2DL8A

Solution structure of the sh3 domain of human slit-robo rho gtpase-activating protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human SLIT-ROBO Rho GTPase-activating protein 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SLIT-ROBO Rho GTPase-activating protein 2
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl8A00
1JQQA 2FO0A 1UG1A 2KRSA 4J9GA 2FRYA 1AWJA 2LP5A 4RTTA 2YDLA 1GBRA 4JJDA 4EIKA 1S1NA 1K0XA 4CC3A 1QKWA 2KT8A 2L2PA 1YWOA 3H0FA 3JV3A 5HCKA 4GLMA 2C0IA 2VVKA 4ESRA 2YUNA 2CSQA 2J6FA 1ZBJA 2J7IA 1WXTA 2L3QA 2OAWA 5IHNA 4RUGA 1NYFA 1GCQC 2GTJA 2CT4A 1ZUKA 2VWFA 1K4US 2EGAA 3UA7A 2AK5A 1LCKA 3NPFA 1B07A 1PKSA 2DA9A 2CUDA 2QDLA 2DL4A 3M0SA 3TSZA 2F2WA 4RTXA 2DL7A 2EGEA 2DL8A 2OJ2A 4CC4B 2A37A 2KROA 1PHTA 4Z8AA 2X3WD 1U3OA 3RNJA 1AZGB 3NMZC 4JPBW 2ABLA 4JJBA 5I22A 2LZ6B 3M0RA 2DBKA 2PNIA 1M3CA 1UUEA 2EPDA 2YT6A 1KSWA 4J9FA 1CKBA 1YWPA 3PE0A 2P4RA 2CT3A 1WX6A 1H8KA 4DEYA 1V1CA 1M3AA 4M4ZA 5GJVB 1YP5A 4A63B 2NWMA 2LX7A 2AZSA 3I5SA 1H3HA 1B3QA 1GCPA 3NHNA 3EG1A 1JXMA 1BU1A 3SEMA 1OV3A 2CH4W 4D8KA 5FWCA 1ABQA 2AKKA 2EYZA 1ZX6A 4JZ4A 1E7OA 4LNPA 5IHIA 1W70A 3I9QA 1XOVA 4J9BA 1G83A 2LJ1A 1X2QA 3EGUA 3M0TA 1X43A 2JXBA 2JT4A 2RNAA 2BTTA 2FPEA 2KE9A 4J9HA 2E5KA 2ECZA 4HVWA 2KEAA 4RTYA 2ED0A 2SRCA 2DRKA 4CC7A 1X6BA 2F2VA 2AKLA 4LUEA 2O31A 4J9EA 2ESWA 1AD5A 2BZXA 2YUQA 4RTVA 3EG0A 1UECA 2EBPA 1NM7A 1Y57A 4JJCA 4OMLA 2KR3A 4LN2A 1X2KA 1OPLA 1PRLC 1UE9A 1PKTA 5GJWB 1JXOA 1GBQA 2LQNA 2LCSA 3UF4A 3I5RA 5IH2A 1OEBA 1UDLA 1JEGA 3I35A 3NGPA 1BB9A 3EG2A 1QWEA 1E6GA 3GBQA 2CH4A 2FPFA 1QKXA 1ABOA 2DRMA 3M0UA 4QT7A 1I1JA 3IQLA 1CSKA 1NEGA 2D8HA 2RQTA 2JM8A 3UATA 2KXCA 1N5ZA 1NLPC 1M3BA 1YCSB 1M27C 1Y0MA 2K79A 2DLPA 4OMOA 4OMMA 4ORZA 1GL5A 2FPDA 3THKA 2DL3A 1WDXA 2MCNA 2A36A 1WXUA 4LUDA 1Z9ZA 3EG3A 1I07A 1VYTA 1K76A 1BK2A 3TSWA 1TUDA 2OI3A 1G2BA 1U5SA 1UHFA 2D0NA 2FG0A 1WA7A 1CKAA 3EHQA 2KGTA 2X3XD 4J9IA 1SPKA 4OMPA 1FMKA 1MUZA 1X6GA 3VS2A 3O5ZA 1A0NB 4J9CA 2LQWA 1GCQA 1U06A 2O88A 4FSSA 1ZUUA 2W10A 1AEYA 4OMQA 1W6XA 1MV0B 1ARKA 2ROLA 1SSHA 5ECAA 1SHFA 1TUCA 2L0AA 1SRMA 1WI7A 3FJ5A 4IIOA 1AOJA 2ED1A 3VS6A 1TG0A 1MV3A 2MIOA 2V1RA 1WYXA 4J9DA 1K0SA 2L3SA 4LE9A 1VYUA 1AWOA 2GNCA 2DL5A 2LJ3A 1UJYA 3C0CA 2KYBA 5EC7A 2SEMA 2DM1A 1IO6A 2O9VA 2D8JA 2KRMA 1VA7A 3VRYA 3TVTA 1M8MA 2JM9A 3PVLA 2RQUA 2C0TA 4JZ3A 2IIMA 2J06A 1FYNA 5IHKA 2EQIA 2RQVA 3A98A 1UJ0A 2KBTA 1Z9QA 2CDTA 4IIMA 4ZNXA 4CC2A 2KYMA 2DYBA 1RI9A 2B86A 2CREA 2GQIA 2HEQA 3SHWA 1WLPB 1YNZA 5L23A 4Z88A 3LH5A 2JMCA 2BZ8A 2D1XA 1RLQC 1PNJA 2FRWA 2K6DA 3H0IA 3ULRB 1M30A 2MOXA 1NLOC 4HVVA 1UHCA 4Y92A 2PZ1A 3PVQA 1NYGA 1JO8A 2YSQA 1SHGA 4HVUA 2DVJA 4OMNA 2LJ0A 3VS4A 2O9SA 2J6KA 2A28A 1UFFA 1WIEA 2JS0A 2V1QA 1T3SA 1ZUYA 1QWFA 2RPNA 2HBWA 2HDAA 2F2XA 2K9GA 4R0KA 2KXDA 2H8HA 1QLYA 3QWYA 4AFSC 1NG2A 2I0NA 2DILA 1GRIA 1KFZA 3UA6A 4F16A 3M0QA 3REAB 2M51A 1AZEA 2DE0X 2YUPA 1UGVA 4KRTA 3U23A 2VKNA 1WFWA 1WXBA 3VS7A 1HSQA 2J05A 2C0OA 1SEMA 4RTUA 1RUWA 2ROTA 1SRLA 4HXJA 3REBB 4E6RA 2EKHA 2LNHB 1K9AA 1KJWA 1I0CA 2RQWA 3VS1A 1W1FA 2ENMA 1X69A 2CUBA 4AFZC 1JU5C 1QCFA 2EW3A 2PTKA 2KT1A 1GFCA 1AWXA 4DEXA 4X1VA 2DX1A 1T0JA 4AG2C 2EYXA 2HCKA 2G6FX 2RF0A 2JMAA 1H92A 1PWTA 3VS3A 3VRZA 3R6NA 2BZYA 1J3TA 1HD3A 5FWBA 5IXBA 4AFUC 2L3PA 5I11A 2J6OA 4Z89A 2KRNA 2JTEA 2GBQA 2W0ZA 2DJQA 1T0HA 4K11A 1EFNA 1YN8A 2AZVA 1E6HA 3M0PA 4HCKA 2GGRA 1GFDA 1PRMC 1ZLMA 1K1ZA 1ZSGA 1OOTA 2RQRA 2DBMA 2K2MA 2YUOA 2XMFA 4AFQC 2EYYA 2FEIA 2KNBB 3CQTA 4GBQA 1RLPC 2RN8A 3H41A 3EHRA 1AWWA 1KIKA 2JS2A 2LMJA 5IXFA 3ZL7C 2DF6A 1UTIA 2RMOA 1VYVA 2DNUA 5FW9A 4D8DA 4AG1C 3VS0A 2A08A 4F17A 1NEBA 4F14A 2GTOA 1X27A 1T3LA 3RBBB 1AVZC 2NUZA 3H0HA 2K7AA 3KFVA 2JW4A 2EYWA 1BBZA 4WCIA 2EGCA 2EVRA 2M0YA 3VS5A 4RTWA 4RTZA 2CSIA 3QWXX 2K3BA 2DMOA 1OPKA 1HJDA 2O2OA 2HSPA
chains in the Genus database with same CATH superfamily
2FO0A 2KRSA 4M78B 4J6WA 1AWJA 1KHCA 1EIFA 1GBRA 2HKNA 4BI3A 1S1NA 2P0PA 3QO3A 3V7CA 5GAOl 2FL7A 2L2PA 3G4ST 4QW2A 3JV3A 3QPHA 3HHTB 2VGNA 1RAHB 3R6OA 1D3BB 2OTLQ 2VVKA 2YUNA 3FLGA 3CMAA 1WXTA 3PGGA 3OYAA 4M75E 3DB4A 3Q1JA 4QVDA 2QAZA 2CT4A 1ZUKA 1K4US 1Q7YR 3JCMJ 4M75C 2CYZB 2O01E 4M78F 1PKSA 2RD1A 2DL4A 3OMCA 4OMFB 4OF1A 3E1SA 5DY9A 2CGHA 4LDYA 2KROA 4TVRA 2FZGB 4Z8AA 4E7ZA 3RNJA 2CP0A 2ZPGB 3NMZC 4JPBW 3OYJA 1PC0A 4JJBA 4M78A 5I22A 2PNIA 1M3CA 1PD1A 1VQ8A 5GANh 1YJWT 2EPDA 3PE0A 1D0XA 1U1TA 1WX6A 1H8KA 4C92E 5GAN8 3RDVA 4DEYA 1V1CA 3UDCA 4XTXA 2NWMA 2OTJA 3M57A 5GAMj 1Q86U 2AZSA 1Q95G 1H3HA 3NHNA 5GANg 4CI0C 3CMAQ 1YJNT 2DK3A 2CP7A 3CC7A 2A0FB 1VUBA 1VQLT 2YLCA 1ABQA 1NJIU 2RH2A 4Y28E 2D9TA 4PK4A 2QGGA 1RI0A 1G83A 3CCMT 2LJ1A 1AT1B 1NJIR 2JXBA 2JT4A 3EH1A 4Q5WA 1VQMT 1KQSP 4OB0B 4A54A 3A8MB 4DOWA 3WXMB 2HNIA 1YCYA 3BE3A 3NTKA 1H641 1S72T 2SRCA 3KUFA 4ATOA 1YITT 3RMSA 3M4YA 2ESWA 1AD5A 2YUQA 1OZ3A 4RTVA 3CMEQ 3EG0A 2Y4XA 1UECA 3WVEB 2NUTB 1Y57A 2KR3A 1M90U 2COZA 1PKTA 3QSUA 5GMKh 1M2OA 2EJGA 1UGSB 1TWBA 1B7TA 4C8QE 3CBOA 3JB9F 3NGPA 1BB9A 2E10A 1WNLA 1QVGA 1JRIA 3QG1A 3J81E 2HBPA 4QT7A 1I1JA 3MHXA 1CSKA 5LJ5e 4C92F 3L2UA 1NLPC 1Y0MA 2K79A 3CC7Q 3I55Q 2HAXA 5GAOp 2DL3A 1WXUA 2HSEB 1O9SA 5GAOn 1Q7YC 3JAME 3EGDA 2P4TA 1TUDA 2O4XB 1G2BA 4DBQA 4AT1B 2KGTA 3ME9A 4J9IA 1YBYA 4OMPA 2D0QB 1X6GA 3SD4A 3O5ZA 2MK5A 1VQMA 2JTFA 2NUTA 4J9CA 1U06A 5KE3A 2DKGA 4HA8A 4F7UF 1MV0B 3I56Q 2EQJA 1M90R 1SHFA 1TUCA 1ZA1B 2JTMA 2BE7D 1M2VA 4IIOA 5GANj 1AOJA 2ED1A 2PU9B 1TG0A 1MV3A 3CMEA 4F7UA 2V1RA 3CCSQ 1K0SA 4XU2A 3V7RA 4M7DD 3VYHB 4JJNK 1AWOA 2GNCA 2LT1A 4B9XA 4EMGA 1VQOA 3BY7A 4XTZA 2E6NA 2O9VA 4M7AC 3VRYA 2DXTA 5AYFA 3PVLA 3SB2A 5FRMA 2IIMA 3G6ET 2RHIA 1VQPQ 5KYWA 1BCOA 3CBMA 5IHKA 3JCMX 3CCLQ 4RCCA 3A98A 3E2UA 4ZNXA 1M1GA 3MEWA 2CS7A 2GQIA 3OA6A 4HKEA 3JB9I 5L23A 4Z88A 2AHJB 2BZ8A 2F1LA 3MJXA 1RLQC 1IZ6A 3MP1A 2COWA 2RHUA 1P92A 4PJOE 2PZ1A 1R77A 3M58A 3PVQA 1IGUA 1WZOA 3HL8A 2RI3A 4J5YA 2YSQA 1SHGA 1WHGA 1DJ7B 4OMNA 2O9SA 2J6KA 2A28A 1PG5B 1UFFA 7AT1B 3P8BB 5CQXA 1TH7A 4C0GA 1T3SA 3HKSA 3G71T 4GY5A 2RPNA 2OTLA 5FU7B 2K9GA 1QLYA 3OYHA 2DZ9A 3M56A 2QA4A 4M77B 3OS2A 2CZ0B 3G7ZA 4M7AB 1WHMA 4P5NA 