1NZ9A

Solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
58
structure length
58
Chain Sequence
AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
molecule keywords TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
total genus 6
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nz9A00
1XNIA 1W2BS 1VQ5T 3CCQA 1IZ6A 2QA4T 1S72T 1YJWA 3CCSA 3HKSA 1VQPA 1NJIU 1VQNT 2MI6A 1KQSS 1JJ2A 3J7AF 2LQ8A 3CPWS 1QVGS 3CCEA 2KDSA 3PIOA 3G6ET 1K8AU 1YIJT 1KD1U 3I55T 1BKBA 1Q82C 3CCLT 1Q81C 3CCJA 2CKKA 3KBGA 1VQ7A 1KHIA 2MWPA 5IT9E 1SSFA 1NJIC 3OW2S 1VQPT 3CCST 2OTJT 1VQMA 1Q86C 2E70A 3CCRT 3LGLA 1YI2T 5LL6S 1M90U 1NZ9A 5A2QE 1VQ8T 2L3RA 1K9MC 1VQKT 4CRIA 3DB4A 3CD6T 3G4ST 3CC7A 3CMAA 3I56A 3JAME 1VQOT 2E6ZA 3PIPA 3J81E 3DB3A 2XHCA 4QQDA 3CMAT 1K9MU 3CPFA 3G4SA 1YI2A 1M90C 1QVFS 1VQ6A 4TVRA 1Q81U 3CCRA 5DLQE 4ZN3A 1KQSA 1YHQT 1JJ2S 3DLLA 1KC8C 1VQKA 2OTJA 5J26A 2DO3A 3CC2T 1KD1C 1UEBA 3CCJT 5J3BA 3A5ZB 2JNGA 3CCLA 1VQMT 3CCMT 1M1KU 2G3RA 3I55A 2OTLT 1VQ9T 5IAYA 3CCUT 2QEXT 4X34A 1Q86U 1K73C 3G6EA 3LH0A 2JVVA 1YITA 3CCET 2QEXA 1M1GA 4YTLA 3G71A 1VQ9A 1YJ9T 1M1KC 1Q7YU 1VQNA 3TREA 1YIJA 2EIFA 1S72A 5FLXE 3J80E 4RG2A 1VQ5A 3OW2A 2LCLA 1N8RU 1NPRA 1W2BA 1VQ4A 1YBYA 5HY6A 1YJ9A 1YJWT 2QA4A 1YHQA 3G71T 1YJNA 3CCQT 3CXCA 1YITT 3CPWA 5DM7R 1QVGA 2IG0A 3CCUA 2OTLA 1RL2A 3I56T 3CC4T 3OYYA 3CC7T 3CCMA 1VQLT 1EIFA 2JUFA 3CMEA 3CCVT 1VQ8A 3LGFA 2KVQG 1XTDA 3CC2A 2LVMA 1K73U 3P8BB 1KC8U 1NPPA 1VQ6T 1K8AC 3ER0A 1Q7YC 3CXCS 1VQOA 1VQ7T 1X6OA 3CCVA 3CMET 1VQLA 1Q82U 4ZN1A 1YJNT 1N8RC 3CD6A 3CC4A 1QVFA 2MWOA 1VQ4T 2JOYA
chains in the Genus database with same CATH superfamily
4C8QD 2KSSA 4ESRA 2DRKA 1M1KR 1BYMA 2JMAA 3CMAQ 3V8JA 2CUDA 1QWEA 2O31A 4B9WA 3PIOA 5GANj 2CT3A 1E6GA 1HSQA 4J8OA 1KD1U 2J05A 4LD9K 3H0IA 3UPUA 1LOJA 2KK4A 4XQ3A 4DA4A 4FYWB 4CI0C 3TSWA 1M27C 2EJFA 2GTJA 1ZSZC 4M75A 2DL8A 2I0NA 2RHZA 3PT9A 1QCNA 4CRIA 5GANe 4E7LA 5GAN7 2MAMA 3PIPA 3L2ZA 1G5VA 4OB1B 1M3CA 4RMOA 3META 3CCRA 1ZSZB 2YWWA 5GAN8 1JO8A 1KQ1A 2M02A 1KHCA 4EPCA 1AWXA 4M77E 2MPXC 8AT1B 1Q86U 4ELYC 1M8MA 3G6EA 3X26B 2QEXA 2YLBA 4FSSA 2XICA 2MIOA 1P92A 1VQNA 2YUOA 1Q7YR 1YWPA 5CKDA 2EBPA 4FYYB 1VQ5A 2J6KA 1N5ZA 3V7SA 3OW2A 3E9GA 5CCAA 1RAHB 4Q5WA 1IRXA 1D0XA 5DM7R 3CCUA 4PJMA 2DL3A 1AVZC 3NTKA 3LGFA 3X28B 2WSFE 5ECAA 2XU8A 3IQLA 1MNEA 4AFUC 1OZ2A 1MMNA 5IHIA 3TCJA 2DEUA 5LJ3d 1X6OA 2HZYA 2DXUA 3WVEB 1Y71A 2O2OA 3O8VA 4PJOF 3L42A 2CYZB 1VQNT 1RLQC 1Y0MA 3ME9A 1DJ7B 1J3TA 1D3BB 4OVAA 2EYZA 4HT9A 4PJOA 4M77D 4XK8E 2XDBA 1LPLA 2DXTA 2K5FA 3ASKA 4JZ3A 3SB2A 1XOVA 2MYSA 4M78B 4JPBW 2K2VA 3P8HA 5HKCA 1W2BP 1W1FA 2JW4A 4F04B 1BI2A 4FW1A 3NTIA 3I56A 1X43A 3HL8A 4HVVA 4C8QG 1VQOT 3A8GB 3L2QA 3E19A 3UDCA 1HK9A 2KT1A 4FW2A 4DEYA 5GAN6 2CH4W 1MV3A 5GMKi 3HRTA 2KGTA 5J3BA 5IXFA 1VQMT 1TH7A 2G3RA 2XDPA 2QQSA 2VC8A 5D6YA 2E64A 4J6WA 1K73C 4E2FB 2KE9A 1VQ9A 4XU3A 1UJ0A 2CSIA 4NOYA 3EGDA 4PNOA 2DXCA 2XDDA 1QP3A 5GMKh 1LNXA 5FRMA 2HD0A 2BE9B 1YHQA 3RESA 4Y92A 2X4WA 3TSZA 3L1AA 1OU8A 2AIRB 4MDXA 1E7OA 3CC4T 1SPKA 2AT1B 3PFSA 2JUFA 4JLIA 3RIRA 3OYKA 2OTLQ 4L6V5 3CEYA 3HHTB 5GMKl 4UC4A 2KI7A 2CP0A 1CKAA 2EYQA 3P8BB 1KC8U 2RQTA 1YP5A 2DF6A 3EFSA 3VUBA 4Z02A 5CKEA 4M75F 3CBPA 1UHCA 2CSQA 3I9QA 2F2VA 1Y7XA 4M7DA 5AYFA 2ATCB 1BB9A 2COZA 1ACMB 1MUZA 2LP5A 5LJ3f 4ORZA 4AFQC 4M75D 2ECZA 1UE9A 2CZ7B 1NYGA 2HQHA 2MK5A 3MJXA 4JRQA 3OSSC 3X20B 3PMIA 1Q81C 2BZXA 2QI2A 2Z0WA 2M0OA 3CCST 4JRIA 3GP8A 1WHMA 1WHKA 1D1AA 1X6GA 3M9QA 5I2MA 2SEMA 3MO8A 4A54A 1ZHIA 3EAEA 1BIBA 2FPFA 5GANf 3OYLA 2FG0A 4C0DC 1BU1A 5AT1B 2PVDB 1O9SA 2CS7A 3DLLA 2XD0A 2DO3A 2VASA 2HL3A 3JRZA 3F70A 4LNPA 1OULA 1TUDA 2FO0A 3A5ZB 3CCLA 5I22A 1WHGA 4F14A 4D8DA 1N6AA 1VQ9T 3OYEA 5FWCA 2COWA 2DJZA 4D8KA 2KNBB 2KRSA 4AMCA 3M0QA 2KRNA 4Y91A 1QMCA 2DL4A 3M59A 4E7IA 1M2OA 3NGPA 2RQWA 4A4FA 1Q7YU 2CP6A 3EHRA 1V1CA 2JZ2A 2A0FB 5FLXE 1K1ZA 2YDLA 1RAAB 3PGGA 1YBYA 3OMCA 2QQRA 3QYGB 3CXCA 1UDLA 1YITT 3X25B 5KE2A 2EFIA 5KYUA 2OTLA 3OYDA 3CCMA 1UG1A 5LJ3g 1YCYA 4M77G 1LCKA 3FRNA 1ARKA 5KCOA 4XTVA 4PJOC 1R8OB 2HQXA 5LJ5d 2O4XB 3EH2A 2VVKA 1G3SA 8ATCB 2RJEA 2GFAA 1I07A 5GANh 2EW3A 2ENMA 1OOTA 5IN1A 3J7AF 2VUBA 3JCMP 1JQQA 4ANJA 4PJOB 4OMFB 2E3HA 1T3SA 2GCXA 1VQMQ 2WACA 4BI8B 1D3BA 1UFFA 1E6HA 5IT9E 2LT1A 1KQSP 2E5QA 1WQ7A 2BTTA 2DIGA 2RI3A 2O9VA 2L3RA 3EFOB 2ZPIB 1YI2Q 1M2VB 4HVWA 2ED0A 3CMAT 4J5YA 3RDVA 3EG9B 3GPLA 1VQKA 3CQTA 2YRVA 4KUIA 1QVFP 1HJDA 2EGCA 2DTIA 2E12A 3M0RA 4HVUA 1FX7A 5IHNA 1K4US 3CMEQ 3H41A 2C0TA 4HA8A 3H0HA 2K6DA 1RAIB 2J6FA 2K79A 4XU1A 1WZOA 3OA6A 1NPRA 1S1NA 2FL7A 2LQWA 3QJYA 4PJOG 3RUXA 3AT1B 4VUBA 5KYXA 1GXIE 2XKOC 2RJCA 5CIUA 2ESWA 1QQJA 2E6NA 2RH2A 4C5GA 1AWOA 3JB9G 1TTHB 4FYXB 1WJRA 3QXEB 1G83A 4HCZA 3RBBB 2RPNA 2K3YA 1FMVA 1TXQA 1VQLA 3C0CA 1HXDA 5CO7A 1C6VX 2YUQA 4M7AG 2HAXA 3S3NA 4E7JA 1H92A 1NLPC 1H3ZA 3UWNA 1N8RR 1PRLC 3M55A 4M77C 2KDSA 1Z9QA 1VIEA 1K76A 1RI0A 3C95A 2FB7A 2PUOB 2MWPA 4F17A 3QSUA 1OQKA 3JCMh 4C92E 3QUIA 1K9MC 1GCQC 4QQ6A 3UT1A 4JDSA 1B3QA 3FIFA 1VQNQ 2A36A 4HXJA 2M1HA 1G3TA 1UGQB 2DKGA 1K9MU 1VQ5Q 2FHDA 3G1JA 4II1A 3WVDB 3JV3A 5J39A 4K11A 4OF1A 2K3BA 1M1KU 2CDTA 2LJ3A 2DD5A 2NLUA 5IAYA 2JVVA 3REBB 1RADB 1PWTA 3TREA 2LJ1A 2DTHA 1VQPQ 2X51A 4PLIA 3GOXA 1FWZA 1KIKA 2F69A 2CT4A 2F5KA 3VS0A 1QKXA 4A4EA 2ROTA 3LLRA 1B34A 4M75G 1EIFA 3CMEA 1GBQA 3CCVT 2QASA 2XMFA 4QT7A 1JB0E 1H641 3M5AA 2CZ0B 2QQAA 4BDZA 4PFZA 3QJ6A 4OB2B 2EYWA 1QCFA 2LQKA 4J9EA 3OS5A 1ABOA 2DBMA 1PCXA 2PU9B 2LMJA 1HD3A 1PD0A 2K57A 3VS6A 3HKSA 4WF2A 2QG9B 4J9FA 3JCMe 1CSKA 4J9HA 4PJJA 1GRIA 1TUCA 1O75A 3L2UA 2RHUA 4M75E 3MP8A 2CZ1B 2P0PA 2DE0X 4AG2C 2JS2A 4JRKA 3I55Q 4CC2A 1ZA1B 1NJIC 5D6XA 4WTOB 7AT1B 4M7AC 1TS9A 2QQBA 1RUWA 4E6RA 5A2QE 2W0ZA 1SKUB 4LN2A 1WQWA 1V29B 2ABLA 4N0AA 3QG1A 3CMAA 2MCNA 1IGQA 3J81E 1TOVA 3BDUA 2EQUA 1YHQT 1VQOQ 4EDUA 5HK3A 2E5KA 3OB9A 1I5LA 1FMWA 2EQMA 3M53A 3NHNA 2R57A 3CCUT 3PVQA 4JLGA 3AHUA 3VYGA 2DNUA 4HCKA 2EKOA 4PJNA 5KYWB 3OS1A 1VIFA 2DD4A 3V7CA 1I0CA 4QVZA 3HTRA 2KEAA 4RG2A 4DOVA 4O5VA 3EG3A 4PFPA 3PMTA 2Y4XA 2BZYA 1EX4A 3OYGA 1D1CA 2JT4A 1QVGA 1RABB 3I56T 4E7KA 3CC7T 3MP1A 1NG2A 2KT8A 2KVQG 4BB7A 4A4HA 4M7DF 4J9GA 2DA9A 1NPPA 3A98A 4BD3A 1BI3A 1VQ7T 2BUDA 2HSEB 4LDYA 4XU0A 2PUKB 5EC7A 4O6JA 1OEBA 2JOYA 1YITQ 4N4HA 2CGHA 3VKIA 5GMKj 1G2BA 1D1BA 4X9DA 2GTOA 1G8XA 4FYVB 1M4ZA 2LZ6B 1UHFA 4OMMA 4HKEA 3CCJA 2A28A 1VQ7A 4RTTA 2M51A 1VQPT 4BI4A 2L3SA 2BE7D 5EG2A 1JU5C 1Z9ZA 3OYCA 3RMQA 2RF0A 3DB4A 2D1XA 1BBZA 3VRZA 4QVCA 1M8VA 2QK0A 4M7DC 1SF9A 