5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
1I81A 1D3BB 1M5Q1 4XTUA 1M8VA 1WPYA 3FJPA 5GANe 2DEQA 4QVCA 4N0AA 5GAN3 4PJOA 4M78G 1N9SA 2DJZA 4C92A 4WF2A 4JRIA 4PJOB 3HFOA 4MMKA 4M78C 5GAMe 5GMKe 5LJ3g 4C92B 3JCMe 5GAOp 4EMKC 5DY9A 3JB9H 2RB6A 5CAIA 1I4K1 2EWNA 4HA8A 1TH7A 3GIBA 4F7UA 3SWNA 1B34A 4JUVA 4M78E 3QUIA 4MMLA 2E65A 1KQ1A 2E41A 4C8QD 5GMKi 4V2SA 5LJ5g 4M78F 5GAN6 3AHUA 4F7UB 3SWNB 1B34B 3M4GA 3SB2A 5LJ3d 3EFRA 2E10A 3RESA 4J6WA 1BIAA 2RD1A 4M77E 4C8QG 2YLCA 3RIRA 5LJ5h 1WNLA 4J6XA 2EJGA 4M77D 4M77F 1N9RA 3JB9D 3V8KA 3JCMP 5GAMg 3JB9F 4M7DA 3JCMg 4C8QC 1H641 2E64A 3QHSA 5GANh 5GAOl 5GAOr 4M78A 1LOJA 5LJ5d 4XTXA 2DZCA 2CGHA 4EMKA 4M7AG 4M7DB 5GANd 3HFNA 1YCYA 2RM4A 5GAOm 4NL3A 1I5LA 1KQ2A 4M77G 4M78B 3JB9G 2DTHA 5GMKh 4C8QE 4EMKB 3JB9J 1U1TA 4J6YA 2DZ9A 2DXTA 4M77C 4C8QF 4J5YA 4XTWA 5LJ3h 5LJ5j 4PJOG 3JCMb 3RUXA 3BDUA 3JCMV 3V7RA 3JCMd 3JCMQ 4M75E 3V8JA 2VXFA 4RCCA 3BW1A 5GANj 4M7AE 2EJFA 4PJOC 4M75F 4M75D 2K57A 3PGGA 4A53A 5GAN5 4M7AF 4M7AD 2JN0A 4XTYA 4EMGA 5GMKj 3JCMc 2YLBA 3L1AA 2VXEA 4XU1A 2Y90A 3VU3C 4C8QA 2DTIA 2EJ9A 3JCMW 1WQ7A 2E1HA 3QO3A 3JB9I 4PJOE 4M75G 5LJ3f 4F7UG 1HXDA 5LJ3j 3V8LA 1MGQA 4C92E 4PJOF 4PJOD 1LNXA 2FB7A 4C8QB 4HT9A 3INZA 5GAN7 4C92F 4M75C 4C92D 4XTZA 5GAMh 1BIBA 5GAN8 3JCMh 3RERA 4M7AC 3HSBA 1WQWA 4XQ3A 3RKWA 4DQ2A 4EMHA 2VC8A 4M77A 4PNOA 4QVDA 4X9CA 4NOYA 5LJ5f 5GAMd 1JRIA 3QSUA 1JBMA 2YHTA 4F7UE 3V7CA 4M77B 4C92G 4XU3A 5I21A 3L2ZA 5GANf 4M7DG 1X01A 4F7UF 4N0AC 3RKXA 4HT8A 4A54A 2FYKA 5GAN4 2DXUA 1HK9A 2ZGWA 3FIFA 4X9DA 4C92C 4M7DC 3RKYA 5GAMf 5GAMj 4XTVA 3JCMf 1U1SA 5GAOn 4XU2A 4XU0A 5GAOq 2RA2A 3JCMJ 4NL2A 2DTOA 2DVEA 5LJ3e 1LJOA 1I8FA 4M7DE 4OP0A 3JCMX 4M75A 3SWNC 4M7DF 1Y96A 3V7SA 3FB9A 3BY7A 4RCBA 5GMKl 4M7AA 4M7DD 4M78D 3EFSA 1D3BA 4Y91A 4JLIA 4M75B 5GAN2 2DKGA 5GANg 1Y96B 2I2LA 4M7AB 5LJ5e 5GMKm 2HNIA 3BFMA 2QTXA 2EAYA 4JRKA
chains in the Genus database with same CATH superfamily
1M3BA 1ZA2B 2HBWA 2JMCA 1TUGB 2J7IA 5KE2A 2KNBB 3ZBDA 2QGGA 2GCXA 4C5HA 1OPKA 3OYHA 2RB6A 5FRNA 1QVFP 1M4ZA 1B7TA 2KSSA 2C0IA 2KRSA 2RI2A 2K9GA 1AT1B 2VKNA 4JJBA 2D9TA 1M90C 1RAGB 4PJMA 2YLCA 3OW2A 4Z88A 2ZPBB 4IIOA 1D09B 1MV3A 3HFNA 1VQOT 1K73C 1ZSZC 3JB9G 3CC7Q 3OYJA 2ENMA 1VQ8T 2LNVA 4R55A 3TSWA 3SD4A 2E6ZA 1FMVA 2P4RA 1YHQA 2QQBA 2RH2A 4EPCA 1BI3A 2QYZA 2YRCA 2KE9A 1AHJB 1FYNA 5EC7A 2O9SA 2YT6A 3M9QA 2KEAA 2FPFA 4C0ZA 4PJOE 1WQ7A 1GL5A 3CC4A 2M0YA 4XTZA 1WJQA 3JCMh 1QCNA 1S1NA 2QAZA 4PNOA 1ZBJA 5LJ5f 5GAMd 3I56Q 4F7UE 4XU3A 2VV5A 3CD6A 1QP3A 4TVRA 3M0UA 2Z0WA 4E47A 3CC7T 1U1SA 4F16A 1Q81R 1VQLA 2EGAA 5CCAA 4J7FA 2DTOA 1VQ5Q 2CZ7B 1BBZA 1SKUB 2ZPGB 5LJ5e 1E7OA 2QG9B 5GJWB 2O4XB 5FU7B 1G2BA 4MZMA 1Q86C 4M78G 2JS2A 4ZN3A 1VQPA 3TEEA 1KK7A 1IREB 2CP3A 4KUIA 3RBBB 4PJOB 5CQYA 4FCYA 4Y28E 2V8KA 1UTIA 2P0QA 3UT1A 4C0GA 3DLLA 4D8DA 4OMMA 3I56T 4MMLA 2PQWA 3MJXA 2YRDA 1OQKA 4BDYA 3CXCS 2HZYA 4F7UB 3SWNB 3EFRA 1UGPB 2QK0A 1ZA1B 1Y0MA 3H8ZA 4BE2A 3QBYA 3GLXA 1WNLA 2FO0A 1N9RA 1VQ5T 4M7DA 4JJDA 3OYDA 1HD3A 1D1CA 5KYYA 3UDCA 4M77G 4ANJA 3CCRQ 1N8RU 1W2BA 2RNAA 4B9XA 1OULA 4C8QF 3ER0A 1RLQC 2AK5A 4PFOA 1UEBA 3OW2P 3L42A 3M5AA 2MOXA 5FW9A 2E70A 4A53A 1LCKA 2K5IA 3ME9A 1MMGA 5FU6B 2LCLA 3JCMc 1R8OB 3MEVA 4A4HA 4C8QA 2EQJA 3G1JA 1JU5C 4C92E 1MGQA 4AG1C 2LX9A 2K3YA 2FRYA 2MIOA 2QXFA 5DLOA 1WA7A 2K79A 2CP2A 3EAEA 1A0NB 3EGDB 2NYSA 1K8AR 2LT1A 2DBMA 1UHCA 1YP5A 4N0AC 2ESWA 1SF9A 1KC8U 4M7DC 3CCRT 1ACMB 1IHVA 4RUGA 2E3HA 2F2VA 2RK1A 2EYYA 4L59A 4M75A 1XNIA 2LQWA 3FB9A 4RCBA 1OOTA 3OSSC 2DL5A 1NBEB 2YUPA 3RDVA 2KBTA 2NWMA 3QYHB 2CDTA 1YJNQ 1UFFA 2COYA 1N9SA 2KRMA 2XICA 2QGFB 4C92B 5CKDA 1UUEA 2HQHA 1I4K1 1SHGA 1Z9ZA 5I2MA 2QA4Q 3NTKA 4JUVA 2E41A 2HD0A 4LD6A 3ULRB 2IVWA 5LJ3d 1NG2A 4HKEA 2KYBA 3SFMA 4M4ZA 2MCNA 2CS7A 2KRNA 2O88A 1IHWA 2CKKA 1YCYA 2Y4XA 2BZXA 2EQUA 4EMKB 3VS6A 1Q7YU 1YJNT 2ZPHB 1WX6A 3M0QA 4M7AE 2EJFA 1G3TA 1VYVA 4ZTFA 1AEYA 1K73U 1PM3A 3MP6A 3ZFJA 1VQNQ 3AT1B 6AT1B 2EYWA 5GMKj 2CYZB 2VXEA 5A0GA 1W2BP 3CPWS 2QQRA 2QA4T 5I2SA 4N4GA 4PJOF 4GY5A 2RQTA 1MV0B 2PVOB 1DJ7B 4RTWA 2HEQA 1C0MA 1H92A 5D6YA 2PNIA 4J9IA 1WQWA 1AVZC 2EQMA 1D0YA 4E7ZA 2K5FA 3CMAQ 3LGLA 2CZ0B 4F7UF 4ELZC 1HK9A 3O5ZA 1WHLA 2BUDA 3TU4K 2KK4A 4A63B 2CUDA 2F5TX 1MMAA 1GBQA 4UC4A 2K7AA 3N5BB 3CCVQ 4NS5A 3V7SA 2LCSA 3OY9A 1KD1R 2V8JA 2QQ9A 4RMOA 2H3EB 2R5AA 1VQNT 4M7AB 1WYXA 4JRKA 2X51A 2PUOB 2LQ8A 4FL6A 2J06A 4Z89A 4J9HA 5CO7A 1JQQA 4BI4A 3I5RA 1Y07A 4J9EA 1HYOA 2DD4A 4C0FA 4ESRA 4HVWA 3UWNA 3A8GB 2OAWA 3A1PA 1Q86U 2KT8A 2QDYB 1RAAB 1X2QA 3QUIA 4BY6C 3CMAT 4R0KA 3L2VA 3QDFA 4QQ6A 3VUBA 1TS9A 2O9VA 4C8QG 4JLGA 3JB9D 1W4SA 1PSFA 2ATCB 3GOXA 2DLPA 2A7YA 3CCVT 2L5QA 2DX1A 2DRKA 2MPXC 3PIPA 2DK3A 1G5VA 3HRTA 2NUZA 2QTVA 1NLPC 3LWIA 1WHJA 2J6KA 2OI3A 4O6JA 3OYMA 3SDZA 3FJ5A 2JT4A 1I5OB 3H0HA 4FYXB 2DO3A 2P0PA 2X35A 5HCKA 4M75G 3V8LA 2DYBA 2FB7A 3JSCA 4LN2A 4MDWA 4C92F 1KQSA 1ZSZB 3CQTA 4AG2C 2XDBA 3RMSA 3I9QA 4PK4A 1VQKA 5KYWB 1VQ6Q 2BE9B 2O31A 3PIOA 2FYKA 5KYXA 2E12A 2F69A 4RTXA 3OYNA 4XU2A 1YIJQ 3O8VA 1EFNA 5DM7R 2L8DA 3A8HB 5GMKl 2F2WA 4M78D 1PD1A 4C0DB 2CP5A 1Y96B 2LMJA 4AFQC 2ED1A 3BFMA 1VQ4A 4RTVA 1UJ0A 2D0NA 2G3RA 2RQUA 4WTOB 1J3TA 3OB9A 2QASA 3CBMA 4DBHA 3FEOA 4ZGDB 1YN8A 2P84A 1VQ6T 1KQ1A 3E9GA 1KD1C 2A28A 4YTLA 2RHZA 1PCXA 3G6EA 2HQEA 1BIAA 1JO8A 3VRYA 1YIJT 2K5LA 4M77D 5GAMg 4E6RA 2OTLA 2A36A 1BCOA 2LDMA 2VB6A 3R6OA 2V1RA 3FC3A 3E9FA 2JS0A 4FYYB 5IXBA 4J6YA 3VS1A 4PJOG 4OB0B 3SHWA 3KFVA 5L8RE 1T0JA 2PU9B 2KAFA 1UG1A 4M7AF 4OGCA 2JN0A 5C6SA 2GGRA 3L1AA 1KFZA 4F7UG 5LJ3f 2LJ3A 8ATCB 3EG1A 1X6OA 2DL8A 4RG2A 5GAN7 2OTJQ 1ABQA 4XQ3A 4KUDK 2ZZDA 1F1BB 1GFCA 2CUBA 1WXUA 2LT4A 2HDAA 2XDDA 2PZ1A 3G4SQ 3REAB 3QKJA 3TSZA 4C5IA 5C0MA 2COWA 4OMPA 3GP8A 2IG0A 4PJLA 4FU6A 5LJ3e 1KQSP 3C95A 1WI7A 1RACB 5KH6A 3JCMX 1UHFA 4CI0C 2FZCB 1XOVA 3X26B 2X4JA 3KXTA 5IXFA 1JB0E 2ZCFB 4AT1B 3G71A 2HNIA 2EAYA 3BE3A 2DEQA 1Y71A 4J9CA 3M0PA 5CQXA 2OTJT 1IXDA 2XIDA 4M78C 2DM1A 2LP5A 5DY9A 1WIEA 1I1JA 1RI9A 4OMLA 1VQ7Q 9ATCB 1H8KA 2C0OA 4JJNK 3HP9A 4Y92A 4A4FA 1RL2A 1B34B 3G4ST 3SB2A 2GFAA 3RESA 3CMEA 1RAIB 2DXCA 2FRWA 3JCMg 3Q1JA 1G83A 1W1FA 3OYCA 2DZCA 1BI2A 1YJWA 1UECA 2JXBA 1BYMA 4EDUA 1M1FA 4BB7A 2DTHA 3DKMA 3RMQA 2JM8A 3QWXX 2D0QB 4M77C 1PC0A 1M30A 2VXFA 1ZX6A 1TWBA 1FX7A 2EKHA 1KHCA 2DF6A 2ABLA 1OZ3A 2RO0A 2LNHB 3M0RA 2QQSA 1VQ7T 2BZ8A 1VQ8A 1M2VB 1GBRA 4KGZB 3RERA 2EQKA 3CC4Q 3PMTA 2BE7D 2LX7A 2LRQA 3I55A 2XDPA 3JRZA 2GF7A 4J9GA 5KYUA 3FDRA 4LUDA 3UATA 3J80E 3FIFA 2DAQA 1OPLA 3PMIA 3CD6Q 5GAOn 4AFZC 1QCFA 4IUVA 3NPFA 1ABOA 1K1ZA 2X3WD 2MWOA 3DB4A 3EG0A 3CPWA 1ZBXA 4M7DD 3UF4A 1WHHA 1FWZA 1K9MC 1VQ9Q 1QVGA 1D3BA 1R77A 4LNPA 