2DL8A

Solution structure of the sh3 domain of human slit-robo rho gtpase-activating protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLIT-ROBO Rho GTPase-activating protein 2
publication title Solution structure of the SH3 domain of human SLIT-ROBO Rho GTPase-activating protein 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl8A00
3VS6A 2HCKA 1I07A 1UHFA 1B3QA 1PRMC 3QWYA 1ZUYA 1PHTA 2KXDA 5L23A 2PNIA 5IH2A 1GBQA 5I11A 1Z9QA 4JJCA 2FPFA 1GL5A 2O88A 4LN2A 1AOJA 2YUOA 2EBPA 2RNAA 4LNPA 2VKNA 2V1QA 4OMOA 4HVUA 3O5ZA 2OJ2A 4AFSC 2K2MA 2DLPA 1YN8A 1H92A 1WDXA 2EQIA 1WYXA 2L0AA 2FG0A 1AZEA 2JM9A 1PKTA 2X3XD 1RUWA 1YWOA 3UATA 3PE0A 3GBQA 2EKHA 3SHWA 2GTOA 4GBQA 2BTTA 5IHKA 2D1XA 2P4RA 1EFNA 2KXCA 2J06A 1YCSB 1TUDA 3M0PA 3LH5A 3VS4A 3ULRB 1WA7A 1FMKA 2FPDA 3NGPA 1CSKA 1NYGA 3ZL7C 4HXJA 4A63B 2RQRA 3M0RA 1FYNA 2DMOA 5IHNA 2DL8A 4X1VA 2XMFA 1UE9A 2CT3A 5FWBA 2CUBA 4F14A 2ROLA 4JZ3A 1GFCA 1X6GA 2ECZA 1AD5A 4RTWA 1HD3A 4K11A 2HBWA 4OMPA 4AG2C 1U3OA 2AZVA 3QWXX 1JQQA 1WXTA 4J9HA 1AWOA 2A37A 2DJQA 2VWFA 2KT8A 2EW3A 2VVKA 2EYZA 2DL7A 2LQNA 4GLMA 3VS7A 2OI3A 5GJWB 1QKWA 5GJVB 1X6BA 1X43A 4J9DA 5EC7A 2KT1A 1T3SA 2GNCA 5I22A 4WCIA 4CC2A 3I5SA 2JS0A 1T3LA 2DYBA 3CQTA 4DEXA 2L3PA 4RTZA 4AFQC 1MV3A 2J05A 2FRYA 2GBQA 1PKSA 2GGRA 3EHQA 2JS2A 3H0HA 2RMOA 2LMJA 2C0OA 1UTIA 5HCKA 2RQVA 3NMZC 2EGEA 2RPNA 1ABOA 1JXMA 2ENMA 2J7IA 2H8HA 2KBTA 1UFFA 1RLQC 4J9EA 1I0CA 2FRWA 5ECAA 1OEBA 1UJYA 1VYTA 2CDTA 2DBKA 4HVVA 1YWPA 4HVWA 3EG0A 1QWEA 2MCNA 3TSZA 2FEIA 4F16A 1NEBA 1YP5A 1Y57A 2HSPA 2HEQA 2KRSA 2KR3A 4DEYA 2JT4A 2L3SA 4LUEA 2J6OA 4RTVA 3I5RA 1H8KA 2AK5A 3M0SA 1KIKA 2LJ0A 4AFZC 1M27C 1AEYA 1U06A 2MIOA 3H0FA 4CC4B 2IIMA 1AVZC 1KJWA 2M51A 4JJBA 1RI9A 1NYFA 4Z8AA 4ESRA 1WXUA 1TG0A 1SPKA 2L3QA 1T0HA 2EVRA 4LE9A 2L2PA 3C0CA 1WIEA 4J9BA 2EYYA 1WLPB 2K3BA 4EIKA 2KNBB 2ROTA 3EG3A 1MUZA 2D0NA 4J9IA 1SHGA 4RTYA 1E7OA 4OMMA 3VS5A 1BK2A 1AWWA 1HSQA 2CSIA 2KYMA 4Y92A 1NG2A 1QCFA 1I1JA 1OOTA 1ZUKA 2GTJA 1M3BA 3I9QA 2YDLA 1VYVA 2EGCA 2DM1A 2O9VA 4ZNXA 3U23A 2MOXA 2X3WD 1IO6A 3H0IA 1UG1A 1NLPC 1QWFA 4ORZA 1PRLC 3I35A 4OMNA 1E6HA 4E6RA 2BZ8A 2BZYA 1S1NA 1GRIA 1W70A 1K4US 2K6DA 3TSWA 3UA7A 2PTKA 4J9CA 3TVTA 2OAWA 2EGAA 1UECA 2K7AA 2KRNA 1G2BA 4Z89A 2DILA 4M4ZA 2DRMA 2D8HA 1GFDA 1A0NB 1SRMA 2KRMA 2DBMA 2C0IA 2FPEA 1ZX6A 2EPDA 4AG1C 1GBRA 1KSWA 1WI7A 1YNZA 2CSQA 2F2VA 3M0UA 2KYBA 1JXOA 3THKA 3RNJA 2JXBA 1SEMA 1CKAA 2AZSA 4RTTA 3UA6A 1SRLA 1N5ZA 2FO0A 2NWMA 2LNHB 3VS0A 2A36A 1T0JA 2KE9A 1JO8A 2DE0X 3UF4A 2DL5A 3NHNA 2QDLA 4FSSA 2ABLA 3PVLA 2YSQA 4F17A 1OPLA 1K1ZA 2C0TA 2DL4A 1UGVA 2HDAA 3M0TA 3H41A 2LP5A 1U5SA 1UDLA 1ZSGA 4RTUA 2JMAA 1X69A 2ED0A 2E5KA 4KRTA 1SSHA 1OPKA 4IIMA 1BB9A 4RUGA 5FW9A 2M0YA 1Y0MA 2RN8A 2LZ6B 1K0SA 2LJ3A 2O31A 1W1FA 2CT4A 2K79A 1V1CA 2YUQA 3JV3A 1PNJA 2BZXA 1LCKA 3REBB 2ESWA 2J6FA 2DA9A 2F2XA 3RBBB 2AKKA 2J6KA 2LCSA 1NLOC 1J3TA 3REAB 2A08A 2CREA 1ZUUA 1K0XA 2KGTA 2W10A 3VS1A 1NM7A 2D8JA 2DF6A 3VS2A 2RF0A 3EG2A 1X27A 4AFUC 3EGUA 1GCQC 1VYUA 2SEMA 3VRZA 3SEMA 4Z88A 4JJDA 2YUPA 5FWCA 2KEAA 1UJ0A 3KFVA 2CUDA 1BU1A 4HCKA 2LX7A 2PZ1A 1M30A 2JTEA 5IHIA 1ZBJA 2SRCA 3M0QA 2EYWA 2CH4A 2RQWA 1BBZA 2O2OA 3FJ5A 2G6FX 1M3AA 2GQIA 2CH4W 3NPFA 4J9GA 1WFWA 4OMQA 4CC3A 2A28A 5IXFA 3VS3A 4JZ4A 4LUDA 1WXBA 1K9AA 1NEGA 1QKXA 4J9FA 4D8KA 1TUCA 1MV0B 2I0NA 2RQUA 1X2QA 1UHCA 2JMCA 1ABQA 2DL3A 3EG1A 2YUNA 2YT6A 3A98A 1JEGA 1UUEA 2LJ1A 1GCQA 1GCPA 1AZGB 1M8MA 1HJDA 2AKLA 1JU5C 1Z9ZA 4JPBW 2DNUA 4RTXA 1H3HA 1K76A 1RLPC 1XOVA 3PVQA 1AWXA 1WX6A 1ZLMA 2EYXA 1KFZA 1VA7A 2K9GA 2O9SA 2RQTA 3EHRA 2ED1A 4R0KA 2JM8A 2V1RA 3IQLA 4CC7A 2DRKA 2DX1A 3R6NA 2DVJA 1QLYA 2F2WA 1E6GA 2NUZA 4D8DA 1CKBA 1G83A 2W0ZA 1AWJA 3VRYA 1W6XA 1OV3A 2KROA 1X2KA 4QT7A 4IIOA 1B07A 2LQWA 4OMLA 5IXBA 1ARKA 2B86A 1SHFA 1PWTA 2JW4A 1M3CA
chains in the Genus database with same CATH superfamily
1IGUA 3OA6A 1MNEA 1UGRB 2DD5A 1I07A 1B3QA 3EH2A 4EDUA 4C8QG 1PHTA 2L5QA 4LDWA 1GBQA 2CP3A 2GQVA 3DB3A 2FPFA 1Y96B 4Y28E 2YUOA 3ZEHA 2EBPA 4OMOA 2OTLA 2OJ2A 3QHSA 1RAHB 3OYYA 2CZ0B 2E65A 3JSCA 2X3XD 1M8VA 2JOYA 3QPHA 1QP2A 4M7AG 1VQ7T 3CC2Q 1C1AA 1M1KC 4M75G 2P4RA 2VYTA 4IUUA 2D6FA 3G7ZA 4QW2A 2FPDA 4B9XA 4FW2A 3ZL7C 3V7SA 4A63B 4C8QE 2FL7A 1C6VX 3A8MB 3RMSA 3CCVQ 1BI3A 2DL8A 4PLIA 4LD6A 5I21A 2LNVA 1UE9A 1SSFA 1Y7XA 1HYOA 5FWBA 2CUBA 1OYXA 2D9TA 4F14A 4BACA 1GFCA 1HD3A 5I2SA 3CCUT 4DQ2A 1U3OA 2AZVA 2AT1B 1VQ7Q 4HT9A 2DJQA 2KT8A 2EW3A 4M7AE 2LQNA 4LD9K 5GAN7 4M75E 1X43A 4J9DA 1T3SA 4C5EA 1T3LA 4FSXA 2FRYA 2GGRA 3G71T 2VB6A 4C8QD 2EGEA 5KCHA 2ENMA 4YTLA 1SG5A 2EYQA 1I8FA 2CDTA 1UJYA 4N0AA 4HVVA 2YRCA 3EG0A 3OYHA 4M78G 2E4HA 4IURA 1N8RR 2LQ8A 4F16A 3QYGB 1NEBA 3RDVA 2DZCA 1N8RC 1YP5A 2HSPA 5GAMf 2RA2A 2DETA 1YHQT 1X75C 5IN1A 4BY6B 1H8KA 2QQSA 4EPCA 2RM4A 2ZAEA 1AEYA 3H0FA 2EJFA 5GAMj 5GAMh 1O9SA 3EH1A 3OQ5A 1SPKA 2X4YA 2AHJB 3C0CA 3G71Q 1D1AA 3FIFA 4BI8B 5DM7R 1X6OA 4DBFA 4OF1A 4M77B 2CZ7B 2QTVA 1E7OA 1WZOA 4ZGDB 1QCFA 4M7AF 2LVMA 1OOTA 3DKMA 2QAZA 4OB3B 2COWA 4M78E 2PU9B 4M75F 1OQKA 3CEYA 1WGSA 1YHQQ 1QWFA 2YXYA 4PL6A 3G6EA 3PNWC 3JCMb 3MPUB 3CCRA 5KYNA 4E7SA 3JB9I 1E6HA 2BZ8A 1IZ6A 1W70A 3TSWA 2QQBA 4A4GA 5D6XA 2QQRA 3OYAA 3RKWA 2X9HA 2PTKA 2XD0A 1TS9A 3MP8A 3PFSA 3FDRA 2KRNA 1VQ6T 3FRNA 4BD3A 5D6YA 1YIJA 2HD0A 3GP8A 2HAXA 3FJPA 4ZGJB 4E7ZA 2RB6A 2EQMA 3RNJA 4C0FA 3I56T 1VQ8Q 1K73U 2F69A 1N5ZA 2OX7A 2A36A 1T0JA 1BCOA 3EGXA 3RKXA 2DE0X 2RH2A 5CKFA 2V26A 4DOVA 4F04B 4FSSA 2ABLA 3CD6T 4F17A 2DZ9A 2HDAA 2NLUA 3MP1A 2X4WA 1FMVA 2Y4YA 4X9DA 1MMDA 4TVRA 4ATOA 4EMHA 1RACB 4QQGA 1VQ6Q 2MF2A 3CC2A 3OYKA 2M0YA 3C94A 5A0GA 2KSSA 2KAFA 4M78F 5HY6A 1V29B 5CO7A 2YUQA 4OB0B 3SD4A 1PNJA 3I56Q 2JJ9A 5DLQE 2BZXA 3REBB 2DKGA 2J6FA 4XTUA 3URGA 5KYWA 2RD1A 2A08A 2HL3A 3HSBA 5GAN8 2W10A 1N9SA 2R58A 1KC8C 2PUKB 3CD6Q 1TSFA 4C92B 5GAMe 1MMNA 1VQ9T 2DF6A 2COYA 2RF0A 3EG2A 4AFUC 4R55A 3EGUA 3CPWP 2GFUA 1NPRA 4XU0A 2ZZDA 4Z88A 4JJDA 2BKDN 5FWCA 2WACA 3KFVA 1VQ7A 3HPWA 3G1JA 2QA4T 5KYXB 2CUDA 4HCKA 3NTHA 2LX7A 4J6YA 3PTAA 2JTEA 2CP6A 2V8IA 5GAOp 4MDXA 2VC8A 2CH4A 3A1PA 1QVFA 2RQWA 3OY9A 3OW2P 5CKDA 2QTXA 