5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
2FB7A 4PJOC 4QVDA 4OP0A 1WQ7A 5LJ3h 2YLBA 4XQ3A 1BIAA 4EMGA 3JCMh 4XU2A 4XTYA 4A53A 5GAOn 5GAOr 4M7AD 4F7UB 4MMKA 4C92C 1HXDA 4EMKC 3SWNA 5LJ3d 3V8LA 5GAMj 2EJFA 4M77F 1JRIA 3SB2A 2DEQA 4M75G 3JB9F 3JCMd 4JLIA 4C8QG 2DXTA 5GMKi 3JCMW 4M7DF 3BFMA 4C8QA 3JCMJ 1M8VA 1WNLA 4NL2A 1I81A 2HNIA 5GANd 2RD1A 4PNOA 3HSBA 1D3BB 4Y91A 3SWNC 3JCMb 4M7AA 4M78G 5GAMh 2K57A 4F7UE 4M78A 5LJ5h 3QSUA 5GAN4 1I8FA 3RUXA 4M7AB 4C8QC 3EFRA 5GMKe 4PJOB 2DTIA 4RCCA 5GAOq 1Y96B 3QHSA 4JRIA 5GAMd 4M7AC 2ZGWA 4M75D 2DXUA 2JN0A 4JUVA 4C8QD 3JCMc 4C92B 4EMKB 5GAN7 5GAOm 4X9DA 1I5LA 3JCMX 3V8JA 3RIRA 1N9SA 4A54A 3PGGA 2VXFA 4M78D 4NOYA 5GANh 4PJOE 4J6XA 2DJZA 4F7UF 3JB9J 2DTHA 2RA2A 4M75A 5GMKl 3JB9I 4V2SA 3SWNB 4M77D 3QUIA 4XU0A 3V8KA 4XU1A 3AHUA 3V7RA 4C92E 4M75B 4C8QB 2VC8A 5LJ5e 1LOJA 4HT8A 3JCMP 3V7CA 3M4GA 1B34A 3BDUA 2EJGA 1JBMA 3INZA 4J6WA 4M75C 3V7SA 5GAOp 1TH7A 5LJ5g 4XTUA 3JB9G 4M77G 2FYKA 3FB9A 1LNXA 4M77A 4M78B 3RKWA 5I21A 4M7AF 4M7DG 4PJOF 2VXEA 4M7DA 5LJ3e 3FJPA 4J5YA 3JCMe 1BIBA 1H641 4M78C 4M75E 4XTZA 4C8QE 3VU3C 1M5Q1 1WPYA 2E41A 1HK9A 3GIBA 4J6YA 4RCBA 4XTXA 3RKYA 4C92F 5GANe 5LJ3g 4M77C 2Y90A 5GAN2 3JCMg 3RERA 1YCYA 4M7DC 4M7AE 3JB9H 5GMKj 4M78E 5GANg 3JB9D 3HFOA 4WF2A 2EJ9A 4M7DD 3RKXA 1MGQA 4EMKA 2CGHA 4XTWA 5GAMe 5GAN5 4QVCA 4MMLA 1I4K1 3JCMQ 4M75F 2DKGA 2EAYA 5GAMf 4C8QF 5LJ5f 5GMKh 5GAMg 2RB6A 3QO3A 4HA8A 4F7UG 3JCMV 1B34B 4F7UA 2DVEA 4EMHA 1N9RA 5GAOl 1U1TA 2E10A 4M78F 2EWNA 4M77B 2E1HA 4PJOD 5LJ3f 5GAN3 4M7DB 1WQWA 2QTXA 3JCMf 5LJ5j 2YHTA 4JRKA 3FIFA 3L2ZA 4N0AA 3BW1A 1D3BA 4XU3A 1KQ1A 2I2LA 3EFSA 4C92D 2E64A 3RESA 3BY7A 5GANf 2DZ9A 5GAN8 1LJOA 3HFNA 4X9CA 5GMKm 4M7AG 2E65A 4PJOG 1U1SA 4DQ2A 4PJOA 5LJ3j 4M77E 1KQ2A 1X01A 4XTVA 1Y96A 2DZCA 2RM4A 4M7DE 4N0AC 4HT9A 4C92G 2DTOA 5CAIA 5DY9A 4NL3A 2YLCA 4C92A 3L1AA 5GANj 5LJ5d 5GAN6
chains in the Genus database with same CATH superfamily
2JMAA 4E7HA 4EPCA 2YLBA 4JJNK 2BIVA 2LJ3A 4Z8AA 2CP2A 4OMFB 4MMKA 1Y57A 1YI2Q 2MMPA 2RHZA 2SEMA 4EMKC 1ZLMA 5HK3A 3JB9F 1AVZC 4M7DF 3JCMJ 2KE9A 5FWCA 2RQUA 3GBQA 4DBFA 3C94A 3J80E 3RUXA 3EGUA 2DTIA 3SEMA 3H0HA 1C0MA 1VQLA 3OYBA 1N6AA 3MEVA 4ESRA 2H3JA 2VWFA 2EIFA 1UGPB 1X69A 3VS5A 2MWOA 1VQ5T 4M77D 2V26A 1I0CA 2Y4YA 4MZTA 2JS0A 2GGRA 2L5QA 4HT8A 3HKSA 3TU4K 5CK9A 2HKNA 1VQNQ 1AEYA 3JB9G 4HCKA 1WGSA 4M7DG 4RTUA 3OW2P 5IT9E 4E2FB 1JU5C 3L42A 1Q86R 2KT1A 5GANe 5M9OA 4M77C 2KXDA 3CCSA 1Q86U 1M2VB 3JB9H 2O31A 2B8AA 3JB9D 4AFZC 4M7DD 1MGQA 3VYHB 3H0FA 3E2UA 5CIUA 2KRNA 4Y92A 4ZNXA 1A0NB 2XK0A 3TEEA 4J8OA 4M7DB 4PFOA 4FU6A 2RK2A 4FYYB 2CP5A 2LDMA 2DZ9A 2LCCA 1BI1A 2OTLQ 5A0LA 4IKFA 4RKUE 5KE3A 1JXMA 5D6WA 4N0AC 2CREA 5FU6C 4BDYA 2OTJQ 3C0CA 2ZPBB 3JCMh 1IXDA 4A53A 1HXDA 3CQTA 5KYYB 1VQMA 1NE8A 2D0NA 4O6JA 3V8LA 2RF0A 3NHNA 4KRTA 3I35A 1IREB 1EX4A 2ENMA 2WSEE 1V76A 1VQ4Q 1XQHA 3CCLT 2KSSA 2XU8A 4OMQA 3PNWC 4EDUA 2DXUA 4JUVA 2JXBA 5GAN7 4JS4A 1VQNA 4PL6A 5C0MA 3OYMA 3DLLA 1W2BP 2DTHA 1TS9A 2OAUA 4JZ4A 2RQRA 3CCUT 3HPWA 3OYKA 2M51A 3CCRT 3QKJA 3OS5A 1VQLT 2GFAA 1ZBXA 1KC8U 1WDXA 4J6WA 1ZSGA 1ZUUA 1YWOA 2FG0A 4BD3A 1YWPA 2JVVA 2R57A 9ATCB 3M53A 2EKOA 2J6KA 3CC7Q 1KHIA 4C92F 1PG5B 2QK0A 1OX8A 2PVGB 2V8KA 2YUPA 3EH1A 3VJPA 3MEWA 3EG9B 2DILA 2KK4A 4FL6A 3X28B 2D9TA 3A8HB 4HA8A 4E7LA 2DRKA 1TWBA 1U1TA 1PD1A 4FYXB 3CCVQ 2AIRB 2OTJA 3CXCP 3L2ZA 4NS5A 2OX7A 1NYFA 2WSCE 4A4HA 3MO8A 3GPLA 1GXIE 1PC0A 3TQ7P 5CKBA 4C92G 1GL5A 5KYWA 5GANj 5CO7A 4FW1A 4DOWA 1VQ4A 1BIAA 1YI2T 4A4KA 4MDWA 2H3EB 4FT2A 1VQPQ 1D0YA 3OYGA 5GMKi 2DXTA 4BACA 1YN8A 1WIEA 1UGQB 2DYBA 3OYFA 2C0IA 3OMGA 1ZUYA 1AWXA 3VKIA 4RG2A 3G7ZA 1RUWA 5FLXE 2NYSA 2KAFA 2PQWA 1UG1A 3RDVA 4C92B 1RI0A 1MHNA 3VUBA 4M4ZA 2L3SA 3PGGA 3QYGB 3A8LB 4X1VA 3THKA 1H8KA 2JTMA 3CC7A 3SWNB 3QUIA 4F17A 1GCPA 3V7RA 3NGPA 2RJEA 3M9QA 4OMOA 1ABQA 1UE9A 1VQNT 1X43A 2MI6A 1RABB 2CKKA 3F70A 4CC2A 2RHXA 1D1BA 1OU8A 1W2BS 3GIBA 2VASA 3NTIA 1UDLA 2MK5A 1VQ7Q 1M1GA 4RG8A 3PIOA 3CCVA 2EYQA 1R0BG 2X9HA 2EJ9A 3VS7A 3G6EQ 4QVCA 1Z9ZA 4M75F 2LCLA 1LCKA 5D6XA 4AFSC 2NWMA 1N9RA 1YJNQ 2WACA 2E1HA 2YDLA 4DBQA 3LLRA 4ZGJB 3OYNA 1JJ2P 3EFSA 2OTLT 3MCAB 1VQPA 4PK4A 1WHHA 3QXEB 1N8RC 1LVKA 4RUGA 3OYDA 1QCOA 3EAEA 2OTJT 4RTWA 2B86A 1S72A 1RAHB 2DD5A 1AT1B 5GAOr 5GAOn 3JRZA 1O9SA 4M75G 3JCMd 1QP3A 3TCJA 2BTTA 3NPFA 4HXJA 3CCEQ 1NEGA 4JJDA 1VQ4T 2VUBA 4M7AA 3EFOB 2GTOA 1JEGA 5I22A 3H8ZA 2COZA 4BY6C 1WLPB 4M75D 1AWWA 5A0DA 3A8OB 2M0YA 3MP6A 1M2VA 2CT4A 3EH2A 2O01E 2CH4W 3MJXA 3JB9I 4V2SA 2IVWA 4XAXB 1HSQA 4M75B 1NM7A 3CC4Q 2HQHA 2R5MA 2PUKB 2ZZDA 4M75C 1UJYA 1EFNA 3G6EA 4M7DA 5LJ3e 1M4ZA 2A3LA 3CC7T 1BIBA 1B07A 1TUDA 1J3TA 2BE7D 2DVJA 2HAXA 3RERA 1YJNA 2FVUA 1KIKA 4GLKA 2ZPGB 3VRYA 3HP9A 2LC4A 3HFOA 3M0QA 2HSEB 2BKDN 2L0AA 2XICA 1K0XA 2JUFA 4MMLA 4C8QF 2F5TX 5FW9A 2RB6A 2BE9B 4E7KA 1KD1U 1SEMA 5KYYA 2E10A 3CCVT 4LDYA 1FWZA 4FT4A 4ZN1A 3BW1A 4JPBW 5GAN8 3NTHA 3HL8A 1BI3A 2D8JA 2RM4A 1QQJA 1AHJB 4HT9A 3A8GB 4PLLA 3L1AA 4XTZA 1K8AC 2FB7A 4QVDA 2DERA 2BZ8A 3FLGA 1M3CA 3GOXA 1VQPT 1JJ2S 4GLMA 4JLGA 3SB2A 4C8QG 1I5OB 3TSZA 3E9GA 5A0GA 4ZGEB 5GANd 1HYOA 1PSEA 2K57A 2K5FA 4LNPA 3J81E 4RCCA 2DXBA 5KYNA 3CC4A 2LZ6B 4C8QD 3JCMc 3UT1A 1C1AA 2MF2A 2X35A 3PTAA 2LJ0A 2XDDA 7AT1B 1HD3A 1YIJA 3H6ZA 5HKCA 4BI8B 2ATCB 3S3OA 1FYNA 3JSCA 1SPKA 2DMOA 2AT1B 2LTOA 3EG9A 5KYUB 1PRLC 1KC8C 4ANJA 4C8QB 5LJ5e 3OYJA 1UHFA 4LDWA 1YCSB 2EJGA 4KUIA 3M5AA 4OB1B 1K76A 1G3YA 3M0RA 1H92A 1K9MR 2FYKA 3FJ5A 5CR2A 1PSFA 1YHQQ 3FJPA 2E41A 2E3IA 1VQ7T 1QCFA 3JCMg 4M7AE 4R56A 1SG5A 4FIBA 1NPRA 5KH6A 2LT4A 2QA4Q 4LE9A 1W6XA 2A37A 3G6ET 2IPOB 1PD0A 1P92A 4D8DA 3M0TA 1RL2A 2RJDA 5IHIA 3MEAA 1YJNT 4A63B 2BZXA 3WVEB 4B9WA 2K2MA 3CPWP 3CCMQ 2GTJA 4P5NA 2O4XB 5IHKA 5LJ3j 3REBB 4M7DE 4QVZA 3QG1A 1G8XA 4RTVA 4C92A 3U23A 3KUFA 1E6GA 5LJ3h 2HEQA 3SFMA 3CCSQ 3G4SQ 1NYGA 3SWNA 4M77F 3OBWA 5AYFA 3JCMW 3CCET 2HZYA 3MHXA 1D3BB 3QJ6A 4E7JA 1N8RR 2YSQA 2C06A 1VIEA 2DA9A 1RAAB 1N8RU 2FZCB 1UGSB 1R77A 4EMKB 2RN8A 4BE1A 2LNHB 2RHIA 2HMAA 1N9SA 1YHQA 2YUNA 4F7UF 2DJZA 1QVGP 4FCYA 3E1SA 1AZGB 2XDBA 2E4HA 3DKMA 3CC4T 2LMJA 4X34A 5CKEA 5EG2A 1BBZA 3ER0A 3INZA 1R8OB 4XK8E 2QA4A 2K3YA 1RI9A 2EW3A 3TSWA 4M77G 4MZMA 3ZL7C 3M0UA 2G3RA 1VQMQ 2RK1A 2AZVA 5CKDA 2RJCA 5GANg 4VUBA 3CCQA 4JJCA 2PVDB 3LX7A 3CCMA 3GNFB 5D6YA 4B6MA 4F7UG 1X6GA 1BB9A 1GCQC 2KQWA 2X51A 1Y07A 3FRNA 4M77B 4PJOD 5GAN3 2RI5A 5LJ5j 2EVRA 2VV5A 3DLMA 1VQKA 3EFOA 3P8BB 3HFNA 2A36A 3G4SA 1K9AA 5EC7A 2R58A 4PJNA 2W0ZA 3FEOA 2CZ7B 1B7TA 2EQUA 2DTOA 4NL3A 2EQJA 1RLPC 4PJOC 2GFUA 3E9FA 1FMVA 4F7UB 3CPWS 3WVDB 1WX6A 2EFIA 4J9GA 1TUGB 3MP8A 2LQKA 3LGLA 2FZKB 2K2VA 5FU6B 4RTYA 2RMOA 