2COWA

Solution structure of the cap-gly domain in human kinesin-like protein kif13b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
100
structure length
100
Chain Sequence
GSSGSSGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the CAP-Gly domain in human Kinesin-like protein KIF13B
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Kinesin-like protein KIF13B
total genus 4
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cowA01
1WHGA 2HL3A 1TOVA 1WHJA 2CP5A 2CP7A 2HKNA 2CP3A 2CP6A 3RDVA 1LPLA 2HL5C 2MPXC 4B6MA 1WHKA 2Z0WA 2E3HA 1IXDA 2CP2A 2QK0A 2M02A 2COYA 2COWA 2CP0A 2HQHA 1TXQA 2E3IA 2HKQB 3TQ7P 2COZA 1WHMA 3E2UA 1WHLA 1WHHA 2E4HA
chains in the Genus database with same CATH superfamily
5I11A 2L89A 4C92A 2DXTA 1QCNA 3OS2A 2ZZDA 2A3LA 2DK3A 4JRKA 5GAMg 2J6OA 3RKYA 1S72Q 2Y4XA 1SRLA 3QJ6A 2E5QA 1M9SA 3BW1A 3FEOA 4X1VA 1S1NA 4QQDA 5LJ5j 2EGCA 2PZ1A 1MV0B 4BE0A 5GAN6 2MK5A 3JSCA 3RESA 1W2BP 4J9HA 1WNLA 5GAOr 2DZCA 3CBPA 1Q81U 4LDWA 2YLBA 1DJ7B 3L1AA 4J83A 4DBRA 4M77B 3R6NA 2JM9A 2E65A 3T9NA 2XDDA 1VQPQ 3S3OA 1GCPA 4PLIA 2M02A 4QQGA 2LCLA 4TVRA 1U3OA 2O31A 1YI2A 3FC3A 2A28A 3TSZA 1K0XA 1H92A 1U5SA 1ZX6A 3M55A 3UF4A 4DA4A 1RABB 4AMCA 1CKBA 4OMPA 1JJ2S 1ZA2B 2QQBA 3QG1A 2MYSA 3RKWA 1X2KA 1VQMA 1NZ9A 2K79A 3CCJQ 5GANh 2YUNA 2LCSA 3CMAT 4QVDA 1JBMA 5GAMh 2EQMA 2LMJA 2FPDA 1XQHA 2DL7A 3TEEA 3H9NA 3EG3A 3GP8A 2QAZA 2GQIA 2XKOC 3OYNA 2FYKA 1PRLC 3BDUA 2DEUA 3H8ZA 3PT9A 1M2VB 1BCOA 1Q81R 3J81E 4C0ZA 2RI5A 3SWNC 5D7UA 5GAN5 3C12A 2YHTA 4BACA 3HP9A 2A08A 1XNIA 1IGUA 1W1FA 3JCMV 2DJQA 4FM4B 3CMAQ 2CYZB 2JS2A 2LQ8A 2A37A 3GBQA 4HCKA 2QA4T 5IH2A 2JOYA 3FIFA 3BDLA 3L42A 1M8VA 5IHIA 3QZ9B 1X6OA 5C6SA 2QQ9A 1YJWQ 1VQ5A 2K5LA 2XDPA 2QTXA 1HXDA 2FRWA 2AT1B 5IT9E 2EYXA 2L5QA 3V7RA 3M0UA 1Y71A 2DE0X 1MGQA 4CC3A 1VYTA 2BKDN 3MEWA 1Y96B 3JB9F 4ZGEB 3CQTA 1UJYA 2VUBA 5FWBA 2EPDA 3VS1A 1YITQ 2BE7D 1YI2T 2I0NA 1RADB 2XHCA 4ZNXA 4B6MA 1PSFA 1X69A 1QVFA 1MV3A 5KYWB 2KGTA 3P8BB 5IHKA 2YWWA 3GNGA 4F7UG 1QCOA 2DTHA 4B9WA 1D0YA 2NWMA 1G3WA 4Z8AA 1QVFS 1VQ8A 1VQLT 2JNGA 1WA7A 3EFSA 3OMGA 2E70A 1BIAA 3E9FA 3HRSA 4AG1C 3CD6T 3V8LA 5HK3A 2HMAA 2JJ9A 1NLPC 1G8XA 4NS5A 2FPFA 2LNHB 1WQ7A 4ZTFA 1LNXA 4C92E 2HDAA 1WXBA 2OTLQ 2D6FA 2O4XA 5CKBA 1B7TA 2DPPB 3LH0A 2RHZA 2YRCA 3OB9A 4DBFA 2PUKB 3VS5A 4JRIA 4Y92A 1G83A 2DTIA 3CCVQ 2VB6A 3KUFA 4AG2C 1OX9A 4HCZA 3MP1A 3VUBA 2COZA 1OZ2A 3RMSA 2DXCA 2DJZA 1UUEA 3QYHB 1Y57A 2JTFA 3I5SA 4BE2A 2KEAA 1PHTA 2FL7A 3EH1A 4F14A 2FG0A 2X3XD 5CKDA 1KQSP 2O9VA 3EHQA 4PLLA 1RAAB 1VQ6T 5LJ3d 1IB8A 1KHCA 3A8GB 1VQLA 2KR3A 1N8RC 1I5LA 1AVZC 4JDSA 4HVVA 4M77A 2VGNA 2RK1A 4J7FA 3Q1JA 2XICA 3VS0A 3CC2A 2CP7A 3RIRA 3M4YA 3ULRB 2VV5A 2M0OA 3LX7A 2X4YA 1AEYA 4E47A 1H3HA 3KFVA 2BZ8A 1WGSA 3S6WA 5GJWB 5AYFA 3OY9A 2D1XA 2A7YA 2D8JA 1U1TA 2JMAA 1SPKA 2E41A 2K57A 3RBBB 3NHNA 3CCST 4CRIA 4M7AF 1N9RA 2LX9A 4C92F 2EW3A 1FYNA 4J9BA 1M2OA 4M78D 3L2QA 2Y4YA 5GAN8 1X43A 3G1JA 4IIOA 4M75D 1Y7XA 1NJIU 1N6AA 3EG2A 4XK8E 1NBEB 1ZBJA 3OBYA 1M1GA 2RQUA 1UECA 1VQMQ 1RLPC 1HD3A 1GCQA 2MI6A 1PC0A 4R0KA 4WTOB 5KYXB 4XU0A 2JXBA 4MMKA 4OF1A 2DILA 1VQKQ 3PFSA 3VU3C 2DZ9A 2OAWA 5GAN4 4ZN3A 1Y07A 2KVQG 1RI9A 2XIDA 3TREA 1NLOC 5A0GA 1WHGA 3EFOB 3CBMA 5LJ3h 2IG0A 5IN1A 5CKEA 2XDBA 2OTJA 1SG5A 3MO8A 2D8HA 5GAN2 1WLPB 1MMGA 4C8QD 1TU0B 3REBB 3KBGA 3QHSA 3CCLT 5LJ3g 3JB9H 2V1RA 1UE9A 1VIEA 2EVRA 3CCUT 1VOMA 4PFOA 1X6GA 3M58A 3M54A 1FMKA 4C92G 1FXXA 5GAMd 1YN8A 4C0DC 3QIIA 5FU6C 4MZPA 3CPWS 1YIJT 1H3ZA 2DERA 1QP3A 2DEQA 1O9SA 2RJFA 2DIQA 1HJDA 4C5HA 1M1FA 2CKKA 2FVUA 2RHYA 4FIBA 2QXFA 1YJ9T 2RI3A 1YJNA 2ZPFB 3IQLA 4FYVB 4F16A 2KDSA 2JUFA 2FB7A 1M1KC 1VYVA 4E7HA 4EMKA 3EG9A 1TH7A 1Q82C 3PGGA 4M78F 2P0KA 3FJ5A 2V8IA 1WX6A 3VS6A 4DBHA 3EFRA 5GAOl 4OB0B 1G3YA 1H8KA 2KXCA 2HL3A 2AZVA 3UT1A 2HKNA 1G5VA 2PVDB 5J39A 4Y91A 1WPYA 2EGAA 5GANe 2LT4A 4JJBA 3FLGA 2JVVA 5DM7R 2DL4A 1MMAA 1QVGS 2X35A 4M78B 2W0ZA 4A63B 2XK0A 9ATCB 1E6GA 3PTAA 4PFPA 4N4HA 1BI1A 4M7AC 1VQ6Q 1UTIA 1GFDA 2HZYA 5CVIA 4LD9K 1KFZA 3CCVA 2QEXT 2LTOA 4PJOD 1YHQQ 4GLMA 3NPFA 4RTVA 2MOXA 2COWA 1ZBXA 