2FPFA

Crystal structure of the ib1 sh3 dimer at low resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
HEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-jun-amino-terminal kinase interacting protein 1
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 14
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpfA00
1K1ZA 2PNIA 1SPKA 2J7IA 2LJ1A 3EHRA 5FWCA 1K0XA 2O88A 3NHNA 1AEYA 1QWEA 2ECZA 1KFZA 3M0TA 2KROA 2JS0A 1Y0MA 2LZ6B 2JS2A 4J9HA 1JQQA 1G2BA 2CREA 5HCKA 2DLPA 2EKHA 3EG0A 1UE9A 3EG2A 4OMNA 1SHFA 2K2MA 1AVZC 2DL3A 2DM1A 1GL5A 2DL8A 5GJWB 1K0SA 5I11A 2O9VA 2BTTA 1X27A 4Z8AA 4DEYA 2C0IA 1YWPA 1ZX6A 1YP5A 3UA7A 1W6XA 5IH2A 1ZUKA 1SEMA 2GNCA 2IIMA 1M30A 2C0OA 3H0IA 3UATA 2XMFA 4GBQA 4AFUC 4R0KA 1UFFA 1OPKA 2RN8A 1QLYA 1WLPB 1RLPC 4OMLA 2RNAA 4F16A 1WI7A 4Y92A 1ZSGA 5IHIA 3ULRB 2AZSA 1VYUA 1X69A 2JT4A 1NEBA 4X1VA 4HXJA 2O9SA 1WDXA 3TSWA 3EG3A 2ED1A 3H0HA 4A63B 1BB9A 1I1JA 4OMQA 2ROLA 3PE0A 4JPBW 2ESWA 2KE9A 2DE0X 2QDLA 4RTTA 1PWTA 2HEQA 2MIOA 2K6DA 5IXFA 4CC2A 4K11A 3THKA 2GTOA 2HSPA 2BZXA 3NGPA 2M51A 3QWYA 2GGRA 2KGTA 1VYTA 2CT3A 3NMZC 1ZLMA 1HD3A 2KR3A 2YUQA 3VS6A 4J9DA 2DRKA 2LNHB 4CC7A 4RTXA 3U23A 2GTJA 2RQRA 2AZVA 3TVTA 5IHNA 2KYBA 2K79A 3A98A 1T0JA 4OMOA 5I22A 2CT4A 2D8HA 2JMCA 4RTWA 4JJBA 5L23A 4FSSA 5IXBA 1YNZA 2W0ZA 2YT6A 3EHQA 3TSZA 1K4US 1NM7A 1U5SA 1X6BA 1GBRA 2AK5A 1HJDA 2K3BA 1IO6A 1X2QA 3PVLA 2SEMA 2DMOA 4GLMA 1BU1A 2DVJA 2KRMA 1GFCA 2LQWA 3O5ZA 1X2KA 4KRTA 1GCQC 1WXUA 1H92A 1BBZA 1I07A 3M0QA 4M4ZA 3VS7A 1U06A 3SHWA 1GFDA 2LX7A 1WXTA 1OEBA 1GRIA 2FEIA 3REBB 1N5ZA 4ESRA 4F14A 2LMJA 3M0PA 2A37A 2AKKA 1NLPC 2PZ1A 2MOXA 1H8KA 2KRSA 4CC4B 4J9BA 2G6FX 1ZUYA 1WXBA 1MV3A 3C0CA 2PTKA 1GCPA 2LJ0A 2YUPA 4RTUA 2HDAA 3M0SA 2FPFA 1ABQA 4JZ4A 4RTYA 2OJ2A 4LN2A 2EQIA 1MV0B 1AZGB 2DNUA 1QKXA 4JZ3A 2MCNA 3H0FA 1FYNA 3RBBB 4J9CA 1SSHA 1WA7A 3VS3A 1JO8A 2NWMA 3LH5A 2A08A 1B07A 1K76A 2VWFA 2EGCA 1M3CA 2EGEA 2KYMA 1CSKA 1M3AA 3VRYA 2YDLA 1NYFA 2RPNA 3FJ5A 2LJ3A 2X3XD 1SRMA 2YSQA 1B3QA 1AWOA 1TG0A 1JEGA 2ABLA 2DILA 1QCFA 2M0YA 3RNJA 1KSWA 4J9EA 1RLQC 1AOJA 1G83A 1UDLA 1OPLA 3JV3A 2JW4A 2L2PA 1UJYA 4LE9A 2CUBA 1A0NB 2B86A 2SRCA 1W1FA 1XOVA 3GBQA 4DEXA 4JJDA 3I35A 2J05A 4IIMA 4RTZA 1VA7A 2DX1A 4LUEA 3VS1A 4LNPA 2LCSA 1WIEA 2ROTA 3VRZA 1X6GA 1W70A 1ABOA 2C0TA 2JM9A 4HVUA 2W10A 2V1QA 5GJVB 3KFVA 1UGVA 1UECA 2L0AA 2CH4A 2DRMA 2KNBB 2KBTA 2EVRA 3I5SA 2JTEA 2JM8A 1AWWA 2A36A 1H3HA 1WX6A 3VS0A 1RI9A 4AFQC 3M0RA 2DF6A 3PVQA 3VS5A 1EFNA 2L3SA 2FPEA 2EYYA 1PKTA 2RF0A 2K9GA 1NG2A 1TUCA 4Z88A 1SHGA 1NEGA 1S1NA 2FO0A 2CSIA 4HCKA 1X43A 4RUGA 3UA6A 5FWBA 2J6OA 4ORZA 2A28A 1UG1A 1VYVA 1PKSA 2DYBA 3VS2A 1JU5C 1PNJA 2JMAA 2F2XA 4D8DA 1ARKA 1K9AA 1QKWA 2BZ8A 1WYXA 2L3QA 2RMOA 2KEAA 1UUEA 1UTIA 4E6RA 3VS4A 1YCSB 2VVKA 1T0HA 2GBQA 2F2VA 2FPDA 2FRYA 1PRLC 2EBPA 1T3LA 4RTVA 2BZYA 2JXBA 1CKAA 1PRMC 2H8HA 1U3OA 4J9IA 4J9GA 1YWOA 2I0NA 3I5RA 2YUOA 2K7AA 2ED0A 5ECAA 3NPFA 2DL4A 2AKLA 2DL7A 1JXMA 3QWXX 4AFSC 2X3WD 2GQIA 2CSQA 2D1XA 4HVVA 1E6GA 4IIOA 2J06A 1BK2A 2DA9A 4ZNXA 2VKNA 2HCKA 2OI3A 3EGUA 2D8JA 3CQTA 3M0UA 1ZBJA 4WCIA 1MUZA 2DBMA 1FMKA 1WFWA 4QT7A 1E6HA 2YUNA 1AD5A 1E7OA 2HBWA 1T3SA 2J6FA 2NUZA 3SEMA 1LCKA 4HVWA 4D8KA 5IHKA 1OV3A 2RQUA 1KIKA 3H41A 2FRWA 1Y57A 4CC3A 2EYZA 4OMMA 2DJQA 4F17A 2EW3A 1ZUUA 1NYGA 2O2OA 4AFZC 2KT8A 1NLOC 1J3TA 2FG0A 3EG1A 4AG2C 1RUWA 1AWXA 1TUDA 2RQVA 1CKBA 2CDTA 2RQWA 2EGAA 4Z89A 2ENMA 1AWJA 4LUDA 3IQLA 1YN8A 1I0CA 2CUDA 5EC7A 2F2WA 2OAWA 1SRLA 2EYXA 5FW9A 2DBKA 1AZEA 3R6NA 1PHTA 2KRNA 1M27C 2D0NA 2V1RA 1GCQA 2L3PA 2KXDA 3ZL7C 1QWFA 1M3BA 1OOTA 1M8MA 2O31A 3UF4A 2J6KA 1GBQA 1HSQA 1KJWA 1Z9QA 2EPDA 4AG1C 1JXOA 3I9QA 2LP5A 1UJ0A 1UHCA 1Z9ZA 2RQTA 3REAB 1V1CA 4JJCA 2EYWA 2KXCA 2E5KA 4OMPA 2P4RA 4J9FA 2CH4W 2KT1A 1UHFA 2DL5A 4EIKA 2LQNA
chains in the Genus database with same CATH superfamily
1TWBA 1OU9A 4PJOF 3OYCA 1YHQQ 1KFZA 1VQ5Q 3BDLA 4C92A 2KROA 2EQUA 3P8DA 2DFUA 1Y0MA 2NUTA 4J9HA 2CP0A 4LXCA 5HCKA 5CK9A 4F7UA 5I2MA 2E70A 5GMKl 3CCJT 5GANg 2X4JA 3GNFB 3A8MB 2EJFA 4FSXA 2DKGA 4FYVB 1GL5A 3JCMQ 2Z0WA 2DL8A 1I81A 5I11A 3JCMd 2BTTA 2QQ9A 1X27A 4Z8AA 3RESA 1RAHB 2M1HA 4C92D 4JUVA 3TCJA 1FWZA 1VQLA 5IH2A 4XK8E 4EMHA 4X34A 4GBQA 5GAOr 3OSVA 2RN8A 4XTXA 4N0AC 2LC4A 2ZAEA 3OYBA 4C8QB 3UT1A 2BE9B 2QEXT 2HAXA 1WHHA 4BDZA 5IHIA 1K9MC 2AIRB 2KSSA 5I21A 4X1VA 4BI3A 4HXJA 2HMAA 3P8HA 2ED1A 5DLQE 1BB9A 2ROLA 3CCLQ 4OF1A 4C5IA 4C92E 4C8QA 1PD1A 4M7DF 1MNDA 3RDVA 1N8RR 3MO8A 4GY5A 4HCZA 2LTOA 4ZGEB 3OYJA 2HSPA 4F7UE 2M51A 3QWYA 3M55A 2EQMA 3O8VA 3M53A 2YUQA 4EDUA 4XTWA 4LDWA 4RMOA 3CMAA 2CP6A 5HK0A 3TVTA 4JDSA 2WACA 4XTZA 5GAOm 5GANe 1QVGS 1O75A 5IXBA 4XTUA 1YNZA 2F5KA 1YJWT 4M77B 3EHQA 2NYSA 1UGRB 1U5SA 3A1PA 3QG1A 3ZFJA 2AK5A 2K3BA 3OYHA 1JJ2A 1NE8A 1Y71A 2SEMA 2VASA 1W2BS 2PVDB 1QVGP 4GLMA 3GNGA 1GFCA 3OS0A 3C94A 1WXUA 3QHSA 3M0QA 4M4ZA 4DQ2A 1C6VX 2DJZA 1SG5A 1U06A 3X25B 3SHWA 1VQ5T 1BI2A 1GFDA 1WXTA 4JRIA 3OS2A 1GRIA 2FEIA 4C8QE 1W2BP 3WXMB 2OTLA 2NLUA 4ESRA 3LH0A 3AHUA 3M0PA 2CZ7B 1M1KC 1VQKA 2PZ1A 2G6FX 1VQ9T 1YFNA 1H3ZA 3PMIA 2VXFA 1VQ7A 3C0CA 4A53A 8AT1B 2Y4XA 3EGXB 4JRPA 2FPFA 4M77D 3PTAA 4FYYB 3M59A 1ZSZC 1UGPB 4V2SA 3CCQA 4XU0A 1AZGB 1WHKA 3L2RA 4BUGA 1FYNA 3JRZA 4KT0E 3L2VA 4HT9A 2HQHA 4A4HA 2DXTA 1C1AA 1Q7YR 3JCMg 1SSHA 1WA7A 3VS3A 3CCSA 1JO8A 4NL3A 2YLBA 3LH5A 1B07A 3EGXA 4TVRA 1CSKA 4PJOG 1VQ6T 1IZ6A 3BE3A 3HHTB 3M57A 2X3XD 5I2SA 1Q86R 2HKNA 1AOJA 1UDLA 4FM4B 3EH1A 4FYXB 2RJCA 4BI8B 2DTHA 4ZGDB 3BFMA 1W1FA 1U8RA 4DBFA 4DEXA 1NJIC 3A8HB 4RTZA 1VA7A 4LUEA 3QZ9B 1LNXA 5D6YA 3CCMQ 3T9NA 1BYMA 5GMKm 1W70A 3ZBDA 3EG9B 1ABOA 3OYEA 4IUVA 2FZCB 1P92A 2EYQA 3KFVA 1N8RC 1UGVA 1UECA 2L0AA 3A8LB 5EG2A 2DRMA 1S72A 2JTEA 3MP6A 2R5AA 1WX6A 1WPYA 2MAMA 4ATOA 1YI2Q 2QEXA 3F70A 1EFNA 2L3SA 3MHXA 1D0YA 3Q1JA 2HD0A 3EG9A 3E2UA 2K9GA 1NG2A 3OW2A 3UA6A 2JTMA 3JCMe 5CO7A 1PD0A 5FU6C 1PKSA 3OBYA 3CMET 2DYBA 2F2XA 1ARKA 5CKBA 5KYUB 2L3RA 4IKFA 3CCRQ 1QKWA 2L3QA 2RMOA 3QUIA 3E9GA 3VS4A 4PJLA 4DOWA 2ZCFB 1JBMA 1LJOA 2LQ8A 2FL7A 3VJPA 4OGCA 3C4SA 1PRMC 2H8HA 3CBOA 4E2FB 1YWOA 2YRCA 3G7ZA 5GAN5 2K3XA 