5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
molecule tags Splicing
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
1D3BA 2DTIA 1M5Q1 3V8JA 4A54A 5GANe 4M7DD 4JRKA 4DQ2A 5GAN6 3BY7A 4XU3A 4HA8A 4XU0A 4XU2A 4XTWA 3VU3C 2Y90A 3L1AA 4M77F 1HXDA 5GAN4 2YLBA 4F7UF 5I21A 1WQ7A 4M78D 4C8QG 5GAMg 4M78E 4J6YA 4C92D 5GAN5 3BFMA 4PNOA 1Y96B 4RCCA 4XTYA 4M75C 5GAMj 1TH7A 1I81A 2K57A 2VC8A 5LJ3e 2RD1A 3JB9G 5GAMf 5GAMd 2DZ9A 4M7DC 5GMKl 2VXFA 1LJOA 2DTHA 1WPYA 4M75F 3SWNC 4C8QA 2E1HA 4M77A 5GMKj 5GAOq 1MGQA 4OP0A 1WQWA 2YLCA 1D3BB 4XTVA 3RIRA 5GAN3 4M7DA 4M77C 5GMKh 5GANh 1X01A 3JCMJ 4M78G 4PJOE 3RUXA 4C92C 1BIAA 3JCMf 3JCMd 3JCMe 1JRIA 3V8KA 2CGHA 3JCMb 4M7AE 2EWNA 4QVCA 4M75A 4M7AF 5CAIA 5GAMh 3QUIA 4XTXA 4A53A 5LJ3f 5LJ3d 4M7DF 1YCYA 4X9CA 3JB9F 3FJPA 5LJ3h 3JCMP 4EMHA 3PGGA 2DJZA 3JCMV 5GANf 2EJ9A 5GANd 1U1TA 3V7SA 2DXTA 5GAOm 3RKXA 1JBMA 5LJ3g 5LJ5j 4V2SA 3JCMQ 1LOJA 4M77E 5GAN8 1B34A 3EFRA 2I2LA 4PJOF 1LNXA 2E10A 5GANg 2DXUA 3JB9H 2E65A 4M78B 4XTZA 1U1SA 3HSBA 5GAOl 4PJOA 4WF2A 4PJOD 4M7AC 3SB2A 4C92A 4J5YA 3L2ZA 4F7UE 1HK9A 4N0AA 3V7CA 3HFNA 5GANj 4M75D 5GAOn 4M7AD 4M75E 3RKYA 4M7AB 5GAMe 5GAN2 4MMKA 2QTXA 4XU1A 3JCMg 4C8QC 5LJ3j 4EMKB 5LJ5g 3JB9I 4NL2A 3GIBA 4M7DB 1I8FA 2RB6A 4JLIA 5GMKi 2EJGA 5GMKm 2EJFA 3JCMW 2DZCA 2HNIA 3EFSA 4C92F 3RKWA 4M77D 2FB7A 3JCMc 3RESA 4HT8A 4M78C 5DY9A 3QSUA 4RCBA 1BIBA 4M77G 3JCMh 3JCMX 4PJOC 2ZGWA 2DKGA 4C8QF 3SWNA 3BW1A 4PJOB 1H641 4M78F 2FYKA 3QO3A 5GMKe 3JB9D 4M7DE 1KQ2A 2E41A 4N0AC 5GAOp 3M4GA 4NOYA 4NL3A 2YHTA 1I4K1 2RA2A 3BDUA 4M78A 1B34B 2RM4A 4C8QE 4C92G 1N9SA 3V8LA 4C8QD 4M7AG 4Y91A 4M75G 4XTUA 2VXEA 2DEQA 2JN0A 2DVEA 4JUVA 4M77B 4EMKA 4F7UB 2DTOA 3AHUA 3FIFA 3HFOA 4M7AA 4XQ3A 1N9RA 2EAYA 4PJOG 4C92E 4F7UG 5LJ5h 1I5LA 1M8VA 5LJ5e 3QHSA 5LJ5f 5LJ5d 3SWNB 4JRIA 4M7DG 4J6XA 1WNLA 4C92B 5GAN7 3RERA 2E64A 1Y96A 4EMGA 4HT9A 4X9DA 5GAOr 3V7RA 3INZA 4QVDA 4M75B 3JB9J 4MMLA 4F7UA 4J6WA 4EMKC 4C8QB 1KQ1A 3FB9A
chains in the Genus database with same CATH superfamily
2DTIA 1YHQQ 3VKIA 1KIKA 2HQHA 4L6V5 4XU0A 1SKUB 3FEOA 4RG2A 3REBB 1OV3A 2ROLA 3H0FA 2YSQA 2COZA 3PIPA 1UJ0A 5GAMd 4KH1B 3VRYA 1WZOA 4JS4A 3CCJT 1ZA2B 4IUUA 4M7DA 4JLGA 5GMKh 4JPBW 5FU6B 1PC0A 1YBYA 2CGHA 1VYTA 2FRWA 2RN8A 2PUKB 1G3YA 2CH4A 1JQQA 2RF0A 3MCAB 2DL8A 2E5QA 2J7IA 4BE0A 3X24B 2DJQA 2LCLA 2O2OA 2RQRA 2KY9A 5HK3A 4GBQA 2V8KA 4M77E 1YI2A 5EG2A 1GCQC 3EG9B 4L5GA 1VQ6A 2GTJA 3I56A 1PCXA 3OYHA 5CK9A 4M7AD 1EFNA 2X4JA 2KYBA 5D7UA 1GBQA 4MZTA 4CI0C 1VQ7Q 2OX7A 2QGFB 4C0DC 4OGEA 2RQUA 3J80E 1AT1B 3JAME 2MF2A 3MKDA 2MCNA 5J26A 4DEXA 4E6RA 4JJDA 2M0OA 2O31A 4OF1A 2YHTA 3G7ZA 4X34A 3VS2A 2FRYA 4M7AG 3Q1JA 4RMOA 2VXEA 2RI5A 1XTDA 5LJ5h 3G6ET 3QHSA 2NWMA 1M90R 5LJ5f 4C0GA 1X6BA 1BYMA 3RERA 1W70A 3TSZA 4C92B 2DA9A 1UGPB 2DL3A 3I55Q 2RHXA 1GL5A 4QVDA 5GAOl 2RJCA 4Q5WA 2KBTA 2LCCA 2EKHA 4KGZB 1TU0B 5CIUA 1MNEA 3KBGA 2JOYA 2KGTA 3E9FA 4FYXB 4E7LA 1T3SA 2W10A 1IHVA 3QG1A 3H41A 3EG0A 1K73U 3CC2T 3M0PA 1VQKT 1Q81R 2P4RA 3DB4A 3RIRA 2A3LA 1J3TA 2EWNA 3TVTA 2FEIA 5CR2A 2J05A 1WGSA 1QCNA 1QWFA 1N8RU 3CCST 2WACA 4A4HA 5AYFA 1MHNA 3VS7A 4RUGA 2E65A 3HSBA 3ER0A 1VOMA 4BE2A 2K5FA 1UUEA 2KT1A 3PIOA 1UHFA 2ABLA 4RKUE 3WVDB 2P0PA 2K5IA 4RG8A 3JCMW 1I0CA 1OPKA 2PQWA 2VGNA 3MEVA 3PMIA 2CZ6B 2JTEA 4IURA 4IUPA 2RM4A 3V8LA 4C8QD 4J9BA 3GP8A 3OYNA 4JRPA 2GTOA 1I5LA 4E7ZA 2OTJT 2EQJA 2QI2A 1K73R 2XHCA 1FMKA 2KYMA 4J7FA 4R55A 2FVUA 4M75B 4X1VA 3C12A 3CC4Q 2F2WA 1AZGB 5I2SA 2YRDA 4OB3B 1K1ZA 2OTLA 1NG2A 3N5BB 1OU8A 1PKSA 3VU3C 2BE9B 3L2WA 2OTJA 2VYTA 4C8QG 2KK4A 3RMQA 1ZBJA 2XI9A 1QVGS 3JB9G 3S6WA 1VQ8A 2LQWA 2D1XA 2CP6A 4M4ZA 3G4SQ 1H3ZA 5KYWA 1X69A 1U5SA 1R77A 4HXJA 1W2BP 1YJ9Q 3M9QA 1OZ3A 1RABB 5C0MA 2C0TA 3I56Q 2M0YA 1VQOQ 1KK7A 5LJ3f 3QYGB 4M7DF 8AT1B 1JU5C 3QBYA 3OYYA 2KEAA 2HAXA 2JVVA 2PUOB 1KQSP 2EQIA 2DMOA 4C0DB 4F16A 1Q86R 4A63B 1QCFA 3M0QA 5GAN2 3CCRQ 2EJGA 2YUPA 3EFSA 4B9WA 1N8RC 1WIEA 1RAGB 5I2MA 2OTLQ 4D8KA 4C8QF 3EAEA 1D1BA 3URGA 2IVWA 2CS7A 2F5TX 2E6ZA 1PWTA 1RADB 2EYQA 4AMCA 3LLRA 1B34B 1YHQT 1UFFA 2DE0X 4PFZA 4JUVA 4M7AA 3BE3A 3FIFA 1QWEA 3CBPA 2C0IA 3PE0A 1BBZA 1KQSS 1VQLA 4EMGA 1AWWA 2FL7A 4QQ6A 2D6FA 2XU8A 3CC4T 3LWIA 1QVPA 3M4YA 1MUZA 2LP5A 1MV0B 3GLXA 1N8RR 1RUWA 3LGLA 3SDZA 3VS1A 3CCMA 5IH2A 1LPLA 3M0TA 1ZBXA 3HRSA 1WHGA 2KT8A 3LH5A 3NTKA 2RI2A 5FU6C 4HVWA 5GMKj 4KT0E 4LUEA 5GAOq 5FU7B 2GNCA 3P8BB 1IGQA 3CCLT 2P0KA 5AT1B 2EW3A 5I22A 4ZTFA 5D6WA 3R6NA 1FXXA 2CP3A 1BI3A 1WJQA 1AEYA 5IAYA 1MMNA 1M2VA 2NUZA 2E3IA 4X9CA 1K0XA 4PL6A 2DLPA 1VQKQ 5KYXA 2DXTA 1B34A 1IO6A 2LRQA 3KFVA 1JJ2S 2B8AA 3DLMA 4FSXA 2MMPA 3TCJA 4F7UE 2LX7A 2LQNA 1M1KU 3CCRT 3VYGA 2JXBA 1M1KC 4EMKB 1VQPT 4NL2A 4DBFA 3X20B 1D09B 4M77D 4WCIA 2PU9B 1VQMQ 1H641 1ABOA 4NS5A 1AWOA 2LJ3A 4M7DE 1ZA1B 1S72A 5IN1A 3QJ6A 1RAEB 1M27C 1S72T 2DEQA 2QDLA 5KE2A 4BD3A 3CCUT 4E47A 1UGSB 3CCEQ 2LZ6B 2AIRB 2QYZA 3GF5A 2YXYA 1TS9A 1Y96A 3CC7Q 1VUBA 3V7RA 3OYEA 3CMEA 4J6WA 1QP2A 2R5MA 4ELYC 3CC2Q 3P8DA 2O9SA 5KYWB 5GANe 2DBMA 4BDZA 4KUDK 1PG5B 1RACB 1VQ5Q 3NTHA 2HDAA 3I35A 4XTWA 2PVGB 1NLPC 4ZN1A 2XDPA 2K7AA 4RTXA 5LL6S 3EGUA 5GMKl 1ARKA 2DTHA 1WPYA 5CVIA 1NM7A 4PJLA 2DRMA 4C8QA 1WLPB 2BZ8A 3CBOA 2QQRA 1NLOC 3LYIA 2KVQG 4R56A 3JCMe 1YI2Q 2NLUA 1T0HA 3MO8A 4M7AF 1NYGA 3FDRA 1UGQB 3G1JA 1VQ6Q 3X26B 5HK0A 2FO0A 4OGCA 4Z89A 4PJMA 2QQBA 4HCBA 5KYUB 3CPWP 2VWFA 2X35A 1TWBA 1VYVA 4XU1A 3JCMg 2PZ1A 2RO0A 3E1SA 1AZEA 3EFOA 3CCEA 4A4GA 9ATCB 4FW2A 2DNUA 2L89A 1VQ9Q 1NJIU 3JCMX 3M57A 4E7SA 2KSSA 2K3XA 4OB0B 1Y57A 4LD6A 2R5AA 3CMEQ 1T3LA 2RJEA 2DVEA 1NPRA 1K0SA 2EQUA 2RNAA 3CCET 1Y71A 2YRCA 5LJ5d 2YUOA 2SEMA 3ASKA 2EKOA 3REAB 2L0AA 4HT9A 5GAOr 4LUDA 1YJNA 5A0LA 1NZ9A 1LVKA 2XKOC 3QKJA 3WVEB 1M5Q1 2HQEA 2YT6A 1IHWA 3G4ST 4GY5A 5CQXA 1FMWA 3DKMA 3S3MA 4M78D 3MHXA 2DXCA 2F69A 3EH1A 4RTUA 4BI4A 5GAMg 1VQKA 4N4IA 1BI1A 2EFIA 5KH6A 2QGGA 3QIIA 1K9MU 3BDLA 3E19A 2K6DA 3OYKA 1D0YA 3MPUB 4PLLA 4O6JA 3VJPA 2WSFE 2EYXA 1BIAA 5EC7A 4Z02A 1RAAB 1TUCA 3JCMb 2XDBA 3VS4A 3U23A 5CAIA 2CKKA 1VQ6T 1NE8A 4LD9K 2A7YA 3PGGA 4RTWA 1U1TA 1O75A 2CP5A 3OYDA 4V2SA 1M9SA 1NEGA 1E7OA 1TUDA 2YWWA 3QWXX 5CKFA 1KD1C 3S3OA 1VA7A 2DD5A 1CKBA 4FYYB 1YJWT 4PFPA 3CXCP 5GAMe 2QTXA 2DD4A 2EBPA 1I8FA 5GMKm 2LVMA 2EJFA 2JJ9A 4J7IA 3VS3A 2HNIA 2QQSA 4F17A 1JXMA 4CRIA 1BIBA 1WXUA 4LDXA 1Z9ZA 2DKGA 3CD6Q 3G4SA 3QO3A 4ESRA 1PD1A 1QVGA 1QW1A 4N4GA 2ROTA 4Y91A 3QXEB 2X3XD 1VQPQ 6AT1B 1AHJB 1KQSA 1DJ7B 4JJBA 1MNDA 1U06A 1A0NB 3SWNB 3I5SA 2CUDA 2LT4A 5KYUA 2BE7D 1M8MA 2CREA 2XD0A 2HQXA 3NFCA 2NUTB 1WXTA 2HSPA 3NGPA 3GPLA 1UJYA 2Y90A 3OSSC 4C5IA 5KYYB 1OOTA 3QDFA 3VYHB 3I55T 4F14A 1I81A 5IHIA 1M3AA 1IRXA 1LJOA 4M75F 1Q82R 