2COWA

Solution structure of the cap-gly domain in human kinesin-like protein kif13b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
100
structure length
100
Chain Sequence
b'GSSGSSGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF13B
publication title Solution structure of the CAP-Gly domain in human Kinesin-like protein KIF13B
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cowA01
1LPLA 2CP6A 3RDVA 1WHHA 3E2UA 2MPXC 2HL5C 2Z0WA 2HL3A 2M02A 1WHGA 2E4HA 2COWA 1TXQA 2COZA 1WHKA 1WHMA 2HKNA 1TOVA 2HKQB 2CP2A 1IXDA 2CP3A 2CP5A 2HQHA 3TQ7P 2CP7A 2QK0A 1WHLA 2E3HA 1WHJA 4B6MA 2COYA 2CP0A 2E3IA
chains in the Genus database with same CATH superfamily
1M9SA 4J9FA 3LH0A 3OBYA 4J6XA 2CKKA 1E6GA 1ARKA 3CMEQ 3OYCA 2DL7A 1JB0E 4C8QF 2EBPA 4M7AG 4DEXA 2L5QA 5CO7A 4J6YA 3TQ7P 4HVWA 3TCJA 3SEMA 1YITQ 2NUTB 4ZGDB 2BE9B 2HSPA 2F5TX 1ZUUA 1YBYA 2CSIA 5GAN5 3NFCA 1RI0A 1VA7A 2MF2A 5GAN4 3QXEB 2HAXA 1M30A 1DJ7B 4AG1C 3VUZA 1Q86R 1RUWA 3EH1A 4PLLA 4IKFA 1QW1A 5I22A 3AHUA 1M1FA 1K73U 1K76A 1VQLA 1YITA 1IRXA 2KRSA 2LVMA 3M58A 1JU5C 3M53A 4IUQA 1ZA2B 1AZGB 5IXFA 3JSCA 2DETA 1B34A 5GAMe 1I0CA 2I2LA 2JT4A 1QKXA 3PFSA 2DXTA 2L3PA 2RQUA 2LCSA 1C6VX 3EG9A 2HSEB 4TVRA 5EC7A 5GAMg 3O5ZA 4LD6A 1M90C 2O9SA 1M2VA 5AT1B 2DTIA 3NGPA 2E6ZA 4Y92A 5IXBA 3O8VA 1UEBA 1W6XA 2RO0A 2K79A 2HDAA 1RLQC 1M3BA 2FRWA 2E12A 4J9HA 2MI6A 3QJYA 1VQKT 1WJSA 3VYGA 1KC8R 2HQHA 3PE0A 4M78A 3MCAB 3L2WA 1Q7YR 5FWBA 2RJEA 2HCKA 4MMLA 3MEUA 1TUDA 1UDLA 4EMGA 2LNHB 2X4YA 4JRPA 2CH4W 4EDUA 2CS7A 3ZFJA 1YFNA 2OTLA 3MHXA 4C8QB 1KQSS 3GPLA 3V8LA 2J05A 4CC4B 3DB3A 1K0SA 1B7TA 2F69A 2VGNA 1Q95G 3JCMe 1NM7A 1ABQA 1OOTA 1SRLA 7AT1B 2EKOA 2WSEE 4ELYC 2ZGWA 3JCMb 2GCXA 2QTXA 3EFOB 1HK9A 3QHSA 3R6OA 1K73R 3G6ET 2LT4A 1I5LA 4RTWA 1PRMC 2BE7D 2XKOC 3P8HA 1VIFA 4CI0C 1FYNA 4M78E 3MPUB 1F1BB 1H92A 5HCKA 4PFOA 3F70A 2DNUA 4DBHA 1X6GA 1VQKQ 1M1GA 4HT8A 1QVGP 2RJDA 5CAIA 4AFQC 1KG1A 3UWNA 4JRKA 2DIQA 1K9MC 1VYUA 2RI2A 1QVGA 2KT1A 1GBRA 5CQYA 1MV3A 4X1VA 2D8HA 4LDUA 1G3TA 3UT1A 1VQKA 3CPFA 4BE0A 1R8OB 4J9GA 3G71T 4M75G 1XJWB 3VUBA 2COZA 4RCCA 4LUEA 3QIIA 3FDRA 1QVFP 2KXCA 2VVKA 2DEQA 3PIPA 2MWPA 3OYBA 1OI1A 1BIAA 2RH2A 1Q81R 4AFUC 1YHQT 4FYYB 2KT8A 2COYA 2KSSA 3DB4A 5CIUA 1Q86C 3RDVA 4QT7A 1QVFA 1W2BS 4ZN1A 1K8AU 3RKWA 1Y0MA 4IUTA 1QCFA 3TVTA 1T3SA 5I21A 4OP0A 2DTHA 2OJ2A 1OULA 2FPDA 1D1BA 3M0RA 2YDLA 1SRMA 4N0AC 1MNDA 1GFDA 4KH1B 1RAFB 4BDYA 2RJFA 2JW4A 2AK5A 4A4FA 3X20B 3REBB 5DLQE 1RLPC 4OGCA 1WHLA 2CUBA 1VQ5T 3H8ZA 4ZGJB 4O6JA 2DXBA 3QYHB 2BZXA 5LJ3f 2H3JA 3G71Q 1KC8C 3M0SA 4CC2A 1ZUKA 1R0CB 4FIBA 4JZ4A 2QQ9A 2FPFA 3M54A 3S3MA 1FMWA 2DA9A 1YHQQ 3QSUA 1M1KU 1GL5A 4M7AA 2E1HA 5IAYA 3JRZA 1PD0A 4PJMA 3HTRA 4BE2A 1RL2A 2EGCA 1ZSZA 1D1AA 3GF5A 1ACMB 3S6WA 1V1CA 5J26A 3G71A 3RMQA 4RTXA 5HK0A 5KCHA 2RHIA 1N9RA 1MNEA 3EH2A 1IB8A 2DK3A 1NZ9A 1YHQA 3H41A 1WZOA 1G3YA 2J6OA 4LXCA 3HFOA 1Z9QA 3QZ9B 3SWNB 4PJNA 1PC0A 1WI7A 2VXEA 4C92D 2H3EB 3MEVA 3OW2P 2BKDN 3HHTB 4EMKB 5D6XA 5KYWA 5LL6S 1KQ2A 4D8DA 3OYLA 3JB9G 3HPWA 1VIEA 4WF2A 1VQ5Q 3RMSA 5GAOp 4C0DB 4C5GA 2GQVA 3A8GB 4C92F 1BBZA 1WXTA 4M7AE 1Q82C 3OW2A 3CC7T 1IZ6A 4ZTJA 2QYZA 3CD6Q 3S3NA 3VS2A 2JOYA 2YUOA 1UE9A 1U3OA 1YWPA 4C8QC 1HYOA 1N6AA 1QLYA 3MP1A 4E7JA 2BIVA 1ZBXA 1MV0B 1VQ5A 2ZPGB 2ED0A 9ATCB 2P0QA 3UA7A 1KFZA 2MIOA 3OY9A 2KQWA 2J6FA 3HRSA 2XDDA 3CD6A 2EYWA 5A0DA 1Q81C 2XHCA 2KVQG 4R56A 2FG0A 3V7RA 3KUFA 1XTDA 1NPPA 4VUBA 2QDLA 2M9UA 1AWJA 2CP3A 4D6WA 1VQ4T 1BI3A 2BTTA 1WHJA 3M59A 1BI1A 1LNXA 2ZPFB 3CMAT 2RF0A 3I9QA 5KYUA 4M78D 4QQGA 1OX9A 2ZPHB 2M1HA 1VUBA 4BY6B 4DBFA 3CCST 1NE8A 2EW3A 2ENMA 3HP9A 2XI9A 5C0MA 2JS0A 1NLOC 3LLRA 1BB9A 4ME7A 3OYAA 3CC7Q 3C0CA 5A0GA 4M78F 2CP7A 1GBQA 3R6NA 5GAOl 2V8KA 1QQJA 2HBWA 3EHQA 2EIFA 2OX7A 4PJOF 4MZTA 2ZCFB 3OYDA 5GAMf 1SSFA 1OEBA 1KSWA 2KAFA 4ATOA 3UA6A 3CC7A 3CEYA 1VQOQ 1Z9ZA 3C95A 1WNLA 2DRKA 4C92B 2HNIA 2P4RA 4J9EA 5IH2A 4EIKA 3LW5E 2ZAEA 3CCEQ 2B86A 3LGFA 4XU1A 5LJ5j 1VQ4Q 2AKLA 4WTOB 3EFSA 4RG8A 5FU6B 4GLMA 2EQMA 3HRUA 1WHMA 3E9FA 1WGSA 4M75A 4NOYA 4OMLA 2CGHA 2K57A 2KK4A 2DE0X 2DZCA 