2COWA

Solution structure of the cap-gly domain in human kinesin-like protein kif13b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
100
structure length
100
Chain Sequence
GSSGSSGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Kinesin-like protein KIF13B
publication title Solution structure of the CAP-Gly domain in human Kinesin-like protein KIF13B
rcsb
source organism Homo sapiens
total genus 4
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cowA01
2E4HA 3E2UA 2HKNA 2MPXC 2CP3A 2COYA 2CP0A 1TXQA 1WHGA 3TQ7P 1LPLA 2HL5C 2HL3A 2Z0WA 2CP5A 1TOVA 1WHMA 2HKQB 2HQHA 4B6MA 2CP2A 1WHHA 2COWA 2CP7A 2E3HA 1WHLA 2E3IA 1WHJA 1IXDA 2M02A 1WHKA 2QK0A 3RDVA 2CP6A 2COZA
chains in the Genus database with same CATH superfamily
3M5AA 1UTIA 3I56Q 1HD3A 1BI0A 4RCCA 3RMSA 2F5TX 3A8LB 2RJFA 1YHQT 1JXOA 2QG9B 4AFQC 1G3SA 4DOVA 1H3ZA 4X9DA 4IUTA 2DVEA 2O01E 2FRYA 4NL2A 3DLLA 3PIOA 3VRZA 2ZPEB 1I8FA 2QA4A 4Q5WA 3CD6Q 3QUIA 2DD5A 1QP2A 3E1SA 2QYZA 4C5EA 1PSFA 1NE8A 2P84A 2KBTA 3QZ9B 2DX1A 1KQSA 2HKQB 5I11A 4CC2A 5IHKA 2ZPIB 2EIFA 4F7UB 3HHTB 3CCLT 1UUEA 5GANh 2L89A 2RHYA 1WHJA 4M7AC 2R57A 2DERA 3QO3A 4OB0B 1WHGA 4ZTFA 4M78E 2LVMA 1OULA 3TREA 2D1XA 5GAN8 1D1CA 4R0KA 1Q86U 1EFNA 4MZMA 1NBEB 4O5VA 4PFOA 2XDPA 5GANd 2F5KA 4FW1A 1VQKA 2XD0A 5FU7C 2CS7A 4P5NA 1K73C 2HBWA 4D8DA 3C94A 1VQNA 2FZCB 4DBQA 5GANj 1RL2A 1HXDA 4M75E 3T9NA 1RI9A 2CP2A 2L2PA 2LT4A 1WJRA 2JMCA 5GAOr 3QZ5B 5FRMA 4UC4A 3PVQA 5GMKi 6AT1B 3RIRA 2NUZA 5GANf 2AKKA 2LC4A 3HPWA 2PVGB 1YHQQ 3MP1A 2AZVA 1VYVA 3LX7A 1Q86R 1V29B 3CC7T 3EG9B 1CKAA 1PSEA 4HT8A 2LNHB 3CXCA 5A0LA 3OS0A 3VV0A 2WACA 4E47A 5CAIA 4ZN3A 1YWOA 1O75A 2XIDA 4M7DD 1Q81U 3D7SB 2MYSA 2VWFA 1JQQA 2L0AA 3NFCA 3X26B 2LRQA 1BKBA 2EGAA 4BE0A 1VQ4T 1M9SA 5KYWB 3R6NA 2R5MA 3EHRA 1PC0A 1FXXA 2EJGA 5L8RE 4EMHA 1RI0A 2YUQA 2CSIA 5A0GA 4JRQA 4M75G 2FPDA 1QCFA 2EQIA 4FSXA 1KC8C 2QA4Q 1J3TA 4FT2A 2KT8A 3I5SA 3UA6A 2KRSA 1SEMA 2K4YA 5FU6C 1M2OA 1AOJA 3ASKA 2CGHA 4FL6A 4JLGA 3QXEB 1Q81R 1M3AA 4DBRA 2H8HA 5GAN3 5KYUB 4MZPA 3HP9A 3QBYA 4A54A 4PJOE 3N5BB 4A53A 2YUNA 4QQ6A 2HD0A 1LOJA 3JB9J 2X9HA 1HJDA 2JTEA 3ULRB 2V8IA 4C8QC 3CBMA 5AT1B 3RERA 3CCSA 2BIVA 3RKXA 5LJ5g 1QVGA 2I0NA 3C95A 4FYWB 4M77C 3OYJA 3CC7Q 1HSQA 3JCMV 1VQKQ 1PRLC 5CKFA 4C92G 3P8HA 3MJXA 1VQNQ 2CUDA 2DEQA 2R58A 4KULA 2NUPB 1BCOA 3C12A 1JB0E 1T0HA 5IHNA 2YRDA 4GLMA 1G5VA 4M4ZA 1Q86C 1VUBA 2EYWA 1ZUKA 2RI3A 2GGRA 2YUPA 3H0IA 5LJ3h 4ESRA 2YHTA 3INZA 3CQTA 1OX8A 4M7AB 4ELZC 4AG1C 1WJSA 2RO0A 4BDZA 3EGDB 4XU1A 3QIIA 4JS4A 1YJ9T 4QW2A 2C0IA 2BUDA 5IT9E 1UFFA 1WI7A 5KYWA 5LJ3d 7AT1B 2K6DA 1YBYA 5FU7B 5LJ5h 3EGUA 1QWFA 3PMIA 3PVLA 3OS2A 2BE9B 2LCCA 2DD4A 3M53A 5CO7A 5LJ3j 4M78B 3JCMW 1YCSB 1LNXA 1SF9A 1RAIB 4MZTA 2MIOA 4N4HA 4D6WA 3OW2A 1M2VA 2JOYA 3SD4A 2FPEA 5CQYA 5J26A 3EG0A 4ANJA 1TUDA 2OTJA 4Y91A 3EFOB 5LJ3f 1QVFA 3M0UA 4OGEA 2QDLA 3IQLA 1X01A 4C0FA 1RAHB 5I2MA 2GCXA 2CREA 3REBB 2W0ZA 4KH0B 4RCBA 2EYQA 1KIKA 3L2VA 1ZSGA 2GQVA 1UG1A 3P8BB 2GF7A 3RDVA 1VQMT 5LJ5f 2VV5A 1K0XA 2QDYB 4OB2B 2DXTA 2YDLA 1VQ5T 1UECA 2O9SA 1AD5A 2X3XD 3VJPA 4LD6A 2QEXA 2K5FA 3CMET 5M9OA 3BFMA 1MMGA 4J9CA 3RKWA 5KE3A 2P0QA 5GAOl 3MCAB 3ER0A 5KYYA 2CP7A 1ZHIA 2Y90A 4CI0C 2NUPA 1RAAB 3CCSQ 1U06A 3OQ5A 5KYXA 1G3TA 3CC2A 3LLRA 5GANe 1YJ9Q 3PE0A 2LQKA 3F70A 5FU6B 3M0QA 1ABOA 2FPFA 2RQVA 3FEOA 2G6FX 1Y96B 3BDLA 4JZ3A 1O9SA 2LX9A 4KGZB 3GOXA 1YJWT 2CH4A 3E2UA 1MMNA 4Z02A 3LH5A 1X2KA 1OV3A 2I2LA 3OS5A 1BI2A 3JB9G 3DB4A 1VYTA 4C8QB 5AYFA 3OMCA 4F7UE 1QW1A 4JRKA 2RJEA 1KHCA 2M1HA 4M78A 1AWJA 4M7DC 2ZAEA 2K3BA 3JV3A 2A37A 4M77B 2JUFA 2V1QA 3CPWA 5DM7R 3EFOA 3H9NA 4KUDK 3RNJA 4BE2A 4ZGJB 1RABB 2XKOC 5CVIA 3OYBA 3QG1A 1ZSZA 1VQ5Q 2JXBA 3GBQA 4J9BA 2WSFE 1IGQA 1FYNA 3H0HA 1WHKA 4E7JA 3CEYA 3SB2A 4FYVB 4FYXB 4E7IA 1YI2A 2COZA 3VS7A 3OMGA 3CCMA 4J9EA 3M58A 4VUBA 3NTHA 4J9DA 4M75F 1H92A 2DK3A 1R0BG 1V76A 3CCUA 3JRZA 1R8OB 1K76A 1SHFA 4L6V5 2O4XB 4A63B 2FYKA 2KNBB 4RUGA 3RESA 3NMZC 2K7AA 1TXQA 2HQEA 2KR3A 1WJQA 1V1CA 1K9MR 1UGVA 1WQ7A 1OU8A 1KQSP 2LJ3A 1NEBA 4RTVA 2E64A 4OVAA 5DLOA 2M0OA 1IHVA 2BTTA 1N9SA 