A;  4RTV A;  4KH0 B;  1UE9 A;  2DIQ A;  4F7U G;  2B86 A;  1OZ3 A;  4C92 D;  1NEB A;  3G71 Q;  3V7C A;  4ANJ A;  1VQ6 T;  3WVE B;  2VXE A;  4D8K A;  1LJO A;  3EGD A;  1JO8 A;  2JT4 A;  3CC7 T;  1OOT A;  1QVG S;  1PM3 A;  3G7Z A;  2C0T A;  1WHK A;  2VUB A;  1BI2 A;  4PKC C;  3PMT A;  5GJV B;  3J81 E;  4M77 A;  2L3P A;  2OTL A;  1RAI B;  1U06 A;  2DMO A;  1UFF A;  4KBM B;  1VA7 A;  2H3J A;  2OTJ T;  5KYX B;  5ECA A;  5D7U A;  1D1B A;  1ARK A;  1X2K A;  2RI5 A;  2ROT A;  1TU0 B;  3TVT A;  3RMS A;  1VQ8 Q;  1HSQ A;  4OGE A;  4QKU A;  2K2V A;  4QQG A;  3N5B B;  4XU0 A;  4KRT A;  1YCY A;  2KRO A;  2Y90 A;  3EG9 B;  4RMO A;  4M7A G;  3REB B;  2DL4 A;  3RNJ A;  2G3R A;  2DTO A;  1MMN A;  1I81 A;  3SB2 A;  4BE1 A;  1TXQ A;  3M9Q A;  1QVF A;  1AHJ B;  1KHC A;  2DVE A;  3MET A;  4E7Z A;  1IRE B;  2LQN A;  1WQ7 A;  3QKJ A;  2O4X B;  2DZC A;  3ZBD A;  2K6D A;  3P8H A;  3RR6 A;  2KAF A;  5GAN h;  1W2B S;  2DJQ A;  2HD0 A;  2LQ8 A;  2QYZ A;  3M57 A;  4CC3 A;  2KMT A;  2HDA A;  4ZTJ A;  2NUP A;  3OMC A;  2JW4 A;  1WA7 A;  1BCO A;  1M3B A;  3QJY A;  1SHF A;  1MHN A;  3CCQ Q;  4FU6 A;  3ULR B;  1M8V A;  3QWY A;  3CCS Q;  1VQM A;  3GF5 A;  1SPK A;  2MF2 A;  1WHM A;  5KYN A;  1G5V A;  2DKG A;  3CCR A;  4XU3 A;  3JCM h;  2JS2 A;  4OMP A;  4FYW B;  2EBP A;  4M75 C;  1YJN T;  2J05 A;  2KRN A;  2ENM A;  4FYY B;  5LJ5 j;  2JM9 A;  3SWN B;  1X27 A;  4E7L A;  5FU7 C;  3CCJ A;  4J9C A;  5LJ5 e;  2RHY A;  1UUE A;  1VQ5 A;  3QUI A;  2AHJ B;  3VS3 A;  4ZGD B;  5KYW A;  3CCQ T;  3CC2 Q;  2FZK B;  3CCS T;  1ZQ1 A;  1TWB A;  1SSF A;  1U3O A;  4Z8A A;  3CMA Q;  3FB9 A;  1JJ2 A;  1WXB A;  1KD1 R;  2CP2 A;  1G3Y A;  2DET A;  1JEG A;  2DXB A;  2D0Q B;  1VQ7 Q;  5GAN 2;  2COW A;  1B34 B;  3QXE B;  3L2Z A;  2QQA A;  5GAN 6;  1D1C A;  3EHQ A;  1NLP C;  5FLX E;  2E41 A;  3CME A;  1BK2 A;  2GBQ A;  1KQS A;  4IUP A;  2O9S A;  1QVP A;  1VQP Q;  3EH2 A;  4NL3 A;  2V1R A;  2VAS A;  5J26 A;  3FJP A;  4ZN3 A;  2DL8 A;  5CCA A;  1Q81 U;  4M78 E;  1Q82 U;  4E7J A;  2FPF A;  4OB2 B;  2EGC A;  5IHI A;  4EMK B;  8AT1 B;  3LWH A;  3TCJ A;  3QII A;  2KT1 A;  2LZ6 B;  4J9E A;  1QVG A;  4HVW A;  3CCV A;  4XQ3 A;  1BCM A;  2WSE E;  4ME7 A;  4EDU A;  2ZCF B;  1J3T A;  1VQ4 A;  3CBM A;  4Z02 A;  4MDX A;  1O75 A;  1UJY A;  1W1F A;  3PVQ A;  2E3I A;  5GAN 7;  5LJ3 g;  1G8X A;  4JRP A;  4QT7 A;  3GLX A;  4WF2 A;  1D0X A;  2HL5 C;  1UHC A;  2DF6 A;  5GAN g;  1WNL A;  1AEY A;  3TSW A;  5FRM A;  2W0Z A;  1K8A C;  3URG A;  1ZSZ B;  4WCI A;  2P0Q A;  3I56 Q;  1GXI E;  1D09 B;  4HVV A;  5HK3 A;  2QQB A;  3GPL A;  3JB9 D;  1Q81 C;  3SHW A;  3PNW C;  1Q82 C;  4XK8 E;  2O2O A;  1RI9 A;  2A37 A;  1X6G A;  3CC4 Q;  2KYM A;  2RQT A;  1RAA B;  3I55 A;  3DLL A;  2HQX A;  5FWC A;  2NUZ A;  5KCH A;  5A2Q E;  1QLY A;  1ZA1 B;  1VQO Q;  1K1Z A;  1TH7 A;  2NWM A;  1VQ6 A;  2RQW A;  1VQN Q;  1W2B A;  1T0H A;  4OB3 B;  3JCM g;  1Q86 R;  4PJO D;  4BDY A;  2XI9 A;  1AT1 B;  2DER A;  3EAE A;  3NFC A;  3ZEH A;  3DB3 A;  4FSS A;  1AD5 A;  3OS0 A;  1PCX A;  3I56 T;  2EKO A;  2JOY A;  4O6J A;  3L2U A;  4J9B A;  1X75 C;  1JXO A;  3OYY A;  4A54 A;  4CI0 C;  2OTJ A;  1K0X A;  4DEY A;  1YJW Q;  3VS4 A;  5IT9 E;  3EGX A;  3G6E Q;  1UDL A;  3OS2 A;  4N4H A;  1I4K 1;  2K4Y A;  3X25 