1PNJA

Solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
86
structure length
86
Chain Sequence
b'GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Solution structure and ligand-binding site of the SH3 domain of the p85 alpha subunit of phosphatidylinositol 3-kinase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Phosphotransferase
total genus 6
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pnjA00
5GJVB 4GLMA 5FWCA 2L0AA 5FW9A 2K7AA 4OMMA 1YWPA 5IHKA 2EGEA 2DILA 2LP5A 4OMPA 3LH5A 3TVTA 1PKSA 2MOXA 1K1ZA 4F17A 1GBRA 1J3TA 2SRCA 4OMOA 2RQWA 2V1RA 4AFZC 1UFFA 2AZSA 4LUEA 2DE0X 4J9EA 3UATA 1I1JA 1AVZC 1Z9ZA 4OMLA 2KGTA 2AKLA 2O31A 3JV3A 1OOTA 3I9QA 3I5RA 2A28A 2EBPA 4AG1C 1X2QA 1X69A 1NEGA 1FMKA 2K6DA 1LCKA 1KJWA 4IIMA 2DBKA 2HBWA 2L2PA 4QT7A 2RQVA 2DL8A 2KT8A 5I11A 1JU5C 2KYMA 1YWOA 2YSQA 2DVJA 1NG2A 2KYBA 4AFQC 2GTJA 2A37A 1PNJA 3VS7A 1ABOA 1E7OA 4A63B 3PVQA 1N5ZA 3VRYA 1MV0B 5IHIA 2LJ0A 1SHFA 2J7IA 1G83A 2G6FX 3VS3A 4RTVA 1MV3A 4D8KA 1H3HA 1T3LA 4Z89A 2DBMA 4KRTA 1WYXA 2DA9A 1S1NA 1GRIA 2O9SA 3SHWA 2K3BA 1QKWA 2JS0A 1VA7A 3M0SA 4J9DA 2L3QA 3VS0A 1TG0A 1SSHA 2IIMA 3VRZA 3EG2A 2HSPA 3THKA 2EGAA 1JXMA 1YP5A 4LUDA 3C0CA 4R0KA 1W1FA 2C0OA 1AWXA 1WXBA 2DJQA 2KEAA 3H0FA 5ECAA 1NLOC 2GBQA 1X6BA 2DM1A 2PZ1A 3EHRA 2EVRA 2W0ZA 3U23A 4RTZA 2EGCA 4CC2A 2EW3A 2GTOA 1V1CA 2EPDA 4AFUC 2RF0A 2FEIA 2DL4A 2C0TA 1AEYA 2J05A 1WX6A 3VS5A 1ZUUA 3I5SA 3ZL7C 1W6XA 2MCNA 1UG1A 2CUBA 2YUQA 3QWYA 1RLQC 1B07A 1M3AA 2CREA 2RNAA 2AK5A 1WXTA 2GQIA 3CQTA 4F14A 1MUZA 2KRMA 1GL5A 2EYYA 2VWFA 2JW4A 2KXDA 2RQUA 2ESWA 2HEQA 1IO6A 2HCKA 5FWBA 2BZ8A 3A98A 1UDLA 1K0XA 1QLYA 1I0CA 1U3OA 1X6GA 2D8HA 3O5ZA 5HCKA 2DMOA 1UGVA 1PWTA 2J6KA 2RMOA 2DNUA 2CH4A 1BU1A 1HD3A 3M0RA 3FJ5A 3GBQA 4RTXA 1CSKA 2F2XA 2JMCA 2ED1A 2BTTA 1GBQA 2M51A 4HXJA 5IH2A 2JS2A 1E6HA 2LCSA 2MIOA 1G2BA 2CT3A 1T0JA 4DEYA 4RTYA 4EIKA 3NGPA 2D1XA 5EC7A 2EYXA 4J9IA 2YDLA 2EKHA 2KBTA 1HSQA 1E6GA 1SHGA 2ROTA 4RTUA 2O88A 2CT4A 1H8KA 2YUOA 2PTKA 4ZNXA 1QWFA 1WXUA 4J9FA 4J9CA 1YN8A 5I22A 2PNIA 4OMQA 3IQLA 3EG3A 2YUPA 1M30A 1GCQC 4Z88A 2NWMA 2FO0A 4GBQA 2KR3A 2JM8A 2DL5A 2J06A 1TUDA 4HVVA 1CKAA 2DF6A 1CKBA 2XMFA 1PHTA 1ABQA 2CSQA 3TSZA 1BB9A 2JTEA 2RQTA 3REAB 1GCQA 2C0IA 3M0TA 2O9VA 3H0HA 1W70A 4LE9A 1AZEA 4JZ4A 3PVLA 1EFNA 1UHCA 2JXBA 2LJ3A 1OEBA 1QWEA 5IXFA 2DX1A 1BBZA 2A36A 3QWXX 2FRYA 1RUWA 1X2KA 4M4ZA 2KXCA 2X3WD 2F2WA 4JJDA 2VVKA 3EGUA 1WDXA 1T3SA 4E6RA 1AZGB 2B86A 2H8HA 4F16A 1YCSB 2KNBB 3NPFA 3VS1A 4Y92A 1KSWA 1OPLA 1ZUYA 1H92A 1M3CA 2ROLA 2SEMA 2NUZA 4RTTA 5IXBA 1FYNA 3H0IA 2LNHB 5L23A 2EQIA 2RPNA 2FRWA 1WFWA 3KFVA 1WI7A 4HCKA 1T0HA 2V1QA 2RN8A 3REBB 2CUDA 2E5KA 1ZBJA 1UJ0A 1GFDA 3UF4A 1QCFA 4FSSA 1M8MA 1JEGA 1WLPB 2CH4W 2LMJA 4K11A 2CSIA 1M3BA 1WA7A 2HDAA 2AKKA 4D8DA 2D8JA 2QDLA 3PE0A 3VS2A 4JJCA 1WIEA 3UA6A 2DL3A 1K9AA 4WCIA 1OPKA 1AD5A 4RUGA 1NYFA 2VKNA 3UA7A 2DRMA 1NEBA 4LN2A 1QKXA 2LQNA 3ULRB 3VS4A 2YUNA 4LNPA 1Y0MA 2FG0A 1K0SA 2JMAA 1UJYA 3SEMA 2KRSA 1Y57A 1ZLMA 2GNCA 4JZ3A 2F2VA 4IIOA 3RBBB 2DYBA 2EYWA 1NM7A 1JO8A 1JXOA 2GGRA 2X3XD 1U5SA 2ECZA 2YT6A 1UUEA 1NYGA 2FPEA 4JPBW 1GFCA 4ESRA 2KROA 2FPDA 1AWJA 2JT4A 2OI3A 1B3QA 1UTIA 2W10A 3H41A 2I0NA 1TUCA 3EG1A 3I35A 1VYUA 2LQWA 2O2OA 4J9GA 3M0UA 3VS6A 2D0NA 4HVWA 3NMZC 2ENMA 2M0YA 1Z9QA 4J9HA 2FPFA 3NHNA 3M0QA 1X27A 2ED0A 1JQQA 2BZYA 2JM9A 5IHNA 1AOJA 1ARKA 2DRKA 2OJ2A 4JJBA 1RLPC 2OAWA 4X1VA 1PRLC 1K4US 1AWOA 2J6OA 1ZSGA 1UE9A 4Z8AA 1UHFA 1U06A 3R6NA 2K9GA 1HJDA 2RQRA 1SEMA 2A08A 2LJ1A 2LZ6B 2ABLA 2EYZA 1I07A 1KIKA 1X43A 2KT1A 4OMNA 4J9BA 1M27C 1RI9A 2P4RA 4CC4B 1GCPA 1NLPC 2J6FA 1PRMC 1VYVA 3EG0A 1AWWA 1BK2A 1VYTA 4AFSC 2KRNA 1ZUKA 1KFZA 1ZX6A 1YNZA 2DL7A 2L3PA 3RNJA 3EHQA 4DEXA 1UECA 2K79A 2CDTA 4ORZA 2DLPA 1K76A 3TSWA 4CC3A 2BZXA 2L3SA 3M0PA 4AG2C 4CC7A 2LX7A 4RTWA 2AZVA 2KE9A 5GJWB 1PKTA 1XOVA 4HVUA 1OV3A 1SPKA 2K2MA 1SRMA 1A0NB 1SRLA
chains in the Genus database with same CATH superfamily
3E19A 1WNLA 1YWPA 5IHKA 1KQSA 1BIAA 4OMPA 1Q82U 3LH5A 4EMKA 1PKSA 2YWWA 5CKDA 4F17A 2Z0WA 2ZPBB 1NPRA 3TREA 3CPWA 4J6XA 1UFFA 8ATCB 3INZA 1I5OB 3HRTA 5D7UA 2EJGA 4OMLA 2AKLA 3JV3A 1OOTA 3I9QA 4FSXA 5CVIA 3A8MB 1VQ9Q 1VQ5Q 1YJ9A 3FB9A 3RESA 4PLLA 5KYUB 4AG1C 3HFNA 5I21A 4FT2A 3X24B 3MEUA 3JB9G 4IIMA 2QK0A 2EJ9A 1KQ2A 4C8QA 2L2PA 3M4YA 2EFIA 1K73R 1JU5C 3CC7Q 2PUOB 3L2VA 3VUBA 3EH2A 4NL2A 2PVGB 2KYBA 3E1SA 2GTJA 1RAHB 1D0XA 2A37A 3VS7A 2EWNA 3CXCA 4M7AE 1E7OA 3PVQA 1N5ZA 4DBFA 3X25B 4E7SA 1UGQB 1VQPT 1LPLA 3C95A 5HK3A 4Z89A 3VV0A 2P4TA 2QASA 3PMTA 4FW1A 4PJOF 3SHWA 2K3BA 3GF5A 4J9DA 3WVDB 2HSPA 2EGAA 5IN1A 1JXMA 4PJOD 4FW2A 2MAMA 2DZ9A 1Q95G 1AWXA 3GPLA 1VQOT 1YBYA 4J8OA 3JCMd 1OQKA 1YJ9Q 2COWA 4M7DC 4O6JA 4CC2A 3JCMX 4AFUC 3MO8A 3M58A 3A8GB 3NTHA 3ZL7C 1KC8U 1EZZB 1UG1A 3EFOA 2CUBA 3JCMf 4C8QF 1B07A 1C6VX 2MMPA 3JAME 3CQTA 1MUZA 3SD4A 1GL5A 3M53A 3CMEA 3BDLA 2RK1A 2BZ8A 1O9SA 4M75F 2D8HA 1I0CA 1U3OA 4C8QD 2DMOA 1PM3A 3JB9J 1M1KU 4M7AC 2CH4A 1VQOA 1VQ8T 3M9QA 1Q86R 4M75D 4RTXA 3V8JA 3GLXA 2MYSA 3KXTA 3P8BB 3MP6A 1GBQA 4BE2A 1M5Q1 2M51A 1K8AR 2RA2A 5IH2A 1PD1A 1IGQA 2XIDA 3O8VA 1MNEA 3BW1A 4EIKA 3RKXA 2D1XA 1QMCA 2EYXA 3GNGA 3M54A 1YITA 1HSQA 1E6GA 1UEBA 4RTUA 3KBGA 2CT4A 1KK7A 2YUOA 3QDFA 1QWFA 1WXUA 2RHIA 4RMOA 5IAYA 5D6YA 4J9CA 5GAN6 1YN8A 1N6AA 2ATCB 2CKKA 2DIGA 5AYFA 1Q81R 3EG3A 3QZ9B 4PJOE 2L89A 1YJWT 2JM8A 2RM4A 4MMLA 4J6YA 4C92A 4L6V5 4KGVB 3P8HA 1PHTA 1HYOA 2RI5A 2CSQA 1UGSB 3CCRA 1GCQA 4LE9A 3G6ET 5GAMd 3EGDB 2NUTA 4A4GA 5LJ5g 1VQOQ 1JBMA 1FMWA 3I56A 2CZ6B 1RUWA 1X2KA 1QW1A 2WSFE 5GAMf 4MDWA 2X3WD 1BI1A 2F2WA 5LJ5h 1AT1B 4E6RA 3S3NA 1MMDA 1YCSB 1M4ZA 5GMKm 2XD0A 4Y92A 2BE7D 1RAIB 1WHLA 2QG9B 3BFMA 2E10A 1XTDA 1M3CA 2NUPA 2K2VA 2NUZA 2ZGWA 5IT9E 2V26A 3FDRA 4PFZA 5GANd 1WFWA 3KFVA 1W2BA 1M90R 4HCKA 1T0HA 1OULA 3REBB 2RN8A 1C0MA 4PJOC 2DYIA 3LH0A 3OYBA 3CC2T 3CCRQ 5GANf 2VC8A 2BE9B 1B34B 3VKIA 2AHJB 2LMJA 4K11A 4RCCA 1K9MR 3MKDA 3G4ST 4MZTA 2HDAA 2AKKA 4OVAA 3PE0A 4F7UF 3GNFB 4N4IA 1SG5A 4OB3B 1JJ2S 2JUFA 4C5EA 2GCXA 3QG1A 2R5AA 1PSEA 1OPKA 4RUGA 3X28B 4BY6C 2VKNA 1NEBA 3E2UA 3CCMT 4GLKA 2R5MA 2ZPFB 1K73C 