1QQJA 5KE3A 5GMKm 3CBPA 3QXEB 4OMQA 4D8KA 5A0DA 4E7IA 7AT1B 5I22A 3CC7A 2ZPFB 2L0AA 1I0CA 1PNJA 3CC4T 4BACA 1OU9A 1E6HA 2R5MA 1RAEB 4FT4A 4J7IA 4C8QD 2AIRB 2L89A 2MAMA 4C5GA 4QVZA 3PTAA 4LUEA 4CRIA 2HQXA 2RQRA 3CD6T 3RIRA 3BDLA 3PE0A 2EJGA 4FW1A 3CCQA 1YJ9A 1Q82R 1NJIC 2EYQA 5GANh 3WVDB 5GAOl 1M1KC 4M7AG 4LDUA 1VQ9T 4Z8AA 2YRVA 1QVFS 5HK3A 3UPUA 3M58A 3CCMA 4DA4A 8AT1B 2DZ9A 3CCJA 5LJ3h 3ZEHA 2AKLA 2AZSA 5LJ5j 1XJWB 3CC2A 3HKSA 4BY6B 3MPUB 4M75D 2RJCA 2Y90A 1ARKA 2DIQA 2DTIA 3EGXB 2E1HA 2GFUA 2O2OA 1VYTA 3QO3A 1OEBA 1CSKA 3QG1A 4CC2A 3INZA 2DIGA 2LZ6B 4B6MA 4PJNA 2OX7A 1NPPA 2RJDA 4CC7A 2LTOA 2XI9A 3QPHA 3PT9A 2F1LA 4JRQA 3TQ7P 2HKQB 4HT8A 4GLKA 2DXUA 3OS0A 2NUTB 1V76A 3NTIA 2XHCA 1QVPA 2ZAEA 3HPWA 4D6WA 1LJOA 2RHIA 3VS0A 2DKGA 5FROA 3CCEA 4L5GA 2VUBA 1M5Q1 2L2PA 4AFUC 3NHNA 2KR3A 2WACA 4WF2A 2ROTA 2WSFE 4MMKA 4WCIA 2MK5A 3CPWP 5KYNA 2RHUA 5GAOp 1VQMQ 3JB9H 4HVUA 1QVGP 3M59A 2RHXA 2JM9A 1QLYA 1S72A 2YSQA 1NYGA 3VS7A 5LJ5g 3EFOB 1JXOA 4KH0B 3V8KA 4C8QC 2VGMA 3THKA 3LH5A 4OVAA 5IH2A 1Q81C 2NUPB 3MCAB 3QJYA 5GANd 1KQ2A 1I5LA 2E6NA 5DLQE 4J9DA 4RTZA 2DETA 3A8MB 4P5NA 3BDUA 2H8HA 1IGQA 1P92A 2HMAA 4II1A 1KG1A 1QKWA 1YITA 3PGGA 1PSEA 5EG2A 1VQMT 3M0SA 2LC4A 1ZSGA 1N27A 4F14A 1X2KA 3C12A 1Q82C 2KI7A 3OYFA 1SG5A 1UGSB 1M90U 4HT9A 4J9BA 2E5KA 4M75C 2RHYA 1R0BG 3RKWA 2VYTA 4DQ2A 2VC8A 4XK8E 3OW2S 3LGFA 1NLOC 4J83A 3QSUA 2KT1A 5IN1A 1X01A 4RTYA 1WHMA 3CBOA 2GTOA 3UA6A 2DFUA 1VA7A 5HK0A 4XU0A 3JCMJ 3MEAA 1I8FA 4OP0A 1PRMC 2V1QA 2HAXA 1SRMA 2QI2A 2EKOA 1V1CA 2L3PA 4RTTA 2O4XA 3EG2A 3JV3A 1M8VA 2XKOC 2JOYA 4PJOA 5CKEA 1UB4A 1AZGB 2DJZA 1K9MU 1RAFB 2LJ1A 1UGVA 2LJ0A 1VYUA 4F7UA 3SWNA 4PJJA 5FWBA 5GAN6 2NLUA 4PFZA 1QWFA 3NGPA 1PD0A 1K8AC 4M77E 3CCSQ 1D1AA 2E64A 2PUKB 5GAOr 1UDLA 3D7SB 2H3JA 3EG9B 1G3WA 1WJSA 2CGHA 3L2WA 3VS4A 3NFCA 5GAOm 4NL3A 4KGXB 4KRTA 2RJEA 4M78B 3JB9J 2FZGB 2L3SA 5HY6A 2YXYA 4J5YA 3JCMb 1NJIU 1M1KU 4HCCA 2PTKA 3JCMQ 1PKTA 4PKCC 4Z02A 4PJOC 2D6FA 2EFIA 4DBQA 3CCUQ 3I5SA 2HKNA 2DRMA 3M0TA 2F5KA 2FZKB 2EJ9A 1JJ2S 3J7AF 2EIFA 2MYSA 2COZA 4KT0E 4GLMA 3EGDA 1IGUA 1EIFA 3HSBA 2FG0A 4EMHA 5CK9A 4X9CA 1NYFA 4NOYA 3CCST 3QZ9B 1RI0A 4M77B 1N8RR 5I21A 3L2ZA 4QQGA 1H3ZA 2M9UA 1WXBA 2LCCA 3RKYA 1W2BS 5GAMj 4XTVA 3CCLQ 3DLMA 1YI2Q 2YUOA 4IURA 5GAOq 4NL2A 2RF0A 1MNDA 1WHGA 2Y4YA 4JZ4A 4LDXA 3BY7A 4DEXA 1C6VX 2QEXQ 5FU6C 3CCUT 3LW5E 1WPYA 1IRXA 1U3OA 2NUPA 4C92A 3OS2A 2JUFA 4OB3B 2X4WA 1VQ4Q 2DBKA 3A8OB 3VV0A 2ECZA 2CP6A 5LL6S 2EWNA 1KC8R 1YWPA 3M53A 4CC3A 1GCQA 2AHJB 4FM4B 1BCMA 4F17A 4BI8B 3TCJA 3CCLT 1YI2T 2DILA 1X27A 1LVKA 4E7KA 3JB9F 1PHTA 3ZL7C 1YCSB 4XTXA 2EW3A 4LDYA 4EMKA 1M3AA 4E2FB 3T9NA 1GCPA 2QEXT 5GMKh 2RN8A 2OTLQ 3VUZA 1IB8A 2EQIA 4JS5A 4VUBA 2X4YA 3RUXA 1OI1A 2P0KA 2R57A 1Q81U 3U23A 3FRNA 4RCCA 4A4EA 2KDSA 1KSWA 1VQ4T 3VYHB 2EYZA 1YIJA 1LPLA 3NMZC 5GAN5 1K0SA 3H0IA 1MUZA 1UJYA 2M0OA 2BIVA 1G8XA 1LNXA 1K9AA 2YUQA 5J39A 2MMPA 3OYBA 1UGQB 4PL6A 4LE9A 4DBFA 2CSQA 5GANf 1AZEA 3J81E 3OYAA 1Q7YR 2ZGWA 3CXCA 1Q95G 1TOVA 4OB2B 3TVTA 2OTLT 4LDWA 2RA2A 2DVEA 3PFSA 1K73R 4M7DE 1N6AA 5A2QE 4MDXA 4M7AA 5M9OA 3EFSA 4DEYA 2A37A 2I2LA 1N8RC 1KJWA 1T3LA 5GANe 3EG9A 4AFSC 2GQVA 1WXTA 3VS2A 1TXQA 2DERA 5IHIA 5IAYA 3EHRA 2JTMA 1YWOA 3EH2A 4N4HA 2EVRA 3KUFA 2LVMA 2E65A 2K4YA 2DYIA 3EGUA 4O5VA 1HSQA 1GRIA 3GF5A 3IQLA 1FMWA 1M2OA 1BK2A 4J6XA 4M77F 4OF1A 5J26A 2OTJA 4JDSA 1QKXA 3CMEQ 4ELYC 4IUUA 4M7DB 1K8AU 5KYYB 1T0HA 1YJWQ 3G4SA 1WJRA 4M75E 1W6XA 5CR2A 2PVGB 3OYGA 1Q86R 1U5SA 2KXCA 4ATOA 3MKDA 2K6DA 1VUBA 2V26A 1Z9QA 3MP8A 4BE0A 2DVJA 1OV3A 4C8QB 1ZSZA 1SSFA 1OZ2A 2IPOB 2J6FA 2KXDA 2L3RA 2X3XD 2A3LA 5KYWA 4DOVA 3OYEA 3URGA 4C92G 1M3CA 3CMET 2CZ1B 3RKXA 2X9HA 1YHQQ 2DXBA 3I55Q 1VQ7A 1TG0A 2KMTA 2A0FB 3TREA 2HL3A 1AWXA 1ZUYA 4HXJA 1VQOA 1YJWT 3PVLA 1ZUKA 2QDLA 1Y96A 1PRLC 3OSVA 4Y91A 4M75B 3REBB 2CP0A 5GANg 2DEUA 3PNWC 3CXCP 2QTXA 4JRPA 1Q7YC 3A8LB 5D6XA 4L6V5 4E7JA 1NEBA 4IUTA 5LJ3g 1CKAA 2EGEA 2B86A 1KQSS 1WHKA 4ME7A 3X28B 4B9WA 1TH7A 3VS5A 3GIBA 2K3XA 2SEMA 1VQLQ 1W70A 1O9SA 2RMOA 2D1XA 5CKBA 1YHQT 4FSSA 1MHNA 3I55T 3OQ5A 2RD1A 3CEYA 1PKSA 3VJPA 2VASA 1ZQ1A 3QHSA 1CKBA 1QMCA 1BKBA 1QW1A 3MHXA 1NZ9A 4C0DC 2OJ2A 1VQPQ 3CCQQ 1BI1A 1YJ9Q 2X4XA 2DJQA 4XTWA 4ZNXA 2DMOA 2RPNA 1VIEA 4X1VA 2JMAA 3BW1A 2DE0X 3CCMQ 3E2UA 2VVKA 3CCJQ 1AD5A 2K57A 3M54A 3PVQA 3CC2Q 2YUNA 3M57A 1KD1U 3JCMW 1VQ9A 1VQLT 3L2UA 2MWPA 3M4YA 4A4KA 4OMNA 3I56A 2KYMA 1PWTA 3S3OA 4QVDA 2XU8A 3SEMA 4A4GA 1JBMA 2J05A 3V7CA 3VS3A 2WSCE 4HCZA 1TU0B 1VQ5A 1G3YA 3LH0A 1VQPT 3CCQT 1YJ9T 4IUQA 4JJCA 1ZLMA 2BKDN 1JJ2A 4M7DF 2XMFA 1SRLA 3M56A 3X25B 3CCMT 4C5EA 3CCJT 4JLIA 1IO6A 1ZUUA 5GAN2 3CC2T 4ZTJA 1QP2A 1I81A 2RI3A 5A0LA 4N0AA 2MF2A 1SPKA 4N4IA 2JZ2A 3CCEQ 3P8HA 3HRSA 1M9SA 2DA9A 4PLIA 2LQNA 2M02A 1SSHA 1MMNA 1Y57A 2GQIA 1M8MA 1BI0A 1B34A 3EHQA 2E3IA 4RKUE 2FEIA 1NEGA 2EBPA 3AHUA 4ZN1A 1AWOA 2E10A 1S72Q 2K2MA 3OYKA 3H41A 1Y7XA 1YFNA 4Q5WA 3CCRA 2CT4A 3OA6A 2B8AA 2EPDA 1B3QA 1C1AA 1OX8A 3MEUA 1JEGA 4BUGA 5I11A 3JB9I 1VOMA 5ECAA 3JCMd 3JCMV 3V8JA 3CCET 1TSFA 4M75F 4FIBA 3R6NA 2BZYA 1WFWA 2YLBA 4XU1A 4RTUA 3VU3C 2DL3A 1YITQ 1X6BA 1M2VA 2HSPA 4R56A 4PJOD 3S3MA 2BTTA 3L2RA 1BIBA 5GAN8 1S72T 2K3BA 3EG3A 4X34A 1JRIA 1WGSA 2YHTA 1RAHB 2D8JA 1VQMA 3OMGA 1TUDA 1U06A 4A54A 1I07A 1N5ZA 2VGNA 2FPEA 1AOJA 5KYXB 1RADB 1WDXA 1SHFA 2FHDA 3OBWA 2JTEA 2G6FX 3QJ6A 1YJNA 2KY9A 3VRZA 3OYIA 3META 4IIMA 1K76A 3LYIA 2ZPIB 3JAME 4QVCA 1YITT 2OAUA 5FWCA 2M1HA 1V29B 2V8IA 3GBQA 5GMKe 2KVQG 2QA4A 1JJ2P 5FRMA 1XTDA 2CZ6B 3WVEB 4MZTA 4M78E 3LWHA 3H6ZA 1K0XA 3MP1A 2IIMA 1TTHB 1X75C 3OBYA 2JJ9A 2R58A 4FW2A 2D8HA 2L3QA 4LD9K 5LJ5h 2CH4W 3X20B 5D7UA 1BB9A 1QVGS 1BU1A 2RM4A 3A98A 3DB3A 5FLXE 2FPDA 1WZOA 3L2QA 1E6GA 2DD5A 1U1TA 4KULA 2K2VA 3V7RA 1VQNA 2CT3A 2DL4A 4J8OA 5AT1B 4BE1A 4FYWB 1MNEA 4JZ3A 5IHKA 1NM7A 3EGXA 1EX4A 3HRUA 3OMCA 4QQDA 2JW4A 1X6GA 2SRCA 4C92D 4GBQA 2ROLA 3CMAA 4KH1B 5D6WA 2FL7A 2M16A 2VWFA 5FU7C 4IKFA 3OS5A 4M7DG 2NUTA 4OMOA 5CIUA 5GAMf 3CCVA 4DBRA 4JS4A 2A08A 1XQHA 3LLRA 1OYXA 3VKIA 3SWNC 3CCSA 2CSIA 4XAXB 5IT9E 4OGEA 4ZGJB 4F04B 2XD0A 5GAN3 2MI6A 2CP7A 2AZVA 4LDVA 2HL5C 3HFOA 1X69A 1VQKQ 5GAMe 3E19A 3C94A 4HVVA 2W10A 2JNGA 2KGTA 3F70A 1MMDA 4HA8A 1M1GA 2AKKA 1D0XA 3EFOA 4QW2A 4BDZA 3CCUA 2J6OA 1FMKA 2ZPEB 4BI3A 1NPRA 4EIKA 4ZGEB 1QWEA 2XG8D 4J6WA 4PLLA 2C0TA 1T3SA 4E7HA 1TUCA 2HCKA 1B07A 5J3BA 1RABB 3VYGA 1R0CB 4KBMB 2W0ZA 1LOJA 5LJ5d 1H3HA 3G7ZA 4QKUA 4AMCA 5IHNA 1OU8A 1YNZA 1ZHIA 2EYXA 5HKCA 3HTRA 3P8DA 5GJVB 3X24B 2C06A 3CCLA 1YI2A 2P4TA 4ORZA 1VQKT 1HJDA 4M7AD 2DNUA 4HCKA 2EGCA 1AWWA 2WSEE 3G6EQ 4FYVB 4IUPA 1D1BA 2FVUA 2QEXA 1KHIA 2E4HA 1UGRB 1VQ6A 2DL7A 4K11A 2QQAA 