1NZ9A

Solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
58
structure length
58
Chain Sequence
AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
publication title Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 6
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nz9A00
1JJ2S 1VQLT 1Q7YC 1XTDA 1VQ8A 3CCQA 3CXCS 1VQ9T 5J26A 1N8RC 1YI2A 3KBGA 1VQ7T 1IZ6A 1Q81C 3J81E 1VQMA 3CPWS 1M1GA 1UEBA 1YJNT 1VQLA 1W2BS 2JNGA 1VQ9A 1Q86U 2MI6A 1VQ5T 3CCLT 3CCSA 1YJWA 3DB3A 5DLQE 2QA4T 2KDSA 1VQPT 5HY6A 1YJNA 1YITT 1Q86C 1NJIU 1QVGA 3CCRT 1VQ5A 2OTLT 1BKBA 1Q7YU 3CCUT 4QQDA 3CCLA 1KHIA 3CC7A 3CCMT 1YITA 3CMAA 1Q81U 3CPFA 1YIJA 1VQOT 3CCRA 3TREA 2DO3A 1VQ6T 4ZN3A 4YTLA 3CCUA 3CCMA 3LH0A 1NPPA 2G3RA 1XNIA 1Q82C 1KD1C 1QVGS 2OTJT 1QVFA 4CRIA 1VQ7A 3ER0A 3G6ET 5IT9E 2LCLA 2JVVA 1YHQT 2CKKA 1M90U 2MWPA 2OTJA 5J3BA 2LVMA 2JOYA 1RL2A 3LGFA 5DM7R 3G6EA 2E70A 1M90C 2QA4A 1YJ9T 1VQPA 1YHQA 3G4ST 3CC2T 5FLXE 3HKSA 1S72T 5LL6S 3JAME 2E6ZA 3PIOA 1Q82U 1KD1U 1KQSA 1VQNT 2OTLA 3CCJT 1KC8C 1M1KC 1YJ9A 3A5ZB 1NZ9A 1K73C 3P8BB 3CMET 1S72A 3G71T 3OYYA 1NPRA 1VQOA 3OW2A 1VQKT 3CCJA 1VQ6A 2JUFA 3CPWA 3CCET 2KVQG 3CC4T 1X6OA 3CMEA 3J7AF 3J80E 3G71A 2L3RA 1KQSS 1YI2T 1VQKA 3CCEA 4X34A 4ZN1A 3CC4A 1K8AC 1KC8U 1M1KU 1K73U 1K9MU 3OW2S 1QVFS 2IG0A 3PIPA 4TVRA 3DLLA 3CCST 3I56T 2MWOA 1YJWT 1EIFA 1SSFA 5A2QE 2EIFA 3CCVT 1K9MC 5IAYA 3G4SA 1YBYA 1JJ2A 3CC2A 3DB4A 3CXCA 1VQNA 2XHCA 3I56A 2QEXT 3CD6T 1VQ4T 3CC7T 3CMAT 3CCVA 4RG2A 3I55T 1YIJT 1W2BA 1VQ8T 3CCQT 1K8AU 2QEXA 3CD6A 1VQ4A 1N8RU 2LQ8A 1VQMT 1NJIC 3I55A 3LGLA
chains in the Genus database with same CATH superfamily
2KNBB 2EPDA 5GMKe 3L1AA 4QVZA 1VQ7T 1X27A 3RMQA 3OBWA 3UF4A 4ESRA 5KH6A 2LRQA 5GAMf 3FEOA 4KT0E 4HCZA 5DLQE 3I9QA 1KD1R 4OMMA 3GPLA 4EMGA 3GIBA 4C0DC 2V26A 4OMPA 4MZTA 1KHIA 1ZUUA 3M4GA 3REAB 1Q81U 1T3LA 1UGSB 2SEMA 1PC0A 2YRCA 1BCMA 1VQPQ 3NFCA 4F7UF 3CQTA 2K6DA 4BI4A 4CRIA 5A0DA 1PNJA 4PFZA 4C8QA 2MWPA 4KH0B 5J3BA 2WSFE 2JOYA 2OX7A 4A54A 4OB3B 1LJOA 2LQWA 4PJOE 8AT1B 3CC2T 1VQKQ 1AWOA 4J9DA 3UDCA 4IUPA 2OI3A 3EH1A 3P8BB 2V1RA 3EGXA 1ARKA 1F1BB 3EG1A 4DA4A 1BI0A 1QVPA 2L3RA 1Y7XA 4D6WA 1KHCA 1I81A 5A0GA 1NG2A 1LCKA 3VJPA 4WF2A 1QVFS 2E5KA 4N4GA 3I56T 2L3PA 2J05A 2FRYA 2VGNA 2EIFA 2A36A 2GGRA 1W1FA 3M0QA 2LZ6B 1OOTA 3I56A 4L6V5 4Z02A 2PVOB 4JJNK 1FMWA 2FZGB 3M57A 3MO8A 2O01E 4EIKA 2G6FX 3IQLA 1JJ2S 3PFSA 5KCHA 4JUVA 1G3SA 2JTEA 2C0IA 1YITQ 1YIJQ 2RQWA 2MI6A 1OX9A 4BE2A 3TCJA 3DB3A 3EHRA 4Y91A 4X1VA 1VYUA 4M77B 4XU1A 2E3IA 2KXDA 4NL2A 1TS9A 4E47A 4JDSA 4ORZA 1U1SA 2IVWA 4FU6A 3FB9A 1VQOT 4DBHA 3QDRB 1QW1A 2OJ2A 3QSUA 1Y71A 2CREA 4LNPA 2RB6A 2KSSA 1P92A 2G3RA 2PQWA 3V8JA 2ENMA 4CC7A 1QVFA 4R0KA 5GMKi 2M02A 3GBQA 2KYBA 3QZ9B 3MEUA 2K9GA 2JTMA 2DILA 2V8JA 4MDWA 4M7AE 1WIEA 2LVMA 4PJOA 2Y4XA 4LDYA 5LJ5e 1EFNA 2M9UA 2LJ0A 3WVEB 3EG3A 2PVDB 2DD5A 4JRIA 2ABLA 2HBPA 3QDFA 5HK3A 4FM4B 1ZHIA 2ZPFB 2QGFB 2KK4A 4QQGA 1UDLA 4M75G 2HL5C 1ZQ1A 2DERA 2J6FA 3QWYA 4C8QD 2FZCB 2JS2A 2P84A 5C0MA 3META 5KYYA 4BUGA 2CS7A 1BCOA 3CD6T 1VQ4T 3CC7T 4IUUA 5GAN6 3THKA 4BB7A 3JCMe 1VQ8T 2BZ8A 1X6GA 3CD6A 1VQ4A 4XTUA 4A63B 2FZKB 4C8QF 1XTDA 3EFOB 1VQ8A 3AHUA 1VQ5Q 1YI2A 3CCLQ 1LNXA 5GMKl 4PJLA 4QT7A 1W4SA 1AWJA 3EGDB 4HT9A 5FU6C 2BE7D 4ANJA 4M7DA 1H92A 2F2XA 5KYUB 4RTYA 2HSEB 3QKJA 4FYYB 3PVLA 3CBMA 4C92G 3RKXA 3N5BB 3RIRA 3SWNA 1VQ6T 3G6EQ 2BTTA 5IXBA 3EFSA 3BFMA 5IHKA 2X4JA 4HT8A 3QHSA 1UGRB 2COWA 1K73R 1YHQT 2CKKA 4J83A 4M78D 4GBQA 4J6XA 2RK1A 2ZZDA 3O8VA 5I11A 4HCCA 1ZSZC 3H8ZA 4O5VA 1YJ9T 1YHQA 1B34B 1W70A 1FMVA 2EW3A 3SDZA 1Q82U 3JB9H 1KQSA 3P8DA 2EGEA 1YJ9A 2ESWA 5CKEA 3G71T 3VS0A 4BE0A 4M78F 2CP2A 2RF0A 2BUDA 3G71A 4E7SA 4DOWA 4FW1A 3PMTA 4JLGA 1KFZA 2D0NA 2ZPBB 4XU2A 1IXDA 1K9MU 3OW2S 1I4K1 9ATCB 3OYNA 3D7SB 3VUZA 1EIFA 2V1QA 4PJOD 4XTWA 2QEXT 3SD4A 4F14A 2R5AA 4F7UG 2HBWA 2XKOC 2PTKA 4RTVA 2QEXA 3QZ5B 3QIIA 1X01A 2LNHB 4Y92A 1VQLT 1IREB 3P8HA 2JT4A 2RPNA 4PJOF 5GANe 1OU8A 2YUNA 1YJNT 1VQLA 3VS2A 3CCUQ 4HA8A 3HPWA 3V7CA 4IKFA 1QMCA 3ZEHA 5HCKA 1YJNA 5IXFA 1X43A 4ME7A 2RHIA 3CPWP 1QVGA 3ASKA 1T0JA 2LT4A 1GL5A 4QQDA 4JRKA 1WLPB 4RMOA 4ZGDB 5DLOA 2ZAEA 3JB9D 4YTLA 2QG9B 4RUGA 2NUZA 2AHJB 4OB2B 1UECA 2DA9A 4M77C 2EQMA 2IIMA 4IUTA 1WHKA 3QXEB 3S3MA 2JXBA 3H41A 2JZ2A 1ZBXA 2BE9B 2XU8A 2LQKA 3CMEQ 1TH7A 3JB9F 4QVDA 1VQNT 3LWIA 1GXIE 5GANj 2DYIA 2FB7A 2DYBA 2YLBA 1W6XA 1K8AR 1T3SA 3RERA 5HK0A 1VYTA 2FVUA 4LDVA 3BDUA 4FYWB 1E6GA 2CP7A 5GAMj 3CC4T 1GCQC 3VU3C 2DK3A 1Z9QA 4J5YA 4XTYA 2EQJA 5LJ5d 3REBB 2RJDA 3M0TA 3CC4A 4FYVB 5LJ5f 3JCMc 3HL8A 5AYFA 4M7AD 4E7LA 2XICA 3RDVA 1NJIR 1X2KA 1OEBA 1SPKA 1ZSGA 3OS0A 5KYXA 2VXEA 3H0FA 2E6NA 4A4GA 2NWMA 5M9OA 1V1CA 1AWXA 1XOVA 3TSZA 2KT1A 5I2MA 2W10A 1WYXA 4N4IA 1YJWQ 2QYZA 4J7FA 3PGGA 5FRNA 4M7AF 3OYEA 2GTOA 1Q7YC 5GANg 2RQTA 2KRMA 2YSQA 3J81E 2ZPHB 2RH2A 1LVKA 3HHTB 4J9EA 4XQ3A 3JCMd 3CCRQ 1Q86U 3JCMf 5GAMg 1OYXA 2KMTA 1G83A 4FIBA 3C94A 4LXCA 2AIRB 4C92B 4M75D 4MZPA 5D6XA 1WNLA 3CBOA 2AKLA 1W2BP 3WXMB 1MMNA 1VOMA 4J6YA 4L59A 2VKNA 4OP0A 2KRSA 4OMLA 1BBZA 1N5ZA 1I8FA 1NE8A 3EG9A 2BIVA 5KE2A 1KC8R 2YT6A 4J9CA 2C06A 4B9XA 4M75F 1SF9A 1YWOA 1HD3A 2DXUA 4FL6A 1RL2A 2EJGA 3INZA 1M90C 1MNDA 3SB2A 2COZA 2E65A 3M5AA 5I21A 1KD1U 3RBBB 1D3BB 2HNIA 1M1KC 3QJYA 2HZYA 1KK7A 1RAAB 1M2VB 2LJ3A 4C8QG 2EYWA 3OYYA 4J9IA 3MCAB 1OPLA 2DE0X 1SHGA 1WXTA 2HEQA 4KULA 2CSIA 2O2OA 2B86A 2FRWA 3I5RA 3PE0A 2L2PA 1WPYA 1EX4A 2CP3A 2I0NA 4MMLA 2KY9A 2CDTA 1D09B 2KI7A 4K11A 4E7JA 4CI0C 4N4HA 4M77E 2WSEE 5GAMh 3H0HA 4JZ4A 4EDUA 4RTXA 3CCQQ 2O88A 4BI8B 8ATCB 3CXCA 4F7UB 1BI1A 1YCSB 4RG2A 3CCSQ 1NYFA 4MZMA 3MP8A 4R55A 1Q86R 4KH1B 4N0AA 1M3CA 4AG1C 1Y0MA 1Q81C 1WX6A 3RKWA 2RHUA 1M1GA 1UEBA 3M56A 1K0SA 2R5MA 1QKWA 1RAIB 1VQPT 3ZFJA 3R6OA 4FW2A 5FU6B 4C5GA 3HSBA 4E7HA 1RI0A 5L8RE 1MV3A 3CCMT 2ZPGB 5I22A 2CSQA 4M78G 3OYGA 1UUEA 3QJ6A 3RKYA 3JB9I 2FO0A 3CCMA 3E9GA 2AKKA 1XNIA 2K5IA 2HQXA 3QPHA 4RKUE 5GAOm 1VQ7A 3ER0A 4JPBW 3BE3A 1U3OA 3FJPA 1AWWA 1OZ3A 3CCJQ 4MMKA 4KGZB 5KYNA 2MOXA 5CKBA 3VRYA 1S72T 2MCNA 4OGCA 1ZSZB 1IGQA 4F16A 1MGQA 2DKGA 2CT3A 3M54A 4C0ZA 4EMKC 5KCOA 1S72A 3Q1JA 4GLKA 2RHYA 1WHLA 5CKDA 3OYHA 4PJOG 2RNAA 2GCXA 4OMFB 2RHXA 2J6KA 4F04B 4CC2A 4LN2A 3SFMA 4C5EA 4ZN1A 3ULRB 4CC3A 3CCVQ 2QAZA 3EAEA 2R58A 5GMKj 5I2SA 4M77A 2FEIA 2EWNA 2E41A 2HCKA 4JLIA 1EZZB 5LJ3e 5A2QE 2XD0A 3CC2A 4KGXB 4OMNA 4M75C 1ABOA 4XAXB 4XTZA 1YIJT 4X9DA 3EG0A 1GBRA 1VQ7Q 4DEYA 2K2VA 3CBPA 1YFNA 1MMAA 1D0XA 1TOVA 2DEUA 2YDLA 3X25B 5CQYA 1BB9A 1VQ9T 1M27C 1NLOC 3CPWS 