4N4IA 1V76A 1W2BA 1I4K1 2E6NA 1Q7YU 5DLQE 2DL5A 5L23A 2KRMA 2RA2A 5GAOp 1QLYA 3MKDA 1NJIR 1AZGB 1WHKA 5A0LA 4KRTA 2NUTA 1VQ7Q 2YLCA 2HBPA 4J9DA 3OMCA 3CMEA 2ZAEA 3WVDB 2GFUA 5DY9A 4M77F 1VQ9T 1H641 3UA6A 4GY5A 1N5ZA 1GRIA 5CK9A 4PJNA 1B3QA 4E6RA 3JB9I 1KD1U 3SFMA 3GIBA 4JPBW 2GCXA 1PWTA 2DLPA 4FYYB 4KT0E 3M0PA 2E64A 4J5YA 3VS4A 3D7SB 5J26A 4DEXA 1D1AA 1YJWA 2L2PA 2RO0A 1HSQA 1VQ5Q 3EG9B 2C06A 1PRMC 1XTDA 3M57A 2E5KA 3AT1B 4A54A 4LE9A 1TS9A 1JB0E 4VUBA 3EH2A 2M9UA 2MWOA 4QT7A 3SHWA 4DOWA 2ZCFB 3NTHA 3VYHB 1JXMA 1C0MA 2CGHA 4OGCA 1JXOA 4XQ3A 4LUDA 4IUPA 3C0CA 3QXEB 2K3XA 3I56A 4NOYA 3A8LB 2LRQA 1E6HA 3LH5A 1K73C 2CZ0B 1VQNT 1YJ9Q 2H3JA 3A8HB 2Y90A 1Z9ZA 3GPLA 2J7IA 3QSUA 1VQNA 4BUGA 1WQWA 4CC2A 1I5OB 2HSPA 4AT1B 1YWPA 3MPUB 2ED1A 3R6OA 2CH4W 2OJ2A 5C0MA 2BZXA 4FW1A 3I5RA 1WDXA 2K5FA 1JJ2A 3INZA 4KGXB 3FB9A 3QBYA 4M7AD 4JZ3A 2ECZA 3P8DA 2RF0A 5IHNA 3CXCP 3JCMc 5LJ5g 4CC4B 4Z02A 4RCCA 4OP0A 1NG2A 4M7AB 3I55A 3CCQT 2XI9A 1FWZA 5FROA 2F2XA 4X34A 2VXEA 3A5ZB 4ELZC 3LYIA 5D6XA 3S3NA 1K9MR 1U06A 3M0QA 1BKBA 1SSFA 1VYUA 4B9XA 1KC8U 1ZLMA 1Q7YR 1M3BA 1QWEA 2V8KA 4DQ2A 2GTOA 2LJ3A 3OSVA 2GQVA 1EIFA 2NUTB 1UEBA 1AHJB 3CMET 2FZCB 2KT8A 4KH0B 2YUPA 2BTTA 4K11A 2CDTA 4C0GA 5GAMf 2RHXA 4PNOA 3QUIA 1LPLA 4L6V5 2J06A 3JCMe 3H0HA 2DNUA 3EGXA 2EYZA 2LC4A 4JLGA 1SSHA 3E19A 2EQJA 1VQPA 1KSWA 4FT4A 3DLMA 3JCMh 5KYNA 3FDRA 3E2UA 2K7AA 5CKFA 1RAIB 3EFOA 2DM1A 2EAYA 3G6ET 1VQ7T 3A1PA 4Z88A 2O88A 2YSQA 4UC4A 4N0AA 1OU9A 4IKFA 4M7DC 3G6EQ 4BI4A 1ACMB 2P0QA 1CSKA 4C8QF 3TU4K 2JM8A 5GAMe 3CCJA 4A4HA 4NL3A 1WHLA 4M75C 1N27A 4OMQA 2YRDA 1NYFA 4FU6A 4FCYA 5I2SA 5LJ3j 2M16A 2F69A 2RPNA 1BI0A 8ATCB 2LQNA 3I35A 3CCEQ 5GANj 1BB9A 1FMVA 1HYOA 2D0NA 2CREA 2EKHA 2DMOA 3V7CA 2GGRA 3LW5E 2IVWA 1Q86C 3CMAA 2X3WD 2BE9B 2EIFA 2HNIA 2R57A 4M77E 1K8AR 2CP3A 1T3SA 2RHIA 1ZQ1A 2HEQA 4RG8A 1NEGA 3CXCA 1S72A 2EFIA 2RI2A 2JTMA 3QKJA 3OA6A 2K9GA 4PJOG 4RMOA 4A4GA 2MAMA 4M77C 1X27A 1KQ1A 1W6XA 2KE9A 4M77D 2CP0A 1E7OA 3GLXA 1QP2A 5GANd 4MDXA 2DXBA 2MF2A 1QW1A 2HSEB 2H8HA 2EYQA 2IIMA 2DETA 2NUPA 5KH6A 4IUUA 2CP6A 4F7UA 4PJJA 3H41A 3CCQA 2WSEE 4MMLA 3X25B 2KT1A 2K2VA 1ABOA 2CP2A 4ELYC 2QQAA 4GBQA 2ZPBB 2EQIA 1TUDA 2DD4A 1QMCA 1VQKA 3CCLA 2DKGA 1YI2Q 5A2QE 1LJOA 3BFMA 1U1SA 2RM4A 1UHCA 2LJ1A 2DVJA 2QA4Q 2QI2A 2R5AA 1UDLA 3SB2A 1K8AU 3CCUQ 1RAFB 2EYYA 4PJOF 3UDCA 5CO7A 2CUBA 4KULA 3CCQQ 1YJ9A 3OW2S 5IXBA 4ZGJB 3I9QA 2AKKA 5KE3A 3CCLQ 1RUWA 3X28B 3SDZA 2AHJB 2OTLA 3DB3A 5FRNA 3VKIA 4HKEA 2BZYA 2O4XB 1SHGA 1KQSS 7AT1B 1Q7YC 1M5Q1 2X9HA 1ZSGA 2MWPA 4IIMA 3QDFA 3CCVT 3QJYA 3CCRQ 1G2BA 2E10A 5GAMj 4II1A 2DFUA 1K9MC 1D1BA 2DF6A 2PU9B 1WHHA 4X9CA 2X4JA 1XJWB 2L3PA 1TUGB 2P4RA 3NTKA 1IZ6A 1GBQA 4HA8A 4LXCA 3PVQA 2SEMA 1PCXA 3I55T 3LWIA 1BIBA 3U23A 3JB9D 2QK0A 3A98A 1M8MA 3G71A 5EG2A 3H0IA 1B07A 2O2OA 1K4US 3MCAB 4PL6A 4OMLA 3OYKA 3OYFA 4XTUA 1Y96A 2DX1A 5GANg 2E1HA 4M75F 1ZSZC 3L2VA 4E7IA 4XU2A 3E9GA 3RR6A 1GFCA 4XTXA 2KBTA 4E7JA 1IHWA 4C8QE 1KHIA 2MIOA 1X2QA 1R77A 4RCBA 4RTXA 6AT1B 2DRMA 1Q95G 1K1ZA 1ZSZB 4J9EA 4WCIA 4ZTJA 2CP5A 3JV3A 4BI3A 1M30A 4BD3A 3O8VA 3QYGB 2QEXQ 2RQRA 1EZZB 2LCCA 1UHFA 3ER0A 2CSQA 1D09B 1M27C 5LL6S 2WACA 3FRNA 5CAIA 1ZUUA 1VQPT 5GMKl 4C0FA 3JCMf 2NUPB 1YNZA 2KRNA 4FYXB 3VRYA 5D6WA 8AT1B 1VQ5T 1RACB 2KRSA 3OYDA 2VWFA 4F04B 4EMHA 3RDVA 2X4XA 4M7AA 2CZ1B 2QDLA 2V26A 4J9IA 1C6VX 2FPEA 4E7SA 1I81A 3M9QA 2K3BA 4FYWB 3CC7T 2JW4A 2LJ0A 3OW2P 3JRZA 4LDYA 3A8OB 3M0SA 1ARKA 5AT1B 4Z89A 2D0QB 3OYJA 2EWNA 2GF7A 4M75G 4BDYA 3VYGA 2LZ6B 1RL2A 4OMNA 2GNCA 3QZ5B 1KQSA 1KQ2A 3GNFB 3SD4A 5I21A 4F17A 1WJRA 2JT4A 5KYWA 4AFQC 4M7DG 5CKHA 1GXIE 4KUIA 2M51A 1RAHB 2QTVA 1YITT 4GLKA 3NGPA 4ZN1A 4DOVA 2LDMA 2DBMA 4RUGA 4M4ZA 3MHXA 2PTKA 1UG1A 5LJ5d 4HCCA 3OS1A 2MMPA 2JZ2A 4A4EA 3GOXA 3EAEA 2ED0A 1BBZA 1JU5C 1T0HA 4QQ6A 3OYMA 3OYGA 3OYAA 2PVGB 2B86A 4J9FA 3GF5A 4LUEA 4C0DB 3NFCA 1YIJA 4PK4A 3JCMW 3EGXB 1PNJA 4ESRA 1VQ8T 2QA4A 2FO0A 2P84A 3C4SA 3UWNA 1I0CA 3I56Q 1K73R 3M4GA 4FL6A 2RQWA 4Q5WA 3CCUA 1UJ0A 3CC4T 3JCMJ 2H3EB 4C8QB 4M75A 1BI3A 4RTUA 4XTZA 3VS3A 2RK2A 2CT3A 1G3TA 3KXTA 