4XTUA 1VQOA 3EFRA 3VU3C 4AFSC 3HSBA 2CT3A 3OS1A 3CCSQ 1WFWA 2L3RA 2M0OA 3EGXA 3CCEA 2PU9B 4HCCA 2OTJQ 1B34B 3H9NA 3M0PA 4QQDA 1VQ4A 1VQ7T 3FJPA 3L2RA 3RUXA 3CCQA 3AT1B 4KGVB 2P0PA 2QQBA 5GANe 2LMJA 2L89A 2LJ0A 5HY6A 1G3WA 1JBMA 4M77D 3CCSA 3I56T 1UHCA 5GANg 3ZEHA 3JCMf 2OTJA 3N5BB 1FXXA 4BD3A 1N9SA 3GP8A 2PQWA 1M27C 2RQVA 5LJ5h 2QTVA 4R0KA 4E7HA 4M77F 2KI7A 4M75E 4M78B 5I2SA 1N8RC 1BYMA 1G8XA 4Y91A 2CZ0B 5FU7B 4OMOA 3MEWA 2OI3A 5DY9A 5IT9E 4PJOB 4JS5A 1T3LA 1QWFA 5M9OA 1WHKA 4OB2B 2L2PA 4FW2A 2X4WA 2W10A 1OYXA 1P92A 2ZPBB 3JAME 3RERA 1KD1U 1HJDA 1D1CA 2C06A 4E7SA 1ZHIA 4F7UB 4PJJA 1X27A 3LX7A 2QA4T 3I5SA 3SWNC 2EVRA 2QK0A 2D9TA 4GBQA 1VQ7Q 2HL5C 3PVQA 1I1JA 5GAN7 3J80E 4EMKC 5CR2A 2JZ2A 4C8QG 4JRIA 3L2UA 2DL5A 2QGFB 3FB9A 3LYIA 3OSSC 4C0DC 1QVGS 3V7SA 2M16A 4RTUA 2RA2A 3FRNA 1H3HA 3V7CA 3I55A 1U8RA 3S3OA 4RTVA 1EX4A 1YJ9Q 2KYMA 2K7AA 3VS6A 4M7AD 1VQ7A 1IO6A 2LCCA 1UGVA 5LJ5d 1PCXA 1ZA1B 1WJRA 4B9XA 2YLCA 3CMEA 2YRVA 2SEMA 1WLPB 1MMGA 4M7AF 3VYHB 4AT1B 4A4HA 1QVFS 3EHRA 3ER0A 1A0NB 3FLGA 3RKYA 4LDXA 5KYYB 1UGPB 1YJ9A 4DQ2A 2AKKA 3EG2A 3A1PA 4KH0B 4UC4A 4FT2A 1ZSGA 5D7UA 2WSCE 2X4XA 1HD3A 4M77B 3SB2A 1O75A 3GLXA 3M9QA 2O88A 1KHIA 2Y4YA 2K2MA 2K6DA 2EGEA 3URGA 3NTHA 2J6KA 4KBMB 1FWZA 3EG1A 2FYKA 4BY6C 4ESRA 2DIGA 3PT9A 1Y96B 1K4US 4QQ6A 1AD5A 3OS0A 3THKA 2NWMA 4BE1A 2AT1B 3GNGA 1I07A 2LQKA 2EYXA 1SG5A 2E6NA 2KXDA 3PVLA 3UPUA 1BI2A 3C94A 3E19A 4A4GA 4FSXA 2RB6A 3M57A 4IIOA 3KBGA 1TUGB 5A2QE 1SF9A 4C92C 4M7DG 4ZGEB 3M0QA 2ZPEB 1M3AA 2DVEA 1YJWT 1UUEA 2GGRA 1SPKA 3H0HA 3U23A 1IHVA 3RKXA 2D8JA 5FU6C 3QDFA 4BDZA 2K2VA 1OV3A 1KIKA 3OYNA 2RQTA 4EPCA 5IHIA 3RR6A 3JB9J 3JCMg 1G2BA 4PFZA 4QVCA 1ZSZB 4IUUA 4J6WA 2ESWA 1TWBA 2VUBA 2RI3A 4N0AA 1GCPA 3L2VA 1NEGA 1WJQA 1E6HA 3RBBB 3TSZA 3VKIA 1FX7A 3OW2S 5C6SA 1X2KA 5LJ3j 1M3CA 2NUTA 2E65A 1G5VA 2JMAA 3PNWC 3GBQA 1V76A 1T0JA 3VJPA 3OYJA 4HCKA 1RAEB 1SHFA 1J3TA 1X01A 5L23A 2PVGB 2AIRB 2HKNA 4FL6A 1OQKA 4N4GA 4M78C 2RD1A 5LJ5e 1YJWQ 2KR3A 1X6BA 2F2VA 4OB3B 5FU7C 4XTVA 4PJOC 4FU6A 2FPEA 2DL8A 1WHHA 3OS2A 3SDZA 3A8LB 3A5ZB 2F2XA 1AWOA 3M5AA 3EG0A 1D0ZA 4RKUE 3G6EQ 1W70A 4DOWA 2ROLA 3INZA 4FSSA 5CVIA 4QW2A 3E9GA 1YJWA 1IGUA 2O4XB 4MZMA 5LJ3h 2FB7A 4OB1B 2W0ZA 3OB9A 4IURA 1RAAB 1WXBA 1RAIB 5GAOm 2DEUA 1IHWA 2DTOA 4J9BA 2DF6A 3SD4A 3G6EA 4XTYA 3H0IA 8ATCB 1VQMT 1X69A 2D1XA 4OMFB 2J06A 2A0FB 3PMIA 4E7KA 5FLXE 2M0YA 1LOJA 1Y07A 1G83A 2GQIA 4JRQA 4LDVA 1PRLC 2R5AA 2IIMA 1Q7YC 1N8RU 5AYFA 1QMCA 2GBQA 1MGQA 3CQTA 2AZSA 4C8QA 2O9VA 1PNJA 1Y7XA 4FCYA 1WX6A 2CP2A 1VQ6T 1D09B 4AMCA 3CC4T 4GY5A 2O31A 3BDLA 2SRCA 2EQKA 2DJZA 2C0TA 2JTMA 2E5KA 2NYSA 1T0HA 3X25B 1M2OA 1NJIU 5HKCA 3OBWA 1KHCA 4J7IA 1LVKA 3MJXA 4RTZA 3QPHA 2KROA 4BUGA 4A4EA 3EFOA 1X43A 4F04B 4M77C 1WXUA 2DXCA 1BI0A 5LJ3d 2CZ6B 1YJNT 2J7IA 2VC8A 3PMTA 5GANf 1M8MA 2GTOA 1VQ9T 1UGRB 1NLPC 4BI4A 3EGDA 1K8AR 2FZKB 1K73C 1H8KA 5EG2A 3LWIA 1VQMQ 3OYMA 3P8DA 2JTEA 4Z8AA 4ZTFA 5KYXA 3ME9A 4BI8B 1HSQA 3GNFB 4C8QE 2E64A 4C92G 2DPPB 1EZZB 1RABB 3M4YA 2DL4A 2RMOA 2RPNA 1NBEB 2DJQA 2LQWA 1VOMA 3JB9D 4O5VA 1BCOA 2Z0WA 5IHKA 1UJ0A 1SHGA 1VQ6Q 1VQMA 1JXMA 3L2ZA 5KCOA 4MMKA 4RG2A 3JB9F 2KRNA 2VB6A 1VQPT 3CPWP 3M0UA 1WQ7A 3QWXX 5GAN6 2LJ3A 5GMKm 1D3BB 4HCZA 3UF4A 1M90U 1VQ6A 3QO3A 1GXIE 2GFAA 2RQWA 2PUKB 3OYHA 3TEEA 4JJBA 3EG3A 4HKEA 4KUDK 3CPWA 1M1KR 2FZGB 3JCMQ 5I2MA 2YXYA 1ZSZC 3X26B 4M7DA 2P4TA 1NJIR 5GJWB 1PKSA 5GAMh 2F5KA 3VS0A 1YCYA 2YSQA 3JCMP 3C12A 4DBQA 1XQHA 2X4JA 2EJFA 5GAOq 2KE9A 2NUPA 5GAN2 2KGTA 2JS2A 4A63B 2PVDB 3CCRT 2DKGA 2AHJB 3UATA 3J7AF 4N4IA 4PJOG 2QGGA 1QKWA 4OMNA 1UJYA 4XU2A 1M8VA 1QCNA 1EIFA 2COWA 3GOXA 4JJNK 1I8FA 4QKUA 1VQNT 2DYIA 2E41A 4F7UG 1VQPQ 2HKQB 4OMQA 3CXCP 4OF1A 3UDCA 2ABLA 2E70A 4OVAA 5GJVB 4XTZA 2G6FX 2MK5A 1GFCA 1B07A 1RAHB 3QUIA 1RADB 2VV5A 3CXCA 1KQ1A 4M7DE 5DLOA 2KNBB 2MMPA 1NEBA 2A36A 2DRMA 1VQPA 1PD1A 1N27A 3OQ5A 1IREB 5KH6A 4JS4A 2CYZB 2DILA 2O01E 1K0XA 3G4ST 3CMAQ 1MHNA 3JB9I 2EFIA 3OYEA 3JCMc 2XDBA 1D0XA 2CP0A 5LJ3e 2KMTA 3JB9H 2MPXC 4KULA 1M90R 2HL3A 4A53A 3VS1A 3E1SA 3CCRQ 1H641 3RIRA 4EMKA 3NTKA 3OYFA 