2FPFA

Crystal structure of the ib1 sh3 dimer at low resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
60
structure length
60
Chain Sequence
HEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords C-jun-amino-terminal kinase interacting protein 1
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 14
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpfA00
1JO8A 2CH4W 1RLPC 4Z89A 1Z9ZA 2KROA 2JMCA 1NG2A 4DEXA 3M0RA 1HD3A 5HCKA 3VS0A 3VS7A 2O2OA 2O9SA 2J6KA 5IXBA 1VYVA 4RTXA 2D0NA 2DVJA 1X6BA 1PKSA 2O9VA 1PWTA 2JW4A 2L3PA 4J9BA 3VRZA 2DX1A 2YUNA 2RQTA 2M51A 2GGRA 1BK2A 1B3QA 1W70A 5EC7A 2KRMA 2DLPA 4JJBA 2J05A 2AKKA 3PVLA 4JZ3A 2BZYA 3M0UA 2AZVA 3VS6A 2KT8A 2GQIA 2GTOA 1OEBA 3TSZA 2J6OA 3I5SA 4RTTA 2L0AA 3GBQA 1W6XA 1VYTA 1X27A 1KIKA 1AZEA 2D8JA 4AG2C 2JXBA 2DA9A 2NUZA 1G83A 1PHTA 4HVWA 2DM1A 2F2XA 1PNJA 2D1XA 4QT7A 4A63B 3I5RA 1QWFA 2A28A 2DL8A 5FWCA 2AZSA 1MV3A 3THKA 1AWJA 1K76A 1UHFA 2ROTA 4GLMA 2RQWA 5IH2A 2FRYA 5IHKA 4OMOA 1AOJA 1B07A 2L2PA 1ZX6A 1X43A 2DBKA 2GTJA 2RQUA 2KEAA 2LJ3A 2EQIA 2K9GA 2LZ6B 2C0OA 2DILA 2RF0A 2IIMA 3UA6A 4LE9A 1WIEA 2VWFA 4KRTA 2LQWA 3UF4A 2DE0X 1SSHA 2F2WA 2L3QA 2QDLA 1I1JA 1WX6A 2MCNA 3REAB 1JEGA 2KYMA 1RI9A 3M0SA 1H3HA 2FEIA 3KFVA 1K9AA 1GBQA 2EYYA 2RQRA 1GCQA 2MIOA 3I9QA 1GCQC 2ABLA 4Z8AA 2SRCA 2LCSA 1GFDA 3H0FA 2EGAA 1X2QA 2HBWA 4OMNA 1X6GA 1BU1A 1WDXA 1PRMC 1J3TA 2JMAA 4E6RA 1UG1A 4OMLA 1WXTA 1UHCA 4JPBW 2BZ8A 4F14A 2HEQA 1UUEA 1HSQA 3NGPA 3IQLA 1YWPA 2VVKA 2FPDA 1UFFA 1JQQA 1T3SA 1SRMA 2C0IA 1YNZA 2CUBA 2E5KA 1OPKA 1OOTA 4CC3A 4D8KA 2K2MA 3H41A 3TSWA 2F2VA 1I0CA 3R6NA 1QKXA 3RBBB 1RLQC 2EGCA 2FO0A 1GRIA 1JXMA 4K11A 4J9CA 3EG3A 2KXCA 1E6HA 2K3BA 3NHNA 3PE0A 2YT6A 2HCKA 3H0IA 4D8DA 1H8KA 1ZUUA 2CT4A 3O5ZA 4Z88A 1XOVA 4OMPA 1U06A 1NYFA 2KXDA 2B86A 3EG0A 4RTUA 3VS2A 5IXFA 2CSIA 1AWXA 1YWOA 4LUDA 2PZ1A 2DMOA 1AD5A 2GNCA 4LUEA 1GFCA 2JTEA 1SRLA 2LQNA 1IO6A 1SHFA 1ZUYA 1W1FA 1M30A 2I0NA 2FRWA 1BB9A 1NEGA 4F16A 4HCKA 2H8HA 2OAWA 2DRKA 2DRMA 2K79A 3UA7A 3TVTA 2FG0A 1KSWA 1CKAA 2AK5A 3JV3A 1OPLA 1SEMA 2G6FX 2LX7A 2JM9A 2GBQA 3RNJA 5IHIA 1AWOA 1M27C 2K7AA 3REBB 1JXOA 2PTKA 2EYZA 1NLOC 2YUQA 1U3OA 2RNAA 1K4US 2DBMA 2KT1A 2DL7A 4RUGA 4X1VA 2P4RA 3H0HA 2J06A 2ED1A 1KFZA 2C0TA 5FWBA 4CC4B 2EYXA 2KE9A 1WA7A 2V1RA 2KGTA 3A98A 4WCIA 2LP5A 4RTWA 4IIMA 1S1NA 2KNBB 2XMFA 1K1ZA 2AKLA 2O88A 3EHRA 4DEYA 1U5SA 1ABOA 4ORZA 1ARKA 2FPEA 1FMKA 3VRYA 2DL5A 1QKWA 4HXJA 1ZSGA 1PKTA 4OMMA 1SPKA 4J9FA 1M3BA 1JU5C 1I07A 2A36A 4LN2A 1CSKA 3EG1A 1QLYA 2YSQA 1RUWA 1NYGA 1ABQA 4AFUC 2KRSA 1UJYA 1MUZA 1VA7A 1K0SA 2W10A 1T0JA 2KRNA 3NPFA 2J7IA 4ZNXA 1AZGB 2EPDA 2CT3A 4RTZA 1UGVA 2CSQA 2W0ZA 2EBPA 2BZXA 2CREA 2FPFA 1V1CA 2V1QA 2LNHB 2CDTA 2EYWA 2JT4A 3UATA 5L23A 3C0CA 2ENMA 3I35A 2DL3A 1WYXA 4RTVA 2RQVA 4JZ4A 4AFSC 1ZLMA 5ECAA 3M0PA 4HVUA 1EFNA 2M0YA 4J9GA 1A0NB 1PRLC 3PVQA 4R0KA 3QWXX 3SHWA 5GJWB 2HDAA 2DJQA 2A08A 4OMQA 1AVZC 2EGEA 1NM7A 1SHGA 1X69A 2A37A 2ESWA 1N5ZA 1TUCA 1Y57A 1UDLA 4HVVA 1UTIA 1Y0MA 2D8HA 4RTYA 4EIKA 1LCKA 1K0XA 1T3LA 2OI3A 4AG1C 4CC2A 1BBZA 4J9DA 1ZUKA 1UJ0A 2RPNA 1CKBA 2VKNA 1GCPA 1KJWA 2SEMA 3CQTA 2BTTA 1NEBA 1M8MA 3VS3A 4J9HA 3VS4A 2CH4A 1WI7A 1OV3A 5FW9A 3ZL7C 1UECA 4GBQA 3ULRB 2EVRA 1AEYA 2L3SA 5I11A 1G2BA 4IIOA 3QWYA 3VS5A 1WLPB 2K6DA 3EGUA 1GBRA 2NWMA 4ESRA 4Y92A 2RMOA 4JJCA 1TG0A 2X3WD 1YCSB 2EW3A 3LH5A 1QWEA 2JS0A 2KR3A 2YDLA 2KBTA 1Z9QA 1T0HA 2JS2A 1NLPC 1E7OA 2HSPA 3U23A 1M3CA 3EHQA 1VYUA 1UE9A 3NMZC 2DNUA 2RN8A 1M3AA 1X2KA 4F17A 1WFWA 1HJDA 2LJ1A 2KYBA 3M0TA 5I22A 3FJ5A 1YN8A 2PNIA 2OJ2A 2X3XD 2ED0A 1WXUA 2ROLA 4J9IA 5IHNA 1MV0B 2ECZA 3EG2A 1AWWA 1TUDA 1H92A 2DL4A 1ZBJA 2O31A 1WXBA 1E6GA 1YP5A 4J9EA 4LNPA 2DF6A 2J6FA 3SEMA 2LMJA 2CUDA 4AFQC 3M0QA 3VS1A 4AFZC 4FSSA 2MOXA 1GL5A 2DYBA 4M4ZA 2LJ0A 5GJVB 4JJDA 2EKHA 2YUOA 2JM8A 4CC7A 2YUPA 1QCFA 1FYNA
chains in the Genus database with same CATH superfamily
3FRNA 2KQWA 3I56A 2K5FA 3S3NA 4RMOA 2KROA 4DBQA 2CP5A 4M75B 4N4GA 3QG1A 3CC2Q 3QJ6A 1NG2A 2B8AA 4A4EA 3I56T 3P8HA 3WXMB 2O9SA 3OYKA 1Q81C 2RHIA 1FX7A 2PVDB 2RHUA 3ZBDA 4RTXA 3A5ZB 1P92A 4BE1A 3LH0A 4KUIA 4E7SA 1PKSA 3EGXB 1FMWA 4J9BA 1FWZA 4PLIA 1O75A 2RQTA 1QVPA 1BK2A 2RHZA 1B3QA 1W70A 1F1BB 2KRMA 4JJBA 2EIFA 2AKKA 3Q1JA 2DIQA 4JZ3A 3URGA 1OX9A 3OBWA 5GAOr 3D7SB 2O4XB 3I5SA 1M90U 3ER0A 1VYTA 1N8RU 1AZEA 5KCHA 4CI0C 1KIKA 2QAZA 2DA9A 4C92F 3QSUA 1G83A 2XG8D 3V8LA 4KGZB 4MMLA 2K57A 2PVGB 4QT7A 1M1KU 5FWCA 1SSFA 1XQHA 5CKBA 1JRIA 1AWJA 1UHFA 4GLMA 2RQWA 2FRYA 4OMOA 3RERA 5GAMg 2L5QA 1AOJA 4EMKA 1B07A 3BFMA 5IN1A 2DBKA 2GTJA 2KEAA 2LJ3A 2XHCA 2C0OA 4RG8A 2DILA 2WSCE 3CCRQ 3C95A 1TWBA 4KUDK 2EWNA 2MYSA 2VWFA 2VGNA 4C0FA 1NBEB 2LQWA 2DTHA 3UF4A 2EQMA 1VQNA 1YJ9Q 3A8GB 5CIUA 1IXDA 1X01A 3LWIA 2MCNA 3REAB 3DLMA 1WHKA 4VUBA 1W2BA 5IT9E 3M0SA 4FYXB 1LNXA 3DB4A 3M4GA 4BD3A 2OX7A 2K5LA 1GBQA 2RQRA 1GCQA 2MIOA 4Z8AA 1K8AR 3OSVA 3CC7Q 1GFDA 4M78A 3E9GA 1VQ7Q 3H6ZA 4PJOG 4OP0A 3VYHB 1O9SA 1BU1A 4QW2A 4JS4A 1BYMA 3GP8A 2P0QA 4EMKB 1SKUB 4XU2A 3IQLA 3QPHA 2CP6A 4C0ZA 1C1AA 1PSFA 3SWNA 2IPOB 1WHMA 3X20B 1IZ6A 4XU0A 5DM7R 2RM4A 4M7DF 1OU9A 1V76A 1G3YA 4NS5A 1I0CA 5HK3A 1QKXA 1VQPA 3I56Q 4X9DA 3EFOA 4JLIA 2FZCB 5AT1B 3H0IA 4OGEA 1H8KA 1Q82R 3X28B 4DQ2A 3OYIA 4M78B 2R5MA 3EG0A 3UWNA 3VS2A 3I55A 2CSIA 3CMEA 1K8AU 2PZ1A 3O8VA 5LJ5h 3L2QA 3I55T 3M4YA 1SHFA 3CMET 1AHJB 2RH2A 4C5EA 2DEQA 1G3TA 2H8HA 3H9NA 3JCMQ 2LNVA 3H8ZA 3OA6A 3SWNB 2EFIA 2A3LA 3JV3A 4FU6A 4PFPA 4X34A 4E47A 3EG9A 2LX7A 2M0OA 2JM9A 5LJ5e 3FIFA 2YWWA 1MMNA 2KDSA 1M27C 2K7AA 1VQOQ 2COWA 2XKOC 1VOMA 2EYZA 1NLOC 2D6FA 1YI2A 3ZEHA 2RNAA 1PC0A 5KYWA 2KT1A 4BACA 2HKQB 4IUTA 3LLRA 4X1VA 2COZA 3EFOB 4L59A 4ME7A 4DOVA 1YI2T 5I21A 4XTYA 1WA7A 3A98A 1JJ2A 3JCMc 2EQJA 2NUPA 4OF1A 4C8QC 1Y7XA 1ZSZC 2MK5A 3A8LB 3FB9A 3FC3A 5HK0A 1Q82U 3OYFA 3EHRA 4DEYA 1U5SA 4FM4B 4HCZA 3CXCA 5GANd 1KC8R 1WGSA 3OMGA 2WACA 3VRYA 1VQNQ 2CKKA 4OMMA 4GLKA 3OS1A 1KQ1A 3PIPA 4LN2A 1CSKA 1QLYA 2YSQA 4C0GA 1IHWA 1QW1A 2DXBA 1N9SA 2QDYB 4AFUC 2DZ9A 3EG9B 1VA7A 4IUPA 4XTZA 1TH7A 3JCMJ 2E64A 1AZGB 5CK9A 1UGVA 3LYIA 5LJ3h 2FL7A 2QI2A 3CD6A 5KYWB 2W0ZA 