3ZEHA 3UA6A 3M0QA 3REAB 3H6ZA 1JBMA 2EYQA 3U23A 2DFUA 2C0OA 3T9NA 1SEMA 2A7YA 4LD6A 1RUWA 4IUTA 3C94A 1SRLA 5CQYA 2E3IA 3REBB 4F7UG 1K9MC 3F70A 3MKDA 1YHQA 3ZBDA 1X69A 2CUBA 4C5IA 2L3RA 4BI4A 1YHQT 3HRUA 2BUDA 1K8AC 1VQKT 1NBEB 1GFCA 3VUBA 2ZAEA 1AWXA 2YXYA 5GMKi 1SF9A 1K73C 4X1VA 3M9QA 2DX1A 2HCKA 4C8QC 2G6FX 5LJ3g 1KQSS 3CC2T 4JDSA 2M1HA 3VS3A 3VRZA 2HKQB 3UPUA 2K4YA 5I11A 2J6OA 2W0ZA 3P8HA 2DJQA 3PIOA 2VV5A 1YN8A 4JS4A 1GFDA 1YFNA 4M77A 3A5ZB 1TTHB 3CD6T 1ZSGA 3OYKA 4OGEA 2RQRA 3X24B 2R5AA 2E4HA 2WSFE 3BDUA 5FLXE 1RLPC 3RR6A 2X35A 2KI7A 4QVCA 5GAOm 3A8OB 2COYA 3JCMW 1VQ7A 5LJ3f 2K2VA 2F69A 2JS2A 5IXFA 1MMGA 4C0ZA 2DF6A 1UTIA 2CP6A 5FW9A 4AG1C 5L8RE 2QQSA 3VS0A 4F14A 2XDBA 5A2QE 2NUZA 3H0HA 4N4IA 4E2FB 3OYLA 3KFVA 4DA4A 3JSCA 2K3XA 2LT4A 2DXBA 4RTWA 3QWXX 1NZ9A 3I55A 1ZQ1A 3EFOA 4E7JA 2DMOA 4FL6A 4A53A 3JCMh 2HSPA 2AIRB 1FX7A 4J9GA 1FMWA 3V7SA 3QJ6A 3JB9J 1O75A 4RTTA 2LTOA 2YRDA 3CC4A 4EIKA 3HSBA 2QQBA 2EJ9A 1WJRA 4KGVB 4RKUE 5LJ3d 2KT8A 1M9SA 1QVPA 2ZPIB 3H0FA 3MCAB 5HCKA 4HT9A 4ESRA 4M78C 2J7IA 3TEEA 4RUGA 3HRTA 2DEUA 2GTJA 5GAOr 2VWFA 2EGAA 4JLGA 5GAMh 3O8VA 2BKDN 3M59A 1YJ9Q 1YJNQ 1K8AU 1QVFP 2I2LA 2DA9A 2C06A 2CUDA 3QDRB 1VQ4Q 1YJWA 1PSEA 2F2WA 4FYXB 2Y90A 4M7DF 2DL7A 2DL8A 2VYTA 4CC4B 2DXCA 1TXQA 4L59A 1VQ9Q 2A37A 4PJOA 4M77D 1NE8A 2OTJQ 1M1KC 1AZGB 4R56A 3OYBA 2RHZA 5I2MA 2DBKA 4OVAA 4ZGDB 3CCLA 1I5LA 1UUEA 2E64A 4YTLA 4J9FA 2CZ6B 1CKBA 1YWPA 2P4RA 1M90C 2CT3A 2OTLT 1LJOA 4M4ZA 2YHTA 1BI1A 2LX7A 1Q82R 1G3WA 1C0MA 1GCPA 3JRZA 3EG1A 2O4XA 1BU1A 2QGFB 3X26B 4D8KA 3G1JA 3CCEQ 5HKCA 5GAN5 2EYZA 1ZX6A 2XD0A 3LX7A 4JZ4A 4NOYA 1HK9A 1E7OA 5IHIA 1XOVA 4EMHA 3EGUA 1RAGB 4M7DC 1VQPT 1X43A 4MZMA 1M2VB 5GANf 2RNAA 2RA2A 4LDVA 2KE9A 4UC4A 1G3SA 1UGRB 4J9HA 1F1BB 1R8OB 1M1KR 4HVWA 4C5GA 2KEAA 4FYWB 4RTYA 3WVDB 3FC3A 4CC7A 1V76A 5A0DA 2LDMA 2X4YA 2KSSA 2V8IA 3S3NA 1OYXA 4J9EA 5GMKm 3LW5E 3P8DA 3JB9D 1RL2A 3S6WA 2BZXA 1IHVA 3C4SA 4RMOA 4OMLA 3A8LB 4PFPA 5KYWB 3FRNA 1X2KA 1OPLA 1PRLC 2CKKA 1JXOA 2E3HA 3G4SQ 3SDZA 2LQNA 3UF4A 3MP8A 3MEVA 1UDLA 1RADB 1R0BG 1N8RR 3EG2A 2XU8A 1BKBA 3G71Q 3CCST 1E6GA 3GBQA 2CH4A 2FPFA 3TREA 4KUIA 4OB1B 2DRMA 3GIBA 1MMDA 3A1PA 2KXCA 3NTIA 1M3BA 2M02A 1YCSB 1M27C 2GQVA 3CCRQ 2DLPA 4OMOA 4OMMA 4QKUA 2X4JA 1WDXA 2A36A 3NTHA 1VQ5A 2H3EB 1K76A 3QJYA 4ZN3A 3TSWA 3OS5A 1Q82U 1S72A 2OI3A 1UHFA 3CMET 3EHQA 2X3XD 1FMKA 2HZYA 2QEXA 1A0NB 9ATCB 2LQWA 1D0YA 4FSSA 2W10A 3URGA 4XQ3A 2M16A 1K9MU 4M7AA 1ARKA 3JCMV 1SSHA 2IVWA 5ECAA 1SRMA 2MIOA 1WJQA 3GNGA 3GP8A 3L2QA 4FYYB 1VYUA 3UWNA 2DL5A 5CAIA 2RB6A 2RHXA 2L89A 2DTIA 1UJYA 3C0CA 2V8JA 2XDPA 1VQLQ 2RK1A 2DM1A 2D8JA 4C0DB 4A4GA 1G8XA 3G71A 2RQUA 4MZPA 2WSEE 1MNEA 5KYXB 3CCSA 2J06A 4O5VA 2HQXA 2EQIA 2RQVA 2X51A 4A4EA 1B34A 1Z9QA 1N8RC 5HK3A 2E12A 3FB9A 4BI8B 2LQKA 4CRIA 4C8QG 1YNZA 3VUZA 1ZHIA 2BE9B 2D1XA 3PMIA 1PNJA 4XTUA 2FRWA 3QUIA 3AHUA 3CEYA 3JCMQ 1UHCA 4Y92A 1EZZB 2GF7A 1M1KU 4PJOF 2DO3A 1NYGA 4ANJA 4M7DG 4HVUA 2LJ0A 1OX8A 2YWWA 1WIEA 1C6VX 3H8ZA 1VQNQ 5HK0A 1NJIC 5LJ5d 4JUVA 3CPWS 2HDAA 1OULA 4NS5A 3FJPA 1HYOA 2GFAA 1GRIA 4C0DC 3CC7T 3MEUA 1KFZA 1D0ZA 3QHSA 1B34B 4EMKB 4F16A 4BDZA 1VQ6A 3CPFA 1KC8C 3EFOB 2YUPA 2RO0A 4KRTA 1WXBA 5LJ3h 4ZTFA 4PJLA 3VS7A 3OYNA 2DXUA 4JLIA 1XJWB 2KY9A 4J6YA 4HXJA 2QASA 3TQ7P 2EKHA 1KJWA 5IAYA 5CKEA 4C92G 3QYHB 3CCVA 2KT1A 1WGSA 3BW1A 4DEXA 3VYGA 3M55A 3VJPA 4LDWA 2EYXA 2RF0A 2JMAA 1KC8R 2F5TX 4FM4B 1BI3A 3R6NA 5FWBA 4OB2B 1PSFA 2G3RA 2QYZA 4KH0B 1KD1C 1IXDA 3L2RA 4IKFA 4M75D 4Z89A 2KRNA 2GBQA 4K11A 1EFNA 2MI6A 3JCMd 1U8RA 3JCMe 1E6HA 3RIRA 2GGRA 4HCCA 1BI2A 1WHKA 1PRMC 2R5MA 1ZLMA 1K1ZA 4PJOB 3OYFA 1OQKA 2A3LA 4NL3A 3ER0A 4M77E 2CZ1B 2EYYA 2FEIA 2IG0A 2QXFA 3CCLT 3CQTA 4N4GA 5J39A 1M5Q1 3H41A 3EHRA 2NUPA 4BY6B 3LYIA 3QZ9B 1VQ6T 4D8DA 4XTWA 1FWZA 1AVZC 2OAUA 2DYIA 2LRQA 2X9HA 2JW4A 2EYWA 1UB4A 1BBZA 1I8FA 1QVFA 2EVRA 3QIIA 4RTZA 2F5KA 2QQRA 3OYDA 2K3BA 4HCBA 4BDYA 1VQ9T 2O2OA 2HD0A 3TU4K 2QG9B 1UG1A 5FU6C 3G6EA 2AT1B 4JJDA 3G4SA 1WHHA 2RJDA 4CC3A 3X28B 1YIJA 1QKWA 2E6ZA 5GANd 1YWOA 4GLMA 5GAN6 3M5AA 5CKDA 4V2SA 1FMVA 5GAOq 1X75C 2RJFA 4IUQA 1WJSA 4M77F 2J6FA 2KK4A 2L3QA 1MMAA 3SFMA 2OAWA 3CCJT 5IHNA 1NYFA 4XU1A 1GCQC 5HY6A 3EAEA 3OBYA 5GAMf 3UA7A 5CCAA 1BYMA 5CIUA 4MMLA 4ELYC 3FEOA 1B07A 3CCET 4MDXA 2QK0A 3MO8A 4RG2A 3TSZA 2FVUA 1D09B 1PM3A 4IUUA 4KULA 4C5HA 4ELZC 1YIJQ 1VQKQ 1PHTA 2LQ8A 2X3WD 2EKOA 3OW2P 1Y96B 2HL5C 1OZ2A 3EH2A 2ABLA 2DD5A 3N5BB 3CPWA 2R58A 2LZ6B 3M0RA 2LC4A 4IURA 1YJ9A 1LPLA 2XICA 3BFMA 1N27A 5LL6S 5D6YA 2KDSA 4X9DA 3X25B 1BIAA 1G3TA 4BE2A 1W2BS 1M3AA 4A63B 3RERA 1G5VA 4M75G 3CD6Q 2QTXA 3I5SA 1B3QA 3OS1A 1VQLA 1JXMA 2JJ9A 1YJ9T 1OV3A 2CH4W 3J7AF 4QQ6A 5CK9A 4PKCC 2DERA 2AKKA 2QA4T 4PFOA 1KK7A 4LNPA 3CC4T 5LJ5f 2XK0A 3I9QA 5LJ3j 1IREB 2Z0WA 4A4KA 5M9OA 5GANe 1FXXA 1I81A 2BTTA 1PD0A 2FPEA 4C8QD 3J80E 2E5KA 2PUOB 1Y96A 4OGCA 2EQMA 2ED0A 2B8AA 4DQ2A 2KAFA 4M78G 3OMGA 5GAMd 3OYCA 1Q81U 1HXDA 2F2VA 1VIEA 2AKLA 2CP2A 2EQUA 2ZPHB 1Y71A 2O31A 1YI2T 4M7AD 1RAIB 3I56A 1NM7A 4LD9K 4JJCA 5KYXA 4LN2A 1I4K1 2FYKA 1UE9A 5GAN4 3PT9A 5GJWB 3HTRA 1VQ7T 2LCSA 1JB0E 2E1HA 5AT1B 3I5RA 5IH2A 1OEBA 2L5QA 2QQAA 3I35A 2DAQA 2L8DA 4MMKA 3JCMP 2V26A 4FW2A 1JJ2S 1QWEA 3V8KA 4EMKC 2QI2A 5GMKe 2OX7A 4C92B 3L42A 1QMCA 2QTVA 1UEBA 3IQLA 2D8HA 4F04B 1IHWA 3UATA 1N5ZA 2RJEA 3DKMA 1VQPA 1Y7XA 1GL5A 2LVMA 3THKA 3FDRA 2E5QA 5LJ5h 1YI2A 2E41A 1WQWA 1Z9ZA 3EG3A 1OU9A 3LWIA 2HMAA 1ACMB 1Q86R 2PVOB 2OTJT 5IN1A 2PVGB 2KVQG 1TSFA 1SPKA 1K8AR 2DTOA 5IT9E 1MUZA 3VS2A 1GCQA 2O88A 4PJOD 1ZUUA 5GAN7 1AEYA 4FCYA 3M4GA 1KQSA 4A4FA 2JNGA 4M7DE 2CP3A 2ROLA 4E7LA 4EMKA 2L0AA 1WI7A 2V8KA 3FJ5A 4J7FA 3ZFJA 4XTYA 4E7HA 3HFNA 1WYXA 2ZCFB 2L3SA 1YJNA 1QP2A 5D6XA 1WHJA 3QDFA 3PNWC 1EX4A 2KYBA 5EC7A 2SEMA 3CCRT 3RKYA 4OB3B 1IO6A 3CCVT 1VA7A 4C92C 3TVTA 2JM9A 3MEAA 4E7SA 2K3YA 2C0TA 4JZ3A 1Q7YU 1IRXA 1FYNA 4DBHA 2H3JA 2CDTA 3RMQA 4CC2A 3LLRA 2DVEA 2DYBA 2B86A 4ZN1A 5A0GA 3SHWA 2ZPFB 5C0MA 2JMCA 4IUVA 2K6DA 3H0IA 4KT0E 1M30A 5FU6B 1NLOC 2DETA 3CCQT 4EPCA 4E47A 4E7KA 5D7UA 2DVJA 2X4WA 1ZBXA 3D7SB 2NUPB 4DBFA 4FYVB 2QQ9A 1RAAB 2JS0A 4KGZB 1N9SA 