2DL8A

Solution structure of the sh3 domain of human slit-robo rho gtpase-activating protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SLIT-ROBO Rho GTPase-activating protein 2
publication title Solution structure of the SH3 domain of human SLIT-ROBO Rho GTPase-activating protein 2
rcsb
source organism Homo sapiens
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl8A00
1BBZA 3JV3A 2D0NA 2LQWA 2BZ8A 2AZVA 4JZ4A 1KIKA 1T0JA 3EG2A 3VS6A 3LH5A 1M3BA 2MOXA 3SEMA 1I0CA 4ORZA 1ARKA 2K7AA 1K76A 2EYYA 2L3PA 2ED0A 2LX7A 2NWMA 1WXBA 2J6KA 4LN2A 1GCQA 3EHQA 1JEGA 3KFVA 1ZX6A 2K9GA 4Y92A 1PKSA 1UDLA 2DBMA 1AOJA 1QKWA 2F2WA 2EYZA 1UTIA 4EIKA 1UUEA 2NUZA 4QT7A 3VS3A 1WXTA 2V1QA 1N5ZA 1AZGB 2IIMA 2RF0A 2DLPA 4RTUA 2YUOA 2CREA 2O31A 2HBWA 2J06A 1W1FA 2KEAA 4OMMA 1TUDA 4IIMA 5IHIA 1U5SA 1NLPC 1NYGA 1LCKA 1X6BA 2HSPA 3VS7A 2A28A 4F14A 2EBPA 5IHNA 4OMPA 1E6GA 3GBQA 3THKA 2DE0X 1K1ZA 4DEYA 2AKLA 4WCIA 2HDAA 1Y57A 1UHCA 1EFNA 1G2BA 1SPKA 4J9IA 4J9BA 2XMFA 1HJDA 1OPKA 2HEQA 3H41A 4CC7A 2C0OA 1JXMA 3RNJA 1VYVA 1YWOA 1WX6A 1AEYA 1WA7A 4JPBW 1SHFA 2D8JA 1HSQA 3REBB 2YUNA 2DL5A 2RQUA 1WLPB 1GBQA 1KSWA 1AVZC 3ZL7C 1B07A 4OMLA 2KNBB 2F2VA 1AWOA 2JTEA 5FWCA 2JMAA 1M3AA 2CUDA 3U23A 4J9HA 3RBBB 3TSWA 1QKXA 3M0PA 4AFZC 1VYUA 4K11A 1E7OA 2DL3A 2EVRA 2KBTA 2DL4A 3NPFA 1RI9A 1V1CA 4JJBA 1U3OA 4RTYA 4GBQA 2CT3A 2FRYA 2JW4A 4JJDA 2ECZA 1G83A 2VVKA 1Y0MA 3CQTA 5ECAA 4LNPA 3A98A 2SRCA 1W70A 1K0XA 2EKHA 2GNCA 1UECA 3TVTA 1PRMC 1PHTA 2BTTA 4OMOA 1OOTA 1MV0B 2KGTA 1CKAA 3R6NA 5IXFA 1ABQA 2L0AA 2L3QA 1AWWA 3QWXX 4ZNXA 1X2QA 2GGRA 1ABOA 2KYBA 1WFWA 2CSIA 1NG2A 1WDXA 2RNAA 2I0NA 3TSZA 1ZLMA 2O2OA 1PKTA 1GBRA 2M0YA 2ED1A 2LJ1A 2AKKA 2CUBA 2FRWA 2YSQA 4F17A 2VKNA 5IHKA 1ZUUA 1I07A 1K9AA 4AFQC 1X27A 2K3BA 1NLOC 1FMKA 1M30A 1VYTA 5GJWB 2J05A 2ROLA 3VS4A 4CC2A 2DL8A 1GCPA 4JZ3A 1QCFA 5I22A 2PTKA 1PRLC 2RPNA 1GFCA 1M8MA 2FPEA 2OJ2A 1AZEA 3IQLA 4M4ZA 3M0UA 1PWTA 1RUWA 4LUEA 4RTWA 1KJWA 2EYXA 4JJCA 1YWPA 1CKBA 4HVWA 1BK2A 1B3QA 3SHWA 3UA7A 1SHGA 1NEGA 4LUDA 2CSQA 4AG2C 1ZBJA 1AWJA 3REAB 4E6RA 4GLMA 1YN8A 1JXOA 1Z9QA 4RTVA 2D1XA 1BB9A 1WI7A 2DJQA 1GFDA 1E6HA 2H8HA 2G6FX 1I1JA 3FJ5A 1H92A 1ZSGA 1IO6A 1QLYA 1JU5C 3H0IA 2LMJA 1QWEA 1W6XA 1OV3A 1FYNA 1YCSB 2B86A 1AD5A 2JT4A 4RTZA 2YUQA 2DMOA 5I11A 2KT1A 3I9QA 2K79A 4J9EA 2C0TA 2YDLA 2D8HA 2E5KA 2W10A 4HVVA 4RTTA 1X2KA 3I5RA 3EGUA 3UATA 2GBQA 1JQQA 2A08A 2JM9A 3EG1A 1T3LA 4X1VA 3EG0A 4ESRA 5IXBA 2KRSA 4Z89A 2RQTA 2ABLA 2O9VA 1HD3A 1NYFA 3VS2A 4J9GA 2RN8A 1MUZA 1WIEA 2C0IA 2KT8A 2MIOA 2RQVA 2MCNA 5IH2A 1X6GA 1ZUKA 3PVQA 3QWYA 2A37A 2FO0A 3M0SA 1UE9A 1U06A 1SRLA 3H0HA 1WYXA 1UJ0A 2QDLA 2SEMA 2LQNA 3VS1A 3NMZC 1PNJA 2OI3A 2KROA 1AWXA 1YP5A 2DM1A 2W0ZA 2KXDA 2X3WD 2DBKA 1T3SA 3EG3A 2EGCA 3C0CA 2AK5A 1UJYA 2YT6A 2BZXA 3UA6A 2LNHB 2LJ0A 1ZUYA 1MV3A 2RQRA 2KR3A 2L2PA 1Z9ZA 1SEMA 5FWBA 2DYBA 2RMOA 2RQWA 2EYWA 3VS0A 2EW3A 3M0QA 2J6OA 2M51A 4J9FA 2DX1A 3I35A 2FPFA 1VA7A 2FPDA 2ESWA 2KRMA 1CSKA 1NEBA 3H0FA 4F16A 1RLPC 1OEBA 2DVJA 4AFUC 3EHRA 2O88A 4D8KA 2KXCA 2YUPA 1M27C 3VS5A 2CDTA 2JS2A 3PVLA 3VRZA 4FSSA 2FG0A 2ENMA 4OMNA 1SRMA 4R0KA 2CH4W 5L23A 1X43A 2CH4A 2DRKA 2J7IA 1NM7A 2DA9A 1TUCA 2DNUA 4CC4B 1UG1A 4J9CA 1GRIA 4RUGA 2OAWA 2K2MA 1WXUA 2JXBA 4OMQA 2LCSA 4CC3A 2K6DA 3NHNA 4AFSC 1H3HA 2O9SA 4DEXA 2F2XA 2CT4A 2KYMA 2PNIA 1GCQC 5GJVB 2DF6A 2EGEA 1UGVA 3NGPA 2LP5A 2LJ3A 1RLQC 2EGAA 4RTXA 1BU1A 2BZYA 4J9DA 4AG1C 1JO8A 3UF4A 2L3SA 2FEIA 5HCKA 2P4RA 2ROTA 4HCKA 1XOVA 3M0RA 1H8KA 4Z88A 1KFZA 4HVUA 4D8DA 1UFFA 2V1RA 1GL5A 1K4US 2PZ1A 1SSHA 2X3XD 1A0NB 4LE9A 1K0SA 1UHFA 4A63B 2A36A 2J6FA 3VRYA 3I5SA 4HXJA 4KRTA 2EPDA 2HCKA 2DRMA 2JS0A 4Z8AA 2VWFA 2AZSA 3O5ZA 2GTOA 2DILA 1J3TA 1TG0A 1OPLA 3M0TA 4IIOA 2KRNA 5EC7A 3PE0A 2JMCA 1YNZA 2LZ6B 3ULRB 1T0HA 1S1NA 1M3CA 1QWFA 2KE9A 2DL7A 2JM8A 1X69A 2EQIA 2GQIA 2GTJA 5FW9A
chains in the Genus database with same CATH superfamily
4M78E 2AZVA 4E2FB 1KIKA 1QVFP 4J6WA 2ZPEB 1M3BA 3ME9A 1I0CA 4F7UE 1HYOA 1YJWQ 1UGPB 1YJNA 2EYYA 3CPWS 2LX7A 2NWMA 3PT9A 3V8JA 1N8RR 4C5EA 5LJ5h 1M1KU 2A7YA 1NJIC 2DIGA 4DBRA 2FVUA 2K9GA 3OYCA 2CKKA 3CCLT 2RM4A 1ZSZA 4OF1A 2JN0A 2DFUA 1KHIA 1UDLA 1V29B 2EYZA 4BB7A 4EIKA 2NUZA 1X01A 3VS3A 2QTXA 1WXTA 4CI0C 3QZ9B 1ZA2B 2YUOA 1GXIE 2O31A 1M5Q1 3I56A 4FT4A 4IIMA 5IHIA 5KYWB 2RI3A 1PC0A 2BIVA 2HQXA 1BI0A 1X6BA 2A28A 2FB7A 1QVPA 4C92D 3CXCS 1KC8R 1JJ2A 4WTOB 1G2BA 1SPKA 3QDFA 2XMFA 4E7HA 3CC7T 3H41A 1ZSZC 4M75B 1PD1A 3RESA 4GY5A 3J80E 3FIFA 3M57A 1YITQ 5KCHA 2R58A 2D6FA 5GAOm 2D8JA 1OQKA 4J6YA 5A2QE 3G4ST 2K2VA 3QYHB 2DL5A 3OY9A 1OU9A 3CD6Q 4C8QA 2XICA 2CZ6B 1NBEB 2KNBB 2QGGA 1AWOA 1RAEB 2JMAA 1M3AA 2CUDA 1VQ4A 2Y4YA 4J9HA 4X34A 4KT0E 1QKXA 5GAMd 2QASA 3X20B 3JCMP 2K5LA 5CO7A 2DL4A 4LDWA 4BE0A 3EGXB 3ZFJA 4XU2A 4BY6B 4M75E 3TU4K 3TVTA 4R55A 1MV0B 4C0DB 1WQ7A 2X4WA 2JUFA 5IXFA 1O75A 2FL7A 4A54A 5I2SA 1AWWA 3VUZA 3JCMg 2I0NA 3T9NA 2HQHA 1UGRB 4M7AD 3G6ET 4KGZB 3J7AF 2FRWA 3JB9G 3J81E 3RUXA 2XU8A 2RD1A 1X27A 3E19A 1YJNT 4M78A 1YIJA 2ROLA 3OS0A 4JZ3A 1QCFA 5I22A 1R77A 4BI3A 2CP3A 2FPEA 4F7UA 1AZEA 2VASA 3GNGA 1WHLA 3M0UA 1RUWA 4LUEA 1C0MA 4M7AE 2YHTA 3JRZA 2JTMA 2ZPBB 3MHXA 3LX7A 4BE2A 1CKBA 1M9SA 3OS2A 1M2OA 1BYMA 2QA4A 1FWZA 1VQMA 2CSQA 2XIDA 4MZTA 4M78G 3I56T 1ZBJA 1AWJA 3JCMb 3BDUA 3QUIA 5I21A 3CMEQ 1BB9A 4M78C 4HCBA 2DJQA 1GFDA 1XQHA 2H8HA 3GLXA 4PJMA 3P8HA 2G6FX 2DPPB 3WVEB 3QO3A 3QKJA 2F5TX 3VJPA 4JLIA 5KH6A 2QEXQ 1Q95G 2A0FB 5KYYB 3I55A 1VQ5Q 1G3WA 1QWEA 1SF9A 1OV3A 2B86A 3ZEHA 3JCMQ 4PJOC 1VQPQ 3H8ZA 1O9SA 2KT1A 3I9QA 2K79A 2ZPIB 4J9EA 2C0TA 2MWPA 2W10A 3JCMh 3JCMW 4HVVA 4RTTA 1X2KA 1JQQA 2HKNA 4X1VA 5IXBA 2E6ZA 1N27A 2LQ8A 1HD3A 1WHHA 2KK4A 2ZGWA 5GAOn 3OYJA 1Q82R 4J9GA 4RG8A 4X9DA 1ZQ1A 2LDMA 3V8LA 5LJ3e 1WIEA 2KT8A 1OX8A 1S72A 1X6GA 5CQXA 5D6XA 2DXBA 3QWYA 2WSEE 1X6OA 4OGEA 1WHGA 1U06A 3OYDA 4EMKA 1BCOA 1ZHIA 3H0HA 2OX7A 1K73R 3VS1A 3R6OA 1G8XA 2DBKA 1N9RA 1KD1C 1T3SA 1MHNA 2DXTA 2XHCA 2BZXA 4IUPA 3JCMJ 3HFNA 1LVKA 3OB9A 1EIFA 2EJ9A 3QDRB 5FWBA 2DYBA 3E9FA 2EYWA 9ATCB 2M51A 4C92G 4FSXA 1Q86U 4M75A 4MZPA 2FPFA 3C4SA 1JRIA 2YRVA 2ESWA 4FU6A 