2G3RA 5KYUA 3QZ5B 2DD4A 3V7SA 4AFSC 2X3WD 6AT1B 2KDSA 2GQIA 2CSQA 2QQRA 1YIJQ 3JCMJ 4HVVA 3WVDB 1YJ9Q 3OYGA 3I55Q 2P0QA 1BK2A 1TS9A 2HCKA 1VQOQ 2OI3A 3EGUA 2ZPBB 3CQTA 2LCLA 3RKYA 3M0UA 4GLKA 3D7SB 3EFRA 2LVMA 1YHQA 2YUNA 4X9DA 5A0GA 1VQ5A 1TUGB 1OYXA 4J8OA 3JB9J 3H41A 1WHLA 3DB3A 4C5GA 4CC3A 4AMCA 2DJQA 4MMKA 2EW3A 2OTJA 1NYGA 1KC8U 4AFZC 4F7UG 3QSUA 1OU8A 2FG0A 3MCAB 1RUWA 2RQVA 2LDMA 1CKBA 2VGMA 4C0DC 5GAN3 3MPUB 2R57A 3CCMT 4LUDA 4BE0A 3OYAA 1I0CA 1Q86C 3CCVQ 5EC7A 2F2WA 2RK2A 5GAN8 2MWPA 4MDXA 1PHTA 2LNVA 3FB9A 4J6XA 1TTHB 3E19A 2DEUA 4JS5A 1KK7A 1PSEA 3CC2T 5GMKe 1YI2T 2J6KA 1KJWA 1UEBA 2I2LA 2EPDA 1QMCA 1EZZB 3I9QA 5GMKi 3NTKA 2LP5A 1M9SA 4M75D 3VKIA 4M78B 1WJSA 3REAB 1YCYA 4JJCA 3G6EQ 2PU9B 4BDYA 1K73C 2KT1A 3V8JA 2DL5A 4KUDK 1K1ZA 2DXBA 3VV0A 2LJ1A 2X4XA 3CCLA 5FWCA 2MK5A 1K0XA 3NHNA 4M7AC 1QWEA 2KK4A 4C8QG 3I56Q 4J7FA 2ZPGB 3MEWA 4QVZA 4DA4A 2JS2A 4M78A 3GIBA 1JQQA 1G2BA 3CCJQ 2DLPA 2EKHA 1WGSA 1U1TA 2YRDA 2BIVA 2BKDN 4OMNA 1SHFA 3QJ6A 2FZKB 2DL3A 4UC4A 2PQWA 4RCBA 2EIFA 2HL3A 3A8OB 4DEYA 3L1AA 2C0IA 3CBPA 4Y28E 3UA7A 3L42A 2GNCA 2QA4Q 2XDBA 3MP8A 2C0OA 1YIJT 3CXCS 1YJ9T 1ZA2B 4FT2A 2MWOA 1OPKA 1IXDA 1LOJA 1R77A 3M4GA 3V8KA 2XHCA 1WLPB 1N9RA 1VQOT 4PLIA 2K3YA 1RLPC 2RNAA 3SB2A 3QO3A 4F16A 1B34B 1WI7A 2V26A 1PM3A 3CXCP 3LGLA 2E5QA 2DD5A 1WDXA 3TSWA 1XQHA 2QGFB 3EG3A 2IPOB 3H0HA 4A63B 1I1JA 3PE0A 2MF2A 2ESWA 2KE9A 4M78E 1PWTA 2HEQA 1W4SA 2MIOA 1B34A 1D0ZA 2MI6A 4EMKB 2BZXA 2JJ9A 1VQNQ 2RHXA 1BI3A 4PFOA 4IUQA 2CT3A 3NMZC 1ZLMA 1HD3A 3WVEB 1QP3A 3VUBA 2KR3A 1IHVA 4J9DA 1M90U 3CCVT 4CC7A 4A54A 5KH6A 3U23A 2RQRA 2AZVA 3QXEB 2KYBA 2K79A 3VYHB 1VOMA 4M7DD 3A98A 1T0JA 2CZ0B 5I22A 4EMKA 3JCMX 4JJBA 1YJWQ 5L23A 2ZPIB 3TU4K 2P0KA 1WHGA 2W0ZA 2YT6A 4M7AF 1K4US 1X6BA 3G6ET 1Q81U 2CP2A 2XD0A 2GQVA 3BW1A 2KRMA 1X6OA 3O5ZA 3CPWA 1Q82U 1H92A 1BBZA 1I07A 1Y7XA 3VS7A 4B6MA 2V8KA 8ATCB 2LX7A 3I56T 3OYDA 4QQGA 4BY6B 1B7TA 3RR6A 3REBB 1XNIA 2AT1B 2XU8A 4F14A 1VQ9Q 2AKKA 1NLPC 1V76A 4CC4B 2KRSA 1ZUYA 3CCMA 4XTVA 4E47A 1IB8A 1KHCA 2RH2A 4L59A 4MMLA 1GCPA 3H8ZA 2YUPA 4RTUA 3PGGA 5FROA 1K8AU 4YTLA 4JZ4A 4RTYA 1KQ1A 4LN2A 2EQIA 2QA4T 2BE7D 1IHWA 3JCMV 1PCXA 2E41A 3LW5E 1VQ8Q 3PIOA 2QAZA 2NWMA 5KCHA 3HTRA 1K76A 2VWFA 3E9FA 4FT4A 4VUBA 2XK0A 1VQ6Q 3JB9I 1VIFA 2ZPFB 2COWA 3SDZA 5LJ5h 1KC8R 3VRYA 3OYFA 2RPNA 4OGEA 1KD1U 1SRMA 1B3QA 1JEGA 2K5IA 1PC0A 1WQ7A 3RNJA 3J7AF 1KSWA 4IUTA 3C95A 3CCRA 5LJ5f 2B8AA 5FRMA 5AYFA 2QXFA 3RIRA 1R8OB 3SWNC 2CUBA 1VQNT 3H9NA 1D1AA 3R6OA 3GBQA 2A7YA 1Y96B 2O4XB 4IIMA 2H3EB 1H641 2MYSA 3VS1A 4LNPA 3JCMb 2ROTA 4LD9K 3VRZA 3V7RA 5CKEA 4C8QC 2JM9A 3X26B 5GJVB 2OX7A 2D6FA 1YJ9A 3I55A 3OA6A 2DZ9A 3I5SA 4ZGJB 2JM8A 5CQXA 1H3HA 1Y96A 2O4XA 1VQOA 3VS0A 1YJNQ 4AFQC 3FEOA 2DF6A 2HL5C 3VS5A 4MZTA 4IURA 1YBYA 1PKTA 1WHMA 3EH2A 2RF0A 3X20B 1TUCA 1YITT 1M5Q1 4XTYA 3RMSA 3N5BB 2BUDA 4M77A 5D6WA 4MZPA 2CP5A 3EFOB 3CCEQ 2E6ZA 3CMEQ 2KVQG 2NUPB 1SKUB 4E7SA 2CS7A 1HXDA 3VUZA 5KYWB 3VS2A 3MEVA 1PNJA 1V29B 4HCBA 4C92F 1K9AA 2COYA 3L2UA 3CCUT 1UUEA 1HK9A 4IUUA 2YHTA 1YCSB 2X51A 4J5YA 1QCNA 4F7UF 2GBQA 1I8FA 1PRLC 2EBPA 1T3LA 3EFOA 3CCVA 4XU1A 2NUPA 4F04B 1U3OA 4J9IA 5KYWA 1MMAA 5GAMh 2I0NA 4DBHA 1QVPA 4PNOA 2YUOA 4M7AG 2K7AA 2RJEA 5AT1B 2DL4A 1NPRA 4ZN3A 3JB9G 1VQ8T 2XKOC 2RHUA 1BI1A 5GAMf 2QTVA 3G6EA 4CRIA 3UDCA 3VU3C 2D8JA 3PT9A 3FC3A 1ZBJA 4WCIA 4XAXB 4JLGA 2DBMA 2QQBA 3MEUA 4KH1B 1WFWA 1ACMB 2CGHA 1K9MU 1WZOA 4M77E 5GAOp 3S3NA 1E7OA 3I56A 2J6FA 3SEMA 1LCKA 5FLXE 5IHKA 1M90R 2DTOA 4J6YA 3JCMc 3CPFA 4M78G 3CCJA 2EYZA 5IT9E 1D1CA 1JJ2S 4F17A 4C8QF 1KHIA 4J6WA 1KC8C 3EG1A 2X4WA 5CQYA 4AT1B 1UGQB 1BIAA 4KGZB 2RHZA 1AWXA 2DZCA 1MMNA 2PUKB 2RQWA 5GAN2 1HYOA 2ENMA 1BCMA 1AWJA 1JJ2P 3IQLA 5FU6B 2VYTA 1YN8A 5A0DA 1Q81R 1GXIE 5FW9A 2QA4A 3R6NA 2KRNA 4FW2A 4HCCA 2V1RA 1GCQA 3CC2Q 3TEEA 1QVFA 4PJNA 3ZL7C 3ZEHA 1QWFA 1OOTA 3V7CA 1YJNT 3JCMW 4AG1C 5GAN4 4B9WA 1UJ0A 1UHCA 1ZHIA 2E3IA 2KXCA 3OYNA 1G8XA 2CH4W 2LQNA 2K57A 3INZA 2PNIA 3CCET 2DETA 4OB2B 2O88A 5DM7R 5GAN7 1LPLA 2FZGB 2XDPA 2JS0A 2LZ6B 1K8AR 2DIGA 3HL8A 4OMFB 2CREA 1N27A 4D6WA 3EG2A 2LT4A 1VQPQ 1AVZC 5GMKh 5FU7C 1VQ4T 1M1KU 5GJWB 2VGNA 1RAAB 2YLCA 5LJ3h 1MMDA 2VUBA 2RA2A 4L6V5 1YP5A 2LCCA 1W6XA 1KQSA 1ZUKA 1YJWA 1KD1R 4KGVB 1M30A 2DEQA 3DB4A 1UGSB 3NTHA 1UFFA 2E12A 4LDUA 2P0PA 4PKCC 1OZ2A 5LJ3f 1X75C 1QLYA 5LJ5j 3TREA 5IAYA 4Y92A 3QBYA 3ULRB 1VYUA 1X69A 4M75B 1Q7YC 2YXYA 2YRVA 4C92G 2O9SA 1FX7A 1NBEB 3QJYA 3M58A 2QGGA 3HRSA 1M2VB 4OMQA 5DLOA 1FMWA 1G3SA 4BACA 1TU0B 2FB7A 2DE0X 3CC4Q 2QDLA 4RTTA 3CD6Q 1VQ9A 4Z02A 3OW2S 2GTOA 3NGPA 2RO0A 4C0GA 4M75A 2RI3A 2KGTA 5A2QE 1NJIU 3OS1A 1G3WA 2QK0A 2LNHB 1M2VA 3OBWA 3OW2P 3FJPA 5CKFA 1NPPA 3OS5A 2DXCA 2D9TA 4NS5A 1VQMQ 4QVCA 1VQ8A 4PJOB 4RKUE 2CT4A 2JMCA 4RTWA 3G4SQ 3FLGA 1VQ6A 4ZTFA 5A0LA 3G1JA 2KQWA 4P5NA 1R0CB 1HJDA 3PVLA 3X24B 3OB9A 1IRXA 4Y91A 4NOYA 2WSEE 1BU1A 4PFZA 3EGDB 3L2WA 4PJOA 3QIIA 2EFIA 2JNGA 3KBGA 1WHJA 9ATCB 4DBQA 1ZA1B 1OEBA 3SD4A 4XQ3A 1KG1A 1XJWB 1N5ZA 3A8GB 2XIDA 5J3BA 1RAIB 1VQPT 4M75E 2A37A 3EGDA 2MOXA 4J9BA 3MJXA 5GAMj 4PJOD 1WXBA 1MV3A 1RL2A 2PTKA 2QYZA 3CC7Q 2LJ0A 1BKBA 5LL6S 2QQAA 2VV5A 2HDAA 3MEAA 1ABQA 1OULA 3MKDA 2LT1A 2OJ2A 2CP7A 2M02A 4M78C 1MV0B 1BIBA 4JZ3A 3H0FA 3HPWA 3RBBB 1YJNA 2K2VA 4OVAA 5LJ5d 4M7DB 2A08A 2EGCA 2HBPA 2EGEA 2IG0A 1EIFA 4JLIA 5GAOn 2L89A 3JCMP 4QKUA 2YDLA 1NYFA 3LYIA 3FJ5A 3CCEA 4M77G 3CMEA 3E1SA 4PJOE 4BB7A 2DK3A 4KGXB 2YSQA 1TG0A 2ABLA 4M7DA 3JB9H 1RLQC 5CIUA 3CC4T 1G83A 4NL2A 3GP8A 2MMPA 1OPLA 2DERA 3JV3A 3CD6T 2JW4A 3G71Q 4PJMA 2H3JA 1A0NB 2SRCA 2DYIA 3RERA 4JJDA 4ZTJA 2DX1A 2C06A 4BD3A 2LCSA 1FMVA 1X6GA 1D09B 4C5EA 2C0TA 4HVUA 1VQMT 1VQ7T 2V1QA 1NZ9A 1Q86U 3META 2Y4YA 2GFUA 2KNBB 4E7ZA 3PIPA 3G4ST 4A4GA 1WJQA 1QP2A 2YWWA 2E1HA 4CI0C 2GCXA 3CCQT 3QDRB 2AHJB 2L8DA 3JB9F 3PVQA 3OY9A 4ZN1A 2FPEA 2EYYA 3QYGB 2ZPHB 1YITQ 4KUIA 1SHGA 1K73U 3NTIA 1X43A 2KY9A 2J6OA 4EMKC 2A28A 1M1KR 1M1FA 1RADB 4M7DE 2HZYA 2EJGA 1JU5C 2JMAA 3BY7A 4D8DA 3CCUQ 5GANh 4DOVA 4M78F 1OX9A 5GMKj 1ZBXA 2KEAA 1QVGA 5GAMd 2HQXA 2ATCB 4MDWA 2VVKA 1TOVA 1T0HA 5LJ3j 2F2VA 4N0AA 2FPDA 1TXQA 