2FPFA

Crystal structure of the ib1 sh3 dimer at low resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
b'HEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-jun-amino-terminal kinase interacting protein 1
molecule tags Signaling protein
source organism Rattus norvegicus
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
total genus 14
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpfA00
2HDAA 2DYBA 2V1QA 2RNAA 2JTEA 4Z8AA 4J9EA 3EGUA 5I11A 1X2QA 4HVVA 1X69A 1NM7A 2SRCA 3VRZA 2M51A 1SRLA 4J9GA 4AFQC 4AFZC 1PWTA 2OI3A 2RF0A 3C0CA 4FSSA 1LCKA 2GBQA 1VYTA 2ESWA 2A28A 1NYFA 5FWBA 1RI9A 1WI7A 2KRSA 2DF6A 2V1RA 1T3SA 1M27C 2RQUA 2DL7A 2DVJA 2LNHB 1B07A 1UTIA 3H41A 3TSZA 1CKBA 4RTTA 1QWEA 3VS5A 4ESRA 1PRLC 1PKSA 2JS2A 1WDXA 2CUBA 1SPKA 2ROLA 1AD5A 1YN8A 1BB9A 4WCIA 4LNPA 1Y57A 1Z9QA 1YWOA 2KEAA 3JV3A 2DE0X 1BBZA 2LJ3A 1H8KA 2ED1A 4Z88A 1UJ0A 1IO6A 2LCSA 2EBPA 2HBWA 1SHGA 3LH5A 3QWXX 4GLMA 1UHCA 3REBB 2DMOA 2DL8A 1VA7A 2FG0A 1E6GA 1HSQA 1X43A 1J3TA 2VKNA 4LN2A 1G2BA 2QDLA 2KRMA 3I5SA 1WA7A 4OMMA 2JM8A 2EQIA 2O88A 2RPNA 4JZ4A 1AEYA 2GTJA 3RNJA 2RQWA 2EYXA 2PZ1A 2RQVA 3REAB 4HVUA 2MOXA 1UDLA 2VWFA 4ORZA 4DEYA 3VS4A 2B86A 1UE9A 4JJDA 1KIKA 2LZ6B 2D8HA 3TVTA 1MV0B 1GFDA 2GTOA 2LMJA 2DRMA 4OMLA 2FPFA 2KNBB 4OMNA 1AWOA 4J9BA 3CQTA 2FO0A 1E7OA 3H0IA 1XOVA 1I0CA 2J6FA 4J9DA 2D8JA 1ARKA 1CSKA 4JJBA 2JS0A 2D0NA 1GL5A 1UHFA 2KYMA 1WXUA 2RMOA 2LX7A 3NGPA 5IXBA 1I1JA 2J06A 2J6OA 4Z89A 5I22A 1OPLA 1WXTA 1M3AA 4DEXA 4E6RA 3EHRA 2L3QA 1NLPC 5ECAA 2EKHA 2L0AA 2DJQA 3UA6A 3H0HA 1GCQA 2KT1A 1H3HA 3M0UA 2DL3A 4ZNXA 4F16A 5HCKA 1RUWA 2CREA 2X3XD 3EG3A 1OEBA 1Z9ZA 2C0OA 2FRWA 2VVKA 1M8MA 1AOJA 4RUGA 1ABQA 1WYXA 4RTZA 1K9AA 2ED0A 2EYZA 3VS2A 1E6HA 1G83A 1AZEA 3I35A 4LE9A 2GNCA 3PE0A 1QKXA 1N5ZA 2BZYA 3QWYA 1T0JA 1JQQA 2BZ8A 3NHNA 2E5KA 1QCFA 1ZUYA 1JU5C 2W0ZA 1PHTA 2O2OA 2FPDA 2YUQA 2JMAA 3I9QA 2JXBA 4CC2A 2PNIA 2ROTA 2NUZA 4D8KA 2HEQA 1TUDA 2KXCA 2J05A 1ZLMA 3UA7A 3M0PA 2F2XA 3VS7A 1BU1A 1UGVA 2K6DA 3H0FA 4RTWA 4K11A 3UATA 2YDLA 2CT4A 1K0SA 3VRYA 4OMQA 1RLPC 4EIKA 1B3QA 3GBQA 2LQWA 1ZBJA 1VYUA 1WIEA 2RQRA 2K79A 1SHFA 1WX6A 3RBBB 1M30A 1WLPB 1CKAA 2C0IA 1NLOC 2MCNA 1OV3A 4OMOA 2CDTA 2HSPA 1YCSB 1GBRA 2YUNA 4D8DA 2YUPA 1X27A 5FW9A 2L3PA 1YWPA 2LJ1A 4AFSC 1U06A 5L23A 1OOTA 1JXOA 3KFVA 1MUZA 2EGAA 1RLQC 1YP5A 2ABLA 4JJCA 4IIMA 3O5ZA 3VS0A 3NMZC 2DA9A 4RTXA 3VS6A 4CC4B 2XMFA 2J6KA 1JEGA 3VS3A 2DM1A 1FYNA 1V1CA 4AG1C 2P4RA 2YSQA 4CC3A 1K76A 2EW3A 2DNUA 2AZVA 2RN8A 3IQLA 1MV3A 2K2MA 1X2KA 2KE9A 2DILA 2KBTA 2KRNA 3M0RA 4LUEA 3R6NA 2L3SA 1K0XA 1WFWA 4J9CA 2EGEA 1WXBA 3EG0A 1JO8A 2A36A 1NYGA 2KT8A 2KYBA 2NWMA 4JZ3A 2JT4A 1T3LA 2DBKA 5IHNA 2FEIA 4CC7A 2C0TA 2DRKA 1GRIA 2IIMA 1VYVA 5IHIA 3FJ5A 2J7IA 2KROA 1AWXA 4J9HA 1JXMA 1EFNA 1QLYA 4LUDA 3VS1A 2CT3A 1S1NA 5EC7A 2EYYA 1Y0MA 2K3BA 2W10A 2X3WD 5GJVB 2OAWA 4RTYA 1GCPA 5IH2A 1W70A 2CSIA 2JM9A 1PRMC 2DL4A 1NEBA 1AWJA 2LJ0A 2EPDA 3M0TA 1GBQA 1H92A 1FMKA 1HD3A 3EHQA 4IIOA 1NEGA 1ABOA 2K7AA 2KR3A 2CH4W 1X6BA 3ULRB 1K4US 1SEMA 2AK5A 4HXJA 3PVQA 1I07A 1KJWA 2AZSA 3THKA 1A0NB 2D1XA 4J9IA 3A98A 2HCKA 4RTVA 2O31A 2YUOA 3SEMA 3U23A 2PTKA 1AVZC 1UFFA 2AKKA 4AG2C 4X1VA 2JW4A 1GCQC 5IXFA 2M0YA 1BK2A 2K9GA 1KSWA 2AKLA 1K1ZA 1UG1A 2GGRA 2I0NA 4J9FA 4AFUC 2BZXA 1TUCA 1PNJA 1PKTA 2CH4A 5IHKA 2EYWA 2SEMA 4OMPA 1ZSGA 1U3OA 1T0HA 3M0SA 1NG2A 2F2VA 2A37A 2FRYA 1SRMA 2KGTA 4F14A 4R0KA 3ZL7C 4KRTA 3I5RA 1ZUKA 2O9SA 1M3BA 4JPBW 2OJ2A 2A08A 3NPFA 4GBQA 4Y92A 2LP5A 1UUEA 1HJDA 3EG2A 3EG1A 3M0QA 2L2PA 4RTUA 1W1FA 2GQIA 1UJYA 1AZGB 1UECA 3PVLA 2ENMA 2F2WA 1SSHA 2RQTA 3TSWA 1GFCA 4HCKA 2H8HA 5GJWB 2FPEA 2LQNA 1QKWA 2DBMA 1QWFA 1ZX6A 2EGCA 2O9VA 4A63B 2CSQA 4F17A 1AWWA 1KFZA 4HVWA 1U5SA 2YT6A 2KXDA 5FWCA 1W6XA 2MIOA 2JMCA 1X6GA 2CUDA 2ECZA 1ZUUA 2DLPA 4QT7A 3SHWA 2BTTA 2DL5A 2DX1A 2EVRA 1OPKA 1TG0A 4M4ZA 1YNZA 2G6FX 1M3CA 3UF4A
chains in the Genus database with same CATH superfamily
5HY6A 2EJFA 2JTEA 4Z8AA 4BI3A 1K73C 4J9EA 1YJNT 3CMAQ 1X2QA 4DBFA 1X69A 4FYVB 2IG0A 3MEAA 4XTUA 2V26A 1NJIC 1EZZB 3CCJA 1QVFA 1SRLA 3E19A 1PWTA 3P8HA 2FZKB 3TCJA 2ESWA 2EQKA 1IXDA 4LDXA 1O9SA 2V1RA 1T3SA 4HA8A 5D7UA 1M27C 1VIFA 4M77C 1B7TA 1FMWA 3UT1A 3CPFA 3J7AF 4XK8E 3VUBA 3J81E 1QWEA 3V8LA 3VS5A 1PRLC 4YTLA 4ZGEB 3PIOA 1WDXA 1SPKA 1VQKT 2K57A 5J3BA 5GAN5 4LNPA 4II1A 4PJOG 2IVWA 3JV3A 1F1BB 2QXFA 4FT2A 3OS1A 3EG9A 1UJ0A 3CPWA 2EFIA 3CMET 3PGGA 2KK4A 2EBPA 1QCOA 3CCET 2K5FA 3CC7Q 3OBWA 3CCSQ 4OB2B 3CC7T 1M1KU 3QWXX 1Q82U 4B6MA 3X24B 1VA7A 4FYYB 4BDZA 1WQWA 1HSQA 4BD3A 1J3TA 4J6WA 4MZTA 3FJPA 2KRMA 5HKCA 2PU9B 4OMMA 3FLGA 4AMCA 1YI2Q 1AEYA 3REAB 2RQVA 3FRNA 4HVUA 2FYKA 1S72Q 2FVUA 5GANh 4ELYC 3AT1B 3RKWA 4PLIA 3OS5A 2FB7A 1Q86C 5GAN7 2DRMA 2IPOB 4OMNA 4E7LA 3LGLA 1WJSA 2VXEA 5LJ5e 2J6FA 2D8JA 1CSKA 2D0NA 2CKKA 1GL5A 3QYGB 1UHFA 2DEQA 5GMKh 1ACMB 3S3OA 2VC8A 5IXBA 3KXTA 3OYFA 1EIFA 1YJNQ 5KE2A 1Q81U 1VQMT 1M3AA 4XQ3A 1D3BB 2EIFA 2LDMA 5GANg 4DA4A 2L0AA 3JRZA 1ZSZB 1O75A 2EQMA 3CMEA 4ZNXA 4DBQA 3QIIA 4FU6A 1MGQA 5HCKA 2V8IA 4WTOB 2VVKA 1AOJA 4RUGA 2RHZA 2PVGB 2GCXA 1MMNA 1WYXA 2NUPA 4TVRA 2FHDA 4C0ZA 1G3SA 2DK3A 2ED0A 3CBMA 2KY9A 4LE9A 1D0YA 2GNCA 3H8ZA 6AT1B 1N5ZA 1T0JA 3QYHB 2EQUA 3M56A 3CXCA 4E47A 2DXCA 2O2OA 3A8GB 2MPXC 2E5QA 3JB9F 4FCYA 2YUQA 2XICA 3ZFJA 2ZZDA 5IAYA 2NUZA 2RB6A 3SB2A 1TUDA 2J05A 1ZLMA 4M7AE 2F2XA 1TXQA 4KT0E 2JOYA 3NFCA 1BU1A 3QXEB 1KHCA 1UGVA 3H0FA 3CCJQ 1WHLA 1JJ2P 1VQ7A 8ATCB 4C5HA 2VB6A 1WJQA 4MDWA 5GMKj 3CMAA 1RLPC 1B3QA 2MAMA 3GBQA 4ZGDB 1WHMA 4M77G 2Z0WA 4PNOA 5D6WA 1VOMA 2YRVA 1Y7XA 2C0IA 1SKUB 1RABB 2CDTA 1YCSB 2MI6A 3A8HB 5CIUA 4F7UA 3CCMQ 4C8QE 4XTWA 3DB4A 3OYNA 3FIFA 1YWPA 1U06A 4C92A 1W2BP 1VQNA 5KYUB 2DVEA 5L23A 2CZ1B 2LT4A 3G4SQ 1OOTA 2GFUA 1JXOA 1VQPQ 1TH7A 4M7AC 4FL6A 1YP5A 4MZMA 2CP0A 4JJCA 3LGFA 1WHKA 3LH0A 3O5ZA 3VS0A 4EMHA 2DA9A 5KYYB 4A4EA 3ZEHA 1R8OB 2CP6A 2J6KA 1JEGA 5LJ3h 4BACA 3OYDA 1N8RC 3GNFB 3RIRA 5KYWB 1D1CA 4A4FA 4X9DA 1MMGA 5GANj 4FSXA 1IREB 4CI0C 3M0RA 3R6NA 1S72A 4FIBA 3M5AA 1Y96A 4J9CA 4IUPA 4ZTFA 3BY7A 3EG0A 2A36A 1BCMA 5LJ3d 4O5VA 3I56Q 3X28B 3CEYA 4LDVA 5IHNA 