2COWA

Solution structure of the cap-gly domain in human kinesin-like protein kif13b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
100
structure length
100
Chain Sequence
GSSGSSGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF13B
publication title Solution structure of the CAP-Gly domain in human Kinesin-like protein KIF13B
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cowA01
1WHJA 2CP2A 2COZA 3E2UA 1WHGA 2CP7A 3RDVA 2CP0A 1WHKA 2E3IA 2HL3A 2Z0WA 2CP3A 2M02A 4B6MA 1LPLA 1WHMA 2HQHA 2COWA 1TXQA 1IXDA 3TQ7P 2HKQB 2E4HA 2CP6A 1WHHA 2HKNA 2E3HA 1WHLA 1TOVA 2CP5A 2HL5C 2COYA 2MPXC 2QK0A
chains in the Genus database with same CATH superfamily
2HBWA 2CH4A 2DIQA 4QQDA 1NEGA 3JRZA 3V8KA 1JO8A 5GAMh 1YNZA 2DL4A 1FMWA 2F5TX 5L23A 1FMKA 1SG5A 5I11A 3G4ST 4J9DA 2ZPFB 1M90U 1NJIU 1I4K1 4PK4A 4FYWB 3BDLA 3M4GA 5C0MA 1VQ8Q 3O8VA 2VXFA 3JCMh 1M5Q1 1VQ9Q 5IHNA 1YJNA 4RCBA 4M7DG 4C0DB 1JJ2S 1D3BB 1QWFA 2C0IA 3ZL7C 2BKDN 2WSEE 2HAXA 2KYBA 4LDWA 1X2QA 4OMMA 3SWNA 3A1PA 3DB4A 2M51A 2J6FA 2CYZB 2EGCA 2DFUA 3MP6A 1YHQQ 2C0OA 2EGEA 1C0MA 2GGRA 1W2BP 3I55Q 2LCLA 3UDCA 3RKYA 5CK9A 1WQ7A 3QSUA 1K73U 1TS9A 2DXCA 2HCKA 4NS5A 1QWEA 3CC7T 2MK5A 3JV3A 1Q95G 3KXTA 3M55A 1TUCA 4BI3A 4C8QC 3MCAB 2NUTA 5DM7R 5FRNA 5LJ5e 1CKAA 4XTXA 2QEXA 1ZX6A 4FYXB 3QYGB 1JRIA 2XD0A 1KSWA 3HP9A 4HA8A 3FIFA 2XDDA 1WHGA 1BI2A 2ZPBB 5GAOl 2HDAA 2DBKA 1N8RU 1K9AA 3N5BB 4ZN1A 5KYXA 4CC7A 4QQGA 4N4IA 1BK2A 5FU7B 4M7DE 4LDXA 1SSHA 4M78E 2KR3A 4ZTFA 1UUEA 4Z8AA 1Y96A 3CCSQ 2KBTA 5LJ3d 1BIBA 3OY9A 2RJCA 5CAIA 3GOXA 3MEWA 1U1TA 2A28A 2L3PA 2XDBA 3OYNA 4XU2A 1FYNA 1JXMA 5C6SA 2KY9A 2DD4A 2ZPHB 3VU3C 3KUFA 4IURA 1Y71A 5LJ5h 2CREA 2WSFE 1D0XA 3M0UA 3JCMc 2KEAA 2R5MA 2LX7A 2GTOA 2M0OA 3FJPA 4RUGA 4XAXB 1YJNQ 1WDXA 3OMCA 3VUZA 3VS4A 1BYMA 1LCKA 1F1BB 1IZ6A 5FW9A 3SWNC 3M4YA 3TSZA 2EAYA 4AG2C 1VQLT 3M5AA 2D9TA 4KRTA 2EJ9A 1TWBA 1M8VA 2KNBB 2M1HA 1S72A 2DEUA 4FW2A 2K5FA 3OW2S 3MKDA 5CKHA 2AT1B 2GNCA 3HTRA 2XDPA 3FJ5A 3EFRA 3NTKA 4BDYA 3F70A 4O5VA 4C0GA 1WHLA 2JM8A 4JRPA 3MP1A 1T0JA 1ZA2B 2ECZA 1QMCA 1VQMT 2KXDA 3CEYA 3JCMQ 2NUPB 4BUGA 3CXCA 4M77G 4JS5A 1NPRA 4L59A 3G71Q 3BFMA 3NTIA 1HD3A 4C8QD 3CCRT 4GY5A 1B7TA 1X75C 2A37A 4EDUA 1RLPC 1RI9A 1M1KU 2K4YA 4A4KA 4B9WA 1K4US 1CSKA 2RNAA 2RQRA 2ZZDA 2GBQA 1ABQA 2JS0A 1QVFP 3OSVA 2YXYA 4AT1B 3PNWC 2HQEA 4BD3A 1Q86C 4PJOG 1RAIB 4KH1B 1PC0A 2EJGA 5CIUA 3GBQA 1PSEA 2KT1A 4M75G 2MCNA 3O5ZA 1VQ5T 4HT8A 2FPEA 1WJRA 3BY7A 3I56T 3P8HA 2NYSA 2OTJA 1UGQB 3LGFA 2KDSA 1AWWA 4QT7A 4FSXA 4QVCA 3OQ5A 1UJYA 4GLMA 2DD5A 2QQ9A 4HCBA 3SDZA 5I22A 3CCQA 2X3WD 2JTMA 3M59A 2V1QA 2DO3A 2DNUA 2P0QA 1YJWT 4AFZC 2CDTA 1JU5C 3VS2A 4ELYC 2YRCA 3H9NA 4B6MA 1H641 4QW2A 1M2VB 3OMGA 3HHTB 1LVKA 1D09B 1B34B 4C5EA 1NLOC 3CCJT 2C06A 5FU6C 5GMKe 3M56A 4M78A 3VS0A 1M30A 3UPUA 3CC2T 4RTYA 1YCYA 4PJOE 5GAOq 8AT1B 3I5RA 2Z0WA 4M75E 1VQKQ 1RI0A 2JUFA 1QQJA 2RJDA 4Z02A 1VQOT 3C95A 3LW5E 4PL6A 2LX9A 2CZ1B 2DIGA 2L3SA 4D6WA 1RADB 3E19A 2RQUA 3HRTA 2JOYA 1VQNT 4AFSC 1KQSS 1QW1A 5KYUB 4C5IA 1S1NA 1Q86R 3CC7A 3PMTA 2P0KA 2QYZA 1SHFA 2AKKA 2LNHB 4IKFA 2DERA 3LWHA 1RLQC 4UC4A 1VQ6Q 1IGUA 1WLPB 5CCAA 3RNJA 3CCVT 3EFOB 1K9MR 1ABOA 3QDRB 4TVRA 3J81E 5IT9E 1HSQA 2FRYA 5GMKh 2E10A 4C92E 4DQ2A 1TG0A 4BY6C 3UA7A 3V8LA 2HZYA 4EPCA 4M7AE 4RTWA 1R0CB 2OTJQ 1OQKA 1VQ4Q 2EIFA 2LC4A 3DLLA 4QKUA 1YIJT 2QI2A 3EH2A 4A53A 3LX7A 2QQBA 4XU0A 3S3NA 2RHUA 2CGHA 2CSIA 4C5GA 3ASKA 2QEXT 2LVMA 2YRDA 5KCHA 4BDZA 5L8RE 2OTLQ 5I2SA 2EBPA 2COWA 2M16A 3G4SQ 2EGAA 2VYTA 4RCCA 1ZSZB 1SRMA 1PCXA 2GQVA 2PUOB 4XU1A 3EFSA 2NLUA 4M7DC 2B86A 3JCMg 4F7UA 1RAHB 4M78C 1K73C 3C4SA 1B07A 3X28B 1ZUKA 2J06A 3CCEQ 4E7JA 2EQJA 1LPLA 1RAEB 2KRSA 2IIMA 1VQ7T 1RABB 2LDMA 1G3WA 4X9CA 2L8DA 2DEQA 3M54A 3RKWA 5KYWB 2FEIA 4XU3A 1N8RC 4J9IA 4OMOA 3VRYA 1MV0B 1VOMA 3OS0A 3CC7Q 2HL3A 1PD0A 4HXJA 2LQWA 3CC4A 2JMAA 1UGVA 4AFUC 3ZFJA 3TU4K 1VQMA 3UT1A 1BIAA 2COYA 2J6OA 3RR6A 3M0SA 1ZUYA 5GAMd 2MIOA 2GTJA 3M0QA 9ATCB 1S72T 1HJDA 3CCRA 4C8QB 1SHGA 4A54A 3J7AF 2YDLA 1K9MU 1TTHB 3EGUA 3TEEA 2EQKA 3M0PA 3E2UA 1ZSGA 2EQIA 2PVDB 