2DL8A

Solution structure of the sh3 domain of human slit-robo rho gtpase-activating protein 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQYIVVQDTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLIT-ROBO Rho GTPase-activating protein 2
publication title Solution structure of the SH3 domain of human SLIT-ROBO Rho GTPase-activating protein 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl8A00
4JJCA 1QLYA 1ZUKA 5IXFA 1ABOA 4Z88A 1WXBA 2MCNA 2J6KA 2K9GA 2HSPA 1SPKA 1A0NB 1HSQA 1ABQA 1HJDA 4FSSA 3R6NA 1UFFA 1UDLA 2GTOA 3M0QA 2OI3A 1JQQA 2BTTA 1W1FA 3EHQA 3H0HA 2FPFA 1OPLA 1EFNA 1H8KA 1VA7A 4RTTA 2L3SA 1MV3A 2EYZA 2EGCA 1JXMA 3RBBB 2AKLA 1X6BA 2YUNA 4JJDA 1YNZA 2FPEA 1NEBA 2C0IA 1U3OA 2EGEA 2YSQA 2DVJA 1UHFA 2JT4A 1RLPC 2IIMA 3VS7A 1E6GA 2RQRA 2QDLA 2GTJA 1I0CA 1K0XA 3I5SA 1X2QA 2C0OA 1GFCA 2KNBB 1X6GA 1SRLA 4QT7A 1X2KA 2EKHA 2DE0X 3UA7A 1NLPC 2DA9A 2BZXA 4ZNXA 1NG2A 2KT8A 2RQTA 1JO8A 2D8HA 4HVUA 2LX7A 1H3HA 2J7IA 1UHCA 1WDXA 2KBTA 2CREA 4M4ZA 3RNJA 1LCKA 4RUGA 1T0HA 3FJ5A 3O5ZA 2YUQA 1ZUYA 1WXTA 2A36A 1AZEA 2O2OA 4J9FA 2XMFA 2FO0A 5GJWB 1BU1A 1OOTA 1QWFA 2GQIA 1M3CA 1SRMA 3JV3A 1YP5A 3QWXX 2K2MA 2KRSA 2JM9A 3EG3A 3M0PA 4GBQA 1AVZC 2ROLA 1AWJA 1YWPA 2VKNA 4RTXA 2KE9A 1RUWA 3M0TA 3IQLA 1GCQA 3UATA 3A98A 1B07A 2DRKA 2JTEA 2ROTA 2CUBA 3ULRB 5IXBA 2LZ6B 4OMLA 4EIKA 1ZLMA 4D8KA 1ZBJA 2ABLA 4IIOA 3THKA 1ZX6A 4AFQC 1GBRA 1PKSA 2GBQA 1TG0A 3EG1A 5I11A 1PHTA 2O88A 1BB9A 1QKXA 4KRTA 2JXBA 2M0YA 4JPBW 5IH2A 1T3LA 2DL5A 3NGPA 1PKTA 1QKWA 3M0RA 2DRMA 2LQNA 4X1VA 1AD5A 2MOXA 1N5ZA 2O9VA 2J05A 2W10A 1W6XA 4Z89A 1NM7A 1WA7A 2LNHB 4JZ3A 2CT3A 1I07A 2EW3A 3QWYA 2D8JA 4LUDA 2AKKA 2DBKA 2DL8A 2I0NA 2OAWA 1AWXA 1GFDA 2X3WD 3U23A 3REBB 2K79A 3VS1A 3SHWA 2HEQA 1UUEA 1Y57A 2RMOA 1CKBA 2J06A 2L0AA 2EVRA 1ZUUA 2KXCA 4F14A 2BZYA 2MIOA 2PTKA 5FW9A 2W0ZA 1WLPB 3NMZC 1OEBA 1J3TA 4IIMA 4F17A 2FEIA 2RN8A 2DYBA 2EYXA 5FWCA 2LCSA 1MUZA 1NYGA 1UECA 4J9DA 4RTWA 1SSHA 1KJWA 1GCPA 2RQVA 1SHFA 4R0KA 1W70A 3PE0A 2CSQA 2CT4A 1FMKA 1AZGB 2DNUA 2CH4W 1SHGA 1IO6A 4J9BA 2M51A 1VYUA 2HCKA 3C0CA 1YWOA 4J9IA 2KXDA 3ZL7C 2E5KA 2DX1A 3VS0A 2FPDA 2DBMA 1QWEA 5L23A 2A37A 4HVVA 4AFZC 2O31A 2LJ0A 2KGTA 3VRYA 4LNPA 4CC7A 1TUDA 3M0UA 1BBZA 3EGUA 3VS3A 1YN8A 3LH5A 2C0TA 3H0IA 2FRWA 3TSZA 1U06A 2JM8A 1JXOA 5EC7A 4AG1C 2SRCA 1GRIA 2RNAA 2CDTA 5ECAA 2DL3A 3CQTA 4J9CA 2KYMA 2EYYA 1WFWA 4AG2C 1TUCA 5I22A 2J6OA 1E6HA 1WXUA 2ENMA 1NYFA 2K7AA 2ED1A 5HCKA 4LE9A 1JU5C 4A63B 1K76A 1UGVA 2EQIA 2V1QA 1JEGA 3GBQA 2O9SA 2KYBA 1HD3A 2KR3A 3EG2A 1MV0B 1KIKA 1M8MA 2AZVA 5IHIA 1K9AA 3SEMA 1M3BA 1WYXA 2LJ1A 1K1ZA 1B3QA 1AWWA 5IHKA 2V1RA 1KFZA 1X69A 4LUEA 2LMJA 1UG1A 3EG0A 2P4RA 4ESRA 2DF6A 1KSWA 2LQWA 2A08A 2AZSA 1PRLC 2KRMA 2EBPA 1PWTA 4CC2A 2EYWA 1PRMC 2DL4A 2EGAA 4OMMA 2ESWA 2RF0A 3TSWA 2J6FA 2RQWA 3PVQA 2PNIA 2NUZA 4F16A 3VRZA 4RTYA 4HXJA 2L3QA 1M30A 2YT6A 2KRNA 2DJQA 2AK5A 2L3PA 2JMAA 4GLMA 1FYNA 1AEYA 3UA6A 2SEMA 4CC3A 2JMCA 2X3XD 4RTVA 2YUOA 1Y0MA 2GNCA 1CSKA 2JW4A 2FRYA 1ZSGA 2BZ8A 1RLQC 1OV3A 4LN2A 4J9EA 1RI9A 2GGRA 2KEAA 4DEYA 1E7OA 3VS4A 1M27C 2K6DA 1T3SA 1PNJA 4HVWA 2HBWA 1G83A 2B86A 2EPDA 4ORZA 1CKAA 1ARKA 2RPNA 2LJ3A 4OMOA 3TVTA 1OPKA 1Z9QA 2VVKA 1NLOC 1K0SA 3NPFA 3I9QA 4J9HA 1H92A 2CH4A 3VS6A 1YCSB 2D0NA 4K11A 2LP5A 2FG0A 3KFVA 4CC4B 3REAB 1UJYA 2G6FX 1GL5A 1SEMA 1S1NA 2D1XA 2JS2A 4RTZA 2ECZA 4HCKA 2NWMA 2DL7A 2YDLA 3I5RA 1G2BA 4OMNA 1UTIA 2K3BA 1V1CA 3M0SA 1GCQC 3VS5A 1BK2A 2CUDA 3EHRA 2F2XA 1XOVA 1X27A 2JS0A 1WIEA 1GBQA 4Y92A 1M3AA 1WI7A 5IHNA 5GJVB 4D8DA 2YUPA 2F2WA 1AWOA 3I35A 4Z8AA 1UJ0A 4OMPA 2F2VA 4AFSC 1T0JA 1VYVA 4JZ4A 2CSIA 4RTUA 2HDAA 3H0FA 4J9GA 1NEGA 2ED0A 2VWFA 4OMQA 1X43A 1Z9ZA 5FWBA 4E6RA 1K4US 3UF4A 2KT1A 4AFUC 4JJBA 2DILA 2DM1A 3H41A 2KROA 1U5SA 2A28A 2DLPA 1UE9A 2L2PA 3VS2A 2RQUA 4DEXA 2OJ2A 2H8HA 1WX6A 1QCFA 3NHNA 1VYTA 3PVLA 2PZ1A 2DMOA 4WCIA 1AOJA 1I1JA
chains in the Genus database with same CATH superfamily
4JJCA 1M2VA 8ATCB 2L89A 1WXBA 2K9GA 1KHCA 3H6ZA 2HSPA 4PFPA 2X9HA 3GF5A 2XD0A 4ELZC 5LJ5d 5GAN7 1UDLA 4KBMB 4LDXA 1ZSZB 2ZZDA 1YI2Q 1B34B 4JRPA 2FPFA 1VQLQ 3G71A 3OS1A 1VA7A 2RK1A 1VQOQ 2QI2A 1D0ZA 2L3SA 2OTJQ 1KQSS 4LDWA 3OW2S 1QQJA 5KE2A 4M7AG 2AKLA 4ZGEB 4JRIA 1SSFA 2ZCFB 1YNZA 2C0IA 2EGEA 2V26A 3V7SA 1UGRB 4NL2A 2DPPB 2MK5A 3QYHB 2CP7A 5J26A 2C0OA 3OYAA 1GFCA 2KNBB 4BUGA 1X2KA 2JOYA 5GAOl 2EYQA 3CCSQ 4M7DB 4HT9A 4FT2A 2R58A 5L8RE 3OYMA 2J7IA 1WDXA 2BUDA 2KBTA 4RUGA 3VYGA 1UB4A 4BB7A 2FL7A 2K3YA 1M90R 2YUQA 3CC7A 1AZEA 3KXTA 4XQ3A 2P4TA 2GFAA 2GQIA 4JLGA 4JRQA 4J6WA 2QTXA 2L3RA 3MCAB 2F5TX 4M7DF 3CC4A 1FMVA 2K2MA 1WQWA 4M75D 2KRSA 2JM9A 3M0PA 3OYFA 3GNGA 5IT9E 1RAHB 4X34A 4TVRA 3S6WA 2I2LA 2VKNA 4UC4A 3M0TA 4E47A 2CZ0B 4C0DC 4FYWB 3DKMA 4PFZA 2LZ6B 2CS7A 4M75E 1ZLMA 1KD1U 1ZA1B 3JB9I 5KH6A 5GMKm 1IHWA 1VQPA 3CCEQ 4IIOA 1ZX6A 1EX4A 4A4KA 1GBRA 3EGXB 2GBQA 2BE9B 1M9SA 1TG0A 5I11A 3G1JA 3S3OA 3CMAT 4GLKA 4KRTA 2DIGA 2EQJA 3OA6A 3WVEB 1IGUA 5IH2A 3NGPA 1PKTA 4FL6A 1PG5B 3OBYA 1K9MU 3HHTB 3EG9B 1VQKQ 2DRMA 1RAGB 4X1VA 4M77C 1QP3A 2LC4A 2MOXA 1N5ZA 4E7KA 2J05A 1N9RA 5KYUA 2OAUA 4MMKA 2HKNA 1NM7A 1G5VA 4ZTFA 3M4GA 1UEBA 5GAMg 2ZPBB 1NJIC 1OQKA 1I07A 5J3BA 4RKUE 3G6EA 2D8JA 3DB4A 2DYIA 3LGFA 1AHJB 1GFDA 4PKCC 2DEQA 1MNEA 2J06A 3VKIA 4F14A 1ZUUA 2DXBA 5CKDA 3OS0A 2W0ZA 4F04B 2R57A 4IIMA 5GAMh 4C8QC 4F17A 4C0ZA 2FEIA 2X4YA 1I5OB 2OX7A 2DYBA 2LCSA 1MUZA 1NYGA 2RI3A 1UECA 3V8KA 3EGDB 3CCQQ 4JS4A 1KJWA 1GCPA 4B9XA 4DBQA 1TU0B 1YIJA 2DNUA 1VQNT 3H9NA 2XU8A 5EG2A 3G71Q 2HCKA 3VV0A 4PJOB 3HFOA 3MO8A 2VASA 2E5KA 2M16A 1VQ8T 1K8AR 1NBEB 3MPUB 4ME7A 2XHCA 2QGGA 2XK0A 3AT1B 2K2VA 3CCMT 1ZSZC 4CC7A 3EGUA 3BDLA 2X4XA 3LH5A 2C0TA 4IUUA 1JJ2S 1VQ7T 1U06A 2JM8A 3Q1JA 4QQGA 2EJ9A 3FDRA 1GRIA 5GAN4 1O75A 3E9GA 1R8OB 3CQTA 4KGZB 2KYMA 2K5LA 4BI3A 3QZ5B 3JCMc 4A4FA 1WXUA 2C06A 2EAYA 3MEVA 4F7UA 1JU5C 3L42A 1VQMT 3L2VA 3H8ZA 1W2BS 3OYIA 3EFOA 1YFNA 2KYBA 5GANd 2XICA 1KIKA 3R6OA 1M8MA 2AZVA 5KYYA 2NYSA 3JCMg 1B3QA 1AWWA 5IHKA 1FMWA 3CC4Q 5CO7A 2K57A 3L2WA 1HXDA 2CZ1B 2XI9A 2L5QA 4E7SA 5D7UA 2A08A 2DTOA 3KBGA 5GANg 