2GQVA 1C0MA 2EJFA 3VKIA 3JB9G 5GJVB 4JRPA 1VQ9A 1RAGB 3UATA 1WQ7A 3BW1A 3X20B 2MF2A 5CKHA 3M4YA 4FT4A 2DETA 5CKFA 3VRZA 3AT1B 1BKBA 1C6VX 4LUDA 3QG1A 2VASA 4RTWA 1OULA 2GF7A 2P0KA 4XTXA 4ZN3A 1RACB 2DIQA 1NPPA 1UHFA 3V8KA 3JB9J 2OTJT 2DL4A 2EQIA 4C92C 1IHWA 2MMPA 3CC2Q 2F1LA 2QASA 4HVVA 2OTJA 4M7DE 3OA6A 2F2WA 4JJDA 5DM7R 3RNJA 2P4TA 2DEQA 2D8HA 5FU7C 2DMOA 5GAOn 1PRMC 4M7AG 2QTXA 1VQOA 3PVQA 2JUFA 3CPWA 3J80E 3X26B 1M3BA 5CQXA 4J9GA 3I56Q 3M53A 3EGDA 2EGCA 1GBQA 1D0ZA 1GFDA 3OYMA 4XU3A 4ZGJB 4ZNXA 5CIUA 2O9SA 1K73U 1G5VA 5KYUA 1M3AA 3NGPA 2L89A 1Z9ZA 1V76A 4OF1A 4PK4A 2ED1A 3BDLA 1JJ2A 2PUKB 3FDRA 1QCNA 2EJ9A 4CC4B 4AT1B 5GMKh 3I55T 4RTUA 3HFNA 1RABB 3GLXA 4J8OA 1N6AA 1VQMT 3I55A 5IH2A 2D8JA 3OMGA 1QP3A 2DIGA 1SG5A 4OGEA 2DRMA 2DNUA 2LP5A 2GFUA 1VQMA 2DTHA 1W2BS 2QDYB 4C0FA 3C4SA 1B34A 2RO0A 2P4RA 4ELYC 2X4WA 1IO6A 1PSEA 4C5IA 5FRMA 4LUEA 4M78B 5CO7A 3OYDA 3CC7A 4PNOA 1E7OA 5LJ5j 2RQRA 5L23A 2QQSA 1Q82C 4HCBA 4J9HA 1OU9A 5GAN7 4KRTA 1WHGA 4B6MA 3A8LB 2D9TA 2H8HA 2EYZA 2RI3A 4PJMA 1OI1A 2GBQA 3S6WA 1PG5B 3MKDA 2CYZB 2KQWA 1WGSA 2VYTA 5FROA 1XQHA 1UHCA 2C0OA 4PJOB 1VQ6A 4VUBA 3VS6A 3OBYA 5IHNA 2D0QB 2D6FA 4E7KA 3TSWA 2KEAA 2DF6A 1MMDA 2LX9A 5LJ5g 3VS5A 2DVEA 1H3HA 3PIPA 4TVRA 1VQ4Q 3CD6Q 3X24B 4C92E 4NS5A 1AT1B 3WVDB 4A53A 3OYCA 4XTVA 1D0YA 1VQ8Q 2A3LA 1X6BA 1YI2Q 2OAUA 3UT1A 1QKXA 2MPXC 3JCMQ 3CMAT 2HDAA 2L8DA 3QUIA 4RTTA 5GAN5 3PT9A 1K8AU 4HXJA 1D1BA 5LJ3d 2F2VA 1HYOA 5LJ3f 5ECAA 3KBGA 2NYSA 2E1HA 3LYIA 5GAN3 2GNCA 2MIOA 3JCMg 5HY6A 1JEGA 1NJIU 1NYGA 1VQ6Q 2R57A 2YRVA 2HSPA 3URGA 1U1TA 2DL3A 3LH0A 1YHQQ 1PWTA 1NLPC 2K5FA 1GCPA 1I5OB 2ZCFB 1X69A 4M4ZA 1YJ9Q 1K9AA 2BKDN 3NPFA 4GY5A 5LJ5h 2LCSA 7AT1B 1QQJA 2LX7A 2HQHA 1YCYA 1H8KA 5KYWB 2IPOB 3E9FA 1KIKA 2J06A 1PD1A 3G71Q 4Z88A 2K5LA 3HKSA 2E6ZA 1I0CA 4M7AB 1UTIA 2CH4A 3UA6A 4ZTJA 1DJ7B 1NPRA 3OW2A 1BI3A 4EMKB 2DPPB 2MK5A 2XIDA 2X35A 3OYIA 3NTHA 2O31A 2F69A 4X34A 2XDBA 1WA7A 4C8QC 6AT1B 1CSKA 1Y96B 3LX7A 1KC8U 3SHWA 3FC3A 2QEXQ 4C92A 3JCMh 3DLLA 1YJWT 4M7DD 2CZ1B 1M8VA 2AZSA 1SSFA 1FX7A 1D1AA 1VQNA 5C6SA 3M0UA 3EHQA 3M55A 1K0XA 1VQLQ 2K57A 4M75B 3OYBA 4IURA 4J9BA 2VWFA 4RG8A 1V29B 2RN8A 4C0GA 1YJNQ 1IGUA 3LW5E 4M7DF 1KJWA 1FMKA 3JCMW 1N8RC 4Z89A 1Q95G 2M16A 4PJJA 1I07A 2JNGA 3S3NA 2I2LA 2L5QA 1D3BA 2QA4T 2QQ9A 2L0AA 4R56A 2JMCA 3HP9A 1OX8A 3KXTA 1M2VA 2OTLT 1C1AA 1G2BA 4L5GA 1HXDA 1WJQA 3OYKA 4BDYA 1KD1C 2EKHA 2HQEA 2NUPB 2QGGA 2YLCA 2PVGB 4M78C 1R8OB 1U06A 2LCLA 1O75A 1VQNQ 2YXYA 3RR6A 3OS1A 1I5LA 2JTFA 4A4HA 4F7UA 2RD1A 4BI3A 3G4ST 4PLLA 2CUDA 5LL6S 4DBFA 4JRQA 4E2FB 4ELZC 2DXCA 5FU7B 3A5ZB 1BU1A 3CC4Q 1QWEA 2H3JA 3VS3A 1HSQA 1WDXA 1MUZA 2X9HA 1AEYA 5D6YA 4BD3A 2RJEA 3OMCA 3CEYA 3CCET 4IUVA 3J7AF 2EYYA 2DTIA 2XI9A 2H3EB 1FWZA 1OPKA 1K1ZA 3CCEA 1CKAA 2RI5A 3CCST 1NBEB 1R0BG 4PJOC 2FYKA 1KQSP 1BIAA 1QLYA 4IIMA 1SRMA 1YBYA 5IN1A 2A0FB 1M9SA 5GAOq 2EBPA 4HVUA 4LD9K 2RA2A 1VYVA 1VUBA 4DEXA 5CCAA 5GANh 4X9CA 4ATOA 1AZGB 5GAOl 3OS2A 1ACMB 3U23A 2AT1B 3A8HB 5HKCA 5FWCA 3MEVA 2MAMA 1MHNA 2AZVA 1YN8A 1JRIA 2HMAA 1JBMA 1U5SA 3A1PA 3ME9A 2BZYA 1RLQC 1HK9A 1OQKA 2YUQA 2CZ7B 1ZSZA 3UWNA 3TVTA 1GFCA 2JW4A 2ECZA 1VA7A 1KQ1A 2GTJA 2O4XB 3E1SA 2HKQB 1UJYA 4J9FA 2GQIA 1KG1A 4A4KA 5CVIA 3L42A 2DM1A 1A0NB 2LQNA 3VS4A 2NUTB 2HL3A 1M90U 1WI7A 1RADB 2FG0A 4II1A 1AVZC 3PNWC 1QVGP 1VQPA 1ZUYA 2D1XA 2FPDA 4WTOB 1N9SA 2YHTA 3SWNC 3I5SA 1VQKT 2KXCA 1ZBJA 2COYA 3GNGA 1G3TA 4Q5WA 1VQKA 5GAN8 4JS5A 1G3YA 3EFRA 1PKSA 4M7AC 3MPUB 2C0TA 1Y07A 4QW2A 4D8DA 1J3TA 1QWFA 2FPFA 4M78E 1H3ZA 2M0YA 5GAMd 4LDWA 1Q7YR 3JSCA 1ZA1B 3JCMb 2QQRA 3A8MB 3C12A 3VV0A 3FJ5A 2DXTA 2BZXA 2DZ9A 2PNIA 4PKCC 5J39A 2FPEA 1BYMA 3JCMX 4KBMB 3GOXA 3ZBDA 2DXBA 1M30A 1IZ6A 3L2VA 1WHJA 3EH2A 4Z8AA 2EGAA 2LMJA 4D8KA 3CCMQ 1H641 4BACA 4DQ2A 1YITT 4O6JA 4A4FA 4JS4A 5GAN2 1BI2A 4C5HA 1N9RA 1YITA 2L3QA 2WSCE 3CPFA 1UGPB 1YIJA 2E4HA 2KR3A 4NL3A 1AD5A 1M90R 2JS0A 4P5NA 2X4YA 2DZCA 2QK0A 3HFOA 1GCQA 2O9VA 2ZPEB 1FYNA 3TQ7P 1M1KR 3DKMA 1PHTA 1SSHA 1S72Q 1WQWA 1M4ZA 2DD4A 2ROLA 1TUCA 3I35A 1NEBA 1XJWB 1G8XA 2QTVA 5FLXE 4ZGEB 3PIOA 3A98A 1UGQB 5LJ3j 2MYSA 4E6RA 2M51A 1K73C 5AT1B 3TU4K 2CUBA 4KUDK 1N27A 3L2WA 4M7DG 2A37A 3JRZA 1RAEB 2K2MA 2KVQG 2FHDA 3H9NA 2W0ZA 3GF5A 4PFOA 3C95A 3DLMA 3JCMJ 1TWBA 4IUQA 3E19A 2M1HA 2AK5A 1ZX6A 1M8MA 4FSSA 1MNEA 2PUOB 4M78A 2DBMA 4C8QB 3OYFA 2EAYA 1WZOA 3BY7A 1Q81R 1WJSA 2DTOA 2LT1A 1PRLC 3EFOA 2VUBA 4NOYA 3MP1A 1R77A 5GAOr 1VQ9Q 2HKNA 4LE9A 2RI2A 1KQ2A 3MP6A 4GLMA 3EGXB 3JV3A 2RK2A 1GRIA 3PTAA 5J26A 5LJ3g 4JZ3A 1B3QA 3EGUA 4DBQA 4OMOA 2ZPIB 2RM4A 1WHMA 1VQ5T 3CCLT 2LJ1A 2ED0A 3CXCP 2QXFA 3T9NA 1VQ5A 3CCLA 3X28B 2OTJQ 2FL7A 4PJNA 3TREA 2VB6A 1BIBA 2EFIA 2XG8D 1X2QA 3ZL7C 4LDUA 4AFZC 2K3BA 2K3XA 4AFQC 4FT2A 2A28A 2X3XD 4M77D 3G6ET 1YNZA 2JM9A 2PU9B 2K7AA 5FW9A 1VQOQ 1K4US 2VGMA 1D1CA 3G6EA 2E70A 3OSVA 4QVCA 3FLGA 2EYQA 4ZTFA 2QQAA 1NZ9A 3OS5A 4M75E 1UE9A 2E3HA 1TTHB 4M77F 1HJDA 2PZ1A 1TUDA 1R0CB 1WXBA 1QCFA 2KGTA 2CGHA 1KQSS 1YI2T 1X75C 5LJ3h 4EMHA 3V7SA 3E2UA 2Y90A 1UB4A 4JJCA 4PLIA 3RESA 4IIOA 3RUXA 2E64A 1K8AC 1B07A 3I55Q 1K9MC 4MDXA 1RI9A 3S3OA 2J7IA 2RQUA 2XHCA 1AHJB 1QP2A 3PMIA 4BE1A 4OB0B 1VQMQ 1RUWA 1WJRA 4KUIA 1W2BA 2X3WD 3C0CA 1IRXA 2LQ8A 3KUFA 1NJIC 2E12A 3QBYA 3CC7Q 1OZ2A 5KYWA 1YP5A 1QCOA 5CR2A 3VS1A 2ROTA 4HVWA 3QO3A 3RMSA 4M7AA 1E6HA 1SHFA 4JJBA 1PCXA 4B9WA 1AZEA 3CCUT 5KYYB 3M0PA 2Y4YA 1KSWA 3CMAA 4EMKA 2SRCA 3V8LA 2DO3A 3CCUA 1ABQA 2LC4A 5GAOp 2QQBA 3L2ZA 1QVGS 1PD0A 4N0AC 3HRUA 2RQVA 2HAXA 1MV0B 1Y96A 2F5KA 1NM7A 2DRKA 2XDPA 3L2QA 3R6NA 4BY6B 2DJQA 4F17A 5GMKm 3LLRA 1M1FA 2EKOA 1PSFA 5A0LA 1ZUKA 3VUBA 3M0SA 1KC8C 4M7DB 4M75A 2YUOA 3QYHB 3CMET 2J6OA 2RJFA 4FSXA 4HCKA 2ZGWA 1X6OA 2CP6A 3CMEA 1JXOA 3SWNB 2E5QA 4AG2C 5CK9A 1TXQA 4AFUC 5EC7A 1U8RA 1NEGA 1K76A 1Y57A 2P0QA 2YRDA 4F7UE 1VIEA 3OSSC 2P0PA 4J7IA 2MWOA 3UA7A 2DAQA 3CMAQ 2GFAA 3V7RA 2DLPA 2DL8A 1O9SA 1VIFA 3DB4A 3HTRA 2B8AA 1WFWA 2VVKA 5KE3A 1QVFP 2DBKA 5GAMe 1IHVA 5D7UA 2NUPA 1UJ0A 4FCYA 3MJXA 1SRLA 2WACA 3LGLA 4C0DB 4Y28E 4DOVA 2K79A 3LH5A 3A8GB 2M0OA 1JJ2P 1YJWA 2DJZA 2HD0A 2VXFA 2KT8A 1Q82R 1Q86C 2XMFA 4DBRA 3CCRT 1AOJA 4LDXA 4RCCA 5GAN4 2LNVA 3CCRA 1UFFA 1LOJA 4RTZA 1ZA2B 1RLPC 1UG1A 4WCIA 1ZLMA 4V2SA 2E10A 1TG0A 3TEEA 1K9MR 3L2UA 3OYJA 2XK0A 2X51A 3LGFA 5EG2A 2QA4A 4RCBA 2K4YA 3M59A 3VYHB 2OTLA 3M0RA 4OVAA 5IHIA 2CZ0B 3EG2A 1I1JA 3SEMA 3HRTA 3JCMP 1RAFB 4XK8E 3QWXX 4PFPA 3G7ZA 4J6WA 1TSFA 2L3SA 4AFSC 2CP0A 1PM3A 1T0HA 1WHHA 2CP5A 2LCCA 3M9QA 1JU5C 2V8KA 4LD6A 1OV3A 3F70A 3G4SA 