3PNWC 2FZCB 2DERA 3FDRA 2KAFA 1VA7A 1SSHA 2DFUA 5DLQE 3CCVQ 1JJ2S 4QW2A 4DBRA 3GF5A 2C0IA 2HBPA 1M30A 2EGEA 1F1BB 2FYKA 2M9UA 1D0ZA 2EQJA 3CCMT 3O5ZA 3I55A 3GNGA 3LW5E 3GBQA 3MKDA 3JCMW 5CQYA 5LJ3e 4ME7A 2G6FX 2LTOA 4ELZC 3ZL7C 2XI9A 1K0SA 4NL3A 3V7RA 5HY6A 3JB9F 4C8QE 5FWBA 4C92D 3JB9H 3M54A 1GBRA 4RKUE 1SRLA 2IG0A 2ZPEB 1PD1A 2CP5A 2Y4YA 5LJ5h 2K9GA 4PKCC 1ZUYA 2RQVA 1EFNA 5FU7B 3RERA 4QQGA 2FPDA 3CC2Q 3QWXX 2QTXA 1BI0A 1YN8A 2AZSA 1IHVA 3MP6A 3EFRA 3C94A 1LVKA 3JCMV 1M3BA 1K8AC 3ER0A 4M75B 3M4YA 2DYIA 3PTAA 2NUZA 2MMPA 1N8RC 5CK9A 2OAWA 1JEGA 2F2WA 3JCMJ 1IHWA 3CCSA 1MMDA 3G71Q 4FT2A 3OW2P 3FEOA 1Q86R 3PVLA 4KUDK 4M78C 4DBHA 1KHIA 1SSFA 3UF4A 4XU2A 3OW2S 4EMHA 1V76A 1Q86C 5C6SA 5C0MA 4M7AD 2P0QA 1WI7A 4AG1C 5KYXB 1OPKA 2CP2A 4L5GA 2E10A 4M77A 3JAME 2IVWA 2RK2A 1M90C 3GIBA 3BFMA 2V8KA 3OQ5A 3M0SA 2V26A 4LD6A 2JN0A 5GAN2 3INZA 2DYBA 4RTWA 2RHXA 3HP9A 1AZGB 4FM4B 2R5AA 1ZSGA 3EFOA 4OB3B 5GAMf 4LDXA 2XK0A 4RTXA 2JTFA 2LT4A 1M1GA 1YJ9T 1ZBXA 2D9TA 2OTJQ 1AHJB 3J80E 5LJ5e 1A0NB 2DLPA 1C0MA 2HCKA 4GLKA 3ULRB 4LUEA 3EG2A 4C5IA 4M4ZA 1TG0A 1FXXA 1K9AA 1OI1A 2SRCA 2X3WD 4JJDA 2W10A 2DRMA 1PSFA 1X2KA 4GBQA 1JRIA 5KE3A 5FW9A 3KXTA 1PKSA 3FB9A 3M4GA 5LJ3j 3TEEA 6AT1B 3H9NA 1JJ2P 1X69A 2ZPGB 1WHLA 2ZPBB 4M78A 4BUGA 3BW1A 1KK7A 1AEYA 1SEMA 2V8JA 3JCMg 2DEQA 1IZ6A 4RTZA 4Y28E 1ABQA 3M58A 2LCSA 3HFNA 1BK2A 2MI6A 4R55A 1M5Q1 3QPHA 4M7AB 1EZZB 2FZGB 3OYNA 1YHQQ 2RHIA 2L0AA 4C5HA 2NWMA 4KGXB 1Q82C 1PC0A 1ZBJA 4GLMA 4BE2A 5FROA 2JJ9A 2YXYA 5GAOl 4JRPA 3I5RA 3S3MA 2KQWA 5GAOp 1VQ6Q 4P5NA 1UGVA 5LL6S 1VQ8T 3EGXB 4F7UA 2PZ1A 2E65A 4C8QF 2H8HA 2CP3A 3G4SA 4F7UG 1KQSA 1I4K1 4FU6A 5CKFA 2LQNA 5GAMg 4AFSC 3I56Q 2ZZDA 2K7AA 1T0HA 4M7AA 3M0PA 2X9HA 3NTHA 2EKHA 3SWNB 4N0AC 3VS4A 2GF7A 1ZSZA 1I81A 3M0UA 1VQ7Q 1ZQ1A 4BE0A 3DKMA 4E7HA 4C92B 2RQUA 2IPOB 3EGXA 1WHJA 3G7ZA 4JJBA 1SG5A 3EG9A 2RI2A 3OYYA 5GMKe 2E1HA 2QGGA 5GAOm 1ZA2B 1QLYA 4OMLA 2V8IA 2V1QA 2K3XA 2H3JA 3NFCA 4AT1B 1OZ3A 2ROLA 2L3PA 2EAYA 1QVFA 2GQVA 2RJFA 3SDZA 1MNDA 1W70A 2WSCE 2L2PA 2A3LA 3JSCA 1HYOA 1TU0B 5GANg 4HCCA 2PVOB 4C92F 1NE8A 3I5SA 1NJIU 1JJ2A 4KGZB 1QVGS 1YIJT 2EJGA 3H0FA 2DZCA 3MPUB 5GANd 2NUPA 1M3AA 2ED1A 5FU6C 4FCYA 1S72Q 1WYXA 4MZMA 3CCRT 4C8QA 3REAB 1NEBA 1M90U 2FZKB 1ZX6A 4CC3A 2RJDA 3CC7A 1BIAA 2MF2A 1K8AR 2E6ZA 2E4HA 3QDFA 1KFZA 2P0KA 3VS1A 1RAFB 4BACA 1NM7A 3NMZC 2DVJA 2AKLA 2QGFB 2EPDA 2JNGA 3OMGA 5GMKm 2F1LA 2HSPA 4MDWA 2K5LA 2X4JA 2BZ8A 2QAZA 4YTLA 3R6NA 4HT8A 1D09B 2X4XA 2JMCA 2RHYA 2J7IA 5A0DA 2OI3A 3KFVA 1W2BA 2YT6A 1YJ9A 2A7YA 1NEGA 1I5OB 3CCQT 2RNAA 2L5QA 4R0KA 1WNLA 3QO3A 2C0OA 4LDVA 3CCMQ 5CVIA 3OSVA 4N4IA 2A08A 4KULA 1R0CB 5LJ5j 1VQ6T 4XTUA 4OMQA 3HRUA 1W6XA 2B86A 2GGRA 4EIKA 1UGPB 3CD6A 2NUTA 2VB6A 2RM4A 2EYYA 1VQ4T 2RA2A 3CCQA 3JCMf 1S72T 2DM1A 2DL5A 4JUVA 4M7DG 3CPWS 5KYYA 1WJSA 2CP7A 2PNIA 2D6FA 2KMTA 3N5BB 3RR6A 1K8AU 2LJ0A 3V8KA 1NJIR 2DILA 1UGRB 2E41A 2KRMA 1VQ9Q 1BCOA 3QBYA 3CXCP 2VKNA 2VGNA 1IGUA 4A4KA 4EMKB 1IXDA 4Z8AA 4KT0E 4RCCA 3VJPA 2WSEE 4OMOA 2D8JA 1TSFA 1N9SA 2HNIA 1X01A 3SEMA 4C0ZA 3OYFA 1I1JA 2KR3A 2OAUA 2YLCA 3OYAA 3JB9D 4NS5A 1AWWA 2K4YA 4RTUA 3VS3A 2JXBA 3FLGA 4ZN3A 2OTJA 2EJ9A 3MEVA 4M7AE 2LX9A 3C4SA 3G6EQ 3WXMB 4OMNA 4BY6C 1X6BA 3FJ5A 3SHWA 3G71A 2HKNA 3A8HB 3ZEHA 2RB6A 2E3IA 2EIFA 5I2SA 4IIMA 1YWOA 4OB0B 1WGSA 2FRWA 4F7UE 1Q81R 1N8RU 1MV0B 1VQ4A 5I11A 3GNFB 3CCUQ 2R58A 4XTZA 4ZGDB 4BY6B 1YIJQ 3EH1A 1M9SA 4KH1B 2KXCA 3CBOA 2VYTA 3QIIA 3ZBDA 2YHTA 2KYBA 1K73U 2LRQA 3I35A 3A8LB 3OYIA 1IB8A 5M9OA 1YJ9Q 3TQ7P 3QKJA 2HMAA 2VXFA 2CUBA 2O9SA 4Z88A 4IUPA 3E9FA 1UJYA 1LJOA 4XTWA 2C06A 4M78E 3RKYA 1YJWA 1VQPA 2V1RA 2NUPB 1KQSS 2LCCA 4FIBA 1JBMA 2CREA 1JXMA 2FVUA 4DEXA 2DETA 3I55T 4J9CA 2QDLA 4LDWA 3VS2A 4ZTFA 4R56A 3C12A 2L89A 2CZ6B 5LJ3h 1K0XA 1OYXA 1GCPA 2FRYA 3VS5A 5A0GA 3CCQQ 4ZGEB 3G4ST 2HBWA 4C5EA 3DB3A 5HK0A 3HRSA 3SWNC 4M78G 1Q81U 3BDLA 2AKKA 1WDXA 4ZTJA 5A0LA 1NLOC 1UEBA 2BIVA 2ZPHB 2COYA 5GAMj 2K2MA 1BCMA 2M0YA 4ZGJB 3QHSA 1OV3A 4J6YA 4OMPA 2DPPB 2ZAEA 5GAOr 4RUGA 4IUVA 1Y96B 3CC7Q 4F16A 4A53A 2JS0A 1UTIA 2AZVA 2AK5A 1VUBA 1OX9A 1GFDA 1WXTA 3JCMc 1VQ8A 1XTDA 1YFNA 2YRCA 2PVGB 4LE9A 3QZ9B 2DMOA 4IKFA 3FJPA 1WFWA 1IREB 1WXUA 4FT4A 3JCMX 1Q7YC 3CMET 2FEIA 4XAXB 2MWOA 3NPFA 4J83A 5CQXA 3LX7A 3T9NA 3E2UA 4PFOA 3TVTA 2DZ9A 2DXBA 1VQ5T 5IH2A 1X2QA 3M57A 1ZUKA 5LJ5f 2HQEA 1X27A 4PK4A 3G6ET 1ZLMA 1QW1A 1ZUUA 4LUDA 1XQHA 4JJNK 3VYHB 4V2SA 1X75C 3KBGA 2EYXA 5GAMh 4RG8A 4KGVB 3LGLA 3JCMd 3V8LA 2GBQA 1G3YA 1R77A 2O4XA 3H8ZA 3CCSQ 3HPWA 1T3LA 4IURA 1YJNQ 4ZNXA 2ZCFB 2DX1A 2XHCA 2CH4A 1QVFS 4OP0A 1D0YA 3P8DA 4TVRA 2RI5A 4J7FA 1PNJA 4C0DB 5FRNA 1QP2A 4KH0B 4RCBA 1QVGP 1VQLQ 1FYNA 2VV5A 5CR2A 3A8MB 4C8QC 4BE1A 2KBTA 4F7UB 1RACB 2P4RA 4X34A 3CCRQ 4EMGA 3S6WA 5GJVB 2R5MA 3CBMA 4E7SA 2RMOA 1QVPA 5GAOn 3M56A 5FU6B 1B07A 1WHHA 3MHXA 3OBWA 1GCQA 1M2VA 2JTMA 1SHFA 3UATA 4C0FA 2KYMA 5KYUB 2RK1A 4J7IA 2EGAA 3CPWA 2F2XA 2RQRA 2LNHB 4C0GA 2KY9A 2OX7A 1T0JA 4GY5A 5D7UA 4IIOA 4ATOA 1JXOA 1AZEA 5LJ5g 2JM8A 1K73R 3EHQA 3CCEQ 1AOJA 2YUPA 4MZTA 4A63B 4F7UF 1RAGB 3CXCS 1VQOA 1KD1R 9ATCB 2L8DA 4DOWA 4A4GA 3G4SQ 4J6XA 5CKBA 4RTYA 3VV0A 1UB4A 3BE3A 3CPWP 1CKBA 2F5TX 4FSXA 1W2BS 2XIDA 3E1SA 2QA4T 3VRYA 3TU4K 2YSQA 1GFCA 2LQ8A 5KYNA 1KC8R 3CCEA 4M7AF 2PQWA 1TWBA 3EG0A 3THKA 3DLMA 4IUQA 4KRTA 2CKKA 2K5IA 2ZGWA 1QKWA 1W4SA 2E70A 1SHGA 3OYBA 1MMAA 5FU7C 2L3QA 1AWJA 3A8OB 2HEQA 1VQKT 2D0QB 3MEWA 3A1PA 2H3EB 4DQ2A 4QQDA 5KYWA 1YI2A 1WA7A 1QCOA 5IHKA 2QTVA 2I2LA 2OJ2A 5DLOA 2HL5C 3LYIA 4N4GA 4M7DB 4B6MA 1KD1C 1KG1A 3MCAB 1GL5A 4KBMB 1PM3A 3CCLQ 3JB9J 4JS5A 2QXFA 1N9RA 1N27A 1BI1A 1Y96A 1RI9A 2RD1A 4PJLA 3S3OA 3CCJQ 4DBFA 3MEUA 5KYYB 3VUZA 2FPEA 4EMKC 4Z89A 3OYHA 5IXBA 1YJWT 3QWYA 3CC4Q 2HKQB 4MZPA 3RKXA 3CD6Q 1WLPB 1KQ2A 1Y57A 3LWHA 5HCKA 1PG5B 4JJCA 1K9MR 2BKDN 4QKUA 1M1FA 3URGA 4AFZC 4L59A 1RAEB 1WJQA 2QA4Q 2X3XD 1Q82R 2GQIA 2EWNA 1U1SA 3M0TA 2DIQA 1NYFA 5KCHA 1YJNT 2MOXA 1UGSB 1B7TA 4M7DE 2QQ9A 1OU9A 3ZFJA 4M75C 1I8FA 3VU3C 1XNIA 2GFUA 4WCIA 1WX6A 3R6OA 1VQ4Q 3X24B 3Q1JA 2NYSA 1VYUA 3QDRB 2X35A 4JZ4A 1TUGB 4M78D 3QYHB 3L2WA 1SRMA 4QVDA 4JS4A 4J9DA 5D6WA 3JCMQ 1AT1B 1VQKQ 1BKBA 4IUTA 4M77B 4MMKA 2GNCA 3BY7A 1IO6A 1PKTA 1VQ8Q 3JB9I 2RN8A 4J9BA 2B8AA 2P84A 2AHJB 4X9CA 4M78F 3UA7A 4M77F 5GJWB 3HSBA 2DAQA 2DK3A 1YCSB 2HDAA 1H8KA 2LDMA 4X1VA 3D7SB 2KXDA 3CPFA 2J6OA 2VXEA 4EMKA 1OX8A 1U3OA 2QDYB 4MMLA 3CC2T 4BDYA 2LX7A 3L2VA 4PL6A 3GLXA 4D6WA 3CCJT 3PE0A 1WPYA 1KSWA 4XTYA 5GAOq 2OTLT 1YJWQ 2QEXT 2YUNA 3LH0A 2EQKA 1YITA 1QWFA 