4KGXB 1N8RC 2M9UA 2RJFA 4C0FA 1RAAB 4CC2A 3JCMh 2DTIA 2EGAA 2E70A 4C92A 4OMMA 2ESWA 3QZ9B 3G4ST 1RL2A 1NJIU 4M7DD 3VRZA 4XU3A 2CP3A 4HXJA 2L3QA 2QQ9A 2YT6A 1YJ9Q 1VQPQ 3SB2A 5GANh 2ZPFB 4F7UE 2EWNA 4KUDK 2LQKA 1AEYA 3CCJT 2E12A 2JMCA 3GP8A 1UGSB 3X24B 1RABB 1WHMA 3E19A 2QXFA 2YUOA 1Y0MA 1S72T 1KQSA 4M7AA 3OW2A 1Y71A 3MEWA 1EZZB 1OV3A 4X9DA 1RI9A 4M7DE 2EJFA 2HQHA 4HVWA 2R5MA 2LNVA 2O01E 1M2VB 1Z9QA 2E41A 1Y7XA 2DTHA 1VQ6T 2RO0A 3G6EQ 1H92A 3MJXA 1BI0A 2CZ6B 3UDCA 1UJYA 2G6FX 4B6MA 1GL5A 2H3JA 2HQEA 3ZBDA 3CCUQ 4N4HA 5C6SA 1M1FA 2MYSA 3CCRA 2PVGB 1VQ9Q 1VQ8A 3VS5A 3G7ZA 2DJZA 3T9NA 4M7AE 3OYJA 2KMTA 4EMKA 4BE2A 5GAMf 1X27A 1YJWA 5FLXE 3J80E 3CCLT 4Y92A 3RKXA 5IHNA 5GJVB 1PSEA 2KQWA 2YUPA 1YIJQ 1BIBA 4QW2A 1AWOA 1G8XA 3RKYA 2KK4A 1Q81U 2DIQA 1UJ0A 1VQ7A 4E7JA 1G3YA 2F1LA 4A4EA 2FZGB 2X35A 4RTUA 2HDAA 2LTOA 1VUBA 1K4US 1O9SA 4E6RA 3LYIA 4JJBA 3BE3A 1C0MA 2HMAA 2A28A 4R55A 2JZ2A 2RB6A 3VS2A 2YRDA 2RQUA 4DEXA 4D6WA 1BI2A 3MKDA 3NHNA 4PJOC 4OB3B 1YITA 2F5KA 1AOJA 1PM3A 2MCNA 1Q95G 2PUOB 3R6NA 1UFFA 1EIFA 2GTOA 3C12A 4XU1A 3OS2A 4XU2A 3OMGA 2MWPA 4EMHA 1MV3A 2E10A 2DXCA 2K5IA 2RD1A 3QPHA 1JXMA 1D3BA 4J83A 4N0AA 2YUNA 4JJDA 4M78C 1NEBA 3O8VA 1K73R 1MMAA 3LX7A 2YSQA 2DVJA 1UHFA 1D1BA 3G4SA 2PU9B 2RI5A 5GMKj 1QMCA 2IIMA 4C8QG 2QDLA 1R77A 2GTJA 1NZ9A 4X9CA 1MNDA 1VIFA 1KG1A 1K0XA 3I5SA 2FVUA 1X2QA 1BYMA 1B7TA 1WGSA 5IN1A 3CCVT 5FROA 3UA7A 1S72A 2BZXA 5CQYA 3WVDB 1NG2A 2BKDN 2RQTA 2VC8A 1R0BG 2LX7A 2CP2A 1H3HA 3V8JA 4RCBA 2CREA 1WHGA 5KYUB 3O5ZA 1ZUYA 2DZCA 3JCMf 1WXTA 1WHKA 8AT1B 2FO0A 5GJWB 3LW5E 1KQSP 1OOTA 1QWFA 1M3CA 2DXUA 2ZPHB 3JV3A 3ER0A 1N6AA 1D1CA 3QWXX 5GANf 4DQ2A 3OYCA 2VB6A 3OYGA 4GBQA 2P0PA 3X25B 3RDVA 2ROLA 2DD5A 3JB9G 3LWHA 2E3HA 4RTXA 1Q7YR 1JJ2A 2OTLT 1M1KR 2CP0A 5KYNA 1B07A 1RAFB 3SWNA 1IXDA 2ROTA 3CC2T 4BDZA 4OGEA 4J7IA 2V8JA 2VGNA 2EIFA 4EPCA 2ABLA 3MP8A 5GANj 1KD1R 4PL6A 4AFQC 5GMKl 1PKSA 2MF2A 1OZ2A 3CCRQ 2COZA 1QKXA 3PIOA 1VQ8Q 1W2BA 4C92G 3JCMX 4MDXA 4J8OA 1T3LA 3M9QA 1YJWQ 3M0RA 2LQNA 3OYKA 1QVFS 3JSCA 5GMKi 3LH0A 1VQ5A 1LNXA 4Z89A 1YHQT 4RG8A 5KE3A 4DBRA 1WA7A 3CXCS 2AHJB 2LNHB 2EW3A 3QWYA 4LUDA 2DETA 2I0NA 4DOWA 3U23A 3REBB 2K79A 1UUEA 1Y57A 4CRIA 5LJ5g 2RMOA 3VU3C 2KXCA 3OY9A 3CPFA 2BZYA 2MIOA 2LCCA 4XTUA 4F7UB 1YJNQ 2RN8A 3EFOB 5CKHA 4GY5A 1UGPB 4LXCA 1YITQ 3INZA 3I56A 5LJ5h 1RADB 1SSHA 2X4WA 2WSCE 2RQVA 3OMCA 5IAYA 5KYYB 1SHFA 1W70A 4M75C 2VYTA 1AT1B 2HBPA 1FMKA 2CH4W 3CPWS 1SHGA 2DERA 4F7UF 3FB9A 3WXMB 3FC3A 4XTXA 3JB9F 4J9IA 2KXDA 3ZL7C 2KSSA 2DX1A 3VS0A 3CMET 2P84A 1M90C 5CKFA 2DBMA 5L23A 4ANJA 4C92B 7AT1B 2LJ0A 3RR6A 1VQ4T 2X4JA 2KAFA 1Q86R 2IVWA 1YN8A 1LVKA 3QSUA 2E65A 3TSZA 1D0XA 1SG5A 2EQKA 5EC7A 2SRCA 4M7AB 4C92F 5I2MA 4JDSA 2DL3A 3P8BB 1ZQ1A 4C5HA 5GAOq 2EYYA 3C4SA 3PTAA 2QEXA 4FYVB 5GAOr 5I22A 2J6OA 4AT1B 1QCOA 1QVPA 3PNWC 1E6HA 4E7ZA 2K7AA 4LE9A 1K76A 3M56A 3GBQA 4A4GA 2O9SA 1HD3A 4M7AF 5CVIA 3EG2A 1MV0B 1HYOA 3CEYA 4BY6C 5IHIA 1Q82R 5LJ3d 2NUTA 1K9AA 1M3BA 4FSXA 2MPXC 2XDDA 2RHZA 1X69A 4Y91A 3EG0A 2P4RA 4Y28E 3URGA 2RH2A 4OF1A 2RJDA 1VOMA 2AZSA 2QA4T 1V76A 1ZBXA 3VYHB 2EBPA 2HNIA 4EMKB 5LJ3g 2DL4A 1TWBA 2RF0A 4E7HA 2J6FA 2Y90A 4KGVB 1IGQA 2RQWA 2PNIA 2GFUA 3E1SA 1WJSA 1KK7A 2COWA 5GAN3 4RTYA 3RMSA 2CZ7B 4OB1B 1RAIB 2KRNA 2AK5A 4OMFB 1FYNA 5HK0A 5LJ3h 2X3XD 4RTVA 3QIIA 2GNCA 2AT1B 1CSKA 1BIAA 2JW4A 1E7OA 3RESA 4IUQA 4Z02A 1T3SA 4MZMA 4C8QA 4MZTA 2JJ9A 2B86A 2EPDA 1ARKA 1VQ5Q 4FU6A 3BY7A 1OPKA 2VVKA 5M9OA 4E7IA 2HZYA 3OBWA 2CH4A 2FZCB 3VS6A 3OSVA 3GNFB 2LP5A 1TOVA 5KYWA 1LJOA 4CC4B 3ASKA 3I55T 1M1GA 1P92A 3S3MA 1D1AA 1M90U 1LPLA 1S1NA 3HSBA 2JS2A 2E64A 4HCKA 1ZHIA 5GMKh 4C8QD 1M8VA 2YDLA 3PFSA 1D3BB 4OMNA 3M0SA 1V1CA 2LX9A 1GCQC 1YI2T 1Q81C 5I21A 3I56Q 1VQLT 2F2XA 1XOVA 3FRNA 2JTMA 1GBQA 1WHHA 4HCBA 2YWWA 1VQOT 2OTJT 3HTRA 5LJ5f 3V7RA 4R56A 2KVQG 4C8QE 5GAOn 2QG9B 3AHUA 1WNLA 2MWOA 1VYVA 3A5ZB 2CSIA 1D09B 3CC7Q 3H0FA 4J9GA 2VWFA 1X43A 1Z9ZA 5LL6S 2KT1A 3CD6T 2KROA 4J5YA 4M7DC 1WHJA 2DXTA 3JCMQ 2JUFA 2BE7D 3PVLA 2PZ1A 1NPRA 4PFOA 2JVVA 4WCIA 4FW1A 1I1JA 5LJ5j 1PD0A 3JB9D 1ABOA 4Z88A 3CCST 2J6KA 1HSQA 3HRSA 4FSSA 5DY9A 3CMAA 1IZ6A 3HRTA 2OI3A 4YTLA 1JQQA 2BTTA 1W1FA 4QVDA 3EHQA 3OB9A 2QEXQ 1OPLA 1EFNA 3PGGA 4CI0C 1N8RR 2EGCA 1QVFA 2EJGA 3M53A 4C5IA 5D6XA 4KT0E 2QA4A 2Y4YA 1X6BA 3SWNB 5GAN8 3CXCA 1D0YA 1KHIA 4DOVA 2FHDA 4XTZA 1U3OA 4C92D 2DVEA 5GAN5 3VS7A 1E6GA 2RQRA 3EFRA 2EQMA 2YRCA 4LDYA 4ZGJB 3EFSA 1QCNA 1SRLA 5AT1B 1TUGB 5CR2A 2QQRA 2DE0X 3ME9A 4E7LA 2HD0A 3HRUA 2DA9A 4M7AD 4C92E 1YBYA 1JO8A 3CCET 2D8HA 4L6V5 4HVUA 2D9TA 2ZPIB 4M4ZA 3GOXA 2QK0A 1FXXA 1LCKA 1OULA 3TU4K 1VQNA 1T0HA 3FJ5A 1K8AU 2RHXA 3CPWA 4J7FA 2A36A 2GCXA 2O2OA 4J9FA 4JS5A 3PMIA 2WSFE 1BU1A 1SF9A 2LQ8A 2LRQA 4MMLA 1VQKT 4IKFA 9ATCB 3JB9H 3EG3A 5LJ3f 3CCMA 2LCLA 3ZEHA 2M02A 1AWJA 1RUWA 1XQHA 3IQLA 2Z0WA 3UATA 3A98A 3V7CA 1KC8R 2DRKA 2JTEA 2IG0A 2CUBA 1VQLA 5IXBA 4OMLA 3A8OB 2CGHA 3HFNA 3QXEB 4D8KA 3M54A 1ZBJA 3JB9J 3THKA 3VUBA 4XTWA 3MP6A 3CCQT 2KY9A 2LVMA 1R0CB 5LJ3j 1XNIA 1I5LA 5GAOp 1VQMA 1BB9A 2DO3A 1WJQA 4RMOA 2E6NA 2DEUA 2JXBA 4JPBW 2L8DA 3FLGA 4FM4B 3CD6A 3G71T 4BI4A 1QKWA 1HK9A 4M77G 1AD5A 3EH2A 2W10A 2PVOB 3UT1A 4LD9K 1W6XA 2H3EB 4ELYC 1OZ3A 4P5NA 2CT3A 2AKKA 2DL8A 4N0AC 2OAWA 1QW1A 1AWXA 3M59A 3VS1A 3SHWA 2BIVA 2L0AA 2EVRA 3QDFA 4LDVA 1K73C 5FW9A 5CKEA 3A8HB 5KCHA 1OEBA 3OYNA 2HAXA 4WF2A 3L2ZA 3JCMV 3A8LB 1MMNA 4ZN3A 3MEUA 2EYXA 5FWCA 4C0DB 1QVGS 3OYEA 4J9DA 3CCJA 4XU0A 4BE1A 4RTWA 2NUTB 4M78A 4R0KA 3PE0A 3CMAQ 3C95A 4HT8A 2CT4A 1KQ1A 1AZGB 3A1PA 4J9BA 2M51A 1VYUA 5GAMe 3C0CA 1KQ2A 1YWOA 1M2OA 3RERA 3M55A 4IUTA 1QWEA 1W4SA 2NUPA 2MMPA 2A37A 2PVDB 3CC4T 2QA4Q 5FU7B 3OW2P 4AFZC 2D0QB 2O31A 1GXIE 1VQ6A 1M4ZA 4DBHA 4LNPA 3CCEA 1TUDA 3L2RA 1FWZA 1NE8A 2V8KA 4BE0A 5CK9A 4EMGA 1FX7A 2ZPEB 4AG1C 2RNAA 3QDRB 1MGQA 3CBOA 2CDTA 1Q7YC 5GAN6 1M1KC 3QJYA 3A8MB 1MMDA 3LLRA 3JRZA 4JJNK 4J9CA 2FYKA 1WFWA 4AG2C 4M77F 1TUCA 1YJ9T 1VQPT 3CCLA 4C8QB 1NYFA 5HCKA 2ED1A 4HCZA 3CPWP 4ATOA 1VQNQ 1X75C 1MMGA 2EQIA 2XIDA 3F70A 2QTVA 1RACB 3TEEA 2DFUA 1NPPA 2QASA 4IUPA 1V29B 5KYWB 2LJ1A 