1N27A

Solution structure of the pwwp domain of mouse hepatoma-derived growth factor, related protein 3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
GSSGSSGEYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PWWP domain of the hepatoma-derived growth factor family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
molecule keywords Hepatoma-derived growth factor, related protein 3
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n27A00
2RO0A 1RI0A 3FDRA 3O8VA 4GY5A 3L2RA 2GFUA 4IUUA 1H3ZA 5D6XA 2BUDA 3FEOA 3PMIA 4BE1A 1N27A 1SSFA 3FC3A 2B8AA 3ZEHA 3L2QA 3LLRA 5D6YA 2L8DA 3L42A 3MO8A 2LDMA 4PLLA 3S3NA 3OA6A 3MEVA 3S6WA 5KE2A 2RI3A 5KH6A 4IURA 4IUPA 4NS5A 1WJQA 3FLGA 3OYDA 3NTKA 5D6WA 3OYFA 2RHIA 4A4EA 5FROA 4A4HA 1OZ2A 4BDZA 2RJFA 2RHZA 2RHXA 3DB3A 3Q1JA 4E7JA 2EFIA 5FRMA 4QQ6A 3DLMA 3OS2A 4PL6A 3MP1A 3L2WA 2HQXA 3MEWA 4UC4A 3MP6A 1XNIA 2E5QA 3PNWC 4E7LA 4BE0A 3CEYA 3UT1A 3F70A 4CRIA 4QVZA 2BKDN 1OI1A 2LVMA 2MWOA 1G5VA 2RHYA 1WJSA 2K3XA 2F5KA 2CKKA 2M1HA 2MWPA 3E9GA 3M9QA 3OB9A 2NLUA 3NTHA 4C5HA 3OYGA 3QJ6A 2FHDA 5C0MA 3MEAA 3MEUA 4FL6A 4QW2A 2XDPA 4LD6A 4IUQA 2XK0A 2R58A 3META 2RJEA 3H6ZA 4QQDA 4RG2A 2QQRA 2EKOA 3LGFA 2EQKA 3C4SA 3ASKA 2D9TA 1OZ3A 4C5EA 3NTIA 4Z02A 4C5GA 3OYEA 2QQSA 2X4WA 1KHCA 3OYIA 5J39A 2LTOA 3P8DA 3PMTA 4X34A 4HCZA 4L59A 4B9WA 2RJDA 3OYJA 1OYXA 2LRQA 3OYBA 5KCHA 2EQMA 4BACA 3KUFA 4E7KA 3S3OA 2L89A 4IUVA 4BE2A 1WJRA 3OYHA 3BDLA 4OVAA 3OYLA 2E6NA 4N4GA 4IKFA 5KE3A 5J26A 1MHNA 2R5AA 2X4XA 3OYMA 3EAEA 3MP8A 4EDUA 3SD4A 5FRNA 2VYTA 2M16A 3OMCA 3LGLA 3QKJA 3L2VA 5M9OA 2X35A 3P8HA 2O4XA 2G3RA 4IUTA 2IG0A 4BD3A 2RI2A 3OYAA 3OYNA 3OYKA 2X4YA 2RJCA 4ZTJA 2DIGA 2EQJA 2GF7A 2WACA 3OQ5A 3LX7A 2LCCA 4BDYA 3L2UA 3OMGA 3OS0A 3ME9A 2O4XB 3LH0A 5CIUA 3QBYA 3PFSA 4II1A 2PQWA 4ZTFA 2JZ2A 2EQUA 3UWNA 2DIQA 2BIVA 3QIIA 4B9XA 5C6SA 3H8ZA 3E9FA 3S3MA 4FU6A 2R57A 2YRVA 5IN1A 4N4HA 4E7IA 2R5MA 2M0OA 2RHUA 2P0KA 4Q5WA 3DB4A 4E7HA 2JTFA 2HQEA 4QQGA 3OYCA 4A4GA 3OS1A 4A4FA 2K3YA 2RI5A 1WGSA 4C5IA 5KCOA 2DAQA 2L3RA 4N4IA 2GFAA 5IAYA 3OY9A 4PLIA 3LYIA 3GOXA
chains in the Genus database with same CATH superfamily
5DM7R 1YBYA 3FEOA 3PMIA 1QMCA 3LWIA 2D0NA 4M77D 4OGEA 2VWFA 4AFUC 4X9DA 1HSQA 4OMMA 3L1AA 2RI3A 1UGQB 3C12A 3NTKA 4PJJA 4A4HA 2RJFA 1KK7A 4QQ6A 1RAGB 3QSUA 3CCJQ 4PL6A 1RAIB 3JCMc 2A36A 2E5QA 3UPUA 1G3YA 2LCLA 4VUBA 5GMKj 4C8QF 2K6DA 2RHYA 4F14A 3OYGA 2YLBA 2K4YA 1VYUA 3META 4J5YA 3T9NA 1FXXA 2ZPEB 3EGXB 4C8QA 4M4ZA 3CC2Q 5GMKi 5IHIA 1NEBA 1BKBA 1RABB 1YFNA 2DTIA 1VQ5Q 2ED1A 4M78B 3EAEA 3MP8A 5HCKA 3UA6A 4XU1A 3LGLA 4C92A 2DEUA 2CS7A 4J7FA 1D3BB 1MMGA 4EMHA 5I21A 3M0RA 1K4US 3CMAT 2HMAA 2OTJQ 1P92A 4E7SA 4JLGA 1TWBA 3PFSA 2JZ2A 2LMJA 2DIQA 2MMPA 1KQ2A 2AZSA 4CI0C 1R77A 2ZPIB 4A4FA 4FYWB 4JJBA 2L0AA 2W0ZA 2EQIA 2L3PA 1B3QA 1H3ZA 5D6XA 1W6XA 4M75A 1YP5A 4F7UA 5FU7C 2QEXQ 3CBOA 1X69A 3QPHA 2QA4A 4X1VA 1X6OA 2X3WD 1PHTA 3JCMW 1VQPT 1Q82C 2QDLA 4C92C 1NEGA 3Q1JA 2DZ9A 2AT1B 2RM4A 1VQNQ 1WX6A 3JCMg 2EVRA 1SKUB 4R0KA 1YIJT 2P0PA 1JQQA 4PFPA 3RESA 1K0SA 1KQSP 3SWNA 2LQKA 3OSVA 2DPPB 3VJPA 1K9AA 2HSPA 1PNJA 3LGFA 3QUIA 4B6MA 4OMNA 1JJ2S 3JV3A 4M75C 4J6WA 3CPWP 2W10A 4M7AG 4B9WA 1OYXA 3VS1A 1I81A 2K5LA 4BE2A 3C0CA 1IGQA 3HTRA 2BE7D 3VS3A 1TSFA 4ZN1A 4O6JA 4PJOD 2DZCA 2EYZA 1VQOQ 1YJWT 4DEYA 2DIGA 3CCET 4A63B 4WCIA 4EIKA 1V76A 5CIUA 2DTOA 1GBQA 3CCVA 3SEMA 1QKWA 1WDXA 2R57A 2M0OA 2P0KA 2ZCFB 1VQ9A 1TTHB 1AWXA 1X43A 2L3RA 1WXTA 3V7RA 3G6ET 4GY5A 3MHXA 2KNBB 4ZNXA 2EJ9A 2LJ3A 2CZ0B 5D7UA 2FZKB 1Q86C 3M0QA 4C0DB 1RAHB 1H92A 5KH6A 2XDBA 4IUPA 4OMPA 1YJ9T 4LXCA 1QCNA 1SPKA 1ZSZC 1ZA1B 4XU2A 5LJ5d 3HSBA 1ZUKA 4N0AA 3MEWA 4UC4A 4HVWA 2XMFA 3LW5E 2ROLA 2XIDA 3OBWA 1W2BA 1HYOA 3M5AA 1KD1C 4FL6A 4QW2A 3U23A 3M0TA 1YCSB 2E4HA 1N9SA 1NBEB 2DF6A 4PJOG 4KBMB 5CAIA 1WHHA 2FG0A 1U06A 5GAN6 3QXEB 2NUTA 1NPPA 2DXCA 3UA7A 1QVGP 2GQVA 1WXBA 2RQVA 1VQ8T 1C1AA 2QA4Q 2EQMA 3S3OA 2NUTB 3H0IA 1U1TA 3BDLA 4OVAA 2EJGA 5GAOq 4PNOA 4IKFA 2PVDB 1BI0A 4N0AC 1D0YA 1VQ4T 4GLMA 1T0HA 4O5VA 5EC7A 3CCMA 1VQKA 2ZAEA 4M75E 1VQLA 2CT3A 3JCMP 4JDSA 1IZ6A 3ME9A 2RD1A 5LJ5h 3H0HA 2BIVA 5CR2A 3G6EQ 1KG1A 3E9FA 2RB6A 4E7IA 2CSQA 1GBRA 3DB4A 1VA7A 3JB9H 8ATCB 5I2SA 2DM1A 1XJWB 2CGHA 3EG1A 4LUEA 2D1XA 5ECAA 1NLPC 2HBWA 2EWNA 4HA8A 2DL8A 3JB9F 5A0DA 1AZEA 3QDFA 1KHIA 3TCJA 1PSEA 3V8LA 1U8RA 2B8AA 1K76A 4HVVA 2O9SA 4J9GA 3S6WA 4F04B 4KGVB 1WHJA 3RBBB 2QGGA 3CCSQ 3A1PA 2LX9A 3CMAA 4QKUA 3ER0A 2HQXA 5KYUA 3OYYA 3RKWA 3SHWA 1ZBJA 4M7AF 1OPKA 4JZ3A 3E9GA 3VS6A 2DETA 2XDPA 2DXBA 2K3BA 3JCMV 1D1CA 5LJ3h 2QQRA 2DL3A 2ZPGB 2LP5A 4WTOB 3FIFA 1OX8A 1X6GA 3GF5A 1K1ZA 2VXEA 2LJ0A 1A0NB 5GJVB 2AKKA 2JNGA 4HCZA 4F16A 2F69A 2F2WA 4HXJA 1EZZB 2KYBA 2Z0WA 1YN8A 3VRYA 1Q81R 1SRMA 2X4XA 4LDUA 1G3SA 2M16A 3JCMd 3VU3C 4ANJA 1YI2Q 3CCUQ 1FMWA 5IXFA 4Y91A 1UG1A 4RKUE 1UE9A 3LWHA 3M4GA 1ZUYA 2PQWA 2QQAA 2J6OA 4C0GA 2CDTA 1VQPA 4B9XA 2DA9A 2L2PA 1NJIU 4FT4A 1YITA 2K3YA 1WGSA 2CZ1B 5IAYA 2AKLA 3E1SA 2YSQA 5FWBA 2JXBA 2HD0A 1BI1A 4M7AE 1UDLA 3M57A 1TOVA 3ULRB 4JJNK 3SB2A 2CUDA 1IHWA 1M8MA 1EIFA 4AFZC 1GFDA 3CMAQ 5GAMj 3L42A 4PJOF 1MNEA 3FJ5A 1JRIA 2MOXA 3MEVA 3VUZA 4DEXA 2L3SA 4KH1B 3EG3A 3AHUA 2FZGB 1WXUA 4FM4B 3CC7A 1OZ2A 2RHXA 5CQYA 2DBKA 3C94A 3CCEA 2JW4A 3DLMA 4R56A 2ROTA 2ZGWA 1HXDA 2DFUA 2P84A 2EAYA 2KSSA 2BZYA 2JT4A 2NUPA 5GAMh 3G4SA 4LN2A 2IPOB 3A98A 4OF1A 1RLPC 2DL4A 3RMQA 1FMKA 3D7SB 2JJ9A 3QJ6A 5GAN7 1VQMT 3DKMA 2M02A 1Q86U 2LC4A 3PE0A 2EKOA 5GANg 2AHJB 3GNGA 1K8AU 4FT2A 4C5EA 3NTIA 3OYEA 1T3SA 3GP8A 2MPXC 5LJ5f 1UGSB 2LTOA 2BZXA 2MIOA 4D8KA 1XOVA 5KCHA 2QEXT 2ABLA 2KRMA 4MZTA 1WJRA 2M9UA 5LJ5e 5KE3A 4D8DA 2RMOA 5M9OA 3CMEQ 2A08A 2E70A 2HL3A 4Y92A 4QT7A 2XICA 3CCLA 1H8KA 3CD6T 4II1A 1D1AA 2DO3A 1TUCA 3CD6Q 4J9DA 1X6BA 4ZGEB 4FYYB 3A8LB 2RHUA 4Q5WA 3EG9B 4JZ4A 5GAN4 4QQGA 4M77G 1G83A 4JJCA 3EG2A 4C8QC 3LYIA 9ATCB 4XTVA 3M0SA 4F7UG 4RG8A 1PD1A 4RUGA 1K8AR 5CO7A 1Z9ZA 4PLLA 1VQMQ 2KRSA 3NFCA 2RQTA 3CBPA 4XAXB 4BY6B 4F7UB 4ZGJB 4IURA 3JB9J 2A37A 3OYFA 4J9CA 1C0MA 4FSXA 3CD6A 5FU6C 1VYTA 3R6OA 3H9NA 1VQLT 1R8OB 2HZYA 4EMGA 2KT8A 5IHNA 1YIJA 1X2QA 1IGUA 2MWOA 2RQUA 3M53A 2CREA 1VQ6A 5C0MA 1WYXA 4LD6A 1VQ9T 3PIPA 4M7DG 3HRSA 2F5TX 1U1SA 4DOVA 1EFNA 2MK5A 4C0ZA 4Z8AA 2EYYA 5GAN5 4JS5A 1AWWA 3RKYA 1W1FA 2RNAA 3PMTA 4A54A 4BI8B 1VQNA 2JTMA 3EFSA 3OBYA 1LVKA 1Y57A 5GAN2 3J7AF 1YJ9A 2GNCA 1BYMA 5CKHA 1RADB 3CMEA 1YWOA 4M7DD 5AT1B 1KQ1A 5FRNA 2K5IA 4CC7A 2QEXA 1KQSA 2O4XA 2D8JA 1TG0A 2RI2A 2OTJA 3NPFA 4RTYA 3CCRA 1PWTA 1VQ7A 2O4XB 1ZLMA 1D09B 1K9MU 4MZMA 4BUGA 2MAMA 1JXOA 3JB9D 5GAMg 4PJLA 4PJMA 4C92D 1N8RC 2R5MA 2IIMA 2H8HA 2JTFA 2KMTA 3CCUT 1WHKA 