3JCMV 1M5Q1 3H6ZA 2O4XA 2CT4A 2RMOA 3MEAA 3UPUA 1RAHB 3M58A 2K3YA 3NTKA 3CCQT 1S1NA 1N8RU 2OAWA 5CAIA 2LDMA 5GJWB 2NUTA 4E7IA 2KBTA 2DL7A 3CCQA 3CXCS 1JQQA 3A8OB 2RHZA 3OB9A 4PL6A 2QA4Q 3MEWA 4E7ZA 5D6WA 1B7TA 3MHXA 5FWBA 4EPCA 2OTLQ 1WXUA 2EQKA 1IB8A 4FYXB 3GNFB 2F5TX 3CCSA 2ATCB 2DX1A 2KDSA 4OMQA 5DY9A 3OYAA 1JB0E 1Q7YU 4M77G 2Z0WA 4QQ6A 1TUGB 5KYXB 2VC8A 2QDLA 2DFUA 2KROA 3HRSA 2KAFA 3GP8A 1UGVA 3NHNA 1TU0B 3O5ZA 4KGVB 4XU0A 1M2OA 5IT9E 1SKUB 2JVVA 3VS7A 4C92D 3OY9A 3G4SQ 4BDZA 1SEMA 4QKUA 2A7YA 4C8QE 2JJ9A 3G1JA 2EYXA 2V8IA 2CH4W 2XDDA 3KFVA 2DVJA 3JAME 3CCJT 3CCEQ 2A08A 1YWPA 1LPLA 4AMCA 3L2RA 4HKEA 3LWHA 2EQUA 2YUPA 2KYMA 3NTIA 4BY6C 1CKBA 3FIFA 3CCJA 2CZ6B 4C92F 1JO8A 4OB1B 2YWWA 2KE9A 2DL5A 3EG9B 3FRNA 2LTOA 1G3WA 4A4EA 1M1KU 3OQ5A 4M7DC 1JXMA 2IG0A 1BK2A 2RJCA 3H0IA 2JMAA 3CCVT 5IAYA 3NMZC 1N8RR 2EVRA 2VV5A 3OW2P 4UC4A 1FXXA 1PKTA 3CCVA 1MMGA 2JM8A 3VYGA 2X4XA 2KRNA 5GANd 2JN0A 3QYGB 2NLUA 3OYLA 2QI2A 5GANf
chains in the Genus database with same CATH topology
5GMKe 1Q7YC 5GANg 3PTAA 3L1AA 5J26A 4QVZA 5LJ3f 3KBGA 5LJ3g 1VQ7T 2E1HA 3LYIA 3J81E 2ZPHB 2RH2A 3RMQA 3HHTB 4XQ3A 3JCMd 5GAN3 2ZPIB 3OBWA 2RM4A 5KH6A 1Q86U 3JCMf 2LRQA 1VQ5T 3JCMg 5GAMf 3CCLT 3FEOA 4KT0E 4HCZA 1OYXA 2KMTA 5DLQE 5GAMg 5HY6A 2QXFA 4FIBA 3C94A 3GPLA 4C92B 1NJIU 4M75D 4MZPA 5D6XA 1WNLA 3T9NA 3CBOA 4EMGA 1VQ5A 2R57A 3GIBA 3CCLA 4C0DC 3WXMB 4MZTA 1KHIA 2YRVA 3M4GA 3X28B 1Q81U 1UGSB 2FL7A 4J6YA 4L59A 3URGA 3TREA 1U1TA 1BIBA 2EFIA 2XG8D 4OP0A 4LDUA 3LH0A 3NFCA 2K5FA 1NE8A 1I8FA 4F7UF 2K3XA 2ZCFB 2BIVA 4FT2A 4BI4A 5KE2A 4CRIA 4M77D 3G6ET 2C06A 4B9XA 4M75F 5A0DA 2BKDN 4GY5A 4C8QA 5LJ5h 2MWPA 2PU9B 2DXUA 5J3BA 2WSFE 2JOYA 4A54A 4FL6A 4OB3B 1YCYA 1RL2A 2EJGA 2VGMA 3INZA 1LJOA 3E9FA 3G6EA 2E70A 1M90C 3SB2A 3OSVA 4PJOE 3CC2T 2K5LA 2E65A 3HKSA 3M5AA 4QVCA 5I21A 2E6ZA 3FLGA 2EYQA 4ZTFA 1D3BB 1KD1U 2QQAA 4M7AB 3UDCA 2HNIA 5FRNA 4M7AF 4IUPA 1M1KC 3QJYA 1NZ9A 3P8BB 3OS5A 4M75E 4ZTJA 4C8QG 1DJ7B 3OYYA 1NPRA 3MCAB 4M77F 1BI3A 3OW2A 4DA4A 1BI0A 4KULA 4EMKB 2DPPB 1QVPA 2XIDA 2X35A 3OYIA 2L3RA 1Y7XA 2CGHA 4D6WA 1KQSS 1YI2T 1KHCA 1I81A 1X75C 3NTHA 5LJ3h 5A0GA 1WPYA 2F69A 4EMHA 3V7SA 4X34A 2XDBA 2Y90A 1UB4A 4MMLA 2KY9A 4PLIA 3RESA 3RUXA 2E64A 4C8QC 1K8AC 1KC8U 1Y96B 3LX7A 3VJPA 4WF2A 1QVFS 3FC3A 4E7JA 4C92A 3JCMh 4CI0C 4N4HA 4M77E 4N4GA 3I56T 2CZ1B 2WSEE 5GAMh 3DLLA 1YJWT 1M8VA 1SSFA 2VGNA 1FX7A 2EIFA 4EDUA 1K9MC 4MDXA 4BI8B 3S3OA 3CXCA 1VQNA 2XHCA 1AHJB 1QP2A 3PMIA 4F7UB 3I56A 4OB0B 5C6SA 3M55A 4BE1A 1BI1A 4L6V5 2PVOB 4Z02A 4JJNK 1WJRA 4RG2A 2K57A 4KUIA 1W2BA 3M57A 4M75B 4IURA 3OYBA 3MO8A 4RG8A 1V29B 2LQ8A 4C0GA 3KUFA 4MZMA 1NJIC 2O01E 3MP8A 2E12A 3LW5E 4R55A 1JJ2S 4M7DF 3PFSA 5KCHA 4N0AA 3JCMW 4JUVA 3QBYA 1N8RC 1G3SA 1Q81C 1OZ2A 2M16A 2RHUA 3RKWA 1M1GA 1UEBA 3M56A 2R5MA 2JNGA 2MI6A 2I2LA 5CR2A 3S3NA 2L5QA 4BE2A 3RMSA 3DB3A 3QO3A 1D3BA 3TCJA 4Y91A 2QQ9A 2QA4T 1VQPT 4M7AA 3ZFJA 4XU1A 4M77B 3R6OA 4R56A 5FU6B 4C5GA 3HSBA 4NL2A 4E7HA 3HP9A 1RI0A 4B9WA 3KXTA 2OTLT 5L8RE 4M7DD 3CCUT 4L5GA 3CCMT 2ZPGB 2Y4YA 4M78G 3CMAA 4E47A 3OYGA 4JDSA 1U1SA 2IVWA 3QJ6A 3FB9A 4FU6A 3RKYA 3V8LA 4EMKA 1VQOT 3QDRB 1HXDA 1WJQA 1QW1A 2DO3A 3JB9I 3OYKA 3CCUA 1Y71A 3QSUA 3CCMA 3E9GA 2RB6A 2KSSA 1P92A 2G3RA 2LC4A 2PQWA 2QQBA 3V8JA 1XNIA 5GAOp 2HQEA 3L2ZA 1KD1C 1BYMA 1QVGS 2K5IA 2HQXA 2PVGB 2YLCA 4N0AC 1QVFA 3HRUA 2HAXA 1Y96A 2F5KA 5GMKi 2XDPA 3QPHA 4RKUE 5GAOm 3L2QA 1VQ7A 3QZ9B 3ER0A 4M78C 1R8OB 3MEUA 4BY6B 2LCLA 2JTMA 4MDWA 2V8JA 1O75A 3FJPA 4M7AE 2LVMA 1OZ3A 5GMKm 4MMKA 3OS1A 1I5LA 2JTFA 4PJOA 4A4HA 2Y4XA 3LLRA 4LDYA 4F7UA 1M1FA 2EKOA 2RD1A 4BI3A 5CKBA 1PSFA 5A0LA 3G4ST 1S72T 4PLLA 3VUBA 5LL6S 4JRQA 4OGCA 4ELZC 5LJ5e 2DXCA 5FU7B 1MGQA 1KC8C 2DKGA 3A5ZB 4M75A 4M7DB 2H3JA 3M54A 3QYHB 4C0ZA 3CMET 2M9UA 4EMKC 5KCOA 1S72A 3WVEB 2RJFA 4JRIA 2PVDB 2DD5A 3Q1JA 2RJEA 4FSXA 4GLKA 2RHYA 5D6YA 3OMCA 3CEYA 5CKDA 2HBPA 3OYHA 4IUVA 4PJOG 2ZGWA 3CCET 5HK3A 1X6OA 4FM4B 3CMEA 3SWNB 3J7AF 1ZHIA 2E5QA 2GCXA 4OMFB 2ZPFB 5CK9A 2KK4A 2RHXA 2DTIA 2XI9A 4QQGA 1FWZA 3CCEA 3SFMA 4C5EA 4ZN1A 1U8RA 4M75G 2P0QA 3EAEA 2R58A 5GMKj 1ZQ1A 5I2SA 4M77A 4F7UE 1VIEA 3OSSC 4C8QD 2P0PA 4J7IA 2RI5A 2EWNA 3CCST 2E41A 2MWOA 2DAQA 4PJOC 2GFAA 2FYKA 4JLIA 5C0MA 5LJ3e 3META 3V7RA 5A2QE 2XD0A 1BIAA 4BUGA 2CS7A 1O9SA 1YBYA 3CC2A 1VIFA 3DB4A 5IN1A 1M9SA 2B8AA 5GAOq 1VQ4T 3CC7T 4IUUA 5GAN6 4M75C 4BB7A 5KE3A 3JCMe 3CD6T 4XAXB 4LD9K 2RA2A 4XTZA 5GAMe 1YIJT 4X9DA 1VQ8T 1VUBA 5CCAA 5GANh 4ATOA 4X9CA 3CD6A 1VQ4A 2K2VA 3CBPA 5GAOl 4XTUA 3OS2A 3X25B 2WACA 4C8QF 3LGLA 3A8HB 4C0DB 1XTDA 5HKCA 1VQ8A 3AHUA 5CQYA 4Y28E 1VQ9T 1YI2A 3MEVA 2MAMA 4DOVA 1MHNA 1LNXA 5GMKl 1JRIA 3CPWS 2GQVA 2EJFA 1W4SA 1JBMA 3A8GB 3VKIA 3OYEA 3JB9G 4JRPA 1VQ9A 3ME9A 4HT9A 5FU6C 1HK9A 2M0OA 2CZ7B 1YJWA 2DJZA 1WQ7A 2HD0A 2VXFA 3BW1A 3UWNA 3X20B 2MF2A 4M7DA 5CKHA 3M4YA 1Q86C 4FT4A 5CKFA 3QKJA 3CCRT 1BKBA 3QG1A 3CBMA 4LDXA 2GF7A 4RCCA 4C92G 3RKXA 5GAN4 3N5BB 2P0KA 3RIRA 2LNVA 3CCRA 3SWNA 4XTXA 1KQ1A 4ZN3A 1VQ6T 2O4XB 1LOJA 2DIQA 1NPPA 3E1SA 3V8KA 3JB9J 1KG1A 3EFSA 4BD3A 4A4KA 2OTJT 3BFMA 5CVIA 4V2SA 2E10A 3L42A 2X4JA 4HT8A 3QHSA 1UGRB 3TEEA 4C92C 3L2UA 2MMPA 3OYJA 1YHQT 2CKKA 1M90U 4J83A 4M78D 2XK0A 4J6XA 2OTJA 4II1A 2RK1A 2ZZDA 3O8VA 3PNWC 4M7DE 3OA6A 4HCCA 3LGFA 5DM7R 5EG2A 2P4TA 2DEQA 3H8ZA 4O5VA 4RCBA 2QA4A 1VQPA 1B34B 2K4YA 5FU7C 1YJ9T 1YHQA 3M59A 3SDZA 5GAOn 1Q82U 3JB9H 1KQSA 3P8DA 3VYHB 2OTLA 4OVAA 1N9SA 1YJ9A 2YHTA 2CZ0B 4M7AG 2QTXA 5CKEA 3G71T 3SWNC 3HRTA 1VQOA 3JCMP 1VQKT 2JUFA 4XK8E 4BE0A 4M78F 3CPWA 3GNGA 3J80E 2BUDA 3X26B 5CQXA 1G3TA 4Q5WA 3G71A 4DOWA 1VQKA 5GAN8 3G7ZA 3M53A 4JS5A 1G3YA 3PMTA 4J6WA 4JLGA 3EFRA 4M7AC 3OYMA 4XU3A 2ZPBB 4ZGJB 4XU2A 5CIUA 4QW2A 1Y07A 1K73U 3OW2S 1K9MU 1I4K1 1G5VA 3OYNA 2LCCA 2L89A 3M9QA 3VUZA 1EIFA 2V8KA 4M78E 4LD6A 5GAMd 1H3ZA 4BDYA 4LDWA 4PJOD 3F70A 4OF1A 3JSCA 3G4SA 3BDLA 3JCMb 2QQRA 1JJ2A 2PUKB 3A8MB 4XTWA 2QEXT 3FDRA 3C12A 2EJ9A 3SD4A 3JCMV 1M5Q1 3H6ZA 3VV0A 2O4XA 5GMKh 3MEAA 3UPUA 2R5AA 2DXTA 3M58A 3I55T 2DZ9A 4F7UG 2XKOC 2K3YA 3HFNA 3NTKA 4PKCC 3CCQT 2QEXA 1N8RU 5J39A 3GLXA 3QZ5B 4J8OA 5CAIA 1N6AA 1VQMT 3QIIA 2LDMA 1X01A 3I55A 3JCMX 1Q7YU 3OMGA 4E7IA 1IREB 1QP3A 4KBMB 2DIGA 1VQLT 4OGEA 3CCQA 3CXCS 3ZBDA 2DXBA 3GOXA 3A8OB 2GFUA 3P8HA 2RHZA 1IZ6A 3OB9A 4PL6A 4PJOF 5GANe 3L2VA 3MEWA 1VQMA 1YJNT 5D6WA 3MHXA 2DTHA 1VQLA 1W2BS 2QDYB 4C0FA 4EPCA 3C4SA 1B34A 2RO0A 2EQKA 3GNFB 4HA8A 3HPWA 2F5TX 2X4WA 3V7CA 4ELYC 3CCSA 4IKFA 1H641 2KDSA 3ZEHA 1PSEA 4DQ2A 4BACA 1YITT 5DY9A 1YJNA 