1PNJA

Solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
86
structure length
86
Chain Sequence
GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Solution structure and ligand-binding site of the SH3 domain of the p85 alpha subunit of phosphatidylinositol 3-kinase.
pubmed doi rcsb
source organism Bos taurus
total genus 6
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pnjA00
1T3SA 1Z9ZA 2DLPA 2ESWA 3NPFA 5IXFA 2K7AA 3M0TA 2C0IA 2YUNA 3IQLA 2LNHB 2K2MA 4HVVA 2J7IA 2V1RA 4LN2A 3TVTA 2CDTA 2YT6A 4RUGA 1YNZA 2D1XA 1AWXA 2LMJA 1E7OA 3NMZC 2KGTA 2KBTA 3PE0A 1V1CA 1CKBA 2L3PA 3CQTA 2JM8A 3H0IA 2JMAA 1ZSGA 1UG1A 1GRIA 2DL7A 2FPEA 2YDLA 2O9SA 4IIMA 3JV3A 1NM7A 1YWOA 2FO0A 1ZX6A 2GNCA 2K3BA 1K4US 1FYNA 1AOJA 2EBPA 1MV0B 2LJ0A 2RF0A 4JJBA 2DX1A 4J9BA 1PRLC 1Z9QA 3I35A 4FSSA 2LP5A 4AFSC 2CSQA 2DL4A 4Z8AA 1K9AA 5FW9A 3LH5A 5HCKA 2VKNA 1AD5A 1M3CA 1WLPB 1KFZA 1U5SA 5I22A 1K76A 2KNBB 1I1JA 2EGCA 1OV3A 1AEYA 3NHNA 3H0FA 4J9CA 2CT3A 4OMMA 1UDLA 2EVRA 1UGVA 1K0SA 1AWWA 1GBRA 2DJQA 1U3OA 2HEQA 4D8DA 1VYVA 1OEBA 2DNUA 2A08A 1AZGB 1X27A 2SRCA 5FWCA 1WXTA 4Y92A 1J3TA 1RLPC 2RQUA 1LCKA 2O31A 2RNAA 1H8KA 2P4RA 4ORZA 2FEIA 1B07A 1M27C 1PNJA 2YUOA 1PKTA 2HSPA 1QCFA 1SRMA 2XMFA 4RTXA 2VVKA 2LQNA 2KROA 2JM9A 2ROLA 1JXMA 1M3AA 1X43A 2RPNA 1TG0A 3TSZA 1ZUUA 3U23A 3EHQA 2EYZA 4LUDA 1S1NA 2KR3A 2QDLA 4RTUA 1UJ0A 2X3XD 2SEMA 1YCSB 1VA7A 2KRMA 2B86A 2OAWA 1BB9A 2BZXA 1UHCA 2LX7A 2LJ3A 1CSKA 1OPLA 1AZEA 1GFCA 1A0NB 1NLOC 1EFNA 2GTJA 1TUCA 3PVLA 4HXJA 1K1ZA 1BBZA 2AKLA 2A36A 4AG2C 5GJVB 4OMOA 1KJWA 1QWEA 1SSHA 1YP5A 2BTTA 2EGEA 2DILA 2JS2A 2RMOA 1WDXA 2J6KA 3QWXX 2H8HA 4WCIA 1WFWA 1ABOA 3EG1A 1CKAA 3REAB 3PVQA 1UUEA 2CT4A 4CC7A 1X6BA 5FWBA 1HJDA 2CUDA 2CH4A 3I9QA 3VS0A 2GTOA 2FG0A 1JXOA 4RTZA 1WXUA 4LUEA 2IIMA 2L2PA 5IHIA 1X2KA 2E5KA 1PHTA 2ABLA 2MIOA 1HSQA 1UJYA 3VRZA 3M0QA 2KRSA 5IH2A 1NYGA 5IHKA 2M51A 2DMOA 1X6GA 4EIKA 4HVWA 1BK2A 1B3QA 2DF6A 2DRMA 3EG3A 1NLPC 2J06A 2ENMA 3VS1A 2DE0X 3THKA 3H41A 4OMPA 3VS3A 2CREA 1PRMC 2RQTA 2DVJA 1ZBJA 2HBWA 1UECA 2KYBA 3REBB 1H92A 1ZLMA 2CUBA 2KE9A 2RQVA 2OJ2A 4CC3A 4CC2A 4GLMA 2KYMA 2YUPA 3ZL7C 3UATA 1TUDA 1E6GA 1M30A 2NUZA 4R0KA 2X3WD 2MCNA 2JS0A 2PZ1A 4JPBW 3VS5A 2DBMA 2DBKA 2YSQA 3VS2A 4AG1C 4AFQC 4RTYA 2M0YA 4AFUC 1E6HA 1FMKA 1GCQA 1KSWA 3EGUA 1SHFA 2KT8A 1X69A 2ECZA 5GJWB 1GFDA 2NWMA 3M0SA 1QWFA 3ULRB 3C0CA 2OI3A 2EPDA 2W10A 1ARKA 4GBQA 3EG0A 4LE9A 2K9GA 2K79A 2FRWA 3KFVA 3EHRA 1H3HA 2C0TA 1UE9A 1NEBA 2DL3A 2KXDA 2JT4A 1NYFA 1T3LA 1M3BA 2O9VA 2RQWA 2CH4W 1JQQA 1JO8A 1W70A 4RTTA 1G83A 5L23A 2RN8A 2BZ8A 1GBQA 1VYUA 2FPFA 2KT1A 4OMLA 3UA6A 4J9DA 2J6OA 4Z89A 2F2XA 1W1FA 5ECAA 1W6XA 2LZ6B 2EYWA 1GL5A 1M8MA 3I5RA 3RBBB 1NG2A 1ZUKA 4LNPA 4CC4B 2JXBA 3A98A 2VWFA 1MUZA 4ESRA 3M0RA 2F2VA 3UA7A 2LJ1A 4J9FA 2ROTA 2A37A 4J9IA 2F2WA 2GGRA 2EW3A 3M0PA 3O5ZA 2AKKA 1UTIA 2L0AA 1G2BA 2PTKA 1SPKA 2K6DA 2J6FA 3R6NA 4DEYA 1NEGA 3VS6A 3I5SA 1SHGA 1RLQC 4RTVA 4IIOA 2EYXA 2W0ZA 1UHFA 1PWTA 4A63B 2O2OA 4F17A 1ZUYA 2RQRA 2ED0A 4RTWA 1K0XA 5IHNA 3RNJA 4E6RA 1YWPA 1QKWA 1OPKA 1U06A 1SRLA 1N5ZA 2EGAA 4KRTA 1GCQC 3GBQA 2JW4A 1UFFA 2GQIA 4J9HA 2ED1A 4F14A 1QKXA 4DEXA 2C0OA 2O88A 3UF4A 1WYXA 3SHWA 4QT7A 2EQIA 4D8KA 2J05A 1VYTA 1WIEA 2JMCA 1GCPA 1SEMA 1JEGA 3VRYA 2FPDA 1JU5C 3EG2A 2DRKA 1ABQA 1AVZC 1AWOA 2LQWA 4AFZC 1KIKA 2D8JA 2D0NA 1RUWA 4M4ZA 4HVUA 4JJDA 3H0HA 2EYYA 2KEAA 1X2QA 1RI9A 2BZYA 2V1QA 1XOVA 2PNIA 2MOXA 4K11A 1WXBA 4X1VA 1OOTA 1MV3A 2DL8A 4OMQA 2DL5A 1WA7A 2DM1A 2KXCA 3TSWA 2AK5A 3FJ5A 2KRNA 3QWYA 2G6FX 2YUQA 2GBQA 4J9EA 2AZSA 3SEMA 4JJCA 4OMNA 1AWJA 2A28A 3VS7A 2EKHA 5IXBA 3NGPA 5EC7A 1WX6A 4J9GA 1I0CA 3VS4A 1QLYA 1Y0MA 3M0UA 1I07A 2DYBA 2L3QA 4ZNXA 2HCKA 1YN8A 2L3SA 2LCSA 2CSIA 1T0HA 1T0JA 2DA9A 4JZ4A 1IO6A 4Z88A 1HD3A 1BU1A 1Y57A 4HCKA 2D8HA 2FRYA 1PKSA 4F16A 5I11A 2HDAA 1WI7A 2JTEA 2AZVA 2I0NA 4JZ3A
chains in the Genus database with same CATH superfamily
2ESWA 3SB2A 5IXFA 3C95A 3M59A 4HVVA 3CCMA 2FYKA 3N5BB 4QVZA 5CKEA 2XDPA 1K8AR 2CDTA 2CP5A 1C6VX 2L5QA 2YT6A 4HCCA 5GAN7 2KGTA 3UWNA 3CCST 1N8RR 3L2RA 2F69A 1V1CA 3QG1A 2E12A 5IN1A 1UG1A 3SWNB 2YDLA 3JCMc 3M57A 2FO0A 2K3BA 2DEUA 5LJ3h 1K4US 1WHMA 1FYNA 1AOJA 4XTUA 3CXCS 4JJBA 2RF0A 1NZ9A 3EGXA 1VQ8A 2NUPA 4J9BA 4Y91A 4WF2A 1Z9QA 2DXUA 3JB9J 1KD1U 1MNEA 1VOMA 2QDYB 2HMAA 2O4XB 3OBYA 4C92D 2DXCA 1Q95G 4E2FB 4CI0C 4QQDA 1VQLT 4OVAA 4C92C 5GMKl 1I1JA 2KI7A 1LOJA 1OV3A 1Q7YR 3EFRA 5GANd 1DJ7B 4J9CA 2CT3A 4LD9K 3CCVQ 5KYNA 4GLKA 3QIIA 4E47A 1K73U 1K0SA 1GBRA 1VYVA 1OEBA 5CAIA 2A08A 3P8HA 4Y92A 2M1HA 1LCKA 1VQ9Q 2LX9A 2P4RA 2ZPHB 4BE2A 1VQ4T 1M27C 1PNJA 4M78B 4A4GA 2XK0A 1M5Q1 5D7UA 3HFOA 2KROA 2R58A 1RAHB 5AYFA 1JXMA 1M3AA 1X43A 2XD0A 3EHQA 4LUDA 2VUBA 1UJ0A 3VYGA 4PJNA 2IG0A 3I56Q 1LPLA 2B86A 3DLMA 2K57A 1UHCA 1B34B 5GAOn 1VQPA 1VIEA 4OGEA 1OPLA 3L42A 1AZEA 1GFCA 1EFNA 4FL6A 4HKEA 3MPUB 3PVLA 3M4YA 3KUFA 2ZPIB 2RK2A 2X4XA 2A36A 4M7AF 2RHZA 5CK9A 1KJWA 2M0OA 2DILA 2J6KA 1MMDA 2FHDA 1YBYA 1BCOA 3MKDA 3OYKA 4M7AG 1G5VA 3EG1A 3EG9B 3J81E 4ZTJA 3ME9A 5M9OA 3JCMh 3CCSA 3EAEA 2CT4A 2DFUA 4XTVA 1X6BA 4QQGA 1ZSZA 4JRIA 1M1GA 2GTOA 4RCBA 3OYAA 4PJOA 3CD6A 1WXUA 4LUEA 5I2SA 3RDVA 1R0CB 3CC7T 1OX9A 2E5KA 2Y90A 1BI0A 3LGLA 2QXFA 5FU7B 1X6GA 4ATOA 4PJLA 3E9FA 1Y07A 4C5IA 4F7UB 1Y96A 4C0DB 2NYSA 2JTMA 3JCMW 4M77E 3WVEB 3BW1A 1P92A 1PRMC 4J7IA 2KYBA 3VU3C 2XG8D 5GAMg 2KE9A 2OJ2A 2Y4XA 4GLMA 1VQLA 3V8LA 2KYMA 2RA2A 1M1FA 2EQJA 1E6GA 4M75E 5HK0A 3GP8A 5DLOA 2PZ1A 2DD5A 2DBKA 3MEUA 1UGPB 1VQOQ 5LJ5g 2RM4A 4IURA 1ZA1B 5J3BA 1E6HA 1FMKA 4JLGA 3EGUA 4HCZA 4DQ2A 1X69A 5FU6B 1GFDA 5KE3A 3CCEQ 4J83A 5KYWA 1VQ4A 1G3SA 4LE9A 2E64A 4EMKA 1HK9A 2K9GA 1VQ6T 3EHRA 3PTAA 2KXDA 1UB4A 3CBOA 4XTZA 5KYUB 1ZSZC 1T3LA 1M3BA 3CCSQ 1JO8A 4LDUA 1KD1C 2JN0A 4RTTA 5L23A 1M90U 4FW2A 3VJPA 1M9SA 1Q86R 1XJWB 2QAZA 4OMLA 4J9DA 2Y4YA 2F2XA 2P0QA 2DPPB 4PLLA 4XU1A 1WHHA 1NG2A 3R6OA 2K5IA 1ZUKA 1M2VB 3BE3A 4FT2A 2LCLA 3UA7A 3V7RA 2NUTA 2ROTA 4LXCA 3CCUT 1QQJA 3OS2A 2EQUA 1OI1A 1X01A 1SPKA 1TS9A 4M77A 4EMHA 1IB8A 4DEYA 3RUXA 2HNIA 4QKUA 1SHGA 3EGDB 3OS0A 1RLQC 4RTVA 4IIOA 4KGVB 2EYXA 3A1PA 