2IPOB 1YIJQ 4JZ4A 2HCKA 4C92D 3H6ZA 1JRIA 1UGRB 2B8AA 2SRCA 2C0OA 4ZGDB 4EMKC 3OW2A 1KK7A 2NLUA 1S72T 2PQWA 4F7UE 2LQKA 3CC4Q 2L8DA 4N4GA 1UB4A 3CCRA 2HL5C 4FSXA 2AK5A 1HK9A 3CPWP 1OZ3A 2BUDA 2YRVA 3NTIA 2E3HA 2LQWA 3O5ZA 2RB6A 3VJPA 3P8HA 1NYGA 4FT2A 1QCFA 1WXTA 4PJOA 2CUDA 2X51A 1BU1A 5KYYB 3OYEA 5FLXE 3QWYA 4N0AC 4OGEA 3CEYA 3QO3A 2GFAA 4J9GA 4LN2A 1PSEA 4KGZB 4OMOA 1Z9QA 3SWNA 3JB9J 2KROA 3VS2A 1VA7A 3OYCA 4OMFB 3CC7A 2EJGA 4A53A 2P0PA 3H0FA 3V8JA 1R0CB 5GMKh 2F2VA 2QASA 2C0TA 2O9SA 1LVKA 4XAXB 2CSIA 5GAN3 2R5MA 3CCMT 1QQJA 1OPLA 2RHUA 4AFSC 1NJIC 3G7ZA 4D8DA 1QKWA 4RG2A 1NM7A 4C5EA 1AWXA 3CCMA 4J8OA 1IREB 2RD1A 4Y28E 4PJOB 5GAOn 1WIEA 3HRUA 2EJFA 2K6DA 2QEXA 5M9OA 5GJVB 4C8QG 3HTRA 4ORZA 2P4TA 2C0IA 1WFWA 4J6YA 4QVZA 2FZKB 1JO8A 4J6XA 3CCET 2AIRB 4XTVA 2AKLA 3ZEHA 1KC8R 1GBRA 1LCKA 3CBOA 1IGQA 2ENMA 2E4HA 2QGFB 2M0YA 3ZL7C 1KD1C 4XTYA 3OS0A 1VQOA 1VQ9Q 3TVTA 3M0RA 2V8JA 1MNEA 5LJ5e 4M78C 4C8QA 1PG5B 2EJ9A 5FU7B 3OYIA 3L2UA 2FRYA 1VQ4A 3HSBA 4IUQA 1RAEB 5A0DA 1F1BB 4EMGA 1WHJA 1ZUYA 2XG8D 4R55A 3WXMB 3JCMb 1OYXA 1N8RU 4A4FA 2YUQA 1VQNQ 1OU8A 1VQOQ 4M78A 1TUCA 2K2MA 4M78G 3CD6A 2F5TX 3OYLA 1K0SA 1TSFA 4M75E 1OPKA 2QYZA 3ME9A 1M90C 1QVPA 2DYBA 2LNVA 3F70A 3LWHA 5KYUB 1D3BB 5KCHA 2LP5A 2NYSA 1JQQA 4M7AG 4XTWA 5GAOm 3OYHA 3CPFA 1N8RR 2KMTA 2OX7A 4L5GA 4JRPA 2MCNA 2F5KA 2YXYA 3OYYA 3JCMQ 4R56A 1VQLQ 1GL5A 2OTJQ 1AZEA 2RNAA 2XD0A 2RN8A 1IRXA 4OB1B 4FW2A 1OV3A 2DA9A 3HFNA 1PD1A 1Y0MA 3CD6Q 3E1SA 2E6ZA 5FU6B 4C8QC 3PMTA 3DLLA 1I8FA 1MMNA 4RTWA 2ZGWA 5GMKi 2XU8A 2EQKA 4MZTA 4M7DF 3MJXA 4FSSA 3META 4WF2A 5LJ3f 1FMWA 3MP8A 5HK0A 1RI0A 3VV0A 2HAXA 4PJMA 2JN0A 5CIUA 2K3YA 3L2WA 1V1CA 3HPWA 4E7KA 4EIKA 5GAOq 1QVGA 3ZBDA 5CQXA 2KI7A 4YTLA 1YHQT 1MUZA 4HCBA 1AWOA 2F1LA 4NL2A 5IXFA 5D6YA 1M1KU 2DD5A 2OI3A 4XU3A 4KGVB 3CC4A 1JEGA 3VS7A 1KC8C 2KAFA 4C92C 5KYXA 1ABQA 4PKCC 4F7UF 5FW9A 4IURA 1VQ9A 2CZ7B 2FHDA 4X9DA 3X20B 3EG0A 1W4SA 1PD0A 2A36A 1TTHB 3ZFJA 3CCSA 1UGQB 2G6FX 5KYYA 1B34B 2HKQB 3G6EA 3HKSA 1KJWA 2K5IA 4M7DB 2AZSA 5HKCA 3L2ZA 1ZUKA 3EGUA 1LOJA 4M75B 2DRKA 3N5BB 4DBQA 3C94A 3PE0A 3MEVA 1IO6A 3RUXA 3CC2T 5GMKm 1SRMA 2ZPGB 1U8RA 1OI1A 3CCSQ 2ZPEB 2J05A 3X24B 1N9SA 4ANJA 3CC2Q 4MZMA 3CCJT 1I1JA 2QDYB 1ZA1B 4LDUA 1RAGB 4D8KA 1KIKA 4RTTA 1UFFA 3CCMQ 3G4SA 3SEMA 1VQ7A 3V7SA 4BY6B 1UGVA 2HQHA 1OX8A 2F2WA 1OEBA 1T0JA 1C1AA 3LGFA 3LLRA 2KXDA 5DLOA 1V29B 5HCKA 1PM3A 4C5GA 2WSFE 1IHVA 1WZOA 4M78E 4LD6A 1D3BA 2NUZA 3G71T 2LT1A 2HD0A 1YJWT 1QKXA 1NPPA 3QDRB 2DAQA 1VQMT 2EBPA 3MP6A 2EQUA 2VKNA 2X4WA 4DEYA 2RJEA 4D6WA 4E7LA 3G4SQ 1EX4A 3PIPA 5FRMA 1K9AA 1P92A 1TOVA 1VQOT 4JJNK 1AOJA 3MEAA 4JJDA 2VASA 5I2MA 4OMMA 1FX7A 2DBKA 5GMKj 2PUOB 3QPHA 4MDWA 5I22A 1VQ8Q 1G3SA 2DIGA 1OOTA 1WI7A 1WHMA 2DVEA 4OVAA 1A0NB 1BYMA 2DL8A 1Q82U 1WXUA 1VQ6A 1MNDA 5LJ3e 2DL3A 1UGPB 1BCMA 4M7DE 1YWOA 3EG1A 1R0BG 3BE3A 2VGMA 4QW2A 3JCMP 1WYXA 2FZGB 3DKMA 3URGA 1X75C 2OAUA 3X26B 1TWBA 1JJ2P 1K8AC 4V2SA 3TSWA 2KSSA 1Q82R 2KK4A 4RTZA 4BE1A 5CQYA 1ZHIA 1M1KR 3RMQA 2ESWA 2ROTA 4JUVA 3UPUA 1Q86R 2O01E 1YCSB 4PJLA 1D0XA 4RKUE 1GCQC 4QKUA 1SHFA 3A8MB 4HXJA 1YITA 2W10A 4LDXA 3VUZA 3CMEQ 2GBQA 2RQVA 5ECAA 2QGGA 2EKOA 3RKXA 3I56T 4PFZA 2QG9B 4JS5A 1M4ZA 3HHTB 1Q86U 2L3RA 2FEIA 3S3MA 1K73U 2JMCA 2VVKA 1Q81C 1D0ZA 1NEBA 4P5NA 2EGEA 2JTEA 3M0TA 4EPCA 3I55Q 5CR2A 3SWNB 3M5AA 2OTLT 2A0FB 3DB4A 2WSCE 3MEUA 4J9CA 4JJCA 3JAME 1M2VA 3JCMX 5GANf 1NPRA 1O75A 1WJSA 1M3AA 3UA7A 3M59A 3C95A 5FU7C 1B34A 4C5IA 4JS4A 1YJNT 2L3QA 2KYMA 1BI2A 2D9TA 1YP5A 1T3LA 2J6KA 2VC8A 2ABLA 2YUOA 4J6WA 2CT4A 2PVOB 2DXUA 1YCYA 2CZ6B 4BB7A 5GAN7 4LNPA 1IXDA 2ATCB 4EDUA 2ROLA 4JLIA 3OQ5A 4OB2B 5L8RE 1MHNA 1R8OB 4LDVA 1YBYA 3L2RA 1KG1A 2ZPIB 4PJOE 3AHUA 3CC7Q 4BDZA 2RJCA 3TCJA 5KE2A 2LX7A 3UATA 1VQ4Q 4OB3B 1QVGP 1J3TA 3JB9G 2RMOA 3PMIA 1PKTA 4HT8A 4RTYA 1VQ4T 3J7AF 3HL8A 4ME7A 3G71Q 2KYBA 4JRQA 2DO3A 4CI0C 3RERA 4KBMB 4F7UB 5LJ5h 1VQKT 2DYIA 3JCMg 1AWJA 1RLQC 3V8KA 1SKUB 2PNIA 2HQXA 4C92B 2BIVA 1CKAA 2MPXC 4ATOA 1SEMA 3CXCS 1NE8A 2DTOA 1WJQA 2KNBB 1ZSZA 4J7IA 2HBWA 3BY7A 3THKA 2EYWA 4EMKB 3LGLA 4KH1B 2GTJA 