B;  5GMK h;  5GAN 4;  1QVF P;  2E3H A;  3PIO A;  1VQO T;  4EIK A;  4M77 C;  4PJO B;  1VQN T;  2ECZ A;  4M78 G;  1F1B B;  2XDB A;  1QCO A;  3VYG A;  1NEG A;  1VQL Q;  2DXT A;  2ED0 A;  4GY5 A;  3LH5 A;  1WJQ A;  1XOV A;  2D8J A;  1A0N B;  2NLU A;  1YNZ A;  2LP5 A;  1U5S A;  2X3W D;  3QDR B;  2LCC A;  3PMI A;  4L6V 5;  4RCC A;  5KYU B;  2P4R A;  2ZPB B;  1X43 A;  1H8K A;  3G6E T;  1QMC A;  5KYY A;  1NJI R;  1GCQ A;  2LJ0 A;  2CZ6 B;  2E65 A;  5CQY A;  1M1G A;  3L2Q A;  3CCU A;  2J6K A;  2E10 A;  4E47 A;  2AT1 B;  1VQL T;  2GTO A;  4KUD K;  4ELY C;  4M4Z A;  3HFN A;  3QSU A;  2FEI A;  2XD0 A;  2DBK A;  2PNI A;  2KXC A;  5LJ3 e;  3VU3 C;  4JZ4 A;  2COY A;  1ZSG A;  1BIA A;  5M9O A;  2EQU A;  4HCZ A;  4DQ2 A;  2E5K A;  4C92 E;  5GAN e;  1YHQ Q;  3VS0 A;  1YWP A;  1YJN A;  2K2M A;  1PRM C;  2MPX C;  1IGU A;  3A8G B;  4M75 F;  4DBH A;  2HNI A;  2LCS A;  1B7T A;  2KQW A;  2OAU A;  3X28 B;  1NYG A;  3E1S A;  5I11 A;  4CC7 A;  2LNH B;  1R8O B;  3HP9 A;  3SEM A;  1SKU B;  2EGE A;  1WIE A;  3Q1J A;  2HL3 A;  1E6H A;  1BI3 A;  3NTH A;  4NL2 A;  4M75 A;  2CKK A;  2ZPI B;  4QVD A;  3GNG A;  1S1N A;  5FU7 B;  1ZHI A;  2QA4 Q;  5FRO A;  3JCM e;  2V8J A;  3OYA A;  3C0C A;  4J9G A;  4J9D A;  2QEX T;  3RMQ A;  4FL6 A;  4LD9 K;  1VYU A;  3RER A;  1Y96 B;  3JCM b;  1JBM A;  4OB0 B;  1ZUU A;  4JDS A;  4Z88 A;  4DBF A;  1R0B G;  3QJ6 A;  4XAX B;  2X4X A;  2L2P A;  1FMK A;  4C8Q D;  2A36 A;  1QVG P;  3F70 A;  2RH2 A;  1YBY A;  3CPW P;  4AMC A;  1B3Q A;  4RUG A;  4JJN K;  1V1C A;  3H6Z A;  3JCM J;  2XKO C;  1M30 A;  1YIJ Q;  2EPD A;  1VQK Q;  4B9X A;  2YRC A;  4N0A A;  2KSS A;  4XTW A;  1IXD A;  4ZGE B;  1XJW B;  2C06 A;  2BE9 B;  4IUT A;  2FZG B;  2EJG A;  2EVR A;  4M7D D;  1UGQ B;  1K76 A;  2JTF A;  1K9M U;  3D7S B;  4HT8 A;  1CKA A;  3VS5 A;  3VV0 A;  2XIC A;  2DEQ A;  2HQE A;  4FYX B;  3L42 A;  2J6F A;  3G4S Q;  1IHV A;  4M7A C;  3HRU A;  1UEB A;  1YI2 A;  1YIJ T;  1QKW A;  1VQK T;  4C92 G;  2E6Z A;  5KCO A;  1PHT A;  4M7D B;  1WHJ A;  5GMK i;  1HXD A;  2EYY A;  4EMH A;  4BB7 A;  4BY6 C;  3RUX A;  2JXB A;  3MP8 A;  3CCL Q;  4E7S A;  3H8Z A;  3S6W A;  1N8R R;  2GGR A;  3VS6 A;  2BKD N;  2ZPG B;  4QVZ A;  5KE2 A;  1RAB B;  4FM4 B;  3G4S T;  2BTT A;  3RIR A;  5LL6 S;  3JB9 H;  2HSE B;  3CCM Q;  1K9M C;  3A8O B;  3L2V A;  2RJE A;  3LGL A;  2K5I A;  2QI2 A;  2SRC A;  1NLO C;  1K73 R;  2HBW A;  2ZPF B;  5GAM h;  1M2V A;  4LN2 A;  3M59 A;  4GBQ A;  2FPD A;  3CD6 Q;  2LCL A;  1JRI A;  2RHX A;  2JNG A;  2CP0 A;  2CUD A;  3JCM V;  2M9U A;  4R56 A;  2FPE A;  4XU2 A;  3I5R A;  2ZZD A;  2KRS A;  1N5Z A;  5LJ3 f;  1UJ0 A;  3CCL T;  2MWO A;  2PQW A;  4LDV A;  1VIF A;  1OU8 A;  1NG2 A;  2IPO B;  2FYK A;  2NUT B;  4OB1 B;  2K9G A;  2PUK B;  2KI7 A;  2CSI A;  5LJ5 g;  4FSX A;  4JJB A;  2RHU A;  5GAN f;  3CXC S;  1AVZ C;  1T0J A;  3CCM T;  3QO3 A;  2COZ A;  4M77 F;  3HRS A;  1VQ9 T;  2O9V A;  5GAM d;  3EGD B;  4C0F A;  3CD6 T;  4A4F A;  5CAI A;  3JSC A;  2EQM A;  4CRI A;  2RJF A;  3INZ A;  2AK5 A;  1EZZ B;  2XID A;  1WHG A;  2BZY A;  1K8A R;  1M90 U;  5GMK j;  2EWN A;  2EJF A;  3CPW S;  4M77 B;  1MV0 B;  4J6X A;  1Z9Q A;  3FC3 A;  1GFC A;  1Q81 R;  3C12 A;  2CUB A;  2DL7 A;  5A0D A;  5GMK e;  1KC8 U;  4E2F B;  2D0N A;  4C0D B;  