4WTOB 1BCMA 4XU3A 5FRNA 4LDUA 2F2XA 2KXDA 4PJMA 2H8HA 3CCQA 1ZSZA 2VXEA 1VQOT 4AFSC 1NG2A 2I0NA 2DILA 4LXCA 5KH6A 1RABB 4J7IA 3LGLA 2M51A 1AZEA 1WQ7A 2MAMA 5KYUA 3VKIA 2J05A 3S3OA 4RTUA 1QQJA 4MDWA 4E6RA 2LNHB 1K9AA 3OYEA 1I0CA 3H9NA 4FU6A 1W1FA 4C92D 4AFZC 3JCMb 3CCUQ 2PTKA 5GAN2 1XNIA 4FT4A 2YRVA 1Q81R 1VQ6Q 2QEXQ 4A4HA 3VV0A 1JJ2A 5CVIA 5CO7A 1T0JA 4JRQA 3DLMA 3DLLA 2K5LA 1V29B 4N4HA 3GPLA 2BZYA 1HD3A 3JCMc 5IXBA 3S3MA 6AT1B 1VQ8Q 5FU7C 4KGXB 2VC8A 1T0HA 3CD6A 3BDLA 2AZVA 2RJCA 4HCKA 3M0PA 4RG8A 3EG9A 4X9CA 2FHDA 2E70A 3CCUA 1OOTA 4NL2A 5DLQE 4EDUA 2YUOA 3CMAT 3UT1A 4AFQC 1M1FA 2PVDB 2QA4Q 2Y4YA 1Q86C 4M77G 2RN8A 2RI2A 5GMKl 1AWWA 5KYYB 2LMJA 3ZL7C 3LGFA 5LJ5j 1VYVA 5I21A 3QBYA 2JVVA 3HRSA 4M75B 4F17A 1NEBA 1QVGS 1X27A 2EIFA 5CKFA 2GCXA 1RACB 2EGCA 2M0YA 2XIDA 3VS5A 4II1A 3X20B 2MMPA 4C0FA 1TS9A 1JJ2P 1YI2Q 4N0AA 1WPYA 1JQQA 2FZKB 2HL3A 3QXEB 3V8LA 2FRYA 3M53A 2LP5A 2YDLA 1VQNT 1VQ4A 3OYMA 1PCXA 1OI1A 2ZPBB 4PFZA 4O6JA 1K0XA 2M0OA 5KCHA 3L2WA 4FT2A 2JUFA 4JRIA 3QZ5B 1TU0B 2HQEA 2VGMA 2C0IA 1YITA 4JS5A 3GLXA 4WF2A 3MP6A 2CSQA 1ZBJA 1G3YA 3NFCA 3QKJA 1UGQB 3OYIA 2NYSA 4XU0A 3CPWP 3CXCS 1IGQA 2AK5A 1QVFS 1LCKA 2EJFA 3NPFA 4M75A 2E65A 2XDDA 2WACA 4BY6C 2QDLA 3M0SA 3L2VA 4PLLA 2PQWA 4ZGEB 5GAMe 3CC4Q 4IUPA 4RTXA 2EGEA 2OJ2A 3CCMQ 1N8RU 4M7DB 2JN0A 5GAMg 3PIPA 2RI5A 1U3OA 3L1AA 3OSVA 1VQMQ 4C92A 4DOVA 2NLUA 2R57A 3CXCP 1K73R 2YT6A 1Q82C 3V8JA 4KUDK 1KSWA 1Q81C 3HPWA 3HP9A 5KE2A 4DBRA 3MPUB 3EGXA 2K5FA 2RK2A 4C8QB 2DTHA 5GJVB 1YP5A 2LNVA 5GAN3 2MPXC 2YLBA 3META 4BE1A 2ZGWA 3RKXA 8ATCB 4M7AE 2P0KA 1M4ZA 1VOMA 3CCJA 3SEMA 1D1BA 1ZA2B 3LH0A 5FWCA 1AHJB 3AT1B 4KH1B 3CCVQ 5FROA 2CP5A 1X6OA 2EQKA 3EFRA 1YIJT 1W70A 4AMCA 4J9BA 4E7IA 1X2QA 4FSXA 1VQ5Q 2M9UA 1UGPB 5C6SA 3M0TA 4PJOG 1OX9A 3JB9G 1KD1R 1WHLA 4M7DA 1QW1A 1VQ9A 2VUBA 3I55T 2ECZA 2ATCB 1MHNA 1YJWQ 2DRKA 3LWHA 1X6BA 1KC8U 2DD4A 4L6V5 1MNDA 1ZSZC 4LUEA 1D1AA 4BUGA 3PMTA 4HT8A 1RAEB 3E9FA 2WSCE 4C8QA 2EBPA 2HQHA 1GBQA 1VIFA 3RUXA 4C8QF 4M7AF 1JEGA 1XTDA 1X01A 4QVZA 3CCJQ 1QCOA 4RCBA 1QKXA 3OW2A 1ABOA 3M0UA 1NEGA 2RQTA 4PJNA 2JM8A 5CKBA 3OS0A 4N0AC 2EAYA 3PTAA 5DM7R 4B9WA 4ORZA 3OQ5A 2FPDA 3A8HB 8AT1B 2MCNA 2LCCA 4LUDA 1I07A 2EFIA 1VYTA 1R0CB 1BK2A 3OYYA 3G6EQ 1M8VA 2P84A 1U5SA 2D0NA 2FG0A 4R55A 1WA7A 1CKAA 2K5IA 4C5EA 5GMKj 3QYGB 1YHQQ 3CCUT 5DLOA 3SWNC 1ZSZB 4F7UE 1VQ7Q 4OMQA 2QEXT 1W6XA 1TUGB 4JRKA 1NPPA 1N6AA 3KXTA 1KQ1A 4L5GA 3E19A 3OW2S 3OYGA 3CCRA 5KYUB 1LNXA 3VS6A 5J3BA 4J9DA 1Y07A 1VQ8T 4LE9A 1K73U 2FB7A 3CC2A 4OP0A 1NPRA 4ME7A 2LJ3A 2DIGA 2DJZA 2KRMA 4FIBA 3GOXA 1M8MA 4LDXA 4JRPA 2VXFA 2XKOC 2D6FA 1UJ0A 2KBTA 3OY9A 4IIMA 2GFUA 3INZA 4M78D 5EG2A 4FW1A 2DEQA 2KYMA 3DB3A 1RI9A 2CREA 3JCMg 4HCZA 2HEQA 1S72Q 1WLPB 3E9GA 1W2BA 2ZZDA 3LH5A 1MGQA 2XHCA 3I56T 4KBMB 1YITQ 1KQ2A 1TOVA 3VU3C 3EG9B 3ULRB 1SG5A 1K9MR 1KHIA 2DIQA 2MOXA 3KBGA 4HVVA 3SWNB 2DZCA 3FIFA 4PJJA 3OBWA 1QCNA 3JCMf 4D6WA 5CR2A 2RM4A 4J83A 1JO8A 4Z02A 1I5OB 3EFSA 4M77C 1KD1U 3VS4A 5KYNA 2MWPA 3EGDB 5KYYA 4BACA 5LJ5g 3CC2Q 1BIBA 2V1QA 1ZUYA 2DPPB 3OB9A 2FZCB 3OSSC 5KCOA 2MYSA 4X34A 3CCMA 1QWFA 1IB8A 2HBWA 4VUBA 4R0KA 5LJ3e 1XQHA 2ZPEB 1QP3A 3QWYA 2LX9A 4B6MA 2QDYB 4XK8E 1KG1A 2RHYA 3GF5A 1OU8A 4BB7A 2DE0X 1UGVA 2VKNA 2X4XA 1WFWA 4PJOC 1W4SA 4F7UB 1HSQA 1N9RA 3JB9H 2JZ2A 2KMTA 2IPOB 3HFOA 2ROTA 4XAXB 1MMNA 1U1SA 2VASA 2RQWA 1SKUB 3VS1A 3CCQQ 2K57A 2ENMA 2PUKB 3L2ZA 1H3ZA 1GXIE 3CCEA 1JU5C 1QCFA 2EW3A 5CKHA 2MF2A 4MZTA 3SWNA 1W2BP 4M7AG 1C1AA 2BIVA 2CZ7B 4QQDA 3PFSA 2EWNA 4PL6A 4PLIA 4AG2C 4ZGJB 1H92A 1PWTA 3A8GB 4J6XA 2VB6A 2P0QA 4M75F 1J3TA 4AFUC 2L3PA 2JTEA 1VQOQ 1D1CA 4XTVA 2XI9A 3GNFB 4M78E 2XG8D 5I2SA 3CXCA 3RESA 3C12A 5D6WA 1VQNA 1QVGP 2YRCA 3M54A 4PNOA 2DBMA 1SSFA 1D3BA 2K2MA 2XMFA 2KQWA 2KNBB 3TCJA 3CBPA 4GLKA 2MWOA 4GBQA 4ZTJA 3C95A 1KIKA 1VQ5T 1BI0A 4BD3A 2RMOA 3EGXB 2JOYA 2LCLA 2DNUA 1VQKA 3RKWA 2A08A 4Y91A 2GTOA 1T3LA 5J26A 3RBBB 4BE0A 1LOJA 4J8OA 2K7AA 3ASKA 5A0LA 1VQ4T 4WCIA 1LVKA 2CSIA 1OPKA 1RAFB 1HJDA 4QQGA
chains in the Genus database with same CATH topology
1JQQA 2FO0A 1UG1A 2KRSA 4J9GA 2FRYA 1AWJA 2LP5A 4RTTA 2YDLA 1GBRA 4JJDA 4EIKA 1S1NA 1K0XA 4CC3A 1QKWA 2KT8A 2L2PA 1YWOA 3H0FA 3JV3A 5HCKA 4GLMA 2C0IA 2VVKA 4ESRA 2YUNA 2CSQA 2J6FA 1ZBJA 2J7IA 1WXTA 2L3QA 2OAWA 5IHNA 4RUGA 1NYFA 1GCQC 2GTJA 2CT4A 1ZUKA 2VWFA 1K4US 2EGAA 3UA7A 2AK5A 1LCKA 3NPFA 1B07A 1PKSA 2DA9A 2CUDA 2QDLA 2DL4A 3M0SA 3TSZA 2F2WA 4RTXA 2DL7A 2EGEA 2DL8A 2OJ2A 4CC4B 2A37A 2KROA 1PHTA 4Z8AA 2X3WD 1U3OA 3RNJA 1AZGB 3NMZC 4JPBW 2ABLA 4JJBA 5I22A 2LZ6B 3M0RA 2DBKA 2PNIA 1M3CA 1UUEA 2EPDA 2YT6A 1KSWA 4J9FA 1CKBA 1YWPA 3PE0A 2P4RA 2CT3A 1WX6A 1H8KA 4DEYA 1V1CA 1M3AA 4M4ZA 5GJVB 1YP5A 4A63B 2NWMA 2LX7A 2AZSA 3I5SA 1H3HA 1B3QA 1GCPA 3NHNA 3EG1A 1JXMA 1BU1A 3SEMA 1OV3A 2CH4W 4D8KA 5FWCA 1ABQA 2AKKA 2EYZA 1ZX6A 4JZ4A 1E7OA 4LNPA 5IHIA 1W70A 3I9QA 1XOVA 4J9BA 1G83A 2LJ1A 1X2QA 3EGUA 3M0TA 1X43A 2JXBA 2JT4A 2RNAA 2BTTA 2FPEA 2KE9A 4J9HA 2E5KA 2ECZA 4HVWA 2KEAA 4RTYA 2ED0A 2SRCA 2DRKA 4CC7A 1X6BA 2F2VA 2AKLA 4LUEA 2O31A 4J9EA 2ESWA 1AD5A 2BZXA 2YUQA 4RTVA 3EG0A 1UECA 2EBPA 1NM7A 1Y57A 4JJCA 4OMLA 2KR3A 4LN2A 1X2KA 1OPLA 1PRLC 1UE9A 1PKTA 5GJWB 1JXOA 1GBQA 2LQNA 2LCSA 3UF4A 3I5RA 5IH2A 1OEBA 1UDLA 1JEGA 3I35A 3NGPA 1BB9A 3EG2A 1QWEA 1E6GA 3GBQA 2CH4A 2FPFA 1QKXA 1ABOA 2DRMA 3M0UA 4QT7A 1I1JA 3IQLA 1CSKA 1NEGA 2D8HA 2RQTA 2JM8A 3UATA 2KXCA 1N5ZA 1NLPC 1M3BA 1YCSB 1M27C 1Y0MA 2K79A 2DLPA 4OMOA 4OMMA 4ORZA 1GL5A 2FPDA 3THKA 2DL3A 1WDXA 2MCNA 2A36A 1WXUA 4LUDA 1Z9ZA 3EG3A 1I07A 1VYTA 1K76A 1BK2A 3TSWA 1TUDA 2OI3A 1G2BA 1U5SA 1UHFA 2D0NA 2FG0A 1WA7A 1CKAA 3EHQA 2KGTA 2X3XD 4J9IA 1SPKA 4OMPA 1FMKA 1MUZA 1X6GA 3VS2A 3O5ZA 1A0NB 4J9CA 2LQWA 1GCQA 1U06A 2O88A 4FSSA 1ZUUA 2W10A 1AEYA 4OMQA 1W6XA 1MV0B 1ARKA 2ROLA 1SSHA 5ECAA 1SHFA 1TUCA 2L0AA 1SRMA 1WI7A 3FJ5A 4IIOA 1AOJA 2ED1A 3VS6A 1TG0A 1MV3A 2MIOA 2V1RA 1WYXA 4J9DA 1K0SA 2L3SA 4LE9A 1VYUA 1AWOA 2GNCA 2DL5A 2LJ3A 1UJYA 3C0CA 2KYBA 5EC7A 2SEMA 2DM1A 1IO6A 2O9VA 2D8JA 2KRMA 1VA7A 3VRYA 3TVTA 1M8MA 2JM9A 3PVLA 2RQUA 2C0TA 4JZ3A 2IIMA 2J06A 1FYNA 5IHKA 2EQIA 2RQVA 