1UHFA 1PWTA 4FW1A 1QVGA 4MZTA 4A63B 3A8LB 3M5AA 1SG5A 1VQLQ 4C8QG 2DERA 1ZUYA 2RQRA 1X6OA 3NFCA 4M75A 1KC8R 3CC7A 1YWPA 4E7ZA 2YXYA 4J9HA 2CP2A 4JJNK 4F14A 1IHVA 1UGQB 1C0MA 2KK4A 1SF9A 4QT7A 3SDZA 1WIEA 3JCMJ 2JMCA 3ZBDA 5GAN2 3X25B 5HY6A 1VQ4Q 4M7DF 2E5QA 1GCPA 3VRYA 2MYSA 2DRKA 4DBRA 1AVZC 2LQWA 4M7AB 1JBMA 5GAMe 5GAN4 1RUWA 1D1BA 1YJ9T 2RI3A 4M7DG 5A0LA 3H9NA 4BY6C 2V1QA 1XOVA 2VC8A 1NPRA 3FB9A 4X1VA 2DL8A 3QDRB 4KH0B 2DM1A 2G3RA 4FYVB 3QYGB 3JB9H 2YLCA 2IPOB 3JB9I 1AWJA 1KHCA 2DO3A 5GMKe 4M77D 2EKHA 2RJDA 1WZOA 4BI3A 4M77C 1VQ6A 5GAOp 4J9GA 1I0CA 1Y0MA 2XHCA 2DTIA 5KH6A 2MWPA 4J6YA 1RAGB 1R77A 2DA9A 1YJNQ 2PQWA 4XU0A 1Q82C 4J8OA 1OULA 1VQ9T 1SKUB 5CIUA 3CC7Q 2QYZA 5LJ5j 2JTEA 1Z9ZA 3NPFA 4FM4B 2L3RA 2K7AA 3BFMA 4VUBA 3FJPA 2C0IA 3IQLA 1EX4A 2LNHB 2K2MA 2PVDB 4BUGA 5CR2A 3CCUA 4RUGA 3QBYA 5CQYA 1TTHB 2L89A 4C92E 4C8QE 2CP7A 3I56T 1QMCA 1PG5B 1QVGP 2D9TA 1CKBA 3URGA 3TQ7P 4PL6A 2DZ9A 2K3XA 3ZEHA 2DL7A 2O9SA 2X51A 5D6YA 1N9RA 2COYA 2HQEA 3FIFA 5L8RE 2D6FA 2GNCA 2M02A 3A5ZB 2E10A 1WJSA 2DX1A 4Y28E 2X35A 4M78G 3CMAT 1PRLC 4M7AD 3MO8A 4Z02A 1HXDA 2LP5A 1VQMT 4M7AC 4C5GA 2GCXA 2M9UA 4AFSC 4JUVA 2ZPFB 2X4YA 4ZGEB 3LH5A 3A8GB 5HCKA 2VKNA 2CZ0B 2KQWA 3PMTA 1VQ6Q 1KFZA 5I22A 5IAYA 3OW2A 1YJ9A 2E65A 4MMKA 4OB2B 5LJ5f 3NHNA 2IVWA 1H3ZA 1ZA2B 1K9MU 4IUUA 4N4HA 1FXXA 4BDZA 4WTOB 3MCAB 5LJ3d 3QZ9B 2SRCA 2CP3A 2GF7A 4PJOF 2QQRA 1BYMA 2ZAEA 1J3TA 1RLPC 1LVKA 3V8JA 2HAXA 3P8DA 2DYIA 4ORZA 2R5MA 2F1LA 2FEIA 4EPCA 1D0XA 1QCFA 2XMFA 1TXQA 4RTXA 4N0AA 2LQNA 3INZA 4C92A 1W2BS 3HRTA 3OYMA 5J39A 1YFNA 3QXEB 3RIRA 1VQOT 1YCSB 3LWHA 3FDRA 1VA7A 5GAOm 5AT1B 2FVUA 1Y7XA 2BZXA 3M53A 3S3OA 1CSKA 4XTXA 1VQ9A 1D09B 4F7UG 3CCET 5LJ5h 4XTYA 4AG2C 1NPPA 1TWBA 4OMOA 2BTTA 1YP5A 4ME7A 4J6WA 2P4TA 1VQNT 3MP8A 4WCIA 2QQ9A 1CKAA 3OYYA 3I56A 3V7SA 3PVQA 5GMKh 5GANj 4CC7A 2X4WA 3OYGA 2GQVA 1VQ5T 4ZN3A 4CRIA 3EGXB 3RKXA 1YJ9Q 2EJFA 2FG0A 2RJCA 1NJIU 4M78E 2KY9A 4MZMA 1X2KA 4ZN1A 2MIOA 1KQ2A 4F04B 4JS4A 4C5HA 1NYGA 4XK8E 3OYNA 3LX7A 3CMAA 8AT1B 1VQMA 1B3QA 2DRMA 3GNGA 3SWNA 2DE0X 3H41A 1YHQQ 4LDVA 4C8QD 3JCMQ 4N0AC 3E2UA 3REBB 2DVJA 4PFOA 4C8QC 1UECA 2OAUA 3OW2P 1TSFA 3JCMd 3SFMA 3ZL7C 1QCNA 3MHXA 3UATA 1K8AU 1TUDA 2JVVA 1M30A 2MK5A 2X3WD 1D3BB 1LJOA 1YCYA 5GAN5 2MCNA 1RADB 4JPBW 3EFSA 2DBMA 4LDWA 2LDMA 2HL5C 1D0YA 2M0YA 1N8RU 1IRXA 4E7SA 4JS5A 1KSWA 2L8DA 1WHKA 2KT8A 1WNLA 2ECZA 3P8BB 1W2BA 2HBPA 2EYQA 3UDCA 2LT4A 3M0SA 1AHJB 1QWFA 5FROA 1M1KR 3RERA 1OZ3A 3JCMP 1ARKA 2JUFA 4M7DD 1TU0B 1N27A 3X26B 4M7DC 2OTJT 2DL3A 2LQ8A 1V76A 4A4HA 3CPWS 1NYFA 2XDBA 1I8FA 2O9VA 1VQOA 1RAAB 4RCCA 2JOYA 2HD0A 2RI2A 2RN8A 2BZ8A 4F7UE 4AT1B 1AT1B 2J6OA 4Z89A 2F5TX 4MMLA 1W6XA 2EYWA 4IUPA 1GL5A 3CCEA 3KXTA 2JXBA 2QEXQ 3CMAQ 2RJEA 3SWNC 4R55A 5GAOl 4J9IA 3E9GA 1VQMQ 2GGRA 2OTLT 1K9MC 1VQNA 2PTKA 3OYHA 4PJOB 2JNGA 2K6DA 3R6NA 3HRSA 4E7HA 2QTVA 3I5SA 2H3EB 1YJNT 1O75A 2X9HA 1Q81R 3DKMA 1VQ5A 2ZGWA 2XICA 2ZCFB 3KBGA 3FRNA 4F17A 4ZTFA 2ED0A 1K0XA 3MP1A 1QVGS 3EH2A 4E6RA 2QQSA 1Y96B 1IGQA 2QK0A 4RMOA 4KRTA 5C6SA 2JW4A 3BY7A 2ED1A 4DEXA 5KYXB 4J7FA 2VXEA 4B9XA 2PU9B 3UF4A 1Q82U 2CP0A 4XU3A 2DTOA 2EQIA 2J05A 4D8KA 4DOVA 4OF1A 3C12A 4B6MA 4QVDA 5FRNA 1SEMA 1JEGA 2CP6A 3TU4K 2FPDA 1MMNA 2XI9A 3MP6A 2HKNA 1KIKA 2JZ2A 3FEOA 2D8JA 5A2QE 4JJDA 3L2VA 4E7JA 4KUIA 4KBMB 1X2QA 2P0PA 1R0BG 2PNIA 3ZFJA 4FSXA 4K11A 3G4SQ 4M78D 2QI2A 5CKDA 1PD1A 1XTDA 4M78C 4OMQA 2DL5A 1WA7A 5KYWB 3BDLA 3TSWA 4TVRA 3MEAA 3H8ZA 3EFOA 3FJ5A 1W2BP 2ZZDA 3QWYA 2G6FX 1LNXA 2GBQA 4AMCA 4J9EA 4KGXB 3CPWA 2AZSA 1ACMB 1OU8A 2I2LA 4OMNA 1NJIC 2XDDA 3OYDA 2EJGA 5IXBA 4XAXB 3CC4T 4X34A 2VGMA 3NGPA 1NBEB 3QO3A 4O5VA 5EC7A 1VQNQ 2OTJA 3VS4A 1QLYA 2DYBA 2L3QA 2E70A 3M4GA 4ZNXA 1WHGA 3TREA 1YN8A 1TH7A 2RO0A 1VQ5Q 1T0JA 2E4HA 1IO6A 1OYXA 4Z88A 1BU1A 1Y57A 2D8HA 1U8RA 3M55A 4NL2A 1VUBA 1MMAA 3CCRQ 4MDXA 1S72Q 2HDAA 4E7LA 4M7AE 2BE7D 4JZ3A 1MGQA 3M0TA 3I55T 3HPWA 1K8AC 2YLBA 4KT0E 2V1RA 2AHJB 2OTLA 2WSCE 3TVTA 1YJWT 2BUDA 3FLGA 1AWXA 1N8RC 1YITT 1YJNA 3OYFA 1X75C 1M2VA 2FL7A 2KBTA 5FU7C 3PE0A 2L3PA 3CQTA 3PFSA 1ZSGA 1MMGA 2EQKA 2FPEA 4C92F 4C0DC 1M8VA 4IIMA 2YRCA 3QUIA 1NM7A 4OB1B 4BI8B 1MV0B 2LJ0A 1PCXA 3OQ5A 1KG1A 3CPFA 4HCBA 4NS5A 3X28B 1BI3A 2CSQA 2WSEE 1W4SA 5DLQE 5FW9A 4FT4A 2YHTA 3CCLT 1WLPB 2EKOA 2VB6A 2OTJQ 1Q7YC 1D1CA 1QVFS 1VQ7T 5FU6C 3M54A 2LC4A 4MZPA 1AEYA 2PUKB 5KCHA 1HYOA 3H0FA 4A4FA 5LJ5e 1RABB 3JRZA 5HKCA 3OW2S 4BACA 2EVRA 3GF5A 4RKUE 2DTHA 3BDUA 1U3OA 4D8DA 2QA4T 2DNUA 1JJ2S 1X27A 4M7AA 3QDFA 3CPWP 1YHQT 1KC8U 1M1KC 3DB4A 1I81A 2KVQG 5GANg 3CC4A 1PKTA 2OTLQ 2HSPA 1WQWA 4HT9A 2R57A 4XTWA 4PFPA 1OZ2A 1TG0A 3TSZA 1ZUUA 3META 4FYYB 3CCJQ 4RTUA 5LL6S 2X3XD 4ELYC 2KRMA 2HKQB 3CC2T 2CZ7B 1A0NB 1NLOC 1R8OB 2FZGB 3OY9A 2GTJA 2MMPA 4MDWA 1TUCA 5KYYA 4HXJA 1K1ZA 4KGZB 2LVMA 3I55A 1BBZA 2AKLA 2MAMA 1QVPA 1YIJT 1IXDA 2EGEA 1QWEA 1M2OA 2RMOA 2MPXC 3QWXX 5EG2A 1YJWA 2Z0WA 1YITA 3L2UA 1I4K1 4JLIA 2LRQA 1TUGB 5FWBA 1HJDA 1BKBA 2E3IA 3I9QA 2BKDN 3VS0A 3C94A 5J26A 2VV5A 3OS5A 2A7YA 2COWA 2C06A 3LGFA 4KULA 4E7KA 2IIMA 2L2PA 5D6WA 5IHIA 5LJ3j 1OX8A 2K4YA 1PHTA 2LCCA 4OGCA 5GAMd 2FZCB 2K5LA 2QEXT 3VRZA 3M0QA 2KRSA 1FMVA 2WACA 1WQ7A 1XQHA 2E6ZA 2X4JA 3S3NA 2DMOA 3AHUA 4HVWA 1BK2A 4BD3A 1VQ8T 2RK1A 4M7DE 3EG3A 2FZKB 1QVFA 4O6JA 2ENMA 1QP2A 1BIAA 5LJ5d 3THKA 2KSSA 2DIQA 3CCLA 2ZPBB 4OMPA 2CREA 2DXBA 2WSFE 3CC4Q 1ZBJA 2HBWA 2DKGA 2HQXA 1H92A 1ZLMA 2CUBA 2RHXA 2RQVA 2EJ9A 2QGFB 1QW1A 3QPHA 1JJ2A 2A3LA 3VYHB 2NUZA 3OYBA 4R0KA 2CZ6B 2JS0A 3VS5A 3L2ZA 2YSQA 3VS2A 2QA4A 1C1AA 2LQKA 1GCQA 5GAOr 4C92B 4PJOG 4OB0B 5GJWB 1YHQA 5FLXE 2NWMA 1ZQ1A 3I55Q 2OI3A 2XIDA 4C8QA 4GBQA 3EG0A 3T9NA 5GANe 1KHIA 2DK3A 3KFVA 4N4IA 1YJWQ 3VUBA 1D1AA 3G4ST 1YITQ 5A0DA 3PIOA 1UGSB 3G7ZA 5CVIA 4DOWA 5LJ3f 3CMEQ 2CH4W 1JQQA 1W70A 2EAYA 3DLLA 1YI2Q 4RG2A 1Q86C 3G6EQ 1H641 1KQ1A 1V29B 1BI2A 1GBQA 3CC2A 1KD1R 2LT1A 2BIVA 2KT1A 1JRIA 2R5AA 3UA6A 1BIBA 2DIGA 3A8OB 3ASKA 1OQKA 4IUTA 5ECAA 4OMFB 2LZ6B 1VIFA 3Q1JA 3GOXA 4LNPA 2BE9B 3H6ZA 2RH2A 2VWFA 3HTRA 4ESRA 3M0RA 1YIJA 2F2VA 2DXTA 5HK3A 4J9FA 3JB9F 2F2WA 4JRKA 5GAN6 4M7DA 2RB6A 4L6V5 3O5ZA 3QJYA 