5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
1WQWA 2FB7A 1I8FA 1D3BA 3INZA 3SWNA 4M78D 5GAOp 3JB9F 2DVEA 4JRKA 1B34A 1I81A 2VXFA 4XTZA 4QVCA 4M7DF 4PJOA 1WQ7A 4XTVA 4XTYA 1LJOA 4M7AE 2DJZA 5GAOl 4XU3A 4M77A 2RD1A 5GMKi 5I21A 5GAN3 2EJ9A 4M75F 1N9SA 4X9CA 4NOYA 2DTIA 5LJ5f 3JB9J 1U1SA 4J6XA 1MGQA 4A54A 1N9RA 4XU2A 4PNOA 3V8KA 4C92B 1KQ2A 3BDUA 4C8QF 3EFSA 3L2ZA 3BY7A 3SWNC 3JCMV 1D3BB 2E41A 2YHTA 3SWNB 5GAN4 4Y91A 3RERA 1Y96A 4NL2A 1B34B 4PJOB 1M8VA 4C8QG 4C92D 2DTOA 5DY9A 3BW1A 5LJ3f 4M7AF 3V7RA 2CGHA 4M77C 5GANj 3PGGA 5LJ3d 4M77B 4MMKA 3RESA 4V2SA 4M78F 3RKWA 2DKGA 4PJOD 1HXDA 4C92E 1I5LA 2E65A 2QTXA 3FB9A 3SB2A 3JCMe 3HSBA 4HT9A 5LJ5h 2DTHA 5GMKe 3JB9G 4PJOE 4OP0A 1U1TA 4EMGA 3JB9I 4M7DG 3QO3A 3RUXA 3RKXA 3HFOA 3AHUA 1Y96B 1YCYA 2RB6A 4C8QA 2YLBA 4N0AA 4M77E 5GAMh 5LJ5d 2DEQA 1JRIA 4F7UF 5GAOn 4M75G 4NL3A 5LJ3g 4WF2A 5GAMf 4M7DC 4M7DB 5LJ3h 3L1AA 5LJ3j 3JCMc 4XTUA 4DQ2A 4F7UG 3M4GA 4C92F 5GANe 5GAMd 3GIBA 2EWNA 5GAN7 4M75C 3JCMX 4M75B 4PJOF 1WPYA 2HNIA 2DZ9A 4QVDA 4XQ3A 4M7DA 2I2LA 3HFNA 4M7AG 2EJFA 1BIBA 1KQ1A 4N0AC 4JRIA 4C8QB 4C8QC 5LJ5g 1X01A 4J6YA 2DZCA 4M7DE 4M77D 4JLIA 4M78G 4M75A 2DXUA 3JCMW 5LJ5j 3JCMf 2EAYA 3QUIA 1BIAA 2JN0A 1WNLA 5GAN8 4M7AC 5GAMg 3JCMd 4JUVA 4A53A 4M75E 4EMKC 4F7UA 1LOJA 3FIFA 1I4K1 2Y90A 3EFRA 1TH7A 2FYKA 4M78C 3VU3C 5GAMj 2ZGWA 4C8QE 3JCMb 4J5YA 4XU0A 2VC8A 3V7CA 3QHSA 5GMKm 4HT8A 4HA8A 4M7AA 4EMKA 5GAN2 3BFMA 4RCCA 5GANf 3V8LA 2DXTA 5GAN6 3JB9D 4M78A 4X9DA 3RKYA 3JCMJ 2E64A 5GAOr 4M7DD 4XU1A 4C92G 5GANd 5GAOm 3RIRA 3JCMP 1LNXA 4MMLA 3JCMQ 2EJGA 3JCMg 2K57A 5GAN5 4M78E 4RCBA 4J6WA 4F7UB 2RA2A 3FJPA 3JCMh 4XTWA 5LJ5e 4M75D 5GMKh 4M77F 4PJOG 5GMKj 3QSUA 4EMHA 5GANh 4C92C 5CAIA 3JB9H 5GAMe 2E10A 3V7SA 4M77G 4C8QD 4M7AB 2YLCA 4EMKB 4PJOC 1M5Q1 2E1HA 3V8JA 5LJ3e 4M78B 1HK9A 5GANg 5GAOq 4F7UE 1JBMA 2VXEA 4C92A 4M7AD 1H641 4XTXA 2RM4A 5GMKl
chains in the Genus database with same CATH superfamily
4Q5WA 4QQGA 1BB9A 2K79A 1E7OA 1P92A 1Y57A 4XTVA 1XOVA 2FHDA 1RAHB 2Z0WA 4KGXB 2QGFB 2QQBA 5HCKA 3GLXA 1YI2Q 4Z88A 2YWWA 3M53A 1MMGA 4FIBA 3BY7A 2RNAA 3SWNC 2A28A 4J9BA 1N6AA 1VOMA 5I2SA 4ZTJA 4RTUA 1NYGA 4BB7A 5FRMA 4PLLA 4M77C 2EIFA 3G4SA 2OTLQ 4J9EA 1YIJA 3CCUQ 4EMGA 1G2BA 1C0MA 4KH1B 8AT1B 5GAMh 1S1NA 2AKKA 2QAZA 3M58A 1B3QA 3ME9A 1SHFA 2EFIA 3G1JA 2MF2A 4PJOF 2LX9A 3G71T 2CYZB 3EFOA 3OMCA 1X01A 4ZNXA 1MNDA 5CK9A 3JCMf 4DOWA 2ATCB 1BIAA 2OTJA 2IVWA 5AYFA 1D09B 2Y90A 2E5QA 1FXXA 2ZGWA 3JCMb 2O88A 3FC3A 4JJCA 1QVGP 1I1JA 2DRMA 1PD1A 3J80E 1G3TA 3JCMJ 2E64A 9ATCB 1UG1A 3JCMP 2CZ1B 4ZN1A 5CR2A 1Y7XA 2DF6A 3UWNA 2COWA 3CCLQ 4ANJA 1OPLA 4DEYA 4M7AB 3HRTA 4EIKA 4AFQC 3LWIA 1D1BA 1W2BP 4XTUA 3S3NA 2DBMA 2E70A 1PM3A 3CCQT 1Y71A 4HXJA 4PJOA 2RHZA 4KGZB 4ORZA 1RL2A 3VRYA 2DD5A 2PU9B 1QMCA 4M75F 1N9SA 2KK4A 2A08A 5FRNA 1AWWA 5CCAA 3TSWA 1YJ9T 3CC7A 2CREA 4Y91A 1Y96A 1VQ4Q 2MMPA 3PGGA 1AT1B 1KIKA 2A0FB 3CXCA 3OB9A 1HSQA 2LP5A 2EBPA 1ZSZA 4RG2A 2J7IA 3X24B 2J6FA 3AHUA 3UT1A 3R6OA 1MHNA 3EGUA 1JRIA 3MPUB 4TVRA 1E6HA 1YFNA 3QDRB 5LJ3j 1U8RA 1V76A 2LT4A 2O01E 1WJRA 5HK3A 4M7AG 4C0FA 4IIOA 3HKSA 4N0AC 5CIUA 1Q82R 1Q86R 5FU6C 2CP7A 3FLGA 2D9TA 4M75A 2BE9B 2O2OA 2CSQA 1KD1U 2JS2A 3KUFA 1WNLA 2JVVA 1X2KA 1BYMA 2DO3A 2LRQA 2YT6A 2RHXA 4J5YA 2HEQA 1VQ5T 3V7CA 3C94A 3EFOB 2DVJA 2CKKA 3EG1A 3JCMQ 2K57A 1DJ7B 3UA7A 2W10A 3CCST 2CP0A 4M77F 2FRYA 3CD6A 1TXQA 1ZSGA 1GBQA 1S72T 1V29B 2LX7A 3CCEA 2RHUA 2YDLA 1KFZA 2RHYA 2DYBA 3HTRA 5GAOq 4FL6A 2FVUA 5I11A 2DXCA 2YUQA 4PJMA 3EH1A 3SD4A 4ZGJB 2WSCE 2HMAA 3R6NA 4R56A 2COZA 1RACB 1VQKT 2D0QB 4X34A 4E7JA 4YTLA 4NOYA 2LQKA 4FYYB 3I55Q 1TUCA 3I56Q 2F2XA 2SEMA 3CCVA 1UFFA 4QQDA 2CP6A 2E3HA 3EG2A 3OS0A 4PJOB 1M8VA 3PTAA 3KFVA 4J7FA 2L89A 4Z89A 1SKUB 2DXBA 2VASA 1FMWA 1WHGA 4FT2A 1ZLMA 2KRNA 1N8RC 3A8GB 2E12A 1Y96B 1PRLC 1M3CA 2GTJA 3C95A 1W6XA 4F7UF 3CCMQ 5GAMf 3QYHB 1YNZA 1PC0A 1K0SA 1VYTA 3SDZA 1ZSZB 4A4EA 2KYMA 1WHJA 2PUOB 2QDYB 1WHHA 3M56A 1M4ZA 2BIVA 2DLPA 2EYZA 1JJ2P 1WLPB 1SSHA 1NPRA 1QVGA 2LC4A 3VYHB 4II1A 2A36A 4XU0A 4J9HA 5GMKm 1JEGA 1M90R 2QXFA 4DBQA 3CC2Q 1ZBJA 2KXCA 2DXTA 3JB9D 3RKYA 3I55T 1VQ7A 5CQXA 5GAOm 2ENMA 2VB6A 5FLXE 4M78E 4PJOG 5GMKj 1M30A 4C5EA 2FO0A 3CBOA 3F70A 2D8HA 1PKSA 1TUGB 1F1BB 1BBZA 1TS9A 2OI3A 2VYTA 2X51A 1QVFP 4XTXA 2BZ8A 4CI0C 2X9HA 4M78D 1WFWA 3L2VA 4BD3A 3I35A 2LJ3A 3I56A 1VQPQ 5FWCA 1VQLA 2JM8A 3BE3A 1NM7A 2ROLA 3E9FA 2J06A 2KGTA 5IAYA 1TG0A 3OW2P 4KT0E 2FZGB 2QQRA 2L3QA 2M16A 5LJ3d 2QQ9A 1OU8A 4OGEA 1M1KC 2YXYA 2PVDB 3JCMe 1VQNT 2CDTA 3JB9I 1Q81C 2ABLA 3DB3A 4BDYA 1XTDA 3OYIA 4M75G 4N4IA 4P5NA 2JXBA 2D1XA 3QG1A 2L3RA 2FRWA 4BACA 5FU7C 3A98A 3H41A 3GOXA 4PFOA 1RAFB 1B7TA 5IH2A 1PG5B 1OV3A 2ZPHB 2GQVA 4M7DE 4AMCA 1YN8A 4PJLA 2K3BA 1EZZB 3CPFA 3VU3C 2ZAEA 2PVGB 2JS0A 3V8LA 3VUBA 4X9DA 1UJYA 4M7DD 2L8DA 3MEAA 1TUDA 3PNWC 3JCMh 3GP8A 1VQ6T 2X4JA 2L5QA 3A8MB 2EQIA 4LNPA 1G3YA 4IURA 4QT7A 1ACMB 4BE1A 3KBGA 1H641 2XG8D 4LD6A 4PFPA 1WZOA 3PFSA 1PNJA 2QEXA 2DD4A 2YSQA 4EDUA 2DNUA 3C12A 4C5GA 1N9RA 3E19A 3QJYA 5IHIA 4HVUA 3CCRT 2AKLA 4FW1A 3CCJT 3OBYA 4MZPA 4DBFA 2YHTA 4C92D 3H0HA 4RTZA 4MMKA 1TTHB 3UA6A 1YJWT 5GJVB 1OEBA 4ESRA 3SB2A 3M5AA 4FYVB 1CSKA 3OYAA 2OJ2A 1VQMT 3EAEA 3CXCS 3CMEA 4QVZA 1UGVA 4J8OA 4IUUA 3JCMc 3M4GA 4E7LA 4L5GA 1YJNT 4DEXA 4XAXB 1FMVA 1WPYA 2HNIA 2RI2A 4FSXA 3X28B 3NGPA 1JJ2A 4MZTA 3I5RA 1K8AU 1IGQA 2DXUA 3CEYA 1WXUA 3G4SQ 3JCMW 3MEWA 1HYOA 4A53A 2H3EB 2OAUA 5KYNA 1RAAB 1TH7A 1YIJQ 1SPKA 2O9SA 1WIEA 5KYYA 3T9NA 5D6WA 2LVMA 4X1VA 2KDSA 3JCMg 1G3WA 2CUBA 4B9WA 1VQ8T 3HPWA 2NUPA 3M4YA 4LDWA 5FU6B 1M1GA 3MP8A 1OPKA 3VUZA 3EG9A 3DLLA 1QVFA 4RUGA 2EYXA 1IRXA 3JV3A 2OTJQ 2V8IA 1JBMA 1K9MU 2XDBA 2RF0A 2GFUA 2DVEA 5HKCA 2LQ8A 3TREA 4XTYA 5LL6S 2O4XA 1IZ6A 2F1LA 5I21A 2L3SA 3OYBA 2E4HA 3OW2A 3L2UA 4XU2A 3URGA 3JAME 3CC4T 3V8KA 4ATOA 5L8RE 1V1CA 3M0UA 2GBQA 2QK0A 1C1AA 2QA4T 2CGHA 1KD1R 2D8JA 1YHQA 1D1CA 3I9QA 3A8LB 1UUEA 3X26B 1BI1A 4BI4A 4BE2A 3OYGA 3HSBA 1Z9ZA 4B9XA 4RTTA 3FDRA 3QO3A 2HKNA 4OB0B 5CKEA 4NL3A 1K73U 1WHKA 3CC7Q 2DL3A 1WI7A 1QWEA 1MV0B 4KUIA 3SHWA 5LJ5g 4BY6B 3G6EA 1Q95G 1OULA 2HSPA 1Q7YU 3QUIA 3NFCA 3OY9A 3WXMB 3CMAT 5M9OA 1WJQA 3EFRA 3L42A 3OQ5A 2EYWA 4A4KA 2D6FA 2YUOA 2VC8A 1AEYA 3NTHA 2LNVA 4PK4A 1QVGS 1WXBA 4IUVA 4OGCA 1M8MA 5GANd 1H3HA 1X6BA 4RTVA 2RA2A 3LH5A 4QW2A 3JB9H 5IN1A 3V7SA 2FEIA 5KYYB 2E1HA 3OYFA 1M2OA 2JUFA 2P4TA 3OS1A 4RTXA 1ABOA 3NPFA 2CP2A 1AZEA 2FB7A 2G6FX 4OMMA 1YI2T 2NUPB 2P0KA 2VXFA 3PE0A 5FW9A 1LJOA 1I0CA 3PMTA 2AHJB 4NS5A 3EG9B 1FWZA 1NLOC 2C0TA 2WACA 4HT8A 1AWXA 2DTIA 3JRZA 3WVDB 5CVIA 1KQ2A 4JJDA 3CC7T 1X75C 2RPNA 3U23A 2NYSA 3JCMV 1A0NB 4OB3B 3CD6Q 2ED0A 3M0PA 4PKCC 