4FW2A 3X26B 1CSKA 4EMKC 5GANd 1RLPC 1Y07A 5C0MA 4C92C 5GAOr 2OTLA 3CC2Q 2JS2A 3VRZA 4BI8B 3KBGA 4WF2A 2CYZB 2VGNA 3C95A 4OMNA 1SRMA 2PVOB 1QVGP 4QVCA 1I81A 2OTJT 2EJFA 5CKBA 2DAQA 2J7IA 2DA9A 4PKCC 1YIJT 3FB9A 1FMWA 1PD0A 2K3YA 3CCQQ 3HHTB 4RUGA 5HK3A 1YHQA 1FX7A 1P92A 2K2MA 1TTHB 4M77F 2LCSA 2DXCA 3NHNA 1KC8C 3E1SA 4XTXA 4ZTJA 1VIEA 3SD4A 4C8QF 2O9SA 4DEXA 1VQLA 3CBMA 3M55A 2KYMA 1GCQC 5J39A 1NE8A 1ZSZB 3NGPA 3L42A 1VQMT 2EGAA 2G3RA 4IUTA 1MMNA 4HKEA 4A4FA 2CP0A 4J9DA 4M7AA 1M1KC 2RK1A 4J7FA 2L3SA 5LJ3j 5GAN7 2QQRA 1M8VA 5KE3A 1RACB 2RB6A 3QJYA 4XK8E 4ATOA 4JJNK 5GMKe 4D8DA 2WACA 2P0PA 4II1A 4C0ZA 3I55T 2HZYA 1LPLA 2X3XD 5J3BA 4LE9A 4XU0A 4A63B 1YCYA 2A36A 4JUVA 2EKOA 5A0LA 5FU6C 4KGVB 4V2SA 1BIAA 2Z0WA 3I5SA 2HBPA 2F69A 4M7AG 2HL5C 1K8AC 4KBMB 2VWFA 2DILA 4M7AC 1SG5A 2KRNA 1YNZA 2XD0A 2RK2A 3CCRA 2JM8A 1I4K1 1IZ6A 2JNGA 1S72T 2DTIA 1OZ3A 2GTJA 1OU8A 3VKIA 2M0OA 2LQWA 3OW2A 1U1TA 4JZ4A 1RADB 1T0JA 3OBWA 1BKBA 3CCLA 5LJ5d 5KYXB 2IG0A 1LJOA 2VC8A 3LH5A 2MOXA 1TOVA 1ARKA 1OULA 1BI1A 2E70A 2J6KA 4PFZA 2FZCB 1JEGA 4E7LA 3KFVA 2XI9A 1ZX6A 4OMFB 4JRKA 3CCEA 1D0XA 2MPXC 3PGGA 4KUIA 1H3ZA 3CPWP 2FZKB 3QSUA 1LOJA 4A4KA 3MP6A 3M4YA 2DBMA 1AOJA 3QZ5B 1UGQB 2HL3A 3OYBA 4QT7A 4Y28E 4XTYA 2V1QA 4M77D 1N5ZA 1NZ9A 2DZ9A 1UB4A 1AZGB 2OTLT 4RTUA 3DKMA 1VQ7Q 1VQ9Q 2CREA 3HRSA 4B9WA 1PSFA 1W1FA 2KEAA 4OMMA 3DB4A 4LDVA 1U5SA 4JDSA 1QP3A 1NYGA 2A3LA 5GMKj 4E7SA 4JS5A 3TREA 4BE1A 3HKSA 2PUKB 2L3RA 4GLKA 4OP0A 3QIIA 3VS7A 5A0GA 1E6GA 4ZGDB 3LWIA 2DE0X 2HDAA 3G7ZA 1VQ6T 1OPKA 3C94A 3OBYA 3OSVA 2VUBA 3BFMA 2Y4XA 1RABB 3RNJA 3CXCP 4M78B 2CP7A 5GMKh 1KD1U 1VQLT 4M7DF 4FT2A 1AEYA 4HCZA 1WA7A 4MDWA 1Q7YR 4IURA 1TWBA 3CMAQ 2DJZA 3PFSA 3CCUQ 1HSQA 4PL6A 1N8RU 2K5FA 2YUNA 3DB3A 3OYNA 4PJOB 1AVZC 1VQKQ 4MMLA 4OMLA 1K9MR 4C5HA 4P5NA 5FU7C 3U23A 3JCMV 2DEUA 2ZCFB 1YJ9Q 2L89A 1OI1A 3M0PA 4AFZC 1VYUA 4K11A 4KULA 2EVRA 4RG2A 4UC4A 2KBTA 2PQWA 3NPFA 1RI9A 1U3OA 1WHKA 2FRYA 5GAOp 2Y90A 4JJDA 4CRIA 2ECZA 2QK0A 1K73C 1Y0MA 5ECAA 2LX9A 1NPRA 3X28B 2AIRB 2E12A 4J7IA 3G6EA 2BTTA 4OMOA 3G71A 1OOTA 2BUDA 1KC8U 1B34A 3TEEA 2RJFA 3M4GA 2L0AA 3URGA 4ZNXA 3CCRT 1X2QA 2GGRA 2KYBA 1WFWA 5LJ3f 2RNAA 2CP2A 3TSZA 1VIFA 4HCCA 2M0YA 4PJOE 3L2UA 4DBQA 2JTFA 2KSSA 4E47A 5GMKl 2VKNA 4J8OA 3CCSQ 1TSFA 2XDBA 2DK3A 4EMKB 1FXXA 1M1GA 2K3BA 1NLOC 1FMKA 1M30A 5GJWB 4C92B 3VS4A 2DL8A 4RCBA 1VQNQ 3CPFA 1PRLC 5I2MA 1D1AA 2RPNA 3CCET 1GFCA 3V7SA 2OJ2A 3QHSA 3IQLA 1Y96A 3JCMc 4M4ZA 4O5VA 4A4HA 1K8AU 3AT1B 1W2BA 1KJWA 3CCVA 3LW5E 2HAXA 1YWPA 3VU3C 4HVWA 1BK2A 3UA7A 2YRCA 4ZTFA 4LUDA 4VUBA 4LD9K 5DY9A 4M7DD 3REAB 1ZA1B 4E6RA 4GLMA 3HFOA 2KQWA 2QI2A 2VV5A 2LRQA 3WVDB 1WI7A 3HP9A 3VUBA 8AT1B 1E6HA 1QP2A 1Q86C 4A4EA 1I1JA 3RIRA 5AT1B 1ZSGA 1IO6A 1JU5C 3JCMd 1D1BA 1D0YA 1W6XA 1FYNA 1AD5A 2JT4A 4C92E 4RTZA 3CC4Q 2LT1A 2YUQA 2DMOA 4QQ6A 2VXFA 5KYXA 3PIOA 2D8HA 2GQVA 4LXCA 1YI2Q 3EGUA 2GBQA 2A08A 2JM9A 2GFUA 4BUGA 5FU6B 1M4ZA 3OS1A 3OYEA 1PM3A 1PSEA 2RQVA 2MCNA 3QBYA 4XTUA 2FO0A 4M7AB 4J6XA 4OGCA 2RO0A 1VUBA 5GAN5 3MEAA 1UJ0A 2DTOA 2LQNA 3LGLA 2OI3A 4IUUA 4N4GA 1YP5A 2KI7A 3QJ6A 1BI3A 2X3WD 2DIQA 4C5IA 3M58A 3EG3A 2EGCA 7AT1B 4IKFA 1YBYA 2VB6A 3CCLQ 1X75C 5GAMe 4M77C 4QKUA 2LNHB 2LJ0A 3UA6A 2RQRA 3G71T 1TU0B 2KR3A 1F1BB 1Z9ZA 1SEMA 1OX9A 4OB0B 3DLMA 2RQWA 3OS5A 1WJSA 2PVDB 2EJGA 3EFRA 3H6ZA 3L2ZA 3M0QA 4AMCA 2J6OA 3PIPA 4J9FA 4QW2A 2QXFA 2OTJA 2DX1A 2QTVA 4Z02A 5GAOl 5A0DA 5C6SA 4E7IA 2HNIA 2P84A 4N0AC 3ASKA 4D8KA 3PNWC 3VYGA 2E64A 2KXCA 2YUPA 1M27C 1QVGA 3PVLA 3RDVA 2RHXA 5FRNA 3MEUA 1KQSA 4O6JA 1Q82U 2CH4A 4PJOA 3CC7Q 1TUCA 1U8RA 4CC4B 1GRIA 4BDZA 2X51A 3RR6A 2OAWA 3FC3A 4YTLA 2B8AA 3UPUA 2H3EB 5D6WA 1K73U 3G4SQ 3CCVT 1ACMB 1MMGA 3TCJA 2EGEA 1UGVA 2QG9B 3JSCA 4PJOG 1RLQC 3GP8A 2WSFE 1JJ2P 4RTXA 1Q7YC 2AT1B 4AG1C 3CCQT 3CCJA 1XOVA 4PJJA 3SWNC 1H8KA 2D9TA 4BDYA 1I8FA 1KHCA 1K4US 2PZ1A 2DO3A 4XU1A 1SSHA 3S3MA 1VQOA 3GIBA 1A0NB 1K0SA 1RAIB 1M90R 2YXYA 2J6FA 1VQ8A 1BIBA 5FU7B 3VRYA 3O8VA 2JJ9A 4F04B 3VYHB 4KRTA 3LH0A 5EG2A 5GAMj 2DXUA 3MEWA 1J3TA 4C92A 1OPLA 3M0TA 3RERA 2KY9A 4IIOA 2JMCA 1T0HA 3A8HB 1QMCA 2KE9A 3G1JA 2QDYB 3G6EQ 2EQIA 1BBZA 2XDDA 2D0NA 1N6AA 2BZ8A 4OB1B 3ER0A 2HSEB 5CKDA 5FROA 5KE2A 5LJ3g 1YJNQ 1N8RC 2DETA 1MGQA 3VS6A 1G3SA 2K7AA 3CBPA 4KUDK 2L3PA 2ED0A 2HKQB 2VXEA 1WXBA 3P8BB 2DZCA 4LN2A 1GCQA 3EHQA 3UWNA 2O4XB 1YJWA 4D6WA 4KH1B 4M7DC 1RL2A 1R0BG 2BKDN 5KCOA 5CKFA 4HA8A 1QKWA 1NJIR 1UTIA 2GCXA 1UUEA 5KYNA 4A4GA 1B34B 3I56Q 5HK0A 3NTKA 1LNXA 2DLPA 2RF0A 5GAN8 2PVGB 1VQ6A 3FRNA 2KMTA 2HBWA 1FMVA 2QAZA 5GAOq 4C0FA 2LCCA 2KAFA 3L2VA 1LCKA 1JJ2S 2HSPA 1KQ2A 4XQ3A 2EBPA 4OMPA 1YFNA 2COZA 3THKA 1K1ZA 5GANe 1Y57A 3FDRA 1EFNA 4XTWA 3OYLA 2KDSA 2M9UA 4J9BA 1HJDA 2NUTA 4CC7A 1JXMA 1G3TA 3S6WA 1YWOA 1KK7A 4QQDA 3KUFA 3SB2A 3JB9F 1OYXA 4JPBW 1SHFA 4XTVA 1BCMA 3X25B 4PFPA 1Y96B 3CCMT 2RQUA 3V7RA 4LDYA 1VQ4Q 1GBQA 1KSWA 5LJ3h 3ZL7C 3CCJT 3BDLA 4PLLA 3CD6A 3QXEB 3TSWA 2X4XA 2C06A 1R0CB 2X35A 4QQGA 1E7OA 2DL3A 1VQOT 1V1CA 3CMAT 4PFOA 1VQ8T 3FJPA 4RTYA 5L8RE 4DOVA 4GBQA 2LQKA 2WSCE 3QYGB 1G83A 2P0QA 2VVKA 3CQTA 4M78F 4BACA 2X4YA 4DBFA 3A98A 1W70A 1K0XA 2EKHA 4BY6C 1QVFA 2GNCA 1Q81R 4EPCA 2QQBA 1PHTA 2KGTA 1YJ9T 4F7UF 1ABQA 1XNIA 4E7KA 4J83A 1ABOA 1DJ7B 4B6MA 2CSIA 2XK0A 3F70A 5DLQE 1ZLMA 1GBRA 2ED1A 2V8IA 1Q7YU 2AKKA 1ZBXA 3MJXA 4MDXA 2H3JA 2OTJQ 2YSQA 1YIJQ 2X4JA 2YLCA 2RHZA 4AFQC 5GANj 1K9MU 2LCLA 3CBOA 3JB9J 4J5YA 1GCPA 5GAMf 1RAAB 2KVQG 4C8QD 1YJWT 3M53A 1C1AA 3EG9B 1M8MA 4ME7A 5LJ5e 1PWTA 3BW1A 2QA4Q 4RTWA 1VQMQ 4JJCA 2DKGA 3CCST 1B3QA 3RKXA 3SHWA 1SHGA 1NEGA 4DBHA 3RMSA 5GAN4 1W4SA 4HT8A 1YN8A 1XTDA 4M77E 4FYWB 1Z9QA 4L6V5 2D1XA 3OMCA 1KQ1A 3I55Q 4C8QE 1MNEA 2K5IA 3CMEA 2CZ1B 2EQMA 1QLYA 5CKHA 4ZN1A 3C12A 4C92F 1YCSB 2QEXA 1SKUB 5I11A 2CZ7B 2P0KA 1BI2A 2MF2A 2YDLA 3INZA 1PG5B 3I5RA 3UATA 4ESRA 1Q82C 3EG1A 3EG0A 1VQPA 1M2VA 1YITT 1IGUA 4Z89A 2RQTA 2DERA 2EQUA 1WHJA 2DYIA 3LYIA 5FRMA 1S72Q 1NYFA 3VS2A 8ATCB 2O4XA 2PUOB 2DD5A 3DLLA 1MUZA 4M75F 2C0IA 5IH2A 2MIOA 2X9HA 2LNVA 5IAYA 3CD6T 3JCMX 1ZUKA 3PVQA 3MO8A 2A37A 2CZ0B 1UE9A 1WQWA 2NUPB 3S3OA 4OVAA 2QGFB 1RAHB 3NMZC 