1K9MU 1CKAA 3EG9B 1TSFA 1H3ZA 1K8AC 2CZ7B 2JM8A 3CCMT 3M4GA 1XOVA 2RQRA 3CMAA 1JRIA 1M2VB 2K5LA 2QASA 2X51A 4N4HA 3KFVA 1VQNQ 2CP6A 2QQAA 3L2QA 2LJ1A 4E7IA 2M02A 3A8OB 2X35A 1WYXA 3CCRA 4A54A 2L0AA 2K9GA 3EAEA 4M77G 2X3XD 2DL3A 2VXFA 3JCMJ 1Q86U 1TG0A 1GCQC 1OX8A 1X6OA 1G3SA 4Z88A 3A8MB 2VASA 1YN8A 1UB4A 1VQLT 1VQNA 4LN2A 3VS5A 1JJ2S 3JCMW 2YWWA 3OSVA 1AEYA 1SEMA 2LCLA 1W4SA 4J9DA 3G4SQ 1WDXA 2LX7A 2RHXA 4LUDA 1PSFA 3T9NA 1ZX6A 2PNIA 2MCNA 2FRYA 2FVUA 1FMVA 1M1KC 3OYKA 2KDSA 1R0BG 2C0OA 1WHGA 4AFZC 4XK8E 5CCAA 3CCMQ 3CC2T 4PLIA 1JQQA 4HT9A 2DM1A 3G4SA 1SSHA 1TOVA 1U5SA 2EYQA 4F17A 2QQRA 5LJ5f 4OGEA 4F14A 3META 1KC8U 1CKBA 3QZ5B 2P0KA 3I56Q 1ZUYA 5CQXA 2LQ8A 2DO3A 5GAOr 1EFNA 3OS5A 3MO8A 2KRMA 4LDWA 2EKHA 1K9MR 1UHFA 3CCMA 1QP3A 2PTKA 4RTTA 3JCMV 3ZBDA 3P8BB 3L42A 3HFNA 2OTLT 4ELZC 1VQLQ 4JJDA 4C92A 2JVVA 2EYYA 2C0IA 1TH7A 3I56A 2MOXA 2E3HA 4B6MA 2ZZDA 2RHYA 1LPLA 1VQ8T 2KEAA 1K9AA 3CBOA 1TXQA 3M55A 5GMKj 3MP6A 4IIMA 2HMAA 2QA4Q 1PHTA 2ED1A 4FYXB 2HQEA 2FL7A 2XG8D 2EAYA 4MDWA 4ORZA 3CC2Q 1VYTA 2JUFA 3BE3A 3QYGB 3NMZC 3QKJA 1E7OA 3QJ6A 3MP8A 3FIFA 2FHDA 3WXMB 2R57A 1BIBA 1Q82U 8AT1B 1RAGB 2QA4A 1KD1R 1D0YA 4HXJA 2DXUA 3SFMA 3G7ZA 3V8KA 1YP5A 2P84A 2X3WD 2FZCB 4C92E 3CC2A 1OZ2A 5GAN8 2PZ1A 2GF7A 3D7SB 2E4HA 1GRIA 1BCMA 1PG5B 2OTLQ 2M51A 3TSWA 3BY7A 3QDRB 4C5HA 1I4K1 2HZYA 5GMKh 1Q81U 1JEGA 1VQ8Q 1OPKA 2KY9A 3ZL7C 1MMAA 4KUIA 1SKUB 3M0TA 1JJ2P 4PJOA 2XD0A 4BB7A 3A98A 5FRMA 4C0ZA 1YIJT 1MUZA 3H6ZA 5D6WA 4M7DD 1JO8A 2BUDA 1AHJB 4OB0B 2QEXT 1PSEA 1IGQA 2R58A 2MAMA 4E47A 1AZEA 3I35A 1JJ2A 3VS7A 4F7UA 5CKEA 5FRNA 4J5YA 4RUGA 4M7AB 4Z89A 2XU8A 2KBTA 1VQ8A 1ABOA 4M7DF 1YWOA 3OMGA 5KE2A 4BACA 4LD9K 4FM4B 1B3QA 2KYBA 3PTAA 4PNOA 2DX1A 1TUCA 3V8JA 2PUOB 3OYIA 4L6V5 3BFMA 2QAZA 2NUZA 3ASKA 3OYGA 2K3XA 4NL2A 2YUQA 4JUVA 1YNZA 1PM3A 2EWNA 4DA4A 3OA6A 3RNJA 3EGDB 4JLGA 2JN0A 3EGUA 4PJOE 3QWYA 2H8HA 5FW9A 1Q82R 3OYYA 1MMNA 5FWCA 4F16A 3CBPA 5KYWB 4A4KA 1S72T 5KYXB 1U06A 1UECA 2XK0A 2IG0A 2A37A 2VYTA 4ZN3A 4X34A 4LNPA 1UG1A 4F7UE 5KYYA 4M75D 1YIJQ 2EQJA 1S1NA 5LJ5g 3CPWS 2AZVA 2YUPA 2QEXQ 1TU0B 1NG2A 4E7LA 2DD5A 5GANj 4B9WA 2LRQA 2FEIA 4M75F 3LH5A 3I5RA 4J7FA 4DBRA 4M77A 2GNCA 3TU4K 4BI3A 1RI9A 3GIBA 1QP2A 1W1FA 1JXOA 4C0FA 5J3BA 1YIJA 2A08A 4CRIA 3QG1A 4L5GA 2QEXA 1X75C 2RJCA 2V8IA 3HKSA 5DM7R 4KGZB 2FO0A 1Y96A 4XU3A 2E10A 2EPDA 2Y4XA 1OU9A 2EGAA 4XQ3A 4EMHA 2RI5A 4JPBW 2LDMA 2DYBA 2ATCB 2YHTA 2F1LA 4LDYA 4M7DB 3H0FA 1VYVA 1KD1C 2RNAA 2YLBA 3HL8A 3NPFA 1N5ZA 4QVZA 5KYUB 2EYZA 3FEOA 1S72Q 2NUPB 2D6FA 3L1AA 4PFPA 2K5IA 2O2OA 1WPYA 4D8KA 2DD4A 5GANh 2VKNA 3G1JA 3CXCS 1AWWA 2JM9A 3CCUT 4XTXA 4M77E 4II1A 4CC7A 2YRDA 1I5OB 2QQSA 3WVDB 1S72A 2XDPA 3CD6T 2D0QB 2HBPA 3CCLT 2RK2A 1KQSP 3FC3A 2JNGA 3PGGA 3DKMA 1NPRA 1WQWA 4GLKA 2YT6A 2YUNA 1TTHB 4Z02A 3TREA 5CK9A 1KK7A 2K3BA 1KQSA 3IQLA 4XAXB 3E2UA 3VS3A 4MZPA 2R5MA 5A0LA 2DZ9A 5CKHA 1UGQB 2BZ8A 2EJ9A 2ROTA 4JJCA 5KYNA 1LJOA 4M75B 4WCIA 1ZBJA 1BKBA 2DERA 3CCJT 2CDTA 5GAMj 1LCKA 4NS5A 3MKDA 3X24B 4MDXA 2WSFE 1PKTA 1BU1A 2V1QA 3HRTA 3EGXB 2A3LA 2ECZA 2DLPA 2XMFA 2OAWA 4RCBA 3NTIA 1AWXA 5GANd 3CC4Q 1QWEA 3CCUQ 4FYWB 2V26A 4L59A 1YCSB 4OMMA 3NHNA 2GFUA 2A7YA 2ZPIB 5KE3A 5GMKe 1OU8A 2HEQA 1C0MA 1YI2T 3LGLA 2RK1A 2X9HA 2G3RA 4KT0E 3CCLQ 2EQUA 2DAQA 2L3QA 2CUDA 1WIEA 1N8RR 1I81A 2D0NA 1KJWA 3RESA 1UFFA 2B8AA 1YJNQ 3CC4A 3CCUA 3WVEB 4E6RA 1IXDA 4QVDA 4M7AC 2O4XA 1VQ9Q 3CCVT 1CSKA 2LZ6B 2LNVA 4X9DA 3VS4A 5CKBA 1W2BP 3VRZA 1VQOT 3CCLA 5J39A 2DFUA 3OMCA 4Y28E 2HD0A 2DVJA 2RN8A 3BW1A 2Y90A 2LP5A 1OPLA 2HQXA 3CCET 1U1TA 3CCJQ 3A8HB 1YJNA 6AT1B 1W2BA 4V2SA 2E5QA 4M78G 4KRTA 3SHWA 1M5Q1 4HCBA 1VQ9A 4HVVA 3C4SA 5HK3A 4KGXB 4FYVB 3CCQT 2I0NA 5L8RE 4P5NA 2RM4A 2VWFA 2V1RA 4C5IA 4FW1A 1NYFA 3PIOA 1MMDA 4PJOD 2CT4A 1UTIA 3CCJA 2OTJT 2OAUA 1ZLMA 2XICA 1YI2Q 2L8DA 2DBMA 4CC3A 5FROA 4DEYA 3KXTA 1TS9A 2QI2A 1GCQA 4Q5WA 2A28A 2XIDA 4J9CA 2QDYB 4PK4A 5GAOn 1RACB 3MEAA 3CCVQ 2EJGA 2QXFA 2VGMA 5CKFA 4JLIA 3JCMX 2WACA 3M56A 1HXDA 4XU0A 3DLLA 1UGSB 3Q1JA 4F7UF 1YI2A 1QCOA 2CP5A 5I11A 4M4ZA 1FMKA 2MWOA 2V8JA 5GAMd 