5LL6S 1MV3A 1RLQC 5C6SA 3J7AF 2AHJB 1X27A 2LT1A 3ASKA 1K8AU 4X9DA 2RI3A 3JCMX 1SRLA 4A54A 4BB7A 1D09B 1QVFS 4NOYA 1KK7A 5FWBA 1VYUA 2JM8A 4OF1A 4XU0A 3VS4A 4C92E 1QLYA 4C5GA 3MEUA 3V7CA 2PNIA 1JBMA 4ELZC 3IQLA 2CT3A 2K3XA 4CC4B 4E7SA 2HL5C 1BU1A 1YHQT 3EGXB 3ME9A 1YJWQ 3L2WA 2RI2A 3PVLA 3QZ5B 4C0DB 4XTXA 3GNGA 1BYMA 2XHCA 3OSSC 1UHCA 2CYZB 3OMCA 4C0DC 4QW2A 3MP1A 2QA4T 2M1HA 1ZSZC 4WF2A 2ED1A 4KT0E 1KC8R 1KHCA 1OX9A 3OA6A 1E7OA 4RMOA 2E70A 1KD1C 2RQTA 5FU7C 1SKUB 4J9CA 1OPLA 2DVEA 1Q81U 1SRMA 1WQWA 1PCXA 1SF9A 3JCMf 3KXTA 3ZEHA 2FL7A 2JNGA 3CCMT 2K6DA 2XI9A 4FYVB 3LH0A 4IIMA 1U1SA 2AKKA 2K3BA 4QKUA 2WSFE 1Q82U 4JRQA 1QVFA 2RHYA 2NUPA 2KGTA 1NPPA 3OW2S 2D6FA 1YFNA 2ED0A 1BI0A 1SHGA 4XQ3A 3CCST 1OZ3A 2QGGA 3G4ST 2EKHA 2QASA 4CRIA 1PNJA 5LJ3d 5KYUA 4QQ6A 2DL8A 1SSFA 4C8QA 1KFZA 1X2QA 4FSXA 1RAEB 1I8FA 4QQDA 1MV0B 1RAGB 3OYIA 4D8KA 1AWOA 2DF6A 3V8JA 3RIRA 1YJWA 5GANh 4LUEA 3EG2A 5IH2A 2DL4A 4XU1A 2NUZA 4PFZA 2KYMA 1M8MA 2LX9A 4LDXA 3I9QA 1S72Q 3GLXA 1CKBA 4HCBA 1LNXA 5IAYA 2MAMA 1VQMT 3S6WA 2ESWA 4HKEA 3C95A 4M75E 2P0PA 1HK9A 3RKYA 3CBPA 2KVQG 3OW2A 1JO8A 2O4XA 5L8RE 1UFFA 2L8DA 1BCMA 4DBHA 3LGFA 5KYXB 2QYZA 1M30A 3HHTB 2JOYA 2J05A 2ZCFB 1QW1A 4LDVA 1MNEA 2DFUA 4AFUC 1IO6A 2EWNA 4DEXA 2AK5A 1YITQ 2YHTA 4ORZA 3REAB 1D0XA 4XU3A 2QQBA 1D3BA 5GANf 2CP0A 2FRWA 4Z88A 4OGCA 3MKDA 2FPEA 1NJIU 3M59A 1VQ8Q 4L59A 5ECAA 1KQSP 4EMKA 5LJ5d 2YT6A 2O88A 1VYTA 2K79A 2P4TA 4CC7A 1UGVA 2D1XA 2QQRA 1UUEA 2CZ1B 2EYXA 4MZPA 3BDLA 4E7ZA 1DJ7B 2EGEA 2LNVA 1LPLA 1MMGA 3OYAA 4LUDA 2QQ9A 2M0OA 4J9IA 1EZZB 3OS1A 2YRDA 1TOVA 2XIDA 4FM4B 1M1KC 2DBMA 2ABLA 2KRSA 1WYXA 3CXCS 2K9GA 1U3OA 1VIFA 2MCNA 2V8IA 2F5KA 3JB9J 3UA7A 4OMLA 3LW5E 3ZBDA 1T3LA 4HVWA 1H3HA 1CKAA 3R6NA 3KBGA 2XD0A 1W2BA 3M4GA 4BY6B 1D0ZA 3X25B 4M77A 4F04B 1YJWT 2R5AA 4ZTFA 4C8QE 3PIPA 5KCHA 1M3AA 1AD5A 5LJ3g 2HBPA 5GAN2 3X20B 2DAQA 2KXCA 2YRCA 1YITA 2RH2A 1OULA 2CGHA 5GAMe 2OAWA 2EGAA 2DBKA 2QAZA 4F16A 1B34B 1G3SA 4F7UA 3JV3A 5GJVB 1VQ8A 3E19A 1YIJQ 5GAOl 3QJYA 1K73U 5J3BA 2KROA 1XTDA 4GY5A 4LD9K 1VQ9A 2X4WA 4N0AA 1M1FA 4IURA 2E64A 3CD6Q 2RQWA 2H8HA 3CXCA 1B3QA 2COWA 1WHGA 4E7IA 4J9DA 1PKTA 2L3PA 4DBRA 5FRMA 4IUPA 5HCKA 2A28A 1M2OA 1KD1R 1TXQA 1ACMB 1WQ7A 5FRNA 1AZEA 4PJMA 4Z02A 1JQQA 4J9BA 4WTOB 2COYA 2QEXA 2DEQA 4Z89A 4JLIA 2NLUA 1I1JA 4C5HA 2IIMA 3RBBB 4C5IA 2RD1A 1UTIA 3HSBA 5J39A 4PJLA 2LX7A 3EGXA 1Y96B 3QHSA 2DM1A 5GAOm 2FPFA 3OYLA 1M27C 2V8JA 1FXXA 1RADB 2E6NA 2YXYA 5IXFA 4ZGDB 1LOJA 3JCMP 3O5ZA 1S72T 1QCNA 4OMMA 3LWHA 1OQKA 1TH7A 6AT1B 5LJ5g 1YJ9Q 3CC2Q 3PE0A 3RR6A 3RNJA 1IGQA 4J5YA 1H641 1KJWA 2EQMA 1W70A 1MNDA 1WJQA 3D7SB 4FW2A 2CSQA 2HQEA 4KH1B 3SHWA 2GQIA 2MWPA 2CP7A 3RKXA 1WHLA 2QI2A 4XTWA 1OI1A 5GAN5 3CD6A 2KBTA 1Q7YC 3L2VA 1Q81C 4PLIA 3HRSA 3H41A 2ZPIB 3CPFA 5HY6A 3OS0A 1OYXA 1BK2A 2J6OA 4J9HA 1YITT 1JXOA 2DIQA 3P8HA 3UF4A 2A7YA 2KDSA 1WA7A 1KG1A 1AWJA 1Q82C 3T9NA 4M77E 3UWNA 2DZCA 2O9SA 3OY9A 1JJ2A 1VQ8T 1VQ5A 3QWYA 4QQGA 2DO3A 4IUUA 5KYWB 2OI3A 4XU2A 1GBRA 3VS2A 3N5BB 5GAMj 3OQ5A 3CCQQ 1Y7XA 4FYWB 1N5ZA 2EGCA 1N27A 4B9XA 3A1PA 5GAMh 2P0QA 4F7UE 5GAN4 1WHKA 1RACB 2RHUA 2K5LA 5GAOq 4JRIA 4RTXA 4OVAA 2RJFA 5I11A 4OGEA 1RAIB 2JN0A 2L89A 5CQXA 1YJ9A 3CC2A 2M02A 1VQKQ 3TREA 4CI0C 1GFCA 2J6FA 4ATOA 1K4US 1Y71A 3VS1A 1PM3A 1OEBA 5KYXA 1X6OA 2XDPA 5GMKl 2KR3A 1T0JA 2IG0A 2YUQA 4O5VA 1W4SA 3L2UA 1UGRB 2E3HA 4XTUA 1M1KR 1M90C 3QDRB 1UJ0A 4M7AF 4PJOF 4KGXB 3CMAQ 3EGDB 1M1KU 4MDXA 4HVUA 4RCBA 4IUTA 2VYTA 3A8MB 3PMIA 4GBQA 2QQSA 5GJWB 1V29B 1G5VA 1I4K1 2CUDA 1VQ6Q 5GAMf 2DLPA 3CCJQ 4LDUA 4L6V5 1YIJT 3CCLA 4D6WA 4M78F 4FSSA 1TUCA 1T3SA 4KGVB 5LJ3f 2FEIA 3URGA 1BKBA 2YUOA 2F2XA 1WJSA 1PWTA 3CD6T 3RESA 1LJOA 4X9CA 5GMKm 4M7AG 4N4IA 2OJ2A 2E65A 4PJOG 2KEAA 1FMKA 1NJIC 1VYVA 1X01A 4LXCA 2DL7A 4C5EA 3CCUA 2KRMA 2GBQA 3CCRA 5CKHA 4BDZA 1QVPA 3LH5A 4OP0A 3VS0A 4EMGA 2P0KA 1BI2A 1WI7A 2ROLA 4XTYA 4M7AD 1OOTA 4N4GA 2EPDA 4OMNA 3X24B 3A98A 2DJQA 4NL2A 1I81A 2HNIA 5DLQE 3OSVA 2NUTB 2A0FB 4Y91A 4M78G 5LJ5h 5CCAA 1ZA1B 4M7AB 5GMKe 4PJOB 1MMDA 5A2QE 4M7AC 2D0QB 1SHFA 1ZX6A 1TG0A 1I5LA 3OYCA 3UA6A 3CMAA 2VXFA 4M78D 4J6XA 2K7AA 4M75A 3QDFA 2EYZA 2KT8A 1B34A 2AZSA 1D1CA 2AKLA 1YJ9T 3M56A 4EIKA 3CC2T 2GNCA 4M78B 1K8AR 3AT1B 1VQ6A 2ZPFB 2L3RA 1FX7A 2JS2A 2JJ9A 4M78C 2MIOA 5CQYA 3VV0A 1WXUA 3CCJA 4BUGA 3QZ9B 3HTRA 8ATCB 4M7DC 1Y0MA 1YI2A 2JTEA 2PU9B 3SD4A 4J83A 1U06A 5DM7R 4ELYC 4HCZA 2DKGA 2EAYA 1IRXA 1TSFA 5LJ5f 4F14A 1BCOA 2CP3A 1K73C 2DL5A 1YP5A 4Q5WA 4R55A 1CSKA 3ZFJA 1OPKA 1QVGS 3M58A 3FIFA 1ZSZB 4LD6A 4JDSA 1GFDA 3BY7A 1S1NA 2DXCA 2KY9A 3CBMA 3CBOA 1V1CA 1OU9A 3VS6A 4BE2A 1VUBA 1Y96A 1T0HA 3LYIA 5FU7B 4JRPA 2QTVA 1Q7YR 2J06A 2VB6A 3CPWA 3I56Q 2YLCA 2E12A 1VOMA 1Q81R 1Q7YU 5KCOA 2HQXA 1R0CB 4C0GA 4PKCC 3CCQT 4OB2B 4RTZA 1JRIA 1M9SA 1NEBA 1OZ2A 3OB9A 1WNLA 2V1QA 1Q82R 1NLPC 2EBPA 3UPUA 5FROA 2JMCA 3PMTA 4LN2A 4C0ZA 3C12A 2MOXA 5GAMd 2DETA 2QQAA 3JAME 1X75C 1VQKT 4QT7A 2DYIA 4HCCA 4PFPA 3BE3A 3DB3A 4IIOA 4BI4A 3VUZA 2RNAA 4J7FA 2J7IA 3OS2A 2YRVA 1I07A 2MPXC 2CZ0B 3SDZA 1QVGA 2LQNA 3MPUB 3V7SA 2OTLA 5GAOp 1WXBA 1X2KA 3RKWA 3UDCA 3CMAT 2C0TA 4KBMB 2XMFA 1OV3A 2DPPB 3CEYA 5CKFA 3L2QA 3X26B 2PZ1A 1K0SA 1XOVA 5GMKj 2HCKA 4PJJA 3OYYA 3PVQA 4AG2C 5IXBA 4JS5A 1VQ6T 1QWFA 4J9EA 3I5RA 1F1BB 2FZGB 2LVMA 3RMQA 5GMKh 3LWIA 2CDTA 3NTKA 2LQ8A 4L5GA 3CCJT 1M90R 5AT1B 2F2VA 1WHJA 1M90U 3I56A 1AOJA 3M57A 4BI3A 2BUDA 2DD4A 1G3WA 3GF5A 4C92D 2M9UA 2V1RA 2I0NA 5J26A 3G71Q 4OB0B 1GRIA 1X6BA 1K9MC 5GAN6 4DA4A 1WJRA 1IHVA 2X3WD 1IGUA 1VQOQ 2JW4A 4C92C 2BZYA 2P84A 2HBWA 4E6RA 2CS7A 2X4XA 2E5QA 2JT4A 4DOVA 2FHDA 3Q1JA 4PNOA 1NJIR 3SWNC 4WCIA 2LCSA 1WZOA 2QXFA 2EYYA 2HDAA 2FPDA 2Z0WA 3EFRA 3EGDA 5I2MA 3VYGA 4A4EA 3QBYA 2ZGWA 3S3NA 1IZ6A 2L3QA 5CVIA 1VQ9Q 3H9NA 5KE2A 4A4GA 3EG3A 1PKSA 2RA2A 3UATA 1QP2A 3V8KA 3AHUA 1MMNA 2VC8A 1W1FA 2CP6A 1PHTA 3BDUA 4R0KA 3OYHA 3OBYA 1TTHB 1SSHA 3FB9A 3VS3A 2VXEA 2ZPEB 2QEXQ 1M5Q1 1WPYA 2CZ6B 4J6YA 3QYHB 2Y90A 3FDRA 2VKNA 1WHMA 1YCYA 1YBYA 5L23A 4RTTA 1C6VX 2JZ2A 3HRTA 2X4JA 3FC3A 1GCQA 3QIIA 1TU0B 4N4HA 4YTLA 4A4FA 2CUBA 2RO0A 5GAMg 3EG1A 3G1JA 4CC3A 3I55Q 3G71A 2QGFB 1E6HA 3JCMV 5HK0A 3NFCA 5IHNA 1EIFA 2KYBA 3ULRB 3WXMB 1ZA2B 2G6FX 2NUTA 1VQOA 1NZ9A 4II1A 1KQ1A 2F69A 3QPHA 2SRCA 1NLOC 4PJOA 1JB0E 2XG8D 1KQ2A 2E6ZA 1WFWA 3CMEQ 3I56T 3M55A 4AMCA 2PVOB 2DL3A 1ARKA 2D8HA 4IUVA 1K73R 3EHQA 2P4RA 2VVKA 2DK3A 3EG0A 2DX1A 4BE0A 2FO0A 1ZBJA 1VQ7A 3M54A 2KNBB 3JCMb 5IN1A 1QKWA 1XNIA 4M78A 3DB4A 1PRMC 3GP8A 2VGMA 2KI7A 4E47A 2DIGA 2MYSA 2RPNA 2HD0A 2EQKA 2E5KA 1Q86C 2FRYA 2F1LA 1VQ5Q 4J9FA 2O2OA 2C0OA 1KQSS 2JM9A 3EHRA 5I21A 1FMWA 1ZHIA 4AG1C 2ECZA 8AT1B 3NMZC 1ZSZA 4ZTJA 3I55A 