1PNJA 2KROA 2EQKA 2W0ZA 3HTRA 3OYHA 2KXDA 4RCCA 3HSBA 4RMOA 3C0CA 2AK5A 3A8MB 3OYAA 5CIUA 1ZUYA 1MV3A 5KYUA 3OYFA 3H9NA 5LJ5j 4N4IA 3OW2P 1KD1R 2RMOA 4B9XA 3N5BB 3OA6A 4R56A 2OTLQ 3I35A 2QYZA 1VA7A 2FPDA 3FLGA 4FCYA 1NEBA 3PMIA 4F16A 2DVJA 4HT9A 4AFUC 2ZPGB 2O88A 2IVWA 4M7DB 2L5QA 3X24B 4M7AF 2E65A 2FG0A 2ENMA 1D0ZA 3CC2A 5L23A 1X43A 2COWA 1YHQQ 2VYTA 2DRKA 1VQ6Q 4X9CA 6AT1B 4LDXA 4FL6A 2DNUA 1UG1A 2LTOA 4J9CA 4ELZC 1QW1A 2DVEA 3OYYA 1VQLQ 1H641 4MZMA 2JXBA 4FYYB 2K6DA 3CCQA 4AFSC 1H3HA 5GAN3 3AHUA 5AYFA 2ZPFB 3HL8A 4JRQA 1VOMA 2F2XA 2DF6A 2EIFA 3ZBDA 1HXDA 2LP5A 2LJ3A 3M59A 3M56A 2O01E 5CAIA 2HD0A 5CR2A 5HCKA 3MPUB 2ZZDA 2CS7A 3L2QA 4Z88A 4M7DE 2D0QB 2EFIA 1M1KR 4C5GA 3CMET 1GL5A 2EYQA 5GANf 3OSSC 2LVMA 1AT1B 4M77A 3KXTA 4M75D 4XU3A 3A8GB 2QEXT 1VQ5T 4HXJA 4KGXB 4A53A 2NUTB 2HCKA 2DRMA 3D7SB 1VQPT 4Z8AA 3O5ZA 3EH1A 3JCMe 2QQAA 3CCRQ 2XKOC 4N0AA 3NTHA 3PE0A 5EC7A 3RKWA 3ULRB 1K8AR 4JS4A 1S1NA 1Q81C 1QWFA 4M77G 4IUVA 4LD6A 3EG9A 1Y7XA 3OQ5A 1QVFS 4C8QG 2CP6A 3OW2S 3A8LB 5FW9A 2LT4A 3JV3A 2P4TA 5LL6S 4JLGA 1WGSA 4C8QC 3MP8A 3EG2A 2NYSA 1D09B 4LDUA 1OZ2A 4ANJA 3SEMA 4ORZA 1WJRA 1IB8A 1K76A 3META 3Q1JA 3CCEQ 2V26A 2QQ9A 3EFOB 1D3BA 2K3XA 2COYA 4Y92A 1PKSA 1IGQA 1QQJA 1M90U 2F2WA 5HKCA 5GAMg 2RHIA 3GNFB 4XAXB 3SWNA 4QVZA 2IIMA 3A1PA 5CCAA 3TQ7P 4E7JA 4MMKA 2J06A 3QG1A 2HQEA 5DLOA 2HMAA 1TUDA 2ZAEA 2YRDA 4ELYC 1VQ7A 4E7ZA 1VQ9A 1NLPC 2IPOB 3CC2T 5GAN2 2EQJA 1M1FA 4DA4A 3RMQA 2XDPA 4F14A 4OB2B 5IHNA 1W2BP 2EWNA 2GF7A 1SSFA 3GBQA 4DEYA 2AKLA 4WCIA 1KG1A 1UHCA 4J9IA 2DTHA 4L5GA 2HEQA 3CCMA 2C0OA 3E2UA 5GMKi 2NUPA 1VYVA 1Y71A 5LJ5f 1WX6A 4TVRA 5LJ3d 4F7UG 3OMGA 5CK9A 2JOYA 1WNLA 1MMAA 1D1CA 2M02A 2K57A 3REBB 1K9MC 4PJNA 3MEVA 2CP5A 2OAUA 2PU9B 1WLPB 4AT1B 5GAN6 3CMAA 4FW1A 3CCUA 2MMPA 3LGFA 1B07A 2F2VA 2E6NA 2JTEA 2R5AA 5J26A 4PNOA 2ATCB 5FWCA 3MP1A 3RBBB 1NJIU 1VQKA 1MMDA 2RHYA 4ZGEB 2E3IA 3V8KA 3PMTA 3L2RA 1YJ9A 4JJBA 5FLXE 3V7CA 4M7DA 2RHUA 2CT3A 3FEOA 2JW4A 1VQ4T 2FHDA 3HRTA 5GAMh 3G71Q 1IHWA 4LNPA 3A5ZB 2RJDA 2SRCA 2E1HA 2AHJB 2E41A 1UECA 1PRMC 1CKAA 2DEQA 3R6NA 3A8OB 2L3QA 4XTZA 3QWXX 1M2VB 1NG2A 1EZZB 1WDXA 4EMHA 5KYWA 4M7DG 2O2OA 1PKTA 1WZOA 4OB3B 2L8DA 2E3HA 2LJ1A 4N4HA 3UT1A 2CUBA 3CPWA 1EX4A 4F17A 1JB0E 3JB9I 1MNDA 5IHKA 4BI4A 1ZUUA 3BY7A 1I07A 1K9AA 4EMGA 1VYTA 2J05A 3WXMB 2GFAA 3CCSA 2E10A 2YLBA 4CC2A 4Q5WA 2BE7D 2PTKA 5CVIA 3EGDB 3GF5A 3CCVQ 1W2BS 2RI5A 1XJWB 1VQNA 3M9QA 1KQSP 5CQYA 2EYXA 5IN1A 5KYUB 2XG8D 4M75G 2FYKA 4AG2C 3CXCA 2RJCA 1HK9A 2CGHA 1Q81U 2MYSA 3JB9H 4M75C 2RJEA 1VQ7T 1VQ9T 1JXOA 4RTVA 3BE3A 2JZ2A 4JRPA 1G5VA 2JVVA 4NL3A 3UDCA 3EGXA 3FJ5A 2QA4T 1H92A 1N9SA 4ZGJB 2K4YA 1YITA 3H0IA 5M9OA 3LWHA 1NPPA 2LMJA 1Q86R 1I5LA 2V8KA 5D7UA 2M1HA 5GANg 3SFMA 1G3YA 3VV0A 2E5KA 2YWWA 4FYVB 1T3LA 2E4HA 3CC4A 2KRSA 1QCOA 1V76A 2ABLA 1TS9A 4KH0B 2O9VA 4BD3A 1YI2A 3E9GA 3CCUT 2QQSA 1RAGB 3EFOA 2RN8A 1WJQA 1VQKT 2RH2A 3M0SA 4Y91A 1SRLA 1PCXA 1TH7A 1WYXA 2QDLA 2SEMA 1IRXA 3OYGA 3OYIA 1AWXA 1JBMA 2DM1A 4C0DC 3QPHA 3RKYA 2R57A 5CKEA 4FYXB 4PJOF 4M77B 1UJYA 2YT6A 1B7TA 1RI0A 4C8QB 1I5OB 1WPYA 2L2PA 4JRIA 3JCMf 1IXDA 3VS0A 4L59A 2EW3A 2FZGB 3EAEA 3LLRA 2ZPHB 2MWOA 2KRMA 3MKDA 3H0FA 1OEBA 1QVGS 3EHRA 1RAFB 4NL2A 3NTIA 1KQSS 4PK4A 3MCAB 3VS5A 2CDTA 4FSSA 2F1LA 2NLUA 3P8DA 2DD4A 5KYYA 4R0KA 3CEYA 1AHJB 2CH4W 5IT9E 5GANh 3JAME 3M54A 1NM7A 3OYMA 4QVDA 2F5KA 2I2LA 2R5MA 3CC7A 1WXUA 4OMQA 2RI2A 4CC3A 2V8JA 4C0GA 4DOWA 2EAYA 3JB9D 4IUQA 1VQNT 1UEBA 2MK5A 2CT4A 2VGMA 3CCMQ 3HPWA 2PNIA 1D3BB 3EFSA 5GJVB 4FM4B 5LJ5g 3L2WA 1YHQT 3G4SA 2MI6A 3CCJQ 1IHVA 1BU1A 2BZYA 1JO8A 3UF4A 4NOYA 5GMKm 2FEIA 4EDUA 3S3NA 2P4RA 2ROTA 3SWNB 4HCKA 3PTAA 1VQ5A 1VQOQ 3M0RA 1KFZA 1M90C 1C6VX 4HVUA 1UFFA 2V1RA 5HY6A 4F7UB 1VQ8Q 3GPLA 2E5QA 1UHFA 4RKUE 3HRUA 4ZN3A 1U1SA 3L1AA 3SDZA 4NS5A 2M16A 4M78D 1QCNA 4PLIA 2BE9B 2EPDA 2MAMA 1WHMA 4DQ2A 3CC4T 5D6YA 3EH2A 3NFCA 2JS0A 5DM7R 2AZSA 2RA2A 4FIBA 1TXQA 2GTOA 1TUGB 1TG0A 2LC4A 1YI2T 3M5AA 3OYKA 2LZ6B 4PJLA 4PJOD 1UGSB 1IREB 1M3CA 2DL7A 3GOXA 3EGDA 1X69A 1R8OB 2GQIA
chains in the Genus database with same CATH topology
1BBZA 3JV3A 2D0NA 2LQWA 2BZ8A 2AZVA 4JZ4A 1KIKA 1T0JA 3EG2A 3VS6A 3LH5A 1M3BA 2MOXA 3SEMA 1I0CA 4ORZA 1ARKA 2K7AA 1K76A 2EYYA 2L3PA 2ED0A 2LX7A 2NWMA 1WXBA 2J6KA 4LN2A 1GCQA 3EHQA 1JEGA 3KFVA 1ZX6A 2K9GA 4Y92A 1PKSA 1UDLA 2DBMA 1AOJA 1QKWA 2F2WA 2EYZA 1UTIA 4EIKA 1UUEA 2NUZA 4QT7A 3VS3A 1WXTA 2V1QA 1N5ZA 1AZGB 2IIMA 2RF0A 2DLPA 4RTUA 2YUOA 2CREA 2O31A 2HBWA 2J06A 1W1FA 2KEAA 4OMMA 1TUDA 4IIMA 5IHIA 1U5SA 1NLPC 1NYGA 1LCKA 1X6BA 2HSPA 3VS7A 2A28A 4F14A 2EBPA 5IHNA 4OMPA 1E6GA 3GBQA 3THKA 2DE0X 1K1ZA 4DEYA 2AKLA 4WCIA 2HDAA 1Y57A 1UHCA 1EFNA 1G2BA 1SPKA 4J9IA 4J9BA 2XMFA 1HJDA 1OPKA 2HEQA 3H41A 4CC7A 2C0OA 1JXMA 3RNJA 1VYVA 1YWOA 1WX6A 1AEYA 1WA7A 4JPBW 1SHFA 2D8JA 1HSQA 3REBB 2YUNA 2DL5A 2RQUA 1WLPB 1GBQA 1KSWA 1AVZC 3ZL7C 1B07A 4OMLA 2KNBB 2F2VA 1AWOA 2JTEA 5FWCA 2JMAA 1M3AA 2CUDA 3U23A 4J9HA 3RBBB 3TSWA 1QKXA 3M0PA 4AFZC 1VYUA 4K11A 1E7OA 2DL3A 2EVRA 2KBTA 2DL4A 3NPFA 1RI9A 1V1CA 4JJBA 1U3OA 4RTYA 4GBQA 2CT3A 2FRYA 2JW4A 4JJDA 2ECZA 1G83A 2VVKA 1Y0MA 3CQTA 5ECAA 4LNPA 3A98A 2SRCA 1W70A 1K0XA 2EKHA 2GNCA 1UECA 3TVTA 1PRMC 1PHTA 2BTTA 4OMOA 1OOTA 1MV0B 2KGTA 1CKAA 3R6NA 5IXFA 1ABQA 2L0AA 2L3QA 1AWWA 3QWXX 4ZNXA 1X2QA 2GGRA 1ABOA 2KYBA 1WFWA 2CSIA 1NG2A 1WDXA 2RNAA 2I0NA 3TSZA 1ZLMA 2O2OA 1PKTA 1GBRA 2M0YA 2ED1A 2LJ1A 2AKKA 2CUBA 2FRWA 2YSQA 4F17A 2VKNA 5IHKA 1ZUUA 1I07A 1K9AA 4AFQC 1X27A 2K3BA 1NLOC 1FMKA 1M30A 1VYTA 5GJWB 2J05A 2ROLA 3VS4A 4CC2A 2DL8A 1GCPA 4JZ3A 1QCFA 5I22A 2PTKA 1PRLC 2RPNA 1GFCA 1M8MA 2FPEA 2OJ2A 1AZEA 3IQLA 4M4ZA 3M0UA 1PWTA 1RUWA 4LUEA 4RTWA 1KJWA 2EYXA 4JJCA 1YWPA 1CKBA 4HVWA 1BK2A 1B3QA 3SHWA 3UA7A 1SHGA 1NEGA 4LUDA 2CSQA 4AG2C 1ZBJA 1AWJA 3REAB 4E6RA 4GLMA 1YN8A 1JXOA 1Z9QA 4RTVA 2D1XA 1BB9A 1WI7A 2DJQA 1GFDA 1E6HA 2H8HA 2G6FX 1I1JA 3FJ5A 1H92A 1ZSGA 1IO6A 1QLYA 1JU5C 3H0IA 2LMJA 1QWEA 1W6XA 1OV3A 1FYNA 1YCSB 2B86A 1AD5A 2JT4A 4RTZA 2YUQA 2DMOA 5I11A 2KT1A 3I9QA 2K79A 4J9EA 2C0TA 2YDLA 2D8HA 2E5KA 2W10A 4HVVA 4RTTA 1X2KA 3I5RA 3EGUA 3UATA 2GBQA 1JQQA 