2HQEA 3ASKA 4M7DA 3M53A 1M3CA 2LVMA 4HT9A 1OULA 3PNWC 1UGSB 5IAYA 2G3RA 3G4ST 2K4YA 1X6BA 2R58A 5EC7A 5KCOA 1AT1B 3CPWA 4M7DD 3OSSC 3QWXX 4BI8B 2E12A 3RNJA 2Z0WA 2XMFA 1M90R 3OYBA 1SF9A 4AFZC 4M77G 1OQKA 2COYA 1PKSA 4PJOC 2M1HA 1TG0A 1VIFA 3NMZC 2OTJT 1XOVA 1W2BS 4XU1A 2JS0A 3J80E 4O5VA 5FWCA 1MMDA 4KUDK 1M90U 3EGDA 3M56A 2KQWA 2RQTA 3OS5A 3EGDB 1TXQA 4CC7A 2I2LA 1EFNA 3TQ7P 4QVCA 4AFUC 1YFNA 2QQSA 1AWWA 1W70A 1KD1R 1VUBA 2YT6A 3PVLA 1K9MU 2CH4A 4IUTA 3PIOA 5CCAA 3REAB 2RH2A 1QVFP 2KY9A 4IUVA 1AD5A 4HVUA 2VYTA 5J3BA 4A4KA 4BY6C 1QWFA 2VXFA 4M7AE 2ZPHB 3EHRA 2RJDA 2E3IA 1I07A 2J6FA 3HFOA 2YDLA 2L3SA 4L59A 3HRTA 5HY6A 4E2FB 4HVWA 1YHQA 3OBWA 3FJPA 3CCEA 5KYUA 1K76A 4E7ZA 2L0AA 1YJNQ 1BK2A 2V1QA 3JCMd 3VRZA 5GMKe 2QQRA 4O6JA 5LJ5f 3CCRT 2CS7A 3WVEB 1D1CA 1X01A
chains in the Genus database with same CATH topology
1WHGA 2HL3A 1TOVA 1WHJA 2CP5A 2CP7A 2HKNA 2CP3A 2CP6A 3RDVA 1LPLA 2HL5C 2MPXC 4B6MA 1WHKA 2Z0WA 2E3HA 1IXDA 2CP2A 2QK0A 2M02A 2COYA 2COWA 2CP0A 2HQHA 1TXQA 2E3IA 2HKQB 3TQ7P 2COZA 1WHMA 3E2UA 1WHLA 1WHHA 2E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHG A;  2HL3 A;  1TOV A;  1WHJ A;  2CP5 A;  2CP7 A;  2HKN A;  2CP3 A;  2CP6 A;  3RDV A;  1LPL A;  2HL5 C;  2MPX C;  4B6M A;  1WHK A;  2Z0W A;  2E3H A;  1IXD A;  2CP2 A;  2QK0 A;  2M02 A;  2COY A;  2COW A;  2CP0 A;  2HQH A;  1TXQ A;  2E3I A;  2HKQ B;  3TQ7 P;  2COZ A;  1WHM A;  3E2U A;  1WHL A;  1WHH A;  2E4H A; 
#chains in the Genus database with same CATH topology
 5I11 A;  2L89 A;  4C92 A;  2DXT A;  1QCN A;  3OS2 A;  2ZZD A;  2A3L A;  2DK3 A;  4JRK A;  5GAM g;  2J6O A;  3RKY A;  1S72 Q;  2Y4X A;  1SRL A;  3QJ6 A;  2E5Q A;  1M9S A;  3BW1 A;  3FEO A;  4X1V A;  1S1N A;  4QQD A;  5LJ5 j;  2EGC A;  2PZ1 A;  1MV0 B;  4BE0 A;  5GAN 6;  2MK5 A;  3JSC A;  3RES A;  1W2B P;  4J9H A;  1WNL A;  5GAO r;  2DZC A;  3CBP A;  1Q81 U;  4LDW A;  2YLB A;  1DJ7 B;  3L1A A;  4J83 A;  4DBR A;  4M77 B;  3R6N A;  2JM9 A;  2E65 A;  3T9N A;  2XDD A;  1VQP Q;  3S3O A;  1GCP A;  4PLI A;  2M02 A;  4QQG A;  2LCL A;  4TVR A;  1U3O A;  2O31 A;  1YI2 A;  3FC3 A;  2A28 A;  3TSZ A;  1K0X A;  1H92 A;  1U5S A;  1ZX6 A;  3M55 A;  3UF4 A;  4DA4 A;  1RAB B;  4AMC A;  1CKB A;  4OMP A;  1JJ2 S;  1ZA2 B;  2QQB A;  3QG1 A;  2MYS A;  3RKW A;  1X2K A;  1VQM A;  1NZ9 A;  2K79 A;  3CCJ Q;  5GAN h;  2YUN A;  2LCS A;  3CMA T;  4QVD A;  1JBM A;  5GAM h;  2EQM A;  2LMJ A;  2FPD A;  1XQH A;  2DL7 A;  3TEE A;  3H9N A;  3EG3 A;  3GP8 A;  2QAZ A;  2GQI A;  2XKO C;  3OYN A;  2FYK A;  1PRL C;  3BDU A;  2DEU A;  3H8Z A;  3PT9 A;  1M2V B;  1BCO A;  1Q81 R;  3J81 E;  4C0Z A;  2RI5 A;  3SWN C;  5D7U A;  5GAN 5;  3C12 A;  2YHT A;  4BAC A;  3HP9 A;  2A08 A;  1XNI A;  1IGU A;  1W1F A;  3JCM V;  2DJQ A;  4FM4 B;  3CMA Q;  2CYZ B;  2JS2 A;  2LQ8 A;  2A37 A;  3GBQ A;  4HCK A;  2QA4 T;  5IH2 A;  2JOY A;  3FIF A;  3BDL A;  3L42 A;  1M8V A;  5IHI A;  3QZ9 B;  1X6O A;  5C6S A;  2QQ9 A;  1YJW Q;  1VQ5 A;  2K5L A;  2XDP A;  2QTX A;  1HXD A;  2FRW A;  2AT1 B;  5IT9 E;  2EYX A;  2L5Q A;  3V7R A;  3M0U A;  1Y71 A;  2DE0 X;  1MGQ A;  4CC3 A;  1VYT A;  2BKD N;  3MEW A;  1Y96 B;  3JB9 F;  4ZGE B;  3CQT A;  1UJY A;  2VUB A;  5FWB A;  2EPD A;  3VS1 A;  1YIT Q;  2BE7 D;  1YI2 T;  2I0N A;  1RAD B;  2XHC A;  4ZNX A;  4B6M A;  1PSF A;  1X69 A;  1QVF A;  1MV3 A;  5KYW B;  2KGT A;  3P8B B;  5IHK A;  2YWW A;  3GNG A;  4F7U G;  1QCO A;  2DTH A;  4B9W A;  1D0Y A;  2NWM A;  1G3W A;  4Z8A A;  1QVF S;  1VQ8 A;  1VQL T;  2JNG A;  1WA7 A;  3EFS A;  3OMG A;  2E70 A;  1BIA A;  3E9F A;  3HRS A;  4AG1 C;  3CD6 T;  3V8L A;  5HK3 A;  2HMA A;  2JJ9 A;  1NLP C;  1G8X A;  4NS5 A;  2FPF A;  2LNH B;  1WQ7 A;  4ZTF A;  1LNX A;  4C92 E;  2HDA A;  1WXB A;  2OTL Q;  2D6F A;  2O4X A;  5CKB A;  1B7T A;  2DPP B;  3LH0 A;  2RHZ A;  2YRC A;  3OB9 A;  4DBF A;  2PUK B;  3VS5 A;  4JRI A;  4Y92 A;  1G83 A;  2DTI A;  3CCV Q;  2VB6 A;  3KUF A;  4AG2 C;  1OX9 A;  4HCZ A;  3MP1 A;  3VUB A;  2COZ A;  1OZ2 A;  3RMS A;  2DXC A;  2DJZ A;  1UUE A;  3QYH B;  1Y57 A;  2JTF A;  3I5S A;  