5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
4F7UE 4J5YA 5GANf 4M77B 4M78A 4QVDA 5LJ5j 4PJOA 3V7CA 2E41A 2ZGWA 4M75F 4XU2A 4PJOC 2EJFA 4M77A 4A53A 4M7DC 4C8QC 4XU3A 3JCMJ 5LJ3j 2FB7A 4M78B 2EJGA 4PJOF 3SWNC 5GAN4 3JB9I 1KQ2A 2RM4A 4XU0A 5GMKi 1B34A 3QO3A 4J6XA 4M7AA 1BIAA 4XU1A 2VXFA 3EFSA 3JB9F 2DEQA 1KQ1A 1LNXA 2RD1A 4C8QG 5LJ3d 5LJ5h 4EMGA 3HFOA 2E10A 2CGHA 5LJ5f 1N9RA 3INZA 4C8QF 4PJOE 5LJ3h 2EAYA 5GANe 1D3BA 4PNOA 2FYKA 3FJPA 3FIFA 4Y91A 5GMKh 5GAOr 4M77G 4NOYA 5GAN2 4M75D 1M8VA 2DTOA 4M7DG 5GAMe 4C92E 3JCMc 1I5LA 3RERA 4F7UG 4M7DE 3JCMb 4JRKA 3BDUA 4M75G 2E1HA 1U1TA 5GAN8 3HSBA 2JN0A 5GAMg 2VXEA 4F7UF 5GMKl 4M75A 4NL2A 1I4K1 1YCYA 5GMKj 4M77F 4N0AA 3JCMh 5LJ5e 5GANg 3BY7A 2YLBA 5GANd 2DJZA 4C8QA 2DKGA 4JLIA 4V2SA 4HT8A 4WF2A 4C8QE 3JCMd 5GAMd 4NL3A 3RIRA 4C92A 3JB9J 4M7AG 2Y90A 2VC8A 1HK9A 2HNIA 2DZ9A 1WQWA 3M4GA 3GIBA 4M7AF 1N9SA 4OP0A 4XTUA 3EFRA 3L2ZA 4J6YA 5LJ3e 5GAOp 4MMKA 1WPYA 3SWNB 4C92D 4XQ3A 4C92G 5LJ3f 5GMKe 3HFNA 1X01A 4RCBA 4C8QB 5CAIA 4M7DD 5GMKm 4M7DB 1I8FA 2I2LA 4M77D 2QTXA 1I81A 3RESA 3PGGA 4F7UA 4M77C 5LJ3g 3JCMe 5GAOm 2RA2A 3V7SA 4M78G 4C92F 2DZCA 2E65A 2EJ9A 3L1AA 4M78D 3QHSA 4M7DA 5GAMj 5GANh 3JCMV 1LOJA 4XTWA 4EMKA 1JRIA 3QSUA 3BFMA 4A54A 3JCMQ 5GANj 4M7AE 5I21A 4M7AD 2DXTA 4PJOD 4EMKB 2EWNA 5GAOn 3JCMW 4C92C 2DTHA 4DQ2A 5GAMh 4JUVA 4M75E 4HA8A 3JB9D 4MMLA 4M75B 1U1SA 4M78C 2DVEA 1LJOA 4J6WA 4X9CA 4XTYA 1WQ7A 1B34B 4M7AB 3RKXA 3RKWA 3JCMg 3BW1A 4QVCA 2YLCA 4JRIA 4M78F 4PJOB 4M77E 5DY9A 1MGQA 3RUXA 3QUIA 3SB2A 3SWNA 3V8LA 3RKYA 5GAN5 4M78E 5LJ5d 5GAOq 4HT9A 4XTVA 4XTXA 4N0AC 4M7DF 4M7AC 4M75C 1H641 2DTIA 2RB6A 5GAN7 3JB9H 3JCMX 4EMHA 1WNLA 2K57A 3V8JA 3V8KA 2DXUA 4X9DA 1JBMA 4C92B 3AHUA 1D3BB 5GAOl 4EMKC 1Y96B 3FB9A 4C8QD 1TH7A 3JCMP 3JB9G 1HXDA 3VU3C 2E64A 5GAN6 5LJ5g 4RCCA 5GAN3 1M5Q1 1Y96A 1BIBA 2YHTA 4PJOG 3V7RA 5GAMf 4XTZA 3JCMf 4F7UB
chains in the Genus database with same CATH superfamily
2GNCA 1OPLA 2LJ1A 2CH4W 1KD1C 2X35A 4C0ZA 3G71Q 3JCMJ 1MMGA 2NUTB 3GF5A 3EG3A 4J6XA 4XU1A 5KYUA 1VQ5Q 2IPOB 1Z9ZA 2QI2A 2FVUA 5LJ3h 2XMFA 4PNOA 2FYKA 1Q82R 3VYHB 2COWA 3MCAB 3OS0A 1M8VA 1K73R 5GAMe 1G83A 4C92E 2QQSA 2QDLA 3HSBA 1PRLC 3META 5FU6B 1M27C 4JLIA 1X69A 4BI4A 1D1CA 3CMAA 3NTHA 3CCJQ 4C92G 5LJ3f 5I11A 1VQMA 2PVOB 5I22A 3CCJT 3GOXA 2XI9A 3ME9A 3LH5A 4M78D 2HKNA 4JLGA 2DMOA 3X20B 1UGRB 3A5ZB 1K9MU 2EQUA 1GCPA 1TOVA 1QVGS 5CKBA 3DLMA 5M9OA 1SSHA 2ENMA 1WQ7A 4P5NA 1WHHA 5A0LA 4N0AC 3OYJA 4IKFA 3Q1JA 3OYIA 2MMPA 1GFDA 5HK3A 2QAZA 1BI1A 1YHQQ 1FMWA 3LH0A 2P0PA 4Y92A 4AMCA 2V8IA 1IXDA 4HKEA 4XU3A 3X28B 1UG1A 2JMCA 1KFZA 2KRSA 3TSZA 4R55A 2CT3A 3JAME 1Q86U 5L23A 1M1KR 3INZA 5D7UA 1NEGA 1P92A 5KH6A 3UDCA 3FJPA 2Z0WA 4ELYC 1SF9A 3MHXA 5HK0A 1ZSZA 4C5GA 4M7DG 4F17A 3RERA 4M75G 5KYXB 3S3NA 1WXBA 1OOTA 5FWCA 2BKDN 2E3IA 4PKCC 2O9VA 4BB7A 3QWXX 3BY7A 3CMET 3M59A 4HT8A 2JVVA 2J6FA 1UTIA 2JXBA 4YTLA 2D9TA 1N9SA 1VQPT 1KJWA 2A28A 4Y28E 2DAQA 1WPYA 4JJBA 3SWNB 2JMAA 5FU7B 2VVKA 1VQPQ 1M90C 3CD6Q 4C8QB 2YSQA 1EX4A 4F7UA 3CD6T 1KD1R 4ME7A 5CO7A 4FYYB 2HKQB 3HTRA 4E47A 1JRIA 3RBBB 5A0GA 2DE0X 3OYHA 1GBRA 3CCVT 4M7AD 4D6WA 1AWWA 3F70A 1QVGP 2EWNA 5IHKA 1ZX6A 4JUVA 2ED0A 3A1PA 3EAEA 4WTOB 2JUFA 2F1LA 3HP9A 4IIMA 1K73U 1NEBA 3E1SA 4DBFA 2E4HA 4GY5A 1G3YA 1S72A 3A8MB 1CKAA 1WNLA 3C95A 3V8JA 4C92B 4D8DA 2G3RA 3E9FA 1YJ9Q 1XJWB 1VQKQ 1UB4A 3JB9G 2O4XA 4ZTFA 3VU3C 2RI2A 1C0MA 5AYFA 2YHTA 5GJWB 3V7RA 2HL3A 1N8RC 2CP0A 3A8OB 1WHJA 3UPUA 1PNJA 1TUGB 1K0XA 2E41A 3CC7A 4MZPA 1I1JA 3I55Q 3CC2Q 1WXUA 1Y0MA 1ZUYA 2FPFA 2JW4A 3EG2A 2RM4A 2I0NA 1M4ZA 5LJ5f 1VQ8A 3CCRA 1NM7A 2ECZA 3ULRB 3CD6A 4R0KA 2KXCA 1TSFA 1IHVA 2D8HA 4IUQA 4C0GA 5HY6A 1H3ZA 1KHIA 4QQ6A 3EHQA 2GF7A 2B86A 3G4SA 1Q82C 2FEIA 4PJJA 1R0CB 3H9NA 2IIMA 1WQWA 3WXMB 1QP3A 3EFRA 4C92D 1M1GA 4RCBA 2L5QA 2YUQA 2RJFA 3LWIA 3QJ6A 2KVQG 1VQOT 2M1HA 2OAWA 2OI3A 2OTLA 2EJ9A 3A8GB 3QHSA 2CZ1B 3I55A 3TREA 2EGAA 2EPDA 3KFVA 3S3MA 2LDMA 4IUVA 3KBGA 1WFWA 4C5IA 2L0AA 2R57A 1RI9A 1KQSS 1U06A 5KYWA 5EC7A 1NYGA 3EFOA 3SHWA 2X3WD 4OGEA 5GAN5 4HT9A 4XTVA 4XTXA 1ZHIA 2P4RA 2KGTA 2VB6A 1UHCA 2SEMA 4DOVA 4RKUE 2BZ8A 2CDTA 3BE3A 3NMZC 4HVUA 1SRLA 4UC4A 1HSQA 2X4YA 4QT7A 1OZ3A 2EKHA 1R77A 1Q81C 2KR3A 5GAMf 1NLPC 3I5RA 2LJ3A 4XTZA 3O5ZA 1VQNQ 3CCMQ 2HZYA 5GANf 4B9WA 1KQSA 1VQNT 1VIFA 3UATA 4RTWA 2DF6A 2NUPA 5GMKi 5KCOA 3M54A 3G1JA 2KK4A 3G71A 1WYXA 1KD1U 5KYUB 3J80E 3PMIA 2M0OA 2E10A 1JXOA 4JS4A 4NOYA 2DA9A 3FRNA 4C0DC 8AT1B 4FW2A 4LE9A 2KMTA 1IB8A 3M58A 2KT8A 4CC7A 5GANd 3UA7A 1BYMA 4C8QA 3RNJA 2CZ7B 1QVPA 2J6KA 2DL3A 1WJRA 3S3OA 2CP3A 1TWBA 3UA6A 3CCLT 1IGUA 1AZGB 2YUNA 3NHNA 1QQJA 3RESA 4M77C 2DL7A 3X25B 2RH2A 2DIGA 1Y7XA 2D6FA 2R5AA 2GCXA 1JO8A 3JCMQ 1K8AU 2AIRB 5I2SA 2DXTA 3FC3A 1R0BG 1W2BA 2C0IA 4C92C 4Z02A 1D0ZA 3CPWA 3QWYA 2QEXA 1QKWA 3CC4T 4JDSA 4MZMA 4FYVB 2FZCB 4X9CA 4M7AB 1W1FA 1YFNA 1K9MC 4OGCA 1MGQA 3V8LA 1PC0A 2F5KA 2CREA 3QZ9B 4DBQA 3OYLA 3M57A 4FYWB 2KE9A 4OMOA 2DYIA 2EVRA 2V1RA 5DLQE 1JBMA 2HSPA 2DXCA 4JZ4A 1X27A 3OYKA 4C8QD 2HL5C 3G4SQ 4J9EA 3QPHA 5GAN6 2MPXC 2DRKA 2FL7A 2X51A 1WDXA 1MV3A 3UF4A 2NYSA 5LJ5j 4DEXA 3CCSA 1WXTA 1M3AA 2MK5A 4C8QC 2HCKA 2EJGA 4FT2A 1IREB 3CCMA 4M7AA 1BIAA 4PFZA 3EFSA 3JB9F 4L6V5 4GLMA 3FJ5A 2E6NA 3OYDA 4E7SA 2YXYA 3VS2A 1JJ2P 5GANe 2EAYA 2K2MA 4LDVA 1VQNA 4M75D 1KC8C 2F5TX 2KYMA 1D09B 1RAIB 3MO8A 3OYMA 2FRWA 3G7ZA 1QP2A 5EG2A 2YUOA 4K11A 1VYUA 2YLBA 4C5HA 1K4US 3CCUT 2XU8A 4C92A 1TXQA 1E6HA 3CCUQ 3CC4A 2JTEA 3GIBA 4M7AF 1WHGA 1YI2Q 1VQ9T 2BE9B 3L2ZA 5FLXE 3OYCA 3KXTA 2QXFA 2YRDA 3OS1A 5CKFA 3ZL7C 3QDRB 1YI2T 3CC2T 2M16A 2VV5A 4RUGA 1YBYA 3NFCA 3FEOA 2RA2A 2QGGA 2J06A 1D0XA 3OYBA 2E65A 4L59A 5J3BA 4A54A 3M5AA 4M7AE 3J7AF 3CCLA 2LP5A 1RL2A 4EDUA 2FO0A 4AG1C 3OYFA 2RQWA 2KI7A 3OW2P 2DVEA 2VUBA 5A2QE 2EQIA 3CC7Q 1KQSP 4BE1A 1UGQB 3M0RA 1RLPC 1XTDA 2KXDA 4OMQA 3VV0A 4M7DF 4M7AC 1ACMB 3EHRA 2JM9A 2DBMA 4X9DA 3PIOA 1BI2A 1OX8A 1TH7A 4PJLA 1VA7A 2CT4A 2G6FX 3TVTA 1VQLT 1ZSGA 4BUGA 2AK5A 3PTAA 3VYGA 3I56A 1WHLA 4M77B 4QVDA 1LVKA 1VQPA 3EG9B 4J7FA 2CUBA 3A8HB 1NG2A 4DA4A 2FZGB 1TUCA 3TQ7P 1TG0A 1V76A 1AWJA 1RACB 3BDLA 4C8QF 1VQKA 5CVIA 3OMCA 5FU6C 4JRPA 3QYHB 3CCVQ 1K9MR 1I5LA 1FMKA 1QWEA 1LCKA 2V8KA 4C0DB 2ABLA 1WGSA 4N0AA 2YWWA 3WVDB 1G2BA 2RK1A 2DYBA 4C8QE 2WSFE 3EG1A 3OYAA 3OYYA 4DOWA 5FRNA 3H8ZA 1KC8U 1ZLMA 1PSEA 5CAIA 1WZOA 1O9SA 2L3QA 2GTOA 5KYWB 4C92F 2GFAA 4CC2A 4E7ZA 4AFSC 4DEYA 3NGPA 4FIBA 2PNIA 3BFMA 4IURA 3VRZA 5GANj 2CYZB 2PTKA 2QQ9A 3HRSA 1W2BP 3SFMA 2RHXA 1VQ7Q 2DRMA 2LVMA 3NPFA 4ZGEB 1VQ7T 4F14A 2KNBB 2QDYB 4M75E 2PVGB 3EGDA 3VS7A 1LJOA 3URGA 3G6ET 1G5VA 1Q86R 1JU5C 2M0YA 4J9FA 2EGEA 3QUIA 1IRXA 3SB2A 