3MP1A 1YJWQ 2YLCA 1Y0MA 2FB7A 2XI9A 4FYXB 3CMAT 2JMAA 4C8QC 1IRXA 2HZYA 1ZLMA 4JZ3A 4J83A 4IIOA 4X9CA 1BI3A 5KE3A 1N9RA 4M75C 1QVFP 2GGRA 2YT6A 1U5SA 3OS5A 3G6EQ 1UUEA 4JPBW 2FPDA 2IG0A 4Y28E 2OI3A 2JT4A 2D6FA 2RJDA 3RKYA 3LYIA 4M77F 5HK0A 3I35A 4OB2B 3M0UA 2QEXT 3NMZC 5EG2A 2ENMA 1WQWA 1X27A 2EAYA 2CP3A 2C06A 2HL5C 1AOJA 1YJNA 3URGA 1WHJA 1KD1C 1AWOA 2I2LA 1ZSGA 2J6OA 1PC0A 4JRIA 3OYNA 3M56A 2OX7A 3CCJT 2A08A 2LZ6B 4N4GA 4HKEA 2P4RA 3ER0A 2CYZB 5C6SA 1M2OA 1NLPC 1IXDA 1AWWA 1IB8A 1VYTA 4C0DC 1ZUKA 5FU7C 2WSEE 2CP2A 2RD1A 3EHQA 3CC2Q 2VV5A 3DKMA 1IZ6A 1YI2T 1QP3A 1ZBXA 2CDTA 4ORZA 5LJ5j 3QUIA 2DLPA 2AT1B 1K76A 2V8JA 3TSWA 2E1HA 3M5AA 3M0PA 1Q86C 1WZOA 4RTWA 4AMCA 2KE9A 2MI6A 2HBPA 1D1CA 1K8AC 2PQWA 3OSSC 4A53A 1SPKA 2K2MA 1ZQ1A 1I8FA 1SRLA 4GLMA 1QCNA 1R77A 5FW9A 2K7AA 4IUVA 2EGEA 4KH1B 3CCVA 4M7DB 2E64A 2DKGA 3RKWA 5GAOq 3CMAQ 2LQ8A 3CC4A 1WHMA 3SWNA 2DZCA 2SRCA 4OMOA 2RQWA 3GIBA 3C94A 2P84A 4LUEA 1D3BB 1RAGB 1I1JA 1AVZC 1Q81C 3FJPA 3TU4K 4M77E 2RHUA 2VUBA 4HCBA 3H8ZA 2O31A 3I5RA 2A28A 3OYHA 3I55T 4XTWA 4OB0B 1EX4A 1G3YA 3H9NA 1NEGA 3S3OA 2DXTA 4M7AB 4XU0A 2K6DA 1LCKA 1KJWA 1VQMA 3OYEA 2QEXQ 4TVRA 1LNXA 3ASKA 2M0OA 5I11A 3FIFA 2KYMA 1YWOA 1KG1A 4A4KA 4FCYA 1PNJA 4NS5A 2EIFA 3JCMc 3TCJA 4BD3A 1QVGA 2E3HA 4C5HA 1QVGS 2A7YA 2QA4T 2Y90A 5AT1B 1G83A 3HSBA 3CCJQ 3KUFA 4B6MA 4N4HA 2RI3A 4HT8A 4KRTA 2DA9A 1QVPA 1FXXA 1M1GA 1VQ6T 2LTOA 2JS0A 3CC4Q 3M0SA 1TS9A 3VS0A 1TG0A 2IIMA 3EG2A 4QVZA 1YP5A 4BACA 3VJPA 3C0CA 4PJNA 3D7SB 2F69A 1YI2Q 1NJIR 1VQ5A 5CKEA 4DBQA 4E2FB 5KYNA 4FT4A 4MDXA 1X6BA 1WGSA 2LT1A 2MF2A 4IUPA 1M90C 1C1AA 4LD9K 2FZKB 2VGMA 2RHZA 1EIFA 5GAN4 2CP6A 4DA4A 1BCOA 2FEIA 2QA4A 2HL3A 2J05A 1NPPA 3LLRA 4KUIA 3VS5A 2MCNA 1TWBA 1ZA1B 3M57A 2VGNA 3HP9A 1K9MC 2AK5A 2GQIA 3MPUB 4F14A 5FRNA 1H3ZA 3TQ7P 4DBHA 5A2QE 2JN0A 3NFCA 4UC4A 1QLYA 4F04B 2JTMA 5HCKA 1OYXA 5CKBA 4RG8A 1UGVA 2J6KA 4M78F 3BDUA 3OYMA 3OYIA 2DNUA 1TTHB 1BKBA 2F2XA 2JMCA 2BTTA 3I55Q 4M78D 2K57A 4BE1A 2DJZA 2JS2A 5CKHA 4M7DE 4XU1A 2HNIA 1I81A 3V7CA 5CK9A 5EC7A 4HA8A 5KYXB 1S72T 4J9IA 2YDLA 4PJOB 2KBTA 3OW2P 5KYWA 2ROTA 4J6WA 3DLLA 3PFSA 2O88A 1VQKA 5GMKl 4ZNXA 3UT1A 5LL6S 3FEOA 5KYYB 1P92A 1FMVA 2QA4Q 3META 4XAXB 1SF9A 4O5VA 3J80E 2NWMA 2FO0A 3G71T 2KR3A 2J06A 4VUBA 4HVVA 1CKAA 2DF6A 2XMFA 4A4EA 4BY6B 2M02A 3M4GA 2CGHA 2DPPB 5CR2A 3M0TA 1RAEB 3H0HA 1W70A 2LRQA 1AZEA 4JZ4A 1EFNA 2JXBA 1TUGB 4FYWB 4C8QB 1V29B 2QQSA 2Y4YA 1M8VA 2L3RA 4M75B 5LJ5e 2GF7A 3OMCA 4M4ZA 3F70A 4JJDA 2EQMA 2VYTA 1T3SA 2P0KA 3FC3A 3A5ZB 4F16A 1KHIA 3NPFA 3E9FA 1NBEB 1TU0B 3TEEA 1M9SA 4JRPA 2E65A 3UPUA 4ZN3A 3RERA 3OYAA 1VOMA 4ZN1A 2ZCFB 3V8KA 4DOVA 1VQPA 3OYJA 1VQKQ 5FLXE 2XHCA 4M78E 2SEMA 4JLGA 4B9WA 1VQ7T 1MGQA 5IXBA 5L23A 2EQIA 1Q82R 3ZBDA 2RPNA 3R6OA 4E7IA 2YRCA 2QQ9A 3VU3C 1N8RC 4LDXA 5GMKi 3QHSA 2QQRA 2V8KA 4DOWA 1WPYA 1GFDA 3CCQT 3UF4A 1QCFA 3EFSA 1M8MA 4FSSA 2HSEB 2GFUA 4XK8E 2CH4W 4A4HA 3OBYA 2CSIA 4C0DB 4EDUA 5FU7B 2D8JA 1ZSZA 3L2UA 3VS2A 3L1AA 2HQXA 3VYGA 3UA6A 2DL3A 1K9AA 2YXYA 2OTJT 4XQ3A 2JVVA 4N0AC 4CRIA 3CPFA 1QVFA 1QVFS 4XTZA 2KY9A 4IUTA 5KH6A 1QKXA 2JNGA 2LQNA 4X9DA 1MMGA 8AT1B 5LJ3h 2FZGB 1ZHIA 2COYA 4L5GA 5GAN2 1V76A 2FG0A 3SEMA 2XICA 4QQDA 1VQPQ 3JCMP 2M9UA 1KQSP 2WSCE 3RBBB 3LGFA 1VQ8A 2EYWA 4NOYA 2FPEA 3CPWP 3EGDA 1GFCA 4ESRA 3MEAA 5GAOl 4M78C 5J3BA 1B3QA 4MZMA 4JRQA 1QQJA 1TUCA 2QTVA 5FU6C 4KGXB 4CI0C 1VYUA 2OTJA 2LQWA 3VYHB 3DB3A 2M0YA 1Z9QA 3OQ5A 1NJIC 1OU9A 2LT4A 1RAAB 2OTLT 1SKUB 2BIVA 2JM9A 4C0GA 2YRDA 4E7KA 5HKCA 1ARKA 3L2RA 4BDYA 4PFPA 4JJBA 1RLPC 4C8QE 3X26B 2PUKB 1YHQT 1KC8R 1UHFA 1Y96B 2VXFA 1YJWA 1VQ7Q 3CXCP 2K9GA 5GAN3 1SEMA 4E7HA 3QBYA 4M75E 3JCMV 3BY7A 3MHXA 3HPWA 4OMNA 4J9BA 3LWIA 3A1PA 1M27C 1YIJT 1Q7YC 2DERA 2J6FA 1PRMC 4F7UB 1D0ZA 4AFSC 1RABB 2KRNA 1KFZA 1ZX6A 3G6EA 2L3PA 4LXCA 1M1KR 3RNJA 4WTOB 1H641 1VQ8Q 2CS7A 4IUQA 5A0GA 3JRZA 4CC7A 1WQ7A 1PD0A 2AZVA 4C92F 3RUXA 3ZEHA 1XOVA 2EQUA 2K4YA 4EMKC 4HVUA 1YHQA 2OTJQ 4E7LA 5HY6A 1SRMA 2IPOB 1IREB 1XNIA 4C92D 5GJVB 3OS2A 2L0AA 2EYQA 4OMMA 4E7ZA 1TH7A 1JJ2A 4M77B 3S3MA 2MOXA 1K1ZA 5GAN5 1GBRA 4OGCA 4AFZC 2DE0X 4MMKA 2VB6A 1YFNA 2H3JA 3C4SA 1X6OA 3HRUA 3AT1B 3CC2A 4FIBA 1VQ4T 3OYLA 1X2QA 1X69A 3OYCA 4II1A 1FMKA 3QJYA 2E5QA 2HBWA 4QT7A 1N8RU 4OMFB 3G4SA 2GFAA 2K3XA 1R0BG 3RIRA 3CD6T 2X4JA 2LCCA 2DVJA 1NG2A 5LJ3j 2OTLQ 2CZ0B 1ABOA 3VRYA 3J81E 4HCCA 4PNOA 5IHIA 3Q1JA 3CCMA 3QDRB 1YHQQ 1SHFA 2J7IA 5CKFA 4C0ZA 4RTVA 3CMAA 1MV3A 4D8KA 2MPXC 1H3HA 4IKFA 1T3LA 2DO3A 2DBMA 2CP0A 4RG2A 2KI7A 3CCST 1YIJQ 1S1NA 1U1SA 1GRIA 2O9SA 5D6XA 2RB6A 1VA7A 3ZFJA 2L3QA 3OBWA 2PU9B 3VRZA 4BUGA 2DETA 4LUDA 1W1FA 3HTRA 2C0OA 4FM4B 4C92E 2DJQA 2KEAA 4M77G 1Q82C 4PFOA 5ECAA 1NLOC 5CCAA 1TSFA 4LD6A 2GBQA 2DM1A 5GAOp 1KQ1A 2PZ1A 5CAIA 2WACA 4LDWA 9ATCB 2QDYB 2QEXA 5GAOm 3LX7A 2HQHA 2DD5A 2EGCA 2GTOA 2EPDA 2XG8D 2RF0A 4JS4A 2CZ1B 2H3EB 4F7UE 1WX6A 1W6XA 3G4SQ 5J26A 3QWYA 4KH0B 1RLQC 3MEWA 2E3IA 1M3AA 2CREA 2K5LA 2E6NA 4M7DA 1DJ7B 2KRMA 2VWFA 2JW4A 2RQUA 2ESWA 2M16A 2HEQA 2HCKA 1VIFA 4KGZB 3CCJA 3A98A 5LJ5d 3HHTB 4WF2A 3CCMQ 3O5ZA 3QXEB 2VXEA 1D3BA 4NL3A 1PWTA 1U1TA 1ZSZC 1BU1A 1HD3A 3M0RA 3OW2S 2A3LA 3GBQA 4ELZC 2ED1A 5LJ5f 2DFUA 1YI2A 1VQ4Q 4HXJA 4JDSA 1W2BP 4EPCA 3QIIA 1E6HA 1Q7YU 4M7AA 2LCSA 2O4XB 2XDDA 2MIOA 1F1BB 2CT3A 4DEYA 4RTYA 3NGPA 2HQEA 5A0DA 4ZTFA 2DTIA 1JB0E 2G3RA 3CD6Q 3A8LB 2K5IA 1R8OB 1H8KA 4RCBA 3EG9A 4C92C 2K5FA 3JCMg 3OA6A 4FYYB 3BE3A 4ZGDB 1W4SA 3QPHA 1GCQC 1MMAA 3QJ6A 4Z88A 2DEUA 2DL5A 3V8LA 1VQLT 3CCSQ 1TUDA 3CCUT 3OS1A 3LW5E 3JCMh 2LC4A 1ABQA 3TSZA 2KK4A 2JTEA 3UWNA 3CCLT 3OY9A 3OYFA 1KC8C 3ME9A 4XTUA 2QI2A 1UHCA 3I55A 4KULA 4XTXA 1OEBA 4RKUE 3DB4A 4XTVA 2RI2A 1K73U 5IXFA 2DX1A 4A4FA 1BBZA 4R56A 2A36A 5FROA 2KVQG 3GP8A 3L2ZA 3RR6A 2QQAA 3EGXB 3PTAA 2DEQA 4GY5A 5DLQE 3PIOA 1VIEA 2KXCA 4M7DG 2DXBA 2L8DA 2VVKA 4M78B 2COZA 3EGUA 4BI8B 1AZGB 1R0CB 2B86A 2H8HA 4XU3A 4PK4A 4QVDA 2KNBB 5FU6B 3SDZA 3T9NA 4X34A 1JRIA 3CCUA 1KSWA 2X4WA 2HAXA 5GAOr 3GOXA 3CBMA 3CCLA 4RTTA 2ZPIB 2LNHB 2KDSA 3S6WA 1VQ6A 4YTLA 2FRWA 2E41A 4M7AG 2P0PA 4HCZA 3FRNA 2XDPA 1M2VB 1IHVA 1VQNT 2DIQA 1KD1U 1OX8A 2MWOA 1ZBJA 