1XJWB 4TVRA 3M0PA 1IB8A 3H0IA 4OB3B 3L2RA 3TVTA 5D7UA 1UB4A 3CCEA 2PTKA 2JTFA 2EQIA 1WXTA 4ME7A 3QO3A 2ZAEA 4EMHA 1Q95G 2CH4A 3CMEA 3I5SA 1H3ZA 1M3BA 4JRKA 1MMAA 1QKXA 2I2LA 3G71T 4JJBA 2X4YA 4ZN3A 1NBEB 4XTVA 1K1ZA 2LRQA 2QG9B 2ZPHB 5DY9A 2X3XD 2NUPB 2LP5A 1VQOT 2GQVA 4HVVA 1ABOA 1KQSA 1GBQA 2EJFA 3BFMA 1M8VA 2A08A 3M4YA 3QSUA 3CCLQ 4C8QC 2PUOB 3PFSA 3P8DA 1UECA 1MUZA 2F2WA 2HL3A 1K9MU 5I2SA 1VQ9T 2DNUA 2XKOC 3M0SA 2DE0X 4DEYA 2RQVA 4C0FA 4Y28E 4PJOE 2QDLA 1HJDA 1G3TA 4AFQC 3HRUA 1QMCA 2CSIA 3A5ZB 3CCUQ 2HSPA 3C4SA 4KH0B 3CCRQ 2GCXA 4KULA 1VQLQ 1O75A 3RMSA 2GF7A 2W10A 1ZQ1A 2ROTA 1G83A 1ZUKA 2LQWA 2QEXT 3PT9A 4KUDK 3JCMe 3VU3C 2EYWA 4J7IA 2M16A 2HKQB 2YWWA 3QWXX 2DEUA 5DLOA 4M78E 3META 1KSWA 3R6OA 3VRZA 1NG2A 4K11A 1U5SA 2LJ1A 3JCMQ 3KFVA 2QDYB 3I55T 2O9VA 1YNZA 4JZ3A 2K4YA 1G2BA 1RAFB 2DRMA 1U8RA 4AT1B 1D1AA 2QTXA 2L2PA 2K5IA 2VGNA 3OYEA 1Z9QA 1QVFP 3O8VA 1IHWA 4DQ2A 2KMTA 1VA7A 4IUQA 4KGZB 4UC4A 3CMET 1QWEA 1UEBA 5CAIA 2Y4XA 3S3MA 4OMPA
chains in the Genus database with same CATH topology
2FB7A 4QVDA 5KCOA 2HQXA 4E7HA 4EPCA 2YLBA 2P4TA 4JJNK 2QQRA 3FLGA 2BIVA 3GOXA 4C0GA 2CZ1B 4PKCC 4OMFB 4MMKA 1VQPT 2MMPA 2RHZA 4EMKC 4OB2B 5HK3A 3CCQT 4MZPA 1JJ2S 3JB9F 3BDLA 1JRIA 4JLGA 1DJ7B 3SB2A 4M7DF 2LNVA 4C8QG 1M9SA 3OYAA 4KUDK 3JCMJ 2QQ9A 1OZ2A 3OB9A 1WNLA 3E9GA 5A0GA 4ZGEB 5GANd 1PSEA 3UPUA 2K57A 2K5FA 2M0OA 5FROA 3PMTA 3C94A 3J80E 3OS1A 3RUXA 4C0ZA 3J81E 2DTIA 2XIDA 3C12A 4RCCA 4FM4B 1M1KC 2DXBA 3CC4A 5GAMd 1VQLA 2QQAA 4C8QD 3JAME 3OYBA 1N6AA 3JCMc 1X75C 2MF2A 3UT1A 3CXCS 2X35A 3PTAA 3MEVA 1VQKT 2XDDA 1VIFA 4HCCA 2H3JA 2V8IA 1YIJA 3H6ZA 2F5KA 2EIFA 5HKCA 1UGPB 3DB3A 4BI8B 4BI4A 3JB9J 3VUZA 3S3OA 2MWOA 1VQ5T 3JSCA 3LW5E 4J7FA 4M77D 3ZBDA 2LTOA 3OS2A 2Y4YA 4MZTA 2YRVA 1KC8C 2CZ0B 3KBGA 2L5QA 4C8QB 5LJ5e 3OYJA 1W2BA 4HT8A 2XD0A 3HKSA 3SDZA 3M4GA 4LDWA 3S3MA 1QVGA 4BY6B 2EJGA 3V7SA 3TU4K 4KUIA 3M5AA 4OB1B 5CK9A 5GAOp 2OTLA 1G3YA 3JB9G 3X25B 2FYKA 1WGSA 3RKWA 4M77A 3UDCA 3CMAT 4M7DG 5CR2A 4KBMB 1YJWT 1PSFA 2R5AA 5IT9E 4ZTFA 3FJPA 2DPPB 3CEYA 3L42A 4XTZA 4C8QE 5KCHA 3PIPA 2E41A 5CKFA 3L2QA 3X26B 5LJ3g 2HBPA 5GANe 5M9OA 5GAN2 4M77C 1VQ7T 3JCMg 3X20B 4M7AE 3CCSA 1Q86U 4R56A 1XOVA 3JB9H 4FIBA 1NPRA 2DAQA 5GMKj 5KH6A 2B8AA 2LT4A 3JB9D 1YITA 3G6ET 2RH2A 3OYYA 4M7DD 1MGQA 3VYHB 2CGHA 4JS5A 5GAMe 1VQ6T 1P92A 5CIUA 1RL2A 2RJDA 2LVMA 2XK0A 3RMQA 5GMKh 3LWIA 3NTKA 4L5GA 2LQ8A 3TEEA 3CCJT 4J8OA 1B34B 1G3SA 4F7UA 3MEAA 1YJNT 1VQ8A 3E19A 5GAOl 1M90U 3QJYA 3I56A 1K73U 5J3BA 4M7DB 3WVEB 1XTDA 4FU6A 4GY5A 4B9WA 3M57A 4LD9K 4BI3A 2BUDA 2DD4A 2RK2A 1G3WA 2X4WA 1VQ9A 2LDMA 4N0AA 3GF5A 1M1FA 4IURA 4C92D 2E64A 2DZ9A 4P5NA 2LCCA 1BI1A 2M9UA 3CXCA 2O4XB 5A0LA 4E7IA 5LJ3j 4IKFA 5J26A 4RKUE 4OB0B 5KE3A 5D6WA 4M7DE 4QVZA 4N0AC 5FRMA 4IUPA 3QG1A 1K9MC 4C92A 5FU6C 4BDYA 3KUFA 5GAN6 1WJRA 4DA4A 1WQ7A 5LJ3h 2ZPBB 5FRNA 3SFMA 4Z02A 3JCMh 4A53A 4C92C 1HXDA 3SWNA 1VQMA 1NE8A 4O6JA 3V8LA 4M77F 2CS7A 2QEXA 2DEQA 2X4XA 3OBWA 4JLIA 5AYFA 3JCMW 3CCET 2NLUA 2E5QA 4C5HA 1IREB 4DOVA 2FHDA 2WSEE 3Q1JA 4C5IA 2RD1A 3MHXA 4PNOA 3HSBA 1D3BB 3SWNC 3QJ6A 5J39A 4E7JA 1XQHA 2C06A 3CCLT 2KSSA 2XU8A 2QXFA 1VIEA 3EFRA 5I2MA 1N8RU 3VYGA 3PNWC 4EDUA 1UGSB 1Y96B 3QHSA 4A4EA 3QBYA 2ZGWA 3S3NA 1IZ6A 2DXUA 4JUVA 5CVIA 4EMKB 5GAN7 5GAOm 4JS4A 4BE1A 1VQNA 4PL6A 5C0MA 2RHIA 3OYMA 5KE2A 3OYLA 4A4GA 3DLLA 1N9SA 2V8JA 1YHQA 1FXXA 4F7UF 2DJZA 2DTHA 2E6NA 2OAUA 2RA2A 3CCUT 1QP2A 4ZGDB 3HPWA 3E1SA 3V8KA 3OYKA 3AHUA 2XDBA 3CCRT 3QKJA 3DKMA 3OS5A 3CC4T 4X34A 5CKEA 2VC8A 1LOJA 5EG2A 1VQLT 3JCMP 2GFAA 3ER0A 1ZBXA 1KC8U 1S72T 1VQ6A 3INZA 3BDUA 1R8OB 4J6WA 3OYHA 3LWHA 4XK8E 2QA4A 1TH7A 2K3YA 3OBYA 5LJ5g 4M77G 4MZMA 3FB9A 4BD3A 2VXEA 2G3RA 2JVVA 2R57A 2ZPEB 3M53A 2RK1A 4J5YA 1H641 2EKOA 2EQMA 1M5Q1 1WPYA 2CZ6B 1KHIA 4J6YA 4C92F 1WJQA 3QYHB 2Y90A 3FDRA 1YCYA 1YBYA 5CKDA 2RJCA 2HQEA 5GANg 4VUBA 3CCQA 2PVGB 2V8KA 2JZ2A 3HRTA 2X4JA 2PVDB 2MWPA 3LX7A 3RKXA 3FC3A 2QI2A 3QIIA 1OI1A 4XTWA 5GAN5 3VJPA 3MEWA 3CD6A 3CCMA 4N4HA 3GNFB 4YTLA 1Q7YC 3L2VA 2KK4A 5D6YA 4FL6A 4A4FA 2RO0A 3X28B 5GAMg 2D9TA 3A8HB 4PLIA 3G71A 4HA8A 4F7UG 3JCMV 4E7LA 1Q81C 3HRSA 2ZPIB 3CPFA 3NFCA 2KQWA 1OYXA 1U1TA 1EIFA 5HY6A 5HK0A 3OS0A 1Y07A 3FRNA 4M77B 3WXMB 4PJOD 5GAN3 2OTJA 2RI5A 1YITT 2DIQA 5LJ5j 2VV5A 3DLMA 3P8HA 1VQOA 3L2ZA 1NZ9A 4II1A 1KQ1A 1VQKA 2A7YA 2F69A 2KDSA 1KG1A 3P8BB 3HFNA 3G4SA 4NS5A 1Q82C 2WSCE 3QPHA 3T9NA 4A4HA 4PJOA 3MO8A 1JB0E 2R58A 2XG8D 4M77E 1KQ2A 3UWNA 2DZCA 3OY9A 3GPLA 1JJ2A 1VQ8T 2E6ZA 1VQ5A 1GXIE 3FEOA 2CZ7B 3I56T 2EQUA 3M55A 2DTOA 4QQGA 2DO3A 5CKBA 4C92G 2EQJA 4NL3A 4IUUA 5GANj 5CO7A 4DOWA 2PVOB 1VQ4A 4PJOC 2GFUA 1BIAA 4IUVA 3E9FA 4XU2A 1YI2T 4A4KA 4MDWA 4F7UB 3N5BB 2DK3A 3OQ5A 4FT2A 5GAMj 3OYGA 3CPWS 3WVDB 5GMKi 2DXTA 4BACA 2EFIA 4BE0A 1Y7XA 3MP8A 1VQ7A 1N27A 2LQKA 3LGLA 3M54A 4B9XA 1UGQB 3JCMb 3OYFA 5IN1A 2K2VA 1XNIA 5GAMh 2P0QA 3OMGA 4F7UE 4M78A 5GAN4 5FU6B 3VKIA 5LL6S 2RHUA 5C6SA 3J7AF 2K5LA 3DB4A 2AHJB 4RG2A 5GAOq 4JRIA 3G7ZA 2VGMA 2RJFA 4OVAA 3GP8A 2LT1A 4OGEA 5FLXE 2KAFA 2PQWA 3ASKA 2JN0A 4E47A 1K8AU 2DIGA 4C92B 1RI0A 4X9DA 1MHNA 2L89A 5CQXA 1YJ9A 2HD0A 2RI3A 2EQKA 3VUBA 3JCMX 3CC2A 3TREA 1Q86C 4CI0C 4A54A 4BB7A 3PGGA 3QYGB 3A8LB 1QVFS 4ATOA 4NOYA 1Y71A 2JTMA 3CC7A 1X6OA 2XDPA 5GMKl 3SWNB 3QUIA 4OF1A 4XU0A 3V7RA 4C92E 2RJEA 3M9QA 4C5GA 3MEUA 2IG0A 3V7CA 1KQSS 4O5VA 1JBMA 1W4SA 4ELZC 1UGRB 2MI6A 3L2UA 1VQNT 2CKKA 4XTUA 2K3XA 3F70A 1M90C 3QDRB 5I21A 4M7AF 2RHXA 4PJOF 1YHQT 3ME9A 1M1KU 1ZHIA 3L2WA 4MDXA 2RI2A 3QZ5B 4ZTJA 4C0DB 3I55A 1W2BS 4XTXA 4RCBA 4TVRA 3GIBA 3NTIA 3GNGA 1BYMA 2XHCA 3OSSC 4IUTA 2CYZB 1M1GA 3OMCA 2VYTA 4QW2A 4C0DC 3MP1A 4RG8A 4OB3B 3PIOA 3L2RA 3CCVA 2QA4T 2M1HA 2EYQA 1UB4A 4WF2A 4KT0E 3A8MB 2EJ9A 1KHCA 3PMIA 3CCEA 2QQSA 4QVCA 1V29B 2JTFA 1G5VA 1I4K1 4M75F 5GAMf 3OA6A 4RMOA 2E70A 2LCLA 1KD1C 5FU7C 4ME7A 3QO3A 4LDUA 5D6XA 4L6V5 2DVEA 4EMHA 1YIJT 1Q81U 4D6WA 3CCLA 1N9RA 3CMEA 4M78F 2WACA 3CC7T 1H3ZA 2E1HA 5LJ3f 1WQWA 3JCMf 3LLRA 3URGA 1BKBA 4JRKA 4ZGJB 3OYNA 3KXTA 3ZEHA 1WJSA 2I2LA 3EFSA 2FL7A 2JNGA 3CCMT 3RESA 3CD6T 1LJOA 4X9CA 2XI9A 3MCAB 5GMKm 3LH0A 4N4IA 1VQPA 2E65A 4PJOG 1U1SA 2OTLT 4M7AG 3G71T 1NJIC 2WSFE 2X4YA 4ZN3A 1Q82U 3QXEB 1X01A 4XTVA 4C5EA 4JRQA 1N8RC 3CCUA 1QVFA 2LRQA 3OYDA 2RHYA 2ZPHB 3CCRA 3EAEA 5DY9A 5CKHA 2OTJT 1NPPA 3OW2S 4BDZA 2D6FA 1QVPA 4OP0A 1BI0A 1S72A 1VQOT 4XQ3A 4EMGA 2P0KA 1BI2A 2DD5A 2GQVA 3CCST 4XTYA 1OZ3A 5GAOn 3G4ST 3JRZA 5GAOr 1KQSA 4M7AD 4CRIA 1O9SA 5LJ3d 4N4GA 2EJFA 4M75G 3JCMd 3X24B 1QP3A 3TCJA 4QQ6A 3BFMA 1SSFA 4C8QA 1M8VA 4NL2A 5DLQE 1I81A 2HNIA 3OSVA 3M4YA 4Y91A 2VUBA 1VQ4T 4M7AA 4M78G 5LJ5h 3QSUA 4FSXA 5CCAA 1I8FA 4C8QC 4M7AB 