2FRYA 4RTVA 3CC7T 2BZYA 2JXBA 4C92C 1M8VA 2OTJQ 4PFPA 2KAFA 4II1A 5GANf 4OB1B 4J9GA 2DAQA 2KMTA 3CC2A 3I5RA 1YI2A 1W2BA 3GF5A 5ECAA 4PJJA 4A4FA 1M4ZA 2AKLA 2E3HA 3SWNB 4KH0B 2P84A 2R58A 1AHJB 1E6GA 4IIOA 2DVEA 1RAFB 5CKDA 1S72T 1PSFA 4ZNXA 2ZZDA 2X4YA 3RKXA 2ZPEB 4X9CA 4BY6C 4ANJA 1MNEA 1MUZA 4OB0B 4BE2A 2X9HA 3PFSA 4O5VA 1FMKA 3SWNA 3RMQA 4QT7A 5LJ5g 4A4EA 5HKCA 2XI9A 2IVWA 4LDYA 1T3SA 1NJIR 4HVWA 4D8KA 1OV3A 1KIKA 2FRWA 1Y57A 2O01E 4OMMA 5CVIA 1G3YA 3G71T 1ZUUA 3LX7A 2O2OA 1TH7A 2QASA 2LRQA 4OB3B 2KT8A 3OSSC 1J3TA 1VQPA 1AT1B 4QW2A 1PG5B 3CPWS 3GPLA 3LGFA 2EGAA 4Z89A 3UPUA 2P4TA 2RJDA 3A5ZB 1YIJA 2OAWA 1SRLA 2EYXA 2DBKA 1AZEA 3M54A 1DJ7B 5DY9A 1M27C 4J83A 3CPWP 2D0NA 4C8QD 1M3BA 2E64A 5M9OA 1M8MA 2RK1A 3UF4A 2D0QB 1HSQA 2XICA 1Z9QA 1KQ2A 3V8LA 1ZSZB 2X35A 2RQTA 5HK3A 5CAIA 2E5KA 2P4RA 4J9FA 1UHFA 3P8BB 3BDUA 3ME9A 1N6AA 5CR2A 1SPKA 2EQKA 2J7IA 3PMTA 1LVKA 4XU2A 3EHRA 5GAN6 3S3OA 4HT8A 3M5AA 3L2QA 1AEYA 3SFMA 3CC4A 2ECZA 4DBRA 3J80E 3CD6A 3M0TA 1YHQT 4QVDA 1ZSZA 3X28B 4M75G 1RABB 3EG0A 5LJ3d 4ELZC 1VQ4Q 1UE9A 5LJ5e 2K2MA 4WF2A 2A0FB 4PLLA 2OTJT 2DM1A 2JUFA 4M77C 1K0SA 2Y90A 3CBMA 2O9VA 1TSFA 1OQKA 1VQMA 1RAGB 1YWPA 1ZX6A 3G4SA 3JCMh 1SEMA 2IIMA 5GAMg 1QQJA 3QYHB 4QQ6A 3UATA 3H0IA 4N4GA 4FL6A 2XMFA 4AFUC 4R55A 5KYXB 4R0KA 2RI2A 4Q5WA 4E7HA 3CEYA 5KCOA 3H6ZA 4E7IA 2RD1A 4OMLA 4JJNK 3TQ7P 3JCMf 1EX4A 1ZSGA 5KE2A 3KXTA 2AZSA 2ZGWA 2EQJA 2JT4A 1NEBA 3ER0A 3M9QA 4B9XA 1VUBA 4PK4A 5KYXA 2GF7A 1SSFA 1UB4A 1WQWA 1IGUA 4JPBW 1IREB 1MMGA 3CCLT 7AT1B 2XG8D 2K6DA 4HA8A 5D7UA 5IXFA 4CC2A 4K11A 2COZA 3THKA 3HFOA 2GGRA 1VYTA 3M4YA 3CC7A 2EJ9A 3VS6A 3OYLA 2DRKA 4RTXA 5J26A 3ASKA 2GTJA 2M16A 1Q82R 4MZMA 5IHNA 2E10A 4KULA 1K73R 2LQKA 4OMOA 1VQLQ 2D8HA 4ME7A 2DPPB 4FSSA 5C6SA 1D0XA 2HSEB 4FYWB 4N4HA 5FU7B 2M0OA 3TSZA 1NM7A 3OMGA 3LLRA 2HNIA 1XTDA 3URGA 1GBRA 1IO6A 3QDFA 1X2QA 3KUFA 4WTOB 2PVOB 1BCOA 2DMOA 5GAMe 2DVJA 2LQWA 1X2KA 2K5FA 3EFSA 4KRTA 1GCQC 1Y07A 3HFNA 4M7DG 2F1LA 4M77F 1D1BA 5GANj 3OYKA 4LDVA 1VQNA 2RB6A 3G71A 3QKJA 1I5OB 2F5TX 1FXXA 2E65A 2LMJA 3M56A 1H8KA 4BI4A 4ELYC 4EPCA 5D6XA 2R5MA 3LWIA 2F69A 2HKQB 3M0SA 2VXEA 3FIFA 2WSFE 3HRTA 3CMAQ 5LJ3g 2DNUA 4IUPA 1QKXA 2CZ1B 2RI5A 4RCCA 4C0DB 4XU3A 2MCNA 4A4KA 4J9CA 1G3TA 1VIEA 1JB0E 2JTFA 4E7JA 2V8IA 4R56A 5FRNA 1YITA 1M3CA 1IGQA 3GLXA 3VYGA 2VB6A 2KYMA 1RAEB 4FW1A 1M3AA 4JRKA 1D3BB 1RACB 1QVFS 2DTIA 2RHYA 2LJ3A 1SF9A 4BE1A 2FYKA 1AWOA 5CKHA 2WSCE 2E4HA 2DILA 1QCFA 3JAME 2M0YA 4J9EA 3CCUA 1QW1A 4C0ZA 1RI0A 5J39A 3C12A 2CYZB 1QCOA 2L2PA 1QVFP 1UJYA 4LE9A 3RKWA 2XDDA 3FDRA 2B86A 1D3BA 1XOVA 1WJRA 3AT1B 2OTLQ 5GAOq 2GFAA 3CXCA 2K4YA 4M7AB 3FRNA 3I35A 2J05A 3HSBA 1M90C 1M2OA 2JZ2A 4O6JA 3HKSA 1VQKQ 3JSCA 4N4IA 4FCYA 1WIEA 1WNLA 1VQ7Q 3L2ZA 1N8RU 2W10A 3S6WA 4FIBA 1VQLT 1I4K1 4E7LA 2CH4A 2KBTA 2EVRA 3CCQQ 2EKOA 1AWWA 2A36A 4M75C 1MGQA 4M7AA 1I5LA 5C0MA 1RI9A 5L8RE 3M0RA 1Q81C 5KYYB 2RJFA 2K5LA 3OQ5A 3CCSQ 3DKMA 2QI2A 2VC8A 4E7KA 5LJ3e 2HQEA 2EAYA 1Q82C 4Z88A 1KQSS 1NEGA 2RM4A 1S1NA 2FO0A 2CSIA 4HCKA 1M1GA 2A3LA 4RUGA 3LWHA 5FWBA 4ORZA 2PUOB 5GANd 1UG1A 1VYVA 1OZ3A 2CKKA 5IN1A 4M7AD 3MP1A 2V8JA 4RG2A 3DLLA 5KYYA 1MHNA 1X01A 4FU6A 1KQSP 1C0MA 3JB9D 3OYMA 4C5HA 2BZ8A 1WYXA 2EWNA 3CCRT 1UTIA 4E6RA 1OI1A 2QTXA 4L5GA 1BI0A 1ZQ1A 3QPHA 4PJOC 4JS4A 4C0FA 3DLMA 1CKAA 5GAOl 2QDYB 3S3MA 1K8AC 4LD6A 3CMAT 5KYNA 2DXUA 2ED0A 1K9MR 3NPFA 2DL7A 3QWXX 1JXMA 4J7IA 2D1XA 4M78D 1JRIA 2JVVA 4M7AE 1S72Q 4PL6A 2JN0A 2J06A 2DA9A 3I55T 2VKNA 2QEXQ 3J81E 2DO3A 4RG8A 1KD1C 3PNWC 1G5VA 1F1BB 2OAUA 1U1SA 1OX8A 1E6HA 1AD5A 3GOXA 2CP3A 2RHIA 1Q7YU 2HBWA 2NUZA 1N9SA 3EAEA 4LDXA 2MPXC 2RQUA 1R0BG 5HY6A 2PVGB 5KE3A 4JRQA 2QG9B 3OMCA 4KBMB 1VQ4A 2OTLT 1NLOC 4HKEA 4AG2C 2DIQA 4OP0A 1TUDA 2L5QA 2CDTA 2JOYA 2FHDA 2M9UA 1VQKT 4M75F 2LX9A 1Q95G 4M7DC 2CUDA 2FVUA 3OYYA 2CZ6B 3RUXA 2QQSA 1O9SA 3OYIA 3HRUA 2L3PA 2KXDA 2KI7A 2O31A 1GBQA 4EMGA 3CCST 4C92B 1JXOA 2E6NA 1Z9ZA 3NFCA 2NUTB 1V1CA 3UWNA 2EYWA 4OMPA 3HP9A 4QQDA 4F7UB 5CCAA 4EIKA
chains in the Genus database with same CATH topology
1K1ZA 2PNIA 1SPKA 2J7IA 2LJ1A 3EHRA 5FWCA 1K0XA 2O88A 3NHNA 1AEYA 1QWEA 2ECZA 1KFZA 3M0TA 2KROA 2JS0A 1Y0MA 2LZ6B 2JS2A 4J9HA 1JQQA 1G2BA 2CREA 5HCKA 2DLPA 2EKHA 3EG0A 1UE9A 3EG2A 4OMNA 1SHFA 2K2MA 1AVZC 2DL3A 2DM1A 1GL5A 2DL8A 5GJWB 1K0SA 5I11A 2O9VA 2BTTA 1X27A 4Z8AA 4DEYA 2C0IA 1YWPA 1ZX6A 1YP5A 3UA7A 1W6XA 5IH2A 1ZUKA 1SEMA 2GNCA 2IIMA 1M30A 2C0OA 3H0IA 3UATA 2XMFA 4GBQA 4AFUC 4R0KA 1UFFA 1OPKA 2RN8A 1QLYA 1WLPB 1RLPC 4OMLA 2RNAA 4F16A 1WI7A 4Y92A 1ZSGA 5IHIA 3ULRB 2AZSA 1VYUA 1X69A 2JT4A 1NEBA 4X1VA 4HXJA 2O9SA 1WDXA 3TSWA 3EG3A 2ED1A 3H0HA 4A63B 1BB9A 1I1JA 4OMQA 2ROLA 3PE0A 4JPBW 2ESWA 2KE9A 2DE0X 2QDLA 4RTTA 1PWTA 2HEQA 2MIOA 2K6DA 5IXFA 4CC2A 4K11A 3THKA 2GTOA 2HSPA 2BZXA 3NGPA 2M51A 3QWYA 2GGRA 2KGTA 1VYTA 2CT3A 3NMZC 1ZLMA 1HD3A 2KR3A 2YUQA 3VS6A 4J9DA 2DRKA 2LNHB 4CC7A 4RTXA 3U23A 2GTJA 2RQRA 2AZVA 3TVTA 5IHNA 2KYBA 2K79A 3A98A 1T0JA 4OMOA 5I22A 2CT4A 2D8HA 2JMCA 4RTWA 4JJBA 5L23A 4FSSA 5IXBA 1YNZA 2W0ZA 2YT6A 3EHQA 3TSZA 1K4US 1NM7A 1U5SA 1X6BA 1GBRA 2AK5A 1HJDA 2K3BA 1IO6A 1X2QA 3PVLA 2SEMA 2DMOA 4GLMA 1BU1A 2DVJA 2KRMA 1GFCA 2LQWA 3O5ZA 1X2KA 4KRTA 1GCQC 1WXUA 1H92A 1BBZA 1I07A 3M0QA 4M4ZA 3VS7A 1U06A 3SHWA 1GFDA 2LX7A 1WXTA 1OEBA 1GRIA 2FEIA 3REBB 1N5ZA 4ESRA 4F14A 2LMJA 3M0PA 2A37A 2AKKA 1NLPC 2PZ1A 2MOXA 1H8KA 2KRSA 4CC4B 4J9BA 2G6FX 1ZUYA 1WXBA 1MV3A 3C0CA 2PTKA 1GCPA 2LJ0A 2YUPA 4RTUA 2HDAA 3M0SA 2FPFA 1ABQA 4JZ4A 4RTYA 2OJ2A 4LN2A 2EQIA 1MV0B 1AZGB 2DNUA 1QKXA 4JZ3A 2MCNA 3H0FA 1FYNA 3RBBB 4J9CA 1SSHA 1WA7A 3VS3A 1JO8A 2NWMA 3LH5A 2A08A 1B07A 1K76A 2VWFA 2EGCA 1M3CA 2EGEA 2KYMA 1CSKA 1M3AA 3VRYA 2YDLA 1NYFA 2RPNA 3FJ5A 2LJ3A 2X3XD 1SRMA 2YSQA 1B3QA 1AWOA 1TG0A 1JEGA 2ABLA 2DILA 1QCFA 2M0YA 3RNJA 1KSWA 4J9EA 1RLQC 1AOJA 1G83A 1UDLA 1OPLA 3JV3A 2JW4A 2L2PA 1UJYA 4LE9A 2CUBA 1A0NB 2B86A 2SRCA 1W1FA 1XOVA 3GBQA 4DEXA 4JJDA 3I35A 2J05A 4IIMA 4RTZA 1VA7A 2DX1A 4LUEA 3VS1A 4LNPA 2LCSA 1WIEA 2ROTA 3VRZA 1X6GA 1W70A 1ABOA 2C0TA 2JM9A 4HVUA 2W10A 2V1QA 5GJVB 3KFVA 1UGVA 1UECA 2L0AA 2CH4A 2DRMA 2KNBB 