3SWNA 3OYNA 2ZAEA 1GBQA 1EFNA 4GLKA 2KRNA 3TEEA 1HXDA 1QCFA 1C6VX 1EZZB 2KEAA 3HL8A 4OMNA 3PT9A 4RTTA 3D7SB 4OMFB 2EYWA 4M78B 2ZPIB 1KQ2A 2HD0A 1J3TA 2PUOB 1PCXA 2DEQA 1OPKA 5LJ3d 1KSWA 4A4KA 4RTUA 2DL4A 3HFOA 2AKLA 2EIFA 1D3BA 2FZKB 4KUDK 2H3EB 1NPPA 1XOVA 3UWNA 2PU9B 1YITA 1U8RA 2YDLA 5KE3A 1N27A 2W10A 4Z8AA 1M90U 3EH1A 2LC4A 4QQDA 4TVRA 1E6GA 2VGMA 1RAEB 4OP0A 4XQ3A 3HFNA 1A0NB 2QTXA 2RPNA 3I5SA 2DFUA 3DB3A 1GXIE 2D0NA 2MF2A 3CPWP 3ER0A 3JCMV 2YRCA 1X2QA 3SEMA 3MP1A 2F69A 2KSSA 2OTLT 1X2KA 2DTHA 3OW2A 2OTLQ 3CCJA 3PMTA 3LX7A 4RTYA 2QASA 1G8XA 1M8MA 3L42A 1YIJA 3CQTA 3TSWA 4M78E 1UGVA 1BB9A 2KY9A 1BBZA 3VJPA 4M4ZA 4II1A 4X34A 2O9SA 3ZBDA 2FHDA 5CKHA 3HKSA 1V29B 2F2VA 4HVWA 4ZTJA 3VRYA 4JJDA 1MNDA 2LQWA 2M02A 2YUPA 3OS5A 3NTIA 2MCNA 1YJWA 5D6WA 2LQNA 1GFCA 3MPUB 2ZCFB 1UUEA 9ATCB 4BACA 3CCLQ 1KC8R 2RHYA 5GAN4 2FPEA 3SWNC 3CBOA 4OB0B 4GBQA 2C06A 2GFUA 2XDPA 2LRQA 2VXFA 3JRZA 3OS2A 2WSCE 3I56T 2K5LA 3CC7T 2CGHA 4J9DA 3CCST 4RG8A 3ZEHA 1VQ6A 2OTJT 2A7YA 4M7DE 2JTMA 3JCMb 2MWPA 4J9HA 2C0OA 1UGPB 1AEYA 3CC4Q 1X6GA 5GANg 2ROLA 4BY6B 2FPDA 3JCMd 5GAMd 4LNPA 5C6SA 3C94A 3NTKA 1PRMC 2XDDA 2P84A 4J6YA 3VKIA 3CCRQ 3WVEB 1SHFA 5L8RE 3JSCA 2CZ0B 3G4ST 3CXCS 2EGCA 1YJNQ 1UE9A 1M2VA 3M0SA 1YJNT 5GAMj 1Q7YU 2O01E 1SKUB 3QXEB 3VS6A 1AT1B 1BU1A 2DVJA 2AHJB 2ZPEB 4EMKB 3JCMW 4ZN1A 4DQ2A 1S72Q 1XQHA 4NL3A 3EFOB 4AFQC 5LJ3e 1JQQA 3MEAA 2CP2A 3OB9A 4BDYA 4JPBW 2E5QA 3EGDB 5GAOq 1WJQA 2GQVA 2XD0A 1RUWA 1UJ0A 1Y96B 3FB9A 3CPWS 1Q86C 3JCMP 5FWBA 1UFFA 4PK4A 3H6ZA 4J83A 4RCCA 2K79A 2AT1B 3RMQA 4J7IA 1M90R 2EW3A 2Y4XA 2KQWA 5J26A 3T9NA 4XU2A 4M77A 4M7DC 2ROTA 5IH2A 3CMAT 5IN1A 1N8RU 1OV3A 2DL5A 2XICA 3CC2A 8ATCB 1ARKA 2DLPA 1YJWT 3J81E 2RHIA 5A0DA 3FIFA 4E7IA 4ORZA 3TU4K 4PLIA 3AT1B 3JCMc 5CK9A 2M51A 1YHQA 2LT1A 2JN0A 1QCNA 2DM1A 2VXEA 2M9UA 3VS5A 1TU0B 2LT4A 4NL2A 3LLRA 1YCYA 4RTVA 1MHNA 3LGLA 3DLLA 2O4XB 3OYEA 1OI1A 3LGFA 2X4JA 2EQJA 4V2SA 1AVZC 2OX7A 4WF2A 1KIKA 4B9XA 5IXBA 4EIKA 3C0CA 5KCHA 1PSFA 1QW1A 5FROA 3THKA 2DETA 1ABQA 4XTUA 4MMKA 3HRTA 3MKDA 1I8FA 2LCSA 5GAOm 4PJMA 1K8AC 3FDRA 1VQOQ 3C12A 3PIPA 4EMKA 4EPCA 3QSUA 2K7AA 4OMLA 2PQWA 1TUDA 1BI3A 3QZ5B 4FT4A 3E2UA 4A63B 5I21A 1UJYA 3GP8A 2K9GA 3JCMg 2EBPA 3VUBA 4JRQA 3QIIA 2MOXA 2JM8A 1XNIA 1GCQA 1KHCA 4NS5A 2RI5A 4JZ3A 4PFPA 2EYXA 1ZQ1A 2MAMA 3PVLA 3V8KA 2V8JA 2H8HA 4OB3B 3DKMA 3GNFB 2OJ2A 4BDZA 5LJ5g 5GAN3 3PE0A 4PJOG 1CSKA 2D1XA 1PD0A 2NUPB 1M3CA 2VKNA 2JS2A 1MNEA 7AT1B 1VQ4A 1RAAB 3OQ5A 4OB1B 1VQOA 5IAYA 4KGZB 2O31A 4AT1B 3MEVA 1YJNA 2A08A 1MMDA 3JV3A 4CI0C 4QW2A 4DBHA 5AT1B 4KRTA 3UT1A 3VUZA 2E1HA 2KBTA 1YJ9A 1YN8A 4F7UF 1K1ZA 1FMVA 2CUDA 4M77F 1PHTA 2V26A 2DJZA 4RMOA 4ESRA 3LW5E 3H0HA 2EYQA 2LCCA 2VC8A 1HD3A 3M4GA 1FYNA 3M0QA 1YIJT 2IG0A 4PL6A 3CBMA 1T0HA 4M7DD 2A0FB 5KYYA 3ZFJA 2DD5A 2CH4A 1GCQC 1TTHB 3I56Q 1IO6A 4RG2A 3L1AA 1K9AA 4RTZA 3CCVA 4FSSA 1VIEA 4N4GA 2MYSA 1M9SA 3VS4A 2Y4YA 4A4EA 4B6MA 1RABB 2P0QA 1N8RR 2COZA 2HMAA 5GAMh 2K3XA 2E70A 3A98A 2LZ6B 3CCQA 4M75B 4M78C 4J6WA 1B34B 4PJOA 4LD9K 4MZTA 4JRIA 1F1BB 1T3LA 5CCAA 1YWOA 1Z9QA 4F16A 4CRIA 1ZSZB 1PKSA 2WACA 2CP5A 4CC4B 1UDLA 3H0IA 2RQTA 3JCMX 5CR2A 4HCZA 3CEYA 1BCMA 3GNGA 3AHUA 1D3BB 4LDXA 4BI8B 2QYZA 1NYFA 1PG5B 2RHZA 2FG0A 2K2VA 1GRIA 1AOJA 4F7UE 3G71T 3HHTB 4J5YA 3EG9A 5J39A 3MP6A 1SRMA 3FLGA 1EIFA 2JTFA 4QQGA 5LJ3j 5DM7R 2L3RA 3JB9I 1NBEB 2P4TA 1B34A 3QO3A 1B07A 2HBWA 3R6OA 4C8QG 5LJ5h 1M1FA 3PFSA 4A4GA 1NJIR 4N4HA 2NUTA 2L2PA 3P8HA 2LNVA 2LQKA 2LX7A 3EGUA 4JRKA 3BDUA 2NUZA 2CP7A 1SHGA 4M75A 1W2BS 3JCMh 4J9IA 2O2OA 1W6XA 3R6NA 4F04B 2XK0A 2BZXA 1YWPA 2DEUA 3CCQT 2H3JA 2VYTA 1QMCA 2V1QA 2X9HA 5GMKe 3OW2S 2EQMA 1V1CA 4J9CA 4OF1A 1I81A 2J6OA 3L2RA 4Z89A 1WJSA 1YJWQ 2NWMA 2KAFA 4ZN3A 1YP5A 4FW1A 5GAOn 1VQ4Q 1I5OB 2GBQA 3REBB 2COYA 2K3BA 2W0ZA 3BW1A 1ZUUA 3CCSQ 2QQBA 3P8BB 1QVFP 4MDXA 2CSIA 1BK2A 4QKUA 2KROA 1H8KA 1VYVA 2RHUA 3QG1A 3QJYA 1YHQT 4QVZA 1BI0A 2X3XD 2K5FA 2KYBA 1VQLQ 2DERA 4M78A 3CCRT 2EJFA 4A53A 1ZA2B 1MMAA 2LX9A 1PM3A 4KGVB 1WHKA 1Y57A 4AG2C 1G3WA 1LNXA 2RD1A 3M0TA 4IUTA 1QVFA 2BUDA 4Y91A 5GMKh 4M77G 5CIUA 5GAN2 2DTOA 1QWFA 1Q81R 4HCCA 4Q5WA 3M55A 4L5GA 1O75A 2HSEB 2EFIA 1S72T 5GMKl 4E7HA 1ZA1B 1BKBA 4BE2A 4N4IA 5FU7C 1SPKA 5LJ5e 5KYYB 2DKGA 2E3HA 1RLQC 1VQMT 1OULA 3VS1A 2ZPFB 3RIRA 4C0FA 1YCSB 5LL6S 3L2UA 4RTXA 5GAOp 1W4SA 5GJVB 4E7JA 4O5VA 3M0PA 4OMMA 1LOJA 2PUKB 3X24B 1Q82U 3TCJA 2GGRA 2DBKA 3EGXB 3CBPA 1X75C 3CMAQ 1U3OA 4LN2A 2HEQA 4PLLA 4HA8A 3RKXA 5GANh 1ZSZC 2RQRA 1NJIU 1OX9A 4M77E 2CZ6B 4LDYA 1JXMA 4KGXB 2RB6A 3OSVA 1Q7YC 5CQXA 2BE7D 4AFUC 2VWFA 3CCET 2QA4Q 2O88A 3OSSC 1U5SA 1SEMA 4HCKA 3OA6A 2LQ8A 3IQLA 2LMJA 2XDBA 3M9QA 2LNHB 3I55T 2E6ZA 2ZGWA 2FB7A 1WA7A 4XU0A 2XIDA 1UEBA 2GQIA 2DPPB 1Q7YR 4E7LA 2K4YA 2MI6A 5LJ5d 2J05A 1JB0E 1AWOA 2RO0A 3EGXA 4HVVA 2RJEA 3SD4A 3H0FA 3RDVA 4VUBA 5GAN8 3OBWA 5IHNA 5IHIA 3OY9A 1NJIC 1VQ6T 1IZ6A 2OTJA 3EH2A 1N5ZA 5FRMA 3HPWA 3E9GA 1IHWA 4M7AG 2C0TA 3JB9J 2LJ0A 3G6EA 4D8KA 1JEGA 3N5BB 2IVWA 1T3SA 2F2WA 4J9BA 1M2OA 1C1AA 1G3SA 3QBYA 1VQ5A 2CKKA 3GLXA 4LUEA 4M78G 1M1KU 4M7DA 4HXJA 2AZSA 2ESWA 4FL6A 3MEWA 4A4FA 1D1BA 2DK3A 4LD6A 3MP8A 1MV0B 2JT4A 1UECA 3RMSA 2L89A 4MMLA 1JJ2S 2JS0A 2DL8A 4BI3A 1AZEA 1K0SA 3CMEA 2AZVA 2DTIA 3CCQQ 2BZYA 1Q81U 4KT0E 3A8LB 3I9QA 4BD3A 2JOYA 2D8JA 3LWHA 3CXCP 1BIBA 4FCYA 2A37A 2ZPGB 1N6AA 4F7UB 3M4YA 1MUZA 4PFOA 1CKBA 4E2FB 1PWTA 2QGFB 1WLPB 3VS0A 4PJOF 3QYGB 1VQ4T 2JJ9A 4IIOA 2BTTA 3DB4A 1KQ1A 2VASA 4J8OA 4PJOE 1N9RA 1RAFB 1E7OA 2A3LA 2RI3A 4ANJA 1WHMA 1AWXA 2OTJQ 4KULA 1M1KC 2R58A 1U1TA 2L3PA 3CXCA 1VQ9A 5GMKj 2QK0A 4JJNK 3L2QA 2QA4A 2J7IA 3H41A 4E6RA 3GPLA 3U23A 2DXBA 2ED1A 2Y90A 3KUFA 1VUBA 1SSFA 4LDWA 4J9GA 1KG1A 1OU8A 3EG0A 4KUIA 2F2XA 4M7DB 4MDWA 1R8OB 2E5KA 3OMGA 3V7SA 3S6WA 1TS9A 1X6BA 6AT1B 2WSEE 4X1VA 5DLOA 4O6JA 3HRUA 1QCOA 2HAXA 2MWOA 3ASKA 5C0MA 3O8VA 1M30A 1Y71A 1VQ5T 2K5IA 1QVGA 3JB9D 5D6XA 4XTYA 4JJCA 1OYXA 4PJOB 5DY9A 1VQMQ 2DD4A 3RKYA 2XKOC 5KYXA 3JB9H 5GAN7 2ZPHB 3VS3A 5GAOl 4EMKC 5KE2A 2SRCA 3X26B 1AD5A 1OU9A 2E64A 1QLYA 2DO3A 1D0YA 2R5MA 1BCOA 4LUDA 3M53A 4ELZC 4FYXB 4WCIA 1NZ9A 1G3TA 3P8DA 3OBYA 4M75F 3V7CA 2RN8A 1VQ7A 1QKXA 1WIEA 2AKKA 4AFZC 5ECAA 2YT6A 4PJNA 2L8DA 2RK2A 4C5EA 2PVDB 4EMGA 2CP6A 4ZGJB 2FRYA 5GAOr 2HQEA 4BY6C 4FSXA 1FX7A 2EYYA 2GTJA 1NLOC 4OVAA 2DX1A 5FW9A 4FU6A 1YITT 1VQLA 5GAMg 1ZBXA 4Z88A 3CCEQ 1UHFA 1YITQ 1VQKT 1I4K1 2K6DA 2RMOA 2P0KA 2CS7A 3OYGA 3C4SA 2RJDA 3M0UA 2MIOA 1HK9A 1VQ9Q 2DZ9A 1T0JA 1X01A 2ZPBB 1WX6A 3MEUA 2QEXQ 3L2VA 3PGGA 3JCMe 2QEXT 1ZUKA 1B3QA 1YNZA 3RR6A 4JS5A 2DZCA 5IXFA 3PNWC 4OMPA 2XHCA 3MJXA 4PJOD 2BIVA 3PVQA 4KBMB 2KRMA 1Q95G 1M3BA 1VYTA 2B8AA 3RKWA 1K73C 