4NL2A 5DY9A 2VGMA 2OTLT 3CPWA 3CCEQ 3V7RA 2GF7A 2O4XB 1T0JA 3CCUT 1KC8U 4F14A 2CZ6B 4DBHA 3OYKA 2YRVA 5AT1B 2YRDA 2KVQG 2ED1A 4A4FA 2K2MA 2RJCA 4E7IA 4PJJA 3MCAB 3OSSC 4LDUA 3GIBA 2MPXC 4JZ3A 3CCVQ 4D8DA 1XQHA 3VV0A 2I2LA 2EJFA 2XICA 2L0AA 5FWBA 4A63B 1UGPB 2MI6A 1AWJA 2WSEE 3EGDA 2DL8A 3ZFJA 3H9NA 4R0KA 5GAMg 4ELZC 2D0NA 5FU7B 3CCLT 3HHTB 1QCNA 3CCQA 5GAOr 5KE3A 2EJGA 2KSSA 2KEAA 3Q1JA 4XTWA 3EHRA 3TCJA 1X2QA 2RQTA 1BCOA 3PVQA 1M9SA 1H8KA 2LJ1A 1RAIB 1YJ9A 3OBWA 2KT1A 4JJBA 1QCFA 1CKAA 2Y4YA 3OYEA 4J9GA 3M59A 1OQKA 3CBPA 5GAOp 4XTZA 4E7ZA 1I81A 5CO7A 4UC4A 2RMOA 1O75A 1KJWA 5EG2A 4XU3A 1MV3A 2A7YA 2XK0A 2C0OA 4KGVB 2EJ9A 1VQ7Q 2R58A 2R5AA 2HAXA 2E6NA 1RAGB 2X4XA 1BCMA 1VQ4T 1ZX6A 5IT9E 2K9GA 2DL5A 2MYSA 3M0SA 3ZL7C 2EQUA 3A5ZB 2ZZDA 2AK5A 2AT1B 1WHMA 2QTXA 3CQTA 3E2UA 1YCSB 2KAFA 2CZ7B 3AT1B 4ME7A 5IXBA 2DPPB 3JSCA 2JMAA 1ZUKA 3D7SB 2KQWA 1T3SA 4QKUA 5GAOn 1VQLQ 3CBMA 4M7DB 3A1PA 2FPDA 1VQ5A 4ZGDB 5KH6A 2JTFA 3M0TA 1UGSB 2CH4A 3JCMX 3VKIA 1YITQ 5IXFA 2F5TX 2V8KA 2HL3A 3J81E 3QIIA 4BY6C 2RQWA 4F17A 3L2WA 3SFMA 4LXCA 3CCSA 1PCXA 2VV5A 3E1SA 2P0PA 1RAEB 1JJ2S 3LX7A 1S72A 2L2PA 1I4K1 3X20B 2DYIA 4C8QE 3EG0A 3PIPA 2LMJA 2DK3A 5GAN2 1GRIA 3TEEA 3EGDB 2DL4A 2RH2A 4FM4B 4XU1A 1BU1A 4J9CA 1VQKA 1QQJA 2R5MA 4C8QD 2MWPA 4FW2A 2BKDN 4ELYC 4JJNK 1AD5A 3FJ5A 1KSWA 4M7AD 2LCSA 4AG2C 1QVFS 2EYYA 2IIMA 1Q86C 1Q82C 3VS2A 1ZHIA 1B34A 1GCQC 4C5HA 1NZ9A 1TWBA 2GFAA 3I56T 1VQOA 3UDCA 2VGNA 3DKMA 2DM1A 3MJXA 4IIMA 2M9UA 4FU6A 4CC4B 4J6XA 1U3OA 1JO8A 2AIRB 2ZPBB 4ZN3A 2EKOA 1W2BA 2HL5C 2E41A 3FRNA 4KUDK 3OW2S 2F5KA 5LJ3f 1R0CB 1K8AR 1N8RU 1Z9QA 3RKWA 1HXDA 2ECZA 3FB9A 4N4HA 3CCMT 2KYBA 2QQAA 3M55A 3REBB 4E6RA 2DERA 1GFCA 2QEXQ 3OYHA 4LUDA 3ZEHA 2FG0A 1RLPC 3QYGB 2SRCA 1YITA 2DJQA 2GTOA 4Y28E 4AFSC 1SF9A 4IUQA 2HQEA 2XIDA 1EFNA 3HFNA 3JB9J 1BIBA 2E6ZA 4J6YA 3S6WA 2EQKA 2EGCA 4Y92A 5KYUA 5HK0A 2EW3A 3QBYA 1AHJB 3CC2T 2FYKA 4M78C 1NLPC 3CMEQ 2IPOB 2F2VA 4GLKA 3BFMA 3QJ6A 1UECA 3UATA 3RIRA 1LNXA 5GAN5 8ATCB 1AWOA 2K7AA 2DAQA 1WGSA 4EMHA 2K5IA 2LCCA 3C4SA 3NTKA 2YLCA 3VS3A 1UHFA 1N5ZA 2K3XA 1HK9A 1WDXA 2ESWA 2LJ0A 1E6GA 2X35A 4HCBA 1VQPT 1PSEA 4JRKA 1LPLA 2CP3A 1UGRB 1K73R 5GMKi 1VQNA 2KT8A 1SRMA 4OMOA 3ASKA 1VIEA 2A37A 2HSEB 1MGQA 4LN2A 1NBEB 3EFSA 5C6SA 1M90C 3RERA 1M1KU 1B34B 2DIQA 1NEBA 2BZYA 5CKFA 4J9FA 1Q7YR 5GANj 1ZQ1A 3OYCA 4E7SA 4PJOD 1Q81U 1GL5A 2AZVA 4C92E 1WX6A 2H3JA 3CPWS 3G7ZA 4FSSA 3RKXA 2VUBA 1K8AC 4M7DC 2RJEA 1QP3A 1QLYA 2XD0A 2CZ0B 2BUDA 3A8HB 2OX7A 3OYYA 1UE9A 2RJFA 2FZKB 5DM7R 4HCZA 2O31A 1MUZA 4JRIA 1PD0A 1YHQQ 1AOJA 2HBPA 2M1HA 4ZGEB 1VQ6A 2KNBB 3OA6A 4M75E 3H6ZA 2RO0A 4EPCA 3QWXX 3TVTA 2COYA 4HA8A 2QQSA 4FT4A 1CKBA 3OS5A 1ZBXA 1TSFA 5KYUB 4DBRA 2LCLA 2DX1A 2K5LA 1MMDA 2QTVA 4M75D 5KCOA 1OZ3A 2JNGA 2DBKA 3I5SA 4C92C 2E10A 4JDSA 3G6EQ 1GXIE 3CCRA 4RG8A 3CCJA 1KC8R 1PSFA 5C0MA 2RM4A 1SHGA 2C0IA 1WQWA 2E3IA 1D3BA 1Y0MA 2EKHA 1OZ2A 2QGGA 1YJWA 3JB9F 4LDXA 2FL7A 1TOVA 2ZPIB 3THKA 1VQMA 1JB0E 3MEVA 4A54A 2KE9A 1GCQA 3GPLA 2KRMA 1RI9A 1KHCA 2MOXA 1YWPA 2PQWA 2JMCA 2EGEA 4BDZA 2X4WA 1YHQT 2XDDA 3OSVA 1YJNA 1K73C 1M3AA 4M78F 1R0BG 3EGXA 1I5LA 2HDAA 4HT9A 3LLRA 4AT1B 4JS4A 3GNGA 2NUTA 1VIFA 4CC7A 1U1TA 2V1RA 2RI3A 2BZXA 1YCYA 4K11A 3E9GA 4C8QA 4M77E 4JS5A 1OX8A 3GBQA 1Q7YC 1VQ9A 1M1FA 3OYMA 1IREB 2I0NA 1WA7A 3G4ST 1ARKA 2DETA 3UPUA 2DZCA 2RQUA 1YIJT 4M77D 5LJ5j 1IGUA 1QW1A 3RR6A 2KR3A 2LDMA 4GBQA 2MAMA 1K4US 4F04B 4BUGA 5FROA 1KQSP 2FPEA 2HQXA 2FZCB 4HKEA 1NJIU 5GANf 4BI3A 2JW4A 4OMLA 4M78A 4PFZA 3MKDA 1X6GA 1NPPA 1I5OB 3QZ9B 2G3RA 4OB2B 1BKBA 5KE2A 2QG9B 2OTJT 2VWFA 2HQHA 2J6OA 2M02A 3CC4A 4OF1A 3N5BB 1M5Q1 3VS7A 5LJ3e 2DFUA 4QQ6A 4F7UE 4RMOA 2JTMA 2QA4A 5GMKl 3PMIA 3X25B 4IKFA 3MP6A 4PL6A 4CC2A 4M7DF 2V8JA 2XMFA 5GAOl 4OVAA 3DLMA 3CCQQ 2X4YA 2DRKA 1OYXA 1KC8C 1H92A 2RJDA 3LW5E 2V1QA 1D3BB 1UB4A 1GFDA 3BW1A 4B6MA 1YJ9Q 2AZSA 1D0XA 2V26A 1W2BS 1OX9A 4FYXB 5HY6A 1ABQA 2GGRA 1AZGB 2P0QA 4O6JA 2L3PA 3CMAA 5CKBA 2KY9A 3RBBB 1EIFA 1G83A 5LJ3h 3EGXB 4DQ2A 2BE7D 4C92F 1MMAA 3NHNA 2HBWA 2EWNA 3QZ5B 5GAN7 2DE0X 1MNEA 2NUTB 5D6XA 3VRZA 1OOTA 2EPDA 4M7DA 4QVDA 3ER0A 2PVOB 3REAB 4C8QB 3G71A 3O5ZA 1X27A 1R8OB 3MEUA 3GNFB 4JLGA 4CRIA 2X3WD 4MZMA 3JCMd 4EMKC 3FIFA 5A0DA 2CT3A 5GAMj 3DB4A 2XI9A 1KD1C 4HCCA 7AT1B 4A4GA 2QASA 1M3BA 1RABB 3P8HA 2P84A 4F16A 1YI2A 3QXEB 1VQ5Q 4JRQA 4D6WA 2JM9A 1PRMC 1PHTA 3TU4K 1Y07A 1JQQA 2RN8A 5CAIA 1N8RR 3KXTA 2LQWA 3M57A 4MDWA 2QYZA 3UF4A 4FCYA 3CCSQ 4M78B 2J6KA 1GCPA 2CP5A 4C92A 1S72Q 2JJ9A 2R57A 2OTLA 1I8FA 1LCKA 3CCUA 2DL7A 1K9AA 1WQ7A 1KK7A 2K5FA 2KRSA 1IB8A 2DILA 1W1FA 1ZUYA 5GAN3 3CD6T 5LJ5f 1W4SA 2PTKA 3TQ7P 1FYNA 2PUKB 3C0CA 1BI0A 3GF5A 3CCET 3BDUA 1N27A 3L2ZA 1QWFA 3IQLA 2PNIA 5GAN4 1VQKQ 4GLMA 4C8QG 4KULA 3HP9A 2M51A 4R55A 5KYWA 1O9SA 4V2SA 2E65A 1UJ0A 2HCKA 1VUBA 5GMKe 1BI2A 3JB9G 1X69A 2QDLA 4E7HA 1BK2A 1YWOA 4VUBA 1C6VX 1EX4A 2HKQB 1VQOQ 1D0ZA 5LJ5d 3A8OB 4AG1C 3CCVT 1IHWA 2DEUA 5LJ3g 5L23A 2JTEA 4HCKA 3FEOA 4DA4A 1VYVA 3CCLA 4E2FB 4XQ3A 2RI5A 1KQ1A 3RDVA 2DMOA 4M78G 4JLIA 5CKDA 1NYFA 2EAYA 3H8ZA 3H0IA 3RMQA 2QI2A 3WVEB 2BTTA 1KQSA 3NTIA 1WYXA 3O8VA 1JXOA 4OMQA 2B8AA 3BDLA 2M0OA 3QHSA 3OYLA 1ZUUA 1YP5A 4WCIA 1IHVA 4C0DB 4MMLA 5KYXA 4KH0B 1NG2A 1PKTA 3FJPA 2C06A 5GMKh 1M1KR 5D6YA 5A0GA 2RQRA 4DOVA 4LDYA 2XDPA 1VQ4A 4ZTFA 1Q81R 2YRCA 3V8JA 5I22A 4LUEA 1OU9A 1WXTA 3SWNA 1VQ7T 4QVCA 4C5IA 2XKOC 1VQOT 5DLOA 4M7AE 1TU0B 2CT4A 1NE8A 4J7IA 3P8BB 4M77A 3QWYA 2ZPEB 1RLQC 1U1SA 4JPBW 4PNOA 4C92B 4LDVA 3ULRB 1U5SA 3PVLA 1K1ZA 4XK8E 1UDLA 1U06A 4O5VA 2K3YA 1T0HA 1PWTA 5D7UA 3RESA 3RNJA 3M54A 1D1AA 4OMPA 2LTOA 4KBMB 1VQLT 1HJDA 5J3BA 4M7DG 2F69A 3QKJA 2RB6A 2YLBA 2DEQA 3OYNA 1VQNQ 5KYWB 1YITT 4E47A 2CS7A 5GANe 5GAMd 1K76A 2OAWA 1QCOA 1RADB 4MDXA 1J3TA 4M75B 2EGAA 2MCNA 6AT1B 2LQNA 1JXMA 4C8QC 4HVVA 4J83A 5GJWB 1BI3A 1D0YA 3LGLA 1W70A 3H0FA 2JN0A 2LNHB 4RTWA 3NMZC 4M7AC 4F7UA 1SG5A 2RK1A 1G5VA 1AVZC 2E5KA 2O9VA 4M4ZA 1UGQB 3OS2A 5CQYA 4EMKA 4RCCA 1KHIA 2YUPA 4PLIA 3OYJA 2K6DA 4C92G 4GY5A 3I55A 3MP1A 4RCBA 4J6WA 3VS4A 2GCXA 3VS5A 4L59A 5CKHA 1K9MR 5J39A 2KXDA 3HRUA 2K4YA 3PIOA 1FX7A 2RK2A 1Q86U 2A3LA 1Q82U 1VQ6Q 4FYWB 2VXEA 5KYXB 2ROTA 5GANh 2IG0A 3HRSA 3M0QA 1M2VA 1UTIA 3VS1A 3INZA 2DIGA 3VS0A 2FPFA 2Y4XA 2RD1A 3CCMA 4X9CA 5KCHA 2KMTA 2XHCA 1YBYA 2K2VA 4OMFB 4CC3A 1NEGA 3SWNB 2NUZA 4JZ4A 1IXDA 3RMSA 5EC7A 3L2RA 3CCRQ 3P8DA 1QVPA 2EQMA 2KBTA 4M77B 4RKUE 3CCJQ 2J05A 2DKGA 2NLUA 2QEXT 2M0YA 2DTHA 1KG1A 2PZ1A 4JRPA 1YJWQ 4PJOE 1UEBA 1UHCA 3LYIA 1LVKA 2HZYA 2X3XD 2EYQA 4N0AA 1NJIR 3PT9A 5IHNA 3CC2A 3J7AF 2EVRA 3MHXA 1VQMQ 4WF2A 4LE9A 2NWMA 2LZ6B 3L1AA 2EQJA 3SEMA 4BI8B 3QPHA 1H3ZA 1RI0A 2KROA 2DZ9A 