2DTIA 3QG1A 2MYSA 2QTVA 4ANJA 1I4K1 1H641 3OYIA 2DRKA 4C92G 2IIMA 4M75B 5IHIA 3FC3A 3OS2A 2PVDB 2J7IA 2QAZA 2XDPA 4E7ZA 2DZ9A 2L8DA 4Y91A 2RJCA 1YBYA 5FU7C 2DERA 3KUFA 5EC7A 1RACB 3M9QA 4A4KA 1Y0MA 2K3BA 4C0DB 2ZPGB 5LJ3e 3MO8A 2OAWA 4RTYA 2HQEA 5GANd 5GANf 3O8VA 2CSIA 2JM9A 4EMKC 3CD6A 4BY6B 3X20B 3EGDB 2LJ0A 3G71T 4XTZA 4E7JA 2HL3A 1IRXA 3C95A 1QVFS 1H92A 1G3TA 5LJ5d 3GF5A 2K7AA 1X6BA 2ZPFB 3ULRB 1SEMA 1QVPA 2AK5A 4HXJA 3CMAT 2EJGA 1I07A 1KJWA 2ZAEA 3CCUT 4RTVA 1K9MR 2O31A 2YUOA 5KYXA 2D0QB 2JW4A 5IT9E 1GCQC 2M0YA 1BK2A 1KSWA 2AKLA 1JBMA 4C5IA 3CCMA 4J9FA 3D7SB 1K9MC 2A7YA 1TUCA 2BZXA 2CH4A 2K5LA 1UGQB 3G71Q 1BIAA 4LDWA 1U3OA 1T0HA 4E7KA 4M77B 2QDYB 3ME9A 4F14A 3VYHB 5CR2A 4M77F 2M16A 1RAEB 2A08A 2OJ2A 2M0OA 1PSFA 1DJ7B 2DTHA 4Y92A 2LP5A 3EG2A 2E12A 3PNWC 3EG1A 3M0QA 2L2PA 4RTUA 4C92F 1W1FA 1VQ6Q 5CVIA 2HZYA 1VQ7Q 3PVLA 3EGXB 2Y90A 4LXCA 1GFCA 5CAIA 2HBPA 5CQXA 1ZX6A 2O9VA 4A63B 1AWWA 1KFZA 3RDVA 3CD6T 1JJ2A 3HRSA 2VYTA 4MMKA 1WGSA 2VGNA 4GY5A 2HMAA 1YCYA 3M55A 2DEUA 2JMCA 2DLPA 3HRTA 2CGHA 2BTTA 2DL5A 1OPKA 1TG0A 1WPYA 2O4XA 2PVOB 3OQ5A 5GAMj 2V1QA 1Y07A 3JCMJ 4ATOA 3QDRB 2KAFA 4C0FA 3DLLA 1X01A 1NJIU 1NM7A 4PJMA 3VRZA 2M51A 3CCQA 3M4YA 2KVQG 2FZGB 4AFQC 2OI3A 1VYTA 5FWBA 2DF6A 1LJOA 3I55Q 2DL7A 2DVJA 5D6XA 5GANe 1IZ6A 1K8AC 3H41A 3TSZA 4RTTA 2DD4A 4NS5A 2DZCA 3TQ7P 2M1HA 5LJ3g 2JS2A 2FL7A 3OB9A 2CUBA 2BE9B 2ROLA 4A54A 1YN8A 1RAIB 4Z02A 1KD1U 4M7AB 4CRIA 1BBZA 4HKEA 1C1AA 2LJ3A 1H8KA 2ED1A 3SWNB 4JRIA 5CKEA 1W2BA 3WVEB 3HP9A 2LCSA 2DIGA 2CP5A 3LH5A 1M2VA 5C6SA 1D1AA 1OZ2A 4P5NA 1Q82C 1C6VX 2BKDN 1X43A 3HFOA 4A4GA 2E1HA 4M78B 2DAQA 4LN2A 5AT1B 4MDXA 2K3XA 4PJOA 2E64A 2JZ2A 2JM8A 5AYFA 2O88A 2GTJA 1VQ6T 2PZ1A 3JCMg 1LVKA 1VQ6A 2P84A 1R77A 1QMCA 2B86A 2AIRB 1KIKA 2D8HA 3EFRA 1MV0B 1MMDA 2L5QA 4OMLA 1KHIA 4HCBA 4J9BA 1SSFA 4M78G 4RCCA 3H0IA 1R0CB 2BUDA 3L2UA 4F7UG 5GAN2 3CCRQ 1YJWQ 1ARKA 3QJ6A 3AHUA 1WXUA 2RMOA 4NL3A 3UWNA 3CC2T 2R57A 2J6OA 4Z89A 3BDLA 1UGSB 3EFSA 1U1TA 4UC4A 4DEXA 4E6RA 4L6V5 2L3QA 5ECAA 1YITA 2H3EB 2D9TA 4EDUA 3UA6A 3H0HA 2KT1A 2MWPA 2RA2A 3C94A 2XD0A 1KC8U 1RL2A 2CREA 4PL6A 1Z9ZA 2C0OA 3CCRT 3G4SA 1M8MA 1ABQA 2G3RA 3A8MB 2NLUA 2QEXQ 4NOYA 2E70A 5GAOn 4OP0A 1VQNT 4KGVB 4M7DE 4E7IA 5HK3A 1KQ2A 2BZYA 5LJ5h 1QVGP 2E5KA 1QCFA 1ZUYA 2QK0A 3QSUA 4NL2A 5KE3A 3I9QA 3GPLA 3JB9D 2HNIA 3E9GA 4D8KA 2MK5A 1RI0A 2R58A 1MNDA 4L59A 2HSEB 1Q7YR 2KXCA 3WVDB 3M0PA 3C4SA 3GNGA 5A0DA 3UDCA 4DBHA 3CCVT 2X4XA 2DFUA 4KUIA 1BI1A 4N4IA 3META 4RG2A 2LQWA 2M02A 2RQRA 3MKDA 4QQDA 4DQ2A 5GMKm 4MMLA 3RBBB 1TOVA 1OV3A 4JDSA 4DOVA 1TTHB 1TU0B 2BE7D 4PJOC 2YUPA 2E65A 2EQJA 4WF2A 2LJ1A 2QEXA 4M7DC 2DIQA 1OQKA 3OW2A 3L42A 2E3HA 3KFVA 1MUZA 2EGAA 3EAEA 4HT9A 3VU3C 2ABLA 1PM3A 1M1KR 1Q82R 2VUBA 5GAMh 2BIVA 2LQKA 4C5EA 4IUVA 5CO7A 4CC4B 4C92B 9ATCB 2HQXA 4HCZA 1ZBXA 1TS9A 3F70A 1FYNA 1V1CA 4AG1C 2P4RA 1QVGS 1UB4A 2V8JA 2YSQA 3FB9A 1KQ1A 2EW3A 2X35A 1QP2A 2RM4A 3CXCP 2RN8A 1MV3A 3A8OB 3DKMA 3JCMd 3RUXA 2KRNA 4LUEA 3PMTA 1VQ5Q 2OTLQ 3G71A 1K0XA 4EMKA 2EGEA 4M78D 3A5ZB 1VQOT 3EFOB 3M57A 2NUTA 1JO8A 4RKUE 1NYGA 2ZPIB 2HL5C 4KH0B 4JLGA 4ELZC 1T3LA 3L1AA 4XTVA 1YHQA 1VQ7T 4C8QB 1Y96B 2JTMA 1Q7YU 4F04B 5LJ3f 1GRIA 1VQ9A 1ZA2B 4N4HA 4BE1A 1AWXA 1D0ZA 1QLYA 2KQWA 2JUFA 4LUDA 2CT3A 1QVFP 5CKDA 2AHJB 1B34B 4IKFA 1I5OB 2W10A 2X3WD 2OAUA 2CZ7B 3OMGA 3VJPA 1QVGA 4BE2A 2LNVA 3OW2P 3S3NA 1RAFB 1WHHA 3TEEA 1GCPA 2P0PA 1W70A 2X9HA 3JCMX 1H3ZA 3RESA 1AWJA 2EPDA 5GAN3 1M8VA 4KH1B 4FYXB 1GBQA 3CCVA 4IIOA 2KR3A 1ABOA 3E9FA 3MP8A 2QQRA 1K4US 5LL6S 1AT1B 4J9IA 2HCKA 4M7AF 1S72T 3SEMA 3U23A 2AKKA 1BYMA 1UGRB 4JRPA 2K9GA 2B8AA 4M7DA 1K1ZA 3SDZA 1UEBA 1M4ZA 1PKTA 5KYNA 3CCJT 3QBYA 2PUOB 1OX9A 5KYXB 3OYBA 2AT1B 4RCBA 3MP6A 1WHJA 1SRMA 4R0KA 4C8QC 1YHQQ 1VQ5T 2O9SA 1M3BA 4C8QF 1Q81R 2DYIA 4A53A 1W2BS 4M77D 1YJ9A 3V7RA 4L5GA 1UUEA 1HJDA 3M58A 4QVZA 3JCMP 4XAXB 1WNLA 1UJYA 3JB9J 5GAOp 3HRUA 2LTOA 1SSHA 2RQTA 3TSWA 2RHYA 5GJWB 2FPEA 3QO3A 4F17A 1QWFA 2EGCA 1TSFA 2CZ6B 2YLBA 2CSQA 3ZBDA 2RO0A 2QTXA 4GLKA 5FWCA 3CCST 3JCMe 4F7UF 2ECZA 1G8XA 2OTLT 3SHWA 4J7FA 2MWOA 1YNZA 3JSCA 3UF4A 4M78E 4N4GA 2A0FB 1VQ8A 1QQJA 2R5AA 2HDAA 1YJNA 1YITT 3EGUA 2COWA 1YI2T 5I2SA 4QVDA 4J9GA 3V7CA 3OYKA 3C0CA 4FSSA 4PJOF 1LCKA 2GBQA 2A28A 1NYFA 1RI9A 1WI7A 2KRSA 4O6JA 2RQUA 3G1JA 1B07A 2VGMA 5EG2A 4J6XA 3L2WA 3OBYA 4FT4A 5GAOl 2YXYA 3HFNA 3LLRA 3LYIA 5DLQE 2QQ9A 2JTFA 1G3YA 4C0GA 1KD1C 2KEAA 2DE0X 3GLXA 4Z88A 1VQ9Q 4XU0A 3MCAB 4JJNK 2RI2A 2HBWA 4FW2A 1SHGA 3V8KA 2QA4A 1KD1R 4GLMA 1UHCA 4BE0A 3REBB 2DMOA 4M7AA 1E6GA 2QASA 3DB3A 2DO3A 3SWNA 4XU2A 2VKNA 1G2BA 2QDLA 3EG9B 3I5SA 4OMFB 1WA7A 2OTJT 2RQWA 2EYXA 3ER0A 1OX8A 1IGQA 3JCMV 5FRMA 4DEYA 3A8LB 4M75F 3VS4A 1UE9A 1ZA1B 3TVTA 3HPWA 4OGCA 2ZPBB 3GP8A 1VQNQ 2GTOA 2LMJA 1K8AU 2CYZB 2FPFA 2KNBB 4M77E 1IGUA 3CQTA 5GAN4 1RAGB 1E7OA 3G6ET 2YLCA 1AHJB 1D3BA 1M2OA 4M7DD 1I0CA 5L8RE 2M9UA 2JS0A 2K3YA 1VUBA 2XI9A 2X4YA 2RJDA 4C8QG 2LX7A 3NGPA 5I22A 3WXMB 5GAMd 5GAMf 3CC4Q 2XK0A 1QW1A 3HHTB 1NBEB 1YFNA 3OA6A 2C06A 1FWZA 2E41A 2QQAA 1YJWA 1VQ8Q 2EKHA 3P8BB 1ZHIA 2DJQA 1YJ9Q 3OMCA 2YRCA 2RI3A 1H3HA 3M0UA 1MMAA 2VASA 1IHWA 3M54A 5GAOm 3CCEA 2X3XD 2RH2A 3EG3A 1OEBA 5LJ5g 3EH2A 1VQOA 3LW5E 4RTZA 4PKCC 2EYQA 1K9AA 2XIDA 3LWIA 1HXDA 2EYZA 5CKBA 2K2VA 3JB9I 2XDBA 3PE0A 1QKXA 2XKOC 2F5TX 2X51A 3A1PA 1QP3A 2RK1A 5HK0A 2BZ8A 3NHNA 3L2QA 2NUPB 1M1GA 2W0ZA 1PHTA 4J8OA 2FPDA 3MJXA 2E10A 2JMAA 3CBPA 1K73R 1OU8A 2XG8D 4KULA 3R6OA 4CC2A 3QZ5B 1X6OA 2LC4A 2HEQA 1NJIR 3UA7A 2YRDA 3VS7A 2LT1A 3I55T 4A4HA 4KBMB 2DETA 4BY6C 3G7ZA 1K0SA 3VRYA 4OMQA 2WSFE 2MMPA 4ZGJB 1VYUA 4BUGA 1WIEA 1VQMA 3CCLA 2ZCFB 3JB9G 2GF7A 1M30A 1NLOC 4X34A 3JCMb 4OMOA 1GBRA 3RMSA 1R0BG 1VQ4A 4D8DA 3GIBA 1YIJQ 3QPHA 2X4WA 3S3MA 2L3PA 3MEVA 1FXXA 4PFPA 2RHIA 4QKUA 3FDRA 3OYLA 5GAN8 3L2ZA 4F7UB 4OGEA 3JB9H 1RLQC 3CD6Q 4IIMA 2KDSA 3PMIA 4LDYA 2HD0A 1YIJT 3NMZC 1U8RA 3NTIA 4PJJA 3E1SA 2XMFA 7AT1B 1D0XA 3VS3A 5KYUA 4M7AD 1D09B 2DM1A 4EMGA 1OULA 1BKBA 3CCSA 4PLLA 4ZTJA 3V7SA 2DNUA 2AZVA 5GAOr 5KYYA 4OB3B 1X2KA 2KE9A 2DILA 2KBTA 1NE8A 1N8RR 2L3SA 1Q86R 1PD0A 1KG1A 1WFWA 3G4ST 5KYWA 3OSVA 