1OZ2A 4M78F 2YLCA 3CCUA 2OAUA 2VGNA 1DJ7B 1K76A 3REAB 4M75C 1H641 2HQHA 1RI0A 4EMHA 3GBQA 2DILA 2K57A 3CPFA 1JJ2A 1H92A 2EYZA 1LPLA 2QQAA 3CMEQ 2K3YA 3JCMf 1X6OA 5I2MA 2X4WA 2DJQA 1K8AR 1VQ8T 4PJOC 4LXCA 2RF0A 1AHJB 5CKDA 1RADB 1VQ8Q 1H3HA 4XK8E 1OQKA 5IT9E 2HBPA 4ZNXA 5CKEA 4E7KA 2EKOA 2KDSA 2CSQA 1WI7A 4A4HA 1HJDA 2RQUA 2RJCA 4F7UG 4ZGDB 3M56A 1I0CA 1FXXA 1S1NA 2X4XA 4R56A 1YI2A 1ZBJA 1B7TA 4XAXB 2KT1A 2HDAA 3QKJA 3CCMT 2HNIA 1MMNA 5D6YA 4IUPA 1YJ9T 2HQXA 1W70A 1YIJQ 1D1AA 2QA4T 5CQYA 5GMKm 1M2VB 2I2LA 2DNUA 4KH0B 4M77D 2QQRA 5LJ3g 2YRVA 1ABOA 3SDZA 4DBRA 2PZ1A 2LCLA 1KK7A 2QTVA 4XTWA 1GL5A 1PKTA 3QDFA 1NPRA 2XG8D 1IGQA 4ATOA 4HCBA 1RAHB 1I07A 1VOMA 4BE0A 4LDUA 5HCKA 2DIQA 3G6EQ 2A36A 2JZ2A 2ZZDA 5HKCA 2NLUA 1U1SA 4QVCA 4IUUA 1UGSB 5KYNA 2ATCB 2RNAA 3RUXA 4CC3A 1Y07A 4OB2B 3I35A 1OEBA 1QVFS 1NE8A 1FWZA 1X43A 3LYIA 2JNGA 1RAGB 2DXUA 3E19A 2L3SA 2RQVA 4FM4B 4KH1B 2E12A 1VQ6Q 2QG9B 2D0QB 1M5Q1 1PD1A 1HYOA 1Y96A 3CCEA 2LTOA 1SG5A 2EQKA 3L2WA
chains in the Genus database with same CATH topology
5IT9E 1KD1C 2Y4XA 5LJ5j 2X35A 2KQWA 5J26A 3I55T 2E6ZA 4C0ZA 3CCSA 2ZGWA 3T9NA 4XU2A 4M77A 4M7DC 4C8QC 3JCMJ 3CMAT 2FB7A 2EJGA 5IN1A 1N8RU 3GF5A 1IREB 4FT2A 4XU0A 3CCMA 4M7AA 4J6XA 2XIDA 1BIAA 1UEBA 2XICA 3EFSA 4XU1A 3CC2A 2QI2A 3JB9F 4L6V5 3OYDA 2DPPB 2E6NA 1YJWT 2FVUA 3J81E 2RHIA 5A0DA 4E7LA 2K4YA 2MI6A 2EAYA 5LJ3h 4PNOA 4LDVA 2FYKA 1JB0E 3FIFA 5GANe 5LJ5d 2RO0A 3VYHB 3MCAB 3OS0A 4E7IA 3TU4K 1VQNA 4M75D 4PLIA 1KC8C 2F5TX 1M8VA 5GAMe 4C92E 3JCMc 3MO8A 2RJEA 3SD4A 5CK9A 3OYMA 2QQSA 3OW2S 3G7ZA 4VUBA 3HSBA 1YHQA 2LT1A 5GAN8 3META 1QP2A 3OBWA 2JN0A 5EG2A 2VXEA 2M9UA 3OY9A 4NL2A 2LT4A 1NJIC 3LLRA 1IZ6A 1VQ6T 1YCYA 2OTJA 1MHNA 5FU6B 5FRMA 3LGLA 2YLBA 2O4XB 3HPWA 4C5HA 1OI1A 3LGFA 2X4JA 3E9GA 2EQJA 3OYEA 4JLIA 3CCUT 4V2SA 2XU8A 4WF2A 4B9XA 4M7AG 4BI4A 4C92A 3JB9J 3G6EA 5KCHA 1PSFA 3CC4A 1QW1A 5FROA 3GIBA 4M7AF 3CMAA 1VQ9T 3N5BB 4XTUA 3L2ZA 5FLXE 2IVWA 3OYCA 3NTHA 4MMKA 2QXFA 3KXTA 3OS1A 3HRTA 5CKFA 3QDRB 5LJ3f 4C92G 1YI2T 1VQMA 3CC2T 1I8FA 2M16A 2PVOB 2VV5A 3CCJT 3GOXA 1G3SA 1YBYA 3NFCA 3QBYA 3FEOA 2XI9A 2CKKA 1VQ5A 5GAOm 2RA2A 1K8AC 3GLXA 3OYBA 4M78G 3FDRA 3ME9A 2E65A 3C12A 4M78D 1M1KU 4M7DA 3PIPA 4EMKA 4FL6A 4EPCA 4JLGA 3MEWA 4L59A 5J3BA 4A54A 4A4FA 2PQWA 3QSUA 3M5AA 4M7AE 2DK3A 1BI3A 3QZ5B 1UGRB 4FT4A 3A5ZB 4LD6A 2EQUA 3MP8A 3X20B 5I21A 1K9MU 3CCLA 3J7AF 1QVGS 5CKBA 3DLMA 1RL2A 4EDUA 5M9OA 3OYFA 3RMSA 2L89A 4MMLA 3GP8A 1JJ2S 2DVEA 2VUBA 5A2QE 1WQ7A 3JCMg 3VUBA 4P5NA 4BI3A 4JRQA 3CMEA 4BE1A 3QIIA 1UGQB 1XNIA 1XTDA 5A0LA 1KHCA 3VV0A 4M7DF 4N0AC 4NS5A 4M7AC 2RI5A 2DTIA 3OYJA 1ZQ1A 4IKFA 1Q81U 2MAMA 4KT0E 3Q1JA 3A8LB 3V8KA 4X9DA 2V8JA 3PIOA 1BI2A 1TH7A 4OB3B 3OYIA 2MMPA 3DKMA 4BD3A 5HK3A 3GNFB 4BDZA 2JOYA 5LJ5g 3LWHA 5GAN3 1VQLT 1BI1A 1BIBA 2ZPGB 4PJOG 4BUGA 1N6AA 4F7UB 3PTAA 3VYGA 3I56A 3LH0A 2P0PA 4M77B 4QVDA 3M4YA 2V8IA 1VQ4A 4HKEA 4XU3A 3X28B 1VQPA 3OQ5A 3QYGB 4J7FA 4OB1B 4PJOF 1VQOA 1VQ4T 3A8HB 4DA4A 4R55A 5IAYA 3DB4A 1KQ1A 3JAME 3MEVA 4J8OA 1Q86U 4PJOE 1N9RA 3BDLA 3INZA 4C8QF 5KH6A 1P92A 1YJNA 3UDCA 3FJPA 1VQKA 2A3LA 5CVIA 2RI3A 4ELYC 3OMCA 5FU6C 4JRPA 3MHXA 3QYHB 4C5GA 5HK0A 4M7DG 4KULA 1M1KC 4CI0C 4QW2A 1I5LA 3RERA 3UT1A 2R58A 2E1HA 1U1TA 4M75G 3VUZA 3S3NA 1YJ9A 4F7UF 2V8KA 2BKDN 4C0DB 3CXCA 1VQ9A 4PKCC 5GMKj 1WGSA 4M77F 4N0AA 4BB7A 3BY7A 4JJNK 3L2QA 2DJZA 3WVDB 4RMOA 3LW5E 3CMET 2QA4A 3M59A 2RK1A 2EYQA 2LCCA 4HT8A 4C8QE 3GPLA 2DXBA 2WSFE 2JVVA 2Y90A 2VC8A 3KUFA 1VUBA 1SSFA 4LDWA 4YTLA 3OYAA 3M4GA 3OYYA 4DOWA 2D9TA 1N9SA 1YIJT 1VQPT 2IG0A 4PL6A 4Y28E 1KG1A 2DAQA 3CBMA 5FRNA 1WPYA 3H8ZA 3SWNB 1KC8U 4KUIA 5FU7B 1PSEA 1M90C 4M7DD 4C8QB 3ZFJA 5CAIA 2DD5A 4MDWA 4M7DB 1O9SA 4F7UA 1R8OB 3OMGA 3CD6T 3V7SA 3S6WA 4RG2A 4C92F 3L1AA 4ME7A 2GFAA 5CO7A 3CCVA 2WSEE 5DLOA 4E47A 1JRIA 4O6JA 4FIBA 3HRUA 3BFMA 5A0GA 4IURA 1VIEA 4N4GA 2MWOA 3ASKA 3OYHA 5GANj 5C0MA 2CYZB 2QQ9A 3HRSA 3O8VA 3CCVT 3SFMA 4M7AD 1M9SA 2RHXA 4D6WA 4A4EA 2Y4YA 2LVMA 3F70A 2P0QA 2EWNA 4ZGEB 1VQ7T 1Y71A 5GAMh 1VQ5T 2K5IA 2QDYB 1QVGA 2K3XA 2PVGB 4JUVA 2E70A 4M75E 3JB9D 3EAEA 5D6XA 3CCQA 4M75B 4M78C 1LJOA 4J6WA 4XTYA 3URGA 3G6ET 1B34B 1OYXA 4PJOA 1G5VA 4LD9K 2JUFA 4MZTA 4JRIA 4PJOB 5CCAA 5DY9A 3QUIA 2DD4A 3SB2A 3HP9A 3SWNA 3RKYA 2XKOC 4CRIA 2WACA 1K73U 3E1SA 3JB9H 5GAN7 3OYNA 3JCMX 4GY5A 5CR2A 1G3YA 2ZPHB 4HCZA 3A8MB 1WNLA 3C95A 3CEYA 3V8JA 1S72A 4C92B 3GNGA 3AHUA 2G3RA 1D3BB 5GAOl 3E9FA 4EMKC 5KE2A 4GLKA 3X26B 4LDXA 1UB4A 4BI8B 3JB9G 2O4XA 3TEEA 1HXDA 3VU3C 4ZTFA 2RI2A 2E64A 2DO3A 5AYFA 2R5MA 2YHTA 2RHZA 3HL8A 3V7RA 1N8RC 3A8OB 3M53A 4ELZC 2K2VA 3UPUA 4F7UE 1NZ9A 3PT9A 3HHTB 3G71T 1G3TA 4J5YA 5J39A 3P8DA 3OBYA 2E41A 4M75F 3MP6A 3V7CA 3CC7A 4MZPA 3FLGA 4OMFB 1EIFA 2JTFA 4QQGA 4M78B 5LJ3j 1VQ7A 5DM7R 2L3RA 2ZPIB 3JB9I 1KQ2A 2HD0A 2P4TA 2RM4A 1B34A 3QO3A 2PUOB 2DEQA 3R6OA 4C8QG 5LJ3d 1M1FA 3PFSA 4A4KA 5LJ5h 2L8DA 4A4GA 2RK2A 1M4ZA 4C5EA 2PVDB 3HFOA 4EMGA 4N4HA 5LJ5f 4ZGJB 1VQ8A 2EIFA 3CCRA 5GAOr 1D3BA 2HQEA 4KUDK 4BY6C 4FSXA 1FX7A 3CD6A 3P8HA 4OVAA 1NPPA 2LNVA 2LQKA 1XOVA 3UWNA 2PU9B 4JRKA 3BDUA 4FU6A 1YITT 1VQLA 4IUQA 4C0GA 5GAMg 1ZBXA 5HY6A 1H3ZA 4M75A 1KHIA 4QQ6A 1VQKT 1I4K1 1W2BS 2GF7A 1YITA 2P0KA 3JCMh 3G4SA 1U8RA 2CS7A 1Q82C 3OYGA 3C4SA 2RJDA 2XK0A 5KE3A 1N27A 1HK9A 3CCQT 1M90U 2DZ9A 2H3JA 2LC4A 2VYTA 1WQWA 4QQDA 4TVRA 2VGMA 3WXMB 4OP0A 1QP3A 3EFRA 4C92D 1M1GA 4XQ3A 5GMKe 2L5QA 1X01A 2EQMA 2ZPBB 3HFNA 3MEUA 4RCBA 2RJFA 3LWIA 3L2VA 2QTXA 3QJ6A 4OF1A 1I81A 2KVQG 2M1HA 3PGGA 3JCMe 2QEXT 1VQOT 3DB3A 4JS5A 1GXIE 3L2RA 2MF2A 2OTLA 1WJSA 2DZCA 2EJ9A 3A8GB 3QHSA 2CZ1B 3ER0A 3I55A 3JCMV 3TREA 2KAFA 3PNWC 4ZN3A 3S3MA 2XHCA 2LDMA 4IUVA 3MP1A 2F69A 2KSSA 3KBGA 4C5IA 4PJOD 2OTLT 2R57A 2BIVA 5GAOn 1KQSS 2DTHA 3OW2A 4KBMB 3CCJA 2B8AA 3RKWA 1K73C 1OZ2A 3BW1A 3LX7A 2YLCA 3PMTA 4M78F 3CCUA 3L42A 2QQBA 1YIJA 4OGEA 3P8BB 5GAN5 2OAUA 2VGNA 1DJ7B 4M78E 4HT9A 2KY9A 4XTVA 4XTXA 4M75C 1H641 1ZHIA 3VJPA 4MDXA 4II1A 1RI0A 4EMHA 4X34A 2K57A 3ZBDA 2FHDA 4DOVA 5CKHA 3HKSA 4RKUE 1V29B 4ZTJA 3CPFA 1JJ2A 2RHUA 4UC4A 2QQAA 2X4YA 1OZ3A 3QG1A 3QJYA 1YHQT 4QVZA 1Q81C 2K3YA 1BI0A 3OS5A 2K5FA 3NTIA 5GAMf 4XTZA 3JCMf 1YJWA 2HAXA 5D6WA 1X6OA 5I2MA 2X4WA 2ZCFB 5GANf 4M78A 4B9WA 1KQSA 1VQNT 1VIFA 1VQ8T 4PJOC 3CCRT 2EJFA 4A53A 4BACA 1AHJB 5CKDA 2LX9A 2RHYA 5GAN4 3SWNC 3CBOA 4OB0B 2C06A 5GMKi 4XK8E 2GFUA 2XDPA 5KCOA 3M54A 2LRQA 2VXFA 2HBPA 2KK4A 3JRZA 3G71A 3OS2A 2WSCE 3I56T 1G3WA 1LNXA 2RD1A 5CKEA 1KD1U 3J80E 3PMIA 4E7KA 2K5LA 2M0OA 4IUTA 3CC7T 2E10A 2CGHA 2EKOA 1QVFA 3CCST 2BUDA 2KDSA 4RG8A 3ZEHA 4JS4A 4Y91A 1VQ6A 2OTJT 5GMKh 4M77G 4NOYA 5CIUA 5GAN2 4A4HA 2DTOA 2A7YA 2RJCA 3FRNA 4F7UG 4C0DC 