1YCYA 1K1ZA 1TXQA 1QP2A 1Y96A 2V1RA 1KFZA 4C8QF 3ZFJA 1K9MR 2M0OA 3CCMQ 2LMJA 4OVAA 4ESRA 2DF6A 1KSWA 4RG2A 2LQWA 3G6ET 3PMTA 2E1HA 1VQ7Q 2CYZB 2KRMA 1PWTA 1PRMC 4DBFA 3TSWA 4QQDA 2ZAEA 4C5EA 4KH0B 3CCUT 1IREB 2NUZA 2ZPGB 1TTHB 4LDUA 1VQ9T 4V2SA 4XTVA 2JMAA 4PJJA 3UA6A 3RMQA 2SEMA 4BD3A 4CC3A 4XTYA 1C1AA 1K73U 4PLIA 5FU6B 1VQMQ 4ZTJA 3JCMe 1YIJT 2FRYA 1ZSGA 3J81E 3E2UA 4LN2A 3L2UA 4J6XA 2KEAA 3CD6Q 4DEYA 2MI6A 3RUXA 4FT4A 3VS4A 3LWIA 3TCJA 5A2QE 1JBMA 1G83A 4KH1B 5GANe 2A7YA 2RPNA 5J39A 2DAQA 2JNGA 3CCVA 3SFMA 1IHVA 1YCSB 4K11A 4M75A 2FG0A 4QQ6A 3KFVA 1SEMA 4ZN1A 2D1XA 4NS5A 4RTZA 5CKBA 2JTFA 2F69A 1Q86C 3QO3A 1JB0E 3G4SQ 3I5RA 4N4GA 3NTIA 1G2BA 1UTIA 3TQ7P 1BK2A 2RK2A 3OYHA 3QUIA 3CCJQ 4PJLA 1WIEA 1JRIA 1BI3A 2COYA 1S72Q 3P8DA 4D8DA 4B9WA 2F2WA 3BDUA 5CCAA 2DZ9A 1Q7YU 3I35A 2A0FB 2X51A 1M1KU 2FB7A 4OMPA 2YXYA 3GLXA 2F2VA 4AFSC 1T0JA 3NFCA 3S3NA 1IRXA 4LD6A 2RI2A 2OTLA 2ED0A 1XJWB 5FWBA 2O4XA 4AFUC 2DILA 3SDZA 1G3TA 2DM1A 1Q82C 1VQ6Q 1U5SA 2DLPA 1UE9A 3CC2A 2L2PA 4XK8E 2IPOB 1YJ9A 2KDSA 2PQWA 2QQBA 1UGQB 4PJOG 3RKWA 1I8FA 2QGFB 5KYXA 5GAMd 1JJ2P 1QLYA 1ZUKA 5IXFA 3OQ5A 1SPKA 1A0NB 1ABQA 3HKSA 1HJDA 3DLMA 3LGLA 5FU7C 3M0QA 3H0HA 4HCCA 3QYGB 4M77A 4MDWA 3CCLQ 1H8KA 4RTTA 1NJIR 3UPUA 2EYZA 4FYYB 1YHQA 1XTDA 3RBBB 3EH1A 5DLQE 4JUVA 1H641 2CKKA 4M78G 1W2BP 2FPEA 2HSEB 4WTOB 1OX8A 2JT4A 1RLPC 1ZA2B 3CCUA 4QVZA 4M77D 2WSEE 4O5VA 1I0CA 1VQ9A 3QJ6A 5GAOm 1X6GA 4QT7A 2EKHA 5CQXA 5C0MA 1NLPC 3DLLA 4ZNXA 1K8AC 1QVGA 2KT8A 4A54A 2VXFA 3OYYA 2NLUA 4KUIA 4C5GA 1UHCA 2VGMA 1OX9A 2GF7A 2QQSA 3RNJA 3CCRT 4M77E 4VUBA 2A3LA 2ZGWA 4AMCA 3MHXA 2XDPA 4OGCA 2XMFA 1Y07A 3CMEA 1OU8A 1SRMA 1YJWT 3JCMJ 1N9SA 4HKEA 1Q86U 1YP5A 1VQ4A 1ZSZA 2E5QA 1B34A 5A0GA 2JN0A 4PJOF 1IB8A 1AVZC 1YWPA 2CP6A 2KE9A 1Q81R 5HKCA 1GCQA 1WQ7A 3QKJA 3C94A 4M78B 4BI8B 1OI1A 5FU6C 2RHIA 2GQVA 3CCVQ 3ULRB 1TSFA 3JCMd 1WJRA 4EIKA 3JCMP 1YJNT 2WACA 3HL8A 3PT9A 4QKUA 2XDBA 4QVCA 1YITT 3E9FA 1DJ7B 3BW1A 5DLOA 3EG1A 3HP9A 1PHTA 1Q82U 2O88A 4M78F 2NUPB 2LDMA 1C6VX 2M0YA 4C92C 2RM4A 2K5FA 2AIRB 1BCMA 2DL5A 2P0QA 4M7DA 5KCOA 2V8IA 4C0GA 2O9VA 4FCYA 4O6JA 3DB3A 3J7AF 4RCCA 1OYXA 4L5GA 4JZ3A 1TS9A 3N5BB 2YHTA 4N4IA 3RIRA 2YRVA 2HQXA 2DBKA 2X3WD 4M7AC 3X20B 2OTLQ 2HEQA 5FRNA 2RHYA 1CKBA 5A0DA 3FEOA 2PTKA 1WLPB 4J6YA 3CC2Q 3NMZC 1J3TA 2QQAA 2RA2A 3BFMA 4E2FB 4A53A 2R5AA 2M1HA 4IURA 1PSFA 3X28B 1G3WA 5HK3A 4M75G 1U1TA 4BDYA 2CSQA 4ZGDB 2YLBA 4KULA 1Y96B 2XKOC 1VIEA 4PK4A 2KI7A 1BI1A 2HL3A 1IO6A 2EFIA 1WHLA 2FZKB 3A8GB 3UWNA 3EGXA 1I4K1 1H3ZA 3JCMb 4IUVA 2FPDA 5LJ5e 1YHQQ 3D7SB 4HVVA 2VV5A 3SD4A 4EMKC 2KGTA 3VRYA 3M0UA 1BBZA 3I55A 2DKGA 3VS3A 2D6FA 3EG9A 2Y4XA 3H0IA 2FRWA 4PLLA 2K3XA 1JXOA 3X26B 1F1BB 5FRMA 1U8RA 3QG1A 5ECAA 1QVGP 1X01A 2LT4A 1YI2A 1KC8C 1PC0A 4JLIA 1N27A 3L2QA 3KUFA 4II1A 2HL5C 3VUZA 2ENMA 1VQOA 1BKBA 2OTJA 5AYFA 3M58A 4A63B 2V1QA 1UGVA 4FW2A 3NTKA 3META 1JEGA 2QAZA 4OB0B 3EAEA 2KR3A 4FIBA 2XG8D 4DA4A 3EGDA 3CMEQ 4M75B 3SEMA 1WYXA 3V8LA 5D6WA 1WPYA 5GAMj 4Q5WA 1YJNA 1VQ5T 1VQ4Q 4LUEA 4NOYA 1UG1A 4PJNA 4PJOA 2LT1A 3FJPA 2HKQB 2ATCB 3GIBA 2G3RA 1PRLC 5D6YA 2EYWA 1BCOA 4M75F 3CCSA 1LOJA 2EQUA 3VJPA 3OS5A 3OYBA 2DK3A 3PVQA 1N8RU 2EKOA 4F16A 4PJMA 3JAME 5GAN2 1M30A 2DJQA 2L3PA 1U1SA 1MHNA 4GLMA 3P8HA 3I56T 1ACMB 4PJOD 3L1AA 2E4HA 1PD1A 1RAEB 3TREA 2O4XB 2VXEA 2BZ8A 1RLQC 4J9EA 4FYXB 3OSSC 3OYDA 2GGRA 2MAMA 1M27C 2K6DA 1PNJA 2HBWA 1X6OA 2RJEA 3CC7T 2QYZA 5KYXB 2P0KA 4ORZA 1CKAA 4PJOE 1QVFP 4JRKA 2LJ3A 1TH7A 4OMOA 3TVTA 5LJ3e 5I2SA 1WZOA 1NLOC 1K0SA 4BY6B 3NPFA 6AT1B 3CXCP 3I9QA 3M57A 4J9HA 2D0NA 4M78D 4MZPA 3PIPA 4EDUA 3REAB 4M77B 3GPLA 3MEAA 2ECZA 1RI0A 2QDYB 3NTHA 2NWMA 3JCMW 2YLCA 2DL7A 2RJCA 5A0LA 1SKUB 5DM7R 2K3BA 3HPWA 3FIFA 3MP1A 2CUDA 3EHRA 5HY6A 2QEXT 3SWNC 4M78E 1I81A 3OYLA 2JS0A 1VQKA 4OB2B 1M3AA 1WI7A 4L59A 1OU9A 2E3IA 2PUKB 2CP5A 4F7UG 2E6ZA 3M5AA 2B8AA 4Z8AA 5GMKe 4HA8A 2VUBA 3CBMA 4A4HA 3QHSA 1KC8U 1KD1C 4JZ4A 2K4YA 1NEGA 4OMQA 3UF4A 4OP0A 4BACA 5CAIA 5CIUA 4PNOA 3H41A 4NL3A 4M7DG 3QBYA 4XAXB 2DD4A 1PCXA 1G3SA 3CBPA 2RHUA 2OJ2A 2H8HA 1WX6A 1M5Q1 1QCFA 3M4YA 3I55Q 1VYTA 1K9MC 2DMOA 3CCQA
chains in the Genus database with same CATH topology
4JJCA 1QLYA 1ZUKA 5IXFA 1ABOA 4Z88A 1WXBA 2MCNA 2J6KA 2K9GA 2HSPA 1SPKA 1A0NB 1HSQA 1ABQA 1HJDA 4FSSA 3R6NA 1UFFA 1UDLA 2GTOA 3M0QA 2OI3A 1JQQA 2BTTA 1W1FA 3EHQA 3H0HA 2FPFA 1OPLA 1EFNA 1H8KA 1VA7A 4RTTA 2L3SA 1MV3A 2EYZA 2EGCA 1JXMA 3RBBB 2AKLA 1X6BA 2YUNA 4JJDA 1YNZA 2FPEA 1NEBA 2C0IA 1U3OA 2EGEA 2YSQA 2DVJA 1UHFA 2JT4A 1RLPC 2IIMA 3VS7A 1E6GA 2RQRA 2QDLA 2GTJA 1I0CA 1K0XA 3I5SA 1X2QA 2C0OA 1GFCA 2KNBB 1X6GA 1SRLA 4QT7A 1X2KA 2EKHA 2DE0X 3UA7A 1NLPC 2DA9A 2BZXA 4ZNXA 1NG2A 2KT8A 2RQTA 1JO8A 2D8HA 4HVUA 2LX7A 1H3HA 2J7IA 1UHCA 1WDXA 2KBTA 2CREA 4M4ZA 3RNJA 1LCKA 4RUGA 1T0HA 3FJ5A 3O5ZA 2YUQA 1ZUYA 1WXTA 2A36A 1AZEA 2O2OA 4J9FA 2XMFA 2FO0A 5GJWB 1BU1A 1OOTA 1QWFA 2GQIA 1M3CA 1SRMA 3JV3A 1YP5A 3QWXX 2K2MA 2KRSA 2JM9A 3EG3A 3M0PA 4GBQA 1AVZC 2ROLA 1AWJA 1YWPA 2VKNA 4RTXA 2KE9A 1RUWA 3M0TA 3IQLA 1GCQA 3UATA 3A98A 1B07A 2DRKA 2JTEA 2ROTA 2CUBA 3ULRB 5IXBA 2LZ6B 4OMLA 4EIKA 1ZLMA 4D8KA 1ZBJA 2ABLA 4IIOA 3THKA 1ZX6A 4AFQC 1GBRA 1PKSA 2GBQA 1TG0A 3EG1A 5I11A 1PHTA 2O88A 1BB9A 1QKXA 4KRTA 2JXBA 2M0YA 4JPBW 5IH2A 1T3LA 2DL5A 3NGPA 1PKTA 1QKWA 3M0RA 2DRMA 2LQNA 4X1VA 1AD5A 2MOXA 1N5ZA 2O9VA 2J05A 2W10A 1W6XA 4Z89A 1NM7A 1WA7A 2LNHB 4JZ3A 2CT3A 1I07A 2EW3A 3QWYA 2D8JA 4LUDA 2AKKA 2DBKA 2DL8A 2I0NA 2OAWA 1AWXA 1GFDA 2X3WD 3U23A 3REBB 2K79A 3VS1A 3SHWA 2HEQA 1UUEA 1Y57A 2RMOA 1CKBA 2J06A 2L0AA 2EVRA 1ZUUA 2KXCA 4F14A 2BZYA 2MIOA 2PTKA 5FW9A 2W0ZA 1WLPB 3NMZC 1OEBA 1J3TA 4IIMA 4F17A 2FEIA 2RN8A 2DYBA 2EYXA 5FWCA 2LCSA 1MUZA 1NYGA 1UECA 4J9DA 4RTWA 1SSHA 1KJWA 1GCPA 2RQVA 1SHFA 4R0KA 1W70A 3PE0A 2CSQA 2CT4A 1FMKA 1AZGB 2DNUA 2CH4W 1SHGA 1IO6A 4J9BA 2M51A 1VYUA 2HCKA 3C0CA 1YWOA 4J9IA 2KXDA 3ZL7C 2E5KA 2DX1A 3VS0A 2FPDA 2DBMA 1QWEA 5L23A 2A37A 4HVVA 4AFZC 2O31A 2LJ0A 2KGTA 3VRYA 4LNPA 4CC7A 1TUDA 3M0UA 1BBZA 3EGUA 3VS3A 1YN8A 3LH5A 2C0TA 3H0IA 2FRWA 3TSZA 1U06A 2JM8A 1JXOA 5EC7A 4AG1C 