4A4GA 5IT9E 2JS2A 3RIRA 1QVGS 2EIFA 3REBB 4CC2A 2E64A 1VOMA 4RTZA 1FX7A 2QYZA 3LLRA 1B07A 5D6YA 4AG2C 2VGNA 4A4KA 3S3NA 2YXYA 2WSFE 2JM9A 1S1NA 3JB9G 2HNIA 5HKCA 1E6GA 1NM7A 1MV0B 3OS5A 4HT8A 4Z89A 2A0FB 4PJOB 3CCVQ 2KAFA 3CCJT 3MP1A 5EG2A 4CRIA 1UTIA 5CVIA 1G5VA 2LVMA 2M1HA 4MDWA 2KBTA 2LQ8A 1NPRA 1ZUUA 3MEAA 1PD0A 1NE8A 1XQHA 4M78F 2E5KA 3M54A 1PC0A 3ZL7C 1YJNQ 3VS0A 4J83A 1YHQA 1F1BB 4C5GA 2XD0A 2L3QA 1N8RR 1Y07A 3JCMJ 1YI2T 2JN0A 3P8DA 5A0GA 3G6EA 5FLXE 1DJ7B 3OYJA 1ZHIA 7AT1B 2F2XA 3JAME 1ZSZA 1U3OA 2FRWA 2QTXA 4F7UF 5GAN8 2DL7A 1OX9A 1JO8A 2KEAA 1FWZA 3CCRT 1VQ7T 1M5Q1 2RN8A 3CCMT 1VQKT 1K9MR 1NZ9A 1Y7XA 3LX7A 3QZ5B 3LH0A 1VQ6Q 2O01E 1OOTA 3NHNA 3RKXA 1ZBXA 5DLQE 3CCSA 5GANf 2LX7A 3A5ZB 1RACB 2O2OA 1M30A 2QQBA 1SF9A 4L6V5 3OYCA 5GAOn 2IVWA 2GFAA 1K73U 4XTXA 3TSWA 1I4K1 1J3TA 3L2RA 1YJWA 2PUKB 3L2ZA 2EYWA 2CZ7B 3EHRA 4R55A 2YT6A 1B34B 1WI7A 3MO8A 4RMOA 3CMET 3M58A 4ATOA 2E3HA 2EPDA 2GQIA 2QG9B 3BDUA 3M59A 4FYXB 5CKBA 2KY9A 3C95A 4M77F 3CCQQ 4ELYC 3OS2A 3CC4A 1TUGB 2AK5A 4FW1A 3L2WA 3MP6A 1AZGB 2FYKA 4BE0A 1VQ4A 4KT0E 4CC4B 1E7OA 4AFSC 2NLUA 1OPLA 5GMKl 3I35A 2A7YA 1UGRB 1YCYA 2K57A 1QCOA 2F1LA 4KGZB 1VYVA 2GTOA 3QDRB 4XTZA 3JCMe 3M0PA 2X51A 1PKSA 4KH0B 2RQRA 3CC7Q 2DERA 3QWXX 4HVUA 3PVQA 1M1FA 3VRZA 4PFZA 3CBMA 2BTTA 3G4SQ 1SG5A 3OYHA 1KSWA 1GCQC 4LD9K 5L23A 4AFQC 5FW9A 4ORZA 1KFZA 3QKJA 1NYFA 2IG0A 1VQOT 3EHQA 1R0BG 3M55A 1V1CA 4J6YA 2K9GA 4BI4A 1X27A 2RK2A 3REAB 2YWWA 2J06A 1WHLA 4J8OA 1MMDA 1E6HA 3TREA 2ZPFB 2CUBA 4HT9A 2EYQA 3A8MB 1Y96B 2RI5A 1GFCA 1WHGA 4MDXA 3OY9A 4C0FA 4PJOE 4XQ3A 2SEMA 2QASA 1AT1B 2QDYB 2KRNA 4BE1A 3UDCA 1GRIA 4DBRA 2DX1A 1D1BA 1AOJA 1GCQA 4IIOA 3CC4Q 1KD1R 1MMAA 2ED0A 2HDAA 3OYDA 1PCXA 5KYWA 1M9SA 2H3JA 1VQMA 2C0IA 5GANj 2RHIA 1TS9A 2FVUA 3CC2A 2DNUA 1LNXA 5GJWB 2O9VA 3OW2P 4E7LA 2D8HA 3CPFA 1Q81C 1OI1A 3I56T 2A3LA 1QP2A 2FEIA 2LT1A 2OJ2A 1NG2A 1UJ0A 2VUBA 1YIJQ 3X25B 4QQDA 4DBHA 3FJPA 2ZPHB 1WIEA 4ZGDB 2QA4T 4FW2A 2JM8A 2QXFA 5KYYB 1YJWQ 4E7ZA 1VQPQ 3THKA 5DY9A 1YWPA 5LJ3d 2LRQA 5LJ3j 1N8RU 1AHJB 1WNLA 4E7KA 2RF0A 3CCUA 1PRMC 2P4RA 4NOYA 2K2VA 2QQ9A 2DE0X 1IRXA 4PK4A 2SRCA 1PG5B 2DRKA 1AEYA 1GL5A 4RCBA 1WPYA 3M4YA 1VUBA 1W2BP 1Y71A 2EQJA 4C92F 1K8AC 2YUPA 3L2UA 1TUDA 3RMSA 3QBYA 1M1KU 1AVZC 2I2LA 2DEQA 3CCLQ 1B34A 2NWMA 5KYUB 2PZ1A 4N4HA 4M78E 1U5SA 4ELZC 2CZ6B 1UECA 5LL6S 3CCRQ 1VQ7Q 2MF2A 4M75B 5I22A 2D0QB 2YLCA 3MCAB 2J05A 3FDRA 2HSEB 3EFOB 1W70A 4J6XA 4M75G 1Z9QA 4F7UE 4HCCA 1VQ8Q 2KI7A 3VS2A 2CP5A 2EKHA 2PU9B 3EFOA 1M3AA 1Q86R 2J6KA 1JU5C 2JMAA 2E12A 3HRTA 2F2VA 2FB7A 4JJDA 1QKXA 1QLYA 4OB0B 2M0YA 1LOJA 3I5RA 2LCSA 4FIBA 2RK1A 3G71A 1WJSA 2MWPA 1S72Q 4J7IA 2KROA 2COZA 5IH2A 4QVDA 2FHDA 2V26A 5LJ3g 4JS4A 2DMOA 1KQSS 1RAAB 1JJ2P 1GCPA 4FYVB 4XTUA 2D6FA 1OULA 2RA2A 3C4SA 1WHMA 5GANd 1TXQA 2ECZA 1LCKA 1BCOA 2LT4A 3OYIA 3PTAA 4PJNA 1M2VB 1YHQQ 3BY7A 3EG0A 1IO6A 2XDDA 4M7AA 1YJNA 3O5ZA 1BBZA 5GAMd 2E6ZA 3G71Q 4F17A 3I55A 2E41A 4M77E 5J26A 1KJWA 5KYXB 2B86A 3OYMA 1YJ9Q 2VYTA 1WZOA 5AYFA 2KXCA 6AT1B 3GIBA 4WF2A 2X4YA 2KYMA 3V7CA 3OYKA 4ZTJA 2GF7A 3TU4K 1M1KR 2YUQA 4OB2B 1O75A 1MGQA 1SSHA 2YRCA 1SHGA 3H41A 1I07A 1H3HA 2DD5A 2DD4A 2I0NA 1JEGA 2Y4XA 4ZN3A 2JUFA 2A28A 4E7HA 4LDXA 1D0ZA 2COWA 3EGDA 3OS1A 1M8VA 4OMLA 2P0QA 2EGAA 4PLIA 1G8XA 3QHSA 5GAOp 2LNHB 1ZQ1A 4M7AD 2COYA 4M78D 5GAN3 1G3WA 2FPDA 1M90U 2LJ1A 4J9FA 3V8KA 3JRZA 1I8FA 4NS5A 2VC8A 2OX7A 4J9HA 4HCBA 4M7AB 3DB3A 3OW2S 1BIBA 2OTLQ 3IQLA 3SWNB 1YNZA 4XU3A 3A8OB 4C92G 2CP7A 1XNIA 2YUOA 4KUDK 4EMKB 2ESWA 4GBQA 1I5OB 5GANh 5FWCA 2K3XA 1HD3A 2HL5C 4QVCA 1ABQA 1VQ5T 1C6VX 5LJ3e 2OAWA 2LNVA 2EQKA 3A8GB 4M7DB 3ASKA 3GNFB 1KC8R 1VQLQ 4Z02A 2PUOB 2EJFA 2DK3A 1V29B 1K9MC 2O88A 5FU6B 4X34A 4MMLA 1K73R 1ZA2B 4KUIA 1OU8A 1BI3A 2L89A 2V1RA 2DKGA 1KD1U 2CP6A 4LUDA 1M90R 4J9EA 2GTJA 1TU0B 1UHCA 1UGVA 3SD4A 3OMCA 4OMQA 1W2BS 3EFRA 3VYGA 3VS4A 2YRDA 4BD3A 2RPNA 1LPLA 3X20B 1M3BA 2CP3A 1I5LA 2HKNA 1CSKA 1VQ9Q 1Q82R 3SFMA 3JCMf 3HPWA 4M7DA 1IHVA 2KQWA 3X24B 1BK2A 3GOXA 5FU7B 3RERA 1FMVA 2FPEA 3M56A 2P4TA 2X3XD 1CKAA 2QK0A 2XG8D 3O8VA 4MZPA 3I56A 2OTJT 5GMKe 4K11A 1RL2A 4RTWA 3HL8A 2RQWA 1RLQC 3EGXA 3URGA 1T3LA 2LDMA 2DBMA 1UUEA 2NUZA 3HFNA 4JRQA 4OMFB 4TVRA 4J9BA 2EFIA 2O31A 4EMKC 4KULA 3TEEA 1SRLA 3TVTA 1MMNA 3F70A 3HHTB 4RTUA 3QYGB 4DOWA 4BB7A 2MI6A 1QWEA 2LQWA 4AT1B 2XK0A 2GBQA 4M7DC 3H6ZA 1RUWA 3I9QA 4HKEA 2OTLT 1PRLC 3WVDB 2DLPA 5CKEA 1I0CA 5A0LA 2CYZB 2EGCA 1N5ZA 1YHQT 4PJOC 4MMKA 4GLKA 4BACA 2K79A 2R5AA 1RAEB 3P8BB 4EDUA 5L8RE 3CCST 1T0JA 1TH7A 3P8HA 2G3RA 1S72T 1X2KA 2J6FA 3CQTA 3R6NA 2WACA 3GPLA 1UGPB 4RTTA 4ME7A 4OB1B 1YI2A 2LCCA 4BDYA 3BE3A 1R0CB 1S72A 1CKBA 3OMGA 4AG1C 4DBFA 1Q82U 2FRYA 1QVFA 2KXDA 4XK8E 4FU6A 5IN1A 1I1JA 3CPWA 1WFWA 4N4IA 2FO0A 1BIAA 1MUZA 4PKCC 3G71T 4IUUA 1M27C 1ARKA 4RTVA 1SSFA 1UEBA 1Q95G 5LJ3f 2K7AA 1QCFA 4FSSA 1MV3A 2L8DA 1QVFP 4LE9A 2LZ6B 3NMZC 2DTHA 1VQ4Q 4E2FB 5D6WA 1B7TA 3HRUA 2BE9B 2E10A 1NLOC 2KGTA 5FROA 3VS5A 3CCLT 2HEQA 2VB6A 3EGUA 2VXFA 2JVVA 3CEYA 4FCYA 3CXCA 4C8QD 3CCQT 2FPFA 2BKDN 1EX4A 4C5HA 2VVKA 2DYBA 2OTLA 2XKOC 1BCMA 2KT1A 2R58A 5GAOm 2XHCA 1M90C 4RG2A 4V2SA 4C8QB 2DJQA 5A2QE 2HKQB 4C92E 3CXCP 1KIKA 1KHCA 1OV3A 2ZZDA 5J39A 5CCAA 4C8QG 8AT1B 3MJXA 3CCJA 3SDZA 3MKDA 3M0UA 1OU9A 4JRKA 3KUFA 1IB8A 1VQ5A 1KC8U 1ZSGA 2CP0A 1M2VA 4N4GA 1M2OA 1VQ6T 2G6FX 2DXUA 3RR6A 1G3TA 2CH4W 2FL7A 1UB4A 3OYAA 2CSIA 3HKSA 2RJCA 2EGEA 3N5BB 2Y90A 1VQOA 3GLXA 4RTXA 4DQ2A 2BZ8A 2JOYA 4ZTFA 2C0OA 2ATCB 3UWNA 1UHFA 4E6RA 1YITQ 3S3MA 3SWNC 5LJ5j 2OAUA 1FYNA 1NYGA 2HQEA 4RCCA 4M78G 2DAQA 2OI3A 5I2MA 2H3EB 4KRTA 2RO0A 4KGXB 3VS7A 1G2BA 1QP3A 3QJYA 2BUDA 3CCEQ 1Q7YR 3QYHB 5I11A 2VV5A 3VUBA 2KK4A 4P5NA 1WJQA 3FLGA 4EPCA 2V8KA 3NGPA 2DJZA 2YHTA 4A4EA 5KYWB 4E7JA 1VIEA 5GANe 4J9IA 5FRMA 1PM3A 1ABOA 4LNPA 3QO3A 3QWYA 2NUPB 2V8JA 2E65A 1K0XA 3BFMA 2CKKA 3M9QA 3NTHA 5HK0A 1M4ZA 2X9HA 1Q7YC 3V7SA 2V8IA 1YITT 4PFOA 2C0TA 1Y96A 4LDYA 4OMOA 2HQHA 1AWJA 3HFOA 3EG9A 4IIMA 2QQSA 2X4WA 3ZFJA 4XTYA 4L59A 3CC4T 2YDLA 2CP2A 3KFVA 1SHFA 4M75F 1QWFA 2GCXA 2VASA 3J81E 4DBQA 4JRPA 1H641 5CQXA 2RH2A 2DRMA 2PVGB 3CCQA 3PGGA 4A53A 1VQ8A 3OYNA 2EBPA 5GAOr 1D3BA 2PVOB 1QQJA 3FRNA 4NL2A 1JJ2A 3PIOA 1O9SA 1PKTA 2EQUA 3UF4A 3OW2A 3QIIA 3JSCA 3BW1A 5HY6A 2YRVA 4JRIA 4LDWA 1Y0MA 3RNJA 1RAFB 1BB9A 4C0DC 5IHKA 5KCOA 2K2MA 2QGFB 1UJYA 2KR3A 4Z88A 4M77C 4M78C 3JCMX 4M7AC 3G4ST 1QVFS 1N27A 3FC3A 1PSFA 3CPWS 2CH4A 3ZEHA 4YTLA 3L2QA 2ENMA 1RI9A 3WXMB 3MPUB 3CCMQ 1VQKQ 1OQKA 5KE2A 2JS0A 3CC7T 3I56Q 4OP0A 5GMKm 5GMKh 2X4JA 4OGCA 3ZBDA 3HP9A 4E47A 5GAOl 2QTVA 2KDSA 2MCNA 3KXTA 2MYSA 3PNWC 1OEBA 1K73C 1SEMA 1D0XA 3CC2T 2C06A 1QVGA 