2RN8A 4J5YA 1ZQ1A 1YITT 3CPWA 2ED1A 3JB9G 1T0HA 2XI9A 2L89A 1H3ZA 4FM4B 3A8HB 4ORZA 1K73R 5KYYA 5GANg 5LJ5g 1KQ1A 5KCOA 1K0XA 3NMZC 2RQTA 4DBFA 3I56A 5D6WA 4KUDK 4JPBW 1YJ9Q 2FG0A 3MEUA 2JN0A 3ME9A 2KK4A 4OB1B 5CKFA 1SSFA 1QVGS 2RI3A 2D1XA 3T9NA 2DLPA 3GF5A 1YI2Q 1NLPC 2HQHA 2D8JA 2E41A 3OB9A 2DXUA 2DILA 1VQLQ 3L2WA 4JZ4A 2MPXC 3EG1A 3VYHB 1V76A 3NTHA 4J9CA 1YJWA 4M78D 2M9UA 4RKUE 1Z9QA 1VIFA 3FB9A 3PMIA 1H3HA 4M4ZA 2ZPIB 2EQUA 5LJ3j 4C92A 4JRKA 1M8MA 2P0PA 5GMKm 2I0NA 3L42A 3QYHB 5GAN7 3CXCS 2O88A 4M7AA 2HKNA 4B9XA 7AT1B 1GFDA 5ECAA 3CCJA 1M1KC 4A4EA 2E5QA 1UE9A 2OAWA 3CCQT 3CC2A 2V1RA 1VQMQ 2LJ3A 1KG1A 1J3TA 3QWYA 5GMKi 4DEXA 2NUTB 1VQOA 2DE0X 1V29B 2O4XA 1QP2A 1OOTA 4XTZA 3FRNA 5DLQE 5EC7A 3CCRQ 4LUDA 1GXIE 4PJNA 1VQNA 1OV3A 2LJ0A 1PRLC 3FEOA 3VKIA 3WXMB 5KYXB 2FZKB 3EGDA 2PVOB 2YRVA 3QKJA 2L5QA 2IPOB 2RK1A 3I9QA 2J6KA 1E7OA 4LN2A 4PJOC 3MP8A 1JBMA 3CCVA 4LXCA 1ACMB 1PWTA 1Y96B 2X35A 4R55A 1OZ2A 2F69A 5GAOr 1I5LA 1WFWA 2FPFA 2R58A 1KQ2A 1VQ5Q 4XQ3A 1G2BA 5HK0A 4PJJA 1TSFA 4AMCA 3OYJA 1PD1A 4FT2A 2QTVA 1Y57A 2D0NA 2EKHA 4CC3A 1YIJA 1SRLA 3GPLA 2P4TA 3JSCA 2KROA 5GANf 4KBMB 3OYLA 1UEBA 5LJ5f 4F14A 1IB8A 1NG2A 2P4RA 2XU8A 1I07A 4OMQA 5GANe 1PNJA 5M9OA 1M27C 4XTVA 1RL2A 4KUIA 5GMKl 3META 1NYFA 3C94A 2CP2A 2QG9B 2COZA 3G1JA 3CCMT 4JJNK 4MDXA 1YJWQ 2K2VA 1M1KR 1FXXA 4LD6A 3MHXA 4C92C 4JRQA 3JB9J 4DBHA 3CBOA 1VQPT 4M7AC 4MMKA 4WTOB 3MEVA 3WVEB 2FO0A 2R57A 1JXOA 5CVIA 4BB7A 4J6WA 2L0AA 3HRUA 1OULA 4WF2A 4A63B 4DBQA 3Q1JA 1X27A 3CC2Q 3RDVA 1BI1A 2K5IA 2QDLA 2F2VA 4N0AC 4M78F 1VQ7A 1NM7A 4XTWA 1D3BA 1AZGB 3R6OA 4PNOA 1VQOQ 3OYHA 4OB0B 2EWNA 3CBPA 5IH2A 5GANh 1WXBA 2KQWA 5FU6B 2LQKA 1OU8A 1JJ2P 2MWPA 1I1JA 4E2FB 3G6ET 3E9FA 1GCPA 2XIDA 3SHWA 3JCMV 2DRKA 1KK7A 4J9EA 4J9FA 3QPHA 4BE0A 4WCIA 1WA7A 2LQNA 2FVUA 1QVGA 4RG2A 1VA7A 1AWXA 2LRQA 2EYZA 2NWMA 3M9QA 4JUVA 2YT6A 4OF1A 4IUUA 4PKCC 3LYIA 1MNDA 5GAOn 4JRIA 1SF9A 2MWOA 2DPPB 5FWBA 2A3LA 3WVDB 2K79A 1W2BA 5CQYA 3M53A 1XQHA 1KJWA 4II1A 1KIKA 5KE2A 3CC4T 4CC2A 2K5LA 1YITA 2W10A 3QG1A 4BY6B 2QEXQ 3RERA 2XK0A 2KVQG 2DZ9A 5LJ3e 1YWPA 1Q82C 1NPPA 1QVPA 2RM4A 2F1LA 4D8DA 2X4WA 2QXFA 3CQTA 2XICA 4A4FA 2Y90A 3C0CA 5HY6A 2M02A 1X69A 2EYWA 3HPWA 3VYGA 3PIPA 1IGQA 1WZOA 5CKDA 2EYQA 1MGQA 1N6AA 4XTUA 1XTDA 2E70A 1PM3A 4J7FA 5GAOp 3CMET 2XG8D 3EG9A 2KGTA 4MDWA 5A0GA 2E6NA 1H8KA 4PJLA 4HKEA 4F7UF 1WGSA 4C0DC 3OYCA 2RHYA 1N9SA 4X34A 4C92D 1U5SA 1I0CA 2YHTA 3OBWA 3THKA 3RMSA 2ZCFB 1VQ7Q 1YCSB 3PTAA 1NE8A 1DJ7B 2EKOA 4C5HA 4OMLA 1OU9A 4M78B 1BBZA 1OX9A 3QXEB 2X3XD 4N4HA 3C12A 1QP3A 5D6YA 2DM1A 1K9MC 2EYYA 2RH2A 4J8OA 4M77E 4IIOA 1HK9A 2CS7A 2VV5A 2KRMA 1FMVA 2F5KA 3OW2P 3TREA 1S72Q 5IXBA 2O9VA 1V1CA 1AD5A 3VS5A 2NUPA 2EJFA 2DF6A 4DA4A 3A8GB 1WNLA 2DTOA 4RTXA 1IXDA 3CPWS 1Q82R 4ZTJA 3FLGA 3H0FA 3QO3A 4O6JA 1EIFA 4C8QG 4LD9K 3QDFA 3X20B 5GAN3 4M7DA 2O2OA 2LZ6B 4OMFB 3JCMX 3I5SA 4BI4A 4A4HA 1GBRA 1QCNA 1K8AR 1IRXA 2ROTA 2E64A 4QQ6A 2ABLA 2RMOA 4Y92A 2YLCA 3OYEA 1C1AA 1TUGB 1OEBA 1PHTA 4HVUA 5IN1A 2PTKA 1G3SA 3TSWA 3SD4A 5FWCA 4OGEA 3URGA 3EG3A 5GAMj 5J39A 2V8KA 1WJSA 1X2KA 3A98A 4F7UB 5DLOA 1KD1C 3G7ZA 4IIMA 3CCMA 3CCUA 4PJMA 4C8QF 2QA4T 2DVJA 1YN8A 4LDUA 5CO7A 5HKCA 5AYFA 2RJEA 1VQPA 1QVFA 5GAN5 5D6XA 3L2VA 1GRIA 1H92A 3HFOA 5EG2A 4J9GA 2HBPA 1C6VX 4QVDA 3OS5A 1T3LA 1D0YA 1ZBXA 2DZCA 4L5GA 3CCQQ 4BE2A 3REBB 3L2RA 3H8ZA 2KXCA 5A0DA 3H41A 1KFZA 3GLXA 2RK2A 3VRZA 3J80E 2VUBA 1QLYA 4ESRA 2EFIA 3MEAA 4NL3A 3OYFA 2LP5A 4ANJA 4FU6A 2HKQB 2MF2A 1AZEA 2KSSA 2L2PA 3P8DA 2JTFA 2FPDA 1BB9A 4RTTA 4C0FA 3G6EA 1OYXA 2HSPA 2OAUA 4PFZA 3PVLA 4K11A 3S3OA 2CSQA 2HMAA 2DL5A 4JDSA 1WQWA 2OI3A 2LNVA 2FRWA 1Q82U 3LGLA 1LJOA 3UF4A 3D7SB 4JZ3A 2YUNA 5KH6A 2G3RA 3CMAT 1SPKA 2LCSA 3FC3A 1KQSP 4ZN3A 2ATCB 4E47A 2KYMA 3RMQA 1WHJA 1ZA1B 5KYYB 2O9SA 1KD1R 4E7ZA 3RIRA 1K8AU 5IXFA 4HVWA 3HL8A 4Q5WA 2I2LA 1WHMA 1W1FA 3R6NA 3VV0A 1X6BA 2FB7A 1G8XA 2E3HA 2LT1A 2RF0A 2CP5A 5GJWB 1LOJA 1JB0E 5LJ5j 3CCMQ 4R56A 4FW1A 4M77A 3OYAA 1YP5A 2DXTA 5FRMA 3QIIA 5J26A 1K0SA 1Z9ZA 1BI0A 1PKTA 2C0TA 1VQPQ 2FL7A 2YSQA 4L6V5 1M3AA 4XTYA 5I21A 