2MAMA 2K2MA 2FG0A 3RBBB 2WSCE 2EQJA 3QDFA 4RTUA 3RKYA 4F16A 4C92F 1KHIA 4OMNA 4ORZA 3CCEA 4J7FA 4EMKC 2CZ6B 3FIFA 2VXFA 4EIKA 4A4EA 3OS1A 1Y07A 3QHSA 1TUCA 3OYAA 4M77D 4KGXB 3M4YA 2HKNA 3AHUA 5KE2A 1Z9QA 4BUGA 3OSSC 1YJNT 2EYYA 2L8DA 4PJOA 2GBQA 3NTKA 1WHMA 2R5AA 2CT3A 2RJCA 2LTOA 1PWTA 3OY9A 2JMAA 3GLXA 4BY6C 2EBPA 3EGXA 4E7KA 1VQ9T 5DY9A 5GAN4 2HMAA 3CCET 1UHFA 4N0AC 1BCMA 1C1AA 5LJ3e 2YLBA 3I5RA 3E19A 4JDSA 4LDUA 2Z0WA 1CKBA 2FHDA 3CXCP 2KI7A 5GANg 4WTOB 1KQSS 2J05A 3EHQA 3SWNA 3PNWC 1SRMA 3RUXA 2EW3A 1M3CA 1UEBA 3FC3A 3CPFA 1PKTA 3L2RA 2WSEE 4XTYA 2A36A 1YI2Q 3CCMQ 1B34A 2ESWA 4PL6A 3MO8A 3TSWA 1KFZA 5LJ5e 1QKXA 1AT1B 2CP5A 2RQWA 3CCUQ 2RA2A 2PQWA 5EG2A 1D09B 2KXCA 1OX9A 1NJIU 1WHLA 2D8JA 2JW4A 4IKFA 4M7DB 4Y28E 4GY5A 1GCQA 1X69A 2KVQG 3G71T 4M7AE 2DYBA 1YITA 2BZXA 3X20B 3THKA 2K9GA 3LWIA 1TTHB 2YT6A 2VKNA 4ZGDB 4L5GA 1PCXA 5CKEA 4F14A 3CCJA 4ELYC 4C0GA 4IUPA 1PG5B 2K79A 1YJNQ 2QK0A 4BACA 3M0SA 1NLOC 1SG5A 2C0TA 2VASA 4OP0A 1FMKA 1AWWA 4LNPA 2JN0A 4PJLA 1QP3A 3HSBA 2X4WA 3VS5A 3VYHB 1NJIR 1SHGA 5CIUA 2QA4T 2A0FB 1KD1U 1VQ9Q 1BIAA 3C0CA 4CC7A 3MEAA 3QDRB 3CXCS 4JS5A 1YITT 3CCEQ 1KJWA 2KEAA 2YRVA 1Q7YU 5FRNA 2JNGA 1QVGP 2DBKA 1K0SA 2ABLA 2B8AA 4LUEA 2BE7D 2LQ8A 5KYNA 2CT4A 1VQPA 2GTJA 4MMKA 1UGPB 1YCYA 3URGA 3HL8A 2YXYA 3Q1JA 3A8MB 1E6GA 4QVZA 2KAFA 2HQXA 5GMKl 2COWA 1X75C 2F2VA 3X24B 4QKUA 1VQ6A 3UATA 2CH4W 4R55A 3JB9F 2JZ2A 1AZGB 5GMKj 1D1BA 3VS4A 5CK9A 2DZCA 3L1AA 1KD1R 3TCJA 2C06A 2OAWA 4DBHA 1Q7YR 2K5LA 2DA9A 2QTXA 1VQKT 2JJ9A 3G71Q 3G6EA 1WHHA 1SSHA 4M78G 2KRNA 2KMTA 4EMKB 4C5IA 4AFSC 4QVDA 1VQ7A 5GAN6 4XTUA 1VQNT 1X27A 1SKUB 2V8JA 1UJYA 2RJDA 1ZBJA 2MWPA 2V8KA 3S3MA 1VQ8A 4J7IA 4JJDA 5C0MA 3JCMb 2RK1A 2QQBA 3SFMA 2OTLA 4M75C 3OW2P 1FMWA 3UWNA 1OPLA 5J3BA 2DJZA 1W2BP 1I5OB 4BD3A 1M90U 4BY6B 1A0NB 1QVGS 5I2SA 3L2QA 2LZ6B 8AT1B 1QVFP 2PU9B 4FT4A 4F7UA 1MNEA 1ACMB 1PD0A 1YITQ 4JLIA 3G6ET 2FZGB 1ZBXA 2JM9A 2DMOA 2LQNA 2F1LA 4C8QE 1UGRB 1LVKA 4PFZA 3QWXX 3CCJQ 2BKDN 4HKEA 5LJ3g 2EJ9A 4M77E 2RK2A 2NLUA 2DZ9A 1PNJA 5GMKm 2LJ0A 5EC7A 4N4GA 2ATCB 3OYCA 1YFNA 2JVVA 4DQ2A 2Y4XA 3EFSA 2X51A 2A7YA 3EG1A 2VXEA 3CCVA 1M90R 5DLQE 2PNIA 3MHXA 3UT1A 4RTXA 3PT9A 4C92C 4OGCA 3GF5A 3ZBDA 3OYYA 1M1FA 2AK5A 2E65A 1OOTA 2ZPBB 2EKHA 4QQGA 3OYLA 3CMAA 2AT1B 3X25B 4QQDA 1VQPQ 4IURA 1PHTA 2DRMA 5KH6A 2RI2A 4HA8A 3LW5E 1WXTA 2D0QB 3OW2S 3O5ZA 2DIQA 2MK5A 3EG9A 1KD1C 1YIJA 1S72A 1VQ6Q 2IIMA 1W2BS 2X4XA 1IRXA 1KK7A 3CCVT 4KRTA 3VS0A 1QVFS 1D3BB 3PGGA 3CCST 1ZUUA 4PJOG 4ZGEB 2DEUA 1RACB 3PTAA 3L2UA 1K9AA 3BE3A 2RQTA 1KQ1A 4BB7A 3G6EQ 2KXDA 3ZFJA 4AG2C 1M8MA 2DRKA 1M27C 2DXUA 2J6FA 3CPWP 4NS5A 1K8AU 2RI5A 5C6SA 4LDXA 2DL4A 2VC8A 1I1JA 1M1KU 1VQ8Q 4E7HA 4PK4A 4LE9A 2PVOB 2OTLQ 1ZUYA 1QLYA 1W2BA 4PKCC 3FJPA 2O9VA 3TVTA 3U23A 4HCBA 2V1RA 5KYUA 5I22A 2HL5C 3OYEA 4FM4B 1Q81C 4LN2A 4A4KA 3LGLA 3NGPA 3QKJA 1EIFA 1AWXA 1UGSB 1ZA1B 2JS0A 3HFNA 4E2FB 1WA7A 1OZ3A 4J6WA 4BI3A 1K8AR 3CC4A 2YWWA 3MEWA 1GCPA 1M1KR 3HKSA 1RAEB 3LH0A 3DKMA 2VUBA 2HL3A 1MMAA 3I35A 2CSQA 2OTJT 2L3QA 4EPCA 3CCVQ 2DIGA 3M0PA 1D0YA 4CC4B 3M0TA 4FCYA 4O6JA 4HXJA 5CCAA 1OQKA 4AT1B 3TEEA 2P4RA 1TWBA 2HCKA 3VYGA 4Z88A 1Y57A 2DJQA 1I0CA 1YWPA 3CMAQ 9ATCB 2KROA 2JTMA 3CPWS 2AKLA 2RNAA 3AT1B 1Q82U 2CKKA 3A8OB 3ZL7C 4M7AA 3A8GB 2DTHA 3HFOA 5D7UA 4C5HA 2ZPFB 2K5IA 4M7DE 1NYFA 5GMKe 1BU1A 4M7AF 3EGDA 1SSFA 2FEIA 4LDVA 2QEXT 5D6YA 4HVVA 1YIJQ 2CZ7B 1S72Q 2CYZB 4YTLA 1TH7A 4JRPA 3BW1A 1TSFA 3EH1A 1QQJA 1FMVA 2AZSA 2E70A 3JCMh 3CC2T 1S1NA 4XTXA 3GNFB 1T0JA 5GAMg 3P8DA 1N8RU 4M78F 2VB6A 1Q82R 2QGFB 2XMFA 5FWBA 4BI4A 3OYIA 2HZYA 4FIBA 3JCMd 1IB8A 4CRIA 4IUQA 3TU4K 1K9MU 4K11A 1CSKA 2EVRA 4J8OA 1E6HA 2P4TA 3I55A 2EYXA 2M16A 5GAN5 2LJ1A 2OTJQ 2FL7A 1UHCA 4KH1B 4RKUE 1RLQC 1NEGA 3QJYA 4IUUA 2HBPA 3ZEHA 4M75D 1QKWA 1X6BA 3JCMf 1M1KC 1W70A 1TUGB 1VYUA 2RMOA 1N8RR 4OMOA 1IXDA 1VIFA 2RD1A 3S3OA 2EGEA 2FZKB 3I56A 4F7UG 4AFZC 3CC4Q 1JJ2A 2A08A 3DB3A 3V7SA 4J83A 5GAMh 2HDAA 2E41A 3PFSA 2RH2A 1U5SA 4A4GA 5FLXE 3CBOA 2EPDA 2QEXQ 2L3RA 3GNGA 2NUTB 2MI6A 4GLKA 1YI2T 4RMOA 3CCMT 2QTVA 3FJ5A 3QYGB 3CBPA 1HK9A 