2KBTA 2EVRA 3I5SA 2JTEA 2JM8A 1AWWA 2A36A 1H3HA 1WX6A 3VS0A 1RI9A 4AFQC 3M0RA 2DF6A 3PVQA 3VS5A 1EFNA 2L3SA 2FPEA 2EYYA 1PKTA 2RF0A 2K9GA 1NG2A 1TUCA 4Z88A 1SHGA 1NEGA 1S1NA 2FO0A 2CSIA 4HCKA 1X43A 4RUGA 3UA6A 5FWBA 2J6OA 4ORZA 2A28A 1UG1A 1VYVA 1PKSA 2DYBA 3VS2A 1JU5C 1PNJA 2JMAA 2F2XA 4D8DA 1ARKA 1K9AA 1QKWA 2BZ8A 1WYXA 2L3QA 2RMOA 2KEAA 1UUEA 1UTIA 4E6RA 3VS4A 1YCSB 2VVKA 1T0HA 2GBQA 2F2VA 2FPDA 2FRYA 1PRLC 2EBPA 1T3LA 4RTVA 2BZYA 2JXBA 1CKAA 1PRMC 2H8HA 1U3OA 4J9IA 4J9GA 1YWOA 2I0NA 3I5RA 2YUOA 2K7AA 2ED0A 5ECAA 3NPFA 2DL4A 2AKLA 2DL7A 1JXMA 3QWXX 4AFSC 2X3WD 2GQIA 2CSQA 2D1XA 4HVVA 1E6GA 4IIOA 2J06A 1BK2A 2DA9A 4ZNXA 2VKNA 2HCKA 2OI3A 3EGUA 2D8JA 3CQTA 3M0UA 1ZBJA 4WCIA 1MUZA 2DBMA 1FMKA 1WFWA 4QT7A 1E6HA 2YUNA 1AD5A 1E7OA 2HBWA 1T3SA 2J6FA 2NUZA 3SEMA 1LCKA 4HVWA 4D8KA 5IHKA 1OV3A 2RQUA 1KIKA 3H41A 2FRWA 1Y57A 4CC3A 2EYZA 4OMMA 2DJQA 4F17A 2EW3A 1ZUUA 1NYGA 2O2OA 4AFZC 2KT8A 1NLOC 1J3TA 2FG0A 3EG1A 4AG2C 1RUWA 1AWXA 1TUDA 2RQVA 1CKBA 2CDTA 2RQWA 2EGAA 4Z89A 2ENMA 1AWJA 4LUDA 3IQLA 1YN8A 1I0CA 2CUDA 5EC7A 2F2WA 2OAWA 1SRLA 2EYXA 5FW9A 2DBKA 1AZEA 3R6NA 1PHTA 2KRNA 1M27C 2D0NA 2V1RA 1GCQA 2L3PA 2KXDA 3ZL7C 1QWFA 1M3BA 1OOTA 1M8MA 2O31A 3UF4A 2J6KA 1GBQA 1HSQA 1KJWA 1Z9QA 2EPDA 4AG1C 1JXOA 3I9QA 2LP5A 1UJ0A 1UHCA 1Z9ZA 2RQTA 3REAB 1V1CA 4JJCA 2EYWA 2KXCA 2E5KA 4OMPA 2P4RA 4J9FA 2CH4W 2KT1A 1UHFA 2DL5A 4EIKA 2LQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1Z A;  2PNI A;  1SPK A;  2J7I A;  2LJ1 A;  3EHR A;  5FWC A;  1K0X A;  2O88 A;  3NHN A;  1AEY A;  1QWE A;  2ECZ A;  1KFZ A;  3M0T A;  2KRO A;  2JS0 A;  1Y0M A;  2LZ6 B;  2JS2 A;  4J9H A;  1JQQ A;  1G2B A;  2CRE A;  5HCK A;  2DLP A;  2EKH A;  3EG0 A;  1UE9 A;  3EG2 A;  4OMN A;  1SHF A;  2K2M A;  1AVZ C;  2DL3 A;  2DM1 A;  1GL5 A;  2DL8 A;  5GJW B;  1K0S A;  5I11 A;  2O9V A;  2BTT A;  1X27 A;  4Z8A A;  4DEY A;  2C0I A;  1YWP A;  1ZX6 A;  1YP5 A;  3UA7 A;  1W6X A;  5IH2 A;  1ZUK A;  1SEM A;  2GNC A;  2IIM A;  1M30 A;  2C0O A;  3H0I A;  3UAT A;  2XMF A;  4GBQ A;  4AFU C;  4R0K A;  1UFF A;  1OPK A;  2RN8 A;  1QLY A;  1WLP B;  1RLP C;  4OML A;  2RNA A;  4F16 A;  1WI7 A;  4Y92 A;  1ZSG A;  5IHI A;  3ULR B;  2AZS A;  1VYU A;  1X69 A;  2JT4 A;  1NEB A;  4X1V A;  4HXJ A;  2O9S A;  1WDX A;  3TSW A;  3EG3 A;  2ED1 A;  3H0H A;  4A63 B;  1BB9 A;  1I1J A;  4OMQ A;  2ROL A;  3PE0 A;  4JPB W;  2ESW A;  2KE9 A;  2DE0 X;  2QDL A;  4RTT A;  1PWT A;  2HEQ A;  2MIO A;  2K6D A;  5IXF A;  4CC2 A;  4K11 A;  3THK A;  2GTO A;  2HSP A;  2BZX A;  3NGP A;  2M51 A;  3QWY A;  2GGR A;  2KGT A;  1VYT A;  2CT3 A;  3NMZ C;  1ZLM A;  1HD3 A;  2KR3 A;  2YUQ A;  3VS6 A;  4J9D A;  2DRK A;  2LNH B;  4CC7 A;  4RTX A;  3U23 A;  2GTJ A;  2RQR A;  2AZV A;  3TVT A;  5IHN A;  2KYB A;  2K79 A;  3A98 A;  1T0J A;  4OMO A;  5I22 A;  2CT4 A;  2D8H A;  2JMC A;  4RTW A;  4JJB A;  5L23 A;  4FSS A;  5IXB A;  1YNZ A;  2W0Z A;  2YT6 A;  3EHQ A;  3TSZ A;  1K4U S;  1NM7 A;  1U5S A;  1X6B A;  1GBR A;  2AK5 A;  1HJD A;  2K3B A;  1IO6 A;  1X2Q A;  3PVL A;  2SEM A;  2DMO A;  4GLM A;  1BU1 A;  2DVJ A;  2KRM A;  1GFC A;  2LQW A;  3O5Z A;  1X2K A;  4KRT A;  1GCQ C;  1WXU A;  1H92 A;  1BBZ A;  1I07 A;  3M0Q A;  4M4Z A;  3VS7 A;  1U06 A;  3SHW A;  1GFD A;  2LX7 A;  1WXT A;  1OEB A;  1GRI A;  2FEI A;  3REB B;  1N5Z A;  4ESR A;  4F14 A;  2LMJ A;  3M0P A;  2A37 A;  2AKK A;  1NLP C;  2PZ1 A;  2MOX A;  1H8K A;  2KRS A;  4CC4 B;  4J9B A;  2G6F X;  1ZUY A;  1WXB A;  1MV3 A;  3C0C A;  2PTK A;  1GCP A;  2LJ0 A;  2YUP A;  4RTU A;  2HDA A;  3M0S A;  2FPF A;  1ABQ A;  4JZ4 A;  4RTY A;  2OJ2 A;  4LN2 A;  2EQI A;  1MV0 B;  1AZG B;  2DNU A;  1QKX A;  4JZ3 A;  2MCN A;  3H0F A;  1FYN A;  3RBB B;  4J9C A;  1SSH A;  1WA7 A;  3VS3 A;  1JO8 A;  2NWM A;  3LH5 A;  2A08 A;  1B07 A;  1K76 A;  2VWF A;  2EGC A;  1M3C A;  2EGE A;  2KYM A;  1CSK A;  1M3A A;  3VRY A;  2YDL A;  1NYF A;  2RPN A;  3FJ5 A;  2LJ3 A;  2X3X D;  1SRM A;  2YSQ A;  1B3Q A;  1AWO A;  1TG0 A;  1JEG A;  2ABL A;  2DIL A;  1QCF A;  2M0Y A;  3RNJ A;  1KSW A;  4J9E A;  1RLQ C;  1AOJ A;  1G83 A;  1UDL A;  1OPL A;  3JV3 A;  2JW4 A;  2L2P A;  1UJY A;  4LE9 A;  2CUB A;  1A0N B;  2B86 A;  2SRC A;  1W1F A;  1XOV A;  3GBQ A;  4DEX A;  4JJD A;  3I35 A;  2J05 A;  4IIM A;  4RTZ A;  1VA7 A;  2DX1 A;  4LUE A;  3VS1 A;  4LNP A;  2LCS A;  1WIE A;  2ROT A;  3VRZ A;  1X6G A;  1W70 A;  1ABO A;  2C0T A;  2JM9 A;  4HVU A;  2W10 A;  2V1Q A;  5GJV B;  3KFV A;  1UGV A;  1UEC A;  2L0A A;  2CH4 A;  2DRM A;  2KNB B;  2KBT A;  2EVR A;  3I5S A;  2JTE A;  2JM8 A;  1AWW A;  2A36 A;  1H3H A;  1WX6 A;  3VS0 A;  1RI9 A;  4AFQ C;  3M0R A;  2DF6 A;  3PVQ A;  3VS5 A;  1EFN A;  2L3S A;  2FPE A;  2EYY A;  1PKT A;  2RF0 A;  2K9G A;  1NG2 A;  1TUC A;  4Z88 A;  1SHG A;  1NEG A;  1S1N A;  2FO0 A;  2CSI A;  4HCK A;  1X43 A;  4RUG A;  3UA6 A;  5FWB A;  2J6O A;  4ORZ A;  2A28 A;  1UG1 A;  1VYV A;  1PKS A;  2DYB A;  3VS2 A;  1JU5 C;  1PNJ A;  2JMA A;  2F2X A;  4D8D A;  1ARK A;  1K9A A;  1QKW A;  2BZ8 A;  1WYX A;  2L3Q A;  2RMO A;  2KEA A;  1UUE A;  1UTI A;  4E6R A;  3VS4 A;  1YCS B;  2VVK A;  1T0H A;  2GBQ A;  2F2V A;  2FPD A;  2FRY A;  1PRL C;  2EBP A;  1T3L A;  4RTV A;  2BZY A;  2JXB A;  1CKA A;  1PRM C;  2H8H A;  1U3O A;  4J9I A;  4J9G A;  1YWO A;  2I0N A;  3I5R A;  2YUO A;  2K7A A;  2ED0 A;  5ECA A;  3NPF A;  2DL4 A;  2AKL A;  2DL7 A;  1JXM A;  3QWX X;  4AFS C;  2X3W D;  2GQI A;  2CSQ A;  2D1X A;  4HVV A;  1E6G A;  4IIO A;  2J06 A;  1BK2 A;  2DA9 A;  4ZNX A;  2VKN A;  2HCK A;  2OI3 A;  3EGU A;  2D8J A;  3CQT A;  3M0U A;  1ZBJ A;  4WCI A;  1MUZ A;  2DBM A;  1FMK A;  1WFW A;  4QT7 A;  1E6H A;  2YUN A;  1AD5 A;  1E7O A;  2HBW A;  1T3S A;  2J6F A;  2NUZ A;  3SEM A;  1LCK A;  4HVW A;  4D8K A;  5IHK A;  1OV3 A;  2RQU A;  1KIK A;  3H41 A;  2FRW A;  1Y57 A;  4CC3 A;  2EYZ A;  4OMM A;  2DJQ A;  4F17 A;  2EW3 A;  1ZUU A;  1NYG A;  2O2O A;  4AFZ C;  2KT8 A;  1NLO C;  1J3T A;  2FG0 A;  3EG1 A;  4AG2 C;  1RUW A;  1AWX A;  1TUD A;  2RQV A;  1CKB A;  2CDT A;  2RQW A;  2EGA A;  4Z89 A;  2ENM A;  1AWJ A;  4LUD A;  3IQL A;  1YN8 A;  1I0C A;  2CUD A;  5EC7 A;  2F2W A;  2OAW A;  1SRL A;  2EYX A;  5FW9 A;  2DBK A;  1AZE A;  3R6N A;  1PHT A;  2KRN A;  1M27 C;  2D0N A;  2V1R A;  1GCQ A;  2L3P A;  2KXD A;  3ZL7 C;  1QWF A;  1M3B A;  1OOT A;  1M8M A;  2O31 A;  3UF4 A;  2J6K A;  1GBQ A;  1HSQ A;  1KJW A;  1Z9Q A;  2EPD A;  4AG1 C;  1JXO A;  3I9Q A;  2LP5 A;  1UJ0 A;  1UHC A;  1Z9Z A;  2RQT A;  3REA B;  1V1C A;  4JJC A;  2EYW A;  2KXC A;  2E5K A;  4OMP A;  2P4R A;  4J9F A;  2CH4 W;  2KT1 A;  1UHF A;  2DL5 A;  4EIK A;  2LQN A; 