3LH5A 3AHUA 3ZEHA 3CMEA 2B8AA 1UGSB 4OMNA 1ZBJA 3JCMd 5FROA 1YWOA 2BTTA 1N27A 2D6FA 2CZ0B 3OS1A 2MAMA 3NGPA 3AT1B 3PGGA 4RG8A 2H3JA 2WACA 2CP0A 2PNIA 4C92B 2XKOC 1N9RA 1OPKA 1KC8R 1D1CA 4JLIA 2YUOA 2VC8A 1W6XA 3M0RA 2XMFA 4PJOA 1B3QA 1UHCA 2GFAA 2RB6A 4M75A 1WXUA 2RJFA 1XOVA 2KE9A 3QHSA 4CC4B 2Y4XA 3GIBA 1I5OB 4JJCA 3G6EQ 2V8IA 2CP7A 2O4XB 1X01A 3L1AA 5HK3A 4RTZA 1VQKT 1Y7XA 1QCFA 1GCQA 4BI8B 1YHQA 4EMKA 1OI1A 4OVAA 2ZAEA 3I55A 1R77A 2RHZA 1UTIA 3DKMA 2E5KA 3EGDB 2D0QB 4M7DD 1WX6A 4LDVA 1QCOA 1MNEA 2X4YA 4FIBA 2HSEB 1W2BS 2RHXA 3PFSA 2EPDA 3JB9I 3IQLA 2CUDA 3JCMP 3BE3A 2FZGB 1TU0B 3PIOA 3BDUA 2AHJB 3SWNB 1KHIA 2K7AA 2NUZA 2RHIA 3DB3A 2YLBA 1VIEA 2LJ1A 3ER0A 3LLRA 2D8HA 2FZCB 1M9SA 2RO0A 1BKBA 2IG0A 4DOVA 3EGXA 5CKBA 2HEQA 4HCZA 3CC4Q 1MUZA 2KRNA 4M77C 1NZ9A 2BZXA 1KD1U 2RI2A 1ZUUA 1G5VA 2L3QA 4FL6A 4GBQA 2ENMA 2QASA 1G3TA 2E1HA 2VXEA 3MPUB 1Q7YC 5GANd 2ED0A 4N0AA 1UJ0A 1ZLMA 5LJ5d 2DYIA 4F16A 1TH7A 1Y0MA 3CCSA 5GAN4 4KH0B 3SFMA 3CMEQ 4IUVA 4E7HA 2QK0A 5DY9A 1M1FA 4RTUA 4EMGA 1UGPB 6AT1B 3INZA 2DK3A 2OTLT 1NEBA 2IVWA 4KULA 1P92A 4N4GA 2VGNA 4M75C 3JCMb 2QA4A 2SEMA 2J7IA 2BE9B 1VUBA 4RTVA 4JS4A 3X26B 2DX1A 1X6OA 2GFUA 4X1VA 5LJ3g 1QVGP 4Y91A 3I56Q 3KBGA 1KC8U 1U06A 1UGRB 1W70A 4M78G 3CCET 1GCQC 2AZSA 2CKKA 4EMKC 3QBYA 3UATA 1TXQA 3M57A 3CCLT 4P5NA 2DAQA 3SEMA 3EHQA 5I2MA 1UDLA 3VJPA 2DA9A 3CCUT 2VB6A 3CBMA 4J83A 2X9HA 4LUEA 5KYNA 3PE0A 1IHWA 2ROLA 3PVQA 4EMHA 1OZ3A 2P84A 2JTEA 1XNIA 2QAZA 1UFFA 3CXCP 3EG2A 1K1ZA 4V2SA 1EZZB 4RMOA 4ZGEB 1T3SA 2HQXA 3X24B 1EFNA 2XHCA 1Q7YR 3QWXX 2LT4A 1WI7A 2EYXA 3U23A 3CCJQ 3G71A 3MJXA 1UG1A 2O31A 4M7DF 3L2QA 5GMKj 2PVGB 3JAME 3A8LB 2H8HA 3CMAA 2DKGA 4DOWA 1N5ZA 2F2XA 1AOJA 2ESWA 4E7IA 4M77D 4F17A 1VQNQ 2JNGA 3REAB 1JQQA 3OSSC 1U3OA 3V8JA 2WSCE 2JT4A 2QQAA 4EIKA 1PKSA 3QZ5B 3E9GA 3EG9B 3L2UA 2JVVA 3V7CA 1QVFS 4Z89A 2KI7A 3CCVQ 2K2MA 1E6HA 2K9GA 3CPFA 1YJ9T 4PFOA 5D7UA 2QA4Q 2DVEA 4OMPA 2SRCA 4F7UG 1Y07A 2OX7A 2X51A 3CD6T 2X4XA 3NPFA 3OS2A 3OYDA 1I8FA 5A0LA 1YI2T 2QQRA 1FX7A 4LE9A 4PJOD 5IHIA 1G83A 3VUBA 2F2WA 1HXDA 1AWJA 1YIJQ 3A8OB 4M75D 2DRMA 4DEYA 1KHCA 4HVVA 4YTLA 1WPYA 3OYYA 1G3YA 2PZ1A 5LJ3f 3EHRA 2K3YA 2CH4W 4J6YA 3QZ9B 4ME7A 4IUTA 1BCMA 2DETA 1EX4A 1D1AA 3I35A 3VS6A 2BE7D 1X6GA 4XK8E 2DL7A 3KFVA 3E1SA 2HD0A 3JB9H 2O01E 2K6DA 2KAFA 3DLMA 3TVTA 5GAN6 4IUQA 1K8AC 4A4GA 1VQKA 2LCCA 3QJ6A 3HKSA 2QQSA 2LQ8A 3GNGA 1ZHIA 3RUXA 3X25B 5GAN2 4F7UE 4MZMA 4M7AD 5KE3A 2CP6A 1R8OB 1Q7YU 2E65A 2GCXA 4M7DB 3CMAQ 4OGCA 2HL5C 4ZGJB 1BI3A 1VQ8T 3NHNA 2JW4A 4FT4A 2RQWA 1I81A 1VQ9T 3SB2A 1HYOA 2KT8A 4ZNXA 5LJ3h 1VQ6A 2DMOA 2AKLA 1CKBA 2H3EB 1BCOA 4KT0E 1PRMC 4FCYA 1IHVA 3VS1A 3NFCA 1Q81C 3ZBDA 2CZ7B 1WHHA 1JJ2A 2VKNA 3P8BB 1SKUB 1YHQT 2AZVA 2K57A 1AVZC 5GJVB 3V7SA 3OYMA 3RBBB 3I55T 3S3MA 3ULRB 1GL5A 3JCMW 1JEGA 1VQ4A 4ATOA 4M77F 2OJ2A 4J9BA 4KGXB 1UB4A 2M0YA 1OPLA 1VYVA 3OA6A 1GFCA 4E7LA 5FU7C 4ZGDB 8ATCB 2KMTA 5CQXA 1OX8A 1PSFA 4ELZC 2VVKA 1YITQ 2OTLA 4CRIA 1NYGA 3G4SA 1XJWB 3M0TA 2JJ9A 2VASA 3MO8A 2LMJA 4HCKA 4C92G 2J05A 1RUWA 5CR2A 1UHFA 5HCKA 1AHJB 4M7AG 3A5ZB 4PJOF 2X4JA 3CCST 4M75F 3CCEA 1MMNA 2GF7A 4J9HA 1WIEA 3EG0A 2BIVA 1WHKA 3EH1A 2ZPEB 3VS7A 3CCLA 2E4HA 5FLXE 5LL6S 2CT4A 4JJDA 1O9SA 1YBYA 4FYVB 4GLKA 3H0HA 1Q81R 1UECA 3EAEA 3V7RA 2R5AA 1M4ZA 2L3RA 2FYKA 1RACB 3UA6A 1M3BA 4PLLA 1U8RA 1YJNT 4C8QE 2E3IA 3HSBA 2RD1A 5AT1B 2E6ZA 2BUDA 3GP8A 4C92F 1TOVA 2GQIA 1M2VA 2PUKB 5CKEA 4M7AF 1RAFB 1D1BA 2G6FX 3RESA 1ARKA 2CUBA 4E7SA 1MMDA 1R0BG 3A8MB 1B34A 2QGGA 3GNFB 5IHKA 1M90C 1NJIC 3CPWP 2A0FB 3H0IA 3LH0A 2LTOA 1E6GA 2MMPA 3TCJA 3OW2A 2DTIA 2EQMA 4M77B 2DXBA 3QJYA 4D8KA 2PQWA 2K3XA 1KC8C 3RKXA 5J3BA 2AK5A 3H6ZA 5GAMg 3L2ZA 1NBEB 5KYUA 3G71T 3LWIA 1WXTA 2DJZA 4E6RA 1BU1A 4IUPA 4NL2A 1YJ9A 4HCCA 4J6XA 3OBYA 2RQVA 3JB9D 1M2OA 2W0ZA 1TUDA 2A36A 3OYKA 3CD6A 2JMCA 4AG1C 2EVRA 3EFOA 2A08A 2BZ8A 4LDYA 1YI2A 1WJQA 1VQLA 4PJOB 2YUPA 2MOXA 4M75B 1MMGA 4Z88A 2PU9B 1AEYA 3CCLQ 4DBRA 3BW1A 4R0KA 4MMLA 5GANj 2FHDA 2RPNA 3CCUQ 4BE1A 2JZ2A 4Y28E 2YUQA 3OYBA 2DL3A 2Y4YA 4EMKB 4KGVB 1QKWA 1RAGB 4OB3B 4VUBA 