4C92C 1XJWB 4E47A 2DJQA 1M90R 1U5SA 2XG8D 4LXCA 2QA4A 3G71T 1YJNA 2IIMA 4C92A 3OYMA 3FC3A 2JTEA 1RL2A 4BI3A 3EG1A 3HFOA 4C92G 3JCMb 3OS2A 2DL7A 1H3HA 2LVMA 1KJWA 4IUUA 3EGDB 3SFMA 3CCVA 2VGMA 4M7DD 1VOMA 1Q82U 2VWFA 4OGCA 4ZN1A 3CC4A 1MHNA 3H6ZA 3LWIA 3OYJA 3RNJA 2DTOA 4FL6A 2M16A 2X4YA 5KH6A 3RMSA 5L23A 1Q95G 4XTXA 4E7ZA 2EQIA 3OBYA 1AD5A 2J06A 3UA6A 1U1TA 3CCLT 1WIEA 3MEAA 1UUEA 5CAIA 2OTJT 1VQMA 4HCBA 1YI2T 3SWNA 1PSEA 1G3WA 1NZ9A 2NUTB 2QYZA 4DBQA 5GAN4 3CD6T 4PJOE 5GAN3 1WXBA 2QEXQ 2JM9A 1VQ6A 1UECA 5CKHA 1KC8C 5J26A 1R0BG 3EGUA 1Y07A 1B34B 2D0NA 3KUFA 1NBEB 1C1AA 2DVEA 1U06A 3CCET 4NL2A 2EVRA 2YRDA 2LNVA 1M1KC 2LC4A 2Y90A 1YIJA 3OS0A 1S72A 4J9IA 2LCLA 4CC4B 3SD4A 3VS7A 1MMGA 1RLPC 3LH5A 3QZ5B 1U8RA 2P4TA 5GAMe 2O88A 2D8HA 1PHTA 1OPLA 1VQLT 4OGEA 1MGQA 1YNZA 4PLLA 4LDUA 3CC2A 1FMKA 3RKWA 2O01E 4CC7A 3U23A 2A37A 4PJOD 4B9XA 5GAMd 3OY9A 2PTKA 5L8RE 2KROA 4RTVA 5GAN5 5I21A 1PRMC 4C8QB 2DBKA 1VYVA 5DY9A 3L2RA 1VYTA 2RO0A 2ZPFB
chains in the Genus database with same CATH topology
2DXBA 2DEQA 1IZ6A 1VQ5T 4C8QD 1H3ZA 4Y28E 2KSSA 3M58A 3UWNA 3HFNA 1BYMA 3M57A 2MI6A 4R55A 1M5Q1 5LJ5f 2HQEA 3M55A 3V8JA 4B9WA 3QPHA 2KDSA 4M77C 3PIOA 4M7AB 3G6ET 5GANj 1VIEA 3OYNA 4J8OA 1KD1U 1QW1A 1RI0A 2RHIA 3C95A 1XQHA 4C5HA 3VYHB 4JJNK 4LD9K 4V2SA 1Q82C 4BE2A 1X75C 5FROA 3UPUA 1LOJA 2FB7A 2PUOB 3KBGA 2KK4A 4XQ3A 4DA4A 2MWPA 3QSUA 4CI0C 5GAMh 3JCMh 2EJFA 4JRPA 5GAOl 4C92E 4RG8A 3S3MA 4M75A 2KQWA 3LGLA 3V8LA 3JCMd 5GAOp 3QUIA 1G3YA 2O4XA 2RHZA 4P5NA 5LL6S 3H8ZA 3PT9A 3HPWA 1VQ8T 4IURA 1K9MC 4QQ6A 4CRIA 3UT1A 4F7UA 4JDSA 5GANe 4E7LA 3FIFA 5GAN7 2E65A 2MAMA 2ZCFB 4C8QF 2M1HA 1G3TA 1UGQB 3L2ZA 2DKGA 2XHCA 3PIPA 1K9MU 4OB1B 3G4SA 4RMOA 1G5VA 1QVFS 3META 4F7UG 2FHDA 4OP0A 3P8DA 4TVRA 2RI5A 3CCRA 4J7FA 4II1A 1I4K1 1KQ1A 4FU6A 5CKFA 3WVDB 5GAN8 3L2RA 1KQSA 4C0DB 1KHCA 5GAMg 5FRNA 5J39A 1QP2A 4RCBA 4OF1A 4EPCA 1M1KU 2ZZDA 2VV5A 5CR2A 3A8MB 4C8QC 4M77E 4F7UB 2DD5A 2NLUA 5IAYA 4BE1A 4M7AA 1Q86U 4X34A 4ELYC 3NTHA 3G6EA 2JVVA 3X26B 4EMGA 3SWNB 3S6WA 2YLBA 4N0AC 2R5MA 2QEXA 3CBMA 2XICA 1VQNA 1P92A 2GF7A 1QVPA 3TREA 5GAOn 2DTHA 1I81A 5CKDA 3M56A 5FU6B 1ZQ1A 1VQ5A 4PLIA 3V7SA 3OW2A 3E9GA 4BE0A 3DKMA 5CCAA 3GOXA 1FWZA 3MHXA 3OBWA 4Q5WA 4C92B 4E7HA 2JTMA 4C0FA 2F69A 2RK1A 2F5KA 4J7IA 3G7ZA 3CPWA 5DM7R 3CCUA 4C0GA 4A4EA 2KY9A 2RI2A 3OYYA 3LLRA 1B34A 4GY5A 4M75G 5GMKe 1EIFA 3CMEA 4ATOA 3NTKA 3CCVT 3LGFA 5LJ5g 3X28B 2WSFE 2E1HA 5GAOm 2XU8A 1JB0E 1H641 1OZ2A 3M5AA 2CZ0B 4MZTA 2V8IA 2K3XA 3TCJA 2QQAA 4BDZA 4F7UF 2H3JA 3NFCA 5LJ3d 3CXCS 3QJ6A 1VQOA 1X6OA 4OB2B 1OZ3A 2L8DA 4DOWA 4A4GA 2LQKA 4J6XA 3CC7A 2DXUA 5CKBA 3VV0A 3WVEB 3OS5A 2EAYA 1UB4A 2GQVA 2RJFA 1QVFA 3SDZA 1Y71A 2PU9B 2F5TX 2WSCE 3O8VA 4FSXA 4PJOF 2A3LA 3JSCA 1W2BS 3L42A 2XIDA 3E1SA 2K57A 2QA4T 2CYZB 3HKSA 5GANg 4HCCA 2PVOB 4WF2A 4C92F 1NE8A 3TU4K 1NJIU 1VQNT 1JJ2A 2LQ8A 3S3NA 3ME9A 3JCMe 1QVGS 3CCEA 4M7AF 2PQWA 1YIJT 2EJGA 2DZCA 1DJ7B 1D3BB 4OVAA 1O75A 3L2UA 5GANd 3DLMA 4IUQA 2RHUA 4M75E 4HT9A 3MP8A 5FU6C 4PJOA 2CZ1B 2P0PA 2CKKA 4M77D 2K5IA 4XK8E 2XDBA 4JRKA 4MZMA 2ZGWA 1NJIC 2DXTA 1W4SA 2E70A 2K5FA 3ASKA 5D6XA 3CCRT 3SB2A 1XOVA 4C8QA 3OYBA 4M78B 4M7AC 5FU7C 2QQBA 2K2VA 3P8HA 1M90U 5A2QE 5HKCA 3A8OB 1VQKT 1BI2A 1V29B 1WQWA 2D0QB 2RJDA 1BIAA 3MEWA 3QG1A 4N0AA 2MF2A 3NTIA 3I56A 3CMAA 3HL8A 2E6ZA 4C8QG 1VQOT 4DQ2A 3A8GB 3J81E 4QQDA 3L2QA 3BDUA 1YI2A 3E19A 2EQUA 2P0KA 2I2LA 4BACA 3UDCA 5DLOA 1YHQT 1HK9A 3LYIA 4EDUA 5GAN6 4N4GA 5HK3A 5GMKi 4M7DB 1KD1C 3HRTA 3OB9A 1I5LA 5J3BA 2JNGA 3OMGA 2EQMA 3M53A 5GMKm 1VQMT 1TH7A 2G3RA 1KG1A 3MCAB 2XDPA 2R57A 2QQSA 4MDWA 3CCUT 2VC8A 4KBMB 5D6YA 2K5LA 2E64A 2X4JA 4J6WA 4JLGA 1K73C 3AHUA 3VYGA 3JB9J 4YTLA 2EKOA 4HT8A 1VQ9A 2X4XA 4JS5A 2QXFA 4XU3A 1N9RA 3OS1A 1N27A 1BI1A 1VIFA 1Y96A 2DD4A 2RD1A 4NOYA 3V7CA 2RHYA 4PNOA 4QVZA 5A0DA 3S3OA 2DXCA 3MEUA 4RG2A 4DOVA 2XDDA 1QP3A 4O5VA 5GMKh 1W2BA 1LNXA 5FRMA 3VUZA 2HD0A 4EMKC 3PMTA 1YJ9A 3OYHA 2Y4XA 2A7YA 1YJWT 1YHQA 3RESA 4MZPA 3RKXA 3CCQT 3OYGA 2X4WA 2L5QA 1KQ2A 3L1AA 1QVGA 1WNLA 4MDXA 3LWHA 3QO3A 3I56T 4E7KA 3CC4T 3CC7T 4LDVA 3PFSA 5CVIA 2JUFA 2BKDN 3MP1A 4JLIA 1M1FA 3RIRA 3OYKA 2KVQG 3OSVA 3URGA 4L6V5 4N4IA 4BB7A 3CEYA 3HHTB 4A4HA 5GMKl 4M7DF 4UC4A 4L59A 4KULA 2EYQA 1WJQA 3P8BB 1NPPA 1KC8U 5LJ5j 1VQ6T 4XTUA 4BD3A 1BI3A 3EFSA 3HRUA 3VUBA 2EWNA 4Z02A 1U1SA 5CKEA 1VQ7T 2BUDA 4M75F 2DIQA 3CBPA 4LDYA 5KCHA 4XU0A 1UGPB 3CD6A 1YJNT 1UGSB 2RM4A 4M7DE 2PUKB 2QQ9A 1VQ4T 1Y7XA 3ZFJA 4O6JA 4M7DA 4M75C 1I8FA 3VU3C 2JOYA 1XNIA 4N4HA 5AYFA 2RA2A 3CCQA 2CGHA 2GFUA 3VKIA 3JCMf 1S72T 3R6OA 3X24B 3Q1JA 5LJ3f 5GMKj 4JUVA 3QDRB 2X35A 3CPWS 1WJSA 4M7DG 4M75D 2D6FA 4M78D 2KMTA 3N5BB 4X9DA 3QYHB 1K8AU 3L2WA 2CZ7B 3V8KA 4QVDA 1M4ZA 4JS4A 4E7JA 1UGRB 2E41A 5D6WA 3JCMQ 4JRQA 3QBYA 1BKBA 3OSSC 3X20B 3PMIA 4IUTA 4HKEA 1Q81C 2VGNA 3CCJA 4M77B 4MMKA 1VQ7A 2QI2A 3BY7A 2M0OA 4A4KA 4EMKB 1VQPT 4BI4A 3CCST 4JRIA 4KT0E 3JB9I 2B8AA 3GP8A 4RCCA 2AHJB 5I2MA 3VJPA 5EG2A 2WSEE 3M9QA 4X9CA 4M78F 4M77F 3MO8A 4A54A 1ZHIA 1N9SA 2HNIA 1BIBA 1X01A 3EAEA 4C0ZA 2DAQA 3RMQA 2DK3A 3OYCA 3HSBA 5GANf 3OYFA 3DB4A 3OYAA 3OYLA 2OAUA 2YLCA 3JB9D 4QVCA 2LDMA 4NS5A 4C0DC 2K4YA 1M8VA 4M7DC 3PNWC 3CPFA 2PVDB 3FLGA 3FDRA 2KAFA 1O9SA 2CS7A 5DLQE 4ZN3A 1JJ2S 2VXEA 4EMKA 3DLLA 2XD0A 2OTJA 2EJ9A 4QW2A 2DO3A 3MEVA 2QDYB 3GF5A 3JRZA 4MMLA 3CC2T 2HBPA 2LX9A 3F70A 4BDYA 4M7AE 3L2VA 4PL6A 3GLXA 4D6WA 2FYKA 3CCJT 2M9UA 3A5ZB 1WPYA 3C4SA 3CCLA 2EQJA 3CCMT 3WXMB 4XTYA 5GAOq 3I55A 1N6AA 1VQ9T 3OYEA 2OTLT 2DJZA 3GNGA 3LW5E 2QEXT 3LH0A 2EQKA 4BY6C 3JCMW 5CQYA 4Y91A 1YITA 5LJ3e 3G71A 3M59A 4E7IA 4ME7A 4C92C 4A4FA 1Q7YU 3A8HB 3ZEHA 4E47A 2RB6A 2EIFA 2JZ2A 2LTOA 4ELZC 5I2SA 5FLXE 4OB0B 1WGSA 2XI9A 4F7UE 1N8RU 4NL3A 2XG8D 3PGGA 3V7RA 1YBYA 1VQ4A 5HY6A 3JB9F 3GNFB 3OMCA 4C8QE 2QA4A 2QQRA 2R58A 4C92D 4XTZA 3G71T 3QYGB 4ZGDB 3CXCA 1YITT 1YJNA 3M54A 3X25B 4BY6B 5KE2A 3JB9H 4C92A 2EFIA 4RKUE 3OYMA 3FC3A 2IG0A 2OTLA 2ZPEB 1RL2A 4BI3A 3OYDA 1M9SA 2Y4YA 5LJ5h 3CCMA 3HFOA 3CBOA 4PKCC 5LJ3g 1YCYA 2VYTA 4C92G 3QIIA 3JCMb 3ZBDA 4M77G 2YHTA 3OS2A 5FU7B 3RERA 4QQGA 2LVMA 2QTXA 1BI0A 1K73U 2LRQA 3A8LB 3OYIA 3MP6A 3EFRA 5M9OA 3C94A 3FRNA 3JCMV 1K8AC 3ER0A 5KCOA 4XTVA 3QKJA 4M75B 4IUUA 4PJOC 1R8OB 2HQXA 2VGMA 3SFMA 5LJ5d 3M4YA 3CCVA 2VXFA 2O4XB 4M7DD 1Q82U 3PTAA 4OGCA 4ZN1A 2MMPA 1G3SA 1N8RC 3CC4A 2RJEA 4IUPA 1MHNA 3H6ZA 3E9FA 5CK9A 3LWIA 2GFAA 3OYJA 1LJOA 4XTWA 5GANh 2C06A 2DTOA 4FL6A 2M16A 4M78E 2X4YA 5KH6A 3RKYA 3JCMJ 3RMSA 3CCSA 1VQPA 1YJWA 4XTXA 5IN1A 3J7AF 1KQSS 