4Z8AA 4BE0A 1VYUA 4RTYA 1YJNQ 1HD3A 2CH4W 1FMKA 5GAN8 3CMET 3EHQA 2XU8A 1LOJA 4KRTA 5A0LA 2ZPGB 1G3SA 5J26A 1T3LA 2JZ2A 1K0XA 1VQPA 5GAN6 4C0DC 1VQ9Q 3VJPA 2MIOA 4PJNA 4Z02A 2MK5A 2RHIA 4C0GA 4F7UB 5LJ5e 2LT1A 3QSUA 4WTOB 4AFZC 3M9QA 5A2QE 1VQ8Q 4M77G 5IHKA 4HVWA 4IUPA 4EMKB 4IUTA 1SRLA 4PJOC 2ZPFB 5GANg 2VVKA 2GNCA 3META 3CPWP 3EG3A 3VS6A 2DA9A 3QDFA 2DJZA 1K9MC 3EH2A 1M90U 4C0ZA 1GBRA 1VA7A 4J9IA 2KI7A 4OB1B 1JU5C 1QP2A 4C8QF 1M2VB 1RUWA 1B07A 1G8XA 4A4HA 2HD0A 2DTOA 3CC4Q 4M7AF 1ZSZC 3MO8A 3HL8A 2JOYA 4E7KA 1WHLA 2QA4Q 1SSFA 5LJ5h 3OYDA 4OP0A 1WJSA 3RUXA 3CXCP 3HFOA 2YUNA 1SEMA 3M0RA 2RQVA 1ZA2B 1VQ9T 5DLQE 2WSFE 2P4RA 3VYGA 2W0ZA 4F7UG 4N4GA 3S3MA 5I2MA 1XNIA 4M75C 4AFUC 4J9DA 5ECAA 4D8KA 1QKXA 1R77A 1NJIC 2CSIA 4OMNA 3LGFA 2F2WA 3TSZA 4L6V5 4JUVA 2VKNA 3ZBDA 2JT4A 3S3OA 1QKWA 2H8HA 1KQSS 4M7AA 3CMAQ 2GQIA 3OMGA 1M27C 4LD9K 3LWHA 3G6ET 1VQ8A 1ZA1B 1OI1A 1X43A 2B86A 1I07A 5GAMe 3G71Q 1MMNA 2MWOA 3LH0A 2CUDA 1IO6A 1X6OA 2ZCFB 1XJWB 3L2QA
chains in the Genus database with same CATH topology
2OTLA 1QVFS 2XG8D 1I8FA 4Q5WA 4QQGA 1Q86C 1Q82C 1ZHIA 4LD6A 3CCUA 1B34A 1P92A 1WQ7A 1XOVA 4XTVA 2FHDA 4C5HA 1NZ9A 2K5FA 2GFAA 3PFSA 3I56T 2QEXA 3UDCA 1VQOA 2VGNA 3DKMA 2QQBA 2DD4A 3GLXA 4EDUA 5GAN3 3CD6T 3C12A 2M9UA 4FU6A 5LJ5f 1W4SA 4J6XA 4C5GA 3M53A 1N9RA 3E19A 2PUKB 3GF5A 1BI0A 2ZPBB 3QJYA 4ZN3A 3CCET 3BDUA 1N27A 2EKOA 3CCRT 3L2ZA 3CCJT 4FIBA 3BY7A 3OBYA 4MZPA 2YHTA 2E41A 3SWNC 5GAN4 1W2BA 3FRNA 1N6AA 4KUDK 3OW2S 4C8QG 4C92D 2F5KA 5I2SA 4ZTJA 5LJ3f 4KULA 3HP9A 4BB7A 1N8RU 5FRMA 4R55A 4PLLA 4M77C 2EIFA 4MMKA 1O9SA 1YJWT 4V2SA 3RKWA 3G4SA 1HXDA 2E65A 3FB9A 4N4HA 3M5AA 3SB2A 1VUBA 3OYAA 3CCMT 2QQAA 1BI2A 5GMKe 3JB9G 1YIJA 1VQMT 3M55A 4EMGA 4E7HA 3EAEA 4VUBA 3CXCS 3CMEA 3OYHA 5GAMh 5LJ5d 3A8OB 4QVZA 3CCVT 3ZEHA 3M58A 5LJ3g 3ME9A 4J8OA 4IUUA 3QYGB 3JCMc 3FEOA 1YITA 3M4GA 4E7LA 4DA4A 4L5GA 4Y28E 2EFIA 1YJNT 3CCLA 4XAXB 4IUQA 2HQEA 2XIDA 2MF2A 4PJOF 1WPYA 2HNIA 2LX9A 2RI2A 4FSXA 4XQ3A 3X28B 3G71T 3HFNA 2CYZB 1JJ2A 2RI5A 1BIBA 1KQ1A 3OMCA 3JB9J 1X01A 2E6ZA 4J6YA 4MZTA 3S6WA 2EQKA 4M78G 4JLIA 5CK9A 5CKDA 1K8AU 2DXUA 3CEYA 3JCMW 3JCMf 2EAYA 3H8ZA 3MEWA 4DOWA 1BIAA 3RMQA 5HK0A 2OTJA 2IVWA 2QI2A 3QBYA 5AYFA 1AHJB 3WVEB 1KQSA 4A53A 2OAUA 3NTIA 3CC2T 2Y90A 1TH7A 2FYKA 2E5QA 3O8VA 4M78C 1FXXA 2B8AA 2ZGWA 3BDLA 3JCMb 3FC3A 2M0OA 3QHSA 3J80E 3OYLA 3T9NA 4GLKA 5D6WA 3BFMA 3QJ6A 1G3TA 2LVMA 4C0DB 3JCMJ 2E64A 3JCMP 3RIRA 1LNXA 4MMLA 5GAN5 2CZ1B 2KDSA 1G3WA 3JCMg 4B9WA 4ZN1A 5CR2A 1Y7XA 3UWNA 1VQ8T 3HPWA 3FJPA 3M4YA 2C06A 5GMKh 4LDWA 2DAQA 5FU6B 1M1GA 1WGSA 5D6YA 3MP8A 4EMHA 5A0GA 4DOVA 2K5IA 4LDYA 3VUZA 2XDPA 2LCCA 3C4SA 1VQ4A 3DLLA 3NTKA 4M7AB 4ZTFA 1QVFA 2YLCA 3HRTA 3V8JA 2K3XA 1HK9A 2X35A 3LWIA 2V8IA 1JBMA 1K9MU 2XDBA 4XTUA 3S3NA 4HCBA 2GFUA 2E70A 1VQPT 3SWNA 3CCQT 1PSEA 1Y71A 1VQ7T 2DVEA 4JRKA 5HKCA 4QVCA 2RHZA 2XKOC 4C5IA 4PJOA 2LQ8A 3TREA 5DLOA 1VQOT 4XTYA 4M7AE 1RL2A 1UGRB 5LL6S 2O4XA 1IZ6A 1NE8A 4J7IA 3P8BB 4M77A 5GMKi 2DD5A 1VQNA 2PU9B 5I21A 2ZPEB 1N9SA 1VIEA 3ASKA 2KK4A 4M75F 3OYBA 1U1SA 1MGQA 3OW2A 5FRNA 3L2UA 4XU2A 3URGA 3JAME 3CC4T 4PNOA 3V8KA 4C92B 5CCAA 4ATOA 1YJ9T 5L8RE 3EFSA 4LDVA 3CC7A 5C6SA 4XK8E 1M90C 4O5VA 4Y91A 1Y96A 3RERA 1M1KU 1B34B 2DIQA 2K3YA 2QA4T 2MMPA 5CKFA 2CGHA 5GANj 1ZQ1A 3PGGA 3RESA 3OYCA 1YHQA 3A8LB 1Q81U 4PJOD 3M54A 4C92E 3X26B 3CXCA 1BI1A 3OB9A 2H3JA 3CPWS 4BI4A 4BE2A 2LTOA 3G7ZA 4KBMB 3OYGA 1VQLT 3HSBA 4RG2A 3X24B 4B9XA 5J3BA 4M7DG 3FDRA 3QO3A 2F69A 3RKXA 4OB0B 3AHUA 3QKJA 3UT1A 2RB6A 3R6OA 1MHNA 2YLBA 2VUBA 2DEQA 1JRIA 3OYNA 4TVRA 5CKEA 4NL3A 1K73U 1K8AC 4M7DC 2RJEA 3QDRB 1YITT 4E47A 1QP3A 5LJ3j 2CS7A 2XD0A 2CZ0B 5GANe 5GAMd 2BUDA 3A8HB 3OYYA 1U8RA 4MDXA 2LT4A 4M75B 2O01E 2RJFA 1WJRA 5HK3A 5DM7R 4HCZA 4KUIA 4M7AG 4C0FA 4C8QC 3HKSA 4N0AC 4JRIA 4J83A 5CIUA 5LJ5g 1BI3A 5FU6C 4BY6B 3G6EA 3FLGA 2D9TA 4M75A 1Q7YU 5LJ5e 3QUIA 3NFCA 3LGLA 2HBPA 2M1HA 3KUFA 4ZGEB 3OY9A 1KD1U 2JN0A 1WNLA 2JVVA 3OA6A 3WXMB 4M7AC 3CMAT 4F7UA 5M9OA 4M75E 1BYMA 1WJQA 3H6ZA 3EFRA 2DO3A 2LRQA 2RK1A 2RO0A 3L42A 3OQ5A 4EPCA 2RHXA 1G5VA 4A4KA 4J5YA 1VQ5T 2D6FA 2VC8A 3V7CA 1UGQB 3C94A 2LNVA 3NTHA 4HA8A 3OS2A 4HT8A 5CQYA 2QQSA 1QVGS 4FT4A 4EMKA 4IUVA 1KHIA 3OS5A 4RCCA 1ZBXA 4OGCA 4PLIA 3OYJA 2CKKA 5GANd 4C92G 4GY5A 3JCMQ 2LCLA 3I55A 2K57A 2K5LA 1DJ7B 3MP1A 4RCBA 4J6WA 2RA2A 4M75D 3CCST 4M77F 2GCXA 4L59A 5KCOA 1OZ3A 2JNGA 3CD6A 5CKHA 4C92C 4QW2A 5J39A 1S72T 1V29B 3JB9H 3HRUA 5IN1A 2E10A 2K4YA 4JDSA 3V7SA 3PIOA 3CCEA 2RHUA 1GXIE 1FX7A 2RK2A 3CCRA 4RG8A 2A3LA 2RHYA 1Q82U 1Q86U 3CCJA 2E1HA 3OYFA 1PSFA 2JUFA 5GAOq 2P4TA 3OS1A 4FL6A 2FVUA 2VXEA 5C0MA 2RM4A 5GANh 2IG0A 2DXCA 3HRSA 1WQWA 2FB7A 1YI2T 1D3BA 3INZA 3SD4A 1OZ2A 4ZGJB 2P0KA 2WSCE 1YJWA 4LDXA 3JB9F 2VXFA 2DIGA 1LJOA 2FL7A 3PMTA 2AHJB 2Y4XA 1FWZA 4NS5A 2RD1A 4R56A 2ZPIB 3CCMA 1VQKT 2D0QB 2WACA 4X34A 4X9CA 4YTLA 3JRZA 2DTIA 4NOYA 2LQKA 1JB0E 4E7JA 1VQMA 5KCHA 3MEVA 3WVDB 4A54A 2KMTA 5CVIA 2XHCA 1KQ2A 3CC7T 1X75C 3GPLA 1YBYA 2K2VA 4OMFB 3CCVA 1KHCA 3JCMV 4OB3B 4QQDA 3SWNB 4PKCC 2PQWA 4NL2A 3OS0A 4PJOB 1M8VA 3PTAA 4BDZA 5DY9A 2X4WA 2VGMA 3RMSA 3CPWA 1YHQT 2OTLT 2XDDA 3OSVA 2GF7A 2O4XB 3V7RA 3L2RA 3P8DA 1QVPA 2EQMA 4J7FA 4M77B 4RKUE 3CCUT 2L89A 1K73C 4M78F 2DKGA 2DXBA 2NLUA 1KC8U 1I5LA 2CZ6B 2QEXT 4FT2A 3OYKA 4HT9A 2YRVA 3LLRA 2DTHA 3A8GB 3GNGA 4JS4A 1VIFA 1N8RC 4JRPA 4PJOE 1U1TA 1UEBA 1KG1A 3LYIA 2E12A 2RI3A 1Y96B 1YCYA 3E9GA 4C8QA 2EYQA 4N0AA 4M77E 2KVQG 3PT9A 4JS5A 3C95A 4F7UF 3CC2A 3J7AF 4A4FA 1Q7YC 3MHXA 4WF2A 1VQ9A 2RJCA 5GAMf 4E7IA 3L1AA 3QYHB 3MCAB 1M1FA 2EQJA 3OYMA 3OSSC 4LDUA 4BI8B 3GIBA 3QPHA 1H3ZA 1IREB 1RI0A 1XQHA 3SDZA 3G4ST 4A4EA 2PUOB 2QDYB 2DZ9A 3VV0A 2I2LA 4BE0A 3M56A 2EJFA 2XICA 3UPUA 1UGPB 1M4ZA 2MI6A 2DZCA 2WSEE 4M77D 1YIJT 5LJ5j 2BIVA 3ZFJA 1QW1A 5GAN8 3CMET 5GAMg 2LDMA 2XU8A 1LOJA 1NPRA 5A0LA 2LC4A 1QVGA 3VYHB 2MAMA 4II1A 4ELZC 2ZPGB 4BUGA 5FROA 4XU0A 1G3SA 5J26A 2HQXA 5GMKm 2QXFA 5FU7B 3CCLT 4HKEA 2JZ2A 1NJIU 3HHTB 5GANf 2DXTA 4BI3A 5GAN6 4C0DC 3JB9D 4M78A 3RKYA 3CCQA 1VQPA 3VJPA 3I55T 5GAOr 5CQXA 1VQ7A 4Z02A 5KE3A 5GAOm 1NPPA 2EJGA 2KSSA 5FLXE 2RHIA 3QZ9B 4M78E 4C0GA 4F7UB 2G3RA 3Q1JA 4OB2B 2LT1A 1BKBA 4XTWA 4PJOG 5KE2A 3TCJA 5GMKj 4C5EA 3QSUA 2OTJT 3M9QA 5A2QE 3CBOA 3F70A 3CC4A 4M77G 1M9SA 4OF1A 4IUPA 1YJ9A 3OBWA 4EMKB 4IUTA 3N5BB 1M5Q1 2VYTA 2Y4YA 5LJ3e 3OYEA 4PJOC 2ZPFB 5GANg 4QQ6A 4F7UE 4RMOA 2JTMA 4XTXA 3M59A 5GMKl 2QA4A 4CI0C 3PMIA 3X25B 4IKFA 3CBPA 4M78D 5GAOp 3META 3MP6A 4PL6A 4XTZA 1I81A 5CO7A 4BD3A 3L2VA 4M7DF 2V8JA 4UC4A 2DJZA 5GAOl 1K9MC 4OVAA 1O75A 5EG2A 4XU3A 3DLMA 3I56A 2A7YA 2XK0A 1VQLA 1M90U 1YJNA 2EJ9A 4C0ZA 2X4YA 2R58A 1OYXA 1KC8C 