4KGVB 1VIFA 1GXIE 4RG8A 2AT1B 4X9DA 4C92C 2YWWA 5KYUB 3JCMf 3MO8A 2KQWA 3RR6A 3C4SA 3A5ZB 4MZPA 3MEWA 5AYFA 2ED0A 1D0ZA 3KBGA 1U8RA 1GCQC 5KCOA 1Q82U 2JTFA 1QVFA 3GNFB 2M51A 3ASKA 1M90R 4XTUA 1D3BB 3G6ET 3FJPA 1YBYA 3OYLA 4QT7A 2GBQA 3P8BB 4JRIA 3UA7A 1O75A 3HHTB 3JCMe 4EMKC 3OYYA 4OB1B 3HL8A 3QIIA 4DOWA 5CAIA 1G3SA 3QWYA 5CVIA 1OX9A 4OMFB 2PVDB 3NTHA 5GMKi 3EH1A 4V2SA 4M78F 2CREA 1K4US 3H9NA 1AWJA 3M4GA 3S3NA 1RLPC 3JCMP 3G71Q 1H641 2E5QA 1SEMA 4M78A 2RK2A 3QZ5B 2O01E 4C8QE 3I35A 1K9MR 1JXMA 5CKFA 2HBPA 3QYGB 2DXTA 3CPFA 5L23A 3QDRB 4FT2A 1KIKA 3E1SA 1M27C 1EZZB 4FSXA 2RJFA 5GANj 2YDLA 1X43A 1GFDA 2XK0A 3H0FA 4XTYA 4EMGA 2KROA 3M55A 4E7LA 4PFPA 4BD3A 2RQWA 2GNCA 1HXDA 5LJ3j 1IZ6A 2F2XA 5CKHA 1RUWA 3FLGA 5KCHA 5GAMh 3OS1A 1KC8C 4M7AC 4E7SA 1WLPB 4M77A 4HCBA 2LQKA 1QCOA 3G71T 3C0CA 1UE9A 4JPBW 5GAN4 2GTJA 3GNGA 1FXXA 4J9FA 1NJIR 1M1KR 3LX7A 3RNJA 1NE8A 2CH4A 2HSEB 4CC4B 2I0NA 2JVVA 1PG5B 3GPLA 4LXCA 2RI5A 1VQOQ 1VQ8Q 3WXMB 3S6WA 2DPPB 2RQVA
chains in the Genus database with same CATH topology
1I81A 2RI3A 1M8VA 2XKOC 2JOYA 5A0LA 4PJOA 5CKEA 4N0AA 1UB4A 2MF2A 2G3RA 2DJZA 4N4IA 2JZ2A 3OB9A 3P8HA 1K9MU 3HRSA 3CBMA 1M9SA 5KE2A 3ZBDA 3FEOA 4PLIA 2GCXA 4C5HA 4ZGDB 3OYHA 2RB6A 5FRNA 1BI0A 1M4ZA 3SWNA 1B34A 2KSSA 4F7UA 2RI2A 1VQ6T 1KQ1A 3E9GA 1KD1C 4YTLA 4RKUE 5GAN6 3AHUA 2D9TA 2NLUA 2RHZA 4ZN1A 3G6EA 1M90C 2E10A 2HQEA 1BIAA 1K8AC 4M77E 3OYKA 2YLCA 3OW2A 1YIJT 2K5LA 4M77D 1Y7XA 4Q5WA 5GAMg 2ZPBB 3CCRA 2E64A 2PUKB 5GAOr 2OTLA 3OA6A 2H3JA 2LDMA 2B8AA 3R6OA 1G3WA 1WJSA 2CGHA 3L2WA 3HFNA 3NFCA 5GAOm 4NL3A 3FC3A 1VQOT 1K73C 2RJEA 4M78B 3JB9G 3OYJA 1VQ8T 2LNVA 4R55A 3MEUA 4BUGA 3E9FA 3SD4A 2E6ZA 4J6YA 3JB9J 5HY6A 3JB9I 4J5YA 3JCMb 2QQBA 1YHQA 4PJOG 4OB0B 3JCMd 1NJIU 3JCMV 2RH2A 3JCMQ 1M1KU 4HCCA 4EPCA 3V8JA 5L8RE 1BI3A 4PKCC 3CCET 4Z02A 4PJOC 2D6FA 4M75F 2PU9B 2KAFA 4FIBA 2EFIA 4M7AF 4OGCA 2JN0A 1AHJB 5C6SA 2YLBA 3L1AA 4XU1A 3M9QA 2F5KA 3VU3C 1JJ2S 2EJ9A 4C0ZA 1WQ7A 4PJOE 3J7AF 4F7UG 2EIFA 5LJ3f 4R56A 3CC4A 4PJOD 1X6OA 3S3MA 4KT0E 5GAN7 4RG2A 1EIFA 3L2RA 4XTZA 1BIBA 1WJQA 3JCMh 5GAN8 3HSBA 1S72T 4XQ3A 4EMHA 5CK9A 2ZZDA 4KUDK 4PNOA 4X9CA 4NOYA 4X34A 5LJ5f 5GAMd 1JRIA 3CCST 3QZ9B 1WGSA 1RI0A 2YHTA 4F7UE 4M77B 4XU3A 5I21A 3L2ZA 2LT4A 2VV5A 1VQMA 3OMGA 3CD6A 2XDDA 1QP3A 4TVRA 4QQGA 4A54A 1H3ZA 2M9UA 3QKJA 4C5IA 2VGNA 2LCCA 3RKYA 4E47A 5C0MA 1W2BS 5GAMj 4XTVA 3CC7T 1U1SA 3DLMA 1VQLA 3GP8A 2IG0A 5CCAA 4IURA 5GAOq 4FU6A 4J7FA 4NL2A 2FHDA 2DTOA 3OBWA 5LJ3e 3C95A 3QJ6A 2Y4YA 3JCMX 5KH6A 4LDXA 2CZ7B 4CI0C 1YJNA 1XOVA 3BY7A 3X26B 2X4JA 3KXTA 1JB0E 2KY9A 2ZCFB 5FU6C 3CCUT 3OYIA 3G71A 2ZPGB 3META 5LJ5e 2HNIA 3LW5E 2EAYA 2O4XB 3LYIA 5FU7B 2ZPIB 1WPYA 4MZMA 4QVCA 2DEQA 3JAME 2OAUA 1Y71A 1YITT 1Q86C 4M78G 4ZN3A 1VQPA 2M1HA 3TEEA 4C92A 1V29B 2JUFA 4OB3B 2X4WA 3OS2A 1IREB 4KUIA 2V8IA 5CQXA 1VQ4A 4PJOB 5CQYA 2OTJT 2XIDA 2KVQG 4M78C 4Y28E 5GMKe 2QA4A 2V8KA 3A8OB 1XTDA 3VV0A 5FRMA 2P0QA 5DY9A 2CZ6B 3UT1A 4C0GA 5LL6S 3WVEB 2EWNA 3DLLA 4MZTA 3I56T 4M78E 4MMLA 3LWHA 2PQWA 3M53A 3H6ZA 2AHJB 4JJNK 4BDYA 3MP1A 3HP9A 4FM4B 3CXCS 4A4FA 1RL2A 3SWNB 1B34B 4F7UB 1X75C 3SB2A 3OBYA 3G4ST 3EFRA 2R58A 2GFAA 3RESA 3CMEA 1UGPB 4BI8B 3TCJA 3CCLT 3H8ZA 4BE2A 1YI2T 3QBYA 4LD9K 3GLXA 5LJ5h 1WNLA 3CC2T 4E7KA 3JB9F 2DXCA 1N9RA 1VQ5T 4M7DA 3JCMg 3X20B 3Q1JA 3OYCA 4XTXA 3OYDA 4LDYA 2DZCA 4EMKA 1QVGS 1BI2A 1YJWA 3UDCA 1BYMA 2RM4A 4EDUA 1M1FA 4M77G 3T9NA 4BB7A 2DTHA 5GMKh 3DB3A 3DKMA 5FLXE 2QEXT 1W2BA 1N8RU 3VUZA 3RMQA 3L2QA 4MDXA 4B9XA 2DD5A 1U1TA 4KULA 2D0QB 4M77C 2K2VA 4C8QF 3ER0A 4JS5A 4VUBA 2X4YA 3RUXA 3V7RA 1OI1A 1VQNA 1UEBA 2P0KA 2R57A 4J8OA 3L42A 3M5AA 2VXFA 3FRNA 4RCCA 4A4EA 2KDSA 4BE1A 1Q81U 1FX7A 1VQ4T 3VYHB 1KHCA 2E70A 1YIJA 4A53A 2K5IA 3ME9A 5GAN5 5FU6B 1OZ3A 2LCLA 2RO0A 3JCMc 1R8OB 3MEVA 2M0OA 4A4HA 2QQSA 2EQJA 4C8QA 1VQ7T 2BIVA 3HRUA 3OMCA 4QQDA 4C92E 1MGQA 1LNXA 2LX9A 1VQ8A 2K3YA 2QXFA 5DLOA 4C92D 3CMAA 3RERA 2EQKA 5D6WA 2FL7A 3EAEA 2M16A 5J39A 5FU7C 3PMTA 2MMPA 3OYBA 4IKFA 1UGQB 2LRQA 3I55A 4PL6A 5GANf 2LT1A 2XDPA 3OS5A 4M7DG 3J81E 3OYAA 3JRZA 2GF7A 3FDRA 4N0AC 3J80E 2ZGWA 3FIFA 3CXCA 1KC8U 4M7DC 5CIUA 5GAMf 2DAQA 3CCRT 4OB2B 3CCVA 3PMIA 2OTLT 5GAOn 4IUVA 4LDWA 4JS4A 2RA2A 2RK1A 4L59A 2DVEA 3PFSA 1XQHA 2MWOA 4M7DE 3LLRA 1N6AA 3DB4A 1OYXA 4M75A 3CPWA 3VKIA 1XNIA 1ZBXA 3SWNC 5A2QE 4M7DD 3FB9A 4RCBA 4M7AA 3CCSA 3OSSC 5M9OA 1FWZA 1K9MC 4XAXB 3EFSA 1QVGA 1D3BA 5IT9E 4OGEA 2I2LA 5KE3A 5GMKm 3QYHB 3CBPA 1N8RC 4ZGJB 3QXEB 5A0DA 5GANe 4E7IA 5GAN3 2XD0A 2MI6A 1N9SA 2GQVA 3CC7A 4LDVA 2ZPFB 3HFOA 2XICA 5GAMe 3E19A 3C94A 5IAYA 4C92B 5CKDA 2JTMA 4N4HA 2JNGA 3KUFA 1I4K1 3CC4T 3F70A 4BACA 4HA8A 5I2MA 2R5MA 1M1GA 2LVMA 3NTKA 4JUVA 4QW2A 4FT4A 4J7IA 2E65A 4C8QD 2E41A 2HD0A 2K4YA 4BDZA 2L89A 2MAMA 3CCUA 4LD6A 4C5GA 4O5VA 2ZPEB 4BI3A 1NPRA 2IVWA 4QVZA 3PTAA 4CRIA 5LJ3d 4ZGEB 2XG8D 4J6WA 2HQXA 4HKEA 4PLLA 4E7HA 3GF5A 3SFMA 3CD6T 5J3BA 3RIRA 3BDLA 4J6XA 4M77F 2EJGA 4OF1A 2CS7A 5J26A 2OTJA 4JDSA 3VYGA 3CCQA 1YJ9A 1NJIC 2EYQA 4ELYC 3WVDB 5GANh 4KBMB 5GAOl 1M1KC 1LOJA 2CKKA 5LJ5d 4IUUA 4M7AG 4M7DB 4LDUA 1VQ9T 1YCYA 1K8AU 2Y4XA 3G7ZA 2YRVA 1QVFS 5HK3A 2EQUA 3UPUA 4EMKB 3M58A 3CCMA 4DA4A 1Q7YU 5HKCA 1ZHIA 2DZ9A 3CCJA 1YJNT 5LJ3h 3ZEHA 5LJ5j 3G4SA 3P8DA 1WJRA 2ZPHB 4M75E 3CC2A 3HKSA 5CR2A 4BY6B 3X24B 2C06A 3CCLA 1YI2A 2EJFA 1G3TA 2P4TA 2PVGB 3OYGA 4M75D 4M7AE 4ZTFA 1K73U 1VQKT 3MP6A 4M7AD 3ZFJA 4ATOA 2RJCA 5GMKj 2CYZB 1VUBA 2VXEA 2Y90A 2WSEE 2DIQA 2DTIA 5A0GA 3CPWS 2E1HA 2GFUA 2QQRA 3QO3A 4IUPA 2QA4T 5I2SA 3MP8A 4BE0A 3QG1A 4N4GA 2FVUA 2QEXA 4PJOF 4GY5A 1KHIA 4C8QB 2PVOB 1DJ7B 3INZA 2DIGA 5D6YA 1SSFA 1UGRB 1OZ2A 1VQ6A 1WQWA 1NPPA 2L3RA 2RJDA 2A3LA 2LTOA 2EQMA 2XI9A 3QPHA 4DOVA 3OYEA 2K5FA 2QQAA 3PT9A 3URGA 4C92G 1VIFA 4JRQA 3CMET 3LGLA 2CZ0B 1GXIE 4F7UF 2CZ1B 4RG8A 3RKXA 4ELZC 4HT8A 2DXBA 4GLKA 2DXUA 1HK9A 4X9DA 4C92C 3OS0A 1VQ7A 2KMTA 3JCMf 3NTIA 2BUDA 3TU4K 2XHCA 2KK4A 3MO8A 3TREA 1QVPA 3HPWA 4D6WA 2KQWA 1VQOA 1LJOA 1YJWT 3C4SA 2F5TX 3A5ZB 4UC4A 4MZPA 2RHIA 3MEWA 3N5BB 5AYFA 4NS5A 1Y96A 3V7SA 3OY9A 2V8JA 3KBGA 2QQ9A 3OSVA 4RMOA 5KCOA 4Y91A 1U8RA 4M75B 1Q82U 2R5AA 2DKGA 2JTFA 1VQNT 5FROA 5GANg 3GNFB 3PNWC 4M7AB 3ASKA 4L5GA 3CCEA 1QVFA 2QTXA 2VUBA 4JRKA 1M5Q1 1D3BB 4XTUA 3G6ET 3FJPA 4JRPA 1YBYA 2PUOB 2LQ8A 3OYLA 1Q7YC 2WACA 4FL6A 3A8LB 4WF2A 3P8BB 4JRIA 5D6XA 4L6V5 4E7JA 2WSFE 4MMKA 5CO7A 1O75A 4BI4A 3HHTB 2RHUA 4IUTA 5LJ3g 3JCMe 1Y07A 5GAOp 4EMKC 1KQSS 2DD4A 3OYYA 4OB1B 4C0FA 3JB9H 3HL8A 3QIIA 4DOWA 3M59A 3UWNA 5CAIA 4ME7A 1G3SA 2RHXA 3A8GB 3X28B 5CVIA 4B9WA 1Q86U 1TH7A 2QDYB 3GIBA 2K3XA 2PVDB 4OMFB 3NTHA 3QUIA 4BY6C 1S72A 5GMKi 3L2VA 3CMAT 4V2SA 1O9SA 4M78F 5LJ5g 