1NZ9A

Solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
58
structure length
58
Chain Sequence
AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
publication title Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
total genus 6
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1nz9A00
1KD1U 1VQOT 1VQPA 1N8RU 1K8AU 1W2BS 1YHQA 3CC2T 1VQ7T 1KC8U 2LQ8A 1VQLA 3LGFA 3CXCS 3G6EA 4YTLA 3ER0A 1Q82C 1QVGA 3CCRT 1UEBA 1YITT 3DB4A 3CCVA 1Q86U 3CCUA 1NPRA 1JJ2S 3LH0A 4ZN3A 3I56A 3G71T 3CCMA 1NJIC 1YJWA 2CKKA 1VQLT 3CPWS 3CCLA 3CCSA 2E70A 4CRIA 2DO3A 1KHIA 3CMAA 1KQSA 3CC7T 1K73C 4ZN1A 2JNGA 1VQKT 1S72A 3P8BB 2E6ZA 5LL6S 3CC4T 1YI2A 1Q86C 1VQ4T 3CCJT 1QVGS 3CD6T 1YIJA 2QEXA 3J7AF 3CCST 3KBGA 1VQ5T 3G4ST 2OTJA 1YJ9A 1YJNT 3CMAT 1VQ9T 1VQ8A 1X6OA 1Q81U 2QA4A 3OW2A 1K9MC 3TREA 2MWPA 4QQDA 1KD1C 1VQPT 2LVMA 1VQMA 1N8RC 1YHQT 1K8AC 1QVFS 1VQNA 1EIFA 2IG0A 3G6ET 1KC8C 1NPPA 1RL2A 4X34A 2QEXT 3JAME 1M90U 2L3RA 2OTLA 4RG2A 3HKSA 3CCQA 5IT9E 5FLXE 1W2BA 1VQ8T 3CCVT 1YBYA 3CMEA 3CCUT 1SSFA 3I55A 3DB3A 3I56T 3CXCA 3CCMT 3CCEA 1YJWT 1Q7YU 1VQMT 2JOYA 1VQNT 3CCLT 3J80E 1Q82U 1JJ2A 1VQ7A 2XHCA 5HY6A 1S72T 4TVRA 5J26A 3CCRA 2JVVA 1YI2T 1BKBA 1M1GA 1NJIU 1YIJT 1KQSS 1Q7YC 1IZ6A 5IAYA 1VQ6A 3LGLA 3PIOA 3OYYA 2OTJT 3CPFA 1YJ9T 1M1KU 2G3RA 3A5ZB 1XTDA 2QA4T 3J81E 1Q81C 1K73U 5DLQE 2EIFA 5DM7R 3G71A 3CC7A 2LCLA 5A2QE 2KDSA 1VQOA 1NZ9A 1VQKA 3CC4A 1XNIA 3CCJA 1VQ4A 3CC2A 1VQ6T 3DLLA 3OW2S 3CD6A 2OTLT 2MWOA 3CCQT 5J3BA 1M90C 2MI6A 2JUFA 1VQ5A 1QVFA 3G4SA 3CMET 1M1KC 3PIPA 3I55T 1YJNA 3CPWA 1VQ9A 1YITA 2KVQG 1K9MU 3CCET
chains in the Genus database with same CATH superfamily
2LJ0A 2DE0X 2E5KA 5I11A 2E6NA 3CC2T 4LDXA 2LQ8A 1D09B 1AEYA 1M5Q1 1D0YA 1VQ4Q 1RUWA 5FWCA 3CCUA 3JB9D 4OP0A 2HL3A 1YJWA 4B9XA 1VYUA 5GAMj 3CCLA 4KGVB 3SEMA 2E70A 3JB9J 1TS9A 3RUXA 1KQSA 3GNFB 1G83A 1P92A 5FRNA 1BB9A 4F7UF 3IQLA 4FYWB 4J9CA 3ZEHA 4AMCA 2DM1A 1HXDA 1M2VA 1UHCA 3CBOA 2CZ1B 1VYVA 3KBGA 4XTUA 1J3TA 4EPCA 1SPKA 2K3BA 3I5SA 1KFZA 3UA6A 1M8VA 1VQMA 2P84A 3C95A 1EIFA 4PJOD 2NUTA 4XTXA 2D9TA 4P5NA 1CKBA 1VQ8T 4RTYA 2KMTA 4J7IA 3SDZA 5GAOl 4E7KA 4FM4B 3OBWA 1PRLC 1OI1A 4L59A 1I81A 3EG3A 1Y71A 4ZGDB 1SSHA 3URGA 1QWEA 1JJ2P 5DY9A 3FC3A 1TUGB 3JCMc 4OGCA 1N9SA 2A37A 2FPDA 3MEAA 2YRVA 2EJFA 5CKBA 2LCLA 8ATCB 1BCMA 4DA4A 3CC4A 5GMKl 1KQ2A 1XNIA 4IUPA 4KT0E 5L8RE 1AZGB 4EDUA 2XICA 4C8QE 3OYDA 1VQPA 1GBQA 2NUPA 2F2VA 2F2WA 2GQVA 2KQWA 3V7CA 4E7ZA 1KC8U 3VS1A 4OF1A 1VQOQ 5GANj 4PJOA 3LH5A 1QMCA 2QTXA 2JMCA 4XTZA 4BD3A 2QTVA 1SEMA 3FLGA 3REAB 3JCMV 1H8KA 2DTHA 2EQMA 4C0FA 2YLBA 1GFCA 1MMDA 1G3SA 3MPUB 1OZ2A 4C5IA 3JB9I 4BY6B 1VYTA 2EBPA 1VQLQ 2K2VA 3OYHA 2RI2A 2QEXA 2DL3A 1YJ9A 2BTTA 5GAN4 2KT8A 1KIKA 4BI8B 3HRSA 4CC4B 2EYQA 4HCBA 1LNXA 1TSFA 1QKXA 2M02A 2DEUA 2SRCA 4JS5A 1OOTA 3BY7A 5J39A 1ABOA 1RABB 4M75D 2FRWA 1RAGB 3I56T 1SF9A 1D1BA 1MMAA 2XDBA 2BE7D 2DL8A 1SRLA 4BB7A 1QKWA 3VS6A 3J80E 5LJ3f 5GAN5 1JJ2A 4D8DA 5KYYA 3A98A 2FZGB 4CC2A 5HKCA 4TVRA 2MPXC 2RJFA 4M78F 2A28A 1YFNA 1PNJA 2BZXA 3CMEQ 3PIOA 1BK2A 4HVWA 3CCEQ 2O88A 2RHUA 2NUTB 2YUPA 2DJZA 1OEBA 1WHGA 2V8IA 1I8FA 4F7UA 1TH7A 3M5AA 4BDYA 2EKOA 3OYEA 5GAMg 2BZYA 1RLQC 4FYVB 2X4YA 2E1HA 3TVTA 2E12A 2NUZA 2AK5A 3HL8A 4LNPA 1ZBXA 4X1VA 4F04B 3NGPA 4C8QC 3ER0A 2W0ZA 2CGHA 3I5RA 1AVZC 1YITT 4Y92A 4RTTA 4L5GA 4M75A 4PNOA 2XIDA 3CCMA 3Q1JA 2CKKA 1NM7A 4BI3A 4MZMA 4M77F 2XDDA 1OX9A 1BI2A 4DBFA 3OYIA 3UT1A 3CCJT 4X9CA 3CD6T 1JO8A 4XU2A 1VQ5T 3G4ST 3FJPA 3S6WA 2OI3A 4GY5A 3V8KA 3MEUA 2KYMA 1FWZA 1Y07A 3MCAB 1RL2A 4LDVA 2HBWA 2HEQA 1MMGA 2KE9A 2I0NA 1W2BA 3G7ZA 4QQGA 2FO0A 3I55A 3X20B 2X35A 4J6YA 2RI3A 1Q81R 1VQMT 2KR3A 2JOYA 4KH1B 4GLMA 5LJ3d 2XDPA 4M78D 5KH6A 3T9NA 1WHKA 1VQNQ 1AT1B 3MP6A 1W1FA 2EQJA 1IGQA 2DZ9A 2EFIA 3E9FA 3OS0A 3VYHB 4FYYB 4KUIA 2QQAA 5CCAA 4KBMB 1S1NA 2X4WA 1KQ1A 4LE9A 2YLCA 5GANg 4M7AG 4QQ6A 1UE9A 2X4XA 1JRIA 4HCKA 1ZQ1A 4HT9A 3H6ZA 1I5OB 5I2SA 2OTLT 1PG5B 3UPUA 3PIPA 1G5VA 2EGCA 1VQ9A 1ZUUA 5KYYB 3VRYA 1UGVA 1QP2A 1ARKA 3AHUA 3L2VA 4J9BA 3QWYA 2VYTA 4R0KA 1QVGP 1OPKA 1HSQA 2AHJB 1I5LA 3TSZA 1WYXA 4RTWA 4F7UB 4M77D 1KHIA 1VUBA 3UA7A 4C8QG 1VQKT 2CZ0B 3HP9A 4M78A 3OA6A 4BE2A 1CKAA 2CS7A 5CQYA 4PJOE 3QO3A 3I56Q 2JXBA 2OTJA 2HDAA 3OW2A 1KD1C 5KYUB 3MHXA 1AHJB 3EH1A 3M4YA 3NMZC 2R5AA 2VWFA 1E7OA 1QVFS 2COZA 3KXTA 3G6ET 2QEXT 2LQNA 2BE9B 4IUQA 2QGGA 3DB3A 1Q95G 5LJ3h 2DILA 1Q82R 2K57A 4J5YA 5CO7A 3PNWC 2J6KA 1VA7A 4RMOA 2DYIA 1Q82U 1F1BB 3FRNA 2O01E 4M7DF 1AWJA 1RI9A 1S72T 4OB1B 1BI3A 1LJOA 5GAOp 1GFDA 1YCYA 2DETA 5D6WA 3VU3C 4JUVA 2K3YA 2ZCFB 1VQ6A 1ZA2B 3L2UA 1ZA1B 3INZA 2DD4A 3ZL7C 2O2OA 4M77A 3V7SA 2DTOA 1MGQA 4A63B 3TU4K 1UJ0A 2ZAEA 5DLOA 2J6FA 2RMOA 1R0CB 4DQ2A 1PD0A 3LLRA 1YJNA 2NLUA 1AWOA 3VRZA 2DK3A 4JJBA 2JTMA 2ZPFB 5GAOr 2DJQA 2RK1A 1M9SA 4AFSC 4ZTFA 4QW2A 3HRTA 1OYXA 1QVGA 2BZ8A 3CCJQ 1WHHA 3CD6Q 2L0AA 1NLOC 2FEIA 4EMKB 2RB6A 1VQ5Q 3G4SQ 2HBPA 4QVZA 3CPWS 1I4K1 2PUOB 4KUDK 3NPFA 4DBHA 2D8JA 4OMOA 2VGNA 2CH4W 3L2ZA 2Y4XA 1YWPA 1WJSA 4GBQA 2YRCA 2M1HA 4CC7A 1X6OA 2PNIA 1IO6A 4RCBA 4M75E 1BIBA 3OMGA 3VS4A 4PJOC 2DBKA 4C92F 3QZ5B 2F5KA 1JXMA 3EFSA 2L3RA 3CCQA 2W10A 5CKHA 3A8OB 1KQSP 3H8ZA 1ZUYA 1EX4A 1X2QA 1MV0B 4Z8AA 3CXCP 1GL5A 4M78B 4M7DD 3P8HA 2O9VA 5IXBA 2G6FX 3HFNA 4J9FA 1ZSZA 1T3SA 2YUQA 2FYKA 2K7AA 5LJ3j 2P4RA 3PVLA 2ED0A 1M1FA 5CKFA 2OTLQ 1UGRB 1Q7YC 4N4IA 5IAYA 2LX9A 2KY9A 3RERA 5IHIA 3G71A 3QXEB 2GNCA 3CC7A 4ZGEB 3SWNA 2QYZA 2EQKA 1K9MR 2L3PA 2RN8A 1M3CA 1N8RR 4HVVA 1M1KC 1GBRA 4NOYA 1K9MU 2EVRA 1N8RU 2F5TX 4OMNA 3UF4A 5D6XA 4RCCA 3VUZA 2CP0A 1VQKQ 2HL5C 1BI0A 1UUEA 1ZHIA 1QQJA 2EJ9A 4XU3A 4ZN3A 2YUOA 1A0NB 5GAOn 2DNUA 4M77B 3QZ9B 4ATOA 4C0DC 4MDWA 4FL6A 4XQ3A 5GAMe 2J05A 4E7IA 4M7DA 2JTEA 2JNGA 3M56A 1MNEA 2E6ZA 5LL6S 3G6EQ 3JB9G 4XTWA 1WA7A 3HSBA 2ZPHB 3OYKA 4JJNK 2FPEA 1I0CA 4EIKA 2LC4A 4C92D 2JT4A 3E2UA 4FCYA 3M0SA 3ME9A 1K8AC 2VGMA 1S72Q 4M75C 1RI0A 2GFUA 2OJ2A 2DVJA 3CXCA 2KYBA 2M9UA 1U3OA 2P4TA 4J9HA 1QVPA 5FU6C 4PJOG 1VQ7A 3QPHA 4X9DA 4RUGA 3TQ7P 3DLMA 2M16A 3OMCA 3QJYA 1M1GA 1YNZA 1WLPB 2ENMA 5I21A 4Y91A 5GAOm 4M7AE 7AT1B 5CKEA 1UECA 3TEEA 1WHLA 2C0TA 4XU0A 2QQ9A 4NS5A 4R56A 2LJ1A 5KCHA 4JLIA 2D1XA 4F14A 2VUBA 1VQ6T 3H9NA 5CQXA 4XAXB 3QHSA 2ED1A 4J9DA 2DXUA 2AT1B 1O9SA 3EG2A 3MKDA 1WJRA 3EH2A 3X25B 1V76A 3FJ5A 1ZSZB 3QJ6A 4C92A 1Q86R 3LGFA 1ZX6A 2L2PA 2RPNA 5GMKm 4IUUA 5GANe 3CCVA 1Q86U 1IRXA 3OY9A 3A1PA 1NE8A 4FT4A 2LTOA 3OYNA 3SWNB 2RQWA 1OULA 1W4SA 2DO3A 1KC8R 2ZPEB 4FU6A 1QCOA 4WCIA 5FU7C 3BW1A 5LJ5f 4E7SA 1U8RA 4J6XA 