2SRCA 1GRIA 2RNAA 2CDTA 5ECAA 2DL3A 3CQTA 4J9CA 2KYMA 2EYYA 1WFWA 4AG2C 1TUCA 5I22A 2J6OA 1E6HA 1WXUA 2ENMA 1NYFA 2K7AA 2ED1A 5HCKA 4LE9A 1JU5C 4A63B 1K76A 1UGVA 2EQIA 2V1QA 1JEGA 3GBQA 2O9SA 2KYBA 1HD3A 2KR3A 3EG2A 1MV0B 1KIKA 1M8MA 2AZVA 5IHIA 1K9AA 3SEMA 1M3BA 1WYXA 2LJ1A 1K1ZA 1B3QA 1AWWA 5IHKA 2V1RA 1KFZA 1X69A 4LUEA 2LMJA 1UG1A 3EG0A 2P4RA 4ESRA 2DF6A 1KSWA 2LQWA 2A08A 2AZSA 1PRLC 2KRMA 2EBPA 1PWTA 4CC2A 2EYWA 1PRMC 2DL4A 2EGAA 4OMMA 2ESWA 2RF0A 3TSWA 2J6FA 2RQWA 3PVQA 2PNIA 2NUZA 4F16A 3VRZA 4RTYA 4HXJA 2L3QA 1M30A 2YT6A 2KRNA 2DJQA 2AK5A 2L3PA 2JMAA 4GLMA 1FYNA 1AEYA 3UA6A 2SEMA 4CC3A 2JMCA 2X3XD 4RTVA 2YUOA 1Y0MA 2GNCA 1CSKA 2JW4A 2FRYA 1ZSGA 2BZ8A 1RLQC 1OV3A 4LN2A 4J9EA 1RI9A 2GGRA 2KEAA 4DEYA 1E7OA 3VS4A 1M27C 2K6DA 1T3SA 1PNJA 4HVWA 2HBWA 1G83A 2B86A 2EPDA 4ORZA 1CKAA 1ARKA 2RPNA 2LJ3A 4OMOA 3TVTA 1OPKA 1Z9QA 2VVKA 1NLOC 1K0SA 3NPFA 3I9QA 4J9HA 1H92A 2CH4A 3VS6A 1YCSB 2D0NA 4K11A 2LP5A 2FG0A 3KFVA 4CC4B 3REAB 1UJYA 2G6FX 1GL5A 1SEMA 1S1NA 2D1XA 2JS2A 4RTZA 2ECZA 4HCKA 2NWMA 2DL7A 2YDLA 3I5RA 1G2BA 4OMNA 1UTIA 2K3BA 1V1CA 3M0SA 1GCQC 3VS5A 1BK2A 2CUDA 3EHRA 2F2XA 1XOVA 1X27A 2JS0A 1WIEA 1GBQA 4Y92A 1M3AA 1WI7A 5IHNA 5GJVB 4D8DA 2YUPA 2F2WA 1AWOA 3I35A 4Z8AA 1UJ0A 4OMPA 2F2VA 4AFSC 1T0JA 1VYVA 4JZ4A 2CSIA 4RTUA 2HDAA 3H0FA 4J9GA 1NEGA 2ED0A 2VWFA 4OMQA 1X43A 1Z9ZA 5FWBA 4E6RA 1K4US 3UF4A 2KT1A 4AFUC 4JJBA 2DILA 2DM1A 3H41A 2KROA 1U5SA 2A28A 2DLPA 1UE9A 2L2PA 3VS2A 2RQUA 4DEXA 2OJ2A 2H8HA 1WX6A 1QCFA 3NHNA 1VYTA 3PVLA 2PZ1A 2DMOA 4WCIA 1AOJA 1I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJC A;  1QLY A;  1ZUK A;  5IXF A;  1ABO A;  4Z88 A;  1WXB A;  2MCN A;  2J6K A;  2K9G A;  2HSP A;  1SPK A;  1A0N B;  1HSQ A;  1ABQ A;  1HJD A;  4FSS A;  3R6N A;  1UFF A;  1UDL A;  2GTO A;  3M0Q A;  2OI3 A;  1JQQ A;  2BTT A;  1W1F A;  3EHQ A;  3H0H A;  2FPF A;  1OPL A;  1EFN A;  1H8K A;  1VA7 A;  4RTT A;  2L3S A;  1MV3 A;  2EYZ A;  2EGC A;  1JXM A;  3RBB B;  2AKL A;  1X6B A;  2YUN A;  4JJD A;  1YNZ A;  2FPE A;  1NEB A;  2C0I A;  1U3O A;  2EGE A;  2YSQ A;  2DVJ A;  1UHF A;  2JT4 A;  1RLP C;  2IIM A;  3VS7 A;  1E6G A;  2RQR A;  2QDL A;  2GTJ A;  1I0C A;  1K0X A;  3I5S A;  1X2Q A;  2C0O A;  1GFC A;  2KNB B;  1X6G A;  1SRL A;  4QT7 A;  1X2K A;  2EKH A;  2DE0 X;  3UA7 A;  1NLP C;  2DA9 A;  2BZX A;  4ZNX A;  1NG2 A;  2KT8 A;  2RQT A;  1JO8 A;  2D8H A;  4HVU A;  2LX7 A;  1H3H A;  2J7I A;  1UHC A;  1WDX A;  2KBT A;  2CRE A;  4M4Z A;  3RNJ A;  1LCK A;  4RUG A;  1T0H A;  3FJ5 A;  3O5Z A;  2YUQ A;  1ZUY A;  1WXT A;  2A36 A;  1AZE A;  2O2O A;  4J9F A;  2XMF A;  2FO0 A;  5GJW B;  1BU1 A;  1OOT A;  1QWF A;  2GQI A;  1M3C A;  1SRM A;  3JV3 A;  1YP5 A;  3QWX X;  2K2M A;  2KRS A;  2JM9 A;  3EG3 A;  3M0P A;  4GBQ A;  1AVZ C;  2ROL A;  1AWJ A;  1YWP A;  2VKN A;  4RTX A;  2KE9 A;  1RUW A;  3M0T A;  3IQL A;  1GCQ A;  3UAT A;  3A98 A;  1B07 A;  2DRK A;  2JTE A;  2ROT A;  2CUB A;  3ULR B;  5IXB A;  2LZ6 B;  4OML A;  4EIK A;  1ZLM A;  4D8K A;  1ZBJ A;  2ABL A;  4IIO A;  3THK A;  1ZX6 A;  4AFQ C;  1GBR A;  1PKS A;  2GBQ A;  1TG0 A;  3EG1 A;  5I11 A;  1PHT A;  2O88 A;  1BB9 A;  1QKX A;  4KRT A;  2JXB A;  2M0Y A;  4JPB W;  5IH2 A;  1T3L A;  2DL5 A;  3NGP A;  1PKT A;  1QKW A;  3M0R A;  2DRM A;  2LQN A;  4X1V A;  1AD5 A;  2MOX A;  1N5Z A;  2O9V A;  2J05 A;  2W10 A;  1W6X A;  4Z89 A;  1NM7 A;  1WA7 A;  2LNH B;  4JZ3 A;  2CT3 A;  1I07 A;  2EW3 A;  3QWY A;  2D8J A;  4LUD A;  2AKK A;  2DBK A;  2DL8 A;  2I0N A;  2OAW A;  1AWX A;  1GFD A;  2X3W D;  3U23 A;  3REB B;  2K79 A;  3VS1 A;  3SHW A;  2HEQ A;  1UUE A;  1Y57 A;  2RMO A;  1CKB A;  2J06 A;  2L0A A;  2EVR A;  1ZUU A;  2KXC A;  4F14 A;  2BZY A;  2MIO A;  2PTK A;  5FW9 A;  2W0Z A;  1WLP B;  3NMZ C;  1OEB A;  1J3T A;  4IIM A;  4F17 A;  2FEI A;  2RN8 A;  2DYB A;  2EYX A;  5FWC A;  2LCS A;  1MUZ A;  1NYG A;  1UEC A;  4J9D A;  4RTW A;  1SSH A;  1KJW A;  1GCP A;  2RQV A;  1SHF A;  4R0K A;  1W70 A;  3PE0 A;  2CSQ A;  2CT4 A;  1FMK A;  1AZG B;  2DNU A;  2CH4 W;  1SHG A;  1IO6 A;  4J9B A;  2M51 A;  1VYU A;  2HCK A;  3C0C A;  1YWO A;  4J9I A;  2KXD A;  3ZL7 C;  2E5K A;  2DX1 A;  3VS0 A;  2FPD A;  2DBM A;  1QWE A;  5L23 A;  2A37 A;  4HVV A;  4AFZ C;  2O31 A;  2LJ0 A;  2KGT A;  3VRY A;  4LNP A;  4CC7 A;  1TUD A;  3M0U A;  1BBZ A;  3EGU A;  3VS3 A;  1YN8 A;  3LH5 A;  2C0T A;  3H0I A;  2FRW A;  3TSZ A;  1U06 A;  2JM8 A;  1JXO A;  5EC7 A;  4AG1 C;  2SRC A;  1GRI A;  2RNA A;  2CDT A;  5ECA A;  2DL3 A;  3CQT A;  4J9C A;  2KYM A;  2EYY A;  1WFW A;  4AG2 C;  1TUC A;  5I22 A;  2J6O A;  1E6H A;  1WXU A;  2ENM A;  1NYF A;  2K7A A;  2ED1 A;  5HCK A;  4LE9 A;  1JU5 C;  4A63 B;  1K76 A;  1UGV A;  2EQI A;  2V1Q A;  1JEG A;  3GBQ A;  2O9S A;  2KYB A;  1HD3 A;  2KR3 A;  3EG2 A;  1MV0 B;  1KIK A;  1M8M A;  2AZV A;  5IHI A;  1K9A A;  3SEM A;  1M3B A;  1WYX A;  2LJ1 A;  1K1Z A;  1B3Q A;  1AWW A;  5IHK A;  2V1R A;  1KFZ A;  1X69 A;  4LUE A;  2LMJ A;  1UG1 A;  3EG0 A;  2P4R A;  4ESR A;  2DF6 A;  1KSW A;  2LQW A;  2A08 A;  2AZS A;  1PRL C;  2KRM A;  2EBP A;  1PWT A;  4CC2 A;  2EYW A;  1PRM C;  2DL4 A;  2EGA A;  4OMM A;  2ESW A;  2RF0 A;  3TSW A;  2J6F A;  2RQW A;  3PVQ A;  2PNI A;  2NUZ A;  4F16 A;  3VRZ A;  4RTY A;  4HXJ A;  2L3Q A;  1M30 A;  2YT6 A;  2KRN A;  2DJQ A;  2AK5 A;  2L3P A;  2JMA A;  4GLM A;  1FYN A;  1AEY A;  3UA6 A;  2SEM A;  4CC3 A;  2JMC A;  2X3X D;  4RTV A;  2YUO A;  1Y0M A;  2GNC A;  1CSK A;  2JW4 A;  2FRY A;  1ZSG A;  2BZ8 A;  1RLQ C;  1OV3 A;  4LN2 A;  4J9E A;  1RI9 A;  2GGR A;  2KEA A;  4DEY A;  1E7O A;  3VS4 A;  1M27 C;  2K6D A;  1T3S A;  1PNJ A;  4HVW A;  2HBW A;  1G83 A;  2B86 A;  2EPD A;  4ORZ A;  1CKA A;  1ARK A;  2RPN A;  2LJ3 A;  4OMO A;  3TVT A;  1OPK A;  1Z9Q A;  2VVK A;  1NLO C;  1K0S A;  3NPF A;  3I9Q A;  4J9H A;  1H92 A;  2CH4 A;  3VS6 A;  1YCS B;  2D0N A;  4K11 A;  2LP5 A;  2FG0 A;  3KFV A;  4CC4 B;  3REA B;  1UJY A;  2G6F X;  1GL5 A;  1SEM A;  1S1N A;  2D1X A;  2JS2 A;  4RTZ A;  2ECZ A;  4HCK A;  2NWM A;  2DL7 A;  2YDL A;  3I5R A;  1G2B A;  4OMN A;  1UTI A;  2K3B A;  1V1C A;  3M0S A;  1GCQ C;  3VS5 A;  1BK2 A;  2CUD A;  3EHR A;  2F2X A;  1XOV A;  1X27 A;  2JS0 A;  1WIE A;  1GBQ A;  4Y92 A;  1M3A A;  1WI7 A;  5IHN A;  5GJV B;  4D8D A;  2YUP A;  2F2W A;  1AWO A;  3I35 A;  4Z8A A;  1UJ0 A;  4OMP A;  2F2V A;  4AFS C;  1T0J A;  1VYV A;  4JZ4 A;  2CSI A;  4RTU A;  2HDA A;  3H0F A;  4J9G A;  1NEG A;  2ED0 A;  2VWF A;  4OMQ A;  1X43 A;  1Z9Z A;  5FWB A;  4E6R A;  1K4U S;  3UF4 A;  2KT1 A;  4AFU C;  4JJB A;  2DIL A;  2DM1 A;  3H41 A;  2KRO A;  1U5S A;  2A28 A;  2DLP A;  1UE9 A;  2L2P A;  3VS2 A;  2RQU A;  4DEX A;  2OJ2 A;  2H8H A;  1WX6 A;  1QCF A;  3NHN A;  1VYT A;  3PVL A;  2PZ1 A;  2DMO A;  4WCI A;  1AOJ A;  1I1J A; 