2VUBA 2LCCA 3JCMP 4FIBA 4PJOB 4FT2A 3OBYA 4OMFB 1JBMA 2GCXA 2WACA 2FVUA 4BI8B 1U1TA 3FEOA 3I55T 3CCLT 4KUDK 1D3BA 3MEAA 4LDWA 4M78C 4ZTFA 1KHIA 5IT9E 1SSFA 2LT1A 4XU2A 4R56A 4EMHA 3C12A 5CAIA 3OW2S 2L89A 1VQMA 1Q86C 5C6SA 2OTJT 4HCBA 2CZ6B 2E5QA 5LJ3h 5C0MA 1WQ7A 4M7AD 2P0QA 1YI2T 3SWNA 1PSEA 1OYXA 1G3WA 1NZ9A 2DIGA 2RI3A 5GAN4 2L3RA 4L5GA 5A0GA 3CD6T 4ZGEB 2ZPIB 3G4ST 4PJOE 2E10A 5GAN3 4M77A 3JAME 2IVWA 4C5EA 3DB3A 5HK0A 3CMAT 1VQ6A 2RK2A 4J5YA 1M90C 3BFMA 3GIBA 2V8KA 3HRSA 4M78G 3OQ5A 3SWNC 3GPLA 5CKHA 3BDLA 1Q81U 2YRVA 4KUIA 1KC8C 1VQKA 4LD6A 5J26A 2JN0A 1Y07A 1B34B 3INZA 5GAN2 4ZTJA 2RHXA 5A0LA 3HP9A 1UEBA 2DTIA 4FM4B 2E12A 3KUFA 2BIVA 2R5AA 2ZPHB 5GAMj 1FX7A 4OB3B 4LDXA 5GAMf 2DVEA 2XK0A 2JTFA 3CCET 4NL2A 4HA8A 4ZGJB 2LT4A 1M1GA 2LNVA 3QHSA 1YJ9T 1M1KC 4J6YA 2LC4A 2DPPB 2Y90A 1ZBXA 1YIJA 2D9TA 3OS0A 4XU1A 1S72A 1AHJB 3J80E 5LJ5e 3OA6A 5GAOr 2LCLA 1NPRA 3SD4A 4GLKA 2FL7A 4IUVA 3QZ5B 1U8RA 2P4TA 3QJYA 1Y96B 4PJOG 3RUXA 4C5IA 4VUBA 4A53A 5GAMe 2XKOC 1GXIE 2RJCA 5CIUA 1FXXA 1OI1A 2E6NA 1VUBA 2RH2A 1PSFA 4C5GA 1VQLT 3JB9G 4PLLA 1MGQA 4OGEA 3JCMc 1JRIA 1VQ8A 5KE3A 1XTDA 4LDUA 2PVGB 3CC2A 1WJRA 3QZ9B 3KXTA 3QXEB 3RKWA 2O01E 4IKFA 3FB9A 3M4GA 5LJ3j 3TEEA 3FJPA 4HCZA 1IREB 4FT4A 3JCMX 1Q7YC 2K3YA 4PJOD 2ZPGB 3CMET 2ZPBB 4B9XA 4M78A 5GAMd 3OY9A 1VQLA 5L8RE 4BUGA 3BW1A 4XAXB 5GAN5 1HXDA 5CO7A 2MWOA 2V8JA 4C8QB 5I21A 4J83A 5CQXA 5DY9A 3JCMg 3LX7A 3T9NA 2HAXA 2RO0A 2ZPFB 4M7AG 2DZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNI A;  1W2B S;  1VQ5 T;  3CCQ A;  1IZ6 A;  2QA4 T;  1S72 T;  1YJW A;  3CCS A;  3HKS A;  1VQP A;  1NJI U;  1VQN T;  2MI6 A;  1KQS S;  1JJ2 A;  3J7A F;  2LQ8 A;  3CPW S;  1QVG S;  3CCE A;  2KDS A;  3PIO A;  3G6E T;  1K8A U;  1YIJ T;  1KD1 U;  3I55 T;  1BKB A;  1Q82 C;  3CCL T;  1Q81 C;  3CCJ A;  2CKK A;  3KBG A;  1VQ7 A;  1KHI A;  2MWP A;  5IT9 E;  1SSF A;  1NJI C;  3OW2 S;  1VQP T;  3CCS T;  2OTJ T;  1VQM A;  1Q86 C;  2E70 A;  3CCR T;  3LGL A;  1YI2 T;  5LL6 S;  1M90 U;  1NZ9 A;  5A2Q E;  1VQ8 T;  2L3R A;  1K9M C;  1VQK T;  4CRI A;  3DB4 A;  3CD6 T;  3G4S T;  3CC7 A;  3CMA A;  3I56 A;  3JAM E;  1VQO T;  2E6Z A;  3PIP A;  3J81 E;  3DB3 A;  2XHC A;  4QQD A;  3CMA T;  1K9M U;  3CPF A;  3G4S A;  1YI2 A;  1M90 C;  1QVF S;  1VQ6 A;  4TVR A;  1Q81 U;  3CCR A;  5DLQ E;  4ZN3 A;  1KQS A;  1YHQ T;  1JJ2 S;  3DLL A;  1KC8 C;  1VQK A;  2OTJ A;  5J26 A;  2DO3 A;  3CC2 T;  1KD1 C;  1UEB A;  3CCJ T;  5J3B A;  3A5Z B;  2JNG A;  3CCL A;  1VQM T;  3CCM T;  1M1K U;  2G3R A;  3I55 A;  2OTL T;  1VQ9 T;  5IAY A;  3CCU T;  2QEX T;  4X34 A;  1Q86 U;  1K73 C;  3G6E A;  3LH0 A;  2JVV A;  1YIT A;  3CCE T;  2QEX A;  1M1G A;  4YTL A;  3G71 A;  1VQ9 A;  1YJ9 T;  1M1K C;  1Q7Y U;  1VQN A;  3TRE A;  1YIJ A;  2EIF A;  1S72 A;  5FLX E;  3J80 E;  4RG2 A;  1VQ5 A;  3OW2 A;  2LCL A;  1N8R U;  1NPR A;  1W2B A;  1VQ4 A;  1YBY A;  5HY6 A;  1YJ9 A;  1YJW T;  2QA4 A;  1YHQ A;  3G71 T;  1YJN A;  3CCQ T;  3CXC A;  1YIT T;  3CPW A;  5DM7 R;  1QVG A;  2IG0 A;  3CCU A;  2OTL A;  1RL2 A;  3I56 T;  3CC4 T;  3OYY A;  3CC7 T;  3CCM A;  1VQL T;  1EIF A;  2JUF A;  3CME A;  3CCV T;  1VQ8 A;  3LGF A;  2KVQ G;  1XTD A;  3CC2 A;  2LVM A;  1K73 U;  3P8B B;  1KC8 U;  1NPP A;  1VQ6 T;  1K8A C;  3ER0 A;  1Q7Y C;  3CXC S;  1VQO A;  1VQ7 T;  1X6O A;  3CCV A;  3CME T;  1VQL A;  1Q82 U;  4ZN1 A;  1YJN T;  1N8R C;  3CD6 A;  3CC4 A;  1QVF A;  2MWO A;  1VQ4 T;  2JOY A; 
#chains in the Genus database with same CATH topology
 4C8Q D;  2KSS A;  4ESR A;  2DRK A;  1M1K R;  1BYM A;  2JMA A;  3CMA Q;  3V8J A;  2CUD A;  1QWE A;  2O31 A;  4B9W A;  3PIO A;  5GAN j;  2CT3 A;  1E6G A;  1HSQ A;  4J8O A;  1KD1 U;  2J05 A;  4LD9 K;  3H0I A;  3UPU A;  1LOJ A;  2KK4 A;  4XQ3 A;  4DA4 A;  4FYW B;  4CI0 C;  3TSW A;  1M27 C;  2EJF A;  2GTJ A;  1ZSZ C;  4M75 A;  2DL8 A;  2I0N A;  2RHZ A;  3PT9 A;  1QCN A;  4CRI A;  5GAN e;  4E7L A;  5GAN 7;  2MAM A;  3PIP A;  3L2Z A;  1G5V A;  4OB1 B;  1M3C A;  4RMO A;  3MET A;  3CCR A;  1ZSZ B;  2YWW A;  5GAN 8;  1JO8 A;  1KQ1 A;  2M02 A;  1KHC A;  4EPC A;  1AWX A;  4M77 E;  2MPX C;  8AT1 B;  1Q86 U;  4ELY C;  1M8M A;  3G6E A;  3X26 B;  2QEX A;  2YLB A;  4FSS A;  2XIC A;  2MIO A;  1P92 A;  1VQN A;  2YUO A;  1Q7Y R;  1YWP A;  5CKD A;  2EBP A;  4FYY B;  1VQ5 A;  2J6K A;  1N5Z A;  3V7S A;  3OW2 A;  3E9G A;  5CCA A;  1RAH B;  4Q5W A;  1IRX A;  1D0X A;  5DM7 R;  3CCU A;  4PJM A;  2DL3 A;  1AVZ C;  3NTK A;  3LGF A;  3X28 B;  2WSF E;  5ECA A;  2XU8 A;  3IQL A;  1MNE A;  4AFU C;  1OZ2 A;  1MMN A;  5IHI A;  3TCJ A;  2DEU A;  5LJ3 d;  1X6O A;  2HZY A;  2DXU A;  3WVE B;  1Y71 A;  2O2O A;  3O8V A;  4PJO F;  3L42 A;  2CYZ B;  1VQN T;  1RLQ C;  1Y0M A;  3ME9 A;  1DJ7 B;  1J3T A;  1D3B B;  4OVA A;  2EYZ A;  4HT9 A;  4PJO A;  4M77 D;  4XK8 E;  2XDB A;  1LPL A;  2DXT A;  2K5F A;  3ASK A;  4JZ3 A;  3SB2 A;  1XOV A;  2MYS A;  4M78 B;  4JPB W;  2K2V A;  3P8H A;  5HKC A;  1W2B P;  1W1F A;  2JW4 A;  4F04 B;  1BI2 A;  4FW1 A;  3NTI A;  3I56 A;  1X43 A;  3HL8 A;  4HVV A;  4C8Q G;  1VQO T;  3A8G B;  3L2Q A;  3E19 A;  3UDC A;  1HK9 A;  2KT1 A;  4FW2 A;  4DEY A;  5GAN 6;  2CH4 W;  1MV3 A;  5GMK i;  3HRT A;  2KGT A;  5J3B A;  5IXF A;  1VQM T;  1TH7 A;  2G3R A;  2XDP A;  2QQS A;  2VC8 A;  5D6Y A;  2E64 A;  4J6W A;  1K73 C;  4E2F B;  2KE9 A;  1VQ9 A;  4XU3 A;  1UJ0 A;  2CSI A;  4NOY A;  3EGD A;  4PNO A;  2DXC A;  2XDD A;  1QP3 A;  5GMK h;  1LNX A;  5FRM A;  2HD0 A;  2BE9 B;  1YHQ A;  3RES A;  4Y92 A;  2X4W A;  3TSZ A;  3L1A A;  1OU8 A;  2AIR B;  4MDX A;  1E7O A;  3CC4 T;  1SPK A;  2AT1 B;  3PFS A;  2JUF A;  4JLI A;  3RIR A;  3OYK A;  2OTL Q;  4L6V 5;  3CEY A;  3HHT B;  5GMK l;  4UC4 A;  2KI7 A;  2CP0 A;  1CKA A;  2EYQ A;  3P8B B;  1KC8 U;  2RQT A;  1YP5 A;  2DF6 A;  3EFS A;  3VUB A;  4Z02 A;  5CKE A;  4M75 F;  3CBP A;  1UHC A;  2CSQ A;  3I9Q A;  2F2V A;  1Y7X A;  4M7D A;  5AYF A;  2ATC B;  1BB9 A;  2COZ A;  1ACM B;  1MUZ A;  2LP5 A;  5LJ3 f;  4ORZ A;  4AFQ C;  4M75 D;  2ECZ A;  1UE9 A;  2CZ7 B;  1NYG A;  2HQH A;  2MK5 A;  3MJX A;  4JRQ A;  3OSS C;  3X20 B;  3PMI A;  1Q81 C;  2BZX A;  2QI2 A;  2Z0W A;  2M0O A;  3CCS T;  4JRI A;  3GP8 A;  1WHM A;  1WHK A;  1D1A A;  1X6G A;  3M9Q A;  5I2M A;  2SEM A;  3MO8 A;  4A54 A;  1ZHI A;  3EAE A;  1BIB A;  2FPF A;  5GAN f;  3OYL A;  2FG0 A;  4C0D C;  1BU1 A;  5AT1 B;  2PVD B;  1O9S A;  2CS7 A;  3DLL A;  2XD0 A;  2DO3 A;  2VAS A;  2HL3 A;  3JRZ A;  3F70 A;  4LNP A;  1OUL A;  1TUD A;  2FO0 