1BI0A 1BBZA 2G6FX 2PQWA 2GQIA 4Y91A 3Q1JA 3NPFA 4J9GA 1FMWA 3CCJT 2YRDA 1WFWA 2VV5A 4CC3A 5IXFA 3MP6A 4WF2A 4PJOA 2XHCA 1VQ9Q 5LJ5g 5CAIA 2KQWA 3INZA 3S3OA 2HZYA 1QKXA 3BFMA 1GXIE 4J9FA 3JRZA 1UHCA 1VIFA 2JMCA 3CCUA 4MMKA 1ABQA 4O5VA 5GANd 4EMKB 3SWNB 1W2BS 1UUEA 4M7DA 2QA4Q 5CQXA 1KQSP 1OU8A 1JU5C 1Z9ZA 2DNUA 1RLPC 3DB4A 1U8RA 1ZLMA 3HTRA 4F7UG 3HHTB 3V7RA 1QQJA 2RHIA 2XK0A 2CP5A 4X9CA 1G3TA 1YITT 2OTJT 3CCJQ 2VXEA 1IXDA 5HK3A 3R6NA 2DVJA 4FYYB 4FCYA 3G71A 5FLXE 2ZGWA 5GAN4 2X51A 1G83A 3MEAA 1XJWB 2MMPA 4KT0E 1WHHA 1X2KA 3CBPA 4IIOA 2P0PA 3MCAB 1VQNQ 2LT4A 2K5FA 4QVZA 3PIPA 4LDXA 2XI9A 5GAMd 2B86A 1SHFA 5FU7B 1PWTA 3WVEB 3HFNA 3VS6A 2HCKA 1UHFA 3NTKA 2FVUA 3M4YA 4PJJA 5KE2A 5I11A 4ZGEB 1YHQA 1Q81U 1Y07A 1WHGA 2BE7D 4C0ZA 4KGZB 2VKNA 2AIRB 4F7UE 1Q82U 4ELYC 1YITQ 2OTJQ 1BI2A 2FZCB 1PSFA 3MHXA 1WDXA 5GAN3 1WYXA 2L0AA 2FG0A 5C6SA 1PKTA 4OP0A 1LNXA 3PE0A 3GBQA 2LT1A 3WXMB 4HCCA 4OGEA 3CC4T 3RMQA 1M2VA 1D3BB 2CGHA 2HL5C 2D1XA 2K2VA 5KCOA 3JCMW 4PJOD 2MWPA 3ULRB 1FMKA 1LPLA 4MMLA 1QVGP 1YBYA 3M0RA 3ASKA 1FYNA 5IHNA 2CYZB 3GPLA 4N0AC 4M7DD 3JCMP 1TOVA 2EJ9A 1K9MU 2ECZA 1WJQA 1AD5A 4RTWA 4C0DB 2E12A 4AG2C 1U1TA 1JQQA 1VQ6A 6AT1B 1K8AC 2DXCA 2PVOB 1AWOA 1YJ9T 3CC4Q 1HK9A 2XIDA 1BI1A 2XDPA 2VVKA 4PFPA 2DL7A 4GLMA 3VS7A 5GJWB 1QKWA 5GJVB 1K9MR 1PC0A 2CP2A 1D0YA 4RCCA 5EC7A 2QGGA 5GAOm 4KUIA 2YRVA 4WCIA 2RK2A 3I56A 4HKEA 3I5SA 2JS0A 3C12A 4A4EA 4DEXA 4KGXB 1WHJA 1ZSZB 2G3RA 3LH0A 4F7UF 2LMJA 2F5TX 3MEWA 3NMZC 3CD6A 2RPNA 1ABOA 1JXMA 1Y96A 4RCBA 2JZ2A 2DBKA 3M58A 8AT1B 1EIFA 3RKYA 4FYXB 3FEOA 1YJ9Q 2RHUA 2K5IA 2FEIA 5A2QE 3P8DA 3OS5A 3S6WA 2HEQA 2JT4A 2L3SA 2J6OA 3QIIA 2HNIA 4RTVA 3CCVT 3I5RA 2AK5A 3M0SA 4UC4A 2LJ0A 5AT1B 4E7JA 2QG9B 1AVZC 3QO3A 2XKOC 4JJBA 1RI9A 3CMET 4GLKA 4Z8AA 3VKIA 1NJIU 3L42A 2L3QA 1T0HA 2E64A 2L2PA 4DBRA 1WIEA 4QVDA 2YHTA 3NTIA 2K3BA 4EIKA 4C5IA 1R77A 2ROTA 4DBQA 1BKBA 3SB2A 1VQ9A 5GAOn 3EG3A 4PJLA 2K4YA 4RTYA 2ZPEB 3L2WA 4C8QB 1PCXA 4A4HA 1QCNA 4Y92A 4RKUE 2E1HA 5KYYB 2GTJA 3I9QA 4E47A 2QA4A 3U23A 2VASA 3L2UA 3LYIA 5IT9E 3H0IA 4A4KA 4R56A 5KYUA 1I5LA 2X35A 3JCMf 2RI3A 3SDZA 3EG9B 4D6WA 2XICA 1WJRA 3M54A 3TCJA 3CMEQ 4E6RA 4XQ3A 1UGSB 1K4US 3JCMh 1RADB 4M7AB 3TQ7P 1W4SA 3UA7A 3CCJA 4J9CA 4ANJA 3D7SB 2EGAA 4M75B 1UECA 5KYUB 1G2BA 4BE0A 5C0MA 2MK5A 4IKFA 5FU6B 1SRMA 5GANf 2MAMA 2DBMA 3EFRA 4VUBA 3ZBDA 3UT1A 2PUOB 4XTVA 1YNZA 3GLXA 1B34A 1ZQ1A 1QVFP 2BIVA 2JXBA 5GANh 5GANj 1CKAA 2NUTB 3UA6A 1SRLA 3CCLT 4C5GA 2NWMA 2LNHB 3VS0A 1YI2Q 3QZ5B 2DL5A 3MEVA 3NHNA 3PVLA 2ATCB 1OU9A 1OPLA 3GNGA 2C0TA 2RHXA 2RJEA 5CKHA 2V8JA 1B34B 1YITA 2OTJA 1NPPA 2LP5A 1U5SA 1KG1A 2JMAA 4IUTA 4BUGA 3CXCA 3H9NA 4KRTA 3L2RA 2C06A 1BB9A 2VUBA 1VQPT 2EIFA 4FT4A 1Y0MA 1W1FA 3ZFJA 2K79A 4M77A 4JDSA 4C8QF 1SF9A 1LCKA 5DLOA 2DA9A 3CCLQ 2RJDA 3RBBB 4PJOC 2RI2A 2LCSA 3REAB 1JJ2A 1R8OB 4JRPA 3VS1A 1G3YA 2HBPA 1KHIA 3M53A 4A53A 3VS2A 4FM4B 3FC3A 4M78B 1X27A 4M7DC 1QVFS 3OYCA 3VRZA 1JBMA 4ZN3A 2P4TA 2P0KA 3M5AA 1I5OB 2QGFB 3BE3A 1VQPQ 2KK4A 1BU1A 2Z0WA 4FT2A 4MDWA 5LJ3f 1VQ8T 3CC4A 4C5HA 2D0QB 1M30A 1WQ7A 2K5LA 5FRNA 2EYWA 3H6ZA 2DEQA 5FU7C 1D0XA 3OYIA 5GMKm 2O2OA 3FJ5A 1Q7YU 1FXXA 4FIBA 4RMOA 4DA4A 2MPXC 1OZ3A 4JZ4A 3X24B 1KD1U 2LTOA 3JCMe 1MHNA 1TUCA 1NBEB 1X2QA 2KI7A 2K3YA 4IUQA 1MGQA 2FZGB 2QASA 1YJ9A 1HJDA 2YLCA 3L1AA 4RTXA 1H3HA 1K76A 1XOVA 5HK0A 2EQJA 3PVQA 1AWXA 1WX6A 2EYXA 4QQDA 1M90U 1KFZA 5GANe 2JTMA 2R57A 1VA7A 2K9GA 2PVGB 2EAYA 3EHRA 2ED1A 4R0KA 5GAOl 3IQLA 1K73R 1VQKT 2DRKA 3RERA 2DX1A 4PK4A 4XK8E 5M9OA 1K73C 4M77D 2OAUA 3OS1A 1M90R 2W0ZA 4C0GA 2KROA 4QT7A 3X20B 4HCZA 3QYHB 4C92A 4C0DC 4OMLA 5KE3A 5IXBA 3OYGA 1U1SA 1ARKA 3TU4K 2JW4A 2H3EB 1ZUYA 2FHDA 5L23A 1W2BP 4FYVB 5KYXA 1VOMA 4LN2A 2HKNA 3CCVA 2RNAA 2V1QA 4HVUA 3CMEA 2DVEA 1VQKQ 5CQYA 2EJGA 2K2MA 5KH6A 2R5AA 2E10A 2CZ1B 3M59A 5CKEA 2EQIA 2JM9A 4BDZA 1RUWA 1YWOA 3UATA 5GAOq 3BDLA 3LX7A 5A0DA 1G8XA 2WSFE 3LWIA 3CMAT 2GTOA 4J6WA 5IHKA 1EX4A 3V7CA 1EFNA 2KXCA 2J06A 5IAYA 1R0BG 1YCSB 3LH5A 3VS4A 5J39A 3OBYA 2HMAA 1WA7A 3L2QA 3JCMd 1YJNT 2RJFA 4EMKA 1MMAA 4O6JA 3SWNA 2RQRA 3UWNA 4MZMA 2V8KA 2QQ9A 1OULA 1DJ7B 4PJOG 2FB7A 4ZN1A 2CT3A 2OTLQ 2DFUA 4LDYA 3PMIA 3OSSC 4JZ3A 1X6GA 1WHLA 4CI0C 1VQNT 1O75A 3LWHA 3HRTA 1JRIA 2HBWA 1H641 3HL8A 1ZA2B 3GF5A 1B7TA 3QZ9B 1Q95G 3MKDA 1WXTA 2RK1A 4M7DG 3CMAQ 2A37A 4QQ6A 3E19A 3OYEA 5D7UA 4RG8A 3RR6A 1WJSA 3A5ZB 1YJNQ 1KHCA 2DO3A 4XTZA 3OYFA 2DYBA 2ZPGB 3PIOA 2ZPIB 2E70A 3CCLA 3CQTA 2IG0A 2L3PA 4C92D 3UDCA 1MV3A 2J05A 4A54A 1AHJB 1PKSA 1RAGB 2JS2A 2RMOA 2RQVA 4MZTA 5GMKi 4PJOE 2LX9A 4J9EA 1I0CA 1IRXA 2FRWA 1VYTA 4X34A 4OMFB 3V8JA 1QWEA 4PJNA 4E2FB 3RESA 3EGDB 3HRSA 3E1SA 3JAME 3CCMT 1VQPA 2ZCFB 3AHUA 4M7DE 1Y57A 2KRSA 2KR3A 4F7UB 4LUEA 4J5YA 3JCMc 1I81A 1D3BA 1KIKA 3UPUA 4AFZC 3VYGA 1U06A 1V76A 2MIOA 2DXTA 2KDSA 1D09B 1NYFA 3OYNA 4ESRA 1WXUA 1PD0A 2EVRA 2DJZA 2DTOA 2WSEE 3VJPA 4J9BA 2EYYA 2DIQA 3CBMA 1WLPB 4E7KA 1Q81R 2KNBB 3CXCP 3JCMV 1Q81C 1MUZA 3JCMX 1XTDA 4PFZA 2QEXT 1SHGA 1KQ1A 1Q82R 3CC7T 1RL2A 5LJ3d 1BK2A 1Y71A 3CPFA 1Q82C 1HSQA 2CSIA 4XTWA 1QW1A 2E6ZA 4L59A 3KXTA 3CCMQ 2YDLA 2BUDA 4DOWA 1VIEA 1VQ8A 5GAMg 2X3WD 1IO6A 4JLGA 1UG1A 4ORZA 1VQLT 1PRLC 4BY6C 3G4ST 4HT8A 5GAN6 4J8OA 4FL6A 4RG2A 2DAQA 3MEUA 4B6MA 5GMKl 2YWWA 1S1NA 1TU0B 3TVTA 4PJOF 4KBMB 2QK0A 4AT1B 3P8HA 1ZSZA 2DRMA 2QEXQ 3JCMQ 2D8HA 2VGNA 4GY5A 1A0NB 4M77C 3CC7Q 2EWNA 2KRMA 2DXBA 2C0IA 1ZX6A 2CP0A 1KSWA 1WI7A 3M0UA 3THKA 5GAOr 2KYBA 1JXOA 1K9MC 4M7DF 3P8BB 4DBHA 2DPPB 2MYSA 2JTFA 5EG2A 4RTTA 3CXCS 4QVCA 4J6XA 1QMCA 1VQLQ 1Q86U 1VQOT 2HSEB 3G4SQ 2KVQG 3OB9A 3BDUA 3TEEA 1N6AA 2PVDB 2VGMA 1UGVA 3TREA 1H3ZA 3S3MA 3H41A 3CCST 3I55T 1VQKA 1UDLA 1ZSGA 4RTUA 1M1GA 2DD4A 2JNGA 1F1BB 5L8RE 1Q86R 2ED0A 3F70A 1JJ2S 2KMTA 4IIMA 2DK3A 5FW9A 8ATCB 3CPWA 3FB9A 1AT1B 2RHZA 2KY9A 2CT4A 1N27A 4ZTFA 1RAFB 1M1FA 4C8QA 4ZTJA 2F2XA 2AKKA 2E3IA 1VQOQ 4JUVA 3OS0A 5KYYA 3EFOB 2KGTA 3BY7A 3JB9H 3OYLA 1M1KU 1RAIB 3OW2A 2E3HA 2A3LA 4FYWB 3JB9J 3CCSQ 5LJ5f 3I55Q 3EG9A 2H3JA 5J3BA 1UB4A 1NJIR 3JCMJ 1VYUA 2SEMA 1BIBA 3CCQT 3LLRA 1NJIC 2KEAA 4M7AA 1UJ0A 5LJ5h 5LJ5j 1PM3A 3CMAA 3VYHB 