3BFM A;  3JCM f;  4RKU E;  1X6B A;  2JMA A;  2PVG B;  5HK0 A;  4A4G A;  2M0O A;  1UHF A;  5GMK l;  5CQX A;  2DLP A;  2F2V A;  4RTY A;  4OVA A;  3PGG A;  5KE3 A;  3G71 T;  3I35 A;  4IUQ A;  4DEX A;  2E1H A;  4C0G A;  3UT1 A;  2VWF A;  5EC7 A;  5FU6 C;  1GCQ C;  1KHI A;  3PT9 A;  1O9S A;  4LE9 A;  1OEB A;  2RNA A;  1M1K R;  4Y91 A;  3FDR A;  2OX7 A;  4C92 A;  1QP2 A;  1GBR A;  3VUB A;  4HXJ A;  5IN1 A;  2EW3 A;  2QDL A;  4PJO E;  4J9H A;  5L23 A;  3VS2 A;  2JN0 A;  2KRM A;  2LMJ A;  3EG2 A;  4KGV B;  1HYO A;  3EG9 A;  3M4G A;  3DB4 A;  1VQ8 T;  2LDM A;  2JS0 A;  4X34 A;  1EIF A;  3OYJ A;  1MMG A;  5FWB A;  1KC8 C;  1BYM A;  2M0Y A;  1BI1 A;  2NUP B;  1KSW A;  2C0O A;  3J7A F;  2ZAE A;  3PIP A;  3UAT A;  1ABO A;  3QYH B;  3L2R A;  1KJW A;  1WI7 A;  2M02 A;  2GQI A;  2QEX A;  4D6W A;  3EFS A;  3JRZ A;  4BI4 A;  4A4E A;  3EG0 A;  4BDZ A;  4F7U F;  1GBQ A;  2XK0 A;  2CP7 A;  4XTZ A;  2MAM A;  3MKD A;  2HQH A;  4AFU C;  1C1A A;  2DYI A;  3JCM P;  1UGP B;  1M3C A;  5KYW B;  1UG1 A;  4MMK A;  1KQ1 A;  2K7A A;  3M55 A;  1OV3 A;  3WVD B;  4F7U A;  4XU1 A;  1Y0M A;  2R57 A;  3P8B B;  1SHG A;  4GLM A;  3MEU A;  1KG1 A;  4F16 A;  3UA7 A;  2CS7 A;  1OU9 A;  2JZ2 A;  3CCE A;  3JAM E;  2VYT A;  5GAO p;  4DA4 A;  2LQK A;  2DL3 A;  3OS5 A;  4PLI A;  4QQ6 A;  3DLM A;  2EGA A;  3OW2 P;  3NMZ C;  3QBY A;  4DOV A;  3JB9 G;  1M3A A;  2FRW A;  4EPC A;  4M78 C;  4N0A C;  2VGM A;  3RDV A;  4YTL A;  2X4W A;  2RJD A;  4KUI A;  3OYL A;  4ZGJ B;  4M7A F;  2A08 A;  5GJW B;  3CC2 T;  4LUE A;  3CXC A;  2XG8 D;  2JVV A;  3OSS C;  2CZ7 B;  4IKF A;  3MEW A;  1PSF A;  1AWO A;  4PJO G;  3EG1 A;  2HMA A;  3CMA T;  5IXF A;  4XTY A;  2EKH A;  3KUF A;  2V8I A;  3IQL A;  2K79 A;  2JJ9 A;  3UA6 A;  3PTA A;  2KEA A;  4M7A A;  1PKS A;  1VQ7 T;  4II1 A;  5DM7 R;  1RAE B;  1NE8 A;  1UGV A;  3S3O A;  3CPW A;  2QK0 A;  3QZ9 B;  2LVM A;  1MUZ A;  2I2L A;  2F5K A;  4AT1 B;  3PE0 A;  4J6W A;  3G4S A;  1LOJ A;  1Y71 A;  2YRV A;  4C5I A;  5C6S A;  3LH0 A;  2KNB B;  4ZTF A;  4BY6 B;  4WTO B;  1VQP T;  3OBY A;  1KQ2 A;  2XMF A;  4OMM A;  2W10 A;  2CH4 W;  1QW1 A;  3BY7 A;  2DVJ A;  4KGX B;  4JUV A;  7AT1 B;  2RI3 A;  5IXB A;  2PZ1 A;  3S3M A;  4LDY A;  1TOV A;  6AT1 B;  1YJ9 Q;  2JMC A;  1D0Y A;  1I5L A;  1LNX A;  4C8Q E;  1G83 A;  3A8H B;  1DJ7 B;  1E6G A;  1HK9 A;  2YUN A;  5CO7 A;  5GAM j;  2PVO B;  3A5Z B;  2ESW A;  1OPL A;  3LWI A;  3FIF A;  2ED1 A;  3CCM A;  4P5N A;  2MMP A;  2AIR B;  1VQ9 A;  5IAY A;  3CPF A;  4KH1 B;  5GAM e;  1WHL A;  1Y57 A;  5C0M A;  2K3B A;  3L2W A;  4M7D E;  1K9A A;  4OMF B;  2HAX A;  4N4G A;  1QP3 A;  2A0F B;  1D3B A;  3EFO A;  3CC7 A;  4ESR A;  3EGU A;  4HKE A;  4JJC A;  2YDL A;  3OYE A;  3EG3 A;  3JCM c;  2P4T A;  1CSK A;  4NOY A;  1X01 A;  3MEA A;  2ZPE B;  2DRK A;  4AFS C;  2V1Q A;  1QQJ A;  2DX1 A;  1K4U S;  1BBZ A;  2DM1 A;  4ZNX A;  4J7F A;  4JS4 A;  2XHC A;  3EGX B;  1BI0 A;  3JB9 J;  3CC4 T;  5FRN A;  2CT4 A;  2E64 A;  4LDX A;  1MGQ A;  2EAY A;  1EFN A;  5GAO n;  3G71 A;  3OW2 S;  1N6A A;  4BD3 A;  1MNE A;  1QKX A;  3CBO A;  1VOM A;  3WXM B;  4J8O A;  1H3Z A;  4BE2 A;  1Q7Y U;  2OTL Q;  2QGF B;  4CC4 B;  4PJM A;  1ZLM A;  5LJ5 f;  4R0K A;  3U23 A;  1UEC A;  4PJL A;  3VS7 A;  5IH2 A;  2R5A A;  5KYY B;  