4HCKA 2E1HA 3ZBDA 2XDDA 1I1JA 1FMVA 3RUXA 2RI3A 1VQ4T 1QCOA 1WI7A 4JS5A 1BB9A 1AWJA 2A36A 1BCOA 2DL7A 5GAMh 3I56T 2SRCA 4FM4B 3I55A 2QASA 5LJ3d 2DAQA 1VQOT 1N6AA 4EMHA 1C1AA 2KE9A 3A8HB 2KNBB 2RMOA 5CQYA 1ACMB 2M02A 4BUGA 1LNXA 4LDVA 2A37A 3D7SB 1SEMA 2E4HA 3C4SA 3SB2A 1YJWQ 3V7CA 3HFNA 3ZEHA 4GLMA 2FHDA 3CCQT 4ATOA 4ELZC 1Q7YC 1TOVA 3QYHB 5FROA 3UWNA 3GIBA 4M7DB 1XNIA 4DA4A 2DIGA 2RK1A 2JM9A 4DOWA 1X6OA 1Q86C 1YJNQ 3S3NA 2LC4A 3CBMA 2OJ2A 2BTTA 4R0KA 4J9HA 2OTLT 3X25B 2JMAA 1H3HA 4M78F 5GMKe 1QMCA 2E41A 1JB0E 3CC2A 4HVUA 1HYOA 2O01E 2CT4A 1KHCA 4FT4A 4XQ3A 4B6MA 1VQNA 1G3SA 1GRIA 1AOJA 3SHWA 4VUBA 3VS6A 4OB1B 5A0DA 1JXOA 1IREB 1ZUKA 5KYYA 2D8HA 1VYUA 2KRNA 2RQVA 4JRQA 3VUBA 1NPPA 4FT2A 2JT4A 1K9MR 3H0HA 1KSWA 4P5NA 3PVLA 1QVFS 1D0XA 3MP8A 1FX7A 1FWZA 1AD5A 2D9TA 3BFMA 1M4ZA 5LJ3e 4J9CA 2DO3A 4OMOA 3VS0A 1OEBA 3GNFB 2K2MA 4KH0B 1OULA 1ZSZB 2R58A 3UT1A 2ENMA 5GANh 1VQ4Q 4J83A 2K5LA 1WHJA 3OS0A 3A8LB 1RLQC 2M1HA 5D6XA 2K2VA 3M0RA 2DX1A 3EGDB 4IUQA 1TXQA 3TSWA 3JCMP 2HKQB 3TREA 1I5OB 4JZ3A 2ATCB 2X4YA 2H3EB 3EG3A 3QJYA 1GXIE 4C0FA 4RTTA 2AT1B 3HTRA 4UC4A 2FPEA 1K8AR 4KBMB 1YJ9T 4C92A 2KAFA 3L2ZA 1HK9A 1X2QA 1X43A 4JJCA 3AT1B 2LQ8A 4MMKA 3HKSA 3OMGA 1EIFA 4QQGA 2KRSA 2XMFA 2QXFA 2FG0A 3ULRB 1TSFA 2RQWA 4IKFA 1Y07A 3BW1A 1YWPA 1R0BG 2LTOA 2H3JA 3I5RA 4L59A 2VUBA 3L42A 3LH0A 1PHTA 2AHJB 2CDTA 1JJ2A 4C92E 2EAYA 3X28B 4IIMA 3G6EQ 4PFOA 3QWYA 5GAN7 1Q86U 2R57A 3CC7T 3OYGA 2X4WA 3HRUA 2V8IA 2ZPFB 1YIJQ 5IT9E 4QKUA 3V8JA 4LXCA 3EH2A 2CYZB 4HA8A 5J3BA 1K8AC 2VASA 2Y4YA 1HXDA 2YLBA 4BI8B 5I21A 3H6ZA 4Y92A 1TH7A 2EQMA 1VQPA 4M7DC 3EGDA 4II1A 1YITQ 1YJWA 4OP0A 2YLCA 2DERA 2VV5A 1WJRA 2COYA 3EHRA 4E7JA 1M3CA 1D0ZA 4M75A 2QA4A 2PNIA 3M0UA 1SSFA 1VIEA 4J9FA 1WX6A 1JO8A 3M5AA 1E6GA 3PNWC 2EJ9A 3LX7A 4Z8AA 1M1FA 5LJ5j 3JCMQ 1K73C 2I2LA 3JRZA 3G71T 1Q7YR 5DM7R 2VKNA 3M59A 3M58A 4N0AA 3OYJA 3L2RA 5HY6A 5IXBA 3DB3A 2MAMA 2A0FB 1WHKA 4HVVA 2G6FX 3OB9A 3EG2A 1Y0MA 2MPXC 3G6EA 3QDRB 3QZ5B 4BB7A 1KFZA 1MMGA 2K3BA 2O4XA 1RI9A 2RHUA 5DY9A 1VQ9T 3UA6A 1G3TA 2AK5A 1IB8A 3OS1A 4C5HA 1WA7A 3ZL7C 1WJSA 5FRMA 3M4GA 4FW1A 3OW2A 1PD0A 4C8QE 1WHLA 4EMKA 2DTOA 2F2XA 4F7UG 4JRIA 3CXCA 1WNLA 1JEGA 2J6OA 3CCVT 3H0IA 3OYMA 4KUIA 2PTKA 3TU4K 4A54A 2CZ0B 1Q82U 3J7AF 3BY7A 1SRMA 3A98A 2DF6A 5GAN4 2DL5A 1AWXA 1Y96B 3OA6A 4M75C 4A4EA 1S1NA 2K4YA 1VQMA 2YDLA 2J06A 3OS2A 2VXFA 1X2KA 1YITT 2M9UA 3NMZC 1D3BB 2JM8A 4XTVA 4M77C 8ATCB 3HRTA 4PJOE 3FC3A 4D6WA 2NYSA 3E2UA 2RQTA 2QAZA 3CCSA 4E7IA 2LDMA 1OYXA 3FJPA 3JCMV 2D0QB 5GANd 1ZX6A 1O9SA 2WSEE 4ORZA 1Z9QA 4JDSA 2HKNA 1M2OA 4XTZA 1U1SA 1HJDA 2LQKA 4CC7A 2FPFA 2V1RA 3QPHA 4DBRA 3LW5E 2QEXQ 4N4HA 5CO7A 4ZNXA 2J6KA 5LJ3j 4C8QC 2P4TA 5KYNA 2LNVA 1YHQA 2RB6A 4B9XA 1PSFA 5GMKi 3CCVA 5L8RE 1VQNQ 4C92F 4DBQA 3MJXA 3NHNA 5HCKA 3JCMc 4M78C 4RCBA 4KRTA 3RMSA 3CD6T 4EDUA 3CMAT 3CPWS 1VIFA 4PJOB 3SWNA 3MEUA 4KULA 2HL5C 2VB6A 2GFUA 4RTZA 4XAXB 4MZMA 2CP7A 1OX9A 5D6YA 3GOXA 2DILA 4FYWB 2JN0A 1R0CB 4F7UB 2KMTA 5IHNA 1N9RA 1TUGB 4PK4A 4BDYA 1QVFA 1FYNA 2A28A 2QG9B 5I11A 1WHHA 1KC8C 5A0GA 3WXMB 1GBRA 2P84A 1VQLQ 4PJJA 2I0NA 3C0CA 4ZGJB 3JV3A 5CKDA 1NBEB 3CMET 2GQVA 4BE1A 5GAN6 3M53A 2XICA 4XU2A 3OSVA 1P92A 2HBPA 2JUFA 4O5VA 1VQ7A 4MDWA 1BI2A 3EGXA 3QZ9B 1Y7XA 5FWCA 5C6SA 1YIJT 1QKWA 3OYLA 3META 2L2PA 3SWNC 5M9OA 2BIVA 2HEQA 2KR3A 1Q81U 1RI0A 2EPDA 3A5ZB 1RAIB 3JCMd 3CCLQ 1M90C 1VQ8Q 2CH4W 2KQWA 2GBQA 1BU1A 5LJ3h 3G71A 1MV3A 2DJZA 2ZCFB 1YIJA 3CEYA 1G8XA 3V7SA 5L23A 5GAOm 1ZSZA 2ZPHB 1LOJA 3O8VA 3M54A 5GANg 3PFSA 2DIQA 3OBYA 3E9GA 3OYFA 1TTHB 3CCMQ 1G5VA 4M75D 2GGRA 2RJDA 4AG2C 4Y28E 3CPWA 5LJ5g 1IXDA 2FZGB 1PSEA 1VQ9A 2PVDB 2DYIA 2FZCB 2LT1A 2B86A 1KG1A 4PJNA 1YITA 2YRVA 2JMCA 1NJIC 5DLQE 3J81E 3JCMh 2ED1A 2AZSA 1NYFA 5CKBA 1SSHA 3PT9A 5A2QE 1PNJA 1C0MA 2AKLA 4QQDA 2F2VA 4OB2B 4LDWA 2JS2A 4XTUA 1WXBA 1OX8A 3NPFA 1ZSGA 1VQ7T 1M8VA 3CCUQ 1ZSZC 5LJ5e 2QQAA 2DK3A 1GFCA 2ZPGB 4DOVA 2PVOB 2V26A 2F5KA 4X9DA 2O4XB 4FSSA 1V76A 2ZPIB 1SRLA 4MMLA 3JB9J 2WSCE 4EMKC 3JCMJ 2BZXA 4HCZA 4DQ2A 3A8OB 1QVFP 2Z0WA 2HZYA 2XK0A 4ZGDB 2JZ2A 3GNGA 4FCYA 3MP1A 4KGVB 1SPKA 1VQ4A 2KRMA 4XTYA 2V8JA 3M56A 4RCCA 2DVJA 2GQIA 3RNJA 1K9MC 2ESWA 2COWA 2IIMA 2ZPBB 2DZ9A 2K79A 1K4US 1PRMC 2JTMA 3HL8A 2LCSA 2JNGA 1MGQA 3JSCA 1W1FA 1RAHB 2QTVA 3G71Q 3O5ZA 4MDXA 2KROA 1GCPA 2MK5A 2DL4A 3V8KA 3UA7A 5CKHA 4E2FB 3CC7A 3CCJA 2DXBA 4GLKA 2E70A 4JJNK 1G83A 4ZTJA 1UECA 3EFOB 1W2BS 2ZPEB 1YNZA 3JB9H 1MMAA 3PMTA 5CCAA 4PJOD 3EGXB 1SG5A 3RKYA 1CKAA 4M7AB 1XQHA 2LMJA 2V1QA 3OY9A 1G2BA 2GCXA 1MMDA 4JLIA 4OMPA 4RTYA 1IZ6A 2QQ9A 2QA4Q 2VGMA 2RHYA 4QVZA 4IUTA 3MEAA 4FYVB 1V29B 1K8AU 2ZGWA 5FRNA 4MZPA 3H9NA 3JB9D 5GAOp 1X27A 4NOYA 4BI3A 2RA2A 4C92G 2RPNA 1PKTA 4C0ZA 1UGVA 2QDYB 1TG0A 3HFOA 2FPDA 2L8DA 2H8HA 4CC3A 1F1BB 3CQTA 2XG8D 4QW2A 2EYYA 2E64A 4KGXB 3RBBB 3IQLA 2KDSA 4F7UA 3RR6A 4AFSC 3EG1A 3CXCS 3M55A 1G3WA 4JRKA 4F04B 3HHTB 1ZUYA 1BKBA 2MWPA 4M77F 3UDCA 1QVGP 2HCKA 3FJ5A 2HD0A 4AT1B 2K57A 5GJWB 5GAMf 1SHFA 1QQJA 2C06A 3CCJQ 5GAN3 3THKA 1ZQ1A 4M78G 4CC4B 4C92C 3CCRA 3LGFA 3PVQA 2L3PA 3EHQA 2DETA 3UPUA 3A1PA 4XTXA 5FWBA 3VRZA 5CKEA 1YWOA 2DPPB 3CCQQ 1GCQA 1SF9A 2D0NA 3RDVA 4HCCA 2D8JA 3T9NA 3RKXA 1VQNT 5GAN8 1OU9A 3OYBA 3SD4A 2BKDN 2HBWA 1RL2A 4M78B 4WF2A 1WHMA 2YUNA 3OS5A 7AT1B 2GF7A 1Q7YU 1D1CA 1M1GA 2MIOA 1E6HA 2QK0A 1W6XA 2LX9A 2ED0A 2DZCA 1OPLA 2DEUA 2OTJQ 3QSUA 2ZZDA 4M77G 3A8GB 2C0OA 1ABQA 2EGAA 1HD3A 5IHKA 1EX4A 1NJIR 2IPOB 4N0AC 4NL3A 3HPWA 4J9IA 2EGCA 4M75G 4AFZC 1U3OA 4PJOC 2VVKA 3F70A 1IGUA 2MWOA 1VQOA 3INZA 2LJ0A 3DLLA 4C8QB 1KQ1A 4DBHA 4LDUA 1I07A 2HSEB 2O88A 1XJWB 2HL3A 5J39A 4BY6B 4D8DA 3L1AA 4AFUC 1B07A 3CCUA 4XK8E 5GAMj 2VC8A 1GFDA 2RD1A 1D1AA 1K9AA 1HSQA 3UF4A 4QT7A 2JS0A 1SHGA 1ZHIA 5HKCA 4OMMA 1X01A 2LNHB 3CCQA 2OI3A 2E6NA 1YFNA 4ZN3A 4A53A 4ANJA 4J8OA 1UGRB 4AG1C 3L2UA 1BCMA 1YCYA 3JB9F 5DLOA 4OMNA 4DEYA 5GANf 4HKEA 1JBMA 1BK2A 3ME9A 3EFRA 2DXUA 2FZKB 2EVRA 2M16A 1UEBA 1V1CA 2CT3A 2K3YA 2QEXT 4Z88A 4OMFB 5GAOn 4C5EA 4M75E 2L5QA 1QLYA 4LDYA 2RH2A 3M0SA 3OYIA 4CC2A 2NUPB 2MYSA 1B3QA 3RKWA 1WDXA 4EIKA 4HT8A 2BUDA 3CCLA 2X3WD 2Y4XA 3OMCA 4OMLA 2FYKA 2O9VA 1KQ2A 1BI0A 5KYXB 4OVAA 3MP6A 4M78A 3CMAA 2ZAEA 3L2QA 3VS5A 2CSQA 1H8KA 2E5KA 1M90U 1WYXA 1UG1A 4IUVA 4JZ4A 1LCKA 4LN2A 3FB9A 2A08A 4A4KA 1YP5A 2X51A 4M7DD 5FW9A 2CSIA 2CUBA 4XU3A 2E3HA 1UE9A 4F7UF 4EPCA 1WQ7A 1YN8A 4M78E 3KXTA 5GAN5 4PNOA 1Q82C 1N27A 2CP2A 1RAFB 4FIBA 4M77A 1B7TA 2F1LA 1VQ5T 1UHCA 1C6VX 3CD6A 5FLXE 3OQ5A 3JCMf 1VQ8T 4IIOA 2DM1A 2RK2A 5FU7C 2L3SA 1R8OB 3ZFJA 1XOVA 1N5ZA 2CP0A 3P8HA 3A8MB 4BY6C 2RHZA 2CZ7B 2W0ZA 2X9HA 3C94A 2M51A 4J9DA 2HMAA 1Q95G 4PJOA 3CCMT 1YI2T 4E7KA 4M7AC 2OAWA 1U8RA 