2A08A 2JM9A 3EG1A 1T3LA 4X1VA 3EG0A 4ESRA 5IXBA 2KRSA 4Z89A 2RQTA 2ABLA 2O9VA 1HD3A 1NYFA 3VS2A 4J9GA 2RN8A 1MUZA 1WIEA 2C0IA 2KT8A 2MIOA 2RQVA 2MCNA 5IH2A 1X6GA 1ZUKA 3PVQA 3QWYA 2A37A 2FO0A 3M0SA 1UE9A 1U06A 1SRLA 3H0HA 1WYXA 1UJ0A 2QDLA 2SEMA 2LQNA 3VS1A 3NMZC 1PNJA 2OI3A 2KROA 1AWXA 1YP5A 2DM1A 2W0ZA 2KXDA 2X3WD 2DBKA 1T3SA 3EG3A 2EGCA 3C0CA 2AK5A 1UJYA 2YT6A 2BZXA 3UA6A 2LNHB 2LJ0A 1ZUYA 1MV3A 2RQRA 2KR3A 2L2PA 1Z9ZA 1SEMA 5FWBA 2DYBA 2RMOA 2RQWA 2EYWA 3VS0A 2EW3A 3M0QA 2J6OA 2M51A 4J9FA 2DX1A 3I35A 2FPFA 1VA7A 2FPDA 2ESWA 2KRMA 1CSKA 1NEBA 3H0FA 4F16A 1RLPC 1OEBA 2DVJA 4AFUC 3EHRA 2O88A 4D8KA 2KXCA 2YUPA 1M27C 3VS5A 2CDTA 2JS2A 3PVLA 3VRZA 4FSSA 2FG0A 2ENMA 4OMNA 1SRMA 4R0KA 2CH4W 5L23A 1X43A 2CH4A 2DRKA 2J7IA 1NM7A 2DA9A 1TUCA 2DNUA 4CC4B 1UG1A 4J9CA 1GRIA 4RUGA 2OAWA 2K2MA 1WXUA 2JXBA 4OMQA 2LCSA 4CC3A 2K6DA 3NHNA 4AFSC 1H3HA 2O9SA 4DEXA 2F2XA 2CT4A 2KYMA 2PNIA 1GCQC 5GJVB 2DF6A 2EGEA 1UGVA 3NGPA 2LP5A 2LJ3A 1RLQC 2EGAA 4RTXA 1BU1A 2BZYA 4J9DA 4AG1C 1JO8A 3UF4A 2L3SA 2FEIA 5HCKA 2P4RA 2ROTA 4HCKA 1XOVA 3M0RA 1H8KA 4Z88A 1KFZA 4HVUA 4D8DA 1UFFA 2V1RA 1GL5A 1K4US 2PZ1A 1SSHA 2X3XD 1A0NB 4LE9A 1K0SA 1UHFA 4A63B 2A36A 2J6FA 3VRYA 3I5SA 4HXJA 4KRTA 2EPDA 2HCKA 2DRMA 2JS0A 4Z8AA 2VWFA 2AZSA 3O5ZA 2GTOA 2DILA 1J3TA 1TG0A 1OPLA 3M0TA 4IIOA 2KRNA 5EC7A 3PE0A 2JMCA 1YNZA 2LZ6B 3ULRB 1T0HA 1S1NA 1M3CA 1QWFA 2KE9A 2DL7A 2JM8A 1X69A 2EQIA 2GQIA 2GTJA 5FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  3JV3 A;  2D0N A;  2LQW A;  2BZ8 A;  2AZV A;  4JZ4 A;  1KIK A;  1T0J A;  3EG2 A;  3VS6 A;  3LH5 A;  1M3B A;  2MOX A;  3SEM A;  1I0C A;  4ORZ A;  1ARK A;  2K7A A;  1K76 A;  2EYY A;  2L3P A;  2ED0 A;  2LX7 A;  2NWM A;  1WXB A;  2J6K A;  4LN2 A;  1GCQ A;  3EHQ A;  1JEG A;  3KFV A;  1ZX6 A;  2K9G A;  4Y92 A;  1PKS A;  1UDL A;  2DBM A;  1AOJ A;  1QKW A;  2F2W A;  2EYZ A;  1UTI A;  4EIK A;  1UUE A;  2NUZ A;  4QT7 A;  3VS3 A;  1WXT A;  2V1Q A;  1N5Z A;  1AZG B;  2IIM A;  2RF0 A;  2DLP A;  4RTU A;  2YUO A;  2CRE A;  2O31 A;  2HBW A;  2J06 A;  1W1F A;  2KEA A;  4OMM A;  1TUD A;  4IIM A;  5IHI A;  1U5S A;  1NLP C;  1NYG A;  1LCK A;  1X6B A;  2HSP A;  3VS7 A;  2A28 A;  4F14 A;  2EBP A;  5IHN A;  4OMP A;  1E6G A;  3GBQ A;  3THK A;  2DE0 X;  1K1Z A;  4DEY A;  2AKL A;  4WCI A;  2HDA A;  1Y57 A;  1UHC A;  1EFN A;  1G2B A;  1SPK A;  4J9I A;  4J9B A;  2XMF A;  1HJD A;  1OPK A;  2HEQ A;  3H41 A;  4CC7 A;  2C0O A;  1JXM A;  3RNJ A;  1VYV A;  1YWO A;  1WX6 A;  1AEY A;  1WA7 A;  4JPB W;  1SHF A;  2D8J A;  1HSQ A;  3REB B;  2YUN A;  2DL5 A;  2RQU A;  1WLP B;  1GBQ A;  1KSW A;  1AVZ C;  3ZL7 C;  1B07 A;  4OML A;  2KNB B;  2F2V A;  1AWO A;  2JTE A;  5FWC A;  2JMA A;  1M3A A;  2CUD A;  3U23 A;  4J9H A;  3RBB B;  3TSW A;  1QKX A;  3M0P A;  4AFZ C;  1VYU A;  4K11 A;  1E7O A;  2DL3 A;  2EVR A;  2KBT A;  2DL4 A;  3NPF A;  1RI9 A;  1V1C A;  4JJB A;  1U3O A;  4RTY A;  4GBQ A;  2CT3 A;  2FRY A;  2JW4 A;  4JJD A;  2ECZ A;  1G83 A;  2VVK A;  1Y0M A;  3CQT A;  5ECA A;  4LNP A;  3A98 A;  2SRC A;  1W70 A;  1K0X A;  2EKH A;  2GNC A;  1UEC A;  3TVT A;  1PRM C;  1PHT A;  2BTT A;  4OMO A;  1OOT A;  1MV0 B;  2KGT A;  1CKA A;  3R6N A;  5IXF A;  1ABQ A;  2L0A A;  2L3Q A;  1AWW A;  3QWX X;  4ZNX A;  1X2Q A;  2GGR A;  1ABO A;  2KYB A;  1WFW A;  2CSI A;  1NG2 A;  1WDX A;  2RNA A;  2I0N A;  3TSZ A;  1ZLM A;  2O2O A;  1PKT A;  1GBR A;  2M0Y A;  2ED1 A;  2LJ1 A;  2AKK A;  2CUB A;  2FRW A;  2YSQ A;  4F17 A;  2VKN A;  5IHK A;  1ZUU A;  1I07 A;  1K9A A;  4AFQ C;  1X27 A;  2K3B A;  1NLO C;  1FMK A;  1M30 A;  1VYT A;  5GJW B;  2J05 A;  2ROL A;  3VS4 A;  4CC2 A;  2DL8 A;  1GCP A;  4JZ3 A;  1QCF A;  5I22 A;  2PTK A;  1PRL C;  2RPN A;  1GFC A;  1M8M A;  2FPE A;  2OJ2 A;  1AZE A;  3IQL A;  4M4Z A;  3M0U A;  1PWT A;  1RUW A;  4LUE A;  4RTW A;  1KJW A;  2EYX A;  4JJC A;  1YWP A;  1CKB A;  4HVW A;  1BK2 A;  1B3Q A;  3SHW A;  3UA7 A;  1SHG A;  1NEG A;  4LUD A;  2CSQ A;  4AG2 C;  1ZBJ A;  1AWJ A;  3REA B;  4E6R A;  4GLM A;  1YN8 A;  1JXO A;  1Z9Q A;  4RTV A;  2D1X A;  1BB9 A;  1WI7 A;  2DJQ A;  1GFD A;  1E6H A;  2H8H A;  2G6F X;  1I1J A;  3FJ5 A;  1H92 A;  1ZSG A;  1IO6 A;  1QLY A;  1JU5 C;  3H0I A;  2LMJ A;  1QWE A;  1W6X A;  1OV3 A;  1FYN A;  1YCS B;  2B86 A;  1AD5 A;  2JT4 A;  4RTZ A;  2YUQ A;  2DMO A;  5I11 A;  2KT1 A;  3I9Q A;  2K79 A;  4J9E A;  2C0T A;  2YDL A;  2D8H A;  2E5K A;  2W10 A;  4HVV A;  4RTT A;  1X2K A;  3I5R A;  3EGU A;  3UAT A;  2GBQ A;  1JQQ A;  2A08 A;  2JM9 A;  3EG1 A;  1T3L A;  4X1V A;  3EG0 A;  4ESR A;  5IXB A;  2KRS A;  4Z89 A;  2RQT A;  2ABL A;  2O9V A;  1HD3 A;  1NYF A;  3VS2 A;  4J9G A;  2RN8 A;  1MUZ A;  1WIE A;  2C0I A;  2KT8 A;  2MIO A;  2RQV A;  2MCN A;  5IH2 A;  1X6G A;  1ZUK A;  3PVQ A;  3QWY A;  2A37 A;  2FO0 A;  3M0S A;  1UE9 A;  1U06 A;  1SRL A;  3H0H A;  1WYX A;  1UJ0 A;  2QDL A;  2SEM A;  2LQN A;  3VS1 A;  3NMZ C;  1PNJ A;  2OI3 A;  2KRO A;  1AWX A;  1YP5 A;  2DM1 A;  2W0Z A;  2KXD A;  2X3W D;  2DBK A;  1T3S A;  3EG3 A;  2EGC A;  3C0C A;  2AK5 A;  1UJY A;  2YT6 A;  2BZX A;  3UA6 A;  2LNH B;  2LJ0 A;  1ZUY A;  1MV3 A;  2RQR A;  2KR3 A;  2L2P A;  1Z9Z A;  1SEM A;  5FWB A;  2DYB A;  2RMO A;  2RQW A;  2EYW A;  3VS0 A;  2EW3 A;  3M0Q A;  2J6O A;  2M51 A;  4J9F A;  2DX1 A;  3I35 A;  2FPF A;  1VA7 A;  2FPD A;  2ESW A;  2KRM A;  1CSK A;  1NEB A;  3H0F A;  4F16 A;  1RLP C;  1OEB A;  2DVJ A;  4AFU C;  3EHR A;  2O88 A;  4D8K A;  2KXC A;  2YUP A;  1M27 C;  3VS5 A;  2CDT A;  2JS2 A;  3PVL A;  3VRZ A;  4FSS A;  2FG0 A;  2ENM A;  4OMN A;  1SRM A;  4R0K A;  2CH4 W;  5L23 A;  1X43 A;  2CH4 A;  2DRK A;  2J7I A;  1NM7 A;  2DA9 A;  1TUC A;  2DNU A;  4CC4 B;  1UG1 A;  4J9C A;  1GRI A;  4RUG A;  2OAW A;  2K2M A;  1WXU A;  2JXB A;  4OMQ A;  2LCS A;  4CC3 A;  2K6D A;  3NHN A;  4AFS C;  1H3H A;  2O9S A;  4DEX A;  2F2X A;  2CT4 A;  2KYM A;  2PNI A;  1GCQ C;  5GJV B;  2DF6 A;  2EGE A;  1UGV A;  3NGP A;  2LP5 A;  2LJ3 A;  1RLQ C;  2EGA A;  4RTX A;  1BU1 A;  2BZY A;  4J9D A;  4AG1 C;  1JO8 A;  3UF4 A;  2L3S A;  2FEI A;  5HCK A;  2P4R A;  2ROT A;  4HCK A;  1XOV A;  3M0R A;  1H8K A;  4Z88 A;  1KFZ A;  4HVU A;  4D8D A;  1UFF A;  2V1R A;  1GL5 A;  1K4U S;  2PZ1 A;  1SSH A;  2X3X D;  1A0N B;  4LE9 A;  1K0S A;  1UHF A;  4A63 B;  2A36 A;  2J6F A;  3VRY A;  3I5S A;  4HXJ A;  4KRT A;  2EPD A;  2HCK A;  2DRM A;  2JS0 A;  4Z8A A;  2VWF A;  2AZS A;  3O5Z A;  2GTO A;  2DIL A;  1J3T A;  1TG0 A;  1OPL A;  3M0T A;  4IIO A;  2KRN A;  5EC7 A;  3PE0 A;  2JMC A;  1YNZ A;  2LZ6 B;  3ULR B;  1T0H A;  1S1N A;  1M3C A;  1QWF A;  2KE9 A;  2DL7 A;  2JM8 A;  1X69 A;  2EQI A;  2GQI A;  2GTJ A;  5FW9 A; 