3JCMW 1UGPB 1JEGA 1WLPB 1XQHA 3JB9F 4ATOA 5KYUA 1M3BA 2QAZA 4PJOA 2ZZDA 2A0FB 2LNVA 5GAN8 2RJEA 5GAMg 2QDLA 1IHWA 1KQSS 3QO3A 4BI4A 3JB9D 3UDCA 3CCET 5GMKh 6AT1B 4WCIA 1AD5A 5LJ3e 3OB9A 5KYYA 3UA7A 3CPWS 3ULRB 3VS4A 2RO0A 3WXMB 5GAMh 1VQLQ 4EMKB 3P8DA 3CCUQ 1HXDA 4BDZA 1UJYA 2VASA 1Q86U 1Y57A 1NE8A 1VQNA 2PVDB 2YRVA 4M78G 5DY9A 3CCLQ 3OS0A 1K8AU 1JO8A 2E70A 2X3XD 3MEVA 4IURA 3G7ZA 1FWZA 2K3YA 1VQ6Q 2HMAA 2QXFA 1WHGA 3QYGB 3H41A 2JZ2A 2I0NA 2RJFA 3EG1A 1SSFA 5GANg 1AHJB 1IGUA 1BI0A 4M75A 5KYWB 3CCEA 2QGGA 1OX9A 2O2OA 4J9GA 3CXCS 2D0NA 2XK0A 4HVWA 1S72A 3JB9H 4JJNK 2KQWA 1RACB 1Q81U 2X35A 5GANh 1JQQA 4JRKA 2OJ2A 3JCMQ 1K4US 2O01E 3OYDA 1UE9A 1OI1A 4KBMB 4Z8AA 3CMET 1U06A 3G71A 3R6NA 1HJDA 3OMGA 1KIKA 1QVGP 2DXCA 4CC4B 3A8OB 2FZCB 3EG0A 3C12A 4QQ6A 1YNZA 5CIUA 2DL7A 1PG5B 1KD1R 1VQNQ 1WJQA 4PJOG 1D0YA 2F1LA 4PKCC 1UECA 2EJFA 2K79A 3PMIA 3WVEB 3G1JA 4IUUA 5KCOA 2KAFA 3OSVA 1YCYA 4CC3A 4ZGJB 2BZXA 2L3SA 4OB1B 2LX7A 4MZPA 5GJWB 1YITT 4KUDK 5D6WA 3CCEQ 1OV3A 2LCLA 2LVMA 3SWNC 4PLIA 1S72Q 1LJOA 5FWCA 3EFOB 5LJ3g 3JCMb 2DILA 2LP5A 5CQYA 1QP2A 3TVTA 1J3TA 4AT1B 1VQ7A 1M90U 4C8QG 2V1RA 3LWHA 1D1AA 2AZSA 2EQKA 2QYZA 4J9EA 3UATA 3SFMA 4ANJA 3G71Q 2F5KA 2GQVA 4BI3A 3CCRT 4M75G 1Z9ZA 1BI2A 2KGTA 2EBPA 2FHDA 3EFRA 1K9MU 2NYSA 3CCQA 3I56T 4QVCA 1ZSZB 1MMNA 5GMKj 2DBKA 4J7IA 7AT1B 2RQVA 2DL8A 2HKQB 2KT8A 1X01A 4Y91A 3CEYA 1M1FA 3QKJA 2YSQA 1G3SA 2ZAEA 3L2WA 1MHNA 4AFQC 5GAMj 2XU8A 4A63B 4FL6A 3PNWC 1MV0B 2X4YA 1N9SA 2LJ0A 1Y96A 3OYYA 3CMEQ 2G6FX 3VS3A 2JJ9A 1HK9A 1I4K1 1LOJA 4DQ2A 3JCMJ 2DD4A 1WYXA 4C92B 1QKWA 4JLIA 4F7UA 1OZ3A 1SSHA 1ZA2B 3THKA 4BE0A 2D0QB 4R0KA 2NUTB 4OP0A 1WXBA 3H0FA 3MJXA 3RMQA 4V2SA 1GXIE 1XJWB 1OU8A 3EHRA 2EVRA 2W0ZA 4QW2A 3U23A 4RTZA 5GANj 2DTOA 2CZ7B 2EW3A 3CCQQ 1B34A 1V1CA 1YITQ 3M55A 2QGFB 1I5LA 2DL4A 2C0TA 3MP8A 4L59A 1U8RA 1AEYA 1ZUUA 3I5SA 2OTLA 1G8XA 3HRSA 2YUQA 3LGLA 4OGEA 2RNAA 1B7TA 4M77A 1WXTA 3HFOA 2QTXA 2EYYA 5DM7R 2IVWA 3RMSA 2KXDA 1W2BS 1X75C 2XDBA 2X4XA 1IO6A 2B8AA 5FWBA 2BKDN 1UDLA 2OAUA 1K0XA 5GAOn 2NUPB 1X6GA 3QYHB 3CBPA 4LDVA 1YIJA 1UGRB 2RMOA 2AIRB 3HL8A 4C5GA 2NLUA 2EQJA 3FJ5A 5CQXA 1CSKA 4FU6A 3OYKA 1G3TA 4ME7A 3EAEA 3V7RA 3I56Q 1WJSA 2E4HA 1G2BA 3J7AF 1T0JA 2ZPHB 1UB4A 4C92G 4BB7A 2EKHA 1Y71A 1SHGA 3M59A 2RJCA 4D6WA 2YLBA 2PTKA 4J9FA 2PVOB 1WHHA 1YJNT 5I22A 2PNIA 1OZ2A 4OMQA 4F7UG 3IQLA 2YUPA 1M30A 3X20B 3H6ZA 1WHKA 3JSCA 4GBQA 4DBRA 3JCMe 2E12A 5GAN7 5I2MA 1CKBA 3CBOA 4C5IA 1BB9A 4PJMA 2RQTA 3REAB 4ZTJA 3QSUA 2C0IA 2O9VA 5LJ3d 1G5VA 3PVLA 1RAFB 1TXQA 2LJ3A 1VQ4A 4M77D 3FLGA 4JUVA 1QWEA 4OF1A 3QWXX 2FRYA 2FVUA 5LJ3f 2YHTA 3CD6A 1WDXA 4A54A 4ELYC 2EKOA 2DAQA 3VS1A 5C0MA 2MK5A 4ZGEB 1OPLA 1ZUYA 2HD0A 2X9HA 4EMHA 1H92A 1PSFA 1RADB 3CCVT 1Y7XA 2ROLA 3CC4T 4QQGA 1FYNA 3H0IA 3QZ5B 3CCSA 1WJRA 3JB9I 2RHYA 1N27A 1NZ9A 1RI0A 3PT9A 1WI7A 1NJIU 1FX7A 1G3WA 3PIPA 2R58A 2V1QA 5DLOA 2X51A 2V8IA 2CUDA 1BIBA 2E5KA 1UJ0A 4R55A 3L2QA 3OW2A 4LDUA 2RK2A 2O4XA 4PJLA 4PL6A 1VQMT 3EH1A 1WA7A 3N5BB 5GMKe 4D8DA 2F5TX 1RL2A 4JJCA 1WIEA 2E6ZA 2ZPGB 2KMTA 1N8RR 2LDMA 4Q5WA 1YJNQ 1NYFA 3NTIA 2DRMA 3V7SA 5GAMe 4LN2A 2HKNA 3DLMA 3RDVA 2YUNA 2FYKA 2Y4XA 4LNPA 1O75A 4JS5A 1K0SA 4N0AA 2KRSA 3SWNB 4E7JA 4P5NA 1LVKA 3OYGA 4B9XA 2GNCA 3VUZA 4HT9A 2F2VA 1JJ2P 4QKUA 5M9OA 2DYBA 2LQKA 1NM7A 3A8HB 1JXOA 2ECZA 1NYGA 1PCXA 2KROA 2M1HA 1AWJA 5A0LA 4Z02A 1VQ9T 1UTIA 1VQ5T 2W10A 1ACMB 4M7DF 1D09B 2RH2A 1VUBA 3EGXA 2DK3A 3AHUA 1Y07A 4EMGA 4E47A 3VS6A 2L5QA 2DTHA 2JOYA 3EG9B 4M7DD 2CP7A 4M78A 3PGGA 5GANe 3CC7T 3L42A 4J9HA 2FPFA 2DVEA 3NHNA 3M0QA 4LDYA 5KCHA 2ED0A 2BZYA 4J5YA 1D1BA 1MNDA 2KSSA 5IHNA 2D9TA 2DRKA 1M1KC 4FYVB 2OAWA 4X1VA 1PRLC 3CCVQ 3SB2A 4M7AF 1VQLA 2R57A 2XKOC 2ZPEB 2RQRA 2LJ1A 2ABLA 2EYZA 1I07A 2MWPA 1X43A 2KT1A 5L8RE 2QQBA 3HKSA 1RI9A 1BYMA 1VQ9A 2FL7A 1GCPA 4M7AD 2CP5A 1VYVA 1BK2A 5KE2A 3MCAB 2JTFA 1M2VA 5FRMA 2LX9A 2RHXA 1QCOA 4DEXA 4M77C 4PJJA 3CC7A 2BUDA 3NTKA 5I2SA 1KHCA 5CO7A 1VQMQ 4AG2C 2DXUA 1YJ9T 4KT0E 1Q7YR 1PKTA 4J7FA 3E9GA 5J39A 1TOVA 4XU2A 4XTYA 4C0FA 2P0QA 1VQKT 5KYXA 1BCMA 1A0NB
chains in the Genus database with same CATH topology
5GJVB 4GLMA 5FWCA 2L0AA 5FW9A 2K7AA 4OMMA 1YWPA 5IHKA 2EGEA 2DILA 2LP5A 4OMPA 3LH5A 3TVTA 1PKSA 2MOXA 1K1ZA 4F17A 1GBRA 1J3TA 2SRCA 4OMOA 2RQWA 2V1RA 4AFZC 1UFFA 2AZSA 4LUEA 2DE0X 4J9EA 3UATA 1I1JA 1AVZC 1Z9ZA 4OMLA 2KGTA 2AKLA 2O31A 3JV3A 1OOTA 3I9QA 3I5RA 2A28A 2EBPA 4AG1C 1X2QA 1X69A 1NEGA 1FMKA 2K6DA 1LCKA 1KJWA 4IIMA 2DBKA 2HBWA 2L2PA 4QT7A 2RQVA 2DL8A 2KT8A 5I11A 1JU5C 2KYMA 1YWOA 2YSQA 2DVJA 1NG2A 2KYBA 4AFQC 2GTJA 2A37A 1PNJA 3VS7A 1ABOA 1E7OA 4A63B 3PVQA 1N5ZA 3VRYA 1MV0B 5IHIA 2LJ0A 1SHFA 2J7IA 1G83A 2G6FX 3VS3A 4RTVA 1MV3A 4D8KA 1H3HA 1T3LA 4Z89A 2DBMA 4KRTA 1WYXA 2DA9A 1S1NA 1GRIA 2O9SA 3SHWA 2K3BA 1QKWA 2JS0A 1VA7A 3M0SA 4J9DA 2L3QA 3VS0A 1TG0A 1SSHA 2IIMA 3VRZA 3EG2A 2HSPA 3THKA 2EGAA 1JXMA 1YP5A 4LUDA 3C0CA 4R0KA 1W1FA 2C0OA 1AWXA 1WXBA 2DJQA 2KEAA 3H0FA 5ECAA 1NLOC 2GBQA 1X6BA 2DM1A 2PZ1A 3EHRA 2EVRA 2W0ZA 3U23A 4RTZA 2EGCA 4CC2A 2EW3A 2GTOA 1V1CA 2EPDA 4AFUC 2RF0A 2FEIA 2DL4A 2C0TA 1AEYA 2J05A 1WX6A 3VS5A 1ZUUA 3I5SA 3ZL7C 1W6XA 2MCNA 1UG1A 2CUBA 2YUQA 3QWYA 1RLQC 1B07A 1M3AA 2CREA 2RNAA 2AK5A 1WXTA 2GQIA 3CQTA 4F14A 1MUZA 2KRMA 1GL5A 2EYYA 2VWFA 2JW4A 2KXDA 2RQUA 2ESWA 2HEQA 1IO6A 2HCKA 5FWBA 2BZ8A 3A98A 1UDLA 1K0XA 1QLYA 1I0CA 1U3OA 1X6GA 2D8HA 3O5ZA 5HCKA 2DMOA 1UGVA 1PWTA 2J6KA 2RMOA 2DNUA 2CH4A 1BU1A 1HD3A 3M0RA 3FJ5A 3GBQA 4RTXA 1CSKA 2F2XA 2JMCA 2ED1A 2BTTA 1GBQA 2M51A 4HXJA 5IH2A 2JS2A 1E6HA 2LCSA 2MIOA 1G2BA 2CT3A 1T0JA 4DEYA 4RTYA 4EIKA 3NGPA 2D1XA 5EC7A 2EYXA 4J9IA 2YDLA 2EKHA 2KBTA 1HSQA 1E6GA 1SHGA 2ROTA 4RTUA 2O88A 2CT4A 1H8KA 2YUOA 2PTKA 4ZNXA 1QWFA 1WXUA 4J9FA 4J9CA 1YN8A 5I22A 2PNIA 4OMQA 3IQLA 3EG3A 2YUPA 1M30A 1GCQC 4Z88A 2NWMA 2FO0A 4GBQA 2KR3A 2JM8A 2DL5A 2J06A 1TUDA 4HVVA 1CKAA 2DF6A 1CKBA 2XMFA 1PHTA 1ABQA 2CSQA 3TSZA 1BB9A 2JTEA 2RQTA 3REAB 1GCQA 2C0IA 3M0TA 2O9VA 3H0HA 1W70A 4LE9A 1AZEA 4JZ4A 3PVLA 1EFNA 1UHCA 2JXBA 2LJ3A 1OEBA 1QWEA 5IXFA 2DX1A 1BBZA 2A36A 3QWXX 2FRYA 1RUWA 1X2KA 4M4ZA 2KXCA 2X3WD 2F2WA 4JJDA 