4QQDA 5GMKe 4PJOB 2PUOB 3PFSA 3P8DA 3H8ZA 3OYIA 4BY6C 5A2QE 4M7AC 2D0QB 4M75D 1K9MU 5I2SA 1VQ9T 2XKOC 5A0DA 3A8OB 1I5LA 3MP6A 3OYCA 3V8JA 3RIRA 4C0FA 3CMAA 4Y28E 2VXFA 4M78D 5GANh 1YJWA 4PJOE 4J6XA 1G3TA 2O01E 3HRUA 3JB9I 4M75A 4V2SA 3A5ZB 4XU1A 2IVWA 3C4SA 4XAXB 4M75B 2GCXA 2LX9A 4KULA 4LDXA 2R5MA 1O75A 1B34A 2GF7A 2PUKB 2ZZDA 4M75C 1ZQ1A 3RMSA 1YJ9T 3GLXA 3M56A 3CC2T 4HCBA 4M78B 1LNXA 3G6EA 5IAYA 2MAMA 1VQMT 4M7DA 5LJ3e 3S6WA 2QEXT 2ZPFB 1M4ZA 2A3LA 2L3RA 3PT9A 3C95A 1FX7A 4HKEA 1BIBA 4M78C 4M75E 5CQYA 2P0PA 3VV0A 3JCMe 3VU3C 1K8AC 3CCJA 1HK9A 4J7IA 3RKYA 3QZ9B 3CBPA 4BUGA 2M16A 2KVQG 2HAXA 3OW2A 3RERA 1YJNA 4M7DC 2FVUA 2O4XA 5L8RE 5DLOA 1YI2A 4GLKA 4M78E 2PU9B 2ZPGB 2L8DA 3META 3SD4A 3HP9A 2LC4A 3HFOA 3R6OA 2BKDN 4J83A 4EMKA 3LGFA 5DM7R 2XICA 2JUFA 4ELYC 4MMLA 4HCZA 3JCMQ 2DKGA 2EAYA 4C8QF 5LJ5f 3HHTB 2F5TX 2JOYA 2QDYB 2RB6A 2ZCFB 3I55T 4E7KA 1KD1U 1QW1A 4LDVA 2K4YA 1K73C 2E10A 3CCVT 2EWNA 4Q5WA 4LDYA 1U8RA 1FWZA 4R55A 3ZFJA 2QTXA 4FT4A 4ZN1A 2YHTA 2K5IA 1QVGS 2VGNA 3OYEA 3M58A 3FIFA 4LD6A 4XU3A 2QQBA 1D3BA 3BW1A 4JDSA 3O8VA 5GANf 3BY7A 5GAN8 3NTHA 2DXCA 2KY9A 3CBMA 3CBOA 4DQ2A 2KMTA 3HL8A 4OGCA 4BE2A 4IUQA 1VUBA 1BI3A 1Y96A 2RM4A 1NJIU 1AHJB 3M59A 4UC4A 3LYIA 5FU7B 3A8GB 3CMET 4PLLA 4JRPA 4HT9A 1UEBA 4L59A 3CPWA 5CAIA 2Y4XA 2YLCA 3L1AA 2E12A 5LJ5d 1Q7YU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB7 A;  4PJO C;  4QVD A;  4OP0 A;  1WQ7 A;  5LJ3 h;  2YLB A;  4XQ3 A;  1BIA A;  4EMG A;  3JCM h;  4XU2 A;  4XTY A;  4A53 A;  5GAO n;  5GAO r;  4M7A D;  4F7U B;  4MMK A;  4C92 C;  1HXD A;  4EMK C;  3SWN A;  5LJ3 d;  3V8L A;  5GAM j;  2EJF A;  4M77 F;  1JRI A;  3SB2 A;  2DEQ A;  4M75 G;  3JB9 F;  3JCM d;  4JLI A;  4C8Q G;  2DXT A;  5GMK i;  3JCM W;  4M7D F;  3BFM A;  4C8Q A;  3JCM J;  1M8V A;  1WNL A;  4NL2 A;  1I81 A;  2HNI A;  5GAN d;  2RD1 A;  4PNO A;  3HSB A;  1D3B B;  4Y91 A;  3SWN C;  3JCM b;  4M7A A;  4M78 G;  5GAM h;  2K57 A;  4F7U E;  4M78 A;  5LJ5 h;  3QSU A;  5GAN 4;  1I8F A;  3RUX A;  4M7A B;  4C8Q C;  3EFR A;  5GMK e;  4PJO B;  2DTI A;  4RCC A;  5GAO q;  1Y96 B;  3QHS A;  4JRI A;  5GAM d;  4M7A C;  2ZGW A;  4M75 D;  2DXU A;  2JN0 A;  4JUV A;  4C8Q D;  3JCM c;  4C92 B;  4EMK B;  5GAN 7;  5GAO m;  4X9D A;  1I5L A;  3JCM X;  3V8J A;  3RIR A;  1N9S A;  4A54 A;  3PGG A;  2VXF A;  4M78 D;  4NOY A;  5GAN h;  4PJO E;  4J6X A;  2DJZ A;  4F7U F;  3JB9 J;  2DTH A;  2RA2 A;  4M75 A;  5GMK l;  3JB9 I;  4V2S A;  3SWN B;  4M77 D;  3QUI A;  4XU0 A;  3V8K A;  4XU1 A;  3AHU A;  3V7R A;  4C92 E;  4M75 B;  4C8Q B;  2VC8 A;  5LJ5 e;  1LOJ A;  4HT8 A;  3JCM P;  3V7C A;  3M4G A;  1B34 A;  3BDU A;  2EJG A;  1JBM A;  3INZ A;  4J6W A;  4M75 C;  3V7S A;  5GAO p;  1TH7 A;  5LJ5 g;  4XTU A;  3JB9 G;  4M77 G;  2FYK A;  3FB9 A;  1LNX A;  4M77 A;  4M78 B;  3RKW A;  5I21 A;  4M7A F;  4M7D G;  4PJO F;  2VXE A;  4M7D A;  5LJ3 e;  3FJP A;  4J5Y A;  3JCM e;  1BIB A;  1H64 1;  4M78 C;  4M75 E;  4XTZ A;  4C8Q E;  3VU3 C;  1M5Q 1;  1WPY A;  2E41 A;  1HK9 A;  3GIB A;  4J6Y A;  4RCB A;  4XTX A;  3RKY A;  4C92 F;  5GAN e;  5LJ3 g;  4M77 C;  2Y90 A;  5GAN 2;  3JCM g;  3RER A;  1YCY A;  4M7D C;  4M7A E;  3JB9 H;  5GMK j;  4M78 E;  5GAN g;  3JB9 D;  3HFO A;  4WF2 A;  2EJ9 A;  4M7D D;  3RKX A;  1MGQ A;  4EMK A;  2CGH A;  4XTW A;  5GAM e;  5GAN 5;  4QVC A;  4MML A;  1I4K 1;  3JCM Q;  4M75 F;  2DKG A;  2EAY A;  5GAM f;  4C8Q F;  5LJ5 f;  5GMK h;  5GAM g;  2RB6 A;  3QO3 A;  4HA8 A;  4F7U G;  3JCM V;  1B34 B;  4F7U A;  2DVE A;  4EMH A;  1N9R A;  5GAO l;  1U1T A;  2E10 A;  4M78 F;  2EWN A;  4M77 B;  2E1H A;  4PJO D;  5LJ3 f;  5GAN 3;  4M7D B;  1WQW A;  2QTX A;  3JCM f;  5LJ5 j;  2YHT A;  4JRK A;  3FIF A;  3L2Z A;  4N0A A;  3BW1 A;  1D3B A;  4XU3 A;  1KQ1 A;  2I2L A;  3EFS A;  4C92 D;  2E64 A;  3RES A;  3BY7 A;  5GAN f;  2DZ9 A;  5GAN 8;  1LJO A;  3HFN A;  4X9C A;  5GMK m;  4M7A G;  2E65 A;  4PJO G;  1U1S A;  4DQ2 A;  4PJO A;  5LJ3 j;  4M77 E;  1KQ2 A;  1X01 A;  4XTV A;  1Y96 A;  2DZC A;  2RM4 A;  4M7D E;  4N0A C;  4HT9 A;  4C92 G;  2DTO A;  5CAI A;  5DY9 A;  4NL3 A;  2YLC A;  4C92 A;  3L1A A;  5GAN j;  5LJ5 d;  5GAN 6; 
#chains in the Genus database with same CATH topology
 2JMA A;  4E7H A;  4EPC A;  2YLB A;  4JJN K;  2BIV A;  2LJ3 A;  4Z8A A;  2CP2 A;  4OMF B;  4MMK A;  1Y57 A;  1YI2 Q;  2MMP A;  2RHZ A;  2SEM A;  4EMK C;  1ZLM A;  5HK3 A;  3JB9 F;  1AVZ C;  4M7D F;  3JCM J;  2KE9 A;  5FWC A;  2RQU A;  3GBQ A;  4DBF A;  3C94 A;  3J80 E;  3RUX A;  3EGU A;  2DTI A;  3SEM A;  3H0H A;  1C0M A;  1VQL A;  3OYB A;  1N6A A;  3MEV A;  4ESR A;  2H3J A;  2VWF A;  2EIF A;  1UGP B;  1X69 A;  3VS5 A;  2MWO A;  1VQ5 T;  4M77 D;  2V26 A;  1I0C A;  2Y4Y A;  4MZT A;  2JS0 A;  2GGR A;  2L5Q A;  4HT8 A;  3HKS A;  3TU4 K;  5CK9 A;  2HKN A;  1VQN Q;  1AEY A;  3JB9 G;  4HCK A;  1WGS A;  4M7D G;  4RTU A;  3OW2 P;  5IT9 E;  4E2F B;  1JU5 C;  3L42 A;  1Q86 R;  2KT1 A;  5GAN e;  5M9O A;  4M77 C;  2KXD A;  3CCS A;  1Q86 U;  1M2V B;  3JB9 H;  2O31 A;  2B8A A;  3JB9 D;  4AFZ C;  4M7D D;  1MGQ A;  3VYH B;  3H0F A;  3E2U A;  5CIU A;  2KRN A;  4Y92 A;  4ZNX A;  1A0N B;  2XK0 A;  3TEE A;  4J8O A;  4M7D B;  4PFO A;  4FU6 A;  2RK2 A;  4FYY B;  2CP5 A;  2LDM A;  2DZ9 A;  2LCC A;  1BI1 A;  2OTL Q;  5A0L A;  4IKF A;  4RKU E;  5KE3 A;  1JXM A;  5D6W A;  4N0A C;  2CRE A;  5FU6 C;  4BDY A;  2OTJ Q;  3C0C A;  2ZPB B;  3JCM h;  1IXD A;  4A53 A;  1HXD A;  3CQT A;  5KYY B;  1VQM A;  1NE8 A;  2D0N A;  4O6J A;  3V8L A;  2RF0 A;  3NHN A;  4KRT A;  3I35 A;  1IRE B;  1EX4 A;  2ENM A;  2WSE E;  1V76 A;  1VQ4 Q;  1XQH A;  3CCL T;  2KSS A;  2XU8 A;  4OMQ A;  3PNW C;  4EDU A;  2DXU A;  4JUV A;  2JXB A;  5GAN 7;  4JS4 A;  1VQN A;  4PL6 A;  5C0M A;  3OYM A;  3DLL A;  1W2B P;  2DTH A;  1TS9 A;  2OAU A;  4JZ4 A;  2RQR A;  3CCU T;  3HPW A;  3OYK A;  2M51 A;  3CCR T;  3QKJ A;  3OS5 A;  1VQL T;  2GFA A;  1ZBX A;  1KC8 U;  1WDX A;  4J6W A;  1ZSG A;  1ZUU A;  1YWO A;  2FG0 A;  4BD3 A;  1YWP A;  2JVV A;  2R57 A;  9ATC B;  3M53 A;  2EKO A;  2J6K A;  3CC7 Q;  1KHI A;  4C92 F;  1PG5 B;  2QK0 A;  1OX8 A;  2PVG B;  2V8K A;  2YUP A;  3EH1 A;  3VJP A;  3MEW A;  3EG9 B;  2DIL A;  2KK4 A;  4FL6 A;  3X28 B;  2D9T A;  3A8H B;  4HA8 A;  4E7L A;  2DRK A;  1TWB A;  1U1T A;  1PD1 A;  4FYX B;  3CCV Q;  2AIR B;  2OTJ A;  3CXC P;  3L2Z A;  4NS5 A;  2OX7 A;  1NYF A;  2WSC E;  4A4H A;  3MO8 A;  3GPL A;  1GXI E;  1PC0 A;  3TQ7 P;  5CKB A;  4C92 G;  1GL5 A;  5KYW A;  5GAN j;  5CO7 A;  4FW1 A;  4DOW A;  1VQ4 A;  1BIA A;  1YI2 T;  4A4K A;  4MDW A;  2H3E B;  4FT2 A;  1VQP Q;  1D0Y A;  3OYG A;  5GMK i;  2DXT A;  4BAC A;  