1M1KR 3GOXA 4M75A 2LCLA 2PZ1A 2QXFA 2SRCA 1YI2T 3E9FA 1HXDA 3META 1OI1A 2Y4XA 4V2SA 1YJNA 4J83A 4JS4A 4Q5WA 1QCOA 1KQSA 2DIGA 2CH4W 1MMGA 3EAEA 1OX9A 1ZA1B 2NUTA 3OBWA 3QJYA 2A28A 2L8DA 3VS3A 4C92C 1VQMT 4BI4A 5CK9A 4XTXA 1K9AA 4L5GA 4ME7A 1I4K1 1MV0B 3LW5E 2RQUA 1VQNA 4IUVA 1LVKA 3CCQQ 2DL3A 3N5BB 3EG1A 1VUBA 3A98A 2HKQB 3H8ZA 1GCQA 1GCPA 1AZGB 4XTYA 1BYMA 1M8MA 3AT1B 2AKLA 5I2MA 1WHKA 5CIUA 2BE9B 4PLLA 3MJXA 2O9SA 1G3WA 2JM8A 1WPYA 2QDYB 2K3XA 3BW1A 5GMKh 5GMKj 1C0MA 3A8OB 1VQMQ 1N8RU 1XNIA 4HCBA 2F2WA 2NUZA 3M55A 1CKBA 4D8DA 3HRUA 1EZZB 1TH7A 2DXUA 3HKSA 4EMKC 3CCUQ 1PD1A 3SWNC 4M78A 2B8AA 2COZA 4M77G 3QBYA 4GBQA 1M3CA 4WTOB 4JS5A 4J7FA 4NL2A 4Z02A 3CCMA 1PRMC 3QWYA 1BCMA 1YJWT 2KXDA 2PNIA 5IH2A 4N4GA 1Z9QA 2GF7A 1OX8A 4JJCA 1GL5A 2O88A 1R0CB 2RJCA 1VQ5T 1AOJA 4M7AD 4LNPA 2DERA 3X25B 3O5ZA 3MO8A 2NUPA 3OYMA 3M57A 4AFSC 4M75D 1QVGA 4JLIA 3VUZA 2DLPA 1YN8A 3V8LA 1H92A 4PJMA 1AZEA 2A0FB 4MZPA 1VQ4T 5HKCA 1IGQA 1M4ZA 3OYDA 3JB9G 2EKHA 3OMCA 1S72T 3CCET 2QEXA 3SHWA 1RAAB 4FW1A 2BTTA 3CC7A 4NS5A 5LL6S 4OGCA 1RABB 2NUPB 1TUDA 3M0PA 5LJ5e 1G3SA 5LJ3h 2Y90A 3L2ZA 5LJ3j 3J81E 3NGPA 4M77E 1CSKA 1NYGA 1YJWQ 4HXJA 3DLMA 3QDFA 2IVWA 1WNLA 1VQLA 2DMOA 2HQXA 1VQ5Q 1KK7A 2M16A 3G4SA 1YCYA 4X1VA 2O4XA 2M02A 2K57A 2XMFA 2ROLA 3QXEB 4BE2A 2X4JA 2L3RA 1Q7YR 1VQ4Q 4K11A 3NFCA 4OMPA 1Q7YC 3QWXX 1S72Q 3CCEQ 4J9HA 2VWFA 1KD1R 2EYZA 3HP9A 1WQWA 4N4HA 5A0LA 2O4XB 1KD1C 2HQEA 2OI3A 1X6BA 1UGPB 2IPOB 5CVIA 1QP3A 1M2OA 2KT1A 5AYFA 3QSUA 2GNCA 5I22A 3C4SA 2QYZA 4CC2A 4RTZA 4AFQC 1VQOA 2FYKA 3R6OA 2LQKA 2GBQA 2JUFA 4M78D 3EHQA 3H0HA 9ATCB 2C0OA 1UTIA 5HCKA 3LGFA 2J7IA 5GMKe 1M90C 3CCSA 2H8HA 2KBTA 1UFFA 1RLQC 3I55A 1BIAA 5ECAA 1OEBA 4C92G 1FWZA 1YWPA 2JN0A 4HVWA 4EMGA 2MCNA 3OMGA 3TSZA 4AMCA 5GAN2 3EGXB 2EQUA 4N4IA 4E7IA 1KC8U 3M4GA 4DEYA 2LRQA 4B9WA 2RI5A 1ZBXA 1IHVA 4M77F 3JB9D 2XG8D 1M27C 5GAN5 4CC4B 2IIMA 2M51A 1KJWA 1QVPA 2OTLT 2O01E 1TG0A 1ZSZC 5LJ5d 4LE9A 2XDBA 1KC8R 3KBGA 4L6V5 4JRQA 3M9QA 3S3NA 1UGQB 2E6NA 4BB7A 2LC4A 4XU1A 2D0NA 3ER0A 3QUIA 4J9IA 4PFOA 3L2VA 3SFMA 3C95A 3HFOA 1PG5B 4OMMA 2X4XA 3VS5A 2YLBA 2DYIA 1AWWA 3CCQA 4CRIA 2KYMA 1TWBA 1NG2A 4C92E 3JB9F 1I1JA 4NL3A 1ZUKA 5KYWB 1M3BA 3ME9A 1VYVA 2EGCA 2DM1A 2O9VA 4ZNXA 4HA8A 2MOXA 2P84A 2CP7A 1M9SA 1NLPC 2L89A 2I2LA 3E2UA 1YI2A 3WVDB 2RHYA 5LJ3e 4KGVB 3PMTA 3I35A 3O8VA 4ELZC 3LGLA 1XQHA 4OMNA 2ZPBB 2CZ6B 4P5NA 2BZYA 1IB8A 3QKJA 1OZ2A 1GRIA 2K6DA 4E7HA 4KH0B 1FX7A 2E41A 2OAWA 1VQMA 3V8KA 2K7AA 4Z89A 2DILA 3PT9A 4M4ZA 1GFDA 5FROA 5CR2A 1M5Q1 2FPEA 4AG1C 2EPDA 4C8QC 1GBRA 2CSQA 2F2VA 1X01A 3RIRA 2XDDA 3CBOA 1SEMA 1MNDA 2AZSA 3QG1A 4FU6A 4PJOB 2FO0A 3JCMg 3EGDA 2LCCA 2KE9A 1JO8A 4LXCA 3UF4A 2CS7A 2QDLA 4F7UA 4A4FA 3CPWS 1PSEA 1D1BA 2HQHA 2YSQA 1K1ZA 3OYBA 2DL4A 1YFNA 1LOJA 2MWOA 3M0TA 1IREB 2DEUA 4KH1B 4M7AC 2EKOA 4M7DB 1NE8A 2JVVA 1X69A 2GCXA 5CCAA 4PNOA 4M75C 4PKCC 1D0ZA 2E5KA 1ACMB 1SSHA 1OPKA 2F1LA 5GANg 5FU6C 4RUGA 3GIBA 4C92F 3T9NA 2RN8A 2LZ6B 3OW2S 1K0SA 2CKKA 2LJ3A 2O31A 2P0QA 4JRKA 1V1CA 4OB2B 3A8HB 3JV3A 2WSCE 1KQ2A 1P92A 4BE1A 2EQKA 2ESWA 2E5QA 1YJWA 2J6KA 4KUDK 1NLOC 1J3TA 4BI3A 2CREA 1IHWA 1ZUUA 1K0XA 1VQ5A 3QJ6A 1ZHIA 1LJOA 1NM7A 2D8JA 4IUPA 2ZPFB 1TXQA 1GCQC 4XU2A 3M56A 3EFSA 4JJNK 1KQSS 3SEMA 3RUXA 4KULA 1VQ4A 2YUPA 2M1HA 5CKBA 1JB0E 1SKUB 3VU3C 1S72A 2VXFA 3CCEA 2XU8A 4QKUA 5IHIA 2EFIA 1JJ2P 1ZBJA 1RAEB 3M0QA 5D6WA 3G6ET 2ZPHB 3J7AF 3CCRT 4JRIA 5DY9A 2DTIA 2F5KA 3VUBA 1M3AA 2M0OA 1K8AU 3QDRB 3A8GB 2QI2A 1WHMA 3DLLA 4OMQA 2QQAA 2A7YA 1M2VB 3X28B 4LUDA 2NYSA 1WXBA 4M78C 1NEGA 1YIJT 4D8KA 2I0NA 3OYJA 4XU3A 2R5MA 4J7IA 1UEBA 2YUNA 3E9GA 2YT6A 1K8AR 1JEGA 2LJ1A 5LJ3g 5FRMA 2GFAA 3KUFA 4JPBW 4OVAA 3X26B 3G6EQ 3GNFB 3CCRQ 1G5VA 5J26A 2RQTA 3OSVA 2LDMA 4XAXB 2M9UA 3A8LB 1D1CA 2FZKB 3VV0A 2V1RA 3FLGA 4CC7A 1N9RA 1W2BA 4LDUA 4BDYA 3J80E 1RI0A 4II1A 2MI6A 1QLYA 1E6GA 1Q86C 3OS2A 2DTHA 3EFOA 1YIJQ 1AWJA 4NOYA 1W6XA 3VRYA 4E7LA 1OV3A 1TTHB 3CC2T 1B07A 2LQWA 4OB1B 1TUGB 1NZ9A 2RO0A 1QVGS 4LDVA 7AT1B 3PGGA
chains in the Genus database with same CATH topology
3VS6A 2HCKA 1I07A 1UHFA 1B3QA 1PRMC 3QWYA 1ZUYA 1PHTA 2KXDA 5L23A 2PNIA 5IH2A 1GBQA 5I11A 1Z9QA 4JJCA 2FPFA 1GL5A 2O88A 4LN2A 1AOJA 2YUOA 2EBPA 2RNAA 4LNPA 2VKNA 2V1QA 4OMOA 4HVUA 3O5ZA 2OJ2A 4AFSC 2K2MA 2DLPA 1YN8A 1H92A 1WDXA 2EQIA 1WYXA 2L0AA 2FG0A 1AZEA 2JM9A 1PKTA 2X3XD 1RUWA 1YWOA 3UATA 3PE0A 3GBQA 2EKHA 3SHWA 2GTOA 4GBQA 2BTTA 5IHKA 2D1XA 2P4RA 1EFNA 2KXCA 2J06A 1YCSB 1TUDA 3M0PA 3LH5A 3VS4A 3ULRB 1WA7A 1FMKA 2FPDA 3NGPA 1CSKA 1NYGA 3ZL7C 4HXJA 4A63B 2RQRA 3M0RA 1FYNA 2DMOA 5IHNA 2DL8A 4X1VA 2XMFA 1UE9A 2CT3A 5FWBA 2CUBA 4F14A 2ROLA 4JZ3A 1GFCA 1X6GA 2ECZA 1AD5A 4RTWA 1HD3A 4K11A 2HBWA 4OMPA 4AG2C 1U3OA 2AZVA 3QWXX 1JQQA 1WXTA 4J9HA 1AWOA 2A37A 2DJQA 2VWFA 2KT8A 2EW3A 2VVKA 2EYZA 2DL7A 2LQNA 4GLMA 3VS7A 2OI3A 5GJWB 1QKWA 5GJVB 1X6BA 1X43A 4J9DA 5EC7A 2KT1A 1T3SA 2GNCA 5I22A 4WCIA 4CC2A 3I5SA 2JS0A 1T3LA 2DYBA 3CQTA 4DEXA 2L3PA 4RTZA 4AFQC 1MV3A 2J05A 2FRYA 2GBQA 1PKSA 2GGRA 3EHQA 2JS2A 3H0HA 2RMOA 2LMJA 2C0OA 1UTIA 5HCKA 2RQVA 3NMZC 2EGEA 2RPNA 1ABOA 1JXMA 2ENMA 2J7IA 2H8HA 2KBTA 1UFFA 1RLQC 4J9EA 1I0CA 2FRWA 5ECAA 1OEBA 1UJYA 1VYTA 2CDTA 2DBKA 4HVVA 1YWPA 4HVWA 3EG0A 1QWEA 2MCNA 3TSZA 2FEIA 4F16A 1NEBA 1YP5A 1Y57A 2HSPA 2HEQA 2KRSA 2KR3A 4DEYA 2JT4A 2L3SA 4LUEA 2J6OA 4RTVA 3I5RA 1H8KA 2AK5A 3M0SA 1KIKA 2LJ0A 4AFZC 1M27C 1AEYA 1U06A 2MIOA 3H0FA 4CC4B 2IIMA 1AVZC 1KJWA 2M51A 4JJBA 1RI9A 1NYFA 4Z8AA 4ESRA 1WXUA 1TG0A 1SPKA 2L3QA 1T0HA 2EVRA 4LE9A 2L2PA 3C0CA 1WIEA 4J9BA 2EYYA 1WLPB 2K3BA 4EIKA 2KNBB 2ROTA 3EG3A 1MUZA 2D0NA 4J9IA 1SHGA 4RTYA 1E7OA 4OMMA 3VS5A 1BK2A 1AWWA 1HSQA 2CSIA 2KYMA 4Y92A 1NG2A 1QCFA 1I1JA 1OOTA 1ZUKA 2GTJA 1M3BA 3I9QA 2YDLA 1VYVA 2EGCA 2DM1A 2O9VA 4ZNXA 3U23A 2MOXA 2X3WD 1IO6A 3H0IA 1UG1A 1NLPC 1QWFA 4ORZA 1PRLC 3I35A 4OMNA 1E6HA 4E6RA 2BZ8A 2BZYA 1S1NA 1GRIA 1W70A 1K4US 2K6DA 3TSWA 3UA7A 2PTKA 4J9CA 3TVTA 2OAWA 2EGAA 1UECA 2K7AA 2KRNA 1G2BA 4Z89A 2DILA 4M4ZA 2DRMA 2D8HA 1GFDA 1A0NB 1SRMA 2KRMA 2DBMA 2C0IA 2FPEA 1ZX6A 2EPDA 4AG1C 1GBRA 1KSWA 1WI7A 1YNZA 2CSQA 2F2VA 3M0UA 