#chains in the Genus database with same CATH topology
 4M78 E;  2AZV A;  4E2F B;  1KIK A;  1QVF P;  4J6W A;  2ZPE B;  1M3B A;  3ME9 A;  1I0C A;  4F7U E;  1HYO A;  1YJW Q;  1UGP B;  1YJN A;  2EYY A;  3CPW S;  2LX7 A;  2NWM A;  3PT9 A;  3V8J A;  1N8R R;  4C5E A;  5LJ5 h;  1M1K U;  2A7Y A;  1NJI C;  2DIG A;  4DBR A;  2FVU A;  2K9G A;  3OYC A;  2CKK A;  3CCL T;  2RM4 A;  1ZSZ A;  4OF1 A;  2JN0 A;  2DFU A;  1KHI A;  1UDL A;  1V29 B;  2EYZ A;  4BB7 A;  4EIK A;  2NUZ A;  1X01 A;  3VS3 A;  2QTX A;  1WXT A;  4CI0 C;  3QZ9 B;  1ZA2 B;  2YUO A;  1GXI E;  2O31 A;  1M5Q 1;  3I56 A;  4FT4 A;  4IIM A;  5IHI A;  5KYW B;  2RI3 A;  1PC0 A;  2BIV A;  2HQX A;  1BI0 A;  1X6B A;  2A28 A;  2FB7 A;  1QVP A;  4C92 D;  3CXC S;  1KC8 R;  1JJ2 A;  4WTO B;  1G2B A;  1SPK A;  3QDF A;  2XMF A;  4E7H A;  3CC7 T;  3H41 A;  1ZSZ C;  4M75 B;  1PD1 A;  3RES A;  4GY5 A;  3J80 E;  3FIF A;  3M57 A;  1YIT Q;  5KCH A;  2R58 A;  2D6F A;  5GAO m;  2D8J A;  1OQK A;  4J6Y A;  5A2Q E;  3G4S T;  2K2V A;  3QYH B;  2DL5 A;  3OY9 A;  1OU9 A;  3CD6 Q;  4C8Q A;  2XIC A;  2CZ6 B;  1NBE B;  2KNB B;  2QGG A;  1AWO A;  1RAE B;  2JMA A;  1M3A A;  2CUD A;  1VQ4 A;  2Y4Y A;  4J9H A;  4X34 A;  4KT0 E;  1QKX A;  5GAM d;  2QAS A;  3X20 B;  3JCM P;  2K5L A;  5CO7 A;  2DL4 A;  4LDW A;  4BE0 A;  3EGX B;  3ZFJ A;  4XU2 A;  4BY6 B;  4M75 E;  3TU4 K;  3TVT A;  4R55 A;  1MV0 B;  4C0D B;  1WQ7 A;  2X4W A;  2JUF A;  5IXF A;  1O75 A;  2FL7 A;  4A54 A;  5I2S A;  1AWW A;  3VUZ A;  3JCM g;  2I0N A;  3T9N A;  2HQH A;  1UGR B;  4M7A D;  3G6E T;  4KGZ B;  3J7A F;  2FRW A;  3JB9 G;  3J81 E;  3RUX A;  2XU8 A;  2RD1 A;  1X27 A;  3E19 A;  1YJN T;  4M78 A;  1YIJ A;  2ROL A;  3OS0 A;  4JZ3 A;  1QCF A;  5I22 A;  1R77 A;  4BI3 A;  2CP3 A;  2FPE A;  4F7U A;  1AZE A;  2VAS A;  3GNG A;  1WHL A;  3M0U A;  1RUW A;  4LUE A;  1C0M A;  4M7A E;  2YHT A;  3JRZ A;  2JTM A;  2ZPB B;  3MHX A;  3LX7 A;  4BE2 A;  1CKB A;  1M9S A;  3OS2 A;  1M2O A;  1BYM A;  2QA4 A;  1FWZ A;  1VQM A;  2CSQ A;  2XID A;  4MZT A;  4M78 G;  3I56 T;  1ZBJ A;  1AWJ A;  3JCM b;  3BDU A;  3QUI A;  5I21 A;  3CME Q;  1BB9 A;  4M78 C;  4HCB A;  2DJQ A;  1GFD A;  1XQH A;  2H8H A;  3GLX A;  4PJM A;  3P8H A;  2G6F X;  2DPP B;  3WVE B;  3QO3 A;  3QKJ A;  2F5T X;  3VJP A;  4JLI A;  5KH6 A;  2QEX Q;  1Q95 G;  2A0F B;  5KYY B;  3I55 A;  1VQ5 Q;  1G3W A;  1QWE A;  1SF9 A;  1OV3 A;  2B86 A;  3ZEH A;  3JCM Q;  4PJO C;  1VQP Q;  3H8Z A;  1O9S A;  2KT1 A;  3I9Q A;  2K79 A;  2ZPI B;  4J9E A;  2C0T A;  2MWP A;  2W10 A;  3JCM h;  3JCM W;  4HVV A;  4RTT A;  1X2K A;  1JQQ A;  2HKN A;  4X1V A;  5IXB A;  2E6Z A;  1N27 A;  2LQ8 A;  1HD3 A;  1WHH A;  2KK4 A;  2ZGW A;  5GAO n;  3OYJ A;  1Q82 R;  4J9G A;  4RG8 A;  4X9D A;  1ZQ1 A;  2LDM A;  3V8L A;  5LJ3 e;  1WIE A;  2KT8 A;  1OX8 A;  1S72 A;  1X6G A;  5CQX A;  5D6X A;  2DXB A;  3QWY A;  2WSE E;  1X6O A;  4OGE A;  1WHG A;  1U06 A;  3OYD A;  4EMK A;  1BCO A;  1ZHI A;  3H0H A;  2OX7 A;  1K73 R;  3VS1 A;  3R6O A;  1G8X A;  2DBK A;  1N9R A;  1KD1 C;  1T3S A;  1MHN A;  2DXT A;  2XHC A;  2BZX A;  4IUP A;  3JCM J;  3HFN A;  1LVK A;  3OB9 A;  1EIF A;  2EJ9 A;  3QDR B;  5FWB A;  2DYB A;  3E9F A;  2EYW A;  9ATC B;  2M51 A;  4C92 G;  4FSX A;  1Q86 U;  4M75 A;  4MZP A;  2FPF A;  3C4S A;  1JRI A;  2YRV A;  2ESW A;  4FU6 A;  4FW2 A;  3X26 B;  1CSK A;  4EMK C;  5GAN d;  1RLP C;  1Y07 A;  5C0M A;  4C92 C;  5GAO r;  2OTL A;  3CC2 Q;  2JS2 A;  3VRZ A;  4BI8 B;  3KBG A;  4WF2 A;  2CYZ B;  2VGN A;  3C95 A;  4OMN A;  1SRM A;  2PVO B;  1QVG P;  4QVC A;  1I81 A;  2OTJ T;  2EJF A;  5CKB A;  2DAQ A;  2J7I A;  2DA9 A;  4PKC C;  1YIJ T;  3FB9 A;  1FMW A;  1PD0 A;  2K3Y A;  3CCQ Q;  3HHT B;  4RUG A;  5HK3 A;  1YHQ A;  1FX7 A;  1P92 A;  2K2M A;  1TTH B;  4M77 F;  2LCS A;  2DXC A;  3NHN A;  1KC8 C;  3E1S A;  4XTX A;  4ZTJ A;  1VIE A;  3SD4 A;  4C8Q F;  2O9S A;  4DEX A;  1VQL A;  3CBM A;  3M55 A;  2KYM A;  1GCQ C;  5J39 A;  1NE8 A;  1ZSZ B;  3NGP A;  3L42 A;  1VQM T;  2EGA A;  2G3R A;  4IUT A;  1MMN A;  4HKE A;  4A4F A;  2CP0 A;  4J9D A;  4M7A A;  1M1K C;  2RK1 A;  4J7F A;  2L3S A;  5LJ3 j;  5GAN 7;  2QQR A;  1M8V A;  5KE3 A;  1RAC B;  2RB6 A;  3QJY A;  4XK8 E;  4ATO A;  4JJN K;  5GMK e;  4D8D A;  2WAC A;  2P0P A;  4II1 A;  4C0Z A;  3I55 T;  2HZY A;  1LPL A;  2X3X D;  5J3B A;  4LE9 A;  4XU0 A;  4A63 B;  1YCY A;  2A36 A;  4JUV A;  2EKO A;  5A0L A;  5FU6 C;  4KGV B;  4V2S A;  1BIA A;  2Z0W A;  3I5S A;  2HBP A;  2F69 A;  4M7A G;  2HL5 C;  1K8A C;  4KBM B;  2VWF A;  2DIL A;  4M7A C;  1SG5 A;  2KRN A;  1YNZ A;  2XD0 A;  2RK2 A;  3CCR A;  2JM8 A;  1I4K 1;  1IZ6 A;  2JNG A;  1S72 T;  2DTI A;  1OZ3 A;  2GTJ A;  1OU8 A;  3VKI A;  2M0O A;  2LQW A;  3OW2 A;  1U1T A;  4JZ4 A;  1RAD B;  1T0J A;  3OBW A;  1BKB A;  3CCL A;  5LJ5 d;  5KYX B;  2IG0 A;  1LJO A;  2VC8 A;  3LH5 A;  2MOX A;  1TOV A;  1ARK A;  1OUL A;  1BI1 A;  2E70 A;  2J6K A;  4PFZ A;  2FZC B;  1JEG A;  4E7L A;  3KFV A;  2XI9 A;  1ZX6 A;  4OMF B;  4JRK A;  3CCE A;  1D0X A;  2MPX C;  3PGG A;  4KUI A;  1H3Z A;  3CPW P;  2FZK B;  3QSU A;  1LOJ A;  4A4K A;  3MP6 A;  3M4Y A;  2DBM A;  1AOJ A;  3QZ5 B;  1UGQ B;  2HL3 A;  3OYB A;  4QT7 A;  4Y28 E;  4XTY A;  2V1Q A;  4M77 D;  1N5Z A;  1NZ9 A;  2DZ9 A;  1UB4 A;  1AZG B;  2OTL T;  4RTU A;  3DKM A;  1VQ7 Q;  1VQ9 Q;  2CRE A;  3HRS A;  4B9W A;  1PSF A;  1W1F A;  2KEA A;  4OMM A;  3DB4 A;  4LDV A;  1U5S A;  4JDS A;  1QP3 A;  1NYG A;  2A3L A;  5GMK j;  4E7S A;  4JS5 A;  3TRE A;  4BE1 A;  3HKS A;  2PUK B;  