2DBKA 3J81E 1O9SA 2YRCA 3SWNA 3JCMh 4IUPA 4HA8A 2RHUA 3VRYA 5IHNA 3BDUA 2PVOB 1C1AA 3CCVA 4JDSA 3DLMA 5LJ3g 4PJLA 4RMOA 3FJ5A 2K3YA 1X2QA 3CCQQ 3X28B 1NYGA 4C0GA 3ULRB 1V29B 1QVPA 4M7DC 2EQIA 2DMOA 4ZNXA 2CZ1B 2E3IA 2LC4A 4ANJA 2LX9A 3I55T 1AVZC 4JZ3A 1WA7A 2JXBA 5CKDA 4HVUA 1PWTA 2QG9B 4OMPA 5GMKi 4R55A 3CMET 1K1ZA 3QBYA 5ECAA 5GAN3 1U1SA 1AT1B 2CREA 4YTLA 1YITT 1D3BA 4E2FB 4J8OA 1YJ9T 2JMCA 2JTFA 1XNIA 1OZ3A 2K5FA 4K11A 2LTOA 5D6YA 4LE9A 4E7ZA 1M4ZA 1Y71A 2GTJA 4PKCC 1R77A 1ZQ1A 3VV0A 2F2WA 3JCMd 2L3SA 3LWHA 2RHZA 4J83A 2NLUA 4XTWA 4FT4A 4DOVA 4IUVA 4X9CA 4PL6A 2JJ9A 3CBMA 1Y57A 2LQNA 1BK2A 3JV3A 2IVWA 4M75C 2CSQA 5IN1A 1NJIC 2BZYA 4J9IA 2MYSA 5GMKl 3I55Q 4NL3A 2CH4A 1AOJA 2IPOB 4RTYA 2K4YA 4AG2C 4C8QD 1Q7YU 3REAB 2LT1A 4C5EA
chains in the Genus database with same CATH topology
1LPLA 2CP6A 3RDVA 1WHHA 3E2UA 2MPXC 2HL5C 2Z0WA 2HL3A 2M02A 1WHGA 2E4HA 2COWA 1TXQA 2COZA 1WHKA 1WHMA 2HKNA 1TOVA 2HKQB 2CP2A 1IXDA 2CP3A 2CP5A 2HQHA 3TQ7P 2CP7A 2QK0A 1WHLA 2E3HA 1WHJA 4B6MA 2COYA 2CP0A 2E3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LPL A;  2CP6 A;  3RDV A;  1WHH A;  3E2U A;  2MPX C;  2HL5 C;  2Z0W A;  2HL3 A;  2M02 A;  1WHG A;  2E4H A;  2COW A;  1TXQ A;  2COZ A;  1WHK A;  1WHM A;  2HKN A;  1TOV A;  2HKQ B;  2CP2 A;  1IXD A;  2CP3 A;  2CP5 A;  2HQH A;  3TQ7 P;  2CP7 A;  2QK0 A;  1WHL A;  2E3H A;  1WHJ A;  4B6M A;  2COY A;  2CP0 A;  2E3I A; 
#chains in the Genus database with same CATH topology
 1M9S A;  4J9F A;  3LH0 A;  3OBY A;  4J6X A;  2CKK A;  1E6G A;  1ARK A;  3CME Q;  3OYC A;  2DL7 A;  1JB0 E;  4C8Q F;  2EBP A;  4M7A G;  4DEX A;  2L5Q A;  5CO7 A;  4J6Y A;  3TQ7 P;  4HVW A;  3TCJ A;  3SEM A;  1YIT Q;  2NUT B;  4ZGD B;  2BE9 B;  2HSP A;  2F5T X;  1ZUU A;  1YBY A;  2CSI A;  5GAN 5;  3NFC A;  1RI0 A;  1VA7 A;  2MF2 A;  5GAN 4;  3QXE B;  2HAX A;  1M30 A;  1DJ7 B;  4AG1 C;  3VUZ A;  1Q86 R;  1RUW A;  3EH1 A;  4PLL A;  4IKF A;  1QW1 A;  5I22 A;  3AHU A;  1M1F A;  1K73 U;  1K76 A;  1VQL A;  1YIT A;  1IRX A;  2KRS A;  2LVM A;  3M58 A;  1JU5 C;  3M53 A;  4IUQ A;  1ZA2 B;  1AZG B;  5IXF A;  3JSC A;  2DET A;  1B34 A;  5GAM e;  1I0C A;  2I2L A;  2JT4 A;  1QKX A;  3PFS A;  2DXT A;  2L3P A;  2RQU A;  2LCS A;  1C6V X;  3EG9 A;  2HSE B;  4TVR A;  5EC7 A;  5GAM g;  3O5Z A;  4LD6 A;  1M90 C;  2O9S A;  1M2V A;  5AT1 B;  2DTI A;  3NGP A;  2E6Z A;  4Y92 A;  5IXB A;  3O8V A;  1UEB A;  1W6X A;  2RO0 A;  2K79 A;  2HDA A;  1RLQ C;  1M3B A;  2FRW A;  2E12 A;  4J9H A;  2MI6 A;  3QJY A;  1VQK T;  1WJS A;  3VYG A;  1KC8 R;  2HQH A;  3PE0 A;  4M78 A;  3MCA B;  3L2W A;  1Q7Y R;  5FWB A;  2RJE A;  2HCK A;  4MML A;  3MEU A;  1TUD A;  1UDL A;  4EMG A;  2LNH B;  2X4Y A;  4JRP A;  2CH4 W;  4EDU A;  2CS7 A;  3ZFJ A;  1YFN A;  2OTL A;  3MHX A;  4C8Q B;  1KQS S;  3GPL A;  3V8L A;  2J05 A;  4CC4 B;  3DB3 A;  1K0S A;  1B7T A;  2F69 A;  2VGN A;  1Q95 G;  3JCM e;  1NM7 A;  1ABQ A;  1OOT A;  1SRL A;  7AT1 B;  2EKO A;  2WSE E;  4ELY C;  2ZGW A;  3JCM b;  2GCX A;  2QTX A;  3EFO B;  1HK9 A;  3QHS A;  3R6O A;  1K73 R;  3G6E T;  2LT4 A;  1I5L A;  4RTW A;  1PRM C;  2BE7 D;  2XKO C;  3P8H A;  1VIF A;  4CI0 C;  1FYN A;  4M78 E;  3MPU B;  1F1B B;  1H92 A;  5HCK A;  4PFO A;  3F70 A;  2DNU A;  4DBH A;  1X6G A;  1VQK Q;  1M1G A;  4HT8 A;  1QVG P;  2RJD A;  5CAI A;  4AFQ C;  1KG1 A;  3UWN A;  4JRK A;  2DIQ A;  1K9M C;  1VYU A;  2RI2 A;  1QVG A;  2KT1 A;  1GBR A;  5CQY A;  1MV3 A;  4X1V A;  2D8H A;  4LDU A;  1G3T A;  3UT1 A;  1VQK A;  3CPF A;  4BE0 A;  1R8O B;  4J9G A;  3G71 T;  4M75 G;  1XJW B;  3VUB A;  2COZ A;  4RCC A;  4LUE A;  3QII A;  3FDR A;  1QVF P;  2KXC A;  2VVK A;  2DEQ A;  3PIP A;  2MWP A;  3OYB A;  1OI1 A;  1BIA A;  2RH2 A;  1Q81 R;  4AFU C;  1YHQ T;  4FYY B;  2KT8 A;  2COY A;  2KSS A;  3DB4 A;  5CIU A;  1Q86 C;  3RDV A;  4QT7 A;  1QVF A;  1W2B S;  4ZN1 A;  1K8A U;  3RKW A;  1Y0M A;  4IUT A;  1QCF A;  3TVT A;  1T3S A;  5I21 A;  4OP0 A;  2DTH A;  2OJ2 A;  1OUL A;  2FPD A;  1D1B A;  3M0R A;  2YDL A;  1SRM A;  4N0A C;  1MND A;  1GFD A;  4KH1 B;  1RAF