A;  3A5Z B;  3CCL A;  5I22 A;  1WHG A;  4F14 A;  4D8D A;  1N6A A;  1VQ9 T;  3OYE A;  5FWC A;  2COW A;  2DJZ A;  4D8K A;  2KNB B;  2KRS A;  4AMC A;  3M0Q A;  2KRN A;  4Y91 A;  1QMC A;  2DL4 A;  3M59 A;  4E7I A;  1M2O A;  3NGP A;  2RQW A;  4A4F A;  1Q7Y U;  2CP6 A;  3EHR A;  1V1C A;  2JZ2 A;  2A0F B;  5FLX E;  1K1Z A;  2YDL A;  1RAA B;  3PGG A;  1YBY A;  3OMC A;  2QQR A;  3QYG B;  3CXC A;  1UDL A;  1YIT T;  3X25 B;  5KE2 A;  2EFI A;  5KYU A;  2OTL A;  3OYD A;  3CCM A;  1UG1 A;  5LJ3 g;  1YCY A;  4M77 G;  1LCK A;  3FRN A;  1ARK A;  5KCO A;  4XTV A;  4PJO C;  1R8O B;  2HQX A;  5LJ5 d;  2O4X B;  3EH2 A;  2VVK A;  1G3S A;  8ATC B;  2RJE A;  2GFA A;  1I07 A;  5GAN h;  2EW3 A;  2ENM A;  1OOT A;  5IN1 A;  3J7A F;  2VUB A;  3JCM P;  1JQQ A;  4ANJ A;  4PJO B;  4OMF B;  2E3H A;  1T3S A;  2GCX A;  1VQM Q;  2WAC A;  4BI8 B;  1D3B A;  1UFF A;  1E6H A;  5IT9 E;  2LT1 A;  1KQS P;  2E5Q A;  1WQ7 A;  2BTT A;  2DIG A;  2RI3 A;  2O9V A;  2L3R A;  3EFO B;  2ZPI B;  1YI2 Q;  1M2V B;  4HVW A;  2ED0 A;  3CMA T;  4J5Y A;  3RDV A;  3EG9 B;  3GPL A;  1VQK A;  3CQT A;  2YRV A;  4KUI A;  1QVF P;  1HJD A;  2EGC A;  2DTI A;  2E12 A;  3M0R A;  4HVU A;  1FX7 A;  5IHN A;  1K4U S;  3CME Q;  3H41 A;  2C0T A;  4HA8 A;  3H0H A;  2K6D A;  1RAI B;  2J6F A;  2K79 A;  4XU1 A;  1WZO A;  3OA6 A;  1NPR A;  1S1N A;  2FL7 A;  2LQW A;  3QJY A;  4PJO G;  3RUX A;  3AT1 B;  4VUB A;  5KYX A;  1GXI E;  2XKO C;  2RJC A;  5CIU A;  2ESW A;  1QQJ A;  2E6N A;  2RH2 A;  4C5G A;  1AWO A;  3JB9 G;  1TTH B;  4FYX B;  1WJR A;  3QXE B;  1G83 A;  4HCZ A;  3RBB B;  2RPN A;  2K3Y A;  1FMV A;  1TXQ A;  1VQL A;  3C0C A;  1HXD A;  5CO7 A;  1C6V X;  2YUQ A;  4M7A G;  2HAX A;  3S3N A;  4E7J A;  1H92 A;  1NLP C;  1H3Z A;  3UWN A;  1N8R R;  1PRL C;  3M55 A;  4M77 C;  2KDS A;  1Z9Q A;  1VIE A;  1K76 A;  1RI0 A;  3C95 A;  2FB7 A;  2PUO B;  2MWP A;  4F17 A;  3QSU A;  1OQK A;  3JCM h;  4C92 E;  3QUI A;  1K9M C;  1GCQ C;  4QQ6 A;  3UT1 A;  4JDS A;  1B3Q A;  3FIF A;  1VQN Q;  2A36 A;  4HXJ A;  2M1H A;  1G3T A;  1UGQ B;  2DKG A;  1K9M U;  1VQ5 Q;  2FHD A;  3G1J A;  4II1 A;  3WVD B;  3JV3 A;  5J39 A;  4K11 A;  4OF1 A;  2K3B A;  1M1K U;  2CDT A;  2LJ3 A;  2DD5 A;  2NLU A;  5IAY A;  2JVV A;  3REB B;  1RAD B;  1PWT A;  3TRE A;  2LJ1 A;  2DTH A;  1VQP Q;  2X51 A;  4PLI A;  3GOX A;  1FWZ A;  1KIK A;  2F69 A;  2CT4 A;  2F5K A;  3VS0 A;  1QKX A;  4A4E A;  2ROT A;  3LLR A;  1B34 A;  4M75 G;  1EIF A;  3CME A;  1GBQ A;  3CCV T;  2QAS A;  2XMF A;  4QT7 A;  1JB0 E;  1H64 1;  3M5A A;  2CZ0 B;  2QQA A;  4BDZ A;  4PFZ A;  3QJ6 A;  4OB2 B;  2EYW A;  1QCF A;  2LQK A;  4J9E A;  3OS5 A;  1ABO A;  2DBM A;  1PCX A;  2PU9 B;  2LMJ A;  1HD3 A;  1PD0 A;  2K57 A;  3VS6 A;  3HKS A;  4WF2 A;  2QG9 B;  4J9F A;  3JCM e;  1CSK A;  4J9H A;  4PJJ A;  1GRI A;  1TUC A;  1O75 A;  3L2U A;  2RHU A;  4M75 E;  3MP8 A;  2CZ1 B;  2P0P A;  2DE0 X;  4AG2 C;  2JS2 A;  4JRK A;  3I55 Q;  4CC2 A;  1ZA1 B;  1NJI C;  5D6X A;  4WTO B;  7AT1 B;  4M7A C;  1TS9 A;  2QQB A;  1RUW A;  4E6R A;  5A2Q E;  2W0Z A;  1SKU B;  4LN2 A;  1WQW A;  1V29 B;  2ABL A;  4N0A A;  3QG1 A;  3CMA A;  2MCN A;  1IGQ A;  3J81 E;  1TOV A;  3BDU A;  2EQU A;  1YHQ T;  1VQO Q;  4EDU A;  5HK3 A;  2E5K A;  3OB9 A;  1I5L A;  1FMW A;  2EQM A;  3M53 A;  3NHN A;  2R57 A;  3CCU T;  3PVQ A;  4JLG A;  3AHU A;  3VYG A;  2DNU A;  4HCK A;  2EKO A;  4PJN A;  5KYW B;  3OS1 A;  1VIF A;  2DD4 A;  3V7C A;  1I0C A;  4QVZ A;  3HTR A;  2KEA A;  4RG2 A;  4DOV A;  4O5V A;  3EG3 A;  4PFP A;  3PMT A;  2Y4X A;  2BZY A;  1EX4 A;  3OYG A;  1D1C A;  2JT4 A;  1QVG A;  1RAB B;  3I56 T;  4E7K A;  3CC7 T;  3MP1 A;  1NG2 A;  2KT8 A;  2KVQ G;  4BB7 A;  4A4H A;  4M7D F;  4J9G A;  2DA9 A;  1NPP A;  3A98 A;  4BD3 A;  1BI3 A;  1VQ7 T;  2BUD A;  2HSE B;  4LDY A;  4XU0 A;  2PUK B;  5EC7 A;  4O6J A;  1OEB A;  2JOY A;  1YIT Q;  4N4H A;  2CGH A;  3VKI A;  5GMK j;  1G2B A;  1D1B A;  4X9D A;  2GTO A;  1G8X A;  4FYV B;  1M4Z A;  2LZ6 B;  1UHF A;  4OMM A;  4HKE A;  3CCJ A;  2A28 A;  1VQ7 A;  4RTT A;  2M51 A;  1VQP T;  4BI4 A;  2L3S A;  2BE7 D;  5EG2 A;  1JU5 C;  1Z9Z A;  3OYC A;  3RMQ A;  2RF0 A;  3DB4 A;  2D1X A;  1BBZ A;  3VRZ A;  4QVC A;  1M8V A;  2QK0 A;  4M7D C;  1SF9 A;  3PNW C;  2FZC B;  2DER A;  3FDR A;  2KAF A;  1VA7 A;  1SSH A;  2DFU A;  5DLQ E;  3CCV Q;  1JJ2 S;  4QW2 A;  4DBR A;  3GF5 A;  2C0I A;  2HBP A;  1M30 A;  2EGE A;  1F1B B;  2FYK A;  2M9U A;  1D0Z A;  2EQJ A;  3CCM T;  3O5Z A;  3I55 A;  3GNG A;  3LW5 E;  3GBQ A;  3MKD A;  3JCM W;  5CQY A;  5LJ3 e;  4ME7 A;  2G6F X;  2LTO A;  4ELZ C;  3ZL7 C;  2XI9 A;  1K0S A;  4NL3 A;  3V7R A;  5HY6 A;  3JB9 F;  4C8Q E;  5FWB A;  4C92 D;  3JB9 H;  3M54 A;  1GBR A;  4RKU E;  1SRL A;  2IG0 A;  2ZPE B;  1PD1 A;  2CP5 A;  2Y4Y A;  5LJ5 h;  2K9G A;  4PKC C;  1ZUY A;  2RQV A;  1EFN A;  5FU7 B;  3RER A;  4QQG A;  2FPD A;  3CC2 Q;  3QWX X;  2QTX A;  1BI0 A;  1YN8 A;  2AZS A;  1IHV A;  3MP6 A;  3EFR A;  3C94 A;  1LVK A;  3JCM V;  1M3B A;  1K8A C;  3ER0 A;  4M75 B;  3M4Y A;  2DYI A;  3PTA A;  2NUZ A;  2MMP A;  1N8R C;  5CK9 A;  2OAW A;  1JEG A;  2F2W A;  3JCM J;  1IHW A;  3CCS A;  1MMD A;  3G71 Q;  4FT2 A;  3OW2 P;  3FEO A;  1Q86 R;  3PVL A;  4KUD K;  4M78 C;  4DBH A;  1KHI A;  1SSF A;  3UF4 A;  4XU2 A;  3OW2 S;  4EMH A;  1V76 A;  1Q86 C;  5C6S A;  5C0M A;  4M7A D;  2P0Q A;  1WI7 A;  4AG1 C;  5KYX B;  1OPK A;  2CP2 A;  4L5G A;  2E10 A;  4M77 A;  3JAM E;  2IVW A;  2RK2 A;  1M90 C;  3GIB A;  3BFM A;  2V8K A;  3OQ5 A;  3M0S A;  2V26 A;  4LD6 A;  2JN0 A;  5GAN 2;  3INZ A;  2DYB A;  4RTW A;  2RHX A;  3HP9 A;  1AZG B;  4FM4 B;  2R5A A;  1ZSG A;  3EFO A;  4OB3 B;  5GAM f;  4LDX A;  2XK0 A;  4RTX A;  2JTF A;  2LT4 A;  1M1G A;  1YJ9 T;  1ZBX A;  2D9T A;  2OTJ Q;  1AHJ B;  3J80 E;  5LJ5 e;  1A0N B;  2DLP A;  1C0M A;  2HCK A;  4GLK A;  3ULR B;  4LUE A;  3EG2 A;  4C5I A;  4M4Z A;  1TG0 A;  1FXX A;  1K9A A;  1OI1 A;  2SRC A;  2X3W D;  4JJD A;  2W10 A;  2DRM A;  1PSF A;  1X2K A;  4GBQ A;  1JRI A;  5KE3 A;  5FW9 A;  3KXT A;  1PKS A;  3FB9 A;  3M4G A;  5LJ3 j;  3TEE A;  6AT1 B;  3H9N A;  1JJ2 P;  1X69 A;  2ZPG B;  1WHL A;  2ZPB B;  4M78 A;  4BUG A;  3BW1 A;  1KK7 A;  1AEY A;  1SEM A;  2V8J A;  3JCM g;  2DEQ A;  1IZ6 A;  4RTZ A;  4Y28 E;  1ABQ A;  3M58 A;  2LCS A;  3HFN A;  1BK2 A;  2MI6 A;  4R55 A;  1M5Q 1;  3QPH A;  4M7A B;  1EZZ B;  2FZG B;  3OYN A;  1YHQ Q;  2RHI A;  2L0A A;  4C5H A;  2NWM A;  4KGX B;  1Q82 C;  1PC0 A;  1ZBJ A;  4GLM