5CVI A;  2EYZ A;  1YJW T;  1RAG B;  5AYF A;  3H0I A;  5HCK A;  3CBP A;  1LCK A;  4PNO A;  5KH6 A;  2KBT A;  1VQ8 A;  3AHU A;  2VB6 A;  4PFO A;  2KVQ G;  3UPU A;  2LC4 A;  3A98 A;  3ER0 A;  4TVR A;  3GIB A;  2FHD A;  2RI2 A;  4KGZ B;  4C92 C;  2RK2 A;  1T3S A;  1X69 A;  4C8Q G;  2JTE A;  2L3S A;  4M75 D;  1WDX A;  2PU9 B;  2DTH A;  2FZC B;  3ZL7 C;  1Y07 A;  2IG0 A;  5J39 A;  5A0L A;  1Q7Y C;  2DO3 A;  4PK4 A;  2MI6 A;  2ROL A;  4IIO A;  3MJX A;  5GAN 3;  1BKB A;  3M0R A;  4M7D G;  2QXF A;  1IRX A;  4RTX A;  2H8H A;  5FW9 A;  3M0S A;  4HA8 A;  2L89 A;  2KGT A;  4A4H A;  3CEY A;  1T3L A;  4M75 B;  3MHX A;  4BE0 A;  2GQV A;  4LXC A;  2KYB A;  1VQM Q;  3OYC A;  1FMW A;  3CCQ A;  3CCR Q;  2BUD A;  1XTD A;  3CCS A;  2ZPH B;  2OJ2 A;  3M53 A;  1TSF A;  1YHQ T;  3CQT A;  3M0T A;  4O5V A;  2AZV A;  4PL6 A;  2CGH A;  1QCN A;  3CCJ Q;  5CKH A;  2MCN A;  3CXC P;  4KT0 E;  1VUB A;  2A28 A;  1M8M A;  5A0G A;  2RHZ A;  4M78 F;  1VQ5 Q;  3OYG A;  2L5Q A;  2CT3 A;  2LTO A;  2KDS A;  3SWN C;  2IVW A;  2FVU A;  1VQM T;  1LVK A;  3M4Y A;  4J9I A;  2RPN A;  3CC2 A;  2LJ3 A;  4JLI A;  2M51 A;  2KXD A;  2OI3 A;  2QA4 T;  2MIO A;  3QG1 A;  3PFS A;  3V8L A;  1TG0 A;  3CMA A;  4M78 A;  2F5T X;  2L8D A;  1RAC B;  1NZ9 A;  4C5G A;  2CZ1 B;  1VQ7 A;  3CCJ T;  2RN8 A;  2YLC A;  1YP5 A;  2KE9 A;  4OF1 A;  2WSC E;  4Q5W A;  4B6M A;  1SG5 A;  2HKQ B;  1RI0 A;  1U1T A;  1VQP A;  2DBM A;  2K3Y A;  1JQQ A;  1E7O A;  1UB4 A;  1GL5 A;  2BZ8 A;  4F17 A;  2X4Y A;  3C94 A;  4DBQ A;  3OW2 A;  4QQD A;  2CP5 A;  4DBR A;  3M56 A;  1W70 A;  3CCV Q;  3FJ5 A;  2LQW A;  2KR3 A;  4C8Q A;  1S72 Q;  2GF7 A;  1VQ4 Q;  4EMK C;  1WJR A;  2YHT A;  3VS1 A;  3OYM A;  4FIB A;  2DD5 A;  2F69 A;  2V26 A;  4LDU A;  1OUL A;  1PG5 B;  4RTT A;  1IB8 A;  1D1A A;  2GCX A;  2E70 A;  1NJI U;  1FWZ A;  4RTZ A;  2VGN A;  4M7D A;  3VRY A;  3MP6 A;  1NPR A;  4HCC A;  1KFZ A;  1M2V B;  2XDD A;  1SRL A;  4RTW A;  1N9S A;  4JJD A;  1HD3 A;  3BW1 A;  5EG2 A;  4HVU A;  3I56 A;  4HCB A;  3CCV T;  3GP8 A;  4X9C A;  3QYG B;  4ELZ C;  1S72 T;  1WQW A;  3NPF A;  2X4J A;  3OYI A;  1VQ4 T;  1M9S A;  4NS5 A;  3CC4 A;  4M77 D;  4DOW A;  1FXX A;  2VXF A;  2MWP A;  2JM8 A;  4PJN A;  3TU4 K;  1VQ6 Q;  4OMQ A;  2EQI A;  1VQO A;  2NYS A;  1SRM A;  3FLG A;  1TS9 A;  4MDW A;  1VQN A;  1I0C A;  2A3L A;  1HJD A;  2YSQ A;  3LX7 A;  1G3T A;  1PRL C;  2QTX A;  3JV3 A;  2R5M A;  2DL5 A;  3V8K A;  3FRN A;  4B9W A;  4X9D A;  2OTJ Q;  3NTK A;  1PKT A;  4RTU A;  3QZ5 B;  3NHN A;  1SSH A;  2O88 A;  1B07 A;  1FMV A;  1WGS A;  1YJW A;  1FYN A;  2QAS A;  3G6E A;  2LT1 A;  2A7Y A;  1Q82 R;  2AKL A;  1R77 A;  3M0P A;  4E7K A;  4X1V A;  5J3B A;  2DYB A;  2E5Q A;  2X35 A;  2WAC A;  3HPW A;  3OB9 A;  2QQS A;  5IHN A;  3RBB B;  1VQL A;  3A8L B;  3X20 B;  2P0K A;  4C92 F;  3GOX A;  1GCP A;  1I07 A;  1AWW A;  5I22 A;  1RL2 A;  3RKX A;  4PJO C;  1YCS B;  1OPK A;  2FL7 A;  3P8D A;  5CR2 A;  2X51 A;  3R6O A;  2F2X A;  2MK5 A;  4E7I A;  5KYX A;  4PFZ A;  3M58 A;  3GBQ A;  4C92 B;  2ABL A;  4J9F A;  1PD1 A;  1VYT A;  4L59 A;  1VIE A;  2AZS A;  1RLP C;  2RM4 A;  1Q95 G;  2EIF A;  3H9N A;  3OY9 A;  3CCU Q;  1M90 C;  1RAF B;  3T9N A;  1YFN A;  1OX8 A;  4OGC A;  4FW2 A;  1G2B A;  3KFV A;  3EFR A;  5LJ3 h;  