#chains in the Genus database with same CATH topology
 4JJC A;  1M2V A;  8ATC B;  2L89 A;  1WXB A;  2K9G A;  1KHC A;  3H6Z A;  2HSP A;  4PFP A;  2X9H A;  3GF5 A;  2XD0 A;  4ELZ C;  5LJ5 d;  5GAN 7;  1UDL A;  4KBM B;  4LDX A;  1ZSZ B;  2ZZD A;  1YI2 Q;  1B34 B;  4JRP A;  2FPF A;  1VQL Q;  3G71 A;  3OS1 A;  1VA7 A;  2RK1 A;  1VQO Q;  2QI2 A;  1D0Z A;  2L3S A;  2OTJ Q;  1KQS S;  4LDW A;  3OW2 S;  1QQJ A;  5KE2 A;  4M7A G;  2AKL A;  4ZGE B;  4JRI A;  1SSF A;  2ZCF B;  1YNZ A;  2C0I A;  2EGE A;  2V26 A;  3V7S A;  1UGR B;  4NL2 A;  2DPP B;  2MK5 A;  3QYH B;  2CP7 A;  5J26 A;  2C0O A;  3OYA A;  1GFC A;  2KNB B;  4BUG A;  1X2K A;  2JOY A;  5GAO l;  2EYQ A;  3CCS Q;  4M7D B;  4HT9 A;  4FT2 A;  2R58 A;  5L8R E;  3OYM A;  2J7I A;  1WDX A;  2BUD A;  2KBT A;  4RUG A;  3VYG A;  1UB4 A;  4BB7 A;  2FL7 A;  2K3Y A;  1M90 R;  2YUQ A;  3CC7 A;  1AZE A;  3KXT A;  4XQ3 A;  2P4T A;  2GFA A;  2GQI A;  4JLG A;  4JRQ A;  4J6W A;  2QTX A;  2L3R A;  3MCA B;  2F5T X;  4M7D F;  3CC4 A;  1FMV A;  2K2M A;  1WQW A;  4M75 D;  2KRS A;  2JM9 A;  3M0P A;  3OYF A;  3GNG A;  5IT9 E;  1RAH B;  4X34 A;  4TVR A;  3S6W A;  2I2L A;  2VKN A;  4UC4 A;  3M0T A;  4E47 A;  2CZ0 B;  4C0D C;  4FYW B;  3DKM A;  4PFZ A;  2LZ6 B;  2CS7 A;  4M75 E;  1ZLM A;  1KD1 U;  1ZA1 B;  3JB9 I;  5KH6 A;  5GMK m;  1IHW A;  1VQP A;  3CCE Q;  4IIO A;  1ZX6 A;  1EX4 A;  4A4K A;  1GBR A;  3EGX B;  2GBQ A;  2BE9 B;  1M9S A;  1TG0 A;  5I11 A;  3G1J A;  3S3O A;  3CMA T;  4GLK A;  4KRT A;  2DIG A;  2EQJ A;  3OA6 A;  3WVE B;  1IGU A;  5IH2 A;  3NGP A;  1PKT A;  4FL6 A;  1PG5 B;  3OBY A;  1K9M U;  3HHT B;  3EG9 B;  1VQK Q;  2DRM A;  1RAG B;  4X1V A;  4M77 C;  1QP3 A;  2LC4 A;  2MOX A;  1N5Z A;  4E7K A;  2J05 A;  1N9R A;  5KYU A;  2OAU A;  4MMK A;  2HKN A;  1NM7 A;  1G5V A;  4ZTF A;  3M4G A;  1UEB A;  5GAM g;  2ZPB B;  1NJI C;  1OQK A;  1I07 A;  5J3B A;  4RKU E;  3G6E A;  2D8J A;  3DB4 A;  2DYI A;  3LGF A;  1AHJ B;  1GFD A;  4PKC C;  2DEQ A;  1MNE A;  2J06 A;  3VKI A;  4F14 A;  1ZUU A;  2DXB A;  5CKD A;  3OS0 A;  2W0Z A;  4F04 B;  2R57 A;  4IIM A;  5GAM h;  4C8Q C;  4F17 A;  4C0Z A;  2FEI A;  2X4Y A;  1I5O B;  2OX7 A;  2DYB A;  2LCS A;  1MUZ A;  1NYG A;  2RI3 A;  1UEC A;  3V8K A;  3EGD B;  3CCQ Q;  4JS4 A;  1KJW A;  1GCP A;  4B9X A;  4DBQ A;  1TU0 B;  1YIJ A;  2DNU A;  1VQN T;  3H9N A;  2XU8 A;  5EG2 A;  3G71 Q;  2HCK A;  3VV0 A;  4PJO B;  3HFO A;  3MO8 A;  2VAS A;  2E5K A;  2M16 A;  1VQ8 T;  1K8A R;  1NBE B;  3MPU B;  4ME7 A;  2XHC A;  2QGG A;  2XK0 A;  3AT1 B;  2K2V A;  3CCM T;  1ZSZ C;  4CC7 A;  3EGU A;  3BDL A;  2X4X A;  3LH5 A;  2C0T A;  4IUU A;  1JJ2 S;  1VQ7 T;  1U06 A;  2JM8 A;  3Q1J A;  4QQG A;  2EJ9 A;  3FDR A;  1GRI A;  5GAN 4;  1O75 A;  3E9G A;  1R8O B;  3CQT A;  4KGZ B;  2KYM A;  2K5L A;  4BI3 A;  3QZ5 B;  3JCM c;  4A4F A;  1WXU A;  2C06 A;  2EAY A;  3MEV A;  4F7U A;  1JU5 C;  3L42 A;  1VQM T;  3L2V A;  3H8Z A;  1W2B S;  3OYI A;  3EFO A;  1YFN A;  2KYB A;  5GAN d;  2XIC A;  1KIK A;  3R6O A;  1M8M A;  2AZV A;  5KYY A;  2NYS A;  3JCM g;  1B3Q A;  1AWW A;  5IHK A;  1FMW A;  3CC4 Q;  5CO7 A;  2K57 A;  3L2W A;  1HXD A;  2CZ1 B;  2XI9 A;  2L5Q A;  4E7S A;  5D7U A;  2A08 A;  2DTO A;  3KBG A;  5GAN g;  4KGX B;  1N8R C;  2M9U A;  2RJF A;  4C0F A;  1RAA B;  4CC2 A;  3JCM h;  2DTI A;  2EGA A;  2E70 A;  4C92 A;  4OMM A;  2ESW A;  3QZ9 B;  3G4S T;  1RL2 A;  1NJI U;  4M7D D;  3VRZ A;  4XU3 A;  2CP3 A;  4HXJ A;  2L3Q A;  2QQ9 A;  2YT6 A;  1YJ9 Q;  1VQP Q;  3SB2 A;  5GAN h;  2ZPF B;  4F7U E;  2EWN A;  4KUD K;  2LQK A;  1AEY A;  3CCJ T;  2E12 A;  2JMC A;  3GP8 A;  1UGS B;  3X24 B;  1RAB B;  1WHM A;  3E19 A;  2QXF A;  2YUO A;  1Y0M A;  1S72 T;  1KQS A;  4M7A A;  3OW2 A;  1Y71 A;  3MEW A;  1EZZ B;  1OV3 A;  4X9D A;  1RI9 A;  4M7D E;  2EJF A;  2HQH A;  4HVW A;  2R5M A;  2LNV A;  2O01 E;  1M2V B;  1Z9Q A;  2E41 A;  1Y7X A;  2DTH A;  1VQ6 T;  2RO0 A;  3G6E Q;  1H92 A;  3MJX A;  1BI0 A;  2CZ6 B;  3UDC A;  1UJY A;  2G6F X;  4B6M A;  1GL5 A;  2H3J A;  2HQE A;  3ZBD A;  3CCU Q;  4N4H A;  5C6S A;  1M1F A;  2MYS A;  3CCR A;  2PVG B;  1VQ9 Q;  1VQ8 A;  3VS5 A;  3G7Z A;  2DJZ A;  3T9N A;  4M7A E;  3OYJ A;  2KMT A;  4EMK A;  4BE2 A;  5GAM f;  1X27 A;  1YJW A;  5FLX E;  3J80 E;  3CCL T;  4Y92 A;  3RKX A;  5IHN A;  5GJV B;  1PSE A;  2KQW A;  2YUP A;  1YIJ Q;  1BIB A;  4QW2 A;  1AWO A;  1G8X A;  3RKY A;  2KK4 A;  1Q81 U;  2DIQ A;  1UJ0 A;  1VQ7 A;  4E7J A;  1G3Y A;  2F1L A;  4A4E A;  2FZG B;  2X35 A;  4RTU A;  2HDA A;  2LTO A;  1VUB A;  1K4U S;  1O9S A;  4E6R A;  3LYI A;  4JJB A;  3BE3 A;  1C0M A;  2HMA A;  2A28 A;  4R55 A;  2JZ2 A;  2RB6 A;  3VS2 A;  2YRD A;  2RQU A;  4DEX A;  4D6W A;  1BI2 A;  3MKD A;  3NHN A;  4PJO C;  4OB3 B;  1YIT A;  2F5K A;  1AOJ A;  1PM3 A;  2MCN A;  1Q95 G;  2PUO B;  3R6N A;  1UFF A;  1EIF A;  2GTO A;  3C12 A;  4XU1 A;  3OS2 A;  4XU2 A;  3OMG A;  2MWP A;  4EMH A;  1MV3 A;  2E10 A;  2DXC A;  2K5I A;  2RD1 A;  3QPH A;  1JXM A;  1D3B A;  4J83 A;  4N0A A;  2YUN A;  4JJD A;  4M78 C;  1NEB A;  3O8V A;  1K73 R;  1MMA A;  3LX7 A;  2YSQ A;  2DVJ A;  1UHF A;  1D1B A;  3G4S A;  2PU9 B;  2RI5 A;  5GMK j;  1QMC A;  2IIM A;  4C8Q G;  2QDL A;  1R77 A;  2GTJ A;  1NZ9 A;  4X9C A;  1MND A;  1VIF A;  1KG1 A;  1K0X A;  3I5S A;  2FVU A;  1X2Q A;  1BYM A;  1B7T A;  1WGS A;  5IN1 A;  