3OYAA 1JB0E 4O6JA 4ME7A 4C5IA 5LJ3d 5FRMA 2RHIA 1QVGA 4M78B 3ASKA 4A4FA 2LT4A 4JS4A 4QQDA 4M77G 4JRKA 5CO7A 5GAN2 1BI2A 4C5HA 1N9RA 3OYDA 4PNOA 4RMOA 4QQ6A 3CC7A 1YITA 2WSCE 4ZGDB 3CPFA 2VC8A 1UGPB 5DLOA 1YIJA 5LJ5j 4NL3A 3HRSA 4YTLA 3JB9D 2KAFA 3GP8A 4P5NA 2X4YA 2DZCA 2QQSA 1Q82C 3HFOA 4HCBA 2AHJB 2ZPEB 4OB2B 4XU0A 4M77C 2EQMA 4IUTA 5GAN7 3DKMA 5IT9E 3QXEB 2JVVA 3OY9A 4C92D 3S3MA 4BDZA 3A8LB 1WQWA 2A7YA 2D9TA 2JZ2A 1M4ZA 4C8QE 2DD4A 1ZBXA 2RI3A 2XU8A 1OI1A 2LQKA 1TH7A 2V8IA 3S6WA 3JB9F 2XDDA 5FLXE 4ZGEB 4QVDA 3JAME 3PIOA 1VQNT 2CYZB 3LWIA 3CCJT 5GANj 1GXIE 2FB7A 2KQWA 1UGQB 2YLBA 5LJ3j 1K73C 3L2RA 1WGSA 2VYTA 2EQUA 4HKEA 5FROA 1XQHA 3LWHA 3TU4K 4KUDK 3RERA 3NTIA 4PJOB 4BY6C 1N27A 5HK0A 3FIFA 3L2WA 4M7DG 3CCJA 1VQ6A 2CZ6B 3JRZA 2FVUA 4VUBA 4C92F 4LDVA 4OB1B 3BDUA 2KVQG 2FHDA 3OBYA 3CC4T 2D0QB 5GAMj 2D6FA 3GF5A 3VU3C 2DK3A 4J5YA 4XTYA 4E7KA 2EQJA 5LJ5d 3FRNA 2RJDA 3C95A 3DLMA 3JCMJ 2LTOA 1G3WA 2LX9A 4A4EA 4IUQA 5LJ5f 3E19A 3CC4A 5LJ5g 3JCMc 2M1HA 3HL8A 3OQ5A 5AYFA 2DVEA 1M1KU 4M7DC 4M7AD 4E7LA 2IG0A 3PIPA 2PUOB 4TVRA 4M78A 2RJCA 2XICA 3X24B 4C92E 4NS5A 4C8QB 3WVDB 4A53A 3OYCA 3OYFA 3CCVT 5IAYA 4XTVA 3OS0A 2EAYA 2A3LA 3BY7A 2OAUA 3UT1A 2VXEA 1WJSA 2DTOA 2LT1A 2E6NA 2VUBA 2VV5A 3MP1A 4NOYA 4A4GA 5M9OA 4UC4A 1FXXA 3JCMQ 3CMAT 3CCVA 5GAOr 1XOVA 2L8DA 3QUIA 3VYGA 5I2MA 5GAN5 2X4XA 3PT9A 1K8AU 2RI2A 4N4IA 5GANd 2JN0A 3QYGB 1KQ2A 2NLUA 3MP6A 3OYLA 2QI2A 4J7FA 3PGGA 2RK2A 5GANf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 S;  1VQL T;  1Q7Y C;  1XTD A;  1VQ8 A;  3CCQ A;  3CXC S;  1VQ9 T;  5J26 A;  1N8R C;  1YI2 A;  3KBG A;  1VQ7 T;  1IZ6 A;  1Q81 C;  3J81 E;  1VQM A;  3CPW S;  1M1G A;  1UEB A;  1YJN T;  1VQL A;  1W2B S;  2JNG A;  1VQ9 A;  1Q86 U;  2MI6 A;  1VQ5 T;  3CCL T;  3CCS A;  1YJW A;  3DB3 A;  5DLQ E;  2QA4 T;  2KDS A;  1VQP T;  5HY6 A;  1YJN A;  1YIT T;  1Q86 C;  1NJI U;  1QVG A;  3CCR T;  1VQ5 A;  2OTL T;  1BKB A;  1Q7Y U;  3CCU T;  4QQD A;  3CCL A;  1KHI A;  3CC7 A;  3CCM T;  1YIT A;  3CMA A;  1Q81 U;  3CPF A;  1YIJ A;  1VQO T;  3CCR A;  3TRE A;  2DO3 A;  1VQ6 T;  4ZN3 A;  4YTL A;  3CCU A;  3CCM A;  3LH0 A;  1NPP A;  2G3R A;  1XNI A;  1Q82 C;  1KD1 C;  1QVG S;  2OTJ T;  1QVF A;  4CRI A;  1VQ7 A;  3ER0 A;  3G6E T;  5IT9 E;  2LCL A;  2JVV A;  1YHQ T;  2CKK A;  1M90 U;  2MWP A;  2OTJ A;  5J3B A;  2LVM A;  2JOY A;  1RL2 A;  3LGF A;  5DM7 R;  3G6E A;  2E70 A;  1M90 C;  2QA4 A;  1YJ9 T;  1VQP A;  1YHQ A;  3G4S T;  3CC2 T;  5FLX E;  3HKS A;  1S72 T;  5LL6 S;  3JAM E;  2E6Z A;  3PIO A;  1Q82 U;  1KD1 U;  1KQS A;  1VQN T;  2OTL A;  3CCJ T;  1KC8 C;  1M1K C;  1YJ9 A;  3A5Z B;  1NZ9 A;  1K73 C;  3P8B B;  3CME T;  1S72 A;  3G71 T;  3OYY A;  1NPR A;  1VQO A;  3OW2 A;  1VQK T;  3CCJ A;  1VQ6 A;  2JUF A;  3CPW A;  3CCE T;  2KVQ G;  3CC4 T;  1X6O A;  3CME A;  3J7A F;  3J80 E;  3G71 A;  2L3R A;  1KQS S;  1YI2 T;  1VQK A;  3CCE A;  4X34 A;  4ZN1 A;  3CC4 A;  1K8A C;  1KC8 U;  1M1K U;  1K73 U;  1K9M U;  3OW2 S;  1QVF S;  2IG0 A;  3PIP A;  4TVR A;  3DLL A;  3CCS T;  3I56 T;  2MWO A;  1YJW T;  1EIF A;  1SSF A;  5A2Q E;  2EIF A;  3CCV T;  1K9M C;  5IAY A;  3G4S A;  1YBY A;  1JJ2 A;  3CC2 A;  3DB4 A;  3CXC A;  1VQN A;  2XHC A;  3I56 A;  2QEX T;  3CD6 T;  1VQ4 T;  3CC7 T;  3CMA T;  3CCV A;  4RG2 A;  3I55 T;  1YIJ T;  1W2B A;  1VQ8 T;  3CCQ T;  1K8A U;  2QEX A;  3CD6 A;  1VQ4 A;  1N8R U;  2LQ8 A;  1VQM T;  1NJI C;  3I55 A;  3LGL A; 
#chains in the Genus database with same CATH topology
 2KNB B;  2EPD A;  5GMK e;  3L1A A;  4QVZ A;  1VQ7 T;  1X27 A;  3RMQ A;  3OBW A;  3UF4 A;  4ESR A;  5KH6 A;  2LRQ A;  5GAM f;  3FEO A;  4KT0 E;  4HCZ A;  5DLQ E;  3I9Q A;  1KD1 R;  4OMM A;  3GPL A;  4EMG A;  3GIB A;  4C0D C;  2V26 A;  4OMP A;  4MZT A;  1KHI A;  1ZUU A;  3M4G A;  3REA B;  1Q81 U;  1T3L A;  1UGS B;  2SEM A;  1PC0 A;  2YRC A;  1BCM A;  1VQP Q;  3NFC A;  4F7U F;  3CQT A;  2K6D A;  4BI4 A;  4CRI A;  5A0D A;  1PNJ A;  4PFZ A;  4C8Q A;  2MWP A;  4KH0 B;  5J3B A;  2WSF E;  2JOY A;  2OX7 A;  4A54 A;  4OB3 B;  1LJO A;  2LQW A;  4PJO E;  8AT1 B;  3CC2 T;  1VQK Q;  1AWO A;  4J9D A;  3UDC A;  4IUP A;  2OI3 A;  3EH1 A;  3P8B B;  2V1R A;  3EGX A;  1ARK A;  1F1B B;  3EG1 A;  4DA4 A;  1BI0 A;  1QVP A;  2L3R A;  1Y7X A;  4D6W A;  1KHC A;  1I81 A;  5A0G A;  1NG2 A;  1LCK A;  3VJP A;  4WF2 A;  1QVF S;  2E5K A;  4N4G A;  3I56 T;  2L3P A;  2J05 A;  2FRY A;  2VGN A;  2EIF A;  2A36 A;  2GGR A;  1W1F A;  3M0Q A;  2LZ6 B;  1OOT A;  3I56 A;  4L6V 5;  4Z02 A;  2PVO B;  4JJN K;  1FMW A;  2FZG B;  3M57 A;  3MO8 A;  2O01 E;  4EIK A;  2G6F X;  3IQL A;  1JJ2 S;  3PFS A;  5KCH A;  4JUV A;  1G3S A;  2JTE A;  2C0I A;  1YIT Q;  1YIJ Q;  2RQW A;  2MI6 A;  1OX9 A;  4BE2 A;  3TCJ A;  3DB3 A;  3EHR A;  4Y91 A;  4X1V A;  1VYU A;  4M77 B;  4XU1 A;  2E3I A;  2KXD A;  4NL2 A;  1TS9 A;  4E47 A;  4JDS A;  4ORZ A;  1U1S A;  2IVW A;  4FU6 A;  3FB9 A;  1VQO T;  4DBH A;  3QDR B;  1QW1 A;  2OJ2 A;  3QSU A;  1Y71 A;  2CRE A;  4LNP A;  2RB6 A;  2KSS A;  1P92 A;  2G3R A;  2PQW A;  3V8J A;  2ENM A;  4CC7 A;  1QVF A;  4R0K A;  5GMK i;  2M02 A;  3GBQ A;  2KYB A;  3QZ9 B;  3MEU A;  2K9G A;  2JTM A;  2DIL A;  2V8J A;  4MDW A;  4M7A E;  1WIE A;  2LVM A;  4PJO A;  2Y4X A;  4LDY A;  5LJ5 e;  1EFN A;  2M9U A;  2LJ0 A;  3WVE B;  3EG3 A;  2PVD B;  2DD5 A;  4JRI A;  2ABL A;  2HBP A;  3QDF A;  5HK3 A;  4FM4 B;  1ZHI A;  2ZPF B;  2QGF B;  2KK4 A;  4QQG A;  1UDL A;  4M75 G;  2HL5 C;  1ZQ1 A;  2DER A;  2J6F A;  3QWY A;  4C8Q D;  2FZC B;  2JS2 A;  2P84 A;  5C0M A;  3MET A;  5KYY A;  4BUG A;  2CS7 A;  1BCO A;  3CD6 T;  1VQ4 T;  3CC7 T;  4IUU A;  5GAN 6;  3THK A;  4BB7 A;  3JCM e;  1VQ8 T;  2BZ8 A;  1X6G A;  3CD6 A;  1VQ4 A;  4XTU A;  4A63 B;  2FZK B;  4C8Q F;  1XTD A;  3EFO B;  1VQ8 A;  3AHU A;  1VQ5 Q;  1YI2 A;  3CCL Q;  1LNX A;  5GMK l;  4PJL A;  4QT7 A;  1W4S A;  1AWJ A;  3EGD B;  4HT9 A;  5FU6 C;  2BE7 D;  4ANJ A;  4M7D A;  1H92 A;  2F2X A;  5KYU B;  4RTY A;  2HSE B;  3QKJ A;  4FYY B;  3PVL A;  3CBM A;  4C92 G;  3RKX A;  3N5B B;  3RIR A;  3SWN A;  1VQ6 T;  3G6E Q;  2BTT A;  5IXB A;  3EFS A;  3BFM A;  5IHK A;  2X4J A;  4HT8 A;  3QHS A;  1UGR B;  2COW A;  1K73 R;  1YHQ T;  2CKK A;  4J83 A;  4M78 D;  4GBQ A;  4J6X A;  2RK1 A;  2ZZD A;  3O8V A;  5I11 A;  4HCC A;  1ZSZ C;  3H8Z A;  4O5V A;  1YJ9 T;  1YHQ A;  1B34 B;  1W70 A;  1FMV A;  2EW3 A;  3SDZ A;  1Q82 U;  3JB9 H;  1KQS A;  3P8D A;  2EGE A;  1YJ9 A;  2ESW A;  5CKE A;  3G71 T;  3VS0 A;  4BE0 A;  