4E6R A;  1EX4 A;  3PVL A;  3MPU B;  1YWO A;  2FRY A;  3H0H A;  3OMG A;  1X2Q A;  2O4X A;  2DRM A;  4Y28 E;  1YJN Q;  1H64 1;  1YHQ A;  3OYB A;  1R0C B;  1TUG B;  4AFQ C;  4JRK A;  2YLB A;  2QGG A;  4IIM A;  3C4S A;  3L1A A;  3CCU T;  2EJ9 A;  3OSV A;  1YIT Q;  5GAM g;  4HCK A;  3UF4 A;  1IO6 A;  5LJ3 d;  1RUW A;  3X26 B;  1AOJ A;  1I8F A;  1WX6 A;  1W4S A;  1N8R U;  3TEE A;  2QA4 A;  4XTV A;  1SEM A;  1KK7 A;  2L3Q A;  4F7U B;  1ZBX A;  1TUD A;  5GAN d;  2RA2 A;  3NTI A;  4J7I A;  2P0P A;  2DEU A;  3QWX X;  1SF9 A;  8ATC B;  3O8V A;  1Q7Y R;  5I21 A;  3SWN A;  1K73 U;  3TQ7 P;  2EQK A;  2DIL A;  3O5Z A;  1JXM A;  2M16 A;  1IZ6 A;  1OX9 A;  5GAO q;  4M7A D;  4M75 E;  1YIT T;  2O01 E;  1I1J A;  2J06 A;  2M1H A;  3BDU A;  1AZE A;  2AKK A;  2DTI A;  4K11 A;  2GTJ A;  2FB7 A;  4XTX A;  3JCM d;  2O31 A;  1YIJ A;  2DK3 A;  1MMD A;  1VQK A;  2V8K A;  1M2O A;  2RHI A;  1N27 A;  2DNU A;  4IUV A;  3JCM Q;  3ME9 A;  3E9G A;  2GNC A;  2HSP A;  1N8R C;  2QQ9 A;  3LYI A;  1B34 A;  5D6X A;  4M7A B;  4J83 A;  1BU1 A;  1V29 B;  1PSE A;  4E7H A;  1K8A U;  4PJJ A;  3FEO A;  1WXT A;  2QG9 B;  3HKS A;  1XQH A;  2CP3 A;  3M54 A;  1I5O B;  2HCK A;  2G6F X;  5CKB A;  2HKN A;  1K73 C;  3ZFJ A;  2X9H A;  2J7I A;  1YI2 Q;  3C95 A;  4C5E A;  1P92 A;  4C8Q C;  4AFZ C;  5CK9 A;  2KK4 A;  3JCM X;  2E12 A;  2VV5 A;  1IGQ A;  4EMK A;  3QDF A;  3G1J A;  1M27 C;  1RAH B;  3VJP A;  4QW2 A;  1UGR B;  2D6F A;  2Z0W A;  5GAO l;  2LRQ A;  1H92 A;  2HZY A;  2MOX A;  5GAN 8;  1AWX A;  1S72 A;  2LX7 A;  3RES A;  3I9Q A;  3M0U A;  3DKM A;  1QCF A;  3CCL A;  1AWJ A;  2IIM A;  4M7D C;  4BUG A;  1ZA2 B;  2LT4 A;  4Z89 A;  5DLO A;  2RF0 A;  2BE7 D;  1TUC A;  2L0A A;  1M1K U;  4LNP A;  1XNI A;  1YI2 T;  1WHH A;  3V8J A;  5I2M A;  2GFU A;  2ZGW A;  3OS1 A;  4ATO A;  1D3B B;  1NPP A;  3EFO B;  1ZSZ A;  4OMN A;  3CD6 A;  3UDC A;  3EH1 A;  1YJ9 T;  1WZO A;  2L3R A;  4OML A;  3GNF B;  4M75 G;  5HY6 A;  2BZX A;  4MZT A;  2PTK A;  4IUR A;  5CKE A;  3OQ5 A;  3JB9 F;  2RO0 A;  2YRD A;  1UGS B;  3BE3 A;  2RB6 A;  3E9F A;  4BAC A;  4XTU A;  3HL8 A;  5GMK m;  3OYK A;  3M5A A;  2YUQ A;  4OMO A;  2I0N A;  4HT9 A;  4C5H A;  1MV3 A;  1GRI A;  4N4I A;  1GFD A;  4BI8 B;  1K9M R;  1BB9 A;  2CH4 A;  4IUU A;  1M1K C;  3V7R A;  4C0Z A;  1M1F A;  2QTV A;  3V7S A;  1U1S A;  4PJO F;  4ORZ A;  4JRI A;  5DY9 A;  2X3X D;  3LGF A;  2GFA A;  1QWF A;  2RQR A;  3M0Q A;  2DA9 A;  2K57 A;  2QQR A;  1G3W A;  2DZ9 A;  2JUF A;  4F14 A;  4Y92 A;  3TSZ A;  2D9T A;  1PWT A;  4MZP A;  2J6O A;  5DLQ E;  5FU6 B;  1WLP B;  4PJO A;  2EQJ A;  4JRQ A;  4UC4 A;  2ATC B;  4PFP A;  4C0D C;  1KD1 U;  1FX7 A;  2B8A A;  2VKN A;  2RQU A;  2D1X A; 
#chains in the Genus database with same CATH homology
 5CCA A;  4M78 E;  1Q82 U;  5FU6 C;  4E7J A;  1KHI A;  2X4Y A;  2DPP B;  4M77 E;  4OB2 B;  2DXC A;  3PT9 A;  1O9S A;  3C94 A;  4EMK B;  2OTL T;  4FT2 A;  3RKY A;  4MML A;  3LWH A;  3TCJ A;  3OW2 A;  4Y91 A;  4QQD A;  3QII A;  3FDR A;  3M56 A;  4C92 A;  1Q86 U;  1QP2 A;  3OYN A;  3VKI A;  1QVG A;  3VUB A;  4C8Q A;  1OZ2 A;  3CCV A;  5IN1 A;  4PJO E;  4XQ3 A;  2WSE E;  2GF7 A;  4ME7 A;  4EDU A;  4EMK C;  2ZCF B;  5LJ3 j;  1WJR A;  2JN0 A;  2YHT A;  3S3N A;  1VQ4 A;  3OYM A;  4FIB A;  1OYX A;  