2R5AA 3E9FA 2HAXA 2E6NA 2RJDA 3LW5E 4OB1B 2X4XA 1VQ4T 1QP2A 4C8QF 5IAYA 5IT9E 1D3BB 4KT0E 2QQRA 1UB4A 4A4HA 2HD0A 2DTOA 3BW1A 4M7AF 3MO8A 2M16A 5LJ3d 2EQUA 2QQ9A 3A5ZB 1W2BS 2ZZDA 3HL8A 2JOYA 4E7KA 4OGEA 1M1KC 2QTXA 5HY6A 2KAFA 2PVDB 2CZ7B 4ME7A 3JCMe 1SSFA 1VQNT 2DPPB 3JSCA 5LJ5h 3OYDA 2P0QA 4OP0A 4O6JA 3JB9I 1WJSA 3RUXA 1Q81C 3HFOA 2KQWA 3DB3A 4BDYA 3CMAA 1VQ6A 1XTDA 5CKBA 5GAOn 3OYIA 1VQ9T 3CBMA 2KY9A 4M75G 4N4IA 4P5NA 5DLQE 1EIFA 4M7DB 2WSFE 5LJ3h 3QG1A 3VYGA 2L3RA 4DQ2A 4F7UG 4N4GA 5FU7C 4C92F 4ZGDB 2JTFA 5KH6A 4BACA 1VQ5A 3S3MA 1UGSB 5I2MA 3QZ5B 2EWNA 5GAN7 1XNIA 4M75C 3JCMX 3VKIA 3GOXA 5D6XA 4M7DA 4QVDA 3ER0A 2F5TX 2PVOB 2V8KA 3J81E 3G71A 3QIIA 2ZPHB 4BY6C 4C8QB 1NJIC 2GQVA 3L2WA 1R8OB 3SFMA 4M7DE 3MEUA 3GNFB 4JLGA 3CCSA 4CRIA 4MZMA 2VV5A 3LGFA 3E1SA 2P0PA 4L6V5 3LX7A 3JCMd 1S72A 1JJ2S 4JUVA 4EMKC 3ZBDA 3FIFA 1I4K1 3CPFA 3VU3C 5A0DA 5GAMj 3S3OA 3X20B 3DB4A 2XI9A 1KD1C 2PVGB 4C8QE 4HCCA 3PIPA 4A4GA 2DK3A 1KQSS 4M7AA 3P8HA 5GAN2 3V8LA 3VUBA 3OMGA 3TEEA 1YI2A 4LD9K 4X9DA 2RH2A 3QXEB 4FM4B 4M7DD 2L8DA 4XU1A 3MEAA 4JRQA 4D6WA 3LWHA 3G6ET 1VQ8A 3PNWC 3JCMh 3TU4K 3GP8A 1OI1A 1VQKA 1VQ6T 1Y07A 2R5MA 2X4JA 5CAIA 2L5QA 5GAMe 3KXTA 4MDWA 3M57A 4C8QD 2MWPA 3A8MB 2BKDN 2MWOA 3LH0A 4ELYC 4JJNK 1G3YA 4IURA 4M78B 1X6OA 4BE1A 2ZCFB 4C92A 3KBGA 1H641 4M7AD 2R57A 3L2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQW A;  2FB7 A;  1I8F A;  1D3B A;  3INZ A;  3SWN A;  4M78 D;  5GAO p;  3JB9 F;  2DVE A;  4JRK A;  1B34 A;  1I81 A;  2VXF A;  4XTZ A;  4QVC A;  4M7D F;  4PJO A;  1WQ7 A;  4XTV A;  4XTY A;  1LJO A;  4M7A E;  2DJZ A;  5GAO l;  4XU3 A;  4M77 A;  2RD1 A;  5GMK i;  5I21 A;  5GAN 3;  2EJ9 A;  4M75 F;  1N9S A;  4X9C A;  4NOY A;  2DTI A;  5LJ5 f;  3JB9 J;  1U1S A;  4J6X A;  1MGQ A;  4A54 A;  1N9R A;  4XU2 A;  4PNO A;  3V8K A;  4C92 B;  1KQ2 A;  3BDU A;  4C8Q F;  3EFS A;  3L2Z A;  3BY7 A;  3SWN C;  3JCM V;  1D3B B;  2E41 A;  2YHT A;  3SWN B;  5GAN 4;  4Y91 A;  3RER A;  1Y96 A;  4NL2 A;  1B34 B;  4PJO B;  1M8V A;  4C8Q G;  4C92 D;  2DTO A;  5DY9 A;  3BW1 A;  5LJ3 f;  4M7A F;  3V7R A;  2CGH A;  4M77 C;  5GAN j;  3PGG A;  5LJ3 d;  4M77 B;  4MMK A;  3RES A;  4V2S A;  4M78 F;  3RKW A;  2DKG A;  4PJO D;  1HXD A;  4C92 E;  1I5L A;  2E65 A;  2QTX A;  3FB9 A;  3SB2 A;  3JCM e;  3HSB A;  4HT9 A;  5LJ5 h;  2DTH A;  5GMK e;  3JB9 G;  4PJO E;  4OP0 A;  1U1T A;  4EMG A;  3JB9 I;  4M7D G;  3QO3 A;  3RUX A;  3RKX A;  3HFO A;  3AHU A;  1Y96 B;  1YCY A;  2RB6 A;  4C8Q A;  2YLB A;  4N0A A;  4M77 E;  5GAM h;  5LJ5 d;  2DEQ A;  1JRI A;  4F7U F;  5GAO n;  4M75 G;  4NL3 A;  5LJ3 g;  4WF2 A;  5GAM f;  4M7D C;  4M7D B;  5LJ3 h;  3L1A A;  5LJ3 j;  3JCM c;  4XTU A;  4DQ2 A;  4F7U G;  3M4G A;  4C92 F;  5GAN e;  5GAM d;  3GIB A;  2EWN A;  5GAN 7;  4M75 C;  3JCM X;  4M75 B;  4PJO F;  1WPY A;  2HNI A;  2DZ9 A;  4QVD A;  4XQ3 A;  4M7D A;  2I2L A;  3HFN A;  4M7A G;  2EJF A;  1BIB A;  1KQ1 A;  4N0A C;  4JRI A;  4C8Q B;  4C8Q C;  5LJ5 g;  1X01 A;  4J6Y A;  2DZC A;  4M7D E;  4M77 D;  4JLI A;  4M78 G;  4M75 A;  2DXU A;  3JCM W;  5LJ5 j;  3JCM f;  2EAY A;  3QUI A;  1BIA A;  2JN0 A;  1WNL A;  5GAN 8;  4M7A C;  5GAM g;  3JCM d;  4JUV A;  4A53 A;  4M75 E;  4EMK C;  4F7U A;  1LOJ A;  3FIF A;  1I4K 1;  2Y90 A;  3EFR A;  1TH7 A;  2FYK A;  4M78 C;  3VU3 C;  5GAM j;  2ZGW A;  4C8Q E;  3JCM b;  4J5Y A;  4XU0 A;  2VC8 A;  3V7C A;  3QHS A;  5GMK m;  4HT8 A;  4HA8 A;  4M7A A;  4EMK A;  5GAN 2;  3BFM A;  4RCC A;  5GAN f;  3V8L A;  2DXT A;  5GAN 6;  3JB9 D;  4M78 A;  4X9D A;  3RKY A;  3JCM J;  2E64 A;  5GAO r;  4M7D D;  4XU1 A;  4C92 G;  5GAN d;  5GAO m;  3RIR A;  3JCM P;  1LNX A;  4MML A;  3JCM Q;  2EJG A;  3JCM g;  2K57 A;  5GAN 5;  4M78 E;  4RCB A;  4J6W A;  4F7U B;  2RA2 A;  3FJP A;  3JCM h;  4XTW A;  5LJ5 e;  4M75 D;  5GMK h;  4M77 F;  4PJO G;  5GMK j;  3QSU A;  4EMH A;  5GAN h;  4C92 C;  5CAI A;  3JB9 H;  5GAM e;  2E10 A;  3V7S A;  4M77 G;  4C8Q D;  4M7A B;  2YLC A;  4EMK B;  4PJO C;  1M5Q 1;  2E1H A;  3V8J A;  5LJ3 e;  4M78 B;  1HK9 A;  5GAN g;  5GAO q;  4F7U E;  1JBM A;  2VXE A;  4C92 A;  4M7A D;  1H64 1;  4XTX A;  2RM4 A;  5GMK l; 
#chains in the Genus database with same CATH topology
 4Q5W A;  4QQG A;  1BB9 A;  2K79 A;  1E7O A;  1P92 A;  1Y57 A;  4XTV A;  1XOV A;  2FHD A;  1RAH B;  2Z0W A;  4KGX B;  2QGF B;  2QQB A;  5HCK A;  3GLX A;  1YI2 Q;  4Z88 A;  2YWW A;  3M53 A;  1MMG A;  4FIB A;  3BY7 A;  2RNA A;  3SWN C;  2A28 A;  4J9B A;  1N6A A;  1VOM A;  5I2S A;  4ZTJ A;  4RTU A;  1NYG A;  4BB7 A;  5FRM A;  4PLL A;  4M77 C;  2EIF A;  3G4S A;  2OTL Q;  4J9E A;  1YIJ A;  3CCU Q;  4EMG A;  1G2B A;  1C0M A;  4KH1 B;  8AT1 B;  5GAM h;  1S1N A;  2AKK A;  2QAZ A;  3M58 A;  1B3Q A;  3ME9 A;  1SHF A;  2EFI A;  3G1J A;  2MF2 A;  4PJO F;  2LX9 A;  3G71 T;  2CYZ B;  3EFO A;  3OMC A;  1X01 A;  4ZNX A;  1MND A;  5CK9 A;  3JCM f;  4DOW A;  2ATC B;  1BIA A;  2OTJ A;  2IVW A;  5AYF A;  1D09 B;  2Y90 A;  2E5Q A;  1FXX A;  2ZGW A;  3JCM b;  2O88 A;  3FC3 A;  4JJC A;  1QVG P;  1I1J A;  2DRM A;  1PD1 A;  3J80 E;  1G3T A;  3JCM J;  2E64 A;  9ATC B;  1UG1 A;  3JCM P;  2CZ1 B;  4ZN1 A;  5CR2 A;  1Y7X A;  2DF6 A;  3UWN A;  2COW A;  3CCL Q;  4ANJ A;  1OPL A;  4DEY A;  4M7A B;  3HRT A;  4EIK A;  4AFQ C;  3LWI A;  1D1B A;  1W2B P;  4XTU A;  3S3N A;  2DBM A;  2E70 A;  1PM3 A;  3CCQ T;  1Y71 A;  4HXJ A;  4PJO A;  2RHZ A;  4KGZ B;  4ORZ A;  1RL2 A;  3VRY A;  2DD5 A;  2PU9 B;  1QMC A;  4M75 F;  1N9S A;  2KK4 A;  2A08 A;  5FRN A;  1AWW A;  5CCA A;  3TSW A;  1YJ9 T;  3CC7 A;  2CRE A;  4Y91 A;  1Y96 A;  1VQ4 Q;  2MMP A;  3PGG A;  1AT1 B;  1KIK A;  2A0F B;  3CXC A;  3OB9 A;  1HSQ A;  2LP5 A;  2EBP A;  1ZSZ A;  4RG2 A;  2J7I A;  3X24 B;  2J6F A;  3AHU A;  3UT1 A;  3R6O A;  1MHN A;  3EGU A;  1JRI A;  3MPU B;  4TVR A;  1E6H A;  1YFN A;  3QDR B;  5LJ3 j;  1U8R A;  1V76 A;  2LT4 A;  2O01 E;  1WJR A;  5HK3 A;  4M7A G;  4C0F A;  4IIO A;  3HKS A;  4N0A C;  5CIU A;  1Q82 R;  1Q86 R;  5FU6 C;  2CP7 A;  3FLG A;  2D9T A;  4M75 A;  2BE9 B;  2O2O A;  2CSQ A;  1KD1 U;  2JS2 A;  3KUF A;  1WNL A;  2JVV A;  1X2K A;  1BYM A;  2DO3 A;  2LRQ A;  2YT6 A;  2RHX A;  4J5Y A;  2HEQ A;  1VQ5 T;  3V7C A;  3C94 A;  3EFO B;  2DVJ A;  2CKK A;  3EG1 A;  3JCM Q;  2K57 A;  1DJ7 B;  3UA7 A;  2W10 A;  3CCS T;  2CP0 A;  4M77 F;  2FRY A;  3CD6 A;  1TXQ A;  1ZSG A;  1GBQ A;  1S72 T;  1V29 B;  2LX7 A;  3CCE A;  2RHU A;  2YDL A;  1KFZ A;  2RHY A;  2DYB A;  3HTR A;  5GAO q;  4FL6 A;  2FVU A;  5I11 A;  2DXC A;  2YUQ A;  4PJM A;  3EH1 A;  3SD4 A;  4ZGJ B;  2WSC E;  2HMA A;  3R6N A;  4R56 A;  2COZ A;  1RAC B;  1VQK T;  2D0Q B;  