1PNJA

Solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
86
structure length
86
Chain Sequence
GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and ligand-binding site of the SH3 domain of the p85 alpha subunit of phosphatidylinositol 3-kinase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
total genus 6
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pnjA00
2EGAA 3EG0A 1QCFA 3VS3A 4F16A 2FPEA 2DE0X 1AOJA 2MCNA 4Z88A 3NPFA 5IH2A 2AZVA 1X6BA 1CKAA 2EVRA 1E7OA 1NEGA 1BU1A 3VRZA 1K76A 1NM7A 1JQQA 5GJVB 4OMMA 5I11A 3UA6A 1X6GA 2DL3A 1WYXA 2A36A 1QKXA 1PKTA 2DL4A 1IO6A 1M3AA 1UE9A 3M0RA 2NWMA 2LP5A 4JJBA 2GQIA 1Z9QA 3UATA 1VA7A 2M51A 1W70A 1WLPB 1UHCA 1I0CA 3TSZA 5EC7A 1UFFA 3EHQA 1V1CA 1ZUKA 1JU5C 4HVVA 3RNJA 2BZXA 1KJWA 1SHGA 3FJ5A 3M0PA 2V1QA 3M0TA 1AWWA 2A37A 1AWXA 4D8DA 1QKWA 1M3CA 2LJ1A 2KE9A 1N5ZA 1GFDA 5IHIA 2GGRA 3VS7A 5IHKA 2YUNA 3ULRB 3VRYA 2FPDA 1UGVA 2G6FX 2GTOA 4OMLA 4Y92A 3VS2A 1KIKA 4Z89A 1G2BA 2SEMA 3CQTA 4AFZC 1Y57A 2FEIA 2X3XD 2FG0A 3EG2A 4LE9A 2DRKA 2M0YA 1JEGA 2BZYA 2K9GA 1AD5A 1GCQA 1K1ZA 2ED0A 2JS2A 1K0SA 1U3OA 2O2OA 2K2MA 1PHTA 4HXJA 4LUEA 2JS0A 1PNJA 1ABOA 4AFQC 3VS4A 4X1VA 2RQRA 2AK5A 2J05A 2KXCA 2J6OA 2RMOA 2HSPA 4J9CA 4D8KA 1UG1A 5L23A 1MUZA 3EGUA 1FYNA 1GBRA 2CUBA 2JM9A 4AG2C 4KRTA 2JXBA 2L3QA 1H3HA 1GFCA 2DMOA 4AFUC 4QT7A 1MV3A 2JM8A 4A63B 1OEBA 1RLQC 1BK2A 1AVZC 1XOVA 1AZEA 1NEBA 1X69A 2EKHA 1H8KA 4M4ZA 4LN2A 1JXMA 2RQWA 2L0AA 1B3QA 2HEQA 1B07A 1A0NB 2LCSA 2CT3A 1YCSB 3R6NA 2FO0A 3UA7A 1M30A 2PNIA 3VS5A 2KR3A 1BBZA 1NLOC 1T0HA 1LCKA 2GNCA 1SRLA 1OV3A 1WXTA 3I5SA 2ABLA 4HVUA 5HCKA 2CSQA 4OMPA 1WI7A 3I9QA 5IXFA 1ZSGA 2KT8A 1WXBA 1G83A 2E5KA 5FWBA 2JT4A 4RTZA 1TG0A 1SRMA 2DL8A 4AG1C 1MV0B 2FPFA 2RQTA 2PZ1A 2KRMA 2DL7A 2K6DA 1SPKA 1WFWA 2K79A 4J9IA 2VVKA 2YUQA 1OPKA 1RLPC 1SSHA 2X3WD 1PRLC 1T3SA 1SHFA 2EYXA 4K11A 2RQVA 4JJCA 2W0ZA 2EPDA 1OPLA 2DM1A 1YN8A 4LUDA 4RTTA 4JJDA 1HJDA 5FW9A 2DF6A 2BZ8A 2CT4A 1UECA 1WDXA 2JW4A 1WA7A 3PVLA 3I5RA 2J7IA 4J9DA 2DBKA 4LNPA 3PVQA 2L3SA 2LQNA 2KNBB 2A28A 2CREA 1BB9A 3NGPA 2NUZA 4J9GA 2F2XA 2I0NA 4HCKA 4Z8AA 2DA9A 1M8MA 2DVJA 2O88A 1E6HA 2LMJA 3U23A 1NYFA 2VWFA 1YWPA 2D1XA 1GL5A 2D8JA 2SRCA 4EIKA 1PRMC 3EHRA 1PWTA 3REAB 4RTVA 2KT1A 2LQWA 4RTWA 2ED1A 4J9HA 2AKKA 2DL5A 2ROTA 2LNHB 2KYMA 3GBQA 4J9EA 3NMZC 1AEYA 2OJ2A 2FRYA 1GCQC 2LJ3A 4F17A 5IXBA 3THKA 1K4US 2LJ0A 2KBTA 1UTIA 1ZBJA 2F2VA 3H41A 3M0UA 1UDLA 2L2PA 2BTTA 4J9BA 4RTUA 3TVTA 4F14A 4ZNXA 1HD3A 1YWOA 3M0SA 2CDTA 2MIOA 2HDAA 1YP5A 2OI3A 4RUGA 4FSSA 5ECAA 2AZSA 1KSWA 2B86A 2QDLA 2KRSA 4ORZA 1NLPC 1ABQA 4RTYA 3QWYA 1X27A 2DNUA 1VYTA 2CH4A 2LX7A 5I22A 3H0HA 3NHNA 1QLYA 1Y0MA 2RPNA 5FWCA 2J06A 1KFZA 2L3PA 1NG2A 1VYUA 1I1JA 1U06A 2LZ6B 3RBBB 3VS6A 2YUOA 3VS1A 2J6FA 3EG1A 3SHWA 4OMOA 4R0KA 4CC4B 3C0CA 1CKBA 4IIMA 2KROA 1S1NA 2JMAA 1T0JA 1EFNA 2D0NA 1YNZA 2XMFA 2C0OA 4CC7A 1X2KA 2VKNA 2YT6A 2IIMA 2EBPA 4GLMA 2GBQA 2KRNA 2KYBA 2EQIA 1X43A 4JPBW 1JXOA 2RQUA 2KGTA 2EGEA 2C0IA 2V1RA 4JZ3A 4OMQA 2RNAA 2H8HA 3H0IA 2DBMA 4ESRA 4J9FA 3ZL7C 4DEXA 1ARKA 3UF4A 4IIOA 3PE0A 2RN8A 1I07A 1WIEA 2EYWA 2RF0A 2ECZA 4E6RA 1QWFA 2YSQA 1W1FA 1T3LA 1AWOA 2D8HA 3QWXX 4CC2A 2O9SA 2W10A 2OAWA 1UJYA 1GCPA 4HVWA 2A08A 2KEAA 2C0TA 2ESWA 2O31A 1TUDA 2DILA 2MOXA 4WCIA 1M3BA 2K7AA 1U5SA 2PTKA 1K9AA 1X2QA 1Z9ZA 3TSWA 3KFVA 1TUCA 2JMCA 2EGCA 3VS0A 2GTJA 2FRWA 1E6GA 4DEYA 1JO8A 1ZUUA 1UHFA 3REBB 1AWJA 2HCKA 1K0XA 1FMKA 4AFSC 3IQLA 2DX1A 2HBWA 2CUDA 1H92A 1M27C 3SEMA 2ENMA 1J3TA 2O9VA 4JZ4A 1VYVA 1W6XA 2DRMA 2AKLA 1WX6A 5IHNA 4GBQA 3I35A 3LH5A 2EYYA 3O5ZA 1ZUYA 4RTXA 1CSKA 2DLPA 3H0FA 2ROLA 1QWEA 2P4RA 2YDLA 5GJWB 2F2WA 1HSQA 1UUEA 1GRIA 2YUPA 4CC3A 1PKSA 2DYBA 1NYGA 1OOTA 1GBQA 2EW3A 3JV3A 2CH4W 2DJQA 1WXUA 1AZGB 1ZX6A 2K3BA 1RI9A 2CSIA 2EYZA 1ZLMA 3A98A 1SEMA 1UJ0A 2J6KA 3M0QA 2KXDA 1RUWA 4OMNA 3EG3A 2JTEA
chains in the Genus database with same CATH superfamily
1Y96A 2FPEA 2A0FB 6AT1B 1AOJA 2DD5A 3JCMg 2MCNA 1X6BA 2EVRA 5J26A 3OYDA 3JCMJ 2F69A 1E7OA 1NE8A 1Y07A 1RADB 2GQVA 1G5VA 2YRCA 1VQNQ 3CCEQ 1NM7A 1WNLA 2EKOA 2DEQA 4OMMA 5I11A 4KH0B 2HBPA 3V8JA 4XTYA 1PKTA 1M3AA 4FU6A 2E4HA 1NBEB 3I55Q 2NWMA 3CCST 4XTVA 2F5TX 4BDZA 3CCJA 5EC7A 2XI9A 1Q86R 3EHQA 1OU8A 2KK4A 4HVVA 1N8RU 1V76A 2ZPEB 1Q86C 2DTOA 5GAMj 1IB8A 1KJWA 1SHGA 3FJ5A 4M78C 4N0AA 3V8KA 2XU8A 3CCRQ 3M0TA 3H9NA 2QQ9A 4OGCA 4F7UG 1AWXA 4D8DA 1QKWA 1GFDA 1VQPQ 2DKGA 1R0BG 2HQXA 3MEVA 1VQ4T 1KIKA 3VS2A 4Z89A 5CKBA 2YLCA 3CD6Q 1HYOA 4AFZC 1YJNA 1VQMT 1OULA 1YHQQ 2DRKA 2M0YA 3L2UA 2OX7A 2ED0A 4O5VA 2O2OA 5GAOl 5KYNA 1PHTA 1BIAA 4LUEA 3TEEA 2XD0A 1ABOA 4AFQC 2PQWA 2AK5A 3M4GA 2JN0A 2AHJB 2RHYA 1Q81C 2FYKA 2K2VA 2VV5A 5L23A 4PK4A 3URGA 4AG2C 3VKIA 5I2MA 2VASA 3CC4T 1NPPA 1OQKA 3X24B 2DMOA 4AMCA 3OYCA 1YI2Q 4PJOD 1RAEB 2JM8A 2DZ9A 3TQ7P 2K4YA 1AVZC 3CCUT 2DVEA 1AZEA 5DLQE 1NEBA 3FEOA 1VQ7A 4FYYB 4M4ZA 4ZN1A 3EFSA 3P8BB 1B3QA 1WHMA 2JUFA 3CMEQ 4OB0B 3VV0A 2LQKA 3CBPA 5A0DA 3E19A 4DBRA 3H6ZA 1SRLA 3E9GA 4DBFA 4E7ZA 2P4TA 4HVUA 4E7JA 2V8IA 1LPLA 2VGNA 5KCHA 1YI2A 4KUIA 5IXFA 1MMAA 1Q82R 4M7DD 5FWBA 2KVQG 2DL8A 2FPFA 2PZ1A 4C0GA 2DL7A 3CCRT 2K79A 1KQ2A 2YUQA 1OPKA 4LXCA 1YHQT 4E7SA 1RLPC 5D6YA 4NOYA 1SHFA 2EYXA 5KE2A 2ZPHB 2W0ZA 3GNFB 4A54A 3EAEA 4LUDA 1TUGB 4J5YA 3UWNA 1VQ6T 1U1TA 3CD6A 2A7YA 4M78G 1HJDA 3FDRA 2X9HA 5GMKh 1BI3A 2PVDB 2J7IA 1NJIC 2GCXA 4J9DA 2KQWA 2DBKA 3PVQA 3OYIA 3L2QA 1VQLA 1D3BA 3S3MA 3NGPA 4J9GA 4Z8AA 2JNGA 3M57A 1E6HA 5HK0A 5GAMe 3DB4A 2XK0A 1OX9A 1UGSB 5KYYA 5CAIA 1MGQA 4PJJA 2D1XA 1UGPB 2RH2A 3EHRA 1MNEA 2LNVA 3EGXA 1KD1R 3RERA 2AKKA 2DL5A 3OYKA 3CXCS 2L8DA 5KE3A 3A1PA 3NMZC 3QHSA 3C94A 4WF2A 5IXBA 4HT8A 2EQKA 2LJ0A 2QTXA 3UPUA 1WHJA 1UTIA 3G7ZA 4M7AB 5GAN3 4M77B 2RD1A 4J9BA 3TVTA 4QKUA 4A4HA 1YJWQ 1N8RC 2CDTA 3QBYA 3OA6A 2YHTA 4BE2A 1ZSZA 2QDLA 4OB3B 1Q82C 3NFCA 2GFUA 3CCLQ 3P8DA 3QWYA 4ZTFA 2DNUA 3CMAT 3NHNA 4M78F 1N27A 5GMKe 2FVUA 2RPNA 3EH1A 5J39A 1I1JA 3JAME 3RIRA 2MK5A 2YUOA 3BDLA 4CC4B 2DZCA 1CKBA 1BI0A 2DJZA 1S1NA 5LJ3g 1K8AC 4J6XA 4M7DF 3L1AA 3SD4A 2BE7D 1I8FA 1VQLT 1LVKA 2VC8A 3PMTA 2D0QB 1TXQA 2YT6A 3I56A 2EBPA 4GLMA 