5GANj 2J6FA 4J9EA 1QP3A 3FLGA 2K9GA 2EYWA 4BACA 2LJ1A 1X75C 1OQKA 4WTOB 3CCSQ 4K11A 2EGEA 2KXCA 2KI7A 2OAUA 3RESA 1UTIA 3OBWA 3L2VA 2DBKA 3CPFA 1NEBA 2G3RA 3C95A 4C5GA 1I4K1 3I9QA 3BDUA 1UDLA 2NUPA 5KCHA 4E7HA 1JJ2P 5GJVB 4M77B 3AHUA 5IXFA 2DFUA 4PJOG 4FU6A 2MI6A 4AFQC 1KJWA 1M30A 4FL6A 2AKKA 1KD1R 3R6OA 2YUQA 3TEEA 2QEXA 3TQ7P 1D3BA 1YJ9A 2MOXA 2L3QA 3SFMA 1PM3A 4OMQA 2DRKA 2EIFA 1KHIA 1WFWA 3GBQA 3OYAA 3OW2P 4J6YA 3EG9A 1QKXA 1UB4A 4C92D 4RTVA 3OW2S 5KCOA 2ECZA 2AZVA 4ZGEB 2P0QA 3OYCA 3H8ZA 1WQWA 1VQ5A 2EYZA 1RLPC 1T0JA 1ZUUA 1JRIA 4M7AE 4QVCA 1OZ2A 1Q81C 3SEMA 2RJFA 3QUIA 2L3RA 3PTAA 4TVRA 4ME7A 4PLIA 1AVZC 3MEWA 1PRLC 1CSKA 2GFAA 3FRNA 5LJ3g 1W2BA 2BZYA 4PJOF 1M1KR 2E10A 4J9GA 3CMAQ 1KD1U 3HP9A 4J5YA 1K76A 1KC8R 3KUFA 3UATA 2JW4A 1OI1A 3JB9I 3CC4A 2QA4T 5KE3A 1YJNT 2NUTA 1M2VB 2FB7A 4LE9A 4YTLA 2E12A 1VQMT 1X6GA 3NTIA 1W4SA 2JTFA 1ZLMA 1VQLT 1EZZB 2IG0A 1N9SA 4LNPA 1M3BA 3LWHA 1S72Q 2X4XA 2RHIA 5ECAA 2CZ1B 4PKCC 4M7DG 2EQKA 4J6XA 1KC8U 3VV0A 2XIDA 2KXDA 2DYBA 4A4FA 3VUZA 3CCVQ 1H92A 1YCSB
chains in the Genus database with same CATH topology
3P8DA 2DTIA 5IT9E 3V8JA 5GANe 3M55A 3VKIA 3CXCS 1G3WA 4BDZA 4JRKA 2CYZB 4L6V5 4KUDK 4HA8A 4XU0A 3FEOA 3HHTB 3NTHA 4XTWA 4RG2A 5J3BA 1K8AC 2Y4YA 1BKBA 1HXDA 2MWPA 2PVGB 2YLBA 4M77F 3UDCA 4BI8B 5I21A 4ZN1A 2XDPA 3H6ZA 2HD0A 3PIPA 1TH7A 2K57A 5LL6S 2EQMA 1VQPA 5GAMf 5GAMd 4M7DC 5GMKl 2DTHA 1WPYA 5CVIA 4JS4A 4C8QA 3CCJT 4IUUA 4II1A 1YJWA 4OP0A 2C06A 2YLCA 2QQRA 3CBOA 5GAN3 4M7DA 4JLGA 2VV5A 5GMKh 1WJRA 1ZQ1A 3LYIA 4M78G 2KVQG 5FU6B 4R56A 4C92C 3CCRA 4E7JA 3LGFA 3JCMe 1YBYA 3UPUA 2NLUA 2CGHA 3MO8A 4M7AF 4M75A 2QA4A 3FDRA 4XTXA 2PUKB 1G3YA 5CKEA 1UGQB 1SSFA 1VIEA 2DPPB 3MCAB 3M5AA 3X26B 3PNWC 2E5QA 4HCCA 5HK0A 4BE0A 4OGCA 2EJ9A 3X24B 2LCLA 3LX7A 3T9NA 1M1FA 3RKXA 5LJ5j 2KY9A 5HK3A 3JCMQ 1YI2A 2V8KA 4M77E 5GAN8 1K73C 3OYBA 5EG2A 1VQNT 3SD4A 2BKDN 2I2LA 3JRZA 3G71T 2QQBA 1RL2A 5DM7R 4M78B 4HCBA 4L5GA 4WF2A 1VQ6A 3M59A 3M58A 3OS5A 2X35A 4N0AA 5HY6A 3OYHA 3OYJA 3I56A 5CK9A 3L2RA 4M7AD 3DB3A 2GF7A 2MAMA 1Q7YU 4XU1A 3JCMg 1M1GA 2X4JA 2RO0A 3E1SA 3OB9A 4MZTA 4CI0C 3G6EA 4A4GA 3CCEA 3QDRB 3HRUA 3QZ5B 4BB7A 2LX9A 2DZCA 2L89A 4C0DC 3CCST 2O4XA 2RHUA 3QSUA 4OGEA 2ZZDA 5DY9A 1G3TA 3J80E 1VQ9T 4M77G 3JCMX 2MF2A 3A8GB 3JAME 1NJIU 3OS1A 4C5HA 5J26A 3M57A 2KSSA 1WJSA 2M0OA 5FRMA 4N0AC 2K3XA 3M4GA 4OF1A 3HPWA 2YHTA 4NL3A 3G7ZA 4X34A 4OB0B 3OW2A 4C8QE 4LD6A 2R5AA 4M7AG 4M75G 3Q1JA 4RMOA 2VXEA 2RI5A 2RJEA 2DVEA 4EMKA 1NPRA 2DTOA 4PJOC 1XTDA 2EQUA 5LJ5h 3F70A 1Y71A 4F7UG 3G6ET 3CCET 3QHSA 5LJ5f 5LJ5d 4C0GA 4JRIA 3CXCA 1BYMA 3ASKA 1WNLA 4C92B 2MWOA 2EKOA 3RERA 4HT9A 1UGPB 1VQOA 2RHXA 5GAOr 3INZA 4QVDA 3CCVT 1YJNA 5A0LA 1NZ9A 3DLLA 4C8QB 1KQ1A 5GAOl 2RJCA 3OYMA 4KUIA 3TU4K 2XKOC 3QKJA 4Q5WA 3WVEB 2LCCA 1M5Q1 2HQEA 4LDUA 4A54A 2CZ0B 1Q82U 3J7AF 3G4ST 3BY7A 4GY5A 5CQXA 4BY6B 5J39A 5CIUA 3DKMA 3L1AA 5GAN4 3KBGA 3S3MA 4M78D 2JOYA 2DXCA 2F69A 3MHXA 4BI4A 5GAMg 3E9FA 1VQKA 3CCUA 1Y96B 4N4IA 4E7LA 3OA6A 4M75C 4A4EA 4XK8E 1BI1A 2EFIA 5GAMj 2VC8A 5KH6A 3QIIA 2RD1A 2K4YA 3QG1A 1VQMA 1K9MU 3OS2A 1K73U 3BDLA 3E19A 2VXFA 3CC2T 3OYKA 1VQKT 1YITT 2M9UA 4PLLA 3DB4A 1D3BB 4XTVA 3RIRA 1ZHIA 4M77C 4O6JA 5HKCA 1X01A 3VJPA 2A3LA 2WSFE 3HRTA 4PJOE 1BIAA 4Z02A 3CCQA 3FC3A 2E6NA 4D6WA 3JCMb 2XDBA 2EWNA 5CAIA 4ZN3A 4A53A 2CKKA 5CR2A 4J8OA 1VQ6T 1NE8A 1UGRB 3CCSA 3L2UA 4LD9K 4E7IA 1WGSA 2LDMA 1YCYA 1OYXA 3FJPA 5DLOA 2A7YA 1N8RU 3JB9F 3PGGA 3JCMV 2D0QB 2WACA 5GANf 5GANd 1U1TA 1O75A 1O9SA 2WSEE 4HKEA 4A4HA 3OYDA 5AYFA 1JBMA 1MHNA 4V2SA 1M9SA 3ME9A 3EFRA 4JDSA 2DXUA 2E65A 4XTZA 5CKFA 1U1SA 2M16A 1UEBA 3ER0A 1KD1C 3HSBA 3S3OA 2LQKA 2K3YA 2QEXT 3QPHA 3LW5E 4OMFB 2DD5A 1YJWT 5GAOn 4BE2A 4C5EA 4M75E 4N4HA 2L5QA 5CO7A 5GAMe 2QTXA 2K5FA 5LJ3j 2DD4A 4LDYA 4C8QC 2P4TA 2RH2A 2LNVA 1YHQA 3PIOA 4RKUE 3WVDB 3OYIA 1I8FA 2RB6A 4B9XA 2P0PA 1PSFA 2K5IA 2LVMA 4RG8A 5GMKi 2EJFA 4J7IA 5L8RE 5GMKm 2HNIA 2QQSA 4C92F 3RKWA 3CCVA 3JCMW 3JCMc 4HT8A 4M78C 2BUDA 3CCLA 4CRIA 4RCBA 1BIBA 3RMSA 4LDXA 4EDUA 3CMAT 3CD6T 3CPWS 1VIFA 2PQWA 2VGNA 2DKGA 2Y4XA 3MEVA 3SWNA 4PJOB 3MEUA 4KULA 1Q81C 3OMCA 3G4SA 2GFUA 2FYKA 3PMIA 2CZ6B 3QO3A 1QVGA 1KQ2A 1BI0A 4IURA 4OVAA 1QW1A 4MZMA 4N4GA 3MP6A 4XAXB 4M78A 4IUPA 2RM4A 5D6YA 3CMAA 3V8LA 4C8QD 3GOXA 4Y91A 3QXEB 3GP8A 1AHJB 1KQSA 1DJ7B 2JN0A 3L2QA 3OYNA 4F7UB 4JRPA 2KMTA 1N9RA 1I5LA 4BDYA 2OTJT 2EQJA 2QI2A 3SWNB 2XHCA 1QVFA 2LT4A 1KC8C 4J7FA 5A0GA 4R55A 2FVUA 4M75B 1M90U 3WXMB 3C12A 4IUVA 2XD0A 3FB9A 4A4KA 2HQXA 3NFCA 5I2SA 4ZGJB 5CKDA 3CMET 4M7DD 4OB3B 2GQVA 4BE1A 5GAN6 3M53A 2XICA 4XU3A 2OTLA 3N5BB 3GPLA 4XU2A 3VU3C 2Y90A 3OSVA 3OSSC 1P92A 4F7UF 4EPCA 3L2WA 2OTJA 1WQ7A 2VYTA 1KC8U 2HBPA 4C5IA 4C8QG 4M78E 3KXTA 2JUFA 2KK4A 3VYHB 4PNOA 4O5VA 3RMQA 5GAN5 3I55T 1Q82C 4MDWA 1BI2A 1N27A 1VQ7A 3QZ9B 1I81A 1Y7XA 2XI9A 1QVGS 3JB9G 5C6SA 1YIJT 3OYLA 3META 1LJOA 4M75F 3SWNC 3S6WA 1VQ8A 5M9OA 4FIBA 2E1HA 4M77A 2BIVA 1Q81U 3ZBDA 1RI0A 1H3ZA 1VQ5T 3A5ZB 2XDDA 3CD6A 3RUXA 5FLXE 2RI3A 1VQ4T 3OQ5A 3JCMf 3JCMd 1VQ8T 4JS5A 3M9QA 1OZ3A 1M90C 2RK2A 5C0MA 5FU7C 5GAMh 3I56T 2KQWA 4FM4B 3I55A 1R8OB 5LJ3f 5LJ3d 3QYGB 4M7DF 3ZFJA 2DAQA 1VQOT 1N6AA 1XOVA 5LJ3h 3G71A 4EMHA 3P8HA 2DJZA 2ZCFB 3QBYA 3OYYA 1YIJA 2HAXA 3A8MB 3CEYA 2RHZA 3A8HB 3V7SA 2JVVA 2CZ7B 5CQYA 4BY6C 5GAOm 2ZPHB 1LOJA 3O8VA 3C94A 2PUOB 4BUGA 3M54A 1LNXA 4LDVA 5GANg 3PFSA 2DIQA 3OBYA 3E9GA 3OYFA 4PJOA 3C4SA 3CCMT 4C0DB 4E7KA 1YI2T 3SB2A 4M7AC 1U8RA 1G5VA 3V7CA 5GANj 3HFNA 3ZEHA 4M75D 2RJDA 2FHDA 3CCQT 1QP3A 4Y28E 5GAN2 3FLGA 3CPWA 5LJ5g 4ATOA 4ELZC 4BACA 1Q7YC 3QYHB 5FROA 1PSEA 1X75C 3UWNA 1VQ9A 1XNIA 4DA4A 2DIGA 3GIBA 2RK1A 4DOWA 4M7DB 2PVDB 1X6OA 2EJGA 2LT1A 1Q86C 1KG1A 3EFSA 4B9WA 3S3NA 1YITA 2YRVA 2LC4A 1N8RC 3CBMA 1NJIC 2OAUA 5DLQE 3RESA 3J81E 5I2MA 3JCMh 3OBWA 3L2VA 2OTLT 3CPFA 3EAEA 5CKBA 3X25B 3PT9A 3URGA 4C8QF 5A2QE 2G3RA 2IVWA 3C95A 4M78F 2CS7A 2F5TX 5GMKe 2E6ZA 3PTAA 2E41A 4C5GA 2EYQA 1I4K1 1JB0E 3LLRA 3BDUA 4QQDA 3CC2A 1B34B 1YHQT 4OB2B 5KCHA 4LDWA 4E7HA 2O01E 4XTUA 1KHCA 4FT4A 4JUVA 4M77B 1VQ7T 3AHUA 4M7AA 3FIFA 4XQ3A 4PJOG 1VQNA 1M8VA 5LJ5e 1G3SA 3CBPA 2QQAA 4FU6A 2MI6A 2DK3A 4VUBA 2ZPGB 4OB1B 4FL6A 5A0DA 4DOVA 1KQSS 1IREB 2PVOB 4X9DA 2F5KA 4EMGA 2O4XB 3R6OA 1VQLA 2FL7A 4QQ6A 2ZPIB 2D6FA 3JB9J 4MMLA 2XU8A 3CC4T 2WSCE 3TEEA 4EMKC 3LWIA 2QEXA 3JCMJ 4JRQA 1D3BA 1YJ9A 1QVPA 3VUBA 3M4YA 4HCZA 1NPPA 4FT2A 3GLXA 3SFMA 4DQ2A 3A8OB 3LGLA 3SDZA 2XK0A 4P5NA 2EIFA 3CCMA 4ZGDB 2JZ2A 1QVFS 3GNGA 1KHIA 3OYAA 3MP8A 3MP1A 1FX7A 1FWZA 2D9TA 4J6YA 4C92D 1UB4A 1VQ4A 3BFMA 1M4ZA 4XTYA 2V8JA 1ZBXA 3HRSA 3M56A 4RCCA 3OW2S 5KCOA 5LJ3e 2DO3A 1K9MC 4ZGEB 3NTKA 2ZPBB 2DZ9A 2RI2A 