2L3R A;  4GLK A;  4OP0 A;  3QII A;  3VS7 A;  5A0G A;  1E6G A;  4ZGD B;  3LWI A;  2DE0 X;  2HDA A;  3G7Z A;  1VQ6 T;  1OPK A;  3C94 A;  3OBY A;  3OSV A;  2VUB A;  3BFM A;  2Y4X A;  1RAB B;  3RNJ A;  3CXC P;  4M78 B;  2CP7 A;  5GMK h;  1KD1 U;  1VQL T;  4M7D F;  4FT2 A;  1AEY A;  4HCZ A;  1WA7 A;  4MDW A;  1Q7Y R;  4IUR A;  1TWB A;  3CMA Q;  2DJZ A;  3PFS A;  3CCU Q;  1HSQ A;  4PL6 A;  1N8R U;  2K5F A;  2YUN A;  3DB3 A;  3OYN A;  4PJO B;  1AVZ C;  1VQK Q;  4MML A;  4OML A;  1K9M R;  4C5H A;  4P5N A;  5FU7 C;  3U23 A;  3JCM V;  2DEU A;  2ZCF B;  1YJ9 Q;  2L89 A;  1OI1 A;  3M0P A;  4AFZ C;  1VYU A;  4K11 A;  4KUL A;  2EVR A;  4RG2 A;  4UC4 A;  2KBT A;  2PQW A;  3NPF A;  1RI9 A;  1U3O A;  1WHK A;  2FRY A;  5GAO p;  2Y90 A;  4JJD A;  4CRI A;  2ECZ A;  2QK0 A;  1K73 C;  1Y0M A;  5ECA A;  2LX9 A;  1NPR A;  3X28 B;  2AIR B;  2E12 A;  4J7I A;  3G6E A;  2BTT A;  4OMO A;  3G71 A;  1OOT A;  2BUD A;  1KC8 U;  1B34 A;  3TEE A;  2RJF A;  3M4G A;  2L0A A;  3URG A;  4ZNX A;  3CCR T;  1X2Q A;  2GGR A;  2KYB A;  1WFW A;  5LJ3 f;  2RNA A;  2CP2 A;  3TSZ A;  1VIF A;  4HCC A;  2M0Y A;  4PJO E;  3L2U A;  4DBQ A;  2JTF A;  2KSS A;  4E47 A;  5GMK l;  2VKN A;  4J8O A;  3CCS Q;  1TSF A;  2XDB A;  2DK3 A;  4EMK B;  1FXX A;  1M1G A;  2K3B A;  1NLO C;  1FMK A;  1M30 A;  5GJW B;  4C92 B;  3VS4 A;  2DL8 A;  4RCB A;  1VQN Q;  3CPF A;  1PRL C;  5I2M A;  1D1A A;  2RPN A;  3CCE T;  1GFC A;  3V7S A;  2OJ2 A;  3QHS A;  3IQL A;  1Y96 A;  3JCM c;  4M4Z A;  4O5V A;  4A4H A;  1K8A U;  3AT1 B;  1W2B A;  1KJW A;  3CCV A;  3LW5 E;  2HAX A;  1YWP A;  3VU3 C;  4HVW A;  1BK2 A;  3UA7 A;  2YRC A;  4ZTF A;  4LUD A;  4VUB A;  4LD9 K;  5DY9 A;  4M7D D;  3REA B;  1ZA1 B;  4E6R A;  4GLM A;  3HFO A;  2KQW A;  2QI2 A;  2VV5 A;  2LRQ A;  3WVD B;  1WI7 A;  3HP9 A;  3VUB A;  8AT1 B;  1E6H A;  1QP2 A;  1Q86 C;  4A4E A;  1I1J A;  3RIR A;  5AT1 B;  1ZSG A;  1IO6 A;  1JU5 C;  3JCM d;  1D1B A;  1D0Y A;  1W6X A;  1FYN A;  1AD5 A;  2JT4 A;  4C92 E;  4RTZ A;  3CC4 Q;  2LT1 A;  2YUQ A;  2DMO A;  4QQ6 A;  2VXF A;  5KYX A;  3PIO A;  2D8H A;  2GQV A;  4LXC A;  1YI2 Q;  3EGU A;  2GBQ A;  2A08 A;  2JM9 A;  2GFU A;  4BUG A;  5FU6 B;  1M4Z A;  3OS1 A;  3OYE A;  1PM3 A;  1PSE A;  2RQV A;  2MCN A;  3QBY A;  4XTU A;  2FO0 A;  4M7A B;  4J6X A;  4OGC A;  2RO0 A;  1VUB A;  5GAN 5;  3MEA A;  1UJ0 A;  2DTO A;  2LQN A;  3LGL A;  2OI3 A;  4IUU A;  4N4G A;  1YP5 A;  2KI7 A;  3QJ6 A;  1BI3 A;  2X3W D;  2DIQ A;  4C5I A;  3M58 A;  3EG3 A;  2EGC A;  7AT1 B;  4IKF A;  1YBY A;  2VB6 A;  3CCL Q;  1X75 C;  5GAM e;  4M77 C;  4QKU A;  2LNH B;  2LJ0 A;  3UA6 A;  2RQR A;  3G71 T;  1TU0 B;  2KR3 A;  1F1B B;  1Z9Z A;  1SEM A;  1OX9 A;  4OB0 B;  3DLM A;  2RQW A;  3OS5 A;  1WJS A;  2PVD B;  2EJG A;  3EFR A;  3H6Z A;  3L2Z A;  3M0Q A;  4AMC A;  2J6O A;  3PIP A;  4J9F A;  4QW2 A;  2QXF A;  2OTJ A;  2DX1 A;  2QTV A;  4Z02 A;  5GAO l;  5A0D A;  5C6S A;  4E7I A;  2HNI A;  2P84 A;  4N0A C;  3ASK A;  4D8K A;  3PNW C;  3VYG A;  2E64 A;  2KXC A;  2YUP A;  1M27 C;  1QVG A;  3PVL A;  3RDV A;  2RHX A;  5FRN A;  3MEU A;  1KQS A;  4O6J A;  1Q82 U;  2CH4 A;  4PJO A;  3CC7 Q;  1TUC A;  1U8R A;  4CC4 B;  1GRI A;  4BDZ A;  2X51 A;  3RR6 A;  2OAW A;  3FC3 A;  4YTL A;  2B8A A;  3UPU A;  2H3E B;  5D6W A;  1K73 U;  3G4S Q;  3CCV T;  1ACM B;  1MMG A;  3TCJ A;  2EGE A;  1UGV A;  2QG9 B;  3JSC A;  4PJO G;  1RLQ C;  3GP8 A;  2WSF E;  1JJ2 P;  4RTX A;  1Q7Y C;  2AT1 B;  4AG1 C;  3CCQ T;  3CCJ A;  1XOV A;  4PJJ A;  3SWN C;  1H8K A;  2D9T A;  4BDY A;  1I8F A;  1KHC A;  1K4U S;  2PZ1 A;  2DO3 A;  4XU1 A;  1SSH A;  3S3M A;  1VQO A;  3GIB A;  1A0N B;  1K0S A;  1RAI B;  1M90 R;  2YXY A;  2J6F A;  1VQ8 A;  1BIB A;  5FU7 B;  3VRY A;  3O8V A;  2JJ9 A;  4F04 B;  3VYH B;  4KRT A;  3LH0 A;  5EG2 A;  5GAM j;  2DXU A;  3MEW A;  1J3T A;  4C92 A;  1OPL A;  3M0T A;  3RER A;  2KY9 A;  4IIO A;  2JMC A;  1T0H A;  3A8H B;  1QMC A;  2KE9 A;  3G1J A;  2QDY B;  3G6E Q;  2EQI A;  1BBZ A;  2XDD A;  2D0N A;  1N6A A;  2BZ8 A;  4OB1 B;  3ER0 A;  2HSE B;  5CKD A;  5FRO A;  5KE2 A;  5LJ3 g;  1YJN Q;  1N8R C;  2DET A;  1MGQ A;  3VS6 A;  1G3S A;  2K7A A;  3CBP A;  4KUD K;  2L3P A;  2ED0 A;  2HKQ B;  2VXE A;  1WXB A;  3P8B B;  2DZC A;  4LN2 A;  1GCQ A;  3EHQ A;  3UWN A;  2O4X B;  1YJW A;  4D6W A;  4KH1 B;  4M7D C;  1RL2 A;  1R0B G;  2BKD N;  5KCO A;  5CKF A;  4HA8 A;  1QKW A;  1NJI R;  1UTI A;  2GCX A;  1UUE A;  5KYN A;  4A4G A;  1B34 B;  3I56 Q;  5HK0 A;  3NTK A;  1LNX A;  2DLP A;  2RF0 A;  5GAN 8;  2PVG B;  1VQ6 A;  3FRN A;  2KMT A;  2HBW A;  1FMV A;  2QAZ A;  5GAO q;  4C0F A;  2LCC A;  2KAF A;  3L2V A;  1LCK A;  1JJ2 S;  2HSP A;  1KQ2 A;  4XQ3 A;  2EBP A;  4OMP A;  1YFN A;  2COZ A;  3THK A;  1K1Z A;  5GAN e;  1Y57 A;  3FDR A;  1EFN A;  4XTW A;  3OYL A;  2KDS A;  2M9U A;  4J9B A;  1HJD A;  2NUT A;  4CC7 A;  1JXM A;  1G3T A;  3S6W A;  1YWO A;  1KK7 A;  4QQD A;  3KUF A;  3SB2 A;  3JB9 F;  1OYX A;  4JPB W;  1SHF A;  4XTV A;  1BCM A;  3X25 B;  4PFP A;  1Y96 B;  3CCM T;  2RQU A;  3V7R A;  4LDY A;  1VQ4 Q;  1GBQ A;  1KSW A;  5LJ3 h;  3ZL7 C;  3CCJ T;  3BDL A;  4PLL A;  3CD6 A;  3QXE B;  3TSW A;  2X4X A;  2C06 A;  1R0C B;  2X35 A;  4QQG A;  1E7O A;  2DL3 A;  1VQO T;  1V1C A;  3CMA T;  4PFO A;  1VQ8 T;  3FJP A;  4RTY A;  5L8R E;  4DOV A;  4GBQ A;  2LQK A;  2WSC E;  3QYG B;  1G83 A;  2P0Q A;  2VVK A;  3CQT A;  4M78 F;  4BAC A;  2X4Y A;  4DBF A;  3A98 A;  1W70 A;  1K0X A;  2EKH A;  4BY6 C;  1QVF A;  2GNC A;  1Q81 R;  4EPC A;  2QQB A;  1PHT A;  2KGT A;  1YJ9 T;  4F7U F;  1ABQ A;  1XNI A;  4E7K A;  4J83 A;  1ABO A;  1DJ7 B;  4B6M A;  2CSI A;  2XK0 A;  3F70 A;  5DLQ E;  1ZLM A;  1GBR A;  2ED1 A;  2V8I A;  1Q7Y U;  2AKK A;  1ZBX A;  3MJX A;  4MDX A;  2H3J A;  2OTJ Q;  2YSQ A;  1YIJ Q;  2X4J A;  2YLC A;  2RHZ A;  4AFQ C;  5GAN j;  1K9M U;  2LCL A;  3CBO A;  3JB9 J;  4J5Y A;  1GCP A;  5GAM f;  1RAA B;  2KVQ G;  4C8Q D;  1YJW T;  3M53 A;  1C1A A;  3EG9 B;  1M8M A;  4ME7 A;  5LJ5 e;  1PWT A;  3BW1 A;  2QA4 Q;  4RTW A;  1VQM Q;  4JJC A;  2DKG A;  3CCS T;  1B3Q A;  