5CKBA 1YHQT 4QQ6A 3M4GA 1MHNA 3I55T 3VUBA 3OQ5A 2RD1A 3CEYA 4C8QG 3S3NA 3VJPA 4JLGA 3JB9D 1W4SA 1PSFA 3V8KA 3JCMP 1ZQ1A 3GOXA 4C8QC 1H641 2E5QA 2VGMA 3QHSA 2A7YA 4M78A 1BKBA 2RK2A 4OVAA 1QW1A 3CCVT 1Q81C 2L5QA 3MHXA 3MCAB 1NZ9A 3QJYA 5GANd 4C0DC 1KQ2A 3PIPA 2DK3A 1I5LA 2E6NA 3HRTA 1BI1A 5DLQE 3QZ5B 1G5VA 2O01E 3A8MB 4C8QE 2X4XA 4P5NA 5CKFA 2HBPA 3QYGB 2DXTA 3LWIA 3CPFA 4XTWA 3QDRB 4FT2A 3BDUA 3E1SA 1VIEA 4FSXA 1P92A 2RJFA 4II1A 4O6JA 3BW1A 3OYMA 5GANj 1KG1A 3SDZA 1YITA 2K57A 3PGGA 1PSEA 2XK0A 5EG2A 1VQMT 3M54A 4XTYA 2LC4A 4EMGA 1N27A 3M57A 3C12A 3M55A 4E7LA 1Q82C 2DO3A 1KD1U 4BD3A 3JCMW 3OYFA 2P0PA 2X35A 1VQ9A 4M75G 1HXDA 5LJ3j 3V8LA 1VQLT 1UGSB 2FB7A 1M90U 3JSCA 1IZ6A 3L2UA 2MWPA 3M4YA 4MDWA 4HT9A 4A4KA 4C92F 4M75C 3I56A 2RHYA 5CKHA 3FLGA 5GAMh 5KCHA 1KC8C 3OS1A 4M7AC 3S3OA 3RKWA 2VYTA 4DQ2A 2VC8A 4M77A 4QVDA 1KQSA 4XK8E 3OW2S 2XU8A 3LGFA 2XDBA 4J83A 3RMSA 3QSUA 4A4GA 4HCBA 1JBMA 2LQKA 3V7CA 1VQKA 3G71T 5IN1A 2WSCE 1X01A 4HCZA 3PIOA 5GAN4 2FYKA 3GNGA 2E12A 1FXXA 3CBOA 1VQ5A 1G3YA 2F69A 3LH0A 1VQPT 3CCQT 3LX7A 5HK0A 1YJ9T 4IUQA 1NE8A 3OYNA 4XU2A 4XU0A 3JCMJ 3O8VA 2JVVA 3MEAA 2BKDN 1I8FA 5DM7R 3GPLA 4OP0A 1JJ2A 2HAXA 2L8DA 3A8HB 4M7DF 2QI2A 3X25B 3M56A 2EKOA 5GMKl 3CCMT 4M78D 4C5EA 4C0DB 3CCJT 2O4XA 2RI5A 4JLIA 5GAN2 1Y96B 3WXMB 3S6WA 2DPPB 4ZTJA 3BFMA 1QP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I81 A;  1D3B B;  1M5Q 1;  4XTU A;  1M8V A;  1WPY A;  3FJP A;  5GAN e;  2DEQ A;  4QVC A;  4N0A A;  5GAN 3;  4PJO A;  4M78 G;  1N9S A;  2DJZ A;  4C92 A;  4WF2 A;  4JRI A;  4PJO B;  3HFO A;  4MMK A;  4M78 C;  5GAM e;  5GMK e;  5LJ3 g;  4C92 B;  3JCM e;  5GAO p;  4EMK C;  5DY9 A;  3JB9 H;  2RB6 A;  5CAI A;  1I4K 1;  2EWN A;  4HA8 A;  1TH7 A;  3GIB A;  4F7U A;  3SWN A;  1B34 A;  4JUV A;  4M78 E;  3QUI A;  4MML A;  2E65 A;  1KQ1 A;  2E41 A;  4C8Q D;  5GMK i;  4V2S A;  5LJ5 g;  4M78 F;  5GAN 6;  3AHU A;  4F7U B;  3SWN B;  1B34 B;  3M4G A;  3SB2 A;  5LJ3 d;  3EFR A;  2E10 A;  3RES A;  4J6W A;  1BIA A;  2RD1 A;  4M77 E;  4C8Q G;  2YLC A;  3RIR A;  5LJ5 h;  1WNL A;  4J6X A;  2EJG A;  4M77 D;  4M77 F;  1N9R A;  3JB9 D;  3V8K A;  3JCM P;  5GAM g;  3JB9 F;  4M7D A;  3JCM g;  4C8Q C;  1H64 1;  2E64 A;  3QHS A;  5GAN h;  5GAO l;  5GAO r;  4M78 A;  1LOJ A;  5LJ5 d;  4XTX A;  2DZC A;  2CGH A;  4EMK A;  4M7A G;  4M7D B;  5GAN d;  3HFN A;  1YCY A;  2RM4 A;  5GAO m;  4NL3 A;  1I5L A;  1KQ2 A;  4M77 G;  4M78 B;  3JB9 G;  2DTH A;  5GMK h;  4C8Q E;  4EMK B;  3JB9 J;  1U1T A;  4J6Y A;  2DZ9 A;  2DXT A;  4M77 C;  4C8Q F;  4J5Y A;  4XTW A;  5LJ3 h;  5LJ5 j;  4PJO G;  3JCM b;  3RUX A;  3BDU A;  3JCM V;  3V7R A;  3JCM d;  3JCM Q;  4M75 E;  3V8J A;  2VXF A;  4RCC A;  3BW1 A;  5GAN j;  4M7A E;  2EJF A;  4PJO C;  4M75 F;  4M75 D;  2K57 A;  3PGG A;  4A53 A;  5GAN 5;  4M7A F;  4M7A D;  2JN0 A;  4XTY A;  4EMG A;  5GMK j;  3JCM c;  2YLB A;  3L1A A;  2VXE A;  4XU1 A;  2Y90 A;  3VU3 C;  4C8Q A;  2DTI A;  2EJ9 A;  3JCM W;  1WQ7 A;  2E1H A;  3QO3 A;  3JB9 I;  4PJO E;  4M75 G;  5LJ3 f;  4F7U G;  1HXD A;  5LJ3 j;  3V8L A;  1MGQ A;  4C92 E;  4PJO F;  4PJO D;  1LNX A;  2FB7 A;  4C8Q B;  4HT9 A;  3INZ A;  5GAN 7;  4C92 F;  4M75 C;  4C92 D;  4XTZ A;  5GAM h;  1BIB A;  5GAN 8;  3JCM h;  3RER A;  4M7A C;  3HSB A;  1WQW A;  4XQ3 A;  3RKW A;  4DQ2 A;  4EMH A;  2VC8 A;  4M77 A;  4PNO A;  4QVD A;  4X9C A;  4NOY A;  5LJ5 f;  5GAM d;  1JRI A;  3QSU A;  1JBM A;  2YHT A;  4F7U E;  3V7C A;  4M77 B;  4C92 G;  4XU3 A;  5I21 A;  3L2Z A;  5GAN f;  4M7D G;  1X01 A;  4F7U F;  4N0A C;  3RKX A;  4HT8 A;  4A54 A;  2FYK A;  5GAN 4;  2DXU A;  1HK9 A;  2ZGW A;  3FIF A;  4X9D A;  4C92 C;  4M7D C;  3RKY A;  5GAM f;  5GAM j;  4XTV A;  3JCM f;  1U1S A;  5GAO n;  4XU2 A;  4XU0 A;  5GAO q;  2RA2 A;  3JCM J;  4NL2 A;  2DTO A;  2DVE A;  5LJ3 e;  1LJO A;  1I8F A;  4M7D E;  4OP0 A;  3JCM X;  4M75 A;  3SWN C;  4M7D F;  1Y96 A;  3V7S A;  3FB9 A;  3BY7 A;  4RCB A;  5GMK l;  4M7A A;  4M7D D;  4M78 D;  3EFS A;  1D3B A;  4Y91 A;  4JLI A;  4M75 B;  5GAN 2;  2DKG A;  5GAN g;  1Y96 B;  2I2L A;  4M7A B;  5LJ5 e;  5GMK m;  2HNI A;  3BFM A;  2QTX A;  2EAY A;  4JRK A; 
#chains in the Genus database with same CATH topology
 1M3B A;  1ZA2 B;  2HBW A;  2JMC A;  1TUG B;  2J7I A;  5KE2 A;  2KNB B;  3ZBD A;  2QGG A;  2GCX A;  4C5H A;  1OPK A;  3OYH A;  2RB6 A;  5FRN A;  1QVF P;  1M4Z A;  1B7T A;  2KSS A;  2C0I A;  2KRS A;  2RI2 A;  2K9G A;  1AT1 B;  2VKN A;  4JJB A;  2D9T A;  1M90 C;  1RAG B;  4PJM A;  2YLC A;  3OW2 A;  4Z88 A;  2ZPB B;  4IIO A;  1D09 B;  1MV3 A;  3HFN A;  1VQO T;  1K73 C;  1ZSZ C;  3JB9 G;  3CC7 Q;  3OYJ A;  2ENM A;  1VQ8 T;  2LNV A;  4R55 A;  3TSW A;  3SD4 A;  2E6Z A;  1FMV A;  2P4R A;  1YHQ A;  2QQB A;  2RH2 A;  4EPC A;  1BI3 A;  2QYZ A;  2YRC A;  2KE9 A;  1AHJ B;  1FYN A;  5EC7 A;  2O9S A;  2YT6 A;  3M9Q A;  2KEA A;  2FPF A;  4C0Z A;  4PJO E;  1WQ7 A;  1GL5 A;  3CC4 A;  2M0Y A;  4XTZ A;  1WJQ A;  3JCM h;  1QCN A;  1S1N A;  2QAZ A;  4PNO A;  1ZBJ A;  5LJ5 f;  5GAM d;  3I56 Q;  4F7U E;  4XU3 A;  2VV5 A;  3CD6 A;  1QP3 A;  4TVR A;  3M0U A;  2Z0W A;  4E47 A;  3CC7 T;  1U1S A;  4F16 A;  1Q81 R;  1VQL A;  2EGA A;  5CCA A;  4J7F A;  2DTO A;  1VQ5 Q;  2CZ7 B;  1BBZ A;  1SKU B;  2ZPG B;  5LJ5 e;  1E7O A;  2QG9 B;  5GJW B;  2O4X B;  5FU7 B;  1G2B A;  4MZM A;  1Q86 C;  4M78 G;  2JS2 A;  4ZN3 A;  1VQP A;  3TEE A;  1KK7 A;  1IRE B;  2CP3 A;  4KUI A;  3RBB B;  4PJO B;  5CQY A;  4FCY A;  4Y28 E;  2V8K A;  1UTI A;  2P0Q A;  3UT1 A;  4C0G A;  3DLL A;  4D8D A;  4OMM A;  3I56 T;  4MML A;  2PQW A;  3MJX A;  2YRD A;  1OQK A;  4BDY A;  3CXC S;  2HZY A;  4F7U B;  3SWN B;  3EFR A;  1UGP B;  2QK0 A;  1ZA1 B;  1Y0M A;  3H8Z A;  4BE2 A;  3QBY A;  3GLX A;  1WNL A;  2FO0 A;  1N9R A;  1VQ5 T;  4M7D A;  4JJD A;  3OYD A;  1HD3 A;  1D1C A;  5KYY A;  3UDC A;  4M77 G;  4ANJ A;  3CCR Q;  1N8R U;  1W2B A;  2RNA A;  4B9X A;  1OUL A;  4C8Q F;  3ER0 A;  1RLQ C;  2AK5 A;  4PFO A;  1UEB A;  3OW2 P;  3L42 A;  3M5A A;  2MOX A;  5FW9 A;  2E70 A;  4A53 A;  1LCK A;  2K5I A;  3ME9 A;  1MMG A;  5FU6 B;  2LCL A;  3JCM c;  1R8O B;  3MEV A;  4A4H A;  4C8Q A;  2EQJ A;  3G1J A;  1JU5 C;  4C92 E;  1MGQ A;  4AG1 C;  2LX9 A;  2K3Y A;  2FRY A;  2MIO A;  2QXF A;  5DLO A;  1WA7 A;  2K79 A;  2CP2 A;  3EAE A;  1A0N B;  3EGD B;  2NYS A;  1K8A R;  2LT1 A;  2DBM A;  1UHC A;  1YP5 A;  4N0A C;  2ESW A;  1SF9 A;  1KC8 U;  4M7D C;  3CCR T;  1ACM B;  1IHV A;  4RUG A;  2E3H A;  2F2V A;  2RK1 A;  2EYY A;  4L59 A;  4M75 A;  1XNI A;  2LQW A;  3FB9 A;  4RCB A;  1OOT A;  3OSS C;  2DL5 A;  1NBE B;  2YUP A;  3RDV A;  2KBT A;  2NWM A;  3QYH