3A98A 1UJ0A 2KBTA 1Z9QA 2CDTA 4IIMA 4ZNXA 4CC2A 2KYMA 2DYBA 1RI9A 2B86A 2CREA 2GQIA 2HEQA 3SHWA 1WLPB 1YNZA 5L23A 4Z88A 3LH5A 2JMCA 2BZ8A 2D1XA 1RLQC 1PNJA 2FRWA 2K6DA 3H0IA 3ULRB 1M30A 2MOXA 1NLOC 4HVVA 1UHCA 4Y92A 2PZ1A 3PVQA 1NYGA 1JO8A 2YSQA 1SHGA 4HVUA 2DVJA 4OMNA 2LJ0A 3VS4A 2O9SA 2J6KA 2A28A 1UFFA 1WIEA 2JS0A 2V1QA 1T3SA 1ZUYA 1QWFA 2RPNA 2HBWA 2HDAA 2F2XA 2K9GA 4R0KA 2KXDA 2H8HA 1QLYA 3QWYA 4AFSC 1NG2A 2I0NA 2DILA 1GRIA 1KFZA 3UA6A 4F16A 3M0QA 3REAB 2M51A 1AZEA 2DE0X 2YUPA 1UGVA 4KRTA 3U23A 2VKNA 1WFWA 1WXBA 3VS7A 1HSQA 2J05A 2C0OA 1SEMA 4RTUA 1RUWA 2ROTA 1SRLA 4HXJA 3REBB 4E6RA 2EKHA 2LNHB 1K9AA 1KJWA 1I0CA 2RQWA 3VS1A 1W1FA 2ENMA 1X69A 2CUBA 4AFZC 1JU5C 1QCFA 2EW3A 2PTKA 2KT1A 1GFCA 1AWXA 4DEXA 4X1VA 2DX1A 1T0JA 4AG2C 2EYXA 2HCKA 2G6FX 2RF0A 2JMAA 1H92A 1PWTA 3VS3A 3VRZA 3R6NA 2BZYA 1J3TA 1HD3A 5FWBA 5IXBA 4AFUC 2L3PA 5I11A 2J6OA 4Z89A 2KRNA 2JTEA 2GBQA 2W0ZA 2DJQA 1T0HA 4K11A 1EFNA 1YN8A 2AZVA 1E6HA 3M0PA 4HCKA 2GGRA 1GFDA 1PRMC 1ZLMA 1K1ZA 1ZSGA 1OOTA 2RQRA 2DBMA 2K2MA 2YUOA 2XMFA 4AFQC 2EYYA 2FEIA 2KNBB 3CQTA 4GBQA 1RLPC 2RN8A 3H41A 3EHRA 1AWWA 1KIKA 2JS2A 2LMJA 5IXFA 3ZL7C 2DF6A 1UTIA 2RMOA 1VYVA 2DNUA 5FW9A 4D8DA 4AG1C 3VS0A 2A08A 4F17A 1NEBA 4F14A 2GTOA 1X27A 1T3LA 3RBBB 1AVZC 2NUZA 3H0HA 2K7AA 3KFVA 2JW4A 2EYWA 1BBZA 4WCIA 2EGCA 2EVRA 2M0YA 3VS5A 4RTWA 4RTZA 2CSIA 3QWXX 2K3BA 2DMOA 1OPKA 1HJDA 2O2OA 2HSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQQ A;  2FO0 A;  1UG1 A;  2KRS A;  4J9G A;  2FRY A;  1AWJ A;  2LP5 A;  4RTT A;  2YDL A;  1GBR A;  4JJD A;  4EIK A;  1S1N A;  1K0X A;  4CC3 A;  1QKW A;  2KT8 A;  2L2P A;  1YWO A;  3H0F A;  3JV3 A;  5HCK A;  4GLM A;  2C0I A;  2VVK A;  4ESR A;  2YUN A;  2CSQ A;  2J6F A;  1ZBJ A;  2J7I A;  1WXT A;  2L3Q A;  2OAW A;  5IHN A;  4RUG A;  1NYF A;  1GCQ C;  2GTJ A;  2CT4 A;  1ZUK A;  2VWF A;  1K4U S;  2EGA A;  3UA7 A;  2AK5 A;  1LCK A;  3NPF A;  1B07 A;  1PKS A;  2DA9 A;  2CUD A;  2QDL A;  2DL4 A;  3M0S A;  3TSZ A;  2F2W A;  4RTX A;  2DL7 A;  2EGE A;  2DL8 A;  2OJ2 A;  4CC4 B;  2A37 A;  2KRO A;  1PHT A;  4Z8A A;  2X3W D;  1U3O A;  3RNJ A;  1AZG B;  3NMZ C;  4JPB W;  2ABL A;  4JJB A;  5I22 A;  2LZ6 B;  3M0R A;  2DBK A;  2PNI A;  1M3C A;  1UUE A;  2EPD A;  2YT6 A;  1KSW A;  4J9F A;  1CKB A;  1YWP A;  3PE0 A;  2P4R A;  2CT3 A;  1WX6 A;  1H8K A;  4DEY A;  1V1C A;  1M3A A;  4M4Z A;  5GJV B;  1YP5 A;  4A63 B;  2NWM A;  2LX7 A;  2AZS A;  3I5S A;  1H3H A;  1B3Q A;  1GCP A;  3NHN A;  3EG1 A;  1JXM A;  1BU1 A;  3SEM A;  1OV3 A;  2CH4 W;  4D8K A;  5FWC A;  1ABQ A;  2AKK A;  2EYZ A;  1ZX6 A;  4JZ4 A;  1E7O A;  4LNP A;  5IHI A;  1W70 A;  3I9Q A;  1XOV A;  4J9B A;  1G83 A;  2LJ1 A;  1X2Q A;  3EGU A;  3M0T A;  1X43 A;  2JXB A;  2JT4 A;  2RNA A;  2BTT A;  2FPE A;  2KE9 A;  4J9H A;  2E5K A;  2ECZ A;  4HVW A;  2KEA A;  4RTY A;  2ED0 A;  2SRC A;  2DRK A;  4CC7 A;  1X6B A;  2F2V A;  2AKL A;  4LUE A;  2O31 A;  4J9E A;  2ESW A;  1AD5 A;  2BZX A;  2YUQ A;  4RTV A;  3EG0 A;  1UEC A;  2EBP A;  1NM7 A;  1Y57 A;  4JJC A;  4OML A;  2KR3 A;  4LN2 A;  1X2K A;  1OPL A;  1PRL C;  1UE9 A;  1PKT A;  5GJW B;  1JXO A;  1GBQ A;  2LQN A;  2LCS A;  3UF4 A;  3I5R A;  5IH2 A;  1OEB A;  1UDL A;  1JEG A;  3I35 A;  3NGP A;  1BB9 A;  3EG2 A;  1QWE A;  1E6G A;  3GBQ A;  2CH4 A;  2FPF A;  1QKX A;  1ABO A;  2DRM A;  3M0U A;  4QT7 A;  1I1J A;  3IQL A;  1CSK A;  1NEG A;  2D8H A;  2RQT A;  2JM8 A;  3UAT A;  2KXC A;  1N5Z A;  1NLP C;  1M3B A;  1YCS B;  1M27 C;  1Y0M A;  2K79 A;  2DLP A;  4OMO A;  4OMM A;  4ORZ A;  1GL5 A;  2FPD A;  3THK A;  2DL3 A;  1WDX A;  2MCN A;  2A36 A;  1WXU A;  4LUD A;  1Z9Z A;  3EG3 A;  1I07 A;  1VYT A;  1K76 A;  1BK2 A;  3TSW A;  1TUD A;  2OI3 A;  1G2B A;  1U5S A;  1UHF A;  2D0N A;  2FG0 A;  1WA7 A;  1CKA A;  3EHQ A;  2KGT A;  2X3X D;  4J9I A;  1SPK A;  4OMP A;  1FMK A;  1MUZ A;  1X6G A;  3VS2 A;  3O5Z A;  1A0N B;  4J9C A;  2LQW A;  1GCQ A;  1U06 A;  2O88 A;  4FSS A;  1ZUU A;  2W10 A;  1AEY A;  4OMQ A;  1W6X A;  1MV0 B;  1ARK A;  2ROL A;  1SSH A;  5ECA A;  1SHF A;  1TUC A;  2L0A A;  1SRM A;  1WI7 A;  3FJ5 A;  4IIO A;  1AOJ A;  2ED1 A;  3VS6 A;  1TG0 A;  1MV3 A;  2MIO A;  2V1R A;  1WYX A;  4J9D A;  1K0S A;  2L3S A;  4LE9 A;  1VYU A;  1AWO A;  2GNC A;  2DL5 A;  2LJ3 A;  1UJY A;  3C0C A;  2KYB A;  5EC7 A;  2SEM A;  2DM1 A;  1IO6 A;  2O9V A;  2D8J A;  2KRM A;  1VA7 A;  3VRY A;  3TVT A;  1M8M A;  2JM9 A;  3PVL A;  2RQU A;  2C0T A;  4JZ3 A;  2IIM A;  2J06 A;  1FYN A;  5IHK A;  2EQI A;  2RQV A;  3A98 A;  1UJ0 A;  2KBT A;  1Z9Q A;  2CDT A;  4IIM A;  4ZNX A;  4CC2 A;  2KYM A;  2DYB A;  1RI9 A;  2B86 A;  2CRE A;  2GQI A;  2HEQ A;  3SHW A;  1WLP B;  1YNZ A;  5L23 A;  4Z88 A;  3LH5 A;  2JMC A;  2BZ8 A;  2D1X A;  1RLQ C;  1PNJ A;  2FRW A;  2K6D A;  3H0I A;  3ULR B;  1M30 A;  2MOX A;  1NLO C;  4HVV A;  1UHC A;  4Y92 A;  2PZ1 A;  3PVQ A;  1NYG A;  1JO8 A;  2YSQ A;  1SHG A;  4HVU A;  2DVJ A;  4OMN A;  2LJ0 A;  3VS4 A;  2O9S A;  2J6K A;  2A28 A;  1UFF A;  1WIE A;  2JS0 A;  2V1Q A;  1T3S A;  1ZUY A;  1QWF A;  2RPN A;  2HBW A;  2HDA A;  2F2X A;  2K9G A;  4R0K A;  2KXD A;  2H8H A;  1QLY A;  3QWY A;  4AFS C;  1NG2 A;  2I0N A;  2DIL A;  1GRI A;  1KFZ A;  3UA6 A;  4F16 A;  3M0Q A;  3REA B;  2M51 A;  1AZE A;  2DE0 X;  2YUP A;  1UGV A;  4KRT A;  3U23 A;  2VKN A;  1WFW A;  1WXB A;  3VS7 A;  1HSQ A;  2J05 A;  2C0O A;  1SEM A;  4RTU A;  1RUW A;  2ROT A;  1SRL A;  4HXJ A;  3REB B;  4E6R A;  2EKH A;  2LNH B;  1K9A A;  1KJW A;  1I0C A;  2RQW A;  3VS1 A;  1W1F A;  2ENM A;  1X69 A;  2CUB A;  4AFZ C;  1JU5 C;  1QCF A;  2EW3 A;  2PTK A;  2KT1 A;  1GFC A;  1AWX A;  4DEX A;  4X1V A;  2DX1 A;  1T0J A;  4AG2 C;  2EYX A;  2HCK A;  2G6F X;  2RF0 A;  2JMA A;  1H92 A;  1PWT A;  3VS3 A;  3VRZ A;  3R6N A;  2BZY A;  1J3T A;  1HD3 A;  5FWB A;  5IXB A;  4AFU C;  2L3P A;  5I11 A;  2J6O A;  4Z89 A;  2KRN A;  2JTE A;  2GBQ A;  2W0Z A;  2DJQ A;  1T0H A;  4K11 A;  1EFN A;  1YN8 A;  2AZV A;  1E6H A;  3M0P A;  4HCK A;  2GGR A;  1GFD A;  1PRM C;  1ZLM A;  1K1Z A;  1ZSG A;  1OOT A;  2RQR A;  2DBM A;  2K2M A;  2YUO A;  2XMF A;  4AFQ C;  2EYY A;  2FEI A;  2KNB B;  3CQT A;  4GBQ A;  1RLP C;  2RN8 A;  3H41 A;  3EHR A;  1AWW A;  1KIK A;  2JS2 A;  2LMJ A;  5IXF A;  3ZL7 C;  2DF6 A;  1UTI A;  2RMO A;  1VYV A;  2DNU A;  5FW9 A;  4D8D A;  4AG1 C;  3VS0 A;  2A08 A;  4F17 A;  1NEB A;  4F14 A;  2GTO A;  1X27 A;  1T3L A;  3RBB B;  1AVZ C;  2NUZ A;  3H0H A;  2K7A A;  3KFV A;  2JW4 A;  2EYW A;  1BBZ A;  4WCI A;  2EGC A;  2EVR A;  2M0Y A;  3VS5 A;  4RTW A;  4RTZ A;  2CSI A;  3QWX X;  2K3B A;  2DMO A;  1OPK A;  1HJD A;  2O2O A;  2HSP A; 
