5LJ5f

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5f00
1I81A 2DEQA 4N0AA 4OP0A 1U1TA 1WQ7A 3BDUA 4M78B 3BFMA 4WF2A 4NL3A 1Y96B 3V7RA 3V8KA 5GAMj 3HSBA 4M7DC 4M75A 4XQ3A 4M77E 4C92A 2RD1A 5GMKh 5GAMf 2ZGWA 4M7DD 2RB6A 4M75E 5LJ3d 4MMKA 5GMKe 5GAN2 5GAMd 2CGHA 2E41A 4X9CA 4C8QE 4C8QC 5GAN6 5LJ5j 3JCMQ 4M7AF 2E64A 4JRKA 4M75C 5LJ5f 5GANg 3JCMJ 3V7SA 4PJOA 2DTIA 4PJOG 3JCMg 5GAOq 2DVEA 4V2SA 1LJOA 3JB9J 4XTZA 4M7AE 1KQ1A 5GAN7 1JBMA 5GAN5 3HFNA 3EFSA 4M78A 3SB2A 2DXTA 2DZCA 3RERA 2EJ9A 2DJZA 1D3BA 4J6YA 4C92G 4HT9A 1I8FA 4XU2A 5GANd 1JRIA 3JB9I 4M7AD 1WQWA 4XTYA 5GAOl 1YCYA 1BIAA 2DKGA 4M78C 4XTWA 4M7DF 4EMKC 2DXUA 1WNLA 3PGGA 4F7UF 1WPYA 5DY9A 5GANj 1LOJA 4M7AA 2FB7A 4M7AG 1B34A 3JCMc 3RIRA 5GMKl 2EWNA 2RA2A 5LJ5g 4PJOF 4F7UB 5LJ3e 2YHTA 5GANh 1H641 4M77A 3V8LA 3L1AA 2EAYA 4M75B 4C8QF 1I5LA 3QUIA 5GAOp 1X01A 4J5YA 3RESA 2HNIA 4XTUA 3BY7A 5GMKm 3AHUA 2I2LA 2DTOA 2E1HA 4JLIA 3JCMb 3INZA 4N0AC 4XU0A 3JB9G 1D3BB 3FIFA 3JCMV 3FB9A 2YLCA 2VXEA 5I21A 4XTVA 5LJ3j 3SWNB 1B34B 5GMKi 1TH7A 2VXFA 4C92C 4M7DA 2E10A 4M7DG 3RKWA 1MGQA 5GAMe 3V8JA 3EFRA 5LJ5h 2RM4A 1HK9A 4C92E 4EMKB 4F7UE 3V7CA 4PJOD 4HT8A 3VU3C 4M77F 4DQ2A 4XU3A 4C8QA 4C8QG 3L2ZA 3QHSA 3RKXA 4M77G 1BIBA 4XU1A 3JCMW 1N9SA 3BW1A 4HA8A 5LJ5d 5GAN4 3QO3A 1M5Q1 4PJOE 4PJOC 1I4K1 2YLBA 4M78E 5CAIA 5GAOm 3HFOA 3JCMX 3JB9F 1HXDA 3JB9H 4M7DB 1LNXA 4XTXA 5LJ3f 4NOYA 4PNOA 5GMKj 2E65A 4M75D 2VC8A 4RCBA 3RKYA 4C92D 4F7UA 4Y91A 4M78D 3JCMd 4EMKA 3JB9D 5GAOn 1N9RA 3SWNC 4RCCA 2EJFA 4M7AC 4C92B 2DZ9A 5GANe 4F7UG 4M75F 4C8QB 4M78G 4NL2A 1Y96A 2QTXA 4M77B 4JUVA 4C92F 4EMGA 5GAMg 5GAN3 4M75G 2DTHA 4EMHA 2EJGA 3FJPA 4QVDA 4X9DA 3SWNA 3JCMP 1M8VA 3JCMh 4M7AB 4JRIA 2FYKA 1KQ2A 2JN0A 5GAN8 3QSUA 4A53A 5GANf 3JCMe 3JCMf 4M77C 5GAOr 4A54A 4M77D 3RUXA 5LJ3h 1U1SA 4C8QD 4QVCA 5LJ3g 2K57A 2Y90A 4PJOB 5LJ5e 5GAMh 3M4GA 4J6WA 4MMLA 4M78F 4M7DE 3GIBA 4J6XA
chains in the Genus database with same CATH superfamily
1U1TA 3OYGA 4QKUA 4AFZC 2COZA 1VQPT 1WLPB 3G6ET 4M7DD 4M75E 4PFOA 4RTZA 1O75A 3S3NA 1VQKT 2RO0A 1FXXA 5EC7A 1KHCA 3ZL7C 4OB0B 4J8OA 2E5KA 2PVGB 2M16A 1MV0B 2OTJQ 2DO3A 3G71A 4L59A 2WSEE 3CCQQ 2L5QA 4FYYB 2K5IA 5GAOl 4DOWA 3QDFA 1T0JA 2QEXA 2CSQA 1KHIA 1B34A 2V8JA 2EQIA 3EAEA 2V1QA 1E6HA 3MEAA 2DX1A 4LN2A 2OTLA 1X01A 2K7AA 5IAYA 5GMKm 2I2LA 1ZSGA 1QW1A 2A28A 2MPXC 1OZ2A 1RAIB 2E4HA 4DBHA 3TQ7P 2XU8A 3UDCA 3V8JA 2FRWA 2MMPA 2FG0A 2K3XA 4F7UE 1XOVA 1YNZA 2J06A 3EHQA 4FYVB 2LZ6B 3GNFB 3CMAT 3LLRA 4C8QA 3OYIA 2JZ2A 2QEXQ 2XG8D 4HA8A 4OVAA 3OYAA 2HKNA 3HKSA 5CAIA 3CXCP 4F17A 2GFAA 4WCIA 1X6BA 3RKYA 1AZGB 2ZAEA 4XAXB 5CKDA 4OB2B 1SG5A 1YJWA 2YSQA 5GAN3 1V1CA 3JCMP 3FJPA 2L3PA 3J80E 3CCMA 1WJSA 3U23A 1VQ7Q 4OB3B 2RHZA 4MMLA 4MDXA 2CZ0B 2J7IA 1H92A 1VQOA 3EGXB 2RB6A 1NLPC 2HBPA 2KY9A 3VS2A 1OULA 2J05A 2L0AA 3CC2Q 2DTIA 5GAOq 2D6FA 3I56A 1VIEA 1ZBJA 3CMEA 1MMNA 1JJ2P 2NUPA 2DZCA 1VQ5Q 3EG9B 2DJZA 2OI3A 3EGUA 3C4SA 4QQDA 4JJBA 4A4GA 1N6AA 1LPLA 1TTHB 2FB7A 2JXBA 4ZN3A 1XQHA 2ROTA 1QQJA 2GCXA 1PG5B 2DE0X 4MDWA 2DTOA 3INZA 2NUPB 1EZZB 1BKBA 1NEBA 4DBQA 3CMEQ 1YJWT 2P0PA 4BY6B 2E10A 4JZ4A 1NPRA 3O5ZA 1VQ6A 3CEYA 4PLIA 3KBGA 4PJOD 4EPCA 1G3TA 4JDSA 2CT3A 2X4JA 1R0CB 4KUDK 3BW1A 3MP6A 5GAN4 3G4SA 2JTMA 3M56A 1QVGA 5GAOm 1S1NA 4E7IA 1K1ZA 2XICA 2HMAA 4PNOA 2QK0A 2CP5A 2A36A 1KD1C 1PKSA 4JS4A 3ASKA 4RMOA 4FCYA 4M7AC 1XNIA 1J3TA 4NL2A 2QTXA 1OPKA 1E6GA 2X4XA 1UEBA 3QBYA 2HDAA 5CQXA 4KH1B 1QMCA 2LX7A 4BE1A 4E7SA 1G8XA 4HCZA 4QVZA 3MJXA 3QZ9B 3LYIA 2JS0A 2ROLA 3OS0A 3UA7A 2G6FX 1X69A 3MHXA 1ZUKA 1WQ7A 2ZPFB 3REAB 1F1BB 5DLQE 4Z02A 1GBQA 3G71Q 4B6MA 4X9CA 4M7AF 4LUEA 2LQ8A 3OS5A 2FEIA 3NTHA 2DD4A 1PM3A 4HXJA 2BE7D 4XTWA 3MP8A 1G3SA 4OMQA 1VQ8Q 3TEEA 1KC8U 2ZPBB 3RIRA 1YITQ 4X1VA 2HQHA 1UHFA 3EG3A 1YJNT 3CCJT 3TREA 5FU7C 3FJ5A 2YT6A 4FW2A 2QGFB 3CCLA 3VS3A 9ATCB 1FX7A 2E6NA 3QPHA 3R6OA 4GLKA 2C06A 1QVGP 3M0RA 4OMOA 2BKDN 4N4IA 3IQLA 2KSSA 1HK9A 1NYFA 4C92E 2YRCA 5FWBA 1WXTA 3PTAA 4M77G 1UTIA 1D1CA 4IKFA 3CC4T 2KVQG 1LNXA 2R57A 2P84A 1Q86U 3LH5A 4ZN1A 1VQ4T 3CCLQ 4FYWB 4RCCA 5HK0A 1S72A 1K76A 4JUVA 1VQKA 5GAMg 3QWYA 2F1LA 3G4SQ 3OYCA 4ESRA 2ATCB 2CUDA 2XK0A 2JTEA 2ZPEB 1VQLA 1KC8C 2NUTA 3I5SA 4A54A 1QCFA 5CR2A 1WHKA 4FT4A 4M7DC 3QZ5B 5KYNA 1AWJA 4BDYA 1WDXA 3NPFA 3CPWP 4M75A 4JS5A 1KG1A 3QWXX 3R6NA 1GL5A 3QIIA 2ED0A 3L2WA 1OZ3A 4PJOA 2ED1A 2ZZDA 4E6RA 2EYWA 2L8DA 4C92G 4XU2A 1JRIA 1W2BA 1YCYA 3M0UA 5FWCA 4ATOA 4M7DF 1YFNA 2JS2A 1QVFS 1RADB 3CCJA 1M2VA 4FIBA 5GMKl 2FL7A 1M1KC 5FLXE 1JJ2S 2D8HA 1FYNA 1I5LA 3VS4A 1WJQA 4J5YA 1RAEB 3QJYA 1QP2A 1ZBXA 3AHUA 4JPBW 4O5VA 3JB9G 2XI9A 3OW2S 4F04B 3QYGB 1YITA 4Z8AA 3E1SA 4JJNK 1VQ4Q 3OYEA 4CC4B 1PSEA 1JB0E 3SD4A 1ZUUA 4EMKB 5IT9E 3M57A 2QDLA 3CC4A 2KI7A 1UGVA 3QO3A 1IREB 3I56T 1I4K1 1TXQA 2R5MA 2YLBA 3LX7A 3JB9F 4M7DB 2KRNA 8AT1B 2KEAA 2X51A 3THKA 4M78D 3JB9D 1BI3A 1IZ6A 2C0TA 2VASA 1PD1A 1RACB 2PVOB 4EMGA 1JO8A 5D6WA 5D6YA 4EMHA 2W10A 3CCVT 4Y92A 1NJIR 3G6EQ 2QQRA 1N8RR 1VQPQ 1AVZC 2DETA 1OV3A 3M0PA 5ECAA 1RLQC 3M0TA 2KYBA 1K9MR 3LGLA 1IXDA 4E7KA 3FRNA 1BI1A 3EH1A 5CKBA 4RG2A 1X43A 4M78B 4NL3A 3V8KA 2NYSA 3M5AA 4C92A 4RKUE 2ZGWA 2FHDA 2DIGA 2YUPA 5LJ5f 4J9HA 2HCKA 4LXCA 1D0XA 1VOMA 2PVDB 2QXFA 2K2MA 5FROA 2KE9A 4JJDA 1K9MU 1DJ7B 2EQJA 2CZ7B 1Q86C 1WNLA 2FZGB 4QQGA 1ARKA 3CCMQ 5D6XA 4JLGA 4LDVA 5GANh 1H641 4M77A 1VQ7A 4WTOB 1K8AR 3DB3A 1V29B 2CP6A 5GAOp 3DLLA 4XTUA 3A1PA 2CH4A 1VIFA 1UGPB 1Q81U 4JLIA 1NBEB 4VUBA 2QQ9A 2L3SA 2QA4Q 1QLYA 3ME9A 5GAMe 3EFRA 1OPLA 8ATCB 2EGCA 1D09B 2AZVA 3X26B 3L2VA 2CP7A 2KT8A 2C0IA 3EG2A 3BE3A 1UE9A 4IUUA 2BIVA 2XIDA 2F5KA 3DB4A 4OMPA 1VQLQ 1OYXA 3OSVA 2KRSA 3OS2A 4OB1B 1VQ6T 2Y4XA 1MMAA 2DTHA 4A4HA 2XDPA 4CC3A 4QVDA 2RK2A 2E12A 5KE2A 5GAOr 1PCXA 1YN8A 4BI8B 5D7UA 2O4XA 3J7AF 2BUDA 1NEGA 2GQIA 5J39A 1TG0A 2A37A 4DEXA 1VQ5T 1N5ZA 5GMKe 2EYQA 4C8QC 2DLPA 1ZSZC 4J9IA 2EVRA 1GFDA 2JMAA 2P4TA 4B9XA 4V2SA 1BB9A 3CC2T 1YWOA 3GPLA 1R77A 2QTVA 1YIJA 2JUFA 2LCCA 3PMIA 1QVFA 4BI3A 1G2BA 2HKQB 4A4KA 3H8ZA 2KROA 2X3WD 2O88A 2LT4A 2XHCA 2H3EB 1RI9A 5FU7B 1MUZA 3NFCA 1IO6A 1AD5A 5I22A 3D7SB 3V8LA 1C1AA 4J7IA 4C8QF 5L8RE 2DPPB 1G3YA 2VGNA 5KH6A 1M30A 4OMMA 2DEUA 2E1HA 2PU9B 1Y0MA 3FIFA 2F2XA 3PVQA 2EGAA 3EFOB 1XJWB 2YWWA 4OGEA 2H3JA 3OYYA 3Q1JA 1VYUA 4J9BA 3EG1A 2OJ2A 2JW4A 3HRSA 1KFZA 3I9QA 4XU3A 3H0FA 1BIBA 2O9VA 3E2UA 1WHLA 3SFMA 4R56A 2EKOA 3MKDA 3RNJA 3KFVA 3P8HA 2QGGA 1VQPA 1M1GA 1I07A 2RHIA 4F7UA 3JCMd 1AWXA 4LNPA 1HD3A 2OTJT 4KUIA 4KGXB 2DZ9A 1Y96A 5FRNA 2NWMA 1D1BA 2WSFE 4GBQA 1M90R 2HAXA 1AT1B 2MYSA 4PJJA 2D8JA 3P8DA 4C8QD 5LJ3g 4PJOB 5LJ5e 1JU5C 2HL3A 2KMTA 2RNAA 5KYXA 3V7RA 3BDLA 1AWWA 3CBOA 5I2MA 3CD6T 5LJ3d 4MMKA 