1M90R 1NJIR 1Q81U 3M58A 2YWWA 1U1SA 1ZSZA 1SEMA 1Q86U 2DTHA 1MV3A 1VYUA 2DYBA 4OB2B 4OP0A 3VS3A 1IREB 2ZPGB 4M7AB 3EGXB 4PLIA 5IAYA 2EW3A 4BACA 4PFPA 4HT9A 1VQ8A 1FWZA 2CZ6B 4FSSA 1AT1B 2ZGWA 2JM9A 1VQ9A 3HRSA 4FYYB 1K76A 5KYWA 4CI0C 4F04B 2MYSA 4JJBA 5GAN8 4MZTA 4KGZB 3TQ7P 4AFQC 3HFNA 1VQ5A 2DL8A 4E7KA 1GBQA 2AIRB 2BZYA 2DJQA 5GAMf 2CT3A 2JS2A 3CD6Q 1YFNA 1IO6A 5GAMe 4MZPA 4C0ZA 3FDRA 3S6WA 2CP3A 4J7IA 1N8RR 1AWOA 1VYTA 4NOYA 1VQ6T 1KQSA 2RI5A 4X9DA 2QTXA 4LNPA 1RAAB 2A7YA 4C8QA 3JCMf 3OYIA 2V8JA 2QDYB 2V26A 1A0NB 1MMAA 3JCMe 4QVZA 2MI6A 5A2QE 1W4SA 2JXBA 3PT9A 1M1GA 1PG5B 1O75A 3OYGA 3JB9F 4JLGA 3JCMJ 1X43A 2RA2A 3UWNA 1WYXA 2OTJT 2K3BA 1VQ4T 2E12A 1M3CA 2HNIA 1MHNA 2VGMA 3QUIA 2VWFA 1QKXA 1ZSZC 5GAOm 1D0ZA 1LNXA 2DBMA 2QGFB
chains in the Genus database with same CATH topology
1WHJA 2CP2A 2COZA 3E2UA 1WHGA 2CP7A 3RDVA 2CP0A 1WHKA 2E3IA 2HL3A 2Z0WA 2CP3A 2M02A 4B6MA 1LPLA 1WHMA 2HQHA 2COWA 1TXQA 1IXDA 3TQ7P 2HKQB 2E4HA 2CP6A 1WHHA 2HKNA 2E3HA 1WHLA 1TOVA 2CP5A 2HL5C 2COYA 2MPXC 2QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHJ A;  2CP2 A;  2COZ A;  3E2U A;  1WHG A;  2CP7 A;  3RDV A;  2CP0 A;  1WHK A;  2E3I A;  2HL3 A;  2Z0W A;  2CP3 A;  2M02 A;  4B6M A;  1LPL A;  1WHM A;  2HQH A;  2COW A;  1TXQ A;  1IXD A;  3TQ7 P;  2HKQ B;  2E4H A;  2CP6 A;  1WHH A;  2HKN A;  2E3H A;  1WHL A;  1TOV A;  2CP5 A;  2HL5 C;  2COY A;  2MPX C;  2QK0 A; 
#chains in the Genus database with same CATH topology
 2HBW A;  2CH4 A;  2DIQ A;  4QQD A;  1NEG A;  3JRZ A;  3V8K A;  1JO8 A;  5GAM h;  1YNZ A;  2DL4 A;  1FMW A;  2F5T X;  5L23 A;  1FMK A;  1SG5 A;  5I11 A;  3G4S T;  4J9D A;  2ZPF B;  1M90 U;  1NJI U;  1I4K 1;  4PK4 A;  4FYW B;  3BDL A;  3M4G A;  5C0M A;  1VQ8 Q;  3O8V A;  2VXF A;  3JCM h;  1M5Q 1;  1VQ9 Q;  5IHN A;  1YJN A;  4RCB A;  4M7D G;  4C0D B;  1JJ2 S;  1D3B B;  1QWF A;  2C0I A;  3ZL7 C;  2BKD N;  2WSE E;  2HAX A;  2KYB A;  4LDW A;  1X2Q A;  4OMM A;  3SWN A;  3A1P A;  3DB4 A;  2M51 A;  2J6F A;  2CYZ B;  2EGC A;  2DFU A;  3MP6 A;  1YHQ Q;  2C0O A;  2EGE A;  1C0M A;  2GGR A;  1W2B P;  3I55 Q;  2LCL A;  3UDC A;  3RKY A;  5CK9 A;  1WQ7 A;  3QSU A;  1K73 U;  1TS9 A;  2DXC A;  2HCK A;  4NS5 A;  1QWE A;  3CC7 T;  2MK5 A;  3JV3 A;  1Q95 G;  3KXT A;  3M55 A;  1TUC A;  4BI3 A;  4C8Q C;  3MCA B;  2NUT A;  5DM7 R;  5FRN A;  5LJ5 e;  1CKA A;  4XTX A;  2QEX A;  1ZX6 A;  4FYX B;  3QYG B;  1JRI A;  2XD0 A;  1KSW A;  3HP9 A;  4HA8 A;  3FIF A;  2XDD A;  1WHG A;  1BI2 A;  2ZPB B;  5GAO l;  2HDA A;  2DBK A;  1N8R U;  1K9A A;  3N5B B;  4ZN1 A;  5KYX A;  4CC7 A;  4QQG A;  4N4I A;  1BK2 A;  5FU7 B;  4M7D E;  4LDX A;  1SSH A;  4M78 E;  2KR3 A;  4ZTF A;  1UUE A;  4Z8A A;  1Y96 A;  3CCS Q;  2KBT A;  5LJ3 d;  1BIB A;  3OY9 A;  2RJC A;  5CAI A;  3GOX A;  3MEW A;  1U1T A;  2A28 A;  2L3P A;  2XDB A;  3OYN A;  4XU2 A;  1FYN A;  1JXM A;  5C6S A;  2KY9 A;  2DD4 A;  2ZPH B;  3VU3 C;  3KUF A;  4IUR A;  1Y71 A;  5LJ5 h;  2CRE A;  2WSF E;  1D0X A;  3M0U A;  3JCM c;  2KEA A;  2R5M A;  2LX7 A;  2GTO A;  2M0O A;  3FJP A;  4RUG A;  4XAX B;  1YJN Q;  1WDX A;  3OMC A;  3VUZ A;  3VS4 A;  1BYM A;  1LCK A;  1F1B B;  1IZ6 A;  5FW9 A;  3SWN C;  3M4Y A;  3TSZ A;  2EAY A;  4AG2 C;  1VQL T;  3M5A A;  2D9T A;  4KRT A;  2EJ9 A;  1TWB A;  1M8V A;  2KNB B;  2M1H A;  1S72 A;  2DEU A;  4FW2 A;  2K5F A;  3OW2 S;  3MKD A;  5CKH A;  2AT1 B;  2GNC A;  3HTR A;  2XDP A;  3FJ5 A;  3EFR A;  3NTK A;  4BDY A;  3F70 A;  4O5V A;  4C0G A;  1WHL A;  2JM8 A;  4JRP A;  3MP1 A;  1T0J A;  1ZA2 B;  2ECZ A;  1QMC A;  1VQM T;  2KXD A;  3CEY A;  3JCM Q;  2NUP B;  4BUG A;  3CXC A;  4M77 G;  4JS5 A;  1NPR A;  4L59 A;  3G71 Q;  3BFM A;  3NTI A;  1HD3 A;  4C8Q D;  3CCR T;  4GY5 A;  1B7T A;  1X75 C;  2A37 A;  4EDU A;  1RLP C;  1RI9 A;  1M1K U;  2K4Y A;  4A4K A;  4B9W A;  1K4U S;  1CSK A;  2RNA A;  2RQR A;  2ZZD A;  2GBQ A;  1ABQ A;  2JS0 A;  1QVF P;  3OSV A;  2YXY A;  4AT1 B;  3PNW C;  2HQE A;  4BD3 A;  1Q86 C;  4PJO G;  1RAI B;  4KH1 B;  1PC0 A;  2EJG A;  5CIU A;  3GBQ A;  1PSE A;  2KT1 A;  4M75 G;  