1VQ8T 2KYBA 4JPBW 5GAN7 3JCMd 2EGEA 3A8MB 3QIIA 2V1RA 3EG9A 3QZ5B 4N4HA 1VQ5Q 1IGQA 5GANf 3ZL7C 4D6WA 3JCMc 3UF4A 3RKWA 3TREA 3M9QA 1WHLA 2XKOC 5GAN6 1C1AA 3QJYA 2VB6A 3R6OA 4PLLA 2BIVA 1QWFA 3E2UA 2HL3A 1VQPT 2E12A 5FRMA 3QUIA 5GAMd 2QQRA 1VQMA 5DLOA 2D8HA 2RI2A 2FL7A 2OAWA 4MMLA 2KEAA 3CCMA 3V7RA 3VYGA 1WHKA 2PU9B 1K8AU 2K7AA 1U5SA 2PTKA 3CCLT 1X2QA 3TSWA 3KFVA 4C92A 1VUBA 2JTFA 2JMCA 4IURA 2EGCA 2V8JA 3OMGA 5GAMg 1Q81U 1VQKT 2XIDA 4DEYA 1JO8A 1ZUUA 5A0LA 3G71A 2ZAEA 1K0XA 2DX1A 2HBWA 2WACA 1H92A 4PJOE 1M27C 1VOMA 3SFMA 2WSCE 1VYVA 1YJNQ 1W6XA 2DRMA 5C6SA 4BI3A 2ZPFB 3I35A 1KC8C 1N9SA 4M75F 1ZUYA 4RTXA 1CSKA 5GJWB 1GRIA 2LQ8A 4PFZA 2DYBA 1NYGA 4LD9K 2EW3A 3JV3A 2CH4W 2CKKA 2JVVA 1WXUA 4HCZA 1I5OB 2RHIA 1VQ5T 3SDZA 3OS2A 1IGUA 2FB7A 2MWOA 1AT1B 3JCMV 3HTRA 1UB4A 4KGZB 3OYGA 2RHUA 3JCMP 2DXCA 1VQ9T 2ATCB 3DLMA 4PLIA 2MWPA 1TOVA 4L5GA 3E9FA 4Z88A 2QA4Q 3QXEB 3CCUA 1QP3A 2NUTA 3MHXA 4C8QB 1K76A 2FZCB 3MCAB 2PUOB 3UA6A 3ER0A 5I21A 1VQNT 1QKXA 2COYA 2RA2A 4QQ6A 1UE9A 1M5Q1 3MPUB 4JJBA 2GQIA 4BACA 1M9SA 1M90R 1UHCA 2B8AA 2OTLQ 1V1CA 2QG9B 3OMCA 4EMKB 4B9WA 3RNJA 3CC2Q 4QW2A 4PJOA 4JLGA 5A0GA 4BDYA 2A37A 2EJGA 4C0FA 2CP2A 5IAYA 3CC4Q 1JRIA 2EJFA 3OYLA 3OS5A 4M75A 1LOJA 4HKEA 3PGGA 4XQ3A 1RACB 1TSFA 3VRYA 2CYZB 1UGVA 1BYMA 1MHNA 2X3XD 4F7UF 1JEGA 2K9GA 1GCQA 1WHGA 1U3OA 2K2MA 3VS4A 2RQRA 2COWA 4N4IA 3A8LB 2KY9A 2KDSA 2E41A 3LYIA 4D8KA 3QG1A 4FYXB 3EGUA 2CUBA 3G4SA 1PD1A 1NZ9A 1H3HA 2MMPA 3GNGA 1GFCA 4C8QC 5GMKi 1OZ2A 2RO0A 3JB9I 4QT7A 1MV3A 4A63B 1D09B 1UGQB 3SWNB 3CMET 3D7SB 1VQ4Q 3OY9A 1XOVA 3OYFA 2EKHA 1JB0E 4PJOC 4LN2A 2CZ6B 2K3YA 2RQWA 1Q86U 1K73U 5KYWB 2OTJQ 1A0NB 2LCSA 3UA7A 4JRKA 5FU7B 3X20B 4M77D 1LCKA 4XU2A 2QQSA 1YITT 2CZ7B 4OGEA 3HFNA 1OV3A 2AT1B 3I5SA 3NTHA 4RG8A 1X75C 3FJPA 3JB9F 4C92B 4FW2A 1W2BP 4OMPA 2YLBA 1WI7A 3I9QA 5GAMh 2KT8A 4RTZA 2K6DA 3WVDB 2VVKA 2X35A 4V2SA 3BW1A 1PRLC 3UDCA 5IT9E 3CBOA 4M7DE 2Z0WA 2K5LA 4IUVA 4J83A 4KBMB 4JRQA 2EPDA 4BY6C 1OPLA 2CP5A 1YN8A 1MMGA 4J6WA 2DTHA 2ZCFB 2XDBA 1LNXA 3FIFA 3JB9J 1QVPA 1UECA 1M1GA 4E7IA 3C12A 1WA7A 4LNPA 2L3SA 3G6EQ 2A28A 1BB9A 4X9DA 3F70A 4DA4A 2F2XA 5LJ3j 1RAHB 2MF2A 2DVJA 1QCNA 4M78B 1QW1A 3ASKA 3EGDA 4A4EA 1ZA2B 3HRTA 5GMKj 3M56A 2QEXA 1YWPA 4PJOB 2D8JA 1GL5A 2WSEE 4EIKA 1JBMA 2YWWA 4RTVA 2KT1A 2LQWA 4RTWA 2DXUA 1UEBA 1KC8U 2ED1A 3G1JA 1PM3A 2DPPB 2LCCA 2LDMA 5KYUB 2KYMA 3JB9D 4A4GA 1RAFB 2FRYA 2M1HA 2LJ3A 4A4FA 1VQ6Q 2M16A 3MEWA 2KBTA 1ZBJA 1ZSZB 3CCVQ 3G6ET 4PJMA 4AT1B 2BTTA 2BKDN 4F14A 2R5MA 4ZNXA 3M0SA 1B7TA 2RB6A 3WVEB 5GAOq 3JB9H 1YP5A 3JCMX 1YCYA 5CKEA 3RESA 2OI3A 4FSSA 4PJOG 2AZSA 5D6WA 4ORZA 1NLPC 2CGHA 2YRDA 4M78A 1K73R 1VYTA 2LX7A 5I22A 3CMEA 1W2BS 3H0HA 4A53A 4BY6B 1NJIU 2H3EB 2DFUA 5KYXB 3PIPA 3RUXA 1VQPA 4IUQA 4E2FB 1KFZA 5FWCA 1BCMA 1M2VA 4UC4A 4BI4A 8AT1B 1X01A 2LZ6B 3RBBB 1YJ9Q 3VS6A 1FXXA 3CPWP 4R0KA 2DAQA 3OQ5A 3CPWS 2KROA 2JMAA 1T0JA 1EFNA 1YITA 5CQYA 1MMDA 3DB3A 4CC7A 2C0OA 2KAFA 2IIMA 4PKCC 3ZBDA 1WHHA 2EIFA 4EMGA 4NS5A 1VQ9A 1S72T 5CVIA 1I5LA 4JZ3A 5GAN8 5GAOn 4BE1A 1WZOA 4ESRA 3L2WA 1JJ2A 1ARKA 2HZYA 3PE0A 4B9XA 5GAOr 3CPWA 1I07A 2QXFA 1M1FA 2EYWA 3LW5E 3L2RA 4E6RA 4F7UE 3CCVT 2RHZA 3QPHA 1W1FA 1T3LA 1AWOA 4CC2A 3S3OA 4YTLA 4LDWA 1UJYA 4E7HA 4HVWA 4F7UB 4KGXB 1WQWA 2DIGA 4JLIA 2DILA 1QVGS 2RJFA 1M3BA 8ATCB 3SWNA 3BY7A 4KT0E 2MYSA 1G3YA 2O4XA 2XG8D 4PJLA 2PVGB 4DBQA 1UHFA 1X6OA 2XDDA 1RI0A 2HSEB 4OB2B 2M0OA 4AFSC 4LDUA 1Q7YC 1D3BB 3EG9B 1J3TA 2CS7A 1YJ9T 2RI5A 3CCET 1WX6A 4LDVA 3QYGB 4TVRA 1M2OA 4JJNK 2M02A 3M55A 2YXYA 2ROLA 1QWEA 2P4RA 4C8QA 2F2WA 1UUEA 3CCJQ 4CC3A 3CCQA 1D1BA 4C5IA 2ZGWA 3OBWA 2OTJT 3MP6A 5KYXA 1BCOA 2P84A 4DBHA 3O8VA 1VIEA 4ELYC 3HKSA 2K3BA 4KH1B 3LX7A 1VQKQ 2DD4A 3MEAA 4M7AC 1UJ0A 3I56Q 3G71T 3CC7A 3CXCA 1RUWA 4OMNA 2MPXC 2JTEA 4PFPA 3CCMQ 3JCMQ 4X9CA 2E6ZA 2EGAA 4OVAA 1O75A 5LJ5e 2DE0X 4PJNA 5FU6B 5IH2A 3NPFA 3LWHA 1OYXA 1YJ9A 1NEGA 4C92G 3CCQQ 1BU1A 3VRZA 2QK0A 5CIUA 2R5AA 4HA8A 3GLXA 2DL3A 3OYAA 2A36A 3EFOA 1C6VX 2EJ9A 1PSFA 1IO6A 4X34A 1BIBA 1SG5A 4ZGEB 2MAMA 3M0RA 3OSSC 1VQ5A 2WSFE 3S3NA 1VA7A 2M51A 5FROA 1WLPB 4BI8B 3CC7Q 3N5BB 3TSZA 1UFFA 4ZN3A 2EQJA 2CZ0B 3VUBA 1VQOT 3OB9A 4MDXA 2RJCA 1K8AR 2NUPB 3KXTA 2BZXA 4FM4B 1YIJA 3M0PA 3VJPA 2V1QA 4KULA 1KQ1A 1AWWA 2RHXA 5C0MA 4CRIA 4LDYA 1M3CA 2LJ1A 5IHIA 2GGRA 4QVCA 4PNOA 5GANh 3CC2T 3RKYA 2DERA 3OW2S 1QQJA 2EAYA 5IHKA 5HKCA 3ULRB 1ZA1B 2FPDA 2G6FX 4OMLA 4R56A 1G2BA 1OZ3A 5CKFA 1Y57A 2E65A 3ME9A 2FG0A 4LE9A 4CI0C 3HSBA 2BZYA 3PIOA 1AD5A 1K1ZA 1K0SA 3EFRA 4C92F 3J80E 1Y7XA 2JS0A 1PNJA 4MZTA 5LJ5f 3I55T 4X1VA 2E3IA 4IKFA 1RABB 3QDRB 2KXCA 2J6OA 2RMOA 2ZZDA 4J9CA 3JCMb 3CPFA 4J8OA 4KGVB 4L59A 5KCOA 1WGSA 2IPOB 3GF5A 1PC0A 3LGFA 2LT4A 3MO8A 4PL6A 2JM9A 2DO3A 4BB7A 2QA4A 1DJ7B 2JXBA 1I4K1 2L3QA 4F04B 2HAXA 2DK3A 4NL3A 2LTOA 4L6V5 1OEBA 1M8VA 1RLQC 4BD3A 3SWNC 1X69A 2CP6A 2DYIA 1H8KA 1M1KC 3VU3C 1JJ2S 4M7AG 1KC8R 2OTJA 1YCSB 2FO0A 1W2BA 3M4YA 3A8OB 1T0HA 2GNCA 3OYNA 1IRXA 3HFOA 2ABLA 5AT1B 3CC7T 1ZHIA 1U1SA 2COZA 4C92C 2CSQA 4N0AC 1ZSGA 2AIRB 5GAN4 2CP3A 4M77E 1Q7YU 2VXEA 4AG1C 1S72Q 2RQTA 1QCOA 2HNIA 3EH2A 3CC4A 3EGDB 1SPKA 1WFWA 2LC4A 3GIBA 3A5ZB 4JJCA 2G3RA 5HY6A 4ZGJB 2M9UA 1VQ7Q 1M1KU 2DM1A 1TH7A 2A3LA 2QGFB 4RTTA 3CMAQ 3TCJA 4BUGA 4JJDA 2EYQA 3I55A 2QQAA 3OBYA 5D7UA 2CT4A 1WDXA 2JW4A 1ACMB 3I5RA 5KYYB 1Q7YR 2CREA 2LCLA 2F1LA 2NUZA 2RK1A 3MJXA 1YIJT 2I0NA 4HCKA 1FMVA 2DA9A 1M8MA 2EQUA 4FT2A 2O88A 2LMJA 2DETA 1TS9A 3G4ST 4HT9A 1IHVA 1NYFA 1F1BB 2SRCA 2NUPA 1PRMC 5GANe 1PG5B 1PWTA 1VQ8Q 2JTMA 3RDVA 5CK9A 2Y4XA 2YRVA 1W4SA 1H3ZA 2ROTA 1UGRB 1SKUB 1D0XA 1AEYA 4F7UA 2VYTA 5KYWA 4XTXA 3RKXA 3MKDA 1RAGB 4F17A 1K4US 1PSEA 1Q82U 3M59A 3EGXB 1BI2A 2QYZA 1UDLA 4MDWA 1XQHA 2E1HA 3LLRA 3SB2A 1QVGP 4RTUA 3OW2A 1VQLQ 1YWOA 1TTHB 2HDAA 2VGMA 2FHDA 2B86A 1KSWA 2KRSA 4PFOA 1N6AA 2HKQB 2QEXT 4PJOF 4RTYA 2JJ9A 1AHJB 1YHQA 5CKDA 2CH4A 5LJ5d 3EFOB 2QGGA 5CCAA 4Y91A 3HHTB 3A8HB 3HRSA 3JB9G 1M4ZA 2D9TA 1RAAB 1QLYA 4RKUE 5GAOm 1LJOA 5HK3A 1QVFS 1Y0MA 2GF7A 2J06A 3OS0A 2DEUA 1ZQ1A 1NG2A 4LD6A 1HK9A 2VXFA 3VS1A 3EG1A 4QQDA 3SHWA 4OMOA 3C0CA 3VUZA 5FU7C 1M2VB 2R58A 