4BE2 A;  2KEA A;  1PHT A;  2FL7 A;  3EH1 A;  4F14 A;  2FG0 A;  2X3X D;  5CKD A;  1KQS P;  2O9V A;  3EHQ A;  4PLL A;  1RAA B;  1VQ6 T;  5LJ3 d;  1IB8 A;  1KHC A;  3A8G B;  1VQL A;  2KR3 A;  1N8R C;  1I5L A;  1AVZ C;  4JDS A;  4HVV A;  4M77 A;  2VGN A;  2RK1 A;  4J7F A;  3Q1J A;  2XIC A;  3VS0 A;  3CC2 A;  2CP7 A;  3RIR A;  3M4Y A;  3ULR B;  2VV5 A;  2M0O A;  3LX7 A;  2X4Y A;  1AEY A;  4E47 A;  1H3H A;  3KFV A;  2BZ8 A;  1WGS A;  3S6W A;  5GJW B;  5AYF A;  3OY9 A;  2D1X A;  2A7Y A;  2D8J A;  1U1T A;  2JMA A;  1SPK A;  2E41 A;  2K57 A;  3RBB B;  3NHN A;  3CCS T;  4CRI A;  4M7A F;  1N9R A;  2LX9 A;  4C92 F;  2EW3 A;  1FYN A;  4J9B A;  1M2O A;  4M78 D;  3L2Q A;  2Y4Y A;  5GAN 8;  1X43 A;  3G1J A;  4IIO A;  4M75 D;  1Y7X A;  1NJI U;  1N6A A;  3EG2 A;  4XK8 E;  1NBE B;  1ZBJ A;  3OBY A;  1M1G A;  2RQU A;  1UEC A;  1VQM Q;  1RLP C;  1HD3 A;  1GCQ A;  2MI6 A;  1PC0 A;  4R0K A;  4WTO B;  5KYX B;  4XU0 A;  2JXB A;  4MMK A;  4OF1 A;  2DIL A;  1VQK Q;  3PFS A;  3VU3 C;  2DZ9 A;  2OAW A;  5GAN 4;  4ZN3 A;  1Y07 A;  2KVQ G;  1RI9 A;  2XID A;  3TRE A;  1NLO C;  5A0G A;  1WHG A;  3EFO B;  3CBM A;  5LJ3 h;  2IG0 A;  5IN1 A;  5CKE A;  2XDB A;  2OTJ A;  1SG5 A;  3MO8 A;  2D8H A;  5GAN 2;  1WLP B;  1MMG A;  4C8Q D;  1TU0 B;  3REB B;  3KBG A;  3QHS A;  3CCL T;  5LJ3 g;  3JB9 H;  2V1R A;  1UE9 A;  1VIE A;  2EVR A;  3CCU T;  1VOM A;  4PFO A;  1X6G A;  3M58 A;  3M54 A;  1FMK A;  4C92 G;  1FXX A;  5GAM d;  1YN8 A;  4C0D C;  3QII A;  5FU6 C;  4MZP A;  3CPW S;  1YIJ T;  1H3Z A;  2DER A;  1QP3 A;  2DEQ A;  1O9S A;  2RJF A;  2DIQ A;  1HJD A;  4C5H A;  1M1F A;  2CKK A;  2FVU A;  2RHY A;  4FIB A;  2QXF A;  1YJ9 T;  2RI3 A;  1YJN A;  2ZPF B;  3IQL A;  4FYV B;  4F16 A;  2KDS A;  2JUF A;  2FB7 A;  1M1K C;  1VYV A;  4E7H A;  4EMK A;  3EG9 A;  1TH7 A;  1Q82 C;  3PGG A;  4M78 F;  2P0K A;  3FJ5 A;  2V8I A;  1WX6 A;  3VS6 A;  4DBH A;  3EFR A;  5GAO l;  4OB0 B;  1G3Y A;  1H8K A;  2KXC A;  2HL3 A;  2AZV A;  3UT1 A;  2HKN A;  1G5V A;  2PVD B;  5J39 A;  4Y91 A;  1WPY A;  2EGA A;  5GAN e;  2LT4 A;  4JJB A;  3FLG A;  2JVV A;  5DM7 R;  2DL4 A;  1MMA A;  1QVG S;  2X35 A;  4M78 B;  2W0Z A;  4A63 B;  2XK0 A;  9ATC B;  1E6G A;  3PTA A;  4PFP A;  4N4H A;  1BI1 A;  4M7A C;  1VQ6 Q;  1UTI A;  1GFD A;  2HZY A;  5CVI A;  4LD9 K;  1KFZ A;  3CCV A;  2QEX T;  2LTO A;  4PJO D;  1YHQ Q;  4GLM A;  3NPF A;  4RTV A;  2MOX A;  2COW A;  1ZBX A;  4N4I A;  1V76 A;  1W2B A;  1I4K 1;  2E6N A;  1Q7Y U;  5DLQ E;  2DL5 A;  5L23 A;  2KRM A;  2RA2 A;  5GAO p;  1QLY A;  3MKD A;  1NJI R;  1AZG B;  1WHK A;  5A0L A;  4KRT A;  2NUT A;  1VQ7 Q;  2YLC A;  2HBP A;  4J9D A;  3OMC A;  3CME A;  2ZAE A;  3WVD B;  2GFU A;  5DY9 A;  4M77 F;  1VQ9 T;  1H64 1;  3UA6 A;  4GY5 A;  1N5Z A;  1GRI A;  5CK9 A;  4PJN A;  1B3Q A;  4E6R A;  3JB9 I;  1KD1 U;  3SFM A;  3GIB A;  4JPB W;  2GCX A;  1PWT A;  2DLP A;  4FYY B;  4KT0 E;  3M0P A;  2E64 A;  4J5Y A;  3VS4 A;  3D7S B;  5J26 A;  4DEX A;  1D1A A;  1YJW A;  2L2P A;  2RO0 A;  1HSQ A;  1VQ5 Q;  3EG9 B;  2C06 A;  1PRM C;  1XTD A;  3M57 A;  2E5K A;  3AT1 B;  4A54 A;  4LE9 A;  1TS9 A;  1JB0 E;  4VUB A;  3EH2 A;  2M9U A;  2MWO A;  4QT7 A;  3SHW A;  4DOW A;  2ZCF B;  3NTH A;  3VYH B;  1JXM A;  1C0M A;  2CGH A;  4OGC A;  1JXO A;  4XQ3 A;  4LUD A;  4IUP A;  3C0C A;  3QXE B;  2K3X A;  3I56 A;  4NOY A;  3A8L B;  2LRQ A;  1E6H A;  3LH5 A;  1K73 C;  2CZ0 B;  1VQN T;  1YJ9 Q;  2H3J A;  3A8H B;  2Y90 A;  1Z9Z A;  3GPL A;  2J7I A;  3QSU A;  1VQN A;  4BUG A;  1WQW A;  4CC2 A;  1I5O B;  2HSP A;  4AT1 B;  1YWP A;  3MPU B;  2ED1 A;  3R6O A;  2CH4 W;  2OJ2 A;  5C0M A;  2BZX A;  4FW1 A;  3I5R A;  1WDX A;  2K5F A;  1JJ2 A;  3INZ A;  4KGX B;  3FB9 A;  3QBY A;  4M7A D;  4JZ3 A;  2ECZ A;  3P8D A;  2RF0 A;  5IHN A;  3CXC P;  3JCM c;  5LJ5 g;  4CC4 B;  4Z02 A;  4RCC A;  4OP0 A;  1NG2 A;  4M7A B;  3I55 A;  3CCQ T;  2XI9 A;  1FWZ A;  5FRO A;  2F2X A;  4X34 A;  2VXE A;  3A5Z B;  4ELZ C;  3LYI A;  5D6X A;  3S3N A;  1K9M R;  1U06 A;  3M0Q A;  1BKB A;  1SSF A;  1VYU A;  4B9X A;  1KC8 U;  1ZLM A;  