4EMGA 1YIJA 1NEBA 1K76A 3QUIA 3J7AF 3A8MB 5M9OA 2HKQB 2DL7A 2IPOB 2MYSA 4F7UG 3M58A 3M59A 2RJDA 3CMAQ 1YHQT 1Y96A 4PL6A 1K1ZA 1W6XA 2BUDA 1D1AA 1NG2A 2E3IA 1PKTA 4ANJA 4L6V5 2PZ1A 3VS5A 3GOXA 3O8VA 3EGDA 4M7DB 3I35A 1PC0A 2KBTA 3ZBDA 4J8OA 3CEYA 3HHTB 4IIMA 3CCRA 2JVVA 4M75G 4E7LA 1YI2T 1ZBJA 1UHFA 1JEGA 2BKDN 2K4YA 2CZ7B 4A53A 4AG2C 2DMOA 5GAOq 4OVAA 2KAFA 2QA4T 4LDWA 2GF7A 2KXCA 1W2BP 4M7AC 4IIOA 1VQ4A 4RTVA 1QWFA 5CR2A 4XU1A 4A4EA 1PSFA 4N0AA 2DVEA 1M3BA 2KXDA 4C0ZA 3G71T 5FRMA 3JCMf 1U1TA 3RESA 4E2FB 3M0PA 2A7YA 1LVKA 1X43A 2QK0A 2CT4A 2QDYB 3CC2Q 2DTIA 2MCNA 2BIVA 1Z9QA 3CCSA 2VASA 1N9RA 4C5EA 2RHYA 1K73C 2CP3A 2DRMA 4HVUA 3R6NA 5LJ5d 1TXQA 1M27C 1E6HA 2K3XA 5KYUA 3VS3A 3OYGA 1WJQA 1PCXA 2PVOB 1AD5A 4C92B 3RKWA 4Z88A 4DBRA 2HKNA 2RJCA 3TREA 3NHNA 3QG1A 2HZYA 4Z89A 2LT4A 2V8JA 1RLPC 4LD9K 1IB8A 1OX8A 3V8JA 3CCUT 4VUBA 1YJWT 2YSQA 1VQ8Q 4KGXB 2ROLA 3CCLT 3OYMA 4OB3B 1JXOA 2QASA 4GLKA 2LZ6B 2EQIA 2PUKB 5J26A 2HQXA 5IN1A 1SRMA 1VQ6Q 3EFRA 4HKEA 3OW2P 4AFUC 3SFMA 3PVQA 1H3ZA 1UB4A 1ZSGA 1Y96B 1Q81C 1RAFB 5IHNA 5IHKA 2KDSA 1VQOA 1NZ9A 1MMNA 4IURA 3VS7A 2RQVA 4C8QF 5GJVB 2H8HA 1Z9ZA 2J6OA 2ZPIB 3RBBB 4LDUA 1M4ZA 4DBQA 1XJWB 3OBYA 2KRNA 2KSSA 3EGDB 3MO8A 4C0GA 3JCMd 4LDYA 2V26A 2DRKA 1QLYA 1VQLA 4EMKA 3PE0A 1WQWA 4J7FA 1HYOA 4MZPA 5EC7A 1PD1A 3X24B 1KK7A 2DL5A 4A4FA 1G3WA 5LJ5h 2FL7A 4OMPA 3SHWA 1YHQQ 3CC4T 1GCQC 4ZGJB 1OZ3A 2HMAA 1PSEA 1QVGS 1U1SA 1WX6A 2LRQA 2ECZA 4II1A 2GTJA 4D8KA 4E7JA 3MEWA 4JZ3A 1VQPT 4OB0B 4BDZA 2OAWA 2RO0A 3JRZA 1R0BG 4JZ4A 2XG8D 1GRIA 2O31A 4RG2A 5GAN7 1YI2Q 2FG0A 3NTHA 5IT9E 2HNIA 4ELZC 2K9GA 2GCXA 3CMEA 2YWWA 3GNGA 5GMKh 3M53A 3FB9A 1BIAA 1PKSA 3QDFA 3CCEA 4RTUA 2C0OA 4E6RA 2QA4Q 4XTVA 3HTRA 2P0QA 5GAN2 5A0GA 1JU5C 3QYGB 3OYFA 2A3LA 2JM8A 1UJYA 1D3BA 2YHTA 1YJ9T 1XTDA 2DX1A 3MJXA 2EIFA 1OU8A 4C8QD 1SHFA 1BBZA 2GFAA 3EG9B 2EJGA 3HFOA 3JCMh 1M90C 2EYYA 3CBPA 2RJEA 1PWTA 1C1AA 1B34A 1WPYA 3OQ5A 1KD1U 3PMIA 3RKXA 1QVFP 4FSSA 3MP8A 4HCZA 3M57A 2R58A 2YDLA 3JCMW 1GCPA 3MP1A 3EGXB 4JRIA 1YITQ 4BUGA 4MMKA 1C6VX 4OGEA 4CRIA 3GBQA 2K5IA 4AFZC 4JRQA 2A36A 2O4XB 3EFOB 2FVUA 2DEQA 1LCKA 5CKDA 1N5ZA 5IXFA 4C5HA 1M8MA 1FMWA 3CCST 3CCUQ 5LJ5j 1K9AA 2WSCE 1YJWQ 1VIEA 2DA9A 1TOVA 2P0PA 4F7UE 2MWPA 1K0SA 1ZLMA 3CCLQ 3S3OA 2LVMA 3L2WA 2PU9B 4C8QA 1EZZB 2ZPGB 1VQNA 2DYBA 2FZCB 2HQHA 1UGSB 4QVCA 2A0FB 3JCMQ 2DAQA 3CCMT 3META 3DKMA 1RAEB 5KYNA 1JQQA 4AFQC 2L3SA 1HJDA 1VQMQ 3EHRA 4MMLA 3RDVA 5GMKj 4KRTA 3ZFJA 4E7HA 1KQSS 5KYXA 1XOVA 3JCMb 2QQSA 1SG5A 2G3RA 4FW2A 3LWIA 3OYJA 3H0HA 4KGZB 1SKUB 3RMSA 2MF2A 1WHMA 3SD4A 2KROA 2DLPA 1FXXA 1X75C 4E47A 3JB9F 4ZNXA 4DOWA 1TUDA 2LX7A 1X2KA 1QVFA 3I55T 1UGQB 4JDSA 3AT1B 1VQOT 1IHVA 3M54A 2OAUA 4DEYA 2GQIA 2XD0A 1X69A 1Y57A 3CBMA 3GIBA 3CC4Q 2WSEE 1WIEA 1D3BB 1BYMA 3KUFA 2KNBB 2RQRA 3VUBA 3LH0A 4UC4A 3I56A 1I07A 1NJIC 2RM4A 3X28B 2RHXA 1T3LA 1VQLT 2CUBA 3OYAA 2K79A 4R55A 2DF6A 1VQPQ 5HK0A 4PJOF 4V2SA 3VS2A 3BDLA 3QWXX 4N0AC 1RACB 4DOVA 1FX7A 5FWBA 2RH2A 1B34B 2C0IA 2P0KA 1G2BA 1IREB 2CSQA 2KEAA 2PQWA 3OB9A 2X4JA 1VQ9T 4A4HA 2CZ6B 3THKA 4IUVA 2QI2A 2FHDA 3JSCA 5CAIA 4ZTJA 4B6MA 3QYHB 2FPFA 5L23A 3JCMX 2DBMA 1ZUKA 1IGUA 3H0IA 3HKSA 5AYFA 2AKLA 3X26B 1WGSA 1U06A 2LDMA 3EGUA 4N4HA 4LUDA 4NL2A 2HAXA 2QEXQ 1YJ9Q 3KFVA 2XHCA 3QIIA 2M51A 3ASKA 2HQEA 2KRMA 4QKUA 1R8OB 4LN2A 2KK4A 2OTJT 2LQKA 4C8QB 1WNLA 1X6GA 2SEMA 2QQRA 4M78E 3J81E 4OMFB 5DM7R 5A2QE 5AT1B 1W70A 1WI7A 2CUDA 1TUCA 3CCJA 3CD6A 2AKKA 1G8XA 1K8AR 5GAN8 2LNVA 3G4SA 1VQ5A 2VB6A 2ZZDA 4XK8E 1K8AU 4LXCA 4ESRA 2DERA 4OMLA 3NTKA 5KYXB 5LJ5g 4JJCA 2ZPBB 5IH2A 1JJ2S 2IVWA 2CDTA 1JBMA 1OU9A 3CCSQ 2R57A 1PHTA 1K4US 2HSEB 1H3HA 3GP8A 2PTKA 1NEGA 1TG0A 2MOXA 1H641 4M75F 1Q86C 3M0QA 2JZ2A 1IXDA 4O6JA 2RD1A 5I2MA 4M77E 1YJNT 3CCMQ 3A8GB 1UFFA 4QQDA 4EMKC 4M4ZA 3MEVA 4PFOA 2ROTA 2EW3A 1RADB 1TTHB 4OMQA 2ATCB 2KGTA 4FW1A 2CH4A 1KC8C 4Y28E 2OTLA 3H41A 1NLPC 2DKGA 1SSFA 3QBYA 4K11A 2D0QB 3REBB 4O5VA 2EWNA 2DIQA 5KYWA 1VQNT 4HXJA 2COYA 4NL3A 1D0XA 4FSXA 4JPBW 2AZSA 5HK3A 2C06A 5LJ3g 3C0CA 2MAMA 1BKBA 3RNJA 4PJJA 2YRDA 2EAYA 2ABLA 3I55Q 3CPFA 3JCMg 4J9EA 4MZTA 3L2QA 3I9QA 4PKCC 4BI4A 2NWMA 1G3YA 1VQKA 5HCKA 4B9WA 3LW5E 1MHNA 2PVDB 4M78C 2MWOA 4LUEA 3CCQT 1WQ7A 2CT3A 3QDRB 1RAIB 3ULRB 3EG0A 3M4GA 2XI9A 3RR6A 1KHCA 2WACA 1UGPB 1W2BS 3UATA 3TCJA 1UG1A 2CSIA 2H3EB 3G6EA 1X01A 1OV3A 1KG1A 4BE1A 2YT6A 3NFCA 2HD0A 2VC8A 2AZVA 3LYIA 2Y4YA 1VQ9Q 1UTIA 2E4HA 4J83A 1NYGA 2K2MA 2DXBA 3CC7T 1U5SA 2CREA 2DD5A 1WHJA 1S72A 5GAN6 2XKOC 3C12A 4HT8A 2EGEA 2LCSA 1D1CA 4PJMA 4RG8A 1VIFA 1M2VB 4BACA 1YP5A 4M77C 2FZKB 2MMPA 1PRMC 1V29B 1VOMA 2RNAA 4JRKA 2VXFA 4ME7A 5FLXE 1RAHB 3JB9H 2OTJQ 4XTYA 2O9SA 3VKIA 1NBEB 2FB7A 5I22A 4J9GA 3VS0A 2RA2A 1HD3A 1MV3A 4M7AF 4JJDA 4WF2A 2Z0WA 2DPPB 3RIRA 4ELYC 1D0ZA 3NTIA 1K73R 2E5QA 3LGLA 2VV5A 2YUNA 4M7DE 3EG9A 2L89A 5D6YA 2EQUA 2RHZA 1K73U 1C0MA 5DLQE 3G1JA 2COWA 2D8HA 1CSKA 2QAZA 3WVEB 1WXBA 1GXIE 3EAEA 2XK0A 1WZOA 3DLLA 3GPLA 3OW2S 5CIUA 2JMAA 4OB2B 5KYWB 3UDCA 5CVIA 4RKUE 2J06A 2QQBA 4RTZA 4PLLA 1VQ7T 2EYWA 3E1SA 3N5BB 4MDXA 3EGXA 4M78G 2NUPB 5GAMf 1LOJA 2RQUA 3LX7A 4FT2A 2O4XA 2GTOA 3EFOA 4PJOB 3S3MA 1YJNQ 3E9GA 2LP5A 5CK9A 1QP3A 3CMAA 3FIFA 2NYSA 2DZCA 2J7IA 3EHQA 3P8BB 1ZSZC 2JW4A 2F2XA 2AIRB 3L42A 2JM9A 2ZGWA 4EMHA 4PFPA 1Q81U 1FMKA 4OMMA 1B3QA 3OSSC 2QDLA 4F16A 3CQTA 2WSFE 3SWNC 1M2OA 4J9IA 6AT1B 2IG0A 1NPPA 1T0JA 2L8DA 3JAME 2EGAA 1WXTA 2F69A 3CCVT 2RK2A 2EYXA 4C92E 2EPDA 3VV0A 3C94A 3OYLA 4RTXA 2DXTA 1QW1A 1FYNA 4M7AD 5GAN3 3JV3A 3S3NA 4M77G 4CC3A 1Y0MA 1UDLA 1ACMB 3PFSA 1MUZA 1N27A 4KULA 4HCCA 1JB0E 1OQKA 1YIJT 3CCQQ 2XMFA 4Z02A 2EYZA 3OYYA 4BY6C 4PJLA 3A5ZB 2K5LA 3H0FA 2E3HA 3L1AA 5KE2A 1AOJA 2L5QA 4M7DC 4ORZA 2F1LA 3M9QA 1EFNA 3M0RA 3CC2A 3P8DA 1WDXA 1TU0B 3E19A 5FW9A 3VYGA 4HA8A 1IHWA 4C0DB 5A0LA 5GMKi 3OSVA 1K0XA 3F70A 3OS5A 2DL4A 5GANf 2IIMA 2CP7A 2CP6A 3G71Q 3CC7Q 2DFUA 1Q82C 4YTLA 3PT9A 5KCOA 2VKNA 4C5GA 2A08A 3O5ZA 1QCNA 1FMVA 3PGGA 3CCRT 3WXMB 2LMJA 5GAMd 2JS2A 1NPRA 4D6WA 4JRPA 2H3JA 1H92A 2HCKA 2CP2A 1KD1R 3LWHA 1LPLA 4PJNA 5FROA 2LQWA 1BU1A 1YWOA 2KT1A 2RQTA 5C6SA 4M75B 3WVDB 1X27A 3EG1A 3GLXA 2GBQA 2V1QA 4M7AA 4JS4A 4BE0A 1M3AA 1B7TA 3M55A 1HK9A 1VQ4T 5GJWB 4A54A 1DJ7B 5FU6B 2M0YA 5KE3A 1VQ8A 2E64A 5LJ5e 2RF0A 1M90R 1BI1A 3HRUA 3BE3A 2KI7A 1WFWA 2V8KA 3FDRA 1ABQA 2QG9B 1M90U 4J6WA 2X3XD 4Q5WA 4A4GA 1YCSB 4IUTA 3QKJA 1V1CA 1E6GA 2D6FA 4PK4A 2MIOA 4C92C 2XU8A 5A0DA 5HY6A 4WTOB 2YXYA 2B86A 1MNDA 2LJ3A 4CI0C 1I1JA 5GMKe 1IZ6A 2L3QA 2JTFA 1QCFA 1O75A 