1YN8 A;  1WIE A;  1UGQ B;  2DYB A;  3OYF A;  2C0I A;  3OMG A;  1ZUY A;  1AWX A;  3VKI A;  4RG2 A;  3G7Z A;  1RUW A;  5FLX E;  2NYS A;  2KAF A;  2PQW A;  1UG1 A;  3RDV A;  4C92 B;  1RI0 A;  1MHN A;  3VUB A;  4M4Z A;  2L3S A;  3PGG A;  3QYG B;  3A8L B;  4X1V A;  3THK A;  1H8K A;  2JTM A;  3CC7 A;  3SWN B;  3QUI A;  4F17 A;  1GCP A;  3V7R A;  3NGP A;  2RJE A;  3M9Q A;  4OMO A;  1ABQ A;  1UE9 A;  1VQN T;  1X43 A;  2MI6 A;  1RAB B;  2CKK A;  3F70 A;  4CC2 A;  2RHX A;  1D1B A;  1OU8 A;  1W2B S;  3GIB A;  2VAS A;  3NTI A;  1UDL A;  2MK5 A;  1VQ7 Q;  1M1G A;  4RG8 A;  3PIO A;  3CCV A;  2EYQ A;  1R0B G;  2X9H A;  2EJ9 A;  3VS7 A;  3G6E Q;  4QVC A;  1Z9Z A;  4M75 F;  2LCL A;  1LCK A;  5D6X A;  4AFS C;  2NWM A;  1N9R A;  1YJN Q;  2WAC A;  2E1H A;  2YDL A;  4DBQ A;  3LLR A;  4ZGJ B;  3OYN A;  1JJ2 P;  3EFS A;  2OTL T;  3MCA B;  1VQP A;  4PK4 A;  1WHH A;  3QXE B;  1N8R C;  1LVK A;  4RUG A;  3OYD A;  1QCO A;  3EAE A;  2OTJ T;  4RTW A;  2B86 A;  1S72 A;  1RAH B;  2DD5 A;  1AT1 B;  5GAO r;  5GAO n;  3JRZ A;  1O9S A;  4M75 G;  3JCM d;  1QP3 A;  3TCJ A;  2BTT A;  3NPF A;  4HXJ A;  3CCE Q;  1NEG A;  4JJD A;  1VQ4 T;  2VUB A;  4M7A A;  3EFO B;  2GTO A;  1JEG A;  5I22 A;  3H8Z A;  2COZ A;  4BY6 C;  1WLP B;  4M75 D;  1AWW A;  5A0D A;  3A8O B;  2M0Y A;  3MP6 A;  1M2V A;  2CT4 A;  3EH2 A;  2O01 E;  2CH4 W;  3MJX A;  3JB9 I;  4V2S A;  2IVW A;  4XAX B;  1HSQ A;  4M75 B;  1NM7 A;  3CC4 Q;  2HQH A;  2R5M A;  2PUK B;  2ZZD A;  4M75 C;  1UJY A;  1EFN A;  3G6E A;  4M7D A;  5LJ3 e;  1M4Z A;  2A3L A;  3CC7 T;  1BIB A;  1B07 A;  1TUD A;  1J3T A;  2BE7 D;  2DVJ A;  2HAX A;  3RER A;  1YJN A;  2FVU A;  1KIK A;  4GLK A;  2ZPG B;  3VRY A;  3HP9 A;  2LC4 A;  3HFO A;  3M0Q A;  2HSE B;  2BKD N;  2L0A A;  2XIC A;  1K0X A;  2JUF A;  4MML A;  4C8Q F;  2F5T X;  5FW9 A;  2RB6 A;  2BE9 B;  4E7K A;  1KD1 U;  1SEM A;  5KYY A;  2E10 A;  3CCV T;  4LDY A;  1FWZ A;  4FT4 A;  4ZN1 A;  3BW1 A;  4JPB W;  5GAN 8;  3NTH A;  3HL8 A;  1BI3 A;  2D8J A;  2RM4 A;  1QQJ A;  1AHJ B;  4HT9 A;  3A8G B;  4PLL A;  3L1A A;  4XTZ A;  1K8A C;  2FB7 A;  4QVD A;  2DER A;  2BZ8 A;  3FLG A;  1M3C A;  3GOX A;  1VQP T;  1JJ2 S;  4GLM A;  4JLG A;  3SB2 A;  4C8Q G;  1I5O B;  3TSZ A;  3E9G A;  5A0G A;  4ZGE B;  5GAN d;  1HYO A;  1PSE A;  2K57 A;  2K5F A;  4LNP A;  3J81 E;  4RCC A;  2DXB A;  5KYN A;  3CC4 A;  2LZ6 B;  4C8Q D;  3JCM c;  3UT1 A;  1C1A A;  2MF2 A;  2X35 A;  3PTA A;  2LJ0 A;  2XDD A;  7AT1 B;  1HD3 A;  1YIJ A;  3H6Z A;  5HKC A;  4BI8 B;  2ATC B;  3S3O A;  1FYN A;  3JSC A;  1SPK A;  2DMO A;  2AT1 B;  2LTO A;  3EG9 A;  5KYU B;  1PRL C;  1KC8 C;  4ANJ A;  4C8Q B;  5LJ5 e;  3OYJ A;  1UHF A;  4LDW A;  1YCS B;  2EJG A;  4KUI A;  3M5A A;  4OB1 B;  1K76 A;  1G3Y A;  3M0R A;  1H92 A;  1K9M R;  2FYK A;  3FJ5 A;  5CR2 A;  1PSF A;  1YHQ Q;  3FJP A;  2E41 A;  2E3I A;  1VQ7 T;  1QCF A;  3JCM g;  4M7A E;  4R56 A;  1SG5 A;  4FIB A;  1NPR A;  5KH6 A;  2LT4 A;  2QA4 Q;  4LE9 A;  1W6X A;  2A37 A;  3G6E T;  2IPO B;  1PD0 A;  1P92 A;  4D8D A;  3M0T A;  1RL2 A;  2RJD A;  5IHI A;  3MEA A;  1YJN T;  4A63 B;  2BZX A;  3WVE B;  4B9W A;  2K2M A;  3CPW P;  3CCM Q;  2GTJ A;  4P5N A;  2O4X B;  5IHK A;  5LJ3 j;  3REB B;  4M7D E;  4QVZ A;  3QG1 A;  1G8X A;  4RTV A;  4C92 A;  3U23 A;  3KUF A;  1E6G A;  5LJ3 h;  2HEQ A;  3SFM A;  3CCS Q;  3G4S Q;  1NYG A;  3SWN A;  4M77 F;  3OBW A;  5AYF A;  3JCM W;  3CCE T;  2HZY A;  3MHX A;  1D3B B;  3QJ6 A;  4E7J A;  1N8R R;  2YSQ A;  2C06 A;  1VIE A;  2DA9 A;  1RAA B;  1N8R U;  2FZC B;  1UGS B;  1R77 A;  4EMK B;  2RN8 A;  4BE1 A;  2LNH B;  2RHI A;  2HMA A;  1N9S A;  1YHQ A;  2YUN A;  4F7U F;  2DJZ A;  1QVG P;  4FCY A;  3E1S A;  1AZG B;  2XDB A;  2E4H A;  3DKM A;  3CC4 T;  2LMJ A;  4X34 A;  5CKE A;  5EG2 A;  1BBZ A;  3ER0 A;  3INZ A;  1R8O B;  4XK8 E;  2QA4 A;  2K3Y A;  1RI9 A;  2EW3 A;  3TSW A;  4M77 G;  4MZM A;  3ZL7 C;  3M0U A;  2G3R A;  1VQM Q;  2RK1 A;  2AZV A;  5CKD A;  2RJC A;  5GAN g;  4VUB A;  3CCQ A;  4JJC A;  2PVD B;  3LX7 A;  3CCM A;  3GNF B;  5D6Y A;  4B6M A;  4F7U G;  1X6G A;  1BB9 A;  1GCQ C;  2KQW A;  2X51 A;  1Y07 A;  3FRN A;  4M77 B;  4PJO D;  5GAN 3;  2RI5 A;  5LJ5 j;  2EVR A;  2VV5 A;  3DLM A;  1VQK A;  3EFO A;  3P8B B;  3HFN A;  2A36 A;  3G4S A;  1K9A A;  5EC7 A;  2R58 A;  4PJN A;  2W0Z A;  3FEO A;  2CZ7 B;  1B7T A;  2EQU A;  2DTO A;  4NL3 A;  2EQJ A;  1RLP C;  4PJO C;  2GFU A;  3E9F A;  1FMV A;  4F7U B;  3CPW S;  3WVD B;  1WX6 A;  2EFI A;  4J9G A;  1TUG B;  3MP8 A;  2LQK A;  3LGL A;  2FZK B;  2K2V A;  5FU6 B;  4RTY A;  2RMO A;  5LL6 S;  1MV3 A;  1RLQ C;  5C6S A;  3J7A F;  2AHJ B;  1X27 A;  2LT1 A;  3ASK A;  1K8A U;  4X9D A;  2RI3 A;  3JCM X;  1SRL A;  4A54 A;  4BB7 A;  1D09 B;  1QVF S;  4NOY A;  1KK7 A;  5FWB A;  1VYU A;  2JM8 A;  4OF1 A;  4XU0 A;  3VS4 A;  4C92 E;  1QLY A;  4C5G A;  3MEU A;  3V7C A;  2PNI A;  1JBM A;  4ELZ C;  3IQL A;  2CT3 A;  2K3X A;  4CC4 B;  4E7S A;  2HL5 C;  1BU1 A;  1YHQ T;  3EGX B;  3ME9 A;  1YJW Q;  3L2W A;  2RI2 A;  3PVL A;  3QZ5 B;  4C0D B;  4XTX A;  3GNG A;  1BYM A;  2XHC A;  3OSS C;  1UHC A;  2CYZ B;  3OMC A;  4C0D C;  4QW2 A;  3MP1 A;  2QA4 T;  2M1H A;  1ZSZ C;  4WF2 A;  2ED1 A;  4KT0 E;  1KC8 R;  1KHC A;  1OX9 A;  3OA6 A;  1E7O A;  4RMO A;  2E70 A;  1KD1 C;  2RQT A;  5FU7 C;  1SKU B;  4J9C A;  1OPL A;  2DVE A;  1Q81 U;  1SRM A;  1WQW A;  1PCX A;  1SF9 A;  3JCM f;  3KXT A;  3ZEH A;  2FL7 A;  2JNG A;  3CCM T;  2K6D A;  2XI9 A;  4FYV B;  3LH0 A;  4IIM A;  1U1S A;  2AKK A;  2K3B A;  4QKU A;  2WSF E;  1Q82 U;  4JRQ A;  1QVF A;  2RHY A;  2NUP A;  2KGT A;  1NPP A;  3OW2 S;  2D6F A;  1YFN A;  2ED0 A;  1BI0 A;  1SHG A;  4XQ3 A;  3CCS T;  1OZ3 A;  2QGG A;  3G4S T;  2EKH A;  2QAS A;  4CRI A;  1PNJ A;  5LJ3 d;  5KYU A;  4QQ6 A;  2DL8 A;  1SSF A;  4C8Q A;  1KFZ A;  1X2Q A;  4FSX A;  1RAE B;  1I8F A;  4QQD A;  1MV0 B;  1RAG B;  3OYI A;  4D8K A;  1AWO A;  2DF6 A;  3V8J A;  3RIR A;  1YJW A;  5GAN h;  4LUE A;  3EG2 A;  5IH2 A;  2DL4 A;  4XU1 A;  2NUZ A;  4PFZ A;  2KYM A;  1M8M A;  2LX9 A;  4LDX A;  3I9Q A;  1S72 Q;  3GLX A;  1CKB A;  4HCB A;  1LNX A;  5IAY A;  2MAM A;  1VQM T;  3S6W A;  2ESW A;  4HKE A;  3C95 A;  4M75 E;  2P0P A;  1HK9 A;  3RKY A;  3CBP A;  2KVQ G;  3OW2 A;  1JO8 A;  2O4X A;  5L8R E;  1UFF A;  2L8D A;  1BCM A;  4DBH A;  3LGF A;  5KYX B;  2QYZ A;  1M30 A;  3HHT B;  2JOY A;  2J05 A;  2ZCF B;  1QW1 A;  4LDV A;  1MNE A;  2DFU A;  4AFU C;  1IO6 A;  2EWN A;  4DEX A;  2AK5 A;  1YIT Q;  2YHT A;  4ORZ A;  3REA B;  1D0X A;  4XU3 A;  2QQB A;  1D3B A;  5GAN f;  2CP0 A;  2FRW A;  4Z88 A;  4OGC A;  3MKD A;  2FPE A;  