4C0ZA 5GAN2 3CC2A 5LJ5j 3HL8A 1OEBA 5GANg 2Y4YA 1KQ1A 3CCRT 5GAN7 1NG2A 2K9GA 1ZSZB 2B86A 2DM1A 3VYHB 2EQUA 3H0HA 1D3BA 1PRLC 2AKKA 4D8DA 4MZTA 3H6ZA 5GANd 1S72Q 2KXCA 2L3RA 4XTYA 2EQKA 1OX9A 1X2QA 2DXUA 1X6OA 2CSIA 1IGUA 3A98A 1YHQA 2MIOA 1VYTA 1H3HA 2DNUA 2RH2A 1R0BG 2YRDA 4PK4A 4BE2A 3FB9A 5LJ3j 1I0CA 3SEMA 1O9SA 3OW2A 5LJ5h 3A8LB 4KH0B 2VYTA 2RMOA 1OX8A 2FVUA 2C0OA 2IIMA 3H0IA 4XU1A 2MWPA 2GTJA 3VUZA 1Q86R 1W4SA 5AT1B 3CCUQ 3JB9H 3CCQA 2MK5A 2GQVA 2X4YA 4P5NA 5C0MA 2M9UA 3E9GA 2E65A 3JSCA 2E6ZA 1VYVA 2JMCA 3EHRA 2JNGA 2K4YA 4M75G 1GCQA 2OTLQ 3CBPA 3SWNA 2CP0A 2A3LA 2EFIA 2KXDA 5KYWA 3JRZA 4M77D 4QVCA 1UGQB 1M2OA 2EYYA 1Q82U 1Y7XA 4M78F 2V8KA 1VQ4A 1PD0A 4N0AA 4OP0A 3BDUA 4RTWA 5KYUB 1W70A 3PNWC 3CCUA 4BE0A 3CCVQ 2CT4A 2RI5A 3QG1A 2AKLA 2E41A 3MO8A 4C8QE 5GAN6 4IIMA 1PHTA 3KUFA 3WXMB 3V7SA 1IHWA 1C6VX 4DA4A 1RAHB 1GCPA 3HFNA 3MEUA 2LRQA 3OS1A 4AFUC 4NS5A 3CC7T 2XD0A 1BIAA 4M78C 1IGQA 2AHJB 2XDBA 1WPYA 2KYMA 2DILA 3CD6Q 2K5FA 3CQTA 3EFOA 3G1JA 2O31A 4E7ZA 4PL6A 2ZPIB 2RJDA 3CCST 5IXFA 3I55Q 4HVWA 2MWOA 1WYXA 1VQNT 3ZBDA 2LCSA 1VQOQ 1K9AA 2LC4A 3CXCA 2HSEB 1AHJB 3RMSA 2E5QA 1Q82C 1YHQQ 2DFUA 2M51A 3OY9A 4JRPA 2GNCA 1BK2A 3META 1UB4A 3TU4K 4FW1A 4DBRA 4HVUA 1YJNA 5LJ5d 3NMZC 5FW9A 1M1KU 1X27A 1TSFA 3E19A 2MAMA 2G3RA 1Q81R 2PTKA 1K8AC 2CUBA 3L42A 1N9RA 3WVDB 1NLOC 4ORZA 4C92B 3OYJA 2DERA 2D0QB 2BZXA 4KT0E 1TUCA 3VKIA 3F70A 4K11A 2WSCE 2RJEA 5I11A 3HRUA 4GLMA 4FSSA 2Y90A 5GAMh 3A5ZB 1I81A 3DKMA 2DBKA 4WF2A 2D1XA 1IHVA 2VKNA 2BZYA 3FC3A 2X3XD 5IHKA 4HCBA 4II1A 4AFQC 2CGHA 4J9FA 3I35A 5HK3A 2PZ1A 3JCMg 2V8IA 3ZFJA 2QASA 5KYXB 2R58A 2F69A 4HT9A 1VQ9Q 2OTJA 1SPKA 2DKGA 4GY5A 1PWTA 4EMKC 2DYIA 1VQMT 3VRYA 2DAQA 4C5HA 5DY9A 5HY6A 2YRVA 1QVGS 2RJCA 2K2VA 4FYXB 5M9OA 5KCOA 2JOYA 1QVFP 2HZYA 3QKJA 4J9CA 2SRCA 4HCCA 1KQSS 1CKBA 1LCKA 4RUGA 1QKXA 2DRKA 4XU0A 2COWA 2VXFA 4C92C 2X4WA 1WXUA 2OX7A 3RKWA 1G5VA 2KNBB 1UGSB 3QDRB 2RM4A 4ELYC 5A0LA 3JV3A 3M0QA 1Q7YU 1VQ9A 1UDLA 2E70A 4ZGJB 2DL3A 1FWZA 2DD5A 1EX4A 1Q82R 4KULA 4E2FB 2RQTA 5C6SA 3JCMX 3GNGA 1RLPC 2ENMA 4M75D 2ZCFB 3HTRA 4RCBA 3PFSA 1S72T 1H3ZA 5FU6B 1I5OB 3CCRA 2ESWA 3RR6A 2CZ6B 1TS9A 1D0ZA 2YDLA 4E7HA 2QYZA 1YP5A 1BU1A 1ZX6A 3H9NA 3CMET 4JRIA 2LMJA 2JN0A 3OQ5A 3GBQA 4KGVB 5CKEA 4RTYA 3RUXA 3PVLA 3VRZA 2LJ0A 3ER0A 1VQNA 2PNIA 2DEQA 3OYLA 2JJ9A 3MEWA 1JXMA 2DL5A 3DLMA 4XQ3A 5CKFA 3EGXA 5HKCA 1ZUYA 3CPFA 4MZPA 5GAMd 3JCMQ 3I5RA 2CZ1B 2B8AA 2VVKA 2EW3A 1JBMA 3QXEB 2K5LA 3CBMA 2MCNA 2RHXA 2O4XB 5A0GA 3RBBB 4N4HA 3RERA 3QYHB 3EG0A 1I8FA 1NPPA 4A63B 4CC2A 1G3WA 4FM4B 1M3CA 2RI2A 5GANj 5CK9A 3JCMc 4B9WA 2JM8A 1ABOA 3J81E 5LJ3e 2YHTA 4PFZA 4BUGA 2ZPHB 4FU6A 2RQUA 1JEGA 2EGEA 1MMGA 1K0XA 3PE0A 1WXBA 1NM7A 1RABB 1AOJA 1JQQA 3OBYA 2DK3A 2JTFA 4Q5WA 3TVTA 2O01E 3OYHA 1WIEA 2GBQA 1VQ6Q 4C8QG 4PJNA 3MEVA 3VS1A 3MCAB 1M5Q1 3GP8A 4PJOE 4LE9A 3M55A 1PKTA 1X6GA 3PMTA 1VQ9T 2K3BA 2VC8A 4XK8E 4C92D 1TWBA 2QEXT 1M90C 2HQXA 1UJYA 2JT4A 5FRMA 2ECZA 3CXCS 4PJMA 2LVMA 3M0SA 2LQNA 4R0KA 2YUOA 4RG8A 1NJIU 1PC0A 2JVVA 2GF7A 3OYFA 2LCLA 2KK4A 1HJDA 1RI0A 1FMVA 3UATA 2K57A 3RMQA 1WZOA 4M4ZA 4J6WA 1UFFA 1SF9A 2QI2A 2GGRA 4CRIA 3BFMA 2GTOA 3VJPA 2RD1A 5GMKh 5GAMf 1X75C 4KBMB 4IUTA 2O2OA 4LDUA 1TOVA 5A2QE 2K79A 1KD1R 3CCQT 4PJOG 1RUWA 2FRYA 2LNVA 4BD3A 5IN1A 4EIKA 2AT1B 5GAN5 2MF2A 4FSXA 2P0KA 1ZLMA 5LL6S 3TSZA 2RJFA 4UC4A 3JB9I 4ZGDB 4LUDA 2P4RA 1B07A 1X2KA 1VQ8A 1WA7A 1JJ2A 1YCSB 4C0FA 1ZHIA 1KQSP 2PQWA 3RESA 4Y28E 1Q7YC 1M3BA 2Z0WA 1YHQT 1D3BB 4ME7A 3JCMV 2QA4T 3SWNB 3ZEHA 1WJRA 3E9FA 4EDUA 4D8KA 5CO7A 3TCJA 2D9TA 4OF1A 3V7CA 4N4GA 4BY6C 1RAAB 2RN8A 1JXOA 2BE9B 4OMNA 4L6V5 5KYWB 1HXDA 3NTIA 4HVVA 2KR3A 3CCET 2EKHA 4Y91A 1N8RC 1VQKQ 3NGPA 2EBPA 2EJFA 2E3HA 3C0CA 4M77B 4JZ3A 3N5BB 2QQSA 2VGMA 3OMGA 3I55T 1LVKA 4FL6A 1W1FA 1MNEA 2FYKA 3I55A 2M02A 3JCMe 1K73R 4C0DB 1E7OA 2IVWA 4ANJA 1TUDA 3M4GA 5IHNA 4O6JA 3T9NA 3H41A 4KRTA 1KSWA 2F5TX 3MPUB 3VS6A 5EG2A 2W0ZA 1YJ9A 2IG0A 3JCMJ 3HRTA 2OTLT 3JB9J 4M7AE 4X34A 3UF4A 1UUEA 2YUQA 2PUKB 1R8OB 1M8MA 3X20B 4M7AD 2DL8A 4ZGEB 1KD1U 4BB7A 4C0GA 1V76A 4E47A 2MOXA 3UPUA 3X28B 1SSHA 1T3LA 1U3OA 4RTUA 2EWNA 2RA2A 5AYFA 4HCKA 3L1AA 4M75B 4CI0C 3LH0A 2HNIA 1WHGA 5IHIA 3BY7A 1UGRB 3NHNA 4N0AC 1K73U 3C95A 5I21A 1D1AA 2YLCA 1YBYA 2SEMA 2QDYB 2DJQA 3S3OA 4PFPA 1QKWA 3VS5A 1IRXA 1OQKA 3CCEQ 3CCSQ 3VU3C 2L89A 1YIJQ 5KYYB 3QHSA 4PKCC 1WFWA 4M78E 5FU6C 1MV3A 2J6KA 1QWFA 1RL2A 1YWPA 3M58A 1SRMA 3X24B 1SSFA 4A4FA 4M75F 1WHMA 4M78G 4PJLA 2LX9A 3HHTB 2DL4A 2OAUA 4IIOA 1WGSA 3A8HB 2CKKA 2E3IA 2EJGA 2XMFA 4ZTFA 3UT1A 2FZCB 5IXBA 3JCMh 5CCAA 3EGDA 2GFUA 2J6FA 4D6WA 2DMOA 2DL7A 3S3MA 1QCOA 3QJ6A 3OYBA 1ZSZA 1Y96B 5GAMj 4BI4A 5CQYA 4QT7A 5DLOA 4M75C 4JRKA 1ZQ1A 2EYXA 2NLUA 2LQWA 1VQMA 1I1JA 1M3AA 3EFSA 3SHWA 2FPDA 3JAME 1W6XA 2LTOA 4Z88A 1M4ZA 4TVRA 2EIFA 3CD6A 2ABLA 3L2RA 3PGGA 1AEYA 3GOXA 2DBMA 1LOJA 2AIRB 2FZKB 2IPOB 4F14A 1U8RA 1Z9QA 1Q81C 3OB9A 2J6OA 1Y07A 2VUBA 4ELZC 4AFSC 1GRIA 1VQ7T 4CC7A 3OYNA 3JCMb 1W2BP 1YI2T 4IURA 1ZA1B 4PLLA 2RF0A 4XTVA 4RTVA 5KE3A 1BI0A 1TH7A 3CCLT 1M2VB 3G7ZA 2HSPA 1HYOA 5J26A 4F16A 2AZSA 4DQ2A 3L2ZA 4RTTA 1N9SA 4L5GA 1TUGB 1K8AU 4C5GA 4NOYA 4C5IA 2I0NA 2NUTB 4EMKA 1QCNA 2CS7A 5KYYA 4C92F 2XDDA 1Q7YR 3C94A 3OA6A 1WX6A 4YTLA 2BTTA 2CYZB 2RK1A 2QAZA 1KQ2A 1PSFA 5GAN8 3JCMf 3PT9A 3A8OB 5CIUA 1NZ9A 1YITT 1KIKA 5DM7R 4F7UF 3GIBA 4J6XA 3FDRA 3GF5A 4QQ6A 4M77E 2DF6A 2HD0A 1QP3A 1BCOA 4AG2C 3OBWA 1RAFB 3L2UA 2QQAA 5CVIA 4XTZA 5KYUA 1WHHA 1EFNA 2HEQA 2KGTA 3SB2A 3EG9A 2DXTA 1FMKA 2HL5C 1WQWA 2K6DA 1SEMA 1SKUB 1HSQA 4M7AA 4IUVA 1OOTA 2M1HA 3VS7A 3WVEB 3EH2A 3QUIA 2CH4W 2CDTA 2DA9A 1YJWQ 3PIOA 2A7YA 3X25B 2RHYA 1VQLT 1KC8R 3CC7A 2X35A 1VUBA 1YI2A 4OMFB 1KQSA 2VWFA 2BZ8A 2KAFA 2V1RA 1P92A 1M27C 1Q95G 1H8KA 3RKXA 5L23A 1GBRA 3JCMW 1OI1A 3CPWS 1ABQA 4BDZA 3P8BB 2DIQA 2PUOB 4J9GA 2FO0A 4XTXA 1B7TA 3MP1A 1M90U 3CCRQ 1GCQC 3VYGA 5GAOn 3SWNC 5GANe 4F7UG 4C8QB 1KK7A 1K9MC 3GLXA 3CPWA 3OSSC 4X9DA 3RDVA 1CKAA 4AT1B 5GJVB 4LDYA 3REBB 6AT1B 4LD9K 3URGA 4LDWA 3UA6A 1YI2Q 3HP9A 1ZA2B 2M0OA 1U06A 1U1SA 2VV5A 4OMLA 4M7DE 4E7LA 1M1KR 1EIFA 1W2BS 3HSBA 1BBZA 3OYMA 3LWHA 1AZEA 4QW2A 3OYDA 4DBFA 3M4YA 1A0NB 2RQWA 4ZNXA 1SHFA 3M59A 1N27A 2RI3A 2L3QA 2KBTA 4M78A 3UWNA 4C0DC 1D0YA 5A0DA 2EJ9A 3S6WA 2AK5A 4DEYA 4A4EA 1K0SA 4OGCA 2F2VA 2F2WA 1SHGA 4M7AG 2L2PA 1GFCA 4MZMA 2LNHB 1BYMA 4PJOF 4F7UB 1U5SA 4AMCA 1BCMA 3VUBA 1WI7A 1PRMC 1YJ9Q 5GJWB 2ZPGB 1T3SA 2LT1A 2M0YA 2JM9A 2VXEA 4BACA 1G83A 1B34B 4M7DA 4KGZB 4JJCA 4LD6A 1M9SA 1RAGB 2EQMA 2DVJA 4IUQA 2CP3A 1WHJA 1QVPA 1TU0B 3A8MB 2HBWA 4E7JA 2K3YA 2RHUA 2DXCA 4PJOC 2YXYA 4R55A 3CMAQ 3CC4Q 1FMWA 1UG1A 5KCHA 2A08A 5LJ3f 5GMKj 