2KYBA 1JXOA 3THKA 3RNJA 2JXBA 1SEMA 1CKAA 2AZSA 4RTTA 3UA6A 1SRLA 1N5ZA 2FO0A 2NWMA 2LNHB 3VS0A 2A36A 1T0JA 2KE9A 1JO8A 2DE0X 3UF4A 2DL5A 3NHNA 2QDLA 4FSSA 2ABLA 3PVLA 2YSQA 4F17A 1OPLA 1K1ZA 2C0TA 2DL4A 1UGVA 2HDAA 3M0TA 3H41A 2LP5A 1U5SA 1UDLA 1ZSGA 4RTUA 2JMAA 1X69A 2ED0A 2E5KA 4KRTA 1SSHA 1OPKA 4IIMA 1BB9A 4RUGA 5FW9A 2M0YA 1Y0MA 2RN8A 2LZ6B 1K0SA 2LJ3A 2O31A 1W1FA 2CT4A 2K79A 1V1CA 2YUQA 3JV3A 1PNJA 2BZXA 1LCKA 3REBB 2ESWA 2J6FA 2DA9A 2F2XA 3RBBB 2AKKA 2J6KA 2LCSA 1NLOC 1J3TA 3REAB 2A08A 2CREA 1ZUUA 1K0XA 2KGTA 2W10A 3VS1A 1NM7A 2D8JA 2DF6A 3VS2A 2RF0A 3EG2A 1X27A 4AFUC 3EGUA 1GCQC 1VYUA 2SEMA 3VRZA 3SEMA 4Z88A 4JJDA 2YUPA 5FWCA 2KEAA 1UJ0A 3KFVA 2CUDA 1BU1A 4HCKA 2LX7A 2PZ1A 1M30A 2JTEA 5IHIA 1ZBJA 2SRCA 3M0QA 2EYWA 2CH4A 2RQWA 1BBZA 2O2OA 3FJ5A 2G6FX 1M3AA 2GQIA 2CH4W 3NPFA 4J9GA 1WFWA 4OMQA 4CC3A 2A28A 5IXFA 3VS3A 4JZ4A 4LUDA 1WXBA 1K9AA 1NEGA 1QKXA 4J9FA 4D8KA 1TUCA 1MV0B 2I0NA 2RQUA 1X2QA 1UHCA 2JMCA 1ABQA 2DL3A 3EG1A 2YUNA 2YT6A 3A98A 1JEGA 1UUEA 2LJ1A 1GCQA 1GCPA 1AZGB 1M8MA 1HJDA 2AKLA 1JU5C 1Z9ZA 4JPBW 2DNUA 4RTXA 1H3HA 1K76A 1RLPC 1XOVA 3PVQA 1AWXA 1WX6A 1ZLMA 2EYXA 1KFZA 1VA7A 2K9GA 2O9SA 2RQTA 3EHRA 2ED1A 4R0KA 2JM8A 2V1RA 3IQLA 4CC7A 2DRKA 2DX1A 3R6NA 2DVJA 1QLYA 2F2WA 1E6GA 2NUZA 4D8DA 1CKBA 1G83A 2W0ZA 1AWJA 3VRYA 1W6XA 1OV3A 2KROA 1X2KA 4QT7A 4IIOA 1B07A 2LQWA 4OMLA 5IXBA 1ARKA 2B86A 1SHFA 1PWTA 2JW4A 1M3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  2HCK A;  1I07 A;  1UHF A;  1B3Q A;  1PRM C;  3QWY A;  1ZUY A;  1PHT A;  2KXD A;  5L23 A;  2PNI A;  5IH2 A;  1GBQ A;  5I11 A;  1Z9Q A;  4JJC A;  2FPF A;  1GL5 A;  2O88 A;  4LN2 A;  1AOJ A;  2YUO A;  2EBP A;  2RNA A;  4LNP A;  2VKN A;  2V1Q A;  4OMO A;  4HVU A;  3O5Z A;  2OJ2 A;  4AFS C;  2K2M A;  2DLP A;  1YN8 A;  1H92 A;  1WDX A;  2EQI A;  1WYX A;  2L0A A;  2FG0 A;  1AZE A;  2JM9 A;  1PKT A;  2X3X D;  1RUW A;  1YWO A;  3UAT A;  3PE0 A;  3GBQ A;  2EKH A;  3SHW A;  2GTO A;  4GBQ A;  2BTT A;  5IHK A;  2D1X A;  2P4R A;  1EFN A;  2KXC A;  2J06 A;  1YCS B;  1TUD A;  3M0P A;  3LH5 A;  3VS4 A;  3ULR B;  1WA7 A;  1FMK A;  2FPD A;  3NGP A;  1CSK A;  1NYG A;  3ZL7 C;  4HXJ A;  4A63 B;  2RQR A;  3M0R A;  1FYN A;  2DMO A;  5IHN A;  2DL8 A;  4X1V A;  2XMF A;  1UE9 A;  2CT3 A;  5FWB A;  2CUB A;  4F14 A;  2ROL A;  4JZ3 A;  1GFC A;  1X6G A;  2ECZ A;  1AD5 A;  4RTW A;  1HD3 A;  4K11 A;  2HBW A;  4OMP A;  4AG2 C;  1U3O A;  2AZV A;  3QWX X;  1JQQ A;  1WXT A;  4J9H A;  1AWO A;  2A37 A;  2DJQ A;  2VWF A;  2KT8 A;  2EW3 A;  2VVK A;  2EYZ A;  2DL7 A;  2LQN A;  4GLM A;  3VS7 A;  2OI3 A;  5GJW B;  1QKW A;  5GJV B;  1X6B A;  1X43 A;  4J9D A;  5EC7 A;  2KT1 A;  1T3S A;  2GNC A;  5I22 A;  4WCI A;  4CC2 A;  3I5S A;  2JS0 A;  1T3L A;  2DYB A;  3CQT A;  4DEX A;  2L3P A;  4RTZ A;  4AFQ C;  1MV3 A;  2J05 A;  2FRY A;  2GBQ A;  1PKS A;  2GGR A;  3EHQ A;  2JS2 A;  3H0H A;  2RMO A;  2LMJ A;  2C0O A;  1UTI A;  5HCK A;  2RQV A;  3NMZ C;  2EGE A;  2RPN A;  1ABO A;  1JXM A;  2ENM A;  2J7I A;  2H8H A;  2KBT A;  1UFF A;  1RLQ C;  4J9E A;  1I0C A;  2FRW A;  5ECA A;  1OEB A;  1UJY A;  1VYT A;  2CDT A;  2DBK A;  4HVV A;  1YWP A;  4HVW A;  3EG0 A;  1QWE A;  2MCN A;  3TSZ A;  2FEI A;  4F16 A;  1NEB A;  1YP5 A;  1Y57 A;  2HSP A;  2HEQ A;  2KRS A;  2KR3 A;  4DEY A;  2JT4 A;  2L3S A;  4LUE A;  2J6O A;  4RTV A;  3I5R A;  1H8K A;  2AK5 A;  3M0S A;  1KIK A;  2LJ0 A;  4AFZ C;  1M27 C;  1AEY A;  1U06 A;  2MIO A;  3H0F A;  4CC4 B;  2IIM A;  1AVZ C;  1KJW A;  2M51 A;  4JJB A;  1RI9 A;  1NYF A;  4Z8A A;  4ESR A;  1WXU A;  1TG0 A;  1SPK A;  2L3Q A;  1T0H A;  2EVR A;  4LE9 A;  2L2P A;  3C0C A;  1WIE A;  4J9B A;  2EYY A;  1WLP B;  2K3B A;  4EIK A;  2KNB B;  2ROT A;  3EG3 A;  1MUZ A;  2D0N A;  4J9I A;  1SHG A;  4RTY A;  1E7O A;  4OMM A;  3VS5 A;  1BK2 A;  1AWW A;  1HSQ A;  2CSI A;  2KYM A;  4Y92 A;  1NG2 A;  1QCF A;  1I1J A;  1OOT A;  1ZUK A;  2GTJ A;  1M3B A;  3I9Q A;  2YDL A;  1VYV A;  2EGC A;  2DM1 A;  2O9V A;  4ZNX A;  3U23 A;  2MOX A;  2X3W D;  1IO6 A;  3H0I A;  1UG1 A;  1NLP C;  1QWF A;  4ORZ A;  1PRL C;  3I35 A;  4OMN A;  1E6H A;  4E6R A;  2BZ8 A;  2BZY A;  1S1N A;  1GRI A;  1W70 A;  1K4U S;  2K6D A;  3TSW A;  3UA7 A;  2PTK A;  4J9C A;  3TVT A;  2OAW A;  2EGA A;  1UEC A;  2K7A A;  2KRN A;  1G2B A;  4Z89 A;  2DIL A;  4M4Z A;  2DRM A;  2D8H A;  1GFD A;  1A0N B;  1SRM A;  2KRM A;  2DBM A;  2C0I A;  2FPE A;  1ZX6 A;  2EPD A;  4AG1 C;  1GBR A;  1KSW A;  1WI7 A;  1YNZ A;  2CSQ A;  2F2V A;  3M0U A;  2KYB A;  1JXO A;  3THK A;  3RNJ A;  2JXB A;  1SEM A;  1CKA A;  2AZS A;  4RTT A;  3UA6 A;  1SRL A;  1N5Z A;  2FO0 A;  2NWM A;  2LNH B;  3VS0 A;  2A36 A;  1T0J A;  2KE9 A;  1JO8 A;  2DE0 X;  3UF4 A;  2DL5 A;  3NHN A;  2QDL A;  4FSS A;  2ABL A;  3PVL A;  2YSQ A;  4F17 A;  1OPL A;  1K1Z A;  2C0T A;  2DL4 A;  1UGV A;  2HDA A;  3M0T A;  3H41 A;  2LP5 A;  1U5S A;  1UDL A;  1ZSG A;  4RTU A;  2JMA A;  1X69 A;  2ED0 A;  2E5K A;  4KRT A;  1SSH A;  1OPK A;  4IIM A;  1BB9 A;  4RUG A;  5FW9 A;  2M0Y A;  1Y0M A;  2RN8 A;  2LZ6 B;  1K0S A;  2LJ3 A;  2O31 A;  1W1F A;  2CT4 A;  2K79 A;  1V1C A;  2YUQ A;  3JV3 A;  1PNJ A;  2BZX A;  1LCK A;  3REB B;  2ESW A;  2J6F A;  2DA9 A;  2F2X A;  3RBB B;  2AKK A;  2J6K A;  2LCS A;  1NLO C;  1J3T A;  3REA B;  2A08 A;  2CRE A;  1ZUU A;  1K0X A;  2KGT A;  2W10 A;  3VS1 A;  1NM7 A;  2D8J A;  2DF6 A;  3VS2 A;  2RF0 A;  3EG2 A;  1X27 A;  4AFU C;  3EGU A;  1GCQ C;  1VYU A;  2SEM A;  3VRZ A;  3SEM A;  4Z88 A;  4JJD A;  2YUP A;  5FWC A;  2KEA A;  1UJ0 A;  3KFV A;  2CUD A;  1BU1 A;  4HCK A;  2LX7 A;  2PZ1 A;  1M30 A;  2JTE A;  5IHI A;  1ZBJ A;  2SRC A;  3M0Q A;  2EYW A;  2CH4 A;  2RQW A;  1BBZ A;  2O2O A;  3FJ5 A;  2G6F X;  1M3A A;  2GQI A;  2CH4 W;  3NPF A;  4J9G A;  1WFW A;  4OMQ A;  4CC3 A;  2A28 A;  5IXF A;  3VS3 A;  4JZ4 A;  4LUD A;  1WXB A;  1K9A A;  1NEG A;  1QKX A;  4J9F A;  4D8K A;  1TUC A;  1MV0 B;  2I0N A;  2RQU A;  1X2Q A;  1UHC A;  2JMC A;  1ABQ A;  2DL3 A;  3EG1 A;  2YUN A;  2YT6 A;  3A98 A;  1JEG A;  1UUE A;  2LJ1 A;  1GCQ A;  1GCP A;  1AZG B;  1M8M A;  1HJD A;  2AKL A;  1JU5 C;  1Z9Z A;  4JPB W;  2DNU A;  4RTX A;  1H3H A;  1K76 A;  1RLP C;  1XOV A;  3PVQ A;  1AWX A;  1WX6 A;  1ZLM A;  2EYX A;  1KFZ A;  1VA7 A;  2K9G A;  2O9S A;  2RQT A;  3EHR A;  2ED1 A;  4R0K A;  2JM8 A;  2V1R A;  3IQL A;  4CC7 A;  2DRK A;  2DX1 A;  3R6N A;  2DVJ A;  1QLY A;  2F2W A;  1E6G A;  2NUZ A;  4D8D A;  1CKB A;  1G83 A;  2W0Z A;  1AWJ A;  3VRY A;  1W6X A;  1OV3 A;  2KRO A;  1X2K A;  4QT7 A;  4IIO A;  1B07 A;  2LQW A;  4OML A;  5IXB A;  1ARK A;  2B86 A;  1SHF A;  1PWT A;  2JW4 A;  1M3C A; 