3CCV T;  5FRO A;  3UA7 A;  1S72 A;  2BZX A;  5CQY A;  3WVD B;  1NG2 A;  2BKD N;  2RQT A;  2VC8 A;  1R0B G;  2LX7 A;  2CP2 A;  1H3H A;  3V8J A;  4RCB A;  2CRE A;  1WHG A;  5KYU B;  3O5Z A;  1ZUY A;  2DZC A;  3JCM f;  1WXT A;  1WHK A;  8AT1 B;  2FO0 A;  5GJW B;  3LW5 E;  1KQS P;  1OOT A;  1QWF A;  1M3C A;  2DXU A;  2ZPH B;  3JV3 A;  3ER0 A;  1N6A A;  1D1C A;  3QWX X;  5GAN f;  4DQ2 A;  3OYC A;  2VB6 A;  3OYG A;  4GBQ A;  2P0P A;  3X25 B;  3RDV A;  2ROL A;  2DD5 A;  3JB9 G;  3LWH A;  2E3H A;  4RTX A;  1Q7Y R;  1JJ2 A;  2OTL T;  1M1K R;  2CP0 A;  5KYN A;  1B07 A;  1RAF B;  3SWN A;  1IXD A;  2ROT A;  3CC2 T;  4BDZ A;  4OGE A;  4J7I A;  2V8J A;  2VGN A;  2EIF A;  4EPC A;  2ABL A;  3MP8 A;  5GAN j;  1KD1 R;  4PL6 A;  4AFQ C;  5GMK l;  1PKS A;  2MF2 A;  1OZ2 A;  3CCR Q;  2COZ A;  1QKX A;  3PIO A;  1VQ8 Q;  1W2B A;  4C92 G;  3JCM X;  4MDX A;  4J8O A;  1T3L A;  3M9Q A;  1YJW Q;  3M0R A;  2LQN A;  3OYK A;  1QVF S;  3JSC A;  5GMK i;  3LH0 A;  1VQ5 A;  1LNX A;  4Z89 A;  1YHQ T;  4RG8 A;  5KE3 A;  4DBR A;  1WA7 A;  3CXC S;  2AHJ B;  2LNH B;  2EW3 A;  3QWY A;  4LUD A;  2DET A;  2I0N A;  4DOW A;  3U23 A;  3REB B;  2K79 A;  1UUE A;  1Y57 A;  4CRI A;  5LJ5 g;  2RMO A;  3VU3 C;  2KXC A;  3OY9 A;  3CPF A;  2BZY A;  2MIO A;  2LCC A;  4XTU A;  4F7U B;  1YJN Q;  2RN8 A;  3EFO B;  5CKH A;  4GY5 A;  1UGP B;  4LXC A;  1YIT Q;  3INZ A;  3I56 A;  5LJ5 h;  1RAD B;  1SSH A;  2X4W A;  2WSC E;  2RQV A;  3OMC A;  5IAY A;  5KYY B;  1SHF A;  1W70 A;  4M75 C;  2VYT A;  1AT1 B;  2HBP A;  1FMK A;  2CH4 W;  3CPW S;  1SHG A;  2DER A;  4F7U F;  3FB9 A;  3WXM B;  3FC3 A;  4XTX A;  3JB9 F;  4J9I A;  2KXD A;  3ZL7 C;  2KSS A;  2DX1 A;  3VS0 A;  3CME T;  2P84 A;  1M90 C;  5CKF A;  2DBM A;  5L23 A;  4ANJ A;  4C92 B;  7AT1 B;  2LJ0 A;  3RR6 A;  1VQ4 T;  2X4J A;  2KAF A;  1Q86 R;  2IVW A;  1YN8 A;  1LVK A;  3QSU A;  2E65 A;  3TSZ A;  1D0X A;  1SG5 A;  2EQK A;  5EC7 A;  2SRC A;  4M7A B;  4C92 F;  5I2M A;  4JDS A;  2DL3 A;  3P8B B;  1ZQ1 A;  4C5H A;  5GAO q;  2EYY A;  3C4S A;  3PTA A;  2QEX A;  4FYV B;  5GAO r;  5I22 A;  2J6O A;  4AT1 B;  1QCO A;  1QVP A;  3PNW C;  1E6H A;  4E7Z A;  2K7A A;  4LE9 A;  1K76 A;  3M56 A;  3GBQ A;  4A4G A;  2O9S A;  1HD3 A;  4M7A F;  5CVI A;  3EG2 A;  1MV0 B;  1HYO A;  3CEY A;  4BY6 C;  5IHI A;  1Q82 R;  5LJ3 d;  2NUT A;  1K9A A;  1M3B A;  4FSX A;  2MPX C;  2XDD A;  2RHZ A;  1X69 A;  4Y91 A;  3EG0 A;  2P4R A;  4Y28 E;  3URG A;  2RH2 A;  4OF1 A;  2RJD A;  1VOM A;  2AZS A;  2QA4 T;  1V76 A;  1ZBX A;  3VYH B;  2EBP A;  2HNI A;  4EMK B;  5LJ3 g;  2DL4 A;  1TWB A;  2RF0 A;  4E7H A;  2J6F A;  2Y90 A;  4KGV B;  1IGQ A;  2RQW A;  2PNI A;  2GFU A;  3E1S A;  1WJS A;  1KK7 A;  2COW A;  5GAN 3;  4RTY A;  3RMS A;  2CZ7 B;  4OB1 B;  1RAI B;  2KRN A;  2AK5 A;  4OMF B;  1FYN A;  5HK0 A;  5LJ3 h;  2X3X D;  4RTV A;  3QII A;  2GNC A;  2AT1 B;  1CSK A;  1BIA A;  2JW4 A;  1E7O A;  3RES A;  4IUQ A;  4Z02 A;  1T3S A;  4MZM A;  4C8Q A;  4MZT A;  2JJ9 A;  2B86 A;  2EPD A;  1ARK A;  1VQ5 Q;  4FU6 A;  3BY7 A;  1OPK A;  2VVK A;  5M9O A;  4E7I A;  2HZY A;  3OBW A;  2CH4 A;  2FZC B;  3VS6 A;  3OSV A;  3GNF B;  2LP5 A;  1TOV A;  5KYW A;  1LJO A;  4CC4 B;  3ASK A;  3I55 T;  1M1G A;  1P92 A;  3S3M A;  1D1A A;  1M90 U;  1LPL A;  1S1N A;  3HSB A;  2JS2 A;  2E64 A;  4HCK A;  1ZHI A;  5GMK h;  4C8Q D;  1M8V A;  2YDL A;  3PFS A;  1D3B B;  4OMN A;  3M0S A;  1V1C A;  2LX9 A;  1GCQ C;  1YI2 T;  1Q81 C;  5I21 A;  3I56 Q;  1VQL T;  2F2X A;  1XOV A;  3FRN A;  2JTM A;  1GBQ A;  1WHH A;  4HCB A;  2YWW A;  1VQO T;  2OTJ T;  3HTR A;  5LJ5 f;  3V7R A;  4R56 A;  2KVQ G;  4C8Q E;  5GAO n;  2QG9 B;  3AHU A;  1WNL A;  2MWO A;  1VYV A;  3A5Z B;  2CSI A;  1D09 B;  3CC7 Q;  3H0F A;  4J9G A;  2VWF A;  1X43 A;  1Z9Z A;  5LL6 S;  2KT1 A;  3CD6 T;  2KRO A;  4J5Y A;  4M7D C;  1WHJ A;  2DXT A;  3JCM Q;  2JUF A;  2BE7 D;  3PVL A;  2PZ1 A;  1NPR A;  4PFO A;  2JVV A;  4WCI A;  4FW1 A;  1I1J A;  5LJ5 j;  1PD0 A;  3JB9 D;  1ABO A;  4Z88 A;  3CCS T;  2J6K A;  1HSQ A;  3HRS A;  4FSS A;  5DY9 A;  3CMA A;  1IZ6 A;  3HRT A;  2OI3 A;  4YTL A;  1JQQ A;  2BTT A;  1W1F A;  4QVD A;  3EHQ A;  3OB9 A;  2QEX Q;  1OPL A;  1EFN A;  3PGG A;  4CI0 C;  1N8R R;  2EGC A;  1QVF A;  2EJG A;  3M53 A;  4C5I A;  5D6X A;  4KT0 E;  2QA4 A;  2Y4Y A;  1X6B A;  3SWN B;  5GAN 8;  3CXC A;  1D0Y A;  1KHI A;  4DOV A;  2FHD A;  4XTZ A;  1U3O A;  4C92 D;  2DVE A;  5GAN 5;  3VS7 A;  1E6G A;  2RQR A;  3EFR A;  2EQM A;  2YRC A;  4LDY A;  4ZGJ B;  3EFS A;  1QCN A;  1SRL A;  5AT1 B;  1TUG B;  5CR2 A;  2QQR A;  2DE0 X;  3ME9 A;  4E7L A;  2HD0 A;  3HRU A;  2DA9 A;  4M7A D;  4C92 E;  1YBY A;  1JO8 A;  3CCE T;  2D8H A;  4L6V 5;  4HVU A;  2D9T A;  2ZPI B;  4M4Z A;  3GOX A;  2QK0 A;  1FXX A;  1LCK A;  1OUL A;  3TU4 K;  1VQN A;  1T0H A;  3FJ5 A;  1K8A U;  2RHX A;  3CPW A;  4J7F A;  2A36 A;  2GCX A;  2O2O A;  4J9F A;  4JS5 A;  3PMI A;  2WSF E;  1BU1 A;  1SF9 A;  2LQ8 A;  2LRQ A;  4MML A;  1VQK T;  4IKF A;  9ATC B;  3JB9 H;  3EG3 A;  5LJ3 f;  3CCM A;  2LCL A;  3ZEH A;  2M02 A;  1AWJ A;  1RUW A;  1XQH A;  3IQL A;  2Z0W A;  3UAT A;  3A98 A;  3V7C A;  1KC8 R;  2DRK A;  2JTE A;  2IG0 A;  2CUB A;  1VQL A;  5IXB A;  4OML A;  3A8O B;  2CGH A;  3HFN A;  3QXE B;  4D8K A;  3M54 A;  1ZBJ A;  3JB9 J;  3THK A;  3VUB A;  4XTW A;  3MP6 A;  3CCQ T;  2KY9 A;  2LVM A;  1R0C B;  5LJ3 j;  1XNI A;  1I5L A;  5GAO p;  1VQM A;  1BB9 A;  2DO3 A;  1WJQ A;  4RMO A;  2E6N A;  2DEU A;  2JXB A;  4JPB W;  2L8D A;  3FLG A;  4FM4 B;  3CD6 A;  3G71 T;  4BI4 A;  1QKW A;  1HK9 A;  4M77 G;  1AD5 A;  3EH2 A;  2W10 A;  2PVO B;  3UT1 A;  4LD9 K;  1W6X A;  2H3E B;  4ELY C;  1OZ3 A;  4P5N A;  2CT3 A;  2AKK A;  2DL8 A;  4N0A C;  2OAW A;  1QW1 A;  1AWX A;  3M59 A;  3VS1 A;  3SHW A;  2BIV A;  2L0A A;  2EVR A;  3QDF A;  4LDV A;  1K73 C;  5FW9 A;  5CKE A;  3A8H B;  5KCH A;  1OEB A;  3OYN A;  2HAX A;  4WF2 A;  3L2Z A;  3JCM V;  3A8L B;  1MMN A;  4ZN3 A;  3MEU A;  2EYX A;  5FWC A;  4C0D B;  1QVG S;  3OYE A;  4J9D A;  3CCJ A;  4XU0 A;  4BE1 A;  