3TSWA 2QG9B 7AT1B 3CC7Q 3KXTA 2D0NA 2H8HA 1NE8A 1T0HA 1UHCA 2RQVA 2KDSA 3M54A 3SDZA 4M7AB 2CREA 5GANf 3CCSA 3G6EA 2LQKA 4J9DA 3FLGA 1YJ9T 3VS0A 3HPWA 2OAWA 4C5EA 2DXBA 4IUPA 3CCEA 1OU8A 4J9EA 4AG1C 1MMDA 3M53A 3CCVA 4J7FA 2E64A 4LDXA 4DOVA 2KQWA 4RTXA 2DVEA 2MI6A 1LJOA 1MNDA 3G4ST 1B3QA 1MHNA 4J6YA 3NTKA 1YIJT 3A8GB 3L2QA 3CCUT 3G71T 2KT1A 3OW2P 3I56Q 1UECA 5LJ5g 2X9HA 1QWEA 3PIPA 2LP5A 2DRMA 3ULRB 2FPFA 1PNJA 1M1FA 2EAYA 2LJ1A 5IH2A 1VQ5A 4FT2A 5J3BA 1VQOT 1IB8A 1VQNQ 1GXIE 3LGFA 1Y71A 2P0QA 2RQRA 2EYZA 1BI2A 5GMKi 5I2SA 2NUZA 4JRQA 4M7DG 3AT1B 1KJWA 1MGQA 3EGDB 5HCKA 3FEOA 1OU9A 2QA4A 2A0FB 3CCMT 2V26A 1VA7A 2EPDA 4J83A 3VV0A 1YJNQ 4HT8A 4M77F 1XTDA 1Z9ZA 1VQMQ 3M9QA 1UJ0A 2CP2A 2VB6A 2COYA 1Y57A 1NYGA 1VQ8T 3HFOA 1SRLA 1N8RU 2WACA 5CKHA 2QQBA 1ACMB 2LJ3A 3C12A 2HQEA 4HKEA 1K73C 4ZTJA 2XKOC 1CSKA 3LWIA 2YUNA 3OYKA 1C0MA 3O8VA 3CMAA 1M8VA 2LDMA 4Z89A 3QSUA 3CCJQ 4A53A 2RPNA 2FPEA 2KRMA 4M77C 3LW5E 1AWOA 5LJ3h 2DYBA 1K4US 3OMCA 2R5AA 2O9SA 1NJIC
chains in the Genus database with same CATH topology
5CKBA 1I81A 4RG2A 1U1TA 4M78B 3OYGA 3DKMA 3OYBA 4WF2A 4NL3A 1Y96B 3V8KA 3M5AA 5GAMj 1VQPT 4BI4A 5CQYA 3FC3A 3G6ET 4C92A 4RKUE 2ZGWA 4M7DD 2FHDA 4M75E 4HCBA 4II1A 5DLOA 2CGHA 2DIGA 1O75A 5HK3A 4M75C 4JRKA 3S3NA 1ZQ1A 5LJ5f 3JCMg 2RO0A 1FXXA 2V8IA 1VQKT 3ZFJA 2NLUA 1KHCA 1VQMA 4OB0B 2R58A 4J8OA 2PVDB 3EFSA 2PVGB 2QXFA 2M16A 5FROA 2F69A 3JAME 2DO3A 4HT9A 3G71A 4L59A 2WSEE 1K9MU 2L5QA 2LTOA 2K5IA 1M4ZA 5GAOl 4TVRA 2DKGA 2EIFA 4GY5A 4DOWA 3CD6A 1DJ7B 2EQJA 2OTJA 4EMKC 1VQMT 3L2RA 2CZ7B 3PGGA 1WNLA 1Q86C 2DAQA 4QQGA 5DY9A 5HY6A 4C5HA 1LOJA 3GOXA 2QEXA 1KHIA 1B34A 2V8JA 2RJCA 2K2VA 2YRVA 5D6XA 5M9OA 1QVGS 4JLGA 4LDVA 1U8RA 5KCOA 5GANh 1Q81C 1H641 2JOYA 3EAEA 3OB9A 4M77A 1VQ7A 3MEAA 3DB3A 1V29B 1Y07A 2VUBA 3QKJA 2OTLA 5GAOp 1X01A 3DLLA 1KQSS 4HCCA 4ELZC 4XTUA 5IAYA 1VIFA 1UGPB 5GMKm 1Q81U 2I2LA 1NJIC 1VQ7T 1QW1A 3OYNA 4JLIA 3JCMb 1YI2T 4XU0A 4VUBA 2QQ9A 4IURA 1OZ2A 4PLLA 4XTVA 5KE3A 2VXFA 1BI0A 1TH7A 4C92C 3CCLT 2X4WA 2XU8A 3ME9A 3RKWA 5GAMe 3UDCA 3EFRA 3V8JA 1G5VA 2MMPA 1UGSB 3QDRB 3G7ZA 2RM4A 4ELYC 2K3XA 5A0LA 3X26B 3L2VA 4F7UE 1XOVA 1Q7YU 1VQ9A 3GNFB 5J26A 2E70A 3CMAT 4ZGJB 4DQ2A 3LLRA 4C8QA 1FWZA 3L2ZA 3OYIA 2DD5A 2JZ2A 2XG8D 1N9SA 4HA8A 4L5GA 4OVAA 3OYAA 4KULA 3HKSA 4IUUA 5CAIA 5C6SA 3JCMX 3GNGA 2GFAA 2BIVA 2XIDA 1K8AU 2F5KA 4C5GA 4NOYA 3DB4A 4M75D 2ZCFB 4RCBA 3RKYA 3PFSA 4C5IA 1S72T 1OYXA 1H3ZA 3OSVA 4EMKA 3OS2A 4OB1B 5FU6B 1VQ6T 4XAXB 5CKDA 3CCRA 2CS7A 4OB2B 2Y4XA 4C92F 1YJWA 2CZ6B 2XDDA 3C94A 3OA6A 5GAN3 4E7HA 2DTHA 4A4HA 2XDPA 3JCMP 3FJPA 4YTLA 2RK2A 4QVDA 3J80E 2E12A 2CYZB 5KE2A 3CMET 2RK1A 4JRIA 3CCMA 1PSFA 2JN0A 5GAN8 1KQ2A 3OQ5A 1WJSA 3JCMf 3PT9A 3A8OB 5GAOr 5CKEA 3RUXA 5CIUA 4BI8B 1NZ9A 1YITT 4OB3B 5DM7R 2O4XA 2RHZA 4F7UF 3ER0A 4MMLA 3GIBA 3J7AF 4J6XA 4MDXA 1VQNA 2BUDA 2DEQA 2CZ0B 3OYLA 3FDRA 3GF5A 3MEWA 5J39A 4QQ6A 3DLMA 4XQ3A 4M77E 1VQOA 5CKFA 5HKCA 2RB6A 3CPFA 1VQ5T 5GMKe 2HD0A 4MZPA 1QP3A 2EYQA 2HBPA 4C8QC 2KY9A 3JCMQ 5GAMd 2CZ1B 2B8AA 2P4TA 2DTIA 3OBWA 4B9XA 3L2UA 5GAOq 4V2SA 2QQAA 3CC2T 5CVIA 3GPLA 2D6FA 4XTZA 1VIEA 3I56A 1JBMA 3CMEA 2JUFA 3QXEB 1YIJA 2K5LA 2LCCA 3CBMA 3PMIA 1QVFA 4BI3A 4A4KA 3SB2A 2RHXA 2DXTA 2DZCA 2O4XB 3H8ZA 4N4HA 2DJZA 3QYHB 5A0GA 3RERA 1I8FA 1NPPA 3C4SA 4QQDA 1WQWA 4A4GA 2LT4A 2XHCA 1G3WA 4FM4B 2RI2A 1N6AA 5GANj 5FU7B 2FB7A 4M7AA 5CK9A 4ZN3A 4IUVA 3NFCA 3JCMc 4B9WA 2M1HA 3J81E 1XQHA 3WVEB 5LJ3e 2YHTA 3V8LA 4BUGA 2ZPHB 2GCXA 4FU6A 4J7IA 4C8QF 5L8RE 3QUIA 2DPPB 1G3YA 2VGNA 5KH6A 4MDWA 2DTOA 2E1HA 3INZA 2PU9B 3FIFA 3OBYA 1BKBA 2DK3A 2JTFA 4Q5WA 2P0PA 1YJWT 4BY6B 2E10A 3PIOA 4OGEA 2O01E 1NPRA 2A7YA 3X25B 2H3JA 3OYHA 2RHYA 3OYYA 3CEYA 4PLIA 1VQLT 3Q1JA 1VQ6A 3CC7A 3KBGA 2X35A 1VUBA 4PJOD 1YI2A 4OMFB 1G3TA 3HRSA 4JDSA 4EPCA 1KQSA 2KAFA 2X4JA 1P92A 4KUDK 4XU3A 4C8QG 3RKXA 3MEVA 1BIBA 3JCMW 3SFMA 3BW1A 3MCAB 1OI1A 3MP6A 5GAN4 1M5Q1 2EKOA 4R56A 3G4SA 3GP8A 3CPWS 4PJOE 2JTMA 3M56A 1QVGA 5GAOm 4BDZA 4E7IA 3P8BB 2DIQA 3M55A 3P8HA 2PUOB 2XICA 4XTXA 1VQPA 1M1GA 3MP1A 3PMTA 4PNOA 1VQ9T 2RHIA 2VC8A 1M90U 4XK8E 4F7UA 4C92D 2QEXT 1M90C 3JCMd 1KD1C 3VYGA 2HQXA 4JS4A 3ASKA 4RMOA 5FRMA 5GAOn 2OTJT 3SWNC 3CXCS 4M7AC 4KUIA 1XNIA 2DZ9A 5GANe 2LVMA 4C8QB 4F7UG 4NL2A 1K9MC 1Y96A 2QTXA 3GLXA 4RG8A 1NJIU 5FRNA 3CPWA 2X4XA 3OSSC 1UEBA 2JVVA 3QBYA 2GF7A 2WSFE 4X9DA 3OYFA 5CQXA 2LCLA 4LDYA 2HAXA 2KK4A 4BE1A 4LD9K 3URGA 4HCZA 4LDWA 4QVZA 3HP9A 2M0OA 3QZ9B 1RI0A 3LYIA 1U1SA 2VV5A 3P8DA 4C8QD 2K57A 3RMQA 5LJ3g 3OS0A 5LJ5e 4M7DE 4PJOB 4J6WA 2KMTA 4E7LA 2QI2A 3MHXA 1EIFA 1WQ7A 4CRIA 2ZPFB 1W2BS 3BFMA 3HSBA 3V7RA 3BDLA 5DLQE 3CBOA 5I2MA 3VJPA 2RD1A 3OYMA 3LWHA 5GMKh 4Z02A 5GAMf 1X75C 3CD6T 4KBMB 5LJ3d 4QW2A 3OYDA 4MMKA 4C0ZA 5GAN2 3CC2A 4X9CA 5LJ5j 4IUTA 4M7AF 3HL8A 2LQ8A 4LDUA 3M4YA 3OS5A 5A2QE 5GANg 3CCQT 2Y4YA 4PJOG 3M59A 2LNVA 4BD3A 5IN1A 1N27A 2RI3A 3NTHA 1KQ1A 3CCRT 5GAN7 5GAN5 2DD4A 3VYHB 2EQUA 4M78A 2MF2A 4FSXA 3UWNA 4C0DC 2P0KA 5A0DA 2EJ9A 1D3BA 5LL6S 3S6WA 2RJFA 4MZTA 3H6ZA 4UC4A 5GANd 4ZGDB 3JB9I 2L3RA 4XTYA 2EQKA 4XTWA 3MP8A 1G3SA 4A4EA 4OGCA 2DXUA 1X6OA 4M7AG 3TEEA 1KC8U 2ZPBB 3RIRA 4MZMA 1BYMA 1YHQA 4PJOF 4F7UB 1VQ8A 2RH2A 1JJ2A 3VUBA 4C0FA 1YJNT 3CCJT 1ZHIA 3TREA 2PQWA 5FU7C 4Y28E 3RESA 3CCLA 4BE2A 1FX7A 1Q7YC 2E6NA 3QPHA 3R6OA 2ZPGB 4GLKA 1YHQT 1D3BB 2LT1A 4ME7A 3JCMV 3FB9A 2QA4T 2VXEA 2C06A 5LJ3j 4BACA 3SWNB 3ZEHA 1B34B 1WJRA 3E9FA 4M7DA 4EDUA 1O9SA 2BKDN 4LD6A 4N4IA 5CO7A 1M9SA 2EQMA 5LJ5h 3OW2A 3A8LB 3TCJA 2D9TA 2VYTA 2KSSA 1HK9A 4OF1A 4C92E 2FVUA 3V7CA 4IUQA 4N4GA 4BY6C 1QVPA 3A8MB 3PTAA 4M77G 4XU1A 4E7JA 2MWPA 2K3YA 4IKFA 2RHUA 4L6V5 2DXCA 4PJOC 3VUZA 4R55A 1W4SA 3JB9H 5KCHA 1HXDA 3NTIA 3CCQA 3CC4T 2KVQG 1LNXA 2GQVA 2R57A 2X4YA 4P5NA 2M9UA 5LJ3f 5C0MA 5GMKj 3E9GA 2E65A 3JSCA 2E6ZA 1Q86U 4ZN1A 3KXTA 4Y91A 1VQ4T 1N8RC 4RCCA 2EJFA 5HK0A 1NE8A 1S72A 2JNGA 2K4YA 4M77B 4JUVA 3N5BB 1VQKA 5GAMg 4M75G 2QQSA 2VGMA 3OMGA 3I55T 2KDSA 3CBPA 3M54A 3OYCA 3SWNA 4FL6A 2A3LA 3SDZA 4M7AB 2FYKA 2EFIA 3I55A 5GANf 3JCMe 2XK0A 3CCSA 2ZPEB 1VQLA 4C0DB 1KC8C 3G6EA 3JRZA 4A54A 4M77D 2LQKA 4QVCA 1UGQB 5CR2A 1Q82U 2IVWA 3FLGA 1YJ9T 3M4GA 1Y7XA 4FT4A 4M78F 3QZ5B 3HPWA 2V8KA 4O6JA 1VQ4A 4M7DC 4C5EA 4N0AA 4OP0A 3T9NA 3BDUA 4BDYA 3PNWC 2DXBA 3CCUA 4BE0A 4IUPA 3CCEA 2F5TX 4M75A 4JS5A 5EG2A 1KG1A 2RI5A 3QG1A 2E41A 3M53A 3MO8A 4C8QE 5GAN6 1YJ9A 3QIIA 4J7FA 3CCVA 3L2WA 3KUFA 2E64A 4LDXA 4DOVA 2IG0A 3WXMB 3JCMJ 1OZ3A 2KQWA 3V7SA 4PJOA 3HRTA 2DVEA 2MI6A 1LJOA 2OTLT 3JB9J 3G4ST 4X34A 4DA4A 4M7AE 3HFNA 3MEUA 2ZZDA 2PUKB 2L8DA 1MHNA 2LRQA 3OS1A 1R8OB 4J6YA 3X20B 4C92G 4XU2A 1JRIA 4M7AD 4NS5A 3CC7T 2XD0A 1W2BA 1YCYA 1BIAA 