#chains in the Genus database with same CATH topology
 1TWB A;  1OU9 A;  4PJO F;  3OYC A;  1YHQ Q;  1KFZ A;  1VQ5 Q;  3BDL A;  4C92 A;  2KRO A;  2EQU A;  3P8D A;  2DFU A;  1Y0M A;  2NUT A;  4J9H A;  2CP0 A;  4LXC A;  5HCK A;  5CK9 A;  4F7U A;  5I2M A;  2E70 A;  5GMK l;  3CCJ T;  5GAN g;  2X4J A;  3GNF B;  3A8M B;  2EJF A;  4FSX A;  2DKG A;  4FYV B;  1GL5 A;  3JCM Q;  2Z0W A;  2DL8 A;  1I81 A;  5I11 A;  3JCM d;  2BTT A;  2QQ9 A;  1X27 A;  4Z8A A;  3RES A;  1RAH B;  2M1H A;  4C92 D;  4JUV A;  3TCJ A;  1FWZ A;  1VQL A;  5IH2 A;  4XK8 E;  4EMH A;  4X34 A;  4GBQ A;  5GAO r;  3OSV A;  2RN8 A;  4XTX A;  4N0A C;  2LC4 A;  2ZAE A;  3OYB A;  4C8Q B;  3UT1 A;  2BE9 B;  2QEX T;  2HAX A;  1WHH A;  4BDZ A;  5IHI A;  1K9M C;  2AIR B;  2KSS A;  5I21 A;  4X1V A;  4BI3 A;  4HXJ A;  2HMA A;  3P8H A;  2ED1 A;  5DLQ E;  1BB9 A;  2ROL A;  3CCL Q;  4OF1 A;  4C5I A;  4C92 E;  4C8Q A;  1PD1 A;  4M7D F;  1MND A;  3RDV A;  1N8R R;  3MO8 A;  4GY5 A;  4HCZ A;  2LTO A;  4ZGE B;  3OYJ A;  2HSP A;  4F7U E;  2M51 A;  3QWY A;  3M55 A;  2EQM A;  3O8V A;  3M53 A;  2YUQ A;  4EDU A;  4XTW A;  4LDW A;  4RMO A;  3CMA A;  2CP6 A;  5HK0 A;  3TVT A;  4JDS A;  2WAC A;  4XTZ A;  5GAO m;  5GAN e;  1QVG S;  1O75 A;  5IXB A;  4XTU A;  1YNZ A;  2F5K A;  1YJW T;  4M77 B;  3EHQ A;  2NYS A;  1UGR B;  1U5S A;  3A1P A;  3QG1 A;  3ZFJ A;  2AK5 A;  2K3B A;  3OYH A;  1JJ2 A;  1NE8 A;  1Y71 A;  2SEM A;  2VAS A;  1W2B S;  2PVD B;  1QVG P;  4GLM A;  3GNG A;  1GFC A;  3OS0 A;  3C94 A;  1WXU A;  3QHS A;  3M0Q A;  4M4Z A;  4DQ2 A;  1C6V X;  2DJZ A;  1SG5 A;  1U06 A;  3X25 B;  3SHW A;  1VQ5 T;  1BI2 A;  1GFD A;  1WXT A;  4JRI A;  3OS2 A;  1GRI A;  2FEI A;  4C8Q E;  1W2B P;  3WXM B;  2OTL A;  2NLU A;  4ESR A;  3LH0 A;  3AHU A;  3M0P A;  2CZ7 B;  1M1K C;  1VQK A;  2PZ1 A;  2G6F X;  1VQ9 T;  1YFN A;  1H3Z A;  3PMI A;  2VXF A;  1VQ7 A;  3C0C A;  4A53 A;  8AT1 B;  2Y4X A;  3EGX B;  4JRP A;  2FPF A;  4M77 D;  3PTA A;  4FYY B;  3M59 A;  1ZSZ C;  1UGP B;  4V2S A;  3CCQ A;  4XU0 A;  1AZG B;  1WHK A;  3L2R A;  4BUG A;  1FYN A;  3JRZ A;  4KT0 E;  3L2V A;  4HT9 A;  2HQH A;  4A4H A;  2DXT A;  1C1A A;  1Q7Y R;  3JCM g;  1SSH A;  1WA7 A;  3VS3 A;  3CCS A;  1JO8 A;  4NL3 A;  2YLB A;  3LH5 A;  1B07 A;  3EGX A;  4TVR A;  1CSK A;  4PJO G;  1VQ6 T;  1IZ6 A;  3BE3 A;  3HHT B;  3M57 A;  2X3X D;  5I2S A;  1Q86 R;  2HKN A;  1AOJ A;  1UDL A;  4FM4 B;  3EH1 A;  4FYX B;  2RJC A;  4BI8 B;  2DTH A;  4ZGD B;  3BFM A;  1W1F A;  1U8R A;  4DBF A;  4DEX A;  1NJI C;  3A8H B;  4RTZ A;  1VA7 A;  4LUE A;  3QZ9 B;  1LNX A;  5D6Y A;  3CCM Q;  3T9N A;  1BYM A;  5GMK m;  1W70 A;  3ZBD A;  3EG9 B;  1ABO A;  3OYE A;  4IUV A;  2FZC B;  1P92 A;  2EYQ A;  3KFV A;  1N8R C;  1UGV A;  1UEC A;  2L0A A;  3A8L B;  5EG2 A;  2DRM A;  1S72 A;  2JTE A;  3MP6 A;  2R5A A;  1WX6 A;  1WPY A;  2MAM A;  4ATO A;  1YI2 Q;  2QEX A;  3F70 A;  1EFN A;  2L3S A;  3MHX A;  1D0Y A;  3Q1J A;  2HD0 A;  3EG9 A;  3E2U A;  2K9G A;  1NG2 A;  3OW2 A;  3UA6 A;  2JTM A;  3JCM e;  5CO7 A;  1PD0 A;  5FU6 C;  1PKS A;  3OBY A;  3CME T;  2DYB A;  2F2X A;  1ARK A;  5CKB A;  5KYU B;  2L3R A;  4IKF A;  3CCR Q;  1QKW A;  2L3Q A;  2RMO A;  3QUI A;  3E9G A;  3VS4 A;  4PJL A;  4DOW A;  2ZCF B;  1JBM A;  1LJO A;  2LQ8 A;  2FL7 A;  3VJP A;  4OGC A;  3C4S A;  1PRM C;  2H8H A;  3CBO A;  4E2F B;  1YWO A;  2YRC A;  3G7Z A;  5GAN 5;  2K3X A;  2G3R A;  5KYU A;  3QZ5 B;  2DD4 A;  3V7S A;  4AFS C;  2X3W D;  6AT1 B;  2KDS A;  2GQI A;  2CSQ A;  2QQR A;  1YIJ Q;  3JCM J;  4HVV A;  3WVD B;  1YJ9 Q;  3OYG A;  3I55 Q;  2P0Q A;  1BK2 A;  1TS9 A;  2HCK A;  1VQO Q;  2OI3 A;  3EGU A;  2ZPB B;  3CQT A;  2LCL A;  3RKY A;  3M0U A;  4GLK A;  3D7S B;  3EFR A;  2LVM A;  1YHQ A;  2YUN A;  4X9D A;  5A0G A;  1VQ5 A;  1TUG B;  1OYX A;  4J8O A;  3JB9 J;  3H41 A;  1WHL A;  3DB3 A;  4C5G A;  4CC3 A;  4AMC A;  2DJQ A;  4MMK A;  2EW3 A;  2OTJ A;  1NYG A;  1KC8 U;  4AFZ C;  4F7U G;  3QSU A;  1OU8 A;  2FG0 A;  3MCA B;  1RUW A;  2RQV A;  2LDM A;  1CKB A;  2VGM A;  4C0D C;  5GAN 3;  3MPU B;  2R57 A;  3CCM T;  4LUD A;  4BE0 A;  3OYA A;  1I0C A;  1Q86 C;  3CCV Q;  5EC7 A;  2F2W A;  2RK2 A;  5GAN 8;  2MWP A;  4MDX A;  1PHT A;  2LNV A;  3FB9 A;  4J6X A;  1TTH B;  3E19 A;  2DEU A;  4JS5 A;  1KK7 A;  1PSE A;  3CC2 T;  5GMK e;  1YI2 T;  2J6K A;  1KJW A;  1UEB A;  2I2L A;  2EPD A;  1QMC A;  1EZZ B;  3I9Q A;  5GMK i;  3NTK A;  2LP5 A;  1M9S A;  4M75 D;  3VKI A;  4M78 B;  1WJS A;  3REA B;  1YCY A;  4JJC A;  3G6E Q;  2PU9 B;  4BDY A;  1K73 C;  2KT1 A;  3V8J A;  2DL5 A;  4KUD K;  1K1Z A;  2DXB A;  3VV0 A;  2LJ1 A;  2X4X A;  3CCL A;  5FWC A;  2MK5 A;  1K0X A;  3NHN A;  4M7A C;  1QWE A;  2KK4 A;  4C8Q G;  3I56 Q;  4J7F A;  2ZPG B;  3MEW A;  4QVZ A;  4DA4 A;  2JS2 A;  4M78 A;  3GIB A;  1JQQ A;  1G2B A;  3CCJ Q;  2DLP A;  2EKH A;  1WGS A;  1U1T A;  2YRD A;  2BIV A;  2BKD N;  4OMN A;  1SHF A;  3QJ6 A;  2FZK B;  2DL3 A;  4UC4 A;  2PQW A;  4RCB A;  2EIF A;  2HL3 A;  3A8O B;  4DEY A;  3L1A A;  2C0I A;  3CBP A;  4Y28 E;  3UA7 A;  3L42 A;  2GNC A;  2QA4 Q;  2XDB A;  3MP8 A;  2C0O A;  1YIJ T;  3CXC S;  1YJ9 T;  1ZA2 B;  4FT2 A;  2MWO A;  1OPK A;  1IXD A;  1LOJ A;  1R77 A;  3M4G A;  3V8K A;  2XHC A;  1WLP B;  1N9R A;  1VQO T;  4PLI A;  2K3Y A;  1RLP C;  2RNA A;  3SB2 A;  3QO3 A;  4F16 A;  1B34 B;  1WI7 A;  2V26 A;  1PM3 A;  3CXC P;  3LGL A;  2E5Q A;  2DD5 A;  1WDX A;  3TSW A;  1XQH A;  2QGF B;  3EG3 A;  2IPO B;  3H0H A;  4A63 B;  1I1J A;  3PE0 A;  2MF2 A;  2ESW A;  2KE9 A;  4M78 E;  1PWT A;  