4JUVA 2BZXA 4PJOA 5GANj 1V1CA 3QKJA 3S6WA 2LNHB 2CDTA 2EYWA 3UATA 4F7UE 1YCYA 4HCBA 3TEEA 3OW2P 4KGVB 2NUPB 2ZAEA 4OVAA 3CCEQ 2F69A 1NJIR 5DLQE 5FLXE 3KUFA 1ACMB 5LJ3e 1EFNA 2M0YA 1OULA 1D0ZA 5LJ5f 2X4WA 5FRNA 2CP7A 2A08A 1SHGA 1X69A 2AHJB 1KC8U 2HL3A 3JCMf 5KCOA 3M9QA 1UDLA 4HVVA 4ZGDB 4XTUA 4LDXA 1Q86R 1VQPQ 4QVZA 2QGFB 4C0DB 1K0XA 1WHGA 3SDZA 4DBHA 3JSCA 1PM3A 1CKBA 4PNOA 3CQTA 2FHDA 1RAFB 2YLBA 3S3MA 1RAIB 4J9HA 5LJ3d 1BIAA 1WPYA 2M16A 2CH4A 2DO3A 2E41A 1Q95G 1UGPB 4PJOB 5FU7C 2L3SA 3VV0A 5CCAA 2K6DA 3EGUA 4ESRA 1D0XA 4JRIA 4M77C 1TG0A 4BY6B 3GOXA 2EW3A 3LH5A 1KD1R 2VXFA 2X35A 3L2ZA 5D7UA 3U23A 4E7JA 1M3CA 4A4HA 2XDBA 3NMZC 1X2KA 1WFWA 5FROA 5LJ3j 4PFZA 2LJ1A 3RKXA 2JTMA 5LJ5g 5C6SA 2ZPFB 4KULA 5IHNA 2F5KA 1MV0B 1QVFP 1TUDA 2DL4A 3JCMg 3CCJT 2DETA 1Q86U 1K73C 3CPWS 3M59A 2KSSA 1KQSP 2E5QA 2XI9A 1EIFA 3M0QA 4JDSA 2E6NA 2KMTA 3LGFA 2DYBA 1FMVA 2RI3A 3JB9G 1I81A 3CCUA 2VUBA 2YUOA 4JRKA 1VQKQ 1TTHB 1Q81R 1RLPC 2EYQA 1N9RA 1OU8A 3CCUT 2JMCA 2GFUA 1UGRB 4X9CA 3TCJA 3G4ST 4XTWA 2GCXA 3M0RA 3UDCA 3OB9A 2O2OA 3OYDA 3JCMP 3RR6A 4C92C 2YLCA 2QA4A 2D0NA 3TU4K 4MMKA 4J6XA 4L6V5 1PWTA 1QVGS 1SF9A 2M9UA 5CKDA 5D6YA 2QA4T 6AT1B 3CD6Q 2GGRA 3DB3A 3J81E 4HCCA 2DLPA 4M7AG 4FSXA 2XDDA 2VYTA 2J05A 5CAIA 3PVLA 2YRDA 3M0UA 3VS6A 2GQIA 1IHVA 1VQ4A 2E6ZA 1C6VX 4PJNA 2LDMA 3GNGA 4RTTA 2K2VA 2L0AA 1W6XA 5CO7A 1X27A 3OW2A 3CCSQ 2OTLA 1JBMA 2LCCA 4AG2C 2JXBA 1VQ4T 1OZ3A 2NUZA 2NLUA 2F2XA 4QVDA 2D1XA 4A63B 4FL6A 2A28A 2RJCA 2OTLT 4J83A 3QXEB 2P0KA 1K76A 2RJEA 3M53A 4QQ6A 5IH2A 2PUKB 4XTVA 1YIJQ 1M1GA 1Q81U 4N0AA 3ME9A 2DXTA 2L2PA 1TUGB 1HK9A 2MMPA 2RQUA 4IKFA 2HKNA 2LZ6B 4F7UF 2IIMA 4OB3B 2GFAA 5GAMd 1WIEA 3MEWA 4LD6A 1G5VA 3BDUA 1QMCA 2F2WA 3HSBA 1I1JA 1JEGA 2EQKA 1LVKA 2LCLA 2FB7A 4B6MA 5J3BA 1K9AA 3OQ5A 4JLGA 2EYYA 1ZA1B 2QEXT 3M56A 1NZ9A 4OGCA 2ABLA 2LCSA 4A4KA 1WQ7A 4FW1A 1QP2A 1RI0A 3QYHB 1PG5B 4OMNA 5GAMj 3P8BB 1UG1A 3MEAA 4JPBW 2BZ8A 1YITQ 2HEQA 2ZCFB 2V8JA 1TSFA 1UUEA 4PLLA 4ZGJB 4ZTFA 1H3ZA 3C94A 3F70A 3QJYA 3VUBA 2VVKA 2FPDA 4BDYA 2WSFE 1T3SA 1SRMA 2C0IA 2E5KA 2M02A 1OPKA 2XIDA 4D8KA 2K2MA 3H41A 2E4HA 4JJNK 2EJGA 1RLQC 2COYA 1GRIA 2ZGWA 1VQ9Q 2CP0A 3CC4T 4C8QB 2KXCA 4KT0E 1E6HA 3MEVA 2QASA 2YT6A 3OYGA 1DJ7B 3JRZA 4RCBA 2CT4A 1JB0E 5A2QE 4J7IA 1I5LA 3JB9H 4OMPA 1U06A 1NYFA 2AT1B 2H3EB 4RTUA 1YHQA 2EKOA 5IXFA 3ZFJA 1M4ZA 2QA4Q 1YWOA 4LUDA 4Y91A 5FU6C 1AD5A 2GNCA 1GFCA 2HL5C 1SRLA 2LQNA 1YHQT 4UC4A 1ZUYA 3TQ7P 1M8VA 4M7AA 2OAWA 2MWOA 2DKGA 2DRKA 2DRMA 3MKDA 5GMKl 1W2BS 1CKAA 2G6FX 2DD4A 2GBQA 7AT1B 4KH0B 2PTKA 3GPLA 2OTLQ 3V7CA 3NTKA 1Q7YC 2J06A 3A8MB 2ED1A 5GAN5 1MHNA 2C0TA 2D0QB 4CC4B 2EYXA 2V1RA 1VQLA 4GY5A 1VQMQ 2LRQA 4M7DG 3X25B 1VQ5Q 3GNFB 1QCOA 3L2UA 1VQLT 2KNBB 2XMFA 1K1ZA 4BDZA 4Y28E 2QXFA 3A8HB 1ABOA 3S3OA 1VQ8A 3CEYA 4XU1A 3JCMb 3CCLT 4HXJA 1ZSGA 2F5TX 1PKTA 4EPCA 4M7AB 4J9FA 1SPKA 1RACB 2A36A 1I07A 4KH1B 2KY9A 2L89A 3RUXA 1VQ8T 1YJNQ 3KXTA 1ABQA 3BDLA 2KRSA 3EFRA 1UJYA 1MUZA 3HL8A 1K0SA 3OY9A 1T0JA 2KRNA 3NPFA 2QQAA 2J7IA 1H641 5GAOn 4ZTJA 2VC8A 3N5BB 5FU7B 4J6WA 2YRVA 2Y4XA 3QBYA 1N8RC 3BY7A 4M77B 2V1QA 1M1KC 5L23A 1NPPA 3C0CA 3JCMV 4E2FB 3RKWA 4M75D 2RQVA 4AFSC 1ZLMA 5ECAA 3L42A 3M0PA 4DOWA 2DD5A 3CBOA 1A0NB 1VIFA 2KI7A 1MMAA 2QQ9A 3QWXX 3OYMA 2DJQA 3JB9I 1MMDA 2ZPBB 1N5ZA 3CMAT 1Y57A 2DFUA 3VJPA 2XDPA 2P84A 5GANh 1UTIA 3NTHA 4M75E 1MMGA 3QDRB 3G6EA 3L2RA 1BBZA 4RKUE 2HBPA 1JJ2S 1UJ0A 2VKNA 1GCPA 2SEMA 2E12A 1NEBA 2RK2A 3G6ET 3M58A 4LD9K 1WI7A 3MHXA 5GANe 1YHQQ 2K3YA 3CXCS 3QO3A 1G2BA 1D1CA 4O5VA 1WLPB 1AT1B 4QQGA 1RABB 2DERA 1ZQ1A 2RMOA 4JJCA 4C5GA 1QWEA 2JS0A 2KR3A 3C4SA 4C92B 3CCMA 4M75C 1Z9QA 1W4SA 3EHQA 2M1HA 1VYUA 3HRUA 2EAYA 3CCMT 4ATOA 1KG1A 3R6OA 3WVDB 1VQ6A 2C06A 1HJDA 4AMCA 1YN8A 2X3XD 1WXUA 2K5IA 2BKDN 1VQ6T 1KHIA 3EG2A 1ZBJA 2FZKB 3C12A 4PK4A 3FJPA 4L5GA 4M7DA 3RMQA 2DEUA 3OYHA 2LQ8A 2CUDA 4AFQC 4ELZC 3G71A 5GAN8 3T9NA 1GL5A 2KK4A 1S72T 3JCMd 3SB2A 3CPWP 3G71T 2JM8A 4CC7A 1FYNA 1RAHB 1VQ8Q 1Z9ZA 2YRCA 1OYXA 2X4JA 4XAXB 1WJQA 1HD3A 2LTOA 3VS0A 3RIRA 3J7AF 2J6KA 5IXBA 3NFCA 5KH6A 4HT9A 2DVJA 1X6BA 4N4IA 3BW1A 3OYAA 3E9FA 3CCVA 1N27A 1B34A 2JW4A 2L3PA 3VRZA 2DX1A 3OYNA 5GANf 3QZ5B 2NYSA 4NL2A 3CCVT 1HYOA 4YTLA 5EC7A 2QTXA 4PJJA 5GMKm 4M7DB 2I2LA 2BZYA 3LW5E 2AZVA 3MO8A 2KT8A 5KYYA 4IURA 2V8KA 3GF5A 2J6OA 2XU8A 1D0YA 2D8JA 4M78D 5GAN7 5I2MA 2DM1A 1PNJA 3I5RA 3M55A 1QWFA 4CRIA 2DL8A 1B7TA 2LC4A 3I55Q 2AZSA 2MAMA 5CKFA 3CMEQ 1MV3A 2ZPEB 3THKA 3V8JA 2IVWA 5IHKA 4KGXB 3PNWC 2EQUA 4EMKC 1X43A 4C8QG 4PJMA 4EMGA 2RF0A 3OSSC 4M78E 5A0GA 1LPLA 1B34B 4DBFA 4ZN3A 1UGQB 1UEBA 8ATCB 1R0CB 4KRTA 3MJXA 4EDUA 1D1AA 1Y96A 3CCJA 2L3QA 1YI2Q 2QDLA 5GANg 1WX6A 1RAEB 5KYYB 3PMIA 1RI9A 1H3HA 2FEIA 2BE7D 3CCMQ 3E19A 3JCMW 3QIIA 5A0LA 5FU6B 1VUBA 3I9QA 1GCQC 4M75F 5LJ3f 3A1PA 3H0FA 4M78C 2EGAA 4PFOA 2DXCA 3P8DA 4PL6A 3UT1A 1X6GA 3CC2A 1WDXA 2JMAA 4PJLA 2RHYA 4OMLA 3G4SA 4OB0B 4F14A 2Y90A 1YWPA 3CC2T 5GAOl 1UFFA 2JOYA 1JQQA 1WJSA 3SWNC 1N6AA 2E3IA 3OW2S 3G71Q 5KYUB 2R57A 3TSWA 2F2VA 3R6NA 1Y96B 2E3HA 5GAMh 2FO0A 4K11A 4J9CA 4F7UG 3PE0A 2K4YA 3NHNA 2OTJA 2K3XA 3O5ZA 4Z88A 1XOVA 2KXDA 1MNEA 3HP9A 2B86A 5LL6S 2DXUA 1I4K1 5GAMe 2OTJT 1NJIC 1AWXA 5M9OA 2MF2A 2QQRA 1X75C 4LUEA 3CCVQ 1YBYA 5LJ3g 3A8OB 1IO6A 1KK7A 4M77G 2I0NA 1M1FA 2FRWA 1NEGA 9ATCB 3CCRA 3UA7A 1BCOA 3TVTA 4RCCA 1KSWA 2AK5A 2H3JA 2NUTB 1SEMA 3RNJA 1RAAB 3G1JA 1WQWA 1EZZB 5IHIA 3RESA 3CCRT 1AWOA 1IB8A 1JXOA 2DTOA 1RADB 3HRSA 2JTFA 2PVOB 4IUVA 3OMCA 3E1SA 2DBMA 4JS5A 4PJOD 2P4RA 3EGDA 1YJ9T 1KFZA 4M7DE 2MPXC 1QQJA 1OQKA 2DK3A 2QEXA 4A4GA 4RTWA 4IIMA 4FT2A 1QCNA 3CC7A 4C8QA 1S1NA 1ZSZA 3HKSA 1R0BG 2BUDA 1KD1C 1Y71A 2AKLA 3CCQA 2O88A 4BI8B 2RJFA 5D6WA 3CC7T 4ORZA 4PJOE 4JRPA 3CCQT 1BCMA 1M5Q1 3PIOA 1JU5C 2EJ9A 3EG1A 3CCJQ 2JJ9A 1ZHIA 2X51A 5IAYA 5CQYA 4C0DC 1WNLA 3NTIA 4C92G 4ZNXA 2HQHA 5GMKh 1V29B 2CT3A 4OB2B 1QVFA 2DZCA 3OS0A 3CC4A 1KQSA 3EGDB 4PJOC 1G3SA 2FVUA 2FPFA 4M78F 2L3RA 4D6WA 3OYLA 3CCUQ 1XTDA 5J26A 1U8RA 1PD1A 2ENMA 3I35A 2Z0WA 4FYWB 4LDWA 3G4SQ 2HZYA 1WYXA 5I2SA 3KBGA 4RTVA 2LT1A 5GMKe 1ZSZB 4BY6C 4J7FA 4Q5WA 4BI3A 1VIEA 3L1AA 2P4TA 4J9GA 