3NTKA 4M78C 4ZGEB 4BB7A 2AHJB 1YIJT 1KD1U 4ATOA 4C0GA 4M7DF 4E47A 3A8GB 3L2QA 1WPYA 3CCUT 3G71T 1QVFS 2XDBA 3UPUA 3CCJA 3X28B 2K5FA 4FIBA 5GMKl 2FL7A 2EWNA 2RA2A 5LJ5g 5AYFA 4PL6A 3PIPA 2ZPIB 1M1KC 5FLXE 3L1AA 1JJ2S 1M1FA 2EAYA 4M75B 4CI0C 3LH0A 1I5LA 1VQ5A 1WJQA 4FT2A 4J5YA 2RJDA 3QJYA 1QP2A 2HNIA 5J3BA 3CCST 1VQOT 1GXIE 1ZBXA 3BY7A 3LGFA 3AHUA 1Y71A 1UGRB 2P0QA 4O5VA 2MWOA 3JB9G 4N0AC 1K73U 1VQNT 3ZBDA 1BI2A 2XI9A 3C95A 5I21A 2YLCA 3OW2S 1YBYA 2LC4A 3QYGB 3CXCA 2QDYB 5I2SA 1AHJB 5GMKi 4JRQA 3RMSA 2E5QA 1YITA 4M7DG 3E1SA 1Q82C 1MGQA 3S3OA 4JJNK 3OYEA 3FEOA 1PSEA 2QA4A 3OY9A 1JB0E 3SD4A 4EMKB 3CCMT 4J83A 3VV0A 4JRPA 5IT9E 4HT8A 3M57A 3VU3C 4M77F 1XTDA 2L89A 1UB4A 3META 3M9QA 3TU4K 3CC4A 3QHSA 4PKCC 1YJNA 5LJ5d 3QO3A 1IREB 3I56T 1I4K1 2R5MA 2YLBA 3LX7A 4M78E 5FU6C 1VQ8T 3HFOA 1M1KU 3JB9F 4M7DB 1N8RU 2WACA 3E19A 1RL2A 2MAMA 2G3RA 5CKHA 2QQBA 3C12A 3M58A 4M78D 3X24B 2HQEA 3JB9D 1BI3A 3L42A 4HKEA 1K8AC 1N9RA 1IZ6A 1SSFA 3WVDB 1K73C 4A4FA 4ZTJA 4C92B 2XKOC 3OYJA 4M75F 4M78G 2LX9A 2PVOB 3HHTB 2OAUA 4EMGA 3LWIA 2D0QB 3OYKA 1WGSA 3A8HB 3O8VA 4KT0E 3CMAA 2CKKA 5D6YA 2EJGA 5D6WA 4EMHA 3VKIA 3UT1A 3CCVT 4ZTFA 2LDMA 3F70A 1M8VA 2QQRA 3JCMh 5CCAA 3QSUA 4A53A 2GFUA 2WSCE 4M77C 3LW5E 2RJEA 4D6WA 5LJ3h 3LGLA 3HRUA 3CCET 3S3MA 2Y90A 5GAMh 3OMCA 3QJ6A 2R5AA 4E7KA 3FRNA 1BI1A 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I81 A;  2DEQ A;  4N0A A;  4OP0 A;  1U1T A;  1WQ7 A;  3BDU A;  4M78 B;  3BFM A;  4WF2 A;  4NL3 A;  1Y96 B;  3V7R A;  3V8K A;  5GAM j;  3HSB A;  4M7D C;  4M75 A;  4XQ3 A;  4M77 E;  4C92 A;  2RD1 A;  5GMK h;  5GAM f;  2ZGW A;  4M7D D;  2RB6 A;  4M75 E;  5LJ3 d;  4MMK A;  5GMK e;  5GAN 2;  5GAM d;  2CGH A;  2E41 A;  4X9C A;  4C8Q E;  4C8Q C;  5GAN 6;  5LJ5 j;  3JCM Q;  4M7A F;  2E64 A;  4JRK A;  4M75 C;  5LJ5 f;  5GAN g;  3JCM J;  3V7S A;  4PJO A;  2DTI A;  4PJO G;  3JCM g;  5GAO q;  2DVE A;  4V2S A;  1LJO A;  3JB9 J;  4XTZ A;  4M7A E;  1KQ1 A;  5GAN 7;  1JBM A;  5GAN 5;  3HFN A;  3EFS A;  4M78 A;  3SB2 A;  2DXT A;  2DZC A;  3RER A;  2EJ9 A;  2DJZ A;  1D3B A;  4J6Y A;  4C92 G;  4HT9 A;  1I8F A;  4XU2 A;  5GAN d;  1JRI A;  3JB9 I;  4M7A D;  1WQW A;  4XTY A;  5GAO l;  1YCY A;  1BIA A;  2DKG A;  4M78 C;  4XTW A;  4M7D F;  4EMK C;  2DXU A;  1WNL A;  3PGG A;  4F7U F;  1WPY A;  5DY9 A;  5GAN j;  1LOJ A;  4M7A A;  2FB7 A;  4M7A G;  1B34 A;  3JCM c;  3RIR A;  5GMK l;  2EWN A;  2RA2 A;  5LJ5 g;  4PJO F;  4F7U B;  5LJ3 e;  2YHT A;  5GAN h;  1H64 1;  4M77 A;  3V8L A;  3L1A A;  2EAY A;  4M75 B;  4C8Q F;  1I5L A;  3QUI A;  5GAO p;  1X01 A;  4J5Y A;  3RES A;  2HNI A;  4XTU A;  3BY7 A;  5GMK m;  3AHU A;  2I2L A;  2DTO A;  2E1H A;  4JLI A;  3JCM b;  3INZ A;  4N0A C;  4XU0 A;  3JB9 G;  1D3B B;  3FIF A;  3JCM V;  3FB9 A;  2YLC A;  2VXE A;  5I21 A;  4XTV A;  5LJ3 j;  3SWN B;  1B34 B;  5GMK i;  1TH7 A;  2VXF A;  4C92 C;  4M7D A;  2E10 A;  4M7D G;  3RKW A;  1MGQ A;  5GAM e;  3V8J A;  3EFR A;  5LJ5 h;  2RM4 A;  1HK9 A;  4C92 E;  4EMK B;  4F7U E;  3V7C A;  4PJO D;  4HT8 A;  3VU3 C;  4M77 F;  4DQ2 A;  4XU3 A;  4C8Q A;  4C8Q G;  3L2Z A;  3QHS A;  3RKX A;  4M77 G;  1BIB A;  4XU1 A;  3JCM W;  1N9S A;  3BW1 A;  4HA8 A;  5LJ5 d;  5GAN 4;  3QO3 A;  1M5Q 1;  4PJO E;  4PJO C;  1I4K 1;  2YLB A;  4M78 E;  5CAI A;  5GAO m;  3HFO A;  3JCM X;  3JB9 F;  1HXD A;  3JB9 H;  4M7D B;  1LNX A;  4XTX A;  5LJ3 f;  4NOY A;  4PNO A;  5GMK j;  2E65 A;  4M75 D;  2VC8 A;  4RCB A;  3RKY A;  4C92 D;  4F7U A;  4Y91 A;  4M78 D;  3JCM d;  4EMK A;  3JB9 D;  5GAO n;  1N9R A;  3SWN C;  4RCC A;  2EJF A;  4M7A C;  4C92 B;  2DZ9 A;  5GAN e;  4F7U G;  4M75 F;  4C8Q B;  4M78 G;  4NL2 A;  1Y96 A;  2QTX A;  4M77 B;  4JUV A;  4C92 F;  4EMG A;  5GAM g;  5GAN 3;  4M75 G;  2DTH A;  4EMH A;  2EJG A;  3FJP A;  4QVD A;  4X9D A;  3SWN A;  3JCM P;  1M8V A;  3JCM h;  4M7A B;  4JRI A;  2FYK A;  1KQ2 A;  2JN0 A;  5GAN 8;  3QSU A;  4A53 A;  5GAN f;  3JCM e;  3JCM f;  4M77 C;  5GAO r;  4A54 A;  4M77 D;  3RUX A;  5LJ3 h;  1U1S A;  4C8Q D;  4QVC A;  5LJ3 g;  2K57 A;  2Y90 A;  4PJO B;  5LJ5 e;  5GAM h;  3M4G A;  4J6W A;  4MML A;  4M78 F;  4M7D E;  3GIB A;  4J6X A; 
#chains in the Genus database with same CATH topology
 1U1T A;  3OYG A;  4QKU A;  4AFZ C;  2COZ A;  1VQP T;  1WLP B;  3G6E T;  4M7D D;  4M75 E;  4PFO A;  4RTZ A;  1O75 A;  3S3N A;  1VQK T;  2RO0 A;  1FXX A;  5EC7 A;  1KHC A;  3ZL7 C;  4OB0 B;  4J8O A;  2E5K A;  2PVG B;  2M16 A;  1MV0 B;  2OTJ Q;  2DO3 A;  3G71 A;  4L59 A;  2WSE E;  3CCQ Q;  2L5Q A;  4FYY B;  2K5I A;  5GAO l;  4DOW A;  3QDF A;  1T0J A;  2QEX A;  2CSQ A;  1KHI A;  1B34 A;  2V8J A;  2EQI A;  3EAE A;  2V1Q A;  1E6H A;  3MEA A;  2DX1 A;  4LN2 A;  2OTL A;  1X01 A;  2K7A A;  5IAY A;  5GMK m;  2I2L A;  1ZSG A;  1QW1 A;  2A28 A;  2MPX C;  1OZ2 A;  1RAI B;  2E4H A;  4DBH A;  3TQ7 P;  2XU8 A;  3UDC A;  3V8J A;  2FRW A;  2MMP A;  2FG0 A;  2K3X A;  4F7U E;  1XOV A;  1YNZ A;  2J06 A;  3EHQ A;  4FYV B;  2LZ6 B;  3GNF B;  3CMA T;  3LLR A;  4C8Q A;  3OYI A;  2JZ2 A;  2QEX Q;  2XG8 D;  4HA8 A;  4OVA A;  3OYA A;  2HKN A;  3HKS A;  5CAI A;  3CXC P;  4F17 A;  2GFA A;  4WCI A;  1X6B A;  3RKY A;  1AZG B;  2ZAE A;  4XAX B;  5CKD A;  4OB2 B;  1SG5 A;  1YJW A;  2YSQ A;  5GAN 3;  1V1C A;  3JCM P;  3FJP A;  2L3P A;  3J80 E;  3CCM A;  1WJS A;  3U23 A;  1VQ7 Q;  4OB3 B;  2RHZ A;  4MML A;  4MDX A;  2CZ0 B;  2J7I A;  1H92 A;  1VQO A;  3EGX B;  2RB6 A;  1NLP C;  2HBP A;  2KY9 A;  3VS2 A;  1OUL A;  2J05 A;  2L0A A;  3CC2 Q;  2DTI A;  5GAO q;  2D6F A;  3I56 A;  1VIE A;  1ZBJ A;  3CME A;  1MMN A;  1JJ2 P;  2NUP A;  2DZC A;  1VQ5 Q;  3EG9 B;  2DJZ A;  2OI3 A;  3EGU A;  3C4S A;  4QQD A;  4JJB A;  4A4G A;  1N6A A;  1LPL A;  1TTH B;  2FB7 A;  2JXB A;  4ZN3 A;  1XQH A;  2ROT A;  1QQJ A;  2GCX A;  1PG5 B;  2DE0 X;  4MDW A;  2DTO A;  3INZ A;  2NUP B;  1EZZ B;  1BKB A;  1NEB A;  4DBQ A;  3CME Q;  1YJW T;  2P0P A;  4BY6 B;  2E10 A;  4JZ4 A;  1NPR A;  3O5Z A;  1VQ6 A;  3CEY A;  4PLI A;  3KBG A;  4PJO D;  4EPC A;  1G3T A;  4JDS A;  2CT3 A;  2X4J A;  1R0C B;  4KUD K;  3BW1 A;  3MP6 A;  5GAN 4;  3G4S A;  2JTM A;  3M56 A;  1QVG A;  5GAO m;  1S1N A;  4E7I A;  1K1Z A;  2XIC A;  2HMA A;  4PNO A;  2QK0 A;  2CP5 A;  2A36 A;  1KD1 C;  1PKS A;  4JS4 A;  3ASK A;  4RMO A;  4FCY A;  4M7A C;  1XNI A;  1J3T A;  4NL2 A;  2QTX A;  1OPK A;  1E6G A;  2X4X A;  1UEB A;  3QBY A;  2HDA A;  5CQX A;  4KH1 B;  1QMC A;  2LX7 A;  4BE1 A;  4E7S A;  1G8X A;  4HCZ A;  4QVZ A;  3MJX A;  3QZ9 B;  3LYI A;  2JS0 A;  2ROL A;  3OS0 A;  3UA7 A;  2G6F X;  1X69 A;  3MHX A;  1ZUK A;  1WQ7 A;  2ZPF B;  3REA B;  1F1B B;  5DLQ E;  