2MCN A;  3O5Z A;  1VQ5 T;  4HT8 A;  2FPE A;  1WJR A;  3BY7 A;  3I56 T;  3P8H A;  2NYS A;  2OTJ A;  1UGQ B;  3LGF A;  2KDS A;  1AWW A;  4QT7 A;  4FSX A;  4QVC A;  3OQ5 A;  1UJY A;  4GLM A;  2DD5 A;  2QQ9 A;  4HCB A;  3SDZ A;  5I22 A;  3CCQ A;  2X3W D;  2JTM A;  3M59 A;  2V1Q A;  2DO3 A;  2DNU A;  2P0Q A;  1YJW T;  4AFZ C;  2CDT A;  1JU5 C;  3VS2 A;  4ELY C;  2YRC A;  3H9N A;  4B6M A;  1H64 1;  4QW2 A;  1M2V B;  3OMG A;  3HHT B;  1LVK A;  1D09 B;  1B34 B;  4C5E A;  1NLO C;  3CCJ T;  2C06 A;  5FU6 C;  5GMK e;  3M56 A;  4M78 A;  3VS0 A;  1M30 A;  3UPU A;  3CC2 T;  4RTY A;  1YCY A;  4PJO E;  5GAO q;  8AT1 B;  3I5R A;  2Z0W A;  4M75 E;  1VQK Q;  1RI0 A;  2JUF A;  1QQJ A;  2RJD A;  4Z02 A;  1VQO T;  3C95 A;  3LW5 E;  4PL6 A;  2LX9 A;  2CZ1 B;  2DIG A;  2L3S A;  4D6W A;  1RAD B;  3E19 A;  2RQU A;  3HRT A;  2JOY A;  1VQN T;  4AFS C;  1KQS S;  1QW1 A;  5KYU B;  4C5I A;  1S1N A;  1Q86 R;  3CC7 A;  3PMT A;  2P0K A;  2QYZ A;  1SHF A;  2AKK A;  2LNH B;  4IKF A;  2DER A;  3LWH A;  1RLQ C;  4UC4 A;  1VQ6 Q;  1IGU A;  1WLP B;  5CCA A;  3RNJ A;  3CCV T;  3EFO B;  1K9M R;  1ABO A;  3QDR B;  4TVR A;  3J81 E;  5IT9 E;  1HSQ A;  2FRY A;  5GMK h;  2E10 A;  4C92 E;  4DQ2 A;  1TG0 A;  4BY6 C;  3UA7 A;  3V8L A;  2HZY A;  4EPC A;  4M7A E;  4RTW A;  1R0C B;  2OTJ Q;  1OQK A;  1VQ4 Q;  2EIF A;  2LC4 A;  3DLL A;  4QKU A;  1YIJ T;  2QI2 A;  3EH2 A;  4A53 A;  3LX7 A;  2QQB A;  4XU0 A;  3S3N A;  2RHU A;  2CGH A;  2CSI A;  4C5G A;  3ASK A;  2QEX T;  2LVM A;  2YRD A;  5KCH A;  4BDZ A;  5L8R E;  2OTL Q;  5I2S A;  2EBP A;  2COW A;  2M16 A;  3G4S Q;  2EGA A;  2VYT A;  4RCC A;  1ZSZ B;  1SRM A;  1PCX A;  2GQV A;  2PUO B;  4XU1 A;  3EFS A;  2NLU A;  4M7D C;  2B86 A;  3JCM g;  4F7U A;  1RAH B;  4M78 C;  1K73 C;  3C4S A;  1B07 A;  3X28 B;  1ZUK A;  2J06 A;  3CCE Q;  4E7J A;  2EQJ A;  1LPL A;  1RAE B;  2KRS A;  2IIM A;  1VQ7 T;  1RAB B;  2LDM A;  1G3W A;  4X9C A;  2L8D A;  2DEQ A;  3M54 A;  3RKW A;  5KYW B;  2FEI A;  4XU3 A;  1N8R C;  4J9I A;  4OMO A;  3VRY A;  1MV0 B;  1VOM A;  3OS0 A;  3CC7 Q;  2HL3 A;  1PD0 A;  4HXJ A;  2LQW A;  3CC4 A;  2JMA A;  1UGV A;  4AFU C;  3ZFJ A;  3TU4 K;  1VQM A;  3UT1 A;  1BIA A;  2COY A;  2J6O A;  3RR6 A;  3M0S A;  1ZUY A;  5GAM d;  2MIO A;  2GTJ A;  3M0Q A;  9ATC B;  1S72 T;  1HJD A;  3CCR A;  4C8Q B;  1SHG A;  4A54 A;  3J7A F;  2YDL A;  1K9M U;  1TTH B;  3EGU A;  3TEE A;  2EQK A;  3M0P A;  3E2U A;  1ZSG A;  2EQI A;  2PVD B;  2RN8 A;  4J5Y A;  1ZQ1 A;  1YIT T;  3CPW A;  2ED1 A;  3JB9 G;  1T0H A;  2XI9 A;  2L89 A;  1H3Z A;  4FM4 B;  3A8H B;  4ORZ A;  1K73 R;  5KYY A;  5GAN g;  5LJ5 g;  1KQ1 A;  5KCO A;  1K0X A;  3NMZ C;  2RQT A;  4DBF A;  3I56 A;  5D6W A;  4KUD K;  4JPB W;  1YJ9 Q;  2FG0 A;  3MEU A;  2JN0 A;  3ME9 A;  2KK4 A;  4OB1 B;  5CKF A;  1SSF A;  1QVG S;  2RI3 A;  2D1X A;  3T9N A;  2DLP A;  3GF5 A;  1YI2 Q;  1NLP C;  2HQH A;  2D8J A;  2E41 A;  3OB9 A;  2DXU A;  2DIL A;  1VQL Q;  3L2W A;  4JZ4 A;  2MPX C;  3EG1 A;  3VYH B;  1V76 A;  3NTH A;  4J9C A;  1YJW A;  4M78 D;  2M9U A;  4RKU E;  1Z9Q A;  1VIF A;  3FB9 A;  3PMI A;  1H3H A;  4M4Z A;  2ZPI B;  2EQU A;  5LJ3 j;  4C92 A;  4JRK A;  1M8M A;  2P0P A;  5GMK m;  2I0N A;  3L42 A;  3QYH B;  5GAN 7;  3CXC S;  2O88 A;  4M7A A;  2HKN A;  4B9X A;  7AT1 B;  1GFD A;  5ECA A;  3CCJ A;  1M1K C;  4A4E A;  2E5Q A;  1UE9 A;  2OAW A;  3CCQ T;  3CC2 A;  2V1R A;  1VQM Q;  2LJ3 A;  1KG1 A;  1J3T A;  3QWY A;  5GMK i;  4DEX A;  2NUT B;  1VQO A;  2DE0 X;  1V29 B;  2O4X A;  1QP2 A;  1OOT A;  4XTZ A;  3FRN A;  5DLQ E;  5EC7 A;  3CCR Q;  4LUD A;  1GXI E;  4PJN A;  1VQN A;  1OV3 A;  2LJ0 A;  1PRL C;  3FEO A;  3VKI A;  3WXM B;  5KYX B;  2FZK B;  3EGD A;  2PVO B;  2YRV A;  3QKJ A;  2L5Q A;  2IPO B;  2RK1 A;  3I9Q A;  2J6K A;  1E7O A;  4LN2 A;  4PJO C;  3MP8 A;  1JBM A;  3CCV A;  4LXC A;  1ACM B;  1PWT A;  1Y96 B;  2X35 A;  4R55 A;  1OZ2 A;  2F69 A;  5GAO r;  1I5L A;  1WFW A;  2FPF A;  2R58 A;  1KQ2 A;  1VQ5 Q;  4XQ3 A;  1G2B A;  5HK0 A;  4PJJ A;  1TSF A;  4AMC A;  3OYJ A;  1PD1 A;  4FT2 A;  