3PTAA 2D0NA 4R55A 3M5AA 2XMFA 1X2KA 2VKNA 3PNWC 2GBQA 2KRNA 4Q5WA 2EQIA 1X43A 1JXOA 2KGTA 2QA4T 2RNAA 5GMKl 3H8ZA 2DBMA 4J9FA 3A8GB 4DEXA 4IIOA 1YJWA 2ZPIB 2RN8A 4QVZA 5CKHA 1PD0A 2CP0A 3CCEA 2JZ2A 4GLKA 2RF0A 4C0DB 4C8QD 1MMNA 2ECZA 1KD1C 2RM4A 4M7AE 5KH6A 2Y4YA 4HCBA 4M7AF 5GAOp 2V8KA 2RK2A 3JCMW 2W10A 4RMOA 1G8XA 1GCPA 1FWZA 2JOYA 5CQXA 2C0TA 2ESWA 1TUDA 4WCIA 1BI1A 1TWBA 4M7AD 1G3WA 1OI1A 3OYHA 1K9AA 1Z9ZA 4FCYA 1KQSS 2CZ1B 2P0PA 1TUCA 4Y28E 1QP2A 1VQKA 1EX4A 3CXCP 3VS0A 5IN1A 2FRWA 1M90U 1E6GA 4M77G 3REBB 3OYBA 2HCKA 3NTKA 4A4KA 3J7AF 2ENMA 5DM7R 5GANj 4FIBA 3QYHB 4GBQA 4XTWA 1XTDA 3O5ZA 2DLPA 3FC3A 5EG2A 2YDLA 2X4XA 1HSQA 5LJ3f 2YUPA 1R77A 2ZPGB 2MI6A 1OOTA 4OB1B 3M54A 1MNDA 2BE9B 4ELZC 2DJQA 3CCMT 1IREB 1NPRA 3VYHB 1ZX6A 3C95A 1ZSZC 4C5EA 5LL6S 7AT1B 2QAZA 3FB9A 2EYZA 3CCJT 1K9MR 1Y96B 2E70A 3Q1JA 1ZLMA 3A98A 1SEMA 4XU1A 1WJRA 2KXDA 4FT4A 1QVFA 2ZPBB 2E3HA 3EG0A 1FX7A 1QCFA 3VS3A 4F16A 4C0DC 4MMKA 1KK7A 4M75C 1EIFA 3PT9A 4OMFB 2HD0A 2AZVA 5FRNA 2V26A 2HL5C 1CKAA 4M7AA 4JUVA 5FLXE 4QQGA 5LJ3h 1JQQA 5GJVB 3E1SA 1VQ4A 1G3TA 3CBMA 1X6GA 2K5FA 3CCQT 1WYXA 3OYMA 2EQMA 2IG0A 3CCSQ 1R8OB 1M1KR 5L8RE 2QDYB 3OSVA 2DL4A 3QZ9B 4M7DG 2LVMA 4ATOA 2X4YA 2LP5A 3X25B 1Z9QA 1JJ2P 3UATA 3CCLA 1W70A 4OF1A 1I0CA 3OS1A 4DOWA 3OYEA 5KYUA 2XICA 4XK8E 3I56T 3G71Q 1ZUKA 1JU5C 1WJQA 3MP1A 1FMWA 3META 4EDUA 1M90C 4C8QG 3KBGA 3TU4K 4C92D 1C0MA 3ZEHA 1EZZB 5I2SA 5AYFA 3X26B 5CR2A 2HKNA 5LJ3e 2K5IA 2O4XB 2RJEA 3CCRA 2GFAA 4M77A 2KE9A 1N5ZA 1VQOQ 5CO7A 2HQEA 3VS7A 4C92E 3OYJA 2YUNA 2HQHA 4BE0A 2K57A 3JSCA 2GTOA 4Y92A 2NYSA 2QASA 3RR6A 2SEMA 3CQTA 2FEIA 4P5NA 3EG2A 3MP8A 4M77C 3FRNA 3CD6T 2JS2A 4N4GA 3PMIA 1OU9A 4HXJA 1YBYA 4M75E 2J05A 2O01E 2HSPA 2OTLA 2RI3A 2KMTA 3BE3A 4JS5A 4XU3A 1P92A 2E6NA 4M75B 3CCUQ 1UG1A 1MUZA 1FYNA 1GBRA 4KRTA 1Q95G 2E64A 4AFUC 3BFMA 1ZBXA 3GPLA 3CC2A 2PVOB 1WJSA 1YFNA 1BK2A 1QVGA 1D1AA 3QO3A 4XU0A 3M53A 1KQSA 1JXMA 2L0AA 2HEQA 9ATCB 1B07A 3DLLA 2P0KA 2CT3A 3R6NA 3HPWA 3PFSA 1M30A 2PNIA 2IVWA 3VS5A 2KR3A 1RAIB 1BBZA 1NLOC 4C5HA 3G6EA 1WXTA 4M7DA 2PUKB 2R57A 3L42A 1D0YA 4LDXA 2X4WA 5HCKA 3WXMB 4GY5A 4M77F 1WXBA 1G83A 3HP9A 2E5KA 2JT4A 1TG0A 1SRMA 2C06A 1MV0B 4XTZA 2KRMA 3CMAA 1BKBA 4J9IA 1KQSP 3LH0A 2KSSA 1SSHA 2X3WD 2K3XA 1T3SA 4M7DC 4ZTJA 4FW1A 1H641 2I2LA 1KD1U 4K11A 2DXBA 3GOXA 2RQVA 4E7KA 4Z02A 3OW2P 1V29B 4O6JA 1WPYA 1YIJQ 1QMCA 5FW9A 2DF6A 2BZ8A 5LJ5j 3G4SQ 3PVLA 2KI7A 3KUFA 2LQNA 2KNBB 2XHCA 4MZPA 4JDSA 1VQOA 5A2QE 2BUDA 4M75D 2X51A 3LGLA 3U23A 4ME7A 3V8LA 2VWFA 4JRPA 4OP0A 2P0QA 2RJDA 3REAB 4J6YA 2L3RA 4J9HA 4EMKA 4KUDK 1WQ7A 3UT1A 4HCCA 1VQ7T 2LNHB 3QJ6A 3GBQA 4J9EA 1B34B 2DXTA 1U8RA 2L5QA 1YITQ 2OJ2A 5DY9A 1GCQC 1XNIA 3S6WA 1B34A 3THKA 2H3JA 3CCSA 2QI2A 2QTVA 2F2VA 3H41A 3M0UA 3L2ZA 4FL6A 2L2PA 3T9NA 3V7SA 1HD3A 4FYVB 2NUTB 2E5QA 2MIOA 4VUBA 1R0CB 3RMSA 2CP7A 4QVDA 1K73C 5ECAA 4RUGA 3DKMA 4FYWB 1IHWA 4M7DB 1KG1A 1ABQA 3BDUA 1VQ9Q 1Q81R 1X27A 3ZFJA 2HMAA 3X28B 1GXIE 1YJWT 4IUTA 5M9OA 3INZA 4E47A 1QVFP 2D6FA 3CEYA 4JS4A 4B6MA 2L3PA 5GANg 1VYUA 5LJ5g 1U06A 2J6FA 1I81A 4FSXA 4IIMA 3JRZA 4EMKC 4M78E 4XAXB 4DQ2A 1D0ZA 4J7IA 1Y71A 1O9SA 1YNZA 4RG2A 3RMQA 3JCMh 2OTLT 3V7CA 3J81E 5LJ3d 2RQUA 3QDFA 1N8RR 2C0IA 4M78D 2L89A 2DTIA 4OMQA 2H8HA 3H0IA 3P8HA 2X4JA 3MEUA 4E7LA 3M58A 2FZKB 3FLGA 2VUBA 1SSFA 3HRUA 1WIEA 2DIQA 1TU0B 3GP8A 5FU6C 3AT1B 2YSQA 3CCVA 2LT1A 3QWXX 4IUPA 2F5KA 2O9SA 4MZMA 2XDPA 2LX9A 5GAN5 3C4SA 1N9RA 2QQBA 2A08A 2O31A 2LRQA 4EMHA 1OX8A 2MOXA 1KHIA 3HL8A 4JRIA 1NJIR 1PCXA 1VIFA 2NLUA 1K9MC 3QKJA 1RL2A 4C0ZA 4IUUA 5GAN2 1VQ8A 4C8QE 2GTJA 4XTUA 4DOVA 3AHUA 5GMKm 4RCCA 1AWJA 1FMKA 3IQLA 1S72A 2CUDA 3SEMA 2O9VA 4JZ4A 5J3BA 4II1A 1SF9A 2AKLA 5IHNA 3LH5A 2E10A 2EYYA 1VQMQ 5LJ5h 2OAUA 2EFIA 3H0FA 3OYYA 4WTOB 3NTIA 3LWIA 1HXDA 1KHCA 1VQNA 1PKSA 3JCMf 1YJNT 4ANJA 3JCMe 1GBQA 1VQ6A 5GANd 4J7FA 4RCBA 4NL2A 4ZGDB 1IZ6A 2FZGB 1AZGB 1D1CA 4M75G 1RI9A 3L2VA 1G3SA 1K9MU 2CSIA 4C8QF 2Y90A 1XJWB 5GAMf 2J6KA 4C5GA 3M0QA 3EG3A 3QSUA 2EWNA 2QEXQ 1YI2T 1IXDA 4EPCA 5D6XA
chains in the Genus database with same CATH topology
2EGAA 3EG0A 1QCFA 3VS3A 4F16A 2FPEA 2DE0X 1AOJA 2MCNA 4Z88A 3NPFA 5IH2A 2AZVA 1X6BA 1CKAA 2EVRA 1E7OA 1NEGA 1BU1A 3VRZA 1K76A 1NM7A 1JQQA 5GJVB 4OMMA 5I11A 3UA6A 1X6GA 2DL3A 1WYXA 2A36A 1QKXA 1PKTA 2DL4A 1IO6A 1M3AA 1UE9A 3M0RA 2NWMA 2LP5A 4JJBA 2GQIA 1Z9QA 3UATA 1VA7A 2M51A 1W70A 1WLPB 1UHCA 1I0CA 3TSZA 5EC7A 1UFFA 3EHQA 1V1CA 1ZUKA 1JU5C 4HVVA 3RNJA 2BZXA 1KJWA 1SHGA 3FJ5A 3M0PA 2V1QA 3M0TA 1AWWA 2A37A 1AWXA 4D8DA 1QKWA 1M3CA 2LJ1A 2KE9A 1N5ZA 1GFDA 5IHIA 2GGRA 3VS7A 5IHKA 2YUNA 3ULRB 3VRYA 2FPDA 1UGVA 2G6FX 2GTOA 4OMLA 4Y92A 3VS2A 1KIKA 4Z89A 1G2BA 2SEMA 3CQTA 4AFZC 1Y57A 2FEIA 2X3XD 2FG0A 3EG2A 4LE9A 2DRKA 2M0YA 1JEGA 2BZYA 2K9GA 1AD5A 1GCQA 1K1ZA 2ED0A 2JS2A 1K0SA 1U3OA 2O2OA 2K2MA 1PHTA 4HXJA 4LUEA 2JS0A 1PNJA 1ABOA 4AFQC 3VS4A 4X1VA 2RQRA 2AK5A 2J05A 2KXCA 2J6OA 2RMOA 2HSPA 4J9CA 4D8KA 1UG1A 5L23A 1MUZA 3EGUA 1FYNA 1GBRA 2CUBA 2JM9A 4AG2C 4KRTA 2JXBA 2L3QA 1H3HA 1GFCA 2DMOA 4AFUC 4QT7A 1MV3A 2JM8A 4A63B 1OEBA 1RLQC 1BK2A 1AVZC 1XOVA 1AZEA 1NEBA 1X69A 2EKHA 1H8KA 4M4ZA 4LN2A 1JXMA 2RQWA 2L0AA 1B3QA 2HEQA 1B07A 1A0NB 2LCSA 2CT3A 1YCSB 3R6NA 2FO0A 3UA7A 1M30A 2PNIA 3VS5A 2KR3A 1BBZA 1NLOC 1T0HA 1LCKA 2GNCA 1SRLA 1OV3A 1WXTA 3I5SA 2ABLA 4HVUA 5HCKA 2CSQA 4OMPA 1WI7A 3I9QA 5IXFA 1ZSGA 2KT8A 1WXBA 1G83A 2E5KA 5FWBA 2JT4A 4RTZA 1TG0A 1SRMA 2DL8A 4AG1C 1MV0B 2FPFA 2RQTA 2PZ1A 2KRMA 2DL7A 2K6DA 1SPKA 1WFWA 2K79A 4J9IA 2VVKA 2YUQA 1OPKA 1RLPC 1SSHA 2X3WD 1PRLC 1T3SA 1SHFA 2EYXA 4K11A 2RQVA 4JJCA 2W0ZA 2EPDA 1OPLA 2DM1A 1YN8A 4LUDA 4RTTA 4JJDA 1HJDA 5FW9A 2DF6A 2BZ8A 2CT4A 1UECA 1WDXA 2JW4A 1WA7A 3PVLA 3I5RA 2J7IA 4J9DA 2DBKA 4LNPA 3PVQA 2L3SA 2LQNA 2KNBB 2A28A 2CREA 1BB9A 3NGPA 2NUZA 4J9GA 2F2XA 2I0NA 4HCKA 4Z8AA 2DA9A 1M8MA 2DVJA 2O88A 1E6HA 2LMJA 3U23A 1NYFA 2VWFA 1YWPA 2D1XA 1GL5A 2D8JA 2SRCA 4EIKA 1PRMC 3EHRA 1PWTA 3REAB 4RTVA 2KT1A 2LQWA 4RTWA 2ED1A 4J9HA 2AKKA 2DL5A 2ROTA 2LNHB 2KYMA 3GBQA 4J9EA 3NMZC 1AEYA 2OJ2A 2FRYA 1GCQC 2LJ3A 4F17A 5IXBA 3THKA 1K4US 2LJ0A 2KBTA 1UTIA 