1Q7Y R;  1M3B A;  1QWE A;  2V8K A;  4DQ2 A;  2GTO A;  2LJ3 A;  3OSV A;  2GQV A;  1EIF A;  2NUT B;  1UEB A;  1AHJ B;  3CME T;  2FZC B;  2KT8 A;  4KH0 B;  2YUP A;  2BTT A;  4K11 A;  2CDT A;  4C0G A;  5GAM f;  2RHX A;  4PNO A;  3QUI A;  1LPL A;  4L6V 5;  2J06 A;  3JCM e;  3H0H A;  2DNU A;  3EGX A;  2EYZ A;  2LC4 A;  4JLG A;  1SSH A;  3E19 A;  2EQJ A;  1VQP A;  1KSW A;  4FT4 A;  3DLM A;  3JCM h;  5KYN A;  3FDR A;  3E2U A;  2K7A A;  5CKF A;  1RAI B;  3EFO A;  2DM1 A;  2EAY A;  3G6E T;  1VQ7 T;  3A1P A;  4Z88 A;  2O88 A;  2YSQ A;  4UC4 A;  4N0A A;  1OU9 A;  4IKF A;  4M7D C;  3G6E Q;  4BI4 A;  1ACM B;  2P0Q A;  1CSK A;  4C8Q F;  3TU4 K;  2JM8 A;  5GAM e;  3CCJ A;  4A4H A;  4NL3 A;  1WHL A;  4M75 C;  1N27 A;  4OMQ A;  2YRD A;  1NYF A;  4FU6 A;  4FCY A;  5I2S A;  5LJ3 j;  2M16 A;  2F69 A;  2RPN A;  1BI0 A;  8ATC B;  2LQN A;  3I35 A;  3CCE Q;  5GAN j;  1BB9 A;  1FMV A;  1HYO A;  2D0N A;  2CRE A;  2EKH A;  2DMO A;  3V7C A;  2GGR A;  3LW5 E;  2IVW A;  1Q86 C;  3CMA A;  2X3W D;  2BE9 B;  2EIF A;  2HNI A;  2R57 A;  4M77 E;  1K8A R;  2CP3 A;  1T3S A;  2RHI A;  1ZQ1 A;  2HEQ A;  4RG8 A;  1NEG A;  3CXC A;  1S72 A;  2EFI A;  2RI2 A;  2JTM A;  3QKJ A;  3OA6 A;  2K9G A;  4PJO G;  4RMO A;  4A4G A;  2MAM A;  4M77 C;  1X27 A;  1KQ1 A;  1W6X A;  2KE9 A;  4M77 D;  2CP0 A;  1E7O A;  3GLX A;  1QP2 A;  5GAN d;  4MDX A;  2DXB A;  2MF2 A;  1QW1 A;  2HSE B;  2H8H A;  2EYQ A;  2IIM A;  2DET A;  2NUP A;  5KH6 A;  4IUU A;  2CP6 A;  4F7U A;  4PJJ A;  3H41 A;  3CCQ A;  2WSE E;  4MML A;  3X25 B;  2KT1 A;  2K2V A;  1ABO A;  2CP2 A;  4ELY C;  2QQA A;  4GBQ A;  2ZPB B;  2EQI A;  1TUD A;  2DD4 A;  1QMC A;  1VQK A;  3CCL A;  2DKG A;  1YI2 Q;  5A2Q E;  1LJO A;  3BFM A;  1U1S A;  2RM4 A;  1UHC A;  2LJ1 A;  2DVJ A;  2QA4 Q;  2QI2 A;  2R5A A;  1UDL A;  3SB2 A;  1K8A U;  3CCU Q;  1RAF B;  2EYY A;  4PJO F;  3UDC A;  5CO7 A;  2CUB A;  4KUL A;  3CCQ Q;  1YJ9 A;  3OW2 S;  5IXB A;  4ZGJ B;  3I9Q A;  2AKK A;  5KE3 A;  3CCL Q;  1RUW A;  3X28 B;  3SDZ A;  2AHJ B;  2OTL A;  3DB3 A;  5FRN A;  3VKI A;  4HKE A;  2BZY A;  2O4X B;  1SHG A;  1KQS S;  7AT1 B;  1Q7Y C;  1M5Q 1;  2X9H A;  1ZSG A;  2MWP A;  4IIM A;  3QDF A;  3CCV T;  3QJY A;  3CCR Q;  1G2B A;  2E10 A;  5GAM j;  4II1 A;  2DFU A;  1K9M C;  1D1B A;  2DF6 A;  2PU9 B;  1WHH A;  4X9C A;  2X4J A;  1XJW B;  2L3P A;  1TUG B;  2P4R A;  3NTK A;  1IZ6 A;  1GBQ A;  4HA8 A;  4LXC A;  3PVQ A;  2SEM A;  1PCX A;  3I55 T;  3LWI A;  1BIB A;  3U23 A;  3JB9 D;  2QK0 A;  3A98 A;  1M8M A;  3G71 A;  5EG2 A;  3H0I A;  1B07 A;  2O2O A;  1K4U S;  3MCA B;  4PL6 A;  4OML A;  3OYK A;  3OYF A;  4XTU A;  1Y96 A;  2DX1 A;  5GAN g;  2E1H A;  4M75 F;  1ZSZ C;  3L2V A;  4E7I A;  4XU2 A;  3E9G A;  3RR6 A;  1GFC A;  4XTX A;  2KBT A;  4E7J A;  1IHW A;  4C8Q E;  1KHI A;  2MIO A;  1X2Q A;  1R77 A;  4RCB A;  4RTX A;  6AT1 B;  2DRM A;  1Q95 G;  1K1Z A;  1ZSZ B;  4J9E A;  4WCI A;  4ZTJ A;  2CP5 A;  3JV3 A;  4BI3 A;  1M30 A;  4BD3 A;  3O8V A;  3QYG B;  2QEX Q;  2RQR A;  1EZZ B;  2LCC A;  1UHF A;  3ER0 A;  2CSQ A;  1D09 B;  1M27 C;  5LL6 S;  2WAC A;  3FRN A;  5CAI A;  1ZUU A;  1VQP T;  5GMK l;  4C0F A;  3JCM f;  2NUP B;  1YNZ A;  2KRN A;  4FYX B;  3VRY A;  5D6W A;  8AT1 B;  1VQ5 T;  1RAC B;  2KRS A;  3OYD A;  2VWF A;  4F04 B;  4EMH A;  3RDV A;  2X4X A;  4M7A A;  2CZ1 B;  2QDL A;  2V26 A;  4J9I A;  1C6V X;  2FPE A;  4E7S A;  1I81 A;  3M9Q A;  2K3B A;  4FYW B;  3CC7 T;  2JW4 A;  2LJ0 A;  3OW2 P;  3JRZ A;  4LDY A;  3A8O B;  3M0S A;  1ARK A;  5AT1 B;  4Z89 A;  2D0Q B;  3OYJ A;  2EWN A;  2GF7 A;  4M75 G;  4BDY A;  3VYG A;  2LZ6 B;  1RL2 A;  4OMN A;  2GNC A;  3QZ5 B;  1KQS A;  1KQ2 A;  3GNF B;  3SD4 A;  5I21 A;  4F17 A;  1WJR A;  2JT4 A;  5KYW A;  4AFQ C;  4M7D G;  5CKH A;  1GXI E;  4KUI A;  2M51 A;  1RAH B;  2QTV A;  1YIT T;  4GLK A;  3NGP A;  4ZN1 A;  4DOV A;  2LDM A;  2DBM A;  4RUG A;  4M4Z A;  3MHX A;  2PTK A;  1UG1 A;  5LJ5 d;  4HCC A;  3OS1 A;  2MMP A;  2JZ2 A;  4A4E A;  3GOX A;  3EAE A;  2ED0 A;  1BBZ A;  1JU5 C;  1T0H A;  4QQ6 A;  3OYM A;  3OYG A;  3OYA A;  