2AKKA 1UTIA 4Q5WA 4UC4A 1U1TA 2J6FA 1F1BB 3QJ6A 3RESA 3VS6A 3CCLQ 3JB9G 1K73R 2NUPB 2K2VA 3AT1B 1VQKQ 1FX7A 1GXIE 3CCRT 2O2OA 1S72T 1KC8C 1VQ7Q 4RTWA 4FYWB 3CBMA 3PGGA 3QZ5B 1RAIB 1OPKA 2QEXA 3CD6T 3SD4A 5KE2A 2EGAA 2E41A 1GCQC 5GAN8 1UFFA 4JDSA 3LH0A 2RD1A 1QKXA 2QA4Q 2C0OA 3VUZA 2O88A 4ANJA 4DA4A 3OYJA 1QVFP 2KMTA 2COZA 3TCJA 1G8XA 1VYTA 1EIFA 5C0MA 4NOYA 1JU5C 3EG2A 1ABQA 4R56A 4AFZC 4M77F 1I5OB 4J6XA 4M4ZA 2K5FA 4PJMA 1JJ2P 3J7AF 2EYYA 2KEAA 1KQSA 2BZYA 3FC3A 2O4XA 4M77G 5A0GA 3G71T 4FU6A 1OOTA 1MV3A 3DB3A 3CC2Q 4JRQA 4PJOE 1TOVA 2KXCA 4PK4A 2KAFA 1D0ZA 4M75F 5CKBA 2KRNA 2YUQA 1RI0A 2RJFA 4KUDK 5GANf 3TEEA 3SEMA 2RI5A 4M75G 2A28A 3JCMf 1YIJQ 1D3BA 2DD4A 4PLIA 2XU8A 4A53A 1ZHIA 2V8KA 1IZ6A 1WX6A 2OX7A 4BDYA 3GNFB 5I2MA 4FCYA 3CCMQ 3V7CA 1RACB 3G4SA 3S6WA 2HCKA 2L3SA 3EH1A 1WGSA 4M78A 3LWIA 4JZ4A 5CO7A 4HCKA 2FRYA 4F16A 4EMGA 1Q7YU 1Q82R 2AT1B 4PKCC 3HSBA 2AZVA 2I0NA 2E1HA 4NL3A 1T3SA 2DLPA 1ZSZB 4QQ6A 4ELZC 4KH1B 4E7IA 1B34A 2YUNA 4C0ZA 1IREB 2J7IA 3J80E 1VQ8Q 4LN2A 4YTLA 3CCJT 1SSFA 1YNZA 2D1XA 3RMSA 2LMJA 1E7OA 3NMZC 5DY9A 3OB9A 3OMGA 2HZYA 2P84A 3JCMV 4D6WA 5GANh 1M1KU 5CQXA 2GFAA 2JM8A 3H0IA 3CCRA 2JMAA 1NE8A 1S72A 1UGRB 1MNDA 1GRIA 1WJQA 3CXCA 3LYIA 4HA8A 2PUOB 1RAEB 3JV3A 3OSSC 3EG9A 1YWOA 1ZX6A 4C0GA 3GPLA 3MJXA 2EBPA 2VGNA 3CCQT 4RG8A 2FB7A 3F70A 3I35A 4FSSA 4P5NA 1N9SA 2LTOA 5CKFA 2CYZB 2DL4A 4Z8AA 2YWWA 3PIPA 1M90R 4IKFA 1K9AA 2DJZA 1B7TA 3A8HB 2EWNA 1AD5A 1M3CA 1JB0E 1U5SA 3MEVA 2V8IA 1K76A 2KNBB 4XU2A 2EGCA 4F7UA 1KQSP 3EFOB 5KYXA 8ATCB 2PVGB 3G71A 1PC0A 2QGGA 4OMMA 4EMKB 1UDLA 2H3JA 4BI4A 1UGVA 1AWWA 2DJQA 1QP3A 2HEQA 3PNWC 2DZCA 1Q81U 2DETA 1AZGB 5FWCA 1WXTA 1VQPQ 9ATCB 2RQUA 2O31A 2RNAA 3JCMX 4BY6B 1H8KA 2EFIA 1B07A 3WXMB 3QYHB 2YUOA 3M9QA 3S3MA 1RAFB 4V2SA 1SRMA 3MEWA 2QQAA 2VVKA 2JM9A 4X9CA 1EZZB 2ROLA 2RPNA 3L2QA 3U23A 1BCMA 3NTIA 2EYZA 1S1NA 2KR3A 2QDLA 5LJ3g 2SEMA 3C4SA 2EIFA 2NUTB 5GAN3 1N6AA 3OYIA 2OAWA 4IUVA 1BB9A 2A0FB 2LX7A 2LJ3A 3RKYA 4PJOD 4M77B 4PJOC 1FWZA 4LDYA 5KYUA 3E19A 1G3WA 3CD6Q 2CZ1B 5GAOq 2RHUA 3UT1A 3OA6A 1WJRA 2QASA 5GJVB 3OYLA 1SSHA 2JS2A 4M75B 2ATCB 1WDXA 3CCJA 3CBPA 2H8HA 1BI1A 3CMET 1IHWA 1WFWA 1ABOA 1YI2T 3G6ET 3A8MB 3REAB 4XQ3A 1UUEA 1K73C 3CEYA 4II1A 4C8QF 2CUDA 2ZPGB 2CH4A 1O9SA 2AIRB 3OS1A 2V8JA 2HSEB 3CXCP 1JXOA 4RTZA 1PM3A 4C92G 3QSUA 3OYEA 6AT1B 4BE0A 3EGDA 3G71Q 2ABLA 5GMKi 1HSQA 1UJYA 5IH2A 5IHKA 3JCMb 3CCQA 2M51A 1Q86U 3OSVA 2LNVA 4EIKA 1XNIA 1G3TA 3JB9D 2DF6A 4C0FA 3HP9A 3JAME 1NLPC 2J06A 3VS1A 1VQKT 3ER0A 3L2WA 3E1SA 3VS3A 3JSCA 3LLRA 1UEBA 2E6NA 2RQTA 2VASA 4L59A 3L1AA 2JJ9A 4EMKC 2F5KA 1M4ZA 1PD0A 2QQBA 4CC3A 4CC2A 3OMCA 2CS7A 2NLUA 4A4EA 2YUPA 3VKIA 4PJJA 4ZGDB 4FYXB 1WHLA 4L5GA 4AG1C 3LW5E 2D0QB 3NTKA 4AFQC 4RTYA 2DVEA 4BB7A 1I5LA 3RKWA 4AFUC 3V8KA 3HKSA 1SHFA 4QW2A 2P0KA 4A54A 3PMIA 3ULRB 3C0CA 4FIBA 2EPDA 2W10A 3JCMg 3RMQA 4HT8A 5D6XA 2K79A 2FRWA 3QKJA 4EDUA 1H3HA 2C0TA 1UE9A 1NEBA 3GIBA 2JT4A 4LDXA 1RL2A 3G1JA 3NTHA 2YRDA 2RQWA 4LD6A 4PNOA 5LJ3e 1WPYA 1G83A 2MWOA 5KYYB 5GAMj 1VYUA 2VXFA 2FPFA 2K3YA 3CCVT 1MHNA 4JRPA 2O01E 4M75D 1W1FA 4J5YA 4M75C 7AT1B 1M8MA 3I5RA 2JTFA 3RBBB 4CC4B 4QVCA 3OYCA 3CCQQ 3A98A 2B8AA 1MUZA 1PSEA 2LJ1A 2A37A 3CCMT 1Y71A 4DBFA 2GFUA 2EW3A 3M0PA 2L0AA 3CMEA 1G2BA 2ZPEB 3UPUA 1YI2A 3G6EA 2YRVA 1K9MR 2DAQA 1NEGA 1Q81C 3VV0A 5GMKj 2KDSA 2W0ZA 2QG9B 2HL3A 3O8VA 1KK7A 1WHJA 2RHYA 2CKKA 5CKHA 4BE1A 1QCOA 3X24B 3QHSA 1IGUA 2HQHA 1OU9A 5IHNA 3RNJA 1QKWA 1U06A 1SRLA 1N5ZA 2VYTA 2QTXA 3GBQA 4M78F 2GQIA 5KCOA 3D7SB 5GMKm 2MI6A 2EQMA 1WYXA 5CCAA 3SHWA 4DBQA 3X20B 1VQKA 1M90C 2PVOB 5DM7R 3HRUA 2V26A 4PFZA 3HFNA 1VQ7A 1AWOA 5GAMf 2D0NA 5FRMA 4ZGJB 2E3HA 4HVUA 5IT9E 3H0HA 1RI9A 2XKOC 2MOXA 3HHTB 1WXBA 4GY5A 3OBWA 1KQSS 4C8QB 2AK5A 4OB3B 4B9WA 3HL8A 4N4GA 4IUQA 2DEQA 4OP0A 2MF2A 1FMWA 3M58A 4JJCA 5I21A 3VS7A 3JCMe 1NJIR 2CGHA 1PSFA 2M16A 4A4KA 1ZBXA 3M0UA 3WVDB 1I07A 4DBHA 1G3YA 3CCUQ 2LCSA 1U1SA 2CSIA 3PT9A 1T0HA 2RHIA 3CCVA 1HD3A 3GLXA 1VQPT 1PKSA 4M7DB 5I11A 5GAMh 4F7UF 3RR6A 4C5EA 4X9DA 1WI7A 3M56A
chains in the Genus database with same CATH topology
1T3SA 1Z9ZA 2DLPA 2ESWA 3NPFA 5IXFA 2K7AA 3M0TA 2C0IA 2YUNA 3IQLA 2LNHB 2K2MA 4HVVA 2J7IA 2V1RA 4LN2A 3TVTA 2CDTA 2YT6A 4RUGA 1YNZA 2D1XA 1AWXA 2LMJA 1E7OA 3NMZC 2KGTA 2KBTA 3PE0A 1V1CA 1CKBA 2L3PA 3CQTA 2JM8A 3H0IA 2JMAA 1ZSGA 1UG1A 1GRIA 2DL7A 2FPEA 2YDLA 2O9SA 4IIMA 3JV3A 1NM7A 1YWOA 2FO0A 1ZX6A 2GNCA 2K3BA 1K4US 1FYNA 1AOJA 2EBPA 1MV0B 2LJ0A 2RF0A 4JJBA 2DX1A 4J9BA 1PRLC 1Z9QA 3I35A 4FSSA 2LP5A 4AFSC 2CSQA 2DL4A 4Z8AA 1K9AA 5FW9A 3LH5A 5HCKA 2VKNA 1AD5A 1M3CA 1WLPB 1KFZA 1U5SA 5I22A 1K76A 2KNBB 1I1JA 2EGCA 1OV3A 1AEYA 3NHNA 3H0FA 4J9CA 2CT3A 4OMMA 1UDLA 2EVRA 1UGVA 1K0SA 1AWWA 1GBRA 2DJQA 1U3OA 2HEQA 4D8DA 1VYVA 1OEBA 2DNUA 2A08A 1AZGB 1X27A 2SRCA 5FWCA 1WXTA 4Y92A 1J3TA 1RLPC 2RQUA 1LCKA 2O31A 2RNAA 1H8KA 2P4RA 4ORZA 2FEIA 1B07A 1M27C 1PNJA 2YUOA 1PKTA 2HSPA 1QCFA 1SRMA 2XMFA 4RTXA 2VVKA 2LQNA 2KROA 2JM9A 2ROLA 1JXMA 1M3AA 1X43A 2RPNA 1TG0A 3TSZA 1ZUUA 3U23A 3EHQA 2EYZA 4LUDA 1S1NA 2KR3A 2QDLA 4RTUA 1UJ0A 2X3XD 2SEMA 1YCSB 1VA7A 2KRMA 2B86A 2OAWA 1BB9A 2BZXA 1UHCA 2LX7A 2LJ3A 1CSKA 1OPLA 1AZEA 1GFCA 1A0NB 1NLOC 1EFNA 2GTJA 1TUCA 3PVLA 4HXJA 1K1ZA 1BBZA 2AKLA 2A36A 4AG2C 5GJVB 4OMOA 1KJWA 1QWEA 1SSHA 1YP5A 2BTTA 2EGEA 2DILA 2JS2A 2RMOA 1WDXA 2J6KA 3QWXX 2H8HA 4WCIA 1WFWA 1ABOA 3EG1A 1CKAA 3REAB 3PVQA 1UUEA 2CT4A 4CC7A 1X6BA 5FWBA 1HJDA 2CUDA 2CH4A 3I9QA 3VS0A 2GTOA 2FG0A 1JXOA 4RTZA 1WXUA 4LUEA 2IIMA 2L2PA 5IHIA 1X2KA 2E5KA 1PHTA 2ABLA 2MIOA 1HSQA 1UJYA 3VRZA 3M0QA 2KRSA 5IH2A 1NYGA 5IHKA 2M51A 2DMOA 1X6GA 4EIKA 4HVWA 1BK2A 1B3QA 2DF6A 2DRMA 3EG3A 1NLPC 2J06A 2ENMA 3VS1A 2DE0X 3THKA 3H41A 4OMPA 3VS3A 2CREA 1PRMC 2RQTA 2DVJA 1ZBJA 2HBWA 1UECA 2KYBA 3REBB 1H92A 1ZLMA 2CUBA 2KE9A 2RQVA 2OJ2A 4CC3A 4CC2A 4GLMA 2KYMA 2YUPA 3ZL7C 3UATA 1TUDA 1E6GA 1M30A 2NUZA 4R0KA 2X3WD 2MCNA 2JS0A 2PZ1A 4JPBW 3VS5A 2DBMA 2DBKA 2YSQA 3VS2A 4AG1C 4AFQC 4RTYA 2M0YA 4AFUC 1E6HA 1FMKA 1GCQA 1KSWA 3EGUA 1SHFA 2KT8A 1X69A 2ECZA 5GJWB 1GFDA 2NWMA 3M0SA 1QWFA 3ULRB 3C0CA 2OI3A 2EPDA 2W10A 1ARKA 