4BI3A 3JCMh 3E2UA 3V8JA 3X26B 1MNDA 1YJNT 3CXCS 3EGDB 2PTKA 2D9TA 4M77A 4M78A 1OZ3A 2M51A 1JXMA 3OSSC 3G7ZA 3JCMQ 1BU1A 2FZCB 1VIFA 3LH5A 1BI2A 1XTDA 1W4SA 2WSCE 4M7DF 4XTWA 2KVQG 3OYBA 1Q81U 2E3IA 2J7IA 4X9CA 4IUVA 1GXIE 5CKDA 2HAXA 3OYLA 1HJDA 1MHNA 3VKIA 2K5FA 3VV0A 3DLLA 2QI2A 5CK9A 5KYXA 3FB9A 2Y4YA 3QZ9B 3RDVA 2VKNA 1ZSZB 1NJIR 4JUVA 2DILA 1X01A 3PT9A 2DVJA 2HCKA 2WSEE 1N9RA 3H8ZA 1WA7A 3INZA 4ESRA 2CT4A 1AWOA 5GAMf 4C5IA 1N6AA 2EW3A 1QVPA 1HK9A 2DYIA 4AMCA 1RI0A 5KYNA 2GFUA 2YUNA 5CKFA 1ZX6A 2QAZA 3GBQA 4JLIA 4Y28E 1LJOA 4XU0A 2DL5A 5GAMe 4HCKA 3EH1A 2AIRB 3OA6A 3E19A 1KC8C 4NL3A 3J80E 4DA4A 4M7DE 1AD5A 5J3BA 3JCMb 4BDZA 2RHZA 4CC3A 3A8HB 1IREB 1VQNT 1ACMB 1WQWA 4C92B 1M3CA 3TSZA 4LDVA 3UT1A 3H0FA 2V1QA 4QVZA 4C8QE 2F5KA 3OB9A 2XU8A 3WVEB 3G1JA 3MEUA 1IXDA 2KE9A 2AZVA 4IUQA 2RJEA 2JMCA 3RUXA 3JB9I 3CCVT 4D6WA 3UATA 2HBPA 1WQ7A 2GGRA 3AT1B 2EYXA 1M1KC 3VYHB 4L5GA 2JTEA 2XI9A 2LQNA 5IXBA 1UFFA 2RJDA 2L5QA 4M75D 1X75C 2E1HA 1Q7YU 3EH2A 1M1GA 1WLPB 3PVLA 2VGMA 2E6NA 1QW1A 4EMKA 1JB0E 5LJ5g 2ZPBB 3L2VA 4JPBW 2X35A 4IUTA 2PNIA 3X28B 5HK3A 2DVEA 3I55Q 4OB3B 3TQ7P 3I5SA 4BY6C 3OQ5A 3OS0A 1NJIC 1JBMA 2NYSA 5KYYA 5C6SA 3I55T 4M77B 5DLOA 3KBGA 2DXTA 3QG1A 4PJOA
chains in the Genus database with same CATH topology
2HD0A 4PJOE 1BI1A 4XQ3A 3M57A 5DM7R 4M7AE 3G71T 1YBYA 4IUUA 4JJNK 3SB2A 2QDYB 3FEOA 3PMIA 4BE1A 3LWIA 1SSFA 1UEBA 4M77D 4OGEA 1EIFA 5LJ3f 3UDCA 4X9DA 5GAMj 2L8DA 3L42A 3L1AA 4PJOF 1JRIA 3MEVA 3VUZA 2DTHA 2RI3A 1UGQB 3C12A 3OYDA 3AHUA 1M9SA 2H3JA 3NTKA 5D6WA 1VQMA 5GANj 4FM4B 3HRUA 2RHIA 2E10A 5FROA 4A4HA 1OZ2A 3CC7A 2RJFA 2RHXA 5CQYA 3CCLT 3RERA 3C94A 3CCEA 4QQ6A 2FVUA 3DLMA 3CC2A 3QSUA 4R56A 4PL6A 1LNXA 3JCMc 2VXFA 2ZGWA 1HXDA 2E5QA 2JVVA 4E7LA 3CPFA 3UPUA 3CEYA 1Q81C 1G3YA 2EAYA 2KSSA 2LCLA 5GAMh 4C8QD 3CXCA 4VUBA 3G4SA 3CCQT 5GMKj 4C8QF 1OI1A 2BKDN 3I56T 2RHYA 2A3LA 1QP2A 4OF1A 3RMQA 4C5HA 2OTLA 3OYGA 3QJ6A 5GAN7 2YLBA 2K4YA 2XKOC 2LT1A 1VQMT 3DKMA 2VUBA 2R58A 3META 2XHCA 3X25B 5GAOm 1Q86U 2LC4A 4QQDA 4RG2A 1M90C 4J5YA 4V2SA 2EKOA 5GANg 4C8QB 3FJPA 2AHJB 2ZPHB 3T9NA 3GNGA 1FXXA 4ZGDB 5A2QE 1K8AU 2QA4T 2ZPEB 4FT2A 3NTIA 4C5EA 4C92E 3OYEA 3GP8A 2QXFA 1KHCA 5LJ5f 4C8QA 2ZZDA 5J39A 1UGSB 2LTOA 5CCAA 4C8QG 5DY9A 3SDZA 3CCJA 5LJ3d 2LRQA 5GMKi 5LJ3j 1N8RU 1XOVA 5KCHA 2QEXT 1VQ5A 4JRKA 1AHJB 1WNLA 3KUFA 4E7KA 1BKBA 1KC8U 4MZTA 1WJRA 3CCUA 4NOYA 4N4GA 2DTIA 2M9UA 2K2VA 2QQ9A 5KE3A 5LJ5e 1VQ6T 4M78B 2DXUA 3EAEA 3MP8A 4XU1A 3LGLA 5M9OA 1G3TA 4C92A 2CS7A 2FL7A 1UB4A 4J7FA 4RCBA 2E70A 3OYAA 1WPYA 3M4YA 1VUBA 1D3BB 3HKSA 2RJCA 1Y71A 2EQJA 4EMHA 4C92F 5I21A 1K8AC 3N5BB 3CMAT 2Y90A 2XICA 1VQOA 3CCLA 3GLXA 3L2UA 3CD6T 1P92A 3RMSA 3QBYA 3PFSA 4II1A 4JLGA 2JOYA 4DQ2A 2I2LA 1M1KU 4ZTFA 2JZ2A 2DEQA 2DO3A 2DIQA 3UWNA 1B34A 2MMPA 1KQ2A 3S3MA 3SWNC 4ZGEB 3A8LB 4N4HA 4CI0C 4M78E 5LJ5j 2RHUA 2OAUA 4Q5WA 2HQEA 2ZPIB 4QQGA 4RCCA 2CZ6B 4M77G 4ELZC 5GAN4 4A4FA 5LL6S 4M78G 2MF2A 4M75B 2D0QB 2YLCA 2DAQA 3MCAB 5I2MA 4C8QC 3LYIA 2RO0A 4XTVA 3FDRA 1QP3A 3QJYA 4RG8A 4F7UG 5D6XA 1H3ZA 4M75A 2BUDA 4F7UA 5FU7C 4J6XA 3CBOA 4M75G 4HCCA 4F7UE 3QPHA 2QA4A 5CO7A 3QYHB 4PLLA 3NFCA 2VV5A 3CBPA 3VUBA 1X6OA 4XAXB 2PU9B 2KK4A 4BY6B 4F7UB 4ZGJB 4IURA 4P5NA 3JCMW 1WJQA 3FLGA 4EPCA 2V8KA 3JB9J 1VQPT 1Q82C 2DJZA 2YHTA 3OYFA 4C92C 4FSXA 4A4EA 3CD6A 4E7JA 5FU6C 3Q1JA 1VIEA 2DZ9A 5GANe 2E12A 3R6OA 1VQLT 3HRTA 5FRMA 1R8OB 2RM4A 2FB7A 3JCMg 4OB0B 3QO3A 4EMGA 1YIJA 1YIJT 2P0PA 2V8JA 1LOJA 2E65A 4FIBA 2MWOA 2RK1A 3G71A 3BFMA 1WJSA 3RESA 2MWPA 2CKKA 3M53A 4J7IA 3M9QA 3NTHA 3SWNA 1VQ6A 5HK0A 1M4ZA 4QVDA 2FHDA 5C0MA 1Q7YC 2LQKA 3OSVA 2DPPB 3V7SA 2V8IA 3VJPA 4LD6A 5LJ3g 4JS4A 1YITT 1KQSS 4LDYA 1Y96A 1VQ9T 3HFOA 3PIPA 4XTUA 4M7DG 2D6FA 3LGFA 3HRSA 2F5TX 2RA2A 1U1SA 3QUIA 3C4SA 4DOVA 5GANd 1JJ2S 4C0ZA 4M75C 2QQSA 2X4WA 4J6WA 3ZFJA 5GAN5 3OYIA 2LT4A 3PTAA 4XTYA 4JS5A 3RKYA 4A54A 4BI8B 3PMTA 3BY7A 2XDDA 4L59A 4B9WA 3CC4T 2JTMA 3EFSA 1VQNA 4M7AG 1OYXA 3OBYA 4M7AA 1YJNA 1I81A 4M75F 5GAN2 2K5LA 5GAMd 3J7AF 4BE2A 1YJ9A 2E6ZA 1BYMA 2GCXA 3I55A 3J81E 4JRPA 2E41A 5CKHA 4M77E 1H641 5J26A 3CMEA 4M7DD 3OYMA 1KQ1A 5CQXA 5FRNA 2VYTA 4ZN1A 4O6JA 2RH2A 2K5IA 2PVGB 5AYFA 3CCQA 3PGGA 4PJOD 2QEXA 4A53A 2DZCA 1KQSA 2O4XA 3GIBA 1VQ8A 2RI2A 1YJWT 3OYNA 2OTJA 4WF2A 2X4YA 3V7CA 3OYKA 5GAOr 4ZTJA 2DIGA 2GF7A 3TU4K 3CCET 1D3BA 2PVOB 4OB2B 3FRNA 4NL2A 1JJ2A 3CCRA 1VQ7A 1O75A 2O4XB 1MGQA 5CIUA 2DTOA 1K9MU 3PIOA 1O9SA 4MZMA 2EQUA 4BUGA 2MAMA 3QIIA 3OW2A 2DD5A 3JSCA 2DD4A 3BW1A 3CCVA 5GAMg 5HY6A 3JB9D 2R57A 2Y4XA 2YRVA 4JRIA 4C92D 1N8RC 2R5MA 2M0OA 4ZN3A 2P0KA 2JUFA 4LDWA 4E7HA 2JTFA 2KMTA 2ZCFB 4C0DC 3CCUT 1U8RA 1VQ9A 4LDXA 4A4GA 3OS1A 1M8VA 5KCOA 2P0QA 2L3RA 4PLIA 5IT9E 3V7RA 3QHSA 5GAOp 3RIRA 4M77C 3G6ET 1QVGS 1ZQ1A 4GY5A 4M78C 3JCMX 4M7AC 3G4ST 1QVFS 2EIFA 3MHXA 4M7AD 2EJ9A 2CZ0B 1N27A 4M78D 3FC3A 1PSFA 5GAN3 2E64A 3ZEHA 1FX7A 1G3WA 3LLRA 4YTLA 3L2QA 3CPWS 5D6YA 1Q86C 1M90U 2VGNA 3WXMB 4C0DB 4A4KA 3V8KA 3S3NA 3JRZA 1I8FA 2WSFE 5KE2A 3JB9G 2HNIA 5KH6A 5HKCA 2XDBA 4IUPA 4NS5A 3CC7T 1YJ9T 2VC8A 4HCBA 4OP0A 5GMKm 5GMKh 2X4JA 4OGCA 3OS5A 4XU2A 3ZBDA 4HT8A 5LJ5d 4M7AB 3HSBA 4PJOB 3DB3A 3HP9A 4E47A 3OW2S 5GAOl 1BIBA 2KAFA 2KDSA 3SWNB 3CCJT 3MP1A 4N0AA 4XU3A 5EG2A 3A8OB 3MEWA 4UC4A 4C92G 3KXTA 1XNIA 3PNWC 4KUDK 4EMKB 1K73C 4CRIA 3LW5E 5CVIA 5GANh 2LVMA 1G5VA 2K3XA 2XIDA 2M1HA 3CC2T 3OBWA 4MDWA 2C06A 1QVGA 1W2BA 4BI3A 2LQ8A 3JCMh 1NPRA 3M5AA 1KD1C 3MEAA 4FL6A 4QW2A 4QVCA 1NE8A 1VQ5T 3V8JA 1XQHA 3X26B 4M78F 5LJ3e 1YJNT 2LNVA 2EQKA 3A8GB 3CXCS 4M7DB 1N9SA 3M54A 3ASKA 2D9TA 3GNFB 4M77A 4KBMB 4PJOG 4M78A 5CAIA 1OZ3A 4J83A 4C5GA 4Z02A 2PUOB 1YHQA 2XD0A 1Y07A 2EJFA 2DK3A 3G7ZA 1V29B 3OSSC 3JCMJ 1K9MC 5GAN6 3JCMQ 1YI2T 2JN0A 3P8DA 3QXEB 1NPPA 1VIFA 5FU6B 2DXCA 5A0GA 4X34A 3G6EA 1BI2A 1XTDA 5FLXE 4MMLA 1W4SA 2WSCE 1DJ7B 3OYJA 2GQVA 4XTWA 4M7DF 1VQ8T 2KVQG 3OYBA 1Q81U 2EQMA 4KUIA 4X9CA 1ZHIA 3S3OA 1BI3A 2L89A 1KD1U 2DKGA 4IUVA 3JAME 1GXIE 5CKDA 2HAXA 1U1TA 3BDLA 4OVAA 3OYLA 2EJGA 5GAOq 2QTXA 4PNOA 4F7UF 4IKFA 5GAN8 1MHNA 2PVDB 3VKIA 2K5FA 1BI0A 3VV0A 3DLLA 4N0AC 3SD4A 2QI2A 3OMCA 5CK9A 1W2BS 3EFRA 3VYGA 3FB9A 2Y4YA 3QZ9B 1FWZA 1VQ4T 3CCRT 1VQ7T 1M5Q1 4BD3A 3CCMT 4O5VA 3X20B 1VQKT 3CCMA 1VQKA 1NZ9A 4M75E 4JUVA 1Y7XA 3LX7A 1X01A 4JDSA 3PT9A 3JCMP 1VQLA 3QZ5B 1IZ6A 3ME9A 3LH0A 2O01E 2WSEE 2RD1A 5LJ5h 3RKXA 1I5LA 1N9RA 1ZBXA 2BIVA 5DLQE 3CCSA 5GANf 3H8ZA 5CR2A 1KG1A 3E9FA 3INZA 2RB6A 3SFMA 4E7IA 3A5ZB 2QQBA 3DB4A 4L6V5 3JCMf 3OYCA 3HPWA 5GAMf 3JB9H 5I2SA 4M7DA 5GAOn 2CGHA 4C5IA 2IVWA 1N6AA 2KQWA 3X24B 1QVPA 2GFAA 5FU7B 3GOXA 4XTXA 1K73U 3M56A 1HK9A 2EWNA 4HA8A 3JB9F 2P4TA 5A0DA 1I4K1 