4ZGDB 4M7DE 2JTMA 3JCMb 4HCCA 4Q5WA 3M55A 4L5GA 2MWPA 1O75A 2KMTA 3M56A 1S72T 2EFIA 1UGPB 5GMKl 4E7HA 1FXXA 1BKBA 2X4XA 3M58A 4BE2A 4N4IA 5FU7C 5LJ5e 5GANg 5GANd 4BY6B 1BYMA 4C8QA 4R56A 2DKGA 1VQMT 1YI2A 2CZ7B 1QVPA 3JCMd 4XAXB 5GAMd 1WJRA 2ZPFB 3RIRA 4C0FA 5C6SA 3QKJA 3CCMT 3C94A 2HNIA 3NTKA 5LL6S 2XDDA 3S3OA 3L2UA 4J6YA 5D6YA 3VKIA 3WVEB 5GAOp 4IUPA 1YJ9T 2HQXA 3DLLA 3CCLT 2QA4T 5CQYA 1W4SA 5GMKm 3JSCA 2CZ0B 2I2LA 4M77D 5L8RE 3G4ST 3CXCS 2QQRA 3RESA 4E7JA 5LJ3g 4M77C 3X25B 2YRVA 3SDZA 4O5VA 2RH2A 2DIGA 1YJNT 5GAMj 1Q7YU 1Y7XA 2LCLA 2O01E 2D6FA 1LOJA 2R5AA 4XTWA 2PUKB 3X24B 1Q82U 3QXEB 2GCXA 3TCJA 3JCMQ 1K8AU 1NPRA 5I2SA 2XG8D 3CBPA 1X75C 2AHJB 4ATOA 2DXTA 2ZPEB 4HCBA 3FC3A 1W2BA 4EMKB 3JCMW 4C92C 4Z02A 4PLLA 4ZN1A 3CPWA 4DQ2A 4LDUA 4BE0A 2DIQA 2QEXA 2JZ2A 2ZZDA 4HA8A 3CC4T 1XQHA 4JDSA 2NLUA 4MZMA 5HKCA 1U1SA 4NL3A 4X9CA 4QVCA 4M7AB 3RKXA 4IUUA 5LJ3e 5GANh 1UGSB 1NJIU 1K9MC 3MEAA 4OGCA 3OB9A 4M77E 3RUXA 1MGQA 2CZ6B 4BDYA 1Y07A 3V8LA 2F5KA 3QZ9B 4OB2B 2E5QA 5GAOq 3OYLA 1WJQA 3M57A 4LDYA 1QVFS 1NE8A 1FWZA 2RB6A 2GQVA 3LYIA 2XD0A 2JNGA 3OSVA 2DXUA 5DLQE 1JBMA 3E19A 2DXCA 5CQXA 1Q7YC 3OYKA 4FM4B 1Y96B 3FB9A 4C8QD 3CPWS 1Q86C 2E12A 3CCET 3JCMP 3OSSC 2D0QB 3H6ZA 3QPHA 5GAN6 4J83A 4RCCA 1M5Q1 3OA6A 2FL7A 1Y96A 2LQ8A 3CCEA 2LTOA 3RMQA 2XDBA 4J7IA 2EQKA 3M9QA 3L2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U E;  4J5Y A;  5GAN f;  4M77 B;  4M78 A;  4QVD A;  5LJ5 j;  4PJO A;  3V7C A;  2E41 A;  2ZGW A;  4M75 F;  4XU2 A;  4PJO C;  2EJF A;  4M77 A;  4A53 A;  4M7D C;  4C8Q C;  4XU3 A;  3JCM J;  5LJ3 j;  2FB7 A;  4M78 B;  2EJG A;  4PJO F;  3SWN C;  5GAN 4;  3JB9 I;  1KQ2 A;  2RM4 A;  4XU0 A;  5GMK i;  1B34 A;  3QO3 A;  4J6X A;  4M7A A;  1BIA A;  4XU1 A;  2VXF A;  3EFS A;  3JB9 F;  2DEQ A;  1KQ1 A;  1LNX A;  2RD1 A;  4C8Q G;  5LJ3 d;  5LJ5 h;  4EMG A;  3HFO A;  2E10 A;  2CGH A;  5LJ5 f;  1N9R A;  3INZ A;  4C8Q F;  4PJO E;  5LJ3 h;  2EAY A;  5GAN e;  1D3B A;  4PNO A;  2FYK A;  3FJP A;  3FIF A;  4Y91 A;  5GMK h;  5GAO r;  4M77 G;  4NOY A;  5GAN 2;  4M75 D;  1M8V A;  2DTO A;  4M7D G;  5GAM e;  4C92 E;  3JCM c;  1I5L A;  3RER A;  4F7U G;  4M7D E;  3JCM b;  4JRK A;  3BDU A;  4M75 G;  2E1H A;  1U1T A;  5GAN 8;  3HSB A;  2JN0 A;  5GAM g;  2VXE A;  4F7U F;  5GMK l;  4M75 A;  4NL2 A;  1I4K 1;  1YCY A;  5GMK j;  4M77 F;  4N0A A;  3JCM h;  5LJ5 e;  5GAN g;  3BY7 A;  2YLB A;  5GAN d;  2DJZ A;  4C8Q A;  2DKG A;  4JLI A;  4V2S A;  4HT8 A;  4WF2 A;  4C8Q E;  3JCM d;  5GAM d;  4NL3 A;  3RIR A;  4C92 A;  3JB9 J;  4M7A G;  2Y90 A;  2VC8 A;  1HK9 A;  2HNI A;  2DZ9 A;  1WQW A;  3M4G A;  3GIB A;  4M7A F;  1N9S A;  4OP0 A;  4XTU A;  3EFR A;  3L2Z A;  4J6Y A;  5LJ3 e;  5GAO p;  4MMK A;  1WPY A;  3SWN B;  4C92 D;  4XQ3 A;  4C92 G;  5LJ3 f;  5GMK e;  3HFN A;  1X01 A;  4RCB A;  4C8Q B;  5CAI A;  4M7D D;  5GMK m;  4M7D B;  1I8F A;  2I2L A;  4M77 D;  2QTX A;  1I81 A;  3RES A;  3PGG A;  4F7U A;  4M77 C;  5LJ3 g;  3JCM e;  5GAO m;  2RA2 A;  3V7S A;  4M78 G;  4C92 F;  2DZC A;  2E65 A;  2EJ9 A;  3L1A A;  4M78 D;  3QHS A;  4M7D A;  5GAM j;  5GAN h;  3JCM V;  1LOJ A;  4XTW A;  4EMK A;  1JRI A;  3QSU A;  3BFM A;  4A54 A;  3JCM Q;  5GAN j;  4M7A E;  5I21 A;  4M7A D;  2DXT A;  4PJO D;  4EMK B;  2EWN A;  5GAO n;  3JCM W;  4C92 C;  2DTH A;  4DQ2 A;  5GAM h;  4JUV A;  4M75 E;  4HA8 A;  3JB9 D;  4MML A;  4M75 B;  1U1S A;  4M78 C;  2DVE A;  1LJO A;  4J6W A;  4X9C A;  4XTY A;  1WQ7 A;  1B34 B;  4M7A B;  3RKX A;  3RKW A;  3JCM g;  3BW1 A;  4QVC A;  2YLC A;  4JRI A;  4M78 F;  4PJO B;  4M77 E;  5DY9 A;  1MGQ A;  3RUX A;  3QUI A;  3SB2 A;  3SWN A;  3V8L A;  3RKY A;  5GAN 5;  4M78 E;  5LJ5 d;  5GAO q;  4HT9 A;  4XTV A;  4XTX A;  4N0A C;  4M7D F;  4M7A C;  4M75 C;  1H64 1;  2DTI A;  2RB6 A;  5GAN 7;  3JB9 H;  3JCM X;  4EMH A;  1WNL A;  2K57 A;  3V8J A;  3V8K A;  2DXU A;  4X9D A;  1JBM A;  4C92 B;  3AHU A;  1D3B B;  5GAO l;  4EMK C;  1Y96 B;  3FB9 A;  4C8Q D;  1TH7 A;  3JCM P;  3JB9 G;  1HXD A;  3VU3 C;  2E64 A;  5GAN 6;  5LJ5 g;  4RCC A;  5GAN 3;  1M5Q 1;  1Y96 A;  1BIB A;  2YHT A;  4PJO G;  3V7R A;  5GAM f;  4XTZ A;  3JCM f;  4F7U B; 
#chains in the Genus database with same CATH topology
 2GNC A;  1OPL A;  2LJ1 A;  2CH4 W;  1KD1 C;  2X35 A;  4C0Z A;  3G71 Q;  3JCM J;  1MMG A;  2NUT B;  3GF5 A;  3EG3 A;  4J6X A;  4XU1 A;  5KYU A;  1VQ5 Q;  2IPO B;  1Z9Z A;  2QI2 A;  2FVU A;  5LJ3 h;  2XMF A;  4PNO A;  2FYK A;  1Q82 R;  3VYH B;  2COW A;  3MCA B;  3OS0 A;  1M8V A;  1K73 R;  5GAM e;  1G83 A;  4C92 E;  2QQS A;  2QDL A;  3HSB A;  1PRL C;  3MET A;  5FU6 B;  1M27 C;  4JLI A;  1X69 A;  4BI4 A;  1D1C A;  3CMA A;  3NTH A;  3CCJ Q;  4C92 G;  5LJ3 f;  5I11 A;  1VQM A;  2PVO B;  5I22 A;  3CCJ T;  3GOX A;  2XI9 A;  3ME9 A;  3LH5 A;  4M78 D;  2HKN A;  4JLG A;  2DMO A;  3X20 B;  1UGR B;  3A5Z B;  1K9M U;  2EQU A;  1GCP A;  1TOV A;  1QVG S;  5CKB A;  3DLM A;  5M9O A;  1SSH A;  2ENM A;  1WQ7 A;  4P5N A;  1WHH A;  5A0L A;  4N0A C;  3OYJ A;  4IKF A;  3Q1J A;  3OYI A;  2MMP A;  1GFD A;  5HK3 A;  2QAZ A;  1BI1 A;  1YHQ Q;  1FMW A;  3LH0 A;  2P0P A;  4Y92 A;  4AMC A;  2V8I A;  1IXD A;  4HKE A;  4XU3 A;  3X28 B;  1UG1 A;  2JMC A;  1KFZ A;  2KRS A;  3TSZ A;  4R55 A;  2CT3 A;  3JAM E;  1Q86 U;  5L23 A;  1M1K R;  3INZ A;  5D7U A;  1NEG A;  1P92 A;  5KH6 A;  3UDC A;  3FJP A;  2Z0W A;  4ELY C;  1SF9 A;  3MHX A;  5HK0 A;  1ZSZ A;  4C5G A;  4M7D G;  4F17 A;  3RER A;  4M75 G;  5KYX B;  3S3N A;  1WXB A;  1OOT A;  5FWC A;  2BKD N;  2E3I A;  4PKC C;  2O9V A;  4BB7 A;  3QWX X;  3BY7 A;  3CME T;  3M59 A;  4HT8 A;  2JVV A;  2J6F A;  1UTI A;  2JXB A;  4YTL A;  2D9T A;  1N9S A;  1VQP T;  1KJW A;  2A28 A;  4Y28 E;  2DAQ A;  1WPY A;  4JJB A;  3SWN B;  2JMA A;  5FU7 B;  2VVK A;  1VQP Q;  1M90 C;  3CD6 Q;  4C8Q B;  2YSQ A;  1EX4 A;  4F7U A;  3CD6 T;  1KD1 R;  4ME7 A;  5CO7 A;  4FYY B;  2HKQ B;  3HTR A;  4E47 A;  1JRI A;  3RBB B;  5A0G A;  2DE0 X;  3OYH A;  1GBR A;  3CCV T;  4M7A D;  4D6W A;  1AWW A;  3F70 A;  1QVG P;  2EWN A;  5IHK A;  1ZX6 A;  4JUV A;  2ED0 A;  3A1P A;  3EAE A;  4WTO B;  2JUF A;  2F1L A;  3HP9 A;  4IIM A;  1K73 U;  1NEB A;  3E1S A;  4DBF A;  2E4H A;  4GY5 A;  1G3Y A;  1S72 A;  3A8M B;  1CKA A;  1WNL A;  3C95 A;  3V8J A;  4C92 B;  4D8D A;  2G3R A;  3E9F A;  1YJ9 Q;  1XJW B;  1VQK Q;  1UB4 A;  3JB9 G;  2O4X A;  4ZTF A;  3VU3 C;  2RI2 A;  1C0M A;  5AYF A;  2YHT A;  5GJW B;  3V7R A;  2HL3 A;  1N8R C;  2CP0 A;  3A8O B;  1WHJ A;  3UPU A;  1PNJ A;  1TUG B;  1K0X A;  2E41 A;  3CC7 A;  4MZP A;  1I1J A;  3I55 Q;  3CC2 Q;  1WXU A;  1Y0M A;  1ZUY A;  2FPF A;  2JW4 A;  3EG2 A;  2RM4 A;  