4M78 F;  2CP2 A;  2RF0 A;  2BUD A;  3G71 A;  4E7S A;  4DOW A;  4FW1 A;  3PMT A;  4JLG A;  1KFZ A;  2D0N A;  2ZPB B;  4XU2 A;  1IXD A;  1K9M U;  3OW2 S;  1I4K 1;  9ATC B;  3OYN A;  3D7S B;  3VUZ A;  1EIF A;  2V1Q A;  4PJO D;  4XTW A;  2QEX T;  3SD4 A;  4F14 A;  2R5A A;  4F7U G;  2HBW A;  2XKO C;  2PTK A;  4RTV A;  2QEX A;  3QZ5 B;  3QII A;  1X01 A;  2LNH B;  4Y92 A;  1VQL T;  1IRE B;  3P8H A;  2JT4 A;  2RPN A;  4PJO F;  5GAN e;  1OU8 A;  2YUN A;  1YJN T;  1VQL A;  3VS2 A;  3CCU Q;  4HA8 A;  3HPW A;  3V7C A;  4IKF A;  1QMC A;  3ZEH A;  5HCK A;  1YJN A;  5IXF A;  1X43 A;  4ME7 A;  2RHI A;  3CPW P;  1QVG A;  3ASK A;  1T0J A;  2LT4 A;  1GL5 A;  4QQD A;  4JRK A;  1WLP B;  4RMO A;  4ZGD B;  5DLO A;  2ZAE A;  3JB9 D;  4YTL A;  2QG9 B;  4RUG A;  2NUZ A;  2AHJ B;  4OB2 B;  1UEC A;  2DA9 A;  4M77 C;  2EQM A;  2IIM A;  4IUT A;  1WHK A;  3QXE B;  3S3M A;  2JXB A;  3H41 A;  2JZ2 A;  1ZBX A;  2BE9 B;  2XU8 A;  2LQK A;  3CME Q;  1TH7 A;  3JB9 F;  4QVD A;  1VQN T;  3LWI A;  1GXI E;  5GAN j;  2DYI A;  2FB7 A;  2DYB A;  2YLB A;  1W6X A;  1K8A R;  1T3S A;  3RER A;  5HK0 A;  1VYT A;  2FVU A;  4LDV A;  3BDU A;  4FYW B;  1E6G A;  2CP7 A;  5GAM j;  3CC4 T;  1GCQ C;  3VU3 C;  2DK3 A;  1Z9Q A;  4J5Y A;  4XTY A;  2EQJ A;  5LJ5 d;  3REB B;  2RJD A;  3M0T A;  3CC4 A;  4FYV B;  5LJ5 f;  3JCM c;  3HL8 A;  5AYF A;  4M7A D;  4E7L A;  2XIC A;  3RDV A;  1NJI R;  1X2K A;  1OEB A;  1SPK A;  1ZSG A;  3OS0 A;  5KYX A;  2VXE A;  3H0F A;  2E6N A;  4A4G A;  2NWM A;  5M9O A;  1V1C A;  1AWX A;  1XOV A;  3TSZ A;  2KT1 A;  5I2M A;  2W10 A;  1WYX A;  4N4I A;  1YJW Q;  2QYZ A;  4J7F A;  3PGG A;  5FRN A;  4M7A F;  3OYE A;  2GTO A;  1Q7Y C;  5GAN g;  2RQT A;  2KRM A;  2YSQ A;  3J81 E;  2ZPH B;  2RH2 A;  1LVK A;  3HHT B;  4J9E A;  4XQ3 A;  3JCM d;  3CCR Q;  1Q86 U;  3JCM f;  5GAM g;  1OYX A;  2KMT A;  1G83 A;  4FIB A;  3C94 A;  4LXC A;  2AIR B;  4C92 B;  4M75 D;  4MZP A;  5D6X A;  1WNL A;  3CBO A;  2AKL A;  1W2B P;  3WXM B;  1MMN A;  1VOM A;  4J6Y A;  4L59 A;  2VKN A;  4OP0 A;  2KRS A;  4OML A;  1BBZ A;  1N5Z A;  1I8F A;  1NE8 A;  3EG9 A;  2BIV A;  5KE2 A;  1KC8 R;  2YT6 A;  4J9C A;  2C06 A;  4B9X A;  4M75 F;  1SF9 A;  1YWO A;  1HD3 A;  2DXU A;  4FL6 A;  1RL2 A;  2EJG A;  3INZ A;  1M90 C;  1MND A;  3SB2 A;  2COZ A;  2E65 A;  3M5A A;  5I21 A;  1KD1 U;  3RBB B;  1D3B B;  2HNI A;  1M1K C;  3QJY A;  2HZY A;  1KK7 A;  1RAA B;  1M2V B;  2LJ3 A;  4C8Q G;  2EYW A;  3OYY A;  4J9I A;  3MCA B;  1OPL A;  2DE0 X;  1SHG A;  1WXT A;  2HEQ A;  4KUL A;  2CSI A;  2O2O A;  2B86 A;  2FRW A;  3I5R A;  3PE0 A;  2L2P A;  1WPY A;  1EX4 A;  2CP3 A;  2I0N A;  4MML A;  2KY9 A;  2CDT A;  1D09 B;  2KI7 A;  4K11 A;  4E7J A;  4CI0 C;  4N4H A;  4M77 E;  2WSE E;  5GAM h;  3H0H A;  4JZ4 A;  4EDU A;  4RTX A;  3CCQ Q;  2O88 A;  4BI8 B;  8ATC B;  3CXC A;  4F7U B;  1BI1 A;  1YCS B;  4RG2 A;  3CCS Q;  1NYF A;  4MZM A;  3MP8 A;  4R55 A;  1Q86 R;  4KH1 B;  4N0A A;  1M3C A;  4AG1 C;  1Y0M A;  1Q81 C;  1WX6 A;  3RKW A;  2RHU A;  1M1G A;  1UEB A;  3M56 A;  1K0S A;  2R5M A;  1QKW A;  1RAI B;  1VQP T;  3ZFJ A;  3R6O A;  4FW2 A;  5FU6 B;  4C5G A;  3HSB A;  4E7H A;  1RI0 A;  5L8R E;  1MV3 A;  3CCM T;  2ZPG B;  5I22 A;  2CSQ A;  4M78 G;  3OYG A;  1UUE A;  3QJ6 A;  3RKY A;  3JB9 I;  2FO0 A;  3CCM A;  3E9G A;  2AKK A;  1XNI A;  2K5I A;  2HQX A;  3QPH A;  4RKU E;  5GAO m;  1VQ7 A;  3ER0 A;  4JPB W;  3BE3 A;  1U3O A;  3FJP A;  1AWW A;  1OZ3 A;  3CCJ Q;  4MMK A;  4KGZ B;  5KYN A;  2MOX A;  5CKB A;  3VRY A;  1S72 T;  2MCN A;  4OGC A;  1ZSZ B;  1IGQ A;  4F16 A;  1MGQ A;  2DKG A;  2CT3 A;  3M54 A;  4C0Z A;  4EMK C;  5KCO A;  1S72 A;  3Q1J A;  4GLK A;  2RHY A;  1WHL A;  5CKD A;  3OYH A;  4PJO G;  2RNA A;  2GCX A;  4OMF B;  2RHX A;  2J6K A;  4F04 B;  4CC2 A;  4LN2 A;  3SFM A;  4C5E A;  4ZN1 A;  3ULR B;  4CC3 A;  3CCV Q;  2QAZ A;  3EAE A;  2R58 A;  5GMK j;  5I2S A;  4M77 A;  2FEI A;  2EWN A;  2E41 A;  2HCK A;  4JLI A;  1EZZ B;  5LJ3 e;  5A2Q E;  2XD0 A;  3CC2 A;  4KGX B;  4OMN A;  4M75 C;  1ABO A;  4XAX B;  4XTZ A;  1YIJ T;  4X9D A;  3EG0 A;  1GBR A;  1VQ7 Q;  4DEY A;  2K2V A;  3CBP A;  1YFN A;  1MMA A;  1D0X A;  1TOV A;  2DEU A;  2YDL A;  3X25 B;  5CQY A;  1BB9 A;  1VQ9 T;  1M27 C;  1NLO C;  3CPW S;  2GQV A;  1C0M A;  2EJF A;  3VKI A;  3JB9 G;  5GJV B;  4JRP A;  1VQ9 A;  1RAG B;  3UAT A;  1WQ7 A;  3BW1 A;  3X20 B;  2MF2 A;  5CKH A;  3M4Y A;  4FT4 A;  2DET A;  5CKF A;  3VRZ A;  3AT1 B;  1BKB A;  1C6V X;  4LUD A;  3QG1 A;  2VAS A;  4RTW A;  1OUL A;  2GF7 A;  2P0K A;  4XTX A;  4ZN3 A;  1RAC B;  2DIQ A;  1NPP A;  1UHF A;  3V8K A;  3JB9 J;  2OTJ T;  2DL4 A;  2EQI A;  4C92 C;  1IHW A;  2MMP A;  3CC2 Q;  2F1L A;  2QAS A;  4HVV A;  2OTJ A;  4M7D E;  3OA6 A;  2F2W A;  4JJD A;  5DM7 R;  3RNJ A;  2P4T A;  2DEQ A;  2D8H A;  5FU7 C;  2DMO A;  5GAO n;  1PRM C;  4M7A G;  2QTX A;  1VQO A;  3PVQ A;  2JUF A;  3CPW A;  3J80 E;  3X26 B;  1M3B A;  5CQX A;  4J9G A;  3I56 Q;  3M53 A;  3EGD A;  2EGC A;  1GBQ A;  1D0Z A;  1GFD A;  3OYM A;  4XU3 A;  4ZGJ B;  4ZNX A;  5CIU A;  2O9S A;  1K73 U;  1G5V A;  5KYU A;  1M3A A;  3NGP A;  2L89 A;  1Z9Z A;  1V76 A;  4OF1 A;  4PK4 A;  2ED1 A;  3BDL A;  1JJ2 A;  2PUK B;  3FDR A;  1QCN A;  2EJ9 A;  4CC4 B;  4AT1 B;  5GMK h;  3I55 T;  4RTU A;  3HFN A;  1RAB B;  3GLX A;  4J8O A;  1N6A A;  1VQM T;  3I55 A;  5IH2 A;  2D8J A;  3OMG A;  1QP3 A;  2DIG A;  1SG5 A;  4OGE A;  2DRM A;  2DNU A;  2LP5 A;  2GFU A;  1VQM A;  2DTH A;  1W2B S;  2QDY B;  4C0F A;  3C4S A;  1B34 A;  2RO0 A;  2P4R A;  4ELY C;  2X4W A;  1IO6 A;  1PSE A;  4C5I A;  5FRM A;  4LUE A;  4M78 B;  5CO7 A;  3OYD A;  3CC7 A;  4PNO A;  1E7O A;  5LJ5 j;  2RQR A;  5L23 A;  2QQS A;  1Q82 C;  4HCB A;  4J9H A;  1OU9 A;  5GAN 7;  4KRT A;  1WHG A;  4B6M A;  3A8L B;  2D9T A;  2H8H A;  2EYZ A;  2RI3 A;  4PJM A;  1OI1 A;  2GBQ A;  3S6W A;  1PG5 B;  3MKD A;  2CYZ B;  2KQW A;  1WGS A;  2VYT A;  5FRO A;  1XQH A;  1UHC A;  2C0O A;  4PJO B;  1VQ6 A;  4VUB A;  3VS6 A;  3OBY A;  5IHN A;  2D0Q B;  2D6F A;  4E7K A;  3TSW A;  2KEA A;  2DF6 A;  1MMD A;  2LX9 A;  5LJ5 g;  3VS5 A;  2DVE A;  1H3H A;  3PIP A;  4TVR A;  1VQ4 Q;  3CD6 Q;  3X24 B;  4C92 E;  4NS5 A;  1AT1 B;  3WVD B;  4A53 A;  3OYC A;  4XTV A;  1D0Y A;  1VQ8 Q;  2A3L A;  1X6B A;  1YI2 Q;  2OAU A;  3UT1 A;  1QKX A;  2MPX C;  3JCM Q;  3CMA T;  2HDA A;  2L8D A;  3QUI A;  4RTT A;  5GAN 5;  3PT9 A;  1K8A U;  4HXJ A;  1D1B A;  5LJ3 d;  2F2V A;  1HYO A;  5LJ3 f;  5ECA A;  3KBG