2M02A 3FRNA 3TSZA 3G4SA 1M1GA 2FVUA 1Y96A 3CCUT 1M5Q1 5GAMd 2QQRA 2H3EB 3CC2Q 1B07A 2XG8D 5CQXA 3OBYA 3A8HB 1KG1A 1UJ0A 1WDXA 2NWMA 3E9GA 1T3SA 5A2QE 2FRWA 2DLPA 2EAYA 5GAMj 1JXMA 3KUFA 2ECZA 5GAOq 4C92D 5KCHA 2KDSA 4C8QA 2FB7A 2QGGA 3M0RA 4DA4A 3JCMX 2E10A 4C8QF 5GAMf 1QVPA 2QI2A 2PVDB 1W6XA 2HNIA 2EFIA 2MMPA 2ROLA 4M77A 3VRYA 3REAB 1EX4A 2OI3A 1JEGA 3CCQA 1TOVA 5HY6A 3V8LA 2SRCA 3J7AF 3EFRA 3QWYA 5IAYA 3WXMB 3V8JA 1GFCA 4PJOF 1Q82C 3X28B 4IIMA 4E7SA 1SRLA 1I81A 2EKOA 1UDLA 1K73R 2E5KA 2EJFA 2EQMA 2KE9A 2RHZA 4WCIA 4J6YA 1MHNA 3M55A 3OB9A 3DLMA 3FB9A 2EQUA 2B86A 2BZ8A 2CUBA 1T3LA 4PNOA 3MKDA 2KYMA 3VS2A 2DETA 2O4XA 3I55Q 5I21A 2XI9A 2A28A 2PUKB 3LGFA 1U1TA 2F69A 3JAME 1ZQ1A 1VOMA 5CKHA 2AIRB 2D9TA 1N8RC 2XHCA 3BDUA 4XTVA 3MP6A 1YNZA 4Z89A 2MWOA 4ATOA 1K9MC 1R77A 4XQ3A 2KGTA 3CCLA 2LP5A 5GAOn 2VYTA 3TQ7P 1WPYA 2DL7A 4KUIA 2K3YA 5CR2A 1WQWA 2DVJA 2E3IA 2KY9A 2YLCA 2DO3A 4LD9K 2EYZA 3KXTA 1GRIA 3G4SQ 1MGQA 1KC8R 5FROA 2X4YA 2DKGA 2XDDA 1KQ2A 4NOYA 4OMFB 3JSCA 3WVEB 1X6OA 1Q95G 2DF6A 2OAUA 1B3QA 5GMKh 4X34A 4LUDA 4EDUA 1P92A 3OBWA 1H8KA 2DXCA 4HCKA 8ATCB 2FO0A 1PKSA 2MF2A 4OMPA 3CCJT 1QCOA 1B7TA 1QWEA 1G3WA 2QQSA 3A5ZB 2G3RA 2HEQA 1H3HA 1OEBA 1RUWA 4M7AG 4IIOA 2ZZDA 2CZ0B 4X1VA 1ZX6A 4C5GA 4PLLA 3CCQQ 1IHWA 3CC7A 1RAGB 5HCKA 4C0ZA 5A0DA 2A3LA 4HVWA 2ZCFB 2J7IA 2KT1A 4LDYA 2KK4A 1WLPB 1NPRA 2CP0A 3JB9D 1IREB 1WX6A 2DTOA 1AEYA 4M78C 3JCMJ 2HSPA 3L42A 1AWOA 4DEXA 2JTFA 1ZLMA 4XU2A 4JJNK 1I5LA 2DL3A 1VQ4A 4KT0E 2ZPGB 1VQPT 1Y0MA 1NPPA 3JCMe 2DL8A 5GAOp 3JCMc 2GTOA 4L59A 1W1FA 2K57A 2YRCA 3KFVA 1Z9ZA 1ZSZC 1OPKA 4FU6A 3KBGA 2GFUA 4M7DA 1BI3A 4A4HA 2XICA 1D1AA 2VGNA 4XTZA 4NL3A 2BZYA 1VQ6T 2EWNA 2L3PA 3HTRA 2DTIA 4J6XA 4M7DF 1U1SA 2VVKA 2JS2A 2RPNA 3OYMA 3QYHB 1ZA2B 4C0DC 3RMQA 4AMCA 3JCMQ 4Y92A 2DNUA 1N9RA 4Z8AA 2XDBA 3L2WA 1PD1A 3EG3A 3RR6A 3CCLQ 4BE1A 1JU5C 4KGVB 4MMLA 4X9CA 5FW9A 1KSWA 4F7UF 1VQ7T 2LX7A 1MV0B 1PM3A 3HRSA 4C92E 2SEMA 2O2OA 1VQ8T 5ECAA 2QQ9A 1XNIA 2D6FA 3VUZA 4MDWA 2LNVA 3FLGA 2O88A 3OYNA 2OTLT 4J9IA 1NJIC 5HKCA 1M2VB 1LCKA 3GP8A 2DILA 3HRUA 5GAMe 2X3WD 4J9HA 3OSVA 4E7ZA 1IGUA 2J06A 1VQLA 2E3HA 1HYOA 3CCRA 4ZN1A 1X6GA 4OB1B 4IUVA 2CP6A 3VS6A 5FWCA 1G8XA 2RQUA 1TS9A 2RQRA 4JZ4A 1W4SA 1Y71A 2DAQA 3QSUA 3WVDB 3OYDA 4II1A 2L3SA 4C8QG 1AHJB 4PFPA 4AFUC 3S3NA 1OZ2A 4R56A 1YJ9A 4PJOC 1FX7A 2F2XA 1TU0B 1Q7YC 2OX7A 4EMKA 2M9UA 4M77G 1VQLT 5KYYB 2LT1A 3CCRT 4OMLA 4J9FA 5KYXB 3LYIA 1QMCA 4B6MA 4F04B 4RTYA 5D6WA 3UF4A 3CMAT 1E7OA 1VQ4Q 4MDXA 4BI8B 4PJNA 3META 1VQ7Q 1UE9A 2E12A 3EAEA 4B9XA 1IO6A 3EH2A 2ROTA 1H641 4PLIA 2KSSA 3MEUA 3EG2A 4HCZA 4RTWA 3SWNC 2LQWA 4N4IA 1YIJT 2E6NA 1WZOA 1S72T 2C0OA 3O8VA 4N0AA 2E1HA 4DOWA 2DM1A 2GQIA 2PZ1A 1WFWA 2EGCA 1I4K1 2XK0A 4JUVA 4WF2A 5GJVB 4JRIA 4PJJA 2MOXA 5D6XA 1NZ9A 2D0NA 3UPUA 1VQMA 3BY7A 3LWHA 2HAXA 1VQ5A 1GCQC 1IZ6A 4KBMB 2MCNA 2KRMA 2YUOA 3CMEA 5LJ5d 1WNLA 1GBQA 3V7CA 2ZPHB 5IHIA 1BB9A 1U8RA 4FSSA 2RHIA 1JJ2P 1GFDA 2OJ2A 1ZSZB 4OF1A 2Y4YA 1M90C 1BK2A 3JCMg 2XU8A 5CKDA 4JPBW 1BIBA 5LJ5j 1RADB 1XJWB 4RG8A 5IXBA 1WXUA 3H0FA 3M59A 4M75B 4TVRA 4J5YA 2F2WA 3QJ6A 2RF0A 1VQLQ 4C0DB 2L5QA 2PUOB 1LJOA 1ARKA 3VKIA 3CCRQ 2NYSA 4EMGA 3JB9I 1M30A 3M9QA 3I9QA 4RG2A 1YJWA 4DEYA 4F17A 3UA7A 3ME9A 1VQOA 4E6RA 2DFUA 1I07A 1GL5A 3OA6A 1D3BA 3CC4T 2RB6A 3V8KA 4BDYA 2IVWA 2IPOB 3MEVA 3OYGA 4HVUA 3J81E 1NG2A 2MPXC 4M7AD 1M4ZA 1XTDA 2O31A 2IG0A 1LPLA 2M0YA 5HK0A 2CDTA 4XAXB 5J39A 1C0MA 1SPKA 4FW2A 3VU3C 4C92B 2LMJA 1X43A 1K4US 2RHUA 1VA7A 5KCOA 1WIEA 5IXFA 1NYGA 2KYBA 1VQOT 4B9WA 5IH2A 5CKBA 4RTZA 2CZ1B 3M4GA 1C6VX 2JT4A 5GAN2 1JJ2S 3M54A 4J9GA 3JB9H 4M78D 2D8HA 2DE0X 3A1PA 3UDCA 4CC3A 3PIPA 4DBFA 4A4FA 2LCLA 2HSEB 4QVCA 4OMQA 3HRTA 3H6ZA 2ED0A 1OYXA 1WYXA 2YSQA 4PJOB 5GJWB 4M7DG 1QCNA 1EZZB 5IN1A 1N5ZA 2DXBA 2RN8A 3M57A 3VS1A 5HK3A 1VQMQ 3MPUB 2RM4A 2DPPB 2HQHA 3EGXB 1K8AC 4RTTA 1PRMC 3JCMP 1GBRA 4HCCA 1BYMA 3GPLA 3CMEQ 2QQAA 1UB4A 4M75A 1YP5A 4ZNXA 4XU0A 1ABQA 2QAZA 2GNCA 5GAOm 2P0KA 1FWZA 4OB3B 1Y7XA 1AVZC 2QXFA 2PTKA 4V2SA 4ME7A 3SWNB 4LDWA 3H8ZA 1XQHA 3I55T 1AZEA 2DYIA 2JM8A 1MNDA 1M8VA 1M3BA 