2I0N A;  1M4Z A;  5LJ5 f;  1VQ8 A;  3CCR A;  1NM7 A;  2ECZ A;  3ULR B;  3CD6 A;  4R0K A;  2KXC A;  1TSF A;  1IHV A;  2D8H A;  4IUQ A;  4C0G A;  5HY6 A;  1H3Z A;  1KHI A;  4QQ6 A;  3EHQ A;  2GF7 A;  2B86 A;  3G4S A;  1Q82 C;  2FEI A;  4PJJ A;  1R0C B;  3H9N A;  2IIM A;  1WQW A;  3WXM B;  1QP3 A;  3EFR A;  4C92 D;  1M1G A;  4RCB A;  2L5Q A;  2YUQ A;  2RJF A;  3LWI A;  3QJ6 A;  2KVQ G;  1VQO T;  2M1H A;  2OAW A;  2OI3 A;  2OTL A;  2EJ9 A;  3A8G B;  3QHS A;  2CZ1 B;  3I55 A;  3TRE A;  2EGA A;  2EPD A;  3KFV A;  3S3M A;  2LDM A;  4IUV A;  3KBG A;  1WFW A;  4C5I A;  2L0A A;  2R57 A;  1RI9 A;  1KQS S;  1U06 A;  5KYW A;  5EC7 A;  1NYG A;  3EFO A;  3SHW A;  2X3W D;  4OGE A;  5GAN 5;  4HT9 A;  4XTV A;  4XTX A;  1ZHI A;  2P4R A;  2KGT A;  2VB6 A;  1UHC A;  2SEM A;  4DOV A;  4RKU E;  2BZ8 A;  2CDT A;  3BE3 A;  3NMZ C;  4HVU A;  1SRL A;  4UC4 A;  1HSQ A;  2X4Y A;  4QT7 A;  1OZ3 A;  2EKH A;  1R77 A;  1Q81 C;  2KR3 A;  5GAM f;  1NLP C;  3I5R A;  2LJ3 A;  4XTZ A;  3O5Z A;  1VQN Q;  3CCM Q;  2HZY A;  5GAN f;  4B9W A;  1KQS A;  1VQN T;  1VIF A;  3UAT A;  4RTW A;  2DF6 A;  2NUP A;  5GMK i;  5KCO A;  3M54 A;  3G1J A;  2KK4 A;  3G71 A;  1WYX A;  1KD1 U;  5KYU B;  3J80 E;  3PMI A;  2M0O A;  2E10 A;  1JXO A;  4JS4 A;  4NOY A;  2DA9 A;  3FRN A;  4C0D C;  8AT1 B;  4FW2 A;  4LE9 A;  2KMT A;  1IB8 A;  3M58 A;  2KT8 A;  4CC7 A;  5GAN d;  3UA7 A;  1BYM A;  4C8Q A;  3RNJ A;  2CZ7 B;  1QVP A;  2J6K A;  2DL3 A;  1WJR A;  3S3O A;  2CP3 A;  1TWB A;  3UA6 A;  3CCL T;  1IGU A;  1AZG B;  2YUN A;  3NHN A;  1QQJ A;  3RES A;  4M77 C;  2DL7 A;  3X25 B;  2RH2 A;  2DIG A;  1Y7X A;  2D6F A;  2R5A A;  2GCX A;  1JO8 A;  3JCM Q;  1K8A U;  2AIR B;  5I2S A;  2DXT A;  3FC3 A;  1R0B G;  1W2B A;  2C0I A;  4C92 C;  4Z02 A;  1D0Z A;  3CPW A;  3QWY A;  2QEX A;  1QKW A;  3CC4 T;  4JDS A;  4MZM A;  4FYV B;  2FZC B;  4X9C A;  4M7A B;  1W1F A;  1YFN A;  1K9M C;  4OGC A;  1MGQ A;  3V8L A;  1PC0 A;  2F5K A;  2CRE A;  3QZ9 B;  4DBQ A;  3OYL A;  3M57 A;  4FYW B;  2KE9 A;  4OMO A;  2DYI A;  2EVR A;  2V1R A;  5DLQ E;  1JBM A;  2HSP A;  2DXC A;  4JZ4 A;  1X27 A;  3OYK A;  4C8Q D;  2HL5 C;  3G4S Q;  4J9E A;  3QPH A;  5GAN 6;  2MPX C;  2DRK A;  2FL7 A;  2X51 A;  1WDX A;  1MV3 A;  3UF4 A;  2NYS A;  5LJ5 j;  4DEX A;  3CCS A;  1WXT A;  1M3A A;  2MK5 A;  4C8Q C;  2HCK A;  2EJG A;  4FT2 A;  1IRE B;  3CCM A;  4M7A A;  1BIA A;  4PFZ A;  3EFS A;  3JB9 F;  4L6V 5;  4GLM A;  3FJ5 A;  2E6N A;  3OYD A;  4E7S A;  2YXY A;  3VS2 A;  1JJ2 P;  5GAN e;  2EAY A;  2K2M A;  4LDV A;  1VQN A;  4M75 D;  1KC8 C;  2F5T X;  2KYM A;  1D09 B;  1RAI B;  3MO8 A;  3OYM A;  2FRW A;  3G7Z A;  1QP2 A;  5EG2 A;  2YUO A;  4K11 A;  1VYU A;  2YLB A;  4C5H A;  1K4U S;  3CCU T;  2XU8 A;  4C92 A;  1TXQ A;  1E6H A;  3CCU Q;  3CC4 A;  2JTE A;  3GIB A;  4M7A F;  1WHG A;  1YI2 Q;  1VQ9 T;  2BE9 B;  3L2Z A;  5FLX E;  3OYC A;  3KXT A;  2QXF A;  2YRD A;  3OS1 A;  5CKF A;  3ZL7 C;  3QDR B;  1YI2 T;  3CC2 T;  2M16 A;  2VV5 A;  4RUG A;  1YBY A;  3NFC A;  3FEO A;  2RA2 A;  2QGG A;  2J06 A;  1D0X A;  3OYB A;  2E65 A;  4L59 A;  5J3B A;  4A54 A;  3M5A A;  4M7A E;  3J7A F;  3CCL A;  2LP5 A;  1RL2 A;  4EDU A;  2FO0 A;  4AG1 C;  3OYF A;  2RQW A;  2KI7 A;  3OW2 P;  2DVE A;  2VUB A;  5A2Q E;  2EQI A;  3CC7 Q;  1KQS P;  4BE1 A;  1UGQ B;  3M0R A;  1RLP C;  1XTD A;  2KXD A;  4OMQ A;  3VV0 A;  4M7D F;  4M7A C;  1ACM B;  3EHR A;  2JM9 A;  2DBM A;  4X9D A;  3PIO A;  1BI2 A;  1OX8 A;  1TH7 A;  4PJL A;  1VA7 A;  2CT4 A;  2G6F X;  3TVT A;  1VQL T;  1ZSG A;  4BUG A;  2AK5 A;  3PTA A;  3VYG A;  3I56 A;  1WHL A;  4M77 B;  4QVD A;  1LVK A;  1VQP A;  3EG9 B;  4J7F A;  2CUB A;  3A8H B;  1NG2 A;  4DA4 A;  2FZG B;  1TUC A;  3TQ7 P;  1TG0 A;  1V76 A;  1AWJ A;  1RAC B;  3BDL A;  4C8Q F;  1VQK A;  5CVI A;  3OMC A;  5FU6 C;  4JRP A;  3QYH B;  3CCV Q;  1K9M R;  1I5L A;  1FMK A;  1QWE A;  1LCK A;  2V8K A;  4C0D B;  2ABL A;  1WGS A;  4N0A A;  2YWW A;  3WVD B;  1G2B A;  2RK1 A;  2DYB A;  4C8Q E;  2WSF E;  3EG1 A;  3OYA A;  3OYY A;  4DOW A;  5FRN A;  3H8Z A;  1KC8 U;  1ZLM A;  1PSE A;  5CAI A;  1WZO A;  1O9S A;  2L3Q A;  2GTO A;  5KYW B;  4C92 F;  2GFA A;  4CC2 A;  4E7Z A;  4AFS C;  4DEY A;  3NGP A;  4FIB A;  2PNI A;  3BFM A;  4IUR A;  3VRZ A;  5GAN j;  2CYZ B;  2PTK A;  2QQ9 A;  3HRS A;  1W2B P;  3SFM A;  2RHX A;  1VQ7 Q;  2DRM A;  2LVM A;  3NPF A;  4ZGE B;  1VQ7 T;  4F14 A;  2KNB B;  2QDY B;  4M75 E;  2PVG B;  3EGD A;  3VS7 A;  1LJO A;  3URG A;  3G6E T;  1G5V A;  1Q86 R;  1JU5 C;  2M0Y A;  4J9F A;  2EGE A;  3QUI A;  1IRX A;  3SB2 A;  3SWN A;  3OYN A;  2ZAE A;  1GBQ A;  1EFN A;  4GLK A;  2KRN A;  3TEE A;  1HXD A;  1QCF A;  1C6V X;  1EZZ B;  2KEA A;  3HL8 A;  4OMN A;  3PT9 A;  4RTT A;  3D7S B;  4OMF B;  2EYW A;  4M78 B;  2ZPI B;  1KQ2 A;  2HD0 A;  1J3T A;  2PUO B;  1PCX A;  2DEQ A;  1OPK A;  5LJ3 d;  1KSW A;  4A4K A;  4RTU A;  2DL4 A;  3HFO A;  2AKL A;  2EIF A;  1D3B A;  2FZK B;  4KUD K;  2H3E B;  1NPP A;  1XOV A;  3UWN A;  2PU9 B;  1YIT A;  1U8R A;  2YDL A;  5KE3 A;  1N27 A;  2W10 A;  4Z8A A;  1M90 U;  3EH1 A;  2LC4 A;  4QQD A;  4TVR A;  1E6G A;  2VGM A;  1RAE B;  4OP0 A;  4XQ3 A;  3HFN A;  1A0N B;  2QTX A;  2RPN A;  3I5S A;  2DFU A;  3DB3 A;  1GXI E;  2D0N A;  2MF2 A;  3CPW P;  3ER0 A;  3JCM V;  2YRC A;  1X2Q A;  3SEM A;  3MP1 A;  2F69 A;  2KSS A;  2OTL T;  1X2K A;  2DTH A;  3OW2 A;  2OTL Q;  3CCJ A;  3PMT A;  3LX7 A;  4RTY A;  2QAS A;  1G8X A;  1M8M A;  3L42 A;  1YIJ A;  3CQT A;  3TSW A;  4M78 E;  1UGV A;  1BB9 A;  2KY9 A;  1BBZ A;  3VJP A;  4M4Z A;  4II1 A;  4X34 A;  2O9S A;  3ZBD A;  2FHD A;  5CKH A;  3HKS A;  1V29 B;  2F2V A;  4HVW A;  4ZTJ A;  3VRY A;  4JJD A;  1MND A;  2LQW A;  2M02 A;  2YUP A;  3OS5 A;  3NTI A;  2MCN A;  1YJW A;  5D6W A;  2LQN A;  1GFC A;  3MPU B;  2ZCF B;  1UUE A;  9ATC B;  4BAC A;  3CCL Q;  1KC8 R;  2RHY A;  5GAN 4;  2FPE A;  3SWN C;  3CBO A;  4OB0 B;  4GBQ A;  2C06 A;  2GFU A;  2XDP A;  2LRQ A;  2VXF A;  3JRZ A;  3OS2 A;  2WSC E;  3I56 T;  2K5L A;  3CC7 T;  2CGH A;  4J9D A;  3CCS T;  4RG8 A;  3ZEH A;  1VQ6 A;  2OTJ T;  2A7Y A;  4M7D E;  2JTM A;  3JCM b;  2MWP A;  4J9H A;  2C0O A;  1UGP B;  1AEY A;  3CC4 Q;  1X6G A;  5GAN g;  2ROL A;  4BY6 B;  2FPD A;  3JCM d;  5GAM d;  4LNP A;  5C6S A;  3C94 A;  3NTK A;  1PRM C;  2XDD A;  2P84 A;  4J6Y A;  3VKI A;  3CCR Q;  3WVE B;  1SHF A;  5L8R E;  3JSC A;  2CZ0 B;  3G4S T;  3CXC S;  2EGC A;  1YJN Q;  1UE9 A;  1M2V A;  3M0S A;  1YJN T;  5GAM j;  1Q7Y U;  2O01 E;  1SKU B;  3QXE B;  3VS6 A;  1AT1 B;  1BU1 A;  2DVJ A;  2AHJ B;  2ZPE B;  4EMK B;  3JCM W;  4ZN1 A;  4DQ2 A;  1S72 Q;  