3CCEQ 2CS7A 2KT8A 5A0LA 3JAME 1UGPB 2XHCA 1M1FA 2FEIA 1N9SA 3CPWS 3OYEA 2JJ9A 2KMTA 2QQSA 4EMKB 1HK9A 4MZPA 3SFMA 1VYVA 2WSCE 3EGDA 3QDFA 4J9HA 1JXMA 1EFNA 5CK9A 1S1NA 4HCCA 4JS5A 1W4SA 1VIEA 3CC2Q 4C8QA 1VQPT 5IH2A 1PRMC 3CCQT 2DL4A 1SG5A 2RK2A 1NEBA 5KCOA 5DM7R 3PTAA 3M0TA 4E7HA 5FRNA 3I55A 1JRIA 1FMKA 3PFSA 3ASKA 1B34A 1NEGA 3CCLQ 1XTDA 2VXFA 3OYAA 2Y4YA 4LD9K 1VQ4T 2RJEA 3THKA 4XU1A 1A0NB 2D1XA 2ZGWA 3S6WA 4IUQA 1VQKA 5A0GA 1AVZC 1OU9A 1X75C 5CCAA 1VQ4Q 4M77A 3VUZA 2A3LA 2YWWA 2GGRA 3BFMA 1TWBA 2I0NA 1RAHB 1YHQT 4AFUC 3OYJA 1PNJA 5IHKA 3HTRA 3CCVQ 2GQVA 2QEXT 2P0KA 4OMPA 5J39A 4J6YA 3G6EQ 4C92D 2A37A 3JCMf 2FRYA 1M9SA 1PSEA 4PJOD 1V76A 2WACA 3ZL7C 4KRTA 4LD6A 2HKNA 3I5RA 4M7DB 4PJNA 1V29B 2QGGA 3NTHA 3NPFA 2HAXA 3CPWP 1NPRA 1N8RU 1VQMQ 2GQIA 2D6FA 1G5VA 4R56A 1AZGB 1KC8R 1UECA 2F2WA 3CC4T 2RD1A 3FEOA 4B9XA 1WJRA 2H8HA 4HCKA 3JCMW 1GXIE 2LQNA 2GFAA 1EX4A 3L2RA 2RHUA 4M7DG 2YT6A 2KXDA 4JRKA 1W6XA 1WZOA 2MIOA 3CXCS 1YIJA 1N6AA 4E7SA 3CCRA 1ZUUA 2I2LA 4EPCA 5C0MA 2DXBA 4M78F 4Q5WA 2EVRA 3OYGA 3CCUA 2ZPEB 2LCLA 2G6FX 3TREA 4OF1A 1VQLA 5KCHA 3I56A 2K5IA 1Y71A 1FMVA 2DYBA 2RNAA 1PC0A 5I11A 1YITQ 5FU7B 3OSSC 4HVVA 4C92E 2DKGA 2E6NA 2SRCA 2P4TA 3UPUA 4PJOE 2XDDA 1BIBA 4AFZC 2RF0A 4LDUA 5J26A 3OYCA 2X4JA 2L3RA 1PG5B 2JVVA 3OYMA 4C8QD 3MPUB 1NZ9A 2LNHB 1UTIA 4KGZB 1CKBA 4ESRA 3QKJA 3M53A 4J5YA 1PKSA 1VQKQ 2COYA 3Q1JA 1AD5A 2QI2A 1Q95G 1BB9A 2LRQA 4WCIA 1Y57A 1Z9QA 1YWOA 5FU6B 1OZ3A 1ZQ1A 4M75G 8AT1B 1IO6A 3HSBA 3RKXA 4VUBA 4BI4A 2ATCB 2F69A 1ZSZC 3URGA 3N5BB 4JRQA 1M1KC 4M7AG 4BB7A 2DL8A 3E2UA 2FG0A 1VQLT 2CP7A 3BDUA 3MHXA 4FYWB 2KSSA 3SWNC 4JS4A 2R5MA 2EQIA 2L89A 2RPNA 4JZ4A 4J83A 4ZN3A 1YJ9T 3RNJA 1M2VB 1MHNA 2ZPHB 5CQYA 2MOXA 1UDLA 2VWFA 4ORZA 2PUKB 1VQ5A 5DY9A 4OVAA 4JJDA 3L2VA 2LZ6B 4M78A 5I2MA 1GFDA 2QA4Q 4PJOB 2F1LA 1D1BA 3OYYA 1P92A 3CC4A 1AWOA 2FO0A 1HYOA 3JCMc 1LPLA 1XOVA 2QYZA 1RAAB 4J9DA 4JJBA 4E2FB 1ZSZA 2KYMA 4X9CA 4M7DF 1I1JA 2J06A 3MEUA 1OPLA 1KQSA 5CKHA 3G6EA 1WXTA 4C92C 3EHRA 5FU6C 1NLPC 3SD4A 5IN1A 4KUDK 3JCMh 3C12A 1GCQA 3MEWA 2VV5A 1XNIA 2DL3A 1KC8C 4F16A 1RUWA 2CZ0B 2K4YA 2FRWA 2LX9A 1XQHA 2LQ8A 1N27A 3QUIA 4HT8A 5LJ3j 3VS2A 1E6HA 1G83A 3TU4K 1AZEA 1BI2A 3I35A 3KBGA 4DBRA 3OS0A 1VQ9T 2QA4T 2DD5A 1PD1A 5D6YA 3QWYA 2YHTA 1Q7YC 1JQQA 2RJFA 1JU5C 4J7IA 4B9WA 5GMKe 3CCUQ 1MNEA 3H9NA 2OTJQ 4IURA 3LX7A 2JXBA 2PNIA 2ROTA 2QGFB 3QZ9B 2EJ9A 3P8DA 1TUGB 3J80E 4AT1B 3QHSA 5GAMe 4OB1B 4XTXA 3RKYA 3V8JA 2K6DA 3OY9A 4D6WA 4RTWA 2LVMA 4K11A 3UATA 1K73U 2YDLA 2CT4A 4EIKA 2E4HA 3M4GA 4FW1A 1ZBJA 4M75D 1BI3A 3INZA 2K79A 1SHFA 2XU8A 1WX6A 1K8AR 1BCOA 5A2QE 1WLPB 1JJ2S 1CKAA 5LJ5j 2H3JA 2MCNA 3NTKA 2HSPA 1VQPA 2YUNA 2F5KA 3CCLT 3X25B 1JB0E 5FLXE 4ME7A 4PFZA 4QQ6A 1Q86U 1KQSS 1X27A 5FW9A 1K9MU 4M75C 1U1SA 4AFSC 2DJZA 2HQHA 2V8KA 3MP1A 2E3IA 1VQOQ 3VKIA 1OI1A 2EKOA 2P0QA 2DPPB 3VV0A 3H6ZA 4RTXA 1N9RA 3VS6A 4Y28E 5DLOA 1IB8A 1WQ7A 5FROA 2COZA 3BW1A 3OW2S 1SF9A 1XJWB 3EFOA 4CC3A 2JNGA 2Y4XA 1K76A 2QQBA 3HL8A 4XU3A 5LJ5f 3IQLA 3RERA 3BE3A 1RADB 2RI5A 2K2MA 2DXUA 4N0AC 4KGXB 4V2SA 2PQWA 2WSEE 1PCXA 1WXBA 2EAYA 3DLMA 4M75A 2MF2A 1M5Q1 2KYBA 4QQGA 2NWMA 4JZ3A 2JT4A 2DBKA 1OYXA 3CCMT 4CC7A 2C0TA 3CC7A 4QVCA 4F7UE 3OYHA 3PIPA 2JN0A 5GAOq 2NUTB 4DOWA 3FJ5A 4JLIA 2KROA 3RMQA 2EWNA 1C0MA 3VS1A 1FX7A 3PT9A 1BI0A 2EYYA 5KH6A 2OTJA 4IUTA 5GJVB 4C5GA 3RR6A 1YI2A 4N0AA 5I21A 1KQSP 2QG9B 3EH1A 1I8FA 2HKQB 4RG8A 4IUUA 4R55A 2E6ZA 1M90C 4XTYA 1HD3A 3EHQA 2CH4W 1QCNA 3PVQA 3QJYA 3JCMQ 2AZSA 1VQ8T 3A98A 3X26B 1NPPA 1KK7A 1M90R 2LCCA 2PTKA 4PFOA 1UFFA 3GOXA 4AG2C 4X1VA 2RHXA 5IXFA 3CBOA 1LOJA 1UG1A 5GAN6 4JUVA 1Q81C 4M78C 3I56T 2EYWA 1YJWT 2DTOA 5CKFA 2SEMA 1ZSGA 3M0SA 5GAMg 1NG2A 2F2VA 4PK4A 2KGTA 4RMOA 2O01E 1ZUKA 3CMEQ 3EGXA 4JPBW 4QW2A 5M9OA 2CP3A 1LNXA 4GBQA 5GMKi 1WHGA 4ZN1A 3HKSA 2DXTA 2FZCB 1M90U 2ENMA 5GMKl 2O4XB 3T9NA 1QKWA 2DBMA 4C0DC 1VQLQ 3CC2A 4M75E 4HVWA 3VYGA 4BDYA 1U5SA 1I81A 3LWHA 2OX7A 3M59A 3CCQQ 4BI8B 2OTLA 1IHVA 1X6GA 1I5LA 2CUDA 1G3WA 2NYSA 4PJLA 2KI7A 4QT7A 2CP2A 2DX1A 4FM4B 4M4ZA 1M3CA 4OB0B
chains in the Genus database with same CATH topology
2HDAA 2DYBA 2V1QA 2RNAA 2JTEA 4Z8AA 4J9EA 3EGUA 5I11A 1X2QA 4HVVA 1X69A 1NM7A 2SRCA 3VRZA 2M51A 1SRLA 4J9GA 4AFQC 4AFZC 1PWTA 2OI3A 2RF0A 3C0CA 4FSSA 1LCKA 2GBQA 1VYTA 2ESWA 2A28A 1NYFA 5FWBA 1RI9A 1WI7A 2KRSA 2DF6A 2V1RA 1T3SA 1M27C 2RQUA 2DL7A 2DVJA 2LNHB 1B07A 1UTIA 3H41A 3TSZA 1CKBA 4RTTA 1QWEA 3VS5A 4ESRA 1PRLC 1PKSA 2JS2A 1WDXA 2CUBA 1SPKA 2ROLA 1AD5A 1YN8A 1BB9A 4WCIA 4LNPA 1Y57A 1Z9QA 1YWOA 2KEAA 3JV3A 2DE0X 1BBZA 2LJ3A 1H8KA 2ED1A 4Z88A 1UJ0A 1IO6A 2LCSA 2EBPA 2HBWA 1SHGA 3LH5A 3QWXX 4GLMA 1UHCA 3REBB 2DMOA 2DL8A 1VA7A 2FG0A 1E6GA 1HSQA 1X43A 1J3TA 2VKNA 4LN2A 1G2BA 2QDLA 2KRMA 3I5SA 1WA7A 4OMMA 2JM8A 2EQIA 2O88A 2RPNA 4JZ4A 1AEYA 2GTJA 3RNJA 2RQWA 2EYXA 2PZ1A 2RQVA 3REAB 4HVUA 2MOXA 1UDLA 2VWFA 4ORZA 4DEYA 3VS4A 2B86A 1UE9A 4JJDA 1KIKA 2LZ6B 2D8HA 3TVTA 1MV0B 1GFDA 2GTOA 2LMJA 2DRMA 4OMLA 2FPFA 2KNBB 4OMNA 1AWOA 4J9BA 3CQTA 2FO0A 1E7OA 3H0IA 1XOVA 1I0CA 2J6FA 4J9DA 2D8JA 1ARKA 1CSKA 4JJBA 2JS0A 2D0NA 1GL5A 1UHFA 2KYMA 1WXUA 2RMOA 2LX7A 3NGPA 5IXBA 1I1JA 2J06A 2J6OA 4Z89A 5I22A 1OPLA 1WXTA 1M3AA 4DEXA 4E6RA 3EHRA 2L3QA 1NLPC 5ECAA 2EKHA 2L0AA 2DJQA 3UA6A 3H0HA 1GCQA 2KT1A 1H3HA 3M0UA 2DL3A 4ZNXA 4F16A 5HCKA 1RUWA 2CREA 2X3XD 3EG3A 1OEBA 1Z9ZA 2C0OA 2FRWA 2VVKA 1M8MA 1AOJA 4RUGA 1ABQA 1WYXA 4RTZA 1K9AA 2ED0A 2EYZA 3VS2A 1E6HA 1G83A 1AZEA 3I35A 4LE9A 2GNCA 3PE0A 1QKXA 1N5ZA 2BZYA 3QWYA 1T0JA 1JQQA 2BZ8A 3NHNA 2E5KA 1QCFA 1ZUYA 1JU5C 2W0ZA 1PHTA 2O2OA 2FPDA 2YUQA 2JMAA 3I9QA 2JXBA 4CC2A 2PNIA 2ROTA 2NUZA 4D8KA 2HEQA 1TUDA 2KXCA 2J05A 1ZLMA 3UA7A 3M0PA 2F2XA 3VS7A 1BU1A 1UGVA 2K6DA 3H0FA 4RTWA 4K11A 3UATA 2YDLA 2CT4A 1K0SA 3VRYA 4OMQA 1RLPC 4EIKA 1B3QA 3GBQA 2LQWA 1ZBJA 1VYUA 1WIEA 2RQRA 2K79A 1SHFA 1WX6A 3RBBB 1M30A 1WLPB 1CKAA 2C0IA 1NLOC 2MCNA 1OV3A 4OMOA 2CDTA 2HSPA 1YCSB 1GBRA 2YUNA 4D8DA 2YUPA 1X27A 5FW9A 2L3PA 1YWPA 2LJ1A 4AFSC 1U06A 5L23A 1OOTA 1JXOA 3KFVA 1MUZA 2EGAA 1RLQC 1YP5A 2ABLA 4JJCA 4IIMA 3O5ZA 3VS0A 3NMZC 2DA9A 4RTXA 3VS6A 4CC4B 2XMFA 2J6KA 