5EG2A 5L8RE 1PRLC 3PVQA 2HDAA 1K9MC 1AVZC 1MGQA 4HKEA 2RO0A 5KYXA 2VASA 1LCKA 4OMFB 2FYKA 3QDFA 4F7UA 4AG1C 1BIBA 4J9DA 1ZUKA 2VV5A 2RPNA 3V7RA 2JN0A 1KJWA 2OTJQ 1VQOA 3VS3A 2O01E 2HQXA 1M9SA 1VQ4Q 5FW9A 1UB4A 4E7LA 1KQ2A 1JJ2P 2EVRA 1VQOT 5AYFA 1RAGB 1ZA2B 1AEYA 4MZTA 5KE2A 2PU9B 4E7IA 2PUOB 2QTVA 1GBRA 2NWMA 3EH2A 3PFSA 4M77A 2MWPA 4J8OA 4DBRA 4B9XA 2X3WD 5KYNA 5GAN3 3CXCP 2YDLA 2ZPGB 4FIBA 5HKCA 3VYGA 5HY6A 3V7SA 2LQKA 1UE9A 4EMHA 2DNUA 5GMKj 2RN8A 3MP6A 4F17A 3CCLA 5CVIA 3HTRA 2KYBA 3OS5A 3FJ5A 1FXXA 5KYXB 2PNIA 2OJ2A 3VKIA 2ED0A 2ROLA 1BKBA 4J9IA 4F7UB 1VQNT 2ECZA 1G8XA 1QP3A 1H92A 5DLOA 2O31A 1XNIA 5GAOm 1MNDA 2RB6A 1E6GA 1YP5A 2R5AA 2QEXQ 1G3WA 2LVMA 1M2VA 2G3RA 1SG5A 2J6FA 3VS1A 4AFZC 4FSSA 5CR2A 3CCQQ 3JAME 5D6XA 1M90C 2LJ0A 5GJVB 4A53A 5GAOp 4JJDA 1QCFA 3E2UA 2E10A 3EFSA 1JO8A 2CH4W 4Z89A 2FZGB 5KE3A 3CCEA 2GF7A 1WHHA 4MDXA 4C5IA 3SD4A 4DEXA 1OX8A 3J80E 1TOVA 5HCKA 3VS7A 3PMTA 3CCET 3MPUB 1RL2A 3CPFA 4C92A 2ATCB 1VYVA 4LDUA 2RI2A 2CP2A 4O6JA 3CMAA 2VB6A 2O9VA 2MI6A 3BE3A 2YUNA 4MZMA 4A4FA 2M51A 4WTOB 1IGUA 4AT1B 1YJWA 2VGMA 2CZ0B 4XQ3A 3CC4Q 3WVEB 2GQVA 2XK0A 1VQPT 5CKHA 4PJOF 4C8QD 1YJWT 2GTOA 1M2VB 1OEBA 3OYEA 3TSZA 4II1A 3GBQA 1WHLA 4OB1B 1PHTA 1HXDA 4HVWA 1YFNA 1WJRA 2A0FB 4FYYB 2Y4YA 3HRTA 2ROTA 3JCMh 2QQBA 2YXYA 2E70A 4C8QE 3GIBA 4N0AC 1ZX6A 5J39A 3RMSA 1BI3A 2EQIA 2K9GA 4B9WA 3UA6A 2HSEB 2E65A 2DJZA 1IREB 4LE9A 3JCMe 4J6YA 1KHCA 5GAN4 3JB9D 2JVVA 2DE0X 1K73R 4NL3A 1SSHA 2CYZB 3M5AA 1U1TA 5CKEA 3OYBA 2KYMA 3KFVA 1TU0B 3JB9J 2JUFA 1VQLQ 2JZ2A 1S72A 5LJ5d 2SRCA 1VQKA 4BUGA 2QK0A 1X6OA 2DVEA 5A0DA 2QG9B 1X2QA 2HBWA 4QQDA 2CP3A 3CCLQ 2DYIA 4QVCA 1C0MA 1VQKT 1PRMC 1K8AC 1J3TA 4E6RA 2E1HA 3FLGA 1WHJA 1WXTA 1UHCA 2YHTA 3M57A 1HSQA 3NGPA 3LWHA 4M7AD 2CZ1B 3JCMX 1YNZA 3X26B 2CUBA 4XK8E 3QYGB 1OOTA 4CC3A 4C5HA 5LJ5j 4WF2A 1D09B 2WSEE 4M77D 3RBBB 4BB7A 2EGCA 3CD6T 2QYZA 4P5NA 3PTAA 1JXMA 4M7AE 2KAFA 2ZZDA 2DPPB 2RK1A 3L2VA 1K73U 3EG3A 4HT8A 3META 2CS7A 4ZN1A 2K3BA 2HCKA 3CBPA 1PD0A 1QVGP 2X4YA 4D8DA 3CCSA 1ZUUA 2LX9A 4FT4A 3L2WA 4HA8A 3OBYA 2AIRB 3PGGA 3INZA 2RI5A 1OZ2A 3CCST 4NOYA 2DMOA 4KBMB 1Q82C 1BI0A 3CMAQ 4M77E 2JTEA 5GAOq 1YIJA 3DKMA 3AT1B 2P0PA 3LGLA 1W1FA 1M30A 4FCYA 1TXQA 1R77A 1BB9A 1YJWQ 4F16A 4HCKA 3VU3C 4M75G 1YIJT 4M7AC 2HMAA 2K79A 5GMKi 2A7YA 4TVRA 3AHUA 2FG0A 3V8KA 1OPLA 4ELYC 4RG2A 3G6EQ 1M2OA 3HPWA 3RKYA 2RJDA 3TREA 3REBB 1U1SA 3OYYA 2YUQA 1BI1A 1U3OA 1K4US 2V26A 3FEOA 5KYUA 2OAUA 3DLLA 3CBMA 2DL7A 4RUGA 4BE0A 3H0HA 4A54A 4FYVB 3PT9A 5GAN6 2DIGA 4FW2A 5FWBA 2KE9A 4PKCC 4IUUA 2KGTA 1LJOA 4WCIA 2LP5A 4QKUA 2VXEA 4C92D 4Z02A 1NJIU 4LDYA 2CZ6B 2XICA 3GLXA 2RHXA 3QZ9B 1ARKA 1D1BA 2QGGA 2FPEA 4BE2A 1YITA 1FMKA 2DL5A 4LDVA 5C0MA 1UGSB 1VQ6Q 1QKWA 3UPUA 4IUQA 1R8OB 3MP8A 4LXCA 1M3BA 4F04B 4V2SA 1D3BA 2X4XA 3M54A 1KC8C 1RUWA 1YITT 1NYGA 4C92E 3OS2A 2W10A 4E7HA 3G7ZA 2EPDA 4C8QF 4RTZA 2NUTA 1S72Q 2HQEA 1XJWB 2CSQA 2DTIA 1VQ9A 2EBPA 2BE9B 4N4HA 2CREA 2EJFA 2JT4A 4BI4A 2V8IA 1I5OB 2DAQA 2DL3A 1VQ9T 1PCXA 4XTXA 1KD1U 3CPWA 4JZ4A 1K9MR 1LOJA 4HVUA 3HHTB 1TS9A 2X9HA 4R0KA 3SHWA 3EH1A 5GJWB 2ZPIB 4OMQA 3MP1A 1I8FA 2EGEA 1NM7A 3LX7A 2A37A 2ESWA 1TUCA 1D3BB 2RD1A 3OYJA 1Y0MA 2D8HA 4RTYA 4EIKA 1NPRA 2XD0A 3JB9F 2CGHA 1T3LA 2OI3A 3RDVA 4CC2A 2ZPHB 2R58A 4M7DD 2D9TA 3ASKA 2BTTA 3OYCA 1M8MA 2RA2A 2L8DA 4R56A 1GXIE 1Q86C 1WZOA 5DY9A 3VS4A 1OV3A 3ZL7C 1UECA 4GBQA 1QVGA 1Q7YR 1IGQA 3ULRB 1EX4A 8AT1B 5I11A 1YJ9A 1W2BP 4IIOA 3QWYA 3VS5A 2HAXA 4MZPA 5CQXA 3X24B 3HFOA 1VQMA 4Y92A 3QUIA 1OI1A 3HFNA 1VQ5A 2LT4A 1YCSB 3VUZA 2KBTA 4M75A 4E7KA 3MCAB 1T0HA 2JNGA 2JS2A 1VQMT 1NLPC 1E7OA 2HSPA 4JRQA 1K9MU 1VQ5T 4DA4A 2CZ7B 4XU3A 4M7AF 4E7ZA 4MDWA 4R55A 1Y07A 4M78G 1M3AA 1VQ7A 5FRMA 1QVFS 4ANJA 1NE8A 3EGXA 3M0TA 2KVQG 5I22A 1VQ7T 4J5YA 1KQSS 1YJNA 3SFMA 4ZGEB 2F1LA 1AWWA 1WXBA 2QQSA 4M77F 1YJNT 1IRXA 1M90R 2BIVA 4J9EA 2PQWA 2DF6A 4LNPA 4M7DC 1BI2A 1N8RR 3MEUA 2IG0A 3SEMA 2LMJA 3EAEA 3FDRA 2O4XA 5GAN2 3QHSA 1PSEA 2HNIA 2MOXA 4M4ZA 1M1KR 2HD0A 2EKHA 5GAMf 1Q7YU 2YUPA 1ZBXA
chains in the Genus database with same CATH topology
1JO8A 2CH4W 1RLPC 4Z89A 1Z9ZA 2KROA 2JMCA 1NG2A 4DEXA 3M0RA 1HD3A 5HCKA 3VS0A 3VS7A 2O2OA 2O9SA 2J6KA 5IXBA 1VYVA 4RTXA 2D0NA 2DVJA 1X6BA 1PKSA 2O9VA 1PWTA 2JW4A 2L3PA 4J9BA 3VRZA 2DX1A 2YUNA 2RQTA 2M51A 2GGRA 1BK2A 1B3QA 1W70A 5EC7A 2KRMA 2DLPA 4JJBA 2J05A 2AKKA 3PVLA 4JZ3A 2BZYA 3M0UA 2AZVA 3VS6A 2KT8A 2GQIA 2GTOA 1OEBA 3TSZA 2J6OA 3I5SA 4RTTA 2L0AA 3GBQA 1W6XA 1VYTA 1X27A 1KIKA 1AZEA 2D8JA 4AG2C 2JXBA 2DA9A 2NUZA 1G83A 1PHTA 4HVWA 2DM1A 2F2XA 1PNJA 2D1XA 4QT7A 4A63B 3I5RA 1QWFA 2A28A 2DL8A 5FWCA 2AZSA 1MV3A 3THKA 1AWJA 1K76A 1UHFA 2ROTA 4GLMA 2RQWA 5IH2A 2FRYA 5IHKA 4OMOA 1AOJA 1B07A 2L2PA 1ZX6A 1X43A 2DBKA 2GTJA 2RQUA 2KEAA 2LJ3A 2EQIA 2K9GA 2LZ6B 2C0OA 2DILA 2RF0A 2IIMA 3UA6A 4LE9A 1WIEA 2VWFA 4KRTA 2LQWA 3UF4A 2DE0X 1SSHA 2F2WA 2L3QA 2QDLA 1I1JA 1WX6A 2MCNA 3REAB 1JEGA 2KYMA 1RI9A 3M0SA 1H3HA 2FEIA 3KFVA 1K9AA 1GBQA 2EYYA 2RQRA 1GCQA 2MIOA 3I9QA 1GCQC 2ABLA 4Z8AA 2SRCA 2LCSA 1GFDA 3H0FA 2EGAA 1X2QA 2HBWA 4OMNA 1X6GA 1BU1A 1WDXA 1PRMC 1J3TA 2JMAA 4E6RA 1UG1A 4OMLA 1WXTA 1UHCA 4JPBW 2BZ8A 4F14A 2HEQA 1UUEA 1HSQA 3NGPA 3IQLA 1YWPA 2VVKA 2FPDA 1UFFA 1JQQA 1T3SA 1SRMA 2C0IA 1YNZA 2CUBA 2E5KA 1OPKA 1OOTA 4CC3A 4D8KA 2K2MA 3H41A 3TSWA 2F2VA 1I0CA 3R6NA 1QKXA 3RBBB 1RLQC 2EGCA 2FO0A 1GRIA 1JXMA 4K11A 4J9CA 3EG3A 2KXCA 1E6HA 2K3BA 3NHNA 3PE0A 2YT6A 2HCKA 3H0IA 4D8DA 1H8KA 1ZUUA 2CT4A 3O5ZA 4Z88A 1XOVA 4OMPA 1U06A 1NYFA 2KXDA 2B86A 3EG0A 4RTUA 3VS2A 5IXFA 2CSIA 1AWXA 1YWOA 4LUDA 2PZ1A 2DMOA 1AD5A 2GNCA 4LUEA 1GFCA 2JTEA 1SRLA 2LQNA 1IO6A 1SHFA 1ZUYA 1W1FA 1M30A 2I0NA 2FRWA 1BB9A 1NEGA 4F16A 4HCKA 2H8HA 2OAWA 2DRKA 2DRMA 2K79A 3UA7A 3TVTA 2FG0A 1KSWA 1CKAA 2AK5A 3JV3A 1OPLA 1SEMA 2G6FX 2LX7A 2JM9A 2GBQA 3RNJA 5IHIA 1AWOA 1M27C 2K7AA 3REBB 1JXOA 2PTKA 2EYZA 1NLOC 2YUQA 1U3OA 2RNAA 1K4US 2DBMA 2KT1A 2DL7A 4RUGA 4X1VA 2P4RA 3H0HA 2J06A 2ED1A 1KFZA 2C0TA 5FWBA 4CC4B 2EYXA 2KE9A 1WA7A 2V1RA 2KGTA 3A98A 4WCIA 2LP5A 4RTWA 4IIMA 1S1NA 2KNBB 2XMFA 1K1ZA 2AKLA 2O88A 3EHRA 4DEYA 1U5SA 1ABOA 4ORZA 