4X34 A;  4E7J A;  4YTL A;  4NOY A;  2LQK A;  4FYY B;  3I55 Q;  1TUC A;  3I56 Q;  2F2X A;  2SEM A;  3CCV A;  1UFF A;  4QQD A;  2CP6 A;  2E3H A;  3EG2 A;  3OS0 A;  4PJO B;  1M8V A;  3PTA A;  3KFV A;  4J7F A;  2L89 A;  4Z89 A;  1SKU B;  2DXB A;  2VAS A;  1FMW A;  1WHG A;  4FT2 A;  1ZLM A;  2KRN A;  1N8R C;  3A8G B;  2E12 A;  1Y96 B;  1PRL C;  1M3C A;  2GTJ A;  3C95 A;  1W6X A;  4F7U F;  3CCM Q;  5GAM f;  3QYH B;  1YNZ A;  1PC0 A;  1K0S A;  1VYT A;  3SDZ A;  1ZSZ B;  4A4E A;  2KYM A;  1WHJ A;  2PUO B;  2QDY B;  1WHH A;  3M56 A;  1M4Z A;  2BIV A;  2DLP A;  2EYZ A;  1JJ2 P;  1WLP B;  1SSH A;  1NPR A;  1QVG A;  2LC4 A;  3VYH B;  4II1 A;  2A36 A;  4XU0 A;  4J9H A;  5GMK m;  1JEG A;  1M90 R;  2QXF A;  4DBQ A;  3CC2 Q;  1ZBJ A;  2KXC A;  2DXT A;  3JB9 D;  3RKY A;  3I55 T;  1VQ7 A;  5CQX A;  5GAO m;  2ENM A;  2VB6 A;  5FLX E;  4M78 E;  4PJO G;  5GMK j;  1M30 A;  4C5E A;  2FO0 A;  3CBO A;  3F70 A;  2D8H A;  1PKS A;  1TUG B;  1F1B B;  1BBZ A;  1TS9 A;  2OI3 A;  2VYT A;  2X51 A;  1QVF P;  4XTX A;  2BZ8 A;  4CI0 C;  2X9H A;  4M78 D;  1WFW A;  3L2V A;  4BD3 A;  3I35 A;  2LJ3 A;  3I56 A;  1VQP Q;  5FWC A;  1VQL A;  2JM8 A;  3BE3 A;  1NM7 A;  2ROL A;  3E9F A;  2J06 A;  2KGT A;  5IAY A;  1TG0 A;  3OW2 P;  4KT0 E;  2FZG B;  2QQR A;  2L3Q A;  2M16 A;  5LJ3 d;  2QQ9 A;  1OU8 A;  4OGE A;  1M1K C;  2YXY A;  2PVD B;  3JCM e;  1VQN T;  2CDT A;  3JB9 I;  1Q81 C;  2ABL A;  3DB3 A;  4BDY A;  1XTD A;  3OYI A;  4M75 G;  4N4I A;  4P5N A;  2JXB A;  2D1X A;  3QG1 A;  2L3R A;  2FRW A;  4BAC A;  5FU7 C;  3A98 A;  3H41 A;  3GOX A;  4PFO A;  1RAF B;  1B7T A;  5IH2 A;  1PG5 B;  1OV3 A;  2ZPH B;  2GQV A;  4M7D E;  4AMC A;  1YN8 A;  4PJL A;  2K3B A;  1EZZ B;  3CPF A;  3VU3 C;  2ZAE A;  2PVG B;  2JS0 A;  3V8L A;  3VUB A;  4X9D A;  1UJY A;  4M7D D;  2L8D A;  3MEA A;  1TUD A;  3PNW C;  3JCM h;  3GP8 A;  1VQ6 T;  2X4J A;  2L5Q A;  3A8M B;  2EQI A;  4LNP A;  1G3Y A;  4IUR A;  4QT7 A;  1ACM B;  4BE1 A;  3KBG A;  1H64 1;  2XG8 D;  4LD6 A;  4PFP A;  1WZO A;  3PFS A;  1PNJ A;  2QEX A;  2DD4 A;  2YSQ A;  4EDU A;  2DNU A;  3C12 A;  4C5G A;  1N9R A;  3E19 A;  3QJY A;  5IHI A;  4HVU A;  3CCR T;  2AKL A;  4FW1 A;  3CCJ T;  3OBY A;  4MZP A;  4DBF A;  2YHT A;  4C92 D;  3H0H A;  4RTZ A;  4MMK A;  1TTH B;  3UA6 A;  1YJW T;  5GJV B;  1OEB A;  4ESR A;  3SB2 A;  3M5A A;  4FYV B;  1CSK A;  3OYA A;  2OJ2 A;  1VQM T;  3EAE A;  3CXC S;  3CME A;  4QVZ A;  1UGV A;  4J8O A;  4IUU A;  3JCM c;  3M4G A;  4E7L A;  4L5G A;  1YJN T;  4DEX A;  4XAX B;  1FMV A;  1WPY A;  2HNI A;  2RI2 A;  4FSX A;  3X28 B;  3NGP A;  1JJ2 A;  4MZT A;  3I5R A;  1K8A U;  1IGQ A;  2DXU A;  3CEY A;  1WXU A;  3G4S Q;  3JCM W;  3MEW A;  1HYO A;  4A53 A;  2H3E B;  2OAU A;  5KYN A;  1RAA B;  1TH7 A;  1YIJ Q;  1SPK A;  2O9S A;  1WIE A;  5KYY A;  3T9N A;  5D6W A;  2LVM A;  4X1V A;  2KDS A;  3JCM g;  1G3W A;  2CUB A;  4B9W A;  1VQ8 T;  3HPW A;  2NUP A;  3M4Y A;  4LDW A;  5FU6 B;  1M1G A;  3MP8 A;  1OPK A;  3VUZ A;  3EG9 A;  3DLL A;  1QVF A;  4RUG A;  2EYX A;  1IRX A;  3JV3 A;  2OTJ Q;  2V8I A;  1JBM A;  1K9M U;  2XDB A;  2RF0 A;  2GFU A;  2DVE A;  5HKC A;  2LQ8 A;  3TRE A;  4XTY A;  5LL6 S;  2O4X A;  1IZ6 A;  2F1L A;  5I21 A;  2L3S A;  3OYB A;  2E4H A;  3OW2 A;  3L2U A;  4XU2 A;  3URG A;  3JAM E;  3CC4 T;  3V8K A;  4ATO A;  5L8R E;  1V1C A;  3M0U A;  2GBQ A;  2QK0 A;  1C1A A;  2QA4 T;  2CGH A;  1KD1 R;  2D8J A;  1YHQ A;  1D1C A;  3I9Q A;  3A8L B;  1UUE A;  3X26 B;  1BI1 A;  4BI4 A;  4BE2 A;  3OYG A;  3HSB A;  1Z9Z A;  4B9X A;  4RTT A;  3FDR A;  3QO3 A;  2HKN A;  4OB0 B;  5CKE A;  4NL3 A;  1K73 U;  1WHK A;  3CC7 Q;  2DL3 A;  1WI7 A;  1QWE A;  1MV0 B;  4KUI A;  3SHW A;  5LJ5 g;  4BY6 B;  3G6E A;  1Q95 G;  1OUL A;  2HSP A;  1Q7Y U;  3QUI A;  3NFC A;  3OY9 A;  3WXM B;  3CMA T;  5M9O A;  1WJQ A;  3EFR A;  3L42 A;  3OQ5 A;  2EYW A;  4A4K A;  2D6F A;  2YUO A;  2VC8 A;  1AEY A;  3NTH A;  2LNV A;  4PK4 A;  1QVG S;  1WXB A;  4IUV A;  4OGC A;  1M8M A;  5GAN d;  1H3H A;  1X6B A;  4RTV A;  2RA2 A;  3LH5 A;  4QW2 A;  3JB9 H;  5IN1 A;  3V7S A;  2FEI A;  5KYY B;  2E1H A;  3OYF A;  1M2O A;  2JUF A;  2P4T A;  3OS1 A;  4RTX A;  1ABO A;  3NPF A;  2CP2 A;  1AZE A;  2FB7 A;  2G6F X;  4OMM A;  1YI2 T;  2NUP B;  2P0K A;  2VXF A;  3PE0 A;  5FW9 A;  1LJO A;  1I0C A;  3PMT A;  2AHJ B;  4NS5 A;  3EG9 B;  1FWZ A;  1NLO C;  2C0T A;  2WAC A;  4HT8 A;  1AWX A;  2DTI A;  3JRZ A;  3WVD B;  5CVI A;  1KQ2 A;  4JJD A;  3CC7 T;  1X75 C;  2RPN A;  3U23 A;  2NYS A;  3JCM V;  1A0N B;  4OB3 B;  3CD6 Q;  2ED0 A;  3M0P A;  4PKC C;  4NL2 A;  5DY9 A;  2VGM A;  2OTL T;  3CPW A;  3CCE Q;  3V7R A;  2GF7 A;  2O4X B;  1T0J A;  3CCU T;  1KC8 U;  4F14 A;  2CZ6 B;  4DBH A;  3OYK A;  2YRV A;  5AT1 B;  2YRD A;  2KVQ G;  2ED1 A;  4A4F A;  2K2M A;  2RJC A;  4E7I A;  4PJJ A;  3MCA B;  3OSS C;  4LDU A;  3GIB A;  2MPX C;  4JZ3 A;  3CCV Q;  4D8D A;  1XQH A;  3VV0 A;  2I2L A;  2EJF A;  2XIC A;  2L0A A;  5FWB A;  4A63 B;  1UGP B;  2MI6 A;  1AWJ A;  2WSE E;  3EGD A;  2DL8 A;  3ZFJ A;  3H9N A;  4R0K A;  5GAM g;  4ELZ C;  2D0N A;  5FU7 B;  3CCL T;  3HHT B;  1QCN A;  3CCQ A;  5GAO r;  5KE3 A;  2EJG A;  2KSS A;  2KEA A;  3Q1J A;  4XTW A;  3EHR A;  3TCJ A;  1X2Q A;  2RQT A;  1BCO A;  3PVQ A;  1M9S A;  1H8K A;  2LJ1 A;  1RAI B;  1YJ9 A;  3OBW A;  2KT1 A;  4JJB A;  1QCF A;  1CKA A;  2Y4Y A;  3OYE A;  4J9G A;  3M59 A;  1OQK A;  3CBP A;  5GAO p;  4XTZ A;  4E7Z A;  1I81 A;  5CO7 A;  4UC4 A;  2RMO A;  1O75 A;  1KJW A;  5EG2 A;  4XU3 A;  1MV3 A;  2A7Y A;  2XK0 A;  2C0O A;  4KGV B;  2EJ9 A;  1VQ7 Q;  2R58 A;  2R5A A;  2HAX A;  2E6N A;  1RAG B;  2X4X A;  1BCM A;  1VQ4 T;  1ZX6 A;  5IT9 E;  2K9G A;  2DL5 A;  2MYS A;  3M0S A;  3ZL7 C;  2EQU A;  3A5Z B;  2ZZD A;  2AK5 A;  2AT1 B;  1WHM A;  2QTX A;  3CQT A;  3E2U A;  1YCS B;  2KAF A;  2CZ7 B;  3AT1 B;  4ME7 A;  5IXB A;  2DPP B;  3JSC A;  2JMA A;  1ZUK A;  3D7S B;  2KQW A;  1T3S A;  4QKU A;  5GAO n;  1VQL Q;  3CBM A;  4M7D B;  3A1P A;  2FPD A;  1VQ5 A;  4ZGD B;  5KH6 A;  2JTF A;  3M0T A;  1UGS B;  2CH4 A;  3JCM X;  3VKI A;  1YIT Q;  5IXF A;  2F5T X;  2V8K A;  2HL3 A;  3J81 E;  3QII A;  4BY6 C;  2RQW A;  4F17 A;  3L2W A;  3SFM A;  4LXC A;  3CCS A;  1PCX A;  2VV5 A;  3E1S A;  2P0P A;  1RAE B;  1JJ2 S;  3LX7 A;  1S72 A;  2L2P A;  1I4K 1;  3X20 B;  2DYI A;  4C8Q E;  3EG0 A;  3PIP A;  2LMJ A;  2DK3 A;  5GAN 2;  1GRI A;  3TEE A;  3EGD B;  2DL4 A;  2RH2 A;  4FM4 B;  4XU1 A;  1BU1 A;  4J9C A;  1VQK A;  1QQJ A;  2R5M A;  4C8Q D;  2MWP A;  4FW2 A;  2BKD N;  4ELY C;  4JJN K;  1AD5 A;  3FJ5 A;  1KSW A;  4M7A D;  2LCS A;  4AG2 C;  1QVF S;  