3SB2A 2ESWA 4N4GA 2OX7A 1VQ7Q 3VJPA 2VXEA 4FYXB 4JLGA 1PM3A 3M0UA 2D0NA 2Y90A 4QT7A 8AT1B 1T0HA 2VVKA 3PTAA 2QGFB 5FU7B 4DEXA 5GANd 5LJ3e 1KSWA 3CPWP 1YHQA 4A4KA 2RI5A 3A8LB 5GAMh 3CXCS 2PVGB 4M7DG 2LCCA 2R5MA 2CP5A 4PLIA 2KRSA 2DXCA 1N6AA 3JCMe 3OS1A 1UEBA 3V7RA 1AZEA 1RAAB 3R6OA 1BCOA 3DB4A 3RMQA 2K5FA 4AG1C 2FRYA 4KH0B 2QXFA 3RKYA 2E10A 5C0MA 5EG2A 2X51A 2JN0A 5D7UA 4ZN1A 2DIGA 1YI2A 2CYZB 4AT1B 3OYCA 3L2RA 3QSUA 3CCVQ 1G3TA 1AWXA 3M0TA 2X9HA 2HSPA 3CMAT 1R77A 3FEOA 2I2LA 3BFMA 3JCMP 1SHGA 3TSWA 2LT1A 2QA4A 1K9MC 1WXUA 3V8LA 2E65A 4IKFA 2E41A 2GGRA 1N8RC 3GF5A 1OPLA 4X34A 3BDUA 2EKHA 1Q7YR 4PFZA 1M30A 2X3WD 1YBYA 1YIJQ 4QVDA 3OYBA 1Q7YU 9ATCB 2RHIA 4M7AB 3UWNA 2M0OA 1TWBA 3A8HB 1NJIR 2JS0A 2K6DA 3C4SA 1KJWA 1X6BA 5ECAA 1GCQA 2V1RA 1Y7XA 1M1KR 3U23A 3OS2A 1NJIU 1YN8A 1M1KU 4F17A 4FIBA 3JCMJ 1B07A 4C92G 1XQHA 3HPWA 3D7SB 2JJ9A 2LNHB 3PMTA 1AWWA 3CCRQ 5J3BA 5GANh 2MI6A 1NYFA 2JUFA 3CMET 2MK5A 4LD6A 3CPWA 1YITA 2KVQG 2B8AA 3CCET
chains in the Genus database with same CATH topology
3JCMd 2JTMA 1KHCA 2ZPFB 5GAOr 2RK1A 4LDYA 1M9SA 2E6NA 4ZTFA 2WACA 1UGPB 4QW2A 1W2BS 3HRTA 1OYXA 3CC2T 4LDXA 3TCJA 2LQ8A 1VQLA 3G6EA 4EMKA 1QVGA 1X01A 1KG1A 1WQWA 4BE1A 1M5Q1 3NFCA 4J7FA 2HD0A 4MZPA 2VC8A 3CCUA 3JB9D 3LYIA 4EMKB 2Y4YA 4OP0A 2RB6A 1YJWA 4B9XA 3X24B 5GAMj 2HBPA 4QVZA 3CPWS 3CCLA 1I4K1 2E70A 2PUOB 4KUDK 3JB9J 4A4FA 4J83A 1G3WA 2DXBA 3RUXA 5LJ5h 2FL7A 1KQSA 3CC7T 3GNFB 1P92A 2DD5A 1S72A 2VGNA 5FRNA 3L2ZA 4F7UF 3CC4T 5GAN6 2Y4XA 4ZGJB 1OZ3A 2XKOC 1WJSA 1PSEA 1QVGS 2M1HA 1U1SA 3C12A 3ZEHA 4HT8A 1HXDA 3CBOA 2LRQA 2CZ1B 3KBGA 4XTUA 4EPCA 1X6OA 4II1A 4E7JA 4RG8A 4RCBA 3MEWA 4M75E 1VIFA 1BIBA 4BACA 4OB0B 4BDZA 1VQPT 3OMGA 4PJOC 1VQMA 1M8VA 2RO0A 4M77C 4C92F 3JRZA 2MMPA 3C95A 3QZ5B 2F5KA 1EIFA 4PJOD 2XG8D 1V29B 4XTXA 3EFSA 2L3RA 4JRKA 4RG2A 2VXFA 5GAN7 2D9TA 3NTHA 4ME7A 4P5NA 5FLXE 3CCQA 5IT9E 1VQ8T 2HNIA 4ELZC 2GCXA 2KMTA 5CKHA 3CMEA 4J7IA 3SDZA 3GNGA 3A8OB 5GMKh 3M53A 4FM4B 3FB9A 1BIAA 3H8ZA 3OBWA 5GAOl 3CCEA 4E7KA 3JB9H 1OI1A 4L59A 4XTYA 3VKIA 1I81A 2FB7A 4M78B 4M7DD 3P8HA 4XTVA 1Y71A 2RA2A 4ZGDB 4M7AF 3URGA 2P0QA 3HFNA 4WF2A 5GAN2 2FYKA 5A0GA 5LJ3j 5DY9A 2DPPB 3RIRA 1M1FA 5CKFA 3QYGB 3FC3A 4ELYC 3OYFA 1UGRB 2A3LA 4OGCA 3JCMc 3NTIA 1Q7YC 4N4IA 5IAYA 2E5QA 2LX9A 1D3BA 3LGLA 1N9SA 2KY9A 2VV5A 2YHTA 1YJ9T 4M7DE 2L89A 1XTDA 3RERA 5D6YA 2EQUA 2RHZA 3MEAA 1K73U 5DLQE 2EIFA 2YRVA 2EJFA 3QXEB 2LCLA 5CKBA 4C8QD 3SWNA 4ZGEB 3G71A 3CC7A 3WVEB 1GXIE 2GFAA 4DA4A 3CC4A 5GMKl 2EJGA 3EAEA 2EQKA 1XNIA 1KQ2A 2XK0A 3HFOA 4IUPA 4KT0E 5L8RE 3DLLA 3GPLA 3OW2S 3JCMh 5CIUA 1M90C 3CBPA 4OB2B 2RJEA 4EDUA 3UDCA 1M1KC 5CVIA 2XICA 4NOYA 1WPYA 1B34A 4RKUE 1K9MU 4C8QE 3OQ5A 3OYDA 1KD1U 3PMIA 3RKXA 2QQBA 1VQPA 1N8RU 2F5TX 4PLLA 2GQVA 2KQWA 3V7CA 1VQ7T 1KC8U 4OF1A 5D6XA 4RCCA 3MP8A 3E1SA 3N5BB 4HCZA 3VUZA 5GANj 4MDXA 4PJOA 1BI0A 4M78G 2QTXA 1ZHIA 3M57A 4XTZA 2EJ9A 4XU3A 5GAMf 2R58A 1LOJA 3JCMW 4BD3A 4ZN3A 3MP1A 3LX7A 3FLGA 3JCMV 4FT2A 2O4XA 4PJOB 5GAOn 3S3MA 3E9GA 2DTHA 2EQMA 4M77B 5CK9A 3QZ9B 4JRIA 4BUGA 4C0FA 2YLBA 4MMKA 4ATOA 4OGEA 4MDWA 4C0DC 4CRIA 1G3SA 2K5IA 4JRQA 1QP3A 1OZ2A 3CMAA 4FL6A 4XQ3A 5GAMe 3FIFA 4C5IA 2O4XB 4BY6B 3JB9I 4E7IA 2DZCA 4M7DA 2FVUA 2JNGA 3P8BB 3M56A 2DEQA 2E6ZA 5LL6S 5CKDA 2K2VA 3JB9G 4C5HA 4XTWA 3OYHA 2RI2A 3L42A 2QEXA 3HSBA 2ZPHB 3CCST 3OYKA 4JJNK 2ZGWA 5LJ5j 4EMHA 1YJ9A 2WSCE 1Q81U 1VIEA 5GAN4 2P0PA 4BI8B 4F7UE 2LC4A 2MWPA 3HRSA 3OSSC 4C92D 3S3OA 2LVMA 3L2WA 2PU9B 3ME9A 4C8QA 2WSFE 2EYQA 2VGMA 3SWNC 2ZPGB 1K8AC 4HCBA 1LNXA 1VQNA 2IG0A 1NPPA 2L8DA 4M75C 3JAME 4JS5A 1RI0A 3BY7A 5J39A 1UGSB 2F69A 4M75D 4QVCA 3CCVT 2GFUA 3JCMQ 3I56T 2RK2A 2DAQA 4C92E 3CXCA 3CCMT 3META 3DKMA 2XDBA 3VV0A 2M9UA 3C94A 2P4TA 4BB7A 3OYLA 2DXTA 1QVPA 1QW1A 5FU6C 5LJ3f 5GAN5 3J80E 4PJOG 1VQ7A 1JJ2A 5GAN3 3S3NA 4M7AD 3QPHA 4M77G 4X9DA 4MMLA 5HKCA 3PFSA 4TVRA 1N27A 3DLMA 2RJFA 4KULA 4M78F 2M16A 3ZFJA 3OMCA 5GMKj 1JB0E 4E7HA 4HCCA 3QJYA 1M1GA 1YIJT 4Z02A 1KQSS 3PIOA 1XOVA 5I21A 4Y91A 3OYYA 5GAOm 4BY6C 2QQSA 3JCMb 4M7AE 5CKEA 3TEEA 2G3RA 3A5ZB 3LWIA 3OYJA 2K5LA 2RHUA 4XU0A 2QQ9A 2DJZA 4NS5A 3L1AA 3RMSA 4R56A 2MF2A 5KCHA 4JLIA 5KE2A 2L5QA 2V8IA 4M7DC 1I8FA 3SD4A 3M9QA 4F7UA 2VUBA 1TH7A 3CC2A 3P8DA 3E19A 1FXXA 1X75C 1VQ6T 3M5AA 5CQXA 3VYGA 2EKOA 4E47A 4BDYA 3JB9F 3OYEA 5GAMg 4HA8A 4DOWA 4XAXB 4C0DB 3QHSA 1QVFA 5A0LA 2X4YA 5GMKi 3I55T 2E1HA 2DXUA 3OSVA 3F70A 3OS5A 1UGQB 1O9SA 4JDSA 1VQOT 2E12A 5GANf 1WJRA 3X25B 3HL8A 3M54A 2OAUA 3QJ6A 1ZBXA 4C92A 2XD0A 3LGFA 4C8QC 1Q82C 4YTLA 3ER0A 3PT9A 5KCOA 4C5GA 3CBMA 3GIBA 2CGHA 2WSEE 3PGGA 3WXMB 4IUUA 1D3BB 5GMKm 3KUFA 5GANe 3CCRT 1YITT 3CCVA 1BYMA 5GAMd 3VUBA 1Q86U 1NPRA 3LH0A 4L5GA 4M75A 4UC4A 2H3JA 4PNOA 4D6WA 3I56A 2XIDA 3OY9A 3Q1JA 3CCMA 4JRPA 2RM4A 1NE8A 3X28B 2RHXA 1NJIC 4FT4A 2CKKA 3LWHA 2LTOA 3OYNA 3SWNB 5FROA 1VQLT 3OYAA 1W4SA 5C6SA 4R55A 2DO3A 4M75B 3WVDB 5HK0A 4PJOF 2ZPEB 3GLXA 4FU6A 4MZMA 4BI3A 4M77F 4M7AA 4JS4A 5FU7C 2XDDA 4BE0A 3BW1A 4V2SA 3BDLA 1BI2A 3OYIA 4N0AC 4DOVA 1FX7A 5LJ5f 3M55A 1HK9A 3UT1A 3CCJT 1VQ4T 4A54A 4X9CA 1U8RA 2RH2A 4J6XA 1B34B 4EMGA 1YIJA 3CD6T 1DJ7B 2P0KA 4XU2A 1IREB 3QUIA 3J7AF 2PQWA 5FU6B 3G4ST 1VQ5T 3FJPA 3A8MB 3OB9A 2X4JA 3S6WA 5KE3A 5M9OA 1VQ9T 1VQ8A 4GY5A 2E64A 4A4HA 2CZ6B 3V8KA 3MEUA 4IUVA 5LJ5e 4F7UG 1BI1A 3HRUA 2QI2A 2FHDA 3JSCA 3M58A 5CAIA 3M59A 4ZTJA 1FWZA 2RJDA 1YHQT 2V8KA 1Y96A 1Y07A 3FDRA 3MCAB 3QYHB 4PL6A 1RL2A 4LDVA 3JCMX 2BUDA 1M90U 4J6WA 3HKSA 5AYFA 4Q5WA 1W2BA 3G7ZA 4QQGA 3X26B 1WGSA 4A4GA 2LDMA 4N4HA 4NL2A 4L6V5 3I55A 3X20B 2X35A 2HAXA 4J6YA 4IUTA 3QKJA 2RI3A 3GOXA 3O8VA 1VQMT 2JOYA 4M7DB 2D6FA 5LJ3d 2XDPA 4C92C 2XU8A 2XHCA 3QIIA 3ZBDA 5HY6A 5A0DA 4M78D 5KH6A 4J8OA 3CEYA 3HHTB 3T9NA 3ASKA 2JVVA 4M75G 3CCRA 4E7LA 1YI2T 2HQEA 2BKDN 2K4YA 4CI0C 3MP6A 2EQJA 2CZ7B 2DZ9A 2EFIA 3E9FA 3OS0A 3VYHB 1R8OB 5GMKe 4KUIA 4A53A 2QQAA 1IZ6A 5CCAA 2KK4A 4KBMB 2JTFA 5GAOq 2X4WA 2OTJT 1KQ1A 2LQKA 4C8QB 2YLCA 1O75A 5GANg 1WNLA 4OVAA 4M7AG 2KAFA 2QA4T 4QQ6A 2QQRA 4M78E 3J81E 4OMFB 5DM7R 3SB2A 2X4XA 1JRIA 4LDWA 2GF7A 4N4GA 5A2QE 1ZQ1A 4M7AC 3VJPA 4HT9A 3H6ZA 2VXEA 4JLGA 1VQ4A 3CCJA 5I2SA 5CR2A 3CD6A 2OTLT 2Y90A 4XU1A 3UPUA 4A4EA 1PSFA 4N0AA 5GAN8 2LNVA 3G4SA 1VQ5A 3PIPA 1G5VA 2DVEA 3PTAA 4C0ZA 1VQ9A 3G71T 5FRMA 3JCMf 1U1TA 3RESA 5FU7B 2ZZDA 5LJ3e 5GANd 1QP2A 4XK8E 1K8AU 1YHQA 4A4KA 3AHUA 2RI5A 3A8LB 5GAMh 3L2VA 2PVGB 3CXCS 2LCCA 2A7YA 4M7DG 2R5MA 4PLIA 3NTKA 2DXCA 1N6AA 5LJ5g 3JCMe 3OS1A 1UEBA 3V7RA 3R6OA 2QDYB 2VYTA 3DB4A 3RMQA 2DTIA 2K5FA 2ZPBB 