2VVKA 3EGUA 1WDXA 1T3SA 4E6RA 1AZGB 2B86A 2H8HA 4F16A 1YCSB 2KNBB 3NPFA 3VS1A 4Y92A 1KSWA 1OPLA 1ZUYA 1H92A 1M3CA 2ROLA 2SEMA 2NUZA 4RTTA 5IXBA 1FYNA 3H0IA 2LNHB 5L23A 2EQIA 2RPNA 2FRWA 1WFWA 3KFVA 1WI7A 4HCKA 1T0HA 2V1QA 2RN8A 3REBB 2CUDA 2E5KA 1ZBJA 1UJ0A 1GFDA 3UF4A 1QCFA 4FSSA 1M8MA 1JEGA 1WLPB 2CH4W 2LMJA 4K11A 2CSIA 1M3BA 1WA7A 2HDAA 2AKKA 4D8DA 2D8JA 2QDLA 3PE0A 3VS2A 4JJCA 1WIEA 3UA6A 2DL3A 1K9AA 4WCIA 1OPKA 1AD5A 4RUGA 1NYFA 2VKNA 3UA7A 2DRMA 1NEBA 4LN2A 1QKXA 2LQNA 3ULRB 3VS4A 2YUNA 4LNPA 1Y0MA 2FG0A 1K0SA 2JMAA 1UJYA 3SEMA 2KRSA 1Y57A 1ZLMA 2GNCA 4JZ3A 2F2VA 4IIOA 3RBBB 2DYBA 2EYWA 1NM7A 1JO8A 1JXOA 2GGRA 2X3XD 1U5SA 2ECZA 2YT6A 1UUEA 1NYGA 2FPEA 4JPBW 1GFCA 4ESRA 2KROA 2FPDA 1AWJA 2JT4A 2OI3A 1B3QA 1UTIA 2W10A 3H41A 2I0NA 1TUCA 3EG1A 3I35A 1VYUA 2LQWA 2O2OA 4J9GA 3M0UA 3VS6A 2D0NA 4HVWA 3NMZC 2ENMA 2M0YA 1Z9QA 4J9HA 2FPFA 3NHNA 3M0QA 1X27A 2ED0A 1JQQA 2BZYA 2JM9A 5IHNA 1AOJA 1ARKA 2DRKA 2OJ2A 4JJBA 1RLPC 2OAWA 4X1VA 1PRLC 1K4US 1AWOA 2J6OA 1ZSGA 1UE9A 4Z8AA 1UHFA 1U06A 3R6NA 2K9GA 1HJDA 2RQRA 1SEMA 2A08A 2LJ1A 2LZ6B 2ABLA 2EYZA 1I07A 1KIKA 1X43A 2KT1A 4OMNA 4J9BA 1M27C 1RI9A 2P4RA 4CC4B 1GCPA 1NLPC 2J6FA 1PRMC 1VYVA 3EG0A 1AWWA 1BK2A 1VYTA 4AFSC 2KRNA 1ZUKA 1KFZA 1ZX6A 1YNZA 2DL7A 2L3PA 3RNJA 3EHQA 4DEXA 1UECA 2K79A 2CDTA 4ORZA 2DLPA 1K76A 3TSWA 4CC3A 2BZXA 2L3SA 3M0PA 4AG2C 4CC7A 2LX7A 4RTWA 2AZVA 2KE9A 5GJWB 1PKTA 1XOVA 4HVUA 1OV3A 1SPKA 2K2MA 1SRMA 1A0NB 1SRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJV B;  4GLM A;  5FWC A;  2L0A A;  5FW9 A;  2K7A A;  4OMM A;  1YWP A;  5IHK A;  2EGE A;  2DIL A;  2LP5 A;  4OMP A;  3LH5 A;  3TVT A;  1PKS A;  2MOX A;  1K1Z A;  4F17 A;  1GBR A;  1J3T A;  2SRC A;  4OMO A;  2RQW A;  2V1R A;  4AFZ C;  1UFF A;  2AZS A;  4LUE A;  2DE0 X;  4J9E A;  3UAT A;  1I1J A;  1AVZ C;  1Z9Z A;  4OML A;  2KGT A;  2AKL A;  2O31 A;  3JV3 A;  1OOT A;  3I9Q A;  3I5R A;  2A28 A;  2EBP A;  4AG1 C;  1X2Q A;  1X69 A;  1NEG A;  1FMK A;  2K6D A;  1LCK A;  1KJW A;  4IIM A;  2DBK A;  2HBW A;  2L2P A;  4QT7 A;  2RQV A;  2DL8 A;  2KT8 A;  5I11 A;  1JU5 C;  2KYM A;  1YWO A;  2YSQ A;  2DVJ A;  1NG2 A;  2KYB A;  4AFQ C;  2GTJ A;  2A37 A;  1PNJ A;  3VS7 A;  1ABO A;  1E7O A;  4A63 B;  3PVQ A;  1N5Z A;  3VRY A;  1MV0 B;  5IHI A;  2LJ0 A;  1SHF A;  2J7I A;  1G83 A;  2G6F X;  3VS3 A;  4RTV A;  1MV3 A;  4D8K A;  1H3H A;  1T3L A;  4Z89 A;  2DBM A;  4KRT A;  1WYX A;  2DA9 A;  1S1N A;  1GRI A;  2O9S A;  3SHW A;  2K3B A;  1QKW A;  2JS0 A;  1VA7 A;  3M0S A;  4J9D A;  2L3Q A;  3VS0 A;  1TG0 A;  1SSH A;  2IIM A;  3VRZ A;  3EG2 A;  2HSP A;  3THK A;  2EGA A;  1JXM A;  1YP5 A;  4LUD A;  3C0C A;  4R0K A;  1W1F A;  2C0O A;  1AWX A;  1WXB A;  2DJQ A;  2KEA A;  3H0F A;  5ECA A;  1NLO C;  2GBQ A;  1X6B A;  2DM1 A;  2PZ1 A;  3EHR A;  2EVR A;  2W0Z A;  3U23 A;  4RTZ A;  2EGC A;  4CC2 A;  2EW3 A;  2GTO A;  1V1C A;  2EPD A;  4AFU C;  2RF0 A;  2FEI A;  2DL4 A;  2C0T A;  1AEY A;  2J05 A;  1WX6 A;  3VS5 A;  1ZUU A;  3I5S A;  3ZL7 C;  1W6X A;  2MCN A;  1UG1 A;  2CUB A;  2YUQ A;  3QWY A;  1RLQ C;  1B07 A;  1M3A A;  2CRE A;  2RNA A;  2AK5 A;  1WXT A;  2GQI A;  3CQT A;  4F14 A;  1MUZ A;  2KRM A;  1GL5 A;  2EYY A;  2VWF A;  2JW4 A;  2KXD A;  2RQU A;  2ESW A;  2HEQ A;  1IO6 A;  2HCK A;  5FWB A;  2BZ8 A;  3A98 A;  1UDL A;  1K0X A;  1QLY A;  1I0C A;  1U3O A;  1X6G A;  2D8H A;  3O5Z A;  5HCK A;  2DMO A;  1UGV A;  1PWT A;  2J6K A;  2RMO A;  2DNU A;  2CH4 A;  1BU1 A;  1HD3 A;  3M0R A;  3FJ5 A;  3GBQ A;  4RTX A;  1CSK A;  2F2X A;  2JMC A;  2ED1 A;  2BTT A;  1GBQ A;  2M51 A;  4HXJ A;  5IH2 A;  2JS2 A;  1E6H A;  2LCS A;  2MIO A;  1G2B A;  2CT3 A;  1T0J A;  4DEY A;  4RTY A;  4EIK A;  3NGP A;  2D1X A;  5EC7 A;  2EYX A;  4J9I A;  2YDL A;  2EKH A;  2KBT A;  1HSQ A;  1E6G A;  1SHG A;  2ROT A;  4RTU A;  2O88 A;  2CT4 A;  1H8K A;  2YUO A;  2PTK A;  4ZNX A;  1QWF A;  1WXU A;  4J9F A;  4J9C A;  1YN8 A;  5I22 A;  2PNI A;  4OMQ A;  3IQL A;  3EG3 A;  2YUP A;  1M30 A;  1GCQ C;  4Z88 A;  2NWM A;  2FO0 A;  4GBQ A;  2KR3 A;  2JM8 A;  2DL5 A;  2J06 A;  1TUD A;  4HVV A;  1CKA A;  2DF6 A;  1CKB A;  2XMF A;  1PHT A;  1ABQ A;  2CSQ A;  3TSZ A;  1BB9 A;  2JTE A;  2RQT A;  3REA B;  1GCQ A;  2C0I A;  3M0T A;  2O9V A;  3H0H A;  1W70 A;  4LE9 A;  1AZE A;  4JZ4 A;  3PVL A;  1EFN A;  1UHC A;  2JXB A;  2LJ3 A;  1OEB A;  1QWE A;  5IXF A;  2DX1 A;  1BBZ A;  2A36 A;  3QWX X;  2FRY A;  1RUW A;  1X2K A;  4M4Z A;  2KXC A;  2X3W D;  2F2W A;  4JJD A;  2VVK A;  3EGU A;  1WDX A;  1T3S A;  4E6R A;  1AZG B;  2B86 A;  2H8H A;  4F16 A;  1YCS B;  2KNB B;  3NPF A;  3VS1 A;  4Y92 A;  1KSW A;  1OPL A;  1ZUY A;  1H92 A;  1M3C A;  2ROL A;  2SEM A;  2NUZ A;  4RTT A;  5IXB A;  1FYN A;  3H0I A;  2LNH B;  5L23 A;  2EQI A;  2RPN A;  2FRW A;  1WFW A;  3KFV A;  1WI7 A;  4HCK A;  1T0H A;  2V1Q A;  2RN8 A;  3REB B;  2CUD A;  2E5K A;  1ZBJ A;  1UJ0 A;  1GFD A;  3UF4 A;  1QCF A;  4FSS A;  1M8M A;  1JEG A;  1WLP B;  2CH4 W;  2LMJ A;  4K11 A;  2CSI A;  1M3B A;  1WA7 A;  2HDA A;  2AKK A;  4D8D A;  2D8J A;  2QDL A;  3PE0 A;  3VS2 A;  4JJC A;  1WIE A;  3UA6 A;  2DL3 A;  1K9A A;  4WCI A;  1OPK A;  1AD5 A;  4RUG A;  1NYF A;  2VKN A;  3UA7 A;  2DRM A;  1NEB A;  4LN2 A;  1QKX A;  2LQN A;  3ULR B;  3VS4 A;  2YUN A;  4LNP A;  1Y0M A;  2FG0 A;  1K0S A;  2JMA A;  1UJY A;  3SEM A;  2KRS A;  1Y57 A;  1ZLM A;  2GNC A;  4JZ3 A;  2F2V A;  4IIO A;  3RBB B;  2DYB A;  2EYW A;  1NM7 A;  1JO8 A;  1JXO A;  2GGR A;  2X3X D;  1U5S A;  2ECZ A;  2YT6 A;  1UUE A;  1NYG A;  2FPE A;  4JPB W;  1GFC A;  4ESR A;  2KRO A;  2FPD A;  1AWJ A;  2JT4 A;  2OI3 A;  1B3Q A;  1UTI A;  2W10 A;  3H41 A;  2I0N A;  1TUC A;  3EG1 A;  3I35 A;  1VYU A;  2LQW A;  2O2O A;  4J9G A;  3M0U A;  3VS6 A;  2D0N A;  4HVW A;  3NMZ C;  2ENM A;  2M0Y A;  1Z9Q A;  4J9H A;  2FPF A;  3NHN A;  3M0Q A;  1X27 A;  2ED0 A;  1JQQ A;  2BZY A;  2JM9 A;  5IHN A;  1AOJ A;  1ARK A;  2DRK A;  2OJ2 A;  4JJB A;  1RLP C;  2OAW A;  4X1V A;  1PRL C;  1K4U S;  1AWO A;  2J6O A;  1ZSG A;  1UE9 A;  4Z8A A;  1UHF A;  1U06 A;  3R6N A;  2K9G A;  1HJD A;  2RQR A;  1SEM A;  2A08 A;  2LJ1 A;  2LZ6 B;  2ABL A;  2EYZ A;  1I07 A;  1KIK A;  1X43 A;  2KT1 A;  4OMN A;  4J9B A;  1M27 C;  1RI9 A;  2P4R A;  4CC4 B;  1GCP A;  1NLP C;  2J6F A;  1PRM C;  1VYV A;  3EG0 A;  1AWW A;  1BK2 A;  1VYT A;  4AFS C;  2KRN A;  1ZUK A;  1KFZ A;  1ZX6 A;  1YNZ A;  2DL7 A;  2L3P A;  3RNJ A;  3EHQ A;  4DEX A;  1UEC A;  2K79 A;  2CDT A;  4ORZ A;  2DLP A;  1K76 A;  3TSW A;  4CC3 A;  2BZX A;  2L3S A;  3M0P A;  4AG2 C;  4CC7 A;  2LX7 A;  4RTW A;  2AZV A;  2KE9 A;  5GJW B;  1PKT A;  1XOV A;  4HVU A;  1OV3 A;  1SPK A;  2K2M A;  1SRM A;  1A0N B;  1SRL A; 
