5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
3JB9J 3VU3C 1MGQA 5LJ3e 4M7AC 4NL2A 1WQ7A 4M7DB 5LJ5j 2E10A 4XU2A 5GAN2 2YHTA 3INZA 5GAMd 4HT8A 1LNXA 4F7UA 4M7AE 4N0AC 4M78C 4M78D 3QSUA 4M77G 5LJ3f 3QUIA 3JCMJ 4EMKB 4PJOA 2E65A 4C92D 3BFMA 5GAOm 3FJPA 4NL3A 4V2SA 5I21A 2JN0A 3FB9A 1X01A 4Y91A 3BY7A 5GAMj 4EMGA 5GAN5 4C8QB 5GMKj 5GANj 1KQ2A 4M75C 1N9RA 4M78F 1D3BB 4QVDA 4M7AA 3V7SA 4RCBA 5GAMg 3JCMQ 1I4K1 5GAMh 3RERA 4PJOC 3BW1A 4M75E 5LJ5d 2EJ9A 1WQWA 4N0AA 2FB7A 2EJGA 1I81A 4MMKA 4XTZA 5DY9A 3SB2A 3V7CA 4X9CA 2CGHA 2E1HA 4F7UF 4WF2A 2DTOA 3JB9D 4M78G 5GAN8 2YLBA 5CAIA 4M7DC 4M7AD 5GAOr 2DVEA 4J6XA 4PJOF 4C92G 1WPYA 1I8FA 4HA8A 1M8VA 4M75A 4M7DE 1U1TA 2HNIA 5GANd 2YLCA 5LJ5g 5GAN3 3JB9F 3JCMe 5LJ5h 4M7AF 3V7RA 5LJ3d 2DEQA 2DKGA 4OP0A 1YCYA 4PNOA 2DZ9A 3RUXA 4RCCA 4EMKA 2DXUA 5GMKi 4C8QC 4NOYA 3V8JA 3JB9H 4J6YA 4M75D 3JCMf 3JCMc 4DQ2A 4M7DA 3JCMV 3JB9G 5GAOl 3RKWA 4C8QE 4EMHA 5LJ3j 5GAOp 1I5LA 4PJOD 4M7AG 1N9SA 5GANg 5GMKh 5GANh 4XTXA 3EFRA 4XU3A 4EMKC 3JCMX 3HSBA 4XQ3A 3QHSA 1U1SA 3FIFA 3L2ZA 4M75F 5LJ3g 4JRIA 3HFNA 2FYKA 2E41A 4X9DA 5LJ3h 4A54A 4XTWA 3JCMP 4M7DD 4QVCA 2DTIA 3QO3A 4JRKA 3SWNB 2RD1A 4C8QA 4C92B 4XU0A 2QTXA 2DXTA 1LJOA 2DZCA 1D3BA 5GMKm 4JLIA 4XTYA 1Y96B 3JB9I 4F7UG 2RB6A 4M75G 4M77B 5GAN6 3GIBA 3AHUA 4M7DF 1B34B 3RKYA 4A53A 1JRIA 2K57A 1KQ1A 3EFSA 4PJOG 5LJ5f 2Y90A 3JCMW 4M77E 4MMLA 2EAYA 4C8QD 3RKXA 2VXFA 4XU1A 1TH7A 2VC8A 2DJZA 4XTUA 1H641 2ZGWA 3SWNA 3RIRA 3JCMd 1JBMA 4C92A 4M7DG 5GAMf 1HK9A 1HXDA 4M7AB 2RM4A 1LOJA 3BDUA 4C8QF 1Y96A 2DTHA 1BIBA 5GANf 5GAOq 2EWNA 4M77A 3RESA 2VXEA 4J5YA 1B34A 4J6WA 4M78B 4JUVA 3SWNC 3JCMb 5GAOn 5GAN7 4C92C 1BIAA 3PGGA 3V8KA 5LJ5e 4M78E 2I2LA 2RA2A 3JCMg 4C8QG 3JCMh 4HT9A 4M77C 4M77D 4C92E 5GAN4 4F7UB 4M75B 3M4GA 4C92F 3V8LA 2EJFA 4PJOB 4F7UE 2E64A 5GAMe 3HFOA 5GMKl 1WNLA 3L1AA 4XTVA 5GMKe 5GANe 1M5Q1 4M78A 4M77F 4PJOE
chains in the Genus database with same CATH superfamily
4E7IA 4E7KA 1G3WA 1K4US 1UGRB 2E3IA 2PVOB 1PD0A 4HCCA 3X28B 3BE3A 1VIFA 1YIJT 2KRNA 3I55Q 5L8RE 2KR3A 1FWZA 2QQ9A 2CH4A 1NJIC 5GAN5 2QA4Q 2MWPA 1OX8A 2HZYA 5AT1B 1RAFB 1HD3A 2VGNA 2YUQA 1MMAA 5FW9A 2EQKA 2EGAA 4E2FB 1NE8A 4E7LA 2KBTA 5GAN8 4AFSC 2AKKA 3OYIA 2YLCA 3UPUA 2FPDA 1YJ9A 3V8JA 2OTLT 5CR2A 4LDXA 5HY6A 4EMHA 3OYGA 3LH5A 5I11A 5GANg 2KT1A 3NTIA 2HQEA 3HSBA 3WVDB 3FRNA 3QDFA 3CCQT 1VQLQ 2PVGB 1QW1A 2RD1A 1MMDA 2QGGA 3CD6T 1LJOA 4GY5A 2JW4A 1N8RC 2KY9A 4AFQC 1ZSZB 1JRIA 1VQ4Q 3CCRQ 1Q86U 2Y90A 3CPWP 2ED0A 3NHNA 1KHCA 2L5QA 1D0XA 1E6HA 2VUBA 2FEIA 4C92A 1UB4A 3M0QA 2DNUA 5GANf 5CKFA 3EG2A 1VUBA 2KXCA 2DA9A 1BB9A 2XDDA 2I2LA 2RA2A 5CKEA 4XAXB 3CC4Q 2QDLA 1G3SA 3CC4T 5HK0A 2RQTA 4A4GA 4XTVA 4Z02A 4J9EA 3EH1A 1PRLC 1OV3A 3EG9B 1VQNQ 1PCXA 2RQRA 1AHJB 4M7DB 4QVZA 2RMOA 5GAN2 4HCKA 2GNCA 2DF6A 1YITA 1VQMA 4JDSA 1JEGA 1IGUA 4ESRA 5GAOm 4ZN3A 2XIDA 3FB9A 5CKBA 1VQ8T 1Q7YU 1KFZA 4BD3A 1UFFA 5IHNA 4M75E 2HEQA 1UEBA 4MMKA 2DD5A 2VGMA 2E1HA 3OW2A 2YLBA 1I8FA 3CEYA 1FMVA 3OMCA 1NLOC 3OBWA 4A4HA 2DKGA 1YCYA 3GNGA 1BCMA 3RUXA 1Q95G 4DBQA 1VQPA 3OS5A 3EG1A 3PVQA 4M7DA 2RQUA 1IZ6A 2VVKA 2K3XA 3VS2A 2L89A 2NWMA 3A8MB 1SHGA 4JLIA 4BB7A 3MJXA 2QEXT 1PM3A 2PUOB 2EVRA 1VQ5A 5KE2A 3CMET 1TH7A 2LQKA 1Q81U 4JS4A 5KYUA 2FZCB 1XNIA 2JMCA 2O2OA 2NUPB 2RH2A 3G4SA 2CP3A 5GJWB 1JQQA 2DX1A 3JCMb 2L3QA 5GAN7 4PLLA 1X2QA 2YDLA 2QDYB 1D1BA 3MEWA 5KH6A 3HP9A 1ZSZC 1QQJA 5IXFA 2FL7A 4C92F 2AHJB 3OYKA 1KQSA 1AZGB 1K8AR 1YP5A 4N4IA 1D0ZA 3KBGA 3OA6A 1UDLA 4K11A 2DLPA 3CXCS 1OU9A 1Q86R 4M7AE 2M02A 3CCUA 3JCMJ 1ZBXA 1NYGA 1YJ9T 5I21A 3S3MA 3BY7A 1WHHA 2XDBA 1N9RA 1OX9A 1XQHA 1K9MU 1NPPA 1NPRA 2F2VA 3VV0A 3S6WA 3C94A 2DIGA 1VQ6T 1VQKA 4E7ZA 1RLQC 2F69A 3EHRA 4M7DC 1KQSS 1WXBA 3MPUB 2E6ZA 1TOVA 2HBPA 2Z0WA 2ZPGB 1OZ3A 3M56A 3ZEHA 1U3OA 2LC4A 1N6AA 1W1FA 2D0QB 3VRYA 2DXUA 2EYXA 1ZSGA 3CCVA 1EX4A 1JJ2A 3JCMc 1WXUA 2MPXC 3TVTA 2G3RA 4BI4A 5LJ3g 1ZBJA 3M57A 2MI6A 3PFSA 1Q7YR 4KH1B 1M1KC 2LJ3A 4FT2A 4Z88A 2LJ0A 4RUGA 4M7DF 1Q82C 4HVUA 4B9XA 4IKFA 2VC8A 1WHJA 1S72Q 1NJIU 1D09B 1H641 1KD1C 3UATA 2CUDA 2HCKA 2E5QA 1WHGA 3I5SA 1JJ2S 2VXEA 2ZPHB 2E4HA 1M2VB 1UE9A 1EIFA 5CKHA 3H0FA 5D7UA 4KULA 3JCMg 1YWPA 2PZ1A 3LW5E 4AT1B 4C92E 1M1FA 1V76A 2QG9B 2X4YA 1YI2Q 4Z89A 1G83A 3GPLA 3X25B 4L59A 2EIFA 2XU8A 5KYYA 3QZ9B 3QSUA 4B9WA 3OMGA 1BI2A 2A36A 1Q81R 4NL3A 5GAMj 3OYEA 4HVVA 2MOXA 1TU0B 5GAMh 3QJ6A 1U5SA 1VOMA 1VQOQ 2DE0X 2V1RA 1CKBA 5HKCA 2QI2A 2Y4XA 2KRSA 2DVEA 3CCJA 2O9SA 1WXTA 2XHCA 2RJCA 4ZNXA 4CRIA 5LJ5g 2HSEB 3TSZA 2DEQA 2V8JA 3UA7A 3PNWC 3VS1A 3PTAA 1TUCA 4DQ2A 1IO6A 1WJRA 1QCOA 1O9SA 1I5LA 1B7TA 1MNDA 2DXCA 4JRIA 3VKIA 2W10A 3I5RA 4XTWA 1G2BA 4JPBW 4M7DD 2X4WA 3OW2P 5HCKA 2SEMA 1JXMA 2KXDA 3O5ZA 4FYWB 4PFPA 4F7UG 1PRMC 1ARKA 5CIUA 2K57A 4J8OA 1KQ1A 4A4EA 5IXBA 5LJ5f 5DLQE 1SRMA 4MZMA 2EPDA 2J05A 2ZGWA 1W4SA 1GRIA 4D6WA 5IAYA 1YWOA 3M0RA 3CCUT 3H41A 2R58A 4WTOB 2R57A 2EW3A 1PWTA 4OB2B 2YT6A 2DEUA 2YUOA 3NMZC 4TVRA 1BK2A 2K2VA 3GF5A 1X75C 4M75B 4JJDA 2JS2A 4ATOA 4LUDA 2EGEA 4OMMA 3NFCA 4PJOE 2ZCFB 1QLYA 1M1GA 3OYFA 2JXBA 2JMAA 3GNFB 2VV5A 2ECZA 3INZA 1UHFA 3F70A 1UGQB 2D6FA 4JZ4A 5GANj 2F5KA 3CC7A 3RERA 1OYXA 5DM7R 2LMJA 4PJNA 5I2MA 1WLPB 1M90C 1KQSP 5DY9A 3S3OA 2WSFE 1RAGB 1YJWQ 3QZ5B 2C06A 2K3BA 4M75A 2E3HA 2HNIA 2LQNA 4QQ6A 1WFWA 3CCLQ 1YBYA 4X34A 3CCLT 4OP0A 4C0DB 2KT8A 1U06A 4RCCA 2O88A 1UGSB 3CCSA 3DLMA 4C8QE 1C0MA 1N9SA 5GMKh 5KYXB 3EFRA 2AK5A 3LLRA 4XQ3A 1YFNA 2OI3A 3R6NA 3M0PA 2MK5A 1IXDA 3MEUA 2B8AA 3NTKA 2E70A 3TU4K 4JLGA 3JB9I 3C12A 2RB6A 3UDCA 1B34B 2ZPEB 3G71Q 1AWXA 1M30A 2FHDA 3R6OA 2VXFA 4XU1A 3VS7A 2DJZA 4E6RA 1ZA2B 3CC2A 2K3YA 2RPNA 3RIRA 3VUBA 4LNPA 3ULRB 4M7DG 4M7AB 3M5AA 1U8RA 3GLXA 4D8KA 1RI9A 4JUVA 4M78E 1NBEB 1TWBA 3REAB 1QWFA 2LJ1A 3M0SA 2E6NA 4WCIA 4JRQA 3CCJT 2DL7A 4AG2C 2NUTA 1YJNA 2AIRB 5GAMd 1NEGA 1VQ9Q 3RMQA 1VQ9T 1K0XA 1G3TA 1RL2A 2RHYA 2KRMA 1M1KU 2RK2A 9ATCB 2EFIA 2X9HA 4M75C 2PVDB 2M16A 4M7AA 2RI5A 1OULA 3RNJA 1G3YA 1M4ZA 5A0GA 1I81A 4WF2A 2DTOA 3OYDA 1HJDA 1KD1U 1QMCA 2LX7A 2ZPBB 1YIJQ 4QW2A 2LRQA 3JB9F 4CI0C 2LVMA 1M27C 2BTTA 3H6ZA 4RG2A 1GBQA 4E7SA 2DZ9A 1TS9A 2EYWA 2KEAA 2X4JA 3RR6A 3PVLA 2LZ6B 4F16A 2NYSA 3P8HA 1YHQT 4FM4B 4XU3A 1AD5A 3G7ZA 2DL4A 2LP5A 3L2ZA 4M75F 1QVFA 4QVCA 1OOTA 3FLGA 3PE0A 1AWOA 4C92B 2EQIA 3SHWA 3VS6A 1ZHIA 4J9HA 4BACA 2BKDN 5EC7A 4C0DC 4KT0E 2OTLQ 1X69A 1GCQA 2GF7A 3QKJA 3CCMA 2DYBA 2ZZDA 5GAOq 1Y96A 2DTHA 7AT1B 2KVQG 2EWNA 3CCQQ 3N5BB 2HKNA 2KYBA 2X4XA 3A1PA 1T0HA 3CD6Q 3PGGA 1R77A 1CKAA 1TUGB 2MWOA 3SEMA 1X2KA 4KGXB 2QGFB 2DJQA 4YTLA 2EYZA 4ZGEB 1M3CA 4GBQA 3CPFA 2QK0A 4CC2A 3VU3C 1ZA1B 2BIVA 4M7AC 2CP5A 4J7IA 2RHXA 2JS0A 2FPFA 5LL6S 3A8GB 4JRPA 