4Z02 A;  1GBQ A;  3G71 Q;  4B6M A;  4X9C A;  4M7A F;  4LUE A;  2LQ8 A;  3OS5 A;  2FEI A;  3NTH A;  2DD4 A;  1PM3 A;  4HXJ A;  2BE7 D;  4XTW A;  3MP8 A;  1G3S A;  4OMQ A;  1VQ8 Q;  3TEE A;  1KC8 U;  2ZPB B;  3RIR A;  1YIT Q;  4X1V A;  2HQH A;  1UHF A;  3EG3 A;  1YJN T;  3CCJ T;  3TRE A;  5FU7 C;  3FJ5 A;  2YT6 A;  4FW2 A;  2QGF B;  3CCL A;  3VS3 A;  9ATC B;  1FX7 A;  2E6N A;  3QPH A;  3R6O A;  4GLK A;  2C06 A;  1QVG P;  3M0R A;  4OMO A;  2BKD N;  4N4I A;  3IQL A;  2KSS A;  1HK9 A;  1NYF A;  4C92 E;  2YRC A;  5FWB A;  1WXT A;  3PTA A;  4M77 G;  1UTI A;  1D1C A;  4IKF A;  3CC4 T;  2KVQ G;  1LNX A;  2R57 A;  2P84 A;  1Q86 U;  3LH5 A;  4ZN1 A;  1VQ4 T;  3CCL Q;  4FYW B;  4RCC A;  5HK0 A;  1S72 A;  1K76 A;  4JUV A;  1VQK A;  5GAM g;  3QWY A;  2F1L A;  3G4S Q;  3OYC A;  4ESR A;  2ATC B;  2CUD A;  2XK0 A;  2JTE A;  2ZPE B;  1VQL A;  1KC8 C;  2NUT A;  3I5S A;  4A54 A;  1QCF A;  5CR2 A;  1WHK A;  4FT4 A;  4M7D C;  3QZ5 B;  5KYN A;  1AWJ A;  4BDY A;  1WDX A;  3NPF A;  3CPW P;  4M75 A;  4JS5 A;  1KG1 A;  3QWX X;  3R6N A;  1GL5 A;  3QII A;  2ED0 A;  3L2W A;  1OZ3 A;  4PJO A;  2ED1 A;  2ZZD A;  4E6R A;  2EYW A;  2L8D A;  4C92 G;  4XU2 A;  1JRI A;  1W2B A;  1YCY A;  3M0U A;  5FWC A;  4ATO A;  4M7D F;  1YFN A;  2JS2 A;  1QVF S;  1RAD B;  3CCJ A;  1M2V A;  4FIB A;  5GMK l;  2FL7 A;  1M1K C;  5FLX E;  1JJ2 S;  2D8H A;  1FYN A;  1I5L A;  3VS4 A;  1WJQ A;  4J5Y A;  1RAE B;  3QJY A;  1QP2 A;  1ZBX A;  3AHU A;  4JPB W;  4O5V A;  3JB9 G;  2XI9 A;  3OW2 S;  4F04 B;  3QYG B;  1YIT A;  4Z8A A;  3E1S A;  4JJN K;  1VQ4 Q;  3OYE A;  4CC4 B;  1PSE A;  1JB0 E;  3SD4 A;  1ZUU A;  4EMK B;  5IT9 E;  3M57 A;  2QDL A;  3CC4 A;  2KI7 A;  1UGV A;  3QO3 A;  1IRE B;  3I56 T;  1I4K 1;  1TXQ A;  2R5M A;  2YLB A;  3LX7 A;  3JB9 F;  4M7D B;  2KRN A;  8AT1 B;  2KEA A;  2X51 A;  3THK A;  4M78 D;  3JB9 D;  1BI3 A;  1IZ6 A;  2C0T A;  2VAS A;  1PD1 A;  1RAC B;  2PVO B;  4EMG A;  1JO8 A;  5D6W A;  5D6Y A;  4EMH A;  2W10 A;  3CCV T;  4Y92 A;  1NJI R;  3G6E Q;  2QQR A;  1N8R R;  1VQP Q;  1AVZ C;  2DET A;  1OV3 A;  3M0P A;  5ECA A;  1RLQ C;  3M0T A;  2KYB A;  1K9M R;  3LGL A;  1IXD A;  4E7K A;  3FRN A;  1BI1 A;  3EH1 A;  5CKB A;  4RG2 A;  1X43 A;  4M78 B;  4NL3 A;  3V8K A;  2NYS A;  3M5A A;  4C92 A;  4RKU E;  2ZGW A;  2FHD A;  2DIG A;  2YUP A;  5LJ5 f;  4J9H A;  2HCK A;  4LXC A;  1D0X A;  1VOM A;  2PVD B;  2QXF A;  2K2M A;  5FRO A;  2KE9 A;  4JJD A;  1K9M U;  1DJ7 B;  2EQJ A;  2CZ7 B;  1Q86 C;  1WNL A;  2FZG B;  4QQG A;  1ARK A;  3CCM Q;  5D6X A;  4JLG A;  4LDV A;  5GAN h;  1H64 1;  4M77 A;  1VQ7 A;  4WTO B;  1K8A R;  3DB3 A;  1V29 B;  2CP6 A;  5GAO p;  3DLL A;  4XTU A;  3A1P A;  2CH4 A;  1VIF A;  1UGP B;  1Q81 U;  4JLI A;  1NBE B;  4VUB A;  2QQ9 A;  2L3S A;  2QA4 Q;  1QLY A;  3ME9 A;  5GAM e;  3EFR A;  1OPL A;  8ATC B;  2EGC A;  1D09 B;  2AZV A;  3X26 B;  3L2V A;  2CP7 A;  2KT8 A;  2C0I A;  3EG2 A;  3BE3 A;  1UE9 A;  4IUU A;  2BIV A;  2XID A;  2F5K A;  3DB4 A;  4OMP A;  1VQL Q;  1OYX A;  3OSV A;  2KRS A;  3OS2 A;  4OB1 B;  1VQ6 T;  2Y4X A;  1MMA A;  2DTH A;  4A4H A;  2XDP A;  4CC3 A;  4QVD A;  2RK2 A;  2E12 A;  5KE2 A;  5GAO r;  1PCX A;  1YN8 A;  4BI8 B;  5D7U A;  2O4X A;  3J7A F;  2BUD A;  1NEG A;  2GQI A;  5J39 A;  1TG0 A;  2A37 A;  4DEX A;  1VQ5 T;  1N5Z A;  5GMK e;  2EYQ A;  4C8Q C;  2DLP A;  1ZSZ C;  4J9I A;  2EVR A;  1GFD A;  2JMA A;  2P4T A;  4B9X A;  4V2S A;  1BB9 A;  3CC2 T;  1YWO A;  3GPL A;  1R77 A;  2QTV A;  1YIJ A;  2JUF A;  2LCC A;  3PMI A;  1QVF A;  4BI3 A;  1G2B A;  2HKQ B;  4A4K A;  3H8Z A;  2KRO A;  2X3W D;  2O88 A;  2LT4 A;  2XHC A;  2H3E B;  1RI9 A;  5FU7 B;  1MUZ A;  3NFC A;  1IO6 A;  1AD5 A;  5I22 A;  3D7S B;  3V8L A;  1C1A A;  4J7I A;  4C8Q F;  5L8R E;  2DPP B;  1G3Y A;  2VGN A;  5KH6 A;  1M30 A;  4OMM A;  2DEU A;  2E1H A;  2PU9 B;  1Y0M A;  3FIF A;  2F2X A;  3PVQ A;  2EGA A;  3EFO B;  1XJW B;  2YWW A;  4OGE A;  2H3J A;  3OYY A;  3Q1J A;  1VYU A;  4J9B A;  3EG1 A;  2OJ2 A;  2JW4 A;  3HRS A;  1KFZ A;  3I9Q A;  4XU3 A;  3H0F A;  1BIB A;  2O9V A;  3E2U A;  1WHL A;  3SFM A;  4R56 A;  2EKO A;  3MKD A;  3RNJ A;  3KFV A;  3P8H A;  2QGG A;  1VQP A;  1M1G A;  1I07 A;  2RHI A;  4F7U A;  3JCM d;  1AWX A;  4LNP A;  1HD3 A;  2OTJ T;  4KUI A;  4KGX B;  2DZ9 A;  1Y96 A;  5FRN A;  2NWM A;  1D1B A;  2WSF E;  4GBQ A;  1M90 R;  2HAX A;  1AT1 B;  2MYS A;  4PJJ A;  2D8J A;  3P8D A;  4C8Q D;  5LJ3 g;  4PJO B;  5LJ5 e;  1JU5 C;  2HL3 A;  2KMT A;  2RNA A;  5KYX A;  3V7R A;  3BDL A;  1AWW A;  3CBO A;  5I2M A;  3CD6 T;  5LJ3 d;  4MMK A;  4C0Z A;  5GAN 2;  3CC2 A;  5LJ5 j;  3HL8 A;  1OEB A;  5GAN g;  2Y4Y A;  1KQ1 A;  3CCR T;  5GAN 7;  1NG2 A;  2K9G A;  1ZSZ B;  2B86 A;  2DM1 A;  3VYH B;  2EQU A;  3H0H A;  1D3B A;  1PRL C;  2AKK A;  4D8D A;  4MZT A;  3H6Z A;  5GAN d;  1S72 Q;  2KXC A;  2L3R A;  4XTY A;  2EQK A;  1OX9 A;  1X2Q A;  2DXU A;  1X6O A;  2CSI A;  1IGU A;  3A98 A;  1YHQ A;  2MIO A;  1VYT A;  1H3H A;  2DNU A;  2RH2 A;  1R0B G;  2YRD A;  4PK4 A;  4BE2 A;  3FB9 A;  5LJ3 j;  1I0C A;  3SEM A;  1O9S A;  3OW2 A;  5LJ5 h;  3A8L B;  4KH0 B;  2VYT A;  2RMO A;  1OX8 A;  2FVU A;  2C0O A;  2IIM A;  3H0I A;  4XU1 A;  2MWP A;  2GTJ A;  3VUZ A;  1Q86 R;  1W4S A;  5AT1 B;  3CCU Q;  3JB9 H;  3CCQ A;  2MK5 A;  2GQV A;  2X4Y A;  4P5N A;  5C0M A;  2M9U A;  3E9G A;  2E65 A;  3JSC A;  2E6Z A;  1VYV A;  2JMC A;  3EHR A;  2JNG A;  2K4Y A;  4M75 G;  1GCQ A;  2OTL Q;  3CBP A;  3SWN A;  2CP0 A;  2A3L A;  2EFI A;  2KXD A;  5KYW A;  3JRZ A;  4M77 D;  4QVC A;  1UGQ B;  1M2O A;  2EYY A;  1Q82 U;  1Y7X A;  4M78 F;  2V8K A;  1VQ4 A;  1PD0 A;  4N0A A;  4OP0 A;  3BDU A;  4RTW A;  5KYU B;  1W70 A;  3PNW C;  3CCU A;  4BE0 A;  3CCV Q;  2CT4 A;  2RI5 A;  3QG1 A;  2AKL A;  2E41 A;  3MO8 A;  4C8Q E;  5GAN 6;  4IIM A;  1PHT A;  3KUF A;  3WXM B;  3V7S A;  1IHW A;  1C6V X;  4DA4 A;  1RAH B;  1GCP A;  3HFN A;  3MEU A;  2LRQ A;  3OS1 A;  4AFU C;  4NS5 A;  3CC7 T;  2XD0 A;  1BIA A;  4M78 C;  1IGQ A;  2AHJ B;  2XDB A;  1WPY A;  2KYM A;  2DIL A;  3CD6 Q;  2K5F A;  3CQT A;  3EFO A;  3G1J A;  2O31 A;  4E7Z A;  4PL6 A;  2ZPI B;  2RJD A;  3CCS T;  5IXF A;  3I55 Q;  4HVW A;  2MWO A;  1WYX A;  1VQN T;  3ZBD A;  2LCS A;  1VQO Q;  1K9A A;  2LC4 A;  3CXC A;  2HSE B;  1AHJ B;  3RMS A;  2E5Q A;  1Q82 C;  1YHQ Q;  2DFU A;  2M51 A;  3OY9 A;  4JRP A;  2GNC A;  1BK2 A;  3MET A;  1UB4 A;  3TU4 K;  4FW1 A;  4DBR A;  4HVU A;  1YJN A;  5LJ5 d;  3NMZ C;  5FW9 A;  1M1K U;  1X27 A;  1TSF A;  3E19 A;  2MAM A;  2G3R A;  1Q81 R;  2PTK A;  1K8A C;  2CUB A;  3L42 A;  1N9R A;  3WVD B;  1NLO C;  4ORZ A;  4C92 B;  3OYJ A;  2DER A;  2D0Q B;  2BZX A;  4KT0 E;  1TUC A;  3VKI A;  3F70 A;  4K11 A;  2WSC E;  2RJE A;  5I11 A;  3HRU A;  4GLM A;  4FSS A;  2Y90 A;  5GAM h;  3A5Z B;  1I81 A;  3DKM A;  2DBK A;  4WF2 A;  2D1X A;  1IHV A;  2VKN A;  2BZY A;  3FC3 A;  2X3X D;  5IHK A;  4HCB A;  4II1 A;  4AFQ C;  2CGH A;  4J9F A;  3I35 A;  5HK3 A;  2PZ1 A;  3JCM g;  2V8I A;  3ZFJ A;  2QAS A;  5KYX B;  2R58 A;  2F69 A;  4HT9 A;  1VQ9 Q;  2OTJ A;  1SPK A;  2DKG A;  4GY5 A;  1PWT A;  4EMK C;  2DYI A;  1VQM T;  3VRY A;  2DAQ A;  4C5H A;  5DY9 A;  5HY6 A;  2YRV A;  1QVG S;  2RJC A;  2K2V A;  4FYX B;  5M9O A;  5KCO A;  2JOY A;  1QVF P;  2HZY A;  3QKJ A;  4J9C A;  2SRC A;  4HCC A;  1KQS S;  1CKB A;  1LCK A;  4RUG A;  1QKX A;  2DRK A;  4XU0 A;  2COW A;  2VXF A;  4C92 C;  2X4W A;  1WXU A;  2OX7 A;  3RKW A;  1G5V A;  2KNB B;  1UGS B;  3QDR B;  2RM4 A;  4ELY C;  5A0L A;  3JV3 A;  3M0Q A;  1Q7Y U;  1VQ9 A;  1UDL A;  2E70 A;  4ZGJ B;  2DL3 A;  1FWZ A;  2DD5 A;  1EX4 A;  1Q82 R;  4KUL A;  4E2F B;  2RQT A;  5C6S A;  3JCM X;  3GNG A;  1RLP C;  2ENM A;  4M75 D;  2ZCF B;  3HTR A;  4RCB A;  3PFS A;  1S72 T;  1H3Z A;  5FU6 B;  1I5O B;  3CCR A;  2ESW A;  3RR6 A;  2CZ6 B;  1TS9 A;  1D0Z A;  2YDL A;  4E7H A;  2QYZ A;  1YP5 A;  1BU1 A;  1ZX6 A;  3H9N A;  3CME T;  4JRI A;  2LMJ A;  2JN0 A;  3OQ5 A;  3GBQ A;  4KGV B;  5CKE A;  4RTY A;  3RUX A;  3PVL A;  3VRZ A;  2LJ0 A;  3ER0 A;  1VQN A;  2PNI A;  2DEQ A;  3OYL A;  2JJ9 A;  3MEW A;  1JXM A;  2DL5 A;  3DLM A;  4XQ3 A;  5CKF A;  3EGX A;  5HKC A;  1ZUY A;  3CPF A;  4MZP A;  5GAM d;  3JCM Q;  3I5R A;  2CZ1 B;  2B8A A;  2VVK A;  2EW3 A;  1JBM A;  3QXE B;  2K5L A;  3CBM A;  2MCN A;  2RHX A;  2O4X B;  5A0G A;  3RBB B;  4N4H A;  3RER A;  3QYH B;  3EG0 A;  1I8F A;  1NPP A;  4A63 B;  4CC2 A;  1G3W A;  4FM4 B;  1M3C A;  2RI2 A;  5GAN j;  5CK9 A;  3JCM c;  4B9W A;  2JM8 A;  1ABO A;  3J81 E;  5LJ3 e;  2YHT A;  4PFZ A;  4BUG A;  2ZPH B;  4FU6 A;  2RQU A;  1JEG A;  2EGE A;  1MMG A;  1K0X A;  3PE0 A;  1WXB A;  1NM7 A;  1RAB B;  1AOJ A;  1JQQ A;  3OBY A;  2DK3 A;  2JTF A;  4Q5W A;  3TVT A;  2O01 E;  3OYH A;  1WIE A;  2GBQ A;  1VQ6 Q;  4C8Q G;  4PJN A;  3MEV A;  3VS1 A;  3MCA B;  1M5Q 1;  3GP8 A;  4PJO E;  4LE9 A;  3M55 A;  1PKT A;  1X6G A;  3PMT A;  1VQ9 T;  2K3B A;  2VC8 A;  4XK8 E;  4C92 D;  1TWB A;  2QEX T;  1M90 C;  2HQX A;  1UJY A;  2JT4 A;  5FRM A;  2ECZ A;  3CXC S;  4PJM A;  2LVM A;  3M0S A;  2LQN A;  4R0K A;  2YUO A;  4RG8 A;  1NJI U;  1PC0 A;  2JVV A;  2GF7 A;  3OYF A;  2LCL A;  2KK4 A;  1HJD A;  1RI0 A;  1FMV A;  3UAT A;  2K57 A;  3RMQ A;  1WZO A;  4M4Z A;  4J6W A;  1UFF A;  1SF9 A;  2QI2 A;  2GGR A;  4CRI A;  3BFM A;  2GTO A;  3VJP A;  2RD1 A;  5GMK h;  5GAM f;  1X75 C;  4KBM B;  4IUT A;  2O2O A;  4LDU A;  1TOV A;  5A2Q E;  2K79 A;  1KD1 R;  3CCQ T;  4PJO G;  1RUW A;  2FRY A;  2LNV A;  4BD3 A;  5IN1 A;  4EIK A;  2AT1 B;  5GAN 5;  2MF2 A;  4FSX A;  2P0K A;  1ZLM A;  5LL6 S;  3TSZ A;  2RJF A;  4UC4 A;  3JB9 I;  4ZGD B;  4LUD A;  2P4R A;  1B07 A;  1X2K A;  1VQ8 A;  1WA7 A;  1JJ2 A;  1YCS B;  4C0F A;  1ZHI A;  1KQS P;  2PQW A;  3RES A;  4Y28 E;  1Q7Y C;  1M3B A;  2Z0W A;  1YHQ T;  1D3B B;  4ME7 A;  3JCM V;  2QA4 T;  3SWN B;  3ZEH A;  1WJR A;  3E9F A;  4EDU A;  4D8K A;  5CO7 A;  3TCJ A;  2D9T A;  4OF1 A;  3V7C A;  4N4G A;  4BY6 C;  1RAA B;  2RN8 A;  1JXO A;  2BE9 B;  4OMN A;  4L6V 5;  5KYW B;  1HXD A;  3NTI A;  4HVV A;  2KR3 A;  3CCE T;  2EKH A;  4Y91 A;  1N8R C;  1VQK Q;  3NGP A;  2EBP A;  2EJF A;  2E3H A;  3C0C A;  4M77 B;  4JZ3 A;  3N5B B;  2QQS A;  2VGM A;  3OMG A;  3I55 T;  1LVK A;  4FL6 A;  1W1F A;  1MNE A;  2FYK A;  3I55 A;  2M02 A;  3JCM e;  1K73 R;  4C0D B;  1E7O A;  2IVW A;  4ANJ A;  1TUD A;  3M4G A;  5IHN A;  4O6J A;  3T9N A;  3H41 A;  4KRT A;  1KSW A;  2F5T X;  3MPU B;  3VS6 A;  5EG2 A;  2W0Z A;  1YJ9 A;  2IG0 A;  3JCM J;  3HRT A;  2OTL T;  3JB9 J;  4M7A E;  4X34 A;  3UF4 A;  1UUE A;  2YUQ A;  2PUK B;  1R8O B;  1M8M A;  3X20 B;  4M7A D;  2DL8 A;  4ZGE B;  1KD1 U;  4BB7 A;  4C0G A;  1V76 A;  4E47 A;  2MOX A;  3UPU A;  3X28 B;  1SSH A;  1T3L A;  1U3O A;  4RTU A;  2EWN A;  2RA2 A;  5AYF A;  4HCK A;  3L1A A;  4M75 B;  4CI0 C;  3LH0 A;  2HNI A;  1WHG A;  5IHI A;  3BY7 A;  1UGR B;  3NHN A;  4N0A C;  1K73 U;  3C95 A;  5I21 A;  1D1A A;  2YLC A;  1YBY A;  2SEM A;  2QDY B;  2DJQ A;  3S3O A;  4PFP A;  1QKW A;  3VS5 A;  1IRX A;  1OQK A;  3CCE Q;  3CCS Q;  3VU3 C;  2L89 A;  1YIJ Q;  5KYY B;  3QHS A;  4PKC C;  1WFW A;  4M78 E;  5FU6 C;  1MV3 A;  2J6K A;  1QWF A;  1RL2 A;  1YWP A;  3M58 A;  1SRM A;  3X24 B;  1SSF A;  4A4F A;  4M75 F;  1WHM A;  4M78 G;  4PJL A;  2LX9 A;  3HHT B;  2DL4 A;  2OAU A;  4IIO A;  1WGS A;  3A8H B;  2CKK A;  2E3I A;  2EJG A;  2XMF A;  4ZTF A;  3UT1 A;  2FZC B;  5IXB A;  3JCM h;  5CCA A;  3EGD A;  2GFU A;  2J6F A;  4D6W A;  2DMO A;  2DL7 A;  3S3M A;  1QCO A;  3QJ6 A;  3OYB A;  1ZSZ A;  1Y96 B;  5GAM j;  4BI4 A;  5CQY A;  4QT7 A;  5DLO A;  4M75 C;  4JRK A;  1ZQ1 A;  2EYX A;  2NLU A;  2LQW A;  1VQM A;  1I1J A;  1M3A A;  3EFS A;  3SHW A;  2FPD A;  3JAM E;  1W6X A;  2LTO A;  4Z88 A;  1M4Z A;  4TVR A;  2EIF A;  3CD6 A;  2ABL A;  3L2R A;  3PGG A;  1AEY A;  3GOX A;  2DBM A;  1LOJ A;  2AIR B;  2FZK B;  2IPO B;  4F14 A;  1U8R A;  1Z9Q A;  1Q81 C;  3OB9 A;  2J6O A;  1Y07 A;  2VUB A;  4ELZ C;  4AFS C;  1GRI A;  1VQ7 T;  4CC7 A;  3OYN A;  3JCM b;  1W2B P;  1YI2 T;  4IUR A;  1ZA1 B;  4PLL A;  2RF0 A;  4XTV A;  4RTV A;  5KE3 A;  1BI0 A;  1TH7 A;  3CCL T;  1M2V B;  3G7Z A;  2HSP A;  1HYO A;  5J26 A;  4F16 A;  2AZS A;  4DQ2 A;  3L2Z A;  4RTT A;  1N9S A;  4L5G A;  1TUG B;  1K8A U;  4C5G A;  4NOY A;  4C5I A;  2I0N A;  2NUT B;  4EMK A;  1QCN A;  2CS7 A;  5KYY A;  4C92 F;  2XDD A;  1Q7Y R;  3C94 A;  3OA6 A;  1WX6 A;  4YTL A;  2BTT A;  2CYZ B;  2RK1 A;  2QAZ A;  1KQ2 A;  1PSF A;  5GAN 8;  3JCM f;  3PT9 A;  3A8O B;  5CIU A;  1NZ9 A;  1YIT T;  1KIK A;  5DM7 R;  4F7U F;  3GIB A;  4J6X A;  3FDR A;  3GF5 A;  4QQ6 A;  4M77 E;  2DF6 A;  2HD0 A;  1QP3 A;  1BCO A;  4AG2 C;  3OBW A;  1RAF B;  3L2U A;  2QQA A;  5CVI A;  4XTZ A;  5KYU A;  1WHH A;  1EFN A;  2HEQ A;  2KGT A;  3SB2 A;  3EG9 A;  2DXT A;  1FMK A;  2HL5 C;  1WQW A;  2K6D A;  1SEM A;  1SKU B;  1HSQ A;  4M7A A;  4IUV A;  1OOT A;  2M1H A;  3VS7 A;  3WVE B;  3EH2 A;  3QUI A;  2CH4 W;  2CDT A;  2DA9 A;  1YJW Q;  3PIO A;  2A7Y A;  3X25 B;  2RHY A;  1VQL T;  1KC8 R;  3CC7 A;  2X35 A;  1VUB A;  1YI2 A;  4OMF B;  1KQS A;  2VWF A;  2BZ8 A;  2KAF A;  2V1R A;  1P92 A;  1M27 C;  1Q95 G;  1H8K A;  3RKX A;  5L23 A;  1GBR A;  3JCM W;  1OI1 A;  3CPW S;  1ABQ A;  4BDZ A;  3P8B