1ARKA 2FPEA 1FMKA 3VRYA 2DL5A 1QKWA 4HXJA 1ZSGA 1PKTA 4OMMA 1SPKA 4J9FA 1M3BA 1JU5C 1I07A 2A36A 4LN2A 1CSKA 3EG1A 1QLYA 2YSQA 1RUWA 1NYGA 1ABQA 4AFUC 2KRSA 1UJYA 1MUZA 1VA7A 1K0SA 2W10A 1T0JA 2KRNA 3NPFA 2J7IA 4ZNXA 1AZGB 2EPDA 2CT3A 4RTZA 1UGVA 2CSQA 2W0ZA 2EBPA 2BZXA 2CREA 2FPFA 1V1CA 2V1QA 2LNHB 2CDTA 2EYWA 2JT4A 3UATA 5L23A 3C0CA 2ENMA 3I35A 2DL3A 1WYXA 4RTVA 2RQVA 4JZ4A 4AFSC 1ZLMA 5ECAA 3M0PA 4HVUA 1EFNA 2M0YA 4J9GA 1A0NB 1PRLC 3PVQA 4R0KA 3QWXX 3SHWA 5GJWB 2HDAA 2DJQA 2A08A 4OMQA 1AVZC 2EGEA 1NM7A 1SHGA 1X69A 2A37A 2ESWA 1N5ZA 1TUCA 1Y57A 1UDLA 4HVVA 1UTIA 1Y0MA 2D8HA 4RTYA 4EIKA 1LCKA 1K0XA 1T3LA 2OI3A 4AG1C 4CC2A 1BBZA 4J9DA 1ZUKA 1UJ0A 2RPNA 1CKBA 2VKNA 1GCPA 1KJWA 2SEMA 3CQTA 2BTTA 1NEBA 1M8MA 3VS3A 4J9HA 3VS4A 2CH4A 1WI7A 1OV3A 5FW9A 3ZL7C 1UECA 4GBQA 3ULRB 2EVRA 1AEYA 2L3SA 5I11A 1G2BA 4IIOA 3QWYA 3VS5A 1WLPB 2K6DA 3EGUA 1GBRA 2NWMA 4ESRA 4Y92A 2RMOA 4JJCA 1TG0A 2X3WD 1YCSB 2EW3A 3LH5A 1QWEA 2JS0A 2KR3A 2YDLA 2KBTA 1Z9QA 1T0HA 2JS2A 1NLPC 1E7OA 2HSPA 3U23A 1M3CA 3EHQA 1VYUA 1UE9A 3NMZC 2DNUA 2RN8A 1M3AA 1X2KA 4F17A 1WFWA 1HJDA 2LJ1A 2KYBA 3M0TA 5I22A 3FJ5A 1YN8A 2PNIA 2OJ2A 2X3XD 2ED0A 1WXUA 2ROLA 4J9IA 5IHNA 1MV0B 2ECZA 3EG2A 1AWWA 1TUDA 1H92A 2DL4A 1ZBJA 2O31A 1WXBA 1E6GA 1YP5A 4J9EA 4LNPA 2DF6A 2J6FA 3SEMA 2LMJA 2CUDA 4AFQC 3M0QA 3VS1A 4AFZC 4FSSA 2MOXA 1GL5A 2DYBA 4M4ZA 2LJ0A 5GJVB 4JJDA 2EKHA 2YUOA 2JM8A 4CC7A 2YUPA 1QCFA 1FYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JO8 A;  2CH4 W;  1RLP C;  4Z89 A;  1Z9Z A;  2KRO A;  2JMC A;  1NG2 A;  4DEX A;  3M0R A;  1HD3 A;  5HCK A;  3VS0 A;  3VS7 A;  2O2O A;  2O9S A;  2J6K A;  5IXB A;  1VYV A;  4RTX A;  2D0N A;  2DVJ A;  1X6B A;  1PKS A;  2O9V A;  1PWT A;  2JW4 A;  2L3P A;  4J9B A;  3VRZ A;  2DX1 A;  2YUN A;  2RQT A;  2M51 A;  2GGR A;  1BK2 A;  1B3Q A;  1W70 A;  5EC7 A;  2KRM A;  2DLP A;  4JJB A;  2J05 A;  2AKK A;  3PVL A;  4JZ3 A;  2BZY A;  3M0U A;  2AZV A;  3VS6 A;  2KT8 A;  2GQI A;  2GTO A;  1OEB A;  3TSZ A;  2J6O A;  3I5S A;  4RTT A;  2L0A A;  3GBQ A;  1W6X A;  1VYT A;  1X27 A;  1KIK A;  1AZE A;  2D8J A;  4AG2 C;  2JXB A;  2DA9 A;  2NUZ A;  1G83 A;  1PHT A;  4HVW A;  2DM1 A;  2F2X A;  1PNJ A;  2D1X A;  4QT7 A;  4A63 B;  3I5R A;  1QWF A;  2A28 A;  2DL8 A;  5FWC A;  2AZS A;  1MV3 A;  3THK A;  1AWJ A;  1K76 A;  1UHF A;  2ROT A;  4GLM A;  2RQW A;  5IH2 A;  2FRY A;  5IHK A;  4OMO A;  1AOJ A;  1B07 A;  2L2P A;  1ZX6 A;  1X43 A;  2DBK A;  2GTJ A;  2RQU A;  2KEA A;  2LJ3 A;  2EQI A;  2K9G A;  2LZ6 B;  2C0O A;  2DIL A;  2RF0 A;  2IIM A;  3UA6 A;  4LE9 A;  1WIE A;  2VWF A;  4KRT A;  2LQW A;  3UF4 A;  2DE0 X;  1SSH A;  2F2W A;  2L3Q A;  2QDL A;  1I1J A;  1WX6 A;  2MCN A;  3REA B;  1JEG A;  2KYM A;  1RI9 A;  3M0S A;  1H3H A;  2FEI A;  3KFV A;  1K9A A;  1GBQ A;  2EYY A;  2RQR A;  1GCQ A;  2MIO A;  3I9Q A;  1GCQ C;  2ABL A;  4Z8A A;  2SRC A;  2LCS A;  1GFD A;  3H0F A;  2EGA A;  1X2Q A;  2HBW A;  4OMN A;  1X6G A;  1BU1 A;  1WDX A;  1PRM C;  1J3T A;  2JMA A;  4E6R A;  1UG1 A;  4OML A;  1WXT A;  1UHC A;  4JPB W;  2BZ8 A;  4F14 A;  2HEQ A;  1UUE A;  1HSQ A;  3NGP A;  3IQL A;  1YWP A;  2VVK A;  2FPD A;  1UFF A;  1JQQ A;  1T3S A;  1SRM A;  2C0I A;  1YNZ A;  2CUB A;  2E5K A;  1OPK A;  1OOT A;  4CC3 A;  4D8K A;  2K2M A;  3H41 A;  3TSW A;  2F2V A;  1I0C A;  3R6N A;  1QKX A;  3RBB B;  1RLQ C;  2EGC A;  2FO0 A;  1GRI A;  1JXM A;  4K11 A;  4J9C A;  3EG3 A;  2KXC A;  1E6H A;  2K3B A;  3NHN A;  3PE0 A;  2YT6 A;  2HCK A;  3H0I A;  4D8D A;  1H8K A;  1ZUU A;  2CT4 A;  3O5Z A;  4Z88 A;  1XOV A;  4OMP A;  1U06 A;  1NYF A;  2KXD A;  2B86 A;  3EG0 A;  4RTU A;  3VS2 A;  5IXF A;  2CSI A;  1AWX A;  1YWO A;  4LUD A;  2PZ1 A;  2DMO A;  1AD5 A;  2GNC A;  4LUE A;  1GFC A;  2JTE A;  1SRL A;  2LQN A;  1IO6 A;  1SHF A;  1ZUY A;  1W1F A;  1M30 A;  2I0N A;  2FRW A;  1BB9 A;  1NEG A;  4F16 A;  4HCK A;  2H8H A;  2OAW A;  2DRK A;  2DRM A;  2K79 A;  3UA7 A;  3TVT A;  2FG0 A;  1KSW A;  1CKA A;  2AK5 A;  3JV3 A;  1OPL A;  1SEM A;  2G6F X;  2LX7 A;  2JM9 A;  2GBQ A;  3RNJ A;  5IHI A;  1AWO A;  1M27 C;  2K7A A;  3REB B;  1JXO A;  2PTK A;  2EYZ A;  1NLO C;  2YUQ A;  1U3O A;  2RNA A;  1K4U S;  2DBM A;  2KT1 A;  2DL7 A;  4RUG A;  4X1V A;  2P4R A;  3H0H A;  2J06 A;  2ED1 A;  1KFZ A;  2C0T A;  5FWB A;  4CC4 B;  2EYX A;  2KE9 A;  1WA7 A;  2V1R A;  2KGT A;  3A98 A;  4WCI A;  2LP5 A;  4RTW A;  4IIM A;  1S1N A;  2KNB B;  2XMF A;  1K1Z A;  2AKL A;  2O88 A;  3EHR A;  4DEY A;  1U5S A;  1ABO A;  4ORZ A;  1ARK A;  2FPE A;  1FMK A;  3VRY A;  2DL5 A;  1QKW A;  4HXJ A;  1ZSG A;  1PKT A;  4OMM A;  1SPK A;  4J9F A;  1M3B A;  1JU5 C;  1I07 A;  2A36 A;  4LN2 A;  1CSK A;  3EG1 A;  1QLY A;  2YSQ A;  1RUW A;  1NYG A;  1ABQ A;  4AFU C;  2KRS A;  1UJY A;  1MUZ A;  1VA7 A;  1K0S A;  2W10 A;  1T0J A;  2KRN A;  3NPF A;  2J7I A;  4ZNX A;  1AZG B;  2EPD A;  2CT3 A;  4RTZ A;  1UGV A;  2CSQ A;  2W0Z A;  2EBP A;  2BZX A;  2CRE A;  2FPF A;  1V1C A;  2V1Q A;  2LNH B;  2CDT A;  2EYW A;  2JT4 A;  3UAT A;  5L23 A;  3C0C A;  2ENM A;  3I35 A;  2DL3 A;  1WYX A;  4RTV A;  2RQV A;  4JZ4 A;  4AFS C;  1ZLM A;  5ECA A;  3M0P A;  4HVU A;  1EFN A;  2M0Y A;  4J9G A;  1A0N B;  1PRL C;  3PVQ A;  4R0K A;  3QWX X;  3SHW A;  5GJW B;  2HDA A;  2DJQ A;  2A08 A;  4OMQ A;  1AVZ C;  2EGE A;  1NM7 A;  1SHG A;  1X69 A;  2A37 A;  2ESW A;  1N5Z A;  1TUC A;  1Y57 A;  1UDL A;  4HVV A;  1UTI A;  1Y0M A;  2D8H A;  4RTY A;  4EIK A;  1LCK A;  1K0X A;  1T3L A;  2OI3 A;  4AG1 C;  4CC2 A;  1BBZ A;  4J9D A;  1ZUK A;  1UJ0 A;  2RPN A;  1CKB A;  2VKN A;  1GCP A;  1KJW A;  2SEM A;  3CQT A;  2BTT A;  1NEB A;  1M8M A;  3VS3 A;  4J9H A;  3VS4 A;  2CH4 A;  1WI7 A;  1OV3 A;  5FW9 A;  3ZL7 C;  1UEC A;  4GBQ A;  3ULR B;  2EVR A;  1AEY A;  2L3S A;  5I11 A;  1G2B A;  4IIO A;  3QWY A;  3VS5 A;  1WLP B;  2K6D A;  3EGU A;  1GBR A;  2NWM A;  4ESR A;  4Y92 A;  2RMO A;  4JJC A;  1TG0 A;  2X3W D;  1YCS B;  2EW3 A;  3LH5 A;  1QWE A;  2JS0 A;  2KR3 A;  2YDL A;  2KBT A;  1Z9Q A;  1T0H A;  2JS2 A;  1NLP C;  1E7O A;  2HSP A;  3U23 A;  1M3C A;  3EHQ A;  1VYU A;  1UE9 A;  3NMZ C;  2DNU A;  2RN8 A;  1M3A A;  1X2K A;  4F17 A;  1WFW A;  1HJD A;  2LJ1 A;  2KYB A;  3M0T A;  5I22 A;  3FJ5 A;  1YN8 A;  2PNI A;  2OJ2 A;  2X3X D;  2ED0 A;  1WXU A;  2ROL A;  4J9I A;  5IHN A;  1MV0 B;  2ECZ A;  3EG2 A;  1AWW A;  1TUD A;  1H92 A;  2DL4 A;  1ZBJ A;  2O31 A;  1WXB A;  1E6G A;  1YP5 A;  4J9E A;  4LNP A;  2DF6 A;  2J6F A;  3SEM A;  2LMJ A;  2CUD A;  4AFQ C;  3M0Q A;  3VS1 A;  4AFZ C;  4FSS A;  2MOX A;  1GL5 A;  2DYB A;  4M4Z A;  2LJ0 A;  5GJV B;  4JJD A;  2EKH A;  2YUO A;  2JM8 A;  4CC7 A;  2YUP A;  1QCF A;  1FYN A; 
#chains in the Genus database with same CATH topology
 3FRN A;  2KQW A;  3I56 A;  2K5F A;  3S3N A;  4RMO A;  2KRO A;  4DBQ A;  2CP5 A;  4M75 B;  4N4G A;  3QG1 A;  3CC2 Q;  3QJ6 A;  1NG2 A;  2B8A A;  4A4E A;  3I56 T;  3P8H A;  3WXM B;  2O9S A;  3OYK A;  1Q81 C;  2RHI A;  1FX7 A;  2PVD B;  2RHU A;  3ZBD A;  4RTX A;  3A5Z B;  1P92 A;  4BE1 A;  3LH0 A;  4KUI A;  4E7S A;  1PKS A;  3EGX B;  1FMW A;  4J9B A;  1FWZ A;  4PLI A;  1O75 A;  2RQT A;  1QVP A;  1BK2 A;  2RHZ A;  1B3Q A;  1W70 A;  1F1B B;  2KRM A;  4JJB A;  2EIF A;  2AKK A;  3Q1J A;  2DIQ A;  4JZ3 A;  3URG A;  1OX9 A;  3OBW A;  5GAO r;  3D7S B;  2O4X B;  3I5S A;  1M90 U;  3ER0 A;  1VYT A;  1N8R U;  1AZE A;  5KCH A;  4CI0 C;  1KIK A;  2QAZ A;  2DA9 A;  4C92 F;  3QSU A;  1G83 A;  2XG8 D;  3V8L A;  4KGZ B;  4MML A;  2K57 A;  2PVG B;  4QT7 A;  1M1K U;  5FWC A;  1SSF A;  1XQH A;  5CKB A;  1JRI A;  1AWJ A;  1UHF A;  4GLM A;  2RQW A;  2FRY A;  4OMO A;  3RER A;  5GAM g;  2L5Q A;  1AOJ A;  4EMK A;  1B07 A;  3BFM A;  5IN1 A;  2DBK A;  2GTJ A;  2KEA A;  2LJ3 A;  2XHC A;  2C0O A;  4RG8 A;  2DIL A;  2WSC E;  3CCR Q;  3C95 A;  1TWB A;  4KUD K;  2EWN A;  2MYS A;  2VWF A;  2VGN A;  4C0F A;  1NBE B;  2LQW A;  2DTH A;  3UF4 A;  2EQM A;  1VQN A;  1YJ9 Q;  3A8G B;  5CIU A;  1IXD A;  1X01 A;  3LWI A;  2MCN A;  3REA B;  3DLM A;  1WHK A;  4VUB A;  1W2B A;  5IT9 E;  3M0S A;  4FYX B;  1LNX A;  3DB4 A;  3M4G A;  4BD3 A;  2OX7 A;  2K5L A;  1GBQ A;  2RQR A;  1GCQ A;  2MIO A;  4Z8A A;  1K8A R;  3OSV A;  3CC7 Q;  1GFD A;  4M78 A;  3E9G A;  1VQ7 Q;  3H6Z A;  4PJO G;  4OP0 A;  3VYH B;  1O9S A;  1BU1 A;  4QW2 A;  4JS4 A;  1BYM A;  3GP8 A;  2P0Q A;  4EMK B;  1SKU B;  4XU2 A;  3IQL A;  3QPH A;  2CP6 A;  4C0Z A;  1C1A A;  1PSF A;  3SWN A;  2IPO B;  1WHM A;  3X20 B;  1IZ6 A;  4XU0 A;  5DM7 R;  2RM4 A;  4M7D F;  1OU9 A;  1V76 A;  1G3Y A;  4NS5 A;  1I0C A;  5HK3 A;  1QKX A;  1VQP A;  3I56 Q;  4X9D A;  3EFO A;  4JLI A;  2FZC B;  5AT1 B;  3H0I A;  4OGE A;  1H8K A;  1Q82 R;  3X28 B;  4DQ2 A;  3OYI A;  4M78 B;  2R5M A;  3EG0 A;  3UWN A;  3VS2 A;  3I55 A;  2CSI A;  3CME A;  1K8A U;  2PZ1 A;  3O8V A;  5LJ5 h;  3L2Q A;  3I55 T;  3M4Y A;  1SHF A;  3CME T;  1AHJ B;  2RH2 A;  4C5E A;  2DEQ A;  1G3T A;  2H8H A;  3H9N A;  3JCM Q;  2LNV A;  3H8Z A;  3OA6 A;  3SWN B;  2EFI A;  2A3L A;  3JV3 A;  4FU6 A;  4PFP A;  4X34 A;  4E47 A;  3EG9 A;  2LX7 A;  2M0O A;  2JM9 A;  5LJ5 e;  3FIF A;  2YWW A;  1MMN A;  2KDS A;  1M27 C;  2K7A A;  1VQO Q;  2COW A;  2XKO C;  1VOM A;  2EYZ A;  1NLO C;  2D6F A;  1YI2 A;  3ZEH A;  2RNA A;  1PC0 A;  5KYW A;  2KT1 A;  4BAC A;  2HKQ B;  4IUT A;  3LLR A;  4X1V A;  2COZ A;  3EFO B;  4L59 A;  4ME7 A;  4DOV A;  1YI2 T;  5I21 A;  4XTY A;  1WA7 A;  3A98 A;  1JJ2 A;  3JCM c;  2EQJ A;  2NUP A;  4OF1 A;  4C8Q C;  1Y7X A;  1ZSZ C;  2MK5 A;  3A8L B;  3FB9 A;  3FC3 A;  5HK0 A;  1Q82 U;  3OYF A;  3EHR A;  4DEY A;  1U5S A;  4FM4 B;  4HCZ A;  3CXC A;  5GAN d;  1KC8 R;  1WGS A;  3OMG A;  2WAC A;  3VRY A;  1VQN Q;  2CKK A;  4OMM A;  4GLK A;  3OS1 A;  1KQ1 A;  3PIP A;  4LN2 A;  1CSK A;  1QLY A;  2YSQ A;  4C0G A;  1IHW A;  1QW1 A;  2DXB A;  1N9S A;  2QDY B;  4AFU C;  2DZ9 A;  3EG9 B;  1VA7 A;  4IUP A;  4XTZ A;  1TH7 A;  3JCM J;  2E64 A;  1AZG B;  5CK9 A;  1UGV A;  3LYI A;  5LJ3 h;  2FL7 A;  2QI2 A;  3CD6 A;  5KYW B;  2W0Z A;  4JUV A;  2BZX A;  4PJO A;  5GAN j;  1V1C A;  3QKJ A;  3S6W A;  2LNH B;  2CDT A;  2EYW A;  3UAT A;  4F7U E;  1YCY A;  4HCB A;  3TEE A;  3OW2 P;  4KGV B;  2NUP B;  2ZAE A;  4OVA A;  3CCE Q;  2F69 A;  1NJI R;  5DLQ E;  5FLX E;  3KUF A;  1ACM B;  5LJ3 e;  1EFN A;  2M0Y A;  1OUL A;  1D0Z A;  5LJ5 f;  2X4W A;  5FRN A;  2CP7 A;  2A08 A;  1SHG A;  1X69 A;  2AHJ B;  1KC8 U;  2HL3 A;  3JCM f;  5KCO A;  3M9Q A;  1UDL A;  4HVV A;  4ZGD B;  4XTU A;  4LDX A;  1Q86 R;  1VQP Q;  4QVZ A;  2QGF B;  4C0D B;  1K0X A;  1WHG A;  3SDZ A;  4DBH A;  3JSC A;  1PM3 A;  1CKB A;  4PNO A;  3CQT A;  2FHD A;  1RAF B;  2YLB A;  3S3M A;  1RAI B;  4J9H A;  5LJ3 d;  1BIA A;  1WPY A;  2M16 A;  2CH4 A;  2DO3 A;  2E41 A;  1Q95 G;  1UGP B;  4PJO B;  5FU7 C;  2L3S A;  3VV0 A;  5CCA A;  2K6D A;  3EGU A;  4ESR A;  1D0X A;  4JRI A;  4M77 C;  1TG0 A;  4BY6 B;  3GOX A;  2EW3 A;  3LH5 A;  1KD1 R;  2VXF A;  2X35 A;  3L2Z A;  5D7U A;  3U23 A;  4E7J A;  1M3C A;  4A4H A;  2XDB A;  3NMZ C;  1X2K A;  1WFW A;  5FRO A;  5LJ3 j;  4PFZ A;  2LJ1 A;  3RKX A;  2JTM A;  5LJ5 g;  5C6S A;  2ZPF B;  4KUL A;  5IHN A;  2F5K A;  1MV0 B;  1QVF P;  1TUD A;  2DL4 A;  3JCM g;  3CCJ T;  2DET A;  1Q86 U;  1K73 C;  3CPW S;  3M59 A;  2KSS A;  1KQS P;  2E5Q A;  2XI9 A;  1EIF A;  3M0Q A;  4JDS A;  2E6N A;  2KMT A;  3LGF A;  2DYB A;  1FMV A;  2RI3 A;  3JB9 G;  1I81 A;  3CCU A;  2VUB A;  2YUO A;  4JRK A;  1VQK Q;  1TTH B;  1Q81 R;  1RLP C;  2EYQ A;  1N9R A;  1OU8 A;  3CCU T;  2JMC A;  2GFU A;  1UGR B;  4X9C A;  3TCJ A;  3G4S T;  4XTW A;  2GCX A;  3M0R A;  3UDC A;  3OB9 A;  2O2O A;  3OYD A;  3JCM P;  3RR6 A;  4C92 C;  2YLC A;  2QA4 A;  2D0N A;  3TU4 K;  4MMK A;  4J6X A;  4L6V 5;  1PWT A;  1QVG S;  1SF9 A;  2M9U A;  5CKD A;  5D6Y A;  2QA4 T;  6AT1 B;  3CD6 Q;  2GGR A;  3DB3 A;  3J81 E;  4HCC A;  2DLP A;  4M7A G;  4FSX A;  2XDD A;  2VYT A;  2J05 A;  5CAI A;  3PVL A;  2YRD A;  3M0U A;  3VS6 A;  2GQI A;  1IHV A;  1VQ4 A;  2E6Z A;  1C6V X;  4PJN A;  2LDM A;  3GNG A;  4RTT A;  2K2V A;  2L0A A;  1W6X A;  5CO7 A;  1X27 A;  3OW2 A;  3CCS Q;  2OTL A;  1JBM A;  2LCC A;  4AG2 C;  2JXB A;  1VQ4 T;  1OZ3 A;  2NUZ A;  2NLU A;  