2EYQ A;  3M4G A;  2DD5 A;  2F69 A;  3DB4 A;  3CBM A;  2VC8 A;  1VQ8 T;  4Z02 A;  2LDM A;  3SDZ A;  1O75 A;  4LDU A;  4X34 A;  5GAN 7;  4MDX A;  5LJ3 g;  1EIF A;  3OYJ A;  4JRP A;  1KC8 C;  1BYM A;  1BI1 A;  5GAN j;  2GCX A;  2XU8 A;  2CZ0 B;  3GLX A;  3HSB A;  2E70 A;  1NJI U;  3OYD A;  1FWZ A;  4WF2 A;  2VGN A;  4M7D A;  4JS5 A;  1WJS A;  3MP6 A;  4J5Y A;  4KUL A;  5GAN g;  1WNL A;  1NPR A;  2DJZ A;  5FRM A;  4HCC A;  1K8A C;  4OP0 A;  3URG A;  2XDD A;  1N9S A;  3J7A F;  3OBW A;  2P0Q A;  1GXI E;  3PIP A;  3JCM W;  1KD1 C;  3BW1 A;  5EG2 A;  5HK3 A;  3I56 A;  4HCB A;  3CCV T;  2QQB A;  4X9C A;  3GPL A;  3GP8 A;  3QYH B;  3L2R A;  3QYG B;  1BIB A;  3JB9 D;  3PNW C;  2QEX A;  1Q81 C;  4XK8 E;  1Q82 C;  4D6W A;  4ELZ C;  1S72 T;  3EFS A;  3JRZ A;  1WQW A;  2DD4 A;  2X4J A;  3OYI A;  4BI4 A;  1M9S A;  4M78 D;  4A4E A;  1VQ4 T;  4NS5 A;  3CC4 A;  4M77 D;  3I55 A;  3DLL A;  4BDZ A;  1JB0 E;  2EFI A;  2HQX A;  4DOW A;  4F7U F;  3JB9 F;  1YIT A;  5KCH A;  1FXX A;  5A2Q E;  2XK0 A;  2VXF A;  5GAN 5;  2MWP A;  3TU4 K;  4VUB A;  1TH7 A;  4XTZ A;  2MAM A;  5D6Y A;  1VQ6 A;  4ZN1 A;  1VQO A;  5LJ5 h;  1W2B A;  3FLG A;  3JCM P;  4OB3 B;  3JCM g;  4MDW A;  1VQN A;  2A3L A;  1UGP B;  4PJO D;  4BDY A;  2RJC A;  2XI9 A;  3MCA B;  4MMK A;  1KQ1 A;  2E6N A;  3LX7 A;  1G3T A;  3EAE A;  3NFC A;  3ZEH A;  2QTX A;  3M55 A;  2R5M A;  3DB3 A;  3WVD B;  3V8K A;  4F7U A;  3HFO A;  4XU1 A;  3OS0 A;  2PVD B;  2K5F A;  2EKO A;  2JOY A;  2R57 A;  2RK1 A;  3MO8 A;  3I56 T;  3UWN A;  4O6J A;  3P8B B;  3L2U A;  3CCR T;  1X75 C;  3FRN A;  3MEU A;  4B9W A;  4X9D A;  1KG1 A;  3NTK A;  4M78 B;  3OYY A;  4A54 A;  4CI0 C;  2OTJ A;  2CS7 A;  2JZ2 A;  3QZ5 B;  3SD4 A;  4BI3 A;  3CCE A;  3JAM E;  2CYZ B;  2VYT A;  5GAO p;  4DA4 A;  5GAM f;  2LQK A;  1OI1 A;  5IT9 E;  1WGS A;  3OS2 A;  3OS5 A;  1YJW A;  1U8R A;  4PLL A;  1Y96 A;  4PLI A;  3G6E A;  2LT1 A;  2A7Y A;  4LD6 A;  4N4H A;  4QQ6 A;  1I4K 1;  3DLM A;  2K4Y A;  5GAO l;  3X25 B;  4E7K A;  5GMK h;  5GAN 4;  2QDY B;  3QBY A;  5J3B A;  4DOV A;  3PIO A;  3JB9 G;  4EPC A;  4M78 C;  4N0A C;  2E5Q A;  5I2S A;  1VQO T;  2X35 A;  4M77 C;  2VGM A;  5LJ5 d;  1QVF S;  4PJO B;  1VQN T;  4RG2 A;  4M78 G;  4YTL A;  4A53 A;  2XDB A;  2X4W A;  2WAC A;  3HPW A;  4M77 G;  1VQ5 T;  3OB9 A;  2RJD A;  2QQS A;  4KUI A;  4EMG A;  3VYG A;  3OYL A;  2DXT A;  4F7U E;  5CKD A;  3E19 A;  4GY5 A;  4ZGJ B;  1VQL A;  4M7A F;  3A8L B;  2BIV A;  1WJQ A;  2K3X A;  2P0K A;  3X20 B;  4C92 F;  5HKC A;  3TRE A;  3GOX A;  3CC2 T;  1XOV A;  2JTM A;  4C8Q F;  3CXC A;  2XG8 D;  2JVV A;  3OSS C;  1RL2 A;  2CZ7 B;  2NLU A;  3RKX A;  4PJO C;  4IKF A;  3MEW A;  3P8D A;  2FL7 A;  1G3S A;  5CR2 A;  3QDR B;  5GAO m;  1X6O A;  1PSF A;  2LCC A;  1N9R A;  4PJO G;  2WSF E;  3PMI A;  4L6V 5;  3R6O A;  3ASK A;  4RCC A;  3CCE T;  3CMA T;  4E7I A;  5CKF A;  3KBG A;  4XTY A;  3KUF A;  3HRT A;  2V8I A;  5CIU A;  2ZPB B;  1M4Z A;  3M58 A;  3KXT A;  4C92 B;  3PTA A;  3G6E T;  1WPY A;  2HBP A;  4M7A A;  4L59 A;  4II1 A;  5DM7 R;  1VIE A;  4C8Q B;  4MZM A;  1VQ7 T;  1NE8 A;  2RM4 A;  3S3O A;  3CPW A;  2EIF A;  2LVM A;  3QZ9 B;  2CZ6 B;  3OY9 A;  4M7D F;  2E65 A;  2I2L A;  2F5K A;  1M90 C;  5CQY A;  1M1G A;  4J6W A;  3VYH B;  2DIG A;  3L2Q