2HEQ A;  1W4S A;  2MIO A;  1B34 A;  1D0Z A;  2MI6 A;  4EMK B;  2BZX A;  2JJ9 A;  1VQN Q;  2RHX A;  1BI3 A;  4PFO A;  4IUQ A;  2CT3 A;  3NMZ C;  1ZLM A;  1HD3 A;  3WVE B;  1QP3 A;  3VUB A;  2KR3 A;  1IHV A;  4J9D A;  1M90 U;  3CCV T;  4CC7 A;  4A54 A;  5KH6 A;  3U23 A;  2RQR A;  2AZV A;  3QXE B;  2KYB A;  2K79 A;  3VYH B;  1VOM A;  4M7D D;  3A98 A;  1T0J A;  2CZ0 B;  5I22 A;  4EMK A;  3JCM X;  4JJB A;  1YJW Q;  5L23 A;  2ZPI B;  3TU4 K;  2P0K A;  1WHG A;  2W0Z A;  2YT6 A;  4M7A F;  1K4U S;  1X6B A;  3G6E T;  1Q81 U;  2CP2 A;  2XD0 A;  2GQV A;  3BW1 A;  2KRM A;  1X6O A;  3O5Z A;  3CPW A;  1Q82 U;  1H92 A;  1BBZ A;  1I07 A;  1Y7X A;  3VS7 A;  4B6M A;  2V8K A;  8ATC B;  2LX7 A;  3I56 T;  3OYD A;  4QQG A;  4BY6 B;  1B7T A;  3RR6 A;  3REB B;  1XNI A;  2AT1 B;  2XU8 A;  4F14 A;  1VQ9 Q;  2AKK A;  1NLP C;  1V76 A;  4CC4 B;  2KRS A;  1ZUY A;  3CCM A;  4XTV A;  4E47 A;  1IB8 A;  1KHC A;  2RH2 A;  4L59 A;  4MML A;  1GCP A;  3H8Z A;  2YUP A;  4RTU A;  3PGG A;  5FRO A;  1K8A U;  4YTL A;  4JZ4 A;  4RTY A;  1KQ1 A;  4LN2 A;  2EQI A;  2QA4 T;  2BE7 D;  1IHW A;  3JCM V;  1PCX A;  2E41 A;  3LW5 E;  1VQ8 Q;  3PIO A;  2QAZ A;  2NWM A;  5KCH A;  3HTR A;  1K76 A;  2VWF A;  3E9F A;  4FT4 A;  4VUB A;  2XK0 A;  1VQ6 Q;  3JB9 I;  1VIF A;  2ZPF B;  2COW A;  3SDZ A;  5LJ5 h;  1KC8 R;  3VRY A;  3OYF A;  2RPN A;  4OGE A;  1KD1 U;  1SRM A;  1B3Q A;  1JEG A;  2K5I A;  1PC0 A;  1WQ7 A;  3RNJ A;  3J7A F;  1KSW A;  4IUT A;  3C95 A;  3CCR A;  5LJ5 f;  2B8A A;  5FRM A;  5AYF A;  2QXF A;  3RIR A;  1R8O B;  3SWN C;  2CUB A;  1VQN T;  3H9N A;  1D1A A;  3R6O A;  3GBQ A;  2A7Y A;  1Y96 B;  2O4X B;  4IIM A;  2H3E B;  1H64 1;  2MYS A;  3VS1 A;  4LNP A;  3JCM b;  2ROT A;  4LD9 K;  3VRZ A;  3V7R A;  5CKE A;  4C8Q C;  2JM9 A;  3X26 B;  5GJV B;  2OX7 A;  2D6F A;  1YJ9 A;  3I55 A;  3OA6 A;  2DZ9 A;  3I5S A;  4ZGJ B;  2JM8 A;  5CQX A;  1H3H A;  1Y96 A;  2O4X A;  1VQO A;  3VS0 A;  1YJN Q;  4AFQ C;  3FEO A;  2DF6 A;  2HL5 C;  3VS5 A;  4MZT A;  4IUR A;  1YBY A;  1PKT A;  1WHM A;  3EH2 A;  2RF0 A;  3X20 B;  1TUC A;  1YIT T;  1M5Q 1;  4XTY A;  3RMS A;  3N5B B;  2BUD A;  4M77 A;  5D6W A;  4MZP A;  2CP5 A;  3EFO B;  3CCE Q;  2E6Z A;  3CME Q;  2KVQ G;  2NUP B;  1SKU B;  4E7S A;  2CS7 A;  1HXD A;  3VUZ A;  5KYW B;  3VS2 A;  3MEV A;  1PNJ A;  1V29 B;  4HCB A;  4C92 F;  1K9A A;  2COY A;  3L2U A;  3CCU T;  1UUE A;  1HK9 A;  4IUU A;  2YHT A;  1YCS B;  2X51 A;  4J5Y A;  1QCN A;  4F7U F;  2GBQ A;  1I8F A;  1PRL C;  2EBP A;  1T3L A;  3EFO A;  3CCV A;  4XU1 A;  2NUP A;  4F04 B;  1U3O A;  4J9I A;  5KYW A;  1MMA A;  5GAM h;  2I0N A;  4DBH A;  1QVP A;  4PNO A;  2YUO A;  4M7A G;  2K7A A;  2RJE A;  5AT1 B;  2DL4 A;  1NPR A;  4ZN3 A;  3JB9 G;  1VQ8 T;  2XKO C;  2RHU A;  1BI1 A;  5GAM f;  2QTV A;  3G6E A;  4CRI A;  3UDC A;  3VU3 C;  2D8J A;  3PT9 A;  3FC3 A;  1ZBJ A;  4WCI A;  4XAX B;  4JLG A;  2DBM A;  2QQB A;  3MEU A;  4KH1 B;  1WFW A;  1ACM B;  2CGH A;  1K9M U;  1WZO A;  4M77 E;  5GAO p;  3S3N A;  1E7O A;  3I56 A;  2J6F A;  3SEM A;  1LCK A;  5FLX E;  5IHK A;  1M90 R;  2DTO A;  4J6Y A;  3JCM c;  3CPF A;  4M78 G;  3CCJ A;  2EYZ A;  5IT9 E;  1D1C A;  1JJ2 S;  4F17 A;  4C8Q F;  1KHI A;  4J6W A;  1KC8 C;  3EG1 A;  2X4W A;  5CQY A;  4AT1 B;  1UGQ B;  1BIA A;  4KGZ B;  2RHZ A;  1AWX A;  2DZC A;  1MMN A;  2PUK B;  2RQW A;  5GAN 2;  1HYO A;  2ENM A;  1BCM A;  1AWJ A;  1JJ2 P;  3IQL A;  5FU6 B;  2VYT A;  1YN8 A;  5A0D A;  1Q81 R;  1GXI E;  5FW9 A;  2QA4 A;  3R6N A;  2KRN A;  4FW2 A;  4HCC A;  2V1R A;  1GCQ A;  3CC2 Q;  3TEE A;  1QVF A;  4PJN A;  3ZL7 C;  3ZEH A;  1QWF A;  1OOT A;  3V7C A;  1YJN T;  3JCM W;  4AG1 C;  5GAN 4;  4B9W A;  1UJ0 A;  1UHC A;  1ZHI A;  2E3I A;  2KXC A;  3OYN A;  1G8X A;  2CH4 W;  2LQN A;  2K57 A;  3INZ A;  2PNI A;  3CCE T;  2DET A;  4OB2 B;  2O88 A;  5DM7 R;  5GAN 7;  1LPL A;  2FZG B;  2XDP A;  2JS0 A;  2LZ6 B;  1K8A R;  2DIG A;  3HL8 A;  4OMF B;  2CRE A;  1N27 A;  4D6W A;  3EG2 A;  2LT4 A;  1VQP Q;  1AVZ C;  5GMK h;  5FU7 C;  1VQ4 T;  1M1K U;  5GJW B;  2VGN A;  1RAA B;  2YLC A;  5LJ3 h;  1MMD A;  2VUB A;  2RA2 A;  4L6V 5;  1YP5 A;  2LCC A;  1W6X A;  1KQS A;  1ZUK A;  1YJW A;  1KD1 R;  4KGV B;  1M30 A;  2DEQ A;  3DB4 A;  1UGS B;  3NTH A;  1UFF A;  2E12 A;  4LDU A;  2P0P A;  4PKC C;  1OZ2 A;  5LJ3 f;  1X75 C;  1QLY A;  5LJ5 j;  3TRE A;  5IAY A;  4Y92 A;  3QBY A;  3ULR B;  1VYU A;  1X69 A;  4M75 B;  1Q7Y C;  2YXY A;  2YRV A;  4C92 G;  2O9S A;  1FX7 A;  1NBE B;  3QJY A;  3M58 A;  2QGG A;  3HRS A;  1M2V B;  4OMQ A;  5DLO A;  1FMW A;  1G3S A;  4BAC A;  1TU0 B;  2FB7 A;  2DE0 X;  3CC4 Q;  2QDL A;  4RTT A;  3CD6 Q;  1VQ9 A;  4Z02 A;  3OW2 S;  2GTO A;  3NGP A;  2RO0 A;  4C0G A;  4M75 A;  2RI3 A;  2KGT A;  5A2Q E;  1NJI U;  3OS1 A;  1G3W A;  2QK0 A;  2LNH B;  1M2V A;  3OBW A;  3OW2 P;  3FJP A;  5CKF A;  1NPP A;  3OS5 A;  2DXC A;  2D9T A;  4NS5 A;  1VQM Q;  4QVC A;  1VQ8 A;  4PJO B;  4RKU E;  2CT4 A;  2JMC A;  4RTW A;  3G4S Q;  3FLG A;  1VQ6 A;  4ZTF A;  5A0L A;  3G1J A;  2KQW A;  4P5N A;  1R0C B;  1HJD A;  3PVL A;  3X24 B;  3OB9 A;  1IRX A;  4Y91 A;  4NOY A;  2WSE E;  1BU1 A;  4PFZ A;  3EGD B;  3L2W A;  4PJO A;  3QII A;  2EFI A;  2JNG A;  3KBG A;  1WHJ A;  9ATC B;  4DBQ A;  1ZA1 B;  1OEB A;  3SD4 A;  4XQ3 A;  1KG1 A;  1XJW B;  1N5Z A;  3A8G B;  2XID A;  5J3B A;  1RAI B;  1VQP T;  4M75 E;  2A37 A;  3EGD A;  2MOX A;  4J9B A;  3MJX A;  5GAM j;  4PJO D;  1WXB A;  1MV3 A;  1RL2 A;  2PTK A;  2QYZ A;  3CC7 Q;  2LJ0 A;  1BKB A;  5LL6 S;  2QQA A;  2VV5 A;  2HDA A;  3MEA A;  1ABQ A;  1OUL A;  3MKD A;  2LT1 A;  2OJ2 A;  2CP7 A;  2M02 A;  4M78 C;  1MV0 B;  1BIB A;  4JZ3 A;  3H0F A;  3HPW A;  3RBB B;  1YJN A;  2K2V A;  4OVA A;  5LJ5 d;  4M7D B;  2A08 A;  2EGC A;  2HBP A;  2EGE A;  2IG0 A;  1EIF A;  4JLI A;  5GAO n;  2L89 A;  3JCM P;  4QKU A;  2YDL A;  1NYF A;  3LYI A;  3FJ5 A;  3CCE A;  4M77 G;  3CME A;  3E1S A;  4PJO E;  4BB7 A;  2DK3 A;  4KGX B;  2YSQ A;  1TG0 A;  2ABL A;  4M7D A;  3JB9 H;  1RLQ C;  5CIU A;  3CC4 T;  1G83 A;  4NL2 A;  3GP8 A;  2MMP A;  1OPL