4GBQA 3EG0A 4LE9A 2K9GA 2K79A 2FRWA 3KFVA 3EHRA 1H3HA 2C0TA 1UE9A 1NEBA 2DL3A 2KXDA 2JT4A 1NYFA 1T3LA 1M3BA 2O9VA 2RQWA 2CH4W 1JQQA 1JO8A 1W70A 4RTTA 1G83A 5L23A 2RN8A 2BZ8A 1GBQA 1VYUA 2FPFA 2KT1A 4OMLA 3UA6A 4J9DA 2J6OA 4Z89A 2F2XA 1W1FA 5ECAA 1W6XA 2LZ6B 2EYWA 1GL5A 1M8MA 3I5RA 3RBBB 1NG2A 1ZUKA 4LNPA 4CC4B 2JXBA 3A98A 2VWFA 1MUZA 4ESRA 3M0RA 2F2VA 3UA7A 2LJ1A 4J9FA 2ROTA 2A37A 4J9IA 2F2WA 2GGRA 2EW3A 3M0PA 3O5ZA 2AKKA 1UTIA 2L0AA 1G2BA 2PTKA 1SPKA 2K6DA 2J6FA 3R6NA 4DEYA 1NEGA 3VS6A 3I5SA 1SHGA 1RLQC 4RTVA 4IIOA 2EYXA 2W0ZA 1UHFA 1PWTA 4A63B 2O2OA 4F17A 1ZUYA 2RQRA 2ED0A 4RTWA 1K0XA 5IHNA 3RNJA 4E6RA 1YWPA 1QKWA 1OPKA 1U06A 1SRLA 1N5ZA 2EGAA 4KRTA 1GCQC 3GBQA 2JW4A 1UFFA 2GQIA 4J9HA 2ED1A 4F14A 1QKXA 4DEXA 2C0OA 2O88A 3UF4A 1WYXA 3SHWA 4QT7A 2EQIA 4D8KA 2J05A 1VYTA 1WIEA 2JMCA 1GCPA 1SEMA 1JEGA 3VRYA 2FPDA 1JU5C 3EG2A 2DRKA 1ABQA 1AVZC 1AWOA 2LQWA 4AFZC 1KIKA 2D8JA 2D0NA 1RUWA 4M4ZA 4HVUA 4JJDA 3H0HA 2EYYA 2KEAA 1X2QA 1RI9A 2BZYA 2V1QA 1XOVA 2PNIA 2MOXA 4K11A 1WXBA 4X1VA 1OOTA 1MV3A 2DL8A 4OMQA 2DL5A 1WA7A 2DM1A 2KXCA 3TSWA 2AK5A 3FJ5A 2KRNA 3QWYA 2G6FX 2YUQA 2GBQA 4J9EA 2AZSA 3SEMA 4JJCA 4OMNA 1AWJA 2A28A 3VS7A 2EKHA 5IXBA 3NGPA 5EC7A 1WX6A 4J9GA 1I0CA 3VS4A 1QLYA 1Y0MA 3M0UA 1I07A 2DYBA 2L3QA 4ZNXA 2HCKA 1YN8A 2L3SA 2LCSA 2CSIA 1T0HA 1T0JA 2DA9A 4JZ4A 1IO6A 4Z88A 1HD3A 1BU1A 1Y57A 4HCKA 2D8HA 2FRYA 1PKSA 4F16A 5I11A 2HDAA 1WI7A 2JTEA 2AZVA 2I0NA 4JZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3S A;  1Z9Z A;  2DLP A;  2ESW A;  3NPF A;  5IXF A;  2K7A A;  3M0T A;  2C0I A;  2YUN A;  3IQL A;  2LNH B;  2K2M A;  4HVV A;  2J7I A;  2V1R A;  4LN2 A;  3TVT A;  2CDT A;  2YT6 A;  4RUG A;  1YNZ A;  2D1X A;  1AWX A;  2LMJ A;  1E7O A;  3NMZ C;  2KGT A;  2KBT A;  3PE0 A;  1V1C A;  1CKB A;  2L3P A;  3CQT A;  2JM8 A;  3H0I A;  2JMA A;  1ZSG A;  1UG1 A;  1GRI A;  2DL7 A;  2FPE A;  2YDL A;  2O9S A;  4IIM A;  3JV3 A;  1NM7 A;  1YWO A;  2FO0 A;  1ZX6 A;  2GNC A;  2K3B A;  1K4U S;  1FYN A;  1AOJ A;  2EBP A;  1MV0 B;  2LJ0 A;  2RF0 A;  4JJB A;  2DX1 A;  4J9B A;  1PRL C;  1Z9Q A;  3I35 A;  4FSS A;  2LP5 A;  4AFS C;  2CSQ A;  2DL4 A;  4Z8A A;  1K9A A;  5FW9 A;  3LH5 A;  5HCK A;  2VKN A;  1AD5 A;  1M3C A;  1WLP B;  1KFZ A;  1U5S A;  5I22 A;  1K76 A;  2KNB B;  1I1J A;  2EGC A;  1OV3 A;  1AEY A;  3NHN A;  3H0F A;  4J9C A;  2CT3 A;  4OMM A;  1UDL A;  2EVR A;  1UGV A;  1K0S A;  1AWW A;  1GBR A;  2DJQ A;  1U3O A;  2HEQ A;  4D8D A;  1VYV A;  1OEB A;  2DNU A;  2A08 A;  1AZG B;  1X27 A;  2SRC A;  5FWC A;  1WXT A;  4Y92 A;  1J3T A;  1RLP C;  2RQU A;  1LCK A;  2O31 A;  2RNA A;  1H8K A;  2P4R A;  4ORZ A;  2FEI A;  1B07 A;  1M27 C;  1PNJ A;  2YUO A;  1PKT A;  2HSP A;  1QCF A;  1SRM A;  2XMF A;  4RTX A;  2VVK A;  2LQN A;  2KRO A;  2JM9 A;  2ROL A;  1JXM A;  1M3A A;  1X43 A;  2RPN A;  1TG0 A;  3TSZ A;  1ZUU A;  3U23 A;  3EHQ A;  2EYZ A;  4LUD A;  1S1N A;  2KR3 A;  2QDL A;  4RTU A;  1UJ0 A;  2X3X D;  2SEM A;  1YCS B;  1VA7 A;  2KRM A;  2B86 A;  2OAW A;  1BB9 A;  2BZX A;  1UHC A;  2LX7 A;  2LJ3 A;  1CSK A;  1OPL A;  1AZE A;  1GFC A;  1A0N B;  1NLO C;  1EFN A;  2GTJ A;  1TUC A;  3PVL A;  4HXJ A;  1K1Z A;  1BBZ A;  2AKL A;  2A36 A;  4AG2 C;  5GJV B;  4OMO A;  1KJW A;  1QWE A;  1SSH A;  1YP5 A;  2BTT A;  2EGE A;  2DIL A;  2JS2 A;  2RMO A;  1WDX A;  2J6K A;  3QWX X;  2H8H A;  4WCI A;  1WFW A;  1ABO A;  3EG1 A;  1CKA A;  3REA B;  3PVQ A;  1UUE A;  2CT4 A;  4CC7 A;  1X6B A;  5FWB A;  1HJD A;  2CUD A;  2CH4 A;  3I9Q A;  3VS0 A;  2GTO A;  2FG0 A;  1JXO A;  4RTZ A;  1WXU A;  4LUE A;  2IIM A;  2L2P A;  5IHI A;  1X2K A;  2E5K A;  1PHT A;  2ABL A;  2MIO A;  1HSQ A;  1UJY A;  3VRZ A;  3M0Q A;  2KRS A;  5IH2 A;  1NYG A;  5IHK A;  2M51 A;  2DMO A;  1X6G A;  4EIK A;  4HVW A;  1BK2 A;  1B3Q A;  2DF6 A;  2DRM A;  3EG3 A;  1NLP C;  2J06 A;  2ENM A;  3VS1 A;  2DE0 X;  3THK A;  3H41 A;  4OMP A;  3VS3 A;  2CRE A;  1PRM C;  2RQT A;  2DVJ A;  1ZBJ A;  2HBW A;  1UEC A;  2KYB A;  3REB B;  1H92 A;  1ZLM A;  2CUB A;  2KE9 A;  2RQV A;  2OJ2 A;  4CC3 A;  4CC2 A;  4GLM A;  2KYM A;  2YUP A;  3ZL7 C;  3UAT A;  1TUD A;  1E6G A;  1M30 A;  2NUZ A;  4R0K A;  2X3W D;  2MCN A;  2JS0 A;  2PZ1 A;  4JPB W;  3VS5 A;  2DBM A;  2DBK A;  2YSQ A;  3VS2 A;  4AG1 C;  4AFQ C;  4RTY A;  2M0Y A;  4AFU C;  1E6H A;  1FMK A;  1GCQ A;  1KSW A;  3EGU A;  1SHF A;  2KT8 A;  1X69 A;  2ECZ A;  5GJW B;  1GFD A;  2NWM A;  3M0S A;  1QWF A;  3ULR B;  3C0C A;  2OI3 A;  2EPD A;  2W10 A;  1ARK A;  4GBQ A;  3EG0 A;  4LE9 A;  2K9G A;  2K79 A;  2FRW A;  3KFV A;  3EHR A;  1H3H A;  2C0T A;  1UE9 A;  1NEB A;  2DL3 A;  2KXD A;  2JT4 A;  1NYF A;  1T3L A;  1M3B A;  2O9V A;  2RQW A;  2CH4 W;  1JQQ A;  1JO8 A;  1W70 A;  4RTT A;  1G83 A;  5L23 A;  2RN8 A;  2BZ8 A;  1GBQ A;  1VYU A;  2FPF A;  2KT1 A;  4OML A;  3UA6 A;  4J9D A;  2J6O A;  4Z89 A;  2F2X A;  1W1F A;  5ECA A;  1W6X A;  2LZ6 B;  2EYW A;  1GL5 A;  1M8M A;  3I5R A;  3RBB B;  1NG2 A;  1ZUK A;  4LNP A;  4CC4 B;  2JXB A;  3A98 A;  2VWF A;  1MUZ A;  4ESR A;  3M0R A;  2F2V A;  3UA7 A;  2LJ1 A;  4J9F A;  2ROT A;  2A37 A;  4J9I A;  2F2W A;  2GGR A;  2EW3 A;  3M0P A;  3O5Z A;  2AKK A;  1UTI A;  2L0A A;  1G2B A;  2PTK A;  1SPK A;  2K6D A;  2J6F A;  3R6N A;  4DEY A;  1NEG A;  3VS6 A;  3I5S A;  1SHG A;  1RLQ C;  4RTV A;  4IIO A;  2EYX A;  2W0Z A;  1UHF A;  1PWT A;  4A63 B;  2O2O A;  4F17 A;  1ZUY A;  2RQR A;  2ED0 A;  4RTW A;  1K0X A;  5IHN A;  3RNJ A;  4E6R A;  1YWP A;  1QKW A;  1OPK A;  1U06 A;  1SRL A;  1N5Z A;  2EGA A;  4KRT A;  1GCQ C;  3GBQ A;  2JW4 A;  1UFF A;  2GQI A;  4J9H A;  2ED1 A;  4F14 A;  1QKX A;  4DEX A;  2C0O A;  2O88 A;  3UF4 A;  1WYX A;  3SHW A;  4QT7 A;  2EQI A;  4D8K A;  2J05 A;  1VYT A;  1WIE A;  2JMC A;  1GCP A;  1SEM A;  1JEG A;  3VRY A;  2FPD A;  1JU5 C;  3EG2 A;  2DRK A;  1ABQ A;  1AVZ C;  1AWO A;  2LQW A;  4AFZ C;  1KIK A;  2D8J A;  2D0N A;  1RUW A;  4M4Z A;  4HVU A;  4JJD A;  3H0H A;  2EYY A;  2KEA A;  1X2Q A;  1RI9 A;  2BZY A;  2V1Q A;  1XOV A;  2PNI A;  2MOX A;  4K11 A;  1WXB A;  4X1V A;  1OOT A;  1MV3 A;  2DL8 A;  4OMQ A;  2DL5 A;  1WA7 A;  2DM1 A;  2KXC A;  3TSW A;  2AK5 A;  3FJ5 A;  2KRN A;  3QWY A;  2G6F X;  2YUQ A;  2GBQ A;  4J9E A;  2AZS A;  3SEM A;  4JJC A;  4OMN A;  1AWJ A;  2A28 A;  3VS7 A;  2EKH A;  5IXB A;  3NGP A;  5EC7 A;  1WX6 A;  4J9G A;  1I0C A;  3VS4 A;  1QLY A;  1Y0M A;  3M0U A;  1I07 A;  2DYB A;  2L3Q A;  4ZNX A;  2HCK A;  1YN8 A;  2L3S A;  2LCS A;  2CSI A;  1T0H A;  1T0J A;  2DA9 A;  4JZ4 A;  1IO6 A;  4Z88 A;  1HD3 A;  1BU1 A;  1Y57 A;  4HCK A;  2D8H A;  2FRY A;  1PKS A;  4F16 A;  5I11 A;  2HDA A;  1WI7 A;  2JTE A;  2AZV A;  2I0N A;  4JZ3 A; 