B;  2DIQ A;  2PUO B;  4J9G A;  2FO0 A;  4XTX A;  1B7T A;  3MP1 A;  1M90 U;  3CCR Q;  1GCQ C;  3VYG A;  5GAO n;  3SWN C;  5GAN e;  4F7U G;  4C8Q B;  1KK7 A;  1K9M C;  3GLX A;  3CPW A;  3OSS C;  4X9D A;  3RDV A;  1CKA A;  4AT1 B;  5GJV B;  4LDY A;  3REB B;  6AT1 B;  4LD9 K;  3URG A;  4LDW A;  3UA6 A;  1YI2 Q;  3HP9 A;  1ZA2 B;  2M0O A;  1U06 A;  1U1S A;  2VV5 A;  4OML A;  4M7D E;  4E7L A;  1M1K R;  1EIF A;  1W2B S;  3HSB A;  1BBZ A;  3OYM A;  3LWH A;  1AZE A;  4QW2 A;  3OYD A;  4DBF A;  3M4Y A;  1A0N B;  2RQW A;  4ZNX A;  1SHF A;  3M59 A;  1N27 A;  2RI3 A;  2L3Q A;  2KBT A;  4M78 A;  3UWN A;  4C0D C;  1D0Y A;  5A0D A;  2EJ9 A;  3S6W A;  2AK5 A;  4DEY A;  4A4E A;  1K0S A;  4OGC A;  2F2V A;  2F2W A;  1SHG A;  4M7A G;  2L2P A;  1GFC A;  4MZM A;  2LNH B;  1BYM A;  4PJO F;  4F7U B;  1U5S A;  4AMC A;  1BCM A;  3VUB A;  1WI7 A;  1PRM C;  1YJ9 Q;  5GJW B;  2ZPG B;  1T3S A;  2LT1 A;  2M0Y A;  2JM9 A;  2VXE A;  4BAC A;  1G83 A;  1B34 B;  4M7D A;  4KGZ B;  4JJC A;  4LD6 A;  1M9S A;  1RAG B;  2EQM A;  2DVJ A;  4IUQ A;  2CP3 A;  1WHJ A;  1QVP A;  1TU0 B;  3A8M B;  2HBW A;  4E7J A;  2K3Y A;  2RHU A;  2DXC A;  4PJO C;  2YXY A;  4R55 A;  3CMA Q;  3CC4 Q;  1FMW A;  1UG1 A;  5KCH A;  2A08 A;  5LJ3 f;  5GMK j;  3TSW A;  2QG9 B;  7AT1 B;  3CC7 Q;  3KXT A;  2D0N A;  2H8H A;  1NE8 A;  1T0H A;  1UHC A;  2RQV A;  2KDS A;  3M54 A;  3SDZ A;  4M7A B;  2CRE A;  5GAN f;  3CCS A;  3G6E A;  2LQK A;  4J9D A;  3FLG A;  1YJ9 T;  3VS0 A;  3HPW A;  2OAW A;  4C5E A;  2DXB A;  4IUP A;  3CCE A;  1OU8 A;  4J9E A;  4AG1 C;  1MMD A;  3M53 A;  3CCV A;  4J7F A;  2E64 A;  4LDX A;  4DOV A;  2KQW A;  4RTX A;  2DVE A;  2MI6 A;  1LJO A;  1MND A;  3G4S T;  1B3Q A;  1MHN A;  4J6Y A;  3NTK A;  1YIJ T;  3A8G B;  3L2Q A;  3CCU T;  3G71 T;  2KT1 A;  3OW2 P;  3I56 Q;  1UEC A;  5LJ5 g;  2X9H A;  1QWE A;  3PIP A;  2LP5 A;  2DRM A;  3ULR B;  2FPF A;  1PNJ A;  1M1F A;  2EAY A;  2LJ1 A;  5IH2 A;  1VQ5 A;  4FT2 A;  5J3B A;  1VQO T;  1IB8 A;  1VQN Q;  1GXI E;  3LGF A;  1Y71 A;  2P0Q A;  2RQR A;  2EYZ A;  1BI2 A;  5GMK i;  5I2S A;  2NUZ A;  4JRQ A;  4M7D G;  3AT1 B;  1KJW A;  1MGQ A;  3EGD B;  5HCK A;  3FEO A;  1OU9 A;  2QA4 A;  2A0F B;  3CCM T;  2V26 A;  1VA7 A;  2EPD A;  4J83 A;  3VV0 A;  1YJN Q;  4HT8 A;  4M77 F;  1XTD A;  1Z9Z A;  1VQM Q;  3M9Q A;  1UJ0 A;  2CP2 A;  2VB6 A;  2COY A;  1Y57 A;  1NYG A;  1VQ8 T;  3HFO A;  1SRL A;  1N8R U;  2WAC A;  5CKH A;  2QQB A;  1ACM B;  2LJ3 A;  3C12 A;  2HQE A;  4HKE A;  1K73 C;  4ZTJ A;  2XKO C;  1CSK A;  3LWI A;  2YUN A;  3OYK A;  1C0M A;  3O8V A;  3CMA A;  1M8V A;  2LDM A;  4Z89 A;  3QSU A;  3CCJ Q;  4A53 A;  2RPN A;  2FPE A;  2KRM A;  4M77 C;  3LW5 E;  1AWO A;  5LJ3 h;  2DYB A;  1K4U S;  3OMC A;  2R5A A;  2O9S A;  1NJI C; 
#chains in the Genus database with same CATH homology
 5CKB A;  1I81 A;  4RG2 A;  1U1T A;  4M78 B;  3OYG A;  3DKM A;  3OYB A;  4WF2 A;  4NL3 A;  1Y96 B;  3V8K A;  3M5A A;  5GAM j;  1VQP T;  4BI4 A;  5CQY A;  3FC3 A;  3G6E T;  4C92 A;  4RKU E;  2ZGW A;  4M7D D;  2FHD A;  4M75 E;  4HCB A;  4II1 A;  5DLO A;  2CGH A;  2DIG A;  1O75 A;  5HK3 A;  4M75 C;  4JRK A;  3S3N A;  1ZQ1 A;  5LJ5 f;  3JCM g;  2RO0 A;  1FXX A;  2V8I A;  1VQK T;  3ZFJ A;  2NLU A;  1KHC A;  1VQM A;  4OB0 B;  2R58 A;  4J8O A;  2PVD B;  3EFS A;  2PVG B;  2QXF A;  2M16 A;  5FRO A;  2F69 A;  3JAM E;  2DO3 A;  4HT9 A;  3G71 A;  4L59 A;  2WSE E;  1K9M U;  2L5Q A;  2LTO A;  2K5I A;  1M4Z A;  5GAO l;  4TVR A;  2DKG A;  2EIF A;  4GY5 A;  4DOW A;  3CD6 A;  1DJ7 B;  2EQJ A;  2OTJ A;  4EMK C;  1VQM T;  3L2R A;  2CZ7 B;  3PGG A;  1WNL A;  1Q86 C;  2DAQ A;  4QQG A;  5DY9 A;  5HY6 A;  4C5H A;  1LOJ A;  3GOX A;  2QEX A;  1KHI A;  1B34 A;  2V8J A;  2RJC A;  2K2V A;  2YRV A;  5D6X A;  5M9O A;  1QVG S;  4JLG A;  4LDV A;  1U8R A;  5KCO A;  5GAN h;  1Q81 C;  1H64 1;  2JOY A;  3EAE A;  3OB9 A;  4M77 A;  1VQ7 A;  3MEA A;  3DB3 A;  1V29 B;  1Y07 A;  2VUB A;  3QKJ A;  2OTL A;  5GAO p;  1X01 A;  3DLL A;  1KQS S;  4HCC A;  4ELZ C;  4XTU A;  5IAY A;  1VIF A;  1UGP B;  5GMK m;  1Q81 U;  2I2L A;  1NJI C;  1VQ7 T;  1QW1 A;  3OYN A;  4JLI A;  3JCM b;  1YI2 T;  4XU0 A;  4VUB A;  2QQ9 A;  4IUR A;  1OZ2 A;  4PLL A;  4XTV A;  5KE3 A;  2VXF A;  1BI0 A;  1TH7 A;  4C92 C;  3CCL T;  2X4W A;  2XU8 A;  3ME9 A;  3RKW A;  5GAM e;  3UDC A;  3EFR A;  3V8J A;  1G5V A;  2MMP A;  1UGS B;  3QDR B;  3G7Z A;  2RM4 A;  4ELY C;  2K3X A;  5A0L A;  3X26 B;  3L2V A;  4F7U E;  1XOV A;  1Q7Y U;  1VQ9 A;  3GNF B;  5J26 A;  2E70 A;  3CMA T;  4ZGJ B;  4DQ2 A;  3LLR A;  4C8Q A;  1FWZ A;  3L2Z A;  3OYI A;  2DD5 A;  2JZ2 A;  2XG8 D;  1N9S A;  4HA8 A;  4L5G A;  4OVA A;  3OYA A;  4KUL A;  3HKS A;  4IUU A;  5CAI A;  5C6S A;  3JCM X;  3GNG A;  2GFA A;  2BIV A;  2XID A;  1K8A U;  2F5K A;  4C5G A;  4NOY A;  3DB4 A;  4M75 D;  2ZCF B;  4RCB A;  3RKY A;  3PFS A;  4C5I A;  1S72 T;  1OYX A;  1H3Z A;  3OSV A;  4EMK A;  3OS2 A;  4OB1 B;  5FU6 B;  1VQ6 T;  4XAX B;  5CKD A;  3CCR A;  2CS7 A;  4OB2 B;  2Y4X A;  4C92 F;  1YJW A;  2CZ6 B;  2XDD A;  3C94 A;  3OA6 A;  5GAN 3;  4E7H A;  2DTH A;  4A4H A;  2XDP A;  3JCM P;  3FJP A;  4YTL A;  2RK2 A;  4QVD A;  3J80 E;  2E12 A;  2CYZ B;  5KE2 A;  3CME T;  2RK1 A;  4JRI A;  3CCM A;  1PSF A;  2JN0 A;  5GAN 8;  1KQ2 A;  3OQ5 A;  1WJS A;  3JCM f;  3PT9 A;  3A8O B;  5GAO r;  5CKE A;  3RUX A;  5CIU A;  4BI8 B;  1NZ9 A;  1YIT T;  4OB3 B;  5DM7 R;  2O4X A;  2RHZ A;  4F7U F;  3ER0 A;  4MML A;  3GIB A;  3J7A F;  4J6X A;  4MDX A;  1VQN A;  2BUD A;  2DEQ A;  2CZ0 B;  3OYL A;  3FDR A;  3GF5 A;  3MEW A;  5J39 A;  4QQ6 A;  3DLM A;  4XQ3 A;  4M77 E;  1VQO A;  5CKF A;  5HKC A;  2RB6 A;  3CPF A;  1VQ5 T;  5GMK e;  2HD0 A;  4MZP A;  1QP3 A;  2EYQ A;  2HBP A;  4C8Q C;  2KY9 A;  3JCM Q;  5GAM d;  2CZ1 B;  2B8A A;  2P4T A;  2DTI A;  3OBW A;  4B9X A;  3L2U A;  5GAO q;  4V2S A;  2QQA A;  3CC2 T;  5CVI A;  3GPL A;  2D6F A;  4XTZ A;  1VIE A;  3I56 A;  1JBM A;  3CME A;  2JUF A;  3QXE B;  1YIJ A;  2K5L A;  2LCC A;  3CBM A;  3PMI A;  1QVF A;  4BI3 A;  4A4K A;  3SB2 A;  2RHX A;  2DXT A;  2DZC A;  2O4X B;  3H8Z A;  4N4H A;  2DJZ A;  3QYH B;  5A0G A;  3RER A;  1I8F A;  1NPP A;  3C4S A;  4QQD A;  1WQW A;  4A4G A;  2LT4 A;  2XHC A;  1G3W A;  4FM4 B;  2RI2 A;  1N6A A;  5GAN j;  5FU7 B;  2FB7 A;  4M7A A;  5CK9 A;  4ZN3 A;  4IUV A;  3NFC A;  3JCM c;  4B9W A;  2M1H A;  3J81 E;  1XQH A;  3WVE B;  5LJ3 e;  2YHT A;  3V8L A;  4BUG A;  2ZPH B;  2GCX A;  4FU6 A;  4J7I A;  4C8Q F;  5L8R E;  3QUI A;  2DPP B;  1G3Y A;  2VGN A;  5KH6 A;  4MDW A;  2DTO A;  2E1H A;  3INZ A;  2PU9 B;  3FIF A;  3OBY A;  1BKB A;  2DK3 