B;  4BDY A;  2RJF A;  2JW4 A;  2AK5 A;  4A4F A;  3X20 B;  3REB B;  5DLQ E;  1RLP C;  4OGC A;  1WHL A;  2CUB A;  1VQ5 T;  3H8Z A;  4ZGJ B;  4O6J A;  2DXB A;  3QYH B;  2BZX A;  5LJ3 f;  2H3J A;  3G71 Q;  1KC8 C;  3M0S A;  4CC2 A;  1ZUK A;  1R0C B;  4FIB A;  4JZ4 A;  2QQ9 A;  2FPF A;  3M54 A;  3S3M A;  1FMW A;  2DA9 A;  1YHQ Q;  3QSU A;  1M1K U;  1GL5 A;  4M7A A;  2E1H A;  5IAY A;  3JRZ A;  1PD0 A;  4PJM A;  3HTR A;  4BE2 A;  1RL2 A;  2EGC A;  1ZSZ A;  1D1A A;  3GF5 A;  1ACM B;  3S6W A;  1V1C A;  5J26 A;  3G71 A;  3RMQ A;  4RTX A;  5HK0 A;  5KCH A;  2RHI A;  1N9R A;  1MNE A;  3EH2 A;  1IB8 A;  2DK3 A;  1NZ9 A;  1YHQ A;  3H41 A;  1WZO A;  1G3Y A;  2J6O A;  4LXC A;  3HFO A;  1Z9Q A;  3QZ9 B;  3SWN B;  4PJN A;  1PC0 A;  1WI7 A;  2VXE A;  4C92 D;  2H3E B;  3MEV A;  3OW2 P;  2BKD N;  3HHT B;  4EMK B;  5D6X A;  5KYW A;  5LL6 S;  1KQ2 A;  4D8D A;  3OYL A;  3JB9 G;  3HPW A;  1VIE A;  4WF2 A;  1VQ5 Q;  3RMS A;  5GAO p;  4C0D B;  4C5G A;  2GQV A;  3A8G B;  4C92 F;  1BBZ A;  1WXT A;  4M7A E;  1Q82 C;  3OW2 A;  3CC7 T;  1IZ6 A;  4ZTJ A;  2QYZ A;  3CD6 Q;  3S3N A;  3VS2 A;  2JOY A;  2YUO A;  1UE9 A;  1U3O A;  1YWP A;  4C8Q C;  1HYO A;  1N6A A;  1QLY A;  3MP1 A;  4E7J A;  2BIV A;  1ZBX A;  1MV0 B;  1VQ5 A;  2ZPG B;  2ED0 A;  9ATC B;  2P0Q A;  3UA7 A;  1KFZ A;  2MIO A;  3OY9 A;  2KQW A;  2J6F A;  3HRS A;  2XDD A;  3CD6 A;  2EYW A;  5A0D A;  1Q81 C;  2XHC A;  2KVQ G;  4R56 A;  2FG0 A;  3V7R A;  3KUF A;  1XTD A;  1NPP A;  4VUB A;  2QDL A;  2M9U A;  1AWJ A;  2CP3 A;  4D6W A;  1VQ4 T;  1BI3 A;  2BTT A;  1WHJ A;  3M59 A;  1BI1 A;  1LNX A;  2ZPF B;  3CMA T;  2RF0 A;  3I9Q A;  5KYU A;  4M78 D;  4QQG A;  1OX9 A;  2ZPH B;  2M1H A;  1VUB A;  4BY6 B;  4DBF A;  3CCS T;  1NE8 A;  2EW3 A;  2ENM A;  3HP9 A;  2XI9 A;  5C0M A;  2JS0 A;  1NLO C;  3LLR A;  1BB9 A;  4ME7 A;  3OYA A;  3CC7 Q;  3C0C A;  5A0G A;  4M78 F;  2CP7 A;  1GBQ A;  3R6N A;  5GAO l;  2V8K A;  1QQJ A;  2HBW A;  3EHQ A;  2EIF A;  2OX7 A;  4PJO F;  4MZT A;  2ZCF B;  3OYD A;  5GAM f;  1SSF A;  1OEB A;  1KSW A;  2KAF A;  4ATO A;  3UA6 A;  3CC7 A;  3CEY A;  1VQO Q;  1Z9Z A;  3C95 A;  1WNL A;  2DRK A;  4C92 B;  2HNI A;  2P4R A;  4J9E A;  5IH2 A;  4EIK A;  3LW5 E;  2ZAE A;  3CCE Q;  2B86 A;  3LGF A;  4XU1 A;  5LJ5 j;  1VQ4 Q;  2AKL A;  4WTO B;  3EFS A;  4RG8 A;  5FU6 B;  4GLM A;  2EQM A;  3HRU A;  1WHM A;  3E9F A;  1WGS A;  4M75 A;  4NOY A;  4OML A;  2CGH A;  2K57 A;  2KK4 A;  2DE0 X;  2DZC A;  4XTU A;  1VQO A;  3EFR A;  3VU3 C;  4AFS C;  3HSB A;  2CT3 A;  3OS1 A;  3CCS Q;  1WFW A;  2L3R A;  2M0O A;  3EGX A;  3CCE A;  2PU9 B;  4HCC A;  2OTJ Q;  1B34 B;  3H9N A;  3M0P A;  4QQD A;  1VQ4 A;  1VQ7 T;  3FJP A;  3L2R A;  3RUX A;  3CCQ A;  3AT1 B;  4KGV B;  2P0P A;  2QQB A;  5GAN e;  2LMJ A;  2L89 A;  2LJ0 A;  5HY6 A;  1G3W A;  1JBM A;  4M77 D;  3CCS A;  3I56 T;  1UHC A;  5GAN g;  3ZEH A;  3JCM f;  2OTJ A;  3N5B B;  1FXX A;  4BD3 A;  1N9S A;  3GP8 A;  2PQW A;  1M27 C;  2RQV A;  5LJ5 h;  2QTV A;  4R0K A;  4E7H A;  4M77 F;  2KI7 A;  4M75 E;  4M78 B;  5I2S A;  1N8R C;  1BYM A;  1G8X A;  4Y91 A;  2CZ0 B;  5FU7 B;  4OMO A;  3MEW A;  2OI3 A;  5DY9 A;  5IT9 E;  4PJO B;  4JS5 A;  1T3L A;  1QWF A;  5M9O A;  1WHK A;  4OB2 B;  2L2P A;  4FW2 A;  2X4W A;  2W10 A;  1OYX A;  1P92 A;  2ZPB B;  3JAM E;  3RER A;  1KD1 U;  1HJD A;  1D1C A;  2C06 A;  4E7S A;  1ZHI A;  4F7U B;  4PJJ A;  1X27 A;  3LX7 A;  2QA4 T;  3I5S A;  3SWN C;  2EVR A;  2QK0 A;  2D9T A;  4GBQ A;  1VQ7 Q;  2HL5 C;  3PVQ A;  1I1J A;  5GAN 7;  3J80 E;  4EMK C;  5CR2 A;  2JZ2 A;  4C8Q G;  4JRI A;  3L2U A;  2DL5 A;  2QGF B;  3FB9 A;  3LYI A;  3OSS C;  4C0D C;  1QVG S;  3V7S A;  2M16 A;  4RTU A;  2RA2 A;  3FRN A;  1H3H A;  3V7C A;  3I55 A;  1U8R A;  3S3O A;  4RTV A;  1EX4 A;  1YJ9 Q;  2KYM A;  2K7A A;  3VS6 A;  4M7A D;  1VQ7 A;  1IO6 A;  2LCC A;  1UGV A;  5LJ5 d;  1PCX A;  1ZA1 B;  1WJR A;  4B9X A;  2YLC A;  3CME A;  2YRV A;  2SEM A;  1WLP B;  1MMG A;  4M7A F;  3VYH B;  4AT1 B;  4A4H A;  1QVF S;  3EHR A;  3ER0 A;  1A0N B;  3FLG A;  3RKY A;  4LDX A;  