2F2X A;  4QVD A;  2D1X A;  4A63 B;  4FL6 A;  2A28 A;  2RJC A;  2OTL T;  4J83 A;  3QXE B;  2P0K A;  1K76 A;  2RJE A;  3M53 A;  4QQ6 A;  5IH2 A;  2PUK B;  4XTV A;  1YIJ Q;  1M1G A;  1Q81 U;  4N0A A;  3ME9 A;  2DXT A;  2L2P A;  1TUG B;  1HK9 A;  2MMP A;  2RQU A;  4IKF A;  2HKN A;  2LZ6 B;  4F7U F;  2IIM A;  4OB3 B;  2GFA A;  5GAM d;  1WIE A;  3MEW A;  4LD6 A;  1G5V A;  3BDU A;  1QMC A;  2F2W A;  3HSB A;  1I1J A;  1JEG A;  2EQK A;  1LVK A;  2LCL A;  2FB7 A;  4B6M A;  5J3B A;  1K9A A;  3OQ5 A;  4JLG A;  2EYY A;  1ZA1 B;  2QEX T;  3M56 A;  1NZ9 A;  4OGC A;  2ABL A;  2LCS A;  4A4K A;  1WQ7 A;  4FW1 A;  1QP2 A;  1RI0 A;  3QYH B;  1PG5 B;  4OMN A;  5GAM j;  3P8B B;  1UG1 A;  3MEA A;  4JPB W;  2BZ8 A;  1YIT Q;  2HEQ A;  2ZCF B;  2V8J A;  1TSF A;  1UUE A;  4PLL A;  4ZGJ B;  4ZTF A;  1H3Z A;  3C94 A;  3F70 A;  3QJY A;  3VUB A;  2VVK A;  2FPD A;  4BDY A;  2WSF E;  1T3S A;  1SRM A;  2C0I A;  2E5K A;  2M02 A;  1OPK A;  2XID A;  4D8K A;  2K2M A;  3H41 A;  2E4H A;  4JJN K;  2EJG A;  1RLQ C;  2COY A;  1GRI A;  2ZGW A;  1VQ9 Q;  2CP0 A;  3CC4 T;  4C8Q B;  2KXC A;  4KT0 E;  1E6H A;  3MEV A;  2QAS A;  2YT6 A;  3OYG A;  1DJ7 B;  3JRZ A;  4RCB A;  2CT4 A;  1JB0 E;  5A2Q E;  4J7I A;  1I5L A;  3JB9 H;  4OMP A;  1U06 A;  1NYF A;  2AT1 B;  2H3E B;  4RTU A;  1YHQ A;  2EKO A;  5IXF A;  3ZFJ A;  1M4Z A;  2QA4 Q;  1YWO A;  4LUD A;  4Y91 A;  5FU6 C;  1AD5 A;  2GNC A;  1GFC A;  2HL5 C;  1SRL A;  2LQN A;  1YHQ T;  4UC4 A;  1ZUY A;  3TQ7 P;  1M8V A;  4M7A A;  2OAW A;  2MWO A;  2DKG A;  2DRK A;  2DRM A;  3MKD A;  5GMK l;  1W2B S;  1CKA A;  2G6F X;  2DD4 A;  2GBQ A;  7AT1 B;  4KH0 B;  2PTK A;  3GPL A;  2OTL Q;  3V7C A;  3NTK A;  1Q7Y C;  2J06 A;  3A8M B;  2ED1 A;  5GAN 5;  1MHN A;  2C0T A;  2D0Q B;  4CC4 B;  2EYX A;  2V1R A;  1VQL A;  4GY5 A;  1VQM Q;  2LRQ A;  4M7D G;  3X25 B;  1VQ5 Q;  3GNF B;  1QCO A;  3L2U A;  1VQL T;  2KNB B;  2XMF A;  1K1Z A;  4BDZ A;  4Y28 E;  2QXF A;  3A8H B;  1ABO A;  3S3O A;  1VQ8 A;  3CEY A;  4XU1 A;  3JCM b;  3CCL T;  4HXJ A;  1ZSG A;  2F5T X;  1PKT A;  4EPC A;  4M7A B;  4J9F A;  1SPK A;  1RAC B;  2A36 A;  1I07 A;  4KH1 B;  2KY9 A;  2L89 A;  3RUX A;  1VQ8 T;  1YJN Q;  3KXT A;  1ABQ A;  3BDL A;  2KRS A;  3EFR A;  1UJY A;  1MUZ A;  3HL8 A;  1K0S A;  3OY9 A;  1T0J A;  2KRN A;  3NPF A;  2QQA A;  2J7I A;  1H64 1;  5GAO n;  4ZTJ A;  2VC8 A;  3N5B B;  5FU7 B;  4J6W A;  2YRV A;  2Y4X A;  3QBY A;  1N8R C;  3BY7 A;  4M77 B;  2V1Q A;  1M1K C;  5L23 A;  1NPP A;  3C0C A;  3JCM V;  4E2F B;  3RKW A;  4M75 D;  2RQV A;  4AFS C;  1ZLM A;  5ECA A;  3L42 A;  3M0P A;  4DOW A;  2DD5 A;  3CBO A;  1A0N B;  1VIF A;  2KI7 A;  1MMA A;  2QQ9 A;  3QWX X;  3OYM A;  2DJQ A;  3JB9 I;  1MMD A;  2ZPB B;  1N5Z A;  3CMA T;  1Y57 A;  2DFU A;  3VJP A;  2XDP A;  2P84 A;  5GAN h;  1UTI A;  3NTH A;  4M75 E;  1MMG A;  3QDR B;  3G6E A;  3L2R A;  1BBZ A;  4RKU E;  2HBP A;  1JJ2 S;  1UJ0 A;  2VKN A;  1GCP A;  2SEM A;  2E12 A;  1NEB A;  2RK2 A;  3G6E T;  3M58 A;  4LD9 K;  1WI7 A;  3MHX A;  5GAN e;  1YHQ Q;  2K3Y A;  3CXC S;  3QO3 A;  1G2B A;  1D1C A;  4O5V A;  1WLP B;  1AT1 B;  4QQG A;  1RAB B;  2DER A;  1ZQ1 A;  2RMO A;  4JJC A;  4C5G A;  1QWE A;  2JS0 A;  2KR3 A;  3C4S A;  4C92 B;  3CCM A;  4M75 C;  1Z9Q A;  1W4S A;  3EHQ A;  2M1H A;  1VYU A;  3HRU A;  2EAY A;  3CCM T;  4ATO A;  1KG1 A;  3R6O A;  3WVD B;  1VQ6 A;  2C06 A;  1HJD A;  4AMC A;  1YN8 A;  2X3X D;  1WXU A;  2K5I A;  2BKD N;  1VQ6 T;  1KHI A;  3EG2 A;  1ZBJ A;  2FZK B;  3C12 A;  4PK4 A;  3FJP A;  4L5G A;  4M7D A;  3RMQ A;  2DEU A;  3OYH A;  2LQ8 A;  2CUD A;  4AFQ C;  4ELZ C;  3G71 A;  5GAN 8;  3T9N A;  1GL5 A;  2KK4 A;  1S72 T;  3JCM d;  3SB2 A;  3CPW P;  3G71 T;  2JM8 A;  4CC7 A;  1FYN A;  1RAH B;  1VQ8 Q;  1Z9Z A;  2YRC A;  1OYX A;  2X4J A;  4XAX B;  1WJQ A;  1HD3 A;  2LTO A;  3VS0 A;  3RIR A;  3J7A F;  2J6K A;  5IXB A;  3NFC A;  5KH6 A;  4HT9 A;  2DVJ A;  1X6B A;  4N4I A;  3BW1 A;  3OYA A;  3E9F A;  3CCV A;  1N27 A;  1B34 A;  2JW4 A;  2L3P A;  3VRZ A;  2DX1 A;  3OYN A;  5GAN f;  3QZ5 B;  2NYS A;  4NL2 A;  3CCV T;  1HYO A;  4YTL A;  5EC7 A;  2QTX A;  4PJJ A;  5GMK m;  4M7D B;  2I2L A;  2BZY A;  3LW5 E;  2AZV A;  3MO8 A;  2KT8 A;  5KYY A;  4IUR A;  2V8K A;  3GF5 A;  2J6O A;  2XU8 A;  1D0Y A;  2D8J A;  4M78 D;  5GAN 7;  5I2M A;  2DM1 A;  1PNJ A;  3I5R A;  3M55 A;  1QWF A;  4CRI A;  2DL8 A;  1B7T A;  2LC4 A;  3I55 Q;  2AZS A;  2MAM A;  5CKF A;  3CME Q;  1MV3 A;  2ZPE B;  3THK A;  3V8J A;  2IVW A;  5IHK A;  4KGX B;  3PNW C;  2EQU A;  4EMK C;  1X43 A;  4C8Q G;  4PJM A;  4EMG A;  2RF0 A;  3OSS C;  4M78 E;  5A0G A;  1LPL A;  1B34 B;  4DBF A;  4ZN3 A;  1UGQ B;  1UEB A;  8ATC B;  1R0C B;  4KRT A;  3MJX A;  4EDU A;  1D1A A;  1Y96 A;  3CCJ A;  2L3Q A;  1YI2 Q;  2QDL A;  5GAN g;  1WX6 A;  1RAE B;  5KYY B;  3PMI A;  1RI9 A;  1H3H A;  2FEI A;  2BE7 D;  3CCM Q;  3E19 A;  3JCM W;  3QII A;  5A0L A;  5FU6 B;  1VUB A;  3I9Q A;  1GCQ C;  4M75 F;  5LJ3 f;  3A1P A;  3H0F A;  4M78 C;  2EGA A;  4PFO A;  2DXC A;  3P8D A;  4PL6 A;  3UT1 A;  1X6G A;  3CC2 A;  1WDX A;  2JMA A;  4PJL A;  2RHY A;  4OML A;  3G4S A;  4OB0 B;  4F14 A;  2Y90 A;  1YWP A;  3CC2 T;  5GAO l;  1UFF A;  2JOY A;  1JQQ A;  1WJS A;  3SWN C;  1N6A A;  2E3I A;  3OW2 S;  3G71 Q;  5KYU B;  2R57 A;  3TSW A;  2F2V A;  3R6N A;  1Y96 B;  2E3H A;  5GAM h;  2FO0 A;  4K11 A;  4J9C A;  4F7U G;  3PE0 A;  2K4Y A;  3NHN A;  2OTJ A;  2K3X A;  3O5Z A;  4Z88 A;  1XOV A;  2KXD A;  1MNE A;  3HP9 A;  2B86 A;  5LL6 S;  2DXU A;  1I4K 1;  5GAM e;  2OTJ T;  1NJI C;  1AWX A;  5M9O A;  2MF2 A;  2QQR A;  1X75 C;  4LUE A;  3CCV Q;  1YBY A;  5LJ3 g;  3A8O B;  1IO6 A;  1KK7 A;  4M77 G;  2I0N A;  1M1F A;  2FRW A;  1NEG A;  9ATC B;  3CCR A;  3UA7 A;  1BCO A;  3TVT A;  4RCC A;  1KSW A;  2AK5 A;  2H3J A;  2NUT B;  1SEM A;  3RNJ A;  1RAA B;  3G1J A;  1WQW A;  1EZZ B;  5IHI A;  3RES A;  3CCR T;  1AWO A;  1IB8 A;  1JXO A;  2DTO A;  1RAD B;  3HRS A;  2JTF A;  2PVO B;  4IUV A;  3OMC A;  3E1S A;  2DBM A;  4JS5 A;  4PJO D;  2P4R A;  3EGD A;  1YJ9 T;  1KFZ A;  4M7D E;  2MPX C;  