3RKX A;  3SHW A;  1SHG A;  1NEG A;  4DBH A;  3RMS A;  5GAN 4;  1W4S A;  4HT8 A;  1YN8 A;  1XTD A;  4M77 E;  4FYW B;  1Z9Q A;  4L6V 5;  2D1X A;  3OMC A;  1KQ1 A;  3I55 Q;  4C8Q E;  1MNE A;  2K5I A;  3CME A;  2CZ1 B;  2EQM A;  1QLY A;  5CKH A;  4ZN1 A;  3C12 A;  4C92 F;  1YCS B;  2QEX A;  1SKU B;  5I11 A;  2CZ7 B;  2P0K A;  1BI2 A;  2MF2 A;  2YDL A;  3INZ A;  1PG5 B;  3I5R A;  3UAT A;  4ESR A;  1Q82 C;  3EG1 A;  3EG0 A;  1VQP A;  1M2V A;  1YIT T;  1IGU A;  4Z89 A;  2RQT A;  2DER A;  2EQU A;  1WHJ A;  2DYI A;  3LYI A;  5FRM A;  1S72 Q;  1NYF A;  3VS2 A;  8ATC B;  2O4X A;  2PUO B;  2DD5 A;  3DLL A;  1MUZ A;  4M75 F;  2C0I A;  5IH2 A;  2MIO A;  2X9H A;  2LNV A;  5IAY A;  3CD6 T;  3JCM X;  1ZUK A;  3PVQ A;  3MO8 A;  2A37 A;  2CZ0 B;  1UE9 A;  1WQW A;  2NUP B;  3S3O A;  4OVA A;  2QGF B;  1RAH B;  3NMZ C;  1PNJ A;  2KRO A;  2EQK A;  2W0Z A;  3HTR A;  3OYH A;  2KXD A;  4RCC A;  3HSB A;  4RMO A;  3C0C A;  2AK5 A;  3A8M B;  3OYA A;  5CIU A;  1ZUY A;  1MV3 A;  5KYU A;  3OYF A;  3H9N A;  5LJ5 j;  4N4I A;  3OW2 P;  1KD1 R;  2RMO A;  4B9X A;  3N5B B;  3OA6 A;  4R56 A;  2OTL Q;  3I35 A;  2QYZ A;  1VA7 A;  2FPD A;  3FLG A;  4FCY A;  1NEB A;  3PMI A;  4F16 A;  2DVJ A;  4HT9 A;  4AFU C;  2ZPG B;  2O88 A;  2IVW A;  4M7D B;  2L5Q A;  3X24 B;  4M7A F;  2E65 A;  2FG0 A;  2ENM A;  1D0Z A;  3CC2 A;  5L23 A;  1X43 A;  2COW A;  1YHQ Q;  2VYT A;  2DRK A;  1VQ6 Q;  4X9C A;  6AT1 B;  4LDX A;  4FL6 A;  2DNU A;  1UG1 A;  2LTO A;  4J9C A;  4ELZ C;  1QW1 A;  2DVE A;  3OYY A;  1VQL Q;  1H64 1;  4MZM A;  2JXB A;  4FYY B;  2K6D A;  3CCQ A;  4AFS C;  1H3H A;  5GAN 3;  3AHU A;  5AYF A;  2ZPF B;  3HL8 A;  4JRQ A;  1VOM A;  2F2X A;  2DF6 A;  2EIF A;  3ZBD A;  1HXD A;  2LP5 A;  2LJ3 A;  3M59 A;  3M56 A;  2O01 E;  5CAI A;  2HD0 A;  5CR2 A;  5HCK A;  3MPU B;  2ZZD A;  2CS7 A;  3L2Q A;  4Z88 A;  4M7D E;  2D0Q B;  2EFI A;  1M1K R;  4C5G A;  3CME T;  1GL5 A;  2EYQ A;  5GAN f;  3OSS C;  2LVM A;  1AT1 B;  4M77 A;  3KXT A;  4M75 D;  4XU3 A;  3A8G B;  2QEX T;  1VQ5 T;  4HXJ A;  4KGX B;  4A53 A;  2NUT B;  2HCK A;  2DRM A;  3D7S B;  1VQP T;  4Z8A A;  3O5Z A;  3EH1 A;  3JCM e;  2QQA A;  3CCR Q;  2XKO C;  4N0A A;  3NTH A;  3PE0 A;  5EC7 A;  3RKW A;  3ULR B;  1K8A R;  4JS4 A;  1S1N A;  1Q81 C;  1QWF A;  4M77 G;  4IUV A;  4LD6 A;  3EG9 A;  1Y7X A;  3OQ5 A;  1QVF S;  4C8Q G;  2CP6 A;  3OW2 S;  3A8L B;  5FW9 A;  2LT4 A;  3JV3 A;  2P4T A;  5LL6 S;  4JLG A;  1WGS A;  4C8Q C;  3MP8 A;  3EG2 A;  2NYS A;  1D09 B;  4LDU A;  1OZ2 A;  4ANJ A;  3SEM A;  4ORZ A;  1WJR A;  1IB8 A;  1K76 A;  3MET A;  3Q1J A;  3CCE Q;  2V26 A;  2QQ9 A;  3EFO B;  1D3B A;  2K3X A;  2COY A;  4Y92 A;  1PKS A;  1IGQ A;  1QQJ A;  1M90 U;  2F2W A;  5HKC A;  5GAM g;  2RHI A;  3GNF B;  4XAX B;  3SWN A;  4QVZ A;  2IIM A;  3A1P A;  5CCA A;  3TQ7 P;  4E7J A;  4MMK A;  2J06 A;  3QG1 A;  2HQE A;  5DLO A;  2HMA A;  1TUD A;  2ZAE A;  2YRD A;  4ELY C;  1VQ7 A;  4E7Z A;  1VQ9 A;  1NLP C;  2IPO B;  3CC2 T;  5GAN 2;  2EQJ A;  1M1F A;  4DA4 A;  3RMQ A;  2XDP A;  4F14 A;  4OB2 B;  5IHN A;  1W2B P;  2EWN A;  2GF7 A;  1SSF A;  3GBQ A;  4DEY A;  2AKL A;  4WCI A;  1KG1 A;  1UHC A;  4J9I A;  2DTH A;  4L5G A;  2HEQ A;  3CCM A;  2C0O A;  3E2U A;  5GMK i;  2NUP A;  1VYV A;  1Y71 A;  5LJ5 f;  1WX6 A;  4TVR A;  5LJ3 d;  4F7U G;  3OMG A;  5CK9 A;  2JOY A;  1WNL A;  1MMA A;  1D1C A;  2M02 A;  2K57 A;  3REB B;  1K9M C;  4PJN A;  3MEV A;  2CP5 A;  2OAU A;  2PU9 B;  1WLP B;  4AT1 B;  5GAN 6;  3CMA A;  4FW1 A;  3CCU A;  2MMP A;  3LGF A;  1B07 A;  2F2V A;  2E6N A;  2JTE A;  2R5A A;  5J26 A;  4PNO A;  2ATC B;  5FWC A;  3MP1 A;  3RBB B;  1NJI U;  1VQK A;  1MMD A;  2RHY A;  4ZGE B;  2E3I A;  3V8K A;  3PMT A;  3L2R A;  1YJ9 A;  4JJB A;  5FLX E;  3V7C A;  4M7D A;  2RHU A;  2CT3 A;  3FEO A;  2JW4 A;  1VQ4 T;  2FHD A;  3HRT A;  5GAM h;  3G71 Q;  1IHW A;  4LNP A;  3A5Z B;  2RJD A;  2SRC A;  2E1H A;  2AHJ B;  2E41 A;  1UEC A;  1PRM C;  1CKA A;  2DEQ A;  3R6N A;  3A8O B;  2L3Q A;  4XTZ A;  3QWX X;  1M2V B;  1NG2 A;  1EZZ B;  1WDX A;  4EMH A;  5KYW A;  4M7D G;  2O2O A;  1PKT A;  1WZO A;  4OB3 B;  2L8D A;  2E3H A;  2LJ1 A;  4N4H A;  3UT1 A;  2CUB A;  3CPW A;  1EX4 A;  4F17 A;  1JB0 E;  3JB9 I;  1MND A;  5IHK A;  4BI4 A;  1ZUU A;  3BY7 A;  1I07 A;  1K9A A;  4EMG A;  1VYT A;  2J05 A;  3WXM B;  2GFA A;  3CCS A;  2E10 A;  2YLB A;  4CC2 A;  4Q5W A;  2BE7 D;  2PTK A;  5CVI A;  3EGD B;  3GF5 A;  3CCV Q;  1W2B S;  2RI5 A;  1XJW B;  1VQN A;  3M9Q A;  1KQS P;  5CQY A;  2EYX A;  5IN1 A;  5KYU B;  2XG8 D;  4M75 G;  2FYK A;  4AG2 C;  3CXC A;  2RJC A;  1HK9 A;  2CGH A;  1Q81 U;  2MYS A;  3JB9 H;  4M75 C;  2RJE A;  1VQ7 T;  1VQ9 T;  1JXO A;  4RTV A;  3BE3 A;  2JZ2 A;  4JRP A;  1G5V A;  2JVV A;  4NL3 A;  3UDC A;  3EGX A;  3FJ5 A;  2QA4 T;  1H92 A;  1N9S A;  4ZGJ B;  2K4Y A;  1YIT A;  3H0I A;  5M9O A;  3LWH A;  1NPP A;  2LMJ A;  1Q86 R;  1I5L A;  2V8K A;  5D7U A;  2M1H A;  5GAN g;  3SFM A;  1G3Y A;  3VV0 A;  2E5K A;  2YWW A;  4FYV B;  1T3L A;  2E4H A;  3CC4 A;  2KRS A;  1QCO A;  1V76 A;  2ABL A;  1TS9 A;  4KH0 B;  2O9V A;  4BD3 A;  1YI2 A;  3E9G A;  3CCU T;  2QQS A;  1RAG B;  3EFO A;  2RN8 A;  1WJQ A;  1VQK T;  2RH2 A;  3M0S A;  4Y91 A;  1SRL A;  1PCX A;  1TH7 A;  1WYX A;  2QDL A;  2SEM A;  1IRX A;  3OYG A;  3OYI A;  1AWX A;  1JBM A;  2DM1 A;  4C0D C;  3QPH A;  3RKY A;  2R57 A;  5CKE A;  4FYX B;  4PJO F;  4M77 B;  1UJY A;  2YT6 A;  1B7T A;  1RI0 A;  4C8Q B;  1I5O B;  1WPY A;  2L2P A;  4JRI A;  3JCM f;  1IXD A;  3VS0 A;  4L59 A;  2EW3 A;  2FZG B;  3EAE A;  3LLR A;  2ZPH B;  2MWO A;  2KRM A;  3MKD A;  3H0F A;  1OEB A;  1QVG S;  3EHR A;  1RAF B;  4NL2 A;  3NTI A;  1KQS S;  4PK4 A;  3MCA B;  3VS5 A;  2CDT A;  4FSS A;  2F1L A;  2NLU A;  3P8D A;  2DD4 A;  5KYY A;  4R0K A;  3CEY A;  1AHJ B;  2CH4 W;  5IT9 E;  5GAN h;  3JAM E;  3M54 A;  1NM7 A;  3OYM A;  4QVD A;  2F5K A;  2I2L A;  2R5M A;  3CC7 A;  1WXU A;  4OMQ A;  2RI2 A;  4CC3 A;  2V8J A;  4C0G A;  4DOW A;  2EAY A;  3JB9 D;  4IUQ A;  1VQN T;  1UEB A;  2MK5 A;  2CT4 A;  2VGM A;  3CCM Q;  3HPW A;  2PNI A;  1D3B B;  3EFS A;  5GJV B;  4FM4 B;  5LJ5 g;  3L2W A;  1YHQ T;  3G4S A;  2MI6 A;  3CCJ Q;  1IHV A;  1BU1 A;  2BZY A;  1JO8 A;  3UF4 A;  4NOY A;  5GMK m;  2FEI A;  4EDU A;  3S3N A;  2P4R A;  2ROT A;  3SWN B;  4HCK A;  3PTA A;  1VQ5 A;  1VQO Q;  3M0R A;  1KFZ A;  1M90 C;  1C6V X;  4HVU A;  1UFF A;  2V1R A;  5HY6 A;  4F7U B;  1VQ8 Q;  3GPL A;  2E5Q A;  1UHF A;  4RKU E;  3HRU A;  4ZN3 A;  1U1S A;  3L1A A;  3SDZ A;  4NS5 A;  2M16 A;  4M78 D;  1QCN A;  4PLI A;  2BE9 B;  2EPD A;  2MAM A;  1WHM A;  4DQ2 A;  3CC4 T;  5D6Y A;  3EH2 A;  3NFC A;  2JS0 A;  5DM7 R;  2AZS A;  2RA2 A;  4FIB A;  1TXQ A;  2GTO A;  1TUG B;  1TG0 A;  2LC4 A;  1YI2 T;  3M5A A;  3OYK A;  2LZ6 B;  4PJL A;  4PJO D;  1UGS B;  1IRE B;  1M3C A;  2DL7 A;  3GOX A;  3EGD A;  1X69 A;  1R8O B;  2GQI A; 