A;  2NYS A;  2E1H A;  3LYI A;  5GAN 3;  2GNC A;  2MIO A;  3JCM g;  5HY6 A;  1JEG A;  1NJI U;  1NYG A;  1VQ6 Q;  2R57 A;  2YRV A;  2HSP A;  3URG A;  1U1T A;  2DL3 A;  3LH0 A;  1YHQ Q;  1PWT A;  1NLP C;  2K5F A;  1GCP A;  1I5O B;  2ZCF B;  1X69 A;  4M4Z A;  1YJ9 Q;  1K9A A;  2BKD N;  3NPF A;  4GY5 A;  5LJ5 h;  2LCS A;  7AT1 B;  1QQJ A;  2LX7 A;  2HQH A;  1YCY A;  1H8K A;  5KYW B;  2IPO B;  3E9F A;  1KIK A;  2J06 A;  1PD1 A;  3G71 Q;  4Z88 A;  2K5L A;  3HKS A;  2E6Z A;  1I0C A;  4M7A B;  1UTI A;  2CH4 A;  3UA6 A;  4ZTJ A;  1DJ7 B;  1NPR A;  3OW2 A;  1BI3 A;  4EMK B;  2DPP B;  2MK5 A;  2XID A;  2X35 A;  3OYI A;  3NTH A;  2O31 A;  2F69 A;  4X34 A;  2XDB A;  1WA7 A;  4C8Q C;  6AT1 B;  1CSK A;  1Y96 B;  3LX7 A;  1KC8 U;  3SHW A;  3FC3 A;  2QEX Q;  4C92 A;  3JCM h;  3DLL A;  1YJW T;  4M7D D;  2CZ1 B;  1M8V A;  2AZS A;  1SSF A;  1FX7 A;  1D1A A;  1VQN A;  5C6S A;  3M0U A;  3EHQ A;  3M55 A;  1K0X A;  1VQL Q;  2K57 A;  4M75 B;  3OYB A;  4IUR A;  4J9B A;  2VWF A;  4RG8 A;  1V29 B;  2RN8 A;  4C0G A;  1YJN Q;  1IGU A;  3LW5 E;  4M7D F;  1KJW A;  1FMK A;  3JCM W;  1N8R C;  4Z89 A;  1Q95 G;  2M16 A;  4PJJ A;  1I07 A;  2JNG A;  3S3N A;  2I2L A;  2L5Q A;  1D3B A;  2QA4 T;  2QQ9 A;  2L0A A;  4R56 A;  2JMC A;  3HP9 A;  1OX8 A;  3KXT A;  1M2V A;  2OTL T;  1C1A A;  1G2B A;  4L5G A;  1HXD A;  1WJQ A;  3OYK A;  4BDY A;  1KD1 C;  2EKH A;  2HQE A;  2NUP B;  2QGG A;  2YLC A;  2PVG B;  4M78 C;  1R8O B;  1U06 A;  2LCL A;  1O75 A;  1VQN Q;  2YXY A;  3RR6 A;  3OS1 A;  1I5L A;  2JTF A;  4A4H A;  4F7U A;  2RD1 A;  4BI3 A;  3G4S T;  4PLL A;  2CUD A;  5LL6 S;  4DBF A;  4JRQ A;  4E2F B;  4ELZ C;  2DXC A;  5FU7 B;  3A5Z B;  1BU1 A;  3CC4 Q;  1QWE A;  2H3J A;  3VS3 A;  1HSQ A;  1WDX A;  1MUZ A;  2X9H A;  1AEY A;  5D6Y A;  4BD3 A;  2RJE A;  3OMC A;  3CEY A;  3CCE T;  4IUV A;  3J7A F;  2EYY A;  2DTI A;  2XI9 A;  2H3E B;  1FWZ A;  1OPK A;  1K1Z A;  3CCE A;  1CKA A;  2RI5 A;  3CCS T;  1NBE B;  1R0B G;  4PJO C;  2FYK A;  1KQS P;  1BIA A;  1QLY A;  4IIM A;  1SRM A;  1YBY A;  5IN1 A;  2A0F B;  1M9S A;  5GAO q;  2EBP A;  4HVU A;  4LD9 K;  2RA2 A;  1VYV A;  1VUB A;  4DEX A;  5CCA A;  5GAN h;  4X9C A;  4ATO A;  1AZG B;  5GAO l;  3OS2 A;  1ACM B;  3U23 A;  2AT1 B;  3A8H B;  5HKC A;  5FWC A;  3MEV A;  2MAM A;  1MHN A;  2AZV A;  1YN8 A;  1JRI A;  2HMA A;  1JBM A;  1U5S A;  3A1P A;  3ME9 A;  2BZY A;  1RLQ C;  1HK9 A;  1OQK A;  2YUQ A;  2CZ7 B;  1ZSZ A;  3UWN A;  3TVT A;  1GFC A;  2JW4 A;  2ECZ A;  1VA7 A;  1KQ1 A;  2GTJ A;  2O4X B;  3E1S A;  2HKQ B;  1UJY A;  4J9F A;  2GQI A;  1KG1 A;  4A4K A;  5CVI A;  3L42 A;  2DM1 A;  1A0N B;  2LQN A;  3VS4 A;  2NUT B;  2HL3 A;  1M90 U;  1WI7 A;  1RAD B;  2FG0 A;  4II1 A;  1AVZ C;  3PNW C;  1QVG P;  1VQP A;  1ZUY A;  2D1X A;  2FPD A;  4WTO B;  1N9S A;  2YHT A;  3SWN C;  3I5S A;  1VQK T;  2KXC A;  1ZBJ A;  2COY A;  3GNG A;  1G3T A;  4Q5W A;  1VQK A;  5GAN 8;  4JS5 A;  1G3Y A;  3EFR A;  1PKS A;  4M7A C;  3MPU B;  2C0T A;  1Y07 A;  4QW2 A;  4D8D A;  1J3T A;  1QWF A;  2FPF A;  4M78 E;  1H3Z A;  2M0Y A;  5GAM d;  4LDW A;  1Q7Y R;  3JSC A;  1ZA1 B;  3JCM b;  2QQR A;  3A8M B;  3C12 A;  3VV0 A;  3FJ5 A;  2DXT A;  2BZX A;  2DZ9 A;  2PNI A;  4PKC C;  5J39 A;  2FPE A;  1BYM A;  3JCM X;  4KBM B;  3GOX A;  3ZBD A;  2DXB A;  1M30 A;  1IZ6 A;  3L2V A;  1WHJ A;  3EH2 A;  4Z8A A;  2EGA A;  2LMJ A;  4D8K A;  3CCM Q;  1H64 1;  4BAC A;  4DQ2 A;  1YIT T;  4O6J A;  4A4F A;  4JS4 A;  5GAN 2;  1BI2 A;  4C5H A;  1N9R A;  1YIT A;  2L3Q A;  2WSC E;  3CPF A;  1UGP B;  1YIJ A;  2E4H A;  2KR3 A;  4NL3 A;  1AD5 A;  1M90 R;  2JS0 A;  4P5N A;  2X4Y A;  2DZC A;  2QK0 A;  3HFO A;  1GCQ A;  2O9V A;  2ZPE B;  1FYN A;  3TQ7 P;  1M1K R;  3DKM A;  1PHT A;  1SSH A;  1S72 Q;  1WQW A;  1M4Z A;  2DD4 A;  2ROL A;  1TUC A;  3I35 A;  1NEB A;  1XJW B;  1G8X A;  2QTV A;  5FLX E;  4ZGE B;  3PIO A;  3A98 A;  1UGQ B;  5LJ3 j;  2MYS A;  4E6R A;  2M51 A;  1K73 C;  5AT1 B;  3TU4 K;  2CUB A;  4KUD K;  1N27 A;  3L2W A;  4M7D G;  2A37 A;  3JRZ A;  1RAE B;  2K2M A;  2KVQ G;  2FHD A;  3H9N A;  2W0Z A;  3GF5 A;  4PFO A;  3C95 A;  3DLM A;  3JCM J;  1TWB A;  4IUQ A;  3E19 A;  2M1H A;  2AK5 A;  1ZX6 A;  1M8M A;  4FSS A;  1MNE A;  2PUO B;  4M78 A;  2DBM A;  4C8Q B;  3OYF A;  2EAY A;  1WZO A;  3BY7 A;  1Q81 R;  1WJS A;  2DTO A;  2LT1 A;  1PRL C;  3EFO A;  2VUB A;  4NOY A;  3MP1 A;  1R77 A;  5GAO r;  1VQ9 Q;  2HKN A;  4LE9 A;  2RI2 A;  1KQ2 A;  3MP6 A;  4GLM A;  3EGX B;  3JV3 A;  2RK2 A;  1GRI A;  3PTA A;  5J26 A;  5LJ3 g;  4JZ3 A;  1B3Q A;  3EGU A;  4DBQ A;  4OMO A;  2ZPI B;  2RM4 A;  1WHM A;  1VQ5 T;  3CCL T;  2LJ1 A;  2ED0 A;  3CXC P;  2QXF A;  3T9N A;  1VQ5 A;  3CCL A;  3X28 B;  2OTJ Q;  2FL7 A;  4PJN A;  3TRE A;  2VB6 A;  1BIB A;  2EFI A;  2XG8 D;  1X2Q A;  3ZL7 C;  4LDU A;  4AFZ C;  2K3B A;  2K3X A;  4AFQ C;  4FT2 A;  2A28 A;  2X3X D;  4M77 D;  3G6E T;  1YNZ A;  2JM9 A;  2PU9 B;  2K7A A;  5FW9 A;  1VQO Q;  1K4U S;  2VGM A;  1D1C A;  3G6E A;  2E70 A;  3OSV A;  4QVC A;  3FLG A;  2EYQ A;  4ZTF A;  2QQA A;  1NZ9 A;  3OS5 A;  4M75 E;  1UE9 A;  2E3H A;  1TTH B;  4M77 F;  1HJD A;  2PZ1 A;  1TUD A;  1R0C B;  1WXB A;  1QCF A;  2KGT A;  2CGH A;  1KQS S;  1YI2 T;  1X75 C;  5LJ3 h;  4EMH A;  3V7S A;  3E2U A;  2Y90 A;  1UB4 A;  4JJC A;  4PLI A;  3RES A;  4IIO A;  3RUX A;  2E64 A;  1K8A C;  1B07 A;  3I55 Q;  1K9M C;  4MDX A;  1RI9 A;  3S3O A;  2J7I A;  2RQU A;  2XHC A;  1AHJ B;  1QP2 A;  3PMI A;  4BE1 A;  4OB0 B;  1VQM Q;  1RUW A;  1WJR A;  4KUI A;  1W2B A;  2X3W D;  3C0C A;  1IRX A;  2LQ8 A;  3KUF A;  1NJI C;  2E12 A;  3QBY A;  3CC7 Q;  1OZ2 A;  5KYW A;  1YP5 A;  1QCO A;  5CR2 A;  3VS1 A;  2ROT A;  4HVW A;  3QO3 A;  3RMS A;  4M7A A;  1E6H A;  1SHF A;  4JJB A;  1PCX A;  4B9W A;  1AZE A;  3CCU T;  5KYY B;  3M0P A;  2Y4Y A;  1KSW A;  3CMA A;  4EMK A;  2SRC A;  3V8L A;  2DO3 A;  3CCU A;  1ABQ A;  2LC4 A;  5GAO p;  2QQB A;  3L2Z A;  1QVG S;  1PD0 A;  4N0A C;  3HRU A;  2RQV A;  2HAX A;  1MV0 B;  1Y96 A;  2F5K A;  1NM7 A;  2DRK A;  2XDP A;  3L2Q A;  3R6N A;  4BY6 B;  2DJQ A;  4F17 A;  5GMK m;  3LLR A;  1M1F A;  2EKO A;  1PSF A;  5A0L A;  1ZUK A;  3VUB A;  3M0S A;  1KC8 C;  4M7D B;  4M75 A;  2YUO A;  3QYH B;  3CME T;  2J6O A;  2RJF A;  4FSX A;  4HCK A;  2ZGW A;  1X6O A;  2CP6 A;  3CME A;  1JXO A;  3SWN B;  2E5Q A;  4AG2 C;  5CK9 A;  1TXQ A;  4AFU C;  5EC7 A;  1U8R A;  1NEG A;  1K76 A;  1Y57 A;  2P0Q A;  2YRD A;  4F7U E;  1VIE A;  3OSS C;  2P0P A;  4J7I