#chains in the Genus database with same CATH topology
 1IGU A;  3OA6 A;  1MNE A;  1UGR B;  2DD5 A;  1I07 A;  1B3Q A;  3EH2 A;  4EDU A;  4C8Q G;  1PHT A;  2L5Q A;  4LDW A;  1GBQ A;  2CP3 A;  2GQV A;  3DB3 A;  2FPF A;  1Y96 B;  4Y28 E;  2YUO A;  3ZEH A;  2EBP A;  4OMO A;  2OTL A;  2OJ2 A;  3QHS A;  1RAH B;  3OYY A;  2CZ0 B;  2E65 A;  3JSC A;  2X3X D;  1M8V A;  2JOY A;  3QPH A;  1QP2 A;  4M7A G;  1VQ7 T;  3CC2 Q;  1C1A A;  1M1K C;  4M75 G;  2P4R A;  2VYT A;  4IUU A;  2D6F A;  3G7Z A;  4QW2 A;  2FPD A;  4B9X A;  4FW2 A;  3ZL7 C;  3V7S A;  4A63 B;  4C8Q E;  2FL7 A;  1C6V X;  3A8M B;  3RMS A;  3CCV Q;  1BI3 A;  2DL8 A;  4PLI A;  4LD6 A;  5I21 A;  2LNV A;  1UE9 A;  1SSF A;  1Y7X A;  1HYO A;  5FWB A;  2CUB A;  1OYX A;  2D9T A;  4F14 A;  4BAC A;  1GFC A;  1HD3 A;  5I2S A;  3CCU T;  4DQ2 A;  1U3O A;  2AZV A;  2AT1 B;  1VQ7 Q;  4HT9 A;  2DJQ A;  2KT8 A;  2EW3 A;  4M7A E;  2LQN A;  4LD9 K;  5GAN 7;  4M75 E;  1X43 A;  4J9D A;  1T3S A;  4C5E A;  1T3L A;  4FSX A;  2FRY A;  2GGR A;  3G71 T;  2VB6 A;  4C8Q D;  2EGE A;  5KCH A;  2ENM A;  4YTL A;  1SG5 A;  2EYQ A;  1I8F A;  2CDT A;  1UJY A;  4N0A A;  4HVV A;  2YRC A;  3EG0 A;  3OYH A;  4M78 G;  2E4H A;  4IUR A;  1N8R R;  2LQ8 A;  4F16 A;  3QYG B;  1NEB A;  3RDV A;  2DZC A;  1N8R C;  1YP5 A;  2HSP A;  5GAM f;  2RA2 A;  2DET A;  1YHQ T;  1X75 C;  5IN1 A;  4BY6 B;  1H8K A;  2QQS A;  4EPC A;  2RM4 A;  2ZAE A;  1AEY A;  3H0F A;  2EJF A;  5GAM j;  5GAM h;  1O9S A;  3EH1 A;  3OQ5 A;  1SPK A;  2X4Y A;  2AHJ B;  3C0C A;  3G71 Q;  1D1A A;  3FIF A;  4BI8 B;  5DM7 R;  1X6O A;  4DBF A;  4OF1 A;  4M77 B;  2CZ7 B;  2QTV A;  1E7O A;  1WZO A;  4ZGD B;  1QCF A;  4M7A F;  2LVM A;  1OOT A;  3DKM A;  2QAZ A;  4OB3 B;  2COW A;  4M78 E;  2PU9 B;  4M75 F;  1OQK A;  3CEY A;  1WGS A;  1YHQ Q;  1QWF A;  2YXY A;  4PL6 A;  3G6E A;  3PNW C;  3JCM b;  3MPU B;  3CCR A;  5KYN A;  4E7S A;  3JB9 I;  1E6H A;  2BZ8 A;  1IZ6 A;  1W70 A;  3TSW A;  2QQB A;  4A4G A;  5D6X A;  2QQR A;  3OYA A;  3RKW A;  2X9H A;  2PTK A;  2XD0 A;  1TS9 A;  3MP8 A;  3PFS A;  3FDR A;  2KRN A;  1VQ6 T;  3FRN A;  4BD3 A;  5D6Y A;  1YIJ A;  2HD0 A;  3GP8 A;  2HAX A;  3FJP A;  4ZGJ B;  4E7Z A;  2RB6 A;  2EQM A;  3RNJ A;  4C0F A;  3I56 T;  1VQ8 Q;  1K73 U;  2F69 A;  1N5Z A;  2OX7 A;  2A36 A;  1T0J A;  1BCO A;  3EGX A;  3RKX A;  2DE0 X;  2RH2 A;  5CKF A;  2V26 A;  4DOV A;  4F04 B;  4FSS A;  2ABL A;  3CD6 T;  4F17 A;  2DZ9 A;  2HDA A;  2NLU A;  3MP1 A;  2X4W A;  1FMV A;  2Y4Y A;  4X9D A;  1MMD A;  4TVR A;  4ATO A;  4EMH A;  1RAC B;  4QQG A;  1VQ6 Q;  2MF2 A;  3CC2 A;  3OYK A;  2M0Y A;  3C94 A;  5A0G A;  2KSS A;  2KAF A;  4M78 F;  5HY6 A;  1V29 B;  5CO7 A;  2YUQ A;  4OB0 B;  3SD4 A;  1PNJ A;  3I56 Q;  2JJ9 A;  5DLQ E;  2BZX A;  3REB B;  2DKG A;  2J6F A;  4XTU A;  3URG A;  5KYW A;  2RD1 A;  2A08 A;  2HL3 A;  3HSB A;  5GAN 8;  2W10 A;  1N9S A;  2R58 A;  1KC8 C;  2PUK B;  3CD6 Q;  1TSF A;  4C92 B;  5GAM e;  1MMN A;  1VQ9 T;  2DF6 A;  2COY A;  2RF0 A;  3EG2 A;  4AFU C;  4R55 A;  3EGU A;  3CPW P;  2GFU A;  1NPR A;  4XU0 A;  2ZZD A;  4Z88 A;  4JJD A;  2BKD N;  5FWC A;  2WAC A;  3KFV A;  1VQ7 A;  3HPW A;  3G1J A;  2QA4 T;  5KYX B;  2CUD A;  4HCK A;  3NTH A;  2LX7 A;  4J6Y A;  3PTA A;  2JTE A;  2CP6 A;  2V8I A;  5GAO p;  4MDX A;  2VC8 A;  2CH4 A;  3A1P A;  1QVF A;  2RQW A;  3OY9 A;  3OW2 P;  5CKD A;  2QTX A;  1BI0 A;  1BBZ A;  2G6F X;  2PQW A;  2GQI A;  4Y91 A;  3Q1J A;  3NPF A;  4J9G A;  1FMW A;  3CCJ T;  2YRD A;  1WFW A;  2VV5 A;  4CC3 A;  5IXF A;  3MP6 A;  4WF2 A;  4PJO A;  2XHC A;  1VQ9 Q;  5LJ5 g;  5CAI A;  2KQW A;  3INZ A;  3S3O A;  2HZY A;  1QKX A;  3BFM A;  1GXI E;  4J9F A;  3JRZ A;  1UHC A;  1VIF A;  2JMC A;  3CCU A;  4MMK A;  1ABQ A;  4O5V A;  5GAN d;  4EMK B;  3SWN B;  1W2B S;  1UUE A;  4M7D A;  2QA4 Q;  5CQX A;  1KQS P;  1OU8 A;  1JU5 C;  1Z9Z A;  2DNU A;  1RLP C;  3DB4 A;  1U8R A;  1ZLM A;  3HTR A;  4F7U G;  3HHT B;  3V7R A;  1QQJ A;  2RHI A;  2XK0 A;  2CP5 A;  4X9C A;  1G3T A;  1YIT T;  2OTJ T;  3CCJ Q;  2VXE A;  1IXD A;  5HK3 A;  3R6N A;  2DVJ A;  4FYY B;  4FCY A;  3G71 A;  5FLX E;  2ZGW A;  5GAN 4;  2X51 A;  1G83 A;  3MEA A;  1XJW B;  2MMP A;  4KT0 E;  1WHH A;  1X2K A;  3CBP A;  4IIO A;  2P0P A;  3MCA B;  1VQN Q;  2LT4 A;  2K5F A;  4QVZ A;  3PIP A;  4LDX A;  2XI9 A;  5GAM d;  2B86 A;  1SHF A;  5FU7 B;  1PWT A;  3WVE B;  3HFN A;  3VS6 A;  2HCK A;  1UHF A;  3NTK A;  2FVU A;  3M4Y A;  4PJJ A;  5KE2 A;  5I11 A;  4ZGE B;  1YHQ A;  1Q81 U;  1Y07 A;  1WHG A;  2BE7 D;  4C0Z A;  4KGZ B;  2VKN A;  2AIR B;  4F7U E;  1Q82 U;  4ELY C;  1YIT Q;  2OTJ Q;  1BI2 A;  2FZC B;  1PSF A;  3MHX A;  1WDX A;  5GAN 3;  1WYX A;  2L0A A;  2FG0 A;  5C6S A;  1PKT A;  4OP0 A;  1LNX A;  3PE0 A;  3GBQ A;  2LT1 A;  3WXM B;  4HCC A;  4OGE A;  3CC4 T;  3RMQ A;  1M2V A;  1D3B B;  2CGH A;  2HL5 C;  2D1X A;  2K2V A;  5KCO A;  3JCM W;  4PJO D;  2MWP A;  3ULR B;  1FMK A;  1LPL A;  4MML A;  1QVG P;  1YBY A;  3M0R A;  3ASK A;  1FYN A;  5IHN A;  2CYZ B;  3GPL A;  4N0A C;  4M7D D;  3JCM P;  1TOV A;  2EJ9 A;  1K9M U;  2ECZ A;  1WJQ A;  1AD5 A;  4RTW A;  4C0D B;  2E12 A;  4AG2 C;  1U1T A;  1JQQ A;  1VQ6 A;  6AT1 B;  1K8A C;  2DXC A;  2PVO B;  1AWO A;  1YJ9 T;  3CC4 Q;  1HK9 A;  2XID A;  1BI1 A;  2XDP A;  2VVK A;  4PFP A;  2DL7 A;  4GLM A;  3VS7 A;  5GJW B;  1QKW A;  5GJV B;  1K9M R;  1PC0 A;  2CP2 A;  1D0Y A;  4RCC A;  5EC7 A;  2QGG A;  5GAO m;  4KUI A;  2YRV A;  4WCI A;  2RK2 A;  3I56 A;  4HKE A;  3I5S A;  2JS0 A;  3C12 A;  4A4E A;  4DEX A;  4KGX B;  1WHJ A;  1ZSZ B;  2G3R A;  3LH0 A;  4F7U F;  2LMJ A;  2F5T X;  3MEW A;  3NMZ C;  3CD6 A;  2RPN A;  1ABO A;  1JXM A;  1Y96 A;  4RCB A;  2JZ2 A;  2DBK A;  3M58 A;  8AT1 B;  1EIF A;  3RKY A;  4FYX B;  3FEO A;  1YJ9 Q;  2RHU A;  2K5I A;  2FEI A;  5A2Q E;  3P8D A;  3OS5 A;  3S6W A;  2HEQ A;  2JT4 A;  2L3S A;  2J6O A;  3QII A;  2HNI A;  4RTV A;  3CCV T;  3I5R A;  2AK5 A;  3M0S A;  4UC4 A;  2LJ0 A;  5AT1 B;  4E7J A;  2QG9 B;  1AVZ C;  3QO3 A;  2XKO C;  4JJB A;  1RI9 A;  3CME T;  4GLK A;  4Z8A A;  3VKI A;  1NJI U;  3L42 A;  2L3Q A;  1T0H A;  2E64 A;  2L2P A;  4DBR A;  1WIE A;  4QVD A;  2YHT A;  3NTI A;  2K3B A;  4EIK A;  4C5I A;  1R77 A;  2ROT A;  4DBQ A;  1BKB A;  3SB2 A;  1VQ9 A;  5GAO n;  3EG3 A;  4PJL A;  2K4Y A;  4RTY A;  2ZPE B;  3L2W A;  4C8Q B;  1PCX A;  4A4H A;  1QCN A;  4Y92 A;  4RKU E;  2E1H A;  5KYY B;  2GTJ A;  3I9Q A;  4E47 A;  2QA4 A;  3U23 A;  2VAS A;  3L2U A;  3LYI A;  5IT9 E;  3H0I A;  4A4K A;  4R56 A;  5KYU A;  1I5L A;  2X35 A;  3JCM f;  2RI3 A;  3SDZ A;  3EG9 B;  4D6W A;  2XIC A;  1WJR A;  3M54 A;  3TCJ A;  3CME Q;  4E6R A;  4XQ3 A;  1UGS B;  1K4U S;  3JCM h;  1RAD B;  4M7A B;  3TQ7 P;  1W4S A;  3UA7 A;  3CCJ A;  4J9C A;  4ANJ A;  3D7S B;  2EGA A;  4M75 B;  1UEC A;  5KYU B;  1G2B A;  4BE0 A;  5C0M A;  2MK5 A;  4IKF A;  5FU6 B;  1SRM A;  5GAN f;  2MAM A;  2DBM A;  3EFR A;  4VUB A;  3ZBD A;  3UT1 A;  2PUO B;  4XTV A;  1YNZ A;  3GLX A;  1B34 A;  1ZQ1 A;  1QVF P;  2BIV A;  2JXB A;  5GAN h;  5GAN j;  1CKA A;  2NUT B;  3UA6 A;  1SRL A;  3CCL T;  4C5G A;  2NWM A;  2LNH B;  3VS0 A;  1YI2 Q;  3QZ5 B;  2DL5 A;  3MEV A;  3NHN A;  3PVL A;  2ATC B;  1OU9 A;  1OPL A;  3GNG A;  2C0T A;  2RHX A;  2RJE A;  5CKH A;  2V8J A;  1B34 B;  1YIT A;  2OTJ A;  1NPP A;  2LP5 A;  1U5S A;  1KG1 A;  2JMA A;  4IUT A;  4BUG A;  3CXC A;  3H9N A;  4KRT A;  3L2R A;  2C06 A;  1BB9 A;  2VUB A;  1VQP T;  2EIF A;  4FT4 A;  1Y0M A;  1W1F A;  3ZFJ A;  2K79 A;  4M77 A;  4JDS A;  4C8Q F;  1SF9 A;  1LCK A;  5DLO A;  2DA9 A;  3CCL Q;  2RJD A;  3RBB B;  4PJO C;  2RI2 A;  2LCS A;  3REA B;  1JJ2 A;  1R8O B;  4JRP A;  3VS1 A;  1G3Y A;  2HBP A;  1KHI A;  3M53 A;  4A53 A;  3VS2 A;  4FM4 B;  3FC3 A;  4M78 B;  1X27 A;  4M7D C;  1QVF S;  3OYC A;  3VRZ A;  1JBM A;  4ZN3 A;  2P4T A;  2P0K A;  3M5A A;  1I5O B;  2QGF B;  3BE3 A;  1VQP Q;  2KK4 A;  1BU1 A;  2Z0W A;  4FT2 A;  4MDW A;  5LJ3 f;  1VQ8 T;  3CC4 A;  4C5H A;  2D0Q B;  1M30 A;  1WQ7 A;  2K5L A;  5FRN A;  2EYW A;  3H6Z A;  2DEQ A;  5FU7 C;  1D0X A;  3OYI A;  5GMK m;  2O2O A;  3FJ5 A;  1Q7Y U;  1FXX A;  4FIB A;  4RMO A;  4DA4 A;  2MPX C;  1OZ3 A;  4JZ4 A;  3X24 B;  1KD1 U;  2LTO A;  3JCM e;  1MHN A;  1TUC A;  1NBE B;  1X2Q A;  2KI7 A;  2K3Y A;  4IUQ A;  1MGQ A;  2FZG B;  2QAS A;  1YJ9 A;  1HJD A;  2YLC A;  3L1A A;  4RTX A;  1H3H A;  1K76 A;  1XOV A;  5HK0 A;  2EQJ A;  3PVQ A;  1AWX A;  1WX6 A;  2EYX A;  4QQD A;  1M90 U;  1KFZ A;  5GAN e;  2JTM A;  2R57 A;  1VA7 A;  2K9G A;  2PVG B;  2EAY A;  3EHR A;  2ED1 A;  4R0K A;  5GAO l;  3IQL A;  1K73 R;  1VQK T;  2DRK A;  3RER A;  2DX1 A;  4PK4 A;  4XK8 E;  5M9O A;  1K73 C;  4M77 D;  2OAU A;  3OS1 A;  1M90 R;  2W0Z A;  4C0G A;  2KRO A;  4QT7 A;  3X20 B;  4HCZ A;  3QYH B;  4C92 A;  4C0D C;  4OML A;  5KE3 A;  5IXB A;  3OYG A;  1U1S A;  1ARK A;  3TU4 K;  2JW4 A;  2H3E B;  1ZUY A;  2FHD A;  5L23 A;  1W2B P;  4FYV B;  5KYX A;  1VOM A;  4LN2 A;  2HKN A;  3CCV A;  2RNA A;  2V1Q A;  4HVU A;  3CME A;  2DVE A;  1VQK Q;  5CQY A;  2EJG A;  2K2M A;  5KH6 A;  2R5A A;  2E10 A;  2CZ1 B;  3M59 A;  5CKE A;  2EQI A;  2JM9 A;  4BDZ A;  1RUW A;  1YWO A;  3UAT A;  5GAO q;  3BDL A;  3LX7 A;  5A0D A;  1G8X A;  2WSF E;  3LWI A;  3CMA T;  2GTO A;  4J6W A;  5IHK A;  1EX4 A;  3V7C A;  1EFN A;  2KXC A;  2J06 A;  5IAY A;  1R0B G;  1YCS B;  3LH5 A;  3VS4 A;  5J39 A;  3OBY A;  2HMA A;  1WA7 A;  3L2Q A;  3JCM d;  1YJN T;  2RJF A;  4EMK A;  1MMA A;  4O6J A;  3SWN A;  2RQR A;  3UWN A;  4MZM A;  2V8K A;  2QQ9 A;  1OUL A;  1DJ7 B;  4PJO G;  2FB7 A;  4ZN1 A;  2CT3 A;  2OTL Q;  2DFU A;  4LDY A;  3PMI A;  3OSS C;  4JZ3 A;  1X6G A;  1WHL A;  4CI0 C;  1VQN T;  1O75 A;  3LWH A;  3HRT A;  1JRI A;  2HBW A;  1H64 1;  3HL8 A;  1ZA2 B;  3GF5 A;  1B7T A;  3QZ9 B;  1Q95 G;  3MKD A;  1WXT A;  2RK1 A;  4M7D G;  3CMA Q;  2A37 A;  4QQ6 A;  3E19 A;  3OYE A;  5D7U A;  4RG8 A;  3RR6 A;  1WJS A;  3A5Z B;  1YJN Q;  1KHC A;  2DO3 A;  4XTZ A;  3OYF A;  2DYB A;  2ZPG B;  3PIO A;  2ZPI B;  2E70 A;  3CCL A;  3CQT A;  2IG0 A;  2L3P A;  4C92 D;  3UDC A;  1MV3 A;  2J05 A;  4A54 A;  1AHJ B;  1PKS A;  1RAG B;  2JS2 A;  2RMO A;  2RQV A;  4MZT A;  5GMK i;  4PJO E;  2LX9 A;  4J9E A;  1I0C A;  1IRX A;  2FRW A;  1VYT A;  4X34 A;  4OMF B;  3V8J A;  1QWE A;  4PJN A;  4E2F B;  3RES A;  3EGD B;  3HRS A;  3E1S A;  3JAM E;  3CCM T;  1VQP A;  2ZCF B;  3AHU A;  4M7D E;  1Y57 A;  2KRS A;  2KR3 A;  4F7U B;  4LUE A;  4J5Y A;  3JCM c;  1I81 A;  1D3B A;  1KIK A;  3UPU A;  4AFZ C;  3VYG A;  1U06 A;  1V76 A;  2MIO A;  2DXT A;  2KDS A;  1D09 B;  1NYF A;  3OYN A;  4ESR A;  1WXU A;  1PD0 A;  2EVR A;  2DJZ A;  2DTO A;  2WSE E;  3VJP A;  4J9B A;  2EYY A;  2DIQ A;  3CBM A;  1WLP B;  4E7K A;  1Q81 R;  2KNB B;  3CXC P;  3JCM V;  1Q81 C;  1MUZ A;  3JCM X;  1XTD A;  4PFZ A;  2QEX T;  1SHG A;  1KQ1 A;  1Q82 R;  3CC7 T;  1RL2 A;  5LJ3 d;  1BK2 A;  1Y71 A;  3CPF A;  1Q82 C;  1HSQ A;  2CSI A;  4XTW A;  1QW1 A;  2E6Z A;  4L59 A;  3KXT A;  3CCM Q;  2YDL A;  2BUD A;  4DOW A;  1VIE A;  1VQ8 A;  5GAM g;  2X3W D;  1IO6 A;  4JLG A;  1UG1 A;  4ORZ A;  1VQL T;  1PRL C;  4BY6 C;  3G4S T;  4HT8 A;  5GAN 6;  4J8O A;  4FL6 A;  4RG2 A;  2DAQ A;  3MEU A;  4B6M A;  5GMK l;  2YWW A;  1S1N A;  1TU0 B;  3TVT A;  4PJO F;  4KBM B;  2QK0 A;  4AT1 B;  3P8H A;  1ZSZ A;  2DRM A;  2QEX Q;  3JCM Q;  2D8H A;  2VGN A;  4GY5 A;  1A0N B;  4M77 C;  3CC7 Q;  2EWN A;  2KRM A;  2DXB A;  2C0I A;  1ZX6 A;  2CP0 A;  1KSW A;  1WI7 A;  3M0U A;  3THK A;  5GAO r;  2KYB A;  1JXO A;  1K9M C;  4M7D F;  3P8B B;  4DBH A;  2DPP B;  2MYS A;  2JTF A;  5EG2 A;  4RTT A;  3CXC S;  