1ZBJA 2F2VA 3H41A 3M0UA 1UDLA 2L2PA 2BTTA 4J9BA 4RTUA 3TVTA 4F14A 4ZNXA 1HD3A 1YWOA 3M0SA 2CDTA 2MIOA 2HDAA 1YP5A 2OI3A 4RUGA 4FSSA 5ECAA 2AZSA 1KSWA 2B86A 2QDLA 2KRSA 4ORZA 1NLPC 1ABQA 4RTYA 3QWYA 1X27A 2DNUA 1VYTA 2CH4A 2LX7A 5I22A 3H0HA 3NHNA 1QLYA 1Y0MA 2RPNA 5FWCA 2J06A 1KFZA 2L3PA 1NG2A 1VYUA 1I1JA 1U06A 2LZ6B 3RBBB 3VS6A 2YUOA 3VS1A 2J6FA 3EG1A 3SHWA 4OMOA 4R0KA 4CC4B 3C0CA 1CKBA 4IIMA 2KROA 1S1NA 2JMAA 1T0JA 1EFNA 2D0NA 1YNZA 2XMFA 2C0OA 4CC7A 1X2KA 2VKNA 2YT6A 2IIMA 2EBPA 4GLMA 2GBQA 2KRNA 2KYBA 2EQIA 1X43A 4JPBW 1JXOA 2RQUA 2KGTA 2EGEA 2C0IA 2V1RA 4JZ3A 4OMQA 2RNAA 2H8HA 3H0IA 2DBMA 4ESRA 4J9FA 3ZL7C 4DEXA 1ARKA 3UF4A 4IIOA 3PE0A 2RN8A 1I07A 1WIEA 2EYWA 2RF0A 2ECZA 4E6RA 1QWFA 2YSQA 1W1FA 1T3LA 1AWOA 2D8HA 3QWXX 4CC2A 2O9SA 2W10A 2OAWA 1UJYA 1GCPA 4HVWA 2A08A 2KEAA 2C0TA 2ESWA 2O31A 1TUDA 2DILA 2MOXA 4WCIA 1M3BA 2K7AA 1U5SA 2PTKA 1K9AA 1X2QA 1Z9ZA 3TSWA 3KFVA 1TUCA 2JMCA 2EGCA 3VS0A 2GTJA 2FRWA 1E6GA 4DEYA 1JO8A 1ZUUA 1UHFA 3REBB 1AWJA 2HCKA 1K0XA 1FMKA 4AFSC 3IQLA 2DX1A 2HBWA 2CUDA 1H92A 1M27C 3SEMA 2ENMA 1J3TA 2O9VA 4JZ4A 1VYVA 1W6XA 2DRMA 2AKLA 1WX6A 5IHNA 4GBQA 3I35A 3LH5A 2EYYA 3O5ZA 1ZUYA 4RTXA 1CSKA 2DLPA 3H0FA 2ROLA 1QWEA 2P4RA 2YDLA 5GJWB 2F2WA 1HSQA 1UUEA 1GRIA 2YUPA 4CC3A 1PKSA 2DYBA 1NYGA 1OOTA 1GBQA 2EW3A 3JV3A 2CH4W 2DJQA 1WXUA 1AZGB 1ZX6A 2K3BA 1RI9A 2CSIA 2EYZA 1ZLMA 3A98A 1SEMA 1UJ0A 2J6KA 3M0QA 2KXDA 1RUWA 4OMNA 3EG3A 2JTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGA A;  3EG0 A;  1QCF A;  3VS3 A;  4F16 A;  2FPE A;  2DE0 X;  1AOJ A;  2MCN A;  4Z88 A;  3NPF A;  5IH2 A;  2AZV A;  1X6B A;  1CKA A;  2EVR A;  1E7O A;  1NEG A;  1BU1 A;  3VRZ A;  1K76 A;  1NM7 A;  1JQQ A;  5GJV B;  4OMM A;  5I11 A;  3UA6 A;  1X6G A;  2DL3 A;  1WYX A;  2A36 A;  1QKX A;  1PKT A;  2DL4 A;  1IO6 A;  1M3A A;  1UE9 A;  3M0R A;  2NWM A;  2LP5 A;  4JJB A;  2GQI A;  1Z9Q A;  3UAT A;  1VA7 A;  2M51 A;  1W70 A;  1WLP B;  1UHC A;  1I0C A;  3TSZ A;  5EC7 A;  1UFF A;  3EHQ A;  1V1C A;  1ZUK A;  1JU5 C;  4HVV A;  3RNJ A;  2BZX A;  1KJW A;  1SHG A;  3FJ5 A;  3M0P A;  2V1Q A;  3M0T A;  1AWW A;  2A37 A;  1AWX A;  4D8D A;  1QKW A;  1M3C A;  2LJ1 A;  2KE9 A;  1N5Z A;  1GFD A;  5IHI A;  2GGR A;  3VS7 A;  5IHK A;  2YUN A;  3ULR B;  3VRY A;  2FPD A;  1UGV A;  2G6F X;  2GTO A;  4OML A;  4Y92 A;  3VS2 A;  1KIK A;  4Z89 A;  1G2B A;  2SEM A;  3CQT A;  4AFZ C;  1Y57 A;  2FEI A;  2X3X D;  2FG0 A;  3EG2 A;  4LE9 A;  2DRK A;  2M0Y A;  1JEG A;  2BZY A;  2K9G A;  1AD5 A;  1GCQ A;  1K1Z A;  2ED0 A;  2JS2 A;  1K0S A;  1U3O A;  2O2O A;  2K2M A;  1PHT A;  4HXJ A;  4LUE A;  2JS0 A;  1PNJ A;  1ABO A;  4AFQ C;  3VS4 A;  4X1V A;  2RQR A;  2AK5 A;  2J05 A;  2KXC A;  2J6O A;  2RMO A;  2HSP A;  4J9C A;  4D8K A;  1UG1 A;  5L23 A;  1MUZ A;  3EGU A;  1FYN A;  1GBR A;  2CUB A;  2JM9 A;  4AG2 C;  4KRT A;  2JXB A;  2L3Q A;  1H3H A;  1GFC A;  2DMO A;  4AFU C;  4QT7 A;  1MV3 A;  2JM8 A;  4A63 B;  1OEB A;  1RLQ C;  1BK2 A;  1AVZ C;  1XOV A;  1AZE A;  1NEB A;  1X69 A;  2EKH A;  1H8K A;  4M4Z A;  4LN2 A;  1JXM A;  2RQW A;  2L0A A;  1B3Q A;  2HEQ A;  1B07 A;  1A0N B;  2LCS A;  2CT3 A;  1YCS B;  3R6N A;  2FO0 A;  3UA7 A;  1M30 A;  2PNI A;  3VS5 A;  2KR3 A;  1BBZ A;  1NLO C;  1T0H A;  1LCK A;  2GNC A;  1SRL A;  1OV3 A;  1WXT A;  3I5S A;  2ABL A;  4HVU A;  5HCK A;  2CSQ A;  4OMP A;  1WI7 A;  3I9Q A;  5IXF A;  1ZSG A;  2KT8 A;  1WXB A;  1G83 A;  2E5K A;  5FWB A;  2JT4 A;  4RTZ A;  1TG0 A;  1SRM A;  2DL8 A;  4AG1 C;  1MV0 B;  2FPF A;  2RQT A;  2PZ1 A;  2KRM A;  2DL7 A;  2K6D A;  1SPK A;  1WFW A;  2K79 A;  4J9I A;  2VVK A;  2YUQ A;  1OPK A;  1RLP C;  1SSH A;  2X3W D;  1PRL C;  1T3S A;  1SHF A;  2EYX A;  4K11 A;  2RQV A;  4JJC A;  2W0Z A;  2EPD A;  1OPL A;  2DM1 A;  1YN8 A;  4LUD A;  4RTT A;  4JJD A;  1HJD A;  5FW9 A;  2DF6 A;  2BZ8 A;  2CT4 A;  1UEC A;  1WDX A;  2JW4 A;  1WA7 A;  3PVL A;  3I5R A;  2J7I A;  4J9D A;  2DBK A;  4LNP A;  3PVQ A;  2L3S A;  2LQN A;  2KNB B;  2A28 A;  2CRE A;  1BB9 A;  3NGP A;  2NUZ A;  4J9G A;  2F2X A;  2I0N A;  4HCK A;  4Z8A A;  2DA9 A;  1M8M A;  2DVJ A;  2O88 A;  1E6H A;  2LMJ A;  3U23 A;  1NYF A;  2VWF A;  1YWP A;  2D1X A;  1GL5 A;  2D8J A;  2SRC A;  4EIK A;  1PRM C;  3EHR A;  1PWT A;  3REA B;  4RTV A;  2KT1 A;  2LQW A;  4RTW A;  2ED1 A;  4J9H A;  2AKK A;  2DL5 A;  2ROT A;  2LNH B;  2KYM A;  3GBQ A;  4J9E A;  3NMZ C;  1AEY A;  2OJ2 A;  2FRY A;  1GCQ C;  2LJ3 A;  4F17 A;  5IXB A;  3THK A;  1K4U S;  2LJ0 A;  2KBT A;  1UTI A;  1ZBJ A;  2F2V A;  3H41 A;  3M0U A;  1UDL A;  2L2P A;  2BTT A;  4J9B A;  4RTU A;  3TVT A;  4F14 A;  4ZNX A;  1HD3 A;  1YWO A;  3M0S A;  2CDT A;  2MIO A;  2HDA A;  1YP5 A;  2OI3 A;  4RUG A;  4FSS A;  5ECA A;  2AZS A;  1KSW A;  2B86 A;  2QDL A;  2KRS A;  4ORZ A;  1NLP C;  1ABQ A;  4RTY A;  3QWY A;  1X27 A;  2DNU A;  1VYT A;  2CH4 A;  2LX7 A;  5I22 A;  3H0H A;  3NHN A;  1QLY A;  1Y0M A;  2RPN A;  5FWC A;  2J06 A;  1KFZ A;  2L3P A;  1NG2 A;  1VYU A;  1I1J A;  1U06 A;  2LZ6 B;  3RBB B;  3VS6 A;  2YUO A;  3VS1 A;  2J6F A;  3EG1 A;  3SHW A;  4OMO A;  4R0K A;  4CC4 B;  3C0C A;  1CKB A;  4IIM A;  2KRO A;  1S1N A;  2JMA A;  1T0J A;  1EFN A;  2D0N A;  1YNZ A;  2XMF A;  2C0O A;  4CC7 A;  1X2K A;  2VKN A;  2YT6 A;  2IIM A;  2EBP A;  4GLM A;  2GBQ A;  2KRN A;  2KYB A;  2EQI A;  1X43 A;  4JPB W;  1JXO A;  2RQU A;  2KGT A;  2EGE A;  2C0I A;  2V1R A;  4JZ3 A;  4OMQ A;  2RNA A;  2H8H A;  3H0I A;  2DBM A;  4ESR A;  4J9F A;  3ZL7 C;  4DEX A;  1ARK A;  3UF4 A;  4IIO A;  3PE0 A;  2RN8 A;  1I07 A;  1WIE A;  2EYW A;  2RF0 A;  2ECZ A;  4E6R A;  1QWF A;  2YSQ A;  1W1F A;  1T3L A;  1AWO A;  2D8H A;  3QWX X;  4CC2 A;  2O9S A;  2W10 A;  2OAW A;  1UJY A;  1GCP A;  4HVW A;  2A08 A;  2KEA A;  2C0T A;  2ESW A;  2O31 A;  1TUD A;  2DIL A;  2MOX A;  4WCI A;  1M3B A;  2K7A A;  1U5S A;  2PTK A;  1K9A A;  1X2Q A;  1Z9Z A;  3TSW A;  3KFV A;  1TUC A;  2JMC A;  2EGC A;  3VS0 A;  2GTJ A;  2FRW A;  1E6G A;  4DEY A;  1JO8 A;  1ZUU A;  1UHF A;  3REB B;  1AWJ A;  2HCK A;  1K0X A;  1FMK A;  4AFS C;  3IQL A;  2DX1 A;  2HBW A;  2CUD A;  1H92 A;  1M27 C;  3SEM A;  2ENM A;  1J3T A;  2O9V A;  4JZ4 A;  1VYV A;  1W6X A;  2DRM A;  2AKL A;  1WX6 A;  5IHN A;  4GBQ A;  3I35 A;  3LH5 A;  2EYY A;  3O5Z A;  1ZUY A;  4RTX A;  1CSK A;  2DLP A;  3H0F A;  2ROL A;  1QWE A;  2P4R A;  2YDL A;  5GJW B;  2F2W A;  1HSQ A;  1UUE A;  1GRI A;  2YUP A;  4CC3 A;  1PKS A;  2DYB A;  1NYG A;  1OOT A;  1GBQ A;  2EW3 A;  3JV3 A;  2CH4 W;  2DJQ A;  1WXU A;  1AZG B;  1ZX6 A;  2K3B A;  1RI9 A;  2CSI A;  2EYZ A;  1ZLM A;  3A98 A;  1SEM A;  1UJ0 A;  2J6K A;  3M0Q A;  2KXD A;  1RUW A;  4OMN A;  3EG3 A;  2JTE A; 