A;  1LOJ A;  3G4S A;  3CME T;  3CCU A;  1Y71 A;  2E10 A;  4E47 A;  2YRV A;  3SFM A;  3T9N A;  4C5I A;  5C6S A;  3LH0 A;  4OGC A;  1VQL T;  4KUD K;  3J80 E;  4ZTF A;  4BY6 B;  4ELY C;  5GAO r;  3A8M B;  1VQP T;  3OBY A;  3QPH A;  3HFN A;  1KQ2 A;  3EFR A;  2XD0 A;  3QSU A;  1Q86 C;  1QW1 A;  3BY7 A;  3MP1 A;  4LDW A;  5D6W A;  5LJ3 h;  4J6Y A;  5LJ3 e;  4JUV A;  3VU3 C;  2RI3 A;  3CPW S;  3S3M A;  3QHS A;  4LDY A;  1BIA A;  2DXU A;  5M9O A;  3OMG A;  2EQU A;  3VUZ A;  4M7A E;  4HCZ A;  2O4X A;  4RG8 A;  1YJ9 A;  4Y28 E;  4DQ2 A;  1H64 1;  2K5L A;  5L8R E;  1LNX A;  4C92 E;  5GAN e;  1I5L A;  1Y7X A;  3HHT B;  1YJN A;  1YHQ A;  3OYB A;  4C8Q E;  3A8G B;  2LX9 A;  4JRK A;  2YLB A;  4M75 F;  3A8H B;  2HNI A;  3C4S A;  1DJ7 B;  3JB9 I;  3L1A A;  1HK9 A;  2KQW A;  2OAU A;  3X28 B;  3BDL A;  3CCU T;  2EJ9 A;  5CO7 A;  3E1S A;  5GAM j;  2PVO B;  3LLR A;  3A5Z B;  1R8O B;  3HP9 A;  3LWI A;  3FIF A;  4QVC A;  3CCM A;  2KY9 A;  4P5N A;  4FT4 A;  2RD1 A;  4V2S A;  3OSV A;  2MMP A;  1M5Q 1;  4R55 A;  2XDP A;  2DAQ A;  3Q1J A;  5GAM g;  3LW5 E;  3OA6 A;  1VQ9 A;  5IAY A;  1JJ2 S;  1BI3 A;  3CPF A;  3NTH A;  3RKW A;  5LJ3 d;  4NL2 A;  5GAM e;  5C0M A;  3L2W A;  4M7D E;  4M75 A;  3X26 B;  4OMF B;  2CKK A;  2HAX A;  2ZPI B;  1I8F A;  4QVD A;  4N4G A;  1QP3 A;  3GNG A;  4L5G A;  1W4S A;  1N8R U;  1D3B A;  2PUO B;  1ZHI A;  2Y4Y A;  5FU7 B;  4A4K A;  3CC7 A;  4ZN3 A;  5FRO A;  3TEE A;  3JCM e;  2R58 A;  2V8J A;  4HKE A;  4XTV A;  2LNV A;  3OYA A;  2QA4 A;  4F7U B;  5GAN d;  1ZBX A;  3OYE A;  3JCM c;  2RA2 A;  2P4T A;  3NTI A;  4J7I A;  4NOY A;  2P0P A;  4GLK A;  3X24 B;  1X01 A;  3MEA A;  1KQS S;  3MEV A;  2ZPE B;  4RCB A;  3O8V A;  2QEX T;  5I21 A;  1NJI C;  3RMQ A;  4FL6 A;  3SWN A;  4J7F A;  4LD9 K;  1K73 U;  4JS4 A;  3RER A;  2XHC A;  3OYF A;  4JLG A;  3OYH A;  1BI0 A;  2EQK A;  3JB9 J;  3CC4 T;  5FRN A;  3I55 T;  1Y96 B;  2Y4X A;  1JBM A;  4OB0 B;  3JCM b;  4JDS A;  2M16 A;  1IZ6 A;  2DIQ A;  4F7U G;  3QJ6 A;  2E64 A;  5GAO q;  4M7A D;  4M75 E;  1YIT T;  1OZ3 A;  4XAX B;  4LDX A;  2X4X A;  4C92 D;  1MGQ A;  2O01 E;  2EAY A;  4C8Q D;  3V7C A;  1VQ6 T;  3WVE B;  2VXE A;  3F70 A;  5GAO n;  2RH2 A;  1YBY A;  2M1H A;  3BDU A;  3G71 A;  1LJO A;  2DTI A;  3OW2 S;  1N6A A;  4BD3 A;  3CC7 T;  3CBO A;  4JJN K;  3WXM B;  3H6Z A;  4J8O A;  2FB7 A;  4XTX A;  3JCM J;  1QVG S;  2XKO C;  3JCM d;  3G7Z A;  4BE2 A;  1Q7Y U;  1H3Z A;  4B9X A;  2VUB A;  4N0A A;  1YIJ A;  2DK3 A;  2KSS A;  1BI2 A;  4PKC C;  3PMT A;  4XTW A;  2V8K A;  4M77 A;  3J81 E;  1VQK A;  2OTL A;  4ZGE B;  2C06 A;  2RHI A;  1N27 A;  4IUT A;  5LJ5 f;  4KBM B;  4IUV A;  2EJG A;  3JCM Q;  2H3J A;  3ME9 A;  3E9G A;  1UGQ B;  4M7D D;  1N8R C;  2OTJ T;  2QQ9 A;  3LYI A;  1B34 A;  5D6X A;  2JTF A;  2R5A A;  1K9M U;  4M7A B;  5CVI A;  2RI5 A;  1YJW T;  4J83 A;  4HT8 A;  1V29 B;  5AYF A;  1PSE A;  3RMS A;  4E7H A;  3CBP A;  1K8A U;  4PNO A;  4OGE A;  2K2V A;  3VV0 A;  4QQG A;  5KH6 A;  2XIC A;  3FEO A;  2DEQ A;  2HQE A;  3N5B B;  1VQ8 A;  4XU0 A;  3AHU A;  3HKS A;  1XQH A;  3L42 A;  3M54 A;  2KVQ G;  1YCY A;  3UPU A;  2LC4 A;  2Y90 A;  5CKB A;  1K73 C;  3ZFJ A;  3ER0 A;  4TVR A;  3GIB A;  4M7A C;  2FHD A;  2RI2 A;  3C95 A;  4C92 C;  3HRU A;  4C5E A;  2RK2 