#chains in the Genus database with same CATH topology
 2FO0 A;  2KRS A;  4M78 B;  4J6W A;  1AWJ A;  1KHC A;  1EIF A;  1GBR A;  2HKN A;  4BI3 A;  1S1N A;  2P0P A;  3QO3 A;  3V7C A;  5GAO l;  2FL7 A;  2L2P A;  3G4S T;  4QW2 A;  3JV3 A;  3QPH A;  3HHT B;  2VGN A;  1RAH B;  3R6O A;  1D3B B;  2OTL Q;  2VVK A;  2YUN A;  3FLG A;  3CMA A;  1WXT A;  3PGG A;  3OYA A;  4M75 E;  3DB4 A;  3Q1J A;  4QVD A;  2QAZ A;  2CT4 A;  1ZUK A;  1K4U S;  1Q7Y R;  3JCM J;  4M75 C;  2CYZ B;  2O01 E;  4M78 F;  1PKS A;  2RD1 A;  2DL4 A;  3OMC A;  4OMF B;  4OF1 A;  3E1S A;  5DY9 A;  2CGH A;  4LDY A;  2KRO A;  4TVR A;  2FZG B;  4Z8A A;  4E7Z A;  3RNJ A;  2CP0 A;  2ZPG B;  3NMZ C;  4JPB W;  3OYJ A;  1PC0 A;  4JJB A;  4M78 A;  5I22 A;  2PNI A;  1M3C A;  1PD1 A;  1VQ8 A;  5GAN h;  1YJW T;  2EPD A;  3PE0 A;  1D0X A;  1U1T A;  1WX6 A;  1H8K A;  4C92 E;  5GAN 8;  3RDV A;  4DEY A;  1V1C A;  3UDC A;  4XTX A;  2NWM A;  2OTJ A;  3M57 A;  5GAM j;  1Q86 U;  2AZS A;  1Q95 G;  1H3H A;  3NHN A;  5GAN g;  4CI0 C;  3CMA Q;  1YJN T;  2DK3 A;  2CP7 A;  3CC7 A;  2A0F B;  1VUB A;  1VQL T;  2YLC A;  1ABQ A;  1NJI U;  2RH2 A;  4Y28 E;  2D9T A;  4PK4 A;  2QGG A;  1RI0 A;  1G83 A;  3CCM T;  2LJ1 A;  1AT1 B;  1NJI R;  2JXB A;  2JT4 A;  3EH1 A;  4Q5W A;  1VQM T;  1KQS P;  4OB0 B;  4A54 A;  3A8M B;  4DOW A;  3WXM B;  2HNI A;  1YCY A;  3BE3 A;  3NTK A;  1H64 1;  1S72 T;  2SRC A;  3KUF A;  4ATO A;  1YIT T;  3RMS A;  3M4Y A;  2ESW A;  1AD5 A;  2YUQ A;  1OZ3 A;  4RTV A;  3CME Q;  3EG0 A;  2Y4X A;  1UEC A;  3WVE B;  2NUT B;  1Y57 A;  2KR3 A;  1M90 U;  2COZ A;  1PKT A;  3QSU A;  5GMK h;  1M2O A;  2EJG A;  1UGS B;  1TWB A;  1B7T A;  4C8Q E;  3CBO A;  3JB9 F;  3NGP A;  1BB9 A;  2E10 A;  1WNL A;  1QVG A;  1JRI A;  3QG1 A;  3J81 E;  2HBP A;  4QT7 A;  1I1J A;  3MHX A;  1CSK A;  5LJ5 e;  4C92 F;  3L2U A;  1NLP C;  1Y0M A;  2K79 A;  3CC7 Q;  3I55 Q;  2HAX A;  5GAO p;  2DL3 A;  1WXU A;  2HSE B;  1O9S A;  5GAO n;  1Q7Y C;  3JAM E;  3EGD A;  2P4T A;  1TUD A;  2O4X B;  1G2B A;  4DBQ A;  4AT1 B;  2KGT A;  3ME9 A;  4J9I A;  1YBY A;  4OMP A;  2D0Q B;  1X6G A;  3SD4 A;  3O5Z A;  2MK5 A;  1VQM A;  2JTF A;  2NUT A;  4J9C A;  1U06 A;  5KE3 A;  2DKG A;  4HA8 A;  4F7U F;  1MV0 B;  3I56 Q;  2EQJ A;  1M90 R;  1SHF A;  1TUC A;  1ZA1 B;  2JTM A;  2BE7 D;  1M2V A;  4IIO A;  5GAN j;  1AOJ A;  2ED1 A;  2PU9 B;  1TG0 A;  1MV3 A;  3CME A;  4F7U A;  2V1R A;  3CCS Q;  1K0S A;  4XU2 A;  3V7R A;  4M7D D;  3VYH B;  4JJN K;  1AWO A;  2GNC A;  2LT1 A;  4B9X A;  4EMG A;  1VQO A;  3BY7 A;  4XTZ A;  2E6N A;  2O9V A;  4M7A C;  3VRY A;  2DXT A;  5AYF A;  3PVL A;  3SB2 A;  5FRM A;  2IIM A;  3G6E T;  2RHI A;  1VQP Q;  5KYW A;  1BCO A;  3CBM A;  5IHK A;  3JCM X;  3CCL Q;  4RCC A;  3A98 A;  3E2U A;  4ZNX A;  1M1G A;  3MEW A;  2CS7 A;  2GQI A;  3OA6 A;  4HKE A;  3JB9 I;  5L23 A;  4Z88 A;  2AHJ B;  2BZ8 A;  2F1L A;  3MJX A;  1RLQ C;  1IZ6 A;  3MP1 A;  2COW A;  2RHU A;  1P92 A;  4PJO E;  2PZ1 A;  1R77 A;  3M58 A;  3PVQ A;  1IGU A;  1WZO A;  3HL8 A;  2RI3 A;  4J5Y A;  2YSQ A;  1SHG A;  1WHG A;  1DJ7 B;  4OMN A;  2O9S A;  2J6K A;  2A28 A;  1PG5 B;  1UFF A;  7AT1 B;  3P8B B;  5CQX A;  1TH7 A;  4C0G A;  1T3S A;  3HKS A;  3G71 T;  4GY5 A;  2RPN A;  2OTL A;  5FU7 B;  2K9G A;  1QLY A;  3OYH A;  2DZ9 A;  3M56 A;  2QA4 A;  4M77 B;  3OS2 A;  2CZ0 B;  3G7Z A;  4M7A B;  1WHM A;  4P5N A;  3ZEH A;  3UA6 A;  3M0Q A;  3REA B;  3H6Z A;  1JBM A;  2EYQ A;  3U23 A;  2DFU A;  2C0O A;  3T9N A;  1SEM A;  2A7Y A;  4LD6 A;  1RUW A;  4IUT A;  3C94 A;  1SRL A;  5CQY A;  2E3I A;  3REB B;  4F7U G;  1K9M C;  3F70 A;  3MKD A;  1YHQ A;  3ZBD A;  1X69 A;  2CUB A;  4C5I A;  2L3R A;  4BI4 A;  1YHQ T;  3HRU A;  2BUD A;  1K8A C;  1VQK T;  1NBE B;  1GFC A;  3VUB A;  2ZAE A;  1AWX A;  2YXY A;  5GMK i;  1SF9 A;  1K73 C;  4X1V A;  3M9Q A;  2DX1 A;  2HCK A;  4C8Q C;  2G6F X;  5LJ3 g;  1KQS S;  3CC2 T;  4JDS A;  2M1H A;  3VS3 A;  3VRZ A;  2HKQ B;  3UPU A;  2K4Y A;  5I11 A;  2J6O A;  2W0Z A;  3P8H A;  2DJQ A;  3PIO A;  2VV5 A;  1YN8 A;  4JS4 A;  1GFD A;  1YFN A;  4M77 A;  3A5Z B;  1TTH B;  3CD6 T;  1ZSG A;  3OYK A;  4OGE A;  2RQR A;  3X24 B;  2R5A A;  2E4H A;  2WSF E;  3BDU A;  5FLX E;  1RLP C;  3RR6 A;  2X35 A;  2KI7 A;  4QVC A;  5GAO m;  3A8O B;  2COY A;  3JCM W;  1VQ7 A;  5LJ3 f;  2K2V A;  2F69 A;  2JS2 A;  5IXF A;  1MMG A;  4C0Z A;  2DF6 A;  1UTI A;  2CP6 A;  5FW9 A;  4AG1 C;  5L8R E;  2QQS A;  3VS0 A;  4F14 A;  2XDB A;  5A2Q E;  2NUZ A;  3H0H A;  4N4I A;  4E2F B;  3OYL A;  3KFV A;  4DA4 A;  3JSC A;  2K3X A;  2LT4 A;  2DXB A;  4RTW A;  3QWX X;  1NZ9 A;  3I55 A;  1ZQ1 A;  3EFO A;  4E7J A;  2DMO A;  4FL6 A;  4A53 A;  3JCM h;  2HSP A;  2AIR B;  1FX7 A;  4J9G A;  1FMW A;  3V7S A;  3QJ6 A;  3JB9 J;  1O75 A;  4RTT A;  2LTO A;  2YRD A;  3CC4 A;  4EIK A;  3HSB A;  2QQB A;  2EJ9 A;  1WJR A;  4KGV B;  4RKU E;  5LJ3 d;  2KT8 A;  1M9S A;  1QVP A;  2ZPI B;  3H0F A;  3MCA B;  5HCK A;  4HT9 A;  4ESR A;  4M78 C;  2J7I A;  3TEE A;  4RUG A;  3HRT A;  2DEU A;  2GTJ A;  5GAO r;  2VWF A;  2EGA A;  4JLG A;  5GAM h;  3O8V A;  2BKD N;  3M59 A;  1YJ9 Q;  1YJN Q;  1K8A U;  1QVF P;  2I2L A;  2DA9 A;  2C06 A;  2CUD A;  3QDR B;  1VQ4 Q;  1YJW A;  1PSE A;  2F2W A;  4FYX B;  2Y90 A;  4M7D F;  2DL7 A;  2DL8 A;  2VYT A;  4CC4 B;  2DXC A;  1TXQ A;  4L59 A;  1VQ9 Q;  2A37 A;  4PJO A;  4M77 D;  1NE8 A;  2OTJ Q;  1M1K C;  1AZG B;  4R56 A;  3OYB A;  2RHZ A;  5I2M A;  2DBK A;  4OVA A;  4ZGD B;  3CCL A;  1I5L A;  1UUE A;  2E64 A;  4YTL A;  4J9F A;  2CZ6 B;  1CKB