1QQJ A;  1OQK A;  2DK3 A;  2QEX A;  4A4G A;  4RTW A;  4IIM A;  4FT2 A;  1QCN A;  3CC7 A;  4C8Q A;  1S1N A;  1ZSZ A;  3HKS A;  1R0B G;  2BUD A;  1KD1 C;  1Y71 A;  2AKL A;  3CCQ A;  2O88 A;  4BI8 B;  2RJF A;  5D6W A;  3CC7 T;  4ORZ A;  4PJO E;  4JRP A;  3CCQ T;  1BCM A;  1M5Q 1;  3PIO A;  1JU5 C;  2EJ9 A;  3EG1 A;  3CCJ Q;  2JJ9 A;  1ZHI A;  2X51 A;  5IAY A;  5CQY A;  4C0D C;  1WNL A;  3NTI A;  4C92 G;  4ZNX A;  2HQH A;  5GMK h;  1V29 B;  2CT3 A;  4OB2 B;  1QVF A;  2DZC A;  3OS0 A;  3CC4 A;  1KQS A;  3EGD B;  4PJO C;  1G3S A;  2FVU A;  2FPF A;  4M78 F;  2L3R A;  4D6W A;  3OYL A;  3CCU Q;  1XTD A;  5J26 A;  1U8R A;  1PD1 A;  2ENM A;  3I35 A;  2Z0W A;  4FYW B;  4LDW A;  3G4S Q;  2HZY A;  1WYX A;  5I2S A;  3KBG A;  4RTV A;  2LT1 A;  5GMK e;  1ZSZ B;  4BY6 C;  4J7F A;  4Q5W A;  4BI3 A;  1VIE A;  3L1A A;  2P4T A;  4J9G A;  5EG2 A;  5L8R E;  1PRL C;  3PVQ A;  2HDA A;  1K9M C;  1AVZ C;  1MGQ A;  4HKE A;  2RO0 A;  5KYX A;  2VAS A;  1LCK A;  4OMF B;  2FYK A;  3QDF A;  4F7U A;  4AG1 C;  1BIB A;  4J9D A;  1ZUK A;  2VV5 A;  2RPN A;  3V7R A;  2JN0 A;  1KJW A;  2OTJ Q;  1VQO A;  3VS3 A;  2O01 E;  2HQX A;  1M9S A;  1VQ4 Q;  5FW9 A;  1UB4 A;  4E7L A;  1KQ2 A;  1JJ2 P;  2EVR A;  1VQO T;  5AYF A;  1RAG B;  1ZA2 B;  1AEY A;  4MZT A;  5KE2 A;  2PU9 B;  4E7I A;  2PUO B;  2QTV A;  1GBR A;  2NWM A;  3EH2 A;  3PFS A;  4M77 A;  2MWP A;  4J8O A;  4DBR A;  4B9X A;  2X3W D;  5KYN A;  5GAN 3;  3CXC P;  2YDL A;  2ZPG B;  4FIB A;  5HKC A;  3VYG A;  5HY6 A;  3V7S A;  2LQK A;  1UE9 A;  4EMH A;  2DNU A;  5GMK j;  2RN8 A;  3MP6 A;  4F17 A;  3CCL A;  5CVI A;  3HTR A;  2KYB A;  3OS5 A;  3FJ5 A;  1FXX A;  5KYX B;  2PNI A;  2OJ2 A;  3VKI A;  2ED0 A;  2ROL A;  1BKB A;  4J9I A;  4F7U B;  1VQN T;  2ECZ A;  1G8X A;  1QP3 A;  1H92 A;  5DLO A;  2O31 A;  1XNI A;  5GAO m;  1MND A;  2RB6 A;  1E6G A;  1YP5 A;  2R5A A;  2QEX Q;  1G3W A;  2LVM A;  1M2V A;  2G3R A;  1SG5 A;  2J6F A;  3VS1 A;  4AFZ C;  4FSS A;  5CR2 A;  3CCQ Q;  3JAM E;  5D6X A;  1M90 C;  2LJ0 A;  5GJV B;  4A53 A;  5GAO p;  4JJD A;  1QCF A;  3E2U A;  2E10 A;  3EFS A;  1JO8 A;  2CH4 W;  4Z89 A;  2FZG B;  5KE3 A;  3CCE A;  2GF7 A;  1WHH A;  4MDX A;  4C5I A;  3SD4 A;  4DEX A;  1OX8 A;  3J80 E;  1TOV A;  5HCK A;  3VS7 A;  3PMT A;  3CCE T;  3MPU B;  1RL2 A;  3CPF A;  4C92 A;  2ATC B;  1VYV A;  4LDU A;  2RI2 A;  2CP2 A;  4O6J A;  3CMA A;  2VB6 A;  2O9V A;  2MI6 A;  3BE3 A;  2YUN A;  4MZM A;  4A4F A;  2M51 A;  4WTO B;  1IGU A;  4AT1 B;  1YJW A;  2VGM A;  2CZ0 B;  4XQ3 A;  3CC4 Q;  3WVE B;  2GQV A;  2XK0 A;  1VQP T;  5CKH A;  4PJO F;  4C8Q D;  1YJW T;  2GTO A;  1M2V B;  1OEB A;  3OYE A;  3TSZ A;  4II1 A;  3GBQ A;  1WHL A;  4OB1 B;  1PHT A;  1HXD A;  4HVW A;  1YFN A;  1WJR A;  2A0F B;  4FYY B;  2Y4Y A;  3HRT A;  2ROT A;  3JCM h;  2QQB A;  2YXY A;  2E70 A;  4C8Q E;  3GIB A;  4N0A C;  1ZX6 A;  5J39 A;  3RMS A;  1BI3 A;  2EQI A;  2K9G A;  4B9W A;  3UA6 A;  2HSE B;  2E65 A;  2DJZ A;  1IRE B;  4LE9 A;  3JCM e;  4J6Y A;  1KHC A;  5GAN 4;  3JB9 D;  2JVV A;  2DE0 X;  1K73 R;  4NL3 A;  1SSH A;  2CYZ B;  3M5A A;  1U1T A;  5CKE A;  3OYB A;  2KYM A;  3KFV A;  1TU0 B;  3JB9 J;  2JUF A;  1VQL Q;  2JZ2 A;  1S72 A;  5LJ5 d;  2SRC A;  1VQK A;  4BUG A;  2QK0 A;  1X6O A;  2DVE A;  5A0D A;  2QG9 B;  1X2Q A;  2HBW A;  4QQD A;  2CP3 A;  3CCL Q;  2DYI A;  4QVC A;  1C0M A;  1VQK T;  1PRM C;  1K8A C;  1J3T A;  4E6R A;  2E1H A;  3FLG A;  1WHJ A;  1WXT A;  1UHC A;  2YHT A;  3M57 A;  1HSQ A;  3NGP A;  3LWH A;  4M7A D;  2CZ1 B;  3JCM X;  1YNZ A;  3X26 B;  2CUB A;  4XK8 E;  3QYG B;  1OOT A;  4CC3 A;  4C5H A;  5LJ5 j;  4WF2 A;  1D09 B;  2WSE E;  4M77 D;  3RBB B;  4BB7 A;  2EGC A;  3CD6 T;  2QYZ A;  4P5N A;  3PTA A;  1JXM A;  4M7A E;  2KAF A;  2ZZD A;  2DPP B;  2RK1 A;  3L2V A;  1K73 U;  3EG3 A;  4HT8 A;  3MET A;  2CS7 A;  4ZN1 A;  2K3B A;  2HCK A;  3CBP A;  1PD0 A;  1QVG P;  2X4Y A;  4D8D A;  3CCS A;  1ZUU A;  2LX9 A;  4FT4 A;  3L2W A;  4HA8 A;  3OBY A;  2AIR B;  3PGG A;  3INZ A;  2RI5 A;  1OZ2 A;  3CCS T;  4NOY A;  2DMO A;  4KBM B;  1Q82 C;  1BI0 A;  3CMA Q;  4M77 E;  2JTE A;  5GAO q;  1YIJ A;  3DKM A;  3AT1 B;  2P0P A;  3LGL A;  1W1F A;  1M30 A;  4FCY A;  1TXQ A;  1R77 A;  1BB9 A;  1YJW Q;  4F16 A;  4HCK A;  3VU3 C;  4M75 G;  1YIJ T;  4M7A C;  2HMA A;  2K79 A;  5GMK i;  2A7Y A;  4TVR A;  3AHU A;  2FG0 A;  3V8K A;  1OPL A;  4ELY C;  4RG2 A;  3G6E Q;  1M2O A;  3HPW A;  3RKY A;  2RJD A;  3TRE A;  3REB B;  1U1S A;  3OYY A;  2YUQ A;  1BI1 A;  1U3O A;  1K4U S;  2V26 A;  3FEO A;  5KYU A;  2OAU A;  3DLL A;  3CBM A;  2DL7 A;  4RUG A;  4BE0 A;  3H0H A;  4A54 A;  4FYV B;  3PT9 A;  5GAN 6;  2DIG A;  4FW2 A;  5FWB A;  2KE9 A;  4PKC C;  4IUU A;  2KGT A;  1LJO A;  4WCI A;  2LP5 A;  4QKU A;  2VXE A;  4C92 D;  4Z02 A;  1NJI U;  4LDY A;  2CZ6 B;  2XIC A;  3GLX A;  2RHX A;  3QZ9 B;  1ARK A;  1D1B A;  2QGG A;  2FPE A;  4BE2 A;  1YIT A;  1FMK A;  2DL5 A;  4LDV A;  5C0M A;  1UGS B;  1VQ6 Q;  1QKW A;  3UPU A;  4IUQ A;  1R8O B;  3MP8 A;  4LXC A;  1M3B A;  4F04 B;  4V2S A;  1D3B A;  2X4X A;  3M54 A;  1KC8 C;  1RUW A;  1YIT T;  1NYG A;  4C92 E;  3OS2 A;  2W10 A;  4E7H A;  3G7Z A;  2EPD A;  4C8Q F;  4RTZ A;  2NUT A;  1S72 Q;  2HQE A;  1XJW B;  2CSQ A;  2DTI A;  1VQ9 A;  2EBP A;  2BE9 B;  4N4H A;  2CRE A;  2EJF A;  2JT4 A;  4BI4 A;  2V8I A;  1I5O B;  2DAQ A;  2DL3 A;  1VQ9 T;  1PCX A;  4XTX A;  1KD1 U;  3CPW A;  4JZ4 A;  1K9M R;  1LOJ A;  4HVU A;  3HHT B;  1TS9 A;  2X9H A;  4R0K A;  3SHW A;  3EH1 A;  5GJW B;  2ZPI B;  4OMQ A;  3MP1 A;  1I8F A;  2EGE A;  1NM7 A;  3LX7 A;  2A37 A;  2ESW A;  1TUC A;  1D3B B;  2RD1 A;  3OYJ A;  1Y0M A;  2D8H A;  4RTY A;  4EIK A;  1NPR A;  2XD0 A;  3JB9 F;  2CGH A;  1T3L A;  2OI3 A;  3RDV A;  4CC2 A;  2ZPH B;  2R58 A;  4M7D D;  2D9T A;  3ASK A;  2BTT A;  3OYC A;  1M8M A;  2RA2 A;  2L8D A;  4R56 A;  1GXI E;  1Q86 C;  1WZO A;  5DY9 A;  3VS4 A;  1OV3 A;  3ZL7 C;  1UEC A;  4GBQ A;  1QVG A;  1Q7Y R;  1IGQ A;  3ULR B;  1EX4 A;  8AT1 B;  5I11 A;  1YJ9 A;  1W2B P;  4IIO A;  3QWY A;  3VS5 A;  2HAX A;  4MZP A;  5CQX A;  3X24 B;  3HFO A;  1VQM A;  4Y92 A;  3QUI A;  1OI1 A;  3HFN A;  1VQ5 A;  2LT4 A;  1YCS B;  3VUZ A;  2KBT A;  4M75 A;  4E7K A;  3MCA B;  1T0H A;  2JNG A;  2JS2 A;  1VQM T;  1NLP C;  1E7O A;  2HSP A;  4JRQ A;  1K9M U;  1VQ5 T;  4DA4 A;  2CZ7 B;  4XU3 A;  4M7A F;  4E7Z A;  4MDW A;  4R55 A;  1Y07 A;  4M78 G;  1M3A A;  1VQ7 A;  5FRM A;  1QVF S;  4ANJ A;  1NE8 A;  3EGX A;  3M0T A;  2KVQ G;  5I22 A;  1VQ7 T;  4J5Y A;  1KQS S;  1YJN A;  3SFM A;  4ZGE B;  2F1L A;  1AWW A;  1WXB A;  2QQS A;  4M77 F;  1YJN T;  1IRX A;  1M90 R;  2BIV A;  4J9E A;  2PQW A;  2DF6 A;  4LNP A;  4M7D C;  1BI2 A;  1N8R R;  3MEU A;  2IG0 A;  3SEM A;  2LMJ A;  3EAE A;  3FDR A;  2O4X A;  5GAN 2;  3QHS A;  1PSE A;  2HNI A;  2MOX A;  4M4Z A;  1M1K R;  2HD0 A;  2EKH A;  5GAM f;  1Q7Y U;  2YUP A;  1ZBX A; 