#chains in the Genus database with same CATH topology
 1Y96 A;  2FPE A;  2A0F B;  6AT1 B;  1AOJ A;  2DD5 A;  3JCM g;  2MCN A;  1X6B A;  2EVR A;  5J26 A;  3OYD A;  3JCM J;  2F69 A;  1E7O A;  1NE8 A;  1Y07 A;  1RAD B;  2GQV A;  1G5V A;  2YRC A;  1VQN Q;  3CCE Q;  1NM7 A;  1WNL A;  2EKO A;  2DEQ A;  4OMM A;  5I11 A;  4KH0 B;  2HBP A;  3V8J A;  4XTY A;  1PKT A;  1M3A A;  4FU6 A;  2E4H A;  1NBE B;  3I55 Q;  2NWM A;  3CCS T;  4XTV A;  2F5T X;  4BDZ A;  3CCJ A;  5EC7 A;  2XI9 A;  1Q86 R;  3EHQ A;  1OU8 A;  2KK4 A;  4HVV A;  1N8R U;  1V76 A;  2ZPE B;  1Q86 C;  2DTO A;  5GAM j;  1IB8 A;  1KJW A;  1SHG A;  3FJ5 A;  4M78 C;  4N0A A;  3V8K A;  2XU8 A;  3CCR Q;  3M0T A;  3H9N A;  2QQ9 A;  4OGC A;  4F7U G;  1AWX A;  4D8D A;  1QKW A;  1GFD A;  1VQP Q;  2DKG A;  1R0B G;  2HQX A;  3MEV A;  1VQ4 T;  1KIK A;  3VS2 A;  4Z89 A;  5CKB A;  2YLC A;  3CD6 Q;  1HYO A;  4AFZ C;  1YJN A;  1VQM T;  1OUL A;  1YHQ Q;  2DRK A;  2M0Y A;  3L2U A;  2OX7 A;  2ED0 A;  4O5V A;  2O2O A;  5GAO l;  5KYN A;  1PHT A;  1BIA A;  4LUE A;  3TEE A;  2XD0 A;  1ABO A;  4AFQ C;  2PQW A;  2AK5 A;  3M4G A;  2JN0 A;  2AHJ B;  2RHY A;  1Q81 C;  2FYK A;  2K2V A;  2VV5 A;  5L23 A;  4PK4 A;  3URG A;  4AG2 C;  3VKI A;  5I2M A;  2VAS A;  3CC4 T;  1NPP A;  1OQK A;  3X24 B;  2DMO A;  4AMC A;  3OYC A;  1YI2 Q;  4PJO D;  1RAE B;  2JM8 A;  2DZ9 A;  3TQ7 P;  2K4Y A;  1AVZ C;  3CCU T;  2DVE A;  1AZE A;  5DLQ E;  1NEB A;  3FEO A;  1VQ7 A;  4FYY B;  4M4Z A;  4ZN1 A;  3EFS A;  3P8B B;  1B3Q A;  1WHM A;  2JUF A;  3CME Q;  4OB0 B;  3VV0 A;  2LQK A;  3CBP A;  5A0D A;  3E19 A;  4DBR A;  3H6Z A;  1SRL A;  3E9G A;  4DBF A;  4E7Z A;  2P4T A;  4HVU A;  4E7J A;  2V8I A;  1LPL A;  2VGN A;  5KCH A;  1YI2 A;  4KUI A;  5IXF A;  1MMA A;  1Q82 R;  4M7D D;  5FWB A;  2KVQ G;  2DL8 A;  2FPF A;  2PZ1 A;  4C0G A;  2DL7 A;  3CCR T;  2K79 A;  1KQ2 A;  2YUQ A;  1OPK A;  4LXC A;  1YHQ T;  4E7S A;  1RLP C;  5D6Y A;  4NOY A;  1SHF A;  2EYX A;  5KE2 A;  2ZPH B;  2W0Z A;  3GNF B;  4A54 A;  3EAE A;  4LUD A;  1TUG B;  4J5Y A;  3UWN A;  1VQ6 T;  1U1T A;  3CD6 A;  2A7Y A;  4M78 G;  1HJD A;  3FDR A;  2X9H A;  5GMK h;  1BI3 A;  2PVD B;  2J7I A;  1NJI C;  2GCX A;  4J9D A;  2KQW A;  2DBK A;  3PVQ A;  3OYI A;  3L2Q A;  1VQL A;  1D3B A;  3S3M A;  3NGP A;  4J9G A;  4Z8A A;  2JNG A;  3M57 A;  1E6H A;  5HK0 A;  5GAM e;  3DB4 A;  2XK0 A;  1OX9 A;  1UGS B;  5KYY A;  5CAI A;  1MGQ A;  4PJJ A;  2D1X A;  1UGP B;  2RH2 A;  3EHR A;  1MNE A;  2LNV A;  3EGX A;  1KD1 R;  3RER A;  2AKK A;  2DL5 A;  3OYK A;  3CXC S;  2L8D A;  5KE3 A;  3A1P A;  3NMZ C;  3QHS A;  3C94 A;  4WF2 A;  5IXB A;  4HT8 A;  2EQK A;  2LJ0 A;  2QTX A;  3UPU A;  1WHJ A;  1UTI A;  3G7Z A;  4M7A B;  5GAN 3;  4M77 B;  2RD1 A;  4J9B A;  3TVT A;  4QKU A;  4A4H A;  1YJW Q;  1N8R C;  2CDT A;  3QBY A;  3OA6 A;  2YHT A;  4BE2 A;  1ZSZ A;  2QDL A;  4OB3 B;  1Q82 C;  3NFC A;  2GFU A;  3CCL Q;  3P8D A;  3QWY A;  4ZTF A;  2DNU A;  3CMA T;  3NHN A;  4M78 F;  1N27 A;  5GMK e;  2FVU A;  2RPN A;  3EH1 A;  5J39 A;  1I1J A;  3JAM E;  3RIR A;  2MK5 A;  2YUO A;  3BDL A;  4CC4 B;  2DZC A;  1CKB A;  1BI0 A;  2DJZ A;  1S1N A;  5LJ3 g;  1K8A C;  4J6X A;  4M7D F;  3L1A A;  3SD4 A;  2BE7 D;  1I8F A;  1VQL T;  1LVK A;  2VC8 A;  3PMT A;  2D0Q B;  1TXQ A;  2YT6 A;  3I56 A;  2EBP A;  4GLM A;  1VQ8 T;  2KYB A;  4JPB W;  5GAN 7;  3JCM d;  2EGE A;  3A8M B;  3QII A;  2V1R A;  3EG9 A;  3QZ5 B;  4N4H A;  1VQ5 Q;  1IGQ A;  5GAN f;  3ZL7 C;  4D6W A;  3JCM c;  3UF4 A;  3RKW A;  3TRE A;  3M9Q A;  1WHL A;  2XKO C;  5GAN 6;  1C1A A;  3QJY A;  2VB6 A;  3R6O A;  4PLL A;  2BIV A;  1QWF A;  3E2U A;  2HL3 A;  1VQP T;  2E12 A;  5FRM A;  3QUI A;  5GAM d;  2QQR A;  1VQM A;  5DLO A;  2D8H A;  2RI2 A;  2FL7 A;  2OAW A;  4MML A;  2KEA A;  3CCM A;  3V7R A;  3VYG A;  1WHK A;  2PU9 B;  1K8A U;  2K7A A;  1U5S A;  2PTK A;  3CCL T;  1X2Q A;  3TSW A;  3KFV A;  4C92 A;  1VUB A;  2JTF A;  2JMC A;  4IUR A;  2EGC A;  2V8J A;  3OMG A;  5GAM g;  1Q81 U;  1VQK T;  2XID A;  4DEY A;  1JO8 A;  1ZUU A;  5A0L A;  3G71 A;  2ZAE A;  1K0X A;  2DX1 A;  2HBW A;  2WAC A;  1H92 A;  4PJO E;  1M27 C;  1VOM A;  3SFM A;  2WSC E;  1VYV A;  1YJN Q;  1W6X A;  2DRM A;  5C6S A;  4BI3 A;  2ZPF B;  3I35 A;  1KC8 C;  1N9S A;  4M75 F;  1ZUY A;  4RTX A;  1CSK A;  5GJW B;  1GRI A;  2LQ8 A;  4PFZ A;  2DYB A;  1NYG A;  4LD9 K;  2EW3 A;  3JV3 A;  2CH4 W;  2CKK A;  2JVV A;  1WXU A;  4HCZ A;  1I5O B;  2RHI A;  1VQ5 T;  3SDZ A;  3OS2 A;  1IGU A;  2FB7 A;  2MWO A;  1AT1 B;  3JCM V;  3HTR A;  1UB4 A;  4KGZ B;  3OYG A;  2RHU A;  3JCM P;  2DXC A;  1VQ9 T;  2ATC B;  3DLM A;  4PLI A;  2MWP A;  1TOV A;  4L5G A;  3E9F A;  4Z88 A;  2QA4 Q;  3QXE B;  3CCU A;  1QP3 A;  2NUT A;  3MHX A;  4C8Q B;  1K76 A;  2FZC B;  3MCA B;  2PUO B;  3UA6 A;  3ER0 A;  5I21 A;  1VQN T;  1QKX A;  2COY A;  2RA2 A;  4QQ6 A;  1UE9 A;  1M5Q 1;  3MPU B;  4JJB A;  2GQI A;  4BAC A;  1M9S A;  1M90 R;  1UHC A;  2B8A A;  2OTL Q;  1V1C A;  2QG9 B;  3OMC A;  4EMK B;  4B9W A;  3RNJ A;  3CC2 Q;  4QW2 A;  4PJO A;  4JLG A;  5A0G A;  4BDY A;  2A37 A;  2EJG A;  4C0F A;  2CP2 A;  5IAY A;  3CC4 Q;  1JRI A;  2EJF A;  3OYL A;  3OS5 A;  4M75 A;  1LOJ A;  4HKE A;  3PGG A;  4XQ3 A;  1RAC B;  1TSF A;  3VRY A;  2CYZ B;  1UGV A;  1BYM A;  1MHN A;  2X3X D;  4F7U F;  1JEG A;  2K9G A;  1GCQ A;  1WHG A;  1U3O A;  2K2M A;  3VS4 A;  2RQR A;  2COW A;  4N4I A;  3A8L B;  2KY9 A;  2KDS A;  2E41 A;  3LYI A;  4D8K A;  3QG1 A;  4FYX B;  3EGU A;  2CUB A;  3G4S A;  1PD1 A;  1NZ9 