1RI0A 3O8VA 2XG8D 4MZPA 3I56A 2GFUA 3L2RA 1YJWA 5CKFA 2OTJT 2PUKB 5GMKe 3L2ZA 1KHIA 4JLIA 1PSEA 2CZ7B 1RL2A 1LJOA 2B8AA 4Y28E 3HL8A 3TCJA 3V8LA 4R55A 3URGA 4XU0A 1B34B 3MO8A 5GAMe 2LDMA 4RMOA 3CMET 3M58A 4ATOA 3HFNA 3S6WA 3OA6A 4JRQA 3E19A 1KC8C 4NL3A 3BDUA 3M59A 4OMFB 5CKBA 3J80E 4TVRA 4DA4A 4M7DE 2KY9A 3C95A 4M77F 5J3BA 3JCMb 4BDZA 2RHZA 3A8HB 2EFIA 2LX9A 3CMAA 4ELYC 1IREB 3ER0A 3OS2A 3CC4A 1VQNT 4EMKC 4KULA 3TEEA 3L2WA 2HQXA 1WQWA 3MP6A 3OYYA 4C92B 2FYKA 4BE0A 1VQ4A 3RKWA 4KT0E 3UT1A 4LDVA 3F70A 3HHTB 4QVZA 4M7AF 4C8QE 3QYGB 2F5KA 3OB9A 2XU8A 3E9GA 4DOWA 2NLUA 3WVEB 5GMKl 4BB7A 2MI6A 2A7YA 1UGRB 3MEUA 1YCYA 2XDPA 2K57A 2DXBA 3JCMV 4IUQA 2XK0A 4M7DC 2RJEA 3H6ZA 5LJ3h 2QQRA 4HKEA 3QDRB 2OTLT 2ZPGB 3RUXA 3JB9I 4XTZA 3CCVT 3FIFA 3WVDB 4D6WA 5CKEA 3JCMe 2HBPA 1WQ7A 3GF5A 5A0LA 2VXEA 2CYZB 1M1KC 3VYHB 2JNGA 1YHQT 4L5GA 4PJOC 4MMKA 4HCZA 1M1FA 2XI9A 4GLKA 2RJDA 2F69A 2L5QA 4M75D 1X75C 2E1HA 4BACA 3CBMA 1Q7YU 3OYHA 1M1GA 4LD9K 2VGMA 2E6NA 2R5AA 2X4XA 1QW1A 3P8BB 4LDUA 1JB0E 4EDUA 5L8RE 1G3SA 2M16A 4EMKA 5LJ5g 3CCST 3JCMd 2ZPBB 3VU3C 3QKJA 3L2VA 1TH7A 2X35A 3P8HA 2G3RA 4IUTA 1S72T 2IG0A 1VQOT 3X28B 5HK3A 2DVEA 3M55A 2WACA 4OB3B 4Y91A 4RKUE 3GPLA 1UGPB 4BY6C 3OQ5A 4ME7A 4J6YA 4OB1B 2LCCA 3M4GA 3LWHA 4BDYA 4BI4A 1YI2A 1S72A 3OMGA 3OS0A 1NJIC 1JBMA 2RK2A 1Q82U 2PQWA 2QQAA 4C0GA 1VQPA 4B9XA 5C6SA 4J8OA 1QVFA 4XK8E 4FU6A 5IN1A 3I55T 3CPWA 4M77B 3TREA 2ZPFB 4HT9A 2EYQA 1NJIU 3A8MB 1Y96B 4FT4A 1YITA 2K3YA 2RI5A 1WGSA 5DLOA 4MDXA 2CZ1B 3KBGA 4N4IA 5IAYA 3OY9A 4C0FA 2DXTA 3QG1A 3E1SA 4PJOA 1BIAA 4PKCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RO0 A;  1RI0 A;  3FDR A;  3O8V A;  4GY5 A;  3L2R A;  2GFU A;  4IUU A;  1H3Z A;  5D6X A;  2BUD A;  3FEO A;  3PMI A;  4BE1 A;  1N27 A;  1SSF A;  3FC3 A;  2B8A A;  3ZEH A;  3L2Q A;  3LLR A;  5D6Y A;  2L8D A;  3L42 A;  3MO8 A;  2LDM A;  4PLL A;  3S3N A;  3OA6 A;  3MEV A;  3S6W A;  5KE2 A;  2RI3 A;  5KH6 A;  4IUR A;  4IUP A;  4NS5 A;  1WJQ A;  3FLG A;  3OYD A;  3NTK A;  5D6W A;  3OYF A;  2RHI A;  4A4E A;  5FRO A;  4A4H A;  1OZ2 A;  4BDZ A;  2RJF A;  2RHZ A;  2RHX A;  3DB3 A;  3Q1J A;  4E7J A;  2EFI A;  5FRM A;  4QQ6 A;  3DLM A;  3OS2 A;  4PL6 A;  3MP1 A;  3L2W A;  2HQX A;  3MEW A;  4UC4 A;  3MP6 A;  1XNI A;  2E5Q A;  3PNW C;  4E7L A;  4BE0 A;  3CEY A;  3UT1 A;  3F70 A;  4CRI A;  4QVZ A;  2BKD N;  1OI1 A;  2LVM A;  2MWO A;  1G5V A;  2RHY A;  1WJS A;  2K3X A;  2F5K A;  2CKK A;  2M1H A;  2MWP A;  3E9G A;  3M9Q A;  3OB9 A;  2NLU A;  3NTH A;  4C5H A;  3OYG A;  3QJ6 A;  2FHD A;  5C0M A;  3MEA A;  3MEU A;  4FL6 A;  4QW2 A;  2XDP A;  4LD6 A;  4IUQ A;  2XK0 A;  2R58 A;  3MET A;  2RJE A;  3H6Z A;  4QQD A;  4RG2 A;  2QQR A;  2EKO A;  3LGF A;  2EQK A;  3C4S A;  3ASK A;  2D9T A;  1OZ3 A;  4C5E A;  3NTI A;  4Z02 A;  4C5G A;  3OYE A;  2QQS A;  2X4W A;  1KHC A;  3OYI A;  5J39 A;  2LTO A;  3P8D A;  3PMT A;  4X34 A;  4HCZ A;  4L59 A;  4B9W A;  2RJD A;  3OYJ A;  1OYX A;  2LRQ A;  3OYB A;  5KCH A;  2EQM A;  4BAC A;  3KUF A;  4E7K A;  3S3O A;  2L89 A;  4IUV A;  4BE2 A;  1WJR A;  3OYH A;  3BDL A;  4OVA A;  3OYL A;  2E6N A;  4N4G A;  4IKF A;  5KE3 A;  5J26 A;  1MHN A;  2R5A A;  2X4X A;  3OYM A;  3EAE A;  3MP8 A;  4EDU A;  3SD4 A;  5FRN A;  2VYT A;  2M16 A;  3OMC A;  3LGL A;  3QKJ A;  3L2V A;  5M9O A;  2X35 A;  3P8H A;  2O4X A;  2G3R A;  4IUT A;  2IG0 A;  4BD3 A;  2RI2 A;  3OYA A;  3OYN A;  3OYK A;  2X4Y A;  2RJC A;  4ZTJ A;  2DIG A;  2EQJ A;  2GF7 A;  2WAC A;  3OQ5 A;  3LX7 A;  2LCC A;  4BDY A;  3L2U A;  3OMG A;  3OS0 A;  3ME9 A;  2O4X B;  3LH0 A;  5CIU A;  3QBY A;  3PFS A;  4II1 A;  2PQW A;  4ZTF A;  2JZ2 A;  2EQU A;  3UWN A;  2DIQ A;  2BIV A;  3QII A;  4B9X A;  5C6S A;  3H8Z A;  3E9F A;  3S3M A;  4FU6 A;  2R57 A;  2YRV A;  5IN1 A;  4N4H A;  4E7I A;  2R5M A;  2M0O A;  2RHU A;  2P0K A;  4Q5W A;  3DB4 A;  4E7H A;  2JTF A;  2HQE A;  4QQG A;  3OYC A;  4A4G A;  3OS1 A;  4A4F A;  2K3Y A;  2RI5 A;  1WGS A;  4C5I A;  5KCO A;  2DAQ A;  2L3R A;  4N4I A;  2GFA A;  5IAY A;  3OY9 A;  4PLI A;  3LYI A;  3GOX A; 
#chains in the Genus database with same CATH topology
 5DM7 R;  1YBY A;  3FEO A;  3PMI A;  1QMC A;  3LWI A;  2D0N A;  4M77 D;  4OGE A;  2VWF A;  4AFU C;  4X9D A;  1HSQ A;  4OMM A;  3L1A A;  2RI3 A;  1UGQ B;  3C12 A;  3NTK A;  4PJJ A;  4A4H A;  2RJF A;  1KK7 A;  4QQ6 A;  1RAG B;  3QSU A;  3CCJ Q;  4PL6 A;  1RAI B;  3JCM c;  2A36 A;  2E5Q A;  3UPU A;  1G3Y A;  2LCL A;  4VUB A;  5GMK j;  4C8Q F;  2K6D A;  2RHY A;  4F14 A;  3OYG A;  2YLB A;  2K4Y A;  1VYU A;  3MET A;  4J5Y A;  3T9N A;  1FXX A;  2ZPE B;  3EGX B;  4C8Q A;  4M4Z A;  3CC2 Q;  5GMK i;  5IHI A;  1NEB A;  1BKB A;  1RAB B;  1YFN A;  2DTI A;  1VQ5 Q;  2ED1 A;  4M78 B;  3EAE A;  3MP8 A;  5HCK A;  3UA6 A;  4XU1 A;  3LGL A;  4C92 A;  2DEU A;  2CS7 A;  4J7F A;  1D3B B;  1MMG A;  4EMH A;  5I21 A;  3M0R A;  1K4U S;  3CMA T;  2HMA A;  2OTJ Q;  1P92 A;  4E7S A;  4JLG A;  1TWB A;  3PFS A;  2JZ2 A;  2LMJ A;  2DIQ A;  2MMP A;  1KQ2 A;  2AZS A;  4CI0 C;  1R77 A;  2ZPI B;  4A4F A;  4FYW B;  4JJB A;  2L0A A;  2W0Z A;  2EQI A;  2L3P A;  1B3Q A;  1H3Z A;  5D6X A;  1W6X A;  4M75 A;  1YP5 A;  4F7U A;  5FU7 C;  2QEX Q;  3CBO A;  1X69 A;  3QPH A;  2QA4 A;  4X1V A;  1X6O A;  2X3W D;  1PHT A;  3JCM W;  1VQP T;  1Q82 C;  2QDL A;  4C92 C;  1NEG A;  3Q1J A;  2DZ9 A;  2AT1 B;  2RM4 A;  1VQN Q;  1WX6 A;  3JCM g;  2EVR A;  1SKU B;  4R0K A;  1YIJ T;  2P0P A;  1JQQ A;  4PFP A;  3RES A;  1K0S A;  1KQS P;  3SWN A;  2LQK A;  3OSV A;  2DPP B;  3VJP A;  1K9A A;  2HSP A;  1PNJ A;  3LGF A;  3QUI A;  4B6M A;  4OMN A;  1JJ2 S;  3JV3 A;  4M75 C;  4J6W A;  3CPW P;  2W10 A;  4M7A G;  4B9W A;  1OYX A;  3VS1 A;  1I81 A;  2K5L A;  4BE2 A;  3C0C A;  1IGQ A;  3HTR A;  2BE7 D;  3VS3 A;  1TSF A;  4ZN1 A;  4O6J A;  4PJO D;  2DZC A;  2EYZ A;  1VQO Q;  1YJW T;  4DEY A;  2DIG A;  3CCE T;  4A63 B;  4WCI A;  4EIK A;  1V76 A;  5CIU A;  2DTO A;  1GBQ A;  3CCV A;  3SEM A;  1QKW A;  1WDX A;  2R57 A;  2M0O A;  2P0K A;  2ZCF B;  1VQ9 A;  1TTH B;  1AWX A;  1X43 A;  2L3R A;  1WXT A;  3V7R A;  3G6E T;  4GY5 A;  3MHX A;  2KNB B;  4ZNX A;  2EJ9 A;  2LJ3 A;  2CZ0 B;  5D7U A;  2FZK B;  1Q86 C;  3M0Q A;  4C0D B;  1RAH B;  1H92 A;  5KH6 A;  2XDB A;  4IUP A;  4OMP A;  1YJ9 T;  4LXC A;  1QCN A;  1SPK A;  1ZSZ C;  1ZA1 B;  4XU2 A;  5LJ5 d;  3HSB A;  1ZUK A;  4N0A A;  3MEW A;  4UC4 A;  4HVW A;  2XMF A;  3LW5 E;  2ROL A;  2XID A;  3OBW A;  1W2B A;  1HYO A;  3M5A A;  1KD1 C;  4FL6 A;  4QW2 A;  3U23 A;  3M0T A;  1YCS B;  2E4H A;  1N9S A;  1NBE B;  2DF6 A;  4PJO G;  4KBM B;  5CAI A;  1WHH A;  2FG0 