2EYY A;  2IIM A;  1Q86 C;  1Q82 C;  3VS2 A;  1ZHI A;  1B34 A;  1GCQ C;  4C5H A;  1NZ9 A;  1TWB A;  2GFA A;  3I56 T;  1VQO A;  3UDC A;  2VGN A;  3DKM A;  2DM1 A;  3MJX A;  4IIM A;  2M9U A;  4FU6 A;  4CC4 B;  4J6X A;  1U3O A;  1JO8 A;  2AIR B;  2ZPB B;  4ZN3 A;  2EKO A;  1W2B A;  2HL5 C;  2E41 A;  3FRN A;  4KUD K;  3OW2 S;  2F5K A;  5LJ3 f;  1R0C B;  1K8A R;  1N8R U;  1Z9Q A;  3RKW A;  1HXD A;  2ECZ A;  3FB9 A;  4N4H A;  3CCM T;  2KYB A;  2QQA A;  3M55 A;  3REB B;  4E6R A;  2DER A;  1GFC A;  2QEX Q;  3OYH A;  4LUD A;  3ZEH A;  2FG0 A;  1RLP C;  3QYG B;  2SRC A;  1YIT A;  2DJQ A;  2GTO A;  4Y28 E;  4AFS C;  1SF9 A;  4IUQ A;  2HQE A;  2XID A;  1EFN A;  3HFN A;  3JB9 J;  1BIB A;  2E6Z A;  4J6Y A;  3S6W A;  2EQK A;  2EGC A;  4Y92 A;  5KYU A;  5HK0 A;  2EW3 A;  3QBY A;  1AHJ B;  3CC2 T;  2FYK A;  4M78 C;  1NLP C;  3CME Q;  2IPO B;  2F2V A;  4GLK A;  3BFM A;  3QJ6 A;  1UEC A;  3UAT A;  3RIR A;  1LNX A;  5GAN 5;  8ATC B;  1AWO A;  2K7A A;  2DAQ A;  1WGS A;  4EMH A;  2K5I A;  2LCC A;  3C4S A;  3NTK A;  2YLC A;  3VS3 A;  1UHF A;  1N5Z A;  2K3X A;  1HK9 A;  1WDX A;  2ESW A;  2LJ0 A;  1E6G A;  2X35 A;  4HCB A;  1VQP T;  1PSE A;  4JRK A;  1LPL A;  2CP3 A;  1UGR B;  1K73 R;  5GMK i;  1VQN A;  2KT8 A;  1SRM A;  4OMO A;  3ASK A;  1VIE A;  2A37 A;  2HSE B;  1MGQ A;  4LN2 A;  1NBE B;  3EFS A;  5C6S A;  1M90 C;  3RER A;  1M1K U;  1B34 B;  2DIQ A;  1NEB A;  2BZY A;  5CKF A;  4J9F A;  1Q7Y R;  5GAN j;  1ZQ1 A;  3OYC A;  4E7S A;  4PJO D;  1Q81 U;  1GL5 A;  2AZV A;  4C92 E;  1WX6 A;  2H3J A;  3CPW S;  3G7Z A;  4FSS A;  3RKX A;  2VUB A;  1K8A C;  4M7D C;  2RJE A;  1QP3 A;  1QLY A;  2XD0 A;  2CZ0 B;  2BUD A;  3A8H B;  2OX7 A;  3OYY A;  1UE9 A;  2RJF A;  2FZK B;  5DM7 R;  4HCZ A;  2O31 A;  1MUZ A;  4JRI A;  1PD0 A;  1YHQ Q;  1AOJ A;  2HBP A;  2M1H A;  4ZGE B;  1VQ6 A;  2KNB B;  3OA6 A;  4M75 E;  3H6Z A;  2RO0 A;  4EPC A;  3QWX X;  3TVT A;  2COY A;  4HA8 A;  2QQS A;  4FT4 A;  1CKB A;  3OS5 A;  1ZBX A;  1TSF A;  5KYU B;  4DBR A;  2LCL A;  2DX1 A;  2K5L A;  1MMD A;  2QTV A;  4M75 D;  5KCO A;  1OZ3 A;  2JNG A;  2DBK A;  3I5S A;  4C92 C;  2E10 A;  4JDS A;  3G6E Q;  1GXI E;  3CCR A;  4RG8 A;  3CCJ A;  1KC8 R;  1PSF A;  5C0M A;  2RM4 A;  1SHG A;  2C0I A;  1WQW A;  2E3I A;  1D3B A;  1Y0M A;  2EKH A;  1OZ2 A;  2QGG A;  1YJW A;  3JB9 F;  4LDX A;  2FL7 A;  1TOV A;  2ZPI B;  3THK A;  1VQM A;  1JB0 E;  3MEV A;  4A54 A;  2KE9 A;  1GCQ A;  3GPL A;  2KRM A;  1RI9 A;  1KHC A;  2MOX A;  1YWP A;  2PQW A;  2JMC A;  2EGE A;  4BDZ A;  2X4W A;  1YHQ T;  2XDD A;  3OSV A;  1YJN A;  1K73 C;  1M3A A;  4M78 F;  1R0B G;  3EGX A;  1I5L A;  2HDA A;  4HT9 A;  3LLR A;  4AT1 B;  4JS4 A;  3GNG A;  2NUT A;  1VIF A;  4CC7 A;  1U1T A;  2V1R A;  2RI3 A;  2BZX A;  1YCY A;  4K11 A;  3E9G A;  4C8Q A;  4M77 E;  4JS5 A;  1OX8 A;  3GBQ A;  1Q7Y C;  1VQ9 A;  1M1F A;  3OYM A;  1IRE B;  2I0N A;  1WA7 A;  3G4S T;  1ARK A;  2DET A;  3UPU A;  2DZC A;  2RQU A;  1YIJ T;  4M77 D;  5LJ5 j;  1IGU A;  1QW1 A;  3RR6 A;  2KR3 A;  2LDM A;  4GBQ A;  2MAM A;  1K4U S;  4F04 B;  4BUG A;  5FRO A;  1KQS P;  2FPE A;  2HQX A;  2FZC B;  4HKE A;  1NJI U;  5GAN f;  4BI3 A;  2JW4 A;  4OML A;  4M78 A;  4PFZ A;  3MKD A;  1X6G A;  1NPP A;  1I5O B;  3QZ9 B;  2G3R A;  4OB2 B;  1BKB A;  5KE2 A;  2QG9 B;  2OTJ T;  2VWF A;  2HQH A;  2J6O A;  2M02 A;  3CC4 A;  4OF1 A;  3N5B B;  1M5Q 1;  3VS7 A;  5LJ3 e;  2DFU A;  4QQ6 A;  4F7U E;  4RMO A;  2JTM A;  2QA4 A;  5GMK l;  3PMI A;  3X25 B;  4IKF A;  3MP6 A;  4PL6 A;  4CC2 A;  4M7D F;  2V8J A;  2XMF A;  5GAO l;  4OVA A;  3DLM A;  3CCQ Q;  2X4Y A;  2DRK A;  1OYX A;  1KC8 C;  1H92 A;  2RJD A;  3LW5 E;  2V1Q A;  1D3B B;  1UB4 A;  1GFD A;  3BW1 A;  4B6M A;  1YJ9 Q;  2AZS A;  1D0X A;  2V26 A;  1W2B S;  1OX9 A;  4FYX B;  5HY6 A;  1ABQ A;  2GGR A;  1AZG B;  2P0Q A;  4O6J A;  2L3P A;  3CMA A;  5CKB A;  2KY9 A;  3RBB B;  1EIF A;  1G83 A;  5LJ3 h;  3EGX B;  4DQ2 A;  2BE7 D;  4C92 F;  1MMA A;  3NHN A;  2HBW A;  2EWN A;  3QZ5 B;  5GAN 7;  2DE0 X;  1MNE A;  2NUT B;  5D6X A;  3VRZ A;  1OOT A;  2EPD A;  4M7D A;  4QVD A;  3ER0 A;  2PVO B;  3REA B;  4C8Q B;  3G71 A;  3O5Z A;  1X27 A;  1R8O B;  3MEU A;  3GNF B;  4JLG A;  4CRI A;  2X3W D;  4MZM A;  3JCM d;  4EMK C;  3FIF A;  5A0D A;  2CT3 A;  5GAM j;  3DB4 A;  2XI9 A;  1KD1 C;  4HCC A;  7AT1 B;  4A4G A;  2QAS A;  1M3B A;  1RAB B;  3P8H A;  2P84 A;  4F16 A;  1YI2 A;  3QXE B;  1VQ5 Q;  4JRQ A;  4D6W A;  2JM9 A;  1PRM C;  1PHT A;  3TU4 K;  1Y07 A;  1JQQ A;  2RN8 A;  5CAI A;  1N8R R;  3KXT A;  2LQW A;  3M57 A;  4MDW A;  2QYZ A;  3UF4 A;  4FCY A;  3CCS Q;  4M78 B;  2J6K A;  1GCP A;  2CP5 A;  4C92 A;  1S72 Q;  2JJ9 A;  2R57 A;  2OTL A;  1I8F A;  1LCK A;  3CCU A;  2DL7 A;  1K9A A;  1WQ7 A;  1KK7 A;  2K5F A;  2KRS A;  1IB8 A;  2DIL A;  1W1F A;  1ZUY A;  5GAN 3;  3CD6 T;  5LJ5 f;  1W4S A;  2PTK A;  3TQ7 P;  1FYN A;  2PUK B;  3C0C A;  1BI0 A;  3GF5 A;  3CCE T;  3BDU A;  1N27 A;  3L2Z A;  1QWF A;  3IQL A;  2PNI A;  5GAN 4;  1VQK Q;  4GLM A;  4C8Q G;  4KUL A;  3HP9 A;  2M51 A;  4R55 A;  5KYW A;  1O9S A;  4V2S A;  2E65 A;  1UJ0 A;  2HCK A;  1VUB A;  5GMK e;  1BI2 A;  3JB9 G;  1X69 A;  2QDL A;  4E7H A;  1BK2 A;  1YWO A;  4VUB A;  1C6V X;  1EX4 A;  2HKQ B;  1VQO Q;  1D0Z A;  5LJ5 d;  3A8O B;  4AG1 C;  3CCV T;  1IHW A;  2DEU A;  5LJ3 g;  5L23 A;  2JTE A;  4HCK A;  3FEO A;  4DA4 A;  1VYV A;  3CCL A;  4E2F B;  4XQ3 A;  2RI5 A;  1KQ1 A;  3RDV A;  2DMO A;  4M78 G;  4JLI A;  5CKD A;  1NYF A;  2EAY A;  3H8Z A;  3H0I A;  3RMQ A;  2QI2 A;  3WVE B;  2BTT A;  1KQS A;  3NTI A;  1WYX A;  3O8V A;  1JXO A;  4OMQ A;  2B8A A;  3BDL A;  2M0O A;  3QHS A;  3OYL A;  1ZUU A;  1YP5 A;  4WCI A;  1IHV A;  4C0D B;  4MML A;  5KYX A;  4KH0 B;  1NG2 A;  1PKT A;  3FJP A;  2C06 A;  5GMK h;  1M1K R;  5D6Y A;  5A0G A;  2RQR A;  4DOV A;  4LDY A;  2XDP A;  1VQ4 A;  4ZTF A;  1Q81 R;  2YRC A;  3V8J A;  5I22 A;  4LUE A;  1OU9 A;  1WXT A;  3SWN A;  1VQ7 T;  4QVC A;  4C5I A;  2XKO C;  1VQO T;  5DLO A;  4M7A E;  1TU0 B;  2CT4 A;  1NE8 A;  4J7I A;  3P8B B;  4M77 A;  3QWY A;  2ZPE B;  1RLQ C;  1U1S A;  4JPB W;  4PNO A;  4C92 B;  4LDV A;  3ULR B;  1U5S A;  3PVL A;  1K1Z A;  4XK8 E;  1UDL A;  1U06 A;  4O5V A;  2K3Y A;  1T0H A;  1PWT A;  5D7U A;  3RES A;  3RNJ A;  3M54 A;  1D1A A;  4OMP A;  2LTO A;  4KBM B;  1VQL T;  1HJD A;  5J3B A;  4M7D G;  2F69 A;  3QKJ A;  2RB6 A;  2YLB A;  2DEQ A;  3OYN A;  1VQN Q;  5KYW B;  1YIT T;  4E47 A;  2CS7 A;  5GAN e;  5GAM d;  1K76 A;  2OAW A;  1QCO A;  1RAD B;  4MDX A;  1J3T A;  4M75 B;  2EGA A;  2MCN A;  6AT1 B;  2LQN A;  1JXM A;  4C8Q C;  4HVV A;  