2JTMA 2P0QA 3GNFB 5FU6C 3HL8A 3OYCA 2JNGA 5GMKj 4KT0E 5GAOq 2R58A 1MGQA 3H8ZA 3UT1A 1WQWA 3JSCA 1VQ5A 5FU7B 5GANh 4J83A 4MDXA 3P8BB 3CCLT 2P0KA 2K5LA 1JRIA 3V8KA 4M7AE 4ZTFA 4QVCA 1OZ2A 1FXXA 5CKHA 5D6WA 2RJFA 1BI3A 2L3RA 3A8LB 3QUIA 1WJQA 3OS0A 2M1HA 4TVRA 2K2VA 5D6XA 5IAYA 4ME7A 3CC7A 4PLIA 3CCJA 2DXBA 4GLKA 4IUQA 4X9CA 3MEWA 3JCMP 4PL6A 3TREA 2X4YA 2E70A 2GFAA 2DXTA 3FRNA 5LJ3g 3QJYA 1W2BA 4JJNK 4C0FA 1GXIE 1B34A 4ZTJA 4PJOF 1W2BS 2ZPEB 2LRQA 2E10A 3JB9H 4UC4A 3PMTA 5CCAA 1JJ2S 4KBMB 1YJ9T 4PJOD 2B8AA 1KD1U 3DLMA 3HP9A 4J5YA 2KAFA 3L2ZA 2MMPA 4FSXA 1HK9A 3TCJA 4C92A 4F7UE 3KUFA 3RKYA 4M7AB 1XQHA 2LQ8A 1OI1A 4MMKA 3CCRT 3VYGA 1M1KU 1M1KC 4EMKB 3HKSA 3JB9I 3OY9A 1VQPT 4NL2A 2GCXA 3CC4A 3OMGA 4JLIA 2QA4T 5KE3A 1YJNT 1EIFA 1IZ6A 2QQ9A 4QQGA 3X20B 2VGMA 4M77D 2FB7A 2RHYA 4QVZA 2QXFA 4IUTA 2E12A 4YTLA 2PU9B 3MEAA 1VQMT 1V29B 3NTIA 1K8AU 2ZGWA 1W4SA 4IKFA 1Y07A 3BW1A 5FRNA 1H641 2JTFA 4MZPA 4NS5A 2LTOA 2H3JA 3JB9D 4M7DE 5GAOp 1VQLT 4NOYA 1S72A 4BI3A 2IG0A 4L59A 2RA2A 5IN1A 2VUBA 3QJ6A 4C92G 1N9SA 3L42A 3LH0A 1S72T 4C0ZA 2DEQA 2QDYB 2AHJB 5KE2A 3LWHA 2X4XA 2RHIA 3HFOA 4BD3A 3CCUT 4C92E 2EAYA 1JJ2A 2L8DA 3X28B 4E47A 2CZ1B 4PKCC 1UGSB 4M7DG 2EQKA 2XG8D 4QW2A 4J6XA 5GAN7 3GF5A 3VV0A 1Q86U 2XIDA 2E64A 1Y96A 2R57A 1VUBA 3V7RA 3CC7T 4A4FA 3OYEA 3OYGA 2X4WA 3CMEA 3VUZA 2KDSA 4J6WA 4F7UA 2V8IA 2ZPFB 1QP2A 2R5MA 4ELYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3B A;  2DTI A;  1M5Q 1;  3V8J A;  4A54 A;  5GAN e;  4M7D D;  4JRK A;  4DQ2 A;  5GAN 6;  3BY7 A;  4XU3 A;  4HA8 A;  4XU0 A;  4XU2 A;  4XTW A;  3VU3 C;  2Y90 A;  3L1A A;  4M77 F;  1HXD A;  5GAN 4;  2YLB A;  4F7U F;  5I21 A;  1WQ7 A;  4M78 D;  4C8Q G;  5GAM g;  4M78 E;  4J6Y A;  4C92 D;  5GAN 5;  3BFM A;  4PNO A;  1Y96 B;  4RCC A;  4XTY A;  4M75 C;  5GAM j;  1TH7 A;  1I81 A;  2K57 A;  2VC8 A;  5LJ3 e;  2RD1 A;  3JB9 G;  5GAM f;  5GAM d;  2DZ9 A;  4M7D C;  5GMK l;  2VXF A;  1LJO A;  2DTH A;  1WPY A;  4M75 F;  3SWN C;  4C8Q A;  2E1H A;  4M77 A;  5GMK j;  5GAO q;  1MGQ A;  4OP0 A;  1WQW A;  2YLC A;  1D3B B;  4XTV A;  3RIR A;  5GAN 3;  4M7D A;  4M77 C;  5GMK h;  5GAN h;  1X01 A;  3JCM J;  4M78 G;  4PJO E;  3RUX A;  4C92 C;  1BIA A;  3JCM f;  3JCM d;  3JCM e;  1JRI A;  3V8K A;  2CGH A;  3JCM b;  4M7A E;  2EWN A;  4QVC A;  4M75 A;  4M7A F;  5CAI A;  5GAM h;  3QUI A;  4XTX A;  4A53 A;  5LJ3 f;  5LJ3 d;  4M7D F;  1YCY A;  4X9C A;  3JB9 F;  3FJP A;  5LJ3 h;  3JCM P;  4EMH A;  3PGG A;  2DJZ A;  3JCM V;  5GAN f;  2EJ9 A;  5GAN d;  1U1T A;  3V7S A;  2DXT A;  5GAO m;  3RKX A;  1JBM A;  5LJ3 g;  5LJ5 j;  4V2S A;  3JCM Q;  1LOJ A;  4M77 E;  5GAN 8;  1B34 A;  3EFR A;  2I2L A;  4PJO F;  1LNX A;  2E10 A;  5GAN g;  2DXU A;  3JB9 H;  2E65 A;  4M78 B;  4XTZ A;  1U1S A;  3HSB A;  5GAO l;  4PJO A;  4WF2 A;  4PJO D;  4M7A C;  3SB2 A;  4C92 A;  4J5Y A;  3L2Z A;  4F7U E;  1HK9 A;  4N0A A;  3V7C A;  3HFN A;  5GAN j;  4M75 D;  5GAO n;  4M7A D;  4M75 E;  3RKY A;  4M7A B;  5GAM e;  5GAN 2;  4MMK A;  2QTX A;  4XU1 A;  3JCM g;  4C8Q C;  5LJ3 j;  4EMK B;  5LJ5 g;  3JB9 I;  4NL2 A;  3GIB A;  4M7D B;  1I8F A;  2RB6 A;  4JLI A;  5GMK i;  2EJG A;  5GMK m;  2EJF A;  3JCM W;  2DZC A;  2HNI A;  3EFS A;  4C92 F;  3RKW A;  4M77 D;  2FB7 A;  3JCM c;  3RES A;  4HT8 A;  4M78 C;  5DY9 A;  3QSU A;  4RCB A;  1BIB A;  4M77 G;  3JCM h;  3JCM X;  4PJO C;  2ZGW A;  2DKG A;  4C8Q F;  3SWN A;  3BW1 A;  4PJO B;  1H64 1;  4M78 F;  2FYK A;  3QO3 A;  5GMK e;  3JB9 D;  4M7D E;  1KQ2 A;  2E41 A;  4N0A C;  5GAO p;  3M4G A;  4NOY A;  4NL3 A;  2YHT A;  1I4K 1;  2RA2 A;  3BDU A;  4M78 A;  1B34 B;  2RM4 A;  4C8Q E;  4C92 G;  1N9S A;  3V8L A;  4C8Q D;  4M7A G;  4Y91 A;  4M75 G;  4XTU A;  2VXE A;  2DEQ A;  2JN0 A;  2DVE A;  4JUV A;  4M77 B;  4EMK A;  4F7U B;  2DTO A;  3AHU A;  3FIF A;  3HFO A;  4M7A A;  4XQ3 A;  1N9R A;  2EAY A;  4PJO G;  4C92 E;  4F7U G;  5LJ5 h;  1I5L A;  1M8V A;  5LJ5 e;  3QHS A;  5LJ5 f;  5LJ5 d;  3SWN B;  4JRI A;  4M7D G;  4J6X A;  1WNL A;  4C92 B;  5GAN 7;  3RER A;  2E64 A;  1Y96 A;  4EMG A;  4HT9 A;  4X9D A;  5GAO r;  3V7R A;  3INZ A;  4QVD A;  4M75 B;  3JB9 J;  4MML A;  4F7U A;  4J6W A;  4EMK C;  4C8Q B;  1KQ1 A;  3FB9 A; 
#chains in the Genus database with same CATH topology
 2DTI A;  1YHQ Q;  3VKI A;  1KIK A;  2HQH A;  4L6V 5;  4XU0 A;  1SKU B;  3FEO A;  4RG2 A;  3REB B;  1OV3 A;  2ROL A;  3H0F A;  2YSQ A;  2COZ A;  3PIP A;  1UJ0 A;  5GAM d;  4KH1 B;  3VRY A;  1WZO A;  4JS4 A;  3CCJ T;  1ZA2 B;  4IUU A;  4M7D A;  4JLG A;  5GMK h;  4JPB W;  5FU6 B;  1PC0 A;  1YBY A;  2CGH A;  1VYT A;  2FRW A;  2RN8 A;  2PUK B;  1G3Y A;  2CH4 A;  1JQQ A;  2RF0 A;  3MCA B;  2DL8 A;  2E5Q A;  2J7I A;  4BE0 A;  3X24 B;  2DJQ A;  2LCL A;  2O2O A;  2RQR A;  2KY9 A;  5HK3 A;  4GBQ A;  2V8K A;  4M77 E;  1YI2 A;  5EG2 A;  1GCQ C;  3EG9 B;  4L5G A;  1VQ6 A;  2GTJ A;  3I56 A;  1PCX A;  3OYH A;  5CK9 A;  4M7A D;  1EFN A;  2X4J A;  2KYB A;  5D7U A;  1GBQ A;  4MZT A;  4CI0 C;  1VQ7 Q;  2OX7 A;  2QGF B;  4C0D C;  4OGE A;  2RQU A;  3J80 E;  1AT1 B;  3JAM E;  2MF2 A;  3MKD A;  2MCN A;  5J26 A;  4DEX A;  4E6R A;  4JJD A;  2M0O A;  2O31 A;  4OF1 A;  2YHT A;  3G7Z A;  4X34 A;  3VS2 A;  2FRY A;  4M7A G;  3Q1J A;  4RMO A;  2VXE A;  2RI5 A;  1XTD A;  5LJ5 h;  3G6E T;  3QHS A;  2NWM A;  1M90 R;  5LJ5 f;  4C0G A;  1X6B A;  1BYM A;  3RER A;  1W70 A;  3TSZ A;  4C92 B;  2DA9 A;  1UGP B;  2DL3 A;  3I55 Q;  2RHX A;  1GL5 A;  4QVD A;  5GAO l;  2RJC A;  4Q5W A;  2KBT A;  2LCC A;  2EKH A;  4KGZ B;  1TU0 B;  5CIU A;  1MNE A;  3KBG A;  2JOY A;  2KGT A;  3E9F A;  4FYX B;  4E7L A;  1T3S A;  2W10 A;  1IHV A;  3QG1 A;  3H41 A;  3EG0 A;  1K73 U;  3CC2 T;  3M0P A;  1VQK T;  1Q81 R;  2P4R A;  3DB4 A;  3RIR A;  2A3L A;  1J3T A;  2EWN A;  3TVT A;  2FEI A;  5CR2 A;  2J05 A;  1WGS A;  1QCN A;  1QWF A;  1N8R U;  3CCS T;  2WAC A;  4A4H A;  5AYF A;  1MHN A;  3VS7 A;  4RUG A;  2E65 A;  3HSB A;  3ER0 A;  1VOM A;  4BE2 A;  2K5F A;  1UUE A;  2KT1 A;  3PIO A;  1UHF A;  2ABL A;  4RKU E;  3WVD B;  2P0P A;  2K5I A;  4RG8 A;  3JCM W;  1I0C A;  1OPK A;  2PQW A;  2VGN A;  3MEV A;  3PMI A;  2CZ6 B;  2JTE A;  4IUR A;  4IUP A;  2RM4 A;  3V8L A;  4C8Q D;  4J9B A;  3GP8 A;  3OYN A;  4JRP A;  2GTO A;  1I5L A;  4E7Z A;  2OTJ T;  2EQJ A;  2QI2 A;  1K73 R;  2XHC A;  1FMK A;  2KYM A;  4J7F A;  4R55 A;  2FVU A;  4M75 B;  4X1V A;  3C12 A;  3CC4 Q;  2F2W A;  1AZG B;  5I2S A;  2YRD A;  4OB3 B;  1K1Z A;  2OTL A;  1NG2 A;  3N5B B;  1OU8 A;  1PKS A;  3VU3 C;  2BE9 B;  3L2W A;  2OTJ A;  2VYT A;  4C8Q G;  2KK4 A;  3RMQ A;  1ZBJ A;  2XI9 A;  1QVG S;  3JB9 G;  3S6W A;  1VQ8 A;  2LQW A;  2D1X