1XQH A;  4NL3 A;  3EFO B;  4AFQ C;  5LJ3 e;  1JQQ A;  3MEA A;  2CP2 A;  3OB9 A;  4BDY A;  4JPB W;  2E5Q A;  3EGD B;  5GAO q;  1WJQ A;  2GQV A;  2XD0 A;  1RUW A;  1UJ0 A;  1Y96 B;  3FB9 A;  3CPW S;  1Q86 C;  3JCM P;  5FWB A;  1UFF A;  4PK4 A;  3H6Z A;  4J83 A;  4RCC A;  2K79 A;  2AT1 B;  3RMQ A;  4J7I A;  1M90 R;  2EW3 A;  2Y4X A;  2KQW A;  5J26 A;  3T9N A;  4XU2 A;  4M77 A;  4M7D C;  2ROT A;  5IH2 A;  3CMA T;  5IN1 A;  1N8R U;  1OV3 A;  2DL5 A;  2XIC A;  3CC2 A;  8ATC B;  1ARK A;  2DLP A;  1YJW T;  3J81 E;  2RHI A;  5A0D A;  3FIF A;  4E7I A;  4ORZ A;  3TU4 K;  4PLI A;  3AT1 B;  3JCM c;  5CK9 A;  2M51 A;  1YHQ A;  2LT1 A;  2JN0 A;  1QCN A;  2DM1 A;  2VXE A;  2M9U A;  3VS5 A;  1TU0 B;  2LT4 A;  4NL2 A;  3LLR A;  1YCY A;  4RTV A;  1MHN A;  3LGL A;  3DLL A;  2O4X B;  3OYE A;  1OI1 A;  3LGF A;  2X4J A;  2EQJ A;  4V2S A;  1AVZ C;  2OX7 A;  4WF2 A;  1KIK A;  4B9X A;  5IXB A;  4EIK A;  3C0C A;  5KCH A;  1PSF A;  1QW1 A;  5FRO A;  3THK A;  2DET A;  1ABQ A;  4XTU A;  4MMK A;  3HRT A;  3MKD A;  1I8F A;  2LCS A;  5GAO m;  4PJM A;  1K8A C;  3FDR A;  1VQO Q;  3C12 A;  3PIP A;  4EMK A;  4EPC A;  3QSU A;  2K7A A;  4OML A;  2PQW A;  1TUD A;  1BI3 A;  3QZ5 B;  4FT4 A;  3E2U A;  4A63 B;  5I21 A;  1UJY A;  3GP8 A;  2K9G A;  3JCM g;  2EBP A;  3VUB A;  4JRQ A;  3QII A;  2MOX A;  2JM8 A;  1XNI A;  1GCQ A;  1KHC A;  4NS5 A;  2RI5 A;  4JZ3 A;  4PFP A;  2EYX A;  1ZQ1 A;  2MAM A;  3PVL A;  3V8K A;  2V8J A;  2H8H A;  4OB3 B;  3DKM A;  3GNF B;  2OJ2 A;  4BDZ A;  5LJ5 g;  5GAN 3;  3PE0 A;  4PJO G;  1CSK A;  2D1X A;  1PD0 A;  2NUP B;  1M3C A;  2VKN A;  2JS2 A;  1MNE A;  7AT1 B;  1VQ4 A;  1RAA B;  3OQ5 A;  4OB1 B;  1VQO A;  5IAY A;  4KGZ B;  2O31 A;  4AT1 B;  3MEV A;  1YJN A;  2A08 A;  1MMD A;  3JV3 A;  4CI0 C;  4QW2 A;  4DBH A;  5AT1 B;  4KRT A;  3UT1 A;  3VUZ A;  2E1H A;  2KBT A;  1YJ9 A;  1YN8 A;  4F7U F;  1K1Z A;  1FMV A;  2CUD A;  4M77 F;  1PHT A;  2V26 A;  2DJZ A;  4RMO A;  4ESR A;  3LW5 E;  3H0H A;  2EYQ A;  2LCC A;  2VC8 A;  1HD3 A;  3M4G A;  1FYN A;  3M0Q A;  1YIJ T;  2IG0 A;  4PL6 A;  3CBM A;  1T0H A;  4M7D D;  2A0F B;  5KYY A;  3ZFJ A;  2DD5 A;  2CH4 A;  1GCQ C;  1TTH B;  3I56 Q;  1IO6 A;  4RG2 A;  3L1A A;  1K9A A;  4RTZ A;  3CCV A;  4FSS A;  1VIE A;  4N4G A;  2MYS A;  1M9S A;  3VS4 A;  2Y4Y A;  4A4E A;  4B6M A;  1RAB B;  2P0Q A;  1N8R R;  2COZ A;  2HMA A;  5GAM h;  2K3X A;  2E70 A;  3A98 A;  2LZ6 B;  3CCQ A;  4M75 B;  4M78 C;  4J6W A;  1B34 B;  4PJO A;  4LD9 K;  4MZT A;  4JRI A;  1F1B B;  1T3L A;  5CCA A;  1YWO A;  1Z9Q A;  4F16 A;  4CRI A;  1ZSZ B;  1PKS A;  2WAC A;  2CP5 A;  4CC4 B;  1UDL A;  3H0I A;  2RQT A;  3JCM X;  5CR2 A;  4HCZ A;  3CEY A;  1BCM A;  3GNG A;  3AHU A;  1D3B B;  4LDX A;  4BI8 B;  2QYZ A;  1NYF A;  1PG5 B;  2RHZ A;  2FG0 A;  2K2V A;  1GRI A;  1AOJ A;  4F7U E;  3G71 T;  3HHT B;  4J5Y A;  3EG9 A;  5J39 A;  3MP6 A;  1SRM A;  3FLG A;  1EIF A;  2JTF A;  4QQG A;  5LJ3 j;  5DM7 R;  2L3R A;  3JB9 I;  1NBE B;  2P4T A;  1B34 A;  3QO3 A;  1B07 A;  2HBW A;  3R6O A;  4C8Q G;  5LJ5 h;  1M1F A;  3PFS A;  4A4G A;  1NJI R;  4N4H A;  2NUT A;  2L2P A;  3P8H A;  2LNV A;  2LQK A;  2LX7 A;  3EGU A;  4JRK A;  3BDU A;  2NUZ A;  2CP7 A;  1SHG A;  4M75 A;  1W2B S;  3JCM h;  4J9I A;  2O2O A;  1W6X A;  3R6N A;  4F04 B;  2XK0 A;  2BZX A;  1YWP A;  2DEU A;  3CCQ T;  2H3J A;  2VYT A;  1QMC A;  2V1Q A;  2X9H A;  5GMK e;  3OW2 S;  2EQM A;  1V1C A;  4J9C A;  4OF1 A;  1I81 A;  2J6O A;  3L2R A;  4Z89 A;  1WJS A;  1YJW Q;  2NWM A;  2KAF A;  4ZN3 A;  1YP5 A;  4FW1 A;  5GAO n;  1VQ4 Q;  1I5O B;  2GBQ A;  3REB B;  2COY A;  2K3B A;  2W0Z A;  3BW1 A;  1ZUU A;  3CCS Q;  2QQB A;  3P8B B;  1QVF P;  4MDX A;  2CSI A;  1BK2 A;  4QKU A;  2KRO A;  1H8K A;  1VYV A;  2RHU A;  3QG1 A;  3QJY A;  1YHQ T;  4QVZ A;  1BI0 A;  2X3X D;  2K5F A;  2KYB A;  1VQL Q;  2DER A;  4M78 A;  3CCR T;  2EJF A;  4A53 A;  1ZA2 B;  1MMA A;  2LX9 A;  1PM3 A;  4KGV B;  1WHK A;  1Y57 A;  4AG2 C;  1G3W A;  1LNX A;  2RD1 A;  3M0T A;  4IUT A;  1QVF A;  2BUD A;  4Y91 A;  5GMK h;  4M77 G;  5CIU A;  5GAN 2;  2DTO A;  1QWF A;  1Q81 R;  4HCC A;  4Q5W A;  3M55 A;  4L5G A;  1O75 A;  2HSE B;  2EFI A;  1S72 T;  5GMK l;  4E7H A;  1ZA1 B;  1BKB A;  4BE2 A;  4N4I A;  5FU7 C;  1SPK A;  5LJ5 e;  5KYY B;  2DKG A;  2E3H A;  1RLQ C;  1VQM T;  1OUL A;  3VS1 A;  2ZPF B;  3RIR A;  4C0F A;  1YCS B;  5LL6 S;  3L2U A;  4RTX A;  5GAO p;  1W4S A;  5GJV B;  4E7J A;  4O5V A;  3M0P A;  4OMM A;  1LOJ A;  2PUK B;  3X24 B;  1Q82 U;  3TCJ A;  2GGR A;  2DBK A;  3EGX B;  3CBP A;  1X75 C;  3CMA Q;  1U3O A;  4LN2 A;  2HEQ A;  4PLL A;  4HA8 A;  3RKX A;  5GAN h;  1ZSZ C;  2RQR A;  1NJI U;  1OX9 A;  4M77 E;  2CZ6 B;  4LDY A;  1JXM A;  4KGX B;  2RB6 A;  3OSV A;  1Q7Y C;  5CQX A;  2BE7 D;  4AFU C;  2VWF A;  3CCE T;  2QA4 Q;  2O88 A;  3OSS C;  1U5S A;  1SEM A;  4HCK A;  3OA6 A;  2LQ8 A;  3IQL A;  2LMJ A;  2XDB A;  3M9Q A;  2LNH B;  3I55 T;  2E6Z A;  2ZGW A;  2FB7 A;  1WA7 A;  4XU0 A;  2XID A;  1UEB A;  2GQI A;  2DPP B;  1Q7Y R;  4E7L A;  2K4Y A;  2MI6 A;  5LJ5 d;  2J05 A;  1JB0 E;  1AWO A;  2RO0 A;  3EGX A;  4HVV A;  2RJE A;  3SD4 A;  3H0F A;  3RDV A;  4VUB A;  5GAN 8;  3OBW A;  5IHN A;  5IHI A;  3OY9 A;  1NJI C;  1VQ6 T;  1IZ6 A;  2OTJ A;  3EH2 A;  1N5Z A;  5FRM A;  3HPW A;  3E9G A;  1IHW A;  4M7A G;  2C0T A;  3JB9 J;  2LJ0 A;  3G6E A;  4D8K A;  1JEG A;  3N5B B;  2IVW A;  1T3S A;  2F2W A;  4J9B A;  1M2O A;  1C1A A;  1G3S A;  3QBY A;  1VQ5 A;  2CKK A;  3GLX A;  4LUE A;  4M78 G;  1M1K U;  4M7D A;  4HXJ A;  2AZS A;  2ESW A;  4FL6 A;  3MEW A;  4A4F A;  1D1B A;  2DK3 A;  4LD6 A;  3MP8 A;  1MV0 B;  2JT4 A;  1UEC A;  3RMS A;  2L89 A;  4MML A;  1JJ2 S;  2JS0 A;  2DL8 A;  4BI3 A;  1AZE A;  1K0S A;  3CME A;  2AZV A;  2DTI A;  3CCQ Q;  2BZY A;  1Q81 U;  4KT0 E;  3A8L B;  3I9Q A;  4BD3 A;  2JOY A;  2D8J A;  3LWH A;  3CXC P;  1BIB A;  4FCY A;  2A37 A;  2ZPG B;  1N6A A;  4F7U B;  3M4Y A;  1MUZ A;  4PFO A;  1CKB A;  4E2F B;  1PWT A;  2QGF B;  1WLP B;  3VS0 A;  4PJO F;  3QYG B;  1VQ4 T;  2JJ9 A;  4IIO A;  2BTT A;  3DB4 A;  1KQ1 A;  2VAS A;  4J8O A;  4PJO E;  1N9R A;  1RAF B;  1E7O A;  2A3L A;  2RI3 A;  4ANJ A;  1WHM A;  1AWX A;  2OTJ Q;  4KUL A;  1M1K C;  2R58 A;  1U1T A;  2L3P A;  3CXC A;  1VQ9 A;  5GMK j;  2QK0 A;  4JJN K;  3L2Q A;  2QA4 A;  2J7I A;  3H41 A;  4E6R A;  3GPL A;  3U23 A;  2DXB A;  2ED1 A;  2Y90 A;  3KUF A;  1VUB A;  1SSF A;  4LDW A;  4J9G A;  1KG1 A;  1OU8 A;  3EG0 A;  4KUI A;  2F2X A;  4M7D B;  4MDW A;  1R8O B;  2E5K A;  3OMG A;  3V7S A;  3S6W A;  1TS9 A;  1X6B A;  6AT1 B;  2WSE E;  4X1V A;  5DLO A;  4O6J A;  