1NJI U;  3M59 A;  1VQ8 Q;  4L59 A;  5ECA A;  1KQS P;  4EMK A;  5LJ5 d;  2YT6 A;  2O88 A;  1VYT A;  2K79 A;  2P4T A;  4CC7 A;  1UGV A;  2D1X A;  2QQR A;  1UUE A;  2CZ1 B;  2EYX A;  4MZP A;  3BDL A;  4E7Z A;  1DJ7 B;  2EGE A;  2LNV A;  1LPL A;  1MMG A;  3OYA A;  4LUD A;  2QQ9 A;  2M0O A;  4J9I A;  1EZZ B;  3OS1 A;  2YRD A;  1TOV A;  2XID A;  4FM4 B;  1M1K C;  2DBM A;  2ABL A;  2KRS A;  1WYX A;  3CXC S;  2K9G A;  1U3O A;  1VIF A;  2MCN A;  2V8I A;  2F5K A;  3JB9 J;  3UA7 A;  4OML A;  3LW5 E;  3ZBD A;  1T3L A;  4HVW A;  1H3H A;  1CKA A;  3R6N A;  3KBG A;  2XD0 A;  1W2B A;  3M4G A;  4BY6 B;  1D0Z A;  3X25 B;  4M77 A;  4F04 B;  1YJW T;  2R5A A;  4ZTF A;  4C8Q E;  3PIP A;  5KCH A;  1M3A A;  1AD5 A;  5LJ3 g;  2HBP A;  5GAN 2;  3X20 B;  2DAQ A;  2KXC A;  2YRC A;  1YIT A;  2RH2 A;  1OUL A;  2CGH A;  5GAM e;  2OAW A;  2EGA A;  2DBK A;  2QAZ A;  4F16 A;  1B34 B;  1G3S A;  4F7U A;  3JV3 A;  5GJV B;  1VQ8 A;  3E19 A;  1YIJ Q;  5GAO l;  3QJY A;  1K73 U;  5J3B A;  2KRO A;  1XTD A;  4GY5 A;  4LD9 K;  1VQ9 A;  2X4W A;  4N0A A;  1M1F A;  4IUR A;  2E64 A;  3CD6 Q;  2RQW A;  2H8H A;  3CXC A;  1B3Q A;  2COW A;  1WHG A;  4E7I A;  4J9D A;  1PKT A;  2L3P A;  4DBR A;  5FRM A;  4IUP A;  5HCK A;  2A28 A;  1M2O A;  1KD1 R;  1TXQ A;  1ACM B;  1WQ7 A;  5FRN A;  1AZE A;  4PJM A;  4Z02 A;  1JQQ A;  4J9B A;  4WTO B;  2COY A;  2QEX A;  2DEQ A;  4Z89 A;  4JLI A;  2NLU A;  1I1J A;  4C5H A;  2IIM A;  3RBB B;  4C5I A;  2RD1 A;  1UTI A;  3HSB A;  5J39 A;  4PJL A;  2LX7 A;  3EGX A;  1Y96 B;  3QHS A;  2DM1 A;  5GAO m;  2FPF A;  3OYL A;  1M27 C;  2V8J A;  1FXX A;  1RAD B;  2E6N A;  2YXY A;  5IXF A;  4ZGD B;  1LOJ A;  3JCM P;  3O5Z A;  1S72 T;  1QCN A;  4OMM A;  3LWH A;  1OQK A;  1TH7 A;  6AT1 B;  5LJ5 g;  1YJ9 Q;  3CC2 Q;  3PE0 A;  3RR6 A;  3RNJ A;  1IGQ A;  4J5Y A;  1H64 1;  1KJW A;  2EQM A;  1W70 A;  1MND A;  1WJQ A;  3D7S B;  4FW2 A;  2CSQ A;  2HQE A;  4KH1 B;  3SHW A;  2GQI A;  2MWP A;  2CP7 A;  3RKX A;  1WHL A;  2QI2 A;  4XTW A;  1OI1 A;  5GAN 5;  3CD6 A;  2KBT A;  1Q7Y C;  3L2V A;  1Q81 C;  4PLI A;  3HRS A;  3H41 A;  2ZPI B;  3CPF A;  5HY6 A;  3OS0 A;  1OYX A;  1BK2 A;  2J6O A;  4J9H A;  1YIT T;  1JXO A;  2DIQ A;  3P8H A;  3UF4 A;  2A7Y A;  2KDS A;  1WA7 A;  1KG1 A;  1AWJ A;  1Q82 C;  3T9N A;  4M77 E;  3UWN A;  2DZC A;  2O9S A;  3OY9 A;  1JJ2 A;  1VQ8 T;  1VQ5 A;  3QWY A;  4QQG A;  2DO3 A;  4IUU A;  5KYW B;  2OI3 A;  4XU2 A;  1GBR A;  3VS2 A;  3N5B B;  5GAM j;  3OQ5 A;  3CCQ Q;  1Y7X A;  4FYW B;  1N5Z A;  2EGC A;  1N27 A;  4B9X A;  3A1P A;  5GAM h;  2P0Q A;  4F7U E;  5GAN 4;  1WHK A;  1RAC B;  2RHU A;  2K5L A;  5GAO q;  4JRI A;  4RTX A;  4OVA A;  2RJF A;  5I11 A;  4OGE A;  1RAI B;  2JN0 A;  2L89 A;  5CQX A;  1YJ9 A;  3CC2 A;  2M02 A;  1VQK Q;  3TRE A;  4CI0 C;  1GFC A;  2J6F A;  4ATO A;  1K4U S;  1Y71 A;  3VS1 A;  1PM3 A;  1OEB A;  5KYX A;  1X6O A;  2XDP A;  5GMK l;  2KR3 A;  1T0J A;  2IG0 A;  2YUQ A;  4O5V A;  1W4S A;  3L2U A;  1UGR B;  2E3H A;  4XTU A;  1M1K R;  1M90 C;  3QDR B;  1UJ0 A;  4M7A F;  4PJO F;  4KGX B;  3CMA Q;  3EGD B;  1M1K U;  4MDX A;  4HVU A;  4RCB A;  4IUT A;  2VYT A;  3A8M B;  3PMI A;  4GBQ A;  2QQS A;  5GJW B;  1V29 B;  1G5V A;  1I4K 1;  2CUD A;  1VQ6 Q;  5GAM f;  2DLP A;  3CCJ Q;  4LDU A;  4L6V 5;  1YIJ T;  3CCL A;  4D6W A;  4M78 F;  4FSS A;  1TUC A;  1T3S A;  4KGV B;  5LJ3 f;  2FEI A;  3URG A;  1BKB A;  2YUO A;  2F2X A;  1WJS A;  1PWT A;  3CD6 T;  3RES A;  1LJO A;  4X9C A;  5GMK m;  4M7A G;  4N4I A;  2OJ2 A;  2E65 A;  4PJO G;  2KEA A;  1FMK A;  1NJI C;  1VYV A;  1X01 A;  4LXC A;  2DL7 A;  4C5E A;  3CCU A;  2KRM A;  2GBQ A;  3CCR A;  5CKH A;  4BDZ A;  1QVP A;  3LH5 A;  4OP0 A;  3VS0 A;  4EMG A;  2P0K A;  1BI2 A;  1WI7 A;  2ROL A;  4XTY A;  4M7A D;  1OOT A;  4N4G A;  2EPD A;  4OMN A;  3X24 B;  3A98 A;  2DJQ A;  4NL2 A;  1I81 A;  2HNI A;  5DLQ E;  3OSV A;  2NUT B;  2A0F B;  4Y91 A;  4M78 G;  5LJ5 h;  5CCA A;  1ZA1 B;  4M7A B;  5GMK e;  4PJO B;  1MMD A;  5A2Q E;  4M7A C;  2D0Q B;  1SHF A;  1ZX6 A;  1TG0 A;  1I5L A;  3OYC A;  3UA6 A;  3CMA A;  2VXF A;  4M78 D;  4J6X A;  2K7A A;  4M75 A;  3QDF A;  2EYZ A;  2KT8 A;  1B34 A;  2AZS A;  1D1C A;  2AKL A;  1YJ9 T;  3M56 A;  4EIK A;  3CC2 T;  2GNC A;  4M78 B;  1K8A R;  3AT1 B;  1VQ6 A;  2ZPF B;  2L3R A;  1FX7 A;  2JS2 A;  2JJ9 A;  4M78 C;  2MIO A;  5CQY A;  3VV0 A;  1WXU A;  3CCJ A;  4BUG A;  3QZ9 B;  3HTR A;  8ATC B;  4M7D C;  1Y0M A;  1YI2 A;  2JTE A;  2PU9 B;  3SD4 A;  4J83 A;  1U06 A;  5DM7 R;  4ELY C;  4HCZ A;  2DKG A;  2EAY A;  1IRX A;  1TSF A;  5LJ5 f;  4F14 A;  1BCO A;  2CP3 A;  1K73 C;  2DL5 A;  1YP5 A;  4Q5W A;  4R55 A;  1CSK A;  3ZFJ A;  1OPK A;  1QVG S;  3M58 A;  3FIF A;  1ZSZ B;  4LD6 A;  4JDS A;  1GFD A;  3BY7 A;  1S1N A;  2DXC A;  2KY9 A;  3CBM A;  3CBO A;  1V1C A;  1OU9 A;  3VS6 A;  4BE2 A;  1VUB A;  1Y96 A;  1T0H A;  3LYI A;  5FU7 B;  4JRP A;  2QTV A;  1Q7Y R;  2J06 A;  2VB6 A;  3CPW A;  3I56 Q;  2YLC A;  2E12 A;  1VOM A;  1Q81 R;  1Q7Y U;  5KCO A;  2HQX A;  1R0C B;  4C0G A;  4PKC C;  3CCQ T;  4OB2 B;  4RTZ A;  1JRI A;  1M9S A;  1NEB A;  1OZ2 A;  3OB9 A;  1WNL A;  2V1Q A;  1Q82 R;  1NLP C;  2EBP A;  3UPU A;  5FRO A;  2JMC A;  3PMT A;  4LN2 A;  4C0Z A;  3C12 A;  2MOX A;  5GAM d;  2DET A;  2QQA A;  3JAM E;  1X75 C;  1VQK T;  4QT7 A;  2DYI A;  4HCC A;  4PFP A;  3BE3 A;  3DB3 A;  4IIO A;  4BI4 A;  3VUZ A;  2RNA A;  4J7F A;  2J7I A;  3OS2 A;  2YRV A;  1I07 A;  2MPX C;  2CZ0 B;  3SDZ A;  1QVG A;  2LQN A;  3MPU B;  3V7S A;  2OTL A;  5GAO p;  1WXB A;  1X2K A;  3RKW A;  3UDC A;  3CMA T;  2C0T A;  4KBM B;  2XMF A;  1OV3 A;  2DPP B;  3CEY A;  5CKF A;  3L2Q A;  3X26 B;  2PZ1 A;  1K0S A;  1XOV A;  5GMK j;  2HCK A;  4PJJ A;  3OYY A;  3PVQ A;  4AG2 C;  5IXB A;  4JS5 A;  1VQ6 T;  1QWF A;  4J9E A;  3I5R A;  1F1B B;  2FZG B;  2LVM A;  3RMQ A;  5GMK h;  3LWI A;  2CDT A;  3NTK A;  2LQ8 A;  4L5G A;  3CCJ T;  1M90 R;  5AT1 B;  2F2V A;  1WHJ A;  1M90 U;  3I56 A;  1AOJ A;  3M57 A;  4BI3 A;  2BUD A;  2DD4 A;  1G3W A;  3GF5 A;  4C92 D;  2M9U A;  2V1R A;  2I0N A;  5J26 A;  3G71 Q;  4OB0 B;  1GRI A;  1X6B A;  1K9M C;  5GAN 6;  4DA4 A;  1WJR A;  1IHV A;  2X3W D;  1IGU A;  1VQO Q;  2JW4 A;  4C92 C;  2BZY A;  2P84 A;  2HBW A;  4E6R A;  2CS7 A;  2X4X A;  2E5Q A;  2JT4 A;  4DOV A;  2FHD A;  3Q1J A;  4PNO A;  1NJI R;  3SWN C;  4WCI A;  2LCS A;  1WZO A;  2QXF A;  2EYY A;  2HDA A;  2FPD A;  2Z0W A;  3EFR A;  3EGD A;  5I2M A;  3VYG A;  4A4E A;  3QBY A;  2ZGW A;  3S3N A;  1IZ6 A;  2L3Q A;  5CVI A;  1VQ9 Q;  3H9N A;  5KE2 A;  4A4G A;  3EG3 A;  1PKS A;  2RA2 A;  3UAT A;  1QP2 A;  3V8K A;  3AHU