4DA4A 3CCST 1VQ7A 2DVJA 5IHKA 3OS0A 1R0CB 1MMGA 4RTVA 1K73R 4EDUA 1H92A 3BW1A 2KK4A 1WGSA 1KC8R 3ZFJA 2DO3A 3JB9D 1QKWA 1ACMB 2DETA 4M7AF 4DBRA 2EBPA 1VQ8Q 3A5ZB 2A28A 4EMKA 2HQXA 5GMKi 3CC2T 3TCJA 4M75D 4FW1A 1HSQA 2DERA 1UGVA 3GBQA 3L2VA 3DB4A 5DLOA 2KNBB 5KYUB 5FRNA 1Y7XA 2BZXA 2J6OA 4XU0A 1UECA 2DL3A 1YNZA 3E9GA 4LN2A 3EAEA 3JSCA 2RO0A 2EGCA 4FW2A 2LQWA 3L2UA 4M77E 2EAYA 1WZOA 3U23A 4C0GA 2OAWA 1YJNT 5KYWB 2RJDA 4ZN1A 1WYXA 3E1SA 1M90U 4LD6A 2A3LA 2K5IA 1SF9A 4C92C 3V8KA 2QEXQ 3OW2S 3EG3A 3LYIA 4BY6B 3CMEQ 1SEMA 1T3LA 3Q1JA 5GMKe 1M5Q1 2VYTA 2M9UA 2XK0A 5LJ5j 2E10A 2V8KA 4RTTA 2ABLA 2GFAA 1MHNA 5AYFA 4PJOA 1OZ2A 2IVWA 4EMGA 1QCNA 3L2WA 4C8QB 5KYWA 4FT4A 3VS5A 4C5IA 4OMLA 3META 3QWYA 2VKNA 1GFDA 2EKOA 2OJ2A 3PIPA 1W6XA 4X1VA 2QQBA 4M7AD 2K9GA 3JV3A 3SDZA 1U1TA 2MIOA 1WHKA 1YJ9Q 3M0TA 3D7SB 3CCMT 5L23A 3MP1A 4PNOA 2O9VA 3JB9G 5GAOp 2FPEA 5D6YA 1VQ6Q 2CZ0B 3H0HA 3VS0A 2CH4W 2BE7D 3URGA 2FG0A 3VYHB 4ZGDB 3GOXA 2P0KA 2YRVA 4C8QA 1TSFA 2QTXA 4J7FA 3HHTB 2OAUA 2JNGA 4M75G 2HQHA 3LWIA 2LQ8A 3LX7A 3TSWA 1X6GA 4BDZA 2CP2A 1DJ7B 2COZA 1C6VX 2CT3A 3SWNA 4LUEA 1V29B 2PUKB 3OYHA 2LCLA 4J5YA 1VYVA 1FMWA 1VQ7T 1QVFP 2QQAA 5KCHA 2A0FB 4N4HA 5KYYB 1G5VA 3I56A 3DB3A 1KSWA 3A8OB 4AFUC 1RAAB 2GFUA 2I0NA 2P0QA 2E64A 4F7UE 1JU5C 3CMAA 4M78A 1SHFA 1MGQA 4NL2A 1YITQ 3P8DA 1VQMQ 2RHIA 2IPOB 1YITT 1VQMT 1LNXA 2OTJA 1WJQA 5LJ3f 4J83A 4J9BA 3UF4A 2WSCE 4C92D 3BFMA 5IH2A 4BY6C 4RG8A 3G6EA 3HRTA 2DPPB 3OSVA 2PQWA 3ASKA 2JJ9A 1G8XA 2FB7A 3SB2A 4EPCA 1FXXA 1RI0A 3SD4A 1ABOA 2QYZA 4ELZC 1KG1A 4F04B 1KHIA 5GAOr 4PJOF 2LCCA 3RBBB 3QG1A 3OYBA 1VQPQ 1I07A 3ZL7C 3CCEA 1Y57A 1VQPT 3C0CA 1IGQA 4PKCC 2CP7A 5CQYA 3EFOA 4OMFB 3VRZA 4C8QC 2C0TA 2R5MA 3JCMf 4BE0A 2K79A 3QXEB 1N8RU 4HKEA 2FZKB 4M7AG 2COWA 4XTXA 1I0CA 2GTJA 2AZVA 2IIMA 2F1LA 4J9GA 4FCYA 2V8IA 2DXTA 3MP6A 4P5NA 3DLLA 1VQ5T 5GAN6 1IHWA 4IIMA 2EYYA 2J7IA 4JZ3A 1Z9QA 1D0YA 1OQKA 3G4ST 1K8AC 3OS2A 2H8HA 4C8QF 4HVWA 4KUDK 2DD4A 3E2UA 3P8BB 3PMIA 1OEBA 5GAOn 4IUPA 2CZ7B 4L5GA 2WACA 2BZYA 1K9MR 3G1JA 3T9NA 4J9IA 1PKSA 1BBZA 3OB9A 1M2OA 5GMKl 4BE2A 3M4YA 5C6SA 2YSQA 2V26A 4N4GA 3KXTA 2CDTA 3CCUQ 1QVGA 1TG0A 3CQTA 3MKDA 1RACB 2DRKA 1Z9ZA 4F17A 4V2SA 2Y4YA 3OBYA 1FYNA 4OVAA 1LPLA 4M78F 1M8MA 3OS1A 3I55A 3V7SA 2F5TX 2RI3A 1I4K1 1AWWA 2CP0A 2HBWA 4QKUA 1UJ0A 1VQKT 3L42A 5CO7A 4RTYA 3M59A 2QA4A 4N0AA 1VYTA 3TEEA 4Y28E 5CAIA 4C92G 3NPFA 1K1ZA 3I9QA 3UT1A 1Q7YC 1WJSA 2QTVA 2HL5C 2NLUA 3EGUA 2X3WD 1NJIR 3OQ5A 1QVGS 3CCVT 4JJBA 4KBMB 1PD1A 2CS7A 2DRMA 4RKUE 3WXMB 1AZEA 5GANh 2L3RA 4X9DA 3EG0A 3JCMP 2J06A 3I56T 1UUEA 1VQLA 3VYGA 2GQIA 2K2MA 4Q5WA 1PSEA 3CMAT 3MP8A 2RJFA 4C8QD 3PMTA 2CUBA 4LDWA 2ZPFB 4O5VA 1VQ4A 3CCRA 4MZPA 2RQVA 4PFOA 5IT9E 4RTXA 2OTJT 1HK9A 1HXDA 1AWJA 2RM4A 3BDUA 5CCAA 4FSSA 4C0ZA 4M77A 4J6WA 4ORZA 4OGCA 2RI2A 2DIQA 3PIOA 1SKUB 1N8RR 2NUTB 1W2BA 2YWWA 2FVUA 1OPKA 2RHUA 4C0FA 2X35A 4NS5A 4VUBA 1BI0A 2HAXA 3CC4A 3REBB 3CBPA 1ZQ1A 2EKHA 3FJ5A 1OI1A 4J9CA 2J6FA 1VQNA 4N0AC 4GLMA 4M78D 2XD0A 3J81E 2R5AA 2E65A 2F2WA 1X6BA 2H3JA 3MO8A 1XOVA 2K5LA 1EFNA 5GAMg 4CC4B 2JT4A 2EJ9A 3CCJQ 5FU6B 2KROA 3V7CA 1QWEA 1PC0A 2KAFA 1WPYA 4DOWA 2E5KA 4R56A 1C1AA 4IIOA 3MEVA 1JB0E 2D0NA 2K5FA 4E7JA 3JB9H 3J80E 1WHMA 2QQRA 4PJJA 1Q82U 3JAME 2ROTA 3EHQA 4A54A 2FYKA 1UG1A 2XG8D 4JRKA 1KIKA 5KYNA 3OYAA 1Y96B 1ABQA 2QQSA 3MCAB 1TTHB 2P84A 3AHUA 1D1CA 4R0KA 4DBHA 2L2PA 3RKXA 4C5EA 4ELYC 1GCPA 2D8HA 1MUZA 2EQUA 1YHQQ 3LWHA 1UGPB 2M0YA 2DBMA 3EGDA 4ZTJA 2YRDA 3I55T 1RADB 4C8QG 2M0OA 4ME7A 3M54A 2GGRA 3VUZA 2QA4T 1OU8A 2EJFA 4BDYA 5GAMe 1WNLA 3QIIA 3PT9A 1F1BB 5FRMA 2W0ZA 4M77F 1K9AA 1LCKA 3FC3A 2DL5A 5M9OA 1WQ7A 4OB3B 2DILA 2ATCB 1Y07A 2YHTA 1YN8A 4F7UA 5D6XA 2O4XA 1IRXA 2K7AA 4Y91A 1X01A 2RJEA 4AG1C 3CC7Q 1MV3A 1I1JA 1V1CA 5FWCA 3CC7T 1QVFS 3RDVA 2DK3A 2ED1A 1SG5A 4EMKB 3DKMA 2CSIA 4ZGJB 3HKSA 4B6MA 5CKDA 2F2XA 4KGVB 4M78G 1VQ6A 2DAQA 1K8AU 1X43A 1VQLT 1KK7A 1QVGP 5FROA 3UA6A 5GANd 1H3HA 4LDYA 1SSHA 3CCSQ 3VS3A 1VQ4T 3CCRT 1N27A 4J6YA 1UHCA 3JCMV 5LJ3j 3OYJA 3OYLA 2DXBA 5FU6C 3QPHA 2HSPA 2CZ6B 3FIFA 2BUDA 3M58A 2L0AA 5LJ3h 2LNVA 2HDAA 1D1AA 2DTIA 5GMKm 1E6GA 2LNHB 1AEYA 1VYUA 3CC2Q 4D8DA 4KRTA 1JXOA 2GCXA 3IQLA 3H8ZA 4PK4A 1QP2A 5I2SA 1VQNT 1S72A 1GCQC 1MMNA 4GLKA 1ZSZA 3L2QA 1M1KR 2M51A 1SPKA 3TREA 3JCMh 1Q82R 4M77D 4OGEA 1EZZB 3S3NA 2XICA 1BKBA 1RAHB 4PJOB 1KD1R 2YRCA 1YJNQ 5GANe 1NG2A 1YI2A 1IHVA 2MF2A 1W70A 2JTFA 3JRZA 4XU2A 2K6DA 3UWNA 2VWFA 3C4SA 3QUIA 4BI8B 4A4KA 1HYOA 3CBOA 1M9SA 3EG9A 2OX7A 1W2BP 1D3BB 2QASA 2QXFA 1PG5B 1WQWA 2CKKA 1GBRA 2CT4A 2KE9A 1M3AA 4X9CA 2CGHA 5EG2A 4F7UF 4FL6A 1PHTA 2RN8A 1IREB 1VQOA 2YUPA 4HA8A 1E7OA 3EH2A 1NM7A 4FYYB 3NTHA 5LJ5h 2CSQA 1B3QA 1BI3A 4JJCA 4UC4A 2DL8A 2LX9A 2B86A 3CXCA 2V1QA 2X51A 2FRWA 3HPWA 4J9DA 1TUDA 4DEXA 2MAMA 4EMKC 3JCMX 3L2RA 4OMOA 5J39A 4LD9K 1A0NB 3A98A 3SWNB 2PNIA 3VS4A 2CP6A 1D3BA 4XTYA 2DMOA 1ZX6A 2GQVA 2JOYA 3CCMQ 4FIBA 2D1XA 4PJMA 4A53A 4JS5A 2JM9A 2KSSA 2IG0A 6AT1B 4LE9A 1J3TA 1ZUUA 1AOJA 1GFCA 1RABB 3RMSA 2ZAEA 2GBQA 2FRYA 2LTOA 1P92A 1VA7A 4M78B 3THKA 1AVZC 1WI7A 2D9TA 2KMTA 1BIAA 1WHLA 4ANJA 4RMOA 4HT9A 5GAN4 3QYHB 4AFZC 3M4GA 1TXQA 1WDXA 2NUPA 2XMFA 2HMAA 4A4FA 3AT1B 1X6OA 4LXCA 1K73C 4MZTA 4QT7A 2MMPA 3H9NA 1ZLMA 1KC8C 3LH0A 4HT8A 1YCSB 2BZ8A 1CSKA 1VQ7Q 4M77G 1BYMA 3FJPA 4MDXA 2JN0A 4IUQA 2JTEA 5A0LA 1PSFA 5IN1A 5HK3A 2XI9A 5FU7B 4L6V5 2KGTA 4RCBA 4PJOC 2JUFA 2L3PA 4IUVA 3EFOB 4KUIA 4XTZA 2EJGA 4J6XA 1NLPC 1SRLA 3I35A 4OMNA 1M8VA 2A7YA 2KI7A 3QDRB 5CK9A 1YJWA 2CZ1B 2JM8A 5J26A 5LJ3d 2C0IA 1Y71A 2CREA 3CCLA 2COYA 3E9FA 4KH0B 4OF1A 1S72T 1M90R 3MEAA 2HD0A 2JVVA 3WVEB 3HFNA 4IUUA 3OYCA 3QO3A 3A8LB 4RTWA 2CYZB 3M9QA 1K0SA 1KJWA 2O31A 4LDUA 5FWBA 3M55A 4E7HA 4MDWA 2RNAA 4MMLA 4ZTFA 5A0DA 5D6WA 1RAIB 5CVIA 3HRUA 1YI2T 1AT1B 3G71A 4C5GA 3JCMd 3OY9A 1N5ZA 2RF0A 3OYYA 3BDLA 4PJLA 5GJVB 3SWNC 5FLXE 2LT1A 2YUNA 4OB1B 2O01E 2EYQA 2AT1B 2X3XD 1VQ5Q 2YXYA 2L8DA 3EGXB 2K4YA 2E12A 2LCSA 1WA7A 1S1NA 3KFVA 1NZ9A 2ROLA 2FZGB 5ECAA 2DM1A 3G4SQ 1M2VA 2P0PA 2JTMA 2M1HA 1VQOT 3X24B 2P4TA 5LJ3e 3SFMA 3LGFA 4KGZB 5CQXA 1R8OB 3HRSA 2AKLA 4M78C 1H3ZA 3ER0A 1K76A 3CBMA 4LDVA 3A8HB 1Q86C 3O8VA 3FDRA 2PU9B 1VQ9A 3HTRA 4PLIA 4DEYA 2EQJA 4CC7A 4HXJA 3JCMQ 1UJYA 5LJ5d 3QBYA 4II1A 3ZBDA 3QWXX 4OMQA 2DBKA 3E19A 1O75A 2RK1A 2G6FX 3EGXA 4M7DE 2QAZA 3JCMe 4AMCA 4CC3A 3CPWA 1MNEA 3GP8A 1YIJA 4E47A 4NOYA 1I5OB 4BE1A 5FU7C 1QCFA 2BE9B 5GAOl 2XDPA 1VQKQ 4PJOD 2LDMA 1QKXA 2RHZA 2VASA 2WSEE 1SSFA 2KDSA 4F14A 1FX7A 1U1SA 1XJWB 1BU1A 2VB6A 4HCBA 1YHQA 2E41A 1R0BG 2ESWA 4PL6A 4FYXB 3C95A 4IUTA 3MHXA 4RTUA 1ZUYA 4M77B 3LGLA 3CCVQ 4J9FA 2PTKA 2A37A 3RKYA 2SRCA 3JCMW 3EFSA 2H3EB 