A;  2CP6 A;  4M4Z A;  3G4S Q;  1H3Z A;  5KYW A;  1X69 A;  1U5S A;  1R77 A;  4HXJ A;  1W2B P;  1YJ9 Q;  3M9Q A;  1OZ3 A;  1RAB B;  5C0M A;  2C0T A;  3I56 Q;  2M0Y A;  1VQO Q;  1KK7 A;  5LJ3 f;  3QYG B;  4M7D F;  8AT1 B;  1JU5 C;  3QBY A;  3OYY A;  2KEA A;  2HAX A;  2JVV A;  2PUO B;  1KQS P;  2EQI A;  2DMO A;  4C0D B;  4F16 A;  1Q86 R;  4A63 B;  1QCF A;  3M0Q A;  5GAN 2;  3CCR Q;  2EJG A;  2YUP A;  3EFS A;  4B9W A;  1N8R C;  1WIE A;  1RAG B;  5I2M A;  2OTL Q;  4D8K A;  4C8Q F;  3EAE A;  1D1B A;  3URG A;  2IVW A;  2CS7 A;  2F5T X;  2E6Z A;  1PWT A;  1RAD B;  2EYQ A;  4AMC A;  3LLR A;  1B34 B;  1YHQ T;  1UFF A;  2DE0 X;  4PFZ A;  4JUV A;  4M7A A;  3BE3 A;  3FIF A;  1QWE A;  3CBP A;  2C0I A;  3PE0 A;  1BBZ A;  1KQS S;  1VQL A;  4EMG A;  1AWW A;  2FL7 A;  4QQ6 A;  2D6F A;  2XU8 A;  3CC4 T;  3LWI A;  1QVP A;  3M4Y A;  1MUZ A;  2LP5 A;  1MV0 B;  3GLX A;  1N8R R;  1RUW A;  3LGL A;  3SDZ A;  3VS1 A;  3CCM A;  5IH2 A;  1LPL A;  3M0T A;  1ZBX A;  3HRS A;  1WHG A;  2KT8 A;  3LH5 A;  3NTK A;  2RI2 A;  5FU6 C;  4HVW A;  5GMK j;  4KT0 E;  4LUE A;  5GAO q;  5FU7 B;  2GNC A;  3P8B B;  1IGQ A;  3CCL T;  2P0K A;  5AT1 B;  2EW3 A;  5I22 A;  4ZTF A;  5D6W A;  3R6N A;  1FXX A;  2CP3 A;  1BI3 A;  1WJQ A;  1AEY A;  5IAY A;  1MMN A;  1M2V A;  2NUZ A;  2E3I A;  4X9C A;  1K0X A;  4PL6 A;  2DLP A;  1VQK Q;  5KYX A;  2DXT A;  1B34 A;  1IO6 A;  2LRQ A;  3KFV A;  1JJ2 S;  2B8A A;  3DLM A;  4FSX A;  2MMP A;  3TCJ A;  4F7U E;  2LX7 A;  2LQN A;  1M1K U;  3CCR T;  3VYG A;  2JXB A;  1M1K C;  4EMK B;  1VQP T;  4NL2 A;  4DBF A;  3X20 B;  1D09 B;  4M77 D;  4WCI A;  2PU9 B;  1VQM Q;  1H64 1;  1ABO A;  4NS5 A;  1AWO A;  2LJ3 A;  4M7D E;  1ZA1 B;  1S72 A;  5IN1 A;  3QJ6 A;  1RAE B;  1M27 C;  1S72 T;  2DEQ A;  2QDL A;  5KE2 A;  4BD3 A;  3CCU T;  4E47 A;  1UGS B;  3CCE Q;  2LZ6 B;  2AIR B;  2QYZ A;  3GF5 A;  2YXY A;  1TS9 A;  1Y96 A;  3CC7 Q;  1VUB A;  3V7R A;  3OYE A;  3CME A;  4J6W A;  1QP2 A;  2R5M A;  4ELY C;  3CC2 Q;  3P8D A;  2O9S A;  5KYW B;  5GAN e;  2DBM A;  4BDZ A;  4KUD K;  1PG5 B;  1RAC B;  1VQ5 Q;  3NTH A;  2HDA A;  3I35 A;  4XTW A;  2PVG B;  1NLP C;  4ZN1 A;  2XDP A;  2K7A A;  4RTX A;  5LL6 S;  3EGU A;  5GMK l;  1ARK A;  2DTH A;  1WPY A;  5CVI A;  1NM7 A;  4PJL A;  2DRM A;  4C8Q A;  1WLP B;  2BZ8 A;  3CBO A;  2QQR A;  1NLO C;  3LYI A;  2KVQ G;  4R56 A;  3JCM e;  1YI2 Q;  2NLU A;  1T0H A;  3MO8 A;  4M7A F;  1NYG A;  3FDR A;  1UGQ B;  3G1J A;  1VQ6 Q;  3X26 B;  5HK0 A;  2FO0 A;  4OGC A;  4Z89 A;  4PJM A;  2QQB A;  4HCB A;  5KYU B;  3CPW P;  2VWF A;  2X35 A;  1TWB A;  1VYV A;  4XU1 A;  3JCM g;  2PZ1 A;  2RO0 A;  3E1S A;  1AZE A;  3EFO A;  3CCE A;  4A4G A;  9ATC B;  4FW2 A;  2DNU A;  2L89 A;  1VQ9 Q;  1NJI U;  3JCM X;  3M57 A;  4E7S A;  2KSS A;  2K3X A;  4OB0 B;  1Y57 A;  4LD6 A;  2R5A A;  3CME Q;  1T3L A;  2RJE A;  2DVE A;  1NPR A;  1K0S A;  2EQU A;  2RNA A;  3CCE T;  1Y71 A;  2YRC A;  5LJ5 d;  2YUO A;  2SEM A;  3ASK A;  2EKO A;  3REA B;  2L0A A;  4HT9 A;  5GAO r;  4LUD A;  1YJN A;  5A0L A;  1NZ9 A;  1LVK A;  2XKO C;  3QKJ A;  3WVE B;  1M5Q 1;  2HQE A;  2YT6 A;  1IHW A;  3G4S T;  4GY5 A;  5CQX A;  1FMW A;  3DKM A;  3S3M A;  4M78 D;  3MHX A;  2DXC A;  2F69 A;  3EH1 A;  4RTU A;  4BI4 A;  5GAM g;  1VQK A;  4N4I A;  1BI1 A;  2EFI A;  5KH6 A;  2QGG A;  3QII A;  1K9M U;  3BDL A;  3E19 A;  2K6D A;  3OYK A;  1D0Y A;  3MPU B;  4PLL A;  4O6J A;  3VJP A;  2WSF E;  2EYX A;  1BIA A;  5EC7 A;  4Z02 A;  1RAA B;  1TUC A;  3JCM b;  2XDB A;  3VS4 A;  3U23 A;  5CAI A;  2CKK A;  1VQ6 T;  1NE8 A;  4LD9 K;  2A7Y A;  3PGG A;  4RTW A;  1U1T A;  1O75 A;  2CP5 A;  3OYD A;  4V2S A;  1M9S A;  1NEG A;  1E7O A;  1TUD A;  2YWW A;  3QWX X;  5CKF A;  1KD1 C;  3S3O A;  1VA7 A;  2DD5 A;  1CKB A;  4FYY B;  1YJW T;  4PFP A;  3CXC P;  5GAM e;  2QTX A;  2DD4 A;  2EBP A;  1I8F A;  5GMK m;  2LVM A;  2EJF A;  2JJ9 A;  4J7I A;  3VS3 A;  2HNI A;  2QQS A;  4F17 A;  1JXM A;  4CRI A;  1BIB A;  1WXU A;  4LDX A;  1Z9Z A;  2DKG A;  3CD6 Q;  3G4S A;  3QO3 A;  4ESR A;  1PD1 A;  1QVG A;  1QW1 A;  4N4G A;  2ROT A;  4Y91 A;  3QXE B;  2X3X D;  1VQP Q;  6AT1 B;  1AHJ B;  1KQS A;  1DJ7 B;  4JJB A;  1MND A;  1U06 A;  1A0N B;  3SWN B;  3I5S A;  2CUD A;  2LT4 A;  5KYU A;  2BE7 D;  1M8M A;  2CRE A;  2XD0 A;  2HQX A;  3NFC A;  2NUT B;  1WXT A;  2HSP A;  3NGP A;  3GPL A;  1UJY A;  2Y90 A;  3OSS C;  4C5I A;  5KYY B;  1OOT A;  3QDF A;  3VYH B;  3I55 T;  4F14 A;  1I81 A;  5IHI A;  1M3A A;  1IRX A;  1LJO A;  4M75 F;  1Q82 R;  4HCK A;  2E1H A;  3ZBD A;  2XDD A;  1I1J A;  1FMV A;  3RUX A;  2RI3 A;  1VQ4 T;  1QCO A;  1WI7 A;  4JS5 A;  1BB9 A;  1AWJ A;  2A36 A;  1BCO A;  2DL7 A;  5GAM h;  3I56 T;  2SRC A;  4FM4 B;  3I55 A;  2QAS A;  5LJ3 d;  2DAQ A;  1VQO T;  1N6A A;  4EMH A;  1C1A A;  2KE9 A;  3A8H B;  2KNB B;  2RMO A;  5CQY A;  1ACM B;  2M02 A;  4BUG A;  1LNX A;  4LDV A;  2A37 A;  3D7S B;  1SEM A;  2E4H A;  3C4S A;  3SB2 A;  1YJW Q;  3V7C A;  3HFN A;  3ZEH A;  4GLM A;  2FHD A;  3CCQ T;  4ATO A;  4ELZ C;  1Q7Y C;  1TOV A;  3QYH B;  5FRO A;  3UWN A;  3GIB A;  4M7D B;  1XNI A;  4DA4 A;  2DIG A;  2RK1 A;  2JM9 A;  4DOW A;  1X6O A;  1Q86 C;  1YJN Q;  3S3N A;  2LC4 A;  3CBM A;  2OJ2 A;  2BTT A;  4R0K A;  4J9H A;  2OTL T;  3X25 B;  2JMA A;  1H3H A;  4M78 F;  5GMK e;  1QMC A;  2E41 A;  1JB0 E;  3CC2 A;  4HVU A;  1HYO A;  2O01 E;  2CT4 A;  1KHC A;  4FT4 A;  4XQ3 A;  4B6M A;  1VQN A;  1G3S A;  1GRI A;  1AOJ A;  3SHW A;  4VUB A;  3VS6 A;  4OB1 B;  5A0D A;  1JXO A;  1IRE B;  1ZUK A;  5KYY A;  2D8H A;  1VYU A;  2KRN A;  2RQV A;  4JRQ A;  3VUB A;  1NPP A;  4FT2 A;  2JT4 A;  1K9M R;  3H0H A;  1KSW A;  4P5N A;  3PVL A;  1QVF S;  1D0X A;  3MP8 A;  1FX7 A;  1FWZ A;  1AD5 A;  2D9T A;  3BFM A;  1M4Z A;  5LJ3 e;  4J9C A;  2DO3 A;  4OMO A;  3VS0 A;  1OEB A;  3GNF B;  2K2M A;  4KH0 B;  1OUL A;  1ZSZ B;  2R58 A;  3UT1 A;  2ENM A;  5GAN h;  1VQ4 Q;  4J83 A;  2K5L A;  1WHJ A;  3OS0 A;  3A8L B;  1RLQ C;  2M1H A;  5D6X A;  2K2V A;  3M0R A;  2DX1 A;  3EGD B;  4IUQ A;  1TXQ A;  3TSW A;  3JCM P;  2HKQ B;  3TRE A;  1I5O B;  4JZ3 A;  2ATC B;  2X4Y A;  2H3E B;  3EG3 A;  3QJY A;  1GXI E;  4C0F A;  4RTT A;  2AT1 B;  3HTR A;  4UC4 A;  2FPE A;  1K8A R;  4KBM B;  1YJ9 T;  4C92 A;  2KAF A;  3L2Z A;  1HK9 A;  1X2Q A;  1X43 A;  4JJC A;  3AT1 B;  2LQ8 A;  4MMK A;  3HKS A;  3OMG A;  1EIF A;  4QQG A;  2KRS A;  2XMF A;  2QXF A;  2FG0 A;  3ULR B;  1TSF A;  2RQW A;  4IKF A;  1Y07 A;  3BW1 A;  1YWP A;  1R0B G;  2LTO A;  2H3J A;  3I5R A;  4L59 A;  2VUB A;  3L42 A;  3LH0 A;  1PHT A;  2AHJ B;  2CDT A;  1JJ2 A;  4C92 E;  2EAY A;  3X28 B;  4IIM A;  3G6E Q;  