2PVG B;  2B86 A;  4J9F A;  3GF5 A;  4LUE A;  4C0D B;  3NFC A;  1YIJ A;  4PK4 A;  3JCM W;  3EGX B;  1PNJ A;  4ESR A;  1VQ8 T;  2QA4 A;  2FO0 A;  2P84 A;  3C4S A;  3UWN A;  1I0C A;  3I56 Q;  1K73 R;  3M4G A;  4FL6 A;  2RQW A;  4Q5W A;  3CCU A;  1UJ0 A;  3CC4 T;  3JCM J;  2H3E B;  4C8Q B;  4M75 A;  1BI3 A;  4RTU A;  4XTZ A;  3VS3 A;  2RK2 A;  2CT3 A;  1G3T A;  3KXT A;  2IPO B;  1YIJ Q;  4JZ4 A;  2HCK A;  4C92 D;  3H6Z A;  1JRI A;  1UGR B;  2B8A A;  2SRC A;  2C0O A;  4ZGD B;  4EMK C;  3OW2 A;  1KK7 A;  2NLU A;  1S72 T;  2PQW A;  4F7U E;  2LQK A;  3CC4 Q;  2L8D A;  4N4G A;  1UB4 A;  3CCR A;  2HL5 C;  4FSX A;  2AK5 A;  1HK9 A;  3CPW P;  1OZ3 A;  2BUD A;  2YRV A;  3NTI A;  2E3H A;  2LQW A;  3O5Z A;  2RB6 A;  3VJP A;  3P8H A;  1NYG A;  4FT2 A;  1QCF A;  1WXT A;  4PJO A;  2CUD A;  2X51 A;  1BU1 A;  5KYY B;  3OYE A;  5FLX E;  3QWY A;  4N0A C;  4OGE A;  3CEY A;  3QO3 A;  2GFA A;  4J9G A;  4LN2 A;  1PSE A;  4KGZ B;  4OMO A;  1Z9Q A;  3SWN A;  3JB9 J;  2KRO A;  3VS2 A;  1VA7 A;  3OYC A;  4OMF B;  3CC7 A;  2EJG A;  4A53 A;  2P0P A;  3H0F A;  3V8J A;  1R0C B;  5GMK h;  2F2V A;  2QAS A;  2C0T A;  2O9S A;  1LVK A;  4XAX B;  2CSI A;  5GAN 3;  2R5M A;  3CCM T;  1QQJ A;  1OPL A;  2RHU A;  4AFS C;  1NJI C;  3G7Z A;  4D8D A;  1QKW A;  4RG2 A;  1NM7 A;  4C5E A;  1AWX A;  3CCM A;  4J8O A;  1IRE B;  2RD1 A;  4Y28 E;  4PJO B;  5GAO n;  1WIE A;  3HRU A;  2EJF A;  2K6D A;  2QEX A;  5M9O A;  5GJV B;  4C8Q G;  3HTR A;  4ORZ A;  2P4T A;  2C0I A;  1WFW A;  4J6Y A;  4QVZ A;  2FZK B;  1JO8 A;  4J6X A;  3CCE T;  2AIR B;  4XTV A;  2AKL A;  3ZEH A;  1KC8 R;  1GBR A;  1LCK A;  3CBO A;  1IGQ A;  2ENM A;  2E4H A;  2QGF B;  2M0Y A;  3ZL7 C;  1KD1 C;  4XTY A;  3OS0 A;  1VQO A;  1VQ9 Q;  3TVT A;  3M0R A;  2V8J A;  1MNE A;  5LJ5 e;  4M78 C;  4C8Q A;  1PG5 B;  2EJ9 A;  5FU7 B;  3OYI A;  3L2U A;  2FRY A;  1VQ4 A;  3HSB A;  4IUQ A;  1RAE B;  5A0D A;  1F1B B;  4EMG A;  1WHJ A;  1ZUY A;  2XG8 D;  4R55 A;  3WXM B;  3JCM b;  1OYX A;  1N8R U;  4A4F A;  2YUQ A;  1VQN Q;  1OU8 A;  1VQO Q;  4M78 A;  1TUC A;  2K2M A;  4M78 G;  3CD6 A;  2F5T X;  3OYL A;  1K0S A;  1TSF A;  4M75 E;  1OPK A;  2QYZ A;  3ME9 A;  1M90 C;  1QVP A;  2DYB A;  2LNV A;  3F70 A;  3LWH A;  5KYU B;  1D3B B;  5KCH A;  2LP5 A;  2NYS A;  1JQQ A;  4M7A G;  4XTW A;  5GAO m;  3OYH A;  3CPF A;  1N8R R;  2KMT A;  2OX7 A;  4L5G A;  4JRP A;  2MCN A;  2F5K A;  2YXY A;  3OYY A;  3JCM Q;  4R56 A;  1VQL Q;  1GL5 A;  2OTJ Q;  1AZE A;  2RNA A;  2XD0 A;  2RN8 A;  1IRX A;  4OB1 B;  4FW2 A;  1OV3 A;  2DA9 A;  3HFN A;  1PD1 A;  1Y0M A;  3CD6 Q;  3E1S A;  2E6Z A;  5FU6 B;  4C8Q C;  3PMT A;  3DLL A;  1I8F A;  1MMN A;  4RTW A;  2ZGW A;  5GMK i;  2XU8 A;  2EQK A;  4MZT A;  4M7D F;  3MJX A;  4FSS A;  3MET A;  4WF2 A;  5LJ3 f;  1FMW A;  3MP8 A;  5HK0 A;  1RI0 A;  3VV0 A;  2HAX A;  4PJM A;  2JN0 A;  5CIU A;  2K3Y A;  3L2W A;  1V1C A;  3HPW A;  4E7K A;  4EIK A;  5GAO q;  1QVG A;  3ZBD A;  5CQX A;  2KI7 A;  4YTL A;  1YHQ T;  1MUZ A;  4HCB A;  1AWO A;  2F1L A;  4NL2 A;  5IXF A;  5D6Y A;  1M1K U;  2DD5 A;  2OI3 A;  4XU3 A;  4KGV B;  3CC4 A;  1JEG A;  3VS7 A;  1KC8 C;  2KAF A;  4C92 C;  5KYX A;  1ABQ A;  4PKC C;  4F7U F;  5FW9 A;  4IUR A;  1VQ9 A;  2CZ7 B;  2FHD A;  4X9D A;  3X20 B;  3EG0 A;  1W4S A;  1PD0 A;  2A36 A;  1TTH B;  3ZFJ A;  3CCS A;  1UGQ B;  2G6F X;  5KYY A;  1B34 B;  2HKQ B;  3G6E A;  3HKS A;  1KJW A;  2K5I A;  4M7D B;  2AZS A;  5HKC A;  3L2Z A;  1ZUK A;  3EGU A;  1LOJ A;  4M75 B;  2DRK A;  3N5B B;  4DBQ A;  3C94 A;  3PE0 A;  3MEV A;  1IO6 A;  3RUX A;  3CC2 T;  5GMK m;  1SRM A;  2ZPG B;  1U8R A;  1OI1 A;  3CCS Q;  2ZPE B;  2J05 A;  3X24 B;  1N9S A;  4ANJ A;  3CC2 Q;  4MZM A;  3CCJ T;  1I1J A;  2QDY B;  1ZA1 B;  4LDU A;  1RAG B;  4D8K A;  1KIK A;  4RTT A;  1UFF A;  3CCM Q;  3G4S A;  3SEM A;  1VQ7 A;  3V7S A;  4BY6 B;  1UGV A;  2HQH A;  1OX8 A;  2F2W A;  1OEB A;  1T0J A;  1C1A A;  3LGF A;  3LLR A;  2KXD A;  5DLO A;  1V29 B;  5HCK A;  1PM3 A;  4C5G A;  2WSF E;  1IHV A;  1WZO A;  4M78 E;  4LD6 A;  1D3B A;  2NUZ A;  3G71 