3HRU A;  1QCO A;  2HAX A;  2MWO A;  3ASK A;  5C0M A;  3O8V A;  1M30 A;  1Y71 A;  1VQ5 T;  2K5I A;  1QVG A;  3JB9 D;  5D6X A;  4XTY A;  4JJC A;  1OYX A;  4PJO B;  5DY9 A;  1VQM Q;  2DD4 A;  3RKY A;  2XKO C;  5KYX A;  3JB9 H;  5GAN 7;  2ZPH B;  3VS3 A;  5GAO l;  4EMK C;  5KE2 A;  2SRC A;  3X26 B;  1AD5 A;  1OU9 A;  2E64 A;  1QLY A;  2DO3 A;  1D0Y A;  2R5M A;  1BCO A;  4LUD A;  3M53 A;  4ELZ C;  4FYX B;  4WCI A;  1NZ9 A;  1G3T A;  3P8D A;  3OBY A;  4M75 F;  3V7C A;  2RN8 A;  1VQ7 A;  1QKX A;  1WIE A;  2AKK A;  4AFZ C;  5ECA A;  2YT6 A;  4PJN A;  2L8D A;  2RK2 A;  4C5E A;  2PVD B;  4EMG A;  2CP6 A;  4ZGJ B;  2FRY A;  5GAO r;  2HQE A;  4BY6 C;  4FSX A;  1FX7 A;  2EYY A;  2GTJ A;  1NLO C;  4OVA A;  2DX1 A;  5FW9 A;  4FU6 A;  1YIT T;  1VQL A;  5GAM g;  1ZBX A;  4Z88 A;  3CCE Q;  1UHF A;  1YIT Q;  1VQK T;  1I4K 1;  2K6D A;  2RMO A;  2P0K A;  2CS7 A;  3OYG A;  3C4S A;  2RJD A;  3M0U A;  2MIO A;  1HK9 A;  1VQ9 Q;  2DZ9 A;  1T0J A;  1X01 A;  2ZPB B;  1WX6 A;  3MEU A;  2QEX Q;  3L2V A;  3PGG A;  3JCM e;  2QEX T;  1ZUK A;  1B3Q A;  1YNZ A;  3RR6 A;  4JS5 A;  2DZC A;  5IXF A;  3PNW C;  4OMP A;  2XHC A;  3MJX A;  4PJO D;  2BIV A;  3PVQ A;  4KBM B;  2KRM A;  1Q95 G;  1M3B A;  1VYT A;  2B8A A;  3RKW A;  1K73 C;  1OZ2 A;  4M78 F;  2YLC A;  3CCU A;  2OAU A;  2VGN A;  1DJ7 B;  1K76 A;  3REA B;  4M75 C;  1H64 1;  2HQH A;  1RI0 A;  4EMH A;  3GBQ A;  2DIL A;  2K57 A;  3CPF A;  1JJ2 A;  1H92 A;  2EYZ A;  1LPL A;  2QQA A;  3CME Q;  2K3Y A;  3JCM f;  1X6O A;  5I2M A;  2X4W A;  2DJQ A;  1K8A R;  1VQ8 T;  4PJO C;  4LXC A;  2RF0 A;  1AHJ B;  5CKD A;  1RAD B;  1VQ8 Q;  1H3H A;  4XK8 E;  1OQK A;  5IT9 E;  2HBP A;  4ZNX A;  5CKE A;  4E7K A;  2EKO A;  2KDS A;  2CSQ A;  1WI7 A;  4A4H A;  1HJD A;  2RQU A;  2RJC A;  4F7U G;  4ZGD B;  3M56 A;  1I0C A;  1FXX A;  1S1N A;  2X4X A;  4R56 A;  1YI2 A;  1ZBJ A;  1B7T A;  4XAX B;  2KT1 A;  2HDA A;  3QKJ A;  3CCM T;  2HNI A;  1MMN A;  5D6Y A;  4IUP A;  1YJ9 T;  2HQX A;  1W70 A;  1YIJ Q;  1D1A A;  2QA4 T;  5CQY A;  5GMK m;  1M2V B;  2I2L A;  2DNU A;  4KH0 B;  4M77 D;  2QQR A;  5LJ3 g;  2YRV A;  1ABO A;  3SDZ A;  4DBR A;  2PZ1 A;  2LCL A;  1KK7 A;  2QTV A;  4XTW A;  1GL5 A;  1PKT A;  3QDF A;  1NPR A;  2XG8 D;  1IGQ A;  4ATO A;  4HCB A;  1RAH B;  1I07 A;  1VOM A;  4BE0 A;  4LDU A;  5HCK A;  2DIQ A;  3G6E Q;  2A36 A;  2JZ2 A;  2ZZD A;  5HKC A;  2NLU A;  1U1S A;  4QVC A;  4IUU A;  1UGS B;  5KYN A;  2ATC B;  2RNA A;  3RUX A;  4CC3 A;  1Y07 A;  4OB2 B;  3I35 A;  1OEB A;  1QVF S;  1NE8 A;  1FWZ A;  1X43 A;  3LYI A;  2JNG A;  1RAG B;  2DXU A;  3E19 A;  2L3S A;  2RQV A;  4FM4 B;  4KH1 B;  2E12 A;  1VQ6 Q;  2QG9 B;  2D0Q B;  1M5Q 1;  1PD1 A;  1HYO A;  1Y96 A;  3CCE A;  2LTO A;  1SG5 A;  2EQK A;  3L2W A; 
#chains in the Genus database with same CATH homology
 5IT9 E;  1KD1 C;  2Y4X A;  5LJ5 j;  2X35 A;  2KQW A;  5J26 A;  3I55 T;  2E6Z A;  4C0Z A;  3CCS A;  2ZGW A;  3T9N A;  4XU2 A;  4M77 A;  4M7D C;  4C8Q C;  3JCM J;  3CMA T;  2FB7 A;  2EJG A;  5IN1 A;  1N8R U;  3GF5 A;  1IRE B;  4FT2 A;  4XU0 A;  3CCM A;  4M7A A;  4J6X A;  2XID A;  1BIA A;  1UEB A;  2XIC A;  3EFS A;  4XU1 A;  3CC2 A;  2QI2 A;  3JB9 F;  4L6V 5;  3OYD A;  2DPP B;  2E6N A;  1YJW T;  2FVU A;  3J81 E;  2RHI A;  5A0D A;  4E7L A;  2K4Y A;  2MI6 A;  2EAY A;  5LJ3 h;  4PNO A;  4LDV A;  2FYK A;  1JB0 E;  3FIF A;  5GAN e;  5LJ5 d;  2RO0 A;  3VYH B;  3MCA B;  3OS0 A;  4E7I A;  3TU4 K;  1VQN A;  4M75 D;  4PLI A;  1KC8 C;  2F5T X;  1M8V A;  5GAM e;  4C92 E;  3JCM c;  3MO8 A;  2RJE A;  3SD4 A;  5CK9 A;  3OYM A;  2QQS A;  3OW2 S;  3G7Z A;  4VUB A;  3HSB A;  1YHQ A;  2LT1 A;  5GAN 8;  3MET A;  1QP2 A;  3OBW A;  2JN0 A;  5EG2 A;  2VXE A;  2M9U A;  3OY9 A;  4NL2 A;  2LT4 A;  1NJI C;  3LLR A;  1IZ6 A;  1VQ6 T;  1YCY A;  2OTJ A;  1MHN A;  5FU6 B;  5FRM A;  3LGL A;  2YLB A;  2O4X B;  3HPW A;  4C5H A;  1OI1 A;  3LGF A;  2X4J A;  3E9G A;  2EQJ A;  3OYE A;  4JLI A;  3CCU T;  4V2S A;  2XU8 A;  4WF2 A;  4B9X A;  4M7A G;  4BI4 A;  4C92 A;  3JB9 J;  3G6E A;  5KCH A;  1PSF A;  3CC4 A;  1QW1 A;  5FRO A;  3GIB A;  4M7A F;  3CMA A;  1VQ9 T;  3N5B B;  4XTU A;  3L2Z A;  5FLX E;  2IVW A;  3OYC A;  3NTH A;  4MMK A;  2QXF A;  3KXT A;  3OS1 A;  3HRT A;  5CKF A;  3QDR B;  5LJ3 f;  4C92 G;  1YI2 T;  1VQM A;  3CC2 T;  1I8F A;  2M16 A;  2PVO B;  2VV5 A;  3CCJ T;  3GOX A;  1G3S A;  1YBY A;  3NFC A;  3QBY A;  3FEO A;  2XI9 A;  2CKK A;  1VQ5 A;  5GAO m;  2RA2 A;  1K8A C;  3GLX A;  3OYB A;  4M78 G;  3FDR A;  3ME9 A;  2E65 A;  3C12 A;  4M78 D;  1M1K U;  4M7D A;  3PIP A;  4EMK A;  4FL6 A;  4EPC A;  4JLG A;  3MEW A;  4L59 A;  5J3B A;  4A54 A;  4A4F A;  2PQW A;  3QSU A;  3M5A A;  4M7A E;  2DK3 A;  1BI3 A;  3QZ5 B;  1UGR B;  4FT4 A;  3A5Z B;  4LD6 A;  2EQU A;  3MP8 A;  3X20 B;  5I21 A;  1K9M U;  3CCL A;  3J7A F;  1QVG S;  5CKB A;  3DLM A;  1RL2 A;  4EDU A;  5M9O A;  3OYF A;  3RMS A;  2L89 A;  4MML A;  3GP8 A;  1JJ2 S;  2DVE A;  2VUB A;  5A2Q E;  1WQ7 A;  3JCM g;  3VUB A;  4P5N A;  4BI3 A;  4JRQ A;  3CME A;  4BE1 A;  3QII A;  1UGQ B;  1XNI A;  1XTD A;  5A0L A;  1KHC A;  3VV0 A;  4M7D F;  4N0A C;  4NS5 A;  4M7A C;  2RI5 A;  2DTI A;  3OYJ A;  1ZQ1 A;  4IKF A;  1Q81 U;  2MAM A;  4KT0 E;  3Q1J A;  3A8L B;  3V8K A;  4X9D A;  2V8J A;  3PIO A;  1BI2 A;  1TH7 A;  4OB3 B;  3OYI A;  2MMP A;  3DKM A;  4BD3 A;  5HK3 A;  3GNF B;  4BDZ A;  2JOY A;  5LJ5 g;  3LWH A;  5GAN 3;  1VQL T;  1BI1 A;  1BIB A;  2ZPG B;  4PJO G;  4BUG A;  1N6A A;  4F7U B;  3PTA A;  3VYG A;  3I56 A;  3LH0 A;  2P0P A;  4M77 B;  4QVD A;  3M4Y A;  2V8I A;  1VQ4 A;  4HKE A;  4XU3 A;  3X28 B;  1VQP A;  3OQ5 A;  3QYG B;  4J7F A;  4OB1 B;  4PJO F;  1VQO A;  1VQ4 T;  3A8H B;  4DA4 A;  4R55 A;  5IAY A;  3DB4 A;  1KQ1 A;  3JAM E;  3MEV A;  4J8O A;  1Q86 U;  4PJO E;  1N9R A;  3BDL A;  3INZ A;  4C8Q F;  5KH6 A;  1P92 A;  1YJN A;  3UDC A;  3FJP A;  1VQK A;  2A3L A;  5CVI A;  2RI3 A;  4ELY C;  3OMC A;  5FU6 C;  4JRP A;  3MHX A;  3QYH B;  4C5G A;  5HK0 A;  4M7D G;  4KUL A;  1M1K C;  4CI0 C;  4QW2 A;  1I5L A;  3RER A;  3UT1 A;  2R58 A;  2E1H A;  1U1T A;  4M75 G;  3VUZ A;  3S3N A;  1YJ9 A;  4F7U F;  2V8K A;  2BKD N;  4C0D B;  3CXC A;  1VQ9 A;  4PKC C;  5GMK j;  1WGS A;  4M77 F;  4N0A A;  4BB7 A;  3BY7 A;  4JJN K;  3L2Q A;  2DJZ A;  3WVD B;  4RMO A;  3LW5 E;  3CME T;  2QA4 A;  3M59 A;  2RK1 A;  2EYQ A;  2LCC A;  4HT8 A;  4C8Q E;  3GPL A;  2DXB A;  2WSF E;  2JVV A;  2Y90 A;  2VC8 A;  3KUF A;  1VUB A;  1SSF A;  4LDW A;  4YTL A;  3OYA A;  3M4G A;  3OYY A;  4DOW A;  2D9T A;  1N9S A;  1YIJ T;  1VQP T;  2IG0 A;  4PL6 A;  4Y28 E;  1KG1 A;  2DAQ A;  3CBM