4QT7A 1B34B 3G7ZA 1U3OA 5LL6S 1NM7A 1N6AA 3FDRA 3CD6A 4XK8E 4XTWA 3V7RA 1D0ZA 3M56A 4LXCA 1MV3A 1MMDA 3S6WA 2EQKA 1N27A 3OYHA 2E6ZA 3R6OA 1YJWQ 1VQOQ 1RAFB 2J6KA 3I56T 2AHJB 1YJNA 1K73U 3C4SA 4OMMA 2ZGWA 3SEMA 3NTIA 2VGMA 2LDMA 4JJBA 1UGQB 2E4HA 1R0CB 1GXIE 3MP8A 3NHNA 4C92A 3OYKA 1OI1A 1G83A 3L2ZA 2M51A 2DL5A 4PJMA 1VQ9A 3NPFA 3GIBA 4E7LA 2GFAA 3CD6T 5L23A 4C8QD 1F1BB 3G4ST 2RHXA 2X4JA 4M77F 4GBQA 1X2QA 1VIEA 2LCSA 5GAN7 4FYYB 1DJ7B 4JJCA 3PMTA 2CP3A 1K1ZA 4PJOD 3J80E 1OU9A 2COYA 3H41A 1G2BA 1RLPC 1XOVA 3G1JA 1YN8A 3OYFA 4XU3A 2W10A 1BBZA 2P0PA 4HT9A 1TG0A 2J6OA 3A98A 3VS3A 1NLPC 2X35A 1YHQA 1BI1A 2K2VA 1JRIA 1D0XA 2DBMA 3CCQT 4D8KA 2KQWA 2K3XA 3SDZA 3SHWA 3G71A 2ENMA 1MUZA 1G3YA 1WXBA 1WGSA 1KC8U 2ED1A 2H3JA 3E9FA 4ZTJA 2E5QA 1JBMA 2QASA 2V26A 1JO8A 2NUTA 3VUBA 3QPHA
chains in the Genus database with same CATH topology
2E4HA 3E2UA 2HKNA 2MPXC 2CP3A 2COYA 2CP0A 1TXQA 1WHGA 3TQ7P 1LPLA 2HL5C 2HL3A 2Z0WA 2CP5A 1TOVA 1WHMA 2HKQB 2HQHA 4B6MA 2CP2A 1WHHA 2COWA 2CP7A 2E3HA 1WHLA 2E3IA 1WHJA 1IXDA 2M02A 1WHKA 2QK0A 3RDVA 2CP6A 2COZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4H A;  3E2U A;  2HKN A;  2MPX C;  2CP3 A;  2COY A;  2CP0 A;  1TXQ A;  1WHG A;  3TQ7 P;  1LPL A;  2HL5 C;  2HL3 A;  2Z0W A;  2CP5 A;  1TOV A;  1WHM A;  2HKQ B;  2HQH A;  4B6M A;  2CP2 A;  1WHH A;  2COW A;  2CP7 A;  2E3H A;  1WHL A;  2E3I A;  1WHJ A;  1IXD A;  2M02 A;  1WHK A;  2QK0 A;  3RDV A;  2CP6 A;  2COZ A; 
#chains in the Genus database with same CATH topology
 3M5A A;  1UTI A;  3I56 Q;  1HD3 A;  1BI0 A;  4RCC A;  3RMS A;  2F5T X;  3A8L B;  2RJF A;  1YHQ T;  1JXO A;  2QG9 B;  4AFQ C;  1G3S A;  4DOV A;  1H3Z A;  4X9D A;  4IUT A;  2DVE A;  2O01 E;  2FRY A;  4NL2 A;  3DLL A;  3PIO A;  3VRZ A;  2ZPE B;  1I8F A;  2QA4 A;  4Q5W A;  3CD6 Q;  3QUI A;  2DD5 A;  1QP2 A;  3E1S A;  2QYZ A;  4C5E A;  1PSF A;  1NE8 A;  2P84 A;  2KBT A;  3QZ9 B;  2DX1 A;  1KQS A;  2HKQ B;  5I11 A;  4CC2 A;  5IHK A;  2ZPI B;  2EIF A;  4F7U B;  3HHT B;  3CCL T;  1UUE A;  5GAN h;  2L89 A;  2RHY A;  1WHJ A;  4M7A C;  2R57 A;  2DER A;  3QO3 A;  4OB0 B;  1WHG A;  4ZTF A;  4M78 E;  2LVM A;  1OUL A;  3TRE A;  2D1X A;  5GAN 8;  1D1C A;  4R0K A;  1Q86 U;  1EFN A;  4MZM A;  1NBE B;  4O5V A;  4PFO A;  2XDP A;  5GAN d;  2F5K A;  4FW1 A;  1VQK A;  2XD0 A;  5FU7 C;  2CS7 A;  4P5N A;  1K73 C;  2HBW A;  4D8D A;  3C94 A;  1VQN A;  2FZC B;  4DBQ A;  5GAN j;  1RL2 A;  1HXD A;  4M75 E;  3T9N A;  1RI9 A;  2CP2 A;  2L2P A;  2LT4 A;  1WJR A;  2JMC A;  5GAO r;  3QZ5 B;  5FRM A;  4UC4 A;  3PVQ A;  5GMK i;  6AT1 B;  3RIR A;  2NUZ A;  5GAN f;  2AKK A;  2LC4 A;  3HPW A;  2PVG B;  1YHQ Q;  3MP1 A;  2AZV A;  1VYV A;  3LX7 A;  1Q86 R;  1V29 B;  3CC7 T;  3EG9 B;  1CKA A;  1PSE A;  4HT8 A;  2LNH B;  3CXC A;  5A0L A;  3OS0 A;  3VV0 A;  2WAC A;  4E47 A;  5CAI A;  4ZN3 A;  1YWO A;  1O75 A;  2XID A;  4M7D D;  1Q81 U;  3D7S B;  2MYS A;  2VWF A;  1JQQ A;  2L0A A;  3NFC A;  3X26 B;  2LRQ A;  1BKB A;  2EGA A;  4BE0 A;  1VQ4 T;  1M9S A;  5KYW B;  3R6N A;  2R5M A;  3EHR A;  1PC0 A;  1FXX A;  2EJG A;  5L8R E;  4EMH A;  1RI0 A;  2YUQ A;  2CSI A;  5A0G A;  4JRQ A;  4M75 G;  2FPD A;  1QCF A;  2EQI A;  4FSX A;  1KC8 C;  2QA4 Q;  1J3T A;  4FT2 A;  2KT8 A;  3I5S A;  3UA6 A;  2KRS A;  1SEM A;  2K4Y A;  5FU6 C;  1M2O A;  1AOJ A;  3ASK A;  2CGH A;  4FL6 A;  4JLG A;  3QXE B;  1Q81 R;  1M3A A;  4DBR A;  2H8H A;  5GAN 3;  5KYU B;  4MZP A;  3HP9 A;  3QBY A;  4A54 A;  4PJO E;  3N5B B;  4A53 A;  2YUN A;  4QQ6 A;  2HD0 A;  1LOJ A;  3JB9 J;  2X9H A;  1HJD A;  2JTE A;  3ULR B;  2V8I A;  4C8Q C;  3CBM A;  5AT1 B;  3RER A;  3CCS A;  2BIV A;  3RKX A;  5LJ5 g;  1QVG A;  2I0N A;  3C95 A;  4FYW B;  4M77 C;  3OYJ A;  3CC7 Q;  1HSQ A;  3JCM V;  1VQK Q;  1PRL C;  5CKF A;  4C92 G;  3P8H A;  3MJX A;  1VQN Q;  2CUD A;  2DEQ A;  2R58 A;  4KUL A;  2NUP B;  1BCO A;  3C12 A;  1JB0 E;  1T0H A;  5IHN A;  2YRD A;  4GLM A;  1G5V A;  4M4Z A;  1Q86 C;  1VUB A;  2EYW A;  1ZUK A;  2RI3 A;  2GGR A;  2YUP A;  3H0I A;  5LJ3 h;  4ESR A;  2YHT A;  3INZ A;  3CQT A;  