A;  1YWP A;  2P4R A;  1M90 C;  2CT3 A;  2OTL T;  1LJO A;  4M4Z A;  2YHT A;  1BI1 A;  2LX7 A;  1Q82 R;  1G3W A;  1C0M A;  1GCP A;  3JRZ A;  3EG1 A;  2O4X A;  1BU1 A;  2QGF B;  3X26 B;  4D8K A;  3G1J A;  3CCE Q;  5HKC A;  5GAN 5;  2EYZ A;  1ZX6 A;  2XD0 A;  3LX7 A;  4JZ4 A;  4NOY A;  1HK9 A;  1E7O A;  5IHI A;  1XOV A;  4EMH A;  3EGU A;  1RAG B;  4M7D C;  1VQP T;  1X43 A;  4MZM A;  1M2V B;  5GAN f;  2RNA A;  2RA2 A;  4LDV A;  2KE9 A;  4UC4 A;  1G3S A;  1UGR B;  4J9H A;  1F1B B;  1R8O B;  1M1K R;  4HVW A;  4C5G A;  2KEA A;  4FYW B;  4RTY A;  3WVD B;  3FC3 A;  4CC7 A;  1V76 A;  5A0D A;  2LDM A;  2X4Y A;  2KSS A;  2V8I A;  3S3N A;  1OYX A;  4J9E A;  5GMK m;  3LW5 E;  3P8D A;  3JB9 D;  1RL2 A;  3S6W A;  2BZX A;  1IHV A;  3C4S A;  4RMO A;  4OML A;  3A8L B;  4PFP A;  5KYW B;  3FRN A;  1X2K A;  1OPL A;  1PRL C;  2CKK A;  1JXO A;  2E3H A;  3G4S Q;  3SDZ A;  2LQN A;  3UF4 A;  3MP8 A;  3MEV A;  1UDL A;  1RAD B;  1R0B G;  1N8R R;  3EG2 A;  2XU8 A;  1BKB A;  3G71 Q;  3CCS T;  1E6G A;  3GBQ A;  2CH4 A;  2FPF A;  3TRE A;  4KUI A;  4OB1 B;  2DRM A;  3GIB A;  1MMD A;  3A1P A;  2KXC A;  3NTI A;  1M3B A;  2M02 A;  1YCS B;  1M27 C;  2GQV A;  3CCR Q;  2DLP A;  4OMO A;  4OMM A;  4QKU A;  2X4J A;  1WDX A;  2A36 A;  3NTH A;  1VQ5 A;  2H3E B;  1K76 A;  3QJY A;  4ZN3 A;  3TSW A;  3OS5 A;  1Q82 U;  1S72 A;  2OI3 A;  1UHF A;  3CME T;  3EHQ A;  2X3X D;  1FMK A;  2HZY A;  2QEX A;  1A0N B;  9ATC B;  2LQW A;  1D0Y A;  4FSS A;  2W10 A;  3URG A;  4XQ3 A;  2M16 A;  1K9M U;  4M7A A;  1ARK A;  3JCM V;  1SSH A;  2IVW A;  5ECA A;  1SRM A;  2MIO A;  1WJQ A;  3GNG A;  3GP8 A;  3L2Q A;  4FYY B;  1VYU A;  3UWN A;  2DL5 A;  5CAI A;  2RB6 A;  2RHX A;  2L89 A;  2DTI A;  1UJY A;  3C0C A;  2V8J A;  2XDP A;  1VQL Q;  2RK1 A;  2DM1 A;  2D8J A;  4C0D B;  4A4G A;  1G8X A;  3G71 A;  2RQU A;  4MZP A;  2WSE E;  1MNE A;  5KYX B;  3CCS A;  2J06 A;  4O5V A;  2HQX A;  2EQI A;  2RQV A;  2X51 A;  4A4E A;  1B34 A;  1Z9Q A;  1N8R C;  5HK3 A;  2E12 A;  3FB9 A;  4BI8 B;  2LQK A;  4CRI A;  4C8Q G;  1YNZ A;  3VUZ A;  1ZHI A;  2BE9 B;  2D1X A;  3PMI A;  1PNJ A;  4XTU A;  2FRW A;  3QUI A;  3AHU A;  3CEY A;  3JCM Q;  1UHC A;  4Y92 A;  1EZZ B;  2GF7 A;  1M1K U;  4PJO F;  2DO3 A;  1NYG A;  4ANJ A;  4M7D G;  4HVU A;  2LJ0 A;  1OX8 A;  2YWW A;  1WIE A;  1C6V X;  3H8Z A;  1VQN Q;  5HK0 A;  1NJI C;  5LJ5 d;  4JUV A;  3CPW S;  2HDA A;  1OUL A;  4NS5 A;  3FJP A;  1HYO A;  2GFA A;  1GRI A;  4C0D C;  3CC7 T;  3MEU A;  1KFZ A;  1D0Z A;  3QHS A;  1B34 B;  4EMK B;  4F16 A;  4BDZ A;  1VQ6 A;  3CPF A;  1KC8 C;  3EFO B;  2YUP A;  2RO0 A;  4KRT A;  1WXB A;  5LJ3 h;  4ZTF A;  4PJL A;  3VS7 A;  3OYN A;  2DXU A;  4JLI A;  1XJW B;  2KY9 A;  4J6Y A;  4HXJ A;  2QAS A;  3TQ7 P;  2EKH A;  1KJW A;  5IAY A;  5CKE A;  4C92 G;  3QYH B;  3CCV A;  2KT1 A;  1WGS A;  3BW1 A;  4DEX A;  3VYG A;  3M55 A;  3VJP A;  4LDW A;  2EYX A;  2RF0 A;  2JMA A;  1KC8 R;  2F5T X;  4FM4 B;  1BI3 A;  3R6N A;  5FWB A;  4OB2 B;  1PSF A;  2G3R A;  2QYZ A;  4KH0 B;  1KD1 C;  1IXD A;  3L2R A;  4IKF A;  4M75 D;  4Z89 A;  2KRN A;  2GBQ A;  4K11 A;  1EFN A;  2MI6 A;  3JCM d;  1U8R A;  3JCM e;  1E6H A;  3RIR A;  2GGR A;  4HCC A;  1BI2 A;  1WHK A;  1PRM C;  2R5M A;  1ZLM A;  1K1Z A;  4PJO B;  3OYF A;  1OQK A;  2A3L A;  4NL3 A;  3ER0 A;  4M77 E;  2CZ1 B;  2EYY A;  2FEI A;  2IG0 A;  2QXF A;  3CCL T;  3CQT A;  4N4G A;  5J39 A;  1M5Q 1;  3H41 A;  3EHR A;  2NUP A;  4BY6 B;  3LYI A;  3QZ9 B;  1VQ6 T;  4D8D A;  4XTW A;  1FWZ A;  1AVZ C;  2OAU A;  2DYI A;  2LRQ A;  2X9H A;  2JW4 A;  2EYW A;  1UB4 A;  1BBZ A;  1I8F A;  1QVF A;  2EVR A;  3QII A;  4RTZ A;  2F5K A;  2QQR A;  3OYD A;  2K3B A;  4HCB A;  4BDY A;  1VQ9 T;  2O2O A;  2HD0 A;  3TU4 K;  2QG9 B;  1UG1 A;  5FU6 C;  3G6E A;  2AT1 B;  4JJD A;  3G4S A;  1WHH A;  2RJD A;  4CC3 A;  3X28 B;  1YIJ A;  1QKW A;  2E6Z A;  5GAN d;  1YWO A;  4GLM A;  5GAN 6;  3M5A A;  5CKD A;  4V2S A;  1FMV A;  5GAO q;  1X75 C;  2RJF A;  4IUQ A;  1WJS A;  4M77 F;  2J6F A;  2KK4 A;  2L3Q A;  1MMA A;  3SFM A;  2OAW A;  3CCJ T;  5IHN A;  1NYF A;  4XU1 A;  1GCQ C;  5HY6 A;  3EAE A;  3OBY A;  5GAM f;  3UA7 A;  5CCA A;  1BYM A;  5CIU A;  4MML A;  4ELY C;  3FEO A;  1B07 A;  3CCE T;  4MDX A;  2QK0 A;  3MO8 A;  4RG2 A;  3TSZ A;  2FVU A;  1D09 B;  1PM3 A;  4IUU A;  4KUL A;  4C5H A;  4ELZ C;  1YIJ Q;  1VQK Q;  1PHT A;  2LQ8 A;  2X3W D;  2EKO A;  3OW2 P;  1Y96 B;  2HL5 C;  1OZ2 A;  3EH2 A;  2ABL A;  2DD5 A;  3N5B B;  3CPW A;  2R58 A;  2LZ6 B;  3M0R A;  2LC4 A;  4IUR A;  1YJ9 A;  1LPL A;  2XIC A;  3BFM A;  1N27 A;  5LL6 S;  5D6Y A;  2KDS A;  4X9D A;  3X25 B;  1BIA A;  1G3T A;  4BE2 A;  1W2B S;  1M3A A;  4A63 B;  3RER A;  1G5V A;  4M75 G;  3CD6 Q;  2QTX A;  3I5S A;  1B3Q A;  3OS1 A;  1VQL A;  1JXM A;  2JJ9 A;  1YJ9 T;  1OV3 A;  2CH4 W;  3J7A F;  4QQ6 A;  5CK9 A;  4PKC C;  2DER A;  2AKK A;  2QA4 T;  4PFO A;  1KK7 A;  4LNP A;  3CC4 T;  5LJ5 f;  2XK0 A;  3I9Q A;  5LJ3 j;  1IRE B;  2Z0W A;  4A4K A;  5M9O A;  5GAN e;  1FXX A;  1I81 A;  2BTT A;  1PD0 A;  2FPE A;  4C8Q D;  3J80 E;  2E5K A;  2PUO B;  1Y96 A;  4OGC A;  2EQM A;  2ED0 A;  2B8A A;  4DQ2 A;  2KAF A;  4M78 G;  3OMG A;  5GAM d;  3OYC A;  1Q81 U;  1HXD A;  2F2V A;  1VIE A;  2AKL A;  2CP2 A;  2EQU A;  2ZPH B;  1Y71 A;  2O31 A;  1YI2 T;  4M7A D;  1RAI B;  3I56 A;  1NM7 A;  4LD9 K;  4JJC A;  5KYX A;  4LN2 A;  1I4K 1;  2FYK A;  1UE9 A;  5GAN 4;  3PT9 A;  5GJW B;  3HTR A;  1VQ7 T;  2LCS A;  1JB0 E;  2E1H A;  5AT1 B;  3I5R A;  5IH2 A;  1OEB A;  2L5Q A;  2QQA A;  3I35 A;  2DAQ A;  2L8D A;  4MMK A;  3JCM P;  2V26 A;  4FW2 A;  1JJ2 S;  1QWE A;  3V8K A;  4EMK C;  2QI2 A;  5GMK e;  2OX7 A;  4C92 B;  3L42 A;  1QMC A;  2QTV A;  1UEB A;  3IQL A;  2D8H A;  4F04 B;  1IHW A;  3UAT A;  1N5Z A;  2RJE A;  3DKM A;  1VQP A;  1Y7X A;  1GL5 A;  2LVM A;  3THK A;  3FDR A;  2E5Q A;  5LJ5 h;  1YI2 A;  2E41 A;  1WQW A;  1Z9Z A;  3EG3 A;  1OU9 A;  3LWI A;  2HMA A;  1ACM B;  1Q86 R;  2PVO B;  2OTJ T;  5IN1 A;  2PVG B;  2KVQ G;  1TSF A;  1SPK A;  1K8A R;  2DTO A;  5IT9 E;  1MUZ A;  3VS2 A;  