A;  1U06 A;  5GAN 6;  3QXE B;  2NUT A;  1NPP A;  2DXC A;  3UA7 A;  1QVG P;  2GQV A;  1WXB A;  2RQV A;  1VQ8 T;  1C1A A;  2QA4 Q;  2EQM A;  3S3O A;  2NUT B;  3H0I A;  1U1T A;  3BDL A;  4OVA A;  2EJG A;  5GAO q;  4PNO A;  4IKF A;  2PVD B;  1BI0 A;  4N0A C;  1D0Y A;  1VQ4 T;  4GLM A;  1T0H A;  4O5V A;  5EC7 A;  3CCM A;  1VQK A;  2ZAE A;  4M75 E;  1VQL A;  2CT3 A;  3JCM P;  4JDS A;  1IZ6 A;  3ME9 A;  2RD1 A;  5LJ5 h;  3H0H A;  2BIV A;  5CR2 A;  3G6E Q;  1KG1 A;  3E9F A;  2RB6 A;  4E7I A;  2CSQ A;  1GBR A;  3DB4 A;  1VA7 A;  3JB9 H;  8ATC B;  5I2S A;  2DM1 A;  1XJW B;  2CGH A;  3EG1 A;  4LUE A;  2D1X A;  5ECA A;  1NLP C;  2HBW A;  2EWN A;  4HA8 A;  2DL8 A;  3JB9 F;  5A0D A;  1AZE A;  3QDF A;  1KHI A;  3TCJ A;  1PSE A;  3V8L A;  1U8R A;  2B8A A;  1K76 A;  4HVV A;  2O9S A;  4J9G A;  3S6W A;  4F04 B;  4KGV B;  1WHJ A;  3RBB B;  2QGG A;  3CCS Q;  3A1P A;  2LX9 A;  3CMA A;  4QKU A;  3ER0 A;  2HQX A;  5KYU A;  3OYY A;  3RKW A;  3SHW A;  1ZBJ A;  4M7A F;  1OPK A;  4JZ3 A;  3E9G A;  3VS6 A;  2DET A;  2XDP A;  2DXB A;  2K3B A;  3JCM V;  1D1C A;  5LJ3 h;  2QQR A;  2DL3 A;  2ZPG B;  2LP5 A;  4WTO B;  3FIF A;  1OX8 A;  1X6G A;  3GF5 A;  1K1Z A;  2VXE A;  2LJ0 A;  1A0N B;  5GJV B;  2AKK A;  2JNG A;  4HCZ A;  4F16 A;  2F69 A;  2F2W A;  4HXJ A;  1EZZ B;  2KYB A;  2Z0W A;  1YN8 A;  3VRY A;  1Q81 R;  1SRM A;  2X4X A;  4LDU A;  1G3S A;  2M16 A;  3JCM d;  3VU3 C;  4ANJ A;  1YI2 Q;  3CCU Q;  1FMW A;  5IXF A;  4Y91 A;  1UG1 A;  4RKU E;  1UE9 A;  3LWH A;  3M4G A;  1ZUY A;  2PQW A;  2QQA A;  2J6O A;  4C0G A;  2CDT A;  1VQP A;  4B9X A;  2DA9 A;  2L2P A;  1NJI U;  4FT4 A;  1YIT A;  2K3Y A;  1WGS A;  2CZ1 B;  5IAY A;  2AKL A;  3E1S A;  2YSQ A;  5FWB A;  2JXB A;  2HD0 A;  1BI1 A;  4M7A E;  1UDL A;  3M57 A;  1TOV A;  3ULR B;  4JJN K;  3SB2 A;  2CUD A;  1IHW A;  1M8M A;  1EIF A;  4AFZ C;  1GFD A;  3CMA Q;  5GAM j;  3L42 A;  4PJO F;  1MNE A;  3FJ5 A;  1JRI A;  2MOX A;  3MEV A;  3VUZ A;  4DEX A;  2L3S A;  4KH1 B;  3EG3 A;  3AHU A;  2FZG B;  1WXU A;  4FM4 B;  3CC7 A;  1OZ2 A;  2RHX A;  5CQY A;  2DBK A;  3C94 A;  3CCE A;  2JW4 A;  3DLM A;  4R56 A;  2ROT A;  2ZGW A;  1HXD A;  2DFU A;  2P84 A;  2EAY A;  2KSS A;  2BZY A;  2JT4 A;  2NUP A;  5GAM h;  3G4S A;  4LN2 A;  2IPO B;  3A98 A;  4OF1 A;  1RLP C;  2DL4 A;  3RMQ A;  1FMK A;  3D7S B;  2JJ9 A;  3QJ6 A;  5GAN 7;  1VQM T;  3DKM A;  2M02 A;  1Q86 U;  2LC4 A;  3PE0 A;  2EKO A;  5GAN g;  2AHJ B;  3GNG A;  1K8A U;  4FT2 A;  4C5E A;  3NTI A;  3OYE A;  1T3S A;  3GP8 A;  2MPX C;  5LJ5 f;  1UGS B;  2LTO A;  2BZX A;  2MIO A;  4D8K A;  1XOV A;  5KCH A;  2QEX T;  2ABL A;  2KRM A;  4MZT A;  1WJR A;  2M9U A;  5LJ5 e;  5KE3 A;  4D8D A;  2RMO A;  5M9O A;  3CME Q;  2A08 A;  2E70 A;  2HL3 A;  4Y92 A;  4QT7 A;  2XIC A;  3CCL A;  1H8K A;  3CD6 T;  4II1 A;  1D1A A;  2DO3 A;  1TUC A;  3CD6 Q;  4J9D A;  1X6B A;  4ZGE B;  4FYY B;  3A8L B;  2RHU A;  4Q5W A;  3EG9 B;  4JZ4 A;  5GAN 4;  4QQG A;  4M77 G;  1G83 A;  4JJC A;  3EG2 A;  4C8Q C;  3LYI A;  9ATC B;  4XTV A;  3M0S A;  4F7U G;  4RG8 A;  1PD1 A;  4RUG A;  1K8A R;  5CO7 A;  1Z9Z A;  4PLL A;  1VQM Q;  2KRS A;  3NFC A;  2RQT A;  3CBP A;  4XAX B;  4BY6 B;  4F7U B;  4ZGJ B;  4IUR A;  3JB9 J;  2A37 A;  3OYF A;  4J9C A;  1C0M A;  4FSX A;  3CD6 A;  5FU6 C;  1VYT A;  3R6O A;  3H9N A;  1VQL T;  1R8O B;  2HZY A;  4EMG A;  2KT8 A;  5IHN A;  1YIJ A;  1X2Q A;  1IGU A;  2MWO A;  2RQU A;  3M53 A;  2CRE A;  1VQ6 A;  5C0M A;  1WYX A;  4LD6 A;  1VQ9 T;  3PIP A;  4M7D G;  3HRS A;  2F5T X;  1U1S A;  4DOV A;  1EFN A;  2MK5 A;  4C0Z A;  4Z8A A;  2EYY A;  5GAN 5;  4JS5 A;  1AWW A;  3RKY A;  1W1F A;  2RNA A;  3PMT A;  4A54 A;  4BI8 B;  1VQN A;  2JTM A;  3EFS A;  3OBY A;  1LVK A;  1Y57 A;  5GAN 2;  3J7A F;  1YJ9 A;  2GNC A;  1BYM A;  5CKH A;  1RAD B;  3CME A;  1YWO A;  4M7D D;  5AT1 B;  1KQ1 A;  5FRN A;  2K5I A;  4CC7 A;  2QEX A;  1KQS A;  2O4X A;  2D8J A;  1TG0 A;  2RI2 A;  2OTJ A;  3NPF A;  4RTY A;  3CCR A;  1PWT A;  1VQ7 A;  2O4X B;  1ZLM A;  1D09 B;  1K9M U;  4MZM A;  4BUG A;  2MAM A;  1JXO A;  3JB9 D;  5GAM g;  4PJL A;  4PJM A;  4C92 D;  1N8R C;  2R5M A;  2IIM A;  2H8H A;  2JTF A;  2KMT A;  3CCU T;  1WHK A;  4A4G A;  5IT9 E;  2JS2 A;  3RIR A;  1QVG S;  2EIF A;  3REB B;  4CC2 A;  2E64 A;  1VOM A;  4RTZ A;  1FX7 A;  2QYZ A;  3LLR A;  1B07 A;  5D6Y A;  4AG2 C;  2VGN A;  4A4K A;  3S3N A;  2YXY A;  2WSF E;  2JM9 A;  1S1N A;  3JB9 G;  2HNI A;  5HKC A;  1E6G A;  1NM7 A;  1MV0 B;  3OS5 A;  4HT8 A;  4Z89 A;  2A0F B;  4PJO B;  3CCV Q;  2KAF A;  3CCJ T;  3MP1 A;  5EG2 A;  4CRI A;  1UTI A;  5CVI A;  1G5V A;  2LVM A;  2M1H A;  4MDW A;  2KBT A;  2LQ8 A;  1NPR A;  1ZUU A;  3MEA A;  1PD0 A;  1NE8 A;  1XQH A;  4M78 F;  2E5K A;  3M54 A;  1PC0 A;  3ZL7 C;  1YJN Q;  3VS0 A;  4J83 A;  1YHQ A;  1F1B B;  4C5G A;  2XD0 A;  2L3Q A;  1N8R R;  1Y07 A;  3JCM J;  1YI2 T;  2JN0 A;  3P8D A;  5A0G A;  3G6E A;  5FLX E;  1DJ7 B;  3OYJ A;  1ZHI A;  7AT1 B;  2F2X A;  3JAM E;  1ZSZ A;  1U3O A;  2FRW A;  2QTX A;  4F7U F;  5GAN 8;  2DL7 A;  1OX9 A;  1JO8 A;  2KEA A;  1FWZ A;  3CCR T;  1VQ7 T;  1M5Q 1;  2RN8 A;  3CCM T;  1VQK T;  1K9M R;  1NZ9 A;  1Y7X A;  3LX7 A;  3QZ5 B;  3LH0 A;  1VQ6 Q;  2O01 E;  1OOT A;  3NHN A;  3RKX A;  1ZBX A;  5DLQ E;  3CCS A;  5GAN f;  2LX7 A;  3A5Z B;  1RAC B;  2O2O A;  1M30 A;  2QQB A;  1SF9 A;  4L6V 5;  3OYC A;  5GAO n;  2IVW A;  2GFA A;  1K73 U;  4XTX A;  3TSW A;  1I4K 1;  1J3T A;  3L2R A;  1YJW A;  2PUK B;  3L2Z A;  2EYW A;  2CZ7 B;  3EHR A;  4R55 A;  2YT6 A;  1B34 B;  1WI7 A;  3MO8 A;  4RMO A;  3CME T;  3M58 A;  4ATO A;  2E3H A;  2EPD A;  2GQI A;  2QG9 B;  3BDU A;  3M59 A;  4FYX B;  5CKB A;  2KY9 A;  3C95 A;  4M77 F;  3CCQ Q;  4ELY C;  3OS2 A;  3CC4 A;  1TUG B;  2AK5 A;  4FW1 A;  3L2W A;  3MP6 A;  1AZG B;  2FYK A;  4BE0 A;  1VQ4 A;  4KT0 E;  4CC4 B;  1E7O A;  4AFS C;  2NLU A;  1OPL A;  5GMK l;  3I35 A;  2A7Y A;  1UGR B;  1YCY A;  2K57 A;  1QCO A;  2F1L A;  4KGZ B;  1VYV A;  2GTO A;  3QDR B;  4XTZ A;  3JCM e;  3M0P A;  2X51 A;  1PKS A;  4KH0 B;  2RQR A;  3CC7 Q;  2DER A;  3QWX X;  4HVU A;  3PVQ A;  1M1F A;  3VRZ A;  4PFZ A;  3CBM A;  2BTT A;  3G4S Q;  1SG5 A;  3OYH A;  1KSW A;  1GCQ C;  4LD9 K;  5L23 A;  4AFQ C;  5FW9 A;  4ORZ A;  1KFZ A;  3QKJ A;  1NYF A;  2IG0 A;  1VQO T;  3EHQ A;  1R0B G;  3M55 A;  1V1C A;  4J6Y A;  2K9G A;  4BI4 A;  1X27 A;  2RK2 A;  3REA B;  2YWW A;  2J06 A;  1WHL A;  4J8O A;  1MMD A;  1E6H A;  3TRE A;  2ZPF B;  2CUB A;  4HT9 A;  2EYQ A;  3A8M B;  1Y96 B;  2RI5 A;  1GFC A;  1WHG A;  4MDX A;  3OY9 A;  4C0F A;  4PJO E;  4XQ3 A;  2SEM A;  2QAS A;  