#chains in the Genus database with same CATH topology
 3E19 A;  1WNL A;  1YWP A;  5IHK A;  1KQS A;  1BIA A;  4OMP A;  1Q82 U;  3LH5 A;  4EMK A;  1PKS A;  2YWW A;  5CKD A;  4F17 A;  2Z0W A;  2ZPB B;  1NPR A;  3TRE A;  3CPW A;  4J6X A;  1UFF A;  8ATC B;  3INZ A;  1I5O B;  3HRT A;  5D7U A;  2EJG A;  4OML A;  2AKL A;  3JV3 A;  1OOT A;  3I9Q A;  4FSX A;  5CVI A;  3A8M B;  1VQ9 Q;  1VQ5 Q;  1YJ9 A;  3FB9 A;  3RES A;  4PLL A;  5KYU B;  4AG1 C;  3HFN A;  5I21 A;  4FT2 A;  3X24 B;  3MEU A;  3JB9 G;  4IIM A;  2QK0 A;  2EJ9 A;  1KQ2 A;  4C8Q A;  2L2P A;  3M4Y A;  2EFI A;  1K73 R;  1JU5 C;  3CC7 Q;  2PUO B;  3L2V A;  3VUB A;  3EH2 A;  4NL2 A;  2PVG B;  2KYB A;  3E1S A;  2GTJ A;  1RAH B;  1D0X A;  2A37 A;  3VS7 A;  2EWN A;  3CXC A;  4M7A E;  1E7O A;  3PVQ A;  1N5Z A;  4DBF A;  3X25 B;  4E7S A;  1UGQ B;  1VQP T;  1LPL A;  3C95 A;  5HK3 A;  4Z89 A;  3VV0 A;  2P4T A;  2QAS A;  3PMT A;  4FW1 A;  4PJO F;  3SHW A;  2K3B A;  3GF5 A;  4J9D A;  3WVD B;  2HSP A;  2EGA A;  5IN1 A;  1JXM A;  4PJO D;  4FW2 A;  2MAM A;  2DZ9 A;  1Q95 G;  1AWX A;  3GPL A;  1VQO T;  1YBY A;  4J8O A;  3JCM d;  1OQK A;  1YJ9 Q;  2COW A;  4M7D C;  4O6J A;  4CC2 A;  3JCM X;  4AFU C;  3MO8 A;  3M58 A;  3A8G B;  3NTH A;  3ZL7 C;  1KC8 U;  1EZZ B;  1UG1 A;  3EFO A;  2CUB A;  3JCM f;  4C8Q F;  1B07 A;  1C6V X;  2MMP A;  3JAM E;  3CQT A;  1MUZ A;  3SD4 A;  1GL5 A;  3M53 A;  3CME A;  3BDL A;  2RK1 A;  2BZ8 A;  1O9S A;  4M75 F;  2D8H A;  1I0C A;  1U3O A;  4C8Q D;  2DMO A;  1PM3 A;  3JB9 J;  1M1K U;  4M7A C;  2CH4 A;  1VQO A;  1VQ8 T;  3M9Q A;  1Q86 R;  4M75 D;  4RTX A;  3V8J A;  3GLX A;  2MYS A;  3KXT A;  3P8B B;  3MP6 A;  1GBQ A;  4BE2 A;  1M5Q 1;  2M51 A;  1K8A R;  2RA2 A;  5IH2 A;  1PD1 A;  1IGQ A;  2XID A;  3O8V A;  1MNE A;  3BW1 A;  4EIK A;  3RKX A;  2D1X A;  1QMC A;  2EYX A;  3GNG A;  3M54 A;  1YIT A;  1HSQ A;  1E6G A;  1UEB A;  4RTU A;  3KBG A;  2CT4 A;  1KK7 A;  2YUO A;  3QDF A;  1QWF A;  1WXU A;  2RHI A;  4RMO A;  5IAY A;  5D6Y A;  4J9C A;  5GAN 6;  1YN8 A;  1N6A A;  2ATC B;  2CKK A;  2DIG A;  5AYF A;  1Q81 R;  3EG3 A;  3QZ9 B;  4PJO E;  2L89 A;  1YJW T;  2JM8 A;  2RM4 A;  4MML A;  4J6Y A;  4C92 A;  4L6V 5;  4KGV B;  3P8H A;  1PHT A;  1HYO A;  2RI5 A;  2CSQ A;  1UGS B;  3CCR A;  1GCQ A;  4LE9 A;  3G6E T;  5GAM d;  3EGD B;  2NUT A;  4A4G A;  5LJ5 g;  1VQO Q;  1JBM A;  1FMW A;  3I56 A;  2CZ6 B;  1RUW A;  1X2K A;  1QW1 A;  2WSF E;  5GAM f;  4MDW A;  2X3W D;  1BI1 A;  2F2W A;  5LJ5 h;  1AT1 B;  4E6R A;  3S3N A;  1MMD A;  1YCS B;  1M4Z A;  5GMK m;  2XD0 A;  4Y92 A;  2BE7 D;  1RAI B;  1WHL A;  2QG9 B;  3BFM A;  2E10 A;  1XTD A;  1M3C A;  2NUP A;  2K2V A;  2NUZ A;  2ZGW A;  5IT9 E;  2V26 A;  3FDR A;  4PFZ A;  5GAN d;  1WFW A;  3KFV A;  1W2B A;  1M90 R;  4HCK A;  1T0H A;  1OUL A;  3REB B;  2RN8 A;  1C0M A;  4PJO C;  2DYI A;  3LH0 A;  3OYB A;  3CC2 T;  3CCR Q;  5GAN f;  2VC8 A;  2BE9 B;  1B34 B;  3VKI A;  2AHJ B;  2LMJ A;  4K11 A;  4RCC A;  1K9M R;  3MKD A;  3G4S T;  4MZT A;  2HDA A;  2AKK A;  4OVA A;  3PE0 A;  4F7U F;  3GNF B;  4N4I A;  1SG5 A;  4OB3 B;  1JJ2 S;  2JUF A;  4C5E A;  2GCX A;  3QG1 A;  2R5A A;  1PSE A;  1OPK A;  4RUG A;  3X28 B;  4BY6 C;  2VKN A;  1NEB A;  3E2U A;  3CCM T;  4GLK A;  2R5M A;  2ZPF B;  1K73 C;  3MP1 A;  1YJW Q;  2YLC A;  1Y0M A;  2FB7 A;  2XI9 A;  4FYX B;  3CMA T;  2JMA A;  4C8Q C;  1IRX A;  2HZY A;  1ZLM A;  4JZ3 A;  4J83 A;  4IIO A;  4X9C A;  1BI3 A;  5KE3 A;  1N9R A;  4M75 C;  1QVF P;  2GGR A;  2YT6 A;  1U5S A;  3OS5 A;  3G6E Q;  1UUE A;  4JPB W;  2FPD A;  2IG0 A;  4Y28 E;  2OI3 A;  2JT4 A;  2D6F A;  2RJD A;  3RKY A;  3LYI A;  4M77 F;  5HK0 A;  3I35 A;  4OB2 B;  3M0U A;  2QEX T;  3NMZ C;  5EG2 A;  2ENM A;  1WQW A;  1X27 A;  2EAY A;  2CP3 A;  2C06 A;  2HL5 C;  1AOJ A;  1YJN A;  3URG A;  1WHJ A;  1KD1 C;  1AWO A;  2I2L A;  1ZSG A;  2J6O A;  1PC0 A;  4JRI A;  3OYN A;  3M56 A;  2OX7 A;  3CCJ T;  2A08 A;  2LZ6 B;  4N4G A;  4HKE A;  2P4R A;  3ER0 A;  2CYZ B;  5C6S A;  1M2O A;  1NLP C;  1IXD A;  1AWW A;  1IB8 A;  1VYT A;  4C0D C;  1ZUK A;  5FU7 C;  2WSE E;  2CP2 A;  2RD1 A;  3EHQ A;  3CC2 Q;  2VV5 A;  3DKM A;  1IZ6 A;  1YI2 T;  1QP3 A;  1ZBX A;  2CDT A;  4ORZ A;  5LJ5 j;  3QUI A;  2DLP A;  2AT1 B;  1K76 A;  2V8J A;  3TSW A;  2E1H A;  3M5A A;  3M0P A;  1Q86 C;  1WZO A;  4RTW A;  4AMC A;  2KE9 A;  2MI6 A;  2HBP A;  1D1C A;  1K8A C;  2PQW A;  3OSS C;  4A53 A;  1SPK A;  2K2M A;  1ZQ1 A;  1I8F A;  1SRL A;  4GLM A;  1QCN A;  1R77 A;  5FW9 A;  2K7A A;  4IUV A;  2EGE A;  4KH1 B;  3CCV A;  4M7D B;  2E64 A;  2DKG A;  3RKW A;  5GAO q;  3CMA Q;  2LQ8 A;  3CC4 A;  1WHM A;  3SWN A;  2DZC A;  2SRC A;  4OMO A;  2RQW A;  3GIB A;  3C94 A;  2P84 A;  4LUE A;  1D3B B;  1RAG B;  1I1J A;  1AVZ C;  1Q81 C;  3FJP A;  3TU4 K;  4M77 E;  2RHU A;  2VUB A;  4HCB A;  3H8Z A;  2O31 A;  3I5R A;  2A28 A;  3OYH A;  3I55 T;  4XTW A;  4OB0 B;  1EX4 A;  1G3Y A;  3H9N A;  1NEG A;  3S3O A;  2DXT A;  4M7A B;  4XU0 A;  2K6D A;  1LCK A;  1KJW A;  1VQM A;  3OYE A;  2QEX Q;  4TVR A;  1LNX A;  3ASK A;  2M0O A;  5I11 A;  3FIF A;  2KYM A;  1YWO A;  1KG1 A;  4A4K A;  4FCY A;  1PNJ A;  4NS5 A;  2EIF A;  3JCM c;  3TCJ A;  4BD3 A;  1QVG A;  2E3H A;  4C5H A;  1QVG S;  2A7Y A;  2QA4 T;  2Y90 A;  5AT1 B;  1G83 A;  3HSB A;  3CCJ Q;  3KUF A;  4B6M A;  4N4H A;  2RI3 A;  4HT8 A;  4KRT A;  2DA9 A;  1QVP A;  1FXX A;  1M1G A;  1VQ6 T;  2LTO A;  2JS0 A;  3CC4 Q;  3M0S A;  1TS9 A;  3VS0 A;  1TG0 A;  2IIM A;  3EG2 A;  4QVZ A;  1YP5 A;  