2QTV A;  1Y57 A;  2D0N A;  2EKH A;  4CC3 A;  1YIJ A;  1SRL A;  3GPL A;  2P4T A;  3JSC A;  2KRO A;  5GAN f;  4KBM B;  3OYL A;  1UEB A;  5LJ5 f;  4F14 A;  1IB8 A;  1NG2 A;  2P4R A;  2XU8 A;  1I07 A;  4OMQ A;  5GAN e;  1PNJ A;  5M9O A;  1M27 C;  4XTV A;  1RL2 A;  4KUI A;  5GMK l;  3MET A;  1NYF A;  3C94 A;  2CP2 A;  2QG9 B;  2COZ A;  3G1J A;  3CCM T;  4JJN K;  4MDX A;  1YJW Q;  2K2V A;  1M1K R;  1FXX A;  4LD6 A;  3MHX A;  4C92 C;  4JRQ A;  3JB9 J;  4DBH A;  3CBO A;  1VQP T;  4M7A C;  4MMK A;  4WTO B;  3MEV A;  3WVE B;  2FO0 A;  2R57 A;  1JXO A;  5CVI A;  4BB7 A;  4J6W A;  2L0A A;  3HRU A;  1OUL A;  4WF2 A;  4A63 B;  4DBQ A;  3Q1J A;  1X27 A;  3CC2 Q;  3RDV A;  1BI1 A;  2K5I A;  2QDL A;  2F2V A;  4N0A C;  4M78 F;  1VQ7 A;  1NM7 A;  4XTW A;  1D3B A;  1AZG B;  3R6O A;  4PNO A;  1VQO Q;  3OYH A;  4OB0 B;  2EWN A;  3CBP A;  5IH2 A;  5GAN h;  1WXB A;  2KQW A;  5FU6 B;  2LQK A;  1OU8 A;  1JJ2 P;  2MWP A;  1I1J A;  4E2F B;  3G6E T;  3E9F A;  1GCP A;  2XID A;  3SHW A;  3JCM V;  2DRK A;  1KK7 A;  4J9E A;  4J9F A;  3QPH A;  4BE0 A;  4WCI A;  1WA7 A;  2LQN A;  2FVU A;  1QVG A;  4RG2 A;  1VA7 A;  1AWX A;  2LRQ A;  2EYZ A;  2NWM A;  3M9Q A;  4JUV A;  2YT6 A;  4OF1 A;  4IUU A;  4PKC C;  3LYI A;  1MND A;  5GAO n;  4JRI A;  1SF9 A;  2MWO A;  2DPP B;  5FWB A;  2A3L A;  3WVD B;  2K79 A;  1W2B A;  5CQY A;  3M53 A;  1XQH A;  1KJW A;  4II1 A;  1KIK A;  5KE2 A;  3CC4 T;  4CC2 A;  2K5L A;  1YIT A;  2W10 A;  3QG1 A;  4BY6 B;  2QEX Q;  3RER A;  2XK0 A;  2KVQ G;  2DZ9 A;  5LJ3 e;  1YWP A;  1Q82 C;  1NPP A;  1QVP A;  2RM4 A;  2F1L A;  4D8D A;  2X4W A;  2QXF A;  3CQT A;  2XIC A;  4A4F A;  2Y90 A;  3C0C A;  5HY6 A;  2M02 A;  1X69 A;  2EYW A;  3HPW A;  3VYG A;  3PIP A;  1IGQ A;  1WZO A;  5CKD A;  2EYQ A;  1MGQ A;  1N6A A;  4XTU A;  1XTD A;  2E70 A;  1PM3 A;  4J7F A;  5GAO p;  3CME T;  2XG8 D;  3EG9 A;  2KGT A;  4MDW A;  5A0G A;  2E6N A;  1H8K A;  4PJL A;  4HKE A;  4F7U F;  1WGS A;  4C0D C;  3OYC A;  2RHY A;  1N9S A;  4X34 A;  4C92 D;  1U5S A;  1I0C A;  2YHT A;  3OBW A;  3THK A;  3RMS A;  2ZCF B;  1VQ7 Q;  1YCS B;  3PTA A;  1NE8 A;  1DJ7 B;  2EKO A;  4C5H A;  4OML A;  1OU9 A;  4M78 B;  1BBZ A;  1OX9 A;  3QXE B;  2X3X D;  4N4H A;  3C12 A;  1QP3 A;  5D6Y A;  2DM1 A;  1K9M C;  2EYY A;  2RH2 A;  4J8O A;  4M77 E;  4IIO A;  1HK9 A;  2CS7 A;  2VV5 A;  2KRM A;  1FMV A;  2F5K A;  3OW2 P;  3TRE A;  1S72 Q;  5IXB A;  2O9V A;  1V1C A;  1AD5 A;  3VS5 A;  2NUP A;  2EJF A;  2DF6 A;  4DA4 A;  3A8G B;  1WNL A;  2DTO A;  4RTX A;  1IXD A;  3CPW S;  1Q82 R;  4ZTJ A;  3FLG A;  3H0F A;  3QO3 A;  4O6J A;  1EIF A;  4C8Q G;  4LD9 K;  3QDF A;  3X20 B;  5GAN 3;  4M7D A;  2O2O A;  2LZ6 B;  4OMF B;  3JCM X;  3I5S A;  4BI4 A;  4A4H A;  1GBR A;  1QCN A;  1K8A R;  1IRX A;  2ROT A;  2E64 A;  4QQ6 A;  2ABL A;  2RMO A;  4Y92 A;  2YLC A;  3OYE A;  1C1A A;  1TUG B;  1OEB A;  1PHT A;  4HVU A;  5IN1 A;  2PTK A;  1G3S A;  3TSW A;  3SD4 A;  5FWC A;  4OGE A;  3URG A;  3EG3 A;  5GAM j;  5J39 A;  2V8K A;  1WJS A;  1X2K A;  3A98 A;  4F7U B;  5DLO A;  1KD1 C;  3G7Z A;  4IIM A;  3CCM A;  3CCU A;  4PJM A;  4C8Q F;  2QA4 T;  2DVJ A;  1YN8 A;  4LDU A;  5CO7 A;  5HKC A;  5AYF A;  2RJE A;  1VQP A;  1QVF A;  5GAN 5;  5D6X A;  3L2V A;  1GRI A;  1H92 A;  3HFO A;  5EG2 A;  4J9G A;  2HBP A;  1C6V X;  4QVD A;  3OS5 A;  1T3L A;  1D0Y A;  1ZBX A;  2DZC A;  4L5G A;  3CCQ Q;  4BE2 A;  3REB B;  3L2R A;  3H8Z A;  2KXC A;  5A0D A;  3H41 A;  1KFZ A;  3GLX A;  2RK2 A;  3VRZ A;  3J80 E;  2VUB A;  1QLY A;  4ESR A;  2EFI A;  3MEA A;  4NL3 A;  3OYF A;  2LP5 A;  4ANJ A;  4FU6 A;  2HKQ B;  2MF2 A;  1AZE A;  2KSS A;  2L2P A;  3P8D A;  2JTF A;  2FPD A;  1BB9 A;  4RTT A;  4C0F A;  3G6E A;  1OYX A;  2HSP A;  2OAU A;  4PFZ A;  3PVL A;  4K11 A;  3S3O A;  2CSQ A;  2HMA A;  2DL5 A;  4JDS A;  1WQW A;  2OI3 A;  2LNV A;  2FRW A;  1Q82 U;  3LGL A;  1LJO A;  3UF4 A;  3D7S B;  4JZ3 A;  2YUN A;  5KH6 A;  2G3R A;  3CMA T;  1SPK A;  2LCS A;  3FC3 A;  1KQS P;  4ZN3 A;  2ATC B;  4E47 A;  2KYM A;  3RMQ A;  1WHJ A;  1ZA1 B;  5KYY B;  