#chains in the Genus database with same CATH topology
 2ESW A;  3SB2 A;  5IXF A;  3C95 A;  3M59 A;  4HVV A;  3CCM A;  2FYK A;  3N5B B;  4QVZ A;  5CKE A;  2XDP A;  1K8A R;  2CDT A;  2CP5 A;  1C6V X;  2L5Q A;  2YT6 A;  4HCC A;  5GAN 7;  2KGT A;  3UWN A;  3CCS T;  1N8R R;  3L2R A;  2F69 A;  1V1C A;  3QG1 A;  2E12 A;  5IN1 A;  1UG1 A;  3SWN B;  2YDL A;  3JCM c;  3M57 A;  2FO0 A;  2K3B A;  2DEU A;  5LJ3 h;  1K4U S;  1WHM A;  1FYN A;  1AOJ A;  4XTU A;  3CXC S;  4JJB A;  2RF0 A;  1NZ9 A;  3EGX A;  1VQ8 A;  2NUP A;  4J9B A;  4Y91 A;  4WF2 A;  1Z9Q A;  2DXU A;  3JB9 J;  1KD1 U;  1MNE A;  1VOM A;  2QDY B;  2HMA A;  2O4X B;  3OBY A;  4C92 D;  2DXC A;  1Q95 G;  4E2F B;  4CI0 C;  4QQD A;  1VQL T;  4OVA A;  4C92 C;  5GMK l;  1I1J A;  2KI7 A;  1LOJ A;  1OV3 A;  1Q7Y R;  3EFR A;  5GAN d;  1DJ7 B;  4J9C A;  2CT3 A;  4LD9 K;  3CCV Q;  5KYN A;  4GLK A;  3QII A;  4E47 A;  1K73 U;  1K0S A;  1GBR A;  1VYV A;  1OEB A;  5CAI A;  2A08 A;  3P8H A;  4Y92 A;  2M1H A;  1LCK A;  1VQ9 Q;  2LX9 A;  2P4R A;  2ZPH B;  4BE2 A;  1VQ4 T;  1M27 C;  1PNJ A;  4M78 B;  4A4G A;  2XK0 A;  1M5Q 1;  5D7U A;  3HFO A;  2KRO A;  2R58 A;  1RAH B;  5AYF A;  1JXM A;  1M3A A;  1X43 A;  2XD0 A;  3EHQ A;  4LUD A;  2VUB A;  1UJ0 A;  3VYG A;  4PJN A;  2IG0 A;  3I56 Q;  1LPL A;  2B86 A;  3DLM A;  2K57 A;  1UHC A;  1B34 B;  5GAO n;  1VQP A;  1VIE A;  4OGE A;  1OPL A;  3L42 A;  1AZE A;  1GFC A;  1EFN A;  4FL6 A;  4HKE A;  3MPU B;  3PVL A;  3M4Y A;  3KUF A;  2ZPI B;  2RK2 A;  2X4X A;  2A36 A;  4M7A F;  2RHZ A;  5CK9 A;  1KJW A;  2M0O A;  2DIL A;  2J6K A;  1MMD A;  2FHD A;  1YBY A;  1BCO A;  3MKD A;  3OYK A;  4M7A G;  1G5V A;  3EG1 A;  3EG9 B;  3J81 E;  4ZTJ A;  3ME9 A;  5M9O A;  3JCM h;  3CCS A;  3EAE A;  2CT4 A;  2DFU A;  4XTV A;  1X6B A;  4QQG A;  1ZSZ A;  4JRI A;  1M1G A;  2GTO A;  4RCB A;  3OYA A;  4PJO A;  3CD6 A;  1WXU A;  4LUE A;  5I2S A;  3RDV A;  1R0C B;  3CC7 T;  1OX9 A;  2E5K A;  2Y90 A;  1BI0 A;  3LGL A;  2QXF A;  5FU7 B;  1X6G A;  4ATO A;  4PJL A;  3E9F A;  1Y07 A;  4C5I A;  4F7U B;  1Y96 A;  4C0D B;  2NYS A;  2JTM A;  3JCM W;  4M77 E;  3WVE B;  3BW1 A;  1P92 A;  1PRM C;  4J7I A;  2KYB A;  3VU3 C;  2XG8 D;  5GAM g;  2KE9 A;  2OJ2 A;  2Y4X A;  4GLM A;  1VQL A;  3V8L A;  2KYM A;  2RA2 A;  1M1F A;  2EQJ A;  1E6G A;  4M75 E;  5HK0 A;  3GP8 A;  5DLO A;  2PZ1 A;  2DD5 A;  2DBK A;  3MEU A;  1UGP B;  1VQO Q;  5LJ5 g;  2RM4 A;  4IUR A;  1ZA1 B;  5J3B A;  1E6H A;  1FMK A;  4JLG A;  3EGU A;  4HCZ A;  4DQ2 A;  1X69 A;  5FU6 B;  1GFD A;  5KE3 A;  3CCE Q;  4J83 A;  5KYW A;  1VQ4 A;  1G3S A;  4LE9 A;  2E64 A;  4EMK A;  1HK9 A;  2K9G A;  1VQ6 T;  3EHR A;  3PTA A;  2KXD A;  1UB4 A;  3CBO A;  4XTZ A;  5KYU B;  1ZSZ C;  1T3L A;  1M3B A;  3CCS Q;  1JO8 A;  4LDU A;  1KD1 C;  2JN0 A;  4RTT A;  5L23 A;  1M90 U;  4FW2 A;  3VJP A;  1M9S A;  1Q86 R;  1XJW B;  2QAZ A;  4OML A;  4J9D A;  2Y4Y A;  2F2X A;  2P0Q A;  2DPP B;  4PLL A;  4XU1 A;  1WHH A;  1NG2 A;  3R6O A;  2K5I A;  1ZUK A;  1M2V B;  3BE3 A;  4FT2 A;  2LCL A;  3UA7 A;  3V7R A;  2NUT A;  2ROT A;  4LXC A;  3CCU T;  1QQJ A;  3OS2 A;  2EQU A;  1OI1 A;  1X01 A;  1SPK A;  1TS9 A;  4M77 A;  4EMH A;  1IB8 A;  4DEY A;  3RUX A;  2HNI A;  4QKU A;  1SHG A;  3EGD B;  3OS0 A;  1RLQ C;  4RTV A;  4IIO A;  4KGV B;  2EYX A;  3A1P A;  1UHF A;  1PWT A;  4FW1 A;  1QVG A;  4MZT A;  4A63 B;  3A8L B;  3M5A A;  1SG5 A;  1VQL Q;  4C8Q G;  2DER A;  1ZUY A;  2RQR A;  1X6O A;  3NFC A;  4M75 A;  1KC8 R;  3CC7 A;  1YWP A;  4E7Z A;  2YXY A;  4J9H A;  2CP2 A;  4JJN K;  4F14 A;  1IHV A;  1UGQ B;  1C0M A;  2KK4 A;  1SF9 A;  4QT7 A;  3SDZ A;  1WIE A;  3JCM J;  2JMC A;  3ZBD A;  5GAN 2;  3X25 B;  5HY6 A;  1VQ4 Q;  4M7D F;  2E5Q A;  1GCP A;  3VRY A;  2MYS A;  2DRK A;  4DBR A;  1AVZ C;  2LQW A;  4M7A B;  1JBM A;  5GAM e;  5GAN 4;  1RUW A;  1D1B A;  1YJ9 T;  2RI3 A;  4M7D G;  5A0L A;  3H9N A;  4BY6 C;  2V1Q A;  1XOV A;  2VC8 A;  1NPR A;  3FB9 A;  4X1V A;  2DL8 A;  3QDR B;  4KH0 B;  2DM1 A;  2G3R A;  4FYV B;  3QYG B;  3JB9 H;  2YLC A;  2IPO B;  3JB9 I;  1AWJ A;  1KHC A;  2DO3 A;  5GMK e;  4M77 D;  2EKH A;  2RJD A;  1WZO A;  4BI3 A;  4M77 C;  1VQ6 A;  5GAO p;  4J9G A;  1I0C A;  1Y0M A;  2XHC A;  2DTI A;  5KH6 A;  2MWP A;  4J6Y A;  1RAG B;  1R77 A;  2DA9 A;  1YJN Q;  2PQW A;  4XU0 A;  1Q82 C;  4J8O A;  1OUL A;  1VQ9 T;  1SKU B;  5CIU A;  3CC7 Q;  2QYZ A;  5LJ5 j;  2JTE A;  1Z9Z A;  3NPF A;  4FM4 B;  2L3R A;  2K7A A;  3BFM A;  4VUB A;  3FJP A;  2C0I A;  3IQL A;  1EX4 A;  2LNH B;  2K2M A;  2PVD B;  4BUG A;  5CR2 A;  3CCU A;  4RUG A;  3QBY A;  5CQY A;  1TTH B;  2L89 A;  4C92 E;  4C8Q E;  2CP7 A;  3I56 T;  1QMC A;  1PG5 B;  1QVG P;  2D9T A;  1CKB A;  3URG A;  3TQ7 P;  4PL6 A;  2DZ9 A;  2K3X A;  3ZEH A;  2DL7 A;  2O9S A;  2X51 A;  5D6Y A;  1N9R A;  2COY A;  2HQE A;  3FIF A;  5L8R E;  2D6F A;  2GNC A;  2M02 A;  3A5Z B;  2E10 A;  1WJS A;  2DX1 A;  4Y28 E;  2X35 A;  4M78 G;  3CMA T;  1PRL C;  4M7A D;  3MO8 A;  4Z02 A;  1HXD A;  2LP5 A;  1VQM T;  4M7A C;  4C5G A;  2GCX A;  2M9U A;  4AFS C;  4JUV A;  2ZPF B;  2X4Y A;  4ZGE B;  3LH5 A;  3A8G B;  5HCK A;  2VKN A;  2CZ0 B;  2KQW A;  3PMT A;  1VQ6 Q;  1KFZ A;  5I22 A;  5IAY A;  3OW2 A;  1YJ9 A;  2E65 A;  4MMK A;  4OB2 B;  5LJ5 f;  3NHN A;  2IVW A;  1H3Z A;  1ZA2 B;  1K9M U;  4IUU A;  4N4H A;  1FXX A;  4BDZ A;  4WTO B;  3MCA B;  5LJ3 d;  3QZ9 B;  2SRC A;  2CP3 A;  2GF7 A;  4PJO F;  2QQR A;  1BYM A;  2ZAE A;  1J3T A;  1RLP C;  1LVK A;  3V8J A;  2HAX A;  3P8D A;  2DYI A;  4ORZ A;  2R5M A;  2F1L A;  2FEI A;  4EPC A;  1D0X A;  1QCF A;  2XMF A;  1TXQ A;  4RTX A;  4N0A A;  2LQN A;  3INZ A;  4C92 A;  1W2B S;  3HRT A;  3OYM A;  5J39 A;  1YFN A;  3QXE B;  3RIR A;  1VQO T;  1YCS B;  3LWH A;  3FDR A;  1VA7 A;  5GAO m;  5AT1 B;  2FVU A;  1Y7X A;  2BZX A;  3M53 A;  3S3O A;  1CSK A;  4XTX A;  1VQ9 A;  1D09 B;  4F7U G;  3CCE T;  5LJ5 h;  4XTY A;  4AG2 C;  1NPP A;  1TWB A;  4OMO A;  2BTT A;  1YP5 A;  4ME7 A;  4J6W A;  2P4T A;  1VQN T;  3MP8 A;  4WCI A;  2QQ9 A;  1CKA A;  3OYY A;  3I56 A;  3V7S A;  3PVQ A;  5GMK h;  5GAN j;  4CC7 A;  2X4W A;  3OYG A;  2GQV A;  1VQ5 T;  4ZN3 A;  4CRI A;  3EGX B;  3RKX A;  1YJ9 Q;  2EJF A;  2FG0 A;  2RJC A;  1NJI U;  4M78 E;  2KY9 A;  4MZM A;  1X2K A;  4ZN1 A;  2MIO A;  1KQ2 A;  4F04 B;  4JS4 A;  4C5H A;  1NYG A;  4XK8 E;  3OYN A;  3LX7 A;  3CMA A;  8AT1 B;  1VQM A;  1B3Q A;  2DRM A;  3GNG A;  3SWN A;  2DE0 X;  3H41 A;  1YHQ Q;  4LDV A;  4C8Q D;  3JCM Q;  4N0A C;  3E2U A;  3REB B;  2DVJ A;  4PFO A;  4C8Q C;  1UEC A;  2OAU A;  3OW2 P;  1TSF A;  3JCM d;  3SFM A;  3ZL7 C;  1QCN A;  3MHX A;  3UAT A;  1K8A U;  1TUD A;  2JVV A;  1M30 A;  2MK5 A;  2X3W D;  1D3B B;  1LJO A;  1YCY A;  5GAN 5;  2MCN A;  1RAD B;  4JPB W;  3EFS A;  2DBM A;  4LDW A;  2LDM A;  2HL5 C;  1D0Y A;  2M0Y A;  1N8R U;  1IRX A;  4E7S A;  4JS5 A;  1KSW A;  2L8D A;  1WHK A;  2KT8 A;  1WNL A;  2ECZ A;  3P8B B;  1W2B A;  2HBP A;  2EYQ A;  3UDC A;  2LT4 A;  3M0S A;  1AHJ B;  1QWF A;  5FRO A;  1M1K R;  3RER A;  1OZ3 A;  3JCM P;  1ARK A;  2JUF A;  4M7D D;  1TU0 B;  1N27 A;  3X26 B;  4M7D C;  2OTJ T;  2DL3 A;  2LQ8 A;  1V76 A;  4A4H A;  3CPW S;  1NYF A;  2XDB A;  1I8F A;  2O9V A;  1VQO A;  1RAA B;  4RCC A;  2JOY A;  2HD0 A;  2RI2 A;  2RN8 A;  2BZ8 A;  4F7U E;  4AT1 B;  1AT1 B;  2J6O A;  4Z89 A;  2F5T X;  4MML A;  1W6X A;  2EYW A;  4IUP A;  1GL5 A;  3CCE A;  3KXT A;  2JXB A;  2QEX Q;  3CMA Q;  2RJE A;  3SWN C;  4R55 A;  5GAO l;  4J9I A;  3E9G A;  1VQM Q;  2GGR A;  2OTL T;  1K9M C;  1VQN A;  2PTK A;  3OYH A;  4PJO B;  2JNG A;  2K6D A;  3R6N A;  3HRS A;  4E7H A;  2QTV A;  3I5S A;  2H3E B;  1YJN T;  1O75 A;  2X9H A;  1Q81 R;  3DKM A;  1VQ5 A;  2ZGW A;  2XIC A;  2ZCF B;  3KBG A;  3FRN A;  4F17 A;  4ZTF A;  2ED0 A;  1K0X A;  3MP1 A;  1QVG S;  3EH2 A;  4E6R A;  2QQS A;  1Y96 B;  1IGQ A;  2QK0 A;  4RMO A;  4KRT A;  5C6S A;  2JW4 A;  3BY7 A;  2ED1 A;  4DEX A;  5KYX B;  4J7F A;  2VXE A;  4B9X A;  2PU9 B;  3UF4 A;  1Q82 U;  2CP0 A;  4XU3 A;  2DTO A;  2EQI A;  2J05 A;  4D8K A;  4DOV A;  4OF1 A;  3C12 A;  4B6M A;  4QVD A;  5FRN A;  1SEM A;  1JEG A;  2CP6 A;  3TU4 K;  2FPD A;  1MMN A;  2XI9 A;  3MP6 A;  2HKN A;  1KIK A;  2JZ2 A;  3FEO A;  2D8J A;  5A2Q E;  4JJD A;  3L2V A;  4E7J A;  4KUI A;  4KBM B;  1X2Q A;  2P0P A;  1R0B G;  2PNI A;  3ZFJ A;  4FSX A;  4K11 A;  3G4S Q;  4M78 D;  2QI2 A;  5CKD A;  1PD1 A;  1XTD A;  4M78 C;  4OMQ A;  2DL5 A;  1WA7 A;  5KYW B;  3BDL A;  3TSW A;  4TVR A;  3MEA A;  3H8Z A;  3EFO A;  3FJ5 A;  1W2B P;  2ZZD A;  3QWY A;  2G6F X;  1LNX A;  2GBQ A;  4AMC A;  4J9E A;  4KGX B;  3CPW A;  2AZS A;  1ACM B;  1OU8 A;  2I2L A;  4OMN A;  1NJI C;  2XDD A;  3OYD A;  2EJG A;  5IXB A;  4XAX B;  3CC4 T;  4X34 A;  2VGM A;  3NGP A;  1NBE B;  3QO3 A;  4O5V A;  5EC7 A;  1VQN Q;  2OTJ A;  3VS4 A;  1QLY A;  2DYB A;  2L3Q A;  2E70 A;  3M4G A;  4ZNX A;  1WHG A;  3TRE A;  1YN8 A;  1TH7 A;  2RO0 A;  1VQ5 Q;  1T0J A;  2E4H A;  1IO6 A;  1OYX A;  4Z88 A;  1BU1 A;  1Y57 A;  2D8H A;  1U8R A;  3M55 A;  4NL2 A;  1VUB A;  1MMA A;  3CCR Q;  4MDX A;  1S72 Q;  2HDA A;  4E7L A;  4M7A E;  2BE7 D;  4JZ3 A;  1MGQ A;  3M0T A;  3I55 T;  3HPW A;  1K8A C;  2YLB A;  4KT0 E;  2V1R A;  2AHJ B;  2OTL A;  2WSC E;  3TVT A;  1YJW T;  2BUD A;  3FLG A;  1AWX A;  1N8R C;  1YIT T;  1YJN A;  3OYF A;  1X75 C;  1M2V A;  2FL7 A;  2KBT A;  5FU7 C;  3PE0 A;  2L3P A;  3CQT A;  3PFS A;  1ZSG A;  1MMG A;  2EQK A;  2FPE A;  4C92 F;  4C0D C;  1M8V A;  4IIM A;  2YRC A;  3QUI A;  1NM7 A;  4OB1 B;  4BI8 B;  1MV0 B;  2LJ0 A;  1PCX A;  3OQ5 A;  1KG1 A;  3CPF A;  4HCB A;  4NS5 A;  3X28 B;  1BI3 A;  2CSQ A;  2WSE E;  1W4S A;  5DLQ E;  5FW9 A;  4FT4 A;  2YHT A;  3CCL T;  1WLP B;  2EKO A;  2VB6 A;  2OTJ Q;  1Q7Y C;  1D1C A;  1QVF S;  1VQ7 T;  5FU6 C;  3M54 A;  2LC4 A;  4MZP A;  1AEY A;  2PUK B;  5KCH A;  1HYO A;  3H0F A;  4A4F A;  5LJ5 e;  1RAB B;  3JRZ A;  5HKC A;  3OW2 S;  4BAC A;  2EVR A;  3GF5 A;  4RKU E;  2DTH A;  3BDU A;  1U3O A;  4D8D A;  2QA4 T;  2DNU A;  1JJ2 S;  1X27 A;  4M7A A;  3QDF A;  3CPW P;  1YHQ T;  1KC8 U;  1M1K C;  3DB4 A;  1I81 A;  2KVQ G;  5GAN g;  3CC4 A;  1PKT A;  2OTL Q;  2HSP A;  1WQW A;  4HT9 A;  2R57 A;  4XTW A;  4PFP A;  1OZ2 A;  1TG0 A;  3TSZ A;  1ZUU A;  3MET A;  4FYY B;  3CCJ Q;  4RTU A;  5LL6 S;  2X3X D;  4ELY C;  2KRM A;  2HKQ B;  3CC2 T;  2CZ7 B;  1A0N B;  1NLO C;  1R8O B;  2FZG B;  3OY9 A;  2GTJ A;  2MMP A;  4MDW A;  1TUC A;  5KYY A;  4HXJ A;  1K1Z A;  4KGZ B;  2LVM A;  3I55 A;  1BBZ A;  2AKL A;  2MAM A;  1QVP A;  1YIJ T;  1IXD A;  2EGE A;  1QWE A;  1M2O A;  2RMO A;  2MPX C;  3QWX X;  5EG2 A;  1YJW A;  2Z0W A;  1YIT A;  3L2U A;  1I4K 1;  4JLI A;  2LRQ A;  1TUG B;  5FWB A;  1HJD A;  1BKB A;  2E3I A;  3I9Q A;  2BKD N;  3VS0 A;  3C94 A;  5J26 A;  2VV5 A;  3OS5 A;  2A7Y A;  2COW A;  2C06 A;  3LGF A;  4KUL A;  4E7K A;  2IIM A;  2L2P A;  5D6W A;  5IHI A;  5LJ3 j;  1OX8 A;  2K4Y A;  1PHT A;  2LCC A;  4OGC A;  5GAM d;  2FZC B;  2K5L A;  2QEX T;  3VRZ A;  3M0Q A;  2KRS A;  1FMV A;  2WAC A;  1WQ7 A;  1XQH A;  2E6Z A;  2X4J A;  3S3N A;  2DMO A;  3AHU A;  4HVW A;  1BK2 A;  4BD3 A;  1VQ8 T;  2RK1 A;  4M7D E;  3EG3 A;  2FZK B;  1QVF A;  4O6J A;  2ENM A;  1QP2 A;  1BIA A;  5LJ5 d;  3THK A;  2KSS A;  2DIQ A;  3CCL A;  2ZPB B;  4OMP A;  2CRE A;  2DXB A;  2WSF E;  3CC4 Q;  1ZBJ A;  2HBW A;  2DKG A;  2HQX A;  1H92 A;  1ZLM A;  2CUB A;  2RHX A;  2RQV A;  2EJ9 A;  2QGF B;  1QW1 A;  3QPH A;  1JJ2 A;  2A3L A;  3VYH B;  2NUZ A;  3OYB A;  4R0K A;  2CZ6 B;  2JS0 A;  3VS5 A;  3L2Z A;  2YSQ A;  3VS2 A;  2QA4 A;  1C1A A;  2LQK A;  1GCQ A;  5GAO