1GCQ A;  2O88 A;  4PJO D;  1ZUU A;  5GAN 7;  1AEY A;  4FCY A;  3M4G A;  1KQS A;  4A4F A;  2JNG A;  4M7D E;  2CP3 A;  2ROL A;  4E7L A;  4EMK A;  2L0A A;  1WI7 A;  2V8K A;  3FJ5 A;  4J7F A;  3ZFJ A;  4XTY A;  4E7H A;  3HFN A;  1WYX A;  2ZCF B;  2L3S A;  1YJN A;  1QP2 A;  5D6X A;  1WHJ A;  3QDF A;  3PNW C;  1EX4 A;  2KYB A;  5EC7 A;  2SEM A;  3CCR T;  3RKY A;  4OB3 B;  1IO6 A;  3CCV T;  1VA7 A;  4C92 C;  3TVT A;  2JM9 A;  3MEA A;  4E7S A;  2K3Y A;  2C0T A;  4JZ3 A;  1Q7Y U;  1IRX A;  1FYN A;  4DBH A;  2H3J A;  2CDT A;  3RMQ A;  4CC2 A;  3LLR A;  2DVE A;  2DYB A;  2B86 A;  4ZN1 A;  5A0G A;  3SHW A;  2ZPF B;  5C0M A;  2JMC A;  4IUV A;  2K6D A;  3H0I A;  4KT0 E;  1M30 A;  5FU6 B;  1NLO C;  2DET A;  3CCQ T;  4EPC A;  4E47 A;  4E7K A;  5D7U A;  2DVJ A;  2X4W A;  1ZBX A;  3D7S B;  2NUP B;  4DBF A;  4FYV B;  2QQ9 A;  1RAA B;  2JS0 A;  4KGZ B;  1N9S A;  4WTO B;  1BCM A;  4XU3 A;  5FRN A;  4LDU A;  2F2X A;  2KXD A;  4PJM A;  2H8H A;  3CCQ A;  1ZSZ A;  2VXE A;  1VQO T;  4AFS C;  1NG2 A;  2I0N A;  2DIL A;  4LXC A;  5KH6 A;  1RAB B;  4J7I A;  3LGL A;  2M51 A;  1AZE A;  1WQ7 A;  2MAM A;  5KYU A;  3VKI A;  2J05 A;  3S3O A;  4RTU A;  1QQJ A;  4MDW A;  4E6R A;  2LNH B;  1K9A A;  3OYE A;  1I0C A;  3H9N A;  4FU6 A;  1W1F A;  4C92 D;  4AFZ C;  3JCM b;  3CCU Q;  2PTK A;  5GAN 2;  1XNI A;  4FT4 A;  2YRV A;  1Q81 R;  1VQ6 Q;  2QEX Q;  4A4H A;  3VV0 A;  1JJ2 A;  5CVI A;  5CO7 A;  1T0J A;  4JRQ A;  3DLM A;  3DLL A;  2K5L A;  1V29 B;  4N4H A;  3GPL A;  2BZY A;  1HD3 A;  3JCM c;  5IXB A;  3S3M A;  6AT1 B;  1VQ8 Q;  5FU7 C;  4KGX B;  2VC8 A;  1T0H A;  3CD6 A;  3BDL A;  2AZV A;  2RJC A;  4HCK A;  3M0P A;  4RG8 A;  3EG9 A;  4X9C A;  2FHD A;  2E70 A;  3CCU A;  1OOT A;  4NL2 A;  5DLQ E;  4EDU A;  2YUO A;  3CMA T;  3UT1 A;  4AFQ C;  1M1F A;  2PVD B;  2QA4 Q;  2Y4Y A;  1Q86 C;  4M77 G;  2RN8 A;  2RI2 A;  5GMK l;  1AWW A;  5KYY B;  2LMJ A;  3ZL7 C;  3LGF A;  5LJ5 j;  1VYV A;  5I21 A;  3QBY A;  2JVV A;  3HRS A;  4M75 B;  4F17 A;  1NEB A;  1QVG S;  1X27 A;  2EIF A;  5CKF A;  2GCX A;  1RAC B;  2EGC A;  2M0Y A;  2XID A;  3VS5 A;  4II1 A;  3X20 B;  2MMP A;  4C0F A;  1TS9 A;  1JJ2 P;  1YI2 Q;  4N0A A;  1WPY A;  1JQQ A;  2FZK B;  2HL3 A;  3QXE B;  3V8L A;  2FRY A;  3M53 A;  2LP5 A;  2YDL A;  1VQN T;  1VQ4 A;  3OYM A;  1PCX A;  1OI1 A;  2ZPB B;  4PFZ A;  4O6J A;  1K0X A;  2M0O A;  5KCH A;  3L2W A;  4FT2 A;  2JUF A;  4JRI A;  3QZ5 B;  1TU0 B;  2HQE A;  2VGM A;  2C0I A;  1YIT A;  4JS5 A;  3GLX A;  4WF2 A;  3MP6 A;  2CSQ A;  1ZBJ A;  1G3Y A;  3NFC A;  3QKJ A;  1UGQ B;  3OYI A;  2NYS A;  4XU0 A;  3CPW P;  3CXC S;  1IGQ A;  2AK5 A;  1QVF S;  1LCK A;  2EJF A;  3NPF A;  4M75 A;  2E65 A;  2XDD A;  2WAC A;  4BY6 C;  2QDL A;  3M0S A;  3L2V A;  4PLL A;  2PQW A;  4ZGE B;  5GAM e;  3CC4 Q;  4IUP A;  4RTX A;  2EGE A;  2OJ2 A;  3CCM Q;  1N8R U;  4M7D B;  2JN0 A;  5GAM g;  3PIP A;  2RI5 A;  1U3O A;  3L1A A;  3OSV A;  1VQM Q;  4C92 A;  4DOV A;  2NLU A;  2R57 A;  3CXC P;  1K73 R;  2YT6 A;  1Q82 C;  3V8J A;  4KUD K;  1KSW A;  1Q81 C;  3HPW A;  3HP9 A;  5KE2 A;  4DBR A;  3MPU B;  3EGX A;  2K5F A;  2RK2 A;  4C8Q B;  2DTH A;  5GJV B;  1YP5 A;  2LNV A;  5GAN 3;  2MPX C;  2YLB A;  3MET A;  4BE1 A;  2ZGW A;  3RKX A;  8ATC B;  4M7A E;  2P0K A;  1M4Z A;  1VOM A;  3CCJ A;  3SEM A;  1D1B A;  1ZA2 B;  3LH0 A;  5FWC A;  1AHJ B;  3AT1 B;  4KH1 B;  3CCV Q;  5FRO A;  2CP5 A;  1X6O A;  2EQK A;  3EFR A;  1YIJ T;  1W70 A;  4AMC A;  4J9B A;  4E7I A;  1X2Q A;  4FSX A;  1VQ5 Q;  2M9U A;  1UGP B;  5C6S A;  3M0T A;  4PJO G;  1OX9 A;  3JB9 G;  1KD1 R;  1WHL A;  4M7D A;  1QW1 A;  1VQ9 A;  2VUB A;  3I55 T;  2ECZ A;  2ATC B;  1MHN A;  1YJW Q;  2DRK A;  3LWH A;  1X6B A;  1KC8 U;  2DD4 A;  4L6V 5;  1MND A;  1ZSZ C;  4LUE A;  1D1A A;  4BUG A;  3PMT A;  4HT8 A;  1RAE B;  3E9F A;  2WSC E;  4C8Q A;  2EBP A;  2HQH A;  1GBQ A;  1VIF A;  3RUX A;  4C8Q F;  4M7A F;  1JEG A;  1XTD A;  1X01 A;  4QVZ A;  3CCJ Q;  1QCO A;  4RCB A;  1QKX A;  3OW2 A;  1ABO A;  3M0U A;  1NEG A;  2RQT A;  4PJN A;  2JM8 A;  5CKB A;  3OS0 A;  4N0A C;  2EAY A;  3PTA A;  5DM7 R;  4B9W A;  4ORZ A;  3OQ5 A;  2FPD A;  3A8H B;  8AT1 B;  2MCN A;  2LCC A;  4LUD A;  1I07 A;  2EFI A;  1VYT A;  1R0C B;  1BK2 A;  3OYY A;  3G6E Q;  1M8V A;  2P84 A;  1U5S A;  2D0N A;  2FG0 A;  4R55 A;  1WA7 A;  1CKA A;  2K5I A;  4C5E A;  5GMK j;  3QYG B;  1YHQ Q;  3CCU T;  5DLO A;  3SWN C;  1ZSZ B;  4F7U E;  1VQ7 Q;  4OMQ A;  2QEX T;  1W6X A;  1TUG B;  4JRK A;  1NPP A;  1N6A A;  3KXT A;  1KQ1 A;  4L5G A;  3E19 A;  3OW2 S;  3OYG A;  3CCR A;  5KYU B;  1LNX A;  3VS6 A;  5J3B A;  4J9D A;  1Y07 A;  1VQ8 T;  4LE9 A;  1K73 U;  2FB7 A;  3CC2 A;  4OP0 A;  1NPR A;  4ME7 A;  2LJ3 A;  2DIG A;  2DJZ A;  2KRM A;  4FIB A;  3GOX A;  1M8M A;  4LDX A;  4JRP A;  2VXF A;  2XKO C;  2D6F A;  1UJ0 A;  2KBT A;  3OY9 A;  4IIM A;  2GFU A;  3INZ A;  4M78 D;  5EG2 A;  4FW1 A;  2DEQ A;  2KYM A;  3DB3 A;  1RI9 A;  2CRE A;  3JCM g;  4HCZ A;  2HEQ A;  1S72 Q;  1WLP B;  3E9G A;  1W2B A;  2ZZD A;  3LH5 A;  1MGQ A;  2XHC A;  3I56 T;  4KBM B;  1YIT Q;  1KQ2 A;  1TOV A;  3VU3 C;  3EG9 B;  3ULR B;  1SG5 A;  1K9M R;  1KHI A;  2DIQ A;  2MOX A;  3KBG A;  4HVV A;  3SWN B;  2DZC A;  3FIF A;  4PJJ A;  3OBW A;  1QCN A;  3JCM f;  4D6W A;  5CR2 A;  2RM4 A;  4J83 A;  1JO8 A;  4Z02 A;  1I5O B;  3EFS A;  4M77 C;  1KD1 U;  3VS4 A;  5KYN A;  2MWP A;  3EGD B;  5KYY A;  4BAC A;  5LJ5 g;  3CC2 Q;  1BIB A;  2V1Q A;  1ZUY A;  2DPP B;  3OB9 A;  2FZC B;  3OSS C;  5KCO A;  2MYS A;  4X34 A;  3CCM A;  1QWF A;  1IB8 A;  2HBW A;  4VUB A;  4R0K A;  5LJ3 e;  1XQH A;  2ZPE B;  1QP3 A;  3QWY A;  2LX9 A;  4B6M A;  2QDY B;  4XK8 E;  1KG1 A;  2RHY A;  3GF5 A;  1OU8 A;  4BB7 A;  2DE0 X;  1UGV A;  2VKN A;  2X4X A;  1WFW A;  4PJO C;  1W4S A;  4F7U B;  1HSQ A;  1N9R A;  3JB9 H;  2JZ2 A;  2KMT A;  2IPO B;  3HFO A;  2ROT A;  4XAX B;  1MMN A;  1U1S A;  2VAS A;  2RQW A;  1SKU B;  3VS1 A;  3CCQ Q;  2K57 A;  2ENM A;  2PUK B;  3L2Z A;  1H3Z A;  1GXI E;  3CCE A;  1JU5 C;  1QCF A;  2EW3 A;  5CKH A;  2MF2 A;  4MZT A;  3SWN A;  1W2B P;  4M7A G;  1C1A A;  2BIV A;  2CZ7 B;  4QQD A;  3PFS A;  2EWN A;  4PL6 A;  4PLI A;  4AG2 C;  4ZGJ B;  1H92 A;  1PWT A;  3A8G B;  4J6X A;  2VB6 A;  2P0Q A;  4M75 F;  1J3T A;  4AFU C;  2L3P A;  2JTE A;  1VQO Q;  1D1C A;  4XTV A;  2XI9 A;  3GNF B;  4M78 E;  2XG8 D;  5I2S A;  3CXC A;  3RES A;  3C12 A;  5D6W A;  1VQN A;  1QVG P;  2YRC A;  3M54 A;  4PNO A;  2DBM A;  1SSF A;  1D3B A;  2K2M A;  2XMF A;  2KQW A;  2KNB B;  3TCJ A;  3CBP A;  4GLK A;  2MWO A;  4GBQ A;  4ZTJ A;  3C95 A;  1KIK A;  1VQ5 T;  1BI0 A;  4BD3 A;  2RMO A;  3EGX B;  2JOY A;  2LCL A;  2DNU A;  1VQK A;  3RKW A;  2A08 A;  4Y91 A;  2GTO A;  1T3L A;  5J26 A;  3RBB B;  4BE0 A;  1LOJ A;  4J8O A;  2K7A A;  3ASK A;  5A0L A;  1VQ4 T;  4WCI A;  1LVK A;  2CSI A;  1OPK A;  1RAF B;  1HJD A;  4QQG A; 