1JJ2S 2AHJB 2IVWA 1JBMA 2BIVA 2R57A 1I5LA 2QXFA 3RKYA 3CCSA 2E10A 4F7UB 4M77D 5C0MA 5EG2A 1KHIA 3GP8A 1N9RA 1VUBA 4C5EA 2RHYA 2JN0A 1K73C 4C8QG 4ZN1A 1VQKT 2DIGA 2CZ0B 3HP9A 4M78A 3OA6A 1H641 1YI2A 4M75F 1Q86C 5LJ5d 2CYZB 3OYCA 4BE2A 2JZ2A 3L2RA 2CS7A 4O6JA 2RD1A 2K3XA 3QSUA 1G3TA 5CQYA 3OYGA 1WJQA 4PJOE 3QO3A 5I2MA 2PVOB 4M77E 1YJNT 3CMAT 4C92B 3A8GB 3RKWA 2OTJA 3FEOA 2I2LA 3BFMA 3JCMP 2RJCA 2QA4A 2LT1A 3OW2A 1K9MC 3TREA 4QQDA 3V8LA 4EMKC 1KD1C 1AHJB 2E65A 3M4YA 3MEVA 2E41A 2R5AA 3MHXA 3QG1A 4IKFA 1N8RC 1QVFS 3GF5A 2LT4A 3KXTA 2V8JA 3G6ET 1KC8C 4Y28E 4X34A 3BDUA 2QEXT 2OTLA 4LD9K 3V8JA 2DKGA 1YBYA 3CCUT 4IUQA 4VUBA 1SSFA 4QVDA 3DB3A 3QBYA 5LJ3h 2D0QB 3OYBA 1YJWT 1Q7YU 2K57A 4J5YA 4O5VA 2RHIA 5CO7A 2EWNA 2DIQA 4M7AB 3PNWC 3UWNA 1VQNT 3CCLT 3OYMA 4RMOA 4OB3B 2M0OA 3A8HB 1Q82U 4NL3A 4GLKA 3FRNA 4FSXA 2O01E 3C4SA 4M7DF 5HK3A 2PUKB 1S72T 2C06A 5J26A 5LJ3g 4OB1B 3MO8A 1BI3A 1LJOA 2HQXA 1BKBA 2MAMA 1Y7XA 5IN1A 5GAOp 1YCYA 3EFRA 4HKEA 3OS2A 5D6WA 3SFMA 3VU3C 4JUVA 1NJIU 2K3YA 2ZCFB 1UB4A 1VQ6A 1H3ZA 2EAYA 3L2UA 3CPFA 3INZA 3JCMg 1M1KU 2DD4A 4FIBA 4MZTA 3JCMJ 1Y96B 3L2QA 1Q81C 4PKCC 4M77A 4BI4A 3V7SA 2KDSA 4C92G 1VQOA 2DTOA 1MGQA 1G3YA 1NZ9A 1XQHA 3HPWA 4IURA 1VQKA 4B9WA 4C8QF 3LW5E 3PMTA 3TU4K 1MHNA 2PVDB 4M78C 2ZPIB 4LDUA 1M4ZA 2MWOA 5DLOA 5J3BA 5GANh 1WQ7A 3CCQT 2MI6A 3OBYA 3QDRB 2JUFA 2KSSA 4DQ2A 3LLRA 3CMET 1YJNA 3M4GA 2NLUA 4LD6A 2XI9A 3CPWA 1YITA 2KVQG 2DK3A 2B8AA 4C0GA 3CCET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 U;  1VQO T;  1VQP A;  1N8R U;  1K8A U;  1W2B S;  1YHQ A;  3CC2 T;  1VQ7 T;  1KC8 U;  2LQ8 A;  1VQL A;  3LGF A;  3CXC S;  3G6E A;  4YTL A;  3ER0 A;  1Q82 C;  1QVG A;  3CCR T;  1UEB A;  1YIT T;  3DB4 A;  3CCV A;  1Q86 U;  3CCU A;  1NPR A;  1JJ2 S;  3LH0 A;  4ZN3 A;  3I56 A;  3G71 T;  3CCM A;  1NJI C;  1YJW A;  2CKK A;  1VQL T;  3CPW S;  3CCL A;  3CCS A;  2E70 A;  4CRI A;  2DO3 A;  1KHI A;  3CMA A;  1KQS A;  3CC7 T;  1K73 C;  4ZN1 A;  2JNG A;  1VQK T;  1S72 A;  3P8B B;  2E6Z A;  5LL6 S;  3CC4 T;  1YI2 A;  1Q86 C;  1VQ4 T;  3CCJ T;  1QVG S;  3CD6 T;  1YIJ A;  2QEX A;  3J7A F;  3CCS T;  3KBG A;  1VQ5 T;  3G4S T;  2OTJ A;  1YJ9 A;  1YJN T;  3CMA T;  1VQ9 T;  1VQ8 A;  1X6O A;  1Q81 U;  2QA4 A;  3OW2 A;  1K9M C;  3TRE A;  2MWP A;  4QQD A;  1KD1 C;  1VQP T;  2LVM A;  1VQM A;  1N8R C;  1YHQ T;  1K8A C;  1QVF S;  1VQN A;  1EIF A;  2IG0 A;  3G6E T;  1KC8 C;  1NPP A;  1RL2 A;  4X34 A;  2QEX T;  3JAM E;  1M90 U;  2L3R A;  2OTL A;  4RG2 A;  3HKS A;  3CCQ A;  5IT9 E;  5FLX E;  1W2B A;  1VQ8 T;  3CCV T;  1YBY A;  3CME A;  3CCU T;  1SSF A;  3I55 A;  3DB3 A;  3I56 T;  3CXC A;  3CCM T;  3CCE A;  1YJW T;  1Q7Y U;  1VQM T;  2JOY A;  1VQN T;  3CCL T;  3J80 E;  1Q82 U;  1JJ2 A;  1VQ7 A;  2XHC A;  5HY6 A;  1S72 T;  4TVR A;  5J26 A;  3CCR A;  2JVV A;  1YI2 T;  1BKB A;  1M1G A;  1NJI U;  1YIJ T;  1KQS S;  1Q7Y C;  1IZ6 A;  5IAY A;  1VQ6 A;  3LGL A;  3PIO A;  3OYY A;  2OTJ T;  3CPF A;  1YJ9 T;  1M1K U;  2G3R A;  3A5Z B;  1XTD A;  2QA4 T;  3J81 E;  1Q81 C;  1K73 U;  5DLQ E;  2EIF A;  5DM7 R;  3G71 A;  3CC7 A;  2LCL A;  5A2Q E;  2KDS A;  1VQO A;  1NZ9 A;  1VQK A;  3CC4 A;  1XNI A;  3CCJ A;  1VQ4 A;  3CC2 A;  1VQ6 T;  3DLL A;  3OW2 S;  3CD6 A;  2OTL T;  2MWO A;  3CCQ T;  5J3B A;  1M90 C;  2MI6 A;  2JUF A;  1VQ5 A;  1QVF A;  3G4S A;  3CME T;  1M1K C;  3PIP A;  3I55 T;  1YJN A;  3CPW A;  1VQ9 A;  1YIT A;  2KVQ G;  1K9M U;  3CCE T; 
#chains in the Genus database with same CATH topology
 2LJ0 A;  2DE0 X;  2E5K A;  5I11 A;  2E6N A;  3CC2 T;  4LDX A;  2LQ8 A;  1D09 B;  1AEY A;  1M5Q 1;  1D0Y A;  1VQ4 Q;  1RUW A;  5FWC A;  3CCU A;  3JB9 D;  4OP0 A;  2HL3 A;  1YJW A;  4B9X A;  1VYU A;  5GAM j;  3CCL A;  4KGV B;  3SEM A;  2E70 A;  3JB9 J;  1TS9 A;  3RUX A;  1KQS A;  3GNF B;  1G83 A;  1P92 A;  5FRN A;  1BB9 A;  4F7U F;  3IQL A;  4FYW B;  4J9C A;  3ZEH A;  4AMC A;  2DM1 A;  1HXD A;  1M2V A;  1UHC A;  3CBO A;  2CZ1 B;  1VYV A;  3KBG A;  4XTU A;  1J3T A;  4EPC A;  1SPK A;  2K3B A;  3I5S A;  1KFZ A;  3UA6 A;  1M8V A;  1VQM A;  2P84 A;  3C95 A;  1EIF A;  4PJO D;  2NUT A;  4XTX A;  2D9T A;  4P5N A;  1CKB A;  1VQ8 T;  4RTY A;  2KMT A;  4J7I A;  3SDZ A;  5GAO l;  4E7K A;  4FM4 B;  3OBW A;  1PRL C;  1OI1 A;  4L59 A;  1I81 A;  3EG3 A;  1Y71 A;  4ZGD B;  1SSH A;  3URG A;  1QWE A;  1JJ2 P;  5DY9 A;  3FC3 A;  1TUG B;  3JCM c;  4OGC A;  1N9S A;  2A37 A;  2FPD A;  3MEA A;  2YRV A;  2EJF A;  5CKB A;  2LCL A;  8ATC B;  1BCM A;  4DA4 A;  3CC4 A;  5GMK l;  1KQ2 A;  1XNI A;  4IUP A;  4KT0 E;  5L8R E;  1AZG B;  4EDU A;  2XIC A;  4C8Q E;  3OYD A;  1VQP A;  1GBQ A;  2NUP A;  2F2V A;  2F2W A;  2GQV A;  2KQW A;  3V7C A;  4E7Z A;  1KC8 U;  3VS1 A;  4OF1 A;  1VQO Q;  5GAN j;  4PJO A;  3LH5 A;  1QMC A;  2QTX A;  2JMC A;  4XTZ A;  4BD3 A;  2QTV A;  1SEM A;  3FLG A;  3REA B;  3JCM V;  1H8K A;  2DTH A;  2EQM A;  4C0F A;  2YLB A;  1GFC A;  1MMD A;  1G3S A;  3MPU B;  1OZ2 A;  4C5I A;  3JB9 I;  4BY6 B;  1VYT A;  2EBP A;  1VQL Q;  2K2V A;  3OYH A;  2RI2 A;  2QEX A;  2DL3 A;  1YJ9 A;  2BTT A;  5GAN 4;  2KT8 A;  1KIK A;  4BI8 B;  3HRS A;  4CC4 B;  2EYQ A;  4HCB A;  1LNX A;  1TSF A;  1QKX A;  2M02 A;  2DEU A;  2SRC A;  4JS5 A;  1OOT A;  3BY7 A;  5J39 A;  1ABO A;  1RAB B;  4M75 D;  2FRW A;  1RAG B;  3I56 T;  1SF9 A;  1D1B A;  1MMA A;  2XDB A;  2BE7 D;  2DL8 A;  1SRL A;  4BB7 A;  1QKW A;  3VS6 A;  3J80 E;  5LJ3 f;  5GAN 5;  1JJ2 A;  4D8D A;  5KYY A;  3A98 A;  2FZG B;  4CC2 A;  5HKC A;  4TVR A;  2MPX C;  2RJF A;  4M78 F;  2A28 A;  1YFN A;  1PNJ A;  2BZX A;  3CME Q;  3PIO A;  1BK2 A;  4HVW A;  3CCE Q;  2O88 A;  2RHU A;  2NUT B;  2YUP A;  2DJZ A;  1OEB A;  1WHG A;  2V8I A;  1I8F A;  4F7U A;  1TH7 A;  3M5A A;  4BDY A;  2EKO A;  3OYE A;  5GAM g;  2BZY A;  1RLQ C;  4FYV B;  2X4Y A;  2E1H A;  3TVT A;  2E12 A;  2NUZ A;  2AK5 A;  3HL8 A;  4LNP A;  1ZBX A;  4X1V A;  4F04 B;  3NGP A;  4C8Q C;  3ER0 A;  2W0Z A;  2CGH A;  3I5R A;  1AVZ C;  1YIT T;  4Y92 A;  4RTT A;  4L5G A;  4M75 A;  4PNO A;  2XID A;  3CCM A;  3Q1J A;  2CKK A;  1NM7 A;  4BI3 A;  4MZM A;  4M77 F;  2XDD A;  1OX9 A;  1BI2 A;  4DBF A;  3OYI A;  3UT1 A;  3CCJ T;  4X9C A;  3CD6 T;  1JO8 A;  4XU2 A;  1VQ5 T;  3G4S T;  3FJP A;  3S6W A;  2OI3 A;  4GY5 A;  3V8K A;  3MEU A;  2KYM A;  1FWZ A;  1Y07 A;  3MCA B;  1RL2 A;  4LDV A;  2HBW A;  2HEQ A;  1MMG A;  2KE9 A;  2I0N A;  1W2B A;  3G7Z A;  4QQG A;  2FO0 A;  3I55 A;  3X20 B;  2X35 A;  4J6Y A;  2RI3 A;  1Q81 R;  1VQM T;  2KR3 A;  2JOY A;  4KH1 B;  4GLM A;  5LJ3 d;  2XDP A;  4M78 D;  5KH6 A;  3T9N A;  1WHK A;  1VQN Q;  1AT1 B;  3MP6 A;  1W1F A;  2EQJ A;  1IGQ A;  2DZ9 A;  2EFI A;  3E9F A;  3OS0 A;  3VYH B;  4FYY B;  4KUI A;  2QQA A;  5CCA A;  4KBM B;  1S1N A;  2X4W A;  1KQ1 A;  4LE9 A;  2YLC A;  5GAN g;  4M7A G;  4QQ6 A;  1UE9 A;  2X4X A;  1JRI A;  4HCK A;  1ZQ1 A;  4HT9 A;  3H6Z A;  1I5O B;  5I2S A;  2OTL T;  1PG5 B;  3UPU A;  3PIP A;  1G5V A;  2EGC A;  1VQ9 A;  1ZUU A;  5KYY B;  3VRY A;  1UGV A;  1QP2 A;  1ARK A;  3AHU A;  3L2V A;  4J9B A;  3QWY A;  2VYT A;  4R0K A;  1QVG P;  1OPK A;  1HSQ A;  2AHJ B;  1I5L A;  3TSZ A;  1WYX A;  4RTW A;  4F7U B;  4M77 D;  1KHI A;  1VUB A;  3UA7 A;  4C8Q G;  1VQK T;  2CZ0 B;  3HP9 A;  4M78 A;  3OA6 A;  4BE2 A;  1CKA A;  2CS7 A;  5CQY A;  4PJO E;  3QO3 A;  3I56 Q;  2JXB A;  2OTJ A;  2HDA A;  3OW2 A;  1KD1 C;  5KYU B;  3MHX A;  1AHJ B;  3EH1 A;  3M4Y A;  3NMZ C;  2R5A A;  2VWF A;  1E7O A;  1QVF S;  2COZ A;  3KXT A;  3G6E T;  2QEX T;  2LQN A;  2BE9 B;  4IUQ A;  2QGG A;  3DB3 A;  1Q95 G;  5LJ3 h;  2DIL A;  1Q82 R;  2K57 A;  4J5Y A;  5CO7 A;  3PNW C;  2J6K A;  1VA7 A;  4RMO A;  2DYI A;  1Q82 U;  1F1B B;  3FRN A;  2O01 E;  4M7D F;  1AWJ A;  1RI9 A;  1S72 T;  4OB1 B;  1BI3 A;  1LJO A;  5GAO p;  1GFD A;  1YCY A;  2DET A;  5D6W A;  3VU3 C;  4JUV A;  2K3Y A;  2ZCF B;  1VQ6 A;  1ZA2 B;  3L2U A;  1ZA1 B;  3INZ A;  2DD4 A;  3ZL7 C;  2O2O A;  4M77 A;  3V7S A;  2DTO A;  1MGQ A;  4A63 B;  3TU4 K;  1UJ0 A;  2ZAE A;  5DLO A;  2J6F A;  2RMO A;  1R0C B;  4DQ2 A;  1PD0 A;  3LLR A;  1YJN A;  2NLU A;  1AWO A;  3VRZ A;  2DK3 A;  4JJB A;  2JTM A;  2ZPF B;  5GAO r;  2DJQ A;  2RK1 A;  1M9S A;  4AFS C;  4ZTF A;  4QW2 A;  3HRT A;  1OYX A;  1QVG A;  2BZ8 A;  3CCJ Q;  1WHH A;  3CD6 Q;  2L0A A;  1NLO C;  2FEI A;  4EMK B;  2RB6 A;  1VQ5 Q;  3G4S Q;  2HBP A;  4QVZ A;  3CPW S;  1I4K 1;  2PUO B;  4KUD K;  3NPF A;  4DBH A;  2D8J A;  4OMO A;  2VGN A;  2CH4 W;  3L2Z A;  2Y4X A;  1YWP A;  1WJS A;  4GBQ A;  2YRC A;  2M1H A;  4CC7 A;  1X6O A;  2PNI A;  1IO6 A;  4RCB A;  4M75 E;  1BIB A;  3OMG A;  3VS4 A;  4PJO C;  2DBK A;  4C92 F;  3QZ5 B;  2F5K A;  1JXM A;  3EFS A;  2L3R A;  3CCQ A;  2W10 A;  5CKH A;  3A8O B;  1KQS P;  3H8Z A;  1ZUY A;  1EX4 A;  1X2Q A;  1MV0 B;  4Z8A A;  3CXC P;  1GL5 A;  4M78 B;  4M7D D;  3P8H A;  2O9V A;  5IXB A;  2G6F X;  3HFN A;  4J9F A;  1ZSZ A;  1T3S A;  2YUQ A;  2FYK A;  2K7A A;  5LJ3 j;  2P4R A;  3PVL A;  2ED0 A;  1M1F A;  5CKF A;  2OTL Q;  1UGR B;  1Q7Y C;  4N4I A;  5IAY A;  2LX9 A;  2KY9 A;  3RER A;  5IHI A;  3G71 A;  3QXE B;  2GNC A;  3CC7 A;  4ZGE B;  3SWN A;  2QYZ A;  2EQK A;  1K9M R;  2L3P A;  2RN8 A;  1M3C A;  1N8R R;  4HVV A;  1M1K C;  1GBR A;  4NOY A;  1K9M U;  2EVR A;  1N8R U;  2F5T X;  4OMN A;  3UF4 A;  5D6X A;  4RCC A;  3VUZ A;  2CP0 A;  1VQK Q;  2HL5 C;  1BI0 A;  1UUE A;  1ZHI A;  1QQJ A;  2EJ9 A;  4XU3 A;  4ZN3 A;  2YUO A;  1A0N B;  5GAO n;  2DNU A;  4M77 B;  3QZ9 B;  4ATO A;  4C0D C;  4MDW A;  4FL6 A;  4XQ3 A;  5GAM e;  2J05 A;  4E7I A;  4M7D A;  2JTE A;  2JNG A;  3M56 A;  1MNE A;  2E6Z A;  5LL6 S;  3G6E Q;  3JB9 G;  4XTW A;  1WA7 A;  3HSB A;  2ZPH B;  3OYK A;  4JJN K;  2FPE A;  1I0C A;  4EIK A;  2LC4 A;  4C92 D;  2JT4 A;  3E2U A;  4FCY A;  3M0S A;  3ME9 A;  1K8A C;  2VGM A;  1S72 Q;  4M75 C;  1RI0 A;  2GFU A;  2OJ2 A;  2DVJ A;  3CXC A;  2KYB A;  2M9U A;  1U3O A;  2P4T A;  4J9H A;  1QVP A;  5FU6 C;  4PJO G;  1VQ7 A;  3QPH A;  4X9D A;  4RUG A;  3TQ7 P;  3DLM A;  2M16 A;  3OMC A;  3QJY A;  1M1G A;  1YNZ A;  1WLP B;  2ENM A;  5I21 A;  4Y91 A;  5GAO m;  4M7A E;  7AT1 B;  5CKE A;  1UEC A;  3TEE A;  1WHL A;  2C0T A;  4XU0 A;  2QQ9 A;  4NS5 A;  4R56 A;  2LJ1 A;  5KCH A;  4JLI A;  2D1X A;  4F14 A;  2VUB A;  1VQ6 T;  3H9N A;  5CQX A;  4XAX B;  3QHS A;  2ED1 A;  4J9D A;  2DXU A;  2AT1 B;  1O9S A;  3EG2 A;  3MKD A;  1WJR A;  3EH2 A;  3X25 B;  1V76 A;  3FJ5 A;  1ZSZ B;  3QJ6 A;  4C92 A;  1Q86 R;  3LGF A;  1ZX6 A;  2L2P A;  2RPN A;  5GMK m;  4IUU A;  5GAN e;  3CCV A;  1Q86 U;  1IRX A;  3OY9 A;  3A1P A;  1NE8 A;  4FT4 A;  2LTO A;  3OYN A;  3SWN B;  2RQW A;  1OUL A;  1W4S A;  2DO3 A;  1KC8 R;  2ZPE B;  4FU6 A;  1QCO A;  4WCI A;  5FU7 C;  3BW1 A;  5LJ5 f;  4E7S A;  1U8R A;  4J6X A;  4EMG A;  1YIJ A;  1NEB A;  1K76 A;  3QUI A;  3J7A F;  3A8M B;  5M9O A;  2HKQ B;  2DL7 A;  2IPO B;  2MYS A;  4F7U G;  3M58 A;  3M59 A;  2RJD A;  3CMA Q;  1YHQ T;  1Y96 A;  4PL6 A;  1K1Z A;  1W6X A;  2BUD A;  1D1A A;  1NG2 A;  2E3I A;  1PKT A;  4ANJ A;  4L6V 5;  2PZ1 A;  3VS5 A;  3GOX A;  3O8V A;  3EGD A;  4M7D B;  3I35 A;  1PC0 A;  2KBT A;  3ZBD A;  4J8O A;  3CEY A;  3HHT B;  4IIM A;  3CCR A;  2JVV A;  4M75 G;  4E7L A;  1YI2 T;  1ZBJ A;  1UHF A;  1JEG A;  2BKD N;  2K4Y A;  2CZ7 B;  4A53 A;  4AG2 C;  2DMO A;  5GAO q;  4OVA A;  2KAF A;  2QA4 T;  4LDW A;  2GF7 A;  2KXC A;  1W2B P;  4M7A C;  4IIO A;  1VQ4 A;  4RTV A;  1QWF A;  5CR2 A;  4XU1 A;  4A4E A;  1PSF A;  4N0A A;  2DVE A;  1M3B A;  2KXD A;  4C0Z A;  3G71 T;  5FRM A;  3JCM f;  1U1T A;  3RES A;  4E2F B;  3M0P A;  2A7Y A;  1LVK A;  1X43 A;  2QK0 A;  2CT4 A;  2QDY B;  3CC2 Q;  2DTI A;  2MCN A;  2BIV A;  1Z9Q A;  3CCS A;  2VAS A;  1N9R A;  4C5E A;  2RHY A;  1K73 C;  2CP3 A;  2DRM A;  4HVU A;  3R6N A;  5LJ5 d;  1TXQ A;  1M27 C;  1E6H A;  2K3X A;  5KYU A;  3VS3 A;  3OYG A;  1WJQ A;  1PCX A;  2PVO B;  1AD5 A;  4C92 B;  3RKW A;  4Z88 A;  4DBR A;  2HKN A;  2RJC A;  3TRE A;  3NHN A;  3QG1 A;  2HZY A;  4Z89 A;  2LT4 A;  2V8J A;  1RLP C;  4LD9 K;  1IB8 A;  1OX8 A;  3V8J A;  3CCU T;  4VUB A;  1YJW T;  2YSQ A;  1VQ8 Q;  4KGX B;  2ROL A;  3CCL T;  3OYM A;  4OB3 B;  1JXO A;  2QAS A;  4GLK A;  2LZ6 B;  2EQI A;  2PUK B;  5J26 A;  2HQX A;  5IN1 A;  1SRM A;  1VQ6 Q;  3EFR A;  4HKE A;  3OW2 P;  4AFU C;  3SFM A;  3PVQ A;  1H3Z A;  1UB4 A;  1ZSG A;  1Y96 B;  1Q81 C;  1RAF B;  5IHN A;  5IHK A;  2KDS A;  1VQO A;  1NZ9 A;  1MMN A;  4IUR A;  3VS7 A;  2RQV A;  4C8Q F;  5GJV B;  2H8H A;  1Z9Z A;  2J6O A;  2ZPI B;  3RBB B;  4LDU A;  1M4Z A;  4DBQ A;  1XJW B;  3OBY A;  2KRN A;  2KSS A;  3EGD B;  3MO8 A;  4C0G A;  3JCM d;  4LDY A;  2V26 A;  2DRK A;  1QLY A;  1VQL A;  4EMK A;  3PE0 A;  1WQW A;  4J7F A;  1HYO A;  4MZP A;  5EC7 A;  1PD1 A;  3X24 B;  1KK7 A;  2DL5 A;  4A4F A;  1G3W A;  5LJ5 h;  2FL7 A;  4OMP A;  3SHW A;  1YHQ Q;  3CC4 T;  1GCQ C;  4ZGJ B;  1OZ3 A;  2HMA A;  1PSE A;  1QVG S;  1U1S A;  1WX6 A;  2LRQ A;  2ECZ A;  4II1 A;  2GTJ A;  4D8K A;  4E7J A;  3MEW A;  