4BAC A;  3VJP A;  3C0C A;  4PJN A;  3D7S B;  2F69 A;  1YI2 Q;  1NJI R;  1VQ5 A;  5CKE A;  4DBQ A;  4E2F B;  5KYN A;  4FT4 A;  4MDX A;  1X6B A;  1WGS A;  2LT1 A;  2MF2 A;  4IUP A;  1M90 C;  1C1A A;  4LD9 K;  2FZK B;  2VGM A;  2RHZ A;  1EIF A;  5GAN 4;  2CP6 A;  4DA4 A;  1BCO A;  2FEI A;  2QA4 A;  2HL3 A;  2J05 A;  1NPP A;  3LLR A;  4KUI A;  3VS5 A;  2MCN A;  1TWB A;  1ZA1 B;  3M57 A;  2VGN A;  3HP9 A;  1K9M C;  2AK5 A;  2GQI A;  3MPU B;  4F14 A;  5FRN A;  1H3Z A;  3TQ7 P;  4DBH A;  5A2Q E;  2JN0 A;  3NFC A;  4UC4 A;  1QLY A;  4F04 B;  2JTM A;  5HCK A;  1OYX A;  5CKB A;  4RG8 A;  1UGV A;  2J6K A;  4M78 F;  3BDU A;  3OYM A;  3OYI A;  2DNU A;  1TTH B;  1BKB A;  2F2X A;  2JMC A;  2BTT A;  3I55 Q;  4M78 D;  2K57 A;  4BE1 A;  2DJZ A;  2JS2 A;  5CKH A;  4M7D E;  4XU1 A;  2HNI A;  1I81 A;  3V7C A;  5CK9 A;  5EC7 A;  4HA8 A;  5KYX B;  1S72 T;  4J9I A;  2YDL A;  4PJO B;  2KBT A;  3OW2 P;  5KYW A;  2ROT A;  4J6W A;  3DLL A;  3PFS A;  2O88 A;  1VQK A;  5GMK l;  4ZNX A;  3UT1 A;  5LL6 S;  3FEO A;  5KYY B;  1P92 A;  1FMV A;  2QA4 Q;  3MET A;  4XAX B;  1SF9 A;  4O5V A;  3J80 E;  2NWM A;  2FO0 A;  3G71 T;  2KR3 A;  2J06 A;  4VUB A;  4HVV A;  1CKA A;  2DF6 A;  2XMF A;  4A4E A;  4BY6 B;  2M02 A;  3M4G A;  2CGH A;  2DPP B;  5CR2 A;  3M0T A;  1RAE B;  3H0H A;  1W70 A;  2LRQ A;  1AZE A;  4JZ4 A;  1EFN A;  2JXB A;  1TUG B;  4FYW B;  4C8Q B;  1V29 B;  2QQS A;  2Y4Y A;  1M8V A;  2L3R A;  4M75 B;  5LJ5 e;  2GF7 A;  3OMC A;  4M4Z A;  3F70 A;  4JJD A;  2EQM A;  2VYT A;  1T3S A;  2P0K A;  3FC3 A;  3A5Z B;  4F16 A;  1KHI A;  3NPF A;  3E9F A;  1NBE B;  1TU0 B;  3TEE A;  1M9S A;  4JRP A;  2E65 A;  3UPU A;  4ZN3 A;  3RER A;  3OYA A;  1VOM A;  4ZN1 A;  2ZCF B;  3V8K A;  4DOV A;  1VQP A;  3OYJ A;  1VQK Q;  5FLX E;  2XHC A;  4M78 E;  2SEM A;  4JLG A;  4B9W A;  1VQ7 T;  1MGQ A;  5IXB A;  5L23 A;  2EQI A;  1Q82 R;  3ZBD A;  2RPN A;  3R6O A;  4E7I A;  2YRC A;  2QQ9 A;  3VU3 C;  1N8R C;  4LDX A;  5GMK i;  3QHS A;  2QQR A;  2V8K A;  4DOW A;  1WPY A;  1GFD A;  3CCQ T;  3UF4 A;  1QCF A;  3EFS A;  1M8M A;  4FSS A;  2HSE B;  2GFU A;  4XK8 E;  2CH4 W;  4A4H A;  3OBY A;  2CSI A;  4C0D B;  4EDU A;  5FU7 B;  2D8J A;  1ZSZ A;  3L2U A;  3VS2 A;  3L1A A;  2HQX A;  3VYG A;  3UA6 A;  2DL3 A;  1K9A A;  2YXY A;  2OTJ T;  4XQ3 A;  2JVV A;  4N0A C;  4CRI A;  3CPF A;  1QVF A;  1QVF S;  4XTZ A;  2KY9 A;  4IUT A;  5KH6 A;  1QKX A;  2JNG A;  2LQN A;  4X9D A;  1MMG A;  8AT1 B;  5LJ3 h;  2FZG B;  1ZHI A;  2COY A;  4L5G A;  5GAN 2;  1V76 A;  2FG0 A;  3SEM A;  2XIC A;  4QQD A;  1VQP Q;  3JCM P;  2M9U A;  1KQS P;  2WSC E;  3RBB B;  3LGF A;  1VQ8 A;  2EYW A;  4NOY A;  2FPE A;  3CPW P;  3EGD A;  1GFC A;  4ESR A;  3MEA A;  5GAO l;  4M78 C;  5J3B A;  1B3Q A;  4MZM A;  4JRQ A;  1QQJ A;  1TUC A;  2QTV A;  5FU6 C;  4KGX B;  4CI0 C;  1VYU A;  2OTJ A;  2LQW A;  3VYH B;  3DB3 A;  2M0Y A;  1Z9Q A;  3OQ5 A;  1NJI C;  1OU9 A;  2LT4 A;  1RAA B;  2OTL T;  1SKU B;  2BIV A;  2JM9 A;  4C0G A;  2YRD A;  4E7K A;  5HKC A;  1ARK A;  3L2R A;  4BDY A;  4PFP A;  4JJB A;  1RLP C;  4C8Q E;  3X26 B;  2PUK B;  1YHQ T;  1KC8 R;  1UHF A;  1Y96 B;  2VXF A;  1YJW A;  1VQ7 Q;  3CXC P;  2K9G A;  5GAN 3;  1SEM A;  4E7H A;  3QBY A;  4M75 E;  3JCM V;  3BY7 A;  3MHX A;  3HPW A;  4OMN A;  4J9B A;  3LWI A;  3A1P A;  1M27 C;  1YIJ T;  1Q7Y C;  2DER A;  2J6F A;  1PRM C;  4F7U B;  1D0Z A;  4AFS C;  1RAB B;  2KRN A;  1KFZ A;  1ZX6 A;  3G6E A;  2L3P A;  4LXC A;  1M1K R;  3RNJ A;  4WTO B;  1H64 1;  1VQ8 Q;  2CS7 A;  4IUQ A;  5A0G A;  3JRZ A;  4CC7 A;  1WQ7 A;  1PD0 A;  2AZV A;  4C92 F;  3RUX A;  3ZEH A;  1XOV A;  2EQU A;  2K4Y A;  4EMK C;  4HVU A;  1YHQ A;  2OTJ Q;  4E7L A;  5HY6 A;  1SRM A;  2IPO B;  1IRE B;  1XNI A;  4C92 D;  5GJV B;  3OS2 A;  2L0A A;  2EYQ A;  4OMM A;  4E7Z A;  1TH7 A;  1JJ2 A;  4M77 B;  3S3M A;  2MOX A;  1K1Z A;  5GAN 5;  1GBR A;  4OGC A;  4AFZ C;  2DE0 X;  4MMK A;  2VB6 A;  1YFN A;  2H3J A;  3C4S A;  1X6O A;  3HRU A;  3AT1 B;  3CC2 A;  4FIB A;  1VQ4 T;  3OYL A;  1X2Q A;  1X69 A;  3OYC A;  4II1 A;  1FMK A;  3QJY A;  2E5Q A;  2HBW A;  4QT7 A;  1N8R U;  4OMF B;  3G4S A;  2GFA A;  2K3X A;  1R0B G;  3RIR A;  3CD6 T;  2X4J A;  2LCC A;  2DVJ A;  1NG2 A;  5LJ3 j;  2OTL Q;  2CZ0 B;  1ABO A;  3VRY A;  3J81 E;  4HCC A;  4PNO A;  5IHI A;  3Q1J A;  3CCM A;  3QDR B;  1YHQ Q;  1SHF A;  2J7I A;  5CKF A;  4C0Z A;  4RTV A;  3CMA A;  1MV3 A;  4D8K A;  2MPX C;  1H3H A;  4IKF A;  1T3L A;  2DO3 A;  2DBM A;  2CP0 A;  4RG2 A;  2KI7 A;  3CCS T;  1YIJ Q;  1S1N A;  1U1S A;  1GRI A;  2O9S A;  5D6X A;  2RB6 A;  1VA7 A;  3ZFJ A;  2L3Q A;  3OBW A;  2PU9 B;  3VRZ A;  4BUG A;  2DET A;  4LUD A;  1W1F A;  3HTR A;  2C0O A;  4FM4 B;  4C92 E;  2DJQ A;  2KEA A;  4M77 G;  1Q82 C;  4PFO A;  5ECA A;  1NLO C;  5CCA A;  1TSF A;  4LD6 A;  2GBQ A;  2DM1 A;  5GAO p;  1KQ1 A;  2PZ1 A;  5CAI A;  2WAC A;  4LDW A;  9ATC B;  2QDY B;  2QEX A;  5GAO m;  3LX7 A;  2HQH A;  2DD5 A;  2EGC A;  2GTO A;  2EPD A;  2XG8 D;  2RF0 A;  4JS4 A;  2CZ1 B;  2H3E B;  4F7U E;  1WX6 A;  1W6X A;  3G4S Q;  5J26 A;  3QWY A;  4KH0 B;  1RLQ C;  3MEW A;  2E3I A;  1M3A A;  2CRE A;  2K5L A;  2E6N A;  4M7D A;  1DJ7 B;  2KRM A;  2VWF A;  2JW4 A;  2RQU A;  2ESW A;  2M16 A;  2HEQ A;  2HCK A;  1VIF A;  4KGZ B;  3CCJ A;  3A98 A;  5LJ5 d;  3HHT B;  4WF2 A;  3CCM Q;  3O5Z A;  3QXE B;  2VXE A;  1D3B A;  4NL3 A;  1PWT A;  1U1T A;  1ZSZ C;  1BU1 A;  1HD3 A;  3M0R A;  3OW2 S;  2A3L A;  3GBQ A;  4ELZ C;  2ED1 A;  5LJ5 f;  2DFU A;  1YI2 A;  1VQ4 Q;  4HXJ A;  4JDS A;  1W2B P;  4EPC A;  3QII A;  1E6H A;  1Q7Y U;  4M7A A;  2LCS A;  2O4X B;  2XDD A;  2MIO A;  1F1B B;  2CT3 A;  4DEY A;  4RTY A;  3NGP A;  2HQE A;  5A0D A;  4ZTF A;  2DTI A;  1JB0 E;  2G3R A;  3CD6 Q;  3A8L B;  2K5I A;  1R8O B;  1H8K A;  4RCB A;  3EG9 A;  4C92 C;  2K5F A;  3JCM g;  3OA6 A;  4FYY B;  3BE3 A;  4ZGD B;  1W4S A;  3QPH A;  1GCQ C;  1MMA A;  3QJ6 A;  4Z88 A;  2DEU A;  2DL5 A;  3V8L A;  1VQL T;  3CCS Q;  1TUD A;  3CCU T;  3OS1 A;  3LW5 E;  3JCM h;  2LC4 A;  1ABQ A;  3TSZ A;  2KK4 A;  2JTE A;  3UWN A;  3CCL T;  