B;  2CDT A;  1YJN Q;  1UFF A;  2COY A;  1N9S A;  2KRM A;  2XIC A;  2QGF B;  4C92 B;  5CKD A;  1UUE A;  2HQH A;  1I4K 1;  1SHG A;  1Z9Z A;  5I2M A;  2QA4 Q;  3NTK A;  4JUV A;  2E41 A;  2HD0 A;  4LD6 A;  3ULR B;  2IVW A;  5LJ3 d;  1NG2 A;  4HKE A;  2KYB A;  3SFM A;  4M4Z A;  2MCN A;  2CS7 A;  2KRN A;  2O88 A;  1IHW A;  2CKK A;  1YCY A;  2Y4X A;  2BZX A;  2EQU A;  4EMK B;  3VS6 A;  1Q7Y U;  1YJN T;  2ZPH B;  1WX6 A;  3M0Q A;  4M7A E;  2EJF A;  1G3T A;  1VYV A;  4ZTF A;  1AEY A;  1K73 U;  1PM3 A;  3MP6 A;  3ZFJ A;  1VQN Q;  3AT1 B;  6AT1 B;  2EYW A;  5GMK j;  2CYZ B;  2VXE A;  5A0G A;  1W2B P;  3CPW S;  2QQR A;  2QA4 T;  5I2S A;  4N4G A;  4PJO F;  4GY5 A;  2RQT A;  1MV0 B;  2PVO B;  1DJ7 B;  4RTW A;  2HEQ A;  1C0M A;  1H92 A;  5D6Y A;  2PNI A;  4J9I A;  1WQW A;  1AVZ C;  2EQM A;  1D0Y A;  4E7Z A;  2K5F A;  3CMA Q;  3LGL A;  2CZ0 B;  4F7U F;  4ELZ C;  1HK9 A;  3O5Z A;  1WHL A;  2BUD A;  3TU4 K;  2KK4 A;  4A63 B;  2CUD A;  2F5T X;  1MMA A;  1GBQ A;  4UC4 A;  2K7A A;  3N5B B;  3CCV Q;  4NS5 A;  3V7S A;  2LCS A;  3OY9 A;  1KD1 R;  2V8J A;  2QQ9 A;  4RMO A;  2H3E B;  2R5A A;  1VQN T;  4M7A B;  1WYX A;  4JRK A;  2X51 A;  2PUO B;  2LQ8 A;  4FL6 A;  2J06 A;  4Z89 A;  4J9H A;  5CO7 A;  1JQQ A;  4BI4 A;  3I5R A;  1Y07 A;  4J9E A;  1HYO A;  2DD4 A;  4C0F A;  4ESR A;  4HVW A;  3UWN A;  3A8G B;  2OAW A;  3A1P A;  1Q86 U;  2KT8 A;  2QDY B;  1RAA B;  1X2Q A;  3QUI A;  4BY6 C;  3CMA T;  4R0K A;  3L2V A;  3QDF A;  4QQ6 A;  3VUB A;  1TS9 A;  2O9V A;  4C8Q G;  4JLG A;  3JB9 D;  1W4S A;  1PSF A;  2ATC B;  3GOX A;  2DLP A;  2A7Y A;  3CCV T;  2L5Q A;  2DX1 A;  2DRK A;  2MPX C;  3PIP A;  2DK3 A;  1G5V A;  3HRT A;  2NUZ A;  2QTV A;  1NLP C;  3LWI A;  1WHJ A;  2J6K A;  2OI3 A;  4O6J A;  3OYM A;  3SDZ A;  3FJ5 A;  2JT4 A;  1I5O B;  3H0H A;  4FYX B;  2DO3 A;  2P0P A;  2X35 A;  5HCK A;  4M75 G;  3V8L A;  2DYB A;  2FB7 A;  3JSC A;  4LN2 A;  4MDW A;  4C92 F;  1KQS A;  1ZSZ B;  3CQT A;  4AG2 C;  2XDB A;  3RMS A;  3I9Q A;  4PK4 A;  1VQK A;  5KYW B;  1VQ6 Q;  2BE9 B;  2O31 A;  3PIO A;  2FYK A;  5KYX A;  2E12 A;  2F69 A;  4RTX A;  3OYN A;  4XU2 A;  1YIJ Q;  3O8V A;  1EFN A;  5DM7 R;  2L8D A;  3A8H B;  5GMK l;  2F2W A;  4M78 D;  1PD1 A;  4C0D B;  2CP5 A;  1Y96 B;  2LMJ A;  4AFQ C;  2ED1 A;  3BFM A;  1VQ4 A;  4RTV A;  1UJ0 A;  2D0N A;  2G3R A;  2RQU A;  4WTO B;  1J3T A;  3OB9 A;  2QAS A;  3CBM A;  4DBH A;  3FEO A;  4ZGD B;  1YN8 A;  2P84 A;  1VQ6 T;  1KQ1 A;  3E9G A;  1KD1 C;  2A28 A;  4YTL A;  2RHZ A;  1PCX A;  3G6E A;  2HQE A;  1BIA A;  1JO8 A;  3VRY A;  1YIJ T;  2K5L A;  4M77 D;  5GAM g;  4E6R A;  2OTL A;  2A36 A;  1BCO A;  2LDM A;  2VB6 A;  3R6O A;  2V1R A;  3FC3 A;  3E9F A;  2JS0 A;  4FYY B;  5IXB A;  4J6Y A;  3VS1 A;  4PJO G;  4OB0 B;  3SHW A;  3KFV A;  5L8R E;  1T0J A;  2PU9 B;  2KAF A;  1UG1 A;  4M7A F;  4OGC A;  2JN0 A;  5C6S A;  2GGR A;  3L1A A;  1KFZ A;  4F7U G;  5LJ3 f;  2LJ3 A;  8ATC B;  3EG1 A;  1X6O A;  2DL8 A;  4RG2 A;  5GAN 7;  2OTJ Q;  1ABQ A;  4XQ3 A;  4KUD K;  2ZZD A;  1F1B B;  1GFC A;  2CUB A;  1WXU A;  2LT4 A;  2HDA A;  2XDD A;  2PZ1 A;  3G4S Q;  3REA B;  3QKJ A;  3TSZ A;  4C5I A;  5C0M A;  2COW A;  4OMP A;  3GP8 A;  2IG0 A;  4PJL A;  4FU6 A;  5LJ3 e;  1KQS P;  3C95 A;  1WI7 A;  1RAC B;  5KH6 A;  3JCM X;  1UHF A;  4CI0 C;  2FZC B;  1XOV A;  3X26 B;  2X4J A;  3KXT A;  5IXF A;  1JB0 E;  2ZCF B;  4AT1 B;  3G71 A;  2HNI A;  2EAY A;  3BE3 A;  2DEQ A;  1Y71 A;  4J9C A;  3M0P A;  5CQX A;  2OTJ T;  1IXD A;  2XID A;  4M78 C;  2DM1 A;  2LP5 A;  5DY9 A;  1WIE A;  1I1J A;  1RI9 A;  4OML A;  1VQ7 Q;  9ATC B;  1H8K A;  2C0O A;  4JJN K;  3HP9 A;  4Y92 A;  4A4F A;  1RL2 A;  1B34 B;  3G4S T;  3SB2 A;  2GFA A;  3RES A;  3CME A;  1RAI B;  2DXC A;  2FRW A;  3JCM g;  3Q1J A;  1G83 A;  1W1F A;  3OYC A;  2DZC A;  1BI2 A;  1YJW A;  1UEC A;  2JXB A;  1BYM A;  4EDU A;  1M1F A;  4BB7 A;  2DTH A;  3DKM A;  3RMQ A;  2JM8 A;  3QWX X;  2D0Q B;  4M77 C;  1PC0 A;  1M30 A;  2VXF A;  1ZX6 A;  1TWB A;  1FX7 A;  2EKH A;  1KHC A;  2DF6 A;  2ABL A;  1OZ3 A;  2RO0 A;  2LNH B;  3M0R A;  2QQS A;  1VQ7 T;  2BZ8 A;  1VQ8 A;  1M2V B;  1GBR A;  4KGZ B;  3RER A;  2EQK A;  3CC4 Q;  3PMT A;  2BE7 D;  2LX7 A;  2LRQ A;  3I55 A;  2XDP A;  3JRZ A;  2GF7 A;  4J9G A;  5KYU A;  3FDR A;  4LUD A;  3UAT A;  3J80 E;  3FIF A;  2DAQ A;  1OPL A;  3PMI A;  3CD6 Q;  5GAO n;  4AFZ C;  1QCF A;  4IUV A;  3NPF A;  1ABO A;  1K1Z A;  2X3W D;  2MWO A;  3DB4 A;  3EG0 A;  3CPW A;  1ZBX A;  4M7D D;  3UF4 A;  1WHH A;  1FWZ A;  1K9M C;  1VQ9 Q;  1QVG A;  1D3B A;  1R77 A;  4LNP A;  1QQJ A;  5KE3 A;  5GMK m;  3CBP A;  3QXE B;  4OMQ A;  4D8K A;  5A0D A;  4E7I A;  7AT1 B;  5I22 A;  3CC7 A;  2ZPF B;  2L0A A;  1I0C A;  1PNJ A;  3CC4 T;  4BAC A;  1OU9 A;  1E6H A;  2R5M A;  1RAE B;  4FT4 A;  4J7I A;  4C8Q D;  2AIR B;  2L89 A;  2MAM A;  4C5G A;  4QVZ A;  3PTA A;  4LUE A;  4CRI A;  2HQX A;  2RQR A;  3CD6 T;  3RIR A;  3BDL A;  3PE0 A;  2EJG A;  4FW1 A;  3CCQ A;  1YJ9 A;  1Q82 R;  1NJI C;  2EYQ A;  5GAN h;  3WVD B;  5GAO l;  1M1K C;  4M7A G;  4LDU A;  1VQ9 T;  4Z8A A;  2YRV A;  1QVF S;  5HK3 A;  3UPU A;  3M58 A;  3CCM A;  4DA4 A;  8AT1 B;  2DZ9 A;  3CCJ A;  5LJ3 h;  3ZEH A;  2AKL A;  2AZS A;  5LJ5 j;  1XJW B;  3CC2 A;  3HKS A;  4BY6 B;  3MPU B;  4M75 D;  2RJC A;  2Y90 A;  1ARK A;  2DIQ A;  2DTI A;  3EGX B;  2E1H A;  2GFU A;  2O2O A;  1VYT A;  3QO3 A;  1OEB A;  1CSK A;  3QG1 A;  4CC2 A;  3INZ A;  2DIG A;  2LZ6 B;  4B6M A;  4PJN A;  2OX7 A;  1NPP A;  2RJD A;  4CC7 A;  2LTO A;  2XI9 A;  3QPH A;  3PT9 A;  2F1L A;  4JRQ A;  3TQ7 P;  2HKQ B;  4HT8 A;  4GLK A;  2DXU A;  3OS0 A;  2NUT B;  1V76 A;  3NTI A;  2XHC A;  1QVP A;  2ZAE A;  3HPW A;  4D6W A;  1LJO A;  2RHI A;  3VS0 A;  2DKG A;  5FRO A;  3CCE A;  4L5G A;  2VUB A;  1M5Q 1;  2L2P A;  4AFU C;  3NHN A;  2KR3 A;  2WAC A;  4WF2 A;  2ROT A;  2WSF E;  4MMK A;  4WCI A;  2MK5 A;  3CPW P;  5KYN A;  2RHU A;  5GAO p;  1VQM Q;  3JB9 H;  4HVU A;  1QVG P;  3M59 A;  2RHX A;  2JM9 A;  1QLY A;  1S72 A;  2YSQ A;  1NYG A;  3VS7 A;  5LJ5 g;  3EFO B;  1JXO A;  4KH0 B;  3V8K A;  4C8Q C;  2VGM A;  3THK A;  3LH5 A;  4OVA A;  5IH2 A;  1Q81 C;  2NUP B;  3MCA B;  3QJY A;  5GAN d;  1KQ2 A;  1I5L A;  2E6N A;  5DLQ E;  4J9D A;  4RTZ A;  2DET A;  3A8M B;  4P5N A;  3BDU A;  2H8H A;  1IGQ A;  1P92 A;  2HMA A;  4II1 A;  1KG1 A;  1QKW A;  1YIT A;  3PGG A;  1PSE A;  5EG2 A;  1VQM T;  3M0S A;  2LC4 A;  1ZSG A;  1N27 A;  4F14 A;  1X2K A;  3C12 A;  1Q82 C;  2KI7 A;  3OYF A;  1SG5 A;  1UGS B;  1M90 U;  4HT9 A;  4J9B A;  2E5K A;  4M75 C;  2RHY A;  1R0B G;  3RKW A;  2VYT A;  4DQ2 A;  2VC8 A;  