A;  2DER A;  3JV3 A;  3CD6 T;  2JW4 A;  3G71 Q;  4PJM A;  2H3J A;  1A0N B;  2SRC A;  2DYI A;  3RER A;  4JJD A;  4ZTJ A;  2DX1 A;  2C06 A;  4BD3 A;  2LCS A;  1FMV A;  1X6G A;  1D09 B;  4C5E A;  2C0T A;  4HVU A;  1VQM T;  1VQ7 T;  2V1Q A;  1NZ9 A;  1Q86 U;  3MET A;  2Y4Y A;  2GFU A;  2KNB B;  4E7Z A;  3PIP A;  3G4S T;  4A4G A;  1WJQ A;  1QP2 A;  2YWW A;  2E1H A;  4CI0 C;  2GCX A;  3CCQ T;  3QDR B;  2AHJ B;  2L8D A;  3JB9 F;  3PVQ A;  3OY9 A;  4ZN1 A;  2FPE A;  2EYY A;  3QYG B;  2ZPH B;  1YIT Q;  4KUI A;  1SHG A;  1K73 U;  3NTI A;  1X43 A;  2KY9 A;  2J6O A;  4EMK C;  2A28 A;  1M1K R;  1M1F A;  1RAD B;  4M7D E;  2HZY A;  2EJG A;  1JU5 C;  2JMA A;  3BY7 A;  4D8D A;  3CCU Q;  5GAN h;  4DOV A;  4M78 F;  1OX9 A;  5GMK j;  1ZBX A;  2KEA A;  1QVG A;  5GAM d;  2HQX A;  2ATC B;  4MDW A;  2VVK A;  1TOV A;  1T0H A;  5LJ3 j;  2F2V A;  4N0A A;  2FPD A;  1TXQ A;  2FRY A;  4RTV A;  3CC7 T;  2BZY A;  2JXB A;  4C92 C;  1M8V A;  2OTJ Q;  4PFP A;  2KAF A;  4II1 A;  5GAN f;  4OB1 B;  4J9G A;  2DAQ A;  2KMT A;  3CC2 A;  3I5R A;  1YI2 A;  1W2B A;  3GF5 A;  5ECA A;  4PJJ A;  4A4F A;  1M4Z A;  2AKL A;  2E3H A;  3SWN B;  4KH0 B;  2P84 A;  2R58 A;  1AHJ B;  1E6G A;  4IIO A;  2DVE A;  1RAF B;  5CKD A;  1S72 T;  1PSF A;  4ZNX A;  2ZZD A;  2X4Y A;  3RKX A;  2ZPE B;  4X9C A;  4BY6 C;  4ANJ A;  1MNE A;  1MUZ A;  4OB0 B;  4BE2 A;  2X9H A;  3PFS A;  4O5V A;  1FMK A;  3SWN A;  3RMQ A;  4QT7 A;  5LJ5 g;  4A4E A;  5HKC A;  2XI9 A;  2IVW A;  4LDY A;  1T3S A;  1NJI R;  4HVW A;  4D8K A;  1OV3 A;  1KIK A;  2FRW A;  1Y57 A;  2O01 E;  4OMM A;  5CVI A;  1G3Y A;  3G71 T;  1ZUU A;  3LX7 A;  2O2O A;  1TH7 A;  2QAS A;  2LRQ A;  4OB3 B;  2KT8 A;  3OSS C;  1J3T A;  1VQP A;  1AT1 B;  4QW2 A;  1PG5 B;  3CPW S;  3GPL A;  3LGF A;  2EGA A;  4Z89 A;  3UPU A;  2P4T A;  2RJD A;  3A5Z B;  1YIJ A;  2OAW A;  1SRL A;  2EYX A;  2DBK A;  1AZE A;  3M54 A;  1DJ7 B;  5DY9 A;  1M27 C;  4J83 A;  3CPW P;  2D0N A;  4C8Q D;  1M3B A;  2E64 A;  5M9O A;  1M8M A;  2RK1 A;  3UF4 A;  2D0Q B;  1HSQ A;  2XIC A;  1Z9Q A;  1KQ2 A;  3V8L A;  1ZSZ B;  2X35 A;  2RQT A;  5HK3 A;  5CAI A;  2E5K A;  2P4R A;  4J9F A;  1UHF A;  3P8B B;  3BDU A;  3ME9 A;  1N6A A;  5CR2 A;  1SPK A;  2EQK A;  2J7I A;  3PMT A;  1LVK A;  4XU2 A;  3EHR A;  5GAN 6;  3S3O A;  4HT8 A;  3M5A A;  3L2Q A;  1AEY A;  3SFM A;  3CC4 A;  2ECZ A;  4DBR A;  3J80 E;  3CD6 A;  3M0T A;  1YHQ T;  4QVD A;  1ZSZ A;  3X28 B;  4M75 G;  1RAB B;  3EG0 A;  5LJ3 d;  4ELZ C;  1VQ4 Q;  1UE9 A;  5LJ5 e;  2K2M A;  4WF2 A;  2A0F B;  4PLL A;  2OTJ T;  2DM1 A;  2JUF A;  4M77 C;  1K0S A;  2Y90 A;  3CBM A;  2O9V A;  1TSF A;  1OQK A;  1VQM A;  1RAG B;  1YWP A;  1ZX6 A;  3G4S A;  3JCM h;  1SEM A;  2IIM A;  5GAM g;  1QQJ A;  3QYH B;  4QQ6 A;  3UAT A;  3H0I A;  4N4G A;  4FL6 A;  2XMF A;  4AFU C;  4R55 A;  5KYX B;  4R0K A;  2RI2 A;  4Q5W A;  4E7H A;  3CEY A;  5KCO A;  3H6Z A;  4E7I A;  2RD1 A;  4OML A;  4JJN K;  3TQ7 P;  3JCM f;  1EX4 A;  1ZSG A;  5KE2 A;  3KXT A;  2AZS A;  2ZGW A;  2EQJ A;  2JT4 A;  1NEB A;  3ER0 A;  3M9Q A;  4B9X A;  1VUB A;  4PK4 A;  5KYX A;  2GF7 A;  1SSF A;  1UB4 A;  1WQW A;  1IGU A;  4JPB W;  1IRE B;  1MMG A;  3CCL T;  7AT1 B;  2XG8 D;  2K6D A;  4HA8 A;  5D7U A;  5IXF A;  4CC2 A;  4K11 A;  2COZ A;  3THK A;  3HFO A;  2GGR A;  1VYT A;  3M4Y A;  3CC7 A;  2EJ9 A;  3VS6 A;  3OYL A;  2DRK A;  4RTX A;  5J26 A;  3ASK A;  2GTJ A;  2M16 A;  1Q82 R;  4MZM A;  5IHN A;  2E10 A;  4KUL A;  1K73 R;  2LQK A;  4OMO A;  1VQL Q;  2D8H A;  4ME7 A;  2DPP B;  4FSS A;  5C6S A;  1D0X A;  2HSE B;  4FYW B;  4N4H A;  5FU7 B;  2M0O A;  3TSZ A;  1NM7 A;  3OMG A;  3LLR A;  2HNI A;  1XTD A;  3URG A;  1GBR A;  1IO6 A;  3QDF A;  1X2Q A;  3KUF A;  4WTO B;  2PVO B;  1BCO A;  2DMO A;  5GAM e;  2DVJ A;  2LQW A;  1X2K A;  2K5F A;  3EFS A;  4KRT A;  1GCQ C;  1Y07 A;  3HFN A;  4M7D G;  2F1L A;  4M77 F;  1D1B A;  5GAN j;  3OYK A;  4LDV A;  1VQN A;  2RB6 A;  3G71 A;  3QKJ A;  1I5O B;  2F5T X;  1FXX A;  2E65 A;  2LMJ A;  3M56 A;  1H8K A;  4BI4 A;  4ELY C;  4EPC A;  5D6X A;  2R5M A;  3LWI A;  2F69 A;  2HKQ B;  3M0S A;  2VXE A;  3FIF A;  2WSF E;  3HRT A;  3CMA Q;  5LJ3 g;  2DNU A;  4IUP A;  1QKX A;  2CZ1 B;  2RI5 A;  4RCC A;  4C0D B;  4XU3 A;  2MCN A;  4A4K A;  4J9C A;  1G3T A;  1VIE A;  1JB0 E;  2JTF A;  4E7J A;  2V8I A;  4R56 A;  5FRN A;  1YIT A;  1M3C A;  1IGQ A;  3GLX A;  3VYG A;  2VB6 A;  2KYM A;  1RAE B;  4FW1 A;  1M3A A;  4JRK A;  1D3B B;  1RAC B;  1QVF S;  2DTI A;  2RHY A;  2LJ3 A;  1SF9 A;  4BE1 A;  2FYK A;  1AWO A;  5CKH A;  2WSC E;  2E4H A;  2DIL A;  1QCF A;  3JAM E;  2M0Y A;  4J9E A;  3CCU A;  1QW1 A;  4C0Z A;  1RI0 A;  5J39 A;  3C12 A;  2CYZ B;  1QCO A;  2L2P A;  1QVF P;  1UJY A;  4LE9 A;  3RKW A;  2XDD A;  3FDR A;  2B86 A;  1D3B A;  1XOV A;  1WJR A;  3AT1 B;  2OTL Q;  5GAO q;  2GFA A;  3CXC A;  2K4Y A;  4M7A B;  3FRN A;  3I35 A;  2J05 A;  3HSB A;  1M90 C;  1M2O A;  2JZ2 A;  4O6J A;  3HKS A;  1VQK Q;  3JSC A;  4N4I A;  4FCY A;  1WIE A;  1WNL A;  1VQ7 Q;  3L2Z A;  1N8R U;  2W10 A;  3S6W A;  4FIB A;  1VQL T;  1I4K 1;  4E7L A;  2CH4 A;  2KBT A;  2EVR A;  3CCQ Q;  2EKO A;  1AWW A;  2A36 A;  4M75 C;  1MGQ A;  4M7A A;  1I5L A;  5C0M A;  1RI9 A;  5L8R E;  3M0R A;  1Q81 C;  5KYY B;  2RJF A;  2K5L A;  3OQ5 A;  3CCS Q;  3DKM A;  2QI2 A;  2VC8 A;  4E7K A;  5LJ3 e;  2HQE A;  2EAY A;  1Q82 C;  4Z88 A;  1KQS S;  1NEG A;  2RM4 A;  1S1N A;  2FO0 A;  2CSI A;  4HCK A;  1M1G A;  2A3L A;  4RUG A;  3LWH A;  5FWB A;  4ORZ A;  2PUO B;  5GAN d;  1UG1 A;  1VYV A;  1OZ3 A;  2CKK A;  5IN1 A;  4M7A D;  3MP1 A;  2V8J A;  4RG2 A;  3DLL A;  5KYY A;  1MHN A;  1X01 A;  4FU6 A;  1KQS P;  1C0M A;  3JB9 D;  3OYM A;  4C5H A;  2BZ8 A;  1WYX A;  2EWN A;  3CCR T;  1UTI A;  4E6R A;  1OI1 A;  2QTX A;  4L5G A;  1BI0 A;  1ZQ1 A;  3QPH A;  4PJO C;  4JS4 A;  4C0F A;  3DLM A;  1CKA A;  5GAO l;  2QDY B;  3S3M A;  1K8A C;  4LD6 A;  3CMA T;  5KYN A;  2DXU A;  2ED0 A;  1K9M R;  3NPF A;  2DL7 A;  3QWX X;  1JXM A;  4J7I A;  2D1X A;  4M78 D;  1JRI A;  2JVV A;  4M7A E;  1S72 Q;  4PL6 A;  2JN0 A;  2J06 A;  2DA9 A;  3I55 T;  2VKN A;  2QEX Q;  3J81 E;  2DO3 A;  4RG8 A;  1KD1 C;  3PNW C;  1G5V A;  1F1B B;  2OAU A;  1U1S A;  1OX8 A;  1E6H A;  1AD5 A;  3GOX A;  2CP3 A;  2RHI A;  1Q7Y U;  2HBW A;  2NUZ A;  1N9S A;  3EAE A;  4LDX A;  2MPX C;  2RQU A;  1R0B G;  5HY6 A;  2PVG B;  5KE3 A;  4JRQ A;  2QG9 B;  3OMC A;  4KBM B;  1VQ4 A;  2OTL T;  1NLO C;  4HKE A;  4AG2 C;  2DIQ A;  4OP0 A;  1TUD A;  2L5Q A;  2CDT A;  2JOY A;  2FHD A;  2M9U A;  1VQK T;  4M75 F;  2LX9 A;  1Q95 G;  4M7D C;  2CUD A;  2FVU A;  3OYY A;  2CZ6 B;  3RUX A;  2QQS A;  1O9S A;  3OYI A;  3HRU A;  2L3P A;  2KXD A;  2KI7 A;  2O31 A;  1GBQ A;  4EMG A;  3CCS T;  4C92 B;  1JXO A;  2E6N A;  1Z9Z A;  3NFC A;  2NUT B;  1V1C A;  3UWN A;  2EYW A;  4OMP A;  3HP9 A;  4QQD A;  4F7U B;  5CCA A;  4EIK A; 