1OX8 A;  4M7A B;  4ELZ C;  4AG1 C;  1WJS A;  2RO0 A;  4BDZ A;  3EGD B;  4XU1 A;  3QII A;  4JS4 A;  1YJ9 T;  4QW2 A;  2C0I A;  2BUD A;  5IT9 E;  1UFF A;  1WI7 A;  5KYW A;  5LJ3 d;  7AT1 B;  2K6D A;  1YBY A;  5FU7 B;  5LJ5 h;  3EGU A;  1QWF A;  3PMI A;  3PVL A;  3OS2 A;  2BE9 B;  2LCC A;  2DD4 A;  3M53 A;  5CO7 A;  5LJ3 j;  4M78 B;  3JCM W;  1YCS B;  1LNX A;  1SF9 A;  1RAI B;  4MZT A;  2MIO A;  4N4H A;  4D6W A;  3OW2 A;  1M2V A;  2JOY A;  3SD4 A;  2FPE A;  5CQY A;  5J26 A;  3EG0 A;  4ANJ A;  1TUD A;  2OTJ A;  4Y91 A;  3EFO B;  5LJ3 f;  1QVF A;  3M0U A;  4OGE A;  2QDL A;  3IQL A;  1X01 A;  4C0F A;  1RAH B;  5I2M A;  2GCX A;  2CRE A;  3REB B;  2W0Z A;  4KH0 B;  4RCB A;  2EYQ A;  1KIK A;  3L2V A;  1ZSG A;  2GQV A;  1UG1 A;  3P8B B;  2GF7 A;  3RDV A;  1VQM T;  5LJ5 f;  2VV5 A;  1K0X A;  2QDY B;  4OB2 B;  2DXT A;  2YDL A;  1VQ5 T;  1UEC A;  2O9S A;  1AD5 A;  2X3X D;  3VJP A;  4LD6 A;  2QEX A;  2K5F A;  3CME T;  5M9O A;  3BFM A;  1MMG A;  4J9C A;  3RKW A;  5KE3 A;  2P0Q A;  5GAO l;  3MCA B;  3ER0 A;  5KYY A;  2CP7 A;  1ZHI A;  2Y90 A;  4CI0 C;  2NUP A;  1RAA B;  3CCS Q;  1U06 A;  3OQ5 A;  5KYX A;  1G3T A;  3CC2 A;  3LLR A;  5GAN e;  1YJ9 Q;  3PE0 A;  2LQK A;  3F70 A;  5FU6 B;  3M0Q A;  1ABO A;  2FPF A;  2RQV A;  3FEO A;  2G6F X;  1Y96 B;  3BDL A;  4JZ3 A;  1O9S A;  2LX9 A;  4KGZ B;  3GOX A;  1YJW T;  2CH4 A;  3E2U A;  1MMN A;  4Z02 A;  3LH5 A;  1X2K A;  1OV3 A;  2I2L A;  3OS5 A;  1BI2 A;  3JB9 G;  3DB4 A;  1VYT A;  4C8Q B;  5AYF A;  3OMC A;  4F7U E;  1QW1 A;  4JRK A;  2RJE A;  1KHC A;  2M1H A;  4M78 A;  1AWJ A;  4M7D C;  2ZAE A;  2K3B A;  3JV3 A;  2A37 A;  4M77 B;  2JUF A;  2V1Q A;  3CPW A;  5DM7 R;  3EFO A;  3H9N A;  4KUD K;  3RNJ A;  4BE2 A;  4ZGJ B;  1RAB B;  2XKO C;  5CVI A;  3OYB A;  3QG1 A;  1ZSZ A;  1VQ5 Q;  2JXB A;  3GBQ A;  4J9B A;  2WSF E;  1IGQ A;  1FYN A;  3H0H A;  1WHK A;  4E7J A;  3CEY A;  3SB2 A;  4FYV B;  4FYX B;  4E7I A;  1YI2 A;  2COZ A;  3VS7 A;  3OMG A;  3CCM A;  4J9E A;  3M58 A;  4VUB A;  3NTH A;  4J9D A;  4M75 F;  1H92 A;  2DK3 A;  1R0B G;  1V76 A;  3CCU A;  3JRZ A;  1R8O B;  1K76 A;  1SHF A;  4L6V 5;  2O4X B;  4A63 B;  2FYK A;  2KNB B;  4RUG A;  3RES A;  3NMZ C;  2K7A A;  1TXQ A;  2HQE A;  2KR3 A;  1WJQ A;  1V1C A;  1K9M R;  1UGV A;  1WQ7 A;  1OU8 A;  1KQS P;  2LJ3 A;  1NEB A;  4RTV A;  2E64 A;  4OVA A;  5DLO A;  2M0O A;  1IHV A;  2BTT A;  1N9S A;  2MAM A;  2K2M A;  2FG0 A;  3RBB B;  2WSC E;  2EQJ A;  3QDF A;  4RTU A;  3RKY A;  4F16 A;  4C92 F;  1KHI A;  4OMN A;  4ORZ A;  3CCE A;  4J7F A;  4EMK C;  2CZ6 B;  3FIF A;  2VXF A;  4EIK A;  4A4E A;  3OS1 A;  1Y07 A;  3QHS A;  1TUC A;  3OYA A;  4M77 D;  4KGX B;  3M4Y A;  2HKN A;  3AHU A;  5KE2 A;  1Z9Q A;  4BUG A;  3OSS C;  1YJN T;  2EYY A;  2L8D A;  4PJO A;  2GBQ A;  3NTK A;  1WHM A;  2R5A A;  2CT3 A;  2RJC A;  2LTO A;  1PWT A;  3OY9 A;  2JMA A;  3GLX A;  4BY6 C;  2EBP A;  3EGX A;  4E7K A;  1VQ9 T;  5DY9 A;  5GAN 4;  2HMA A;  3CCE T;  1UHF A;  4N0A C;  1BCM A;  1C1A A;  5LJ3 e;  2YLB A;  3I5R A;  3E19 A;  4JDS A;  4LDU A;  2Z0W A;  1CKB A;  2FHD A;  3CXC P;  2KI7 A;  5GAN g;  4WTO B;  1KQS S;  2J05 A;  3EHQ A;  3SWN A;  3PNW C;  1SRM A;  3RUX A;  2EW3 A;  1M3C A;  1UEB A;  3FC3 A;  3CPF A;  1PKT A;  3L2R A;  2WSE E;  4XTY A;  2A36 A;  1YI2 Q;  3CCM Q;  1B34 A;  2ESW A;  4PL6 A;  3MO8 A;  3TSW A;  1KFZ A;  5LJ5 e;  1QKX A;  1AT1 B;  2CP5 A;  2RQW A;  3CCU Q;  2RA2 A;  2PQW A;  5EG2 A;  1D09 B;  2KXC A;  1OX9 A;  1NJI U;  1WHL A;  2D8J A;  2JW4 A;  4IKF A;  4M7D B;  4Y28 E;  4GY5 A;  1GCQ A;  1X69 A;  2KVQ G;  3G71 T;  4M7A E;  2DYB A;  1YIT A;  2BZX A;  3X20 B;  3THK A;  2K9G A;  3LWI A;  1TTH B;  2YT6 A;  2VKN A;  4ZGD B;  4L5G A;  1PCX A;  5CKE A;  4F14 A;  3CCJ A;  4ELY C;  4C0G A;  4IUP A;  1PG5 B;  2K79 A;  1YJN Q;  2QK0 A;  4BAC A;  3M0S A;  1NLO C;  1SG5 A;  2C0T A;  2VAS A;  4OP0 A;  1FMK A;  1AWW A;  4LNP A;  2JN0 A;  4PJL A;  1QP3 A;  3HSB A;  2X4W A;  3VS5 A;  3VYH B;  1NJI R;  1SHG A;  5CIU A;  2QA4 T;  2A0F B;  1KD1 U;  1VQ9 Q;  1BIA A;  3C0C A;  