r;  4C92 B;  4PJO G;  4OB0 B;  5GJW B;  1YHQ A;  5FLX E;  2NWM A;  1ZQ1 A;  3I55 Q;  2OI3 A;  2XID A;  4C8Q A;  4GBQ A;  3EG0 A;  3T9N A;  5GAN e;  1KHI A;  2DK3 A;  3KFV A;  4N4I A;  1YJW Q;  3VUB A;  1D1A A;  3G4S T;  1YIT Q;  5A0D A;  3PIO A;  1UGS B;  3G7Z A;  5CVI A;  4DOW A;  5LJ3 f;  3CME Q;  2CH4 W;  1JQQ A;  1W70 A;  2EAY A;  3DLL A;  1YI2 Q;  4RG2 A;  1Q86 C;  3G6E Q;  1H64 1;  1KQ1 A;  1V29 B;  1BI2 A;  1GBQ A;  3CC2 A;  1KD1 R;  2LT1 A;  2BIV A;  2KT1 A;  1JRI A;  2R5A A;  3UA6 A;  1BIB A;  2DIG A;  3A8O B;  3ASK A;  1OQK A;  4IUT A;  5ECA A;  4OMF B;  2LZ6 B;  1VIF A;  3Q1J A;  3GOX A;  4LNP A;  2BE9 B;  3H6Z A;  2RH2 A;  2VWF A;  3HTR A;  4ESR A;  3M0R A;  1YIJ A;  2F2V A;  2DXT A;  5HK3 A;  4J9F A;  3JB9 F;  2F2W A;  4JRK A;  5GAN 6;  4M7D A;  2RB6 A;  4L6V 5;  3O5Z A;  3QJY A;  2AKK A;  1UTI A;  4Q5W A;  4UC4 A;  1U1T A;  2J6F A;  1F1B B;  3QJ6 A;  3RES A;  3VS6 A;  3CCL Q;  3JB9 G;  1K73 R;  2NUP B;  2K2V A;  3AT1 B;  1VQK Q;  1FX7 A;  1GXI E;  3CCR T;  2O2O A;  1S72 T;  1KC8 C;  1VQ7 Q;  4RTW A;  4FYW B;  3CBM A;  3PGG A;  3QZ5 B;  1RAI B;  1OPK A;  2QEX A;  3CD6 T;  3SD4 A;  5KE2 A;  2EGA A;  2E41 A;  1GCQ C;  5GAN 8;  1UFF A;  4JDS A;  3LH0 A;  2RD1 A;  1QKX A;  2QA4 Q;  2C0O A;  3VUZ A;  2O88 A;  4ANJ A;  4DA4 A;  3OYJ A;  1QVF P;  2KMT A;  2COZ A;  3TCJ A;  1G8X A;  1VYT A;  1EIF A;  5C0M A;  4NOY A;  1JU5 C;  3EG2 A;  1ABQ A;  4R56 A;  4AFZ C;  4M77 F;  1I5O B;  4J6X A;  4M4Z A;  2K5F A;  4PJM A;  1JJ2 P;  3J7A F;  2EYY A;  2KEA A;  1KQS A;  2BZY A;  3FC3 A;  2O4X A;  4M77 G;  5A0G A;  3G71 T;  4FU6 A;  1OOT A;  1MV3 A;  3DB3 A;  3CC2 Q;  4JRQ A;  4PJO E;  1TOV A;  2KXC A;  4PK4 A;  2KAF A;  1D0Z A;  4M75 F;  5CKB A;  2KRN A;  2YUQ A;  1RI0 A;  2RJF A;  4KUD K;  5GAN f;  3TEE A;  3SEM A;  2RI5 A;  4M75 G;  2A28 A;  3JCM f;  1YIJ Q;  1D3B A;  2DD4 A;  4PLI A;  2XU8 A;  4A53 A;  1ZHI A;  2V8K A;  1IZ6 A;  1WX6 A;  2OX7 A;  4BDY A;  3GNF B;  5I2M A;  4FCY A;  3CCM Q;  3V7C A;  1RAC B;  3G4S A;  3S6W A;  2HCK A;  2L3S A;  3EH1 A;  1WGS A;  4M78 A;  3LWI A;  4JZ4 A;  5CO7 A;  4HCK A;  2FRY A;  4F16 A;  4EMG A;  1Q7Y U;  1Q82 R;  2AT1 B;  4PKC C;  3HSB A;  2AZV A;  2I0N A;  2E1H A;  4NL3 A;  1T3S A;  2DLP A;  1ZSZ B;  4QQ6 A;  4ELZ C;  4KH1 B;  4E7I A;  1B34 A;  2YUN A;  4C0Z A;  1IRE B;  2J7I A;  3J80 E;  1VQ8 Q;  4LN2 A;  4YTL A;  3CCJ T;  1SSF A;  1YNZ A;  2D1X A;  3RMS A;  2LMJ A;  1E7O A;  3NMZ C;  5DY9 A;  3OB9 A;  3OMG A;  2HZY A;  2P84 A;  3JCM V;  4D6W A;  5GAN h;  1M1K U;  5CQX A;  2GFA A;  2JM8 A;  3H0I A;  3CCR A;  2JMA A;  1NE8 A;  1S72 A;  1UGR B;  1MND A;  1GRI A;  1WJQ A;  3CXC A;  3LYI A;  4HA8 A;  2PUO B;  1RAE B;  3JV3 A;  3OSS C;  3EG9 A;  1YWO A;  1ZX6 A;  4C0G A;  3GPL A;  3MJX A;  2EBP A;  2VGN A;  3CCQ T;  4RG8 A;  2FB7 A;  3F70 A;  3I35 A;  4FSS A;  4P5N A;  1N9S A;  2LTO A;  5CKF A;  2CYZ B;  2DL4 A;  4Z8A A;  2YWW A;  3PIP A;  1M90 R;  4IKF A;  1K9A A;  2DJZ A;  1B7T A;  3A8H B;  2EWN A;  1AD5 A;  1M3C A;  1JB0 E;  1U5S A;  3MEV A;  2V8I A;  1K76 A;  2KNB B;  4XU2 A;  2EGC A;  4F7U A;  1KQS P;  3EFO B;  5KYX A;  8ATC B;  2PVG B;  3G71 A;  1PC0 A;  2QGG A;  4OMM A;  4EMK B;  1UDL A;  2H3J A;  4BI4 A;  1UGV A;  1AWW A;  2DJQ A;  1QP3 A;  2HEQ A;  3PNW C;  2DZC A;  1Q81 U;  2DET A;  1AZG B;  5FWC A;  1WXT A;  1VQP Q;  9ATC B;  2RQU A;  2O31 A;  2RNA A;  3JCM X;  4BY6 B;  1H8K A;  2EFI A;  1B07 A;  3WXM B;  3QYH B;  2YUO A;  3M9Q A;  3S3M A;  1RAF B;  4V2S A;  1SRM A;  3MEW A;  2QQA A;  2VVK A;  2JM9 A;  4X9C A;  1EZZ B;  2ROL A;  2RPN A;  3L2Q A;  3U23 A;  1BCM A;  3NTI A;  2EYZ A;  1S1N A;  2KR3 A;  2QDL A;  5LJ3 g;  2SEM A;  3C4S A;  2EIF A;  2NUT B;  5GAN 3;  1N6A A;  3OYI A;  2OAW A;  4IUV A;  1BB9 A;  2A0F B;  2LX7 A;  2LJ3 A;  3RKY A;  4PJO D;  4M77 B;  4PJO C;  1FWZ A;  4LDY A;  5KYU A;  3E19 A;  1G3W A;  3CD6 Q;  2CZ1 B;  5GAO q;  2RHU A;  3UT1 A;  3OA6 A;  1WJR A;  2QAS A;  5GJV B;  3OYL A;  1SSH A;  2JS2 A;  4M75 B;  2ATC B;  1WDX A;  3CCJ A;  3CBP A;  2H8H A;  1BI1 A;  3CME T;  1IHW A;  1WFW A;  1ABO A;  1YI2 T;  3G6E T;  3A8M B;  3REA B;  4XQ3 A;  1UUE A;  1K73 C;  3CEY A;  4II1 A;  4C8Q F;  2CUD A;  2ZPG B;  2CH4 A;  1O9S A;  2AIR B;  3OS1 A;  2V8J A;  2HSE B;  3CXC P;  1JXO A;  4RTZ A;  1PM3 A;  4C92 G;  3QSU A;  3OYE A;  6AT1 B;  4BE0 A;  3EGD A;  3G71 Q;  2ABL A;  5GMK i;  1HSQ A;  1UJY A;  5IH2 A;  5IHK A;  3JCM b;  3CCQ A;  2M51 A;  1Q86 U;  3OSV A;  2LNV A;  4EIK A;  1XNI A;  1G3T A;  3JB9 D;  2DF6 A;  4C0F A;  3HP9 A;  3JAM E;  1NLP C;  2J06 A;  3VS1 A;  1VQK T;  3ER0 A;  3L2W A;  3E1S A;  3VS3 A;  3JSC A;  3LLR A;  1UEB A;  2E6N A;  2RQT A;  2VAS A;  4L59 A;  3L1A A;  2JJ9 A;  4EMK C;  2F5K A;  1M4Z A;  1PD0 A;  2QQB A;  4CC3 A;  4CC2 A;  3OMC A;  2CS7 A;  2NLU A;  4A4E A;  2YUP A;  3VKI A;  4PJJ A;  4ZGD B;  4FYX B;  1WHL A;  4L5G A;  4AG1 C;  3LW5 E;  2D0Q B;  3NTK A;  4AFQ C;  4RTY A;  2DVE A;  4BB7 A;  1I5L A;  3RKW A;  4AFU C;  3V8K A;  3HKS A;  1SHF A;  4QW2 A;  2P0K A;  4A54 A;  3PMI A;  3ULR B;  3C0C A;  4FIB A;  2EPD A;  2W10 A;  3JCM g;  3RMQ A;  4HT8 A;  5D6X A;  2K79 A;  2FRW A;  3QKJ A;  4EDU A;  1H3H A;  2C0T A;  1UE9 A;  1NEB A;  3GIB A;  2JT4 A;  4LDX A;  1RL2 A;  3G1J A;  3NTH A;  2YRD A;  2RQW A;  4LD6 A;  4PNO A;  5LJ3 e;  1WPY A;  1G83 A;  2MWO A;  5KYY B;  5GAM j;  1VYU A;  2VXF A;  2FPF A;  2K3Y A;  3CCV T;  1MHN A;  4JRP A;  2O01 E;  4M75 D;  1W1F A;  4J5Y A;  4M75 C;  7AT1 B;  1M8M A;  3I5R A;  2JTF A;  3RBB B;  4CC4 B;  4QVC A;  3OYC A;  3CCQ Q;  3A98 A;  2B8A A;  1MUZ A;  1PSE A;  2LJ1 A;  2A37 A;  3CCM T;  1Y71 A;  4DBF A;  2GFU A;  2EW3 A;  3M0P A;  2L0A A;  3CME A;  1G2B A;  2ZPE B;  3UPU A;  1YI2 A;  3G6E A;  2YRV A;  1K9M R;  2DAQ A;  1NEG A;  1Q81 C;  3VV0 A;  5GMK j;  2KDS A;  2W0Z A;  2QG9 B;  2HL3 A;  3O8V A;  1KK7 A;  1WHJ A;  2RHY A;  2CKK A;  5CKH A;  4BE1 A;  1QCO A;  3X24 B;  3QHS A;  1IGU A;  2HQH A;  1OU9 A;  5IHN A;  3RNJ A;  1QKW A;  1U06 A;  1SRL A;  1N5Z A;  2VYT A;  2QTX A;  3GBQ A;  4M78 F;  2GQI A;  5KCO A;  3D7S B;  5GMK m;  2MI6 A;  2EQM A;  1WYX A;  5CCA A;  3SHW A;  4DBQ A;  3X20 B;  1VQK A;  1M90 C;  2PVO B;  5DM7 R;  3HRU A;  2V26 A;  4PFZ A;  3HFN A;  1VQ7 A;  1AWO A;  5GAM f;  2D0N A;  5FRM A;  4ZGJ B;  2E3H A;  4HVU A;  5IT9 E;  3H0H A;  1RI9 A;  2XKO C;  2MOX A;  3HHT B;  1WXB A;  4GY5 A;  3OBW A;  1KQS S;  4C8Q B;  2AK5 A;  4OB3 B;  4B9W A;  3HL8 A;  4N4G A;  4IUQ A;  2DEQ A;  4OP0 A;  2MF2 A;  1FMW A;  3M58 A;  4JJC A;  5I21 A;  3VS7 A;  3JCM e;  1NJI R;  2CGH A;  1PSF A;  2M16 A;  4A4K A;  1ZBX A;  3M0U A;  3WVD B;  1I07 A;  4DBH A;  1G3Y A;  3CCU Q;  2LCS A;  1U1S A;  2CSI A;  3PT9 A;  1T0H A;  2RHI A;  3CCV A;  1HD3 A;  3GLX A;  1VQP T;  1PKS A;  4M7D B;  5I11 A;  5GAM h;  4F7U F;  3RR6 A;  4C5E A;  4X9D A;  1WI7 A;  3M56 A; 