2O9S A;  1KD1 R;  4E7Z A;  3RIR A;  1K8A U;  5IXF A;  4HVW A;  3HL8 A;  4Q5W A;  2I2L A;  1WHM A;  1W1F A;  3R6N A;  3VV0 A;  1X6B A;  2FB7 A;  1G8X A;  2E3H A;  2LT1 A;  2RF0 A;  2CP5 A;  5GJW B;  1LOJ A;  1JB0 E;  5LJ5 j;  3CCM Q;  4R56 A;  4FW1 A;  4M77 A;  3OYA A;  1YP5 A;  2DXT A;  5FRM A;  3QII A;  5J26 A;  1K0S A;  1Z9Z A;  1BI0 A;  1PKT A;  2C0T A;  1VQP Q;  2FL7 A;  2YSQ A;  4L6V 5;  1M3A A;  4XTY A;  5I21 A;  3LH5 A;  3AHU A;  3ZEH A;  3CME A;  2B8A A;  1UGS B;  4OMN A;  1ZBJ A;  3JCM d;  5FRO A;  1YWO A;  2BTT A;  1N27 A;  2D6F A;  2CZ0 B;  3OS1 A;  2MAM A;  3NGP A;  3AT1 B;  3PGG A;  4RG8 A;  2H3J A;  2WAC A;  2CP0 A;  2PNI A;  4C92 B;  2XKO C;  1N9R A;  1OPK A;  1KC8 R;  1D1C A;  4JLI A;  2YUO A;  2VC8 A;  1W6X A;  3M0R A;  2XMF A;  4PJO A;  1B3Q A;  1UHC A;  2GFA A;  2RB6 A;  4M75 A;  1WXU A;  2RJF A;  1XOV A;  2KE9 A;  3QHS A;  4CC4 B;  2Y4X A;  3GIB A;  1I5O B;  4JJC A;  3G6E Q;  2V8I A;  2CP7 A;  2O4X B;  1X01 A;  3L1A A;  5HK3 A;  4RTZ A;  1VQK T;  1Y7X A;  1QCF A;  1GCQ A;  4BI8 B;  1YHQ A;  4EMK A;  1OI1 A;  4OVA A;  2ZAE A;  3I55 A;  1R77 A;  2RHZ A;  1UTI A;  3DKM A;  2E5K A;  3EGD B;  2D0Q B;  4M7D D;  1WX6 A;  4LDV A;  1QCO A;  1MNE A;  2X4Y A;  4FIB A;  2HSE B;  1W2B S;  2RHX A;  3PFS A;  2EPD A;  3JB9 I;  3IQL A;  2CUD A;  3JCM P;  3BE3 A;  2FZG B;  1TU0 B;  3PIO A;  3BDU A;  2AHJ B;  3SWN B;  1KHI A;  2K7A A;  2NUZ A;  2RHI A;  3DB3 A;  2YLB A;  1VIE A;  2LJ1 A;  3ER0 A;  3LLR A;  2D8H A;  2FZC B;  1M9S A;  2RO0 A;  1BKB A;  2IG0 A;  4DOV A;  3EGX A;  5CKB A;  2HEQ A;  4HCZ A;  3CC4 Q;  1MUZ A;  2KRN A;  4M77 C;  1NZ9 A;  2BZX A;  1KD1 U;  2RI2 A;  1ZUU A;  1G5V A;  2L3Q A;  4FL6 A;  4GBQ A;  2ENM A;  2QAS A;  1G3T A;  2E1H A;  2VXE A;  3MPU B;  1Q7Y C;  5GAN d;  2ED0 A;  4N0A A;  1UJ0 A;  1ZLM A;  5LJ5 d;  2DYI A;  4F16 A;  1TH7 A;  1Y0M A;  3CCS A;  5GAN 4;  4KH0 B;  3SFM A;  3CME Q;  4IUV A;  4E7H A;  2QK0 A;  5DY9 A;  1M1F A;  4RTU A;  4EMG A;  1UGP B;  6AT1 B;  3INZ A;  2DK3 A;  2OTL T;  1NEB A;  2IVW A;  4KUL A;  1P92 A;  4N4G A;  2VGN A;  4M75 C;  3JCM b;  2QA4 A;  2SEM A;  2J7I A;  2BE9 B;  1VUB A;  4RTV A;  4JS4 A;  3X26 B;  2DX1 A;  1X6O A;  2GFU A;  4X1V A;  5LJ3 g;  1QVG P;  4Y91 A;  3I56 Q;  3KBG A;  1KC8 U;  1U06 A;  1UGR B;  1W70 A;  4M78 G;  3CCE T;  1GCQ C;  2AZS A;  2CKK A;  4EMK C;  3QBY A;  3UAT A;  1TXQ A;  3M57 A;  3CCL T;  4P5N A;  2DAQ A;  3SEM A;  3EHQ A;  5I2M A;  1UDL A;  3VJP A;  2DA9 A;  3CCU T;  2VB6 A;  3CBM A;  4J83 A;  2X9H A;  4LUE A;  5KYN A;  3PE0 A;  1IHW A;  2ROL A;  3PVQ A;  4EMH A;  1OZ3 A;  2P84 A;  2JTE A;  1XNI A;  2QAZ A;  1UFF A;  3CXC P;  3EG2 A;  1K1Z A;  4V2S A;  1EZZ B;  4RMO A;  4ZGE B;  1T3S A;  2HQX A;  3X24 B;  1EFN A;  2XHC A;  1Q7Y R;  3QWX X;  2LT4 A;  1WI7 A;  2EYX A;  3U23 A;  3CCJ Q;  3G71 A;  3MJX A;  1UG1 A;  2O31 A;  4M7D F;  3L2Q A;  5GMK j;  2PVG B;  3JAM E;  3A8L B;  2H8H A;  3CMA A;  2DKG A;  4DOW A;  1N5Z A;  2F2X A;  1AOJ A;  2ESW A;  4E7I A;  4M77 D;  4F17 A;  1VQN Q;  2JNG A;  3REA B;  1JQQ A;  3OSS C;  1U3O A;  3V8J A;  2WSC E;  2JT4 A;  2QQA A;  4EIK A;  1PKS A;  3QZ5 B;  3E9G A;  3EG9 B;  3L2U A;  2JVV A;  3V7C A;  1QVF S;  4Z89 A;  2KI7 A;  3CCV Q;  2K2M A;  1E6H A;  2K9G A;  3CPF A;  1YJ9 T;  4PFO A;  5D7U A;  2QA4 Q;  2DVE A;  4OMP A;  2SRC A;  4F7U G;  1Y07 A;  2OX7 A;  2X51 A;  3CD6 T;  2X4X A;  3NPF A;  3OS2 A;  3OYD A;  1I8F A;  5A0L A;  1YI2 T;  2QQR A;  1FX7 A;  4LE9 A;  4PJO D;  5IHI A;  1G83 A;  3VUB A;  2F2W A;  1HXD A;  1AWJ A;  1YIJ Q;  3A8O B;  4M75 D;  2DRM A;  4DEY A;  1KHC A;  4HVV A;  4YTL A;  1WPY A;  3OYY A;  1G3Y A;  2PZ1 A;  5LJ3 f;  3EHR A;  2K3Y A;  2CH4 W;  4J6Y A;  3QZ9 B;  4ME7 A;  4IUT A;  1BCM A;  2DET A;  1EX4 A;  1D1A A;  3I35 A;  3VS6 A;  2BE7 D;  1X6G A;  4XK8 E;  2DL7 A;  3KFV A;  3E1S A;  2HD0 A;  3JB9 H;  2O01 E;  2K6D A;  2KAF A;  3DLM A;  3TVT A;  5GAN 6;  4IUQ A;  1K8A C;  4A4G A;  1VQK A;  2LCC A;  3QJ6 A;  3HKS A;  2QQS A;  2LQ8 A;  3GNG A;  1ZHI A;  3RUX A;  3X25 B;  5GAN 