4CC7 A;  3MEA A;  3QDR B;  3CXC S;  4JS5 A;  1YIT T;  3CCE Q;  1KJW A;  2KEA A;  2YRV A;  1Q7Y U;  5FRN A;  2JNG A;  1QVG P;  2DBK A;  1K0S A;  2ABL A;  2B8A A;  4LUE A;  2BE7 D;  2LQ8 A;  5KYN A;  2CT4 A;  1VQP A;  2GTJ A;  4MMK A;  1UGP B;  1YCY A;  3URG A;  3HL8 A;  2YXY A;  3Q1J A;  3A8M B;  1E6G A;  4QVZ A;  2KAF A;  2HQX A;  5GMK l;  2COW A;  1X75 C;  2F2V A;  3X24 B;  4QKU A;  1VQ6 A;  3UAT A;  2CH4 W;  4R55 A;  3JB9 F;  2JZ2 A;  1AZG B;  5GMK j;  1D1B A;  3VS4 A;  5CK9 A;  2DZC A;  3L1A A;  1KD1 R;  3TCJ A;  2C06 A;  2OAW A;  4DBH A;  1Q7Y R;  2K5L A;  2DA9 A;  2QTX A;  1VQK T;  2JJ9 A;  3G71 Q;  3G6E A;  1WHH A;  1SSH A;  4M78 G;  2KRN A;  2KMT A;  4EMK B;  4C5I A;  4AFS C;  4QVD A;  1VQ7 A;  5GAN 6;  4XTU A;  1VQN T;  1X27 A;  1SKU B;  2V8J A;  1UJY A;  2RJD A;  1ZBJ A;  2MWP A;  2V8K A;  3S3M A;  1VQ8 A;  4J7I A;  4JJD A;  5C0M A;  3JCM b;  2RK1 A;  2QQB A;  3SFM A;  2OTL A;  4M75 C;  3OW2 P;  1FMW A;  3UWN A;  1OPL A;  5J3B A;  2DJZ A;  1W2B P;  1I5O B;  4BD3 A;  1M90 U;  4BY6 B;  1A0N B;  1QVG S;  5I2S A;  3L2Q A;  2LZ6 B;  8AT1 B;  1QVF P;  2PU9 B;  4FT4 A;  4F7U A;  1MNE A;  1ACM B;  1PD0 A;  1YIT Q;  4JLI A;  3G6E T;  2FZG B;  1ZBX A;  2JM9 A;  2DMO A;  2LQN A;  2F1L A;  4C8Q E;  1UGR B;  1LVK A;  4PFZ A;  3QWX X;  3CCJ Q;  2BKD N;  4HKE A;  5LJ3 g;  2EJ9 A;  4M77 E;  2RK2 A;  2NLU A;  2DZ9 A;  1PNJ A;  5GMK m;  2LJ0 A;  5EC7 A;  4N4G A;  2ATC B;  3OYC A;  1YFN A;  2JVV A;  4DQ2 A;  2Y4X A;  3EFS A;  2X51 A;  2A7Y A;  3EG1 A;  2VXE A;  3CCV A;  1M90 R;  5DLQ E;  2PNI A;  3MHX A;  3UT1 A;  4RTX A;  3PT9 A;  4C92 C;  4OGC A;  3GF5 A;  3ZBD A;  3OYY A;  1M1F A;  2AK5 A;  2E65 A;  1OOT A;  2ZPB B;  2EKH A;  4QQG A;  3OYL A;  3CMA A;  2AT1 B;  3X25 B;  4QQD A;  1VQP Q;  4IUR A;  1PHT A;  2DRM A;  5KH6 A;  2RI2 A;  4HA8 A;  3LW5 E;  1WXT A;  2D0Q B;  3OW2 S;  3O5Z A;  2DIQ A;  2MK5 A;  3EG9 A;  1KD1 C;  1YIJ A;  1S72 A;  1VQ6 Q;  2IIM A;  1W2B S;  2X4X A;  1IRX A;  1KK7 A;  3CCV T;  4KRT A;  3VS0 A;  1QVF S;  1D3B B;  3PGG A;  3CCS T;  1ZUU A;  4PJO G;  4ZGE B;  2DEU A;  1RAC B;  3PTA A;  3L2U A;  1K9A A;  3BE3 A;  2RQT A;  1KQ1 A;  4BB7 A;  3G6E Q;  2KXD A;  3ZFJ A;  4AG2 C;  1M8M A;  2DRK A;  1M27 C;  2DXU A;  2J6F A;  3CPW P;  4NS5 A;  1K8A U;  2RI5 A;  5C6S A;  4LDX A;  2DL4 A;  2VC8 A;  1I1J A;  1M1K U;  1VQ8 Q;  4E7H A;  4PK4 A;  4LE9 A;  2PVO B;  2OTL Q;  1ZUY A;  1QLY A;  1W2B A;  4PKC C;  3FJP A;  2O9V A;  3TVT A;  3U23 A;  4HCB A;  2V1R A;  5KYU A;  5I22 A;  2HL5 C;  3OYE A;  4FM4 B;  1Q81 C;  4LN2 A;  4A4K A;  3LGL A;  3NGP A;  3QKJ A;  1EIF A;  1AWX A;  1UGS B;  1ZA1 B;  2JS0 A;  3HFN A;  4E2F B;  1WA7 A;  1OZ3 A;  4J6W A;  4BI3 A;  1K8A R;  3CC4 A;  2YWW A;  3MEW A;  1GCP A;  1M1K R;  3HKS A;  1RAE B;  3LH0 A;  3DKM A;  2VUB A;  2HL3 A;  1MMA A;  3I35 A;  2CSQ A;  2OTJ T;  2L3Q A;  4EPC A;  3CCV Q;  2DIG A;  3M0P A;  1D0Y A;  4CC4 B;  3M0T A;  4FCY A;  4O6J A;  4HXJ A;  5CCA A;  1OQK A;  4AT1 B;  3TEE A;  2P4R A;  1TWB A;  2HCK A;  3VYG A;  4Z88 A;  1Y57 A;  2DJQ A;  1I0C A;  1YWP A;  3CMA Q;  9ATC B;  2KRO A;  2JTM A;  3CPW S;  2AKL A;  2RNA A;  3AT1 B;  1Q82 U;  2CKK A;  3A8O B;  3ZL7 C;  4M7A A;  3A8G B;  2DTH A;  3HFO A;  5D7U A;  4C5H A;  2ZPF B;  2K5I A;  4M7D E;  1NYF A;  5GMK e;  1BU1 A;  4M7A F;  3EGD A;  1SSF A;  2FEI A;  4LDV A;  2QEX T;  5D6Y A;  4HVV A;  1YIJ Q;  2CZ7 B;  1S72 Q;  2CYZ B;  4YTL A;  1TH7 A;  4JRP A;  3BW1 A;  1TSF A;  3EH1 A;  1QQJ A;  1FMV A;  2AZS A;  2E70 A;  3JCM h;  3CC2 T;  1S1N A;  4XTX A;  3GNF B;  1T0J A;  5GAM g;  3P8D A;  1N8R U;  4M78 F;  2VB6 A;  1Q82 R;  2QGF B;  2XMF A;  5FWB A;  4BI4 A;  3OYI A;  2HZY A;  4FIB A;  3JCM d;  1IB8 A;  4CRI A;  4IUQ A;  3TU4 K;  1K9M U;  4K11 A;  1CSK A;  2EVR A;  4J8O A;  1E6H A;  2P4T A;  3I55 A;  2EYX A;  2M16 A;  5GAN 5;  2LJ1 A;  2OTJ Q;  2FL7 A;  1UHC A;  4KH1 B;  4RKU E;  1RLQ C;  1NEG A;  3QJY A;  4IUU A;  2HBP A;  3ZEH A;  4M75 D;  1QKW A;  1X6B A;  3JCM f;  1M1K C;  1W70 A;  1TUG B;  1VYU A;  2RMO A;  1N8R R;  4OMO