#chains in the Genus database with same CATH homology
 1BBZ A;  3JV3 A;  2D0N A;  2LQW A;  2BZ8 A;  2AZV A;  4JZ4 A;  1KIK A;  1T0J A;  3EG2 A;  3VS6 A;  3LH5 A;  1M3B A;  2MOX A;  3SEM A;  1I0C A;  4ORZ A;  1ARK A;  2K7A A;  1K76 A;  2EYY A;  2L3P A;  2ED0 A;  2LX7 A;  2NWM A;  1WXB A;  2J6K A;  4LN2 A;  1GCQ A;  3EHQ A;  1JEG A;  3KFV A;  1ZX6 A;  2K9G A;  4Y92 A;  1PKS A;  1UDL A;  2DBM A;  1AOJ A;  1QKW A;  2F2W A;  2EYZ A;  1UTI A;  4EIK A;  1UUE A;  2NUZ A;  4QT7 A;  3VS3 A;  1WXT A;  2V1Q A;  1N5Z A;  1AZG B;  2IIM A;  2RF0 A;  2DLP A;  4RTU A;  2YUO A;  2CRE A;  2O31 A;  2HBW A;  2J06 A;  1W1F A;  2KEA A;  4OMM A;  1TUD A;  4IIM A;  5IHI A;  1U5S A;  1NLP C;  1NYG A;  1LCK A;  1X6B A;  2HSP A;  3VS7 A;  2A28 A;  4F14 A;  2EBP A;  5IHN A;  4OMP A;  1E6G A;  3GBQ A;  3THK A;  2DE0 X;  1K1Z A;  4DEY A;  2AKL A;  4WCI A;  2HDA A;  1Y57 A;  1UHC A;  1EFN A;  1G2B A;  1SPK A;  4J9I A;  4J9B A;  2XMF A;  1HJD A;  1OPK A;  2HEQ A;  3H41 A;  4CC7 A;  2C0O A;  1JXM A;  3RNJ A;  1VYV A;  1YWO A;  1WX6 A;  1AEY A;  1WA7 A;  4JPB W;  1SHF A;  2D8J A;  1HSQ A;  3REB B;  2YUN A;  2DL5 A;  2RQU A;  1WLP B;  1GBQ A;  1KSW A;  1AVZ C;  3ZL7 C;  1B07 A;  4OML A;  2KNB B;  2F2V A;  1AWO A;  2JTE A;  5FWC A;  2JMA A;  1M3A A;  2CUD A;  3U23 A;  4J9H A;  3RBB B;  3TSW A;  1QKX A;  3M0P A;  4AFZ C;  1VYU A;  4K11 A;  1E7O A;  2DL3 A;  2EVR A;  2KBT A;  2DL4 A;  3NPF A;  1RI9 A;  1V1C A;  4JJB A;  1U3O A;  4RTY A;  4GBQ A;  2CT3 A;  2FRY A;  2JW4 A;  4JJD A;  2ECZ A;  1G83 A;  2VVK A;  1Y0M A;  3CQT A;  5ECA A;  4LNP A;  3A98 A;  2SRC A;  1W70 A;  1K0X A;  2EKH A;  2GNC A;  1UEC A;  3TVT A;  1PRM C;  1PHT A;  2BTT A;  4OMO A;  1OOT A;  1MV0 B;  2KGT A;  1CKA A;  3R6N A;  5IXF A;  1ABQ A;  2L0A A;  2L3Q A;  1AWW A;  3QWX X;  4ZNX A;  1X2Q A;  2GGR A;  1ABO A;  2KYB A;  1WFW A;  2CSI A;  1NG2 A;  1WDX A;  2RNA A;  2I0N A;  3TSZ A;  1ZLM A;  2O2O A;  1PKT A;  1GBR A;  2M0Y A;  2ED1 A;  2LJ1 A;  2AKK A;  2CUB A;  2FRW A;  2YSQ A;  4F17 A;  2VKN A;  5IHK A;  1ZUU A;  1I07 A;  1K9A A;  4AFQ C;  1X27 A;  2K3B A;  1NLO C;  1FMK A;  1M30 A;  1VYT A;  5GJW B;  2J05 A;  2ROL A;  3VS4 A;  4CC2 A;  2DL8 A;  1GCP A;  4JZ3 A;  1QCF A;  5I22 A;  2PTK A;  1PRL C;  2RPN A;  1GFC A;  1M8M A;  2FPE A;  2OJ2 A;  1AZE A;  3IQL A;  4M4Z A;  3M0U A;  1PWT A;  1RUW A;  4LUE A;  4RTW A;  1KJW A;  2EYX A;  4JJC A;  1YWP A;  1CKB A;  4HVW A;  1BK2 A;  1B3Q A;  3SHW A;  3UA7 A;  1SHG A;  1NEG A;  4LUD A;  2CSQ A;  4AG2 C;  1ZBJ A;  1AWJ A;  3REA B;  4E6R A;  4GLM A;  1YN8 A;  1JXO A;  1Z9Q A;  4RTV A;  2D1X A;  1BB9 A;  1WI7 A;  2DJQ A;  1GFD A;  1E6H A;  2H8H A;  2G6F X;  1I1J A;  3FJ5 A;  1H92 A;  1ZSG A;  1IO6 A;  1QLY A;  1JU5 C;  3H0I A;  2LMJ A;  1QWE A;  1W6X A;  1OV3 A;  1FYN A;  1YCS B;  2B86 A;  1AD5 A;  2JT4 A;  4RTZ A;  2YUQ A;  2DMO A;  5I11 A;  2KT1 A;  3I9Q A;  2K79 A;  4J9E A;  2C0T A;  2YDL A;  2D8H A;  2E5K A;  2W10 A;  4HVV A;  4RTT A;  1X2K A;  3I5R A;  3EGU A;  3UAT A;  2GBQ A;  1JQQ A;  2A08 A;  2JM9 A;  3EG1 A;  1T3L A;  4X1V A;  3EG0 A;  4ESR A;  5IXB A;  2KRS A;  4Z89 A;  2RQT A;  2ABL A;  2O9V A;  1HD3 A;  1NYF A;  3VS2 A;  4J9G A;  2RN8 A;  1MUZ A;  1WIE A;  2C0I A;  2KT8 A;  2MIO A;  2RQV A;  2MCN A;  5IH2 A;  1X6G A;  1ZUK A;  3PVQ A;  3QWY A;  2A37 A;  2FO0 A;  3M0S A;  1UE9 A;  1U06 A;  1SRL A;  3H0H A;  1WYX A;  1UJ0 A;  2QDL A;  2SEM A;  2LQN A;  3VS1 A;  3NMZ C;  1PNJ A;  2OI3 A;  2KRO A;  1AWX A;  1YP5 A;  2DM1 A;  2W0Z A;  2KXD A;  2X3W D;  2DBK A;  1T3S A;  3EG3 A;  2EGC A;  3C0C A;  2AK5 A;  1UJY A;  2YT6 A;  2BZX A;  3UA6 A;  2LNH B;  2LJ0 A;  1ZUY A;  1MV3 A;  2RQR A;  2KR3 A;  2L2P A;  1Z9Z A;  1SEM A;  5FWB A;  2DYB A;  2RMO A;  2RQW A;  2EYW A;  3VS0 A;  2EW3 A;  3M0Q A;  2J6O A;  2M51 A;  4J9F A;  2DX1 A;  3I35 A;  2FPF A;  1VA7 A;  2FPD A;  2ESW A;  2KRM A;  1CSK A;  1NEB A;  3H0F A;  4F16 A;  1RLP C;  1OEB A;  2DVJ A;  4AFU C;  3EHR A;  2O88 A;  4D8K A;  2KXC A;  2YUP A;  1M27 C;  3VS5 A;  2CDT A;  2JS2 A;  3PVL A;  3VRZ A;  4FSS A;  2FG0 A;  2ENM A;  4OMN A;  1SRM A;  4R0K A;  2CH4 W;  5L23 A;  1X43 A;  2CH4 A;  2DRK A;  2J7I A;  1NM7 A;  2DA9 A;  1TUC A;  2DNU A;  4CC4 B;  1UG1 A;  4J9C A;  1GRI A;  4RUG A;  2OAW A;  2K2M A;  1WXU A;  2JXB A;  4OMQ A;  2LCS A;  4CC3 A;  2K6D A;  3NHN A;  4AFS C;  1H3H A;  2O9S A;  4DEX A;  2F2X A;  2CT4 A;  2KYM A;  2PNI A;  1GCQ C;  5GJV B;  2DF6 A;  2EGE A;  1UGV A;  3NGP A;  2LP5 A;  2LJ3 A;  1RLQ C;  2EGA A;  4RTX A;  1BU1 A;  2BZY A;  4J9D A;  4AG1 C;  1JO8 A;  3UF4 A;  2L3S A;  2FEI A;  5HCK A;  2P4R A;  2ROT A;  4HCK A;  1XOV A;  3M0R A;  1H8K A;  4Z88 A;  1KFZ A;  4HVU A;  4D8D A;  1UFF A;  2V1R A;  1GL5 A;  1K4U S;  2PZ1 A;  1SSH A;  2X3X D;  1A0N B;  4LE9 A;  1K0S A;  1UHF A;  4A63 B;  2A36 A;  2J6F A;  3VRY A;  3I5S A;  4HXJ A;  4KRT A;  2EPD A;  2HCK A;  2DRM A;  2JS0 A;  4Z8A A;  2VWF A;  2AZS A;  3O5Z A;  2GTO A;  2DIL A;  1J3T A;  1TG0 A;  1OPL A;  3M0T A;  4IIO A;  2KRN A;  5EC7 A;  3PE0 A;  2JMC A;  1YNZ A;  2LZ6 B;  3ULR B;  1T0H A;  1S1N A;  1M3C A;  1QWF A;  2KE9 A;  2DL7 A;  2JM8 A;  1X69 A;  2EQI A;  2GQI A;  2GTJ A;  5FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...