A;  4BE2 A;  5FRO A;  2JJ9 A;  2YXY A;  5GAO l;  4JRP A;  3I5R A;  3S3M A;  2KQW A;  5GAO p;  1VQ6 Q;  4P5N A;  1UGV A;  5LL6 S;  1VQ8 T;  3EGX B;  4F7U A;  2PZ1 A;  2E65 A;  4C8Q F;  2H8H A;  2CP3 A;  3G4S A;  4F7U G;  1KQS A;  1I4K 1;  4FU6 A;  5CKF A;  2LQN A;  5GAM g;  4AFS C;  3I56 Q;  2ZZD A;  2K7A A;  1T0H A;  4M7A A;  3M0P A;  2X9H A;  3NTH A;  2EKH A;  3SWN B;  4N0A C;  3VS4 A;  2GF7 A;  1ZSZ A;  1I81 A;  3M0U A;  1VQ7 Q;  1ZQ1 A;  4BE0 A;  3DKM A;  4E7H A;  4C92 B;  2RQU A;  2IPO B;  3EGX A;  1WHJ A;  3G7Z A;  4JJB A;  1SG5 A;  3EG9 A;  2RI2 A;  3OYY A;  5GMK e;  2E1H A;  2QGG A;  5GAO m;  1ZA2 B;  1QLY A;  4OML A;  2V8I A;  2V1Q A;  2K3X A;  2H3J A;  3NFC A;  4AT1 B;  1OZ3 A;  2ROL A;  2L3P A;  2EAY A;  1QVF A;  2GQV A;  2RJF A;  3SDZ A;  1MND A;  1W70 A;  2WSC E;  2L2P A;  2A3L A;  3JSC A;  1HYO A;  1TU0 B;  5GAN g;  4HCC A;  2PVO B;  4C92 F;  1NE8 A;  3I5S A;  1NJI U;  1JJ2 A;  4KGZ B;  1QVG S;  1YIJ T;  2EJG A;  3H0F A;  2DZC A;  3MPU B;  5GAN d;  2NUP A;  1M3A A;  2ED1 A;  5FU6 C;  4FCY A;  1S72 Q;  1WYX A;  4MZM A;  3CCR T;  4C8Q A;  3REA B;  1NEB A;  1M90 U;  2FZK B;  1ZX6 A;  4CC3 A;  2RJD A;  3CC7 A;  1BIA A;  2MF2 A;  1K8A R;  2E6Z A;  2E4H A;  3QDF A;  1KFZ A;  2P0K A;  3VS1 A;  1RAF B;  4BAC A;  1NM7 A;  3NMZ C;  2DVJ A;  2AKL A;  2QGF B;  2EPD A;  2JNG A;  3OMG A;  5GMK m;  2F1L A;  2HSP A;  4MDW A;  2K5L A;  2X4J A;  2BZ8 A;  2QAZ A;  4YTL A;  3R6N A;  4HT8 A;  1D09 B;  2X4X A;  2JMC A;  2RHY A;  2J7I A;  5A0D A;  2OI3 A;  3KFV A;  1W2B A;  2YT6 A;  1YJ9 A;  2A7Y A;  1NEG A;  1I5O B;  3CCQ T;  2RNA A;  2L5Q A;  4R0K A;  1WNL A;  3QO3 A;  2C0O A;  4LDV A;  3CCM Q;  5CVI A;  3OSV A;  4N4I A;  2A08 A;  4KUL A;  1R0C B;  5LJ5 j;  1VQ6 T;  4XTU A;  4OMQ A;  3HRU A;  1W6X A;  2B86 A;  2GGR A;  4EIK A;  1UGP B;  3CD6 A;  2NUT A;  2VB6 A;  2RM4 A;  2EYY A;  1VQ4 T;  2RA2 A;  3CCQ A;  3JCM f;  1S72 T;  2DM1 A;  2DL5 A;  4JUV A;  4M7D G;  3CPW S;  5KYY A;  1WJS A;  2CP7 A;  2PNI A;  2D6F A;  2KMT A;  3N5B B;  3RR6 A;  1K8A U;  2LJ0 A;  3V8K A;  1NJI R;  2DIL A;  1UGR B;  2E41 A;  2KRM A;  1VQ9 Q;  1BCO A;  3QBY A;  3CXC P;  2VKN A;  2VGN A;  1IGU A;  4A4K A;  4EMK B;  1IXD A;  4Z8A A;  4KT0 E;  4RCC A;  3VJP A;  2WSE E;  4OMO A;  2D8J A;  1TSF A;  1N9S A;  2HNI A;  1X01 A;  3SEM A;  4C0Z A;  3OYF A;  1I1J A;  2KR3 A;  2OAU A;  2YLC A;  3OYA A;  3JB9 D;  4NS5 A;  1AWW A;  2K4Y A;  4RTU A;  3VS3 A;  2JXB A;  3FLG A;  4ZN3 A;  2OTJ A;  2EJ9 A;  3MEV A;  4M7A E;  2LX9 A;  3C4S A;  3G6E Q;  3WXM B;  4OMN A;  4BY6 C;  1X6B A;  3FJ5 A;  3SHW A;  3G71 A;  2HKN A;  3A8H B;  3ZEH A;  2RB6 A;  2E3I A;  2EIF A;  5I2S A;  4IIM A;  1YWO A;  4OB0 B;  1WGS A;  2FRW A;  4F7U E;  1Q81 R;  1N8R U;  1MV0 B;  1VQ4 A;  5I11 A;  3GNF B;  3CCU Q;  2R58 A;  4XTZ A;  4ZGD B;  4BY6 B;  1YIJ Q;  3EH1 A;  1M9S A;  4KH1 B;  2KXC A;  3CBO A;  2VYT A;  3QII A;  3ZBD A;  2YHT A;  2KYB A;  1K73 U;  2LRQ A;  3I35 A;  3A8L B;  3OYI A;  1IB8 A;  5M9O A;  1YJ9 Q;  3TQ7 P;  3QKJ A;  2HMA A;  2VXF A;  2CUB A;  2O9S A;  4Z88 A;  4IUP A;  3E9F A;  1UJY A;  1LJO A;  4XTW A;  2C06 A;  4M78 E;  3RKY A;  1YJW A;  1VQP A;  2V1R A;  2NUP B;  1KQS S;  2LCC A;  4FIB A;  1JBM A;  2CRE A;  1JXM A;  2FVU A;  4DEX A;  2DET A;  3I55 T;  4J9C A;  2QDL A;  4LDW A;  3VS2 A;  4ZTF A;  4R56 A;  3C12 A;  2L89 A;  2CZ6 B;  5LJ3 h;  1K0X A;  1OYX A;  1GCP A;  2FRY A;  3VS5 A;  5A0G A;  3CCQ Q;  4ZGE B;  3G4S T;  2HBW A;  4C5E A;  3DB3 A;  5HK0 A;  3HRS A;  3SWN C;  4M78 G;  1Q81 U;  3BDL A;  2AKK A;  1WDX A;  4ZTJ A;  5A0L A;  1NLO C;  1UEB A;  2BIV A;  2ZPH B;  2COY A;  5GAM j;  2K2M A;  1BCM A;  2M0Y A;  4ZGJ B;  3QHS A;  1OV3 A;  4J6Y A;  4OMP A;  2DPP B;  2ZAE A;  5GAO r;  4RUG A;  4IUV A;  1Y96 B;  3CC7 Q;  4F16 A;  4A53 A;  2JS0 A;  1UTI A;  2AZV A;  2AK5 A;  1VUB A;  1OX9 A;  1GFD A;  1WXT A;  3JCM c;  1VQ8 A;  1XTD A;  1YFN A;  2YRC A;  2PVG B;  4LE9 A;  3QZ9 B;  2DMO A;  4IKF A;  3FJP A;  1WFW A;  1IRE B;  1WXU A;  4FT4 A;  3JCM X;  1Q7Y C;  3CME T;  2FEI A;  4XAX B;  2MWO A;  3NPF A;  4J83 A;  5CQX A;  3LX7 A;  3T9N A;  3E2U A;  4PFO A;  3TVT A;  2DZ9 A;  2DXB A;  1VQ5 T;  5IH2 A;  1X2Q A;  3M57 A;  1ZUK A;  5LJ5 f;  2HQE A;  1X27 A;  4PK4 A;  3G6E T;  1ZLM A;  1QW1 A;  1ZUU A;  4LUD A;  1XQH A;  4JJN K;  3VYH B;  4V2S A;  1X75 C;  3KBG A;  2EYX A;  5GAM h;  4RG8 A;  4KGV B;  3LGL A;  3JCM d;  3V8L A;  2GBQ A;  1G3Y A;  1R77 A;  2O4X A;  3H8Z A;  3CCS Q;  3HPW A;  1T3L A;  4IUR A;  1YJN Q;  4ZNX A;  2ZCF B;  2DX1 A;  2XHC A;  2CH4 A;  1QVF S;  4OP0 A;  1D0Y A;  3P8D A;  4TVR A;  2RI5 A;  4J7F A;  1PNJ A;  4C0D B;  5FRN A;  1QP2 A;  4KH0 B;  4RCB A;  1QVG P;  1VQL Q;  1FYN A;  2VV5 A;  5CR2 A;  3A8M B;  4C8Q C;  4BE1 A;  2KBT A;  4F7U B;  1RAC B;  2P4R A;  4X34 A;  3CCR Q;  4EMG A;  3S6W A;  5GJV B;  2R5M A;  3CBM A;  4E7S A;  2RMO A;  1QVP A;  5GAO n;  3M56 A;  5FU6 B;  1B07 A;  1WHH A;  3MHX A;  3OBW A;  1GCQ A;  1M2V A;  2JTM A;  1SHF A;  3UAT A;  4C0F A;  2KYM A;  5KYU B;  2RK1 A;  4J7I A;  2EGA A;  3CPW A;  2F2X A;  2RQR A;  2LNH B;  4C0G A;  2KY9 A;  2OX7 A;  1T0J A;  4GY5 A;  5D7U A;  4IIO A;  4ATO A;  1JXO A;  1AZE A;  5LJ5 g;  2JM8 A;  1K73 R;  3EHQ A;  3CCE Q;  1AOJ A;  2YUP A;  4MZT A;  4A63 B;  4F7U F;  1RAG B;  3CXC S;  1VQO A;  1KD1 R;  9ATC B;  2L8D A;  4DOW A;  4A4G A;  3G4S Q;  4J6X A;  5CKB A;  4RTY A;  3VV0 A;  1UB4 A;  3BE3 A;  3CPW P;  1CKB A;  2F5T X;  4FSX A;  1W2B S;  2XID A;  3E1S A;  2QA4 T;  3VRY A;  3TU4 K;  2YSQ A;  1GFC A;  2LQ8 A;  5KYN A;  1KC8 R;  3CCE A;  4M7A F;  2PQW A;  1TWB A;  3EG0 A;  3THK A;  3DLM A;  4IUQ A;  4KRT A;  2CKK A;  2K5I A;  2ZGW A;  1QKW A;  1W4S A;  2E70 A;  1SHG A;  3OYB A;  1MMA A;  5FU7 C;  2L3Q A;  1AWJ A;  3A8O B;  2HEQ A;  1VQK T;  2D0Q B;  3MEW A;  3A1P A;  2H3E B;  4DQ2 A;  4QQD A;  5KYW A;  1YI2 A;  1WA7 A;  1QCO A;  5IHK A;  2QTV A;  2I2L A;  2OJ2 A;  5DLO A;  2HL5 C;  3LYI A;  4N4G A;  4M7D B;  4B6M A;  1KD1 C;  1KG1 A;  3MCA B;  1GL5 A;  4KBM B;  1PM3 A;  3CCL Q;  3JB9 J;  4JS5 A;  2QXF A;  1N9R A;  1N27 A;  1BI1 A;  1Y96 A;  1RI9 A;  2RD1 A;  4PJL A;  3S3O A;  3CCJ Q;  4DBF A;  3MEU A;  5KYY B;  3VUZ A;  2FPE A;  4EMK C;  4Z89 A;  3OYH A;  5IXB A;  1YJW T;  3QWY A;  3CC4 Q;  2HKQ B;  4MZP A;  3RKX A;  3CD6 Q;  1WLP B;  1KQ2 A;  1Y57 A;  3LWH A;  5HCK A;  1PG5 B;  4JJC A;  1K9M R;  2BKD N;  4QKU A;  1M1F A;  3URG A;  4AFZ C;  4L59 A;  