#chains in the Genus database with same CATH homology
 1JQQ A;  2FO0 A;  1UG1 A;  2KRS A;  4J9G A;  2FRY A;  1AWJ A;  2LP5 A;  4RTT A;  2YDL A;  1GBR A;  4JJD A;  4EIK A;  1S1N A;  1K0X A;  4CC3 A;  1QKW A;  2KT8 A;  2L2P A;  1YWO A;  3H0F A;  3JV3 A;  5HCK A;  4GLM A;  2C0I A;  2VVK A;  4ESR A;  2YUN A;  2CSQ A;  2J6F A;  1ZBJ A;  2J7I A;  1WXT A;  2L3Q A;  2OAW A;  5IHN A;  4RUG A;  1NYF A;  1GCQ C;  2GTJ A;  2CT4 A;  1ZUK A;  2VWF A;  1K4U S;  2EGA A;  3UA7 A;  2AK5 A;  1LCK A;  3NPF A;  1B07 A;  1PKS A;  2DA9 A;  2CUD A;  2QDL A;  2DL4 A;  3M0S A;  3TSZ A;  2F2W A;  4RTX A;  2DL7 A;  2EGE A;  2DL8 A;  2OJ2 A;  4CC4 B;  2A37 A;  2KRO A;  1PHT A;  4Z8A A;  2X3W D;  1U3O A;  3RNJ A;  1AZG B;  3NMZ C;  4JPB W;  2ABL A;  4JJB A;  5I22 A;  2LZ6 B;  3M0R A;  2DBK A;  2PNI A;  1M3C A;  1UUE A;  2EPD A;  2YT6 A;  1KSW A;  4J9F A;  1CKB A;  1YWP A;  3PE0 A;  2P4R A;  2CT3 A;  1WX6 A;  1H8K A;  4DEY A;  1V1C A;  1M3A A;  4M4Z A;  5GJV B;  1YP5 A;  4A63 B;  2NWM A;  2LX7 A;  2AZS A;  3I5S A;  1H3H A;  1B3Q A;  1GCP A;  3NHN A;  3EG1 A;  1JXM A;  1BU1 A;  3SEM A;  1OV3 A;  2CH4 W;  4D8K A;  5FWC A;  1ABQ A;  2AKK A;  2EYZ A;  1ZX6 A;  4JZ4 A;  1E7O A;  4LNP A;  5IHI A;  1W70 A;  3I9Q A;  1XOV A;  4J9B A;  1G83 A;  2LJ1 A;  1X2Q A;  3EGU A;  3M0T A;  1X43 A;  2JXB A;  2JT4 A;  2RNA A;  2BTT A;  2FPE A;  2KE9 A;  4J9H A;  2E5K A;  2ECZ A;  4HVW A;  2KEA A;  4RTY A;  2ED0 A;  2SRC A;  2DRK A;  4CC7 A;  1X6B A;  2F2V A;  2AKL A;  4LUE A;  2O31 A;  4J9E A;  2ESW A;  1AD5 A;  2BZX A;  2YUQ A;  4RTV A;  3EG0 A;  1UEC A;  2EBP A;  1NM7 A;  1Y57 A;  4JJC A;  4OML A;  2KR3 A;  4LN2 A;  1X2K A;  1OPL A;  1PRL C;  1UE9 A;  1PKT A;  5GJW B;  1JXO A;  1GBQ A;  2LQN A;  2LCS A;  3UF4 A;  3I5R A;  5IH2 A;  1OEB A;  1UDL A;  1JEG A;  3I35 A;  3NGP A;  1BB9 A;  3EG2 A;  1QWE A;  1E6G A;  3GBQ A;  2CH4 A;  2FPF A;  1QKX A;  1ABO A;  2DRM A;  3M0U A;  4QT7 A;  1I1J A;  3IQL A;  1CSK A;  1NEG A;  2D8H A;  2RQT A;  2JM8 A;  3UAT A;  2KXC A;  1N5Z A;  1NLP C;  1M3B A;  1YCS B;  1M27 C;  1Y0M A;  2K79 A;  2DLP A;  4OMO A;  4OMM A;  4ORZ A;  1GL5 A;  2FPD A;  3THK A;  2DL3 A;  1WDX A;  2MCN A;  2A36 A;  1WXU A;  4LUD A;  1Z9Z A;  3EG3 A;  1I07 A;  1VYT A;  1K76 A;  1BK2 A;  3TSW A;  1TUD A;  2OI3 A;  1G2B A;  1U5S A;  1UHF A;  2D0N A;  2FG0 A;  1WA7 A;  1CKA A;  3EHQ A;  2KGT A;  2X3X D;  4J9I A;  1SPK A;  4OMP A;  1FMK A;  1MUZ A;  1X6G A;  3VS2 A;  3O5Z A;  1A0N B;  4J9C A;  2LQW A;  1GCQ A;  1U06 A;  2O88 A;  4FSS A;  1ZUU A;  2W10 A;  1AEY A;  4OMQ A;  1W6X A;  1MV0 B;  1ARK A;  2ROL A;  1SSH A;  5ECA A;  1SHF A;  1TUC A;  2L0A A;  1SRM A;  1WI7 A;  3FJ5 A;  4IIO A;  1AOJ A;  2ED1 A;  3VS6 A;  1TG0 A;  1MV3 A;  2MIO A;  2V1R A;  1WYX A;  4J9D A;  1K0S A;  2L3S A;  4LE9 A;  1VYU A;  1AWO A;  2GNC A;  2DL5 A;  2LJ3 A;  1UJY A;  3C0C A;  2KYB A;  5EC7 A;  2SEM A;  2DM1 A;  1IO6 A;  2O9V A;  2D8J A;  2KRM A;  1VA7 A;  3VRY A;  3TVT A;  1M8M A;  2JM9 A;  3PVL A;  2RQU A;  2C0T A;  4JZ3 A;  2IIM A;  2J06 A;  1FYN A;  5IHK A;  2EQI A;  2RQV A;  3A98 A;  1UJ0 A;  2KBT A;  1Z9Q A;  2CDT A;  4IIM A;  4ZNX A;  4CC2 A;  2KYM A;  2DYB A;  1RI9 A;  2B86 A;  2CRE A;  2GQI A;  2HEQ A;  3SHW A;  1WLP B;  1YNZ A;  5L23 A;  4Z88 A;  3LH5 A;  2JMC A;  2BZ8 A;  2D1X A;  1RLQ C;  1PNJ A;  2FRW A;  2K6D A;  3H0I A;  3ULR B;  1M30 A;  2MOX A;  1NLO C;  4HVV A;  1UHC A;  4Y92 A;  2PZ1 A;  3PVQ A;  1NYG A;  1JO8 A;  2YSQ A;  1SHG A;  4HVU A;  2DVJ A;  4OMN A;  2LJ0 A;  3VS4 A;  2O9S A;  2J6K A;  2A28 A;  1UFF A;  1WIE A;  2JS0 A;  2V1Q A;  1T3S A;  1ZUY A;  1QWF A;  2RPN A;  2HBW A;  2HDA A;  2F2X A;  2K9G A;  4R0K A;  2KXD A;  2H8H A;  1QLY A;  3QWY A;  4AFS C;  1NG2 A;  2I0N A;  2DIL A;  1GRI A;  1KFZ A;  3UA6 A;  4F16 A;  3M0Q A;  3REA B;  2M51 A;  1AZE A;  2DE0 X;  2YUP A;  1UGV A;  4KRT A;  3U23 A;  2VKN A;  1WFW A;  1WXB A;  3VS7 A;  1HSQ A;  2J05 A;  2C0O A;  1SEM A;  4RTU A;  1RUW A;  2ROT A;  1SRL A;  4HXJ A;  3REB B;  4E6R A;  2EKH A;  2LNH B;  1K9A A;  1KJW A;  1I0C A;  2RQW A;  3VS1 A;  1W1F A;  2ENM A;  1X69 A;  2CUB A;  4AFZ C;  1JU5 C;  1QCF A;  2EW3 A;  2PTK A;  2KT1 A;  1GFC A;  1AWX A;  4DEX A;  4X1V A;  2DX1 A;  1T0J A;  4AG2 C;  2EYX A;  2HCK A;  2G6F X;  2RF0 A;  2JMA A;  1H92 A;  1PWT A;  3VS3 A;  3VRZ A;  3R6N A;  2BZY A;  1J3T A;  1HD3 A;  5FWB A;  5IXB A;  4AFU C;  2L3P A;  5I11 A;  2J6O A;  4Z89 A;  2KRN A;  2JTE A;  2GBQ A;  2W0Z A;  2DJQ A;  1T0H A;  4K11 A;  1EFN A;  1YN8 A;  2AZV A;  1E6H A;  3M0P A;  4HCK A;  2GGR A;  1GFD A;  1PRM C;  1ZLM A;  1K1Z A;  1ZSG A;  1OOT A;  2RQR A;  2DBM A;  2K2M A;  2YUO A;  2XMF A;  4AFQ C;  2EYY A;  2FEI A;  2KNB B;  3CQT A;  4GBQ A;  1RLP C;  2RN8 A;  3H41 A;  3EHR A;  1AWW A;  1KIK A;  2JS2 A;  2LMJ A;  5IXF A;  3ZL7 C;  2DF6 A;  1UTI A;  2RMO A;  1VYV A;  2DNU A;  5FW9 A;  4D8D A;  4AG1 C;  3VS0 A;  2A08 A;  4F17 A;  1NEB A;  4F14 A;  2GTO A;  1X27 A;  1T3L A;  3RBB B;  1AVZ C;  2NUZ A;  3H0H A;  2K7A A;  3KFV A;  2JW4 A;  2EYW A;  1BBZ A;  4WCI A;  2EGC A;  2EVR A;  2M0Y A;  3VS5 A;  4RTW A;  4RTZ A;  2CSI A;  3QWX X;  2K3B A;  2DMO A;  1OPK A;  1HJD A;  2O2O A;  2HSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...