4J83 A;  5GJW B;  1BI3 A;  1D0Y A;  3LGL A;  1W70 A;  3H0F A;  2JN0 A;  2LNH B;  4RTW A;  3NMZ C;  4M7A C;  4F7U A;  1SG5 A;  2RK1 A;  1G5V A;  1AVZ C;  2E5K A;  2O9V A;  4M4Z A;  1UGQ B;  3OS2 A;  5CQY A;  4EMK A;  4RCC A;  1KHI A;  2YUP A;  4PLI A;  3OYJ A;  2K6D A;  4C92 G;  4GY5 A;  3I55 A;  3MP1 A;  4RCB A;  4J6W A;  3VS4 A;  2GCX A;  3VS5 A;  4L59 A;  5CKH A;  1K9M R;  5J39 A;  2KXD A;  3HRU A;  2K4Y A;  3PIO A;  1FX7 A;  2RK2 A;  1Q86 U;  2A3L A;  1Q82 U;  1VQ6 Q;  4FYW B;  2VXE A;  5KYX B;  2ROT A;  5GAN h;  2IG0 A;  3HRS A;  3M0Q A;  1M2V A;  1UTI A;  3VS1 A;  3INZ A;  2DIG A;  3VS0 A;  2FPF A;  2Y4X A;  2RD1 A;  3CCM A;  4X9C A;  5KCH A;  2KMT A;  2XHC A;  1YBY A;  2K2V A;  4OMF B;  4CC3 A;  1NEG A;  3SWN B;  2NUZ A;  4JZ4 A;  1IXD A;  3RMS A;  5EC7 A;  3L2R A;  3CCR Q;  3P8D A;  1QVP A;  2EQM A;  2KBT A;  4M77 B;  4RKU E;  3CCJ Q;  2J05 A;  2DKG A;  2NLU A;  2QEX T;  2M0Y A;  2DTH A;  1KG1 A;  2PZ1 A;  4JRP A;  1YJW Q;  4PJO E;  1UEB A;  1UHC A;  3LYI A;  1LVK A;  2HZY A;  2X3X D;  2EYQ A;  4N0A A;  1NJI R;  3PT9 A;  5IHN A;  3CC2 A;  3J7A F;  2EVR A;  3MHX A;  1VQM Q;  4WF2 A;  4LE9 A;  2NWM A;  2LZ6 B;  3L1A A;  2EQJ A;  3SEM A;  4BI8 B;  3QPH A;  1H3Z A;  1RI0 A;  2KRO A;  2DZ9 A;  4Z8A A;  4BE0 A;  1VYU A;  4RTY A;  1YJN Q;  1HD3 A;  2CH4 W;  1FMK A;  5GAN 8;  3CME T;  3EHQ A;  2XU8 A;  1LOJ A;  4KRT A;  5A0L A;  2ZPG B;  1G3S A;  5J26 A;  1T3L A;  2JZ2 A;  1K0X A;  1VQP A;  5GAN 6;  4C0D C;  1VQ9 Q;  3VJP A;  2MIO A;  4PJN A;  4Z02 A;  2MK5 A;  2RHI A;  4C0G A;  4F7U B;  5LJ5 e;  2LT1 A;  3QSU A;  4WTO B;  4AFZ C;  3M9Q A;  5A2Q E;  1VQ8 Q;  4M77 G;  5IHK A;  4HVW A;  4IUP A;  4EMK B;  4IUT A;  1SRL A;  4PJO C;  2ZPF B;  5GAN g;  2VVK A;  2GNC A;  3MET A;  3CPW P;  3EG3 A;  3VS6 A;  2DA9 A;  3QDF A;  2DJZ A;  1K9M C;  3EH2 A;  1M90 U;  4C0Z A;  1GBR A;  1VA7 A;  4J9I A;  2KI7 A;  4OB1 B;  1JU5 C;  1QP2 A;  4C8Q F;  1M2V B;  1RUW A;  1B07 A;  1G8X A;  4A4H A;  2HD0 A;  2DTO A;  3CC4 Q;  4M7A F;  1ZSZ C;  3MO8 A;  3HL8 A;  2JOY A;  4E7K A;  1WHL A;  2QA4 Q;  1SSF A;  5LJ5 h;  3OYD A;  4OP0 A;  1WJS A;  3RUX A;  3CXC P;  3HFO A;  2YUN A;  1SEM A;  3M0R A;  2RQV A;  1ZA2 B;  1VQ9 T;  5DLQ E;  2WSF E;  2P4R A;  3VYG A;  2W0Z A;  4F7U G;  4N4G A;  3S3M A;  5I2M A;  1XNI A;  4M75 C;  4AFU C;  4J9D A;  5ECA A;  4D8K A;  1QKX A;  1R77 A;  1NJI C;  2CSI A;  4OMN A;  3LGF A;  2F2W A;  3TSZ A;  4L6V 5;  4JUV A;  2VKN A;  3ZBD A;  2JT4 A;  3S3O A;  1QKW A;  2H8H A;  1KQS S;  4M7A A;  3CMA Q;  2GQI A;  3OMG A;  1M27 C;  4LD9 K;  3LWH A;  3G6E T;  1VQ8 A;  1ZA1 B;  1OI1 A;  1X43 A;  2B86 A;  1I07 A;  5GAM e;  3G71 Q;  1MMN A;  2MWO A;  3LH0 A;  2CUD A;  1IO6 A;  1X6O A;  2ZCF B;  1XJW B;  3L2Q A; 
#chains in the Genus database with same CATH homology
 2OTL A;  1QVF S;  2XG8 D;  1I8F A;  4Q5W A;  4QQG A;  1Q86 C;  1Q82 C;  1ZHI A;  4LD6 A;  3CCU A;  1B34 A;  1P92 A;  1WQ7 A;  1XOV A;  4XTV A;  2FHD A;  4C5H A;  1NZ9 A;  2K5F A;  2GFA A;  3PFS A;  3I56 T;  2QEX A;  3UDC A;  1VQO A;  2VGN A;  3DKM A;  2QQB A;  2DD4 A;  3GLX A;  4EDU A;  5GAN 3;  3CD6 T;  3C12 A;  2M9U A;  4FU6 A;  5LJ5 f;  1W4S A;  4J6X A;  4C5G A;  3M53 A;  1N9R A;  3E19 A;  2PUK B;  3GF5 A;  1BI0 A;  2ZPB B;  3QJY A;  4ZN3 A;  3CCE T;  3BDU A;  1N27 A;  2EKO A;  3CCR T;  3L2Z A;  3CCJ T;  4FIB A;  3BY7 A;  3OBY A;  4MZP A;  2YHT A;  2E41 A;  3SWN C;  5GAN 4;  1W2B A;  3FRN A;  1N6A A;  4KUD K;  3OW2 S;  4C8Q G;  4C92 D;  2F5K A;  5I2S A;  4ZTJ A;  5LJ3 f;  4KUL A;  3HP9 A;  4BB7 A;  1N8R U;  5FRM A;  4R55 A;  4PLL A;  4M77 C;  2EIF A;  4MMK A;  1O9S A;  1YJW T;  4V2S A;  3RKW A;  3G4S A;  1HXD A;  2E65 A;  3FB9 A;  4N4H A;  3M5A A;  3SB2 A;  1VUB A;  3OYA A;  3CCM T;  2QQA A;  1BI2 A;  5GMK e;  3JB9 G;  1YIJ A;  1VQM T;  3M55 A;  4EMG A;  4E7H A;  3EAE A;  4VUB A;  3CXC S;  3CME A;  3OYH A;  5GAM h;  5LJ5 d;  3A8O B;  4QVZ A;  3CCV T;  3ZEH A;  3M58 A;  5LJ3 g;  3ME9 A;  4J8O A;  4IUU A;  3QYG B;  3JCM c;  3FEO A;  1YIT A;  3M4G A;  4E7L A;  4DA4 A;  4L5G A;  4Y28 E;  2EFI A;  1YJN T;  3CCL A;  4XAX B;  4IUQ A;  2HQE A;  2XID A;  2MF2 A;  4PJO F;  1WPY A;  2HNI A;  2LX9 A;  2RI2 A;  4FSX A;  4XQ3 A;  3X28 B;  3G71 T;  3HFN A;  2CYZ B;  1JJ2 A;  2RI5 A;  1BIB A;  1KQ1 A;  3OMC A;  3JB9 J;  1X01 A;  2E6Z A;  4J6Y A;  4MZT A;  3S6W A;  2EQK A;  4M78 G;  4JLI A;  5CK9 A;  5CKD A;  1K8A U;  2DXU A;  3CEY A;  3JCM W;  3JCM f;  2EAY A;  3H8Z A;  3MEW A;  4DOW A;  1BIA A;  3RMQ A;  5HK0 A;  2OTJ A;  2IVW A;  2QI2 A;  3QBY A;  5AYF A;  1AHJ B;  3WVE B;  1KQS A;  4A53 A;  2OAU A;  3NTI A;  3CC2 T;  2Y90 A;  1TH7 A;  2FYK A;  2E5Q A;  3O8V A;  4M78 C;  1FXX A;  2B8A A;  2ZGW A;  3BDL A;  3JCM b;  3FC3 A;  2M0O A;  3QHS A;  3J80 E;  3OYL A;  3T9N A;  4GLK A;  5D6W A;  3BFM A;  3QJ6 A;  1G3T A;  2LVM A;  4C0D B;  3JCM J;  2E64 A;  3JCM P;  3RIR A;  1LNX A;  4MML A;  5GAN 5;  2CZ1 B;  2KDS A;  1G3W A;  3JCM g;  4B9W A;  4ZN1 A;  5CR2 A;  1Y7X A;  3UWN A;  1VQ8 T;  3HPW A;  3FJP A;  3M4Y A;  2C06 A;  5GMK h;  4LDW A;  2DAQ A;  5FU6 B;  1M1G A;  1WGS A;  5D6Y A;  3MP8 A;  4EMH A;  5A0G A;  4DOV A;  2K5I A;  4LDY A;  3VUZ A;  2XDP A;  2LCC A;  3C4S A;  1VQ4 A;  3DLL A;  3NTK A;  4M7A B;  4ZTF A;  1QVF A;  2YLC A;  3HRT A;  3V8J A;  2K3X A;  1HK9 A;  2X35 A;  3LWI A;  2V8I A;  1JBM A;  1K9M U;  2XDB A;  4XTU A;  3S3N A;  4HCB A;  2GFU A;  2E70 A;  1VQP T;  3SWN A;  3CCQ T;  1PSE A;  1Y71 A;  1VQ7 T;  2DVE A;  4JRK A;  5HKC A;  4QVC A;  2RHZ A;  2XKO C;  4C5I A;  4PJO A;  2LQ8 A;  3TRE A;  5DLO A;  1VQO T;  4XTY A;  4M7A E;  1RL2 A;  1UGR B;  5LL6 S;  2O4X A;  1IZ6 A;  1NE8 A;  4J7I A;  3P8B B;  4M77 A;  5GMK i;  2DD5 A;  1VQN A;  2PU9 B;  5I21 A;  2ZPE B;  1N9S A;  1VIE A;  3ASK A;  2KK4 A;  4M75 F;  3OYB A;  1U1S A;  1MGQ A;  3OW2 A;  5FRN A;  3L2U A;  4XU2 A;  3URG A;  3JAM E;  3CC4 T;  4PNO A;  3V8K A;  4C92 B;  5CCA A;  4ATO A;  1YJ9 T;  5L8R E;  3EFS A;  4LDV A;  3CC7 A;  5C6S A;  4XK8 E;  1M90 C;  4O5V A;  4Y91 A;  1Y96 A;  3RER A;  1M1K U;  1B34 B;  2DIQ A;  2K3Y A;  2QA4 T;  2MMP A;  5CKF A;  2CGH A;  5GAN j;  1ZQ1 A;  3PGG A;  3RES A;  3OYC A;  1YHQ A;  3A8L B;  1Q81 U;  4PJO D;  3M54 A;  4C92 E;  3X26 B;  3CXC A;  1BI1 A;  3OB9 A;  2H3J A;  3CPW S;  4BI4 A;  4BE2 A;  2LTO A;  3G7Z A;  4KBM B;  3OYG A;  1VQL T;  3HSB A;  4RG2 A;  3X24 B;  4B9X A;  5J3B A;  4M7D G;  3FDR A;  3QO3 A;  2F69 A;  3RKX A;  4OB0 B;  3AHU A;  3QKJ A;  3UT1 A;  2RB6 A;  3R6O A;  1MHN A;  2YLB A;  2VUB A;  2DEQ A;  1JRI A;  3OYN A;  4TVR A;  5CKE A;  4NL3 A;  1K73 