1AT1 B;  2QDY B;  2KRN A;  4BE1 A;  3UDC A;  1GRI A;  4DBR A;  2DX1 A;  1D1B A;  1AOJ A;  1GCQ A;  4IIO A;  3CC4 Q;  1KD1 R;  1MMA A;  2ED0 A;  2HDA A;  3OYD A;  1PCX A;  5KYW A;  1M9S A;  2H3J A;  1VQM A;  2C0I A;  5GAN j;  2RHI A;  1TS9 A;  2FVU A;  3CC2 A;  2DNU A;  1LNX A;  5GJW B;  2O9V A;  3OW2 P;  4E7L A;  2D8H A;  3CPF A;  1Q81 C;  1OI1 A;  3I56 T;  2A3L A;  1QP2 A;  2FEI A;  2LT1 A;  2OJ2 A;  1NG2 A;  1UJ0 A;  2VUB A;  1YIJ Q;  3X25 B;  4QQD A;  4DBH A;  3FJP A;  2ZPH B;  1WIE A;  4ZGD B;  2QA4 T;  4FW2 A;  2JM8 A;  2QXF A;  5KYY B;  1YJW Q;  4E7Z A;  1VQP Q;  3THK A;  5DY9 A;  1YWP A;  5LJ3 d;  2LRQ A;  5LJ3 j;  1N8R U;  1AHJ B;  1WNL A;  4E7K A;  2RF0 A;  3CCU A;  1PRM C;  2P4R A;  4NOY A;  2K2V A;  2QQ9 A;  2DE0 X;  1IRX A;  4PK4 A;  2SRC A;  1PG5 B;  2DRK A;  1AEY A;  1GL5 A;  4RCB A;  1WPY A;  3M4Y A;  1VUB A;  1W2B P;  1Y71 A;  2EQJ A;  4C92 F;  1K8A C;  2YUP A;  3L2U A;  1TUD A;  3RMS A;  3QBY A;  1M1K U;  1AVZ C;  2I2L A;  2DEQ A;  3CCL Q;  1B34 A;  2NWM A;  5KYU B;  2PZ1 A;  4N4H A;  4M78 E;  1U5S A;  4ELZ C;  2CZ6 B;  1UEC A;  5LL6 S;  3CCR Q;  1VQ7 Q;  2MF2 A;  4M75 B;  5I22 A;  2D0Q B;  2YLC A;  3MCA B;  2J05 A;  3FDR A;  2HSE B;  3EFO B;  1W70 A;  4J6X A;  4M75 G;  1Z9Q A;  4F7U E;  4HCC A;  1VQ8 Q;  2KI7 A;  3VS2 A;  2CP5 A;  2EKH A;  2PU9 B;  3EFO A;  1M3A A;  1Q86 R;  2J6K A;  1JU5 C;  2JMA A;  2E12 A;  3HRT A;  2F2V A;  2FB7 A;  4JJD A;  1QKX A;  1QLY A;  4OB0 B;  2M0Y A;  1LOJ A;  3I5R A;  2LCS A;  4FIB A;  2RK1 A;  3G71 A;  1WJS A;  2MWP A;  1S72 Q;  4J7I A;  2KRO A;  2COZ A;  5IH2 A;  4QVD A;  2FHD A;  2V26 A;  5LJ3 g;  4JS4 A;  2DMO A;  1KQS S;  1RAA B;  1JJ2 P;  1GCP A;  4FYV B;  4XTU A;  2D6F A;  1OUL A;  2RA2 A;  3C4S A;  1WHM A;  5GAN d;  1TXQ A;  2ECZ A;  1LCK A;  1BCO A;  2LT4 A;  3OYI A;  3PTA A;  4PJN A;  1M2V B;  1YHQ Q;  3BY7 A;  3EG0 A;  1IO6 A;  2XDD A;  4M7A A;  1YJN A;  3O5Z A;  1BBZ A;  5GAM d;  2E6Z A;  3G71 Q;  4F17 A;  3I55 A;  2E41 A;  4M77 E;  5J26 A;  1KJW A;  5KYX B;  2B86 A;  3OYM A;  1YJ9 Q;  2VYT A;  1WZO A;  5AYF A;  2KXC A;  6AT1 B;  3GIB A;  4WF2 A;  2X4Y A;  2KYM A;  3V7C A;  3OYK A;  4ZTJ A;  2GF7 A;  3TU4 K;  1M1K R;  2YUQ A;  4OB2 B;  1O75 A;  1MGQ A;  1SSH A;  2YRC A;  1SHG A;  3H41 A;  1I07 A;  1H3H A;  2DD5 A;  2DD4 A;  2I0N A;  1JEG A;  2Y4X A;  4ZN3 A;  2JUF A;  2A28 A;  4E7H A;  4LDX A;  1D0Z A;  2COW A;  3EGD A;  3OS1 A;  1M8V A;  4OML A;  2P0Q A;  2EGA A;  4PLI A;  1G8X A;  3QHS A;  5GAO p;  2LNH B;  1ZQ1 A;  4M7A D;  2COY A;  4M78 D;  5GAN 3;  1G3W A;  2FPD A;  1M90 U;  2LJ1 A;  4J9F A;  3V8K A;  3JRZ A;  1I8F A;  4NS5 A;  2VC8 A;  2OX7 A;  4J9H A;  4HCB A;  4M7A B;  3DB3 A;  3OW2 S;  1BIB A;  2OTL Q;  3IQL A;  3SWN B;  1YNZ A;  4XU3 A;  3A8O B;  4C92 G;  2CP7 A;  1XNI A;  2YUO A;  4KUD K;  4EMK B;  2ESW A;  4GBQ A;  1I5O B;  5GAN h;  5FWC A;  2K3X A;  1HD3 A;  2HL5 C;  4QVC A;  1ABQ A;  1VQ5 T;  1C6V X;  5LJ3 e;  2OAW A;  2LNV A;  2EQK A;  3A8G B;  4M7D B;  3ASK A;  3GNF B;  1KC8 R;  1VQL Q;  4Z02 A;  2PUO B;  2EJF A;  2DK3 A;  1V29 B;  1K9M C;  2O88 A;  5FU6 B;  4X34 A;  4MML A;  1K73 R;  1ZA2 B;  4KUI A;  1OU8 A;  1BI3 A;  2L89 A;  2V1R A;  2DKG A;  1KD1 U;  2CP6 A;  4LUD A;  1M90 R;  4J9E A;  2GTJ A;  1TU0 B;  1UHC A;  1UGV A;  3SD4 A;  3OMC A;  4OMQ A;  1W2B S;  3EFR A;  3VYG A;  3VS4 A;  2YRD A;  4BD3 A;  2RPN A;  1LPL A;  3X20 B;  1M3B A;  2CP3 A;  1I5L A;  2HKN A;  1CSK A;  1VQ9 Q;  1Q82 R;  3SFM A;  3JCM f;  3HPW A;  4M7D A;  1IHV A;  2KQW A;  3X24 B;  1BK2 A;  3GOX A;  5FU7 B;  3RER A;  1FMV A;  2FPE A;  3M56 A;  2P4T A;  2X3X D;  1CKA A;  2QK0 A;  2XG8 D;  3O8V A;  4MZP A;  3I56 A;  2OTJ T;  5GMK e;  4K11 A;  1RL2 A;  4RTW A;  3HL8 A;  2RQW A;  1RLQ C;  3EGX A;  3URG A;  1T3L A;  2LDM A;  2DBM A;  1UUE A;  2NUZ A;  3HFN A;  4JRQ A;  4OMF B;  4TVR A;  4J9B A;  2EFI A;  2O31 A;  4EMK C;  4KUL A;  3TEE A;  1SRL A;  3TVT A;  1MMN A;  3F70 A;  3HHT B;  4RTU A;  3QYG B;  4DOW A;  4BB7 A;  2MI6 A;  1QWE A;  2LQW A;  4AT1 B;  2XK0 A;  2GBQ A;  4M7D C;  3H6Z A;  1RUW A;  3I9Q A;  4HKE A;  2OTL T;  1PRL C;  3WVD B;  2DLP A;  5CKE A;  1I0C A;  5A0L A;  2CYZ B;  2EGC A;  1N5Z A;  1YHQ T;  4PJO C;  4MMK A;  4GLK A;  4BAC A;  2K79 A;  2R5A A;  1RAE B;  3P8B B;  4EDU A;  5L8R E;  3CCS T;  1T0J A;  1TH7 A;  3P8H A;  2G3R A;  1S72 T;  1X2K A;  2J6F A;  3CQT A;  3R6N A;  2WAC A;  3GPL A;  1UGP B;  4RTT A;  4ME7 A;  4OB1 B;  1YI2 A;  2LCC A;  4BDY A;  3BE3 A;  1R0C B;  1S72 A;  1CKB A;  3OMG A;  4AG1 C;  4DBF A;  1Q82 U;  2FRY A;  1QVF A;  2KXD A;  4XK8 E;  4FU6 A;  5IN1 A;  1I1J A;  3CPW A;  1WFW A;  4N4I A;  2FO0 A;  1BIA A;  1MUZ A;  4PKC C;  3G71 T;  4IUU A;  1M27 C;  1ARK A;  4RTV A;  1SSF A;  1UEB A;  1Q95 G;  5LJ3 f;  2K7A A;  1QCF A;  4FSS A;  1MV3 A;  2L8D A;  1QVF P;  4LE9 A;  2LZ6 B;  3NMZ C;  2DTH A;  1VQ4 Q;  4E2F B;  5D6W A;  1B7T A;  3HRU A;  2BE9 B;  2E10 A;  1NLO C;  2KGT A;  5FRO A;  3VS5 A;  3CCL T;  2HEQ A;  2VB6 A;  3EGU A;  2VXF A;  2JVV A;  3CEY A;  4FCY A;  3CXC A;  4C8Q D;  3CCQ T;  2FPF A;  2BKD N;  1EX4 A;  4C5H A;  2VVK A;  2DYB A;  2OTL A;  2XKO C;  1BCM A;  2KT1 A;  2R58 A;  5GAO m;  2XHC A;  1M90 C;  4RG2 A;  4V2S A;  4C8Q B;  2DJQ A;  5A2Q E;  2HKQ B;  4C92 E;  3CXC P;  1KIK A;  1KHC A;  1OV3 A;  2ZZD A;  5J39 A;  5CCA A;  4C8Q G;  8AT1 B;  3MJX A;  3CCJ A;  3SDZ A;  3MKD A;  3M0U A;  1OU9 A;  4JRK A;  3KUF A;  1IB8 A;  1VQ5 A;  1KC8 U;  1ZSG A;  2CP0 A;  1M2V A;  4N4G A;  1M2O A;  1VQ6 T;  2G6F X;  2DXU A;  3RR6 A;  1G3T A;  2CH4 W;  2FL7 A;  1UB4 A;  3OYA A;  2CSI A;  3HKS A;  2RJC A;  2EGE A;  3N5B B;  2Y90 A;  1VQO A;  3GLX A;  4RTX A;  4DQ2 A;  2BZ8 A;  2JOY A;  4ZTF A;  2C0O A;  2ATC B;  3UWN A;  1UHF A;  4E6R A;  1YIT Q;  3S3M A;  3SWN C;  5LJ5 j;  2OAU A;  1FYN A;  1NYG A;  2HQE A;  4RCC A;  4M78 G;  2DAQ A;  2OI3 A;  5I2M A;  2H3E B;  4KRT A;  2RO0 A;  4KGX B;  3VS7 A;  1G2B A;  1QP3 A;  3QJY A;  2BUD A;  3CCE Q;  1Q7Y R;  3QYH B;  5I11 A;  2VV5 A;  3VUB A;  2KK4 A;  4P5N A;  1WJQ A;  3FLG A;  4EPC A;  2V8K A;  3NGP A;  2DJZ A;  2YHT A;  4A4E A;  5KYW B;  4E7J A;  1VIE A;  5GAN e;  4J9I A;  5FRM A;  1PM3 A;  1ABO A;  4LNP A;  3QO3 A;  3QWY A;  2NUP B;  2V8J A;  2E65 A;  1K0X A;  3BFM A;  2CKK A;  3M9Q A;  3NTH A;  5HK0 A;  1M4Z A;  2X9H A;  1Q7Y C;  3V7S A;  2V8I A;  1YIT T;  4PFO A;  2C0T A;  1Y96 A;  4LDY A;  4OMO A;  2HQH A;  1AWJ A;  3HFO A;  3EG9 A;  4IIM A;  2QQS A;  2X4W A;  3ZFJ A;  4XTY A;  4L59 A;  3CC4 T;  2YDL A;  2CP2 A;  3KFV A;  1SHF A;  4M75 F;  1QWF A;  2GCX