A;  1H3H A;  2MMP A;  3GNG A;  1GFC A;  4C8Q C;  5GMK i;  1OZ2 A;  2RO0 A;  3JB9 I;  4QT7 A;  1MV3 A;  4A63 B;  1D09 B;  1UGQ B;  3SWN B;  3CME T;  3D7S B;  1VQ4 Q;  3OY9 A;  1XOV A;  3OYF A;  2EKH A;  1JB0 E;  4PJO C;  4LN2 A;  2CZ6 B;  2K3Y A;  2RQW A;  1Q86 U;  1K73 U;  5KYW B;  2OTJ Q;  1A0N B;  2LCS A;  3UA7 A;  4JRK A;  5FU7 B;  3X20 B;  4M77 D;  1LCK A;  4XU2 A;  2QQS A;  1YIT T;  2CZ7 B;  4OGE A;  3HFN A;  1OV3 A;  2AT1 B;  3I5S A;  3NTH A;  4RG8 A;  1X75 C;  3FJP A;  3JB9 F;  4C92 B;  4FW2 A;  1W2B P;  4OMP A;  2YLB A;  1WI7 A;  3I9Q A;  5GAM h;  2KT8 A;  4RTZ A;  2K6D A;  3WVD B;  2VVK A;  2X35 A;  4V2S A;  3BW1 A;  1PRL C;  3UDC A;  5IT9 E;  3CBO A;  4M7D E;  2Z0W A;  2K5L A;  4IUV A;  4J83 A;  4KBM B;  4JRQ A;  2EPD A;  4BY6 C;  1OPL A;  2CP5 A;  1YN8 A;  1MMG A;  4J6W A;  2DTH A;  2ZCF B;  2XDB A;  1LNX A;  3FIF A;  3JB9 J;  1QVP A;  1UEC A;  1M1G A;  4E7I A;  3C12 A;  1WA7 A;  4LNP A;  2L3S A;  3G6E Q;  2A28 A;  1BB9 A;  4X9D A;  3F70 A;  4DA4 A;  2F2X A;  5LJ3 j;  1RAH B;  2MF2 A;  2DVJ A;  1QCN A;  4M78 B;  1QW1 A;  3ASK A;  3EGD A;  4A4E A;  1ZA2 B;  3HRT A;  5GMK j;  3M56 A;  2QEX A;  1YWP A;  4PJO B;  2D8J A;  1GL5 A;  2WSE E;  4EIK A;  1JBM A;  2YWW A;  4RTV A;  2KT1 A;  2LQW A;  4RTW A;  2DXU A;  1UEB A;  1KC8 U;  2ED1 A;  3G1J A;  1PM3 A;  2DPP B;  2LCC A;  2LDM A;  5KYU B;  2KYM A;  3JB9 D;  4A4G A;  1RAF B;  2FRY A;  2M1H A;  2LJ3 A;  4A4F A;  1VQ6 Q;  2M16 A;  3MEW A;  2KBT A;  1ZBJ A;  1ZSZ B;  3CCV Q;  3G6E T;  4PJM A;  4AT1 B;  2BTT A;  2BKD N;  4F14 A;  2R5M A;  4ZNX A;  3M0S A;  1B7T A;  2RB6 A;  3WVE B;  5GAO q;  3JB9 H;  1YP5 A;  3JCM X;  1YCY A;  5CKE A;  3RES A;  2OI3 A;  4FSS A;  4PJO G;  2AZS A;  5D6W A;  4ORZ A;  1NLP C;  2CGH A;  2YRD A;  4M78 A;  1K73 R;  1VYT A;  2LX7 A;  5I22 A;  3CME A;  1W2B S;  3H0H A;  4A53 A;  4BY6 B;  1NJI U;  2H3E B;  2DFU A;  5KYX B;  3PIP A;  3RUX A;  1VQP A;  4IUQ A;  4E2F B;  1KFZ A;  5FWC A;  1BCM A;  1M2V A;  4UC4 A;  4BI4 A;  8AT1 B;  1X01 A;  2LZ6 B;  3RBB B;  1YJ9 Q;  3VS6 A;  1FXX A;  3CPW P;  4R0K A;  2DAQ A;  3OQ5 A;  3CPW S;  2KRO A;  2JMA A;  1T0J A;  1EFN A;  1YIT A;  5CQY A;  1MMD A;  3DB3 A;  4CC7 A;  2C0O A;  2KAF A;  2IIM A;  4PKC C;  3ZBD A;  1WHH A;  2EIF A;  4EMG A;  4NS5 A;  1VQ9 A;  1S72 T;  5CVI A;  1I5L A;  4JZ3 A;  5GAN 8;  5GAO n;  4BE1 A;  1WZO A;  4ESR A;  3L2W A;  1JJ2 A;  1ARK A;  2HZY A;  3PE0 A;  4B9X A;  5GAO r;  3CPW A;  1I07 A;  2QXF A;  1M1F A;  2EYW A;  3LW5 E;  3L2R A;  4E6R A;  4F7U E;  3CCV T;  2RHZ A;  3QPH A;  1W1F A;  1T3L A;  1AWO A;  4CC2 A;  3S3O A;  4YTL A;  4LDW A;  1UJY A;  4E7H A;  4HVW A;  4F7U B;  4KGX B;  1WQW A;  2DIG A;  4JLI A;  2DIL A;  1QVG S;  2RJF A;  1M3B A;  8ATC B;  3SWN A;  3BY7 A;  4KT0 E;  2MYS A;  1G3Y A;  2O4X A;  2XG8 D;  4PJL A;  2PVG B;  4DBQ A;  1UHF A;  1X6O A;  2XDD A;  1RI0 A;  2HSE B;  4OB2 B;  2M0O A;  4AFS C;  4LDU A;  1Q7Y C;  1D3B B;  3EG9 B;  1J3T A;  2CS7 A;  1YJ9 T;  2RI5 A;  3CCE T;  1WX6 A;  4LDV A;  3QYG B;  4TVR A;  1M2O A;  4JJN K;  2M02 A;  3M55 A;  2YXY A;  2ROL A;  1QWE A;  2P4R A;  4C8Q A;  2F2W A;  1UUE A;  3CCJ Q;  4CC3 A;  3CCQ A;  1D1B A;  4C5I A;  2ZGW A;  3OBW A;  2OTJ T;  3MP6 A;  5KYX A;  1BCO A;  2P84 A;  4DBH A;  3O8V A;  1VIE A;  4ELY C;  3HKS A;  2K3B A;  4KH1 B;  3LX7 A;  1VQK Q;  2DD4 A;  3MEA A;  4M7A C;  1UJ0 A;  3I56 Q;  3G71 T;  3CC7 A;  3CXC A;  1RUW A;  4OMN A;  2MPX C;  2JTE A;  4PFP A;  3CCM Q;  3JCM Q;  4X9C A;  2E6Z A;  2EGA A;  4OVA A;  1O75 A;  5LJ5 e;  2DE0 X;  4PJN A;  5FU6 B;  5IH2 A;  3NPF A;  3LWH A;  1OYX A;  1YJ9 A;  1NEG A;  4C92 G;  3CCQ Q;  1BU1 A;  3VRZ A;  2QK0 A;  5CIU A;  2R5A A;  4HA8 A;  3GLX A;  2DL3 A;  3OYA A;  2A36 A;  3EFO A;  1C6V X;  2EJ9 A;  1PSF A;  1IO6 A;  4X34 A;  1BIB A;  1SG5 A;  4ZGE B;  2MAM A;  3M0R A;  3OSS C;  1VQ5 A;  2WSF E;  3S3N A;  1VA7 A;  2M51 A;  5FRO A;  1WLP B;  4BI8 B;  3CC7 Q;  3N5B B;  3TSZ A;  1UFF A;  4ZN3 A;  2EQJ A;  2CZ0 B;  3VUB A;  1VQO T;  3OB9 A;  4MDX A;  2RJC A;  1K8A R;  2NUP B;  3KXT A;  2BZX A;  4FM4 B;  1YIJ A;  3M0P A;  3VJP A;  2V1Q A;  4KUL A;  1KQ1 A;  1AWW A;  2RHX A;  5C0M A;  4CRI A;  4LDY A;  1M3C A;  2LJ1 A;  5IHI A;  2GGR A;  4QVC A;  4PNO A;  5GAN h;  3CC2 T;  3RKY A;  2DER A;  3OW2 S;  1QQJ A;  2EAY A;  5IHK A;  5HKC A;  3ULR B;  1ZA1 B;  2FPD A;  2G6F X;  4OML A;  4R56 A;  1G2B A;  1OZ3 A;  5CKF A;  1Y57 A;  2E65 A;  3ME9 A;  2FG0 A;  4LE9 A;  4CI0 C;  3HSB A;  2BZY A;  3PIO A;  1AD5 A;  1K1Z A;  1K0S A;  3EFR A;  4C92 F;  3J80 E;  1Y7X A;  2JS0 A;  1PNJ A;  4MZT A;  5LJ5 f;  3I55 T;  4X1V A;  2E3I A;  4IKF A;  1RAB B;  3QDR B;  2KXC A;  2J6O A;  2RMO A;  2ZZD A;  4J9C A;  3JCM b;  3CPF A;  4J8O A;  4KGV B;  4L59 A;  5KCO A;  1WGS A;  2IPO B;  3GF5 A;  1PC0 A;  3LGF A;  2LT4 A;  3MO8 A;  4PL6 A;  2JM9 A;  2DO3 A;  4BB7 A;  2QA4 A;  1DJ7 B;  2JXB A;  1I4K 1;  2L3Q A;  4F04 B;  2HAX A;  2DK3 A;  4NL3 A;  2LTO A;  4L6V 5;  1OEB A;  1M8V A;  1RLQ C;  4BD3 A;  3SWN C;  1X69 A;  2CP6 A;  2DYI A;  1H8K A;  1M1K C;  3VU3 C;  1JJ2 S;  4M7A G;  1KC8 R;  2OTJ A;  1YCS B;  2FO0 A;  1W2B A;  3M4Y A;  3A8O B;  1T0H A;  2GNC A;  3OYN A;  1IRX A;  3HFO A;  2ABL A;  5AT1 B;  3CC7 T;  1ZHI A;  1U1S A;  2COZ A;  4C92 C;  2CSQ A;  4N0A C;  1ZSG A;  2AIR B;  5GAN 4;  2CP3 A;  4M77 E;  1Q7Y U;  2VXE A;  4AG1 C;  1S72 Q;  2RQT A;  1QCO A;  2HNI A;  3EH2 A;  3CC4 A;  3EGD B;  1SPK A;  1WFW A;  2LC4 A;  3GIB A;  3A5Z B;  4JJC A;  2G3R A;  5HY6 A;  4ZGJ B;  2M9U A;  1VQ7 Q;  1M1K U;  2DM1 A;  1TH7 A;  2A3L A;  2QGF B;  4RTT A;  3CMA Q;  3TCJ A;  4BUG A;  4JJD A;  2EYQ A;  3I55 A;  2QQA A;  3OBY A;  5D7U A;  2CT4 A;  1WDX A;  2JW4 A;  1ACM B;  3I5R A;  5KYY B;  1Q7Y R;  2CRE A;  2LCL A;  2F1L A;  2NUZ A;  2RK1 A;  3MJX A;  1YIJ T;  2I0N A;  4HCK A;  1FMV A;  2DA9 A;  1M8M A;  2EQU A;  4FT2 A;  2O88 A;  2LMJ A;  2DET A;  1TS9 A;  3G4S T;  4HT9 A;  1IHV A;  1NYF A;  1F1B B;  2SRC A;  2NUP A;  1PRM C;  5GAN e;  1PG5 B;  1PWT A;  1VQ8 Q;  2JTM A;  3RDV A;  5CK9 A;  