#chains in the Genus database with same CATH homology
 1JO8 A;  2CH4 W;  1RLP C;  4Z89 A;  1Z9Z A;  2KRO A;  2JMC A;  1NG2 A;  4DEX A;  3M0R A;  1HD3 A;  5HCK A;  3VS0 A;  3VS7 A;  2O2O A;  2O9S A;  2J6K A;  5IXB A;  1VYV A;  4RTX A;  2D0N A;  2DVJ A;  1X6B A;  1PKS A;  2O9V A;  1PWT A;  2JW4 A;  2L3P A;  4J9B A;  3VRZ A;  2DX1 A;  2YUN A;  2RQT A;  2M51 A;  2GGR A;  1BK2 A;  1B3Q A;  1W70 A;  5EC7 A;  2KRM A;  2DLP A;  4JJB A;  2J05 A;  2AKK A;  3PVL A;  4JZ3 A;  2BZY A;  3M0U A;  2AZV A;  3VS6 A;  2KT8 A;  2GQI A;  2GTO A;  1OEB A;  3TSZ A;  2J6O A;  3I5S A;  4RTT A;  2L0A A;  3GBQ A;  1W6X A;  1VYT A;  1X27 A;  1KIK A;  1AZE A;  2D8J A;  4AG2 C;  2JXB A;  2DA9 A;  2NUZ A;  1G83 A;  1PHT A;  4HVW A;  2DM1 A;  2F2X A;  1PNJ A;  2D1X A;  4QT7 A;  4A63 B;  3I5R A;  1QWF A;  2A28 A;  2DL8 A;  5FWC A;  2AZS A;  1MV3 A;  3THK A;  1AWJ A;  1K76 A;  1UHF A;  2ROT A;  4GLM A;  2RQW A;  5IH2 A;  2FRY A;  5IHK A;  4OMO A;  1AOJ A;  1B07 A;  2L2P A;  1ZX6 A;  1X43 A;  2DBK A;  2GTJ A;  2RQU A;  2KEA A;  2LJ3 A;  2EQI A;  2K9G A;  2LZ6 B;  2C0O A;  2DIL A;  2RF0 A;  2IIM A;  3UA6 A;  4LE9 A;  1WIE A;  2VWF A;  4KRT A;  2LQW A;  3UF4 A;  2DE0 X;  1SSH A;  2F2W A;  2L3Q A;  2QDL A;  1I1J A;  1WX6 A;  2MCN A;  3REA B;  1JEG A;  2KYM A;  1RI9 A;  3M0S A;  1H3H A;  2FEI A;  3KFV A;  1K9A A;  1GBQ A;  2EYY A;  2RQR A;  1GCQ A;  2MIO A;  3I9Q A;  1GCQ C;  2ABL A;  4Z8A A;  2SRC A;  2LCS A;  1GFD A;  3H0F A;  2EGA A;  1X2Q A;  2HBW A;  4OMN A;  1X6G A;  1BU1 A;  1WDX A;  1PRM C;  1J3T A;  2JMA A;  4E6R A;  1UG1 A;  4OML A;  1WXT A;  1UHC A;  4JPB W;  2BZ8 A;  4F14 A;  2HEQ A;  1UUE A;  1HSQ A;  3NGP A;  3IQL A;  1YWP A;  2VVK A;  2FPD A;  1UFF A;  1JQQ A;  1T3S A;  1SRM A;  2C0I A;  1YNZ A;  2CUB A;  2E5K A;  1OPK A;  1OOT A;  4CC3 A;  4D8K A;  2K2M A;  3H41 A;  3TSW A;  2F2V A;  1I0C A;  3R6N A;  1QKX A;  3RBB B;  1RLQ C;  2EGC A;  2FO0 A;  1GRI A;  1JXM A;  4K11 A;  4J9C A;  3EG3 A;  2KXC A;  1E6H A;  2K3B A;  3NHN A;  3PE0 A;  2YT6 A;  2HCK A;  3H0I A;  4D8D A;  1H8K A;  1ZUU A;  2CT4 A;  3O5Z A;  4Z88 A;  1XOV A;  4OMP A;  1U06 A;  1NYF A;  2KXD A;  2B86 A;  3EG0 A;  4RTU A;  3VS2 A;  5IXF A;  2CSI A;  1AWX A;  1YWO A;  4LUD A;  2PZ1 A;  2DMO A;  1AD5 A;  2GNC A;  4LUE A;  1GFC A;  2JTE A;  1SRL A;  2LQN A;  1IO6 A;  1SHF A;  1ZUY A;  1W1F A;  1M30 A;  2I0N A;  2FRW A;  1BB9 A;  1NEG A;  4F16 A;  4HCK A;  2H8H A;  2OAW A;  2DRK A;  2DRM A;  2K79 A;  3UA7 A;  3TVT A;  2FG0 A;  1KSW A;  1CKA A;  2AK5 A;  3JV3 A;  1OPL A;  1SEM A;  2G6F X;  2LX7 A;  2JM9 A;  2GBQ A;  3RNJ A;  5IHI A;  1AWO A;  1M27 C;  2K7A A;  3REB B;  1JXO A;  2PTK A;  2EYZ A;  1NLO C;  2YUQ A;  1U3O A;  2RNA A;  1K4U S;  2DBM A;  2KT1 A;  2DL7 A;  4RUG A;  4X1V A;  2P4R A;  3H0H A;  2J06 A;  2ED1 A;  1KFZ A;  2C0T A;  5FWB A;  4CC4 B;  2EYX A;  2KE9 A;  1WA7 A;  2V1R A;  2KGT A;  3A98 A;  4WCI A;  2LP5 A;  4RTW A;  4IIM A;  1S1N A;  2KNB B;  2XMF A;  1K1Z A;  2AKL A;  2O88 A;  3EHR A;  4DEY A;  1U5S A;  1ABO A;  4ORZ A;  1ARK A;  2FPE A;  1FMK A;  3VRY A;  2DL5 A;  1QKW A;  4HXJ A;  1ZSG A;  1PKT A;  4OMM A;  1SPK A;  4J9F A;  1M3B A;  1JU5 C;  1I07 A;  2A36 A;  4LN2 A;  1CSK A;  3EG1 A;  1QLY A;  2YSQ A;  1RUW A;  1NYG A;  1ABQ A;  4AFU C;  2KRS A;  1UJY A;  1MUZ A;  1VA7 A;  1K0S A;  2W10 A;  1T0J A;  2KRN A;  3NPF A;  2J7I A;  4ZNX A;  1AZG B;  2EPD A;  2CT3 A;  4RTZ A;  1UGV A;  2CSQ A;  2W0Z A;  2EBP A;  2BZX A;  2CRE A;  2FPF A;  1V1C A;  2V1Q A;  2LNH B;  2CDT A;  2EYW A;  2JT4 A;  3UAT A;  5L23 A;  3C0C A;  2ENM A;  3I35 A;  2DL3 A;  1WYX A;  4RTV A;  2RQV A;  4JZ4 A;  4AFS C;  1ZLM A;  5ECA A;  3M0P A;  4HVU A;  1EFN A;  2M0Y A;  4J9G A;  1A0N B;  1PRL C;  3PVQ A;  4R0K A;  3QWX X;  3SHW A;  5GJW B;  2HDA A;  2DJQ A;  2A08 A;  4OMQ A;  1AVZ C;  2EGE A;  1NM7 A;  1SHG A;  1X69 A;  2A37 A;  2ESW A;  1N5Z A;  1TUC A;  1Y57 A;  1UDL A;  4HVV A;  1UTI A;  1Y0M A;  2D8H A;  4RTY A;  4EIK A;  1LCK A;  1K0X A;  1T3L A;  2OI3 A;  4AG1 C;  4CC2 A;  1BBZ A;  4J9D A;  1ZUK A;  1UJ0 A;  2RPN A;  1CKB A;  2VKN A;  1GCP A;  1KJW A;  2SEM A;  3CQT A;  2BTT A;  1NEB A;  1M8M A;  3VS3 A;  4J9H A;  3VS4 A;  2CH4 A;  1WI7 A;  1OV3 A;  5FW9 A;  3ZL7 C;  1UEC A;  4GBQ A;  3ULR B;  2EVR A;  1AEY A;  2L3S A;  5I11 A;  1G2B A;  4IIO A;  3QWY A;  3VS5 A;  1WLP B;  2K6D A;  3EGU A;  1GBR A;  2NWM A;  4ESR A;  4Y92 A;  2RMO A;  4JJC A;  1TG0 A;  2X3W D;  1YCS B;  2EW3 A;  3LH5 A;  1QWE A;  2JS0 A;  2KR3 A;  2YDL A;  2KBT A;  1Z9Q A;  1T0H A;  2JS2 A;  1NLP C;  1E7O A;  2HSP A;  3U23 A;  1M3C A;  3EHQ A;  1VYU A;  1UE9 A;  3NMZ C;  2DNU A;  2RN8 A;  1M3A A;  1X2K A;  4F17 A;  1WFW A;  1HJD A;  2LJ1 A;  2KYB A;  3M0T A;  5I22 A;  3FJ5 A;  1YN8 A;  2PNI A;  2OJ2 A;  2X3X D;  2ED0 A;  1WXU A;  2ROL A;  4J9I A;  5IHN A;  1MV0 B;  2ECZ A;  3EG2 A;  1AWW A;  1TUD A;  1H92 A;  2DL4 A;  1ZBJ A;  2O31 A;  1WXB A;  1E6G A;  1YP5 A;  4J9E A;  4LNP A;  2DF6 A;  2J6F A;  3SEM A;  2LMJ A;  2CUD A;  4AFQ C;  3M0Q A;  3VS1 A;  4AFZ C;  4FSS A;  2MOX A;  1GL5 A;  2DYB A;  4M4Z A;  2LJ0 A;  5GJV B;  4JJD A;  2EKH A;  2YUO A;  2JM8 A;  4CC7 A;  2YUP A;  1QCF A;  1FYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...