A;  2JTF A;  4Q5W A;  2P0P A;  1YJW T;  4BY6 B;  2E10 A;  3PIO A;  4OGE A;  2O01 E;  1NPR A;  2A7Y A;  3X25 B;  2H3J A;  3OYH A;  2RHY A;  3OYY A;  3CEY A;  4PLI A;  1VQL T;  3Q1J A;  1VQ6 A;  3CC7 A;  3KBG A;  2X35 A;  1VUB A;  4PJO D;  1YI2 A;  4OMF B;  1G3T A;  3HRS A;  4JDS A;  4EPC A;  1KQS A;  2KAF A;  2X4J A;  1P92 A;  4KUD K;  4XU3 A;  4C8Q G;  3RKX A;  3MEV A;  1BIB A;  3JCM W;  3SFM A;  3BW1 A;  3MCA B;  1OI1 A;  3MP6 A;  5GAN 4;  1M5Q 1;  2EKO A;  4R56 A;  3G4S A;  3GP8 A;  3CPW S;  4PJO E;  2JTM A;  3M56 A;  1QVG A;  5GAO m;  4BDZ A;  4E7I A;  3P8B B;  2DIQ A;  3M55 A;  3P8H A;  2PUO B;  2XIC A;  4XTX A;  1VQP A;  1M1G A;  3MP1 A;  3PMT A;  4PNO A;  1VQ9 T;  2RHI A;  2VC8 A;  1M90 U;  4XK8 E;  4F7U A;  4C92 D;  2QEX T;  1M90 C;  3JCM d;  1KD1 C;  3VYG A;  2HQX A;  4JS4 A;  3ASK A;  4RMO A;  5FRM A;  5GAO n;  2OTJ T;  3SWN C;  3CXC S;  4M7A C;  4KUI A;  1XNI A;  2DZ9 A;  5GAN e;  2LVM A;  4C8Q B;  4F7U G;  4NL2 A;  1K9M C;  1Y96 A;  2QTX A;  3GLX A;  4RG8 A;  1NJI U;  5FRN A;  3CPW A;  2X4X A;  3OSS C;  1UEB A;  2JVV A;  3QBY A;  2GF7 A;  2WSF E;  4X9D A;  3OYF A;  5CQX A;  2LCL A;  4LDY A;  2HAX A;  2KK4 A;  4BE1 A;  4LD9 K;  3URG A;  4HCZ A;  4LDW A;  4QVZ A;  3HP9 A;  2M0O A;  3QZ9 B;  1RI0 A;  3LYI A;  1U1S A;  2VV5 A;  3P8D A;  4C8Q D;  2K57 A;  3RMQ A;  5LJ3 g;  3OS0 A;  5LJ5 e;  4M7D E;  4PJO B;  4J6W A;  2KMT A;  4E7L A;  2QI2 A;  3MHX A;  1EIF A;  1WQ7 A;  4CRI A;  2ZPF B;  1W2B S;  3BFM A;  3HSB A;  3V7R A;  3BDL A;  5DLQ E;  3CBO A;  5I2M A;  3VJP A;  2RD1 A;  3OYM A;  3LWH A;  5GMK h;  4Z02 A;  5GAM f;  1X75 C;  3CD6 T;  4KBM B;  5LJ3 d;  4QW2 A;  3OYD A;  4MMK A;  4C0Z A;  5GAN 2;  3CC2 A;  4X9C A;  5LJ5 j;  4IUT A;  4M7A F;  3HL8 A;  2LQ8 A;  4LDU A;  3M4Y A;  3OS5 A;  5A2Q E;  5GAN g;  3CCQ T;  2Y4Y A;  4PJO G;  3M59 A;  2LNV A;  4BD3 A;  5IN1 A;  1N27 A;  2RI3 A;  3NTH A;  1KQ1 A;  3CCR T;  5GAN 7;  5GAN 5;  2DD4 A;  3VYH B;  2EQU A;  4M78 A;  2MF2 A;  4FSX A;  3UWN A;  4C0D C;  2P0K A;  5A0D A;  2EJ9 A;  1D3B A;  5LL6 S;  3S6W A;  2RJF A;  4MZT A;  3H6Z A;  4UC4 A;  5GAN d;  4ZGD B;  3JB9 I;  2L3R A;  4XTY A;  2EQK A;  4XTW A;  3MP8 A;  1G3S A;  4A4E A;  4OGC A;  2DXU A;  1X6O A;  4M7A G;  3TEE A;  1KC8 U;  2ZPB B;  3RIR A;  4MZM A;  1BYM A;  1YHQ A;  4PJO F;  4F7U B;  1VQ8 A;  2RH2 A;  1JJ2 A;  3VUB A;  4C0F A;  1YJN T;  3CCJ T;  1ZHI A;  3TRE A;  2PQW A;  5FU7 C;  4Y28 E;  3RES A;  3CCL A;  4BE2 A;  1FX7 A;  1Q7Y C;  2E6N A;  3QPH A;  3R6O A;  2ZPG B;  4GLK A;  1YHQ T;  1D3B B;  2LT1 A;  4ME7 A;  3JCM V;  3FB9 A;  2QA4 T;  2VXE A;  2C06 A;  5LJ3 j;  4BAC A;  3SWN B;  3ZEH A;  1B34 B;  1WJR A;  3E9F A;  4M7D A;  4EDU A;  1O9S A;  2BKD N;  4LD6 A;  4N4I A;  5CO7 A;  1M9S A;  2EQM A;  5LJ5 h;  3OW2 A;  3A8L B;  3TCJ A;  2D9T A;  2VYT A;  2KSS A;  1HK9 A;  4OF1 A;  4C92 E;  2FVU A;  3V7C A;  4IUQ A;  4N4G A;  4BY6 C;  1QVP A;  3A8M B;  3PTA A;  4M77 G;  4XU1 A;  4E7J A;  2MWP A;  2K3Y A;  4IKF A;  2RHU A;  4L6V 5;  2DXC A;  4PJO C;  3VUZ A;  4R55 A;  1W4S A;  3JB9 H;  5KCH A;  1HXD A;  3NTI A;  3CCQ A;  3CC4 T;  2KVQ G;  1LNX A;  2GQV A;  2R57 A;  2X4Y A;  4P5N A;  2M9U A;  5LJ3 f;  5C0M A;  5GMK j;  3E9G A;  2E65 A;  3JSC A;  2E6Z A;  1Q86 U;  4ZN1 A;  3KXT A;  4Y91 A;  1VQ4 T;  1N8R C;  4RCC A;  2EJF A;  5HK0 A;  1NE8 A;  1S72 A;  2JNG A;  2K4Y A;  4M77 B;  4JUV A;  3N5B B;  1VQK A;  5GAM g;  4M75 G;  2QQS A;  2VGM A;  3OMG A;  3I55 T;  2KDS A;  3CBP A;  3M54 A;  3OYC A;  3SWN A;  4FL6 A;  2A3L A;  3SDZ A;  4M7A B;  2FYK A;  2EFI A;  3I55 A;  5GAN f;  3JCM e;  2XK0 A;  3CCS A;  2ZPE B;  1VQL A;  4C0D B;  1KC8 C;  3G6E A;  3JRZ A;  4A54 A;  4M77 D;  2LQK A;  4QVC A;  1UGQ B;  5CR2 A;  1Q82 U;  2IVW A;  3FLG A;  1YJ9 T;  3M4G A;  1Y7X A;  4FT4 A;  4M78 F;  3QZ5 B;  3HPW A;  2V8K A;  4O6J A;  1VQ4 A;  4M7D C;  4C5E A;  4N0A A;  4OP0 A;  3T9N A;  3BDU A;  4BDY A;  3PNW C;  2DXB A;  3CCU A;  4BE0 A;  4IUP A;  3CCE A;  2F5T X;  4M75 A;  4JS5 A;  5EG2 A;  1KG1 A;  2RI5 A;  3QG1 A;  2E41 A;  3M53 A;  3MO8 A;  4C8Q E;  5GAN 6;  1YJ9 A;  3QII A;  4J7F A;  3CCV A;  3L2W A;  3KUF A;  2E64 A;  4LDX A;  4DOV A;  2IG0 A;  3WXM B;  3JCM J;  1OZ3 A;  2KQW A;  3V7S A;  4PJO A;  3HRT A;  2DVE A;  2MI6 A;  1LJO A;  2OTL T;  3JB9 J;  3G4S T;  4X34 A;  4DA4 A;  4M7A E;  3HFN A;  3MEU A;  2ZZD A;  2PUK B;  2L8D A;  1MHN A;  2LRQ A;  3OS1 A;  1R8O B;  4J6Y A;  3X20 B;  4C92 G;  4XU2 A;  1JRI A;  4M7A D;  4NS5 A;  3CC7 T;  2XD0 A;  1W2B A;  1YCY A;  1BIA A;  3NTK A;  4M78 C;  4ZGE B;  4BB7 A;  2AHJ B;  1YIJ T;  1KD1 U;  4ATO A;  4C0G A;  4M7D F;  4E47 A;  3A8G B;  3L2Q A;  1WPY A;  3CCU T;  3G71 T;  1QVF S;  2XDB A;  3UPU A;  3CCJ A;  3X28 B;  2K5F A;  4FIB A;  5GMK l;  2FL7 A;  2EWN A;  2RA2 A;  5LJ5 g;  5AYF A;  4PL6 A;  3PIP A;  2ZPI B;  1M1K C;  5FLX E;  3L1A A;  1JJ2 S;  1M1F A;  2EAY A;  4M75 B;  4CI0 C;  3LH0 A;  1I5L A;  1VQ5 A;  1WJQ A;  4FT2 A;  4J5Y A;  2RJD A;  3QJY A;  1QP2 A;  2HNI A;  5J3B A;  3CCS T;  1VQO T;  1GXI E;  1ZBX A;  3BY7 A;  3LGF A;  3AHU A;  1Y71 A;  1UGR B;  2P0Q A;  4O5V A;  2MWO A;  3JB9 G;  4N0A C;  1K73 U;  1VQN T;  3ZBD A;  1BI2 A;  2XI9 A;  3C95 A;  5I21 A;  2YLC A;  3OW2 S;  1YBY A;  2LC4 A;  3QYG B;  3CXC A;  2QDY B;  5I2S A;  1AHJ B;  5GMK i;  4JRQ A;  3RMS A;  2E5Q A;  1YIT A;  4M7D G;  3E1S A;  1Q82 C;  1MGQ A;  3S3O A;  4JJN K;  3OYE A;  3FEO A;  1PSE A;  2QA4 A;  3OY9 A;  1JB0 E;  3SD4 A;  4EMK B;  3CCM T;  4J83 A;  3VV0 A;  4JRP A;  5IT9 E;  4HT8 A;  3M57 A;  3VU3 C;  4M77 F;  1XTD A;  2L89 A;  1UB4 A;  3MET A;  3M9Q A;  3TU4 K;  3CC4 A;  3QHS A;  4PKC C;  1YJN A;  5LJ5 d;  3QO3 A;  1IRE B;  3I56 T;  1I4K 1;  2R5M A;  2YLB A;  3LX7 A;  4M78 E;  5FU6 C;  1VQ8 T;  3HFO A;  1M1K U;  3JB9 F;  4M7D B;  1N8R U;  2WAC A;  3E19 A;  1RL2 A;  2MAM A;  2G3R A;  5CKH A;  2QQB A;  3C12 A;  3M58 A;  4M78 D;  3X24 B;  2HQE A;  3JB9 D;  1BI3 A;  3L42 A;  4HKE A;  1K8A C;  1N9R A;  1IZ6 A;  1SSF A;  3WVD B;  1K73 C;  4A4F A;  4ZTJ A;  4C92 B;  2XKO C;  3OYJ A;  4M75 F;  4M78 G;  2LX9 A;  2PVO B;  3HHT B;  2OAU A;  4EMG A;  3LWI A;  2D0Q B;  3OYK A;  1WGS A;  3A8H B;  3O8V A;  4KT0 E;  3CMA A;  2CKK A;  5D6Y A;  2EJG A;  5D6W A;  4EMH A;  3VKI A;  3UT1 A;  3CCV T;  4ZTF A;  2LDM A;  3F70 A;  1M8V A;  2QQR A;  3JCM h;  5CCA A;  3QSU A;  4A53 A;  2GFU A;  2WSC E;  4M77 C;  3LW5 E;  2RJE A;  4D6W A;  5LJ3 h;  3LGL A;  3HRU A;  3CCE T;  3S3M A;  2Y90 A;  5GAM h;  3OMC A;  3QJ6 A;  2R5A A;  4E7K A;  3FRN A;  1BI1 A;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...