2;  4F7U E;  4MZM A;  4M7A D;  5KE3 A;  2CP6 A;  1R8O B;  1Q7Y U;  2E65 A;  2GCX A;  4M7D B;  3CMA Q;  4OGC A;  2HL5 C;  4ZGJ B;  1BI3 A;  1VQ8 T;  3NHN A;  2JW4 A;  4FT4 A;  2RQW A;  1I81 A;  1VQ9 T;  3SB2 A;  1HYO A;  2KT8 A;  4ZNX A;  5LJ3 h;  1VQ6 A;  2DMO A;  2AKL A;  1CKB A;  2H3E B;  1BCO A;  4KT0 E;  1PRM C;  4FCY A;  1IHV A;  3VS1 A;  3NFC A;  1Q81 C;  3ZBD A;  2CZ7 B;  1WHH A;  1JJ2 A;  2VKN A;  3P8B B;  1SKU B;  1YHQ T;  2AZV A;  2K57 A;  1AVZ C;  5GJV B;  3V7S A;  3OYM A;  3RBB B;  3I55 T;  3S3M A;  3ULR B;  1GL5 A;  3JCM W;  1JEG A;  1VQ4 A;  4ATO A;  4M77 F;  2OJ2 A;  4J9B A;  4KGX B;  1UB4 A;  2M0Y A;  1OPL A;  1VYV A;  3OA6 A;  1GFC A;  4E7L A;  5FU7 C;  4ZGD B;  8ATC B;  2KMT A;  5CQX A;  1OX8 A;  1PSF A;  4ELZ C;  2VVK A;  1YIT Q;  2OTL A;  4CRI A;  1NYG A;  3G4S A;  1XJW B;  3M0T A;  2JJ9 A;  2VAS A;  3MO8 A;  2LMJ A;  4HCK A;  4C92 G;  2J05 A;  1RUW A;  5CR2 A;  1UHF A;  5HCK A;  1AHJ B;  4M7A G;  3A5Z B;  4PJO F;  2X4J A;  3CCS T;  4M75 F;  3CCE A;  1MMN A;  2GF7 A;  4J9H A;  1WIE A;  3EG0 A;  2BIV A;  1WHK A;  3EH1 A;  2ZPE B;  3VS7 A;  3CCL A;  2E4H A;  5FLX E;  5LL6 S;  2CT4 A;  4JJD A;  1O9S A;  1YBY A;  4FYV B;  4GLK A;  3H0H A;  1Q81 R;  1UEC A;  3EAE A;  3V7R A;  2R5A A;  1M4Z A;  2L3R A;  2FYK A;  1RAC B;  3UA6 A;  1M3B A;  4PLL A;  1U8R A;  1YJN T;  4C8Q E;  2E3I A;  3HSB A;  2RD1 A;  5AT1 B;  2E6Z A;  2BUD A;  3GP8 A;  4C92 F;  1TOV A;  2GQI A;  1M2V A;  2PUK B;  5CKE A;  4M7A F;  1RAF B;  1D1B A;  2G6F X;  3RES A;  1ARK A;  2CUB A;  4E7S A;  1MMD A;  1R0B G;  3A8M B;  1B34 A;  2QGG A;  3GNF B;  5IHK A;  1M90 C;  1NJI C;  3CPW P;  2A0F B;  3H0I A;  3LH0 A;  2LTO A;  1E6G A;  2MMP A;  3TCJ A;  3OW2 A;  2DTI A;  2EQM A;  4M77 B;  2DXB A;  3QJY A;  4D8K A;  2PQW A;  2K3X A;  1KC8 C;  3RKX A;  5J3B A;  2AK5 A;  3H6Z A;  5GAM g;  3L2Z A;  1NBE B;  5KYU A;  3G71 T;  3LWI A;  1WXT A;  2DJZ A;  4E6R A;  1BU1 A;  4IUP A;  4NL2 A;  1YJ9 A;  4HCC A;  4J6X A;  3OBY A;  2RQV A;  3JB9 D;  1M2O A;  2W0Z A;  1TUD A;  2A36 A;  3OYK A;  3CD6 A;  2JMC A;  4AG1 C;  2EVR A;  3EFO A;  2A08 A;  2BZ8 A;  4LDY A;  1YI2 A;  1WJQ A;  1VQL A;  4PJO B;  2YUP A;  2MOX A;  4M75 B;  1MMG A;  4Z88 A;  2PU9 B;  1AEY A;  3CCL Q;  4DBR A;  3BW1 A;  4R0K A;  4MML A;  5GAN j;  2FHD A;  2RPN A;  3CCU Q;  4BE1 A;  2JZ2 A;  4Y28 E;  2YUQ A;  3OYB A;  2DL3 A;  2Y4Y A;  4EMK B;  4KGV B;  1QKW A;  1RAG B;  4OB3 B;  4VUB A;  1M90 R;  1NJI R;  1Q81 U;  3M58 A;  2YWW A;  1U1S A;  1ZSZ A;  1SEM A;  1Q86 U;  2DTH A;  1MV3 A;  1VYU A;  2DYB A;  4OB2 B;  4OP0 A;  3VS3 A;  1IRE B;  2ZPG B;  4M7A B;  3EGX B;  4PLI A;  5IAY A;  2EW3 A;  4BAC A;  4PFP A;  4HT9 A;  1VQ8 A;  1FWZ A;  2CZ6 B;  4FSS A;  1AT1 B;  2ZGW A;  2JM9 A;  1VQ9 A;  3HRS A;  4FYY B;  1K76 A;  5KYW A;  4CI0 C;  4F04 B;  2MYS A;  4JJB A;  5GAN 8;  4MZT A;  4KGZ B;  3TQ7 P;  4AFQ C;  3HFN A;  1VQ5 A;  2DL8 A;  4E7K A;  1GBQ A;  2AIR B;  2BZY A;  2DJQ A;  5GAM f;  2CT3 A;  2JS2 A;  3CD6 Q;  1YFN A;  1IO6 A;  5GAM e;  4MZP A;  4C0Z A;  3FDR A;  3S6W A;  2CP3 A;  4J7I A;  1N8R R;  1AWO A;  1VYT A;  4NOY A;  1VQ6 T;  1KQS A;  2RI5 A;  4X9D A;  2QTX A;  4LNP A;  1RAA B;  2A7Y A;  4C8Q A;  3JCM f;  3OYI A;  2V8J A;  2QDY B;  2V26 A;  1A0N B;  1MMA A;  3JCM e;  4QVZ A;  2MI6 A;  5A2Q E;  1W4S A;  2JXB A;  3PT9 A;  1M1G A;  1PG5 B;  1O75 A;  3OYG A;  3JB9 F;  4JLG A;  3JCM J;  1X43 A;  2RA2 A;  3UWN A;  1WYX A;  2OTJ T;  2K3B A;  1VQ4 T;  2E12 A;  1M3C A;  2HNI A;  1MHN A;  2VGM A;  3QUI A;  2VWF A;  1QKX A;  1ZSZ C;  5GAO m;  1D0Z A;  1LNX A;  2DBM A;  2QGF B; 
#chains in the Genus database with same CATH homology
 1WHJ A;  2CP2 A;  2COZ A;  3E2U A;  1WHG A;  2CP7 A;  3RDV A;  2CP0 A;  1WHK A;  2E3I A;  2HL3 A;  2Z0W A;  2CP3 A;  2M02 A;  4B6M A;  1LPL A;  1WHM A;  2HQH A;  2COW A;  1TXQ A;  1IXD A;  3TQ7 P;  2HKQ B;  2E4H A;  2CP6 A;  1WHH A;  2HKN A;  2E3H A;  1WHL A;  1TOV A;  2CP5 A;  2HL5 C;  2COY A;  2MPX C;  2QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...