5KYY B;  1UGP B;  1YJ9 A;  4DQ2 A;  2AKK A;  3EG2 A;  3A1P A;  4KH0 B;  4UC4 A;  4FT2 A;  1ZSG A;  5D7U A;  2WSC E;  2X4X A;  1HD3 A;  4M77 B;  3SB2 A;  1O75 A;  3GLX A;  3M9Q A;  2O88 A;  1KHI A;  2Y4Y A;  2K2M A;  2K6D A;  2EGE A;  3URG A;  3NTH A;  2J6K A;  4KBM B;  1FWZ A;  3EG1 A;  2FYK A;  4BY6 C;  4ESR A;  2DIG A;  3PT9 A;  1Y96 B;  1K4U S;  4QQ6 A;  1AD5 A;  3OS0 A;  3THK A;  2NWM A;  4BE1 A;  2AT1 B;  3GNG A;  1I07 A;  2LQK A;  2EYX A;  1SG5 A;  2E6N A;  2KXD A;  3PVL A;  3UPU A;  1BI2 A;  3C94 A;  3E19 A;  4A4G A;  4FSX A;  2RB6 A;  3M57 A;  4IIO A;  3KBG A;  1TUG B;  5A2Q E;  1SF9 A;  4C92 C;  4M7D G;  4ZGE B;  3M0Q A;  2ZPE B;  1M3A A;  2DVE A;  1YJW T;  1UUE A;  2GGR A;  1SPK A;  3H0H A;  3U23 A;  1IHV A;  3RKX A;  2D8J A;  5FU6 C;  3QDF A;  4BDZ A;  2K2V A;  1OV3 A;  1KIK A;  3OYN A;  2RQT A;  4EPC A;  5IHI A;  3RR6 A;  3JB9 J;  3JCM g;  1G2B A;  4PFZ A;  4QVC A;  1ZSZ B;  4IUU A;  4J6W A;  2ESW A;  1TWB A;  2VUB A;  2RI3 A;  4N0A A;  1GCP A;  3L2V A;  1NEG A;  1WJQ A;  1E6H A;  3RBB B;  3TSZ A;  3VKI A;  1FX7 A;  3OW2 S;  5C6S A;  1X2K A;  5LJ3 j;  1M3C A;  2NUT A;  2E65 A;  1G5V A;  2JMA A;  3PNW C;  3GBQ A;  1V76 A;  1T0J A;  3VJP A;  3OYJ A;  4HCK A;  1RAE B;  1SHF A;  1J3T A;  1X01 A;  5L23 A;  2PVG B;  2AIR B;  2HKN A;  4FL6 A;  1OQK A;  4N4G A;  4M78 C;  2RD1 A;  5LJ5 e;  1YJW Q;  2KR3 A;  1X6B A;  2F2V A;  4OB3 B;  5FU7 C;  4XTV A;  4PJO C;  4FU6 A;  2FPE A;  2DL8 A;  1WHH A;  3OS2 A;  3SDZ A;  3A8L B;  3A5Z B;  2F2X A;  1AWO A;  3M5A A;  3EG0 A;  1D0Z A;  4RKU E;  3G6E Q;  1W70 A;  4DOW A;  2ROL A;  3INZ A;  4FSS A;  5CVI A;  4QW2 A;  3E9G A;  1YJW A;  1IGU A;  2O4X B;  4MZM A;  5LJ3 h;  2FB7 A;  4OB1 B;  2W0Z A;  3OB9 A;  4IUR A;  1RAA B;  1WXB A;  1RAI B;  5GAO m;  2DEU A;  1IHW A;  2DTO A;  4J9B A;  2DF6 A;  3SD4 A;  3G6E A;  4XTY A;  3H0I A;  8ATC B;  1VQM T;  1X69 A;  2D1X A;  4OMF B;  2J06 A;  2A0F B;  3PMI A;  4E7K A;  5FLX E;  2M0Y A;  1LOJ A;  1Y07 A;  1G83 A;  2GQI A;  4JRQ A;  4LDV A;  1PRL C;  2R5A A;  2IIM A;  1Q7Y C;  1N8R U;  5AYF A;  1QMC A;  2GBQ A;  1MGQ A;  3CQT A;  2AZS A;  4C8Q A;  2O9V A;  1PNJ A;  1Y7X A;  4FCY A;  1WX6 A;  2CP2 A;  1VQ6 T;  1D09 B;  4AMC A;  3CC4 T;  4GY5 A;  2O31 A;  3BDL A;  2SRC A;  2EQK A;  2DJZ A;  2C0T A;  2JTM A;  2E5K A;  2NYS A;  1T0H A;  3X25 B;  1M2O A;  1NJI U;  5HKC A;  3OBW A;  1KHC A;  4J7I A;  1LVK A;  3MJX A;  4RTZ A;  3QPH A;  2KRO A;  4BUG A;  4A4E A;  3EFO A;  1X43 A;  4F04 B;  4M77 C;  1WXU A;  2DXC A;  1BI0 A;  5LJ3 d;  2CZ6 B;  1YJN T;  2J7I A;  2VC8 A;  3PMT A;  5GAN f;  1M8M A;  2GTO A;  1VQ9 T;  1UGR B;  1NLP C;  4BI4 A;  3EGD A;  1K8A R;  2FZK B;  1K73 C;  1H8K A;  5EG2 A;  3LWI A;  1VQM Q;  3OYM A;  3P8D A;  2JTE A;  4Z8A A;  4ZTF A;  5KYX A;  3ME9 A;  4BI8 B;  1HSQ A;  3GNF B;  4C8Q E;  2E64 A;  4C92 G;  2DPP B;  1EZZ B;  1RAB B;  3M4Y A;  2DL4 A;  2RMO A;  2RPN A;  1NBE B;  2DJQ A;  2LQW A;  1VOM A;  3JB9 D;  4O5V A;  1BCO A;  2Z0W A;  5IHK A;  1UJ0 A;  1SHG A;  1VQ6 Q;  1VQM A;  1JXM A;  3L2Z A;  5KCO A;  4MMK A;  4RG2 A;  3JB9 F;  2KRN A;  2VB6 A;  1VQP T;  3CPW P;  3M0U A;  1WQ7 A;  3QWX X;  5GAN 6;  2LJ3 A;  5GMK m;  1D3B B;  4HCZ A;  3UF4 A;  1M90 U;  1VQ6 A;  3QO3 A;  1GXI E;  2GFA A;  2RQW A;  2PUK B;  3OYH A;  3TEE A;  4JJB A;  3EG3 A;  4HKE A;  4KUD K;  3CPW A;  1M1K R;  2FZG B;  3JCM Q;  5I2M A;  2YXY A;  1ZSZ C;  3X26 B;  4M7D A;  2P4T A;  1NJI R;  5GJW B;  1PKS A;  5GAM h;  2F5K A;  3VS0 A;  1YCY A;  2YSQ A;  3JCM P;  3C12 A;  4DBQ A;  1XQH A;  2X4J A;  2EJF A;  5GAO q;  2KE9 A;  2NUP A;  5GAN 2;  2KGT A;  2JS2 A;  4A63 B;  2PVD B;  3CCR T;  2DKG A;  2AHJ B;  3UAT A;  3J7A F;  4N4I A;  4PJO G;  2QGG A;  1QKW A;  4OMN A;  1UJY A;  4XU2 A;  1M8V A;  1QCN A;  1EIF A;  2COW A;  3GOX A;  4JJN K;  1I8F A;  4QKU A;  1VQN T;  2DYI A;  2E41 A;  4F7U G;  1VQP Q;  2HKQ B;  4OMQ A;  3CXC P;  4OF1 A;  3UDC A;  2ABL A;  2E70 A;  4OVA A;  5GJV B;  4XTZ A;  2G6F X;  2MK5 A;  1GFC A;  1B07 A;  1RAH B;  3QUI A;  1RAD B;  