1B07A 4XTUA 1NEBA 3CPWS 2OTLA 3CXCP 1H8KA 1IB8A 4FSXA 1UTIA 1NYFA 3RESA 5KCOA 3I56Q 3QJYA 1WX6A 5LJ5e 4Z8AA 3CCQA 3M53A 4BI3A 3FEOA 1QVPA 2JZ2A 3CD6A 5I22A 2EQMA 3CMAQ 1GL5A 4HCZA 5A2QE 1PNJA 1T0JA 3M0UA 3JB9J 2OTJQ 1T3SA 2AZSA 1YJWT 2KQWA 2D8JA 3J7AF 2HL3A 3OYNA 2A08A 3TQ7P 3G6EQ 1X27A 4EIKA 3G6ET 4R55A 1Q81C 5GMKj 2ZPIB 1KQ2A 1BI1A 4QVDA 4OMPA 3X26B 1Y0MA 1BCOA 2HKQB 2P4RA 3VJPA 8ATCB 1RUWA 1RLPC 3CCEQ 3CCET 4FYVB 4QQGA 3H0IA 2XKOC 5GAN3 3NGPA 3OSSC 3V7RA 4DOVA 4XK8E 3G71T 2NUZA 5C0MA 1XTDA 1ZUKA 2C0OA 1VQ8A 4DBFA 1JJ2P 3RKWA 3QYGB 1QP3A 2L3SA 3OYMA 1W2BS 3QHSA 2DFUA 4OB0B 8AT1B 1K73U 2FO0A 2ENMA 5J3BA 2KYMA 3HL8A 4PFZA 1KC8U 4O6JA 2DZCA 4M4ZA 3EGDB 3ME9A 3GIBA 1K9MC 2DYIA 5KYXA 1RAEB 4PJOG 2J6KA 1LVKA 1MV0B 1M3BA 1OPLA 2MCNA 5IHIA 2LT4A 1JBMA 5GAMf 3X20B 1LOJA 2MYSA 1BIBA 3KUFA 4BUGA 1B34A 4IURA 4QQDA 1GXIE 1VIEA 4FU6A 1WIEA 4M77C 4F7UB 1JO8A 4Y92A 2O4XB 4RTZA 2QEXA 4JJNK 3V8LA 1FMKA 2GTOA 4C5HA 5KE3A 3HFOA 1PKTA 3L1AA 3CMEA 4A63B 2RQWA
chains in the Genus database with same CATH topology
4E7IA 4E7KA 1G3WA 1YI2A 1MGQA 2MF2A 2ZCFB 4NL2A 2JTFA 1UGRB 3JRZA 3P8DA 1M1GA 2RHIA 3OYFA 4XU2A 2PVOB 3GNFB 2VV5A 3INZA 1VQMT 1YITT 1LNXA 4HCCA 2OTJA 1WJQA 3UWNA 3X28B 3C4SA 3F70A 1UGQB 3QUIA 4J83A 5LJ3f 4BI8B 4A4KA 1VIFA 2WSCE 1YIJT 4C92D 3BFMA 2D6FA 5L8RE 1FWZA 2QQ9A 3CBOA 1M9SA 1NJIC 5GAN5 5GANj 2MWPA 1D3BB 2F5KA 4BY6C 4RG8A 3G6EA 3HRTA 2DPPB 2VGNA 3CC7A 3OSVA 2PQWA 1OYXA 3ASKA 5DM7R 3RERA 2QXFA 5I2MA 1WQWA 2CKKA 2EQKA 1M90C 2FB7A 5DY9A 3SB2A 4EPCA 1FXXA 3S3OA 4X9CA 1RI0A 2CGHA 1NE8A 5EG2A 3SD4A 4F7UF 4E7LA 4ELZC 1KG1A 4FL6A 5GAN8 1KHIA 2WSFE 5GAOr 4PJOF 2C06A 2LCCA 3QZ5B 1IREB 3QG1A 1VQOA 3OYBA 4HA8A 3OYIA 4M75A 2HNIA 2YLCA 4QQ6A 3UPUA 3NTHA 3CCEA 1YBYA 5LJ5h 1VQPT 4PKCC 4X34A 3CCLT 5CQYA 4OP0A 1BI3A 4C0DB 4OMFB 4RCCA 4C8QC 4UC4A 3V8JA 1YJ9A 2OTLT 5CR2A 2R5MA 3JCMf 2LX9A 4BE0A 4LDXA 1UGSB 3CCSA 3CXCA 3DLMA 3QXEB 5HY6A 4C8QE 4EMHA 3OYGA 4HKEA 1N8RU 3HPWA 4M7AG 1N9SA 5GANg 5GMKh 3NTIA 2MAMA 4XTXA 3EFRA 2HQEA 4EMKC 3LLRA 3WVDB 4XQ3A 3JCMX 3HSBA 3L2RA 3FRNA 5J39A 4LD9K 3CCQT 2PVGB 3SWNB 1QW1A 2RD1A 3MEUA 2B8AA 3NTKA 2E70A 2V8IA 2DXTA 1LJOA 3MP6A 1D3BA 4GY5A 4P5NA 3TU4K 4JLGA 4XTYA 3CD6T 3JB9I 3C12A 2GQVA 2JOYA 3DLLA 2RB6A 1VQ5T 5GAN6 3UDCA 1B34B 4FIBA 1N8RC 2KY9A 2ZPEB 4A53A 1JRIA 4JS5A 3R6OA 2FHDA 1Q86U 2Y90A 2KSSA 2IG0A 2VXFA 4XU1A 2DJZA 1KHCA 2L5QA 3CC2A 2K3YA 3G4ST 3RIRA 3VUBA 1K8AC 3RMSA 2VUBA 4C92A 3OS2A 4M7DG 1UB4A 4M7AB 3M5AA 1U8RA 2LTOA 4C8QF 3GLXA 5GANf 5CKFA 1P92A 4KUDK 1VUBA 2DD4A 3P8BB 3PMIA 4M78B 4JUVA 5GAOn 2D9TA 2KMTA 4IUPA 2CZ7B 4L5GA 1BIAA 2XDDA 2WACA 4M78E 2I2LA 2RA2A 4RMOA 4HT9A 5GAN4 3QYHB 5CKEA 4XAXB 3M4GA 3T9NA 1G3SA 4A4FA 3OB9A 1X6OA 3CC4T 5HK0A 5GMKl 4BE2A 3M4YA 4A4GA 5C6SA 4XTVA 1K73C 4MZTA 4Z02A 2E6NA 4JRQA 3CCJT 4N4GA 3KXTA 2MMPA 1KC8C 1AHJB 4M7DB 4QVZA 1YJNA 1QVGA 3LH0A 5GAN2 5GAMd 4HT8A 3RMQA 1BYMA 4M77G 1VQ9T 1YITA 1VQMA 4JDSA 5GAOm 4ZN3A 3FJPA 4V2SA 2Y4YA 3OBYA 4MDXA 2XIDA 2JN0A 3FB9A 4IUQA 1G3TA 1RL2A 2RHYA 1PSFA 4OVAA 5CKBA 5A0LA 2RK2A 1Q7YU 5IN1A 2EFIA 1M1KU 1VQ8T 5HK3A 4M75C 4BD3A 2XI9A 4M78F 3OS1A 5FU7B 2PVDB 2M16A 4L6V5 3I55A 4M7AA 2RI5A 2F5TX 4RCBA 2RI3A 3V7SA 1I4K1 4PJOC 2JUFA 4IUVA 4M75E 1VQKT 3L42A 5CO7A 1UEBA 1G3YA 1M4ZA 3M59A 4KUIA 4N0AA 2EJGA 1I81A 4MMKA 4XTZA 3TEEA 2DD5A 2VGMA 4Y28E 2E1HA 4WF2A 2DTOA 3OYDA 3OW2A 1KD1U 2YLBA 5CAIA 4J6XA 4C92G 1I8FA 3CEYA 3UT1A 1Q7YC 1WJSA 3OMCA 2ZPBB 2A7YA 3QDRB 1M8VA 2NLUA 4QW2A 2LRQA 5CK9A 3JB9F 4CI0C 2LVMA 3OBWA 2CZ1B 1YJWA 4A4HA 5J26A 3OQ5A 5LJ3d 1QVGS 3H6ZA 3CCVT 1Y71A 2DKGA 4RG2A 1YCYA 3GNGA 2DZ9A 3RUXA 1VQPA 3OS5A 4KBMB 2X4JA 3CCLA 2CS7A 3E9FA 4M7DA 4OF1A 1S72T 4RKUE 3WXMB 5GANh 3P8HA 1YHQT 1IZ6A 4FM4B 4XU3A 3MEAA 2HD0A 2K3XA 2JVVA 3G7ZA 2L3RA 3L2ZA 4M75F 3WVEB 3HFNA 4X9DA 2L89A 4IUUA 3OYCA 3JCMP 1QVFA 4QVCA 3QO3A 3A8LB 3FLGA 3A8MB 3I56T 4C92B 2CYZB 3M9QA 4PJOE 1ZHIA 4JLIA 4BACA 4BB7A 1VQLA 3VYGA 2QEXT 4LDUA 2BKDN 3M55A 4Q5WA 4E7HA 4MDWA 2PUOB 4C0DC 1PSEA 4KT0E 1VQ5A 3CMAT 5KE2A 3MP8A 4MMLA 3CMET 2RJFA 2GF7A 4C8QD 4ZTFA 3QKJA 5A0DA 1TH7A 5D6WA 3CCMA 3PMTA 5CVIA 3HRUA 4O5VA 4LDWA 2LQKA 2ZPFB 3G71A 1VQ4A 1YI2T 4C5GA 3CCRA 4JS4A 1Q81U 4MZPA 3JCMd 1XNIA 5IT9E 3OY9A 2OTJT 1HK9A 1HXDA 2RH2A 3G4SA 2RM4A 2ZZDA 3BDUA 5GAOq 1Y96A 2DTHA 5CCAA 4C0ZA 2KVQG 2EWNA 4M77A 3OYYA 3N5BB 3BDLA 2X4XA 4J6WA 3JCMb 3SWNC 5FLXE 4OGCA 5GAN7 2RI2A 2DIQA 2LT1A 4PLLA 3PIOA 3PGGA 4OB1B 2O01E 2EYQA 2QDYB 1W2BA 3MEWA 2L8DA 5KH6A 3HP9A 2MWOA 2K4YA 2E12A 2FVUA 2FL7A 4C92F 2AHJB 3OYKA 1KQSA 1NZ9A 2RHUA 4YTLA 4C0FA 2X35A 4NS5A 4VUBA 4ZGEB 4N4IA 1BI0A 2HAXA 3CC4A 3CPFA 3KBGA 2P0PA 2JTMA 2M1HA 3VU3C 3CBPA 2P4TA 3X24B 1VQOT 1ZQ1A 5LJ3e 2BIVA 3OA6A 3SFMA 4M7AC 3LGFA 1OI1A 5CQXA 4J7IA 1R8OB 3CXCS 3HRSA 4N0AC 1VQNA 4M7AE 2RHXA 4M78C 4M78D 2XD0A 1H3ZA 3ER0A 3CCUA 3JCMJ 3CBMA 1ZBXA 4LDVA 3A8HB 3J81E 2R5AA 3FDRA 2E65A 3O8VA 2PU9B 5LL6S 1YJ9T 1Q86C 3A8GB 4JRPA 5I21A 4DA4A 4PLIA 3S3MA 1VQ9A 2EQJA 3BY7A 3CCST 1VQ7A 2H3JA 3MO8A 1XOVA 2XDBA 1N9RA 3OS0A 2K5LA 1XQHA 5GAMg 3JCMQ 1K9MU 4EDUA 1NPPA 1NPRA 3BW1A 2KK4A 5LJ5d 2EJ9A 3VV0A 3S6WA 1WGSA 3C94A 2DIGA 3QBYA 4II1A 5FU6B 3V7CA 3ZFJA 1VQ6T 3ZBDA 2DO3A 1VQKA 3JB9D 4M7DC 2F69A 2KAFA 1KQSS 3E19A 1WPYA 1O75A 2E6ZA 2RK1A 4DOWA 2HBPA 2ZPGB 4M7DE 1OZ3A 3M56A 3ZEHA 2LC4A 4R56A 3JCMe 4M7AF 3CPWA 3MEVA 3A5ZB 1N6AA 2D0QB 5A0GA 3GP8A 1JB0E 4EMKA 2HQXA 5GMKi 1YIJA 2DXUA 3CC2T 4E47A 4NOYA 3TCJA 2K5FA 4E7JA 4BE1A 4M75D 3CCVA 1JJ2A 5FU7C 3JCMc 3J80E 2QQRA 3JB9H 5GAOl 2XDPA 4PJOD 2LDMA 2RHZA 1Q82U 2QA4A 2WSEE 2G3RA 1SSFA 2KDSA 4BI4A 1FX7A 1U1SA 3DB4A 5DLOA 5LJ3g 3JAME 3L2VA 4HCBA 4A54A 2FYKA 2E41A 1YHQA 2XG8D 3M57A 4PL6A 2MI6A 3PFSA 4JRKA 3C95A 4IUTA 3MHXA 5FRNA 1Y7XA 4XU0A 1M1KC 4FT2A 3E9GA 3OYAA 1Y96B 2QQSA 3EAEA 3MCAB 4M77B 3JSCA 3LGLA 2RO0A 3AHUA 4M7DF 3L2UA 3RKYA 3JCMW 1Q82C 3EFSA 4M77E 2EAYA 3RKXA 4B9XA 4IKFA 2VC8A 4C5EA 4XTUA 1NJIU 4ELYC 1H641 4C0GA 1KD1C 3CPWS 2OTLA 2EQUA 1YJNT 2E5QA 3LWHA 1UGPB 2RJDA 4ZN1A 4FSXA 1JJ2S 3E1SA 3RESA 2VXEA 2ZPHB 1M90U 5KCOA 4LD6A 4ZTJA 2A3LA 2K5IA 3QJYA 1EIFA 5CKHA 4C92C 3V8KA 5LJ5e 3CCQA 4KULA 3JCMg 3M53A 3I55T 4BI3A 4C8QG 3FEOA 3LW5E 2M0OA 4ME7A 1QVPA 2JZ2A 1M1FA 3M54A 4C92E 3LYIA 3OW2S 3CD6A 2EQMA 4BY6B 3VUZA 4HCZA 2QA4T 2X4YA 2EJFA 5A2QE 4BDYA 5GAMe 1WNLA 3QIIA 3PT9A 3Q1JA 5GMKe 3GPLA 5FRMA 1M5Q1 4M77F 3X25B 2VYTA 4L59A 3FC3A 3JB9J 2EIFA 2XU8A 2M9UA 2XK0A 5M9OA 1WQ7A 4OB3B 5LJ5j 2E10A 2V8KA 3QZ9B 2YHTA 1Y07A 1YJWT 4F7UA 2KQWA 3QSUA 2GFAA 5D6XA 2O4XA 3J7AF 1MHNA 5AYFA 4B9WA 3OMGA 1BI2A 3OYNA 4PJOA 4NL3A 1OZ2A 4Y91A 1X01A 2RJEA 5GAMj 2IVWA 4EMGA 4R55A 3OYEA 3L2WA 3G6ET 4C8QB 5GMKj 2ZPIB 1Q81C 3CC7T 