1RAE B;  1WJQ A;  2QA4 Q;  2X3X D;  1Q82 R;  2GQI A;  2EWN A;  1U1S A;  3M0T A;  2DIQ A;  1NYF A;  5KCH A;  1YJN T;  2MOX A;  1UGS B;  1B7T A;  4M7D E;  2QQ9 A;  1OU9 A;  3ZFJ A;  4M75 C;  1I8F A;  3VU3 C;  1XNI A;  2GFU A;  4WCI A;  1WX6 A;  3R6O A;  1VQ4 Q;  3X24 B;  3Q1J A;  2NYS A;  1VYU A;  3QDR B;  2X35 A;  4JZ4 A;  1TUG B;  4M78 D;  3QYH B;  3L2W A;  1SRM A;  4QVD A;  4JS4 A;  4J9D A;  5D6W A;  3JCM Q;  1AT1 B;  1VQK Q;  1BKB A;  4IUT A;  4M77 B;  4MMK A;  2GNC A;  3BY7 A;  1IO6 A;  1PKT A;  1VQ8 Q;  3JB9 I;  2RN8 A;  4J9B A;  2B8A A;  2P84 A;  2AHJ B;  4X9C A;  4M78 F;  3UA7 A;  4M77 F;  5GJW B;  3HSB A;  2DAQ A;  2DK3 A;  1YCS B;  2HDA A;  1H8K A;  2LDM A;  4X1V A;  3D7S B;  2KXD A;  3CPF A;  2J6O A;  2VXE A;  4EMK A;  1OX8 A;  1U3O A;  2QDY B;  4MML A;  3CC2 T;  4BDY A;  2LX7 A;  3L2V A;  4PL6 A;  3GLX A;  4D6W A;  3CCJ T;  3PE0 A;  1WPY A;  1KSW A;  4XTY A;  5GAO q;  2OTL T;  1YJW Q;  2QEX T;  2YUN A;  3LH0 A;  2EQK A;  1YIT A;  1QWF A;  4C92 C;  1XJW B;  4E47 A;  2DJQ A;  1M90 R;  1U5S A;  2XG8 D;  4LXC A;  2QA4 A;  3G71 T;  1YJN A;  2IIM A;  4C92 A;  3OYM A;  3FC3 A;  2JTE A;  1RL2 A;  4BI3 A;  3EG1 A;  3HFO A;  4C92 G;  3JCM b;  3OS2 A;  2DL7 A;  1H3H A;  2LVM A;  1KJW A;  4IUU A;  3EGD B;  3SFM A;  3CCV A;  2VGM A;  4M7D D;  1VOM A;  1Q82 U;  2VWF A;  4OGC A;  4ZN1 A;  3CC4 A;  1MHN A;  3H6Z A;  3LWI A;  3OYJ A;  3RNJ A;  2DTO A;  4FL6 A;  2M16 A;  2X4Y A;  5KH6 A;  3RMS A;  5L23 A;  1Q95 G;  4XTX A;  4E7Z A;  2EQI A;  3OBY A;  1AD5 A;  2J06 A;  3UA6 A;  1U1T A;  3CCL T;  1WIE A;  3MEA A;  1UUE A;  5CAI A;  2OTJ T;  1VQM A;  4HCB A;  1YI2 T;  3SWN A;  1PSE A;  1G3W A;  1NZ9 A;  2NUT B;  2QYZ A;  4DBQ A;  5GAN 4;  3CD6 T;  4PJO E;  5GAN 3;  1WXB A;  2QEX Q;  2JM9 A;  1VQ6 A;  1UEC A;  5CKH A;  1KC8 C;  5J26 A;  1R0B G;  3EGU A;  1Y07 A;  1B34 B;  2D0N A;  3KUF A;  1NBE B;  1C1A A;  2DVE A;  1U06 A;  3CCE T;  4NL2 A;  2EVR A;  2YRD A;  2LNV A;  1M1K C;  2LC4 A;  2Y90 A;  1YIJ A;  3OS0 A;  1S72 A;  4J9I A;  2LCL A;  4CC4 B;  3SD4 A;  3VS7 A;  1MMG A;  1RLP C;  3LH5 A;  3QZ5 B;  1U8R A;  2P4T A;  5GAM e;  2O88 A;  2D8H A;  1PHT A;  1OPL A;  1VQL T;  4OGE A;  1MGQ A;  1YNZ A;  4PLL A;  4LDU A;  3CC2 A;  1FMK A;  3RKW A;  2O01 E;  4CC7 A;  3U23 A;  2A37 A;  4PJO D;  4B9X A;  5GAM d;  3OY9 A;  2PTK A;  5L8R E;  2KRO A;  4RTV A;  5GAN 5;  5I21 A;  1PRM C;  4C8Q B;  2DBK A;  1VYV A;  5DY9 A;  3L2R A;  1VYT A;  2RO0 A;  2ZPF B; 
#chains in the Genus database with same CATH homology
 2DXB A;  2DEQ A;  1IZ6 A;  1VQ5 T;  4C8Q D;  1H3Z A;  4Y28 E;  2KSS A;  3M58 A;  3UWN A;  3HFN A;  1BYM A;  3M57 A;  2MI6 A;  4R55 A;  1M5Q 1;  5LJ5 f;  2HQE A;  3M55 A;  3V8J A;  4B9W A;  3QPH A;  2KDS A;  4M77 C;  3PIO A;  4M7A B;  3G6E T;  5GAN j;  1VIE A;  3OYN A;  4J8O A;  1KD1 U;  1QW1 A;  1RI0 A;  2RHI A;  3C95 A;  1XQH A;  4C5H A;  3VYH B;  4JJN K;  4LD9 K;  4V2S A;  1Q82 C;  4BE2 A;  1X75 C;  5FRO A;  3UPU A;  1LOJ A;  2FB7 A;  2PUO B;  3KBG A;  2KK4 A;  4XQ3 A;  4DA4 A;  2MWP A;  3QSU A;  4CI0 C;  5GAM h;  3JCM h;  2EJF A;  4JRP A;  5GAO l;  4C92 E;  4RG8 A;  3S3M A;  4M75 A;  2KQW A;  3LGL A;  3V8L A;  3JCM d;  5GAO p;  3QUI A;  1G3Y A;  2O4X A;  2RHZ A;  4P5N A;  5LL6 S;  3H8Z A;  3PT9 A;  3HPW A;  1VQ8 T;  4IUR A;  1K9M C;  4QQ6 A;  4CRI A;  3UT1 A;  4F7U A;  4JDS A;  5GAN e;  4E7L A;  3FIF A;  5GAN 7;  2E65 A;  2MAM A;  2ZCF B;  4C8Q F;  2M1H A;  1G3T A;  1UGQ B;  3L2Z A;  2DKG A;  2XHC A;  3PIP A;  1K9M U;  4OB1 B;  3G4S A;  4RMO A;  1G5V A;  1QVF S;  3MET A;  4F7U G;  2FHD A;  4OP0 A;  3P8D A;  4TVR A;  2RI5 A;  3CCR A;  4J7F A;  4II1 A;  1I4K 1;  1KQ1 A;  4FU6 A;  5CKF A;  3WVD B;  5GAN 8;  3L2R A;  1KQS A;  4C0D B;  1KHC A;  5GAM g;  5FRN A;  5J39 A;  1QP2 A;  4RCB A;  4OF1 A;  4EPC A;  1M1K U;  2ZZD A;  2VV5 A;  5CR2 A;  3A8M B;  4C8Q C;  4M77 E;  4F7U B;  2DD5 A;  2NLU A;  5IAY A;  4BE1 A;  4M7A A;  1Q86 U;  4X34 A;  4ELY C;  3NTH A;  3G6E A;  2JVV A;  3X26 B;  4EMG A;  3SWN B;  3S6W A;  2YLB A;  4N0A C;  2R5M A;  2QEX A;  3CBM A;  2XIC A;  1VQN A;  1P92 A;  2GF7 A;  1QVP A;  3TRE A;  5GAO n;  2DTH A;  1I81 A;  5CKD A;  3M56 A;  5FU6 B;  1ZQ1 A;  1VQ5 A;  4PLI A;  3V7S A;  3OW2 A;  3E9G A;  4BE0 A;  3DKM A;  5CCA A;  3GOX A;  1FWZ A;  3MHX A;  3OBW A;  4Q5W A;  4C92 B;  4E7H A;  2JTM A;  4C0F A;  2F69 A;  2RK1 A;  2F5K A;  4J7I A;  3G7Z A;  3CPW A;  5DM7 R;  3CCU A;  4C0G A;  4A4E A;  2KY9 A;  2RI2 A;  3OYY A;  3LLR A;  1B34 A;  4GY5 A;  4M75 G;  5GMK e;  1EIF A;  3CME A;  4ATO A;  3NTK A;  3CCV T;  3LGF A;  5LJ5 g;  3X28 B;  2WSF E;  2E1H A;  5GAO m;  2XU8 A;  1JB0 E;  1H64 1;  1OZ2 A;  3M5A A;  2CZ0 B;  4MZT A;  2V8I A;  2K3X A;  3TCJ A;  2QQA A;  4BDZ A;  4F7U F;  2H3J A;  3NFC A;  5LJ3 d;  3CXC S;  3QJ6 A;  1VQO A;  1X6O A;  4OB2 B;  1OZ3 A;  2L8D A;  4DOW A;  4A4G A;  2LQK A;  4J6X A;  3CC7 A;  2DXU A;  5CKB A;  3VV0 A;  3WVE B;  3OS5 A;  2EAY A;  1UB4 A;  2GQV A;  2RJF A;  1QVF A;  3SDZ A;  1Y71 A;  2PU9 B;  2F5T X;  2WSC E;  3O8V A;  4FSX A;  4PJO F;  2A3L A;  3JSC A;  1W2B S;  3L42 A;  2XID A;  3E1S A;  2K57 A;  2QA4 T;  2CYZ B;  3HKS A;  5GAN g;  4HCC A;  2PVO B;  4WF2 A;  4C92 F;  1NE8 A;  3TU4 K;  1NJI U;  1VQN T;  1JJ2 A;  2LQ8 A;  3S3N A;  3ME9 A;  3JCM e;  1QVG S;  3CCE A;  4M7A F;  2PQW A;  1YIJ T;  2EJG A;  2DZC A;  1DJ7 B;  1D3B B;  4OVA A;  1O75 A;  3L2U A;  5GAN d;  3DLM A;  4IUQ A;  2RHU A;  4M75 E;  4HT9 A;  3MP8 A;  5FU6 C;  4PJO A;  2CZ1 B;  2P0P A;  2CKK A;  4M77 D;  2K5I A;  4XK8 E;  2XDB A;  4JRK A;  4MZM A;  2ZGW A;  1NJI C;  2DXT A;  1W4S A;  2E70 A;  2K5F A;  3ASK A;  5D6X A;  3CCR T;  3SB2 A;  1XOV A;  4C8Q A;  3OYB A;  4M78 B;  4M7A C;  5FU7 C;  2QQB A;  2K2V A;  3P8H A;  1M90 U;  5A2Q E;  5HKC A;  3A8O B;  1VQK T;  1BI2 A;  1V29 B;  1WQW A;  2D0Q B;  2RJD A;  1BIA A;  3MEW A;  3QG1 A;  4N0A A;  2MF2 A;  3NTI A;  3I56 A;  3CMA A;  3HL8 A;  2E6Z A;  4C8Q G;  1VQO T;  4DQ2 A;  3A8G B;  3J81 E;  4QQD A;  3L2Q A;  3BDU A;  1YI2 A;  3E19 A;  2EQU A;  2P0K A;  2I2L A;  4BAC A;  3UDC A;  5DLO A;  1YHQ T;  1HK9 A;  3LYI A;  4EDU A;  5GAN 6;  4N4G A;  5HK3 A;  5GMK i;  4M7D B;  1KD1 C;  3HRT A;  3OB9 A;  1I5L A;  5J3B A;  2JNG A;  3OMG A;  2EQM A;  3M53 A;  5GMK m;  1VQM T;  1TH7 A;  2G3R A;  1KG1 A;  3MCA B;  2XDP A;  2R57 A;  2QQS A;  4MDW A;  3CCU T;  2VC8 A;  4KBM B;  5D6Y A;  2K5L A;  2E64 A;  2X4J A;  4J6W A;  4JLG A;  1K73 C;  