#chains in the Genus database with same CATH homology
 1K1Z A;  2PNI A;  1SPK A;  2J7I A;  2LJ1 A;  3EHR A;  5FWC A;  1K0X A;  2O88 A;  3NHN A;  1AEY A;  1QWE A;  2ECZ A;  1KFZ A;  3M0T A;  2KRO A;  2JS0 A;  1Y0M A;  2LZ6 B;  2JS2 A;  4J9H A;  1JQQ A;  1G2B A;  2CRE A;  5HCK A;  2DLP A;  2EKH A;  3EG0 A;  1UE9 A;  3EG2 A;  4OMN A;  1SHF A;  2K2M A;  1AVZ C;  2DL3 A;  2DM1 A;  1GL5 A;  2DL8 A;  5GJW B;  1K0S A;  5I11 A;  2O9V A;  2BTT A;  1X27 A;  4Z8A A;  4DEY A;  2C0I A;  1YWP A;  1ZX6 A;  1YP5 A;  3UA7 A;  1W6X A;  5IH2 A;  1ZUK A;  1SEM A;  2GNC A;  2IIM A;  1M30 A;  2C0O A;  3H0I A;  3UAT A;  2XMF A;  4GBQ A;  4AFU C;  4R0K A;  1UFF A;  1OPK A;  2RN8 A;  1QLY A;  1WLP B;  1RLP C;  4OML A;  2RNA A;  4F16 A;  1WI7 A;  4Y92 A;  1ZSG A;  5IHI A;  3ULR B;  2AZS A;  1VYU A;  1X69 A;  2JT4 A;  1NEB A;  4X1V A;  4HXJ A;  2O9S A;  1WDX A;  3TSW A;  3EG3 A;  2ED1 A;  3H0H A;  4A63 B;  1BB9 A;  1I1J A;  4OMQ A;  2ROL A;  3PE0 A;  4JPB W;  2ESW A;  2KE9 A;  2DE0 X;  2QDL A;  4RTT A;  1PWT A;  2HEQ A;  2MIO A;  2K6D A;  5IXF A;  4CC2 A;  4K11 A;  3THK A;  2GTO A;  2HSP A;  2BZX A;  3NGP A;  2M51 A;  3QWY A;  2GGR A;  2KGT A;  1VYT A;  2CT3 A;  3NMZ C;  1ZLM A;  1HD3 A;  2KR3 A;  2YUQ A;  3VS6 A;  4J9D A;  2DRK A;  2LNH B;  4CC7 A;  4RTX A;  3U23 A;  2GTJ A;  2RQR A;  2AZV A;  3TVT A;  5IHN A;  2KYB A;  2K79 A;  3A98 A;  1T0J A;  4OMO A;  5I22 A;  2CT4 A;  2D8H A;  2JMC A;  4RTW A;  4JJB A;  5L23 A;  4FSS A;  5IXB A;  1YNZ A;  2W0Z A;  2YT6 A;  3EHQ A;  3TSZ A;  1K4U S;  1NM7 A;  1U5S A;  1X6B A;  1GBR A;  2AK5 A;  1HJD A;  2K3B A;  1IO6 A;  1X2Q A;  3PVL A;  2SEM A;  2DMO A;  4GLM A;  1BU1 A;  2DVJ A;  2KRM A;  1GFC A;  2LQW A;  3O5Z A;  1X2K A;  4KRT A;  1GCQ C;  1WXU A;  1H92 A;  1BBZ A;  1I07 A;  3M0Q A;  4M4Z A;  3VS7 A;  1U06 A;  3SHW A;  1GFD A;  2LX7 A;  1WXT A;  1OEB A;  1GRI A;  2FEI A;  3REB B;  1N5Z A;  4ESR A;  4F14 A;  2LMJ A;  3M0P A;  2A37 A;  2AKK A;  1NLP C;  2PZ1 A;  2MOX A;  1H8K A;  2KRS A;  4CC4 B;  4J9B A;  2G6F X;  1ZUY A;  1WXB A;  1MV3 A;  3C0C A;  2PTK A;  1GCP A;  2LJ0 A;  2YUP A;  4RTU A;  2HDA A;  3M0S A;  2FPF A;  1ABQ A;  4JZ4 A;  4RTY A;  2OJ2 A;  4LN2 A;  2EQI A;  1MV0 B;  1AZG B;  2DNU A;  1QKX A;  4JZ3 A;  2MCN A;  3H0F A;  1FYN A;  3RBB B;  4J9C A;  1SSH A;  1WA7 A;  3VS3 A;  1JO8 A;  2NWM A;  3LH5 A;  2A08 A;  1B07 A;  1K76 A;  2VWF A;  2EGC A;  1M3C A;  2EGE A;  2KYM A;  1CSK A;  1M3A A;  3VRY A;  2YDL A;  1NYF A;  2RPN A;  3FJ5 A;  2LJ3 A;  2X3X D;  1SRM A;  2YSQ A;  1B3Q A;  1AWO A;  1TG0 A;  1JEG A;  2ABL A;  2DIL A;  1QCF A;  2M0Y A;  3RNJ A;  1KSW A;  4J9E A;  1RLQ C;  1AOJ A;  1G83 A;  1UDL A;  1OPL A;  3JV3 A;  2JW4 A;  2L2P A;  1UJY A;  4LE9 A;  2CUB A;  1A0N B;  2B86 A;  2SRC A;  1W1F A;  1XOV A;  3GBQ A;  4DEX A;  4JJD A;  3I35 A;  2J05 A;  4IIM A;  4RTZ A;  1VA7 A;  2DX1 A;  4LUE A;  3VS1 A;  4LNP A;  2LCS A;  1WIE A;  2ROT A;  3VRZ A;  1X6G A;  1W70 A;  1ABO A;  2C0T A;  2JM9 A;  4HVU A;  2W10 A;  2V1Q A;  5GJV B;  3KFV A;  1UGV A;  1UEC A;  2L0A A;  2CH4 A;  2DRM A;  2KNB B;  2KBT A;  2EVR A;  3I5S A;  2JTE A;  2JM8 A;  1AWW A;  2A36 A;  1H3H A;  1WX6 A;  3VS0 A;  1RI9 A;  4AFQ C;  3M0R A;  2DF6 A;  3PVQ A;  3VS5 A;  1EFN A;  2L3S A;  2FPE A;  2EYY A;  1PKT A;  2RF0 A;  2K9G A;  1NG2 A;  1TUC A;  4Z88 A;  1SHG A;  1NEG A;  1S1N A;  2FO0 A;  2CSI A;  4HCK A;  1X43 A;  4RUG A;  3UA6 A;  5FWB A;  2J6O A;  4ORZ A;  2A28 A;  1UG1 A;  1VYV A;  1PKS A;  2DYB A;  3VS2 A;  1JU5 C;  1PNJ A;  2JMA A;  2F2X A;  4D8D A;  1ARK A;  1K9A A;  1QKW A;  2BZ8 A;  1WYX A;  2L3Q A;  2RMO A;  2KEA A;  1UUE A;  1UTI A;  4E6R A;  3VS4 A;  1YCS B;  2VVK A;  1T0H A;  2GBQ A;  2F2V A;  2FPD A;  2FRY A;  1PRL C;  2EBP A;  1T3L A;  4RTV A;  2BZY A;  2JXB A;  1CKA A;  1PRM C;  2H8H A;  1U3O A;  4J9I A;  4J9G A;  1YWO A;  2I0N A;  3I5R A;  2YUO A;  2K7A A;  2ED0 A;  5ECA A;  3NPF A;  2DL4 A;  2AKL A;  2DL7 A;  1JXM A;  3QWX X;  4AFS C;  2X3W D;  2GQI A;  2CSQ A;  2D1X A;  4HVV A;  1E6G A;  4IIO A;  2J06 A;  1BK2 A;  2DA9 A;  4ZNX A;  2VKN A;  2HCK A;  2OI3 A;  3EGU A;  2D8J A;  3CQT A;  3M0U A;  1ZBJ A;  4WCI A;  1MUZ A;  2DBM A;  1FMK A;  1WFW A;  4QT7 A;  1E6H A;  2YUN A;  1AD5 A;  1E7O A;  2HBW A;  1T3S A;  2J6F A;  2NUZ A;  3SEM A;  1LCK A;  4HVW A;  4D8K A;  5IHK A;  1OV3 A;  2RQU A;  1KIK A;  3H41 A;  2FRW A;  1Y57 A;  4CC3 A;  2EYZ A;  4OMM A;  2DJQ A;  4F17 A;  2EW3 A;  1ZUU A;  1NYG A;  2O2O A;  4AFZ C;  2KT8 A;  1NLO C;  1J3T A;  2FG0 A;  3EG1 A;  4AG2 C;  1RUW A;  1AWX A;  1TUD A;  2RQV A;  1CKB A;  2CDT A;  2RQW A;  2EGA A;  4Z89 A;  2ENM A;  1AWJ A;  4LUD A;  3IQL A;  1YN8 A;  1I0C A;  2CUD A;  5EC7 A;  2F2W A;  2OAW A;  1SRL A;  2EYX A;  5FW9 A;  2DBK A;  1AZE A;  3R6N A;  1PHT A;  2KRN A;  1M27 C;  2D0N A;  2V1R A;  1GCQ A;  2L3P A;  2KXD A;  3ZL7 C;  1QWF A;  1M3B A;  1OOT A;  1M8M A;  2O31 A;  3UF4 A;  2J6K A;  1GBQ A;  1HSQ A;  1KJW A;  1Z9Q A;  2EPD A;  4AG1 C;  1JXO A;  3I9Q A;  2LP5 A;  1UJ0 A;  1UHC A;  1Z9Z A;  2RQT A;  3REA B;  1V1C A;  4JJC A;  2EYW A;  2KXC A;  2E5K A;  4OMP A;  2P4R A;  4J9F A;  2CH4 W;  2KT1 A;  1UHF A;  2DL5 A;  4EIK A;  2LQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...