4XK8 E;  3OW2 S;  3LGF A;  1NLO C;  4J83 A;  3QSU A;  2KT1 A;  5IN1 A;  1X01 A;  4RTY A;  1WHM A;  3CBO A;  2GTO A;  3UA6 A;  2DFU A;  1VA7 A;  5HK0 A;  4XU0 A;  3JCM J;  3MEA A;  1I8F A;  4OP0 A;  1PRM C;  2V1Q A;  2HAX A;  1SRM A;  2QI2 A;  2EKO A;  1V1C A;  2L3P A;  4RTT A;  2O4X A;  3EG2 A;  3JV3 A;  1M8V A;  2XKO C;  2JOY A;  4PJO A;  5CKE A;  1UB4 A;  1AZG B;  2DJZ A;  1K9M U;  1RAF B;  2LJ1 A;  1UGV A;  2LJ0 A;  1VYU A;  4F7U A;  3SWN A;  4PJJ A;  5FWB A;  5GAN 6;  2NLU A;  4PFZ A;  1QWF A;  3NGP A;  1PD0 A;  1K8A C;  4M77 E;  3CCS Q;  1D1A A;  2E64 A;  2PUK B;  5GAO r;  1UDL A;  3D7S B;  2H3J A;  3EG9 B;  1G3W A;  1WJS A;  2CGH A;  3L2W A;  3VS4 A;  3NFC A;  5GAO m;  4NL3 A;  4KGX B;  4KRT A;  2RJE A;  4M78 B;  3JB9 J;  2FZG B;  2L3S A;  5HY6 A;  2YXY A;  4J5Y A;  3JCM b;  1NJI U;  1M1K U;  4HCC A;  2PTK A;  3JCM Q;  1PKT A;  4PKC C;  4Z02 A;  4PJO C;  2D6F A;  2EFI A;  4DBQ A;  3CCU Q;  3I5S A;  2HKN A;  2DRM A;  3M0T A;  2F5K A;  2FZK B;  2EJ9 A;  1JJ2 S;  3J7A F;  2EIF A;  2MYS A;  2COZ A;  4KT0 E;  4GLM A;  3EGD A;  1IGU A;  1EIF A;  3HSB A;  2FG0 A;  4EMH A;  5CK9 A;  4X9C A;  1NYF A;  4NOY A;  3CCS T;  3QZ9 B;  1RI0 A;  4M77 B;  1N8R R;  5I21 A;  3L2Z A;  4QQG A;  1H3Z A;  2M9U A;  1WXB A;  2LCC A;  3RKY A;  1W2B S;  5GAM j;  4XTV A;  3CCL Q;  3DLM A;  1YI2 Q;  2YUO A;  4IUR A;  5GAO q;  4NL2 A;  2RF0 A;  1MND A;  1WHG A;  2Y4Y A;  4JZ4 A;  4LDX A;  3BY7 A;  4DEX A;  1C6V X;  2QEX Q;  5FU6 C;  3CCU T;  3LW5 E;  1WPY A;  1IRX A;  1U3O A;  2NUP A;  4C92 A;  3OS2 A;  2JUF A;  4OB3 B;  2X4W A;  1VQ4 Q;  2DBK A;  3A8O B;  3VV0 A;  2ECZ A;  2CP6 A;  5LL6 S;  2EWN A;  1KC8 R;  1YWP A;  3M53 A;  4CC3 A;  1GCQ A;  2AHJ B;  4FM4 B;  1BCM A;  4F17 A;  4BI8 B;  3TCJ A;  3CCL T;  1YI2 T;  2DIL A;  1X27 A;  1LVK A;  4E7K A;  3JB9 F;  1PHT A;  3ZL7 C;  1YCS B;  4XTX A;  2EW3 A;  4LDY A;  4EMK A;  1M3A A;  4E2F B;  3T9N A;  1GCP A;  2QEX T;  5GMK h;  2RN8 A;  2OTL Q;  3VUZ A;  1IB8 A;  2EQI A;  4JS5 A;  4VUB A;  2X4Y A;  3RUX A;  1OI1 A;  2P0K A;  2R57 A;  1Q81 U;  3U23 A;  3FRN A;  4RCC A;  4A4E A;  2KDS A;  1KSW A;  1VQ4 T;  3VYH B;  2EYZ A;  1YIJ A;  1LPL A;  3NMZ C;  5GAN 5;  1K0S A;  3H0I A;  1MUZ A;  1UJY A;  2M0O A;  2BIV A;  1G8X A;  1LNX A;  1K9A A;  2YUQ A;  5J39 A;  2MMP A;  3OYB A;  1UGQ B;  4PL6 A;  4LE9 A;  4DBF A;  2CSQ A;  5GAN f;  1AZE A;  3J81 E;  3OYA A;  1Q7Y R;  2ZGW A;  3CXC A;  1Q95 G;  1TOV A;  4OB2 B;  3TVT A;  2OTL T;  4LDW A;  2RA2 A;  2DVE A;  3PFS A;  1K73 R;  4M7D E;  1N6A A;  5A2Q E;  4MDX A;  4M7A A;  5M9O A;  3EFS A;  4DEY A;  2A37 A;  2I2L A;  1N8R C;  1KJW A;  1T3L A;  5GAN e;  3EG9 A;  4AFS C;  2GQV A;  1WXT A;  3VS2 A;  1TXQ A;  2DER A;  5IHI A;  5IAY A;  3EHR A;  2JTM A;  1YWO A;  3EH2 A;  4N4H A;  2EVR A;  3KUF A;  2LVM A;  2E65 A;  2K4Y A;  2DYI A;  3EGU A;  4O5V A;  1HSQ A;  1GRI A;  3GF5 A;  3IQL A;  1FMW A;  1M2O A;  1BK2 A;  4J6X A;  4M77 F;  4OF1 A;  5J26 A;  2OTJ A;  4JDS A;  1QKX A;  3CME Q;  4ELY C;  4IUU A;  4M7D B;  1K8A U;  5KYY B;  1T0H A;  1YJW Q;  3G4S A;  1WJR A;  4M75 E;  1W6X A;  5CR2 A;  2PVG B;  3OYG A;  1Q86 R;  1U5S A;  2KXC A;  4ATO A;  3MKD A;  2K6D A;  1VUB A;  2V26 A;  1Z9Q A;  3MP8 A;  4BE0 A;  2DVJ A;  1OV3 A;  4C8Q B;  1ZSZ A;  1SSF A;  1OZ2 A;  2IPO B;  2J6F A;  2KXD A;  2L3R A;  2X3X D;  2A3L A;  5KYW A;  4DOV A;  3OYE A;  3URG A;  4C92 G;  1M3C A;  3CME T;  2CZ1 B;  3RKX A;  2X9H A;  1YHQ Q;  2DXB A;  3I55 Q;  1VQ7 A;  1TG0 A;  2KMT A;  2A0F B;  3TRE A;  2HL3 A;  1AWX A;  1ZUY A;  4HXJ A;  1VQO A;  1YJW T;  3PVL A;  1ZUK A;  2QDL A;  1Y96 A;  1PRL C;  3OSV A;  4Y91 A;  4M75 B;  3REB B;  2CP0 A;  5GAN g;  2DEU A;  3PNW C;  3CXC P;  2QTX A;  4JRP A;  1Q7Y C;  3A8L B;  5D6X A;  4L6V 5;  4E7J A;  1NEB A;  4IUT A;  5LJ3 g;  1CKA A;  2EGE A;  2B86 A;  1KQS S;  1WHK A;  4ME7 A;  3X28 B;  4B9W A;  1TH7 A;  3VS5 A;  3GIB A;  2K3X A;  2SEM A;  1VQL Q;  1W70 A;  1O9S A;  2RMO A;  2D1X A;  5CKB A;  1YHQ T;  4FSS A;  1MHN A;  3I55 T;  3OQ5 A;  2RD1 A;  3CEY A;  1PKS A;  3VJP A;  2VAS A;  1ZQ1 A;  3QHS A;  1CKB A;  1QMC A;  1BKB A;  1QW1 A;  3MHX A;  1NZ9 A;  4C0D C;  2OJ2 A;  1VQP Q;  3CCQ Q;  1BI1 A;  1YJ9 Q;  2X4X A;  2DJQ A;  4XTW A;  4ZNX A;  2DMO A;  2RPN A;  1VIE A;  4X1V A;  2JMA A;  3BW1 A;  2DE0 X;  3CCM Q;  3E2U A;  2VVK A;  3CCJ Q;  1AD5 A;  2K57 A;  3M54 A;  3PVQ A;  3CC2 Q;  2YUN A;  3M57 A;  1KD1 U;  3JCM W;  1VQ9 A;  1VQL T;  3L2U A;  2MWP A;  3M4Y A;  4A4K A;  4OMN A;  3I56 A;  2KYM A;  1PWT A;  3S3O A;  4QVD A;  2XU8 A;  3SEM A;  4A4G A;  1JBM A;  2J05 A;  3V7C A;  3VS3 A;  2WSC E;  4HCZ A;  1TU0 B;  1VQ5 A;  1G3Y A;  3LH0 A;  1VQP T;  3CCQ T;  1YJ9 T;  4IUQ A;  4JJC A;  1ZLM A;  2BKD N;  1JJ2 A;  4M7D F;  2XMF A;  1SRL A;  3M56 A;  3X25 B;  3CCM T;  4C5E A;  3CCJ T;  4JLI A;  1IO6 A;  1ZUU A;  5GAN 2;  3CC2 T;  4ZTJ A;  1QP2 A;  1I81 A;  2RI3 A;  5A0L A;  4N0A A;  2MF2 A;  1SPK A;  4N4I A;  2JZ2 A;  3CCE Q;  3P8H A;  3HRS A;  1M9S A;  2DA9 A;  4PLI A;  2LQN A;  2M02 A;  1SSH A;  1MMN A;  1Y57 A;  2GQI A;  1M8M A;  1BI0 A;  1B34 A;  3EHQ A;  2E3I A;  4RKU E;  2FEI A;  1NEG A;  2EBP A;  3AHU A;  4ZN1 A;  1AWO A;  2E10 A;  1S72 Q;  2K2M A;  3OYK A;  3H41 A;  1Y7X A;  1YFN A;  4Q5W A;  3CCR A;  2CT4 A;  3OA6 A;  2B8A A;  2EPD A;  1B3Q A;  1C1A A;  1OX8 A;  3MEU A;  1JEG A;  4BUG A;  5I11 A;  3JB9 I;  1VOM A;  5ECA A;  3JCM d;  3JCM V;  3V8J A;  3CCE T;  1TSF A;  4M75 F;  4FIB A;  3R6N A;  2BZY A;  1WFW A;  2YLB A;  4XU1 A;  4RTU A;  3VU3 C;  2DL3 A;  1YIT Q;  1X6B A;  1M2V A;  2HSP A;  4R56 A;  4PJO D;  3S3M A;  2BTT A;  3L2R A;  1BIB A;  5GAN 8;  1S72 T;  2K3B A;  3EG3 A;  4X34 A;  1JRI A;  1WGS A;  2YHT A;  1RAH B;  2D8J A;  1VQM A;  3OMG A;  1TUD A;  1U06 A;  4A54 A;  1I07 A;  1N5Z A;  2VGN A;  2FPE A;  1AOJ A;  5KYX B;  1RAD B;  1WDX A;  1SHF A;  2FHD A;  3OBW A;  2JTE A;  2G6F X;  3QJ6 A;  1YJN A;  2KY9 A;  3VRZ A;  3OYI A;  3MET A;  4IIM A;  1K76 A;  3LYI A;  2ZPI B;  3JAM E;  4QVC A;  1YIT T;  2OAU A;  5FWC A;  2M1H A;  1V29 B;  2V8I A;  3GBQ A;  5GMK e;  2KVQ G;  2QA4 A;  1JJ2 P;  5FRM A;  1XTD A;  2CZ6 B;  3WVE B;  4MZT A;  4M78 E;  3LWH A;  3H6Z A;  1K0X A;  3MP1 A;  2IIM A;  1TTH B;  1X75 C;  3OBY A;  2JJ9 A;  2R58 A;  4FW2 A;  2D8H A;  2L3Q A;  4LD9 K;  5LJ5 h;  2CH4 W;  3X20 B;  5D7U A;  1BB9 A;  1QVG S;  1BU1 A;  2RM4 A;  3A98 A;  3DB3 A;  5FLX E;  2FPD A;  1WZO A;  3L2Q A;  1E6G A;  2DD5 A;  1U1T A;  4KUL A;  2K2V A;  3V7R A;  1VQN A;  2CT3 A;  2DL4 A;  4J8O A;  5AT1 B;  4BE1 A;  4FYW B;  1MNE A;  4JZ3 A;  