U;  1K8A C;  4M7D C;  2RJE A;  3QDR B;  1YIT T;  4E47 A;  1QP3 A;  5LJ3 j;  2CS7 A;  2XD0 A;  2CZ0 B;  5GAN e;  5GAM d;  2BUD A;  3A8H B;  3OYY A;  1U8R A;  4MDX A;  2LT4 A;  4M75 B;  2O01 E;  2RJF A;  1WJR A;  5HK3 A;  5DM7 R;  4HCZ A;  4KUI A;  4M7A G;  4C0F A;  4C8Q C;  3HKS A;  4N0A C;  4JRI A;  4J83 A;  5CIU A;  5LJ5 g;  1BI3 A;  5FU6 C;  4BY6 B;  3G6E A;  3FLG A;  2D9T A;  4M75 A;  1Q7Y U;  5LJ5 e;  3QUI A;  3NFC A;  3LGL A;  2HBP A;  2M1H A;  3KUF A;  4ZGE B;  3OY9 A;  1KD1 U;  2JN0 A;  1WNL A;  2JVV A;  3OA6 A;  3WXM B;  4M7A C;  3CMA T;  4F7U A;  5M9O A;  4M75 E;  1BYM A;  1WJQ A;  3H6Z A;  3EFR A;  2DO3 A;  2LRQ A;  2RK1 A;  2RO0 A;  3L42 A;  3OQ5 A;  4EPC A;  2RHX A;  1G5V A;  4A4K A;  4J5Y A;  1VQ5 T;  2D6F A;  2VC8 A;  3V7C A;  1UGQ B;  3C94 A;  2LNV A;  3NTH A;  4HA8 A;  3OS2 A;  4HT8 A;  5CQY A;  2QQS A;  1QVG S;  4FT4 A;  4EMK A;  4IUV A;  1KHI A;  3OS5 A;  4RCC A;  1ZBX A;  4OGC A;  4PLI A;  3OYJ A;  2CKK A;  5GAN d;  4C92 G;  4GY5 A;  3JCM Q;  2LCL A;  3I55 A;  2K57 A;  2K5L A;  1DJ7 B;  3MP1 A;  4RCB A;  4J6W A;  2RA2 A;  4M75 D;  3CCS T;  4M77 F;  2GCX A;  4L59 A;  5KCO A;  1OZ3 A;  2JNG A;  3CD6 A;  5CKH A;  4C92 C;  4QW2 A;  5J39 A;  1S72 T;  1V29 B;  3JB9 H;  3HRU A;  5IN1 A;  2E10 A;  2K4Y A;  4JDS A;  3V7S A;  3PIO A;  3CCE A;  2RHU A;  1GXI E;  1FX7 A;  2RK2 A;  3CCR A;  4RG8 A;  2A3L A;  2RHY A;  1Q82 U;  1Q86 U;  3CCJ A;  2E1H A;  3OYF A;  1PSF A;  2JUF A;  5GAO q;  2P4T A;  3OS1 A;  4FL6 A;  2FVU A;  2VXE A;  5C0M A;  2RM4 A;  5GAN h;  2IG0 A;  2DXC A;  3HRS A;  1WQW A;  2FB7 A;  1YI2 T;  1D3B A;  3INZ A;  3SD4 A;  1OZ2 A;  4ZGJ B;  2P0K A;  2WSC E;  1YJW A;  4LDX A;  3JB9 F;  2VXF A;  2DIG A;  1LJO A;  2FL7 A;  3PMT A;  2AHJ B;  2Y4X A;  1FWZ A;  4NS5 A;  2RD1 A;  4R56 A;  2ZPI B;  3CCM A;  1VQK T;  2D0Q B;  2WAC A;  4X34 A;  4X9C A;  4YTL A;  3JRZ A;  2DTI A;  4NOY A;  2LQK A;  1JB0 E;  4E7J A;  1VQM A;  5KCH A;  3MEV A;  3WVD B;  4A54 A;  2KMT A;  5CVI A;  2XHC A;  1KQ2 A;  3CC7 T;  1X75 C;  3GPL A;  1YBY A;  2K2V A;  4OMF B;  3CCV A;  1KHC A;  3JCM V;  4OB3 B;  4QQD A;  3SWN B;  4PKC C;  2PQW A;  4NL2 A;  3OS0 A;  4PJO B;  1M8V A;  3PTA A;  4BDZ A;  5DY9 A;  2X4W A;  2VGM A;  3RMS A;  3CPW A;  1YHQ T;  2OTL T;  2XDD A;  3OSV A;  2GF7 A;  2O4X B;  3V7R A;  3L2R A;  3P8D A;  1QVP A;  2EQM A;  4J7F A;  4M77 B;  4RKU E;  3CCU T;  2L89 A;  1K73 C;  4M78 F;  2DKG A;  2DXB A;  2NLU A;  1KC8 U;  1I5L A;  2CZ6 B;  2QEX T;  4FT2 A;  3OYK A;  4HT9 A;  2YRV A;  3LLR A;  2DTH A;  3A8G B;  3GNG A;  4JS4 A;  1VIF A;  1N8R C;  4JRP A;  4PJO E;  1U1T A;  1UEB A;  1KG1 A;  3LYI A;  2E12 A;  2RI3 A;  1Y96 B;  1YCY A;  3E9G A;  4C8Q A;  2EYQ A;  4N0A A;  4M77 E;  2KVQ G;  3PT9 A;  4JS5 A;  3C95 A;  4F7U F;  3CC2 A;  3J7A F;  4A4F A;  1Q7Y C;  3MHX A;  4WF2 A;  1VQ9 A;  2RJC A;  5GAM f;  4E7I A;  3L1A A;  3QYH B;  3MCA B;  1M1F A;  2EQJ A;  3OYM A;  3OSS C;  4LDU A;  4BI8 B;  3GIB A;  3QPH A;  1H3Z A;  1IRE B;  1RI0 A;  1XQH A;  3SDZ A;  3G4S T;  4A4E A;  2PUO B;  2QDY B;  2DZ9 A;  3VV0 A;  2I2L A;  4BE0 A;  3M56 A;  2EJF A;  2XIC A;  3UPU A;  1UGP B;  1M4Z A;  2MI6 A;  2DZC A;  2WSE E;  4M77 D;  1YIJ T;  5LJ5 j;  2BIV A;  3ZFJ A;  1QW1 A;  5GAN 8;  3CME T;  5GAM g;  2LDM A;  2XU8 A;  1LOJ A;  1NPR A;  5A0L A;  2LC4 A;  1QVG A;  3VYH B;  2MAM A;  4II1 A;  4ELZ C;  2ZPG B;  4BUG A;  5FRO A;  4XU0 A;  1G3S A;  5J26 A;  2HQX A;  5GMK m;  2QXF A;  5FU7 B;  3CCL T;  4HKE A;  2JZ2 A;  1NJI U;  3HHT B;  5GAN f;  2DXT A;  4BI3 A;  5GAN 6;  4C0D C;  3JB9 D;  4M78 A;  3RKY A;  3CCQ A;  1VQP A;  3VJP A;  3I55 T;  5GAO r;  5CQX A;  1VQ7 A;  4Z02 A;  5KE3 A;  5GAO m;  1NPP A;  2EJG A;  2KSS A;  5FLX E;  2RHI A;  3QZ9 B;  4M78 E;  4C0G A;  4F7U B;  2G3R A;  3Q1J A;  4OB2 B;  2LT1 A;  1BKB A;  4XTW A;  4PJO G;  5KE2 A;  3TCJ A;  5GMK j;  4C5E A;  3QSU A;  2OTJ T;  3M9Q A;  5A2Q E;  3CBO A;  3F70 A;  3CC4 A;  4M77 G;  1M9S A;  4OF1 A;  4IUP A;  1YJ9 A;  3OBW A;  4EMK B;  4IUT A;  3N5B B;  1M5Q 1;  2VYT A;  2Y4Y A;  5LJ3 e;  3OYE A;  4PJO C;  2ZPF B;  5GAN g;  4QQ6 A;  4F7U E;  4RMO A;  2JTM A;  4XTX A;  3M59 A;  5GMK l;  2QA4 A;  4CI0 C;  3PMI A;  3X25 B;  4IKF A;  3CBP A;  4M78 D;  5GAO p;  3MET A;  3MP6 A;  4PL6 A;  4XTZ A;  1I81 A;  5CO7 A;  4BD3 A;  3L2V A;  4M7D F;  2V8J A;  4UC4 A;  2DJZ A;  5GAO l;  1K9M C;  4OVA A;  1O75 A;  5EG2 A;  4XU3 A;  3DLM A;  3I56 A;  2A7Y A;  2XK0 A;  1VQL A;  1M90 U;  1YJN A;  2EJ9 A;  4C0Z A;  2X4Y A;  2R58 A;  1OYX A;  1KC8 C;  2R5A A;  3E9F A;  2HAX A;  2E6N A;  2RJD A;  3LW5 E;  4OB1 B;  2X4X A;  1VQ4 T;  1QP2 A;  4C8Q F;  5IAY A;  5IT9 E;  1D3B B;  4KT0 E;  2QQR A;  1UB4 A;  4A4H A;  2HD0 A;  2DTO A;  3BW1 A;  4M7A F;  3MO8 A;  2M16 A;  5LJ3 d;  2EQU A;  2QQ9 A;  3A5Z B;  1W2B S;  2ZZD A;  3HL8 A;  2JOY A;  4E7K A;  4OGE A;  1M1K C;  2QTX A;  5HY6 A;  2KAF A;  2PVD B;  2CZ7 B;  4ME7 A;  3JCM e;  1SSF A;  1VQN T;  2DPP B;  3JSC A;  5LJ5 h;  3OYD A;  2P0Q A;  4OP0 A;  4O6J A;  3JB9 I;  1WJS A;  3RUX A;  1Q81 C;  3HFO A;  2KQW A;  3DB3 A;  4BDY A;  3CMA A;  1VQ6 A;  1XTD A;  5CKB A;  5GAO n;  3OYI A;  1VQ9 T;  3CBM A;  2KY9 A;  4M75 G;  4N4I A;  4P5N A;  5DLQ E;  1EIF A;  4M7D B;  2WSF E;  5LJ3 h;  3QG1 A;  3VYG A;  2L3R A;  4DQ2 A;  4F7U G;  4N4G A;  5FU7 C;  4C92 F;  4ZGD B;  2JTF A;  5KH6 A;  4BAC A;  1VQ5 A;  3S3M A;  1UGS B;  5I2M A;  3QZ5 B;  2EWN A;  5GAN 7;  1XNI A;  4M75 C;  3JCM X;  3VKI A;  3GOX A;  5D6X A;  4M7D A;  4QVD A;  3ER0 A;  2F5T X;  2PVO B;  2V8K A;  3J81 E;  3G71 A;  3QII A;  2ZPH B;  4BY6 C;  4C8Q B;  1NJI C;  2GQV A;  3L2W A;  1R8O B;  3SFM A;  4M7D E;  3MEU A;  3GNF B;  4JLG A;  3CCS A;  4CRI A;  4MZM A;  2VV5 A;  3LGF A;  3E1S A;  2P0P A;  4L6V 5;  3LX7 A;  3JCM d;  1S72 A;  1JJ2 S;  4JUV A;  4EMK C;  3ZBD A;  3FIF A;  1I4K 1;  3CPF A;  3VU3 C;  5A0D A;  5GAM j;  3S3O A;  3X20 B;  3DB4 A;  2XI9 A;  1KD1 C;  2PVG B;  4C8Q E;  4HCC A;  3PIP A;  4A4G A;  2DK3 A;  1KQS S;  4M7A A;  3P8H A;  5GAN 2;  3V8L A;  3VUB A;  3OMG A;  3TEE A;  1YI2 A;  4LD9 K;  4X9D A;  2RH2 A;  3QXE B;  4FM4 B;  4M7D D;  2L8D A;  4XU1 A;  3MEA A;  4JRQ A;  4D6W A;  3LWH A;  3G6E T;  1VQ8 A;  3PNW C;  3JCM h;  3TU4 K;  3GP8 A;  1OI1 A;  1VQK A;  1VQ6 T;  1Y07 A;  2R5M A;  2X4J A;  5CAI A;  2L5Q A;  5GAM e;  3KXT A;  4MDW A;  3M57 A;  4C8Q D;  2MWP A;  3A8M B;  2BKD N;  2MWO A;  3LH0 A;  4ELY C;  4JJN K;  1G3Y A;  4IUR A;  4M78 B;  1X6O A;  4BE1 A;  2ZCF B;  4C92 A;  3KBG A;  1H64 1;  4M7A D;  2R57 A;  3L2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...