4PFO A;  3QWY A;  5GAN 7;  1Q86 U;  2R57 A;  3CC7 T;  3OYG A;  2X4W A;  3HRU A;  2V8I A;  2ZPF B;  1YIJ Q;  5IT9 E;  4QKU A;  3V8J A;  4LXC A;  3EH2 A;  2CYZ B;  4HA8 A;  5J3B A;  1K8A C;  2VAS A;  2Y4Y A;  1HXD A;  2YLB A;  4BI8 B;  5I21 A;  3H6Z A;  4Y92 A;  1TH7 A;  2EQM A;  1VQP A;  4M7D C;  3EGD A;  4II1 A;  1YIT Q;  1YJW A;  4OP0 A;  2YLC A;  2DER A;  2VV5 A;  1WJR A;  2COY A;  3EHR A;  4E7J A;  1M3C A;  1D0Z A;  4M75 A;  2QA4 A;  2PNI A;  3M0U A;  1SSF A;  1VIE A;  4J9F A;  1WX6 A;  1JO8 A;  3M5A A;  1E6G A;  3PNW C;  2EJ9 A;  3LX7 A;  4Z8A A;  1M1F A;  5LJ5 j;  3JCM Q;  1K73 C;  2I2L A;  3JRZ A;  3G71 T;  1Q7Y R;  5DM7 R;  2VKN A;  3M59 A;  3M58 A;  4N0A A;  3OYJ A;  3L2R A;  5HY6 A;  5IXB A;  3DB3 A;  2MAM A;  2A0F B;  1WHK A;  4HVV A;  2G6F X;  3OB9 A;  3EG2 A;  1Y0M A;  2MPX C;  3G6E A;  3QDR B;  3QZ5 B;  4BB7 A;  1KFZ A;  1MMG A;  2K3B A;  2O4X A;  1RI9 A;  2RHU A;  5DY9 A;  1VQ9 T;  3UA6 A;  1G3T A;  2AK5 A;  1IB8 A;  3OS1 A;  4C5H A;  1WA7 A;  3ZL7 C;  1WJS A;  5FRM A;  3M4G A;  4FW1 A;  3OW2 A;  1PD0 A;  4C8Q E;  1WHL A;  4EMK A;  2DTO A;  2F2X A;  4F7U G;  4JRI A;  3CXC A;  1WNL A;  1JEG A;  2J6O A;  3CCV T;  3H0I A;  3OYM A;  4KUI A;  2PTK A;  3TU4 K;  4A54 A;  2CZ0 B;  1Q82 U;  3J7A F;  3BY7 A;  1SRM A;  3A98 A;  2DF6 A;  5GAN 4;  2DL5 A;  1AWX A;  1Y96 B;  3OA6 A;  4M75 C;  4A4E A;  1S1N A;  2K4Y A;  1VQM A;  2YDL A;  2J06 A;  3OS2 A;  2VXF A;  1X2K A;  1YIT T;  2M9U A;  3NMZ C;  1D3B B;  2JM8 A;  4XTV A;  4M77 C;  8ATC B;  3HRT A;  4PJO E;  3FC3 A;  4D6W A;  2NYS A;  3E2U A;  2RQT A;  2QAZ A;  3CCS A;  4E7I A;  2LDM A;  1OYX A;  3FJP A;  3JCM V;  2D0Q B;  5GAN d;  1ZX6 A;  1O9S A;  2WSE E;  4ORZ A;  1Z9Q A;  4JDS A;  2HKN A;  1M2O A;  4XTZ A;  1U1S A;  1HJD A;  2LQK A;  4CC7 A;  2FPF A;  2V1R A;  3QPH A;  4DBR A;  3LW5 E;  2QEX Q;  4N4H A;  5CO7 A;  4ZNX A;  2J6K A;  5LJ3 j;  4C8Q C;  2P4T A;  5KYN A;  2LNV A;  1YHQ A;  2RB6 A;  4B9X A;  1PSF A;  5GMK i;  3CCV A;  5L8R E;  1VQN Q;  4C92 F;  4DBQ A;  3MJX A;  3NHN A;  5HCK A;  3JCM c;  4M78 C;  4RCB A;  4KRT A;  3RMS A;  3CD6 T;  4EDU A;  3CMA T;  3CPW S;  1VIF A;  4PJO B;  3SWN A;  3MEU A;  4KUL A;  2HL5 C;  2VB6 A;  2GFU A;  4RTZ A;  4XAX B;  4MZM A;  2CP7 A;  1OX9 A;  5D6Y A;  3GOX A;  2DIL A;  4FYW B;  2JN0 A;  1R0C B;  4F7U B;  2KMT A;  5IHN A;  1N9R A;  1TUG B;  4PK4 A;  4BDY A;  1QVF A;  1FYN A;  2A28 A;  2QG9 B;  5I11 A;  1WHH A;  1KC8 C;  5A0G A;  3WXM B;  1GBR A;  2P84 A;  1VQL Q;  4PJJ A;  2I0N A;  3C0C A;  4ZGJ B;  3JV3 A;  5CKD A;  1NBE B;  3CME T;  2GQV A;  4BE1 A;  5GAN 6;  3M53 A;  2XIC A;  4XU2 A;  3OSV A;  1P92 A;  2HBP A;  2JUF A;  4O5V A;  1VQ7 A;  4MDW A;  1BI2 A;  3EGX A;  3QZ9 B;  1Y7X A;  5FWC A;  5C6S A;  1YIJ T;  1QKW A;  3OYL A;  3MET A;  2L2P A;  3SWN C;  5M9O A;  2BIV A;  2HEQ A;  2KR3 A;  1Q81 U;  1RI0 A;  2EPD A;  3A5Z B;  1RAI B;  3JCM d;  3CCL Q;  1M90 C;  1VQ8 Q;  2CH4 W;  2KQW A;  2GBQ A;  1BU1 A;  5LJ3 h;  3G71 A;  1MV3 A;  2DJZ A;  2ZCF B;  1YIJ A;  3CEY A;  1G8X A;  3V7S A;  5L23 A;  5GAO m;  1ZSZ A;  2ZPH B;  1LOJ A;  3O8V A;  3M54 A;  5GAN g;  3PFS A;  2DIQ A;  3OBY A;  3E9G A;  3OYF A;  1TTH B;  3CCM Q;  1G5V A;  4M75 D;  2GGR A;  2RJD A;  4AG2 C;  4Y28 E;  3CPW A;  5LJ5 g;  1IXD A;  2FZG B;  1PSE A;  1VQ9 A;  2PVD B;  2DYI A;  2FZC B;  2LT1 A;  2B86 A;  1KG1 A;  4PJN A;  1YIT A;  2YRV A;  2JMC A;  1NJI C;  5DLQ E;  3J81 E;  3JCM h;  2ED1 A;  2AZS A;  1NYF A;  5CKB A;  1SSH A;  3PT9 A;  5A2Q E;  1PNJ A;  1C0M A;  2AKL A;  4QQD A;  2F2V A;  4OB2 B;  4LDW A;  2JS2 A;  4XTU A;  1WXB A;  1OX8 A;  3NPF A;  1ZSG A;  1VQ7 T;  1M8V A;  3CCU Q;  1ZSZ C;  5LJ5 e;  2QQA A;  2DK3 A;  1GFC A;  2ZPG B;  4DOV A;  2PVO B;  2V26 A;  2F5K A;  4X9D A;  2O4X B;  4FSS A;  1V76 A;  2ZPI B;  1SRL A;  4MML A;  3JB9 J;  2WSC E;  4EMK C;  3JCM J;  2BZX A;  4HCZ A;  4DQ2 A;  3A8O B;  1QVF P;  2Z0W A;  2HZY A;  2XK0 A;  4ZGD B;  2JZ2 A;  3GNG A;  4FCY A;  3MP1 A;  4KGV B;  1SPK A;  1VQ4 A;  2KRM A;  4XTY A;  2V8J A;  3M56 A;  4RCC A;  2DVJ A;  2GQI A;  3RNJ A;  1K9M C;  2ESW A;  2COW A;  2IIM A;  2ZPB B;  2DZ9 A;  2K79 A;  1K4U S;  1PRM C;  2JTM A;  3HL8 A;  2LCS A;  2JNG A;  1MGQ A;  3JSC A;  1W1F A;  1RAH B;  2QTV A;  3G71 Q;  3O5Z A;  4MDX A;  2KRO A;  1GCP A;  2MK5 A;  2DL4 A;  3V8K A;  3UA7 A;  5CKH A;  4E2F B;  3CC7 A;  3CCJ A;  2DXB A;  4GLK A;  2E70 A;  4JJN K;  1G83 A;  4ZTJ A;  1UEC A;  3EFO B;  1W2B S;  2ZPE B;  1YNZ A;  3JB9 H;  1MMA A;  3PMT A;  5CCA A;  4PJO D;  3EGX B;  1SG5 A;  3RKY A;  1CKA A;  4M7A B;  1XQH A;  2LMJ A;  2V1Q A;  3OY9 A;  1G2B A;  2GCX A;  1MMD A;  4JLI A;  4OMP A;  4RTY A;  1IZ6 A;  2QQ9 A;  2QA4 Q;  2VGM A;  2RHY A;  4QVZ A;  4IUT A;  3MEA A;  4FYV B;  1V29 B;  1K8A U;  2ZGW A;  5FRN A;  4MZP A;  3H9N A;  3JB9 D;  5GAO p;  1X27 A;  4NOY A;  4BI3 A;  2RA2 A;  4C92 G;  2RPN A;  1PKT A;  4C0Z A;  1UGV A;  2QDY B;  1TG0 A;  3HFO A;  2FPD A;  2L8D A;  2H8H A;  4CC3 A;  1F1B B;  3CQT A;  2XG8 D;  4QW2 A;  2EYY A;  2E64 A;  4KGX B;  3RBB B;  3IQL A;  2KDS A;  4F7U A;  3RR6 A;  4AFS C;  3EG1 A;  3CXC S;  3M55 A;  1G3W A;  4JRK A;  4F04 B;  3HHT B;  1ZUY A;  1BKB A;  2MWP A;  4M77 F;  3UDC A;  1QVG P;  2HCK A;  3FJ5 A;  2HD0 A;  4AT1 B;  2K57 A;  5GJW B;  5GAM f;  1SHF A;  1QQJ A;  2C06 A;  3CCJ Q;  5GAN 3;  3THK A;  1ZQ1 A;  4M78 G;  4CC4 B;  4C92 C;  3CCR A;  3LGF A;  3PVQ A;  2L3P A;  3EHQ A;  2DET A;  3UPU A;  3A1P A;  4XTX A;  5FWB A;  3VRZ A;  5CKE A;  1YWO A;  2DPP B;  3CCQ Q;  1GCQ A;  1SF9 A;  2D0N A;  3RDV A;  4HCC A;  2D8J A;  3T9N A;  3RKX A;  1VQN T;  5GAN 8;  1OU9 A;  3OYB A;  3SD4 A;  2BKD N;  2HBW A;  1RL2 A;  4M78 B;  4WF2 A;  1WHM A;  2YUN A;  3OS5 A;  7AT1 B;  2GF7 A;  1Q7Y U;  1D1C A;  1M1G A;  2MIO A;  1E6H A;  2QK0 A;  1W6X A;  2LX9 A;  2ED0 A;  2DZC A;  1OPL A;  2DEU A;  2OTJ Q;  3QSU A;  2ZZD A;  4M77 G;  3A8G B;  2C0O A;  1ABQ A;  2EGA A;  1HD3 A;  5IHK A;  1EX4 A;  1NJI R;  2IPO B;  4N0A C;  4NL3 A;  3HPW A;  4J9I A;  2EGC A;  4M75 G;  4AFZ C;  1U3O A;  4PJO C;  2VVK A;  3F70 A;  1IGU A;  2MWO A;  1VQO A;  3INZ A;  2LJ0 A;  3DLL A;  4C8Q B;  1KQ1 A;  4DBH A;  4LDU A;  1I07 A;  2HSE B;  2O88 A;  1XJW B;  2HL3 A;  5J39 A;  4BY6 B;  4D8D A;  3L1A A;  4AFU C;  1B07 A;  3CCU A;  4XK8 E;  5GAM j;  2VC8 A;  1GFD A;  2RD1 A;  1D1A A;  1K9A A;  1HSQ A;  3UF4 A;  4QT7 A;  2JS0 A;  1SHG A;  1ZHI A;  5HKC A;  4OMM A;  1X01 A;  2LNH B;  3CCQ A;  2OI3 A;  2E6N A;  1YFN A;  4ZN3 A;  4A53 A;  4ANJ A;  4J8O A;  1UGR B;  4AG1 C;  3L2U A;  1BCM A;  1YCY A;  3JB9 F;  5DLO A;  4OMN A;  