5IHK A;  1NM7 A;  3EGX A;  1EX4 A;  3HRU A;  3OMC A;  4QQD A;  2JW4 A;  1X6G A;  2SRC A;  4C92 D;  4GBQ A;  2ROL A;  3CMA A;  4KH1 B;  5D6W A;  2FL7 A;  2M16 A;  2VWF A;  5FU7 C;  4IKF A;  3OS5 A;  4M7D G;  2NUT A;  4OMO A;  5CIU A;  5GAM f;  3CCV A;  4DBR A;  4JS4 A;  2A08 A;  1XQH A;  3LLR A;  1OYX A;  3VKI A;  3SWN C;  3CCS A;  2CSI A;  4XAX B;  5IT9 E;  4OGE A;  4ZGJ B;  4F04 B;  2XD0 A;  5GAN 3;  2MI6 A;  2CP7 A;  2AZV A;  4LDV A;  2HL5 C;  3HFO A;  1X69 A;  1VQK Q;  5GAM e;  3E19 A;  3C94 A;  4HVV A;  2W10 A;  2JNG A;  2KGT A;  3F70 A;  1MMD A;  4HA8 A;  1M1G A;  2AKK A;  1D0X A;  3EFO A;  4QW2 A;  4BDZ A;  3CCU A;  2J6O A;  1FMK A;  2ZPE B;  4BI3 A;  1NPR A;  4EIK A;  4ZGE B;  1QWE A;  2XG8 D;  4J6W A;  4PLL A;  2C0T A;  1T3S A;  4E7H A;  1TUC A;  2HCK A;  1B07 A;  5J3B A;  1RAB B;  3VYG A;  1R0C B;  4KBM B;  2W0Z A;  1LOJ A;  5LJ5 d;  1H3H A;  3G7Z A;  4QKU A;  4AMC A;  5IHN A;  1OU8 A;  1YNZ A;  1ZHI A;  2EYX A;  5HKC A;  3HTR A;  3P8D A;  5GJV B;  3X24 B;  2C06 A;  3CCL A;  1YI2 A;  2P4T A;  4ORZ A;  1VQK T;  1HJD A;  4M7A D;  2DNU A;  4HCK A;  2EGC A;  1AWW A;  2WSE E;  3G6E Q;  4FYV B;  4IUP A;  1D1B A;  2FVU A;  2QEX A;  1KHI A;  2E4H A;  1UGR B;  1VQ6 A;  2DL7 A;  4K11 A;  2QQA A;  4KGV B;  1VIF A;  1GXI E;  4RG8 A;  2AT1 B;  4X9D A;  4C92 C;  2YWW A;  5KYU B;  3JCM f;  3MO8 A;  2KQW A;  3RR6 A;  3C4S A;  3A5Z B;  4MZP A;  3MEW A;  5AYF A;  2ED0 A;  1D0Z A;  3KBG A;  1U8R A;  1GCQ C;  5KCO A;  1Q82 U;  2JTF A;  1QVF A;  3GNF B;  2M51 A;  3ASK A;  1M90 R;  4XTU A;  1D3B B;  3G6E T;  3FJP A;  1YBY A;  3OYL A;  4QT7 A;  2GBQ A;  3P8B B;  4JRI A;  3UA7 A;  1O75 A;  3HHT B;  3JCM e;  4EMK C;  3OYY A;  4OB1 B;  3HL8 A;  3QII A;  4DOW A;  5CAI A;  1G3S A;  3QWY A;  5CVI A;  1OX9 A;  4OMF B;  2PVD B;  3NTH A;  5GMK i;  3EH1 A;  4V2S A;  4M78 F;  2CRE A;  1K4U S;  3H9N A;  1AWJ A;  3M4G A;  3S3N A;  1RLP C;  3JCM P;  3G71 Q;  1H64 1;  2E5Q A;  1SEM A;  4M78 A;  2RK2 A;  3QZ5 B;  2O01 E;  4C8Q E;  3I35 A;  1K9M R;  1JXM A;  5CKF A;  2HBP A;  3QYG B;  2DXT A;  3CPF A;  5L23 A;  3QDR B;  4FT2 A;  1KIK A;  3E1S A;  1M27 C;  1EZZ B;  4FSX A;  2RJF A;  5GAN j;  2YDL A;  1X43 A;  1GFD A;  2XK0 A;  3H0F A;  4XTY A;  4EMG A;  2KRO A;  3M55 A;  4E7L A;  4PFP A;  4BD3 A;  2RQW A;  2GNC A;  1HXD A;  5LJ3 j;  1IZ6 A;  2F2X A;  5CKH A;  1RUW A;  3FLG A;  5KCH A;  5GAM h;  3OS1 A;  1KC8 C;  4M7A C;  4E7S A;  1WLP B;  4M77 A;  4HCB A;  2LQK A;  1QCO A;  3G71 T;  3C0C A;  1UE9 A;  4JPB W;  5GAN 4;  2GTJ A;  3GNG A;  1FXX A;  4J9F A;  1NJI R;  1M1K R;  3LX7 A;  3RNJ A;  1NE8 A;  2CH4 A;  2HSE B;  4CC4 B;  2I0N A;  2JVV A;  1PG5 B;  3GPL A;  4LXC A;  2RI5 A;  1VQO Q;  1VQ8 Q;  3WXM B;  3S6W A;  2DPP B;  2RQV A; 
#chains in the Genus database with same CATH homology
 1I81 A;  2RI3 A;  1M8V A;  2XKO C;  2JOY A;  5A0L A;  4PJO A;  5CKE A;  4N0A A;  1UB4 A;  2MF2 A;  2G3R A;  2DJZ A;  4N4I A;  2JZ2 A;  3OB9 A;  3P8H A;  1K9M U;  3HRS A;  3CBM A;  1M9S A;  5KE2 A;  3ZBD A;  3FEO A;  4PLI A;  2GCX A;  4C5H A;  4ZGD B;  3OYH A;  2RB6 A;  5FRN A;  1BI0 A;  1M4Z A;  3SWN A;  1B34 A;  2KSS A;  4F7U A;  2RI2 A;  1VQ6 T;  1KQ1 A;  3E9G A;  1KD1 C;  4YTL A;  4RKU E;  5GAN 6;  3AHU A;  2D9T A;  2NLU A;  2RHZ A;  4ZN1 A;  3G6E A;  1M90 C;  2E10 A;  2HQE A;  1BIA A;  1K8A C;  4M77 E;  3OYK A;  2YLC A;  3OW2 A;  1YIJ T;  2K5L A;  4M77 D;  1Y7X A;  4Q5W A;  5GAM g;  2ZPB B;  3CCR A;  2E64 A;  2PUK B;  5GAO r;  2OTL A;  3OA6 A;  2H3J A;  2LDM A;  2B8A A;  3R6O A;  1G3W A;  1WJS A;  2CGH A;  3L2W A;  3HFN A;  3NFC A;  5GAO m;  4NL3 A;  3FC3 A;  1VQO T;  1K73 C;  2RJE A;  4M78 B;  3JB9 G;  3OYJ A;  1VQ8 T;  2LNV A;  4R55 A;  3MEU A;  4BUG A;  3E9F A;  3SD4 A;  2E6Z A;  4J6Y A;  3JB9 J;  5HY6 A;  3JB9 I;  4J5Y A;  3JCM b;  2QQB A;  1YHQ A;  4PJO G;  4OB0 B;  3JCM d;  1NJI U;  3JCM V;  2RH2 A;  3JCM Q;  1M1K U;  4HCC A;  4EPC A;  3V8J A;  5L8R E;  1BI3 A;  4PKC C;  3CCE T;  4Z02 A;  4PJO C;  2D6F A;  4M75 F;  2PU9 B;  2KAF A;  4FIB A;  2EFI A;  4M7A F;  4OGC A;  2JN0 A;  1AHJ B;  5C6S A;  2YLB A;  3L1A A;  4XU1 A;  3M9Q A;  2F5K A;  3VU3 C;  1JJ2 S;  2EJ9 A;  4C0Z A;  1WQ7 A;  4PJO E;  3J7A F;  4F7U G;  2EIF A;  5LJ3 f;  4R56 A;  3CC4 A;  4PJO D;  1X6O A;  3S3M A;  4KT0 E;  5GAN 7;  4RG2 A;  1EIF A;  3L2R A;  4XTZ A;  1BIB A;  1WJQ A;  3JCM h;  5GAN 8;  3HSB A;  1S72 T;  4XQ3 A;  4EMH A;  5CK9 A;  2ZZD A;  4KUD K;  4PNO A;  4X9C A;  4NOY A;  4X34 A;  5LJ5 f;  5GAM d;  1JRI A;  3CCS T;  3QZ9 B;  1WGS A;  1RI0 A;  2YHT A;  4F7U E;  4M77 B;  4XU3 A;  5I21 A;  3L2Z A;  2LT4 A;  2VV5 A;  1VQM A;  3OMG A;  3CD6 A;  2XDD A;  1QP3 A;  4TVR A;  4QQG A;  4A54 A;  1H3Z A;  2M9U A;  3QKJ A;  4C5I A;  2VGN A;  2LCC A;  3RKY A;  4E47 A;  5C0M A;  1W2B S;  5GAM j;  4XTV A;  3CC7 T;  1U1S A;  3DLM A;  1VQL A;  3GP8 A;  2IG0 A;  5CCA A;  4IUR A;  5GAO q;  4FU6 A;  4J7F A;  4NL2 A;  2FHD A;  2DTO A;  3OBW A;  5LJ3 e;  3C95 A;  3QJ6 A;  2Y4Y A;  3JCM X;  5KH6 A;  4LDX A;  2CZ7 B;  4CI0 C;  1YJN A;  1XOV A;  3BY7 A;  3X26 B;  2X4J A;  3KXT A;  1JB0 E;  2KY9 A;  2ZCF B;  5FU6 C;  3CCU T;  3OYI A;  3G71 A;  2ZPG B;  3MET A;  5LJ5 e;  2HNI A;  3LW5 E;  2EAY A;  2O4X B;  3LYI A;  5FU7 B;  2ZPI B;  1WPY A;  4MZM A;  4QVC A;  2DEQ A;  3JAM E;  2OAU A;  1Y71 A;  1YIT T;  1Q86 C;  4M78 G;  4ZN3 A;  1VQP A;  2M1H A;  3TEE A;  4C92 A;  1V29 B;  2JUF A;  4OB3 B;  2X4W A;  3OS2 A;  1IRE B;  4KUI A;  2V8I A;  5CQX A;  1VQ4 A;  4PJO B;  5CQY A;  2OTJ T;  2XID A;  2KVQ G;  4M78 C;  4Y28 E;  5GMK e;  2QA4 A;  2V8K A;  3A8O B;  1XTD A;  3VV0 A;  5FRM A;  2P0Q A;  5DY9 A;  2CZ6 B;  3UT1 A;  4C0G A;  5LL6 S;  3WVE B;  2EWN A;  3DLL A;  4MZT A;  3I56 T;  4M78 E;  4MML A;  3LWH A;  2PQW A;  3M53 A;  3H6Z A;  2AHJ B;  4JJN K;  4BDY A;  3MP1 A;  3HP9 A;  4FM4 B;  3CXC S;  4A4F A;  1RL2 A;  3SWN B;  1B34 B;  4F7U B;  1X75 C;  3SB2 A;  3OBY A;  3G4S T;  3EFR A;  2R58 A;  2GFA A;  3RES A;  3CME A;  1UGP B;  4BI8 B;  3TCJ A;  3CCL T;  3H8Z A;  4BE2 A;  1YI2 T;  3QBY A;  4LD9 K;  3GLX A;  5LJ5 h;  1WNL A;  3CC2 T;  4E7K A;  3JB9 F;  2DXC A;  1N9R A;  1VQ5 T;  4M7D A;  3JCM g;  3X20 B;  3Q1J A;  3OYC A;  4XTX A;  3OYD A;  4LDY A;  2DZC A;  4EMK A;  1QVG S;  1BI2 A;  1YJW A;  3UDC A;  1BYM A;  2RM4 A;  4EDU A;  1M1F A;  4M77 G;  3T9N A;  4BB7 A;  2DTH A;  5GMK h;  3DB3 A;  3DKM A;  5FLX E;  2QEX T;  1W2B A;  1N8R U;  3VUZ A;  3RMQ A;  3L2Q A;  4MDX A;  4B9X A;  2DD5 A;  1U1T A;  4KUL A;  2D0Q B;  4M77 C;  2K2V A;  4C8Q F;  3ER0 A;  4JS5 A;  4VUB A;  2X4Y A;  3RUX A;  3V7R A;  1OI1 