A;  2MWO A;  3UA7 A;  2DAQ A;  3CMA Q;  2GFA A;  3V7R A;  2DLP A;  2DL8 A;  1O9S A;  1VIF A;  3DB4 A;  3HTR A;  2B8A A;  1WFW A;  2VVK A;  5KE3 A;  1QVF P;  2DBK A;  5GAM e;  1IHV A;  5D7U A;  2NUP A;  1UJ0 A;  4FCY A;  3MJX A;  1SRL A;  2WAC A;  3LGL A;  4C0D B;  4Y28 E;  4DOV A;  2K79 A;  3LH5 A;  3A8G B;  2M0O A;  1JJ2 P;  1YJW A;  2DJZ A;  2HD0 A;  2VXF A;  2KT8 A;  1Q82 R;  1Q86 C;  2XMF A;  4DBR A;  3CCR T;  1AOJ A;  4LDX A;  4RCC A;  5GAN 4;  2LNV A;  3CCR A;  1UFF A;  1LOJ A;  4RTZ A;  1ZA2 B;  1RLP C;  1UG1 A;  4WCI A;  1ZLM A;  4V2S A;  2E10 A;  1TG0 A;  3TEE A;  1K9M R;  3L2U A;  3OYJ A;  2XK0 A;  2X51 A;  3LGF A;  5EG2 A;  2QA4 A;  4RCB A;  2K4Y A;  3M59 A;  3VYH B;  2OTL A;  3M0R A;  4OVA A;  5IHI A;  2CZ0 B;  3EG2 A;  1I1J A;  3SEM A;  3HRT A;  3JCM P;  1RAF B;  4XK8 E;  3QWX X;  4PFP A;  3G7Z A;  4J6W A;  1TSF A;  2L3S A;  4AFS C;  2CP0 A;  1PM3 A;  1T0H A;  1WHH A;  2CP5 A;  2LCC A;  3M9Q A;  1JU5 C;  2V8K A;  4LD6 A;  1OV3 A;  3F70 A;  3G4S A;  3JCM V;  1M5Q 1;  3H6Z A;  2O4X A;  2CT4 A;  2RMO A;  3MEA A;  3UPU A;  1RAH B;  3M58 A;  2K3Y A;  3NTK A;  3CCQ T;  1S1N A;  1N8R U;  2OAW A;  5CAI A;  2LDM A;  5GJW B;  2NUT A;  4E7I A;  2KBT A;  2DL7 A;  3CCQ A;  3CXC S;  1JQQ A;  3A8O B;  2RHZ A;  3OB9 A;  4PL6 A;  2QA4 Q;  3MEW A;  4E7Z A;  5D6W A;  1B7T A;  3MHX A;  5FWB A;  4EPC A;  2OTL Q;  1WXU A;  2EQK A;  1IB8 A;  4FYX B;  3GNF B;  2F5T X;  3CCS A;  2ATC B;  2DX1 A;  2KDS A;  4OMQ A;  5DY9 A;  3OYA A;  1JB0 E;  1Q7Y U;  4M77 G;  2Z0W A;  4QQ6 A;  1TUG B;  5KYX B;  2VC8 A;  2QDL A;  2DFU A;  2KRO A;  3HRS A;  2KAF A;  3GP8 A;  1UGV A;  3NHN A;  1TU0 B;  3O5Z A;  4KGV B;  4XU0 A;  1M2O A;  5IT9 E;  1SKU B;  2JVV A;  3VS7 A;  4C92 D;  3OY9 A;  3G4S Q;  4BDZ A;  1SEM A;  4QKU A;  2A7Y A;  4C8Q E;  2JJ9 A;  3G1J A;  2EYX A;  2V8I A;  2CH4 W;  2XDD A;  3KFV A;  2DVJ A;  3JAM E;  3CCJ T;  3CCE Q;  2A08 A;  1YWP A;  1LPL A;  4AMC A;  3L2R A;  4HKE A;  3LWH A;  2EQU A;  2YUP A;  2KYM A;  3NTI A;  4BY6 C;  1CKB A;  3FIF A;  3CCJ A;  2CZ6 B;  4C92 F;  1JO8 A;  4OB1 B;  2YWW A;  2KE9 A;  2DL5 A;  3EG9 B;  3FRN A;  2LTO A;  1G3W A;  4A4E A;  1M1K U;  3OQ5 A;  4M7D C;  1JXM A;  2IG0 A;  1BK2 A;  2RJC A;  3H0I A;  2JMA A;  3CCV T;  5IAY A;  3NMZ C;  1N8R R;  2EVR A;  2VV5 A;  3OW2 P;  4UC4 A;  1FXX A;  1PKT A;  3CCV A;  1MMG A;  2JM8 A;  3VYG A;  2X4X A;  2KRN A;  5GAN d;  2JN0 A;  3QYG B;  2NLU A;  3OYL A;  2QI2 A;  5GAN f; 
#chains in the Genus database with same CATH homology
 5GMK e;  1Q7Y C;  5GAN g;  3PTA A;  3L1A A;  5J26 A;  4QVZ A;  5LJ3 f;  3KBG A;  5LJ3 g;  1VQ7 T;  2E1H A;  3LYI A;  3J81 E;  2ZPH B;  2RH2 A;  3RMQ A;  3HHT B;  4XQ3 A;  3JCM d;  5GAN 3;  2ZPI B;  3OBW A;  2RM4 A;  5KH6 A;  1Q86 U;  3JCM f;  2LRQ A;  1VQ5 T;  3JCM g;  5GAM f;  3CCL T;  3FEO A;  4KT0 E;  4HCZ A;  1OYX A;  2KMT A;  5DLQ E;  5GAM g;  5HY6 A;  2QXF A;  4FIB A;  3C94 A;  3GPL A;  4C92 B;  1NJI U;  4M75 D;  4MZP A;  5D6X A;  1WNL A;  3T9N A;  3CBO A;  4EMG A;  1VQ5 A;  2R57 A;  3GIB A;  3CCL A;  4C0D C;  3WXM B;  4MZT A;  1KHI A;  2YRV A;  3M4G A;  3X28 B;  1Q81 U;  1UGS B;  2FL7 A;  4J6Y A;  4L59 A;  3URG A;  3TRE A;  1U1T A;  1BIB A;  2EFI A;  2XG8 D;  4OP0 A;  4LDU A;  3LH0 A;  3NFC A;  2K5F A;  1NE8 A;  1I8F A;  4F7U F;  2K3X A;  2ZCF B;  2BIV A;  4FT2 A;  4BI4 A;  5KE2 A;  4CRI A;  4M77 D;  3G6E T;  2C06 A;  4B9X A;  4M75 F;  5A0D A;  2BKD N;  4GY5 A;  4C8Q A;  5LJ5 h;  2MWP A;  2PU9 B;  2DXU A;  5J3B A;  2WSF E;  2JOY A;  4A54 A;  4FL6 A;  4OB3 B;  1YCY A;  1RL2 A;  2EJG A;  2VGM A;  3INZ A;  1LJO A;  3E9F A;  3G6E A;  2E70 A;  1M90 C;  3SB2 A;  3OSV A;  4PJO E;  3CC2 T;  2K5L A;  2E65 A;  3HKS A;  3M5A A;  4QVC A;  5I21 A;  2E6Z A;  3FLG A;  2EYQ A;  4ZTF A;  1D3B B;  1KD1 U;  2QQA A;  4M7A B;  3UDC A;  2HNI A;  5FRN A;  4M7A F;  4IUP A;  1M1K C;  3QJY A;  1NZ9 A;  3P8B B;  3OS5 A;  4M75 E;  4ZTJ A;  4C8Q G;  1DJ7 B;  3OYY A;  1NPR A;  3MCA B;  4M77 F;  1BI3 A;  3OW2 A;  4DA4 A;  1BI0 A;  4KUL A;  4EMK B;  2DPP B;  1QVP A;  2XID A;  2X35 A;  3OYI A;  2L3R A;  1Y7X A;  2CGH A;  4D6W A;  1KQS S;  1YI2 T;  1KHC A;  1I81 A;  1X75 C;  3NTH A;  5LJ3 h;  5A0G A;  1WPY A;  2F69 A;  4EMH A;  3V7S A;  4X34 A;  2XDB A;  2Y90 A;  1UB4 A;  4MML A;  2KY9 A;  4PLI A;  3RES A;  3RUX A;  2E64 A;  4C8Q C;  1K8A C;  1KC8 U;  1Y96 B;  3LX7 A;  3VJP A;  4WF2 A;  1QVF S;  3FC3 A;  4E7J A;  4C92 A;  3JCM h;  4CI0 C;  4N4H A;  4M77 E;  4N4G A;  3I56 T;  2CZ1 B;  2WSE E;  5GAM h;  3DLL A;  1YJW T;  1M8V A;  1SSF A;  2VGN A;  1FX7 A;  2EIF A;  4EDU A;  1K9M C;  4MDX A;  4BI8 B;  3S3O A;  3CXC A;  1VQN A;  2XHC A;  1AHJ B;  1QP2 A;  3PMI A;  4F7U B;  3I56 A;  4OB0 B;  5C6S A;  3M55 A;  4BE1 A;  1BI1 A;  4L6V 5;  2PVO B;  4Z02 A;  4JJN K;  1WJR A;  4RG2 A;  2K57 A;  4KUI A;  1W2B A;  3M57 A;  4M75 B;  4IUR A;  3OYB A;  3MO8 A;  4RG8 A;  1V29 B;  2LQ8 A;  4C0G A;  3KUF A;  4MZM A;  1NJI C;  2O01 E;  3MP8 A;  2E12 A;  3LW5 E;  4R55 A;  1JJ2 S;  4M7D F;  3PFS A;  5KCH A;  4N0A A;  3JCM W;  4JUV A;  3QBY A;  1N8R C;  1G3S A;  1Q81 C;  1OZ2 A;  2M16 A;  2RHU A;  3RKW A;  1M1G A;  1UEB A;  3M56 A;  2R5M A;  2JNG A;  2MI6 A;  2I2L A;  5CR2 A;  3S3N A;  2L5Q A;  4BE2 A;  3RMS A;  3DB3 A;  3QO3 A;  1D3B A;  3TCJ A;  4Y91 A;  2QQ9 A;  2QA4 T;  1VQP T;  4M7A A;  3ZFJ A;  4XU1 A;  4M77 B;  3R6O A;  4R56 A;  5FU6 B;  4C5G A;  3HSB A;  4NL2 A;  4E7H A;  3HP9 A;  1RI0 A;  4B9W A;  3KXT A;  2OTL T;  5L8R E;  4M7D D;  3CCU T;  4L5G A;  3CCM T;  2ZPG B;  2Y4Y A;  4M78 G;  3CMA A;  4E47 A;  3OYG A;  4JDS A;  1U1S A;  2IVW A;  3QJ6 A;  3FB9 A;  4FU6 A;  3RKY A;  3V8L A;  4EMK A;  1VQO T;  3QDR B;  1HXD A;  1WJQ A;  1QW1 A;  2DO3 A;  3JB9 I;  3OYK A;  3CCU A;  1Y71 A;  3QSU A;  3CCM A;  3E9G A;  2RB6 A;  2KSS A;  1P92 A;  2G3R A;  2LC4 A;  2PQW A;  2QQB A;  3V8J A;  1XNI A;  5GAO p;  2HQE A;  3L2Z A;  1KD1 C;  1BYM A;  1QVG S;  2K5I A;  2HQX A;  2PVG B;  2YLC A;  4N0A C;  1QVF A;  3HRU A;  2HAX A;  1Y96 A;  2F5K A;  5GMK i;  2XDP A;  3QPH A;  4RKU E;  5GAO m;  3L2Q A;  1VQ7 A;  3QZ9 B;  3ER0 A;  4M78 C;  1R8O B;  3MEU A;  4BY6 B;  2LCL A;  2JTM A;  4MDW A;  2V8J A;  1O75 A;  3FJP A;  4M7A E;  2LVM A;  1OZ3 A;  5GMK m;  4MMK A;  3OS1 A;  1I5L A;  2JTF A;  4PJO A;  4A4H A;  2Y4X A;  3LLR A;  4LDY A;  4F7U A;  1M1F A;  2EKO A;  2RD1 A;  4BI3 A;  5CKB A;  1PSF A;  5A0L A;  3G4S T;  1S72 T;  4PLL A;  3VUB A;  5LL6 