T;  2LT1 A;  2HD0 A;  1YJW T;  1QKX A;  1NPP A;  3QDR B;  2DAQ A;  1VQM T;  2EBP A;  3MP6 A;  2EQU A;  2VKN A;  2X4W A;  4DEY A;  2RJE A;  4D6W A;  4E7L A;  3G4S Q;  1EX4 A;  3PIP A;  5FRM A;  1K9A A;  1P92 A;  1TOV A;  1VQO T;  4JJN K;  1AOJ A;  3MEA A;  4JJD A;  2VAS A;  5I2M A;  4OMM A;  1FX7 A;  2DBK A;  5GMK j;  2PUO B;  3QPH A;  4MDW A;  5I22 A;  1VQ8 Q;  1G3S A;  2DIG A;  1OOT A;  1WI7 A;  1WHM A;  2DVE A;  4OVA A;  1A0N B;  1BYM A;  2DL8 A;  1Q82 U;  1WXU A;  1VQ6 A;  1MND A;  5LJ3 e;  2DL3 A;  1UGP B;  1BCM A;  4M7D E;  1YWO A;  3EG1 A;  1R0B G;  3BE3 A;  2VGM A;  4QW2 A;  3JCM P;  1WYX A;  2FZG B;  3DKM A;  3URG A;  1X75 C;  2OAU A;  3X26 B;  1TWB A;  1JJ2 P;  1K8A C;  4V2S A;  3TSW A;  2KSS A;  1Q82 R;  2KK4 A;  4RTZ A;  4BE1 A;  5CQY A;  1ZHI A;  1M1K R;  3RMQ A;  2ESW A;  2ROT A;  4JUV A;  3UPU A;  1Q86 R;  2O01 E;  1YCS B;  4PJL A;  1D0X A;  4RKU E;  1GCQ C;  4QKU A;  1SHF A;  3A8M B;  4HXJ A;  1YIT A;  2W10 A;  4LDX A;  3VUZ A;  3CME Q;  2GBQ A;  2RQV A;  5ECA A;  2QGG A;  2EKO A;  3RKX A;  3I56 T;  4PFZ A;  2QG9 B;  4JS5 A;  1M4Z A;  3HHT B;  1Q86 U;  2L3R A;  2FEI A;  3S3M A;  1K73 U;  2JMC A;  2VVK A;  1Q81 C;  1D0Z A;  1NEB A;  4P5N A;  2EGE A;  2JTE A;  3M0T A;  4EPC A;  3I55 Q;  5CR2 A;  3SWN B;  3M5A A;  2OTL T;  2A0F B;  3DB4 A;  2WSC E;  3MEU A;  4J9C A;  4JJC A;  3JAM E;  1M2V A;  3JCM X;  5GAN f;  1NPR A;  1O75 A;  1WJS A;  1M3A A;  3UA7 A;  3M59 A;  3C95 A;  5FU7 C;  1B34 A;  4C5I A;  4JS4 A;  1YJN T;  2L3Q A;  2KYM A;  1BI2 A;  2D9T A;  1YP5 A;  1T3L A;  2J6K A;  2VC8 A;  2ABL A;  2YUO A;  4J6W A;  2CT4 A;  2PVO B;  2DXU A;  1YCY A;  2CZ6 B;  4BB7 A;  5GAN 7;  4LNP A;  1IXD A;  2ATC B;  4EDU A;  2ROL A;  4JLI A;  3OQ5 A;  4OB2 B;  5L8R E;  1MHN A;  1R8O B;  4LDV A;  1YBY A;  3L2R A;  1KG1 A;  2ZPI B;  4PJO E;  3AHU A;  3CC7 Q;  4BDZ A;  2RJC A;  3TCJ A;  5KE2 A;  2LX7 A;  3UAT A;  1VQ4 Q;  4OB3 B;  1QVG P;  1J3T A;  3JB9 G;  2RMO A;  3PMI A;  1PKT A;  4HT8 A;  4RTY A;  1VQ4 T;  3J7A F;  3HL8 A;  4ME7 A;  3G71 Q;  2KYB A;  4JRQ A;  2DO3 A;  4CI0 C;  3RER A;  4KBM B;  4F7U B;  5LJ5 h;  1VQK T;  2DYI A;  3JCM g;  1AWJ A;  1RLQ C;  3V8K A;  1SKU B;  2PNI A;  2HQX A;  4C92 B;  2BIV A;  1CKA A;  2MPX C;  4ATO A;  1SEM A;  3CXC S;  1NE8 A;  2DTO A;  1WJQ A;  2KNB B;  1ZSZ A;  4J7I A;  2HBW A;  3BY7 A;  3THK A;  2EYW A;  4EMK B;  3LGL A;  4KH1 B;  2GTJ A;  2HQE A;  3ASK A;  4M7D A;  3M53 A;  1M3C A;  2LVM A;  4HT9 A;  1OUL A;  3PNW C;  1UGS B;  5IAY A;  2G3R A;  3G4S T;  2K4Y A;  1X6B A;  2R58 A;  5EC7 A;  5KCO A;  1AT1 B;  3CPW A;  4M7D D;  3OSS C;  3QWX X;  4BI8 B;  2E12 A;  3RNJ A;  2Z0W A;  2XMF A;  1M90 R;  3OYB A;  1SF9 A;  4AFZ C;  4M77 G;  1OQK A;  2COY A;  1PKS A;  4PJO C;  2M1H A;  1TG0 A;  1VIF A;  3NMZ C;  2OTJ T;  1XOV A;  1W2B S;  4XU1 A;  2JS0 A;  3J80 E;  4O5V A;  5FWC A;  1MMD A;  4KUD K;  1M90 U;  3EGD A;  3M56 A;  2KQW A;  2RQT A;  3OS5 A;  3EGD B;  1TXQ A;  4CC7 A;  2I2L A;  1EFN A;  3TQ7 P;  4QVC A;  4AFU C;  1YFN A;  2QQS A;  1AWW A;  1W70 A;  1KD1 R;  1VUB A;  2YT6 A;  3PVL A;  1K9M U;  2CH4 A;  4IUT A;  3PIO A;  5CCA A;  3REA B;  2RH2 A;  1QVF P;  2KY9 A;  4IUV A;  1AD5 A;  4HVU A;  2VYT A;  5J3B A;  4A4K A;  4BY6 C;  1QWF A;  2VXF A;  4M7A E;  2ZPH B;  3EHR A;  2RJD A;  2E3I A;  1I07 A;  2J6F A;  3HFO A;  2YDL A;  2L3S A;  4L59 A;  3HRT A;  5HY6 A;  4E2F B;  4HVW A;  1YHQ A;  3OBW A;  3FJP A;  3CCE A;  5KYU A;  1K76 A;  4E7Z A;  2L0A A;  1YJN Q;  1BK2 A;  2V1Q A;  3JCM d;  3VRZ A;  5GMK e;  2QQR A;  4O6J A;  5LJ5 f;  3CCR T;  2CS7 A;  3WVE B;  1D1C A;  1X01 A; 
#chains in the Genus database with same CATH homology
 1WHG A;  2HL3 A;  1TOV A;  1WHJ A;  2CP5 A;  2CP7 A;  2HKN A;  2CP3 A;  2CP6 A;  3RDV A;  1LPL A;  2HL5 C;  2MPX C;  4B6M A;  1WHK A;  2Z0W A;  2E3H A;  1IXD A;  2CP2 A;  2QK0 A;  2M02 A;  2COY A;  2COW A;  2CP0 A;  2HQH A;  1TXQ A;  2E3I A;  2HKQ B;  3TQ7 P;  2COZ A;  1WHM A;  3E2U A;  1WHL A;  1WHH A;  2E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...