1KQ2A 1BI1A 1QVFS 4QVDA 4FT4A 5GAMh 4C5IA 2DK3A 3QJ6A 3META 3X26B 4EMKB 3DKMA 2EKOA 4ZGJB 3PIPA 3HKSA 2QQBA 5CKDA 4M78G 5HKCA 3VJPA 2QI2A 2Y4XA 4M7AD 1VQ6A 2DAQA 2DVEA 3CCJA 1K8AU 1VQLT 3CCET 3SDZA 2XHCA 2RJCA 5FROA 4QQGA 1U1TA 5GANd 2XKOC 4CRIA 5LJ5g 5GAN3 4LDYA 3OSSC 3V7RA 3CCMT 2DEQA 4DOVA 3MP1A 4XK8E 4PNOA 3G71T 5C0MA 1VQ4T 1XTDA 2V8JA 3CCRT 3PNWC 3PTAA 1N27A 4J6YA 4DQ2A 1VQ8A 1WJRA 3JCMV 3JB9G 3RKWA 5LJ3j 5GAOp 1O9SA 1QP3A 3QYGB 3OYLA 3OYJA 1I5LA 5D6YA 2DXBA 3OYMA 2CZ0B 2DXCA 1W2BS 5FU6C 3QPHA 2CZ6B 3QHSA 3FIFA 2BUDA 3M58A 4OB0B 1K73U 4JRIA 5LJ3h 3VKIA 2LNVA 5J3BA 4XTWA 3URGA 3HL8A 3VYHB 4ZGDB 2DTIA 3GOXA 2P0KA 4M7DD 2X4WA 1KC8U 2YRVA 4O6JA 4C8QA 2QTXA 4J7FA 5GMKm 2DZCA 3HHTB 2OAUA 2JNGA 3ME9A 4F7UG 4M75G 3GIBA 1K9MC 5CIUA 3LWIA 2LQ8A 2K57A 3LX7A 1KQ1A 4J8OA 4PJOG 4A4EA 5LJ5f 5DLQE 4BDZA 4MZMA 1DJ7B 2ZGWA 2LT4A 2GCXA 3SWNA 1W4SA 1JBMA 3H8ZA 4D6WA 5GAMf 3X20B 1QP2A 1V29B 5I2SA 2PUKB 5IAYA 3OYHA 1LOJA 1S72A 1VQNT 1BIBA 2LCLA 3KUFA 4BUGA 3CCUT 2R58A 4J5YA 1B34A 2R57A 4IURA 4GLKA 3L2QA 4QQDA 4OB2B 1VQ7T 3TREA 2QQAA 5KCHA 4N4HA 1GXIE 1VIEA 4TVRA 4FU6A 1G5VA 3JCMh 3I56A 2K2VA 3DB3A 4M77C 4M77D 3A8OB 3GF5A 1X75C 4OGEA 4F7UB 4M75B 2GFUA 3S3NA 2O4XB 2XICA 1BKBA 2QEXA 4JJNK 4ATOA 3V8LA 4C5HA 4PJOB 2P0QA 2E64A 4F7UE 3HFOA 5KE3A 3L1AA 3CMAA 5GANe 4M78A 3CMEA 3NFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 J;  3VU3 C;  1MGQ A;  5LJ3 e;  4M7A C;  4NL2 A;  1WQ7 A;  4M7D B;  5LJ5 j;  2E10 A;  4XU2 A;  5GAN 2;  2YHT A;  3INZ A;  5GAM d;  4HT8 A;  1LNX A;  4F7U A;  4M7A E;  4N0A C;  4M78 C;  4M78 D;  3QSU A;  4M77 G;  5LJ3 f;  3QUI A;  3JCM J;  4EMK B;  4PJO A;  2E65 A;  4C92 D;  3BFM A;  5GAO m;  3FJP A;  4NL3 A;  4V2S A;  5I21 A;  2JN0 A;  3FB9 A;  1X01 A;  4Y91 A;  3BY7 A;  5GAM j;  4EMG A;  5GAN 5;  4C8Q B;  5GMK j;  5GAN j;  1KQ2 A;  4M75 C;  1N9R A;  4M78 F;  1D3B B;  4QVD A;  4M7A A;  3V7S A;  4RCB A;  5GAM g;  3JCM Q;  1I4K 1;  5GAM h;  3RER A;  4PJO C;  3BW1 A;  4M75 E;  5LJ5 d;  2EJ9 A;  1WQW A;  4N0A A;  2FB7 A;  2EJG A;  1I81 A;  4MMK A;  4XTZ A;  5DY9 A;  3SB2 A;  3V7C A;  4X9C A;  2CGH A;  2E1H A;  4F7U F;  4WF2 A;  2DTO A;  3JB9 D;  4M78 G;  5GAN 8;  2YLB A;  5CAI A;  4M7D C;  4M7A D;  5GAO r;  2DVE A;  4J6X A;  4PJO F;  4C92 G;  1WPY A;  1I8F A;  4HA8 A;  1M8V A;  4M75 A;  4M7D E;  1U1T A;  2HNI A;  5GAN d;  2YLC A;  5LJ5 g;  5GAN 3;  3JB9 F;  3JCM e;  5LJ5 h;  4M7A F;  3V7R A;  5LJ3 d;  2DEQ A;  2DKG A;  4OP0 A;  1YCY A;  4PNO A;  2DZ9 A;  3RUX A;  4RCC A;  4EMK A;  2DXU A;  5GMK i;  4C8Q C;  4NOY A;  3V8J A;  3JB9 H;  4J6Y A;  4M75 D;  3JCM f;  3JCM c;  4DQ2 A;  4M7D A;  3JCM V;  3JB9 G;  5GAO l;  3RKW A;  4C8Q E;  4EMH A;  5LJ3 j;  5GAO p;  1I5L A;  4PJO D;  4M7A G;  1N9S A;  5GAN g;  5GMK h;  5GAN h;  4XTX A;  3EFR A;  4XU3 A;  4EMK C;  3JCM X;  3HSB A;  4XQ3 A;  3QHS A;  1U1S A;  3FIF A;  3L2Z A;  4M75 F;  5LJ3 g;  4JRI A;  3HFN A;  2FYK A;  2E41 A;  4X9D A;  5LJ3 h;  4A54 A;  4XTW A;  3JCM P;  4M7D D;  4QVC A;  2DTI A;  3QO3 A;  4JRK A;  3SWN B;  2RD1 A;  4C8Q A;  4C92 B;  4XU0 A;  2QTX A;  2DXT A;  1LJO A;  2DZC A;  1D3B A;  5GMK m;  4JLI A;  4XTY A;  1Y96 B;  3JB9 I;  4F7U G;  2RB6 A;  4M75 G;  4M77 B;  5GAN 6;  3GIB A;  3AHU A;  4M7D F;  1B34 B;  3RKY A;  4A53 A;  1JRI A;  2K57 A;  1KQ1 A;  3EFS A;  4PJO G;  5LJ5 f;  2Y90 A;  3JCM W;  4M77 E;  4MML A;  2EAY A;  4C8Q D;  3RKX A;  2VXF A;  4XU1 A;  1TH7 A;  2VC8 A;  2DJZ A;  4XTU A;  1H64 1;  2ZGW A;  3SWN A;  3RIR A;  3JCM d;  1JBM A;  4C92 A;  4M7D G;  5GAM f;  1HK9 A;  1HXD A;  4M7A B;  2RM4 A;  1LOJ A;  3BDU A;  4C8Q F;  1Y96 A;  2DTH A;  1BIB A;  5GAN f;  5GAO q;  2EWN A;  4M77 A;  3RES A;  2VXE A;  4J5Y A;  1B34 A;  4J6W A;  4M78 B;  4JUV A;  3SWN C;  3JCM b;  5GAO n;  5GAN 7;  4C92 C;  1BIA A;  3PGG A;  3V8K A;  5LJ5 e;  4M78 E;  2I2L A;  2RA2 A;  3JCM g;  4C8Q G;  3JCM h;  4HT9 A;  4M77 C;  4M77 D;  4C92 E;  5GAN 4;  4F7U B;  4M75 B;  3M4G A;  4C92 F;  3V8L A;  2EJF A;  4PJO B;  4F7U E;  2E64 A;  5GAM e;  3HFO A;  5GMK l;  1WNL A;  3L1A A;  4XTV A;  5GMK e;  5GAN e;  1M5Q 1;  4M78 A;  4M77 F;  4PJO E; 
#chains in the Genus database with same CATH topology
 4E7I A;  4E7K A;  1G3W A;  1K4U S;  1UGR B;  2E3I A;  2PVO B;  1PD0 A;  4HCC A;  3X28 B;  3BE3 A;  1VIF A;  1YIJ T;  2KRN A;  3I55 Q;  5L8R E;  2KR3 A;  1FWZ A;  2QQ9 A;  2CH4 A;  1NJI C;  5GAN 5;  2QA4 Q;  2MWP A;  1OX8 A;  2HZY A;  5AT1 B;  1RAF B;  1HD3 A;  2VGN A;  2YUQ A;  1MMA A;  5FW9 A;  2EQK A;  2EGA A;  4E2F B;  1NE8 A;  4E7L A;  2KBT A;  5GAN 8;  4AFS C;  2AKK A;  3OYI A;  2YLC A;  3UPU A;  2FPD A;  1YJ9 A;  3V8J A;  2OTL T;  5CR2 A;  4LDX A;  5HY6 A;  4EMH A;  3OYG A;  3LH5 A;  5I11 A;  5GAN g;  2KT1 A;  3NTI A;  2HQE A;  3HSB A;  3WVD B;  3FRN A;  3QDF A;  3CCQ T;  1VQL Q;  2PVG B;  1QW1 A;  2RD1 A;  1MMD A;  2QGG A;  3CD6 T;  1LJO A;  4GY5 A;  2JW4 A;  1N8R C;  2KY9 A;  4AFQ C;  1ZSZ B;  1JRI A;  1VQ4 Q;  3CCR Q;  1Q86 U;  2Y90 A;  3CPW P;  2ED0 A;  3NHN A;  1KHC A;  2L5Q A;  1D0X A;  1E6H A;  2VUB A;  2FEI A;  4C92 A;  1UB4 A;  3M0Q A;  2DNU A;  5GAN f;  5CKF A;  3EG2 A;  1VUB A;  2KXC A;  2DA9 A;  1BB9 A;  2XDD A;  2I2L A;  2RA2 A;  5CKE A;  4XAX B;  3CC4 Q;  2QDL A;  1G3S A;  3CC4 T;  5HK0 A;  2RQT A;  4A4G A;  4XTV A;  4Z02 A;  4J9E A;  3EH1 A;  1PRL C;  1OV3 A;  3EG9 B;  1VQN Q;  1PCX A;  2RQR A;  1AHJ B;  4M7D B;  4QVZ A;  2RMO A;  5GAN 2;  4HCK A;  2GNC A;  2DF6 A;  1YIT A;  1VQM A;  4JDS A;  1JEG A;  1IGU A;  4ESR A;  5GAO m;  4ZN3 A;  2XID A;  3FB9 A;  5CKB A;  1VQ8 T;  1Q7Y U;  1KFZ A;  4BD3 A;  1UFF A;  5IHN A;  4M75 E;  2HEQ A;  1UEB A;  4MMK A;  2DD5 A;  2VGM A;  2E1H A;  3OW2 A;  2YLB A;  1I8F A;  3CEY A;  1FMV A;  3OMC A;  1NLO C;  3OBW A;  4A4H A;  2DKG A;  1YCY A;  3GNG A;  1BCM A;  3RUX A;  1Q95 G;  4DBQ A;  1VQP A;  3OS5 A;  3EG1 A;  3PVQ A;  4M7D A;  2RQU A;  1IZ6 A;  2VVK A;  2K3X A;  3VS2 A;  2L89 A;  2NWM A;  3A8M B;  1SHG A;  4JLI A;  4BB7 A;  3MJX A;  2QEX T;  1PM3 A;  2PUO B;  2EVR A;  1VQ5 A;  5KE2 A;  3CME T;  1TH7 A;  2LQK A;  1Q81 U;  4JS4 A;  5KYU A;  2FZC B;  1XNI A;  2JMC A;  2O2O A;  2NUP B;  2RH2 A;  3G4S A;  2CP3 A;  5GJW B;  1JQQ A;  2DX1 A;  3JCM b;  2L3Q A;  5GAN 7;  4PLL A;  1X2Q A;  2YDL A;  2QDY B;  1D1B A;  3MEW A;  5KH6 A;  3HP9 A;  1ZSZ C;  1QQJ A;  5IXF A;  2FL7 A;  4C92 F;  2AHJ B;  3OYK A;  1KQS A;  1AZG B;  1K8A R;  1YP5 A;  4N4I A;  1D0Z A;  3KBG A;  3OA6 A;  1UDL A;  4K11 A;  2DLP A;  3CXC S;  1OU9 A;  1Q86 R;  4M7A E;  2M02 A;  3CCU A;  3JCM J;  1ZBX A;  1NYG A;  1YJ9 T;  5I21 A;  3S3M A;  3BY7 A;  