1JEGA 3VS3A 2DM1A 1FYNA 1V1CA 4AG1C 2P4RA 2YSQA 4CC3A 1K76A 2EW3A 2DNUA 2AZVA 2RN8A 3IQLA 1MV3A 2K2MA 1X2KA 2KE9A 2DILA 2KBTA 2KRNA 3M0RA 4LUEA 3R6NA 2L3SA 1K0XA 1WFWA 4J9CA 2EGEA 1WXBA 3EG0A 1JO8A 2A36A 1NYGA 2KT8A 2KYBA 2NWMA 4JZ3A 2JT4A 1T3LA 2DBKA 5IHNA 2FEIA 4CC7A 2C0TA 2DRKA 1GRIA 2IIMA 1VYVA 5IHIA 3FJ5A 2J7IA 2KROA 1AWXA 4J9HA 1JXMA 1EFNA 1QLYA 4LUDA 3VS1A 2CT3A 1S1NA 5EC7A 2EYYA 1Y0MA 2K3BA 2W10A 2X3WD 5GJVB 2OAWA 4RTYA 1GCPA 5IH2A 1W70A 2CSIA 2JM9A 1PRMC 2DL4A 1NEBA 1AWJA 2LJ0A 2EPDA 3M0TA 1GBQA 1H92A 1FMKA 1HD3A 3EHQA 4IIOA 1NEGA 1ABOA 2K7AA 2KR3A 2CH4W 1X6BA 3ULRB 1K4US 1SEMA 2AK5A 4HXJA 3PVQA 1I07A 1KJWA 2AZSA 3THKA 1A0NB 2D1XA 4J9IA 3A98A 2HCKA 4RTVA 2O31A 2YUOA 3SEMA 3U23A 2PTKA 1AVZC 1UFFA 2AKKA 4AG2C 4X1VA 2JW4A 1GCQC 5IXFA 2M0YA 1BK2A 2K9GA 1KSWA 2AKLA 1K1ZA 1UG1A 2GGRA 2I0NA 4J9FA 4AFUC 2BZXA 1TUCA 1PNJA 1PKTA 2CH4A 5IHKA 2EYWA 2SEMA 4OMPA 1ZSGA 1U3OA 1T0HA 3M0SA 1NG2A 2F2VA 2A37A 2FRYA 1SRMA 2KGTA 4F14A 4R0KA 3ZL7C 4KRTA 3I5RA 1ZUKA 2O9SA 1M3BA 4JPBW 2OJ2A 2A08A 3NPFA 4GBQA 4Y92A 2LP5A 1UUEA 1HJDA 3EG2A 3EG1A 3M0QA 2L2PA 4RTUA 1W1FA 2GQIA 1UJYA 1AZGB 1UECA 3PVLA 2ENMA 2F2WA 1SSHA 2RQTA 3TSWA 1GFCA 4HCKA 2H8HA 5GJWB 2FPEA 2LQNA 1QKWA 2DBMA 1QWFA 1ZX6A 2EGCA 2O9VA 4A63B 2CSQA 4F17A 1AWWA 1KFZA 4HVWA 1U5SA 2YT6A 2KXDA 5FWCA 1W6XA 2MIOA 2JMCA 1X6GA 2CUDA 2ECZA 1ZUUA 2DLPA 4QT7A 3SHWA 2BTTA 2DL5A 2DX1A 2EVRA 1OPKA 1TG0A 4M4ZA 1YNZA 2G6FX 1M3CA 3UF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDA A;  2DYB A;  2V1Q A;  2RNA A;  2JTE A;  4Z8A A;  4J9E A;  3EGU A;  5I11 A;  1X2Q A;  4HVV A;  1X69 A;  1NM7 A;  2SRC A;  3VRZ A;  2M51 A;  1SRL A;  4J9G A;  4AFQ C;  4AFZ C;  1PWT A;  2OI3 A;  2RF0 A;  3C0C A;  4FSS A;  1LCK A;  2GBQ A;  1VYT A;  2ESW A;  2A28 A;  1NYF A;  5FWB A;  1RI9 A;  1WI7 A;  2KRS A;  2DF6 A;  2V1R A;  1T3S A;  1M27 C;  2RQU A;  2DL7 A;  2DVJ A;  2LNH B;  1B07 A;  1UTI A;  3H41 A;  3TSZ A;  1CKB A;  4RTT A;  1QWE A;  3VS5 A;  4ESR A;  1PRL C;  1PKS A;  2JS2 A;  1WDX A;  2CUB A;  1SPK A;  2ROL A;  1AD5 A;  1YN8 A;  1BB9 A;  4WCI A;  4LNP A;  1Y57 A;  1Z9Q A;  1YWO A;  2KEA A;  3JV3 A;  2DE0 X;  1BBZ A;  2LJ3 A;  1H8K A;  2ED1 A;  4Z88 A;  1UJ0 A;  1IO6 A;  2LCS A;  2EBP A;  2HBW A;  1SHG A;  3LH5 A;  3QWX X;  4GLM A;  1UHC A;  3REB B;  2DMO A;  2DL8 A;  1VA7 A;  2FG0 A;  1E6G A;  1HSQ A;  1X43 A;  1J3T A;  2VKN A;  4LN2 A;  1G2B A;  2QDL A;  2KRM A;  3I5S A;  1WA7 A;  4OMM A;  2JM8 A;  2EQI A;  2O88 A;  2RPN A;  4JZ4 A;  1AEY A;  2GTJ A;  3RNJ A;  2RQW A;  2EYX A;  2PZ1 A;  2RQV A;  3REA B;  4HVU A;  2MOX A;  1UDL A;  2VWF A;  4ORZ A;  4DEY A;  3VS4 A;  2B86 A;  1UE9 A;  4JJD A;  1KIK A;  2LZ6 B;  2D8H A;  3TVT A;  1MV0 B;  1GFD A;  2GTO A;  2LMJ A;  2DRM A;  4OML A;  2FPF A;  2KNB B;  4OMN A;  1AWO A;  4J9B A;  3CQT A;  2FO0 A;  1E7O A;  3H0I A;  1XOV A;  1I0C A;  2J6F A;  4J9D A;  2D8J A;  1ARK A;  1CSK A;  4JJB A;  2JS0 A;  2D0N A;  1GL5 A;  1UHF A;  2KYM A;  1WXU A;  2RMO A;  2LX7 A;  3NGP A;  5IXB A;  1I1J A;  2J06 A;  2J6O A;  4Z89 A;  5I22 A;  1OPL A;  1WXT A;  1M3A A;  4DEX A;  4E6R A;  3EHR A;  2L3Q A;  1NLP C;  5ECA A;  2EKH A;  2L0A A;  2DJQ A;  3UA6 A;  3H0H A;  1GCQ A;  2KT1 A;  1H3H A;  3M0U A;  2DL3 A;  4ZNX A;  4F16 A;  5HCK A;  1RUW A;  2CRE A;  2X3X D;  3EG3 A;  1OEB A;  1Z9Z A;  2C0O A;  2FRW A;  2VVK A;  1M8M A;  1AOJ A;  4RUG A;  1ABQ A;  1WYX A;  4RTZ A;  1K9A A;  2ED0 A;  2EYZ A;  3VS2 A;  1E6H A;  1G83 A;  1AZE A;  3I35 A;  4LE9 A;  2GNC A;  3PE0 A;  1QKX A;  1N5Z A;  2BZY A;  3QWY A;  1T0J A;  1JQQ A;  2BZ8 A;  3NHN A;  2E5K A;  1QCF A;  1ZUY A;  1JU5 C;  2W0Z A;  1PHT A;  2O2O A;  2FPD A;  2YUQ A;  2JMA A;  3I9Q A;  2JXB A;  4CC2 A;  2PNI A;  2ROT A;  2NUZ A;  4D8K A;  2HEQ A;  1TUD A;  2KXC A;  2J05 A;  1ZLM A;  3UA7 A;  3M0P A;  2F2X A;  3VS7 A;  1BU1 A;  1UGV A;  2K6D A;  3H0F A;  4RTW A;  4K11 A;  3UAT A;  2YDL A;  2CT4 A;  1K0S A;  3VRY A;  4OMQ A;  1RLP C;  4EIK A;  1B3Q A;  3GBQ A;  2LQW A;  1ZBJ A;  1VYU A;  1WIE A;  2RQR A;  2K79 A;  1SHF A;  1WX6 A;  3RBB B;  1M30 A;  1WLP B;  1CKA A;  2C0I A;  1NLO C;  2MCN A;  1OV3 A;  4OMO A;  2CDT A;  2HSP A;  1YCS B;  1GBR A;  2YUN A;  4D8D A;  2YUP A;  1X27 A;  5FW9 A;  2L3P A;  1YWP A;  2LJ1 A;  4AFS C;  1U06 A;  5L23 A;  1OOT A;  1JXO A;  3KFV A;  1MUZ A;  2EGA A;  1RLQ C;  1YP5 A;  2ABL A;  4JJC A;  4IIM A;  3O5Z A;  3VS0 A;  3NMZ C;  2DA9 A;  4RTX A;  3VS6 A;  4CC4 B;  2XMF A;  2J6K A;  1JEG A;  3VS3 A;  2DM1 A;  1FYN A;  1V1C A;  4AG1 C;  2P4R A;  2YSQ A;  4CC3 A;  1K76 A;  2EW3 A;  2DNU A;  2AZV A;  2RN8 A;  3IQL A;  1MV3 A;  2K2M A;  1X2K A;  2KE9 A;  2DIL A;  2KBT A;  2KRN A;  3M0R A;  4LUE A;  3R6N A;  2L3S A;  1K0X A;  1WFW A;  4J9C A;  2EGE A;  1WXB A;  3EG0 A;  1JO8 A;  2A36 A;  1NYG A;  2KT8 A;  2KYB A;  2NWM A;  4JZ3 A;  2JT4 A;  1T3L A;  2DBK A;  5IHN A;  2FEI A;  4CC7 A;  2C0T A;  2DRK A;  1GRI A;  2IIM A;  1VYV A;  5IHI A;  3FJ5 A;  2J7I A;  2KRO A;  1AWX A;  4J9H A;  1JXM A;  1EFN A;  1QLY A;  4LUD A;  3VS1 A;  2CT3 A;  1S1N A;  5EC7 A;  2EYY A;  1Y0M A;  2K3B A;  2W10 A;  2X3W D;  5GJV B;  2OAW A;  4RTY A;  1GCP A;  5IH2 A;  1W70 A;  2CSI A;  2JM9 A;  1PRM C;  2DL4 A;  1NEB A;  1AWJ A;  2LJ0 A;  2EPD A;  3M0T A;  1GBQ A;  1H92 A;  1FMK A;  1HD3 A;  3EHQ A;  4IIO A;  1NEG A;  1ABO A;  2K7A A;  2KR3 A;  2CH4 W;  1X6B A;  3ULR B;  1K4U S;  1SEM A;  2AK5 A;  4HXJ A;  3PVQ A;  1I07 A;  1KJW A;  2AZS A;  3THK A;  1A0N B;  2D1X A;  4J9I A;  3A98 A;  2HCK A;  4RTV A;  2O31 A;  2YUO A;  3SEM A;  3U23 A;  2PTK A;  1AVZ C;  1UFF A;  2AKK A;  4AG2 C;  4X1V A;  2JW4 A;  1GCQ C;  5IXF A;  2M0Y A;  1BK2 A;  2K9G A;  1KSW A;  2AKL A;  1K1Z A;  1UG1 A;  2GGR A;  2I0N A;  4J9F A;  4AFU C;  2BZX A;  1TUC A;  1PNJ A;  1PKT A;  2CH4 A;  5IHK A;  2EYW A;  2SEM A;  4OMP A;  1ZSG A;  1U3O A;  1T0H A;  3M0S A;  1NG2 A;  2F2V A;  2A37 A;  2FRY A;  1SRM A;  2KGT A;  4F14 A;  4R0K A;  3ZL7 C;  4KRT A;  3I5R A;  1ZUK A;  2O9S A;  1M3B A;  4JPB W;  2OJ2 A;  2A08 A;  3NPF A;  4GBQ A;  4Y92 A;  2LP5 A;  1UUE A;  1HJD A;  3EG2 A;  3EG1 A;  3M0Q A;  2L2P A;  4RTU A;  1W1F A;  2GQI A;  1UJY A;  1AZG B;  1UEC A;  3PVL A;  2ENM A;  2F2W A;  1SSH A;  2RQT A;  3TSW A;  1GFC A;  4HCK A;  2H8H A;  5GJW B;  2FPE A;  2LQN A;  1QKW A;  2DBM A;  1QWF A;  1ZX6 A;  2EGC A;  2O9V A;  4A63 B;  2CSQ A;  4F17 A;  1AWW A;  1KFZ A;  4HVW A;  1U5S A;  2YT6 A;  2KXD A;  5FWC A;  1W6X A;  2MIO A;  2JMC A;  1X6G A;  2CUD A;  2ECZ A;  1ZUU A;  2DLP A;  4QT7 A;  3SHW A;  2BTT A;  2DL5 A;  2DX1 A;  2EVR A;  1OPK A;  1TG0 A;  4M4Z A;  1YNZ A;  2G6F X;  1M3C A;  3UF4 A; 