4DEY A;  5GAN f;  4HKE A;  1JBM A;  1BK2 A;  3ME9 A;  3EFR A;  2DXU A;  2FZK B;  2EVR A;  2M16 A;  1UEB A;  1V1C A;  2CT3 A;  2K3Y A;  2QEX T;  4Z88 A;  4OMF B;  5GAO n;  4C5E A;  4M75 E;  2L5Q A;  1QLY A;  4LDY A;  2RH2 A;  3M0S A;  3OYI A;  4CC2 A;  2NUP B;  2MYS A;  1B3Q A;  3RKW A;  1WDX A;  4EIK A;  4HT8 A;  2BUD A;  3CCL A;  2X3W D;  2Y4X A;  3OMC A;  4OML A;  2FYK A;  2O9V A;  1KQ2 A;  1BI0 A;  5KYX B;  4OVA A;  3MP6 A;  4M78 A;  3CMA A;  2ZAE A;  3L2Q A;  3VS5 A;  2CSQ A;  1H8K A;  2E5K A;  1M90 U;  1WYX A;  1UG1 A;  4IUV A;  4JZ4 A;  1LCK A;  4LN2 A;  3FB9 A;  2A08 A;  4A4K A;  1YP5 A;  2X51 A;  4M7D D;  5FW9 A;  2CSI A;  2CUB A;  4XU3 A;  2E3H A;  1UE9 A;  4F7U F;  4EPC A;  1WQ7 A;  1YN8 A;  4M78 E;  3KXT A;  5GAN 5;  4PNO A;  1Q82 C;  1N27 A;  2CP2 A;  1RAF B;  4FIB A;  4M77 A;  1B7T A;  2F1L A;  1VQ5 T;  1UHC A;  1C6V X;  3CD6 A;  5FLX E;  3OQ5 A;  3JCM f;  1VQ8 T;  4IIO A;  2DM1 A;  2RK2 A;  5FU7 C;  2L3S A;  1R8O B;  3ZFJ A;  1XOV A;  1N5Z A;  2CP0 A;  3P8H A;  3A8M B;  4BY6 C;  2RHZ A;  2CZ7 B;  2W0Z A;  2X9H A;  3C94 A;  2M51 A;  4J9D A;  2HMA A;  1Q95 G;  4PJO A;  3CCM T;  1YI2 T;  4E7K A;  4M7A C;  2OAW A;  1U8R A;  5GAN j;  2J6F A;  4J9E A;  1QP3 A;  3FLG A;  2K9G A;  2EYW A;  4BAC A;  2LJ1 A;  1X75 C;  1OQK A;  4WTO B;  3CCS Q;  4K11 A;  2EGE A;  2KXC A;  2KI7 A;  2OAU A;  3RES A;  1UTI A;  3OBW A;  3L2V A;  2DBK A;  3CPF A;  1NEB A;  2G3R A;  3C95 A;  4C5G A;  1I4K 1;  3I9Q A;  3BDU A;  1UDL A;  2NUP A;  5KCH A;  4E7H A;  1JJ2 P;  5GJV B;  4M77 B;  3AHU A;  5IXF A;  2DFU A;  4PJO G;  4FU6 A;  2MI6 A;  4AFQ C;  1KJW A;  1M30 A;  4FL6 A;  2AKK A;  1KD1 R;  3R6O A;  2YUQ A;  3TEE A;  2QEX A;  3TQ7 P;  1D3B A;  1YJ9 A;  2MOX A;  2L3Q A;  3SFM A;  1PM3 A;  4OMQ A;  2DRK A;  2EIF A;  1KHI A;  1WFW A;  3GBQ A;  3OYA A;  3OW2 P;  4J6Y A;  3EG9 A;  1QKX A;  1UB4 A;  4C92 D;  4RTV A;  3OW2 S;  5KCO A;  2ECZ A;  2AZV A;  4ZGE B;  2P0Q A;  3OYC A;  3H8Z A;  1WQW A;  1VQ5 A;  2EYZ A;  1RLP C;  1T0J A;  1ZUU A;  1JRI A;  4M7A E;  4QVC A;  1OZ2 A;  1Q81 C;  3SEM A;  2RJF A;  3QUI A;  2L3R A;  3PTA A;  4TVR A;  4ME7 A;  4PLI A;  1AVZ C;  3MEW A;  1PRL C;  1CSK A;  2GFA A;  3FRN A;  5LJ3 g;  1W2B A;  2BZY A;  4PJO F;  1M1K R;  2E10 A;  4J9G A;  3CMA Q;  1KD1 U;  3HP9 A;  4J5Y A;  1K76 A;  1KC8 R;  3KUF A;  3UAT A;  2JW4 A;  1OI1 A;  3JB9 I;  3CC4 A;  2QA4 T;  5KE3 A;  1YJN T;  2NUT A;  1M2V B;  2FB7 A;  4LE9 A;  4YTL A;  2E12 A;  1VQM T;  1X6G A;  3NTI A;  1W4S A;  2JTF A;  1ZLM A;  1VQL T;  1EZZ B;  2IG0 A;  1N9S A;  4LNP A;  1M3B A;  3LWH A;  1S72 Q;  2X4X A;  2RHI A;  5ECA A;  2CZ1 B;  4PKC C;  4M7D G;  2EQK A;  4J6X A;  1KC8 U;  3VV0 A;  2XID A;  2KXD A;  2DYB A;  4A4F A;  3VUZ A;  3CCV Q;  1H92 A;  1YCS B; 
#chains in the Genus database with same CATH homology
 3P8D A;  2DTI A;  5IT9 E;  3V8J A;  5GAN e;  3M55 A;  3VKI A;  3CXC S;  1G3W A;  4BDZ A;  4JRK A;  2CYZ B;  4L6V 5;  4KUD K;  4HA8 A;  4XU0 A;  3FEO A;  3HHT B;  3NTH A;  4XTW A;  4RG2 A;  5J3B A;  1K8A C;  2Y4Y A;  1BKB A;  1HXD A;  2MWP A;  2PVG B;  2YLB A;  4M77 F;  3UDC A;  4BI8 B;  5I21 A;  4ZN1 A;  2XDP A;  3H6Z A;  2HD0 A;  3PIP A;  1TH7 A;  2K57 A;  5LL6 S;  2EQM A;  1VQP A;  5GAM f;  5GAM d;  4M7D C;  5GMK l;  2DTH A;  1WPY A;  5CVI A;  4JS4 A;  4C8Q A;  3CCJ T;  4IUU A;  4II1 A;  1YJW A;  4OP0 A;  2C06 A;  2YLC A;  2QQR A;  3CBO A;  5GAN 3;  4M7D A;  4JLG A;  2VV5 A;  5GMK h;  1WJR A;  1ZQ1 A;  3LYI A;  4M78 G;  2KVQ G;  5FU6 B;  4R56 A;  4C92 C;  3CCR A;  4E7J A;  3LGF A;  3JCM e;  1YBY A;  3UPU A;  2NLU A;  2CGH A;  3MO8 A;  4M7A F;  4M75 A;  2QA4 A;  3FDR A;  4XTX A;  2PUK B;  1G3Y A;  5CKE A;  1UGQ B;  1SSF A;  1VIE A;  2DPP B;  3MCA B;  3M5A A;  3X26 B;  3PNW C;  2E5Q A;  4HCC A;  5HK0 A;  4BE0 A;  4OGC A;  2EJ9 A;  3X24 B;  2LCL A;  3LX7 A;  3T9N A;  1M1F A;  3RKX A;  5LJ5 j;  2KY9 A;  5HK3 A;  3JCM Q;  1YI2 A;  2V8K A;  4M77 E;  5GAN 8;  1K73 C;  3OYB A;  5EG2 A;  1VQN T;  3SD4 A;  2BKD N;  2I2L A;  3JRZ A;  3G71 T;  2QQB A;  1RL2 A;  5DM7 R;  4M78 B;  4HCB A;  4L5G A;  4WF2 A;  1VQ6 A;  3M59 A;  3M58 A;  3OS5 A;  2X35 A;  4N0A A;  5HY6 A;  3OYH A;  3OYJ A;  3I56 A;  5CK9 A;  3L2R A;  4M7A D;  3DB3 A;  2GF7 A;  2MAM A;  1Q7Y U;  4XU1 A;  3JCM g;  1M1G A;  2X4J A;  2RO0 A;  3E1S A;  3OB9 A;  4MZT A;  4CI0 C;  3G6E A;  4A4G A;  3CCE A;  3QDR B;  3HRU A;  3QZ5 B;  4BB7 A;  2LX9 A;  2DZC A;  2L89 A;  4C0D C;  3CCS T;  2O4X A;  2RHU A;  3QSU A;  4OGE A;  2ZZD A;  5DY9 A;  1G3T A;  3J80 E;  1VQ9 T;  4M77 G;  3JCM X;  2MF2 A;  3A8G B;  3JAM E;  1NJI U;  3OS1 A;  4C5H A;  5J26 A;  3M57 A;  2KSS A;  1WJS A;  2M0O A;  5FRM A;  4N0A C;  2K3X A;  3M4G A;  4OF1 A;  3HPW A;  2YHT A;  4NL3 A;  3G7Z A;  4X34 A;  4OB0 B;  3OW2 A;  4C8Q E;  4LD6 A;  2R5A A;  4M7A G;  4M75 G;  3Q1J A;  4RMO A;  2VXE A;  2RI5 A;  2RJE A;  2DVE A;  4EMK A;  1NPR A;  2DTO A;  4PJO C;  1XTD A;  2EQU A;  5LJ5 h;  3F70 A;  1Y71 A;  4F7U G;  3G6E T;  3CCE T;  3QHS A;  5LJ5 f;  5LJ5 d;  4C0G A;  4JRI A;  3CXC A;  1BYM A;  3ASK A;  1WNL A;  4C92 B;  2MWO A;  2EKO A;  3RER A;  4HT9 A;  1UGP B;  1VQO A;  2RHX A;  5GAO r;  3INZ A;  4QVD A;  3CCV T;  1YJN A;  5A0L A;  1NZ9 A;  3DLL A;  4C8Q B;  1KQ1 A;  5GAO l;  2RJC A;  3OYM A;  4KUI A;  3TU4 K;  2XKO C;  3QKJ A;  4Q5W A;  3WVE B;  2LCC A;  1M5Q 1;  2HQE A;  4LDU A;  4A54 A;  2CZ0 B;  1Q82 U;  3J7A F;  3G4S T;  3BY7 A;  4GY5 A;  5CQX A;  4BY6 B;  5J39 A;  5CIU A;  3DKM A;  3L1A A;  5GAN 4;  3KBG A;  3S3M A;  4M78 D;  2JOY A;  2DXC A;  2F69 A;  3MHX A;  4BI4 A;  5GAM g;  3E9F A;  1VQK A;  3CCU A;  1Y96 B;  4N4I A;  4E7L A;  3OA6 A;  4M75 C;  4A4E A;  4XK8 E;  1BI1 A;  2EFI A;  5GAM j;  2VC8 A;  5KH6 A;  3QII A;  2RD1 A;  2K4Y A;  3QG1 A;  1VQM A;  1K9M U;  3OS2 A;  1K73 U;  3BDL A;  3E19 A;  2VXF A;  3CC2 T;  3OYK A;  1VQK T;  1YIT T;  2M9U A;  4PLL A;  3DB4 A;  1D3B B;  4XTV A;  3RIR A;  1ZHI A;  4M77 C;  4O6J A;  5HKC A;  1X01 A;  3VJP A;  2A3L A;  2WSF E;  3HRT A;  4PJO E;  1BIA A;  4Z02 A;  3CCQ A;  3FC3 A;  2E6N A;  4D6W A;  3JCM b;  2XDB A;  2EWN A;  5CAI A;  4ZN3 A;  4A53 A;  2CKK A;  5CR2 A;  4J8O A;  1VQ6 T;  1NE8 A;  1UGR B;  3CCS A;  3L2U A;  4LD9 K;  4E7I A;  1WGS A;  2LDM A;  1YCY A;  1OYX A;  3FJP A;  5DLO A;  2A7Y A;  1N8R U;  3JB9 F;  3PGG A;  3JCM V;  2D0Q B;  2WAC A;  5GAN f;  5GAN d;  1U1T A;  1O75 A;  1O9S A;  2WSE E;  4HKE A;  4A4H A;  3OYD A;  5AYF A;  1JBM A;  1MHN A;  4V2S A;  1M9S A;  3ME9 A;  3EFR A;  4JDS A;  2DXU A;  2E65 A;  4XTZ A;  5CKF A;  1U1S A;  2M16 A;  1UEB A;  3ER0 A;  1KD1 C;  3HSB