1WHH A;  2XDB A;  1N9R A;  1OX9 A;  1XQH A;  1K9M U;  1NPP A;  1NPR A;  2F2V A;  3VV0 A;  3S6W A;  3C94 A;  2DIG A;  1VQ6 T;  1VQK A;  4E7Z A;  1RLQ C;  2F69 A;  3EHR A;  4M7D C;  1KQS S;  1WXB A;  3MPU B;  2E6Z A;  1TOV A;  2HBP A;  2Z0W A;  2ZPG B;  1OZ3 A;  3M56 A;  3ZEH A;  1U3O A;  2LC4 A;  1N6A A;  1W1F A;  2D0Q B;  3VRY A;  2DXU A;  2EYX A;  1ZSG A;  3CCV A;  1EX4 A;  1JJ2 A;  3JCM c;  1WXU A;  2MPX C;  3TVT A;  2G3R A;  4BI4 A;  5LJ3 g;  1ZBJ A;  3M57 A;  2MI6 A;  3PFS A;  1Q7Y R;  4KH1 B;  1M1K C;  2LJ3 A;  4FT2 A;  4Z88 A;  2LJ0 A;  4RUG A;  4M7D F;  1Q82 C;  4HVU A;  4B9X A;  4IKF A;  2VC8 A;  1WHJ A;  1S72 Q;  1NJI U;  1D09 B;  1H64 1;  1KD1 C;  3UAT A;  2CUD A;  2HCK A;  2E5Q A;  1WHG A;  3I5S A;  1JJ2 S;  2VXE A;  2ZPH B;  2E4H A;  1M2V B;  1UE9 A;  1EIF A;  5CKH A;  3H0F A;  5D7U A;  4KUL A;  3JCM g;  1YWP A;  2PZ1 A;  3LW5 E;  4AT1 B;  4C92 E;  1M1F A;  1V76 A;  2QG9 B;  2X4Y A;  1YI2 Q;  4Z89 A;  1G83 A;  3GPL A;  3X25 B;  4L59 A;  2EIF A;  2XU8 A;  5KYY A;  3QZ9 B;  3QSU A;  4B9W A;  3OMG A;  1BI2 A;  2A36 A;  1Q81 R;  4NL3 A;  5GAM j;  3OYE A;  4HVV A;  2MOX A;  1TU0 B;  5GAM h;  3QJ6 A;  1U5S A;  1VOM A;  1VQO Q;  2DE0 X;  2V1R A;  1CKB A;  5HKC A;  2QI2 A;  2Y4X A;  2KRS A;  2DVE A;  3CCJ A;  2O9S A;  1WXT A;  2XHC A;  2RJC A;  4ZNX A;  4CRI A;  5LJ5 g;  2HSE B;  3TSZ A;  2DEQ A;  2V8J A;  3UA7 A;  3PNW C;  3VS1 A;  3PTA A;  1TUC A;  4DQ2 A;  1IO6 A;  1WJR A;  1QCO A;  1O9S A;  1I5L A;  1B7T A;  1MND A;  2DXC A;  4JRI A;  3VKI A;  2W10 A;  3I5R A;  4XTW A;  1G2B A;  4JPB W;  4M7D D;  2X4W A;  3OW2 P;  5HCK A;  2SEM A;  1JXM A;  2KXD A;  3O5Z A;  4FYW B;  4PFP A;  4F7U G;  1PRM C;  1ARK A;  5CIU A;  2K57 A;  4J8O A;  1KQ1 A;  4A4E A;  5IXB A;  5LJ5 f;  5DLQ E;  1SRM A;  4MZM A;  2EPD A;  2J05 A;  2ZGW A;  1W4S A;  1GRI A;  4D6W A;  5IAY A;  1YWO A;  3M0R A;  3CCU T;  3H41 A;  2R58 A;  4WTO B;  2R57 A;  2EW3 A;  1PWT A;  4OB2 B;  2YT6 A;  2DEU A;  2YUO A;  3NMZ C;  4TVR A;  1BK2 A;  2K2V A;  3GF5 A;  1X75 C;  4M75 B;  4JJD A;  2JS2 A;  4ATO A;  4LUD A;  2EGE A;  4OMM A;  3NFC A;  4PJO E;  2ZCF B;  1QLY A;  1M1G A;  3OYF A;  2JXB A;  2JMA A;  3GNF B;  2VV5 A;  2ECZ A;  3INZ A;  1UHF A;  3F70 A;  1UGQ B;  2D6F A;  4JZ4 A;  5GAN j;  2F5K A;  3CC7 A;  3RER A;  1OYX A;  5DM7 R;  2LMJ A;  4PJN A;  5I2M A;  1WLP B;  1M90 C;  1KQS P;  5DY9 A;  3S3O A;  2WSF E;  1RAG B;  1YJW Q;  3QZ5 B;  2C06 A;  2K3B A;  4M75 A;  2E3H A;  2HNI A;  2LQN A;  4QQ6 A;  1WFW A;  3CCL Q;  1YBY A;  4X34 A;  3CCL T;  4OP0 A;  4C0D B;  2KT8 A;  1U06 A;  4RCC A;  2O88 A;  1UGS B;  3CCS A;  3DLM A;  4C8Q E;  1C0M A;  1N9S A;  5GMK h;  5KYX B;  3EFR A;  2AK5 A;  3LLR A;  4XQ3 A;  1YFN A;  2OI3 A;  3R6N A;  3M0P A;  2MK5 A;  1IXD A;  3MEU A;  2B8A A;  3NTK A;  2E70 A;  3TU4 K;  4JLG A;  3JB9 I;  3C12 A;  2RB6 A;  3UDC A;  1B34 B;  2ZPE B;  3G71 Q;  1AWX A;  1M30 A;  2FHD A;  3R6O A;  2VXF A;  4XU1 A;  3VS7 A;  2DJZ A;  4E6R A;  1ZA2 B;  3CC2 A;  2K3Y A;  2RPN A;  3RIR A;  3VUB A;  4LNP A;  3ULR B;  4M7D G;  4M7A B;  3M5A A;  1U8R A;  3GLX A;  4D8K A;  1RI9 A;  4JUV A;  4M78 E;  1NBE B;  1TWB A;  3REA B;  1QWF A;  2LJ1 A;  3M0S A;  2E6N A;  4WCI A;  4JRQ A;  3CCJ T;  2DL7 A;  4AG2 C;  2NUT A;  1YJN A;  2AIR B;  5GAM d;  1NEG A;  1VQ9 Q;  3RMQ A;  1VQ9 T;  1K0X A;  1G3T A;  1RL2 A;  2RHY A;  2KRM A;  1M1K U;  2RK2 A;  9ATC B;  2EFI A;  2X9H A;  4M75 C;  2PVD B;  2M16 A;  4M7A A;  2RI5 A;  1OUL A;  3RNJ A;  1G3Y A;  1M4Z A;  5A0G A;  1I81 A;  4WF2 A;  2DTO A;  3OYD A;  1HJD A;  1KD1 U;  1QMC A;  2LX7 A;  2ZPB B;  1YIJ Q;  4QW2 A;  2LRQ A;  3JB9 F;  4CI0 C;  2LVM A;  1M27 C;  2BTT A;  3H6Z A;  4RG2 A;  1GBQ A;  4E7S A;  2DZ9 A;  1TS9 A;  2EYW A;  2KEA A;  2X4J A;  3RR6 A;  3PVL A;  2LZ6 B;  4F16 A;  2NYS A;  3P8H A;  1YHQ T;  4FM4 B;  4XU3 A;  1AD5 A;  3G7Z A;  2DL4 A;  2LP5 A;  3L2Z A;  4M75 F;  1QVF A;  4QVC A;  1OOT A;  3FLG A;  3PE0 A;  1AWO A;  4C92 B;  2EQI A;  3SHW A;  3VS6 A;  1ZHI A;  4J9H A;  4BAC A;  2BKD N;  5EC7 A;  4C0D C;  4KT0 E;  2OTL Q;  1X69 A;  1GCQ A;  2GF7 A;  3QKJ A;  3CCM A;  2DYB A;  2ZZD A;  5GAO q;  1Y96 A;  2DTH A;  7AT1 B;  2KVQ G;  2EWN A;  3CCQ Q;  3N5B B;  2HKN A;  2KYB A;  2X4X A;  3A1P A;  1T0H A;  3CD6 Q;  3PGG A;  1R77 A;  1CKA A;  1TUG B;  2MWO A;  3SEM A;  1X2K A;  4KGX B;  2QGF B;  2DJQ A;  4YTL A;  2EYZ A;  4ZGE B;  1M3C A;  4GBQ A;  3CPF A;  2QK0 A;  4CC2 A;  3VU3 C;  1ZA1 B;  2BIV A;  4M7A C;  2CP5 A;  4J7I A;  2RHX A;  2JS0 A;  2FPF A;  5LL6 S;  3A8G B;  4JRP A;  4DA4 A;  3CCS T;  1VQ7 A;  2DVJ A;  5IHK A;  3OS0 A;  1R0C B;  1MMG A;  4RTV A;  1K73 R;  4EDU A;  1H92 A;  3BW1 A;  2KK4 A;  1WGS A;  1KC8 R;  3ZFJ A;  2DO3 A;  3JB9 D;  1QKW A;  1ACM B;  2DET A;  4M7A F;  4DBR A;  2EBP A;  1VQ8 Q;  3A5Z B;  2A28 A;  4EMK A;  2HQX A;  5GMK i;  3CC2 T;  3TCJ A;  4M75 D;  4FW1 A;  1HSQ A;  2DER A;  1UGV A;  3GBQ A;  3L2V A;  3DB4 A;  5DLO A;  2KNB B;  5KYU B;  5FRN A;  1Y7X A;  2BZX A;  2J6O A;  4XU0 A;  1UEC A;  2DL3 A;  1YNZ A;  3E9G A;  4LN2 A;  3EAE A;  3JSC A;  2RO0 A;  2EGC A;  4FW2 A;  2LQW A;  3L2U A;  4M77 E;  2EAY A;  1WZO A;  3U23 A;  4C0G A;  2OAW A;  1YJN T;  5KYW B;  2RJD A;  4ZN1 A;  1WYX A;  3E1S A;  1M90 U;  4LD6 A;  2A3L A;  2K5I A;  1SF9 A;  4C92 C;  3V8K A;  2QEX Q;  3OW2 S;  3EG3 A;  3LYI A;  4BY6 B;  3CME Q;  1SEM A;  1T3L A;  3Q1J A;  5GMK e;  1M5Q 1;  2VYT A;  2M9U A;  2XK0 A;  5LJ5 j;  2E10 A;  2V8K A;  4RTT A;  2ABL A;  2GFA A;  1MHN A;  5AYF A;  4PJO A;  1OZ2 A;  2IVW A;  4EMG A;  1QCN A;  3L2W A;  4C8Q B;  5KYW A;  4FT4 A;  3VS5 A;  4C5I A;  4OML A;  3MET A;  3QWY A;  2VKN A;  1GFD A;  2EKO A;  2OJ2 A;  3PIP A;  1W6X A;  4X1V A;  2QQB A;  4M7A D;  2K9G A;  3JV3 A;  3SDZ A;  1U1T A;  2MIO A;  1WHK A;  1YJ9 Q;  3M0T A;  3D7S B;  3CCM T;  5L23 A;  3MP1 A;  4PNO A;  2O9V A;  3JB9 G;  5GAO p;  2FPE A;  5D6Y A;  1VQ6 Q;  2CZ0 B;  3H0H A;  3VS0 A;  2CH4 W;  2BE7 D;  3URG A;  2FG0 A;  3VYH B;  4ZGD B;  3GOX A;  2P0K A;  2YRV A;  4C8Q A;  1TSF A;  2QTX A;  4J7F A;  3HHT B;  2OAU A;  2JNG A;  4M75 G;  2HQH A;  3LWI A;  2LQ8 A;  3LX7 A;  3TSW A;  1X6G A;  4BDZ A;  2CP2 A;  1DJ7 B;  2COZ A;  1C6V X;  2CT3 A;  3SWN A;  4LUE A;  1V29 B;  2PUK B;  3OYH A;  2LCL A;  4J5Y A;  1VYV A;  1FMW A;  1VQ7 T;  1QVF P;  2QQA A;  5KCH A;  2A0F B;  4N4H A;  5KYY B;  1G5V A;  3I56 A;  3DB3 A;  1KSW A;  3A8O B;  4AFU C;  1RAA B;  2GFU A;  2I0N A;  2P0Q A;  2E64 A;  4F7U E;  1JU5 C;  3CMA A;  4M78 A;  1SHF A;  1MGQ A;  4NL2 A;  1YIT Q;  3P8D A;  1VQM Q;  2RHI A;  2IPO B;  1YIT T;  