A;  1IXD A;  1VIF A;  2RD1 A;  3S3O A;  2EGE A;  2FZK B;  3I56 A;  4F7U G;  4AFZ C;  3CC4 Q;  1JJ2 A;  2A08 A;  3DB3 A;  3V7S A;  4J83 A;  5GAM h;  2HDA A;  2E41 A;  3PFS A;  2RH2 A;  1U5S A;  4A4G A;  5FLX E;  3CBO A;  2EPD A;  2QEX Q;  2L3R A;  3GNG A;  2NUT B;  2MI6 A;  4GLK A;  1YI2 T;  4RMO A;  3CCM T;  2QTV A;  3FJ5 A;  3QYG B;  3CBP A;  1HK9 A;  2M02 A;  3FRN A;  3TSZ A;  3G4S A;  1M1G A;  2FVU A;  1Y96 A;  3CCU T;  1M5Q 1;  5GAM d;  2QQR A;  2H3E B;  3CC2 Q;  1B07 A;  2XG8 D;  5CQX A;  3OBY A;  3A8H B;  1KG1 A;  1UJ0 A;  1WDX A;  2NWM A;  3E9G A;  1T3S A;  5A2Q E;  2FRW A;  2DLP A;  2EAY A;  5GAM j;  1JXM A;  3KUF A;  2ECZ A;  5GAO q;  4C92 D;  5KCH A;  2KDS A;  4C8Q A;  2FB7 A;  2QGG A;  3M0R A;  4DA4 A;  3JCM X;  2E10 A;  4C8Q F;  5GAM f;  1QVP A;  2QI2 A;  2PVD B;  1W6X A;  2HNI A;  2EFI A;  2MMP A;  2ROL A;  4M77 A;  3VRY A;  3REA B;  1EX4 A;  2OI3 A;  1JEG A;  3CCQ A;  1TOV A;  5HY6 A;  3V8L A;  2SRC A;  3J7A F;  3EFR A;  3QWY A;  5IAY A;  3WXM B;  3V8J A;  1GFC A;  4PJO F;  1Q82 C;  3X28 B;  4IIM A;  4E7S A;  1SRL A;  1I81 A;  2EKO A;  1UDL A;  1K73 R;  2E5K A;  2EJF A;  2EQM A;  2KE9 A;  2RHZ A;  4WCI A;  4J6Y A;  1MHN A;  3M55 A;  3OB9 A;  3DLM A;  3FB9 A;  2EQU A;  2B86 A;  2BZ8 A;  2CUB A;  1T3L A;  4PNO A;  3MKD A;  2KYM A;  3VS2 A;  2DET A;  2O4X A;  3I55 Q;  5I21 A;  2XI9 A;  2A28 A;  2PUK B;  3LGF A;  1U1T A;  2F69 A;  3JAM E;  1ZQ1 A;  1VOM A;  5CKH A;  2AIR B;  2D9T A;  1N8R C;  2XHC A;  3BDU A;  4XTV A;  3MP6 A;  1YNZ A;  4Z89 A;  2MWO A;  4ATO A;  1K9M C;  1R77 A;  4XQ3 A;  2KGT A;  3CCL A;  2LP5 A;  5GAO n;  2VYT A;  3TQ7 P;  1WPY A;  2DL7 A;  4KUI A;  2K3Y A;  5CR2 A;  1WQW A;  2DVJ A;  2E3I A;  2KY9 A;  2YLC A;  2DO3 A;  4LD9 K;  2EYZ A;  3KXT A;  1GRI A;  3G4S Q;  1MGQ A;  1KC8 R;  5FRO A;  2X4Y A;  2DKG A;  2XDD A;  1KQ2 A;  4NOY A;  4OMF B;  3JSC A;  3WVE B;  1X6O A;  1Q95 G;  2DF6 A;  2OAU A;  1B3Q A;  5GMK h;  4X34 A;  4LUD A;  4EDU A;  1P92 A;  3OBW A;  1H8K A;  2DXC A;  4HCK A;  8ATC B;  2FO0 A;  1PKS A;  2MF2 A;  4OMP A;  3CCJ T;  1QCO A;  1B7T A;  1QWE A;  1G3W A;  2QQS A;  3A5Z B;  2G3R A;  2HEQ A;  1H3H A;  1OEB A;  1RUW A;  4M7A G;  4IIO A;  2ZZD A;  2CZ0 B;  4X1V A;  1ZX6 A;  4C5G A;  4PLL A;  3CCQ Q;  1IHW A;  3CC7 A;  1RAG B;  5HCK A;  4C0Z A;  5A0D A;  2A3L A;  4HVW A;  2ZCF B;  2J7I A;  2KT1 A;  4LDY A;  2KK4 A;  1WLP B;  1NPR A;  2CP0 A;  3JB9 D;  1IRE B;  1WX6 A;  2DTO A;  1AEY A;  4M78 C;  3JCM J;  2HSP A;  3L42 A;  1AWO A;  4DEX A;  2JTF A;  1ZLM A;  4XU2 A;  4JJN K;  1I5L A;  2DL3 A;  1VQ4 A;  4KT0 E;  2ZPG B;  1VQP T;  1Y0M A;  1NPP A;  3JCM e;  2DL8 A;  5GAO p;  3JCM c;  2GTO A;  4L59 A;  1W1F A;  2K57 A;  2YRC A;  3KFV A;  1Z9Z A;  1ZSZ C;  1OPK A;  4FU6 A;  3KBG A;  2GFU A;  4M7D A;  1BI3 A;  4A4H A;  2XIC A;  1D1A A;  2VGN A;  4XTZ A;  4NL3 A;  2BZY A;  1VQ6 T;  2EWN A;  2L3P A;  3HTR A;  2DTI A;  4J6X A;  4M7D F;  1U1S A;  2VVK A;  2JS2 A;  2RPN A;  3OYM A;  3QYH B;  1ZA2 B;  4C0D C;  3RMQ A;  4AMC A;  3JCM Q;  4Y92 A;  2DNU A;  1N9R A;  4Z8A A;  2XDB A;  3L2W A;  1PD1 A;  3EG3 A;  3RR6 A;  3CCL Q;  4BE1 A;  1JU5 C;  4KGV B;  4MML A;  4X9C A;  5FW9 A;  1KSW A;  4F7U F;  1VQ7 T;  2LX7 A;  1MV0 B;  1PM3 A;  3HRS A;  4C92 E;  2SEM A;  2O2O A;  1VQ8 T;  5ECA A;  2QQ9 A;  1XNI A;  2D6F A;  3VUZ A;  4MDW A;  2LNV A;  3FLG A;  2O88 A;  3OYN A;  2OTL T;  4J9I A;  1NJI C;  5HKC A;  1M2V B;  1LCK A;  3GP8 A;  2DIL A;  3HRU A;  5GAM e;  2X3W D;  4J9H A;  3OSV A;  4E7Z A;  1IGU A;  2J06 A;  1VQL A;  2E3H A;  1HYO A;  3CCR A;  4ZN1 A;  1X6G A;  4OB1 B;  4IUV A;  2CP6 A;  3VS6 A;  5FWC A;  1G8X A;  2RQU A;  1TS9 A;  2RQR A;  4JZ4 A;  1W4S A;  1Y71 A;  2DAQ A;  3QSU A;  3WVD B;  3OYD A;  4II1 A;  2L3S A;  4C8Q G;  1AHJ B;  4PFP A;  4AFU C;  3S3N A;  1OZ2 A;  4R56 A;  1YJ9 A;  4PJO C;  1FX7 A;  2F2X A;  1TU0 B;  1Q7Y C;  2OX7 A;  4EMK A;  2M9U A;  4M77 G;  1VQL T;  5KYY B;  2LT1 A;  3CCR T;  4OML A;  4J9F A;  5KYX B;  3LYI A;  1QMC A;  4B6M A;  4F04 B;  4RTY A;  5D6W A;  3UF4 