4JZ3 A;  1VQP T;  4OB0 B;  4BDZ A;  2OAW A;  2RO0 A;  3JRZ A;  1R0B G;  4JZ4 A;  2XG8 D;  1GRI A;  2O31 A;  4RG2 A;  5GAN 7;  1YI2 Q;  2FG0 A;  3NTH A;  5IT9 E;  2HNI A;  4ELZ C;  2K9G A;  2GCX A;  3CME A;  2YWW A;  3GNG A;  5GMK h;  3M53 A;  3FB9 A;  1BIA A;  1PKS A;  3QDF A;  3CCE A;  4RTU A;  2C0O A;  4E6R A;  2QA4 Q;  4XTV A;  3HTR A;  2P0Q A;  5GAN 2;  5A0G A;  1JU5 C;  3QYG B;  3OYF A;  2A3L A;  2JM8 A;  1UJY A;  1D3B A;  2YHT A;  1YJ9 T;  1XTD A;  2DX1 A;  3MJX A;  2EIF A;  1OU8 A;  4C8Q D;  1SHF A;  1BBZ A;  2GFA A;  3EG9 B;  2EJG A;  3HFO A;  3JCM h;  1M90 C;  2EYY A;  3CBP A;  2RJE A;  1PWT A;  1C1A A;  1B34 A;  1WPY A;  3OQ5 A;  1KD1 U;  3PMI A;  3RKX A;  1QVF P;  4FSS A;  3MP8 A;  4HCZ A;  3M57 A;  2R58 A;  2YDL A;  3JCM W;  1GCP A;  3MP1 A;  3EGX B;  4JRI A;  1YIT Q;  4BUG A;  4MMK A;  1C6V X;  4OGE A;  4CRI A;  3GBQ A;  2K5I A;  4AFZ C;  4JRQ A;  2A36 A;  2O4X B;  3EFO B;  2FVU A;  2DEQ A;  1LCK A;  5CKD A;  1N5Z A;  5IXF A;  4C5H A;  1M8M A;  1FMW A;  3CCS T;  3CCU Q;  5LJ5 j;  1K9A A;  2WSC E;  1YJW Q;  1VIE A;  2DA9 A;  1TOV A;  2P0P A;  4F7U E;  2MWP A;  1K0S A;  1ZLM A;  3CCL Q;  3S3O A;  2LVM A;  3L2W A;  2PU9 B;  4C8Q A;  1EZZ B;  2ZPG B;  1VQN A;  2DYB A;  2FZC B;  2HQH A;  1UGS B;  4QVC A;  2A0F B;  3JCM Q;  2DAQ A;  3CCM T;  3MET A;  3DKM A;  1RAE B;  5KYN A;  1JQQ A;  4AFQ C;  2L3S A;  1HJD A;  1VQM Q;  3EHR A;  4MML A;  3RDV A;  5GMK j;  4KRT A;  3ZFJ A;  4E7H A;  1KQS S;  5KYX A;  1XOV A;  3JCM b;  2QQS A;  1SG5 A;  2G3R A;  4FW2 A;  3LWI A;  3OYJ A;  3H0H A;  4KGZ B;  1SKU B;  3RMS A;  2MF2 A;  1WHM A;  3SD4 A;  2KRO A;  2DLP A;  1FXX A;  1X75 C;  4E47 A;  3JB9 F;  4ZNX A;  4DOW A;  1TUD A;  2LX7 A;  1X2K A;  1QVF A;  3I55 T;  1UGQ B;  4JDS A;  3AT1 B;  1VQO T;  1IHV A;  3M54 A;  2OAU A;  4DEY A;  2GQI A;  2XD0 A;  1X69 A;  1Y57 A;  3CBM A;  3GIB A;  3CC4 Q;  2WSE E;  1WIE A;  1D3B B;  1BYM A;  3KUF A;  2KNB B;  2RQR A;  3VUB A;  3LH0 A;  4UC4 A;  3I56 A;  1I07 A;  1NJI C;  2RM4 A;  3X28 B;  2RHX A;  1T3L A;  1VQL T;  2CUB A;  3OYA A;  2K79 A;  4R55 A;  2DF6 A;  1VQP Q;  5HK0 A;  4PJO F;  4V2S A;  3VS2 A;  3BDL A;  3QWX X;  4N0A C;  1RAC B;  4DOV A;  1FX7 A;  5FWB A;  2RH2 A;  1B34 B;  2C0I A;  2P0K A;  1G2B A;  1IRE B;  2CSQ A;  2KEA A;  2PQW A;  3OB9 A;  2X4J A;  1VQ9 T;  4A4H A;  2CZ6 B;  3THK A;  4IUV A;  2QI2 A;  2FHD A;  3JSC A;  5CAI A;  4ZTJ A;  4B6M A;  3QYH B;  2FPF A;  5L23 A;  3JCM X;  2DBM A;  1ZUK A;  1IGU A;  3H0I A;  3HKS A;  5AYF A;  2AKL A;  3X26 B;  1WGS A;  1U06 A;  2LDM A;  3EGU A;  4N4H A;  4LUD A;  4NL2 A;  2HAX A;  2QEX Q;  1YJ9 Q;  3KFV A;  2XHC A;  3QII A;  2M51 A;  3ASK A;  2HQE A;  2KRM A;  4QKU A;  1R8O B;  4LN2 A;  2KK4 A;  2OTJ T;  2LQK A;  4C8Q B;  1WNL A;  1X6G A;  2SEM A;  2QQR A;  4M78 E;  3J81 E;  4OMF B;  5DM7 R;  5A2Q E;  5AT1 B;  1W70 A;  1WI7 A;  2CUD A;  1TUC A;  3CCJ A;  3CD6 A;  2AKK A;  1G8X A;  1K8A R;  5GAN 8;  2LNV A;  3G4S A;  1VQ5 A;  2VB6 A;  2ZZD A;  4XK8 E;  1K8A U;  4LXC A;  4ESR A;  2DER A;  4OML A;  3NTK A;  5KYX B;  5LJ5 g;  4JJC A;  2ZPB B;  5IH2 A;  1JJ2 S;  2IVW A;  2CDT A;  1JBM A;  1OU9 A;  3CCS Q;  2R57 A;  1PHT A;  1K4U S;  2HSE B;  1H3H A;  3GP8 A;  2PTK A;  1NEG A;  1TG0 A;  2MOX A;  1H64 1;  4M75 F;  1Q86 C;  3M0Q A;  2JZ2 A;  1IXD A;  4O6J A;  2RD1 A;  5I2M A;  4M77 E;  1YJN T;  3CCM Q;  3A8G B;  1UFF A;  4QQD A;  4EMK C;  4M4Z A;  3MEV A;  4PFO A;  2ROT A;  2EW3 A;  1RAD B;  1TTH B;  4OMQ A;  2ATC B;  2KGT A;  4FW1 A;  2CH4 A;  1KC8 C;  4Y28 E;  2OTL A;  3H41 A;  1NLP C;  2DKG A;  1SSF A;  3QBY A;  4K11 A;  2D0Q B;  3REB B;  4O5V A;  2EWN A;  2DIQ A;  5KYW A;  1VQN T;  4HXJ A;  2COY A;  4NL3 A;  1D0X A;  4FSX A;  4JPB W;  2AZS A;  5HK3 A;  2C06 A;  5LJ3 g;  3C0C A;  2MAM A;  1BKB A;  3RNJ A;  4PJJ A;  2YRD A;  2EAY A;  2ABL A;  3I55 Q;  3CPF A;  3JCM g;  4J9E A;  4MZT A;  3L2Q A;  3I9Q A;  4PKC C;  4BI4 A;  2NWM A;  1G3Y A;  1VQK A;  5HCK A;  4B9W A;  3LW5 E;  1MHN A;  2PVD B;  4M78 C;  2MWO A;  4LUE A;  3CCQ T;  1WQ7 A;  2CT3 A;  3QDR B;  1RAI B;  3ULR B;  3EG0 A;  3M4G A;  2XI9 A;  3RR6 A;  1KHC A;  2WAC A;  1UGP B;  1W2B S;  3UAT A;  3TCJ A;  1UG1 A;  2CSI A;  2H3E B;  3G6E A;  1X01 A;  1OV3 A;  1KG1 A;  4BE1 A;  2YT6 A;  3NFC A;  2HD0 A;  2VC8 A;  2AZV A;  3LYI A;  2Y4Y A;  1VQ9 Q;  1UTI A;  2E4H A;  4J83 A;  1NYG A;  2K2M A;  2DXB A;  3CC7 T;  1U5S A;  2CRE A;  2DD5 A;  1WHJ A;  1S72 A;  5GAN 6;  2XKO C;  3C12 A;  4HT8 A;  2EGE A;  2LCS A;  1D1C A;  4PJM A;  4RG8 A;  1VIF A;  1M2V B;  4BAC A;  1YP5 A;  4M77 C;  2FZK B;  2MMP A;  1PRM C;  1V29 B;  1VOM A;  2RNA A;  4JRK A;  2VXF A;  4ME7 A;  5FLX E;  1RAH B;  3JB9 H;  2OTJ Q;  4XTY A;  2O9S A;  3VKI A;  1NBE B;  2FB7 A;  5I22 A;  4J9G A;  3VS0 A;  2RA2 A;  1HD3 A;  1MV3 A;  4M7A F;  4JJD A;  4WF2 A;  2Z0W A;  2DPP B;  3RIR A;  4ELY C;  1D0Z A;  3NTI A;  1K73 R;  2E5Q A;  3LGL A;  2VV5 A;  2YUN A;  4M7D E;  3EG9 A;  2L89 A;  5D6Y A;  2EQU A;  2RHZ A;  1K73 U;  1C0M A;  5DLQ E;  3G1J A;  2COW A;  2D8H A;  1CSK A;  2QAZ A;  3WVE B;  1WXB A;  1GXI E;  3EAE A;  2XK0 A;  1WZO A;  3DLL A;  3GPL A;  3OW2 S;  5CIU A;  2JMA A;  4OB2 B;  5KYW B;  3UDC A;  5CVI A;  4RKU E;  2J06 A;  2QQB A;  4RTZ A;  4PLL A;  1VQ7 T;  2EYW A;  3E1S A;  3N5B B;  4MDX A;  3EGX A;  4M78 G;  2NUP B;  5GAM f;  1LOJ A;  2RQU A;  3LX7 A;  4FT2 A;  2O4X A;  2GTO A;  3EFO A;  4PJO B;  3S3M A;  1YJN Q;  3E9G A;  2LP5 A;  5CK9 A;  1QP3 A;  3CMA A;  3FIF A;  2NYS A;  2DZC A;  2J7I A;  3EHQ A;  3P8B B;  1ZSZ C;  2JW4 A;  2F2X A;  2AIR B;  3L42 A;  2JM9 A;  2ZGW A;  4EMH A;  4PFP A;  1Q81 U;  1FMK A;  4OMM A;  1B3Q A;  3OSS C;  2QDL A;  4F16 A;  3CQT A;  2WSF E;  3SWN C;  1M2O A;  4J9I A;  6AT1 B;  2IG0 A;  1NPP A;  1T0J A;  2L8D A;  3JAM E;  2EGA A;  1WXT A;  2F69 A;  3CCV T;  2RK2 A;  2EYX A;  4C92 E;  2EPD A;  3VV0 A;  3C94 A;  3OYL A;  4RTX A;  2DXT A;  1QW1 A;  1FYN A;  4M7A D;  5GAN 3;  3JV3 A;  3S3N A;  4M77 G;  4CC3 A;  1Y0M A;  1UDL A;  1ACM B;  3PFS A;  1MUZ A;  1N27 A;  4KUL A;  4HCC A;  1JB0 E;  1OQK A;  1YIJ T;  3CCQ Q;  2XMF A;  4Z02 A;  2EYZ A;  3OYY A;  4BY6 C;  4PJL A;  3A5Z B;  2K5L A;  3H0F A;  2E3H A;  3L1A A;  5KE2 A;  1AOJ A;  2L5Q A;  4M7D C;  4ORZ A;  2F1L A;  3M9Q A;  1EFN A;  3M0R A;  3CC2 A;  3P8D A;  1WDX A;  1TU0 B;  3E19 A;  5FW9 A;  3VYG A;  4HA8 A;  1IHW A;  4C0D B;  5A0L A;  5GMK i;  3OSV A;  1K0X A;  3F70 A;  3OS5 A;  