3OY9 A;  3OYF A;  1KC8 C;  3ME9 A;  4XTU A;  2QI2 A;  1UHC A;  3I55 A;  4KUL A;  4XTX A;  1OEB A;  4RKU E;  3DB4 A;  4XTV A;  2RI2 A;  1K73 U;  5IXF A;  2DX1 A;  4A4F A;  1BBZ A;  4R56 A;  2A36 A;  5FRO A;  2KVQ G;  3GP8 A;  3L2Z A;  3RR6 A;  2QQA A;  3EGX B;  3PTA A;  2DEQ A;  4GY5 A;  5DLQ E;  3PIO A;  1VIE A;  2KXC A;  4M7D G;  2DXB A;  2L8D A;  2VVK A;  4M78 B;  2COZ A;  3EGU A;  4BI8 B;  1AZG B;  1R0C B;  2B86 A;  2H8H A;  4XU3 A;  4PK4 A;  4QVD A;  2KNB B;  5FU6 B;  3SDZ A;  3T9N A;  4X34 A;  1JRI A;  3CCU A;  1KSW A;  2X4W A;  2HAX A;  5GAO r;  3GOX A;  3CBM A;  3CCL A;  4RTT A;  2ZPI B;  2LNH B;  2KDS A;  3S6W A;  1VQ6 A;  4YTL A;  2FRW A;  2E41 A;  4M7A G;  2P0P A;  4HCZ A;  3FRN A;  2XDP A;  1M2V B;  1IHV A;  1VQN T;  2DIQ A;  1KD1 U;  1OX8 A;  2MWO A;  1ZBJ A;  3JCM W;  1UGP B;  1JEG A;  1WLP B;  1XQH A;  3JB9 F;  4ATO A;  5KYU A;  1M3B A;  2QAZ A;  4PJO A;  2ZZD A;  2A0F B;  2LNV A;  5GAN 8;  2RJE A;  5GAM g;  2QDL A;  1IHW A;  1KQS S;  3QO3 A;  4BI4 A;  3JB9 D;  3UDC A;  3CCE T;  5GMK h;  6AT1 B;  4WCI A;  1AD5 A;  5LJ3 e;  3OB9 A;  5KYY A;  3UA7 A;  3CPW S;  3ULR B;  3VS4 A;  2RO0 A;  3WXM B;  5GAM h;  1VQL Q;  4EMK B;  3P8D A;  3CCU Q;  1HXD A;  4BDZ A;  1UJY A;  2VAS A;  1Q86 U;  1Y57 A;  1NE8 A;  1VQN A;  2PVD B;  2YRV A;  4M78 G;  5DY9 A;  3CCL Q;  3OS0 A;  1K8A U;  1JO8 A;  2E70 A;  2X3X D;  3MEV A;  4IUR A;  3G7Z A;  1FWZ A;  2K3Y A;  1VQ6 Q;  2HMA A;  2QXF A;  1WHG A;  3QYG B;  3H41 A;  2JZ2 A;  2I0N A;  2RJF A;  3EG1 A;  1SSF A;  5GAN g;  1AHJ B;  1IGU A;  1BI0 A;  4M75 A;  5KYW B;  3CCE A;  2QGG A;  1OX9 A;  2O2O A;  4J9G A;  3CXC S;  2D0N A;  2XK0 A;  4HVW A;  1S72 A;  3JB9 H;  4JJN K;  2KQW A;  1RAC B;  1Q81 U;  2X35 A;  5GAN h;  1JQQ A;  4JRK A;  2OJ2 A;  3JCM Q;  1K4U S;  2O01 E;  3OYD A;  1UE9 A;  1OI1 A;  4KBM B;  4Z8A A;  3CME T;  1U06 A;  3G71 A;  3R6N A;  1HJD A;  3OMG A;  1KIK A;  1QVG P;  2DXC A;  4CC4 B;  3A8O B;  2FZC B;  3EG0 A;  3C12 A;  4QQ6 A;  1YNZ A;  5CIU A;  2DL7 A;  1PG5 B;  1KD1 R;  1VQN Q;  1WJQ A;  4PJO G;  1D0Y A;  2F1L A;  4PKC C;  1UEC A;  2EJF A;  2K79 A;  3PMI A;  3WVE B;  3G1J A;  4IUU A;  5KCO A;  2KAF A;  3OSV A;  1YCY A;  4CC3 A;  4ZGJ B;  2BZX A;  2L3S A;  4OB1 B;  2LX7 A;  4MZP A;  5GJW B;  1YIT T;  4KUD K;  5D6W A;  3CCE Q;  1OV3 A;  2LCL A;  2LVM A;  3SWN C;  4PLI A;  1S72 Q;  1LJO A;  5FWC A;  3EFO B;  5LJ3 g;  3JCM b;  2DIL A;  2LP5 A;  5CQY A;  1QP2 A;  3TVT A;  1J3T A;  4AT1 B;  1VQ7 A;  1M90 U;  4C8Q G;  2V1R A;  3LWH A;  1D1A A;  2AZS A;  2EQK A;  2QYZ A;  4J9E A;  3UAT A;  3SFM A;  4ANJ A;  3G71 Q;  2F5K A;  2GQV A;  4BI3 A;  3CCR T;  4M75 G;  1Z9Z A;  1BI2 A;  2KGT A;  2EBP A;  2FHD A;  3EFR A;  1K9M U;  2NYS A;  3CCQ A;  3I56 T;  4QVC A;  1ZSZ B;  1MMN A;  5GMK j;  2DBK A;  4J7I A;  7AT1 B;  2RQV A;  2DL8 A;  2HKQ B;  2KT8 A;  1X01 A;  4Y91 A;  3CEY A;  1M1F A;  3QKJ A;  2YSQ A;  1G3S A;  2ZAE A;  3L2W A;  1MHN A;  4AFQ C;  5GAM j;  2XU8 A;  4A63 B;  4FL6 A;  3PNW C;  1MV0 B;  2X4Y A;  1N9S A;  2LJ0 A;  1Y96 A;  3OYY A;  3CME Q;  2G6F X;  3VS3 A;  2JJ9 A;  1HK9 A;  1I4K 1;  1LOJ A;  4DQ2 A;  3JCM J;  2DD4 A;  1WYX A;  4C92 B;  1QKW A;  4JLI A;  4F7U A;  1OZ3 A;  1SSH A;  1ZA2 B;  3THK A;  4BE0 A;  2D0Q B;  4R0K A;  2NUT B;  4OP0 A;  1WXB A;  3H0F A;  3MJX A;  3RMQ A;  4V2S A;  1GXI E;  1XJW B;  1OU8 A;  3EHR A;  2EVR A;  2W0Z A;  4QW2 A;  3U23 A;  4RTZ A;  5GAN j;  2DTO A;  2CZ7 B;  2EW3 A;  3CCQ Q;  1B34 A;  1V1C A;  1YIT Q;  3M55 A;  2QGF B;  1I5L A;  2DL4 A;  2C0T A;  3MP8 A;  4L59 A;  1U8R A;  1AEY A;  1ZUU A;  3I5S A;  2OTL A;  1G8X A;  3HRS A;  2YUQ A;  3LGL A;  4OGE A;  2RNA A;  1B7T A;  4M77 A;  1WXT A;  3HFO A;  2QTX A;  2EYY A;  5DM7 R;  2IVW A;  3RMS A;  2KXD A;  1W2B S;  1X75 C;  2XDB A;  2X4X A;  1IO6 A;  2B8A A;  5FWB A;  2BKD N;  1UDL A;  2OAU A;  1K0X A;  5GAO n;  2NUP B;  1X6G A;  3QYH B;  3CBP A;  4LDV A;  1YIJ A;  1UGR B;  2RMO A;  2AIR B;  3HL8 A;  4C5G A;  2NLU A;  2EQJ A;  3FJ5 A;  5CQX A;  1CSK A;  4FU6 A;  3OYK A;  1G3T A;  4ME7 A;  3EAE A;  3V7R A;  3I56 Q;  1WJS A;  2E4H A;  1G2B A;  3J7A F;  1T0J A;  2ZPH B;  1UB4 A;  4C92 G;  4BB7 A;  2EKH A;  1Y71 A;  1SHG A;  3M59 A;  2RJC A;  4D6W A;  2YLB A;  2PTK A;  4J9F A;  2PVO B;  1WHH A;  1YJN T;  5I22 A;  2PNI A;  1OZ2 A;  4OMQ A;  4F7U G;  3IQL A;  2YUP A;  1M30 A;  3X20 B;  3H6Z A;  1WHK A;  3JSC A;  4GBQ A;  4DBR A;  3JCM e;  2E12 A;  5GAN 7;  5I2M A;  1CKB A;  3CBO A;  4C5I A;  1BB9 A;  4PJM A;  2RQT A;  3REA B;  4ZTJ A;  3QSU A;  2C0I A;  2O9V A;  5LJ3 d;  1G5V A;  3PVL A;  1RAF B;  1TXQ A;  2LJ3 A;  1VQ4 A;  4M77 D;  3FLG A;  4JUV A;  1QWE A;  4OF1 A;  3QWX X;  2FRY A;  2FVU A;  5LJ3 f;  2YHT A;  3CD6 A;  1WDX A;  4A54 A;  4ELY C;  2EKO A;  2DAQ A;  3VS1 A;  5C0M A;  2MK5 A;  4ZGE B;  1OPL A;  1ZUY A;  2HD0 A;  2X9H A;  4EMH A;  1H92 A;  1PSF A;  1RAD B;  3CCV T;  1Y7X A;  2ROL A;  3CC4 T;  4QQG A;  1FYN A;  3H0I A;  3QZ5 B;  3CCS A;  1WJR A;  3JB9 I;  2RHY A;  1N27 A;  1NZ9 A;  1RI0 A;  3PT9 A;  1WI7 A;  1NJI U;  1FX7 A;  1G3W A;  3PIP A;  2R58 A;  2V1Q A;  5DLO A;  2X51 A;  2V8I A;  2CUD A;  1BIB A;  2E5K A;  1UJ0 A;  4R55 A;  3L2Q A;  3OW2 A;  4LDU A;  2RK2 A;  2O4X A;  4PJL A;  4PL6 A;  1VQM T;  3EH1 A;  1WA7 A;  3N5B B;  5GMK e;  4D8D A;  2F5T X;  1RL2 A;  4JJC A;  1WIE A;  2E6Z A;  2ZPG B;  2KMT A;  1N8R R;  2LDM A;  4Q5W A;  1YJN Q;  1NYF A;  3NTI A;  2DRM A;  3V7S A;  5GAM e;  4LN2 A;  2HKN A;  3DLM A;  3RDV A;  2YUN A;  2FYK A;  2Y4X A;  4LNP A;  1O75 A;  4JS5 A;  1K0S A;  4N0A A;  2KRS A;  3SWN B;  4E7J A;  4P5N A;  1LVK A;  3OYG A;  4B9X A;  2GNC A;  3VUZ A;  4HT9 A;  2F2V A;  1JJ2 P;  4QKU A;  5M9O A;  2DYB A;  2LQK A;  1NM7 A;  3A8H B;  1JXO A;  2ECZ A;  1NYG A;  1PCX A;  2KRO A;  2M1H A;  1AWJ A;  5A0L A;  4Z02 A;  1VQ9 T;  1UTI A;  1VQ5 T;  2W10 A;  1ACM B;  4M7D F;  1D09 B;  2RH2 A;  1VUB A;  3EGX A;  2DK3 A;  3AHU A;  1Y07 A;  4EMG A;  4E47 A;  3VS6 A;  2L5Q A;  2DTH A;  2JOY A;  3EG9 B;  4M7D D;  2CP7 A;  4M78 A;  3PGG A;  5GAN e;  3CC7 T;  3L42 A;  4J9H A;  2FPF A;  2DVE A;  3NHN A;  3M0Q A;  4LDY A;  5KCH A;  2ED0 A;  2BZY A;  4J5Y A;  1D1B A;  1MND A;  2KSS A;  5IHN A;  2D9T A;  2DRK A;  1M1K C;  4FYV B;  2OAW A;  4X1V A;  1PRL C;  3CCV Q;  3SB2 A;  4M7A F;  1VQL A;  2R57 A;  2XKO C;  2ZPE B;  2RQR A;  2LJ1 A;  2ABL A;  2EYZ A;  1I07 A;  2MWP A;  1X43 A;  2KT1 A;  5L8R E;  2QQB A;  3HKS A;  1RI9 A;  1BYM A;  1VQ9 A;  2FL7 A;  1GCP A;  4M7A D;  2CP5 A;  1VYV A;  1BK2 A;  5KE2 A;  3MCA B;  2JTF A;  1M2V A;  5FRM A;  2LX9 A;  2RHX A;  1QCO A;  4DEX A;  4M77 C;  4PJJ A;  3CC7 A;  2BUD A;  3NTK A;  5I2S A;  1KHC A;  5CO7 A;  1VQM Q;  4AG2 C;  2DXU A;  1YJ9 T;  4KT0 E;  1Q7Y R;  1PKT A;  4J7F A;  3E9G A;  5J39 A;  1TOV A;  4XU2 A;  4XTY A;  4C0F A;  2P0Q A;  1VQK T;  5KYX A;  1BCM A;  1A0N B; 