3AHU A;  3VYG A;  3JB9 J;  4YTL A;  2EKO A;  4HT8 A;  1VQ9 A;  2X4X A;  4JS5 A;  2QXF A;  4XU3 A;  1N9R A;  3OS1 A;  1N27 A;  1BI1 A;  1VIF A;  1Y96 A;  2DD4 A;  2RD1 A;  4NOY A;  3V7C A;  2RHY A;  4PNO A;  4QVZ A;  5A0D A;  3S3O A;  2DXC A;  3MEU A;  4RG2 A;  4DOV A;  2XDD A;  1QP3 A;  4O5V A;  5GMK h;  1W2B A;  1LNX A;  5FRM A;  3VUZ A;  2HD0 A;  4EMK C;  3PMT A;  1YJ9 A;  3OYH A;  2Y4X A;  2A7Y A;  1YJW T;  1YHQ A;  3RES A;  4MZP A;  3RKX A;  3CCQ T;  3OYG A;  2X4W A;  2L5Q A;  1KQ2 A;  3L1A A;  1QVG A;  1WNL A;  4MDX A;  3LWH A;  3QO3 A;  3I56 T;  4E7K A;  3CC4 T;  3CC7 T;  4LDV A;  3PFS A;  5CVI A;  2JUF A;  2BKD N;  3MP1 A;  4JLI A;  1M1F A;  3RIR A;  3OYK A;  2KVQ G;  3OSV A;  3URG A;  4L6V 5;  4N4I A;  4BB7 A;  3CEY A;  3HHT B;  4A4H A;  5GMK l;  4M7D F;  4UC4 A;  4L59 A;  4KUL A;  2EYQ A;  1WJQ A;  3P8B B;  1NPP A;  1KC8 U;  5LJ5 j;  1VQ6 T;  4XTU A;  4BD3 A;  1BI3 A;  3EFS A;  3HRU A;  3VUB A;  2EWN A;  4Z02 A;  1U1S A;  5CKE A;  1VQ7 T;  2BUD A;  4M75 F;  2DIQ A;  3CBP A;  4LDY A;  5KCH A;  4XU0 A;  1UGP B;  3CD6 A;  1YJN T;  1UGS B;  2RM4 A;  4M7D E;  2PUK B;  2QQ9 A;  1VQ4 T;  1Y7X A;  3ZFJ A;  4O6J A;  4M7D A;  4M75 C;  1I8F A;  3VU3 C;  2JOY A;  1XNI A;  4N4H A;  5AYF A;  2RA2 A;  3CCQ A;  2CGH A;  2GFU A;  3VKI A;  3JCM f;  1S72 T;  3R6O A;  3X24 B;  3Q1J A;  5LJ3 f;  5GMK j;  4JUV A;  3QDR B;  2X35 A;  3CPW S;  1WJS A;  4M7D G;  4M75 D;  2D6F A;  4M78 D;  2KMT A;  3N5B B;  4X9D A;  3QYH B;  1K8A U;  3L2W A;  2CZ7 B;  3V8K A;  4QVD A;  1M4Z A;  4JS4 A;  4E7J A;  1UGR B;  2E41 A;  5D6W A;  3JCM Q;  4JRQ A;  3QBY A;  1BKB A;  3OSS C;  3X20 B;  3PMI A;  4IUT A;  4HKE A;  1Q81 C;  2VGN A;  3CCJ A;  4M77 B;  4MMK A;  1VQ7 A;  2QI2 A;  3BY7 A;  2M0O A;  4A4K A;  4EMK B;  1VQP T;  4BI4 A;  3CCS T;  4JRI A;  4KT0 E;  3JB9 I;  2B8A A;  3GP8 A;  4RCC A;  2AHJ B;  5I2M A;  3VJP A;  5EG2 A;  2WSE E;  3M9Q A;  4X9C A;  4M78 F;  4M77 F;  3MO8 A;  4A54 A;  1ZHI A;  1N9S A;  2HNI A;  1BIB A;  1X01 A;  3EAE A;  4C0Z A;  2DAQ A;  3RMQ A;  2DK3 A;  3OYC A;  3HSB A;  5GAN f;  3OYF A;  3DB4 A;  3OYA A;  3OYL A;  2OAU A;  2YLC A;  3JB9 D;  4QVC A;  2LDM A;  4NS5 A;  4C0D C;  2K4Y A;  1M8V A;  4M7D C;  3PNW C;  3CPF A;  2PVD B;  3FLG A;  3FDR A;  2KAF A;  1O9S A;  2CS7 A;  5DLQ E;  4ZN3 A;  1JJ2 S;  2VXE A;  4EMK A;  3DLL A;  2XD0 A;  2OTJ A;  2EJ9 A;  4QW2 A;  2DO3 A;  3MEV A;  2QDY B;  3GF5 A;  3JRZ A;  4MML A;  3CC2 T;  2HBP A;  2LX9 A;  3F70 A;  4BDY A;  4M7A E;  3L2V A;  4PL6 A;  3GLX A;  4D6W A;  2FYK A;  3CCJ T;  2M9U A;  3A5Z B;  1WPY A;  3C4S A;  3CCL A;  2EQJ A;  3CCM T;  3WXM B;  4XTY A;  5GAO q;  3I55 A;  1N6A A;  1VQ9 T;  3OYE A;  2OTL T;  2DJZ A;  3GNG A;  3LW5 E;  2QEX T;  3LH0 A;  2EQK A;  4BY6 C;  3JCM W;  5CQY A;  4Y91 A;  1YIT A;  5LJ3 e;  3G71 A;  3M59 A;  4E7I A;  4ME7 A;  4C92 C;  4A4F A;  1Q7Y U;  3A8H B;  3ZEH A;  4E47 A;  2RB6 A;  2EIF A;  2JZ2 A;  2LTO A;  4ELZ C;  5I2S A;  5FLX E;  4OB0 B;  1WGS A;  2XI9 A;  4F7U E;  1N8R U;  4NL3 A;  2XG8 D;  3PGG A;  3V7R A;  1YBY A;  1VQ4 A;  5HY6 A;  3JB9 F;  3GNF B;  3OMC A;  4C8Q E;  2QA4 A;  2QQR A;  2R58 A;  4C92 D;  4XTZ A;  3G71 T;  3QYG B;  4ZGD B;  3CXC A;  1YIT T;  1YJN A;  3M54 A;  3X25 B;  4BY6 B;  5KE2 A;  3JB9 H;  4C92 A;  2EFI A;  4RKU E;  3OYM A;  3FC3 A;  2IG0 A;  2OTL A;  2ZPE B;  1RL2 A;  4BI3 A;  3OYD A;  1M9S A;  2Y4Y A;  5LJ5 h;  3CCM A;  3HFO A;  3CBO A;  4PKC C;  5LJ3 g;  1YCY A;  2VYT A;  4C92 G;  3QII A;  3JCM b;  3ZBD A;  4M77 G;  2YHT A;  3OS2 A;  5FU7 B;  3RER A;  4QQG A;  2LVM A;  2QTX A;  1BI0 A;  1K73 U;  2LRQ A;  3A8L B;  3OYI A;  3MP6 A;  3EFR A;  5M9O A;  3C94 A;  3FRN A;  3JCM V;  1K8A C;  3ER0 A;  5KCO A;  4XTV A;  3QKJ A;  4M75 B;  4IUU A;  4PJO C;  1R8O B;  2HQX A;  2VGM A;  3SFM A;  5LJ5 d;  3M4Y A;  3CCV A;  2VXF A;  2O4X B;  4M7D D;  1Q82 U;  3PTA A;  4OGC A;  4ZN1 A;  2MMP A;  1G3S A;  1N8R C;  3CC4 A;  2RJE A;  4IUP A;  1MHN A;  3H6Z A;  3E9F A;  5CK9 A;  3LWI A;  2GFA A;  3OYJ A;  1LJO A;  4XTW A;  5GAN h;  2C06 A;  2DTO A;  4FL6 A;  2M16 A;  4M78 E;  2X4Y A;  5KH6 A;  3RKY A;  3JCM J;  3RMS A;  3CCS A;  1VQP A;  1YJW A;  4XTX A;  5IN1 A;  3J7A F;  1KQS S;  2VUB A;  2LCC A;  3JCM P;  4FIB A;  4PJO B;  4FT2 A;  3OBY A;  4OMF B;  1JBM A;  2GCX A;  2WAC A;  2FVU A;  4BI8 B;  1U1T A;  3FEO A;  3I55 T;  3CCL T;  4KUD K;  1D3B A;  3MEA A;  4LDW A;  4M78 C;  4ZTF A;  1KHI A;  5IT9 E;  1SSF A;  2LT1 A;  4XU2 A;  4R56 A;  4EMH A;  3C12 A;  5CAI A;  3OW2 S;  2L89 A;  1VQM A;  1Q86 C;  5C6S A;  2OTJ T;  4HCB A;  2CZ6 B;  2E5Q A;  5LJ3 h;  5C0M A;  1WQ7 A;  4M7A D;  2P0Q A;  1YI2 T;  3SWN A;  1PSE A;  1OYX A;  1G3W A;  1NZ9 A;  2DIG A;  2RI3 A;  5GAN 4;  2L3R A;  4L5G A;  5A0G A;  3CD6 T;  4ZGE B;  2ZPI B;  3G4S T;  4PJO E;  2E10 A;  5GAN 3;  4M77 A;  3JAM E;  2IVW A;  4C5E A;  3DB3 A;  5HK0 A;  3CMA T;  1VQ6 A;  2RK2 A;  4J5Y A;  1M90 C;  3BFM A;  3GIB A;  2V8K A;  3HRS A;  4M78 G;  3OQ5 A;  3SWN C;  3GPL A;  5CKH A;  3BDL A;  1Q81 U;  2YRV A;  4KUI A;  1KC8 C;  1VQK A;  4LD6 A;  5J26 A;  2JN0 A;  1Y07 A;  1B34 B;  3INZ A;  5GAN 2;  4ZTJ A;  2RHX A;  5A0L A;  3HP9 A;  1UEB A;  2DTI A;  4FM4 B;  2E12 A;  3KUF A;  2BIV A;  2R5A A;  2ZPH B;  5GAM j;  1FX7 A;  4OB3 B;  4LDX A;  5GAM f;  2DVE A;  2XK0 A;  2JTF A;  3CCE T;  4NL2 A;  4HA8 A;  4ZGJ B;  2LT4 A;  1M1G A;  2LNV A;  3QHS A;  1YJ9 T;  1M1K C;  4J6Y A;  2LC4 A;  2DPP B;  2Y90 A;  1ZBX A;  1YIJ A;  2D9T A;  3OS0 A;  4XU1 A;  1S72 A;  1AHJ B;  3J80 E;  5LJ5 e;  3OA6 A;  5GAO r;  2LCL A;  1NPR A;  3SD4 A;  4GLK A;  2FL7 A;  4IUV A;  3QZ5 B;  1U8R A;  2P4T A;  3QJY A;  1Y96 B;  4PJO G;  3RUX A;  4C5I A;  4VUB A;  4A53 A;  5GAM e;  2XKO C;  1GXI E;  2RJC A;  5CIU A;  1FXX A;  1OI1 A;  2E6N A;  1VUB A;  2RH2 A;  1PSF A;  4C5G A;  1VQL T;  3JB9 G;  4PLL A;  1MGQ A;  4OGE A;  3JCM c;  1JRI A;  1VQ8 A;  5KE3 A;  1XTD A;  4LDU A;  2PVG B;  3CC2 A;  1WJR A;  3QZ9 B;  3KXT A;  3QXE B;  3RKW A;  2O01 E;  4IKF A;  3FB9 A;  3M4G A;  5LJ3 j;  3TEE A;  3FJP A;  4HCZ A;  1IRE B;  4FT4 A;  3JCM X;  1Q7Y C;  2K3Y A;  4PJO D;  2ZPG B;  3CME T;  2ZPB B;  4B9X A;  4M78 A;  5GAM d;  3OY9 A;  1VQL A;  5L8R E;  4BUG A;  3BW1 A;  4XAX B;  5GAN 5;  1HXD A;  5CO7 A;  2MWO A;  2V8J A;  4C8Q B;  5I21 A;  4J83 A;  5CQX A;  5DY9 A;  3JCM g;  3LX7 A;  3T9N A;  2HAX A;  2RO0 A;  2ZPF B;  4M7A G;  2DZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...