2VV5 A;  3CXC A;  1KQ1 A;  4M7D E;  5DLO A;  2KNB B;  2MMP A;  1NEB A;  2A36 A;  2DRM A;  1VQP A;  1PD1 A;  1N27 A;  3OQ5 A;  1IRE B;  5KH6 A;  4JS4 A;  2CYZ B;  2DIL A;  2O01 E;  1K0X A;  3G4S T;  3CMA Q;  1MHN A;  3JB9 I;  2EFI A;  3OYE A;  3JCM c;  2XDB A;  1D0X A;  2CP0 A;  5LJ3 e;  2KMT A;  3JB9 H;  2MPX C;  4KUL A;  1M90 R;  2HL3 A;  4A53 A;  3VS1 A;  3E1S A;  3CCR Q;  1H64 1;  3RIR A;  4EMK A;  3NTK A;  3OYF A;  1K9M U;  1CKA A;  3EG9 B;  1TSF A;  1H3Z A;  1K8A C;  2CZ7 B;  2JM8 A;  3CCM T;  3M4G A;  1XOV A;  2RQR A;  3CMA A;  1JRI A;  1M2V B;  2K5L A;  2QAS A;  2X51 A;  4N4H A;  3KFV A;  1VQN Q;  2CP6 A;  2QQA A;  3L2Q A;  2LJ1 A;  4E7I A;  2M02 A;  3A8O B;  2X35 A;  1WYX A;  3CCR A;  4A54 A;  2L0A A;  2K9G A;  3EAE A;  4M77 G;  2X3X D;  2DL3 A;  2VXF A;  3JCM J;  1Q86 U;  1TG0 A;  1GCQ C;  1OX8 A;  1X6O A;  1G3S A;  4Z88 A;  3A8M B;  2VAS A;  1YN8 A;  1UB4 A;  1VQL T;  1VQN A;  4LN2 A;  3VS5 A;  1JJ2 S;  3JCM W;  2YWW A;  3OSV A;  1AEY A;  1SEM A;  2LCL A;  1W4S A;  4J9D A;  3G4S Q;  1WDX A;  2LX7 A;  2RHX A;  4LUD A;  1PSF A;  3T9N A;  1ZX6 A;  2PNI A;  2MCN A;  2FRY A;  2FVU A;  1FMV A;  1M1K C;  3OYK A;  2KDS A;  1R0B G;  2C0O A;  1WHG A;  4AFZ C;  4XK8 E;  5CCA A;  3CCM Q;  3CC2 T;  4PLI A;  1JQQ A;  4HT9 A;  2DM1 A;  3G4S A;  1SSH A;  1TOV A;  1U5S A;  2EYQ A;  4F17 A;  2QQR A;  5LJ5 f;  4OGE A;  4F14 A;  3MET A;  1KC8 U;  1CKB A;  3QZ5 B;  2P0K A;  3I56 Q;  1ZUY A;  5CQX A;  2LQ8 A;  2DO3 A;  5GAO r;  1EFN A;  3OS5 A;  3MO8 A;  2KRM A;  4LDW A;  2EKH A;  1K9M R;  1UHF A;  3CCM A;  1QP3 A;  2PTK A;  4RTT A;  3JCM V;  3ZBD A;  3P8B B;  3L42 A;  3HFN A;  2OTL T;  4ELZ C;  1VQL Q;  4JJD A;  4C92 A;  2JVV A;  2EYY A;  2C0I A;  1TH7 A;  3I56 A;  2MOX A;  2E3H A;  4B6M A;  2ZZD A;  2RHY A;  1LPL A;  1VQ8 T;  2KEA A;  1K9A A;  3CBO A;  1TXQ A;  3M55 A;  5GMK j;  3MP6 A;  4IIM A;  2HMA A;  2QA4 Q;  1PHT A;  2ED1 A;  4FYX B;  2HQE A;  2FL7 A;  2XG8 D;  2EAY A;  4MDW A;  4ORZ A;  3CC2 Q;  1VYT A;  2JUF A;  3BE3 A;  3QYG B;  3NMZ C;  3QKJ A;  1E7O A;  3QJ6 A;  3MP8 A;  3FIF A;  2FHD A;  3WXM B;  2R57 A;  1BIB A;  1Q82 U;  8AT1 B;  1RAG B;  2QA4 A;  1KD1 R;  1D0Y A;  4HXJ A;  2DXU A;  3SFM A;  3G7Z A;  3V8K A;  1YP5 A;  2P84 A;  2X3W D;  2FZC B;  4C92 E;  3CC2 A;  1OZ2 A;  5GAN 8;  2PZ1 A;  2GF7 A;  3D7S B;  2E4H A;  1GRI A;  1BCM A;  1PG5 B;  2OTL Q;  2M51 A;  3TSW A;  3BY7 A;  3QDR B;  4C5H A;  1I4K 1;  2HZY A;  5GMK h;  1Q81 U;  1JEG A;  1VQ8 Q;  1OPK A;  2KY9 A;  3ZL7 C;  1MMA A;  4KUI A;  1SKU B;  3M0T A;  1JJ2 P;  4PJO A;  2XD0 A;  4BB7 A;  3A98 A;  5FRM A;  4C0Z A;  1YIJ T;  1MUZ A;  3H6Z A;  5D6W A;  4M7D D;  1JO8 A;  2BUD A;  1AHJ B;  4OB0 B;  2QEX T;  1PSE A;  1IGQ A;  2R58 A;  2MAM A;  4E47 A;  1AZE A;  3I35 A;  1JJ2 A;  3VS7 A;  4F7U A;  5CKE A;  5FRN A;  4J5Y A;  4RUG A;  4M7A B;  4Z89 A;  2XU8 A;  2KBT A;  1VQ8 A;  1ABO A;  4M7D F;  1YWO A;  3OMG A;  5KE2 A;  4BAC A;  4LD9 K;  4FM4 B;  1B3Q A;  2KYB A;  3PTA A;  4PNO A;  2DX1 A;  1TUC A;  3V8J A;  2PUO B;  3OYI A;  4L6V 5;  3BFM A;  2QAZ A;  2NUZ A;  3ASK A;  3OYG A;  2K3X A;  4NL2 A;  2YUQ A;  4JUV A;  1YNZ A;  1PM3 A;  2EWN A;  4DA4 A;  3OA6 A;  3RNJ A;  3EGD B;  4JLG A;  2JN0 A;  3EGU A;  4PJO E;  3QWY A;  2H8H A;  5FW9 A;  1Q82 R;  3OYY A;  1MMN A;  5FWC A;  4F16 A;  3CBP A;  5KYW B;  4A4K A;  1S72 T;  5KYX B;  1U06 A;  1UEC A;  2XK0 A;  2IG0 A;  2A37 A;  2VYT A;  4ZN3 A;  4X34 A;  4LNP A;  1UG1 A;  4F7U E;  5KYY A;  4M75 D;  1YIJ Q;  2EQJ A;  1S1N A;  5LJ5 g;  3CPW S;  2AZV A;  2YUP A;  2QEX Q;  1TU0 B;  1NG2 A;  4E7L A;  2DD5 A;  5GAN j;  4B9W A;  2LRQ A;  2FEI A;  4M75 F;  3LH5 A;  3I5R A;  4J7F A;  4DBR A;  4M77 A;  2GNC A;  3TU4 K;  4BI3 A;  1RI9 A;  3GIB A;  1QP2 A;  1W1F A;  1JXO A;  4C0F A;  5J3B A;  1YIJ A;  2A08 A;  4CRI A;  3QG1 A;  4L5G A;  2QEX A;  1X75 C;  2RJC A;  2V8I A;  3HKS A;  5DM7 R;  4KGZ B;  2FO0 A;  1Y96 A;  4XU3 A;  2E10 A;  2EPD A;  2Y4X A;  1OU9 A;  2EGA A;  4XQ3 A;  4EMH A;  2RI5 A;  4JPB W;  2LDM A;  2DYB A;  2ATC