A;  2VAS A;  3J81 E;  4DBQ A;  4JRP A;  1H64 1;  5CQX A;  2RH2 A;  2DRM A;  2PVG B;  3CCQ A;  3PGG A;  4A53 A;  1VQ8 A;  3OYN A;  2EBP A;  5GAO r;  1D3B A;  2PVO B;  1QQJ A;  3FRN A;  4NL2 A;  1JJ2 A;  3PIO A;  1O9S A;  1PKT A;  2EQU A;  3UF4 A;  3OW2 A;  3QII A;  3JSC A;  3BW1 A;  5HY6 A;  2YRV A;  4JRI A;  4LDW A;  1Y0M A;  3RNJ A;  1RAF B;  1BB9 A;  4C0D C;  5IHK A;  5KCO A;  2K2M A;  2QGF B;  1UJY A;  2KR3 A;  4Z88 A;  4M77 C;  4M78 C;  3JCM X;  4M7A C;  3G4S T;  1QVF S;  1N27 A;  3FC3 A;  1PSF A;  3CPW S;  2CH4 A;  3ZEH A;  4YTL A;  3L2Q A;  2ENM A;  1RI9 A;  3WXM B;  3MPU B;  3CCM Q;  1VQK Q;  1OQK A;  5KE2 A;  2JS0 A;  3CC7 T;  3I56 Q;  4OP0 A;  5GMK m;  5GMK h;  2X4J A;  4OGC A;  3ZBD A;  3HP9 A;  4E47 A;  5GAO l;  2QTV A;  2KDS A;  2MCN A;  3KXT A;  2MYS A;  3PNW C;  1OEB A;  1K73 C;  1SEM A;  1D0X A;  3CC2 T;  2C06 A;  1QVG A;  4BI3 A;  3JCM h;  3E2U A;  3V8J A;  3X26 B;  1MND A;  1YJN T;  3CXC S;  3EGD B;  2PTK A;  2D9T A;  4M77 A;  4M78 A;  1OZ3 A;  2M51 A;  1JXM A;  3OSS C;  3G7Z A;  3JCM Q;  1BU1 A;  2FZC B;  1VIF A;  3LH5 A;  1BI2 A;  1XTD A;  1W4S A;  2WSC E;  4M7D F;  4XTW A;  2KVQ G;  3OYB A;  1Q81 U;  2E3I A;  2J7I A;  4X9C A;  4IUV A;  1GXI E;  5CKD A;  2HAX A;  3OYL A;  1HJD A;  1MHN A;  3VKI A;  2K5F A;  3VV0 A;  3DLL A;  2QI2 A;  5CK9 A;  5KYX A;  3FB9 A;  2Y4Y A;  3QZ9 B;  3RDV A;  2VKN A;  1ZSZ B;  1NJI R;  4JUV A;  2DIL A;  1X01 A;  3PT9 A;  2DVJ A;  2HCK A;  2WSE E;  1N9R A;  3H8Z A;  1WA7 A;  3INZ A;  4ESR A;  2CT4 A;  1AWO A;  5GAM f;  4C5I A;  1N6A A;  2EW3 A;  1QVP A;  1HK9 A;  2DYI A;  4AMC A;  1RI0 A;  5KYN A;  2GFU A;  2YUN A;  5CKF A;  1ZX6 A;  2QAZ A;  3GBQ A;  4JLI A;  4Y28 E;  1LJO A;  4XU0 A;  2DL5 A;  5GAM e;  4HCK A;  3EH1 A;  2AIR B;  3OA6 A;  3E19 A;  1KC8 C;  4NL3 A;  3J80 E;  4DA4 A;  4M7D E;  1AD5 A;  5J3B A;  3JCM b;  4BDZ A;  2RHZ A;  4CC3 A;  3A8H B;  1IRE B;  1VQN T;  1ACM B;  1WQW A;  4C92 B;  1M3C A;  3TSZ A;  4LDV A;  3UT1 A;  3H0F A;  2V1Q A;  4QVZ A;  4C8Q E;  2F5K A;  3OB9 A;  2XU8 A;  3WVE B;  3G1J A;  3MEU A;  1IXD A;  2KE9 A;  2AZV A;  4IUQ A;  2RJE A;  2JMC A;  3RUX A;  3JB9 I;  3CCV T;  4D6W A;  3UAT A;  2HBP A;  1WQ7 A;  2GGR A;  3AT1 B;  2EYX A;  1M1K C;  3VYH B;  4L5G A;  2JTE A;  2XI9 A;  2LQN A;  5IXB A;  1UFF A;  2RJD A;  2L5Q A;  4M75 D;  1X75 C;  2E1H A;  1Q7Y U;  3EH2 A;  1M1G A;  1WLP B;  3PVL A;  2VGM A;  2E6N A;  1QW1 A;  4EMK A;  1JB0 E;  5LJ5 g;  2ZPB B;  3L2V A;  4JPB W;  2X35 A;  4IUT A;  2PNI A;  3X28 B;  5HK3 A;  2DVE A;  3I55 Q;  4OB3 B;  3TQ7 P;  3I5S A;  4BY6 C;  3OQ5 A;  3OS0 A;  1NJI C;  1JBM A;  2NYS A;  5KYY A;  5C6S A;  3I55 T;  4M77 B;  5DLO A;  3KBG A;  2DXT A;  3QG1 A;  4PJO A; 
#chains in the Genus database with same CATH homology
 2HD0 A;  4PJO E;  1BI1 A;  4XQ3 A;  3M57 A;  5DM7 R;  4M7A E;  3G71 T;  1YBY A;  4IUU A;  4JJN K;  3SB2 A;  2QDY B;  3FEO A;  3PMI A;  4BE1 A;  3LWI A;  1SSF A;  1UEB A;  4M77 D;  4OGE A;  1EIF A;  5LJ3 f;  3UDC A;  4X9D A;  5GAM j;  2L8D A;  3L42 A;  3L1A A;  4PJO F;  1JRI A;  3MEV A;  3VUZ A;  2DTH A;  2RI3 A;  1UGQ B;  3C12 A;  3OYD A;  3AHU A;  1M9S A;  2H3J A;  3NTK A;  5D6W A;  1VQM A;  5GAN j;  4FM4 B;  3HRU A;  2RHI A;  2E10 A;  5FRO A;  4A4H A;  1OZ2 A;  3CC7 A;  2RJF A;  2RHX A;  5CQY A;  3CCL T;  3RER A;  3C94 A;  3CCE A;  4QQ6 A;  2FVU A;  3DLM A;  3CC2 A;  3QSU A;  4R56 A;  4PL6 A;  1LNX A;  3JCM c;  2VXF A;  2ZGW A;  1HXD A;  2E5Q A;  2JVV A;  4E7L A;  3CPF A;  3UPU A;  3CEY A;  1Q81 C;  1G3Y A;  2EAY A;  2KSS A;  2LCL A;  5GAM h;  4C8Q D;  3CXC A;  4VUB A;  3G4S A;  3CCQ T;  5GMK j;  4C8Q F;  1OI1 A;  2BKD N;  3I56 T;  2RHY A;  2A3L A;  1QP2 A;  4OF1 A;  3RMQ A;  4C5H A;  2OTL A;  3OYG A;  3QJ6 A;  5GAN 7;  2YLB A;  2K4Y A;  2XKO C;  2LT1 A;  1VQM T;  3DKM A;  2VUB A;  2R58 A;  3MET A;  2XHC A;  3X25 B;  5GAO m;  1Q86 U;  2LC4 A;  4QQD A;  4RG2 A;  1M90 C;  4J5Y A;  4V2S A;  2EKO A;  5GAN g;  4C8Q B;  3FJP A;  2AHJ B;  2ZPH B;  3T9N A;  3GNG A;  1FXX A;  4ZGD B;  5A2Q E;  1K8A U;  2QA4 T;  2ZPE B;  4FT2 A;  3NTI A;  4C5E A;  4C92 E;  3OYE A;  3GP8 A;  2QXF A;  1KHC A;  5LJ5 f;  4C8Q A;  2ZZD A;  5J39 A;  1UGS B;  2LTO A;  5CCA A;  4C8Q G;  5DY9 A;  3SDZ A;  3CCJ A;  5LJ3 d;  2LRQ A;  5GMK i;  5LJ3 j;  1N8R U;  1XOV A;  5KCH A;  2QEX T;  1VQ5 A;  4JRK A;  1AHJ B;  1WNL A;  3KUF A;  4E7K A;  1BKB A;  1KC8 U;  4MZT A;  1WJR A;  3CCU A;  4NOY A;  4N4G A;  2DTI A;  2M9U A;  2K2V A;  2QQ9 A;  5KE3 A;  5LJ5 e;  1VQ6 T;  4M78 B;  2DXU A;  3EAE A;  3MP8 A;  4XU1 A;  3LGL A;  5M9O A;  1G3T A;  4C92 A;  2CS7 A;  2FL7 A;  1UB4 A;  4J7F A;  4RCB A;  2E70 A;  3OYA A;  1WPY A;  3M4Y A;  1VUB A;  1D3B B;  3HKS A;  2RJC A;  1Y71 A;  2EQJ A;  4EMH A;  4C92 F;  5I21 A;  1K8A C;  3N5B B;  3CMA T;  2Y90 A;  2XIC A;  1VQO A;  3CCL A;  3GLX A;  3L2U A;  3CD6 T;  1P92 A;  3RMS A;  3QBY A;  3PFS A;  4II1 A;  4JLG A;  2JOY A;  4DQ2 A;  2I2L A;  1M1K U;  4ZTF A;  2JZ2 A;  2DEQ A;  2DO3 A;  2DIQ A;  3UWN A;  1B34 A;  2MMP A;  1KQ2 A;  3S3M A;  3SWN C;  4ZGE B;  3A8L B;  4N4H A;  4CI0 C;  4M78 E;  5LJ5 j;  2RHU A;  2OAU A;  4Q5W A;  2HQE A;  2ZPI B;  4QQG A;  4RCC A;  2CZ6 B;  4M77 G;  4ELZ C;  5GAN 4;  4A4F A;  5LL6 S;  4M78 G;  2MF2 A;  4M75 B;  2D0Q B;  2YLC A;  2DAQ A;  3MCA B;  5I2M A;  4C8Q C;  3LYI A;  2RO0 A;  4XTV A;  3FDR A;  1QP3 A;  3QJY A;  4RG8 A;  4F7U G;  5D6X A;  1H3Z A;  4M75 A;  2BUD A;  4F7U A;  5FU7 C;  4J6X A;  3CBO A;  4M75 G;  4HCC A;  4F7U E;  3QPH A;  2QA4 A;  5CO7 A;  3QYH B;  4PLL A;  3NFC A;  2VV5 A;  3CBP A;  3VUB A;  1X6O A;  4XAX B;  2PU9 B;  2KK4 A;  4BY6 B;  4F7U B;  4ZGJ B;  4IUR A;  4P5N A;  3JCM W;  1WJQ A;  3FLG A;  4EPC A;  2V8K A;  3JB9 J;  1VQP T;  1Q82 C;  2DJZ A;  2YHT A;  3OYF A;  4C92 C;  4FSX A;  4A4E A;  3CD6 A;  4E7J A;  5FU6 C;  3Q1J A;  1VIE A;  2DZ9 A;  5GAN e;  2E12 A;  3R6O A;  1VQL T;  3HRT A;  5FRM A;  1R8O B;  2RM4 A;  2FB7 A;  3JCM g;  4OB0 B;  3QO3 A;  4EMG A;  1YIJ A;  1YIJ T;  2P0P A;  2V8J A;  1LOJ A;  2E65 A;  4FIB A;  2MWO A;  2RK1 A;  3G71 A;  3BFM A;  1WJS A;  3RES A;  2MWP A;  2CKK A;  3M53 A;  4J7I A;  3M9Q A;  3NTH A;  3SWN A;  1VQ6 A;  5HK0 A;  1M4Z A;  4QVD A;  2FHD A;  5C0M A;  1Q7Y C;  2LQK A;  3OSV A;  2DPP B;  3V7S A;  2V8I A;  3VJP A;  4LD6 A;  5LJ3 g;  4JS4 A;  1YIT T;  1KQS S;  4LDY A;  1Y96 A;  1VQ9 T;  3HFO A;  3PIP A;  4XTU A;  4M7D G;  2D6F A;  3LGF A;  3HRS A;  2F5T X;  2RA2 A;  1U1S A;  3QUI A;  3C4S A;  4DOV A;  5GAN d;  1JJ2 S;  4C0Z A;  4M75 C;  2QQS A;  2X4W A;  4J6W A;  3ZFJ A;  5GAN 5;  