A;  1VQN A;  1UEB A;  2P0K A;  2R57 A;  4J8O A;  3L42 A;  3M5A A;  2VXF A;  3FRN A;  4RCC A;  4A4E A;  2KDS A;  4BE1 A;  1Q81 U;  1FX7 A;  1VQ4 T;  3VYH B;  1KHC A;  2E70 A;  1YIJ A;  4A53 A;  2K5I A;  3ME9 A;  5GAN 5;  5FU6 B;  1OZ3 A;  2LCL A;  2RO0 A;  3JCM c;  1R8O B;  3MEV A;  2M0O A;  4A4H A;  2QQS A;  2EQJ A;  4C8Q A;  1VQ7 T;  2BIV A;  3HRU A;  3OMC A;  4QQD A;  4C92 E;  1MGQ A;  1LNX A;  2LX9 A;  1VQ8 A;  2K3Y A;  2QXF A;  5DLO A;  4C92 D;  3CMA A;  3RER A;  2EQK A;  5D6W A;  2FL7 A;  3EAE A;  2M16 A;  5J39 A;  5FU7 C;  3PMT A;  2MMP A;  3OYB A;  4IKF A;  1UGQ B;  2LRQ A;  3I55 A;  4PL6 A;  5GAN f;  2LT1 A;  2XDP A;  3OS5 A;  4M7D G;  3J81 E;  3OYA A;  3JRZ A;  2GF7 A;  3FDR A;  4N0A C;  3J80 E;  2ZGW A;  3FIF A;  3CXC A;  1KC8 U;  4M7D C;  5CIU A;  5GAM f;  2DAQ A;  3CCR T;  4OB2 B;  3CCV A;  3PMI A;  2OTL T;  5GAO n;  4IUV A;  4LDW A;  4JS4 A;  2RA2 A;  2RK1 A;  4L59 A;  2DVE A;  3PFS A;  1XQH A;  2MWO A;  4M7D E;  3LLR A;  1N6A A;  3DB4 A;  1OYX A;  4M75 A;  3CPW A;  3VKI A;  1XNI A;  1ZBX A;  3SWN C;  5A2Q E;  4M7D D;  3FB9 A;  4RCB A;  4M7A A;  3CCS A;  3OSS C;  5M9O A;  1FWZ A;  1K9M C;  4XAX B;  3EFS A;  1QVG A;  1D3B A;  5IT9 E;  4OGE A;  2I2L A;  5KE3 A;  5GMK m;  3QYH B;  3CBP A;  1N8R C;  4ZGJ B;  3QXE B;  5A0D A;  5GAN e;  4E7I A;  5GAN 3;  2XD0 A;  2MI6 A;  1N9S A;  2GQV A;  3CC7 A;  4LDV A;  2ZPF B;  3HFO A;  2XIC A;  5GAM e;  3E19 A;  3C94 A;  5IAY A;  4C92 B;  5CKD A;  2JTM A;  4N4H A;  2JNG A;  3KUF A;  1I4K 1;  3CC4 T;  3F70 A;  4BAC A;  4HA8 A;  5I2M A;  2R5M A;  1M1G A;  2LVM A;  3NTK A;  4JUV A;  4QW2 A;  4FT4 A;  4J7I A;  2E65 A;  4C8Q D;  2E41 A;  2HD0 A;  2K4Y A;  4BDZ A;  2L89 A;  2MAM A;  3CCU A;  4LD6 A;  4C5G A;  4O5V A;  2ZPE B;  4BI3 A;  1NPR A;  2IVW A;  4QVZ A;  3PTA A;  4CRI A;  5LJ3 d;  4ZGE B;  2XG8 D;  4J6W A;  2HQX A;  4HKE A;  4PLL A;  4E7H A;  3GF5 A;  3SFM A;  3CD6 T;  5J3B A;  3RIR A;  3BDL A;  4J6X A;  4M77 F;  2EJG A;  4OF1 A;  2CS7 A;  5J26 A;  2OTJ A;  4JDS A;  3VYG A;  3CCQ A;  1YJ9 A;  1NJI C;  2EYQ A;  4ELY C;  3WVD B;  5GAN h;  4KBM B;  5GAO l;  1M1K C;  1LOJ A;  2CKK A;  5LJ5 d;  4IUU A;  4M7A G;  4M7D B;  4LDU A;  1VQ9 T;  1YCY A;  1K8A U;  2Y4X A;  3G7Z A;  2YRV A;  1QVF S;  5HK3 A;  2EQU A;  3UPU A;  4EMK B;  3M58 A;  3CCM A;  4DA4 A;  1Q7Y U;  5HKC A;  1ZHI A;  2DZ9 A;  3CCJ A;  1YJN T;  5LJ3 h;  3ZEH A;  5LJ5 j;  3G4S A;  3P8D A;  1WJR A;  2ZPH B;  4M75 E;  3CC2 A;  3HKS A;  5CR2 A;  4BY6 B;  3X24 B;  2C06 A;  3CCL A;  1YI2 A;  2EJF A;  1G3T A;  2P4T A;  2PVG B;  3OYG A;  4M75 D;  4M7A E;  4ZTF A;  1K73 U;  1VQK T;  3MP6 A;  4M7A D;  3ZFJ A;  4ATO A;  2RJC A;  5GMK j;  2CYZ B;  1VUB A;  2VXE A;  2Y90 A;  2WSE E;  2DIQ A;  2DTI A;  5A0G A;  3CPW S;  2E1H A;  2GFU A;  2QQR A;  3QO3 A;  4IUP A;  2QA4 T;  5I2S A;  3MP8 A;  4BE0 A;  3QG1 A;  4N4G A;  2FVU A;  2QEX A;  4PJO F;  4GY5 A;  1KHI A;  4C8Q B;  2PVO B;  1DJ7 B;  3INZ A;  2DIG A;  5D6Y A;  1SSF A;  1UGR B;  1OZ2 A;  1VQ6 A;  1WQW A;  1NPP A;  2L3R A;  2RJD A;  2A3L A;  2LTO A;  2EQM A;  2XI9 A;  3QPH A;  4DOV A;  3OYE A;  2K5F A;  2QQA A;  3PT9 A;  3URG A;  4C92 G;  1VIF A;  4JRQ A;  3CME T;  3LGL A;  2CZ0 B;  1GXI E;  4F7U F;  2CZ1 B;  4RG8 A;  3RKX A;  4ELZ C;  4HT8 A;  2DXB A;  4GLK A;  2DXU A;  1HK9 A;  4X9D A;  4C92 C;  3OS0 A;  1VQ7 A;  2KMT A;  3JCM f;  3NTI A;  2BUD A;  3TU4 K;  2XHC A;  2KK4 A;  3MO8 A;  3TRE A;  1QVP A;  3HPW A;  4D6W A;  2KQW A;  1VQO A;  1LJO A;  1YJW T;  3C4S A;  2F5T X;  3A5Z B;  4UC4 A;  4MZP A;  2RHI A;  3MEW A;  3N5B B;  5AYF A;  4NS5 A;  1Y96 A;  3V7S A;  3OY9 A;  2V8J A;  3KBG A;  2QQ9 A;  3OSV A;  4RMO A;  5KCO A;  4Y91 A;  1U8R A;  4M75 B;  1Q82 U;  2R5A A;  2DKG A;  2JTF A;  1VQN T;  5FRO A;  5GAN g;  3GNF B;  3PNW C;  4M7A B;  3ASK A;  4L5G A;  3CCE A;  1QVF A;  2QTX A;  2VUB A;  4JRK A;  1M5Q 1;  1D3B B;  4XTU A;  3G6E T;  3FJP A;  4JRP A;  1YBY A;  2PUO B;  2LQ8 A;  3OYL A;  1Q7Y C;  2WAC A;  4FL6 A;  3A8L B;  4WF2 A;  3P8B B;  4JRI A;  5D6X A;  4L6V 5;  4E7J A;  2WSF E;  4MMK A;  5CO7 A;  1O75 A;  4BI4 A;  3HHT B;  2RHU A;  4IUT A;  5LJ3 g;  3JCM e;  1Y07 A;  5GAO p;  4EMK C;  1KQS S;  2DD4 A;  3OYY A;  4OB1 B;  4C0F A;  3JB9 H;  3HL8 A;  3QII A;  4DOW A;  3M59 A;  3UWN A;  5CAI A;  4ME7 A;  1G3S A;  2RHX A;  3A8G B;  3X28 B;  5CVI A;  4B9W A;  1Q86 U;  1TH7 A;  2QDY B;  3GIB A;  2K3X A;  2PVD B;  4OMF B;  3NTH A;  3QUI A;  4BY6 C;  1S72 A;  5GMK i;  3L2V A;  3CMA T;  4V2S A;  1O9S A;  4M78 F;  5LJ5 g;  5CKB A;  1YHQ T;  4QQ6 A;  3M4G A;  1MHN A;  3I55 T;  3VUB A;  3OQ5 A;  2RD1 A;  3CEY A;  4C8Q G;  3S3N A;  3VJP A;  4JLG A;  3JB9 D;  1W4S A;  1PSF A;  3V8K A;  3JCM P;  1ZQ1 A;  3GOX A;  4C8Q C;  1H64 1;  2E5Q A;  2VGM A;  3QHS A;  2A7Y A;  4M78 A;  1BKB A;  2RK2 A;  4OVA A;  1QW1 A;  3CCV T;  1Q81 C;  2L5Q A;  3MHX A;  3MCA B;  1NZ9 A;  3QJY A;  5GAN d;  4C0D C;  1KQ2 A;  3PIP A;  2DK3 A;  1I5L A;  2E6N A;  3HRT A;  1BI1 A;  5DLQ E;  3QZ5 B;  1G5V A;  2O01 E;  3A8M B;  4C8Q E;  2X4X A;  4P5N A;  5CKF A;  2HBP A;  3QYG B;  2DXT A;  3LWI A;  3CPF A;  4XTW A;  3QDR B;  4FT2 A;  3BDU A;  3E1S A;  1VIE A;  4FSX A;  1P92 A;  2RJF A;  4II1 A;  4O6J A;  3BW1 A;  3OYM A;  5GAN j;  1KG1 A;  3SDZ A;  1YIT A;  2K57 A;  3PGG A;  1PSE A;  2XK0 A;  5EG2 A;  1VQM T;  3M54 A;  4XTY A;  2LC4 A;  4EMG A;  1N27 A;  3M57 A;  3C12 A;  3M55 A;  4E7L A;  1Q82 C;  2DO3 A;  1KD1 U;  4BD3 A;  3JCM W;  3OYF A;  2P0P A;  2X35 A;  1VQ9 A;  4M75 G;  1HXD A;  5LJ3 j;  3V8L A;  1VQL T;  1UGS B;  2FB7 A;  1M90 U;  3JSC A;  1IZ6 A;  3L2U A;  2MWP A;  3M4Y A;  4MDW A;  4HT9 A;  4A4K A;  4C92 F;  4M75 C;  3I56 A;  2RHY A;  5CKH A;  3FLG A;  5GAM h;  5KCH A;  1KC8 C;  3OS1 A;  4M7A C;  3S3O A;  3RKW A;  2VYT A;  4DQ2 A;  2VC8 A;  4M77 A;  4QVD A;  1KQS A;  4XK8 E;  3OW2 S;  2XU8 A;  3LGF A;  2XDB A;  4J83 A;  3RMS A;  3QSU A;  4A4G A;  4HCB A;  1JBM A;  2LQK A;  3V7C A;  1VQK A;  3G71 T;  5IN1 A;  2WSC E;  1X01 A;  4HCZ A;  3PIO A;  5GAN 4;  2FYK A;  3GNG A;  2E12 A;  1FXX A;  3CBO A;  1VQ5 A;  1G3Y A;  2F69 A;  3LH0 A;  1VQP T;  3CCQ T;  3LX7 A;  5HK0 A;  1YJ9 T;  4IUQ A;  1NE8 A;  3OYN A;  4XU2 A;  4XU0 A;  3JCM J;  3O8V A;  2JVV A;  3MEA A;  2BKD N;  1I8F A;  5DM7 R;  3GPL A;  4OP0 A;  1JJ2 A;  2HAX A;  2L8D A;  3A8H B;  4M7D F;  2QI2 A;  3X25 B;  3M56 A;  2EKO A;  5GMK l;  3CCM T;  4M78 D;  4C5E A;  4C0D B;  3CCJ T;  2O4X A;  2RI5 A;  4JLI A;  5GAN 2;  1Y96 B;  3WXM B;  3S6W A;  2DPP B;  4ZTJ A;  3BFM A;  1QP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...