B;  2YHT A;  2F1L A;  4LDY A;  4M7D B;  3H0F A;  1VYV A;  1KD1 C;  2RNA A;  2YLB A;  3HL8 A;  3NPF A;  1N5Z A;  4QVZ A;  5KYU B;  2EYZ A;  3FEO A;  1S72 Q;  2NUP B;  2D6F A;  3L1A A;  4PFP A;  2K5I A;  2O2O A;  1WPY A;  4D8K A;  2DD4 A;  5GAN h;  2VKN A;  3G1J A;  3CXC S;  1AWW A;  2JM9 A;  3CCU T;  4XTX A;  4M77 E;  4II1 A;  4CC7 A;  2YRD A;  1I5O B;  2QQS A;  3WVD B;  1S72 A;  2XDP A;  3CD6 T;  2D0Q B;  2HBP A;  3CCL T;  2RK2 A;  1KQS P;  3FC3 A;  2JNG A;  3PGG A;  3DKM A;  1NPR A;  1WQW A;  4GLK A;  2YT6 A;  2YUN A;  1TTH B;  4Z02 A;  3TRE A;  5CK9 A;  1KK7 A;  2K3B A;  1KQS A;  3IQL A;  4XAX B;  3E2U A;  3VS3 A;  4MZP A;  2R5M A;  5A0L A;  2DZ9 A;  5CKH A;  1UGQ B;  2BZ8 A;  2EJ9 A;  2ROT A;  4JJC A;  5KYN A;  1LJO A;  4M75 B;  4WCI A;  1ZBJ A;  1BKB A;  2DER A;  3CCJ T;  2CDT A;  5GAM j;  1LCK A;  4NS5 A;  3MKD A;  3X24 B;  4MDX A;  2WSF E;  1PKT A;  1BU1 A;  2V1Q A;  3HRT A;  3EGX B;  2A3L A;  2ECZ A;  2DLP A;  2XMF A;  2OAW A;  4RCB A;  3NTI A;  1AWX A;  5GAN d;  3CC4 Q;  1QWE A;  3CCU Q;  4FYW B;  2V26 A;  4L59 A;  1YCS B;  4OMM A;  3NHN A;  2GFU A;  2A7Y A;  2ZPI B;  5KE3 A;  5GMK e;  1OU8 A;  2HEQ A;  1C0M A;  1YI2 T;  3LGL A;  2RK1 A;  2X9H A;  2G3R A;  4KT0 E;  3CCL Q;  2EQU A;  2DAQ A;  2L3Q A;  2CUD A;  1WIE A;  1N8R R;  1I81 A;  2D0N A;  1KJW A;  3RES A;  1UFF A;  2B8A A;  1YJN Q;  3CC4 A;  3CCU A;  3WVE B;  4E6R A;  1IXD A;  4QVD A;  4M7A C;  2O4X A;  1VQ9 Q;  3CCV T;  1CSK A;  2LZ6 B;  2LNV A;  4X9D A;  3VS4 A;  5CKB A;  1W2B P;  3VRZ A;  1VQO T;  3CCL A;  5J39 A;  2DFU A;  3OMC A;  4Y28 E;  2HD0 A;  2DVJ A;  2RN8 A;  3BW1 A;  2Y90 A;  2LP5 A;  1OPL A;  2HQX A;  3CCE T;  1U1T A;  3CCJ Q;  3A8H B;  1YJN A;  6AT1 B;  1W2B A;  4V2S A;  2E5Q A;  4M78 G;  4KRT A;  3SHW A;  1M5Q 1;  4HCB A;  1VQ9 A;  4HVV A;  3C4S A;  5HK3 A;  4KGX B;  4FYV B;  3CCQ T;  2I0N A;  5L8R E;  4P5N A;  2RM4 A;  2VWF A;  2V1R A;  4C5I A;  4FW1 A;  1NYF A;  3PIO A;  1MMD A;  4PJO D;  2CT4 A;  1UTI A;  3CCJ A;  2OTJ T;  2OAU A;  1ZLM A;  2XIC A;  1YI2 Q;  2L8D A;  2DBM A;  4CC3 A;  5FRO A;  4DEY A;  3KXT A;  1TS9 A;  2QI2 A;  1GCQ A;  4Q5W A;  2A28 A;  2XID A;  4J9C A;  2QDY B;  4PK4 A;  5GAO n;  1RAC B;  3MEA A;  3CCV Q;  2EJG A;  2QXF A;  2VGM A;  5CKF A;  4JLI A;  3JCM X;  2WAC A;  3M56 A;  1HXD A;  4XU0 A;  3DLL A;  1UGS B;  3Q1J A;  4F7U F;  1YI2 A;  1QCO A;  2CP5 A;  5I11 A;  4M4Z A;  1FMK A;  2MWO A;  2V8J A;  5GAM d;  2DBK A;  3J81 E;  1O9S A;  2YRC A;  3SWN A;  3JCM h;  4IUP A;  4HA8 A;  2RHU A;  3VRY A;  5IHN A;  3BDU A;  2PVO B;  1C1A A;  3CCV A;  4JDS A;  3DLM A;  5LJ3 g;  4PJL A;  4RMO A;  3FJ5 A;  2K3Y A;  1X2Q A;  3CCQ Q;  3X28 B;  1NYG A;  4C0G A;  3ULR B;  1V29 B;  1QVP A;  4M7D C;  2EQI A;  2DMO A;  4ZNX A;  2CZ1 B;  2E3I A;  2LC4 A;  4ANJ A;  2LX9 A;  3I55 T;  1AVZ C;  4JZ3 A;  1WA7 A;  2JXB A;  5CKD A;  4HVU A;  1PWT A;  2QG9 B;  4OMP A;  5GMK i;  4R55 A;  3CME T;  1K1Z A;  3QBY A;  5ECA A;  5GAN 3;  1U1S A;  1AT1 B;  2CRE A;  4YTL A;  1YIT T;  1D3B A;  4E2F B;  4J8O A;  1YJ9 T;  2JMC A;  2JTF A;  1XNI A;  1OZ3 A;  2K5F A;  4K11 A;  2LTO A;  5D6Y A;  4LE9 A;  4E7Z A;  1M4Z A;  1Y71 A;  2GTJ A;  4PKC C;  1R77 A;  1ZQ1 A;  3VV0 A;  2F2W A;  3JCM d;  2L3S A;  3LWH A;  2RHZ A;  4J83 A;  2NLU A;  4XTW A;  4FT4 A;  4DOV A;  4IUV A;  4X9C A;  4PL6 A;  2JJ9 A;  3CBM A;  1Y57 A;  2LQN A;  1BK2 A;  3JV3 A;  2IVW A;  4M75 C;  2CSQ A;  5IN1 A;  1NJI C;  2BZY A;  4J9I A;  2MYS A;  5GMK l;  3I55 Q;  4NL3 A;  2CH4 A;  1AOJ A;  2IPO B;  4RTY A;  2K4Y A;  4AG2 C;  4C8Q D;  1Q7Y U;  3REA B;  2LT1 A;  4C5E A; 
#chains in the Genus database with same CATH homology
 1LPL A;  2CP6 A;  3RDV A;  1WHH A;  3E2U A;  2MPX C;  2HL5 C;  2Z0W A;  2HL3 A;  2M02 A;  1WHG A;  2E4H A;  2COW A;  1TXQ A;  2COZ A;  1WHK A;  1WHM A;  2HKN A;  1TOV A;  2HKQ B;  2CP2 A;  1IXD A;  2CP3 A;  2CP5 A;  2HQH A;  3TQ7 P;  2CP7 A;  2QK0 A;  1WHL A;  2E3H A;  1WHJ A;  4B6M A;  2COY A;  2CP0 A;  2E3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...