A;  1MMN A;  2VC8 A;  1W1F A;  2CP6 A;  1PHT A;  3BDU A;  4R0K A;  3OYH A;  3OBY A;  1TTH B;  1SSH A;  3FB9 A;  3VS3 A;  2VXE A;  2ZPE B;  2QEX Q;  1M5Q 1;  1WPY A;  2CZ6 B;  4J6Y A;  3QYH B;  2Y90 A;  3FDR A;  2VKN A;  1WHM A;  1YCY A;  1YBY A;  5L23 A;  4RTT A;  1C6V X;  2JZ2 A;  3HRT A;  2X4J A;  3FC3 A;  1GCQ A;  3QII A;  1TU0 B;  4N4H A;  4YTL A;  4A4F A;  2CUB A;  2RO0 A;  5GAM g;  3EG1 A;  3G1J A;  4CC3 A;  3I55 Q;  3G71 A;  2QGF B;  1E6H A;  3JCM V;  5HK0 A;  3NFC A;  5IHN A;  1EIF A;  2KYB A;  3ULR B;  3WXM B;  1ZA2 B;  2G6F X;  2NUT A;  1VQO A;  1NZ9 A;  4II1 A;  1KQ1 A;  2F69 A;  3QPH A;  2SRC A;  1NLO C;  4PJO A;  1JB0 E;  2XG8 D;  1KQ2 A;  2E6Z A;  1WFW A;  3CME Q;  3I56 T;  3M55 A;  4AMC A;  2PVO B;  2DL3 A;  1ARK A;  2D8H A;  4IUV A;  1K73 R;  3EHQ A;  2P4R A;  2VVK A;  2DK3 A;  3EG0 A;  2DX1 A;  4BE0 A;  2FO0 A;  1ZBJ A;  1VQ7 A;  3M54 A;  2KNB B;  3JCM b;  5IN1 A;  1QKW A;  1XNI A;  4M78 A;  3DB4 A;  1PRM C;  3GP8 A;  2VGM A;  2KI7 A;  4E47 A;  2DIG A;  2MYS A;  2RPN A;  2HD0 A;  2EQK A;  2E5K A;  1Q86 C;  2FRY A;  2F1L A;  1VQ5 Q;  4J9F A;  2O2O A;  2C0O A;  1KQS S;  2JM9 A;  3EHR A;  5I21 A;  1FMW A;  1ZHI A;  4AG1 C;  2ECZ A;  8AT1 B;  3NMZ C;  1ZSZ A;  4ZTJ A;  3I55 A;  1XJW B;  4TVR A;  3M0P A;  1IB8 A;  3H0I A;  4OB3 B;  3L2R A;  3TVT A;  5D7U A;  1UB4 A;  3CCE A;  2PTK A;  2JTF A;  2EQI A;  1WXT A;  4ME7 A;  3QO3 A;  2ZAE A;  4EMH A;  1Q95 G;  2CH4 A;  3CME A;  3I5S A;  1H3Z A;  1M3B A;  4JRK A;  1MMA A;  1QKX A;  2I2L A;  3G71 T;  4JJB A;  2X4Y A;  4ZN3 A;  1NBE B;  4XTV A;  1K1Z A;  2LRQ A;  2QG9 B;  2ZPH B;  5DY9 A;  2X3X D;  2NUP B;  2LP5 A;  1VQO T;  2GQV A;  4HVV A;  1ABO A;  1KQS A;  1GBQ A;  2EJF A;  3BFM A;  1M8V A;  2A08 A;  3M4Y A;  3QSU A;  3CCL Q;  4C8Q C;  2PUO B;  3PFS A;  3P8D A;  1UEC A;  1MUZ A;  2F2W A;  2HL3 A;  1K9M U;  5I2S A;  1VQ9 T;  2DNU A;  2XKO C;  3M0S A;  2DE0 X;  4DEY A;  2RQV A;  4C0F A;  4Y28 E;  4PJO E;  2QDL A;  1HJD A;  1G3T A;  4AFQ C;  3HRU A;  1QMC A;  2CSI A;  3A5Z B;  3CCU Q;  2HSP A;  3C4S A;  4KH0 B;  3CCR Q;  2GCX A;  4KUL A;  1VQL Q;  1O75 A;  3RMS A;  2GF7 A;  2W10 A;  1ZQ1 A;  2ROT A;  1G83 A;  1ZUK A;  2LQW A;  2QEX T;  3PT9 A;  4KUD K;  3JCM e;  3VU3 C;  2EYW A;  4J7I A;  2M16 A;  2HKQ B;  2YWW A;  3QWX X;  2DEU A;  5DLO A;  4M78 E;  3MET A;  1KSW A;  3R6O A;  3VRZ A;  1NG2 A;  4K11 A;  1U5S A;  2LJ1 A;  3JCM Q;  3KFV A;  2QDY B;  3I55 T;  2O9V A;  1YNZ A;  4JZ3 A;  2K4Y A;  1G2B A;  1RAF B;  2DRM A;  1U8R A;  4AT1 B;  1D1A A;  2QTX A;  2L2P A;  2K5I A;  2VGN A;  3OYE A;  1Z9Q A;  1QVF P;  3O8V A;  1IHW A;  4DQ2 A;  2KMT A;  1VA7 A;  4IUQ A;  4KGZ B;  4UC4 A;  3CME T;  1QWE A;  1UEB A;  5CAI A;  2Y4X A;  3S3M A;  4OMP A; 
#chains in the Genus database with same CATH homology
 2FB7 A;  4QVD A;  5KCO A;  2HQX A;  4E7H A;  4EPC A;  2YLB A;  2P4T A;  4JJN K;  2QQR A;  3FLG A;  2BIV A;  3GOX A;  4C0G A;  2CZ1 B;  4PKC C;  4OMF B;  4MMK A;  1VQP T;  2MMP A;  2RHZ A;  4EMK C;  4OB2 B;  5HK3 A;  3CCQ T;  4MZP A;  1JJ2 S;  3JB9 F;  3BDL A;  1JRI A;  4JLG A;  1DJ7 B;  3SB2 A;  4M7D F;  2LNV A;  4C8Q G;  1M9S A;  3OYA A;  4KUD K;  3JCM J;  2QQ9 A;  1OZ2 A;  3OB9 A;  1WNL A;  3E9G A;  5A0G A;  4ZGE B;  5GAN d;  1PSE A;  3UPU A;  2K57 A;  2K5F A;  2M0O A;  5FRO A;  3PMT A;  3C94 A;  3J80 E;  3OS1 A;  3RUX A;  4C0Z A;  3J81 E;  2DTI A;  2XID A;  3C12 A;  4RCC A;  4FM4 B;  1M1K C;  2DXB A;  3CC4 A;  5GAM d;  1VQL A;  2QQA A;  4C8Q D;  3JAM E;  3OYB A;  1N6A A;  3JCM c;  1X75 C;  2MF2 A;  3UT1 A;  3CXC S;  2X35 A;  3PTA A;  3MEV A;  1VQK T;  2XDD A;  1VIF A;  4HCC A;  2H3J A;  2V8I A;  1YIJ A;  3H6Z A;  2F5K A;  2EIF A;  5HKC A;  1UGP B;  3DB3 A;  4BI8 B;  4BI4 A;  3JB9 J;  3VUZ A;  3S3O A;  2MWO A;  1VQ5 T;  3JSC A;  3LW5 E;  4J7F A;  4M77 D;  3ZBD A;  2LTO A;  3OS2 A;  2Y4Y A;  4MZT A;  2YRV A;  1KC8 C;  2CZ0 B;  3KBG A;  2L5Q A;  4C8Q B;  5LJ5 e;  3OYJ A;  1W2B A;  4HT8 A;  2XD0 A;  3HKS A;  3SDZ A;  3M4G A;  4LDW A;  3S3M A;  1QVG A;  4BY6 B;  2EJG A;  3V7S A;  3TU4 K;  4KUI A;  3M5A A;  4OB1 B;  5CK9 A;  5GAO p;  2OTL A;  1G3Y A;  3JB9 G;  3X25 B;  2FYK A;  1WGS A;  3RKW A;  4M77 A;  3UDC A;  3CMA T;  4M7D G;  5CR2 A;  4KBM B;  1YJW T;  1PSF A;  2R5A A;  5IT9 E;  4ZTF A;  3FJP A;  2DPP B;  3CEY A;  3L42 A;  4XTZ A;  4C8Q E;  5KCH A;  3PIP A;  2E41 A;  5CKF A;  3L2Q A;  3X26 B;  5LJ3 g;  2HBP A;  5GAN e;  5M9O A;  5GAN 2;  4M77 C;  1VQ7 T;  3JCM g;  3X20 B;  4M7A E;  3CCS A;  1Q86 U;  4R56 A;  1XOV A;  3JB9 H;  4FIB A;  1NPR A;  2DAQ A;  5GMK j;  5KH6 A;  2B8A A;  2LT4 A;  3JB9 D;  1YIT A;  3G6E T;  2RH2 A;  3OYY A;  4M7D D;  1MGQ A;  3VYH B;  2CGH A;  4JS5 A;  5GAM e;  1VQ6 T;  1P92 A;  5CIU A;  1RL2 A;  2RJD A;  2LVM A;  2XK0 A;  3RMQ A;  5GMK h;  3LWI A;  3NTK A;  4L5G A;  2LQ8 A;  3TEE A;  3CCJ T;  4J8O A;  1B34 B;  1G3S A;  4F7U A;  3MEA A;  1YJN T;  1VQ8 A;  3E19 A;  5GAO l;  1M90 U;  3QJY A;  3I56 A;  1K73 U;  5J3B A;  4M7D B;  3WVE B;  1XTD A;  4FU6 A;  4GY5 A;  4B9W A;  3M57 A;  4LD9 K;  4BI3 A;  2BUD A;  2DD4 A;  2RK2 A;  1G3W A;  2X4W A;  1VQ9 A;  2LDM A;  4N0A A;  3GF5 A;  1M1F A;  4IUR A;  4C92 D;  2E64 A;  2DZ9 A;  4P5N A;  2LCC A;  1BI1 A;  2M9U A;  3CXC A;  2O4X B;  5A0L A;  4E7I A;  5LJ3 j;  4IKF A;  5J26 A;  4RKU E;  4OB0 B;  5KE3 A;  5D6W A;  4M7D E;  4QVZ A;  4N0A C;  5FRM A;  4IUP A;  3QG1 A;  1K9M C;  4C92 A;  5FU6 C;  4BDY A;  3KUF A;  5GAN 6;  1WJR A;  4DA4 A;  1WQ7 A;  5LJ3 h;  2ZPB B;  5FRN A;  3SFM A;  4Z02 A;  3JCM h;  4A53 A;  4C92 C;  1HXD A;  3SWN A;  1VQM A;  1NE8 A;  4O6J A;  3V8L A;  4M77 F;  2CS7 A;  2QEX A;  2DEQ A;  2X4X A;  3OBW A;  4JLI A;  5AYF A;  3JCM W;  3CCE T;  2NLU A;  2E5Q A;  4C5H A;  1IRE B;  4DOV A;  2FHD A;  2WSE E;  3Q1J A;  4C5I A;  2RD1 A;  3MHX A;  4PNO A;  3HSB A;  1D3B B;  3SWN C;  3QJ6 A;  5J39 A;  4E7J A;  1XQH A;  2C06 A;  3CCL T;  2KSS A;  2XU8 A;  2QXF A;  1VIE A;  3EFR A;  5I2M A;  1N8R U;  3VYG A;  3PNW C;  4EDU A;  1UGS B;  1Y96 B;  3QHS A;  4A4E A;  3QBY A;  2ZGW A;  3S3N A;  1IZ6 A;  2DXU A;  4JUV A;  5CVI A;  4EMK B;  5GAN 7;  5GAO m;  4JS4 A;  4BE1 A;  1VQN A;  4PL6 A;  5C0M A;  2RHI A;  3OYM A;  5KE2 A;  3OYL A;  4A4G A;  3DLL A;  1N9S A;  2V8J A;  1YHQ A;  1FXX A;  4F7U F;  2DJZ A;  2DTH A;  2E6N A;  2OAU A;  2RA2 A;  3CCU T;  1QP2 A;  4ZGD B;  3HPW A;  3E1S A;  3V8K A;  3OYK A;  3AHU A;  2XDB A;  3CCR T;  3QKJ A;  3DKM A;  3OS5 A;  3CC4 T;  4X34 A;  5CKE A;  2VC8 A;  1LOJ A;  5EG2 A;  1VQL T;  3JCM P;  2GFA A;  3ER0 A;  1ZBX A;  1KC8 U;  1S72 T;  1VQ6 A;  3INZ A;  3BDU A;  1R8O B;  4J6W A;  3OYH A;  3LWH A;  4XK8 E;  2QA4 A;  1TH7 A;  2K3Y A;  3OBY A;  5LJ5 g;  4M77 G;  4MZM A;  3FB9 A;  4BD3 A;  2VXE A;  2G3R A;  2JVV A;  2R57 A;  2ZPE B;  3M53 A;  2RK1 A;  4J5Y A;  1H64 1;  2EKO A;  2EQM A;  1M5Q 1;  1WPY A;  2CZ6 B;  1KHI A;  4J6Y A;  4C92 F;  1WJQ A;  3QYH B;  2Y90 A;  3FDR A;  1YCY A;  1YBY A;  5CKD A;  2RJC A;  2HQE A;  5GAN g;  4VUB A;  3CCQ A;  2PVG B;  2V8K A;  2JZ2 A;  3HRT A;  2X4J A;  2PVD B;  2MWP A;  3LX7 A;  3RKX A;  3FC3 A;  2QI2 A;  3QII A;  1OI1 A;  4XTW A;  5GAN 5;  3VJP A;  3MEW A;  3CD6 A;  3CCM A;  4N4H A;  3GNF B;  4YTL A;  1Q7Y C;  3L2V A;  2KK4 A;  5D6Y A;  4FL6 A;  4A4F A;  2RO0 A;  3X28 B;  5GAM g;  2D9T A;  3A8H B;  4PLI A;  3G71 A;  4HA8 A;  4F7U G;  3JCM V;  4E7L A;  1Q81 C;  3HRS A;  2ZPI B;  3CPF A;  3NFC A;  2KQW A;  1OYX A;  1U1T A;  1EIF A;  5HY6 A;  5HK0 A;  3OS0 A;  1Y07 A;  3FRN A;  4M77 B;  3WXM B;  4PJO D;  5GAN 3;  2OTJ A;  2RI5 A;  1YIT T;  2DIQ A;  5LJ5 j;  2VV5 A;  3DLM A;  3P8H A;  1VQO A;  3L2Z A;  1NZ9 A;  4II1 A;  1KQ1 A;  1VQK A;  2A7Y A;  2F69 A;  2KDS A;  1KG1 A;  3P8B B;  3HFN A;  3G4S A;  4NS5 A;  1Q82 C;  2WSC E;  3QPH A;  3T9N A;  4A4H A;  4PJO A;  3MO8 A;  1JB0 E;  2R58 A;  2XG8 D;  4M77 E;  1KQ2 A;  3UWN A;  2DZC A;  3OY9 A;  3GPL A;  1JJ2 A;  1VQ8 T;  2E6Z A;  1VQ5 A;  1GXI E;  3FEO A;  2CZ7 B;  3I56 T;  2EQU A;  3M55 A;  2DTO A;  4QQG A;  2DO3 A;  5CKB A;  4C92 G;  2EQJ A;  4NL3 A;  4IUU A;  5GAN j;  5CO7 A;  4DOW A;  2PVO B;  1VQ4 A;  4PJO C;  2GFU A;  1BIA A;  4IUV A;  3E9F A;  4XU2 A;  1YI2 T;  4A4K A;  4MDW A;  4F7U B;  3N5B B;  2DK3 A;  3OQ5 A;  4FT2 A;  5GAM j;  3OYG A;  3CPW S;  3WVD B;  5GMK i;  2DXT A;  4BAC A;  2EFI A;  4BE0 A;  1Y7X A;  3MP8 A;  1VQ7 A;  1N27 A;  2LQK A;  3LGL A;  3M54 A;  4B9X A;  1UGQ B;  3JCM b;  3OYF A;  5IN1 A;  2K2V A;  1XNI A;  5GAM h;  2P0Q A;  3OMG A;  4F7U E;  4M78 A;  5GAN 4;  5FU6 B;  3VKI A;  5LL6 S;  2RHU A;  5C6S A;  3J7A F;  2K5L A;  3DB4 A;  2AHJ B;  4RG2 A;  5GAO q;  4JRI A;  3G7Z A;  2VGM A;  2RJF A;  4OVA A;  3GP8 A;  2LT1 A;  4OGE A;  5FLX E;  2KAF A;  2PQW A;  3ASK A;  2JN0 A;  4E47 A;  1K8A U;  2DIG A;  4C92 B;  1RI0 A;  4X9D A;  1MHN A;  2L89 A;  5CQX A;  1YJ9 A;  2HD0 A;  2RI3 A;  2EQK A;  3VUB A;  3JCM X;  3CC2 A;  3TRE A;  1Q86 C;  4CI0 C;  4A54 A;  4BB7 A;  3PGG A;  3QYG B;  3A8L B;  1QVF S;  4ATO A;  4NOY A;  1Y71 A;  2JTM A;  3CC7 A;  1X6O A;  2XDP A;  5GMK l;  3SWN B;  3QUI A;  4OF1 A;  4XU0 A;  3V7R A;  4C92 E;  2RJE A;  3M9Q A;  4C5G A;  3MEU A;  2IG0 A;  3V7C A;  1KQS S;  4O5V A;  1JBM A;  1W4S A;  4ELZ C;  1UGR B;  2MI6 A;  3L2U A;  1VQN T;  2CKK A;  4XTU A;  2K3X A;  3F70 A;  1M90 C;  3QDR B;  5I21 A;  4M7A F;  2RHX A;  4PJO F;  1YHQ T;  3ME9 A;  1M1K U;  1ZHI A;  3L2W A;  4MDX A;  2RI2 A;  3QZ5 B;  4ZTJ A;  4C0D B;  3I55 A;  1W2B S;  4XTX A;  4RCB A;  4TVR A;  3GIB A;  3NTI A;  3GNG A;  1BYM A;  2XHC A;  3OSS C;  4IUT A;  2CYZ B;  1M1G A;  3OMC A;  2VYT A;  4QW2 A;  4C0D C;  3MP1 A;  4RG8 A;  4OB3 B;  3PIO A;  3L2R A;  3CCV A;  2QA4 T;  2M1H A;  2EYQ A;  1UB4 A;  4WF2 A;  4KT0 E;  3A8M B;  2EJ9 A;  1KHC A;  3PMI A;  3CCE A;  2QQS A;  4QVC A;  1V29 B;  2JTF A;  1G5V A;  1I4K 1;  4M75 F;  5GAM f;  3OA6 A;  4RMO A;  2E70 A;  2LCL A;  1KD1 C;  5FU7 C;  4ME7 A;  3QO3 A;  4LDU A;  5D6X A;  4L6V 5;  2DVE A;  4EMH A;  1YIJ T;  1Q81 U;  4D6W A;  3CCL A;  1N9R A;  3CME A;  4M78 F;  2WAC A;  3CC7 T;  1H3Z A;  2E1H A;  5LJ3 f;  1WQW A;  3JCM f;  3LLR A;  3URG A;  1BKB A;  4JRK A;  4ZGJ B;  3OYN A;  3KXT A;  3ZEH A;  1WJS A;  2I2L A;  3EFS A;  2FL7 A;  2JNG A;  3CCM T;  3RES A;  3CD6 T;  1LJO A;  4X9C A;  2XI9 A;  3MCA B;  5GMK m;  3LH0 A;  4N4I A;  1VQP A;  2E65 A;  4PJO G;  1U1S A;  2OTL T;  4M7A G;  3G71 T;  1NJI C;  2WSF E;  2X4Y A;  4ZN3 A;  1Q82 U;  3QXE B;  1X01 A;  4XTV A;  4C5E A;  4JRQ A;  1N8R C;  3CCU A;  1QVF A;  2LRQ A;  3OYD A;  2RHY A;  2ZPH B;  3CCR A;  3EAE A;  5DY9 A;  5CKH A;  2OTJ T;  1NPP A;  3OW2 S;  4BDZ A;  2D6F A;  1QVP A;  4OP0 A;  1BI0 A;  1S72 A;  1VQO T;  4XQ3 A;  4EMG A;  2P0K A;  1BI2 A;  2DD5 A;  2GQV A;  3CCS T;  4XTY A;  1OZ3 A;  5GAO n;  3G4S T;  3JRZ A;  5GAO r;  1KQS A;  4M7A D;  4CRI A;  1O9S A;  5LJ3 d;  4N4G A;  2EJF A;  4M75 G;  3JCM d;  3X24 B;  1QP3 A;  3TCJ A;  4QQ6 A;  3BFM A;  1SSF A;  4C8Q A;  1M8V A;  4NL2 A;  5DLQ E;  1I81 A;  2HNI A;  3OSV A;  3M4Y A;  4Y91 A;  2VUB A;  1VQ4 T;  4M7A A;  4M78 G;  5LJ5 h;  3QSU A;  4FSX A;  5CCA A;  1I8F A;  4C8Q C;  4M7A B;  4QQD A;  5GMK e;  4PJO B;  2PUO B;  3PFS A;  3P8D A;  3H8Z A;  3OYI A;  4BY6 C;  5A2Q E;  4M7A C;  2D0Q B;  4M75 D;  1K9M U;  5I2S A;  1VQ9 T;  2XKO C;  5A0D A;  3A8O B;  1I5L A;  3MP6 A;  3OYC A;  3V8J A;  3RIR A;  4C0F A;  3CMA A;  4Y28 E;  2VXF A;  4M78 D;  5GAN h;  1YJW A;  4PJO E;  4J6X A;  1G3T A;  2O01 E;  3HRU A;  3JB9 I;  4M75 A;  4V2S A;  3A5Z B;  4XU1 A;  2IVW A;  3C4S A;  4XAX B;  4M75 B;  2GCX A;  2LX9 A;  4KUL A;  4LDX A;  2R5M A;  1O75 A;  1B34 A;  2GF7 A;  2PUK B;  2ZZD A;  4M75 C;  1ZQ1 A;  3RMS A;  1YJ9 T;  3GLX A;  3M56 A;  3CC2 T;  4HCB A;  4M78 B;  1LNX A;  3G6E A;  5IAY A;  2MAM A;  1VQM T;  4M7D A;  5LJ3 e;  3S6W A;  2QEX T;  2ZPF B;  1M4Z A;  2A3L A;  2L3R A;  3PT9 A;  3C95 A;  1FX7 A;  4HKE A;  1BIB A;  4M78 C;  4M75 E;  5CQY A;  2P0P A;  3VV0 A;  3JCM e;  3VU3 C;  1K8A C;  3CCJ A;  1HK9 A;  4J7I A;  3RKY A;  3QZ9 B;  3CBP A;  4BUG A;  2M16 A;  2KVQ G;  2HAX A;  3OW2 A;  3RER A;  1YJN A;  4M7D C;  2FVU A;  2O4X A;  5L8R E;  5DLO A;  1YI2 A;  4GLK A;  4M78 E;  2PU9 B;  2ZPG B;  2L8D A;  3MET A;  3SD4 A;  3HP9 A;  2LC4 A;  3HFO A;  3R6O A;  2BKD N;  4J83 A;  4EMK A;  3LGF A;  5DM7 R;  2XIC A;  2JUF A;  4ELY C;  4MML A;  4HCZ A;  3JCM Q;  2DKG A;  2EAY A;  4C8Q F;  5LJ5 f;  3HHT B;  2F5T X;  2JOY A;  2QDY B;  2RB6 A;  2ZCF B;  3I55 T;  4E7K A;  1KD1 U;  1QW1 A;  4LDV A;  2K4Y A;  1K73 C;  2E10 A;  3CCV T;  2EWN A;  4Q5W A;  4LDY A;  1U8R A;  1FWZ A;  4R55 A;  3ZFJ A;  2QTX A;  4FT4 A;  4ZN1 A;  2YHT A;  2K5I A;  1QVG S;  2VGN A;  3OYE A;  3M58 A;  3FIF A;  4LD6 A;  4XU3 A;  2QQB A;  1D3B A;  3BW1 A;  4JDS A;  3O8V A;  5GAN f;  3BY7 A;  5GAN 8;  3NTH A;  2DXC A;  2KY9 A;  3CBM A;  3CBO A;  4DQ2 A;  2KMT A;  3HL8 A;  4OGC A;  4BE2 A;  4IUQ A;  1VUB A;  1BI3 A;  1Y96 A;  2RM4 A;  1NJI U;  1AHJ B;  3M59 A;  4UC4 A;  3LYI A;  5FU7 B;  3A8G B;  3CME T;  4PLL A;  4JRP A;  4HT9 A;  1UEB A;  4L59 A;  3CPW A;  5CAI A;  2Y4X A;  2YLC A;  3L1A A;  2E12 A;  5LJ5 d;  1Q7Y U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...