#chains in the Genus database with same CATH homology
 1T3S A;  1Z9Z A;  2DLP A;  2ESW A;  3NPF A;  5IXF A;  2K7A A;  3M0T A;  2C0I A;  2YUN A;  3IQL A;  2LNH B;  2K2M A;  4HVV A;  2J7I A;  2V1R A;  4LN2 A;  3TVT A;  2CDT A;  2YT6 A;  4RUG A;  1YNZ A;  2D1X A;  1AWX A;  2LMJ A;  1E7O A;  3NMZ C;  2KGT A;  2KBT A;  3PE0 A;  1V1C A;  1CKB A;  2L3P A;  3CQT A;  2JM8 A;  3H0I A;  2JMA A;  1ZSG A;  1UG1 A;  1GRI A;  2DL7 A;  2FPE A;  2YDL A;  2O9S A;  4IIM A;  3JV3 A;  1NM7 A;  1YWO A;  2FO0 A;  1ZX6 A;  2GNC A;  2K3B A;  1K4U S;  1FYN A;  1AOJ A;  2EBP A;  1MV0 B;  2LJ0 A;  2RF0 A;  4JJB A;  2DX1 A;  4J9B A;  1PRL C;  1Z9Q A;  3I35 A;  4FSS A;  2LP5 A;  4AFS C;  2CSQ A;  2DL4 A;  4Z8A A;  1K9A A;  5FW9 A;  3LH5 A;  5HCK A;  2VKN A;  1AD5 A;  1M3C A;  1WLP B;  1KFZ A;  1U5S A;  5I22 A;  1K76 A;  2KNB B;  1I1J A;  2EGC A;  1OV3 A;  1AEY A;  3NHN A;  3H0F A;  4J9C A;  2CT3 A;  4OMM A;  1UDL A;  2EVR A;  1UGV A;  1K0S A;  1AWW A;  1GBR A;  2DJQ A;  1U3O A;  2HEQ A;  4D8D A;  1VYV A;  1OEB A;  2DNU A;  2A08 A;  1AZG B;  1X27 A;  2SRC A;  5FWC A;  1WXT A;  4Y92 A;  1J3T A;  1RLP C;  2RQU A;  1LCK A;  2O31 A;  2RNA A;  1H8K A;  2P4R A;  4ORZ A;  2FEI A;  1B07 A;  1M27 C;  1PNJ A;  2YUO A;  1PKT A;  2HSP A;  1QCF A;  1SRM A;  2XMF A;  4RTX A;  2VVK A;  2LQN A;  2KRO A;  2JM9 A;  2ROL A;  1JXM A;  1M3A A;  1X43 A;  2RPN A;  1TG0 A;  3TSZ A;  1ZUU A;  3U23 A;  3EHQ A;  2EYZ A;  4LUD A;  1S1N A;  2KR3 A;  2QDL A;  4RTU A;  1UJ0 A;  2X3X D;  2SEM A;  1YCS B;  1VA7 A;  2KRM A;  2B86 A;  2OAW A;  1BB9 A;  2BZX A;  1UHC A;  2LX7 A;  2LJ3 A;  1CSK A;  1OPL A;  1AZE A;  1GFC A;  1A0N B;  1NLO C;  1EFN A;  2GTJ A;  1TUC A;  3PVL A;  4HXJ A;  1K1Z A;  1BBZ A;  2AKL A;  2A36 A;  4AG2 C;  5GJV B;  4OMO A;  1KJW A;  1QWE A;  1SSH A;  1YP5 A;  2BTT A;  2EGE A;  2DIL A;  2JS2 A;  2RMO A;  1WDX A;  2J6K A;  3QWX X;  2H8H A;  4WCI A;  1WFW A;  1ABO A;  3EG1 A;  1CKA A;  3REA B;  3PVQ A;  1UUE A;  2CT4 A;  4CC7 A;  1X6B A;  5FWB A;  1HJD A;  2CUD A;  2CH4 A;  3I9Q A;  3VS0 A;  2GTO A;  2FG0 A;  1JXO A;  4RTZ A;  1WXU A;  4LUE A;  2IIM A;  2L2P A;  5IHI A;  1X2K A;  2E5K A;  1PHT A;  2ABL A;  2MIO A;  1HSQ A;  1UJY A;  3VRZ A;  3M0Q A;  2KRS A;  5IH2 A;  1NYG A;  5IHK A;  2M51 A;  2DMO A;  1X6G A;  4EIK A;  4HVW A;  1BK2 A;  1B3Q A;  2DF6 A;  2DRM A;  3EG3 A;  1NLP C;  2J06 A;  2ENM A;  3VS1 A;  2DE0 X;  3THK A;  3H41 A;  4OMP A;  3VS3 A;  2CRE A;  1PRM C;  2RQT A;  2DVJ A;  1ZBJ A;  2HBW A;  1UEC A;  2KYB A;  3REB B;  1H92 A;  1ZLM A;  2CUB A;  2KE9 A;  2RQV A;  2OJ2 A;  4CC3 A;  4CC2 A;  4GLM A;  2KYM A;  2YUP A;  3ZL7 C;  3UAT A;  1TUD A;  1E6G A;  1M30 A;  2NUZ A;  4R0K A;  2X3W D;  2MCN A;  2JS0 A;  2PZ1 A;  4JPB W;  3VS5 A;  2DBM A;  2DBK A;  2YSQ A;  3VS2 A;  4AG1 C;  4AFQ C;  4RTY A;  2M0Y A;  4AFU C;  1E6H A;  1FMK A;  1GCQ A;  1KSW A;  3EGU A;  1SHF A;  2KT8 A;  1X69 A;  2ECZ A;  5GJW B;  1GFD A;  2NWM A;  3M0S A;  1QWF A;  3ULR B;  3C0C A;  2OI3 A;  2EPD A;  2W10 A;  1ARK A;  4GBQ A;  3EG0 A;  4LE9 A;  2K9G A;  2K79 A;  2FRW A;  3KFV A;  3EHR A;  1H3H A;  2C0T A;  1UE9 A;  1NEB A;  2DL3 A;  2KXD A;  2JT4 A;  1NYF A;  1T3L A;  1M3B A;  2O9V A;  2RQW A;  2CH4 W;  1JQQ A;  1JO8 A;  1W70 A;  4RTT A;  1G83 A;  5L23 A;  2RN8 A;  2BZ8 A;  1GBQ A;  1VYU A;  2FPF A;  2KT1 A;  4OML A;  3UA6 A;  4J9D A;  2J6O A;  4Z89 A;  2F2X A;  1W1F A;  5ECA A;  1W6X A;  2LZ6 B;  2EYW A;  1GL5 A;  1M8M A;  3I5R A;  3RBB B;  1NG2 A;  1ZUK A;  4LNP A;  4CC4 B;  2JXB A;  3A98 A;  2VWF A;  1MUZ A;  4ESR A;  3M0R A;  2F2V A;  3UA7 A;  2LJ1 A;  4J9F A;  2ROT A;  2A37 A;  4J9I A;  2F2W A;  2GGR A;  2EW3 A;  3M0P A;  3O5Z A;  2AKK A;  1UTI A;  2L0A A;  1G2B A;  2PTK A;  1SPK A;  2K6D A;  2J6F A;  3R6N A;  4DEY A;  1NEG A;  3VS6 A;  3I5S A;  1SHG A;  1RLQ C;  4RTV A;  4IIO A;  2EYX A;  2W0Z A;  1UHF A;  1PWT A;  4A63 B;  2O2O A;  4F17 A;  1ZUY A;  2RQR A;  2ED0 A;  4RTW A;  1K0X A;  5IHN A;  3RNJ A;  4E6R A;  1YWP A;  1QKW A;  1OPK A;  1U06 A;  1SRL A;  1N5Z A;  2EGA A;  4KRT A;  1GCQ C;  3GBQ A;  2JW4 A;  1UFF A;  2GQI A;  4J9H A;  2ED1 A;  4F14 A;  1QKX A;  4DEX A;  2C0O A;  2O88 A;  3UF4 A;  1WYX A;  3SHW A;  4QT7 A;  2EQI A;  4D8K A;  2J05 A;  1VYT A;  1WIE A;  2JMC A;  1GCP A;  1SEM A;  1JEG A;  3VRY A;  2FPD A;  1JU5 C;  3EG2 A;  2DRK A;  1ABQ A;  1AVZ C;  1AWO A;  2LQW A;  4AFZ C;  1KIK A;  2D8J A;  2D0N A;  1RUW A;  4M4Z A;  4HVU A;  4JJD A;  3H0H A;  2EYY A;  2KEA A;  1X2Q A;  1RI9 A;  2BZY A;  2V1Q A;  1XOV A;  2PNI A;  2MOX A;  4K11 A;  1WXB A;  4X1V A;  1OOT A;  1MV3 A;  2DL8 A;  4OMQ A;  2DL5 A;  1WA7 A;  2DM1 A;  2KXC A;  3TSW A;  2AK5 A;  3FJ5 A;  2KRN A;  3QWY A;  2G6F X;  2YUQ A;  2GBQ A;  4J9E A;  2AZS A;  3SEM A;  4JJC A;  4OMN A;  1AWJ A;  2A28 A;  3VS7 A;  2EKH A;  5IXB A;  3NGP A;  5EC7 A;  1WX6 A;  4J9G A;  1I0C A;  3VS4 A;  1QLY A;  1Y0M A;  3M0U A;  1I07 A;  2DYB A;  2L3Q A;  4ZNX A;  2HCK A;  1YN8 A;  2L3S A;  2LCS A;  2CSI A;  1T0H A;  1T0J A;  2DA9 A;  4JZ4 A;  1IO6 A;  4Z88 A;  1HD3 A;  1BU1 A;  1Y57 A;  4HCK A;  2D8H A;  2FRY A;  1PKS A;  4F16 A;  5I11 A;  2HDA A;  1WI7 A;  2JTE A;  2AZV A;  2I0N A;  4JZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...