2Y4X A;  2YRV A;  1W4S A;  1H3Z A;  2ROT A;  1UGR B;  1SKU B;  1D0X A;  1AEY A;  4F7U A;  2VYT A;  5KYW A;  4XTX A;  3RKX A;  3MKD A;  1RAG B;  4F17 A;  1K4U S;  1PSE A;  1Q82 U;  3M59 A;  3EGX B;  1BI2 A;  2QYZ A;  1UDL A;  4MDW A;  1XQH A;  2E1H A;  3LLR A;  3SB2 A;  1QVG P;  4RTU A;  3OW2 A;  1VQL Q;  1YWO A;  1TTH B;  2HDA A;  2VGM A;  2FHD A;  2B86 A;  1KSW A;  2KRS A;  4PFO A;  1N6A A;  2HKQ B;  2QEX T;  4PJO F;  4RTY A;  2JJ9 A;  1AHJ B;  1YHQ A;  5CKD A;  2CH4 A;  5LJ5 d;  3EFO B;  2QGG A;  5CCA A;  4Y91 A;  3HHT B;  3A8H B;  3HRS A;  3JB9 G;  1M4Z A;  2D9T A;  1RAA B;  1QLY A;  4RKU E;  5GAO m;  1LJO A;  5HK3 A;  1QVF S;  1Y0M A;  2GF7 A;  2J06 A;  3OS0 A;  2DEU A;  1ZQ1 A;  1NG2 A;  4LD6 A;  1HK9 A;  2VXF A;  3VS1 A;  3EG1 A;  4QQD A;  3SHW A;  4OMO A;  3C0C A;  3VUZ A;  5FU7 C;  1M2V B;  2R58 A;  3PTA A;  2D0N A;  4R55 A;  3M5A A;  2XMF A;  1X2K A;  2VKN A;  3PNW C;  2GBQ A;  2KRN A;  4Q5W A;  2EQI A;  1X43 A;  1JXO A;  2KGT A;  2QA4 T;  2RNA A;  5GMK l;  3H8Z A;  2DBM A;  4J9F A;  3A8G B;  4DEX A;  4IIO A;  1YJW A;  2ZPI B;  2RN8 A;  4QVZ A;  5CKH A;  1PD0 A;  2CP0 A;  3CCE A;  2JZ2 A;  4GLK A;  2RF0 A;  4C0D B;  4C8Q D;  1MMN A;  2ECZ A;  1KD1 C;  2RM4 A;  4M7A E;  5KH6 A;  2Y4Y A;  4HCB A;  4M7A F;  5GAO p;  2V8K A;  2RK2 A;  3JCM W;  2W10 A;  4RMO A;  1G8X A;  1GCP A;  1FWZ A;  2JOY A;  5CQX A;  2C0T A;  2ESW A;  1TUD A;  4WCI A;  1BI1 A;  1TWB A;  4M7A D;  1G3W A;  1OI1 A;  3OYH A;  1K9A A;  1Z9Z A;  4FCY A;  1KQS S;  2CZ1 B;  2P0P A;  1TUC A;  4Y28 E;  1QP2 A;  1VQK A;  1EX4 A;  3CXC P;  3VS0 A;  5IN1 A;  2FRW A;  1M90 U;  1E6G A;  4M77 G;  3REB B;  3OYB A;  2HCK A;  3NTK A;  4A4K A;  3J7A F;  2ENM A;  5DM7 R;  5GAN j;  4FIB A;  3QYH B;  4GBQ A;  4XTW A;  1XTD A;  3O5Z A;  2DLP A;  3FC3 A;  5EG2 A;  2YDL A;  2X4X A;  1HSQ A;  5LJ3 f;  2YUP A;  1R77 A;  2ZPG B;  2MI6 A;  1OOT A;  4OB1 B;  3M54 A;  1MND A;  2BE9 B;  4ELZ C;  2DJQ A;  3CCM T;  1IRE B;  1NPR A;  3VYH B;  1ZX6 A;  3C95 A;  1ZSZ C;  4C5E A;  5LL6 S;  7AT1 B;  2QAZ A;  3FB9 A;  2EYZ A;  3CCJ T;  1K9M R;  1Y96 B;  2E70 A;  3Q1J A;  1ZLM A;  3A98 A;  1SEM A;  4XU1 A;  1WJR A;  2KXD A;  4FT4 A;  1QVF A;  2ZPB B;  2E3H A;  3EG0 A;  1FX7 A;  1QCF A;  3VS3 A;  4F16 A;  4C0D C;  4MMK A;  1KK7 A;  4M75 C;  1EIF A;  3PT9 A;  4OMF B;  2HD0 A;  2AZV A;  5FRN A;  2V26 A;  2HL5 C;  1CKA A;  4M7A A;  4JUV A;  5FLX E;  4QQG A;  5LJ3 h;  1JQQ A;  5GJV B;  3E1S A;  1VQ4 A;  1G3T A;  3CBM A;  1X6G A;  2K5F A;  3CCQ T;  1WYX A;  3OYM A;  2EQM A;  2IG0 A;  3CCS Q;  1R8O B;  1M1K R;  5L8R E;  2QDY B;  3OSV A;  2DL4 A;  3QZ9 B;  4M7D G;  2LVM A;  4ATO A;  2X4Y A;  2LP5 A;  3X25 B;  1Z9Q A;  1JJ2 P;  3UAT A;  3CCL A;  1W70 A;  4OF1 A;  1I0C A;  3OS1 A;  4DOW A;  3OYE A;  5KYU A;  2XIC A;  4XK8 E;  3I56 T;  3G71 Q;  1ZUK A;  1JU5 C;  1WJQ A;  3MP1 A;  1FMW A;  3MET A;  4EDU A;  1M90 C;  4C8Q G;  3KBG A;  3TU4 K;  4C92 D;  1C0M A;  3ZEH A;  1EZZ B;  5I2S A;  5AYF A;  3X26 B;  5CR2 A;  2HKN A;  5LJ3 e;  2K5I A;  2O4X B;  2RJE A;  3CCR A;  2GFA A;  4M77 A;  2KE9 A;  1N5Z A;  1VQO Q;  5CO7 A;  2HQE A;  3VS7 A;  4C92 E;  3OYJ A;  2YUN A;  2HQH A;  4BE0 A;  2K57 A;  3JSC A;  2GTO A;  4Y92 A;  2NYS A;  2QAS A;  3RR6 A;  2SEM A;  3CQT A;  2FEI A;  4P5N A;  3EG2 A;  3MP8 A;  4M77 C;  3FRN A;  3CD6 T;  2JS2 A;  4N4G A;  3PMI A;  1OU9 A;  4HXJ A;  1YBY A;  4M75 E;  2J05 A;  2O01 E;  2HSP A;  2OTL A;  2RI3 A;  2KMT A;  3BE3 A;  4JS5 A;  4XU3 A;  1P92 A;  2E6N A;  4M75 B;  3CCU Q;  1UG1 A;  1MUZ A;  1FYN A;  1GBR A;  4KRT A;  1Q95 G;  2E64 A;  4AFU C;  3BFM A;  1ZBX A;  3GPL A;  3CC2 A;  2PVO B;  1WJS A;  1YFN A;  1BK2 A;  1QVG A;  1D1A A;  3QO3 A;  4XU0 A;  3M53 A;  1KQS A;  1JXM A;  2L0A A;  2HEQ A;  9ATC B;  1B07 A;  3DLL A;  2P0K A;  2CT3 A;  3R6N A;  3HPW A;  3PFS A;  1M30 A;  2PNI A;  2IVW A;  3VS5 A;  2KR3 A;  1RAI B;  1BBZ A;  1NLO C;  4C5H A;  3G6E A;  1WXT A;  4M7D A;  2PUK B;  2R57 A;  3L42 A;  1D0Y A;  4LDX A;  2X4W A;  5HCK A;  3WXM B;  4GY5 A;  4M77 F;  1WXB A;  1G83 A;  3HP9 A;  2E5K A;  2JT4 A;  1TG0 A;  1SRM A;  2C06 A;  1MV0 B;  4XTZ A;  2KRM A;  3CMA A;  1BKB A;  4J9I A;  1KQS P;  3LH0 A;  2KSS A;  1SSH A;  2X3W D;  2K3X A;  1T3S A;  4M7D C;  4ZTJ A;  4FW1 A;  1H64 1;  2I2L A;  1KD1 U;  4K11 A;  2DXB A;  3GOX A;  2RQV A;  4E7K A;  4Z02 A;  3OW2 P;  1V29 B;  4O6J A;  1WPY A;  1YIJ Q;  1QMC A;  5FW9 A;  2DF6 A;  2BZ8 A;  5LJ5 j;  3G4S Q;  3PVL A;  2KI7 A;  3KUF A;  2LQN A;  2KNB B;  2XHC A;  4MZP A;  4JDS A;  1VQO A;  5A2Q E;  2BUD A;  4M75 D;  2X51 A;  3LGL A;  3U23 A;  4ME7 A;  3V8L A;  2VWF A;  4JRP A;  4OP0 A;  2P0Q A;  2RJD A;  3REA B;  4J6Y A;  2L3R A;  4J9H A;  4EMK A;  4KUD K;  1WQ7 A;  3UT1 A;  4HCC A;  1VQ7 T;  2LNH B;  3QJ6 A;  3GBQ A;  4J9E A;  1B34 B;  2DXT A;  1U8R A;  2L5Q A;  1YIT Q;  2OJ2 A;  5DY9 A;  1GCQ C;  1XNI A;  3S6W A;  1B34 A;  3THK A;  2H3J A;  3CCS A;  2QI2 A;  2QTV A;  2F2V A;  3H41 A;  3M0U A;  3L2Z A;  4FL6 A;  2L2P A;  3T9N A;  3V7S A;  1HD3 A;  4FYV B;  2NUT B;  2E5Q A;  2MIO A;  4VUB A;  1R0C B;  3RMS A;  2CP7 A;  4QVD A;  1K73 C;  5ECA A;  4RUG A;  3DKM A;  4FYW B;  1IHW A;  4M7D B;  1KG1 A;  1ABQ A;  3BDU A;  1VQ9 Q;  1Q81 R;  1X27 A;  3ZFJ A;  2HMA A;  3X28 B;  1GXI E;  1YJW T;  4IUT A;  5M9O A;  3INZ A;  4E47 A;  1QVF P;  2D6F A;  3CEY A;  4JS4 A;  4B6M A;  2L3P A;  5GAN g;  1VYU A;  5LJ5 g;  1U06 A;  2J6F A;  1I81 A;  4FSX A;  4IIM A;  3JRZ A;  4EMK C;  4M78 E;  4XAX B;  4DQ2 A;  1D0Z A;  4J7I A;  1Y71 A;  1O9S A;  1YNZ A;  4RG2 A;  3RMQ A;  3JCM h;  2OTL T;  3V7C A;  3J81 E;  5LJ3 d;  2RQU A;  3QDF A;  1N8R R;  2C0I A;  4M78 D;  2L89 A;  2DTI A;  4OMQ A;  2H8H A;  3H0I A;  3P8H A;  2X4J A;  3MEU A;  4E7L A;  3M58 A;  2FZK B;  3FLG A;  2VUB A;  1SSF A;  3HRU A;  1WIE A;  2DIQ A;  1TU0 B;  3GP8 A;  5FU6 C;  3AT1 B;  2YSQ A;  3CCV A;  2LT1 A;  3QWX X;  4IUP A;  2F5K A;  2O9S A;  4MZM A;  2XDP A;  2LX9 A;  5GAN 5;  3C4S A;  1N9R A;  2QQB A;  2A08 A;  2O31 A;  2LRQ A;  4EMH A;  1OX8 A;  2MOX A;  1KHI A;  3HL8 A;  4JRI A;  1NJI R;  1PCX A;  1VIF A;  2NLU A;  1K9M C;  3QKJ A;  1RL2 A;  4C0Z A;  4IUU A;  5GAN 2;  1VQ8 A;  4C8Q E;  2GTJ A;  4XTU A;  4DOV A;  3AHU A;  5GMK m;  4RCC A;  1AWJ A;  1FMK A;  3IQL A;  1S72 A;  2CUD A;  3SEM A;  2O9V A;  4JZ4 A;  5J3B A;  4II1 A;  1SF9 A;  2AKL A;  5IHN A;  3LH5 A;  2E10 A;  2EYY A;  1VQM Q;  5LJ5 h;  2OAU A;  2EFI A;  3H0F A;  3OYY A;  4WTO B;  3NTI A;  3LWI A;  1HXD A;  1KHC A;  1VQN A;  1PKS A;  3JCM f;  1YJN T;  4ANJ A;  3JCM e;  1GBQ A;  1VQ6 A;  5GAN d;  4J7F A;  4RCB A;  4NL2 A;  4ZGD B;  1IZ6 A;  2FZG B;  1AZG B;  1D1C A;  4M75 G;  1RI9 A;  3L2V A;  1G3S A;  1K9M U;  2CSI A;  4C8Q F;  2Y90 A;  1XJW B;  5GAM f;  2J6K A;  4C5G A;  3M0Q A;  3EG3 A;  3QSU A;  2EWN A;  2QEX Q;  1YI2 T;  1IXD A;  4EPC A;  5D6X A; 