#chains in the Genus database with same CATH topology
 5HY6 A;  2EJF A;  2JTE A;  4Z8A A;  4BI3 A;  1K73 C;  4J9E A;  1YJN T;  3CMA Q;  1X2Q A;  4DBF A;  1X69 A;  4FYV B;  2IG0 A;  3MEA A;  4XTU A;  2V26 A;  1NJI C;  1EZZ B;  3CCJ A;  1QVF A;  1SRL A;  3E19 A;  1PWT A;  3P8H A;  2FZK B;  3TCJ A;  2ESW A;  2EQK A;  1IXD A;  4LDX A;  1O9S A;  2V1R A;  1T3S A;  4HA8 A;  5D7U A;  1M27 C;  1VIF A;  4M77 C;  1B7T A;  1FMW A;  3UT1 A;  3CPF A;  3J7A F;  4XK8 E;  3VUB A;  3J81 E;  1QWE A;  3V8L A;  3VS5 A;  1PRL C;  4YTL A;  4ZGE B;  3PIO A;  1WDX A;  1SPK A;  1VQK T;  2K57 A;  5J3B A;  5GAN 5;  4LNP A;  4II1 A;  4PJO G;  2IVW A;  3JV3 A;  1F1B B;  2QXF A;  4FT2 A;  3OS1 A;  3EG9 A;  1UJ0 A;  3CPW A;  2EFI A;  3CME T;  3PGG A;  2KK4 A;  2EBP A;  1QCO A;  3CCE T;  2K5F A;  3CC7 Q;  3OBW A;  3CCS Q;  4OB2 B;  3CC7 T;  1M1K U;  3QWX X;  1Q82 U;  4B6M A;  3X24 B;  1VA7 A;  4FYY B;  4BDZ A;  1WQW A;  1HSQ A;  4BD3 A;  1J3T A;  4J6W A;  4MZT A;  3FJP A;  2KRM A;  5HKC A;  2PU9 B;  4OMM A;  3FLG A;  4AMC A;  1YI2 Q;  1AEY A;  3REA B;  2RQV A;  3FRN A;  4HVU A;  2FYK A;  1S72 Q;  2FVU A;  5GAN h;  4ELY C;  3AT1 B;  3RKW A;  4PLI A;  3OS5 A;  2FB7 A;  1Q86 C;  5GAN 7;  2DRM A;  2IPO B;  4OMN A;  4E7L A;  3LGL A;  1WJS A;  2VXE A;  5LJ5 e;  2J6F A;  2D8J A;  1CSK A;  2D0N A;  2CKK A;  1GL5 A;  3QYG B;  1UHF A;  2DEQ A;  5GMK h;  1ACM B;  3S3O A;  2VC8 A;  5IXB A;  3KXT A;  3OYF A;  1EIF A;  1YJN Q;  5KE2 A;  1Q81 U;  1VQM T;  1M3A A;  4XQ3 A;  1D3B B;  2EIF A;  2LDM A;  5GAN g;  4DA4 A;  2L0A A;  3JRZ A;  1ZSZ B;  1O75 A;  2EQM A;  3CME A;  4ZNX A;  4DBQ A;  3QII A;  4FU6 A;  1MGQ A;  5HCK A;  2V8I A;  4WTO B;  2VVK A;  1AOJ A;  4RUG A;  2RHZ A;  2PVG B;  2GCX A;  1MMN A;  1WYX A;  2NUP A;  4TVR A;  2FHD A;  4C0Z A;  1G3S A;  2DK3 A;  2ED0 A;  3CBM A;  2KY9 A;  4LE9 A;  1D0Y A;  2GNC A;  3H8Z A;  6AT1 B;  1N5Z A;  1T0J A;  3QYH B;  2EQU A;  3M56 A;  3CXC A;  4E47 A;  2DXC A;  2O2O A;  3A8G B;  2MPX C;  2E5Q A;  3JB9 F;  4FCY A;  2YUQ A;  2XIC A;  3ZFJ A;  2ZZD A;  5IAY A;  2NUZ A;  2RB6 A;  3SB2 A;  1TUD A;  2J05 A;  1ZLM A;  4M7A E;  2F2X A;  1TXQ A;  4KT0 E;  2JOY A;  3NFC A;  1BU1 A;  3QXE B;  1KHC A;  1UGV A;  3H0F A;  3CCJ Q;  1WHL A;  1JJ2 P;  1VQ7 A;  8ATC B;  4C5H A;  2VB6 A;  1WJQ A;  4MDW A;  5GMK j;  3CMA A;  1RLP C;  1B3Q A;  2MAM A;  3GBQ A;  4ZGD B;  1WHM A;  4M77 G;  2Z0W A;  4PNO A;  5D6W A;  1VOM A;  2YRV A;  1Y7X A;  2C0I A;  1SKU B;  1RAB B;  2CDT A;  1YCS B;  2MI6 A;  3A8H B;  5CIU A;  4F7U A;  3CCM Q;  4C8Q E;  4XTW A;  3DB4 A;  3OYN A;  3FIF A;  1YWP A;  1U06 A;  4C92 A;  1W2B P;  1VQN A;  5KYU B;  2DVE A;  5L23 A;  2CZ1 B;  2LT4 A;  3G4S Q;  1OOT A;  2GFU A;  1JXO A;  1VQP Q;  1TH7 A;  4M7A C;  4FL6 A;  1YP5 A;  4MZM A;  2CP0 A;  4JJC A;  3LGF A;  1WHK A;  3LH0 A;  3O5Z A;  3VS0 A;  4EMH A;  2DA9 A;  5KYY B;  4A4E A;  3ZEH A;  1R8O B;  2CP6 A;  2J6K A;  1JEG A;  5LJ3 h;  4BAC A;  3OYD A;  1N8R C;  3GNF B;  3RIR A;  5KYW B;  1D1C A;  4A4F A;  4X9D A;  1MMG A;  5GAN j;  4FSX A;  1IRE B;  4CI0 C;  3M0R A;  3R6N A;  1S72 A;  4FIB A;  3M5A A;  1Y96 A;  4J9C A;  4IUP A;  4ZTF A;  3BY7 A;  3EG0 A;  2A36 A;  1BCM A;  5LJ3 d;  4O5V A;  3I56 Q;  3X28 B;  3CEY A;  4LDV A;  5IHN A;  2DTI A;  3QG1 A;  2MYS A;  2QTV A;  4ANJ A;  1I4K 1;  1H64 1;  3OYI A;  2DRK A;  4C92 G;  2IIM A;  4M75 B;  5IHI A;  3FC3 A;  3OS2 A;  2PVD B;  2J7I A;  2QAZ A;  2XDP A;  4E7Z A;  2DZ9 A;  2L8D A;  4Y91 A;  2RJC A;  1YBY A;  5FU7 C;  2DER A;  3KUF A;  5EC7 A;  1RAC B;  3M9Q A;  4A4K A;  1Y0M A;  2K3B A;  4C0D B;  2ZPG B;  5LJ3 e;  3MO8 A;  2OAW A;  4RTY A;  2HQE A;  5GAN d;  5GAN f;  3O8V A;  2CSI A;  2JM9 A;  4EMK C;  3CD6 A;  4BY6 B;  3X20 B;  3EGD B;  2LJ0 A;  3G71 T;  4XTZ A;  4E7J A;  2HL3 A;  1IRX A;  3C95 A;  1QVF S;  1H92 A;  1G3T A;  5LJ5 d;  3GF5 A;  2K7A A;  1X6B A;  2ZPF B;  3ULR B;  1SEM A;  1QVP A;  2AK5 A;  4HXJ A;  3CMA T;  2EJG A;  1I07 A;  1KJW A;  2ZAE A;  3CCU T;  4RTV A;  1K9M R;  2O31 A;  2YUO A;  5KYX A;  2D0Q B;  2JW4 A;  5IT9 E;  1GCQ C;  2M0Y A;  1BK2 A;  1KSW A;  2AKL A;  1JBM A;  4C5I A;  3CCM A;  4J9F A;  3D7S B;  1K9M C;  2A7Y A;  1TUC A;  2BZX A;  2CH4 A;  2K5L A;  1UGQ B;  3G71 Q;  1BIA A;  4LDW A;  1U3O A;  1T0H A;  4E7K A;  4M77 B;  2QDY B;  3ME9 A;  4F14 A;  3VYH B;  5CR2 A;  4M77 F;  2M16 A;  1RAE B;  2A08 A;  2OJ2 A;  2M0O A;  1PSF A;  1DJ7 B;  2DTH A;  4Y92 A;  2LP5 A;  3EG2 A;  2E12 A;  3PNW C;  3EG1 A;  3M0Q A;  2L2P A;  4RTU A;  4C92 F;  1W1F A;  1VQ6 Q;  5CVI A;  2HZY A;  1VQ7 Q;  3PVL A;  3EGX B;  2Y90 A;  4LXC A;  1GFC A;  5CAI A;  2HBP A;  5CQX A;  1ZX6 A;  2O9V A;  4A63 B;  1AWW A;  1KFZ A;  3RDV A;  3CD6 T;  1JJ2 A;  3HRS A;  2VYT A;  4MMK A;  1WGS A;  2VGN A;  4GY5 A;  2HMA A;  1YCY A;  3M55 A;  2DEU A;  2JMC A;  2DLP A;  3HRT A;  2CGH A;  2BTT A;  2DL5 A;  1OPK A;  1TG0 A;  1WPY A;  2O4X A;  2PVO B;  3OQ5 A;  5GAM j;  2V1Q A;  1Y07 A;  3JCM J;  4ATO A;  3QDR B;  2KAF A;  4C0F A;  3DLL A;  1X01 A;  1NJI U;  1NM7 A;  4PJM A;  3VRZ A;  2M51 A;  3CCQ A;  3M4Y A;  2KVQ G;  2FZG B;  4AFQ C;  2OI3 A;  1VYT A;  5FWB A;  2DF6 A;  1LJO A;  3I55 Q;  2DL7 A;  2DVJ A;  5D6X A;  5GAN e;  1IZ6 A;  1K8A C;  3H41 A;  3TSZ A;  4RTT A;  2DD4 A;  4NS5 A;  2DZC A;  3TQ7 P;  2M1H A;  5LJ3 g;  2JS2 A;  2FL7 A;  3OB9 A;  2CUB A;  2BE9 B;  2ROL A;  4A54 A;  1YN8 A;  1RAI B;  4Z02 A;  1KD1 U;  4M7A B;  4CRI A;  1BBZ A;  4HKE A;  1C1A A;  2LJ3 A;  1H8K