#chains in the Genus database with same CATH homology
 5GJV B;  4GLM A;  5FWC A;  2L0A A;  5FW9 A;  2K7A A;  4OMM A;  1YWP A;  5IHK A;  2EGE A;  2DIL A;  2LP5 A;  4OMP A;  3LH5 A;  3TVT A;  1PKS A;  2MOX A;  1K1Z A;  4F17 A;  1GBR A;  1J3T A;  2SRC A;  4OMO A;  2RQW A;  2V1R A;  4AFZ C;  1UFF A;  2AZS A;  4LUE A;  2DE0 X;  4J9E A;  3UAT A;  1I1J A;  1AVZ C;  1Z9Z A;  4OML A;  2KGT A;  2AKL A;  2O31 A;  3JV3 A;  1OOT A;  3I9Q A;  3I5R A;  2A28 A;  2EBP A;  4AG1 C;  1X2Q A;  1X69 A;  1NEG A;  1FMK A;  2K6D A;  1LCK A;  1KJW A;  4IIM A;  2DBK A;  2HBW A;  2L2P A;  4QT7 A;  2RQV A;  2DL8 A;  2KT8 A;  5I11 A;  1JU5 C;  2KYM A;  1YWO A;  2YSQ A;  2DVJ A;  1NG2 A;  2KYB A;  4AFQ C;  2GTJ A;  2A37 A;  1PNJ A;  3VS7 A;  1ABO A;  1E7O A;  4A63 B;  3PVQ A;  1N5Z A;  3VRY A;  1MV0 B;  5IHI A;  2LJ0 A;  1SHF A;  2J7I A;  1G83 A;  2G6F X;  3VS3 A;  4RTV A;  1MV3 A;  4D8K A;  1H3H A;  1T3L A;  4Z89 A;  2DBM A;  4KRT A;  1WYX A;  2DA9 A;  1S1N A;  1GRI A;  2O9S A;  3SHW A;  2K3B A;  1QKW A;  2JS0 A;  1VA7 A;  3M0S A;  4J9D A;  2L3Q A;  3VS0 A;  1TG0 A;  1SSH A;  2IIM A;  3VRZ A;  3EG2 A;  2HSP A;  3THK A;  2EGA A;  1JXM A;  1YP5 A;  4LUD A;  3C0C A;  4R0K A;  1W1F A;  2C0O A;  1AWX A;  1WXB A;  2DJQ A;  2KEA A;  3H0F A;  5ECA A;  1NLO C;  2GBQ A;  1X6B A;  2DM1 A;  2PZ1 A;  3EHR A;  2EVR A;  2W0Z A;  3U23 A;  4RTZ A;  2EGC A;  4CC2 A;  2EW3 A;  2GTO A;  1V1C A;  2EPD A;  4AFU C;  2RF0 A;  2FEI A;  2DL4 A;  2C0T A;  1AEY A;  2J05 A;  1WX6 A;  3VS5 A;  1ZUU A;  3I5S A;  3ZL7 C;  1W6X A;  2MCN A;  1UG1 A;  2CUB A;  2YUQ A;  3QWY A;  1RLQ C;  1B07 A;  1M3A A;  2CRE A;  2RNA A;  2AK5 A;  1WXT A;  2GQI A;  3CQT A;  4F14 A;  1MUZ A;  2KRM A;  1GL5 A;  2EYY A;  2VWF A;  2JW4 A;  2KXD A;  2RQU A;  2ESW A;  2HEQ A;  1IO6 A;  2HCK A;  5FWB A;  2BZ8 A;  3A98 A;  1UDL A;  1K0X A;  1QLY A;  1I0C A;  1U3O A;  1X6G A;  2D8H A;  3O5Z A;  5HCK A;  2DMO A;  1UGV A;  1PWT A;  2J6K A;  2RMO A;  2DNU A;  2CH4 A;  1BU1 A;  1HD3 A;  3M0R A;  3FJ5 A;  3GBQ A;  4RTX A;  1CSK A;  2F2X A;  2JMC A;  2ED1 A;  2BTT A;  1GBQ A;  2M51 A;  4HXJ A;  5IH2 A;  2JS2 A;  1E6H A;  2LCS A;  2MIO A;  1G2B A;  2CT3 A;  1T0J A;  4DEY A;  4RTY A;  4EIK A;  3NGP A;  2D1X A;  5EC7 A;  2EYX A;  4J9I A;  2YDL A;  2EKH A;  2KBT A;  1HSQ A;  1E6G A;  1SHG A;  2ROT A;  4RTU A;  2O88 A;  2CT4 A;  1H8K A;  2YUO A;  2PTK A;  4ZNX A;  1QWF A;  1WXU A;  4J9F A;  4J9C A;  1YN8 A;  5I22 A;  2PNI A;  4OMQ A;  3IQL A;  3EG3 A;  2YUP A;  1M30 A;  1GCQ C;  4Z88 A;  2NWM A;  2FO0 A;  4GBQ A;  2KR3 A;  2JM8 A;  2DL5 A;  2J06 A;  1TUD A;  4HVV A;  1CKA A;  2DF6 A;  1CKB A;  2XMF A;  1PHT A;  1ABQ A;  2CSQ A;  3TSZ A;  1BB9 A;  2JTE A;  2RQT A;  3REA B;  1GCQ A;  2C0I A;  3M0T A;  2O9V A;  3H0H A;  1W70 A;  4LE9 A;  1AZE A;  4JZ4 A;  3PVL A;  1EFN A;  1UHC A;  2JXB A;  2LJ3 A;  1OEB A;  1QWE A;  5IXF A;  2DX1 A;  1BBZ A;  2A36 A;  3QWX X;  2FRY A;  1RUW A;  1X2K A;  4M4Z A;  2KXC A;  2X3W D;  2F2W A;  4JJD A;  2VVK A;  3EGU A;  1WDX A;  1T3S A;  4E6R A;  1AZG B;  2B86 A;  2H8H A;  4F16 A;  1YCS B;  2KNB B;  3NPF A;  3VS1 A;  4Y92 A;  1KSW A;  1OPL A;  1ZUY A;  1H92 A;  1M3C A;  2ROL A;  2SEM A;  2NUZ A;  4RTT A;  5IXB A;  1FYN A;  3H0I A;  2LNH B;  5L23 A;  2EQI A;  2RPN A;  2FRW A;  1WFW A;  3KFV A;  1WI7 A;  4HCK A;  1T0H A;  2V1Q A;  2RN8 A;  3REB B;  2CUD A;  2E5K A;  1ZBJ A;  1UJ0 A;  1GFD A;  3UF4 A;  1QCF A;  4FSS A;  1M8M A;  1JEG A;  1WLP B;  2CH4 W;  2LMJ A;  4K11 A;  2CSI A;  1M3B A;  1WA7 A;  2HDA A;  2AKK A;  4D8D A;  2D8J A;  2QDL A;  3PE0 A;  3VS2 A;  4JJC A;  1WIE A;  3UA6 A;  2DL3 A;  1K9A A;  4WCI A;  1OPK A;  1AD5 A;  4RUG A;  1NYF A;  2VKN A;  3UA7 A;  2DRM A;  1NEB A;  4LN2 A;  1QKX A;  2LQN A;  3ULR B;  3VS4 A;  2YUN A;  4LNP A;  1Y0M A;  2FG0 A;  1K0S A;  2JMA A;  1UJY A;  3SEM A;  2KRS A;  1Y57 A;  1ZLM A;  2GNC A;  4JZ3 A;  2F2V A;  4IIO A;  3RBB B;  2DYB A;  2EYW A;  1NM7 A;  1JO8 A;  1JXO A;  2GGR A;  2X3X D;  1U5S A;  2ECZ A;  2YT6 A;  1UUE A;  1NYG A;  2FPE A;  4JPB W;  1GFC A;  4ESR A;  2KRO A;  2FPD A;  1AWJ A;  2JT4 A;  2OI3 A;  1B3Q A;  1UTI A;  2W10 A;  3H41 A;  2I0N A;  1TUC A;  3EG1 A;  3I35 A;  1VYU A;  2LQW A;  2O2O A;  4J9G A;  3M0U A;  3VS6 A;  2D0N A;  4HVW A;  3NMZ C;  2ENM A;  2M0Y A;  1Z9Q A;  4J9H A;  2FPF A;  3NHN A;  3M0Q A;  1X27 A;  2ED0 A;  1JQQ A;  2BZY A;  2JM9 A;  5IHN A;  1AOJ A;  1ARK A;  2DRK A;  2OJ2 A;  4JJB A;  1RLP C;  2OAW A;  4X1V A;  1PRL C;  1K4U S;  1AWO A;  2J6O A;  1ZSG A;  1UE9 A;  4Z8A A;  1UHF A;  1U06 A;  3R6N A;  2K9G A;  1HJD A;  2RQR A;  1SEM A;  2A08 A;  2LJ1 A;  2LZ6 B;  2ABL A;  2EYZ A;  1I07 A;  1KIK A;  1X43 A;  2KT1 A;  4OMN A;  4J9B A;  1M27 C;  1RI9 A;  2P4R A;  4CC4 B;  1GCP A;  1NLP C;  2J6F A;  1PRM C;  1VYV A;  3EG0 A;  1AWW A;  1BK2 A;  1VYT A;  4AFS C;  2KRN A;  1ZUK A;  1KFZ A;  1ZX6 A;  1YNZ A;  2DL7 A;  2L3P A;  3RNJ A;  3EHQ A;  4DEX A;  1UEC A;  2K79 A;  2CDT A;  4ORZ A;  2DLP A;  1K76 A;  3TSW A;  4CC3 A;  2BZX A;  2L3S A;  3M0P A;  4AG2 C;  4CC7 A;  2LX7 A;  4RTW A;  2AZV A;  2KE9 A;  5GJW B;  1PKT A;  1XOV A;  4HVU A;  1OV3 A;  1SPK A;  2K2M A;  1SRM A;  1A0N B;  1SRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...