#chains in the Genus database with same CATH homology
 2EGA A;  3EG0 A;  1QCF A;  3VS3 A;  4F16 A;  2FPE A;  2DE0 X;  1AOJ A;  2MCN A;  4Z88 A;  3NPF A;  5IH2 A;  2AZV A;  1X6B A;  1CKA A;  2EVR A;  1E7O A;  1NEG A;  1BU1 A;  3VRZ A;  1K76 A;  1NM7 A;  1JQQ A;  5GJV B;  4OMM A;  5I11 A;  3UA6 A;  1X6G A;  2DL3 A;  1WYX A;  2A36 A;  1QKX A;  1PKT A;  2DL4 A;  1IO6 A;  1M3A A;  1UE9 A;  3M0R A;  2NWM A;  2LP5 A;  4JJB A;  2GQI A;  1Z9Q A;  3UAT A;  1VA7 A;  2M51 A;  1W70 A;  1WLP B;  1UHC A;  1I0C A;  3TSZ A;  5EC7 A;  1UFF A;  3EHQ A;  1V1C A;  1ZUK A;  1JU5 C;  4HVV A;  3RNJ A;  2BZX A;  1KJW A;  1SHG A;  3FJ5 A;  3M0P A;  2V1Q A;  3M0T A;  1AWW A;  2A37 A;  1AWX A;  4D8D A;  1QKW A;  1M3C A;  2LJ1 A;  2KE9 A;  1N5Z A;  1GFD A;  5IHI A;  2GGR A;  3VS7 A;  5IHK A;  2YUN A;  3ULR B;  3VRY A;  2FPD A;  1UGV A;  2G6F X;  2GTO A;  4OML A;  4Y92 A;  3VS2 A;  1KIK A;  4Z89 A;  1G2B A;  2SEM A;  3CQT A;  4AFZ C;  1Y57 A;  2FEI A;  2X3X D;  2FG0 A;  3EG2 A;  4LE9 A;  2DRK A;  2M0Y A;  1JEG A;  2BZY A;  2K9G A;  1AD5 A;  1GCQ A;  1K1Z A;  2ED0 A;  2JS2 A;  1K0S A;  1U3O A;  2O2O A;  2K2M A;  1PHT A;  4HXJ A;  4LUE A;  2JS0 A;  1PNJ A;  1ABO A;  4AFQ C;  3VS4 A;  4X1V A;  2RQR A;  2AK5 A;  2J05 A;  2KXC A;  2J6O A;  2RMO A;  2HSP A;  4J9C A;  4D8K A;  1UG1 A;  5L23 A;  1MUZ A;  3EGU A;  1FYN A;  1GBR A;  2CUB A;  2JM9 A;  4AG2 C;  4KRT A;  2JXB A;  2L3Q A;  1H3H A;  1GFC A;  2DMO A;  4AFU C;  4QT7 A;  1MV3 A;  2JM8 A;  4A63 B;  1OEB A;  1RLQ C;  1BK2 A;  1AVZ C;  1XOV A;  1AZE A;  1NEB A;  1X69 A;  2EKH A;  1H8K A;  4M4Z A;  4LN2 A;  1JXM A;  2RQW A;  2L0A A;  1B3Q A;  2HEQ A;  1B07 A;  1A0N B;  2LCS A;  2CT3 A;  1YCS B;  3R6N A;  2FO0 A;  3UA7 A;  1M30 A;  2PNI A;  3VS5 A;  2KR3 A;  1BBZ A;  1NLO C;  1T0H A;  1LCK A;  2GNC A;  1SRL A;  1OV3 A;  1WXT A;  3I5S A;  2ABL A;  4HVU A;  5HCK A;  2CSQ A;  4OMP A;  1WI7 A;  3I9Q A;  5IXF A;  1ZSG A;  2KT8 A;  1WXB A;  1G83 A;  2E5K A;  5FWB A;  2JT4 A;  4RTZ A;  1TG0 A;  1SRM A;  2DL8 A;  4AG1 C;  1MV0 B;  2FPF A;  2RQT A;  2PZ1 A;  2KRM A;  2DL7 A;  2K6D A;  1SPK A;  1WFW A;  2K79 A;  4J9I A;  2VVK A;  2YUQ A;  1OPK A;  1RLP C;  1SSH A;  2X3W D;  1PRL C;  1T3S A;  1SHF A;  2EYX A;  4K11 A;  2RQV A;  4JJC A;  2W0Z A;  2EPD A;  1OPL A;  2DM1 A;  1YN8 A;  4LUD A;  4RTT A;  4JJD A;  1HJD A;  5FW9 A;  2DF6 A;  2BZ8 A;  2CT4 A;  1UEC A;  1WDX A;  2JW4 A;  1WA7 A;  3PVL A;  3I5R A;  2J7I A;  4J9D A;  2DBK A;  4LNP A;  3PVQ A;  2L3S A;  2LQN A;  2KNB B;  2A28 A;  2CRE A;  1BB9 A;  3NGP A;  2NUZ A;  4J9G A;  2F2X A;  2I0N A;  4HCK A;  4Z8A A;  2DA9 A;  1M8M A;  2DVJ A;  2O88 A;  1E6H A;  2LMJ A;  3U23 A;  1NYF A;  2VWF A;  1YWP A;  2D1X A;  1GL5 A;  2D8J A;  2SRC A;  4EIK A;  1PRM C;  3EHR A;  1PWT A;  3REA B;  4RTV A;  2KT1 A;  2LQW A;  4RTW A;  2ED1 A;  4J9H A;  2AKK A;  2DL5 A;  2ROT A;  2LNH B;  2KYM A;  3GBQ A;  4J9E A;  3NMZ C;  1AEY A;  2OJ2 A;  2FRY A;  1GCQ C;  2LJ3 A;  4F17 A;  5IXB A;  3THK A;  1K4U S;  2LJ0 A;  2KBT A;  1UTI A;  1ZBJ A;  2F2V A;  3H41 A;  3M0U A;  1UDL A;  2L2P A;  2BTT A;  4J9B A;  4RTU A;  3TVT A;  4F14 A;  4ZNX A;  1HD3 A;  1YWO A;  3M0S A;  2CDT A;  2MIO A;  2HDA A;  1YP5 A;  2OI3 A;  4RUG A;  4FSS A;  5ECA A;  2AZS A;  1KSW A;  2B86 A;  2QDL A;  2KRS A;  4ORZ A;  1NLP C;  1ABQ A;  4RTY A;  3QWY A;  1X27 A;  2DNU A;  1VYT A;  2CH4 A;  2LX7 A;  5I22 A;  3H0H A;  3NHN A;  1QLY A;  1Y0M A;  2RPN A;  5FWC A;  2J06 A;  1KFZ A;  2L3P A;  1NG2 A;  1VYU A;  1I1J A;  1U06 A;  2LZ6 B;  3RBB B;  3VS6 A;  2YUO A;  3VS1 A;  2J6F A;  3EG1 A;  3SHW A;  4OMO A;  4R0K A;  4CC4 B;  3C0C A;  1CKB A;  4IIM A;  2KRO A;  1S1N A;  2JMA A;  1T0J A;  1EFN A;  2D0N A;  1YNZ A;  2XMF A;  2C0O A;  4CC7 A;  1X2K A;  2VKN A;  2YT6 A;  2IIM A;  2EBP A;  4GLM A;  2GBQ A;  2KRN A;  2KYB A;  2EQI A;  1X43 A;  4JPB W;  1JXO A;  2RQU A;  2KGT A;  2EGE A;  2C0I A;  2V1R A;  4JZ3 A;  4OMQ A;  2RNA A;  2H8H A;  3H0I A;  2DBM A;  4ESR A;  4J9F A;  3ZL7 C;  4DEX A;  1ARK A;  3UF4 A;  4IIO A;  3PE0 A;  2RN8 A;  1I07 A;  1WIE A;  2EYW A;  2RF0 A;  2ECZ A;  4E6R A;  1QWF A;  2YSQ A;  1W1F A;  1T3L A;  1AWO A;  2D8H A;  3QWX X;  4CC2 A;  2O9S A;  2W10 A;  2OAW A;  1UJY A;  1GCP A;  4HVW A;  2A08 A;  2KEA A;  2C0T A;  2ESW A;  2O31 A;  1TUD A;  2DIL A;  2MOX A;  4WCI A;  1M3B A;  2K7A A;  1U5S A;  2PTK A;  1K9A A;  1X2Q A;  1Z9Z A;  3TSW A;  3KFV A;  1TUC A;  2JMC A;  2EGC A;  3VS0 A;  2GTJ A;  2FRW A;  1E6G A;  4DEY A;  1JO8 A;  1ZUU A;  1UHF A;  3REB B;  1AWJ A;  2HCK A;  1K0X A;  1FMK A;  4AFS C;  3IQL A;  2DX1 A;  2HBW A;  2CUD A;  1H92 A;  1M27 C;  3SEM A;  2ENM A;  1J3T A;  2O9V A;  4JZ4 A;  1VYV A;  1W6X A;  2DRM A;  2AKL A;  1WX6 A;  5IHN A;  4GBQ A;  3I35 A;  3LH5 A;  2EYY A;  3O5Z A;  1ZUY A;  4RTX A;  1CSK A;  2DLP A;  3H0F A;  2ROL A;  1QWE A;  2P4R A;  2YDL A;  5GJW B;  2F2W A;  1HSQ A;  1UUE A;  1GRI A;  2YUP A;  4CC3 A;  1PKS A;  2DYB A;  1NYG A;  1OOT A;  1GBQ A;  2EW3 A;  3JV3 A;  2CH4 W;  2DJQ A;  1WXU A;  1AZG B;  1ZX6 A;  2K3B A;  1RI9 A;  2CSI A;  2EYZ A;  1ZLM A;  3A98 A;  1SEM A;  1UJ0 A;  2J6K A;  3M0Q A;  2KXD A;  1RUW A;  4OMN A;  3EG3 A;  2JTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...