4QVC A;  4J6X A;  1QMC A;  1VQL Q;  1Q86 U;  1VQO T;  2HSE B;  3G4S Q;  2KVQ G;  3OB9 A;  3BDU A;  3TEE A;  1N6A A;  2PVD B;  2VGM A;  1UGV A;  3TRE A;  1H3Z A;  3S3M A;  3H41 A;  3CCS T;  3I55 T;  1VQK A;  1UDL A;  1ZSG A;  4RTU A;  1M1G A;  2DD4 A;  2JNG A;  1F1B B;  5L8R E;  1Q86 R;  2ED0 A;  3F70 A;  1JJ2 S;  2KMT A;  4IIM A;  2DK3 A;  5FW9 A;  8ATC B;  3CPW A;  3FB9 A;  1AT1 B;  2RHZ A;  2KY9 A;  2CT4 A;  1N27 A;  4ZTF A;  1RAF B;  1M1F A;  4C8Q A;  4ZTJ A;  2F2X A;  2AKK A;  2E3I A;  1VQO Q;  4JUV A;  3OS0 A;  5KYY A;  3EFO B;  2KGT A;  3BY7 A;  3JB9 H;  3OYL A;  1M1K U;  1RAI B;  3OW2 A;  2E3H A;  2A3L A;  4FYW B;  3JB9 J;  3CCS Q;  5LJ5 f;  3I55 Q;  3EG9 A;  2H3J A;  5J3B A;  1UB4 A;  1NJI R;  3JCM J;  1VYU A;  2SEM A;  1BIB A;  3CCQ T;  3LLR A;  1NJI C;  2KEA A;  4M7A A;  1UJ0 A;  5LJ5 h;  5LJ5 j;  1PM3 A;  3CMA A;  3VYH B;  1M1K R;  3GOX A;  4M75 A;  2LCL A;  2PZ1 A;  2QXF A;  2SRC A;  1YI2 T;  3E9F A;  1HXD A;  3MET A;  1OI1 A;  2Y4X A;  4V2S A;  1YJN A;  4J83 A;  4JS4 A;  4Q5W A;  1QCO A;  1KQS A;  2DIG A;  2CH4 W;  1MMG A;  3EAE A;  1OX9 A;  1ZA1 B;  2NUT A;  3OBW A;  3QJY A;  2A28 A;  2L8D A;  3VS3 A;  4C92 C;  1VQM T;  4BI4 A;  5CK9 A;  4XTX A;  1K9A A;  4L5G A;  4ME7 A;  1I4K 1;  1MV0 B;  3LW5 E;  2RQU A;  1VQN A;  4IUV A;  1LVK A;  3CCQ Q;  2DL3 A;  3N5B B;  3EG1 A;  1VUB A;  3A98 A;  2HKQ B;  3H8Z A;  1GCQ A;  1GCP A;  1AZG B;  4XTY A;  1BYM A;  1M8M A;  3AT1 B;  2AKL A;  5I2M A;  1WHK A;  5CIU A;  2BE9 B;  4PLL A;  3MJX A;  2O9S A;  1G3W A;  2JM8 A;  1WPY A;  2QDY B;  2K3X A;  3BW1 A;  5GMK h;  5GMK j;  1C0M A;  3A8O B;  1VQM Q;  1N8R U;  1XNI A;  4HCB A;  2F2W A;  2NUZ A;  3M55 A;  1CKB A;  4D8D A;  3HRU A;  1EZZ B;  1TH7 A;  2DXU A;  3HKS A;  4EMK C;  3CCU Q;  1PD1 A;  3SWN C;  4M78 A;  2B8A A;  2COZ A;  4M77 G;  3QBY A;  4GBQ A;  1M3C A;  4WTO B;  4JS5 A;  4J7F A;  4NL2 A;  4Z02 A;  3CCM A;  1PRM C;  3QWY A;  1BCM A;  1YJW T;  2KXD A;  2PNI A;  5IH2 A;  4N4G A;  1Z9Q A;  2GF7 A;  1OX8 A;  4JJC A;  1GL5 A;  2O88 A;  1R0C B;  2RJC A;  1VQ5 T;  1AOJ A;  4M7A D;  4LNP A;  2DER A;  3X25 B;  3O5Z A;  3MO8 A;  2NUP A;  3OYM A;  3M57 A;  4AFS C;  4M75 D;  1QVG A;  4JLI A;  3VUZ A;  2DLP A;  1YN8 A;  3V8L A;  1H92 A;  4PJM A;  1AZE A;  2A0F B;  4MZP A;  1VQ4 T;  5HKC A;  1IGQ A;  1M4Z A;  3OYD A;  3JB9 G;  2EKH A;  3OMC A;  1S72 T;  3CCE T;  2QEX A;  3SHW A;  1RAA B;  4FW1 A;  2BTT A;  3CC7 A;  4NS5 A;  5LL6 S;  4OGC A;  1RAB B;  2NUP B;  1TUD A;  3M0P A;  5LJ5 e;  1G3S A;  5LJ3 h;  2Y90 A;  3L2Z A;  5LJ3 j;  3J81 E;  3NGP A;  4M77 E;  1CSK A;  1NYG A;  1YJW Q;  4HXJ A;  3DLM A;  3QDF A;  2IVW A;  1WNL A;  1VQL A;  2DMO A;  2HQX A;  1VQ5 Q;  1KK7 A;  2M16 A;  3G4S A;  1YCY A;  4X1V A;  2O4X A;  2M02 A;  2K57 A;  2XMF A;  2ROL A;  3QXE B;  4BE2 A;  2X4J A;  2L3R A;  1Q7Y R;  1VQ4 Q;  4K11 A;  3NFC A;  4OMP A;  1Q7Y C;  3QWX X;  1S72 Q;  3CCE Q;  4J9H A;  2VWF A;  1KD1 R;  2EYZ A;  3HP9 A;  1WQW A;  4N4H A;  5A0L A;  2O4X B;  1KD1 C;  2HQE A;  2OI3 A;  1X6B A;  1UGP B;  2IPO B;  5CVI A;  1QP3 A;  1M2O A;  2KT1 A;  5AYF A;  3QSU A;  2GNC A;  5I22 A;  3C4S A;  2QYZ A;  4CC2 A;  4RTZ A;  4AFQ C;  1VQO A;  2FYK A;  3R6O A;  2LQK A;  2GBQ A;  2JUF A;  4M78 D;  3EHQ A;  3H0H A;  9ATC B;  2C0O A;  1UTI A;  5HCK A;  3LGF A;  2J7I A;  5GMK e;  1M90 C;  3CCS A;  2H8H A;  2KBT A;  1UFF A;  1RLQ C;  3I55 A;  1BIA A;  5ECA A;  1OEB A;  4C92 G;  1FWZ A;  1YWP A;  2JN0 A;  4HVW A;  4EMG A;  2MCN A;  3OMG A;  3TSZ A;  4AMC A;  5GAN 2;  3EGX B;  2EQU A;  4N4I A;  4E7I A;  1KC8 U;  3M4G A;  4DEY A;  2LRQ A;  4B9W A;  2RI5 A;  1ZBX A;  1IHV A;  4M77 F;  3JB9 D;  2XG8 D;  1M27 C;  5GAN 5;  4CC4 B;  2IIM A;  2M51 A;  1KJW A;  1QVP A;  2OTL T;  2O01 E;  1TG0 A;  1ZSZ C;  5LJ5 d;  4LE9 A;  2XDB A;  1KC8 R;  3KBG A;  4L6V 5;  4JRQ A;  3M9Q A;  3S3N A;  1UGQ B;  2E6N A;  4BB7 A;  2LC4 A;  4XU1 A;  2D0N A;  3ER0 A;  3QUI A;  4J9I A;  4PFO A;  3L2V A;  3SFM A;  3C95 A;  3HFO A;  1PG5 B;  4OMM A;  2X4X A;  3VS5 A;  2YLB A;  2DYI A;  1AWW A;  3CCQ A;  4CRI A;  2KYM A;  1TWB A;  1NG2 A;  4C92 E;  3JB9 F;  1I1J A;  4NL3 A;  1ZUK A;  5KYW B;  1M3B A;  3ME9 A;  1VYV A;  2EGC A;  2DM1 A;  2O9V A;  4ZNX A;  4HA8 A;  2MOX A;  2P84 A;  2CP7 A;  1M9S A;  1NLP C;  2L89 A;  2I2L A;  3E2U A;  1YI2 A;  3WVD B;  2RHY A;  5LJ3 e;  4KGV B;  3PMT A;  3I35 A;  3O8V A;  4ELZ C;  3LGL A;  1XQH A;  4OMN A;  2ZPB B;  2CZ6 B;  4P5N A;  2BZY A;  1IB8 A;  3QKJ A;  1OZ2 A;  1GRI A;  2K6D A;  4E7H A;  4KH0 B;  1FX7 A;  2E41 A;  2OAW A;  1VQM A;  3V8K A;  2K7A A;  4Z89 A;  2DIL A;  3PT9 A;  4M4Z A;  1GFD A;  5FRO A;  5CR2 A;  1M5Q 1;  2FPE A;  4AG1 C;  2EPD A;  4C8Q C;  1GBR A;  2CSQ A;  2F2V A;  1X01 A;  3RIR A;  2XDD A;  3CBO A;  1SEM A;  1MND A;  2AZS A;  3QG1 A;  4FU6 A;  4PJO B;  2FO0 A;  3JCM g;  3EGD A;  2LCC A;  2KE9 A;  1JO8 A;  4LXC A;  3UF4 A;  2CS7 A;  2QDL A;  4F7U A;  4A4F A;  3CPW S;  1PSE A;  1D1B A;  2HQH A;  2YSQ A;  1K1Z A;  3OYB A;  2DL4 A;  1YFN A;  1LOJ A;  2MWO A;  3M0T A;  1IRE B;  2DEU A;  4KH1 B;  4M7A C;  2EKO A;  4M7D B;  1NE8 A;  2JVV A;  1X69 A;  2GCX A;  5CCA A;  4PNO A;  4M75 C;  4PKC C;  1D0Z A;  2E5K A;  1ACM B;  1SSH A;  1OPK A;  2F1L A;  5GAN g;  5FU6 C;  4RUG A;  3GIB A;  4C92 F;  3T9N A;  2RN8 A;  2LZ6 B;  3OW2 S;  1K0S A;  2CKK A;  2LJ3 A;  2O31 A;  2P0Q A;  4JRK A;  1V1C A;  4OB2 B;  3A8H B;  3JV3 A;  2WSC E;  1KQ2 A;  1P92 A;  4BE1 A;  2EQK A;  2ESW A;  2E5Q A;  1YJW A;  2J6K A;  4KUD K;  1NLO C;  1J3T A;  4BI3 A;  2CRE A;  1IHW A;  1ZUU A;  1K0X A;  1VQ5 A;  3QJ6 A;  1ZHI A;  1LJO A;  1NM7 A;  2D8J A;  4IUP A;  2ZPF B;  1TXQ A;  1GCQ C;  4XU2 A;  3M56 A;  3EFS A;  4JJN K;  1KQS S;  3SEM A;  3RUX A;  4KUL A;  1VQ4 A;  2YUP A;  2M1H A;  5CKB A;  1JB0 E;  1SKU B;  3VU3 C;  1S72 A;  2VXF A;  3CCE A;  2XU8 A;  4QKU A;  5IHI A;  2EFI A;  1JJ2 P;  1ZBJ A;  1RAE B;  3M0Q A;  5D6W A;  3G6E T;  2ZPH B;  3J7A F;  3CCR T;  4JRI A;  5DY9 A;  2DTI A;  2F5K A;  3VUB A;  1M3A A;  2M0O A;  1K8A U;  3QDR B;  3A8G B;  2QI2 A;  1WHM A;  3DLL A;  4OMQ A;  2QQA A;  2A7Y A;  1M2V B;  3X28 B;  4LUD A;  2NYS A;  1WXB A;  4M78 C;  1NEG A;  1YIJ T;  4D8K A;  2I0N A;  3OYJ A;  4XU3 A;  2R5M A;  4J7I A;  1UEB A;  2YUN A;  3E9G A;  2YT6 A;  1K8A R;  1JEG A;  2LJ1 A;  5LJ3 g;  5FRM A;  2GFA A;  3KUF A;  4JPB W;  4OVA A;  3X26 B;  3G6E Q;  3GNF B;  3CCR Q;  1G5V A;  5J26 A;  2RQT A;  3OSV A;  2LDM A;  4XAX B;  2M9U A;  3A8L B;  1D1C A;  2FZK B;  3VV0 A;  2V1R A;  3FLG A;  4CC7 A;  1N9R A;  1W2B A;  4LDU A;  4BDY A;  3J80 E;  1RI0 A;  4II1 A;  2MI6 A;  1QLY A;  1E6G A;  1Q86 C;  3OS2 A;  2DTH A;  3EFO A;  1YIJ Q;  1AWJ A;  4NOY A;  1W6X A;  3VRY A;  4E7L A;  1OV3 A;  1TTH B;  3CC2 T;  1B07 A;  2LQW A;  4OB1 B;  1TUG B;  1NZ9 A;  2RO0 A;  1QVG S;  4LDV A;  7AT1 B;  3PGG A; 