3OYI A;  2LT4 A;  3PTA A;  4XTY A;  4JS5 A;  3RKY A;  4A54 A;  4BI8 B;  3PMT A;  3BY7 A;  2XDD A;  4L59 A;  4B9W A;  3CC4 T;  2JTM A;  3EFS A;  1VQN A;  4M7A G;  1OYX A;  3OBY A;  4M7A A;  1YJN A;  1I81 A;  4M75 F;  5GAN 2;  2K5L A;  5GAM d;  3J7A F;  4BE2 A;  1YJ9 A;  2E6Z A;  1BYM A;  2GCX A;  3I55 A;  3J81 E;  4JRP A;  2E41 A;  5CKH A;  4M77 E;  1H64 1;  5J26 A;  3CME A;  4M7D D;  3OYM A;  1KQ1 A;  5CQX A;  5FRN A;  2VYT A;  4ZN1 A;  4O6J A;  2RH2 A;  2K5I A;  2PVG B;  5AYF A;  3CCQ A;  3PGG A;  4PJO D;  2QEX A;  4A53 A;  2DZC A;  1KQS A;  2O4X A;  3GIB A;  1VQ8 A;  2RI2 A;  1YJW T;  3OYN A;  2OTJ A;  4WF2 A;  2X4Y A;  3V7C A;  3OYK A;  5GAO r;  4ZTJ A;  2DIG A;  2GF7 A;  3TU4 K;  3CCE T;  1D3B A;  2PVO B;  4OB2 B;  3FRN A;  4NL2 A;  1JJ2 A;  3CCR A;  1VQ7 A;  1O75 A;  2O4X B;  1MGQ A;  5CIU A;  2DTO A;  1K9M U;  3PIO A;  1O9S A;  4MZM A;  2EQU A;  4BUG A;  2MAM A;  3QII A;  3OW2 A;  2DD5 A;  3JSC A;  2DD4 A;  3BW1 A;  3CCV A;  5GAM g;  5HY6 A;  3JB9 D;  2R57 A;  2Y4X A;  2YRV A;  4JRI A;  4C92 D;  1N8R C;  2R5M A;  2M0O A;  4ZN3 A;  2P0K A;  2JUF A;  4LDW A;  4E7H A;  2JTF A;  2KMT A;  2ZCF B;  4C0D C;  3CCU T;  1U8R A;  1VQ9 A;  4LDX A;  4A4G A;  3OS1 A;  1M8V A;  5KCO A;  2P0Q A;  2L3R A;  4PLI A;  5IT9 E;  3V7R A;  3QHS A;  5GAO p;  3RIR A;  4M77 C;  3G6E T;  1QVG S;  1ZQ1 A;  4GY5 A;  4M78 C;  3JCM X;  4M7A C;  3G4S T;  1QVF S;  2EIF A;  3MHX A;  4M7A D;  2EJ9 A;  2CZ0 B;  1N27 A;  4M78 D;  3FC3 A;  1PSF A;  5GAN 3;  2E64 A;  3ZEH A;  1FX7 A;  1G3W A;  3LLR A;  4YTL A;  3L2Q A;  3CPW S;  5D6Y A;  1Q86 C;  1M90 U;  2VGN A;  3WXM B;  4C0D B;  4A4K A;  3V8K A;  3S3N A;  3JRZ A;  1I8F A;  2WSF E;  5KE2 A;  3JB9 G;  2HNI A;  5KH6 A;  5HKC A;  2XDB A;  4IUP A;  4NS5 A;  3CC7 T;  1YJ9 T;  2VC8 A;  4HCB A;  4OP0 A;  5GMK m;  5GMK h;  2X4J A;  4OGC A;  3OS5 A;  4XU2 A;  3ZBD A;  4HT8 A;  5LJ5 d;  4M7A B;  3HSB A;  4PJO B;  3DB3 A;  3HP9 A;  4E47 A;  3OW2 S;  5GAO l;  1BIB A;  2KAF A;  2KDS A;  3SWN B;  3CCJ T;  3MP1 A;  4N0A A;  4XU3 A;  5EG2 A;  3A8O B;  3MEW A;  4UC4 A;  4C92 G;  3KXT A;  1XNI A;  3PNW C;  4KUD K;  4EMK B;  1K73 C;  4CRI A;  3LW5 E;  5CVI A;  5GAN h;  2LVM A;  1G5V A;  2K3X A;  2XID A;  2M1H A;  3CC2 T;  3OBW A;  4MDW A;  2C06 A;  1QVG A;  1W2B A;  4BI3 A;  2LQ8 A;  3JCM h;  1NPR A;  3M5A A;  1KD1 C;  3MEA A;  4FL6 A;  4QW2 A;  4QVC A;  1NE8 A;  1VQ5 T;  3V8J A;  1XQH A;  3X26 B;  4M78 F;  5LJ3 e;  1YJN T;  2LNV A;  2EQK A;  3A8G B;  3CXC S;  4M7D B;  1N9S A;  3M54 A;  3ASK A;  2D9T A;  3GNF B;  4M77 A;  4KBM B;  4PJO G;  4M78 A;  5CAI A;  1OZ3 A;  4J83 A;  4C5G A;  4Z02 A;  2PUO B;  1YHQ A;  2XD0 A;  1Y07 A;  2EJF A;  2DK3 A;  3G7Z A;  1V29 B;  3OSS C;  3JCM J;  1K9M C;  5GAN 6;  3JCM Q;  1YI2 T;  2JN0 A;  3P8D A;  3QXE B;  1NPP A;  1VIF A;  5FU6 B;  2DXC A;  5A0G A;  4X34 A;  3G6E A;  1BI2 A;  1XTD A;  5FLX E;  4MML A;  1W4S A;  2WSC E;  1DJ7 B;  3OYJ A;  2GQV A;  4XTW A;  4M7D F;  1VQ8 T;  2KVQ G;  3OYB A;  1Q81 U;  2EQM A;  4KUI A;  4X9C A;  1ZHI A;  3S3O A;  1BI3 A;  2L89 A;  1KD1 U;  2DKG A;  4IUV A;  3JAM E;  1GXI E;  5CKD A;  2HAX A;  1U1T A;  3BDL A;  4OVA A;  3OYL A;  2EJG A;  5GAO q;  2QTX A;  4PNO A;  4F7U F;  4IKF A;  5GAN 8;  1MHN A;  2PVD B;  3VKI A;  2K5F A;  1BI0 A;  3VV0 A;  3DLL A;  4N0A C;  3SD4 A;  2QI2 A;  3OMC A;  5CK9 A;  1W2B S;  3EFR A;  3VYG A;  3FB9 A;  2Y4Y A;  3QZ9 B;  1FWZ A;  1VQ4 T;  3CCR T;  1VQ7 T;  1M5Q 1;  4BD3 A;  3CCM T;  4O5V A;  3X20 B;  1VQK T;  3CCM A;  1VQK A;  1NZ9 A;  4M75 E;  4JUV A;  1Y7X A;  3LX7 A;  1X01 A;  4JDS A;  3PT9 A;  3JCM P;  1VQL A;  3QZ5 B;  1IZ6 A;  3ME9 A;  3LH0 A;  2O01 E;  2WSE E;  2RD1 A;  5LJ5 h;  3RKX A;  1I5L A;  1N9R A;  1ZBX A;  2BIV A;  5DLQ E;  3CCS A;  5GAN f;  3H8Z A;  5CR2 A;  1KG1 A;  3E9F A;  3INZ A;  2RB6 A;  3SFM A;  4E7I A;  3A5Z B;  2QQB A;  3DB4 A;  4L6V 5;  3JCM f;  3OYC A;  3HPW A;  5GAM f;  3JB9 H;  5I2S A;  4M7D A;  5GAO n;  2CGH A;  4C5I A;  2IVW A;  1N6A A;  2KQW A;  3X24 B;  1QVP A;  2GFA A;  5FU7 B;  3GOX A;  4XTX A;  1K73 U;  3M56 A;  1HK9 A;  2EWN A;  4HA8 A;  3JB9 F;  2P4T A;  5A0D A;  1I4K 1;  1RI0 A;  3O8V A;  2XG8 D;  4MZP A;  3I56 A;  2GFU A;  3L2R A;  1YJW A;  5CKF A;  2OTJ T;  2PUK B;  5GMK e;  3L2Z A;  1KHI A;  4JLI A;  1PSE A;  2CZ7 B;  1RL2 A;  1LJO A;  2B8A A;  4Y28 E;  3HL8 A;  3TCJ A;  3V8L A;  4R55 A;  3URG A;  4XU0 A;  1B34 B;  3MO8 A;  5GAM e;  2LDM A;  4RMO A;  3CME T;  3M58 A;  4ATO A;  3HFN A;  3S6W A;  3OA6 A;  4JRQ A;  3E19 A;  1KC8 C;  4NL3 A;  3BDU A;  3M59 A;  4OMF B;  5CKB A;  3J80 E;  4TVR A;  4DA4 A;  4M7D E;  2KY9 A;  3C95 A;  4M77 F;  5J3B A;  3JCM b;  4BDZ A;  2RHZ A;  3A8H B;  2EFI A;  2LX9 A;  3CMA A;  4ELY C;  1IRE B;  3ER0 A;  3OS2 A;  3CC4 A;  1VQN T;  4EMK C;  4KUL A;  3TEE A;  3L2W A;  2HQX A;  1WQW A;  3MP6 A;  3OYY A;  4C92 B;  2FYK A;  4BE0 A;  1VQ4 A;  3RKW A;  4KT0 E;  3UT1 A;  4LDV A;  3F70 A;  3HHT B;  4QVZ A;  4M7A F;  4C8Q E;  3QYG B;  2F5K A;  3OB9 A;  2XU8 A;  3E9G A;  4DOW A;  2NLU A;  3WVE B;  5GMK l;  4BB7 A;  2MI6 A;  2A7Y A;  1UGR B;  3MEU A;  1YCY A;  2XDP A;  2K57 A;  2DXB A;  3JCM V;  4IUQ A;  2XK0 A;  4M7D C;  2RJE A;  3H6Z A;  5LJ3 h;  2QQR A;  4HKE A;  3QDR B;  2OTL T;  2ZPG B;  3RUX A;  3JB9 I;  4XTZ A;  3CCV T;  3FIF A;  3WVD B;  4D6W A;  5CKE A;  3JCM e;  2HBP A;  1WQ7 A;  3GF5 A;  5A0L A;  2VXE A;  2CYZ B;  1M1K C;  3VYH B;  2JNG A;  1YHQ T;  4L5G A;  4PJO C;  4MMK A;  4HCZ A;  1M1F A;  2XI9 A;  4GLK A;  2RJD A;  2F69 A;  2L5Q A;  4M75 D;  1X75 C;  2E1H A;  4BAC A;  3CBM A;  1Q7Y U;  3OYH A;  1M1G A;  4LD9 K;  2VGM A;  2E6N A;  2R5A A;  2X4X A;  1QW1 A;  3P8B B;  4LDU A;  1JB0 E;  4EDU A;  5L8R E;  1G3S A;  2M16 A;  4EMK A;  5LJ5 g;  3CCS T;  3JCM d;  2ZPB B;  3VU3 C;  3QKJ A;  3L2V A;  1TH7 A;  2X35 A;  3P8H A;  2G3R A;  4IUT A;  1S72 T;  2IG0 A;  1VQO T;  3X28 B;  5HK3 A;  2DVE A;  3M55 A;  2WAC A;  4OB3 B;  4Y91 A;  4RKU E;  3GPL A;  1UGP B;  4BY6 C;  3OQ5 A;  4ME7 A;  4J6Y A;  4OB1 B;  2LCC A;  3M4G A;  3LWH A;  4BDY A;  4BI4 A;  1YI2 A;  1S72 A;  3OMG A;  3OS0 A;  1NJI C;  1JBM A;  2RK2 A;  1Q82 U;  2PQW A;  2QQA A;  4C0G A;  1VQP A;  4B9X A;  5C6S A;  4J8O A;  1QVF A;  4XK8 E;  4FU6 A;  5IN1 A;  3I55 T;  3CPW A;  4M77 B;  3TRE A;  2ZPF B;  4HT9 A;  2EYQ A;  1NJI U;  3A8M B;  1Y96 B;  4FT4 A;  1YIT A;  2K3Y A;  2RI5 A;  1WGS A;  5DLO A;  4MDX A;  2CZ1 B;  3KBG A;  4N4I A;  5IAY A;  3OY9 A;  4C0F A;  2DXT A;  3QG1 A;  3E1S A;  4PJO A;  1BIA A;  4PKC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...