A;  3CMA T;  1E7O A;  1VQ4 Q;  4MDX A;  4BI8 B;  4PJN A;  3MET A;  1VQ7 Q;  1UE9 A;  2E12 A;  3EAE A;  4B9X A;  1IO6 A;  3EH2 A;  2ROT A;  1H64 1;  4PLI A;  2KSS A;  3MEU A;  3EG2 A;  4HCZ A;  4RTW A;  3SWN C;  2LQW A;  4N4I A;  1YIJ T;  2E6N A;  1WZO A;  1S72 T;  2C0O A;  3O8V A;  4N0A A;  2E1H A;  4DOW A;  2DM1 A;  2GQI A;  2PZ1 A;  1WFW A;  2EGC A;  1I4K 1;  2XK0 A;  4JUV A;  4WF2 A;  5GJV B;  4JRI A;  4PJJ A;  2MOX A;  5D6X A;  1NZ9 A;  2D0N A;  3UPU A;  1VQM A;  3BY7 A;  3LWH A;  2HAX A;  1VQ5 A;  1GCQ C;  1IZ6 A;  4KBM B;  2MCN A;  2KRM A;  2YUO A;  3CME A;  5LJ5 d;  1WNL A;  1GBQ A;  3V7C A;  2ZPH B;  5IHI A;  1BB9 A;  1U8R A;  4FSS A;  2RHI A;  1JJ2 P;  1GFD A;  2OJ2 A;  1ZSZ B;  4OF1 A;  2Y4Y A;  1M90 C;  1BK2 A;  3JCM g;  2XU8 A;  5CKD A;  4JPB W;  1BIB A;  5LJ5 j;  1RAD B;  1XJW B;  4RG8 A;  5IXB A;  1WXU A;  3H0F A;  3M59 A;  4M75 B;  4TVR A;  4J5Y A;  2F2W A;  3QJ6 A;  2RF0 A;  1VQL Q;  4C0D B;  2L5Q A;  2PUO B;  1LJO A;  1ARK A;  3VKI A;  3CCR Q;  2NYS A;  4EMG A;  3JB9 I;  1M30 A;  3M9Q A;  3I9Q A;  4RG2 A;  1YJW A;  4DEY A;  4F17 A;  3UA7 A;  3ME9 A;  1VQO A;  4E6R A;  2DFU A;  1I07 A;  1GL5 A;  3OA6 A;  1D3B A;  3CC4 T;  2RB6 A;  3V8K A;  4BDY A;  2IVW A;  2IPO B;  3MEV A;  3OYG A;  4HVU A;  3J81 E;  1NG2 A;  2MPX C;  4M7A D;  1M4Z A;  1XTD A;  2O31 A;  2IG0 A;  1LPL A;  2M0Y A;  5HK0 A;  2CDT A;  4XAX B;  5J39 A;  1C0M A;  1SPK A;  4FW2 A;  3VU3 C;  4C92 B;  2LMJ A;  1X43 A;  1K4U S;  2RHU A;  1VA7 A;  5KCO A;  1WIE A;  5IXF A;  1NYG A;  2KYB A;  1VQO T;  4B9W A;  5IH2 A;  5CKB A;  4RTZ A;  2CZ1 B;  3M4G A;  1C6V X;  2JT4 A;  5GAN 2;  1JJ2 S;  3M54 A;  4J9G A;  3JB9 H;  4M78 D;  2D8H A;  2DE0 X;  3A1P A;  3UDC A;  4CC3 A;  3PIP A;  4DBF A;  4A4F A;  2LCL A;  2HSE B;  4QVC A;  4OMQ A;  3HRT A;  3H6Z A;  2ED0 A;  1OYX A;  1WYX A;  2YSQ A;  4PJO B;  5GJW B;  4M7D G;  1QCN A;  1EZZ B;  5IN1 A;  1N5Z A;  2DXB A;  2RN8 A;  3M57 A;  3VS1 A;  5HK3 A;  1VQM Q;  3MPU B;  2RM4 A;  2DPP B;  2HQH A;  3EGX B;  1K8A C;  4RTT A;  1PRM C;  3JCM P;  1GBR A;  4HCC A;  1BYM A;  3GPL A;  3CME Q;  2QQA A;  1UB4 A;  4M75 A;  1YP5 A;  4ZNX A;  4XU0 A;  1ABQ A;  2QAZ A;  2GNC A;  5GAO m;  2P0K A;  1FWZ A;  4OB3 B;  1Y7X A;  1AVZ C;  2QXF A;  2PTK A;  4V2S A;  4ME7 A;  3SWN B;  4LDW A;  3H8Z A;  1XQH A;  3I55 T;  1AZE A;  2DYI A;  2JM8 A;  1MND A;  1M8V A;  1M3B A;  4QT7 A;  1B34 B;  3G7Z A;  1U3O A;  5LL6 S;  1NM7 A;  1N6A A;  3FDR A;  3CD6 A;  4XK8 E;  4XTW A;  3V7R A;  1D0Z A;  3M56 A;  4LXC A;  1MV3 A;  1MMD A;  3S6W A;  2EQK A;  1N27 A;  3OYH A;  2E6Z A;  3R6O A;  1YJW Q;  1VQO Q;  1RAF B;  2J6K A;  3I56 T;  2AHJ B;  1YJN A;  1K73 U;  3C4S A;  4OMM A;  2ZGW A;  3SEM A;  3NTI A;  2VGM A;  2LDM A;  4JJB A;  1UGQ B;  2E4H A;  1R0C B;  1GXI E;  3MP8 A;  3NHN A;  4C92 A;  3OYK A;  1OI1 A;  1G83 A;  3L2Z A;  2M51 A;  2DL5 A;  4PJM A;  1VQ9 A;  3NPF A;  3GIB A;  4E7L A;  2GFA A;  3CD6 T;  5L23 A;  4C8Q D;  1F1B B;  3G4S T;  2RHX A;  2X4J A;  4M77 F;  4GBQ A;  1X2Q A;  1VIE A;  2LCS A;  5GAN 7;  4FYY B;  1DJ7 B;  4JJC A;  3PMT A;  2CP3 A;  1K1Z A;  4PJO D;  3J80 E;  1OU9 A;  2COY A;  3H41 A;  1G2B A;  1RLP C;  1XOV A;  3G1J A;  1YN8 A;  3OYF A;  4XU3 A;  2W10 A;  1BBZ A;  2P0P A;  4HT9 A;  1TG0 A;  2J6O A;  3A98 A;  3VS3 A;  1NLP C;  2X35 A;  1YHQ A;  1BI1 A;  2K2V A;  1JRI A;  1D0X A;  2DBM A;  3CCQ T;  4D8K A;  2KQW A;  2K3X A;  3SDZ A;  3SHW A;  3G71 A;  2ENM A;  1MUZ A;  1G3Y A;  1WXB A;  1WGS A;  1KC8 U;  2ED1 A;  2H3J A;  3E9F A;  4ZTJ A;  2E5Q A;  1JBM A;  2QAS A;  2V26 A;  1JO8 A;  2NUT A;  3VUB A;  3QPH A; 
#chains in the Genus database with same CATH homology
 2E4H A;  3E2U A;  2HKN A;  2MPX C;  2CP3 A;  2COY A;  2CP0 A;  1TXQ A;  1WHG A;  3TQ7 P;  1LPL A;  2HL5 C;  2HL3 A;  2Z0W A;  2CP5 A;  1TOV A;  1WHM A;  2HKQ B;  2HQH A;  4B6M A;  2CP2 A;  1WHH A;  2COW A;  2CP7 A;  2E3H A;  1WHL A;  2E3I A;  1WHJ A;  1IXD A;  2M02 A;  1WHK A;  2QK0 A;  3RDV A;  2CP6 A;  2COZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...