1VQM T;  1LNX A;  2OTJ A;  1WJQ A;  5LJ3 f;  4J83 A;  4J9B A;  3UF4 A;  2WSC E;  4C92 D;  3BFM A;  5IH2 A;  4BY6 C;  4RG8 A;  3G6E A;  3HRT A;  2DPP B;  3OSV A;  2PQW A;  3ASK A;  2JJ9 A;  1G8X A;  2FB7 A;  3SB2 A;  4EPC A;  1FXX A;  1RI0 A;  3SD4 A;  1ABO A;  2QYZ A;  4ELZ C;  1KG1 A;  4F04 B;  1KHI A;  5GAO r;  4PJO F;  2LCC A;  3RBB B;  3QG1 A;  3OYB A;  1VQP Q;  1I07 A;  3ZL7 C;  3CCE A;  1Y57 A;  1VQP T;  3C0C A;  1IGQ A;  4PKC C;  2CP7 A;  5CQY A;  3EFO A;  4OMF B;  3VRZ A;  4C8Q C;  2C0T A;  2R5M A;  3JCM f;  4BE0 A;  2K79 A;  3QXE B;  1N8R U;  4HKE A;  2FZK B;  4M7A G;  2COW A;  4XTX A;  1I0C A;  2GTJ A;  2AZV A;  2IIM A;  2F1L A;  4J9G A;  4FCY A;  2V8I A;  2DXT A;  3MP6 A;  4P5N A;  3DLL A;  1VQ5 T;  5GAN 6;  1IHW A;  4IIM A;  2EYY A;  2J7I A;  4JZ3 A;  1Z9Q A;  1D0Y A;  1OQK A;  3G4S T;  1K8A C;  3OS2 A;  2H8H A;  4C8Q F;  4HVW A;  4KUD K;  2DD4 A;  3E2U A;  3P8B B;  3PMI A;  1OEB A;  5GAO n;  4IUP A;  2CZ7 B;  4L5G A;  2WAC A;  2BZY A;  1K9M R;  3G1J A;  3T9N A;  4J9I A;  1PKS A;  1BBZ A;  3OB9 A;  1M2O A;  5GMK l;  4BE2 A;  3M4Y A;  5C6S A;  2YSQ A;  2V26 A;  4N4G A;  3KXT A;  2CDT A;  3CCU Q;  1QVG A;  1TG0 A;  3CQT A;  3MKD A;  1RAC B;  2DRK A;  1Z9Z A;  4F17 A;  4V2S A;  2Y4Y A;  3OBY A;  1FYN A;  4OVA A;  1LPL A;  4M78 F;  1M8M A;  3OS1 A;  3I55 A;  3V7S A;  2F5T X;  2RI3 A;  1I4K 1;  1AWW A;  2CP0 A;  2HBW A;  4QKU A;  1UJ0 A;  1VQK T;  3L42 A;  5CO7 A;  4RTY A;  3M59 A;  2QA4 A;  4N0A A;  1VYT A;  3TEE A;  4Y28 E;  5CAI A;  4C92 G;  3NPF A;  1K1Z A;  3I9Q A;  3UT1 A;  1Q7Y C;  1WJS A;  2QTV A;  2HL5 C;  2NLU A;  3EGU A;  2X3W D;  1NJI R;  3OQ5 A;  1QVG S;  3CCV T;  4JJB A;  4KBM B;  1PD1 A;  2CS7 A;  2DRM A;  4RKU E;  3WXM B;  1AZE A;  5GAN h;  2L3R A;  4X9D A;  3EG0 A;  3JCM P;  2J06 A;  3I56 T;  1UUE A;  1VQL A;  3VYG A;  2GQI A;  2K2M A;  4Q5W A;  1PSE A;  3CMA T;  3MP8 A;  2RJF A;  4C8Q D;  3PMT A;  2CUB A;  4LDW A;  2ZPF B;  4O5V A;  1VQ4 A;  3CCR A;  4MZP A;  2RQV A;  4PFO A;  5IT9 E;  4RTX A;  2OTJ T;  1HK9 A;  1HXD A;  1AWJ A;  2RM4 A;  3BDU A;  5CCA A;  4FSS A;  4C0Z A;  4M77 A;  4J6W A;  4ORZ A;  4OGC A;  2RI2 A;  2DIQ A;  3PIO A;  1SKU B;  1N8R R;  2NUT B;  1W2B A;  2YWW A;  2FVU A;  1OPK A;  2RHU A;  4C0F A;  2X35 A;  4NS5 A;  4VUB A;  1BI0 A;  2HAX A;  3CC4 A;  3REB B;  3CBP A;  1ZQ1 A;  2EKH A;  3FJ5 A;  1OI1 A;  4J9C A;  2J6F A;  1VQN A;  4N0A C;  4GLM A;  4M78 D;  2XD0 A;  3J81 E;  2R5A A;  2E65 A;  2F2W A;  1X6B A;  2H3J A;  3MO8 A;  1XOV A;  2K5L A;  1EFN A;  5GAM g;  4CC4 B;  2JT4 A;  2EJ9 A;  3CCJ Q;  5FU6 B;  2KRO A;  3V7C A;  1QWE A;  1PC0 A;  2KAF A;  1WPY A;  4DOW A;  2E5K A;  4R56 A;  1C1A A;  4IIO A;  3MEV A;  1JB0 E;  2D0N A;  2K5F A;  4E7J A;  3JB9 H;  3J80 E;  1WHM A;  2QQR A;  4PJJ A;  1Q82 U;  3JAM E;  2ROT A;  3EHQ A;  4A54 A;  2FYK A;  1UG1 A;  2XG8 D;  4JRK A;  1KIK A;  5KYN A;  3OYA A;  1Y96 B;  1ABQ A;  2QQS A;  3MCA B;  1TTH B;  2P84 A;  3AHU A;  1D1C A;  4R0K A;  4DBH A;  2L2P A;  3RKX A;  4C5E A;  4ELY C;  1GCP A;  2D8H A;  1MUZ A;  2EQU A;  1YHQ Q;  3LWH A;  1UGP B;  2M0Y A;  2DBM A;  3EGD A;  4ZTJ A;  2YRD A;  3I55 T;  1RAD B;  4C8Q G;  2M0O A;  4ME7 A;  3M54 A;  2GGR A;  3VUZ A;  2QA4 T;  1OU8 A;  2EJF A;  4BDY A;  5GAM e;  1WNL A;  3QII A;  3PT9 A;  1F1B B;  5FRM A;  2W0Z A;  4M77 F;  1K9A A;  1LCK A;  3FC3 A;  2DL5 A;  5M9O A;  1WQ7 A;  4OB3 B;  2DIL A;  2ATC B;  1Y07 A;  2YHT A;  1YN8 A;  4F7U A;  5D6X A;  2O4X A;  1IRX A;  2K7A A;  4Y91 A;  1X01 A;  2RJE A;  4AG1 C;  3CC7 Q;  1MV3 A;  1I1J A;  1V1C A;  5FWC A;  3CC7 T;  1QVF S;  3RDV A;  2DK3 A;  2ED1 A;  1SG5 A;  4EMK B;  3DKM A;  2CSI A;  4ZGJ B;  3HKS A;  4B6M A;  5CKD A;  2F2X A;  4KGV B;  4M78 G;  1VQ6 A;  2DAQ A;  1K8A U;  1X43 A;  1VQL T;  1KK7 A;  1QVG P;  5FRO A;  3UA6 A;  5GAN d;  1H3H A;  4LDY A;  1SSH A;  3CCS Q;  3VS3 A;  1VQ4 T;  3CCR T;  1N27 A;  4J6Y A;  1UHC A;  3JCM V;  5LJ3 j;  3OYJ A;  3OYL A;  2DXB A;  5FU6 C;  3QPH A;  2HSP A;  2CZ6 B;  3FIF A;  2BUD A;  3M58 A;  2L0A A;  5LJ3 h;  2LNV A;  2HDA A;  1D1A A;  2DTI A;  5GMK m;  1E6G A;  2LNH B;  1AEY A;  1VYU A;  3CC2 Q;  4D8D A;  4KRT A;  1JXO A;  2GCX A;  3IQL A;  3H8Z A;  4PK4 A;  1QP2 A;  5I2S A;  1VQN T;  1S72 A;  1GCQ C;  1MMN A;  4GLK A;  1ZSZ A;  3L2Q A;  1M1K R;  2M51 A;  1SPK A;  3TRE A;  3JCM h;  1Q82 R;  4M77 D;  4OGE A;  1EZZ B;  3S3N A;  2XIC A;  1BKB A;  1RAH B;  4PJO B;  1KD1 R;  2YRC A;  1YJN Q;  5GAN e;  1NG2 A;  1YI2 A;  1IHV A;  2MF2 A;  1W70 A;  2JTF A;  3JRZ A;  4XU2 A;  2K6D A;  3UWN A;  2VWF A;  3C4S A;  3QUI A;  4BI8 B;  4A4K A;  1HYO A;  3CBO A;  1M9S A;  3EG9 A;  2OX7 A;  1W2B P;  1D3B B;  2QAS A;  2QXF A;  1PG5 B;  1WQW A;  2CKK A;  1GBR A;  2CT4 A;  2KE9 A;  1M3A A;  4X9C A;  2CGH A;  5EG2 A;  4F7U F;  4FL6 A;  1PHT A;  2RN8 A;  1IRE B;  1VQO A;  2YUP A;  4HA8 A;  1E7O A;  3EH2 A;  1NM7 A;  4FYY B;  3NTH A;  5LJ5 h;  2CSQ A;  1B3Q A;  1BI3 A;  4JJC A;  4UC4 A;  2DL8 A;  2LX9 A;  2B86 A;  3CXC A;  2V1Q A;  2X51 A;  2FRW A;  3HPW A;  4J9D A;  1TUD A;  4DEX A;  2MAM A;  4EMK C;  3JCM X;  3L2R A;  4OMO A;  5J39 A;  4LD9 K;  1A0N B;  3A98 A;  3SWN B;  2PNI A;  3VS4 A;  2CP6 A;  1D3B A;  4XTY A;  2DMO A;  1ZX6 A;  2GQV A;  2JOY A;  3CCM Q;  4FIB A;  2D1X A;  4PJM A;  4A53 A;  4JS5 A;  2JM9 A;  2KSS A;  2IG0 A;  6AT1 B;  4LE9 A;  1J3T A;  1ZUU A;  1AOJ A;  1GFC A;  1RAB B;  3RMS A;  2ZAE A;  2GBQ A;  2FRY A;  2LTO A;  1P92 A;  1VA7 A;  4M78 B;  3THK A;  1AVZ C;  1WI7 A;  2D9T A;  2KMT A;  1BIA A;  1WHL A;  4ANJ A;  4RMO A;  4HT9 A;  5GAN 4;  3QYH B;  4AFZ C;  3M4G A;  1TXQ A;  1WDX A;  2NUP A;  2XMF A;  2HMA A;  4A4F A;  3AT1 B;  1X6O A;  4LXC A;  1K73 C;  4MZT A;  4QT7 A;  2MMP A;  3H9N A;  1ZLM A;  1KC8 C;  3LH0 A;  4HT8 A;  1YCS B;  2BZ8 A;  1CSK A;  1VQ7 Q;  4M77 G;  1BYM A;  3FJP A;  4MDX A;  2JN0 A;  4IUQ A;  2JTE A;  5A0L A;  1PSF A;  5IN1 A;  5HK3 A;  2XI9 A;  5FU7 B;  4L6V 5;  2KGT A;  4RCB A;  4PJO C;  2JUF A;  2L3P A;  4IUV A;  3EFO B;  4KUI A;  4XTZ A;  2EJG A;  4J6X A;  1NLP C;  1SRL A;  3I35 A;  4OMN A;  1M8V A;  2A7Y A;  2KI7 A;  3QDR B;  5CK9 A;  1YJW A;  2CZ1 B;  2JM8 A;  5J26 A;  5LJ3 d;  2C0I A;  1Y71 A;  2CRE A;  3CCL A;  2COY A;  3E9F A;  4KH0 B;  4OF1 A;  1S72 T;  1M90 R;  3MEA A;  2HD0 A;  2JVV A;  3WVE B;  3HFN A;  4IUU A;  3OYC A;  3QO3 A;  3A8L B;  4RTW A;  2CYZ B;  3M9Q A;  1K0S A;  1KJW A;  2O31 A;  4LDU A;  5FWB A;  3M55 A;  4E7H A;  4MDW A;  2RNA A;  4MML A;  4ZTF A;  5A0D A;  5D6W A;  1RAI B;  5CVI A;  3HRU A;  1YI2 T;  1AT1 B;  3G71 A;  4C5G A;  3JCM d;  3OY9 