A;  2ED1 A;  3SWN B;  4JRI A;  5CKE A;  1W2B A;  3WVE B;  3HP9 A;  2LCS A;  2DIG A;  2CP5 A;  3LH5 A;  1M2V A;  5C6S A;  1D1A A;  1OZ2 A;  4P5N A;  1Q82 C;  1C6V X;  2BKD N;  1X43 A;  3HFO A;  4A4G A;  2E1H A;  4M78 B;  2DAQ A;  4LN2 A;  5AT1 B;  4MDX A;  2K3X A;  4PJO A;  2E64 A;  2JZ2 A;  2JM8 A;  5AYF A;  2O88 A;  2GTJ A;  1VQ6 T;  2PZ1 A;  3JCM g;  1LVK A;  1VQ6 A;  2P84 A;  1R77 A;  1QMC A;  2B86 A;  2AIR B;  1KIK A;  2D8H A;  3EFR A;  1MV0 B;  1MMD A;  2L5Q A;  4OML A;  1KHI A;  4HCB A;  4J9B A;  1SSF A;  4M78 G;  4RCC A;  3H0I A;  1R0C B;  2BUD A;  3L2U A;  4F7U G;  5GAN 2;  3CCR Q;  1YJW Q;  1ARK A;  3QJ6 A;  3AHU A;  1WXU A;  2RMO A;  4NL3 A;  3UWN A;  3CC2 T;  2R57 A;  2J6O A;  4Z89 A;  3BDL A;  1UGS B;  3EFS A;  1U1T A;  4UC4 A;  4DEX A;  4E6R A;  4L6V 5;  2L3Q A;  5ECA A;  1YIT A;  2H3E B;  2D9T A;  4EDU A;  3UA6 A;  3H0H A;  2KT1 A;  2MWP A;  2RA2 A;  3C94 A;  2XD0 A;  1KC8 U;  1RL2 A;  2CRE A;  4PL6 A;  1Z9Z A;  2C0O A;  3CCR T;  3G4S A;  1M8M A;  1ABQ A;  2G3R A;  3A8M B;  2NLU A;  2QEX Q;  4NOY A;  2E70 A;  5GAO n;  4OP0 A;  1VQN T;  4KGV B;  4M7D E;  4E7I A;  5HK3 A;  1KQ2 A;  2BZY A;  5LJ5 h;  1QVG P;  2E5K A;  1QCF A;  1ZUY A;  2QK0 A;  3QSU A;  4NL2 A;  5KE3 A;  3I9Q A;  3GPL A;  3JB9 D;  2HNI A;  3E9G A;  4D8K A;  2MK5 A;  1RI0 A;  2R58 A;  1MND A;  4L59 A;  2HSE B;  1Q7Y R;  2KXC A;  3WVD B;  3M0P A;  3C4S A;  3GNG A;  5A0D A;  3UDC A;  4DBH A;  3CCV T;  2X4X A;  2DFU A;  4KUI A;  1BI1 A;  4N4I A;  3MET A;  4RG2 A;  2LQW A;  2M02 A;  2RQR A;  3MKD A;  4QQD A;  4DQ2 A;  5GMK m;  4MML A;  3RBB B;  1TOV A;  1OV3 A;  4JDS A;  4DOV A;  1TTH B;  1TU0 B;  2BE7 D;  4PJO C;  2YUP A;  2E65 A;  2EQJ A;  4WF2 A;  2LJ1 A;  2QEX A;  4M7D C;  2DIQ A;  1OQK A;  3OW2 A;  3L42 A;  2E3H A;  3KFV A;  1MUZ A;  2EGA A;  3EAE A;  4HT9 A;  3VU3 C;  2ABL A;  1PM3 A;  1M1K R;  1Q82 R;  2VUB A;  5GAM h;  2BIV A;  2LQK A;  4C5E A;  4IUV A;  5CO7 A;  4CC4 B;  4C92 B;  9ATC B;  2HQX A;  4HCZ A;  1ZBX A;  1TS9 A;  3F70 A;  1FYN A;  1V1C A;  4AG1 C;  2P4R A;  1QVG S;  1UB4 A;  2V8J A;  2YSQ A;  3FB9 A;  1KQ1 A;  2EW3 A;  2X35 A;  1QP2 A;  2RM4 A;  3CXC P;  2RN8 A;  1MV3 A;  3A8O B;  3DKM A;  3JCM d;  3RUX A;  2KRN A;  4LUE A;  3PMT A;  1VQ5 Q;  2OTL Q;  3G71 A;  1K0X A;  4EMK A;  2EGE A;  4M78 D;  3A5Z B;  1VQO T;  3EFO B;  3M57 A;  2NUT A;  1JO8 A;  4RKU E;  1NYG A;  2ZPI B;  2HL5 C;  4KH0 B;  4JLG A;  4ELZ C;  1T3L A;  3L1A A;  4XTV A;  1YHQ A;  1VQ7 T;  4C8Q B;  1Y96 B;  2JTM A;  1Q7Y U;  4F04 B;  5LJ3 f;  1GRI A;  1VQ9 A;  1ZA2 B;  4N4H A;  4BE1 A;  1AWX A;  1D0Z A;  1QLY A;  2KQW A;  2JUF A;  4LUD A;  2CT3 A;  1QVF P;  5CKD A;  2AHJ B;  1B34 B;  4IKF A;  1I5O B;  2W10 A;  2X3W D;  2OAU A;  2CZ7 B;  3OMG A;  3VJP A;  1QVG A;  4BE2 A;  2LNV A;  3OW2 P;  3S3N A;  1RAF B;  1WHH A;  3TEE A;  1GCP A;  2P0P A;  1W70 A;  2X9H A;  3JCM X;  1H3Z A;  3RES A;  1AWJ A;  2EPD A;  5GAN 3;  1M8V A;  4KH1 B;  4FYX B;  1GBQ A;  3CCV A;  4IIO A;  2KR3 A;  1ABO A;  3E9F A;  3MP8 A;  2QQR A;  1K4U S;  5LL6 S;  1AT1 B;  4J9I A;  2HCK A;  4M7A F;  1S72 T;  3SEM A;  3U23 A;  2AKK A;  1BYM A;  1UGR B;  4JRP A;  2K9G A;  2B8A A;  4M7D A;  1K1Z A;  3SDZ A;  1UEB A;  1M4Z A;  1PKT A;  5KYN A;  3CCJ T;  3QBY A;  2PUO B;  1OX9 A;  5KYX B;  3OYB A;  2AT1 B;  4RCB A;  3MP6 A;  1WHJ A;  1SRM A;  4R0K A;  4C8Q C;  1YHQ Q;  1VQ5 T;  2O9S A;  1M3B A;  4C8Q F;  1Q81 R;  2DYI A;  4A53 A;  1W2B S;  4M77 D;  1YJ9 A;  3V7R A;  4L5G A;  1UUE A;  1HJD A;  3M58 A;  4QVZ A;  3JCM P;  4XAX B;  1WNL A;  1UJY A;  3JB9 J;  5GAO p;  3HRU A;  2LTO A;  1SSH A;  2RQT A;  3TSW A;  2RHY A;  5GJW B;  2FPE A;  3QO3 A;  4F17 A;  1QWF A;  2EGC A;  1TSF A;  2CZ6 B;  2YLB A;  2CSQ A;  3ZBD A;  2RO0 A;  2QTX A;  4GLK A;  5FWC A;  3CCS T;  3JCM e;  4F7U F;  2ECZ A;  1G8X A;  2OTL T;  3SHW A;  4J7F A;  2MWO A;  1YNZ A;  3JSC A;  3UF4 A;  4M78 E;  4N4G A;  2A0F B;  1VQ8 A;  1QQJ A;  2R5A A;  2HDA A;  1YJN A;  1YIT T;  3EGU A;  2COW A;  1YI2 T;  5I2S A;  4QVD A;  4J9G A;  3V7C A;  3OYK A;  3C0C A;  4FSS A;  4PJO F;  1LCK A;  2GBQ A;  2A28 A;  1NYF A;  1RI9 A;  1WI7 A;  2KRS A;  4O6J A;  2RQU A;  3G1J A;  1B07 A;  2VGM A;  5EG2 A;  4J6X A;  3L2W A;  3OBY A;  4FT4 A;  5GAO l;  2YXY A;  3HFN A;  3LLR A;  3LYI A;  5DLQ E;  2QQ9 A;  2JTF A;  1G3Y A;  4C0G A;  1KD1 C;  2KEA A;  2DE0 X;  3GLX A;  4Z88 A;  1VQ9 Q;  4XU0 A;  3MCA B;  4JJN K;  2RI2 A;  2HBW A;  4FW2 A;  1SHG A;  3V8K A;  2QA4 A;  1KD1 R;  4GLM A;  1UHC A;  4BE0 A;  3REB B;  2DMO A;  4M7A A;  1E6G A;  2QAS A;  3DB3 A;  2DO3 A;  3SWN A;  4XU2 A;  2VKN A;  1G2B A;  2QDL A;  3EG9 B;  3I5S A;  4OMF B;  1WA7 A;  2OTJ T;  2RQW A;  2EYX A;  3ER0 A;  1OX8 A;  1IGQ A;  3JCM V;  5FRM A;  4DEY A;  3A8L B;  4M75 F;  3VS4 A;  1UE9 A;  1ZA1 B;  3TVT A;  3HPW A;  4OGC A;  2ZPB B;  3GP8 A;  1VQN Q;  2GTO A;  2LMJ A;  1K8A U;  2CYZ B;  2FPF A;  2KNB B;  4M77 E;  1IGU A;  3CQT A;  5GAN 4;  1RAG B;  1E7O A;  3G6E T;  2YLC A;  1AHJ B;  1D3B A;  1M2O A;  4M7D D;  1I0C A;  5L8R E;  2M9U A;  2JS0 A;  2K3Y A;  1VUB A;  2XI9 A;  2X4Y A;  2RJD A;  4C8Q G;  2LX7 A;  3NGP A;  5I22 A;  3WXM B;  5GAM d;  5GAM f;  3CC4 Q;  2XK0 A;  1QW1 A;  3HHT B;  1NBE B;  1YFN A;  3OA6 A;  2C06 A;  1FWZ A;  2E41 A;  2QQA A;  1YJW A;  1VQ8 Q;  2EKH A;  3P8B B;  1ZHI A;  2DJQ A;  1YJ9 Q;  3OMC A;  2YRC A;  2RI3 A;  1H3H A;  3M0U A;  1MMA A;  2VAS A;  1IHW A;  3M54 A;  5GAO m;  3CCE A;  2X3X D;  2RH2 A;  3EG3 A;  1OEB A;  5LJ5 g;  3EH2 A;  1VQO A;  3LW5 E;  4RTZ A;  4PKC C;  2EYQ A;  1K9A A;  2XID A;  3LWI A;  1HXD A;  2EYZ A;  5CKB A;  2K2V A;  3JB9 I;  2XDB A;  3PE0 A;  1QKX A;  2XKO C;  2F5T X;  2X51 A;  3A1P A;  1QP3 A;  2RK1 A;  5HK0 A;  2BZ8 A;  3NHN A;  3L2Q A;  2NUP B;  1M1G A;  2W0Z A;  1PHT A;  4J8O A;  2FPD A;  3MJX A;  2E10 A;  2JMA A;  3CBP A;  1K73 R;  1OU8 A;  2XG8 D;  4KUL A;  3R6O A;  4CC2 A;  3QZ5 B;  1X6O A;  2LC4 A;  2HEQ A;  1NJI R;  3UA7 A;  2YRD A;  3VS7 A;  2LT1 A;  3I55 T;  4A4H A;  4KBM B;  2DET A;  4BY6 C;  3G7Z A;  1K0S A;  3VRY