A;  3S3O A;  2LQK A;  2K3Y A;  2QEX T;  3QPH A;  3LW5 E;  4OMF B;  2DD5 A;  1YJW T;  5GAO n;  4BE2 A;  4C5E A;  4M75 E;  4N4H A;  2L5Q A;  5CO7 A;  5GAM e;  2QTX A;  2K5F A;  5LJ3 j;  2DD4 A;  4LDY A;  4C8Q C;  2P4T A;  2RH2 A;  2LNV A;  1YHQ A;  3PIO A;  4RKU E;  3WVD B;  3OYI A;  1I8F A;  2RB6 A;  4B9X A;  2P0P A;  1PSF A;  2K5I A;  2LVM A;  4RG8 A;  5GMK i;  2EJF A;  4J7I A;  5L8R E;  5GMK m;  2HNI A;  2QQS A;  4C92 F;  3RKW A;  3CCV A;  3JCM W;  3JCM c;  4HT8 A;  4M78 C;  2BUD A;  3CCL A;  4CRI A;  4RCB A;  1BIB A;  3RMS A;  4LDX A;  4EDU A;  3CMA T;  3CD6 T;  3CPW S;  1VIF A;  2PQW A;  2VGN A;  2DKG A;  2Y4X A;  3MEV A;  3SWN A;  4PJO B;  3MEU A;  4KUL A;  1Q81 C;  3OMC A;  3G4S A;  2GFU A;  2FYK A;  3PMI A;  2CZ6 B;  3QO3 A;  1QVG A;  1KQ2 A;  1BI0 A;  4IUR A;  4OVA A;  1QW1 A;  4MZM A;  4N4G A;  3MP6 A;  4XAX B;  4M78 A;  4IUP A;  2RM4 A;  5D6Y A;  3CMA A;  3V8L A;  4C8Q D;  3GOX A;  4Y91 A;  3QXE B;  3GP8 A;  1AHJ B;  1KQS A;  1DJ7 B;  2JN0 A;  3L2Q A;  3OYN A;  4F7U B;  4JRP A;  2KMT A;  1N9R A;  1I5L A;  4BDY A;  2OTJ T;  2EQJ A;  2QI2 A;  3SWN B;  2XHC A;  1QVF A;  2LT4 A;  1KC8 C;  4J7F A;  5A0G A;  4R55 A;  2FVU A;  4M75 B;  1M90 U;  3WXM B;  3C12 A;  4IUV A;  2XD0 A;  3FB9 A;  4A4K A;  2HQX A;  3NFC A;  5I2S A;  4ZGJ B;  5CKD A;  3CME T;  4M7D D;  4OB3 B;  2GQV A;  4BE1 A;  5GAN 6;  3M53 A;  2XIC A;  4XU3 A;  2OTL A;  3N5B B;  3GPL A;  4XU2 A;  3VU3 C;  2Y90 A;  3OSV A;  3OSS C;  1P92 A;  4F7U F;  4EPC A;  3L2W A;  2OTJ A;  1WQ7 A;  2VYT A;  1KC8 U;  2HBP A;  4C5I A;  4C8Q G;  4M78 E;  3KXT A;  2JUF A;  2KK4 A;  3VYH B;  4PNO A;  4O5V A;  3RMQ A;  5GAN 5;  3I55 T;  1Q82 C;  4MDW A;  1BI2 A;  1N27 A;  1VQ7 A;  3QZ9 B;  1I81 A;  1Y7X A;  2XI9 A;  1QVG S;  3JB9 G;  5C6S A;  1YIJ T;  3OYL A;  3MET A;  1LJO A;  4M75 F;  3SWN C;  3S6W A;  1VQ8 A;  5M9O A;  4FIB A;  2E1H A;  4M77 A;  2BIV A;  1Q81 U;  3ZBD A;  1RI0 A;  1H3Z A;  1VQ5 T;  3A5Z B;  2XDD A;  3CD6 A;  3RUX A;  5FLX E;  2RI3 A;  1VQ4 T;  3OQ5 A;  3JCM f;  3JCM d;  1VQ8 T;  4JS5 A;  3M9Q A;  1OZ3 A;  1M90 C;  2RK2 A;  5C0M A;  5FU7 C;  5GAM h;  3I56 T;  2KQW A;  4FM4 B;  3I55 A;  1R8O B;  5LJ3 f;  5LJ3 d;  3QYG B;  4M7D F;  3ZFJ A;  2DAQ A;  1VQO T;  1N6A A;  1XOV A;  5LJ3 h;  3G71 A;  4EMH A;  3P8H A;  2DJZ A;  2ZCF B;  3QBY A;  3OYY A;  1YIJ A;  2HAX A;  3A8M B;  3CEY A;  2RHZ A;  3A8H B;  3V7S A;  2JVV A;  2CZ7 B;  5CQY A;  4BY6 C;  5GAO m;  2ZPH B;  1LOJ A;  3O8V A;  3C94 A;  2PUO B;  4BUG A;  3M54 A;  1LNX A;  4LDV A;  5GAN g;  3PFS A;  2DIQ A;  3OBY A;  3E9G A;  3OYF A;  4PJO A;  3C4S A;  3CCM T;  4C0D B;  4E7K A;  1YI2 T;  3SB2 A;  4M7A C;  1U8R A;  1G5V A;  3V7C A;  5GAN j;  3HFN A;  3ZEH A;  4M75 D;  2RJD A;  2FHD A;  3CCQ T;  1QP3 A;  4Y28 E;  5GAN 2;  3FLG A;  3CPW A;  5LJ5 g;  4ATO A;  4ELZ C;  4BAC A;  1Q7Y C;  3QYH B;  5FRO A;  1PSE A;  1X75 C;  3UWN A;  1VQ9 A;  1XNI A;  4DA4 A;  2DIG A;  3GIB A;  2RK1 A;  4DOW A;  4M7D B;  2PVD B;  1X6O A;  2EJG A;  2LT1 A;  1Q86 C;  1KG1 A;  3EFS A;  4B9W A;  3S3N A;  1YIT A;  2YRV A;  2LC4 A;  1N8R C;  3CBM A;  1NJI C;  2OAU A;  5DLQ E;  3RES A;  3J81 E;  5I2M A;  3JCM h;  3OBW A;  3L2V A;  2OTL T;  3CPF A;  3EAE A;  5CKB A;  3X25 B;  3PT9 A;  3URG A;  4C8Q F;  5A2Q E;  2G3R A;  2IVW A;  3C95 A;  4M78 F;  2CS7 A;  2F5T X;  5GMK e;  2E6Z A;  3PTA A;  2E41 A;  4C5G A;  2EYQ A;  1I4K 1;  1JB0 E;  3LLR A;  3BDU A;  4QQD A;  3CC2 A;  1B34 B;  1YHQ T;  4OB2 B;  5KCH A;  4LDW A;  4E7H A;  2O01 E;  4XTU A;  1KHC A;  4FT4 A;  4JUV A;  4M77 B;  1VQ7 T;  3AHU A;  4M7A A;  3FIF A;  4XQ3 A;  4PJO G;  1VQN A;  1M8V A;  5LJ5 e;  1G3S A;  3CBP A;  2QQA A;  4FU6 A;  2MI6 A;  2DK3 A;  4VUB A;  2ZPG B;  4OB1 B;  4FL6 A;  5A0D A;  4DOV A;  1KQS S;  1IRE B;  2PVO B;  4X9D A;  2F5K A;  4EMG A;  2O4X B;  3R6O A;  1VQL A;  2FL7 A;  4QQ6 A;  2ZPI B;  2D6F A;  3JB9 J;  4MML A;  2XU8 A;  3CC4 T;  2WSC E;  3TEE A;  4EMK C;  3LWI A;  2QEX A;  3JCM J;  4JRQ A;  1D3B A;  1YJ9 A;  1QVP A;  3VUB A;  3M4Y A;  4HCZ A;  1NPP A;  4FT2 A;  3GLX A;  3SFM A;  4DQ2 A;  3A8O B;  3LGL A;  3SDZ A;  2XK0 A;  4P5N A;  2EIF A;  3CCM A;  4ZGD B;  2JZ2 A;  1QVF S;  3GNG A;  1KHI A;  3OYA A;  3MP8 A;  3MP1 A;  1FX7 A;  1FWZ A;  2D9T A;  4J6Y A;  4C92 D;  1UB4 A;  1VQ4 A;  3BFM A;  1M4Z A;  4XTY A;  2V8J A;  1ZBX A;  3HRS A;  3M56 A;  4RCC A;  3OW2 S;  5KCO A;  5LJ3 e;  2DO3 A;  1K9M C;  4ZGE B;  3NTK A;  2ZPB B;  2DZ9 A;  2RI2 A;  2JTM A;  2P0Q A;  3GNF B;  5FU6 C;  3HL8 A;  3OYC A;  2JNG A;  5GMK j;  4KT0 E;  5GAO q;  2R58 A;  1MGQ A;  3H8Z A;  3UT1 A;  1WQW A;  3JSC A;  1VQ5 A;  5FU7 B;  5GAN h;  4J83 A;  4MDX A;  3P8B B;  3CCL T;  2P0K A;  2K5L A;  1JRI A;  3V8K A;  4M7A E;  4ZTF A;  4QVC A;  1OZ2 A;  1FXX A;  5CKH A;  5D6W A;  2RJF A;  1BI3 A;  2L3R A;  3A8L B;  3QUI A;  1WJQ A;  3OS0 A;  2M1H A;  4TVR A;  2K2V A;  5D6X A;  5IAY A;  4ME7 A;  3CC7 A;  4PLI A;  3CCJ A;  2DXB A;  4GLK A;  4IUQ A;  4X9C A;  3MEW A;  3JCM P;  4PL6 A;  3TRE A;  2X4Y A;  2E70 A;  2GFA A;  2DXT A;  3FRN A;  5LJ3 g;  3QJY A;  1W2B A;  4JJN K;  4C0F A;  1GXI E;  1B34 A;  4ZTJ A;  4PJO F;  1W2B S;  2ZPE B;  2LRQ A;  2E10 A;  3JB9 H;  4UC4 A;  3PMT A;  5CCA A;  1JJ2 S;  4KBM B;  1YJ9 T;  4PJO D;  2B8A A;  1KD1 U;  3DLM A;  3HP9 A;  4J5Y A;  2KAF A;  3L2Z A;  2MMP A;  4FSX A;  1HK9 A;  3TCJ A;  4C92 A;  4F7U E;  3KUF A;  3RKY A;  4M7A B;  1XQH A;  2LQ8 A;  1OI1 A;  4MMK A;  3CCR T;  3VYG A;  1M1K U;  1M1K C;  4EMK B;  3HKS A;  3JB9 I;  3OY9 A;  1VQP T;  4NL2 A;  2GCX A;  3CC4 A;  3OMG A;  4JLI A;  2QA4 T;  5KE3 A;  1YJN T;  1EIF A;  1IZ6 A;  2QQ9 A;  4QQG A;  3X20 B;  2VGM A;  4M77 D;  2FB7 A;  2RHY A;  4QVZ A;  2QXF A;  4IUT A;  2E12 A;  4YTL A;  2PU9 B;  3MEA A;  1VQM T;  1V29 B;  3NTI A;  1K8A U;  2ZGW A;  1W4S A;  4IKF A;  1Y07 A;  3BW1 A;  5FRN A;  1H64 1;  2JTF A;  4MZP A;  4NS5 A;  2LTO A;  2H3J A;  3JB9 D;  4M7D E;  5GAO p;  1VQL T;  4NOY A;  1S72 A;  4BI3 A;  2IG0 A;  4L59 A;  2RA2 A;  5IN1 A;  2VUB A;  3QJ6 A;  4C92 G;  1N9S A;  3L42 A;  3LH0 A;  1S72 T;  4C0Z A;  2DEQ A;  2QDY B;  2AHJ B;  5KE2 A;  3LWH A;  2X4X A;  2RHI A;  3HFO A;  4BD3 A;  3CCU T;  4C92 E;  2EAY A;  1JJ2 A;  2L8D A;  3X28 B;  4E47 A;  2CZ1 B;  4PKC C;  1UGS B;  4M7D G;  2EQK A;  2XG8 D;  4QW2 A;  4J6X A;  5GAN 7;  3GF5 A;  3VV0 A;  1Q86 U;  2XID A;  2E64 A;  1Y96 A;  2R57 A;  1VUB A;  3V7R A;  3CC7 T;  4A4F A;  3OYE A;  3OYG A;  2X4W A;  3CME A;  3VUZ A;  2KDS A;  4J6W A;  4F7U A;  2V8I A;  2ZPF B;  1QP2 A;  2R5M A;  4ELY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...