S;  4JRQ A;  4OGC A;  4ELZ C;  5LJ5 e;  2DXC A;  5FU7 B;  1MGQ A;  1KC8 C;  2DKG A;  3A5Z B;  4M75 A;  4M7D B;  2H3J A;  3M54 A;  3QYH B;  4C0Z A;  3CME T;  2M9U A;  4EMK C;  5KCO A;  1S72 A;  3WVE B;  2RJF A;  4JRI A;  2PVD B;  2DD5 A;  3Q1J A;  2RJE A;  4FSX A;  4GLK A;  2RHY A;  5D6Y A;  3OMC A;  3CEY A;  5CKD A;  2HBP A;  3OYH A;  4IUV A;  4PJO G;  2ZGW A;  3CCE T;  5HK3 A;  1X6O A;  4FM4 B;  3CME A;  3SWN B;  3J7A F;  1ZHI A;  2E5Q A;  2GCX A;  4OMF B;  2ZPF B;  5CK9 A;  2KK4 A;  2RHX A;  2DTI A;  2XI9 A;  4QQG A;  1FWZ A;  3CCE A;  3SFM A;  4C5E A;  4ZN1 A;  1U8R A;  4M75 G;  2P0Q A;  3EAE A;  2R58 A;  5GMK j;  1ZQ1 A;  5I2S A;  4M77 A;  4F7U E;  1VIE A;  3OSS C;  4C8Q D;  2P0P A;  4J7I A;  2RI5 A;  2EWN A;  3CCS T;  2E41 A;  2MWO A;  2DAQ A;  4PJO C;  2GFA A;  2FYK A;  4JLI A;  5C0M A;  5LJ3 e;  3MET A;  3V7R A;  5A2Q E;  2XD0 A;  1BIA A;  4BUG A;  2CS7 A;  1O9S A;  1YBY A;  3CC2 A;  1VIF A;  3DB4 A;  5IN1 A;  1M9S A;  2B8A A;  5GAO q;  1VQ4 T;  3CC7 T;  4IUU A;  5GAN 6;  4M75 C;  4BB7 A;  5KE3 A;  3JCM e;  3CD6 T;  4XAX B;  4LD9 K;  2RA2 A;  4XTZ A;  5GAM e;  1YIJ T;  4X9D A;  1VQ8 T;  1VUB A;  5CCA A;  5GAN h;  4ATO A;  4X9C A;  3CD6 A;  1VQ4 A;  2K2V A;  3CBP A;  5GAO l;  4XTU A;  3OS2 A;  3X25 B;  2WAC A;  4C8Q F;  3LGL A;  3A8H B;  4C0D B;  1XTD A;  5HKC A;  1VQ8 A;  3AHU A;  5CQY A;  4Y28 E;  1VQ9 T;  1YI2 A;  3MEV A;  2MAM A;  4DOV A;  1MHN A;  1LNX A;  5GMK l;  1JRI A;  3CPW S;  2GQV A;  2EJF A;  1W4S A;  1JBM A;  3A8G B;  3VKI A;  3OYE A;  3JB9 G;  4JRP A;  1VQ9 A;  3ME9 A;  4HT9 A;  5FU6 C;  1HK9 A;  2M0O A;  2CZ7 B;  1YJW A;  2DJZ A;  1WQ7 A;  2HD0 A;  2VXF A;  3BW1 A;  3UWN A;  3X20 B;  2MF2 A;  4M7D A;  5CKH A;  3M4Y A;  1Q86 C;  4FT4 A;  5CKF A;  3QKJ A;  3CCR T;  1BKB A;  3QG1 A;  3CBM A;  4LDX A;  2GF7 A;  4RCC A;  4C92 G;  3RKX A;  5GAN 4;  3N5B B;  2P0K A;  3RIR A;  2LNV A;  3CCR A;  3SWN A;  4XTX A;  1KQ1 A;  4ZN3 A;  1VQ6 T;  2O4X B;  1LOJ A;  2DIQ A;  1NPP A;  3E1S A;  3V8K A;  3JB9 J;  1KG1 A;  3EFS A;  4BD3 A;  4A4K A;  2OTJ T;  3BFM A;  5CVI A;  4V2S A;  2E10 A;  3L42 A;  2X4J A;  4HT8 A;  3QHS A;  1UGR B;  3TEE A;  4C92 C;  3L2U A;  2MMP A;  3OYJ A;  1YHQ T;  2CKK A;  1M90 U;  4J83 A;  4M78 D;  2XK0 A;  4J6X A;  2OTJ A;  4II1 A;  2RK1 A;  2ZZD A;  3O8V A;  3PNW C;  4M7D E;  3OA6 A;  4HCC A;  3LGF A;  5DM7 R;  5EG2 A;  2P4T A;  2DEQ A;  3H8Z A;  4O5V A;  4RCB A;  2QA4 A;  1VQP A;  1B34 B;  2K4Y A;  5FU7 C;  1YJ9 T;  1YHQ A;  3M59 A;  3SDZ A;  5GAO n;  1Q82 U;  3JB9 H;  1KQS A;  3P8D A;  3VYH B;  2OTL A;  4OVA A;  1N9S A;  1YJ9 A;  2YHT A;  2CZ0 B;  4M7A G;  2QTX A;  5CKE A;  3G71 T;  3SWN C;  3HRT A;  1VQO A;  3JCM P;  1VQK T;  2JUF A;  4XK8 E;  4BE0 A;  4M78 F;  3CPW A;  3GNG A;  3J80 E;  2BUD A;  3X26 B;  5CQX A;  1G3T A;  4Q5W A;  3G71 A;  4DOW A;  1VQK A;  5GAN 8;  3G7Z A;  3M53 A;  4JS5 A;  1G3Y A;  3PMT A;  4J6W A;  4JLG A;  3EFR A;  4M7A C;  3OYM A;  4XU3 A;  2ZPB B;  4ZGJ B;  4XU2 A;  5CIU A;  4QW2 A;  1Y07 A;  1K73 U;  3OW2 S;  1K9M U;  1I4K 1;  1G5V A;  3OYN A;  2LCC A;  2L89 A;  3M9Q A;  3VUZ A;  1EIF A;  2V8K A;  4M78 E;  4LD6 A;  5GAM d;  1H3Z A;  4BDY A;  4LDW A;  4PJO D;  3F70 A;  4OF1 A;  3JSC A;  3G4S A;  3BDL A;  3JCM b;  2QQR A;  1JJ2 A;  2PUK B;  3A8M B;  4XTW A;  2QEX T;  3FDR A;  3C12 A;  2EJ9 A;  3SD4 A;  3JCM V;  1M5Q 1;  3H6Z A;  3VV0 A;  2O4X A;  5GMK h;  3MEA A;  3UPU A;  2R5A A;  2DXT A;  3M58 A;  3I55 T;  2DZ9 A;  4F7U G;  2XKO C;  2K3Y A;  3HFN A;  3NTK A;  4PKC C;  3CCQ T;  2QEX A;  1N8R U;  5J39 A;  3GLX A;  3QZ5 B;  4J8O A;  5CAI A;  1N6A A;  1VQM T;  3QII A;  2LDM A;  1X01 A;  3I55 A;  3JCM X;  1Q7Y U;  3OMG A;  4E7I A;  1IRE B;  1QP3 A;  4KBM B;  2DIG A;  1VQL T;  4OGE A;  3CCQ A;  3CXC S;  3ZBD A;  2DXB A;  3GOX A;  3A8O B;  2GFU A;  3P8H A;  2RHZ A;  1IZ6 A;  3OB9 A;  4PL6 A;  4PJO F;  5GAN e;  3L2V A;  3MEW A;  1VQM A;  1YJN T;  5D6W A;  3MHX A;  2DTH A;  1VQL A;  1W2B S;  2QDY B;  4C0F A;  4EPC A;  3C4S A;  1B34 A;  2RO0 A;  2EQK A;  3GNF B;  4HA8 A;  3HPW A;  2F5T X;  2X4W A;  3V7C A;  4ELY C;  3CCS A;  4IKF A;  1H64 1;  2KDS A;  3ZEH A;  1PSE A;  4DQ2 A;  4BAC A;  1YIT T;  5DY9 A;  1YJN A;  3OYA A;  1JB0 E;  4O6J A;  4ME7 A;  4C5I A;  5LJ3 d;  5FRM A;  2RHI A;  1QVG A;  4M78 B;  3ASK A;  4A4F A;  2LT4 A;  4JS4 A;  4QQD A;  4M77 G;  4JRK A;  5CO7 A;  5GAN 2;  1BI2 A;  4C5H A;  1N9R A;  3OYD A;  4PNO A;  4RMO A;  4QQ6 A;  3CC7 A;  1YIT A;  2WSC E;  4ZGD B;  3CPF A;  2VC8 A;  1UGP B;  5DLO A;  1YIJ A;  5LJ5 j;  4NL3 A;  3HRS A;  4YTL A;  3JB9 D;  2KAF A;  3GP8 A;  4P5N A;  2X4Y A;  2DZC A;  2QQS A;  1Q82 C;  3HFO A;  4HCB A;  2AHJ B;  2ZPE B;  4OB2 B;  4XU0 A;  4M77 C;  2EQM A;  4IUT A;  5GAN 7;  3DKM A;  5IT9 E;  3QXE B;  2JVV A;  3OY9 A;  4C92 D;  3S3M A;  4BDZ A;  3A8L B;  1WQW A;  2A7Y A;  2D9T A;  2JZ2 A;  1M4Z A;  4C8Q E;  2DD4 A;  1ZBX A;  2RI3 A;  2XU8 A;  1OI1 A;  2LQK A;  1TH7 A;  2V8I A;  3S6W A;  3JB9 F;  2XDD A;  5FLX E;  4ZGE B;  4QVD A;  3JAM E;  3PIO A;  1VQN T;  2CYZ B;  3LWI A;  3CCJ T;  5GAN j;  1GXI E;  2FB7 A;  2KQW A;  1UGQ B;  2YLB A;  5LJ3 j;  1K73 C;  3L2R A;  1WGS A;  2VYT A;  2EQU A;  4HKE A;  5FRO A;  1XQH A;  3LWH A;  3TU4 K;  4KUD K;  3RER A;  3NTI A;  4PJO B;  4BY6 C;  1N27 A;  5HK0 A;  3FIF A;  3L2W A;  4M7D G;  3CCJ A;  1VQ6 A;  2CZ6 B;  3JRZ A;  2FVU A;  4VUB A;  4C92 F;  4LDV A;  4OB1 B;  3BDU A;  2KVQ G;  2FHD A;  3OBY A;  3CC4 T;  2D0Q B;  5GAM j;  2D6F A;  3GF5 A;  3VU3 C;  2DK3 A;  4J5Y A;  4XTY A;  4E7K A;  2EQJ A;  5LJ5 d;  3FRN A;  2RJD A;  3C95 A;  3DLM A;  3JCM J;  2LTO A;  1G3W A;  2LX9 A;  4A4E A;  4IUQ A;  5LJ5 f;  3E19 A;  3CC4 A;  5LJ5 g;  3JCM c;  2M1H A;  3HL8 A;  3OQ5 A;  5AYF A;  2DVE A;  1M1K U;  4M7D C;  4M7A D;  4E7L A;  2IG0 A;  3PIP A;  2PUO B;  4TVR A;  4M78 A;  2RJC A;  2XIC A;  3X24 B;  4C92 E;  4NS5 A;  4C8Q B;  3WVD B;  4A53 A;  3OYC A;  3OYF A;  3CCV T;  5IAY A;  4XTV A;  3OS0 A;  2EAY A;  2A3L A;  3BY7 A;  2OAU A;  3UT1 A;  2VXE A;  1WJS A;  2DTO A;  2LT1 A;  2E6N A;  2VUB A;  2VV5 A;  3MP1 A;  4NOY A;  4A4G A;  5M9O A;  4UC4 A;  1FXX A;  3JCM Q;  3CMA T;  3CCV A;  5GAO r;  1XOV A;  2L8D A;  3QUI A;  3VYG A;  5I2M A;  5GAN 5;  2X4X A;  3PT9 A;  1K8A U;  2RI2 A;  4N4I A;  5GAN d;  2JN0 A;  3QYG B;  1KQ2 A;  2NLU A;  3MP6 A;  3OYL A;  2QI2 A;  4J7F A;  3PGG A;  2RK2 A;  5GAN f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...