2DL4 A;  5GAN f;  2IIM A;  2CP7 A;  2CP6 A;  3G71 Q;  3CC7 Q;  2DFU A;  1Q82 C;  4YTL A;  3PT9 A;  5KCO A;  2VKN A;  4C5G A;  2A08 A;  3O5Z A;  1QCN A;  1FMV A;  3PGG A;  3CCR T;  3WXM B;  2LMJ A;  5GAM d;  2JS2 A;  1NPR A;  4D6W A;  4JRP A;  2H3J A;  1H92 A;  2HCK A;  2CP2 A;  1KD1 R;  3LWH A;  1LPL A;  4PJN A;  5FRO A;  2LQW A;  1BU1 A;  1YWO A;  2KT1 A;  2RQT A;  5C6S A;  4M75 B;  3WVD B;  1X27 A;  3EG1 A;  3GLX A;  2GBQ A;  2V1Q A;  4M7A A;  4JS4 A;  4BE0 A;  1M3A A;  1B7T A;  3M55 A;  1HK9 A;  1VQ4 T;  5GJW B;  4A54 A;  1DJ7 B;  5FU6 B;  2M0Y A;  5KE3 A;  1VQ8 A;  2E64 A;  5LJ5 e;  2RF0 A;  1M90 R;  1BI1 A;  3HRU A;  3BE3 A;  2KI7 A;  1WFW A;  2V8K A;  3FDR A;  1ABQ A;  2QG9 B;  1M90 U;  4J6W A;  2X3X D;  4Q5W A;  4A4G A;  1YCS B;  4IUT A;  3QKJ A;  1V1C A;  1E6G A;  2D6F A;  4PK4 A;  2MIO A;  4C92 C;  2XU8 A;  5A0D A;  5HY6 A;  4WTO B;  2YXY A;  2B86 A;  1MND A;  2LJ3 A;  4CI0 C;  1I1J A;  5GMK e;  1IZ6 A;  2L3Q A;  2JTF A;  1QCF A;  1O75 A;  3SB2 A;  2ESW A;  4N4G A;  2OX7 A;  1VQ7 Q;  3VJP A;  2VXE A;  4FYX B;  4JLG A;  1PM3 A;  3M0U A;  2D0N A;  2Y90 A;  4QT7 A;  8AT1 B;  1T0H A;  2VVK A;  3PTA A;  2QGF B;  5FU7 B;  4DEX A;  5GAN d;  5LJ3 e;  1KSW A;  3CPW P;  1YHQ A;  4A4K A;  2RI5 A;  3A8L B;  5GAM h;  3CXC S;  2PVG B;  4M7D G;  2LCC A;  2R5M A;  2CP5 A;  4PLI A;  2KRS A;  2DXC A;  1N6A A;  3JCM e;  3OS1 A;  1UEB A;  3V7R A;  1AZE A;  1RAA B;  3R6O A;  1BCO A;  3DB4 A;  3RMQ A;  2K5F A;  4AG1 C;  2FRY A;  4KH0 B;  2QXF A;  3RKY A;  2E10 A;  5C0M A;  5EG2 A;  2X51 A;  2JN0 A;  5D7U A;  4ZN1 A;  2DIG A;  1YI2 A;  2CYZ B;  4AT1 B;  3OYC A;  3L2R A;  3QSU A;  3CCV Q;  1G3T A;  1AWX A;  3M0T A;  2X9H A;  2HSP A;  3CMA T;  1R77 A;  3FEO A;  2I2L A;  3BFM A;  3JCM P;  1SHG A;  3TSW A;  2LT1 A;  2QA4 A;  1K9M C;  1WXU A;  3V8L A;  2E65 A;  4IKF A;  2E41 A;  2GGR A;  1N8R C;  3GF5 A;  1OPL A;  4X34 A;  3BDU A;  2EKH A;  1Q7Y R;  4PFZ A;  1M30 A;  2X3W D;  1YBY A;  1YIJ Q;  4QVD A;  3OYB A;  1Q7Y U;  9ATC B;  2RHI A;  4M7A B;  3UWN A;  2M0O A;  1TWB A;  3A8H B;  1NJI R;  2JS0 A;  2K6D A;  3C4S A;  1KJW A;  1X6B A;  5ECA A;  1GCQ A;  2V1R A;  1Y7X A;  1M1K R;  3U23 A;  3OS2 A;  1NJI U;  1YN8 A;  1M1K U;  4F17 A;  4FIB A;  3JCM J;  1B07 A;  4C92 G;  1XQH A;  3HPW A;  3D7S B;  2JJ9 A;  2LNH B;  3PMT A;  1AWW A;  3CCR Q;  5J3B A;  5GAN h;  2MI6 A;  1NYF A;  2JUF A;  3CME T;  2MK5 A;  4LD6 A;  3CPW A;  1YIT A;  2KVQ G;  2B8A A;  3CCE T; 
#chains in the Genus database with same CATH homology
 3JCM d;  2JTM A;  1KHC A;  2ZPF B;  5GAO r;  2RK1 A;  4LDY A;  1M9S A;  2E6N A;  4ZTF A;  2WAC A;  1UGP B;  4QW2 A;  1W2B S;  3HRT A;  1OYX A;  3CC2 T;  4LDX A;  3TCJ A;  2LQ8 A;  1VQL A;  3G6E A;  4EMK A;  1QVG A;  1X01 A;  1KG1 A;  1WQW A;  4BE1 A;  1M5Q 1;  3NFC A;  4J7F A;  2HD0 A;  4MZP A;  2VC8 A;  3CCU A;  3JB9 D;  3LYI A;  4EMK B;  2Y4Y A;  4OP0 A;  2RB6 A;  1YJW A;  4B9X A;  3X24 B;  5GAM j;  2HBP A;  4QVZ A;  3CPW S;  3CCL A;  1I4K 1;  2E70 A;  2PUO B;  4KUD K;  3JB9 J;  4A4F A;  4J83 A;  1G3W A;  2DXB A;  3RUX A;  5LJ5 h;  2FL7 A;  1KQS A;  3CC7 T;  3GNF B;  1P92 A;  2DD5 A;  1S72 A;  2VGN A;  5FRN A;  3L2Z A;  4F7U F;  3CC4 T;  5GAN 6;  2Y4X A;  4ZGJ B;  1OZ3 A;  2XKO C;  1WJS A;  1PSE A;  1QVG S;  2M1H A;  1U1S A;  3C12 A;  3ZEH A;  4HT8 A;  1HXD A;  3CBO A;  2LRQ A;  2CZ1 B;  3KBG A;  4XTU A;  4EPC A;  1X6O A;  4II1 A;  4E7J A;  4RG8 A;  4RCB A;  3MEW A;  4M75 E;  1VIF A;  1BIB A;  4BAC A;  4OB0 B;  4BDZ A;  1VQP T;  3OMG A;  4PJO C;  1VQM A;  1M8V A;  2RO0 A;  4M77 C;  4C92 F;  3JRZ A;  2MMP A;  3C95 A;  3QZ5 B;  2F5K A;  1EIF A;  4PJO D;  2XG8 D;  1V29 B;  4XTX A;  3EFS A;  2L3R A;  4JRK A;  4RG2 A;  2VXF A;  5GAN 7;  2D9T A;  3NTH A;  4ME7 A;  4P5N A;  5FLX E;  3CCQ A;  5IT9 E;  1VQ8 T;  2HNI A;  4ELZ C;  2GCX A;  2KMT A;  5CKH A;  3CME A;  4J7I A;  3SDZ A;  3GNG A;  3A8O B;  5GMK h;  3M53 A;  4FM4 B;  3FB9 A;  1BIA A;  3H8Z A;  3OBW A;  5GAO l;  3CCE A;  4E7K A;  3JB9 H;  1OI1 A;  4L59 A;  4XTY A;  3VKI A;  1I81 A;  2FB7 A;  4M78 B;  4M7D D;  3P8H A;  4XTV A;  1Y71 A;  2RA2 A;  4ZGD B;  4M7A F;  3URG A;  2P0Q A;  3HFN A;  4WF2 A;  5GAN 2;  2FYK A;  5A0G A;  5LJ3 j;  5DY9 A;  2DPP B;  3RIR A;  1M1F A;  5CKF A;  3QYG B;  3FC3 A;  4ELY C;  3OYF A;  1UGR B;  2A3L A;  4OGC A;  3JCM c;  3NTI A;  1Q7Y C;  4N4I A;  5IAY A;  2E5Q A;  2LX9 A;  1D3B A;  3LGL A;  1N9S A;  2KY9 A;  2VV5 A;  2YHT A;  1YJ9 T;  4M7D E;  2L89 A;  1XTD A;  3RER A;  5D6Y A;  2EQU A;  2RHZ A;  3MEA A;  1K73 U;  5DLQ E;  2EIF A;  2YRV A;  2EJF A;  3QXE B;  2LCL A;  5CKB A;  4C8Q D;  3SWN A;  4ZGE B;  3G71 A;  3CC7 A;  3WVE B;  1GXI E;  2GFA A;  4DA4 A;  3CC4 A;  5GMK l;  2EJG A;  3EAE A;  2EQK A;  1XNI A;  1KQ2 A;  2XK0 A;  3HFO A;  4IUP A;  4KT0 E;  5L8R E;  3DLL A;  3GPL A;  3OW2 S;  3JCM h;  5CIU A;  1M90 C;  3CBP A;  4OB2 B;  2RJE A;  4EDU A;  3UDC A;  1M1K C;  5CVI A;  2XIC A;  4NOY A;  1WPY A;  1B34 A;  4RKU E;  1K9M U;  4C8Q E;  3OQ5 A;  3OYD A;  1KD1 U;  3PMI A;  3RKX A;  2QQB A;  1VQP A;  1N8R U;  2F5T X;  4PLL A;  2GQV A;  2KQW A;  3V7C A;  1VQ7 T;  1KC8 U;  4OF1 A;  5D6X A;  4RCC A;  3MP8 A;  3E1S A;  3N5B B;  4HCZ A;  3VUZ A;  5GAN j;  4MDX A;  4PJO A;  1BI0 A;  4M78 G;  2QTX A;  1ZHI A;  3M57 A;  4XTZ A;  2EJ9 A;  4XU3 A;  5GAM f;  2R58 A;  1LOJ A;  3JCM W;  4BD3 A;  4ZN3 A;  3MP1 A;  3LX7 A;  3FLG A;  3JCM V;  4FT2 A;  2O4X A;  4PJO B;  5GAO n;  3S3M A;  3E9G A;  2DTH A;  2EQM A;  4M77 B;  5CK9 A;  3QZ9 B;  4JRI A;  4BUG A;  4C0F A;  2YLB A;  4MMK A;  4ATO A;  4OGE A;  4MDW A;  4C0D C;  4CRI A;  1G3S A;  2K5I A;  4JRQ A;  1QP3 A;  1OZ2 A;  3CMA A;  4FL6 A;  4XQ3 A;  5GAM e;  3FIF A;  4C5I A;  2O4X B;  4BY6 B;  3JB9 I;  4E7I A;  2DZC A;  4M7D A;  2FVU A;  2JNG A;  3P8B B;  3M56 A;  2DEQ A;  2E6Z A;  5LL6 S;  5CKD A;  2K2V A;  3JB9 G;  4C5H A;  4XTW A;  3OYH A;  2RI2 A;  3L42 A;  2QEX A;  3HSB A;  2ZPH B;  3CCS T;  3OYK A;  4JJN K;  2ZGW A;  5LJ5 j;  4EMH A;  1YJ9 A;  2WSC E;  1Q81 U;  1VIE A;  5GAN 4;  2P0P A;  4BI8 B;  4F7U E;  2LC4 A;  2MWP A;  3HRS A;  3OSS C;  4C92 D;  3S3O A;  2LVM A;  3L2W A;  2PU9 B;  3ME9 A;  4C8Q A;  2WSF E;  2EYQ A;  2VGM A;  3SWN C;  2ZPG B;  1K8A C;  4HCB A;  1LNX A;  1VQN A;  2IG0 A;  1NPP A;  2L8D A;  4M75 C;  3JAM E;  4JS5 A;  1RI0 A;  3BY7 A;  5J39 A;  1UGS B;  2F69 A;  4M75 D;  4QVC A;  3CCV T;  2GFU A;  3JCM Q;  3I56 T;  2RK2 A;  2DAQ A;  4C92 E;  3CXC