A;  4OMQ A;  2WSF E;  2MMP A;  4ZGJ B;  1VYU A;  4BUG A;  1WIE A;  1VQM A;  3CCL A;  2ZCF B;  3JB9 G;  2GF7 A;  1M30 A;  1NLO C;  4X34 A;  3JCM b;  4OMO A;  1GBR A;  3RMS A;  1R0B G;  1VQ4 A;  4D8D A;  3GIB A;  1YIJ Q;  3QPH A;  2X4W A;  3S3M A;  2L3P A;  3MEV A;  1FXX A;  4PFP A;  2RHI A;  4QKU A;  3FDR A;  3OYL A;  5GAN 8;  3L2Z A;  4F7U B;  4OGE A;  3JB9 H;  1RLQ C;  3CD6 Q;  4IIM A;  2KDS A;  3PMI A;  4LDY A;  2HD0 A;  1YIJ T;  3NMZ C;  1U8R A;  3NTI A;  4PJJ A;  3E1S A;  2XMF A;  7AT1 B;  1D0X A;  3VS3 A;  5KYU A;  4M7A D;  1D09 B;  2DM1 A;  4EMG A;  1OUL A;  1BKB A;  3CCS A;  4PLL A;  4ZTJ A;  3V7S A;  2DNU A;  2AZV A;  5GAO r;  5KYY A;  4OB3 B;  1X2K A;  2KE9 A;  2DIL A;  2KBT A;  1NE8 A;  1N8R R;  2L3S A;  1Q86 R;  1PD0 A;  1KG1 A;  1WFW A;  3G4S T;  5KYW A;  3OSV A;  3CCE Q;  2CS7 A;  2KT8 A;  5A0L A;  3JAM E;  1UGP B;  2XHC A;  1M1F A;  2FEI A;  1N9S A;  3CPW S;  3OYE A;  2JJ9 A;  2KMT A;  2QQS A;  4EMK B;  1HK9 A;  4MZP A;  3SFM A;  1VYV A;  2WSC E;  3EGD A;  3QDF A;  4J9H A;  1JXM A;  1EFN A;  5CK9 A;  1S1N A;  4HCC A;  4JS5 A;  1W4S A;  1VIE A;  3CC2 Q;  4C8Q A;  1VQP T;  5IH2 A;  1PRM C;  3CCQ T;  2DL4 A;  1SG5 A;  2RK2 A;  1NEB A;  5KCO A;  5DM7 R;  3PTA A;  3M0T A;  4E7H A;  5FRN A;  3I55 A;  1JRI A;  1FMK A;  3PFS A;  3ASK A;  1B34 A;  1NEG A;  3CCL Q;  1XTD A;  2VXF A;  3OYA A;  2Y4Y A;  4LD9 K;  1VQ4 T;  2RJE A;  3THK A;  4XU1 A;  1A0N B;  2D1X A;  2ZGW A;  3S6W A;  4IUQ A;  1VQK A;  5A0G A;  1AVZ C;  1OU9 A;  1X75 C;  5CCA A;  1VQ4 Q;  4M77 A;  3VUZ A;  2A3L A;  2YWW A;  2GGR A;  3BFM A;  1TWB A;  2I0N A;  1RAH B;  1YHQ T;  4AFU C;  3OYJ A;  1PNJ A;  5IHK A;  3HTR A;  3CCV Q;  2GQV A;  2QEX T;  2P0K A;  4OMP A;  5J39 A;  4J6Y A;  3G6E Q;  4C92 D;  2A37 A;  3JCM f;  2FRY A;  1M9S A;  1PSE A;  4PJO D;  1V76 A;  2WAC A;  3ZL7 C;  4KRT A;  4LD6 A;  2HKN A;  3I5R A;  4M7D B;  4PJN A;  1V29 B;  2QGG A;  3NTH A;  3NPF A;  2HAX A;  3CPW P;  1NPR A;  1N8R U;  1VQM Q;  2GQI A;  2D6F A;  1G5V A;  4R56 A;  1AZG B;  1KC8 R;  1UEC A;  2F2W A;  3CC4 T;  2RD1 A;  3FEO A;  4B9X A;  1WJR A;  2H8H A;  4HCK A;  3JCM W;  1GXI E;  2LQN A;  2GFA A;  1EX4 A;  3L2R A;  2RHU A;  4M7D G;  2YT6 A;  2KXD A;  4JRK A;  1W6X A;  1WZO A;  2MIO A;  3CXC S;  1YIJ A;  1N6A A;  4E7S A;  3CCR A;  1ZUU A;  2I2L A;  4EPC A;  5C0M A;  2DXB A;  4M78 F;  4Q5W A;  2EVR A;  3OYG A;  3CCU A;  2ZPE B;  2LCL A;  2G6F X;  3TRE A;  4OF1 A;  1VQL A;  5KCH A;  3I56 A;  2K5I A;  1Y71 A;  1FMV A;  2DYB A;  2RNA A;  1PC0 A;  5I11 A;  1YIT Q;  5FU7 B;  3OSS C;  4HVV A;  4C92 E;  2DKG A;  2E6N A;  2SRC A;  2P4T A;  3UPU A;  4PJO E;  2XDD A;  1BIB A;  4AFZ C;  2RF0 A;  4LDU A;  5J26 A;  3OYC A;  2X4J A;  2L3R A;  1PG5 B;  2JVV A;  3OYM A;  4C8Q D;  3MPU B;  1NZ9 A;  2LNH B;  1UTI A;  4KGZ B;  1CKB A;  4ESR A;  3QKJ A;  3M53 A;  4J5Y A;  1PKS A;  1VQK Q;  2COY A;  3Q1J A;  1AD5 A;  2QI2 A;  1Q95 G;  1BB9 A;  2LRQ A;  4WCI A;  1Y57 A;  1Z9Q A;  1YWO A;  5FU6 B;  1OZ3 A;  1ZQ1 A;  4M75 G;  8AT1 B;  1IO6 A;  3HSB A;  3RKX A;  4VUB A;  4BI4 A;  2ATC B;  2F69 A;  1ZSZ C;  3URG A;  3N5B B;  4JRQ A;  1M1K C;  4M7A G;  4BB7 A;  2DL8 A;  3E2U A;  2FG0 A;  1VQL T;  2CP7 A;  3BDU A;  3MHX A;  4FYW B;  2KSS A;  3SWN C;  4JS4 A;  2R5M A;  2EQI A;  2L89 A;  2RPN A;  4JZ4 A;  4J83 A;  4ZN3 A;  1YJ9 T;  3RNJ A;  1M2V B;  1MHN A;  2ZPH B;  5CQY A;  2MOX A;  1UDL A;  2VWF A;  4ORZ A;  2PUK B;  1VQ5 A;  5DY9 A;  4OVA A;  4JJD A;  3L2V A;  2LZ6 B;  4M78 A;  5I2M A;  1GFD A;  2QA4 Q;  4PJO B;  2F1L A;  1D1B A;  3OYY A;  1P92 A;  3CC4 A;  1AWO A;  2FO0 A;  1HYO A;  3JCM c;  1LPL A;  1XOV A;  2QYZ A;  1RAA B;  4J9D A;  4JJB A;  4E2F B;  1ZSZ A;  2KYM A;  4X9C A;  4M7D F;  1I1J A;  2J06 A;  3MEU A;  1OPL A;  1KQS A;  5CKH A;  3G6E A;  1WXT A;  4C92 C;  3EHR A;  5FU6 C;  1NLP C;  3SD4 A;  5IN1 A;  4KUD K;  3JCM h;  3C12 A;  1GCQ A;  3MEW A;  2VV5 A;  1XNI A;  2DL3 A;  1KC8 C;  4F16 A;  1RUW A;  2CZ0 B;  2K4Y A;  2FRW A;  2LX9 A;  1XQH A;  2LQ8 A;  1N27 A;  3QUI A;  4HT8 A;  5LJ3 j;  3VS2 A;  1E6H A;  1G83 A;  3TU4 K;  1AZE A;  1BI2 A;  3I35 A;  3KBG A;  4DBR A;  3OS0 A;  1VQ9 T;  2QA4 T;  2DD5 A;  1PD1 A;  5D6Y A;  3QWY A;  2YHT A;  1Q7Y C;  1JQQ A;  2RJF A;  1JU5 C;  4J7I A;  4B9W A;  5GMK e;  3CCU Q;  1MNE A;  3H9N A;  2OTJ Q;  4IUR A;  3LX7 A;  2JXB A;  2PNI A;  2ROT A;  2QGF B;  3QZ9 B;  2EJ9 A;  3P8D A;  1TUG B;  3J80 E;  4AT1 B;  3QHS A;  5GAM e;  4OB1 B;  4XTX A;  3RKY A;  3V8J A;  2K6D A;  3OY9 A;  4D6W A;  4RTW A;  2LVM A;  4K11 A;  3UAT A;  1K73 U;  2YDL A;  2CT4 A;  4EIK A;  2E4H A;  3M4G A;  4FW1 A;  1ZBJ A;  4M75 D;  1BI3 A;  3INZ A;  2K79 A;  1SHF A;  2XU8 A;  1WX6 A;  1K8A R;  1BCO A;  5A2Q E;  1WLP B;  1JJ2 S;  1CKA A;  5LJ5 j;  2H3J A;  2MCN A;  3NTK A;  2HSP A;  1VQP A;  2YUN A;  2F5K A;  3CCL T;  3X25 B;  1JB0 E;  5FLX E;  4ME7 A;  4PFZ A;  4QQ6 A;  1Q86 U;  1KQS S;  1X27 A;  5FW9 A;  1K9M U;  4M75 C;  1U1S A;  4AFS C;  2DJZ A;  2HQH A;  2V8K A;  3MP1 A;  2E3I A;  1VQO Q;  3VKI A;  1OI1 A;  2EKO A;  2P0Q A;  2DPP B;  3VV0 A;  3H6Z A;  4RTX A;  1N9R A;  3VS6 A;  4Y28 E;  5DLO A;  1IB8 A;  1WQ7 A;  5FRO A;  2COZ A;  3BW1 A;  3OW2 S;  1SF9 A;  1XJW B;  3EFO A;  4CC3 A;  2JNG A;  2Y4X A;  1K76 A;  2QQB A;  3HL8 A;  4XU3 A;  5LJ5 f;  3IQL A;  3RER A;  3BE3 A;  1RAD B;  2RI5 A;  2K2M A;  2DXU A;  4N0A C;  4KGX B;  4V2S A;  2PQW A;  2WSE E;  1PCX A;  1WXB A;  2EAY A;  3DLM A;  4M75 A;  2MF2 A;  1M5Q 1;  2KYB A;  4QQG A;  2NWM A;  4JZ3 A;  2JT4 A;  2DBK A;  1OYX A;  3CCM T;  4CC7 A;  2C0T A;  3CC7 A;  4QVC A;  4F7U E;  3OYH A;  3PIP A;  2JN0 A;  5GAO q;  2NUT B;  4DOW A;  3FJ5 A;  4JLI A;  2KRO A;  3RMQ A;  2EWN A;  1C0M A;  3VS1 A;  1FX7 A;  3PT9 A;  1BI0 A;  2EYY A;  5KH6 A;  2OTJ A;  4IUT A;  5GJV B;  4C5G A;  3RR6 A;  1YI2 A;  4N0A A;  5I21 A;  1KQS P;  2QG9 B;  3EH1 A;  1I8F A;  2HKQ B;  4RG8 A;  4IUU A;  4R55 A;  2E6Z A;  1M90 C;  4XTY A;  1HD3 A;  3EHQ A;  2CH4 W;  1QCN A;  3PVQ A;  3QJY A;  3JCM Q;  2AZS A;  1VQ8 T;  3A98 A;  3X26 B;  1NPP A;  1KK7 A;  1M90 R;  2LCC A;  2PTK A;  4PFO A;  1UFF A;  3GOX A;  4AG2 C;  4X1V A;  2RHX A;  5IXF A;  3CBO A;  1LOJ A;  1UG1 A;  5GAN 6;  4JUV A;  1Q81 C;  4M78 C;  3I56 T;  2EYW A;  1YJW T;  2DTO A;  5CKF A;  2SEM A;  1ZSG A;  3M0S A;  5GAM g;  1NG2 A;  2F2V A;  4PK4 A;  2KGT A;  4RMO A;  2O01 E;  1ZUK A;  3CME Q;  3EGX A;  4JPB W;  4QW2 A;  5M9O A;  2CP3 A;  1LNX A;  4GBQ A;  5GMK i;  1WHG A;  4ZN1 A;  3HKS A;  2DXT A;  2FZC B;  1M90 U;  2ENM A;  5GMK l;  2O4X B;  3T9N A;  1QKW A;  2DBM A;  4C0D C;  1VQL Q;  3CC2 A;  4M75 E;  4HVW A;  3VYG A;  4BDY A;  1U5S A;  1I81 A;  3LWH A;  2OX7 A;  3M59 A;  3CCQ Q;  4BI8 B;  2OTL A;  1IHV A;  1X6G A;  1I5L A;  2CUD A;  1G3W A;  2NYS A;  4PJL A;  2KI7 A;  4QT7 A;  2CP2 A;  2DX1 A;  4FM4 B;  4M4Z A;  1M3C A;  4OB0 B; 