A;  1N5Z A;  2RF0 A;  3OYY A;  3BDL A;  4PJL A;  5GJV B;  3SWN C;  5FLX E;  2LT1 A;  2YUN A;  4OB1 B;  2O01 E;  2EYQ A;  2AT1 B;  2X3X D;  1VQ5 Q;  2YXY A;  2L8D A;  3EGX B;  2K4Y A;  2E12 A;  2LCS A;  1WA7 A;  1S1N A;  3KFV A;  1NZ9 A;  2ROL A;  2FZG B;  5ECA A;  2DM1 A;  3G4S Q;  1M2V A;  2P0P A;  2JTM A;  2M1H A;  1VQO T;  3X24 B;  2P4T A;  5LJ3 e;  3SFM A;  3LGF A;  4KGZ B;  5CQX A;  1R8O B;  3HRS A;  2AKL A;  4M78 C;  1H3Z A;  3ER0 A;  1K76 A;  3CBM A;  4LDV A;  3A8H B;  1Q86 C;  3O8V A;  3FDR A;  2PU9 B;  1VQ9 A;  3HTR A;  4PLI A;  4DEY A;  2EQJ A;  4CC7 A;  4HXJ A;  3JCM Q;  1UJY A;  5LJ5 d;  3QBY A;  4II1 A;  3ZBD A;  3QWX X;  4OMQ A;  2DBK A;  3E19 A;  1O75 A;  2RK1 A;  2G6F X;  3EGX A;  4M7D E;  2QAZ A;  3JCM e;  4AMC A;  4CC3 A;  3CPW A;  1MNE A;  3GP8 A;  1YIJ A;  4E47 A;  4NOY A;  1I5O B;  4BE1 A;  5FU7 C;  1QCF A;  2BE9 B;  5GAO l;  2XDP A;  1VQK Q;  4PJO D;  2LDM A;  1QKX A;  2RHZ A;  2VAS A;  2WSE E;  1SSF A;  2KDS A;  4F14 A;  1FX7 A;  1U1S A;  1XJW B;  1BU1 A;  2VB6 A;  4HCB A;  1YHQ A;  2E41 A;  1R0B G;  2ESW A;  4PL6 A;  4FYX B;  3C95 A;  4IUT A;  3MHX A;  4RTU A;  1ZUY A;  4M77 B;  3LGL A;  3CCV Q;  4J9F A;  2PTK A;  2A37 A;  3RKY A;  2SRC A;  3JCM W;  3EFS A;  2H3E B;  1B07 A;  4XTU A;  1NEB A;  3CPW S;  2OTL A;  3CXC P;  1H8K A;  1IB8 A;  4FSX A;  1UTI A;  1NYF A;  3RES A;  5KCO A;  3I56 Q;  3QJY A;  1WX6 A;  5LJ5 e;  4Z8A A;  3CCQ A;  3M53 A;  4BI3 A;  3FEO A;  1QVP A;  2JZ2 A;  3CD6 A;  5I22 A;  2EQM A;  3CMA Q;  1GL5 A;  4HCZ A;  5A2Q E;  1PNJ A;  1T0J A;  3M0U A;  3JB9 J;  2OTJ Q;  1T3S A;  2AZS A;  1YJW T;  2KQW A;  2D8J A;  3J7A F;  2HL3 A;  3OYN A;  2A08 A;  3TQ7 P;  3G6E Q;  1X27 A;  4EIK A;  3G6E T;  4R55 A;  1Q81 C;  5GMK j;  2ZPI B;  1KQ2 A;  1BI1 A;  4QVD A;  4OMP A;  3X26 B;  1Y0M A;  1BCO A;  2HKQ B;  2P4R A;  3VJP A;  8ATC B;  1RUW A;  1RLP C;  3CCE Q;  3CCE T;  4FYV B;  4QQG A;  3H0I A;  2XKO C;  5GAN 3;  3NGP A;  3OSS C;  3V7R A;  4DOV A;  4XK8 E;  3G71 T;  2NUZ A;  5C0M A;  1XTD A;  1ZUK A;  2C0O A;  1VQ8 A;  4DBF A;  1JJ2 P;  3RKW A;  3QYG B;  1QP3 A;  2L3S A;  3OYM A;  1W2B S;  3QHS A;  2DFU A;  4OB0 B;  8AT1 B;  1K73 U;  2FO0 A;  2ENM A;  5J3B A;  2KYM A;  3HL8 A;  4PFZ A;  1KC8 U;  4O6J A;  2DZC A;  4M4Z A;  3EGD B;  3ME9 A;  3GIB A;  1K9M C;  2DYI A;  5KYX A;  1RAE B;  4PJO G;  2J6K A;  1LVK A;  1MV0 B;  1M3B A;  1OPL A;  2MCN A;  5IHI A;  2LT4 A;  1JBM A;  5GAM f;  3X20 B;  1LOJ A;  2MYS A;  1BIB A;  3KUF A;  4BUG A;  1B34 A;  4IUR A;  4QQD A;  1GXI E;  1VIE A;  4FU6 A;  1WIE A;  4M77 C;  4F7U B;  1JO8 A;  4Y92 A;  2O4X B;  4RTZ A;  2QEX A;  4JJN K;  3V8L A;  1FMK A;  2GTO A;  4C5H A;  5KE3 A;  3HFO A;  1PKT A;  3L1A A;  3CME A;  4A63 B;  2RQW A; 
#chains in the Genus database with same CATH homology
 4E7I A;  4E7K A;  1G3W A;  1YI2 A;  1MGQ A;  2MF2 A;  2ZCF B;  4NL2 A;  2JTF A;  1UGR B;  3JRZ A;  3P8D A;  1M1G A;  2RHI A;  3OYF A;  4XU2 A;  2PVO B;  3GNF B;  2VV5 A;  3INZ A;  1VQM T;  1YIT T;  1LNX A;  4HCC A;  2OTJ A;  1WJQ A;  3UWN A;  3X28 B;  3C4S A;  3F70 A;  1UGQ B;  3QUI A;  4J83 A;  5LJ3 f;  4BI8 B;  4A4K A;  1VIF A;  2WSC E;  1YIJ T;  4C92 D;  3BFM A;  2D6F A;  5L8R E;  1FWZ A;  2QQ9 A;  3CBO A;  1M9S A;  1NJI C;  5GAN 5;  5GAN j;  2MWP A;  1D3B B;  2F5K A;  4BY6 C;  4RG8 A;  3G6E A;  3HRT A;  2DPP B;  2VGN A;  3CC7 A;  3OSV A;  2PQW A;  1OYX A;  3ASK A;  5DM7 R;  3RER A;  2QXF A;  5I2M A;  1WQW A;  2CKK A;  2EQK A;  1M90 C;  2FB7 A;  5DY9 A;  3SB2 A;  4EPC A;  1FXX A;  3S3O A;  4X9C A;  1RI0 A;  2CGH A;  1NE8 A;  5EG2 A;  3SD4 A;  4F7U F;  4E7L A;  4ELZ C;  1KG1 A;  4FL6 A;  5GAN 8;  1KHI A;  2WSF E;  5GAO r;  4PJO F;  2C06 A;  2LCC A;  3QZ5 B;  1IRE B;  3QG1 A;  1VQO A;  3OYB A;  4HA8 A;  3OYI A;  4M75 A;  2HNI A;  2YLC A;  4QQ6 A;  3UPU A;  3NTH A;  3CCE A;  1YBY A;  5LJ5 h;  1VQP T;  4PKC C;  4X34 A;  3CCL T;  5CQY A;  4OP0 A;  1BI3 A;  4C0D B;  4OMF B;  4RCC A;  4C8Q C;  4UC4 A;  3V8J A;  1YJ9 A;  2OTL T;  5CR2 A;  2R5M A;  3JCM f;  2LX9 A;  4BE0 A;  4LDX A;  1UGS B;  3CCS A;  3CXC A;  3DLM A;  3QXE B;  5HY6 A;  4C8Q E;  4EMH A;  3OYG A;  4HKE A;  1N8R U;  3HPW A;  4M7A G;  1N9S A;  5GAN g;  5GMK h;  3NTI A;  2MAM A;  4XTX A;  3EFR A;  2HQE A;  4EMK C;  3LLR A;  3WVD B;  4XQ3 A;  3JCM X;  3HSB A;  3L2R A;  3FRN A;  5J39 A;  4LD9 K;  3CCQ T;  2PVG B;  3SWN B;  1QW1 A;  2RD1 A;  3MEU A;  2B8A A;  3NTK A;  2E70 A;  2V8I A;  2DXT A;  1LJO A;  3MP6 A;  1D3B A;  4GY5 A;  4P5N A;  3TU4 K;  4JLG A;  4XTY A;  3CD6 T;  3JB9 I;  3C12 A;  2GQV A;  2JOY A;  3DLL A;  2RB6 A;  1VQ5 T;  5GAN 6;  3UDC A;  1B34 B;  4FIB A;  1N8R C;  2KY9 A;  2ZPE B;  4A53 A;  1JRI A;  4JS5 A;  3R6O A;  2FHD A;  1Q86 U;  2Y90 A;  2KSS A;  2IG0 A;  2VXF A;  4XU1 A;  2DJZ A;  1KHC A;  2L5Q A;  3CC2 A;  2K3Y A;  3G4S T;  3RIR A;  3VUB A;  1K8A C;  3RMS A;  2VUB A;  4C92 A;  3OS2 A;  4M7D G;  1UB4 A;  4M7A B;  3M5A A;  1U8R A;  2LTO A;  4C8Q F;  3GLX A;  5GAN f;  5CKF A;  1P92 A;  4KUD K;  1VUB A;  2DD4 A;  3P8B B;  3PMI A;  4M78 B;  4JUV A;  5GAO n;  2D9T A;  2KMT A;  4IUP A;  2CZ7 B;  4L5G A;  1BIA A;  2XDD A;  2WAC A;  4M78 E;  2I2L A;  2RA2 A;  4RMO A;  4HT9 A;  5GAN 4;  3QYH B;  5CKE A;  4XAX B;  3M4G A;  3T9N A;  1G3S A;  4A4F A;  3OB9 A;  1X6O A;  3CC4 T;  5HK0 A;  5GMK l;  4BE2 A;  3M4Y A;  4A4G A;  5C6S A;  4XTV A;  1K73 C;  4MZT A;  4Z02 A;  2E6N A;  4JRQ A;  3CCJ T;  4N4G A;  3KXT A;  2MMP A;  1KC8 C;  1AHJ B;  4M7D B;  4QVZ A;  1YJN A;  1QVG A;  3LH0 A;  5GAN 2;  5GAM d;  4HT8 A;  3RMQ A;  1BYM A;  4M77 G;  1VQ9 T;  1YIT A;  1VQM A;  4JDS A;  5GAO m;  4ZN3 A;  3FJP A;  4V2S A;  2Y4Y A;  3OBY A;  4MDX A;  2XID A;  2JN0 A;  3FB9 A;  4IUQ A;  1G3T A;  1RL2 A;  2RHY A;  1PSF A;  4OVA A;  5CKB A;  5A0L A;  2RK2 A;  1Q7Y U;  5IN1 A;  2EFI A;  1M1K U;  1VQ8 T;  5HK3 A;  4M75 C;  4BD3 A;  2XI9 A;  4M78 F;  3OS1 A;  5FU7 B;  2PVD B;  2M16 A;  4L6V 5;  3I55 A;  4M7A A;  2RI5 A;  2F5T X;  4RCB A;  2RI3 A;  3V7S A;  1I4K 1;  4PJO C;  2JUF A;  4IUV A;  4M75 E;  1VQK T;  3L42 A;  5CO7 A;  1UEB A;  1G3Y A;  1M4Z A;  3M59 A;  4KUI A;  4N0A A;  2EJG A;  1I81 A;  4MMK A;  4XTZ A;  3TEE A;  2DD5 A;  2VGM A;  4Y28 E;  2E1H A;  4WF2 A;  2DTO A;  3OYD A;  3OW2 A;  1KD1 U;  2YLB A;  5CAI A;  4J6X A;  4C92 G;  1I8F A;  3CEY A;  3UT1 A;  1Q7Y C;  1WJS A;  3OMC A;  2ZPB B;  2A7Y A;  3QDR B;  1M8V A;  2NLU A;  4QW2 A;  2LRQ A;  5CK9 A;  3JB9 F;  4CI0 C;  2LVM A;  3OBW A;  2CZ1 B;  1YJW A;  4A4H A;  5J26 A;  3OQ5 A;  5LJ3 d;  1QVG S;  3H6Z A;  3CCV T;  1Y71 A;  2DKG A;  4RG2 A;  1YCY