A;  4RMO A;  1UEB A;  1YI2 A;  1YIJ T;  4M7A G;  1P92 A;  1VQK T;  4C8Q C;  4C92 G;  5CK9 A;  2KK4 A;  2E6Z A;  2E12 A;  2G3R A;  5KCO A;  3JCM X;  2VV5 A;  2DTO A;  3SB2 A;  1I81 A;  4C8Q G;  4EMK A;  4BE1 A;  3M9Q A;  1QVF A;  4M75 D;  1AHJ B;  1KHC A;  2DVE A;  4M7D B;  2PU9 B;  3MET A;  2DTH A;  5GMK i;  3VJP A;  1IRE B;  1UGR B;  4QW2 A;  2D6F A;  1WQ7 A;  1HXD A;  1Y07 A;  3QKJ A;  2LRQ A;  2O4X B;  2DZC A;  2IG0 A;  3ZBD A;  4BB7 A;  4EMH A;  5J39 A;  5GAN 8;  4BY6 C;  3RUX A;  3P8H A;  5A0L A;  1S72 A;  1Q7Y C;  3MP8 A;  3RES A;  2KAF A;  2DO3 A;  5GAN h;  3DKM A;  1W2B S;  2MI6 A;  3CCL A;  3H8Z A;  3S6W A;  5GAN 3;  4M7D C;  4BUG A;  2BKD N;  2LT4 A;  2ZPG B;  4QVZ A;  1BKB A;  5KE2 A;  4M7D G;  2QXF A;  2HD0 A;  2LQ8 A;  5DLO A;  4FM4 B;  3M57 A;  3G4S T;  3RIR A;  5LL6 S;  1M1K U;  3JB9 H;  4HA8 A;  2KMT A;  1XNI A;  2L89 A;  1K9M C;  4ZTJ A;  3A8O B;  3L2V A;  1YI2 T;  4A4H A;  3OMC A;  2RJE A;  3LGL A;  2K5I A;  2QI2 A;  3CEY A;  3V8J A;  5I2M A;  2GFU A;  2ZGW A;  3OS1 A;  3QJY A;  4M75 B;  1MHN A;  3MHX A;  4BE0 A;  2GQV A;  2ZPF B;  4FU6 A;  3OYC A;  5GAM h;  1M8V A;  4ATO A;  3CCQ A;  1VQM A;  3M59 A;  3GF5 A;  1D3B B;  2BUD A;  1XTD A;  2LCL A;  1NPP A;  2MF2 A;  3CCS A;  2ZPH B;  1G5V A;  3CD6 A;  2DKG A;  3CCR A;  1JRI A;  2RHX A;  3UDC A;  2JNG A;  4XU3 A;  3JCM V;  2M9U A;  4R56 A;  1YJ9 T;  3JCM h;  4XU2 A;  2ZZD A;  3M53 A;  4M75 C;  1YJN T;  1YHQ T;  5LJ3 f;  3CCL T;  2L3R A;  2MWO A;  2PQW A;  5LJ5 j;  3GNF B;  4M75 G;  4O5V A;  5HY6 A;  4LDV A;  1VIF A;  4PL6 A;  4MZT A;  2CGH A;  3SWN B;  4E7L A;  5CKH A;  4IUR A;  5FU7 C;  4KT0 E;  2FYK A;  3OQ5 A;  1VUB A;  2RO0 A;  4OB1 B;  5CKE A;  2PUK B;  5LJ5 g;  1UGS B;  3CCJ A;  4FSX A;  2RB6 A;  5A0G A;  2RHU A;  3E9F A;  5LJ5 e;  5GAN f;  4BAC A;  4XTU A;  3CXC S;  2RHY A;  3HL8 A;  2RHZ A;  4M78 F;  3CCM T;  3OYG A;  3QO3 A;  2L5Q A;  5GMK m;  4M77 F;  3M5A A;  3OYK A;  1VQ5 A;  2LTO A;  3QUI A;  3HRS A;  1VQ9 T;  2AHJ B;  4ZGD B;  2KDS A;  4HT9 A;  3SWN C;  4C5H A;  2IVW A;  2FVU A;  3CCQ T;  1VQM T;  5GAM d;  4N4I A;  3M4Y A;  4BI8 B;  3CCS T;  1ZQ1 A;  4C0F A;  3CC2 A;  1SSF A;  3CD6 T;  4JLI A;  4A4F A;  5CAI A;  3JSC A;  2EQM A;  4IUU A;  4CRI A;  2RJF A;  3INZ A;  1M1K C;  3V7R A;  2XID A;  1M1F A;  4C0Z A;  1M90 U;  3V7S A;  2QA4 T;  5GMK j;  1U1S A;  2EJF A;  2EWN A;  4PJO F;  3QG1 A;  4JRI A;  4M77 B;  3FB9 A;  3PFS A;  5DY9 A;  4J6X A;  3V8L A;  3CMA A;  1JJ2 A;  4M78 A;  2F5T X;  1G3Y A;  2L8D A;  3LGF A;  2GFA A;  2DXB A;  3FC3 A;  2D0Q B;  3C12 A;  1NZ9 A;  4C5G A;  5A0D A;  2CZ1 B;  5GAN 2;  1VQ7 A;  5GMK e;  1KC8 U;  1B34 B;  4C0D B;  3CCJ T;  2QQR A;  2K57 A;  1G3W A;  3BFM A;  2DZ9 A;  2JUF A;  3QXE B;  3JCM f;  2YLC A;  4RKU E;  2D9T A;  2PVG B;  3L2Z A;  4OF1 A;  5HK0 A;  2WSC E;  4Q5W A;  2QQA A;  4MZP A;  4A4G A;  5GAN 6;  2M0O A;  5FLX E;  3CME A;  2E41 A;  5DLQ E;  5FU6 B;  5GMK l;  1KQS A;  4IUP A;  4PJO A;  2EQJ A;  1RI0 A;  1QVP A;  5CQX A;  1U1T A;  4JRQ A;  4NL3 A;  4UC4 A;  1VQP A;  2K3Y A;  4OVA A;  3PGG A;  5J26 A;  4C0D C;  1UB4 A;  1KD1 U;  3FJP A;  5KE3 A;  3G71 T;  1FX7 A;  2B8A A;  4IUQ A;  2E1H A;  4C0G A;  3UT1 A;  1Q81 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...