A;  5FRN A;  1WPY A;  3H8Z A;  3SWN B;  1KC8 U;  4KUI A;  5FU7 B;  1PSE A;  1M90 C;  4M7D D;  4C8Q B;  3ZFJ A;  5CAI A;  2DD5 A;  4MDW A;  4M7D B;  1O9S A;  4F7U A;  1R8O B;  3OMG A;  3CD6 T;  3V7S A;  3S6W A;  4RG2 A;  4C92 F;  3L1A A;  4ME7 A;  2GFA A;  5CO7 A;  3CCV A;  2WSE E;  5DLO A;  4E47 A;  1JRI A;  4O6J A;  4FIB A;  3HRU A;  3BFM A;  5A0G A;  4IUR A;  1VIE A;  4N4G A;  2MWO A;  3ASK A;  3OYH A;  5GAN j;  5C0M A;  2CYZ B;  2QQ9 A;  3HRS A;  3O8V A;  3CCV T;  3SFM A;  4M7A D;  1M9S A;  2RHX A;  4D6W A;  4A4E A;  2Y4Y A;  2LVM A;  3F70 A;  2P0Q A;  2EWN A;  4ZGE B;  1VQ7 T;  1Y71 A;  5GAM h;  1VQ5 T;  2K5I A;  2QDY B;  1QVG A;  2K3X A;  2PVG B;  4JUV A;  2E70 A;  4M75 E;  3JB9 D;  3EAE A;  5D6X A;  3CCQ A;  4M75 B;  4M78 C;  1LJO A;  4J6W A;  4XTY A;  3URG A;  3G6E T;  1B34 B;  1OYX A;  4PJO A;  1G5V A;  4LD9 K;  2JUF A;  4MZT A;  4JRI A;  4PJO B;  5CCA A;  5DY9 A;  3QUI A;  2DD4 A;  3SB2 A;  3HP9 A;  3SWN A;  3RKY A;  2XKO C;  4CRI A;  2WAC A;  1K73 U;  3E1S A;  3JB9 H;  5GAN 7;  3OYN A;  3JCM X;  4GY5 A;  5CR2 A;  1G3Y A;  2ZPH B;  4HCZ A;  3A8M B;  1WNL A;  3C95 A;  3CEY A;  3V8J A;  1S72 A;  4C92 B;  3GNG A;  3AHU A;  2G3R A;  1D3B B;  5GAO l;  3E9F A;  4EMK C;  5KE2 A;  4GLK A;  3X26 B;  4LDX A;  1UB4 A;  4BI8 B;  3JB9 G;  2O4X A;  3TEE A;  1HXD A;  3VU3 C;  4ZTF A;  2RI2 A;  2E64 A;  2DO3 A;  5AYF A;  2R5M A;  2YHT A;  2RHZ A;  3HL8 A;  3V7R A;  1N8R C;  3A8O B;  3M53 A;  4ELZ C;  2K2V A;  3UPU A;  4F7U E;  1NZ9 A;  3PT9 A;  3HHT B;  3G71 T;  1G3T A;  4J5Y A;  5J39 A;  3P8D A;  3OBY A;  2E41 A;  4M75 F;  3MP6 A;  3V7C A;  3CC7 A;  4MZP A;  3FLG A;  4OMF B;  1EIF A;  2JTF A;  4QQG A;  4M78 B;  5LJ3 j;  1VQ7 A;  5DM7 R;  2L3R A;  2ZPI B;  3JB9 I;  1KQ2 A;  2HD0 A;  2P4T A;  2RM4 A;  1B34 A;  3QO3 A;  2PUO B;  2DEQ A;  3R6O A;  4C8Q G;  5LJ3 d;  1M1F A;  3PFS A;  4A4K A;  5LJ5 h;  2L8D A;  4A4G A;  2RK2 A;  1M4Z A;  4C5E A;  2PVD B;  3HFO A;  4EMG A;  4N4H A;  5LJ5 f;  4ZGJ B;  1VQ8 A;  2EIF A;  3CCR A;  5GAO r;  1D3B A;  2HQE A;  4KUD K;  4BY6 C;  4FSX A;  1FX7 A;  3CD6 A;  3P8H A;  4OVA A;  1NPP A;  2LNV A;  2LQK A;  1XOV A;  3UWN A;  2PU9 B;  4JRK A;  3BDU A;  4FU6 A;  1YIT T;  1VQL A;  4IUQ A;  4C0G A;  5GAM g;  1ZBX A;  5HY6 A;  1H3Z A;  4M75 A;  1KHI A;  4QQ6 A;  1VQK T;  1I4K 1;  1W2B S;  2GF7 A;  1YIT A;  2P0K A;  3JCM h;  3G4S A;  1U8R A;  2CS7 A;  1Q82 C;  3OYG A;  3C4S A;  2RJD A;  2XK0 A;  5KE3 A;  1N27 A;  1HK9 A;  3CCQ T;  1M90 U;  2DZ9 A;  2H3J A;  2LC4 A;  2VYT A;  1WQW A;  4QQD A;  4TVR A;  2VGM A;  3WXM B;  4OP0 A;  1QP3 A;  3EFR A;  4C92 D;  1M1G A;  4XQ3 A;  5GMK e;  2L5Q A;  1X01 A;  2EQM A;  2ZPB B;  3HFN A;  3MEU A;  4RCB A;  2RJF A;  3LWI A;  3L2V A;  2QTX A;  3QJ6 A;  4OF1 A;  1I81 A;  2KVQ G;  2M1H A;  3PGG A;  3JCM e;  2QEX T;  1VQO T;  3DB3 A;  4JS5 A;  1GXI E;  3L2R A;  2MF2 A;  2OTL A;  1WJS A;  2DZC A;  2EJ9 A;  3A8G B;  3QHS A;  2CZ1 B;  3ER0 A;  3I55 A;  3JCM V;  3TRE A;  2KAF A;  3PNW C;  4ZN3 A;  3S3M A;  2XHC A;  2LDM A;  4IUV A;  3MP1 A;  2F69 A;  2KSS A;  3KBG A;  4C5I A;  4PJO D;  2OTL T;  2R57 A;  2BIV A;  5GAO n;  1KQS S;  2DTH A;  3OW2 A;  4KBM B;  3CCJ A;  2B8A A;  3RKW A;  1K73 C;  1OZ2 A;  3BW1 A;  3LX7 A;  2YLC A;  3PMT A;  4M78 F;  3CCU A;  3L42 A;  2QQB A;  1YIJ A;  4OGE A;  3P8B B;  5GAN 5;  2OAU A;  2VGN A;  1DJ7 B;  4M78 E;  4HT9 A;  2KY9 A;  4XTV A;  4XTX A;  4M75 C;  1H64 1;  1ZHI A;  3VJP A;  4MDX A;  4II1 A;  1RI0 A;  4EMH A;  4X34 A;  2K57 A;  3ZBD A;  2FHD A;  4DOV A;  5CKH A;  3HKS A;  4RKU E;  1V29 B;  4ZTJ A;  3CPF A;  1JJ2 A;  2RHU A;  4UC4 A;  2QQA A;  2X4Y A;  1OZ3 A;  3QG1 A;  3QJY A;  1YHQ T;  4QVZ A;  1Q81 C;  2K3Y A;  1BI0 A;  3OS5 A;  2K5F A;  3NTI A;  5GAM f;  4XTZ A;  3JCM f;  1YJW A;  2HAX A;  5D6W A;  1X6O A;  5I2M A;  2X4W A;  2ZCF B;  5GAN f;  4M78 A;  4B9W A;  1KQS A;  1VQN T;  1VIF A;  1VQ8 T;  4PJO C;  3CCR T;  2EJF A;  4A53 A;  4BAC A;  1AHJ B;  5CKD A;  2LX9 A;  2RHY A;  5GAN 4;  3SWN C;  3CBO A;  4OB0 B;  2C06 A;  5GMK i;  4XK8 E;  2GFU A;  2XDP A;  5KCO A;  3M54 A;  2LRQ A;  2VXF A;  2HBP A;  2KK4 A;  3JRZ A;  3G71 A;  3OS2 A;  2WSC E;  3I56 T;  1G3W A;  1LNX A;  2RD1 A;  5CKE A;  1KD1 U;  3J80 E;  3PMI A;  4E7K A;  2K5L A;  2M0O A;  4IUT A;  3CC7 T;  2E10 A;  2CGH A;  2EKO A;  1QVF A;  3CCS T;  2BUD A;  2KDS A;  4RG8 A;  3ZEH A;  4JS4 A;  4Y91 A;  1VQ6 A;  2OTJ T;  5GMK h;  4M77 G;  4NOY A;  5CIU A;  5GAN 2;  4A4H A;  2DTO A;  2A7Y A;  2RJC A;  3FRN A;  4F7U G;  4C0D C;  4ZGD B;  4M7D E;  2JTM A;  3JCM b;  4HCC A;  4Q5W A;  3M55 A;  4L5G A;  2MWP A;  1O75 A;  2KMT A;  3M56 A;  1S72 T;  2EFI A;  1UGP B;  5GMK l;  4E7H A;  1FXX A;  1BKB A;  2X4X A;  3M58 A;  4BE2 A;  4N4I A;  5FU7 C;  5LJ5 e;  5GAN g;  5GAN d;  4BY6 B;  1BYM A;  4C8Q A;  4R56 A;  2DKG A;  1VQM T;  1YI2 A;  2CZ7 B;  1QVP A;  3JCM d;  4XAX B;  5GAM d;  1WJR A;  2ZPF B;  3RIR A;  4C0F A;  5C6S A;  3QKJ A;  3CCM T;  3C94 A;  2HNI A;  3NTK A;  5LL6 S;  2XDD A;  3S3O A;  3L2U A;  4J6Y A;  5D6Y A;  3VKI A;  3WVE B;  5GAO p;  4IUP A;  1YJ9 T;  2HQX A;  3DLL A;  3CCL T;  2QA4 T;  5CQY A;  1W4S A;  5GMK m;  3JSC A;  2CZ0 B;  2I2L A;  4M77 D;  5L8R E;  3G4S T;  3CXC S;  2QQR A;  3RES A;  4E7J A;  5LJ3 g;  4M77 C;  3X25 B;  2YRV A;  3SDZ A;  4O5V A;  2RH2 A;  2DIG A;  1YJN T;  5GAM j;  1Q7Y U;  1Y7X A;  2LCL A;  2O01 E;  2D6F A;  1LOJ A;  2R5A A;  4XTW A;  2PUK B;  3X24 B;  1Q82 U;  3QXE B;  2GCX A;  3TCJ A;  3JCM Q;  1K8A U;  1NPR A;  5I2S A;  2XG8 D;  3CBP A;  1X75 C;  2AHJ B;  4ATO A;  2DXT A;  2ZPE B;  4HCB A;  3FC3 A;  1W2B A;  4EMK B;  3JCM W;  4C92 C;  4Z02 A;  4PLL A;  4ZN1 A;  3CPW A;  4DQ2 A;  4LDU A;  4BE0 A;  2DIQ A;  2QEX A;  2JZ2 A;  2ZZD A;  4HA8 A;  3CC4 T;  1XQH A;  4JDS A;  2NLU A;  4MZM A;  5HKC A;  1U1S A;  4NL3 A;  4X9C A;  4QVC A;  4M7A B;  3RKX A;  4IUU A;  5LJ3 e;  5GAN h;  1UGS B;  1NJI U;  1K9M C;  3MEA A;  4OGC A;  3OB9 A;  4M77 E;  3RUX A;  1MGQ A;  2CZ6 B;  4BDY A;  1Y07 A;  3V8L A;  2F5K A;  3QZ9 B;  4OB2 B;  2E5Q A;  5GAO q;  3OYL A;  1WJQ A;  3M57 A;  4LDY A;  1QVF S;  1NE8 A;  1FWZ A;  2RB6 A;  2GQV A;  3LYI A;  2XD0 A;  2JNG A;  3OSV A;  2DXU A;  5DLQ E;  1JBM A;  3E19 A;  2DXC A;  5CQX A;  1Q7Y C;  3OYK A;  4FM4 B;  1Y96 B;  3FB9 A;  4C8Q D;  3CPW S;  1Q86 C;  2E12 A;  3CCE T;  3JCM P;  3OSS C;  2D0Q B;  3H6Z A;  3QPH A;  5GAN 6;  4J83 A;  4RCC A;  1M5Q 1;  3OA6 A;  2FL7 A;  1Y96 A;  2LQ8 A;  3CCE A;  2LTO A;  3RMQ A;  2XDB A;  4J7I A;  2EQK A;  3M9Q A;  3L2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...