A;  3GNG A;  2DZ9 A;  3RUX A;  1VQP A;  3OS5 A;  4KBM B;  2X4J A;  3CCL A;  2CS7 A;  3E9F A;  4M7D A;  4OF1 A;  1S72 T;  4RKU E;  3WXM B;  5GAN h;  3P8H A;  1YHQ T;  1IZ6 A;  4FM4 B;  4XU3 A;  3MEA A;  2HD0 A;  2K3X A;  2JVV A;  3G7Z A;  2L3R A;  3L2Z A;  4M75 F;  3WVE B;  3HFN A;  4X9D A;  2L89 A;  4IUU A;  3OYC A;  3JCM P;  1QVF A;  4QVC A;  3QO3 A;  3A8L B;  3FLG A;  3A8M B;  3I56 T;  4C92 B;  2CYZ B;  3M9Q A;  4PJO E;  1ZHI A;  4JLI A;  4BAC A;  4BB7 A;  1VQL A;  3VYG A;  2QEX T;  4LDU A;  2BKD N;  3M55 A;  4Q5W A;  4E7H A;  4MDW A;  2PUO B;  4C0D C;  1PSE A;  4KT0 E;  1VQ5 A;  3CMA T;  5KE2 A;  3MP8 A;  4MML A;  3CME T;  2RJF A;  2GF7 A;  4C8Q D;  4ZTF A;  3QKJ A;  5A0D A;  1TH7 A;  5D6W A;  3CCM A;  3PMT A;  5CVI A;  3HRU A;  4O5V A;  4LDW A;  2LQK A;  2ZPF B;  3G71 A;  1VQ4 A;  1YI2 T;  4C5G A;  3CCR A;  4JS4 A;  1Q81 U;  4MZP A;  3JCM d;  1XNI A;  5IT9 E;  3OY9 A;  2OTJ T;  1HK9 A;  1HXD A;  2RH2 A;  3G4S A;  2RM4 A;  2ZZD A;  3BDU A;  5GAO q;  1Y96 A;  2DTH A;  5CCA A;  4C0Z A;  2KVQ G;  2EWN A;  4M77 A;  3OYY A;  3N5B B;  3BDL A;  2X4X A;  4J6W A;  3JCM b;  3SWN C;  5FLX E;  4OGC A;  5GAN 7;  2RI2 A;  2DIQ A;  2LT1 A;  4PLL A;  3PIO A;  3PGG A;  4OB1 B;  2O01 E;  2EYQ A;  2QDY B;  1W2B A;  3MEW A;  2L8D A;  5KH6 A;  3HP9 A;  2MWO A;  2K4Y A;  2E12 A;  2FVU A;  2FL7 A;  4C92 F;  2AHJ B;  3OYK A;  1KQS A;  1NZ9 A;  2RHU A;  4YTL A;  4C0F A;  2X35 A;  4NS5 A;  4VUB A;  4ZGE B;  4N4I A;  1BI0 A;  2HAX A;  3CC4 A;  3CPF A;  3KBG A;  2P0P A;  2JTM A;  2M1H A;  3VU3 C;  3CBP A;  2P4T A;  3X24 B;  1VQO T;  1ZQ1 A;  5LJ3 e;  2BIV A;  3OA6 A;  3SFM A;  4M7A C;  3LGF A;  1OI1 A;  5CQX A;  4J7I A;  1R8O B;  3CXC S;  3HRS A;  4N0A C;  1VQN A;  4M7A E;  2RHX A;  4M78 C;  4M78 D;  2XD0 A;  1H3Z A;  3ER0 A;  3CCU A;  3JCM J;  3CBM A;  1ZBX A;  4LDV A;  3A8H B;  3J81 E;  2R5A A;  3FDR A;  2E65 A;  3O8V A;  2PU9 B;  5LL6 S;  1YJ9 T;  1Q86 C;  3A8G B;  4JRP A;  5I21 A;  4DA4 A;  4PLI A;  3S3M A;  1VQ9 A;  2EQJ A;  3BY7 A;  3CCS T;  1VQ7 A;  2H3J A;  3MO8 A;  1XOV A;  2XDB A;  1N9R A;  3OS0 A;  2K5L A;  1XQH A;  5GAM g;  3JCM Q;  1K9M U;  4EDU A;  1NPP A;  1NPR A;  3BW1 A;  2KK4 A;  5LJ5 d;  2EJ9 A;  3VV0 A;  3S6W A;  1WGS A;  3C94 A;  2DIG A;  3QBY A;  4II1 A;  5FU6 B;  3V7C A;  3ZFJ A;  1VQ6 T;  3ZBD A;  2DO3 A;  1VQK A;  3JB9 D;  4M7D C;  2F69 A;  2KAF A;  1KQS S;  3E19 A;  1WPY A;  1O75 A;  2E6Z A;  2RK1 A;  4DOW A;  2HBP A;  2ZPG B;  4M7D E;  1OZ3 A;  3M56 A;  3ZEH A;  2LC4 A;  4R56 A;  3JCM e;  4M7A F;  3CPW A;  3MEV A;  3A5Z B;  1N6A A;  2D0Q B;  5A0G A;  3GP8 A;  1JB0 E;  4EMK A;  2HQX A;  5GMK i;  1YIJ A;  2DXU A;  3CC2 T;  4E47 A;  4NOY A;  3TCJ A;  2K5F A;  4E7J A;  4BE1 A;  4M75 D;  3CCV A;  1JJ2 A;  5FU7 C;  3JCM c;  3J80 E;  2QQR A;  3JB9 H;  5GAO l;  2XDP A;  4PJO D;  2LDM A;  2RHZ A;  1Q82 U;  2QA4 A;  2WSE E;  2G3R A;  1SSF A;  2KDS A;  4BI4 A;  1FX7 A;  1U1S A;  3DB4 A;  5DLO A;  5LJ3 g;  3JAM E;  3L2V A;  4HCB A;  4A54 A;  2FYK A;  2E41 A;  1YHQ A;  2XG8 D;  3M57 A;  4PL6 A;  2MI6 A;  3PFS A;  4JRK A;  3C95 A;  4IUT A;  3MHX A;  5FRN A;  1Y7X A;  4XU0 A;  1M1K C;  4FT2 A;  3E9G A;  3OYA A;  1Y96 B;  2QQS A;  3EAE A;  3MCA B;  4M77 B;  3JSC A;  3LGL A;  2RO0 A;  3AHU A;  4M7D F;  3L2U A;  3RKY A;  3JCM W;  1Q82 C;  3EFS A;  4M77 E;  2EAY A;  3RKX A;  4B9X A;  4IKF A;  2VC8 A;  4C5E A;  4XTU A;  1NJI U;  4ELY C;  1H64 1;  4C0G A;  1KD1 C;  3CPW S;  2OTL A;  2EQU A;  1YJN T;  2E5Q A;  3LWH A;  1UGP B;  2RJD A;  4ZN1 A;  4FSX A;  1JJ2 S;  3E1S A;  3RES A;  2VXE A;  2ZPH B;  1M90 U;  5KCO A;  4LD6 A;  4ZTJ A;  2A3L A;  2K5I A;  3QJY A;  1EIF A;  5CKH A;  4C92 C;  3V8K A;  5LJ5 e;  3CCQ A;  4KUL A;  3JCM g;  3M53 A;  3I55 T;  4BI3 A;  4C8Q G;  3FEO A;  3LW5 E;  2M0O A;  4ME7 A;  1QVP A;  2JZ2 A;  1M1F A;  3M54 A;  4C92 E;  3LYI A;  3OW2 S;  3CD6 A;  2EQM A;  4BY6 B;  3VUZ A;  4HCZ A;  2QA4 T;  2X4Y A;  2EJF A;  5A2Q E;  4BDY A;  5GAM e;  1WNL A;  3QII A;  3PT9 A;  3Q1J A;  5GMK e;  3GPL A;  5FRM A;  1M5Q 1;  4M77 F;  3X25 B;  2VYT A;  4L59 A;  3FC3 A;  3JB9 J;  2EIF A;  2XU8 A;  2M9U A;  2XK0 A;  5M9O A;  1WQ7 A;  4OB3 B;  5LJ5 j;  2E10 A;  2V8K A;  3QZ9 B;  2YHT A;  1Y07 A;  1YJW T;  4F7U A;  2KQW A;  3QSU A;  2GFA A;  5D6X A;  2O4X A;  3J7A F;  1MHN A;  5AYF A;  4B9W A;  3OMG A;  1BI2 A;  3OYN A;  4PJO A;  4NL3 A;  1OZ2 A;  4Y91 A;  1X01 A;  2RJE A;  5GAM j;  2IVW A;  4EMG A;  4R55 A;  3OYE A;  3L2W A;  3G6E T;  4C8Q B;  5GMK j;  2ZPI B;  1Q81 C;  3CC7 T;  1KQ2 A;  1BI1 A;  1QVF S;  4QVD A;  4FT4 A;  5GAM h;  4C5I A;  2DK3 A;  3QJ6 A;  3MET A;  3X26 B;  4EMK B;  3DKM A;  2EKO A;  4ZGJ B;  3PIP A;  3HKS A;  2QQB A;  5CKD A;  4M78 G;  5HKC A;  3VJP A;  2QI2 A;  2Y4X A;  4M7A D;  1VQ6 A;  2DAQ A;  2DVE A;  3CCJ A;  1K8A U;  1VQL T;  3CCE T;  3SDZ A;  2XHC A;  2RJC A;  5FRO A;  4QQG A;  1U1T A;  5GAN d;  2XKO C;  4CRI A;  5LJ5 g;  5GAN 3;  4LDY A;  3OSS C;  3V7R A;  3CCM T;  2DEQ A;  4DOV A;  3MP1 A;  4XK8 E;  4PNO A;  3G71 T;  5C0M A;  1VQ4 T;  1XTD A;  2V8J A;  3CCR T;  3PNW C;  3PTA A;  1N27 A;  4J6Y A;  4DQ2 A;  1VQ8 A;  1WJR A;  3JCM V;  3JB9 G;  3RKW A;  5LJ3 j;  5GAO p;  1O9S A;  1QP3 A;  3QYG B;  3OYL A;  3OYJ A;  1I5L A;  5D6Y A;  2DXB A;  3OYM A;  2CZ0 B;  2DXC A;  1W2B S;  5FU6 C;  3QPH A;  2CZ6 B;  3QHS A;  3FIF A;  2BUD A;  3M58 A;  4OB0 B;  1K73 U;  4JRI A;  5LJ3 h;  3VKI A;  2LNV A;  5J3B A;  4XTW A;  3URG A;  3HL8 A;  3VYH B;  4ZGD B;  2DTI A;  3GOX A;  2P0K A;  4M7D D;  2X4W A;  1KC8 U;  2YRV A;  4O6J A;  4C8Q A;  2QTX A;  4J7F A;  5GMK m;  2DZC A;  3HHT B;  2OAU A;  2JNG A;  3ME9 A;  4F7U G;  4M75 G;  3GIB A;  1K9M C;  5CIU A;  3LWI A;  2LQ8 A;  2K57 A;  3LX7 A;  1KQ1 A;  4J8O A;  4PJO G;  4A4E A;  5LJ5 f;  5DLQ E;  4BDZ A;  4MZM A;  1DJ7 B;  2ZGW A;  2LT4 A;  2GCX A;  3SWN A;  1W4S A;  1JBM A;  3H8Z A;  4D6W A;  5GAM f;  3X20 B;  1QP2 A;  1V29 B;  5I2S A;  2PUK B;  5IAY A;  3OYH A;  1LOJ A;  1S72 A;  1VQN T;  1BIB A;  2LCL A;  3KUF A;  4BUG A;  3CCU T;  2R58 A;  4J5Y A;  1B34 A;  2R57 A;  4IUR A;  4GLK A;  3L2Q A;  4QQD A;  4OB2 B;  1VQ7 T;  3TRE A;  2QQA A;  5KCH A;  4N4H A;  1GXI E;  1VIE A;  4TVR A;  4FU6 A;  1G5V A;  3JCM h;  3I56 A;  2K2V A;  3DB3 A;  4M77 C;  4M77 D;  3A8O B;  3GF5 A;  1X75 C;  4OGE A;  4F7U B;  4M75 B;  2GFU A;  3S3N A;  2O4X B;  2XIC A;  1BKB A;  2QEX A;  4JJN K;  4ATO A;  3V8L A;  4C5H A;  4PJO B;  2P0Q A;  2E64 A;  4F7U E;  3HFO A;  5KE3 A;  3L1A A;  3CMA A;  5GAN e;  4M78 A;  3CME A;  3NFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...