A;  3CCM T;  3MET A;  3DKM A;  2XDB A;  3VV0 A;  2M9U A;  3C94 A;  2P4T A;  4BB7 A;  3OYL A;  2DXT A;  1QVP A;  1QW1 A;  5FU6 C;  5LJ3 f;  5GAN 5;  3J80 E;  4PJO G;  1VQ7 A;  1JJ2 A;  5GAN 3;  3S3N A;  4M7A D;  3QPH A;  4M77 G;  4X9D A;  4MML A;  5HKC A;  3PFS A;  4TVR A;  1N27 A;  3DLM A;  2RJF A;  4KUL A;  4M78 F;  2M16 A;  3ZFJ A;  3OMC A;  5GMK j;  1JB0 E;  4E7H A;  4HCC A;  3QJY A;  1M1G A;  1YIJ T;  4Z02 A;  1KQS S;  3PIO A;  1XOV A;  5I21 A;  4Y91 A;  3OYY A;  5GAO m;  4BY6 C;  2QQS A;  3JCM b;  4M7A E;  5CKE A;  3TEE A;  2G3R A;  3A5Z B;  3LWI A;  3OYJ A;  2K5L A;  2RHU A;  4XU0 A;  2QQ9 A;  2DJZ A;  4NS5 A;  3L1A A;  3RMS A;  4R56 A;  2MF2 A;  5KCH A;  4JLI A;  5KE2 A;  2L5Q A;  2V8I A;  4M7D C;  1I8F A;  3SD4 A;  3M9Q A;  4F7U A;  2VUB A;  1TH7 A;  3CC2 A;  3P8D A;  3E19 A;  1FXX A;  1X75 C;  1VQ6 T;  3M5A A;  5CQX A;  3VYG A;  2EKO A;  4E47 A;  4BDY A;  3JB9 F;  3OYE A;  5GAM g;  4HA8 A;  4DOW A;  4XAX B;  4C0D B;  3QHS A;  1QVF A;  5A0L A;  2X4Y A;  5GMK i;  3I55 T;  2E1H A;  2DXU A;  3OSV A;  3F70 A;  3OS5 A;  1UGQ B;  1O9S A;  4JDS A;  1VQO T;  2E12 A;  5GAN f;  1WJR A;  3X25 B;  3HL8 A;  3M54 A;  2OAU A;  3QJ6 A;  1ZBX A;  4C92 A;  2XD0 A;  3LGF A;  4C8Q C;  1Q82 C;  4YTL A;  3ER0 A;  3PT9 A;  5KCO A;  4C5G A;  3CBM A;  3GIB A;  2CGH A;  2WSE E;  3PGG A;  3WXM B;  4IUU A;  1D3B B;  5GMK m;  3KUF A;  5GAN e;  3CCR T;  1YIT T;  3CCV A;  1BYM A;  5GAM d;  3VUB A;  1Q86 U;  1NPR A;  3LH0 A;  4L5G A;  4M75 A;  4UC4 A;  2H3J A;  4PNO A;  4D6W A;  3I56 A;  2XID A;  3OY9 A;  3Q1J A;  3CCM A;  4JRP A;  2RM4 A;  1NE8 A;  3X28 B;  2RHX A;  1NJI C;  4FT4 A;  2CKK A;  3LWH A;  2LTO A;  3OYN A;  3SWN B;  5FRO A;  1VQL T;  3OYA A;  1W4S A;  5C6S A;  4R55 A;  2DO3 A;  4M75 B;  3WVD B;  5HK0 A;  4PJO F;  2ZPE B;  3GLX A;  4FU6 A;  4MZM A;  4BI3 A;  4M77 F;  4M7A A;  4JS4 A;  5FU7 C;  2XDD A;  4BE0 A;  3BW1 A;  4V2S A;  3BDL A;  1BI2 A;  3OYI A;  4N0A C;  4DOV A;  1FX7 A;  5LJ5 f;  3M55 A;  1HK9 A;  3UT1 A;  3CCJ T;  1VQ4 T;  4A54 A;  4X9C A;  1U8R A;  2RH2 A;  4J6X A;  1B34 B;  4EMG A;  1YIJ A;  3CD6 T;  1DJ7 B;  2P0K A;  4XU2 A;  1IRE B;  3QUI A;  3J7A F;  2PQW A;  5FU6 B;  3G4S T;  1VQ5 T;  3FJP A;  3A8M B;  3OB9 A;  2X4J A;  3S6W A;  5KE3 A;  5M9O A;  1VQ9 T;  1VQ8 A;  4GY5 A;  2E64 A;  4A4H A;  2CZ6 B;  3V8K A;  3MEU A;  4IUV A;  5LJ5 e;  4F7U G;  1BI1 A;  3HRU A;  2QI2 A;  2FHD A;  3JSC A;  3M58 A;  5CAI A;  3M59 A;  4ZTJ A;  1FWZ A;  2RJD A;  1YHQ T;  2V8K A;  1Y96 A;  1Y07 A;  3FDR A;  3MCA B;  3QYH B;  4PL6 A;  1RL2 A;  4LDV A;  3JCM X;  2BUD A;  1M90 U;  4J6W A;  3HKS A;  5AYF A;  4Q5W A;  1W2B A;  3G7Z A;  4QQG A;  3X26 B;  1WGS A;  4A4G A;  2LDM A;  4N4H A;  4NL2 A;  4L6V 5;  3I55 A;  3X20 B;  2X35 A;  2HAX A;  4J6Y A;  4IUT A;  3QKJ A;  2RI3 A;  3GOX A;  3O8V A;  1VQM T;  2JOY A;  4M7D B;  2D6F A;  5LJ3 d;  2XDP A;  4C92 C;  2XU8 A;  2XHC A;  3QII A;  3ZBD A;  5HY6 A;  5A0D A;  4M78 D;  5KH6 A;  4J8O A;  3CEY A;  3HHT B;  3T9N A;  3ASK A;  2JVV A;  4M75 G;  3CCR A;  4E7L A;  1YI2 T;  2HQE A;  2BKD N;  2K4Y A;  4CI0 C;  3MP6 A;  2EQJ A;  2CZ7 B;  2DZ9 A;  2EFI A;  3E9F A;  3OS0 A;  3VYH B;  1R8O B;  5GMK e;  4KUI A;  4A53 A;  2QQA A;  1IZ6 A;  5CCA A;  2KK4 A;  4KBM B;  2JTF A;  5GAO q;  2X4W A;  2OTJ T;  1KQ1 A;  2LQK A;  4C8Q B;  2YLC A;  1O75 A;  5GAN g;  1WNL A;  4OVA A;  4M7A G;  2KAF A;  2QA4 T;  4QQ6 A;  2QQR A;  4M78 E;  3J81 E;  4OMF B;  5DM7 R;  3SB2 A;  2X4X A;  1JRI A;  4LDW A;  2GF7 A;  4N4G A;  5A2Q E;  1ZQ1 A;  4M7A C;  3VJP A;  4HT9 A;  3H6Z A;  2VXE A;  4JLG A;  1VQ4 A;  3CCJ A;  5I2S A;  5CR2 A;  3CD6 A;  2OTL T;  2Y90 A;  4XU1 A;  3UPU A;  4A4E A;  1PSF A;  4N0A A;  5GAN 8;  2LNV A;  3G4S A;  1VQ5 A;  3PIP A;  1G5V A;  2DVE A;  3PTA A;  4C0Z A;  1VQ9 A;  3G71 T;  5FRM A;  3JCM f;  1U1T A;  3RES A;  5FU7 B;  2ZZD A;  5LJ3 e;  5GAN d;  1QP2 A;  4XK8 E;  1K8A U;  1YHQ A;  4A4K A;  3AHU A;  2RI5 A;  3A8L B;  5GAM h;  3L2V A;  2PVG B;  3CXC S;  2LCC A;  2A7Y A;  4M7D G;  2R5M A;  4PLI A;  3NTK A;  2DXC A;  1N6A A;  5LJ5 g;  3JCM e;  3OS1 A;  1UEB A;  3V7R A;  3R6O A;  2QDY B;  2VYT A;  3DB4 A;  3RMQ A;  2DTI A;  2K5F A;  2ZPB B;  1JJ2 S;  2AHJ B;  2IVW A;  1JBM A;  2BIV A;  2R57 A;  1I5L A;  2QXF A;  3RKY A;  3CCS A;  2E10 A;  4F7U B;  4M77 D;  5C0M A;  5EG2 A;  1KHI A;  3GP8 A;  1N9R A;  1VUB A;  4C5E A;  2RHY A;  2JN0 A;  1K73 C;  4C8Q G;  4ZN1 A;  1VQK T;  2DIG A;  2CZ0 B;  3HP9 A;  4M78 A;  3OA6 A;  1H64 1;  1YI2 A;  4M75 F;  1Q86 C;  5LJ5 d;  2CYZ B;  3OYC A;  4BE2 A;  2JZ2 A;  3L2R A;  2CS7 A;  4O6J A;  2RD1 A;  2K3X A;  3QSU A;  1G3T A;  5CQY A;  3OYG A;  1WJQ A;  4PJO E;  3QO3 A;  5I2M A;  2PVO B;  4M77 E;  1YJN T;  3CMA T;  4C92 B;  3A8G B;  3RKW A;  2OTJ A;  3FEO A;  2I2L A;  3BFM A;  3JCM P;  2RJC A;  2QA4 A;  2LT1 A;  3OW2 A;  1K9M C;  3TRE A;  4QQD A;  3V8L A;  4EMK C;  1KD1 C;  1AHJ B;  2E65 A;  3M4Y A;  3MEV A;  2E41 A;  2R5A A;  3MHX A;  3QG1 A;  4IKF A;  1N8R C;  1QVF S;  3GF5 A;  2LT4 A;  3KXT A;  2V8J A;  3G6E T;  1KC8 C;  4Y28 E;  4X34 A;  3BDU A;  2QEX T;  2OTL A;  4LD9 K;  3V8J A;  2DKG A;  1YBY A;  3CCU T;  4IUQ A;  4VUB A;  1SSF A;  4QVD A;  3DB3 A;  3QBY A;  5LJ3 h;  2D0Q B;  3OYB A;  1YJW T;  1Q7Y U;  2K57 A;  4J5Y A;  4O5V A;  2RHI A;  5CO7 A;  2EWN A;  2DIQ A;  4M7A B;  3PNW C;  3UWN A;  1VQN T;  3CCL T;  3OYM A;  4RMO A;  4OB3 B;  2M0O A;  3A8H B;  1Q82 U;  4NL3 A;  4GLK A;  3FRN A;  4FSX A;  2O01 E;  3C4S A;  4M7D F;  5HK3 A;  2PUK B;  1S72 T;  2C06 A;  5J26 A;  5LJ3 g;  4OB1 B;  3MO8 A;  1BI3 A;  1LJO A;  2HQX A;  1BKB A;  2MAM A;  1Y7X A;  5IN1 A;  5GAO p;  1YCY A;  3EFR A;  4HKE A;  3OS2 A;  5D6W A;  3SFM A;  3VU3 C;  4JUV A;  1NJI U;  2K3Y A;  2ZCF B;  1UB4 A;  1VQ6 A;  1H3Z A;  2EAY A;  3L2U A;  3CPF A;  3INZ A;  3JCM g;  1M1K U;  2DD4 A;  4FIB A;  4MZT A;  3JCM J;  1Y96 B;  3L2Q A;  1Q81 C;  4PKC C;  4M77 A;  4BI4 A;  3V7S A;  2KDS A;  4C92 G;  1VQO A;  2DTO A;  1MGQ A;  1G3Y A;  1NZ9 A;  1XQH A;  3HPW A;  4IUR A;  1VQK A;  4B9W A;  4C8Q F;  3LW5 E;  3PMT A;  3TU4 K;  1MHN A;  2PVD B;  4M78 C;  2ZPI B;  4LDU A;  1M4Z A;  2MWO A;  5DLO A;  5J3B A;  5GAN h;  1WQ7 A;  3CCQ T;  2MI6 A;  3OBY A;  3QDR B;  2JUF A;  2KSS A;  4DQ2 A;  3LLR A;  3CME T;  1YJN A;  3M4G A;  2NLU A;  4LD6 A;  2XI9 A;  3CPW A;  1YIT A;  2KVQ G;  2DK3 A;  2B8A A;  4C0G A;  3CCE T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...