#chains in the Genus database with same CATH homology
 3VS6 A;  2HCK A;  1I07 A;  1UHF A;  1B3Q A;  1PRM C;  3QWY A;  1ZUY A;  1PHT A;  2KXD A;  5L23 A;  2PNI A;  5IH2 A;  1GBQ A;  5I11 A;  1Z9Q A;  4JJC A;  2FPF A;  1GL5 A;  2O88 A;  4LN2 A;  1AOJ A;  2YUO A;  2EBP A;  2RNA A;  4LNP A;  2VKN A;  2V1Q A;  4OMO A;  4HVU A;  3O5Z A;  2OJ2 A;  4AFS C;  2K2M A;  2DLP A;  1YN8 A;  1H92 A;  1WDX A;  2EQI A;  1WYX A;  2L0A A;  2FG0 A;  1AZE A;  2JM9 A;  1PKT A;  2X3X D;  1RUW A;  1YWO A;  3UAT A;  3PE0 A;  3GBQ A;  2EKH A;  3SHW A;  2GTO A;  4GBQ A;  2BTT A;  5IHK A;  2D1X A;  2P4R A;  1EFN A;  2KXC A;  2J06 A;  1YCS B;  1TUD A;  3M0P A;  3LH5 A;  3VS4 A;  3ULR B;  1WA7 A;  1FMK A;  2FPD A;  3NGP A;  1CSK A;  1NYG A;  3ZL7 C;  4HXJ A;  4A63 B;  2RQR A;  3M0R A;  1FYN A;  2DMO A;  5IHN A;  2DL8 A;  4X1V A;  2XMF A;  1UE9 A;  2CT3 A;  5FWB A;  2CUB A;  4F14 A;  2ROL A;  4JZ3 A;  1GFC A;  1X6G A;  2ECZ A;  1AD5 A;  4RTW A;  1HD3 A;  4K11 A;  2HBW A;  4OMP A;  4AG2 C;  1U3O A;  2AZV A;  3QWX X;  1JQQ A;  1WXT A;  4J9H A;  1AWO A;  2A37 A;  2DJQ A;  2VWF A;  2KT8 A;  2EW3 A;  2VVK A;  2EYZ A;  2DL7 A;  2LQN A;  4GLM A;  3VS7 A;  2OI3 A;  5GJW B;  1QKW A;  5GJV B;  1X6B A;  1X43 A;  4J9D A;  5EC7 A;  2KT1 A;  1T3S A;  2GNC A;  5I22 A;  4WCI A;  4CC2 A;  3I5S A;  2JS0 A;  1T3L A;  2DYB A;  3CQT A;  4DEX A;  2L3P A;  4RTZ A;  4AFQ C;  1MV3 A;  2J05 A;  2FRY A;  2GBQ A;  1PKS A;  2GGR A;  3EHQ A;  2JS2 A;  3H0H A;  2RMO A;  2LMJ A;  2C0O A;  1UTI A;  5HCK A;  2RQV A;  3NMZ C;  2EGE A;  2RPN A;  1ABO A;  1JXM A;  2ENM A;  2J7I A;  2H8H A;  2KBT A;  1UFF A;  1RLQ C;  4J9E A;  1I0C A;  2FRW A;  5ECA A;  1OEB A;  1UJY A;  1VYT A;  2CDT A;  2DBK A;  4HVV A;  1YWP A;  4HVW A;  3EG0 A;  1QWE A;  2MCN A;  3TSZ A;  2FEI A;  4F16 A;  1NEB A;  1YP5 A;  1Y57 A;  2HSP A;  2HEQ A;  2KRS A;  2KR3 A;  4DEY A;  2JT4 A;  2L3S A;  4LUE A;  2J6O A;  4RTV A;  3I5R A;  1H8K A;  2AK5 A;  3M0S A;  1KIK A;  2LJ0 A;  4AFZ C;  1M27 C;  1AEY A;  1U06 A;  2MIO A;  3H0F A;  4CC4 B;  2IIM A;  1AVZ C;  1KJW A;  2M51 A;  4JJB A;  1RI9 A;  1NYF A;  4Z8A A;  4ESR A;  1WXU A;  1TG0 A;  1SPK A;  2L3Q A;  1T0H A;  2EVR A;  4LE9 A;  2L2P A;  3C0C A;  1WIE A;  4J9B A;  2EYY A;  1WLP B;  2K3B A;  4EIK A;  2KNB B;  2ROT A;  3EG3 A;  1MUZ A;  2D0N A;  4J9I A;  1SHG A;  4RTY A;  1E7O A;  4OMM A;  3VS5 A;  1BK2 A;  1AWW A;  1HSQ A;  2CSI A;  2KYM A;  4Y92 A;  1NG2 A;  1QCF A;  1I1J A;  1OOT A;  1ZUK A;  2GTJ A;  1M3B A;  3I9Q A;  2YDL A;  1VYV A;  2EGC A;  2DM1 A;  2O9V A;  4ZNX A;  3U23 A;  2MOX A;  2X3W D;  1IO6 A;  3H0I A;  1UG1 A;  1NLP C;  1QWF A;  4ORZ A;  1PRL C;  3I35 A;  4OMN A;  1E6H A;  4E6R A;  2BZ8 A;  2BZY A;  1S1N A;  1GRI A;  1W70 A;  1K4U S;  2K6D A;  3TSW A;  3UA7 A;  2PTK A;  4J9C A;  3TVT A;  2OAW A;  2EGA A;  1UEC A;  2K7A A;  2KRN A;  1G2B A;  4Z89 A;  2DIL A;  4M4Z A;  2DRM A;  2D8H A;  1GFD A;  1A0N B;  1SRM A;  2KRM A;  2DBM A;  2C0I A;  2FPE A;  1ZX6 A;  2EPD A;  4AG1 C;  1GBR A;  1KSW A;  1WI7 A;  1YNZ A;  2CSQ A;  2F2V A;  3M0U A;  2KYB A;  1JXO A;  3THK A;  3RNJ A;  2JXB A;  1SEM A;  1CKA A;  2AZS A;  4RTT A;  3UA6 A;  1SRL A;  1N5Z A;  2FO0 A;  2NWM A;  2LNH B;  3VS0 A;  2A36 A;  1T0J A;  2KE9 A;  1JO8 A;  2DE0 X;  3UF4 A;  2DL5 A;  3NHN A;  2QDL A;  4FSS A;  2ABL A;  3PVL A;  2YSQ A;  4F17 A;  1OPL A;  1K1Z A;  2C0T A;  2DL4 A;  1UGV A;  2HDA A;  3M0T A;  3H41 A;  2LP5 A;  1U5S A;  1UDL A;  1ZSG A;  4RTU A;  2JMA A;  1X69 A;  2ED0 A;  2E5K A;  4KRT A;  1SSH A;  1OPK A;  4IIM A;  1BB9 A;  4RUG A;  5FW9 A;  2M0Y A;  1Y0M A;  2RN8 A;  2LZ6 B;  1K0S A;  2LJ3 A;  2O31 A;  1W1F A;  2CT4 A;  2K79 A;  1V1C A;  2YUQ A;  3JV3 A;  1PNJ A;  2BZX A;  1LCK A;  3REB B;  2ESW A;  2J6F A;  2DA9 A;  2F2X A;  3RBB B;  2AKK A;  2J6K A;  2LCS A;  1NLO C;  1J3T A;  3REA B;  2A08 A;  2CRE A;  1ZUU A;  1K0X A;  2KGT A;  2W10 A;  3VS1 A;  1NM7 A;  2D8J A;  2DF6 A;  3VS2 A;  2RF0 A;  3EG2 A;  1X27 A;  4AFU C;  3EGU A;  1GCQ C;  1VYU A;  2SEM A;  3VRZ A;  3SEM A;  4Z88 A;  4JJD A;  2YUP A;  5FWC A;  2KEA A;  1UJ0 A;  3KFV A;  2CUD A;  1BU1 A;  4HCK A;  2LX7 A;  2PZ1 A;  1M30 A;  2JTE A;  5IHI A;  1ZBJ A;  2SRC A;  3M0Q A;  2EYW A;  2CH4 A;  2RQW A;  1BBZ A;  2O2O A;  3FJ5 A;  2G6F X;  1M3A A;  2GQI A;  2CH4 W;  3NPF A;  4J9G A;  1WFW A;  4OMQ A;  4CC3 A;  2A28 A;  5IXF A;  3VS3 A;  4JZ4 A;  4LUD A;  1WXB A;  1K9A A;  1NEG A;  1QKX A;  4J9F A;  4D8K A;  1TUC A;  1MV0 B;  2I0N A;  2RQU A;  1X2Q A;  1UHC A;  2JMC A;  1ABQ A;  2DL3 A;  3EG1 A;  2YUN A;  2YT6 A;  3A98 A;  1JEG A;  1UUE A;  2LJ1 A;  1GCQ A;  1GCP A;  1AZG B;  1M8M A;  1HJD A;  2AKL A;  1JU5 C;  1Z9Z A;  4JPB W;  2DNU A;  4RTX A;  1H3H A;  1K76 A;  1RLP C;  1XOV A;  3PVQ A;  1AWX A;  1WX6 A;  1ZLM A;  2EYX A;  1KFZ A;  1VA7 A;  2K9G A;  2O9S A;  2RQT A;  3EHR A;  2ED1 A;  4R0K A;  2JM8 A;  2V1R A;  3IQL A;  4CC7 A;  2DRK A;  2DX1 A;  3R6N A;  2DVJ A;  1QLY A;  2F2W A;  1E6G A;  2NUZ A;  4D8D A;  1CKB A;  1G83 A;  2W0Z A;  1AWJ A;  3VRY A;  1W6X A;  1OV3 A;  2KRO A;  1X2K A;  4QT7 A;  4IIO A;  1B07 A;  2LQW A;  4OML A;  5IXB A;  1ARK A;  2B86 A;  1SHF A;  1PWT A;  2JW4 A;  1M3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...