#chains in the Genus database with same CATH homology
 2HDA A;  2DYB A;  2V1Q A;  2RNA A;  2JTE A;  4Z8A A;  4J9E A;  3EGU A;  5I11 A;  1X2Q A;  4HVV A;  1X69 A;  1NM7 A;  2SRC A;  3VRZ A;  2M51 A;  1SRL A;  4J9G A;  4AFQ C;  4AFZ C;  1PWT A;  2OI3 A;  2RF0 A;  3C0C A;  4FSS A;  1LCK A;  2GBQ A;  1VYT A;  2ESW A;  2A28 A;  1NYF A;  5FWB A;  1RI9 A;  1WI7 A;  2KRS A;  2DF6 A;  2V1R A;  1T3S A;  1M27 C;  2RQU A;  2DL7 A;  2DVJ A;  2LNH B;  1B07 A;  1UTI A;  3H41 A;  3TSZ A;  1CKB A;  4RTT A;  1QWE A;  3VS5 A;  4ESR A;  1PRL C;  1PKS A;  2JS2 A;  1WDX A;  2CUB A;  1SPK A;  2ROL A;  1AD5 A;  1YN8 A;  1BB9 A;  4WCI A;  4LNP A;  1Y57 A;  1Z9Q A;  1YWO A;  2KEA A;  3JV3 A;  2DE0 X;  1BBZ A;  2LJ3 A;  1H8K A;  2ED1 A;  4Z88 A;  1UJ0 A;  1IO6 A;  2LCS A;  2EBP A;  2HBW A;  1SHG A;  3LH5 A;  3QWX X;  4GLM A;  1UHC A;  3REB B;  2DMO A;  2DL8 A;  1VA7 A;  2FG0 A;  1E6G A;  1HSQ A;  1X43 A;  1J3T A;  2VKN A;  4LN2 A;  1G2B A;  2QDL A;  2KRM A;  3I5S A;  1WA7 A;  4OMM A;  2JM8 A;  2EQI A;  2O88 A;  2RPN A;  4JZ4 A;  1AEY A;  2GTJ A;  3RNJ A;  2RQW A;  2EYX A;  2PZ1 A;  2RQV A;  3REA B;  4HVU A;  2MOX A;  1UDL A;  2VWF A;  4ORZ A;  4DEY A;  3VS4 A;  2B86 A;  1UE9 A;  4JJD A;  1KIK A;  2LZ6 B;  2D8H A;  3TVT A;  1MV0 B;  1GFD A;  2GTO A;  2LMJ A;  2DRM A;  4OML A;  2FPF A;  2KNB B;  4OMN A;  1AWO A;  4J9B A;  3CQT A;  2FO0 A;  1E7O A;  3H0I A;  1XOV A;  1I0C A;  2J6F A;  4J9D A;  2D8J A;  1ARK A;  1CSK A;  4JJB A;  2JS0 A;  2D0N A;  1GL5 A;  1UHF A;  2KYM A;  1WXU A;  2RMO A;  2LX7 A;  3NGP A;  5IXB A;  1I1J A;  2J06 A;  2J6O A;  4Z89 A;  5I22 A;  1OPL A;  1WXT A;  1M3A A;  4DEX A;  4E6R A;  3EHR A;  2L3Q A;  1NLP C;  5ECA A;  2EKH A;  2L0A A;  2DJQ A;  3UA6 A;  3H0H A;  1GCQ A;  2KT1 A;  1H3H A;  3M0U A;  2DL3 A;  4ZNX A;  4F16 A;  5HCK A;  1RUW A;  2CRE A;  2X3X D;  3EG3 A;  1OEB A;  1Z9Z A;  2C0O A;  2FRW A;  2VVK A;  1M8M A;  1AOJ A;  4RUG A;  1ABQ A;  1WYX A;  4RTZ A;  1K9A A;  2ED0 A;  2EYZ A;  3VS2 A;  1E6H A;  1G83 A;  1AZE A;  3I35 A;  4LE9 A;  2GNC A;  3PE0 A;  1QKX A;  1N5Z A;  2BZY A;  3QWY A;  1T0J A;  1JQQ A;  2BZ8 A;  3NHN A;  2E5K A;  1QCF A;  1ZUY A;  1JU5 C;  2W0Z A;  1PHT A;  2O2O A;  2FPD A;  2YUQ A;  2JMA A;  3I9Q A;  2JXB A;  4CC2 A;  2PNI A;  2ROT A;  2NUZ A;  4D8K A;  2HEQ A;  1TUD A;  2KXC A;  2J05 A;  1ZLM A;  3UA7 A;  3M0P A;  2F2X A;  3VS7 A;  1BU1 A;  1UGV A;  2K6D A;  3H0F A;  4RTW A;  4K11 A;  3UAT A;  2YDL A;  2CT4 A;  1K0S A;  3VRY A;  4OMQ A;  1RLP C;  4EIK A;  1B3Q A;  3GBQ A;  2LQW A;  1ZBJ A;  1VYU A;  1WIE A;  2RQR A;  2K79 A;  1SHF A;  1WX6 A;  3RBB B;  1M30 A;  1WLP B;  1CKA A;  2C0I A;  1NLO C;  2MCN A;  1OV3 A;  4OMO A;  2CDT A;  2HSP A;  1YCS B;  1GBR A;  2YUN A;  4D8D A;  2YUP A;  1X27 A;  5FW9 A;  2L3P A;  1YWP A;  2LJ1 A;  4AFS C;  1U06 A;  5L23 A;  1OOT A;  1JXO A;  3KFV A;  1MUZ A;  2EGA A;  1RLQ C;  1YP5 A;  2ABL A;  4JJC A;  4IIM A;  3O5Z A;  3VS0 A;  3NMZ C;  2DA9 A;  4RTX A;  3VS6 A;  4CC4 B;  2XMF A;  2J6K A;  1JEG A;  3VS3 A;  2DM1 A;  1FYN A;  1V1C A;  4AG1 C;  2P4R A;  2YSQ A;  4CC3 A;  1K76 A;  2EW3 A;  2DNU A;  2AZV A;  2RN8 A;  3IQL A;  1MV3 A;  2K2M A;  1X2K A;  2KE9 A;  2DIL A;  2KBT A;  2KRN A;  3M0R A;  4LUE A;  3R6N A;  2L3S A;  1K0X A;  1WFW A;  4J9C A;  2EGE A;  1WXB A;  3EG0 A;  1JO8 A;  2A36 A;  1NYG A;  2KT8 A;  2KYB A;  2NWM A;  4JZ3 A;  2JT4 A;  1T3L A;  2DBK A;  5IHN A;  2FEI A;  4CC7 A;  2C0T A;  2DRK A;  1GRI A;  2IIM A;  1VYV A;  5IHI A;  3FJ5 A;  2J7I A;  2KRO A;  1AWX A;  4J9H A;  1JXM A;  1EFN A;  1QLY A;  4LUD A;  3VS1 A;  2CT3 A;  1S1N A;  5EC7 A;  2EYY A;  1Y0M A;  2K3B A;  2W10 A;  2X3W D;  5GJV B;  2OAW A;  4RTY A;  1GCP A;  5IH2 A;  1W70 A;  2CSI A;  2JM9 A;  1PRM C;  2DL4 A;  1NEB A;  1AWJ A;  2LJ0 A;  2EPD A;  3M0T A;  1GBQ A;  1H92 A;  1FMK A;  1HD3 A;  3EHQ A;  4IIO A;  1NEG A;  1ABO A;  2K7A A;  2KR3 A;  2CH4 W;  1X6B A;  3ULR B;  1K4U S;  1SEM A;  2AK5 A;  4HXJ A;  3PVQ A;  1I07 A;  1KJW A;  2AZS A;  3THK A;  1A0N B;  2D1X A;  4J9I A;  3A98 A;  2HCK A;  4RTV A;  2O31 A;  2YUO A;  3SEM A;  3U23 A;  2PTK A;  1AVZ C;  1UFF A;  2AKK A;  4AG2 C;  4X1V A;  2JW4 A;  1GCQ C;  5IXF A;  2M0Y A;  1BK2 A;  2K9G A;  1KSW A;  2AKL A;  1K1Z A;  1UG1 A;  2GGR A;  2I0N A;  4J9F A;  4AFU C;  2BZX A;  1TUC A;  1PNJ A;  1PKT A;  2CH4 A;  5IHK A;  2EYW A;  2SEM A;  4OMP A;  1ZSG A;  1U3O A;  1T0H A;  3M0S A;  1NG2 A;  2F2V A;  2A37 A;  2FRY A;  1SRM A;  2KGT A;  4F14 A;  4R0K A;  3ZL7 C;  4KRT A;  3I5R A;  1ZUK A;  2O9S A;  1M3B A;  4JPB W;  2OJ2 A;  2A08 A;  3NPF A;  4GBQ A;  4Y92 A;  2LP5 A;  1UUE A;  1HJD A;  3EG2 A;  3EG1 A;  3M0Q A;  2L2P A;  4RTU A;  1W1F A;  2GQI A;  1UJY A;  1AZG B;  1UEC A;  3PVL A;  2ENM A;  2F2W A;  1SSH A;  2RQT A;  3TSW A;  1GFC A;  4HCK A;  2H8H A;  5GJW B;  2FPE A;  2LQN A;  1QKW A;  2DBM A;  1QWF A;  1ZX6 A;  2EGC A;  2O9V A;  4A63 B;  2CSQ A;  4F17 A;  1AWW A;  1KFZ A;  4HVW A;  1U5S A;  2YT6 A;  2KXD A;  5FWC A;  1W6X A;  2MIO A;  2JMC A;  1X6G A;  2CUD A;  2ECZ A;  1ZUU A;  2DLP A;  4QT7 A;  3SHW A;  2BTT A;  2DL5 A;  2DX1 A;  2EVR A;  1OPK A;  1TG0 A;  4M4Z A;  1YNZ A;  2G6F X;  1M3C A;  3UF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...