4RTW A;  2NUT B;  4M78 A;  4R0K A;  3PE0 A;  3CMA Q;  3C95 A;  4HT8 A;  2CT4 A;  1KQ1 A;  1AZG B;  3A1P A;  4J9B A;  2M51 A;  1VYU A;  5GAM e;  3C0C A;  1KQ2 A;  1YWO A;  1M2O A;  3RER A;  3M55 A;  4IUT A;  1QWE A;  1W4S A;  2NUP A;  2MMP A;  2A37 A;  2PVD B;  3CC4 T;  2QA4 Q;  5FU7 B;  3OW2 P;  4AFZ C;  2D0Q B;  2O31 A;  1GXI E;  1VQ6 A;  1M4Z A;  4DBH A;  4LNP A;  3CCE A;  1TUD A;  3L2R A;  1FWZ A;  1NE8 A;  2V8K A;  4BE0 A;  5CK9 A;  4EMG A;  1FX7 A;  2ZPE B;  4AG1 C;  2RNA A;  3QDR B;  1MGQ A;  3CBO A;  2CDT A;  1Q7Y C;  5GAN 6;  1M1K C;  3QJY A;  3A8M B;  1MMD A;  3LLR A;  3JRZ A;  4JJN K;  4J9C A;  2FYK A;  1WFW A;  4AG2 C;  4M77 F;  1TUC A;  1YJ9 T;  1VQP T;  3CCL A;  4C8Q B;  1NYF A;  5HCK A;  2ED1 A;  4HCZ A;  3CPW P;  4ATO A;  1VQN Q;  1X75 C;  1MMG A;  2EQI A;  2XID A;  3F70 A;  2QTV A;  1RAC B;  3TEE A;  2DFU A;  1NPP A;  2QAS A;  4IUP A;  1V29 B;  5KYW B;  2LJ1 A;  1YCY A;  1K1Z A;  1TXQ A;  1QP2 A;  1Y96 A;  2V1R A;  1KFZ A;  4C8Q F;  3ZFJ A;  1K9M R;  2M0O A;  3CCM Q;  2LMJ A;  4OVA A;  4ESR A;  2DF6 A;  1KSW A;  4RG2 A;  2LQW A;  3G6E T;  3PMT A;  2E1H A;  1VQ7 Q;  2CYZ B;  2KRM A;  1PWT A;  1PRM C;  4DBF A;  3TSW A;  4QQD A;  2ZAE A;  4C5E A;  4KH0 B;  3CCU T;  1IRE B;  2NUZ A;  2ZPG B;  1TTH B;  4LDU A;  1VQ9 T;  4V2S A;  4XTV A;  2JMA A;  4PJJ A;  3UA6 A;  3RMQ A;  2SEM A;  4BD3 A;  4CC3 A;  4XTY A;  1C1A A;  1K73 U;  4PLI A;  5FU6 B;  1VQM Q;  4ZTJ A;  3JCM e;  1YIJ T;  2FRY A;  1ZSG A;  3J81 E;  3E2U A;  4LN2 A;  3L2U A;  4J6X A;  2KEA A;  3CD6 Q;  4DEY A;  2MI6 A;  3RUX A;  4FT4 A;  3VS4 A;  3LWI A;  3TCJ A;  5A2Q E;  1JBM A;  1G83 A;  4KH1 B;  5GAN e;  2A7Y A;  2RPN A;  5J39 A;  2DAQ A;  2JNG A;  3CCV A;  3SFM A;  1IHV A;  1YCS B;  4K11 A;  4M75 A;  2FG0 A;  4QQ6 A;  3KFV A;  1SEM A;  4ZN1 A;  2D1X A;  4NS5 A;  4RTZ A;  5CKB A;  2JTF A;  2F69 A;  1Q86 C;  3QO3 A;  1JB0 E;  3G4S Q;  3I5R A;  4N4G A;  3NTI A;  1G2B A;  1UTI A;  3TQ7 P;  1BK2 A;  2RK2 A;  3OYH A;  3QUI A;  3CCJ Q;  4PJL A;  1WIE A;  1JRI A;  1BI3 A;  2COY A;  1S72 Q;  3P8D A;  4D8D A;  4B9W A;  2F2W A;  3BDU A;  5CCA A;  2DZ9 A;  1Q7Y U;  3I35 A;  2A0F B;  2X51 A;  1M1K U;  2FB7 A;  4OMP A;  2YXY A;  3GLX A;  2F2V A;  4AFS C;  1T0J A;  3NFC A;  3S3N A;  1IRX A;  4LD6 A;  2RI2 A;  2OTL A;  2ED0 A;  1XJW B;  5FWB A;  2O4X A;  4AFU C;  2DIL A;  3SDZ A;  1G3T A;  2DM1 A;  1Q82 C;  1VQ6 Q;  1U5S A;  2DLP A;  1UE9 A;  3CC2 A;  2L2P A;  4XK8 E;  2IPO B;  1YJ9 A;  2KDS A;  2PQW A;  2QQB A;  1UGQ B;  4PJO G;  3RKW A;  1I8F A;  2QGF B;  5KYX A;  5GAM d;  1JJ2 P;  1QLY A;  1ZUK A;  5IXF A;  3OQ5 A;  1SPK A;  1A0N B;  1ABQ A;  3HKS A;  1HJD A;  3DLM A;  3LGL A;  5FU7 C;  3M0Q A;  3H0H A;  4HCC A;  3QYG B;  4M77 A;  4MDW A;  3CCL Q;  1H8K A;  4RTT A;  1NJI R;  3UPU A;  2EYZ A;  4FYY B;  1YHQ A;  1XTD A;  3RBB B;  3EH1 A;  5DLQ E;  4JUV A;  1H64 1;  2CKK A;  4M78 G;  1W2B P;  2FPE A;  2HSE B;  4WTO B;  1OX8 A;  2JT4 A;  1RLP C;  1ZA2 B;  3CCU A;  4QVZ A;  4M77 D;  2WSE E;  4O5V A;  1I0C A;  1VQ9 A;  3QJ6 A;  5GAO m;  1X6G A;  4QT7 A;  2EKH A;  5CQX A;  5C0M A;  1NLP C;  3DLL A;  4ZNX A;  1K8A C;  1QVG A;  2KT8 A;  4A54 A;  2VXF A;  3OYY A;  2NLU A;  4KUI A;  4C5G A;  1UHC A;  2VGM A;  1OX9 A;  2GF7 A;  2QQS A;  3RNJ A;  3CCR T;  4M77 E;  4VUB A;  2A3L A;  2ZGW A;  4AMC A;  3MHX A;  2XDP A;  4OGC A;  2XMF A;  1Y07 A;  3CME A;  1OU8 A;  1SRM A;  1YJW T;  3JCM J;  1N9S A;  4HKE A;  1Q86 U;  1YP5 A;  1VQ4 A;  1ZSZ A;  2E5Q A;  1B34 A;  5A0G A;  2JN0 A;  4PJO F;  1IB8 A;  1AVZ C;  1YWP A;  2CP6 A;  2KE9 A;  1Q81 R;  5HKC A;  1GCQ A;  1WQ7 A;  3QKJ A;  3C94 A;  4M78 B;  4BI8 B;  1OI1 A;  5FU6 C;  2RHI A;  2GQV A;  3CCV Q;  3ULR B;  1TSF A;  3JCM d;  1WJR A;  4EIK A;  3JCM P;  1YJN T;  2WAC A;  3HL8 A;  3PT9 A;  4QKU A;  2XDB A;  4QVC A;  1YIT T;  3E9F A;  1DJ7 B;  3BW1 A;  5DLO A;  3EG1 A;  3HP9 A;  1PHT A;  1Q82 U;  2O88 A;  4M78 F;  2NUP B;  2LDM A;  1C6V X;  2M0Y A;  4C92 C;  2RM4 A;  2K5F A;  2AIR B;  1BCM A;  2DL5 A;  2P0Q A;  4M7D A;  5KCO A;  2V8I A;  4C0G A;  2O9V A;  4FCY A;  4O6J A;  3DB3 A;  3J7A F;  4RCC A;  1OYX A;  4L5G A;  4JZ3 A;  1TS9 A;  3N5B B;  2YHT A;  4N4I A;  3RIR A;  2YRV A;  2HQX A;  2DBK A;  2X3W D;  4M7A C;  3X20 B;  2OTL Q;  2HEQ A;  5FRN A;  2RHY A;  1CKB A;  5A0D A;  3FEO A;  2PTK A;  1WLP B;  4J6Y A;  3CC2 Q;  3NMZ C;  1J3T A;  2QQA A;  2RA2 A;  3BFM A;  4E2F B;  4A53 A;  2R5A A;  2M1H A;  4IUR A;  1PSF A;  3X28 B;  1G3W A;  5HK3 A;  4M75 G;  1U1T A;  4BDY A;  2CSQ A;  4ZGD B;  2YLB A;  4KUL A;  1Y96 B;  2XKO C;  1VIE A;  4PK4 A;  2KI7 A;  1BI1 A;  2HL3 A;  1IO6 A;  2EFI A;  1WHL A;  2FZK B;  3A8G B;  3UWN A;  3EGX A;  1I4K 1;  1H3Z A;  3JCM b;  4IUV A;  2FPD A;  5LJ5 e;  1YHQ Q;  3D7S B;  4HVV A;  2VV5 A;  3SD4 A;  4EMK C;  2KGT A;  3VRY A;  3M0U A;  1BBZ A;  3I55 A;  2DKG A;  3VS3 A;  2D6F A;  3EG9 A;  2Y4X A;  3H0I A;  2FRW A;  4PLL A;  2K3X A;  1JXO A;  3X26 B;  1F1B B;  5FRM A;  1U8R A;  3QG1 A;  5ECA A;  1QVG P;  1X01 A;  2LT4 A;  1YI2 A;  1KC8 C;  1PC0 A;  4JLI A;  1N27 A;  3L2Q A;  3KUF A;  4II1 A;  2HL5 C;  3VUZ A;  2ENM A;  1VQO A;  1BKB A;  2OTJ A;  5AYF A;  3M58 A;  4A63 B;  2V1Q A;  1UGV A;  4FW2 A;  3NTK A;  3MET A;  1JEG A;  2QAZ A;  4OB0 B;  3EAE A;  2KR3 A;  4FIB A;  2XG8 D;  4DA4 A;  3EGD A;  3CME Q;  4M75 B;  3SEM A;  1WYX A;  3V8L A;  5D6W A;  1WPY A;  5GAM j;  4Q5W A;  1YJN A;  1VQ5 T;  1VQ4 Q;  4LUE A;  4NOY A;  1UG1 A;  4PJN A;  4PJO A;  2LT1 A;  3FJP A;  2HKQ B;  2ATC B;  3GIB A;  2G3R A;  1PRL C;  5D6Y A;  2EYW A;  1BCO A;  4M75 F;  3CCS A;  1LOJ A;  2EQU A;  3VJP A;  3OS5 A;  3OYB A;  2DK3 A;  3PVQ A;  1N8R U;  2EKO A;  4F16 A;  4PJM A;  3JAM E;  5GAN 2;  1M30 A;  2DJQ A;  2L3P A;  1U1S A;  1MHN A;  4GLM A;  3P8H A;  3I56 T;  1ACM B;  4PJO D;  3L1A A;  2E4H A;  1PD1 A;  1RAE B;  3TRE A;  2O4X B;  2VXE A;  2BZ8 A;  1RLQ C;  4J9E A;  4FYX B;  3OSS C;  3OYD A;  2GGR A;  2MAM A;  1M27 C;  2K6D A;  1PNJ A;  2HBW A;  1X6O A;  2RJE A;  3CC7 T;  2QYZ A;  5KYX B;  2P0K A;  4ORZ A;  1CKA A;  4PJO E;  1QVF P;  4JRK A;  2LJ3 A;  1TH7 A;  4OMO A;  3TVT A;  5LJ3 e;  5I2S A;  1WZO A;  1NLO C;  1K0S A;  4BY6 B;  3NPF A;  6AT1 B;  3CXC P;  3I9Q A;  3M57 A;  4J9H A;  2D0N A;  4M78 D;  4MZP A;  3PIP A;  4EDU A;  3REA B;  4M77 B;  3GPL A;  3MEA A;  2ECZ A;  1RI0 A;  2QDY B;  3NTH A;  2NWM A;  3JCM W;  2YLC A;  2DL7 A;  2RJC A;  5A0L A;  1SKU B;  5DM7 R;  2K3B A;  3HPW A;  3FIF A;  3MP1 A;  2CUD A;  3EHR A;  5HY6 A;  2QEX T;  3SWN C;  4M78 E;  1I81 A;  3OYL A;  2JS0 A;  1VQK A;  4OB2 B;  1M3A A;  1WI7 A;  4L59 A;  1OU9 A;  2E3I A;  2PUK B;  2CP5 A;  4F7U G;  2E6Z A;  3M5A A;  2B8A A;  4Z8A A;  5GMK e;  4HA8 A;  2VUB A;  3CBM A;  4A4H A;  3QHS A;  1KC8 U;  1KD1 C;  4JZ4 A;  2K4Y A;  1NEG A;  4OMQ A;  3UF4 A;  4OP0 A;  4BAC A;  5CAI A;  5CIU A;  4PNO A;  3H41 A;  4NL3 A;  4M7D G;  3QBY A;  4XAX B;  2DD4 A;  1PCX A;  1G3S A;  3CBP A;  2RHU A;  2OJ2 A;  2H8H A;  1WX6 A;  1M5Q 1;  1QCF A;  3M4Y A;  3I55 Q;  1VYT A;  1K9M C;  2DMO A;  3CCQ A; 
#chains in the Genus database with same CATH homology
 4JJC A;  1QLY A;  1ZUK A;  5IXF A;  1ABO A;  4Z88 A;  1WXB A;  2MCN A;  2J6K A;  2K9G A;  2HSP A;  1SPK A;  1A0N B;  1HSQ A;  1ABQ A;  1HJD A;  4FSS A;  3R6N A;  1UFF A;  1UDL A;  2GTO A;  3M0Q A;  2OI3 A;  1JQQ A;  2BTT A;  1W1F A;  3EHQ A;  3H0H A;  2FPF A;  1OPL A;  1EFN A;  1H8K A;  1VA7 A;  4RTT A;  2L3S A;  1MV3 A;  2EYZ A;  2EGC A;  1JXM A;  3RBB B;  2AKL A;  1X6B A;  2YUN A;  4JJD A;  1YNZ A;  2FPE A;  1NEB A;  2C0I A;  1U3O A;  2EGE A;  2YSQ A;  2DVJ A;  1UHF A;  2JT4 A;  1RLP C;  2IIM A;  3VS7 A;  1E6G A;  2RQR A;  2QDL A;  2GTJ A;  1I0C A;  1K0X A;  3I5S A;  1X2Q A;  2C0O A;  1GFC A;  2KNB B;  1X6G A;  1SRL A;  4QT7 A;  1X2K A;  2EKH A;  2DE0 X;  3UA7 A;  1NLP C;  2DA9 A;  2BZX A;  4ZNX A;  1NG2 A;  2KT8 A;  2RQT A;  1JO8 A;  2D8H A;  4HVU A;  2LX7 A;  1H3H A;  2J7I A;  1UHC A;  1WDX A;  2KBT A;  2CRE A;  4M4Z A;  3RNJ A;  1LCK A;  4RUG A;  1T0H A;  3FJ5 A;  3O5Z A;  2YUQ A;  1ZUY A;  1WXT A;  2A36 A;  1AZE A;  2O2O A;  4J9F A;  2XMF A;  2FO0 A;  5GJW B;  1BU1 A;  1OOT A;  1QWF A;  2GQI A;  1M3C A;  1SRM A;  3JV3 A;  1YP5 A;  3QWX X;  2K2M A;  2KRS A;  2JM9 A;  3EG3 A;  3M0P A;  4GBQ A;  1AVZ C;  2ROL A;  1AWJ A;  1YWP A;  2VKN A;  4RTX A;  2KE9 A;  1RUW A;  3M0T A;  3IQL A;  1GCQ A;  3UAT A;  3A98 A;  1B07 A;  2DRK A;  2JTE A;  2ROT A;  2CUB A;  3ULR B;  5IXB A;  2LZ6 B;  4OML A;  4EIK A;  1ZLM A;  4D8K A;  1ZBJ A;  2ABL A;  4IIO A;  3THK A;  1ZX6 A;  4AFQ C;  1GBR A;  1PKS A;  2GBQ A;  1TG0 A;  3EG1 A;  5I11 A;  1PHT A;  2O88 A;  1BB9 A;  1QKX A;  4KRT A;  2JXB A;  2M0Y A;  4JPB W;  5IH2 A;  1T3L A;  2DL5 A;  3NGP A;  1PKT A;  1QKW A;  3M0R A;  2DRM A;  2LQN A;  4X1V A;  1AD5 A;  2MOX A;  1N5Z A;  2O9V A;  2J05 A;  2W10 A;  1W6X A;  4Z89 A;  1NM7 A;  1WA7 A;  2LNH B;  4JZ3 A;  2CT3 A;  1I07 A;  2EW3 A;  3QWY A;  2D8J A;  4LUD A;  2AKK A;  2DBK A;  2DL8 A;  2I0N A;  2OAW A;  1AWX A;  1GFD A;  2X3W D;  3U23 A;  3REB B;  2K79 A;  3VS1 A;  3SHW A;  2HEQ A;  1UUE A;  1Y57 A;  2RMO A;  1CKB A;  2J06 A;  2L0A A;  2EVR A;  1ZUU A;  2KXC A;  4F14 A;  2BZY A;  2MIO A;  2PTK A;  5FW9 A;  2W0Z A;  1WLP B;  3NMZ C;  1OEB A;  1J3T A;  4IIM A;  4F17 A;  2FEI A;  2RN8 A;  2DYB A;  2EYX A;  5FWC A;  2LCS A;  1MUZ A;  1NYG A;  1UEC A;  4J9D A;  4RTW A;  1SSH A;  1KJW A;  1GCP A;  2RQV A;  1SHF A;  4R0K A;  1W70 A;  3PE0 A;  2CSQ A;  2CT4 A;  1FMK A;  1AZG B;  2DNU A;  2CH4 W;  1SHG A;  1IO6 A;  4J9B A;  2M51 A;  1VYU A;  2HCK A;  3C0C A;  1YWO A;  4J9I A;  2KXD A;  3ZL7 C;  2E5K A;  2DX1 A;  3VS0 A;  2FPD A;  2DBM A;  1QWE A;  5L23 A;  2A37 A;  4HVV A;  4AFZ C;  2O31 A;  2LJ0 A;  2KGT A;  3VRY A;  4LNP A;  4CC7 A;  1TUD A;  3M0U A;  1BBZ A;  3EGU A;  3VS3 A;  1YN8 A;  3LH5 A;  2C0T A;  3H0I A;  2FRW A;  3TSZ A;  1U06 A;  2JM8 A;  1JXO A;  5EC7 A;  4AG1 C;  2SRC A;  1GRI A;  2RNA A;  2CDT A;  5ECA A;  2DL3 A;  3CQT A;  4J9C A;  2KYM A;  2EYY A;  1WFW A;  4AG2 C;  1TUC A;  5I22 A;  2J6O A;  1E6H A;  1WXU A;  2ENM A;  1NYF A;  2K7A A;  2ED1 A;  5HCK A;  4LE9 A;  1JU5 C;  4A63 B;  1K76 A;  1UGV A;  2EQI A;  2V1Q A;  1JEG A;  3GBQ A;  2O9S A;  2KYB A;  1HD3 A;  2KR3 A;  3EG2 A;  1MV0 B;  1KIK A;  1M8M A;  2AZV A;  5IHI A;  1K9A A;  3SEM A;  1M3B A;  1WYX A;  2LJ1 A;  1K1Z A;  1B3Q A;  1AWW A;  5IHK A;  2V1R A;  1KFZ A;  1X69 A;  4LUE A;  2LMJ A;  1UG1 A;  3EG0 A;  2P4R A;  4ESR A;  2DF6 A;  1KSW A;  2LQW A;  2A08 A;  2AZS A;  1PRL C;  2KRM A;  2EBP A;  1PWT A;  4CC2 A;  2EYW A;  1PRM C;  2DL4 A;  2EGA A;  4OMM A;  2ESW A;  2RF0 A;  3TSW A;  2J6F A;  2RQW A;  3PVQ A;  2PNI A;  2NUZ A;  4F16 A;  3VRZ A;  4RTY A;  4HXJ A;  2L3Q A;  1M30 A;  2YT6 A;  2KRN A;  2DJQ A;  2AK5 A;  2L3P A;  2JMA A;  4GLM A;  1FYN A;  1AEY A;  3UA6 A;  2SEM A;  4CC3 A;  2JMC A;  2X3X D;  4RTV A;  2YUO A;  1Y0M A;  2GNC A;  1CSK A;  2JW4 A;  2FRY A;  1ZSG A;  2BZ8 A;  1RLQ C;  1OV3 A;  4LN2 A;  4J9E A;  1RI9 A;  2GGR A;  2KEA A;  4DEY A;  1E7O A;  3VS4 A;  1M27 C;  2K6D A;  1T3S A;  1PNJ A;  4HVW A;  2HBW A;  1G83 A;  2B86 A;  2EPD A;  4ORZ A;  1CKA A;  1ARK A;  2RPN A;  2LJ3 A;  4OMO A;  3TVT A;  1OPK A;  1Z9Q A;  2VVK A;  1NLO C;  1K0S A;  3NPF A;  3I9Q A;  4J9H A;  1H92 A;  2CH4 A;  3VS6 A;  1YCS B;  2D0N A;  4K11 A;  2LP5 A;  2FG0 A;  3KFV A;  4CC4 B;  3REA B;  1UJY A;  2G6F X;  1GL5 A;  1SEM A;  1S1N A;  2D1X A;  2JS2 A;  4RTZ A;  2ECZ A;  4HCK A;  2NWM A;  2DL7 A;  2YDL A;  3I5R A;  1G2B A;  4OMN A;  1UTI A;  2K3B A;  1V1C A;  3M0S A;  1GCQ C;  3VS5 A;  1BK2 A;  2CUD A;  3EHR A;  2F2X A;  1XOV A;  1X27 A;  2JS0 A;  1WIE A;  1GBQ A;  4Y92 A;  1M3A A;  1WI7 A;  5IHN A;  5GJV B;  4D8D A;  2YUP A;  2F2W A;  1AWO A;  3I35 A;  4Z8A A;  1UJ0 A;  4OMP A;  2F2V A;  4AFS C;  1T0J A;  1VYV A;  4JZ4 A;  2CSI A;  4RTU A;  2HDA A;  3H0F A;  4J9G A;  1NEG A;  2ED0 A;  2VWF A;  4OMQ A;  1X43 A;  1Z9Z A;  5FWB A;  4E6R A;  1K4U S;  3UF4 A;  2KT1 A;  4AFU C;  4JJB A;  2DIL A;  2DM1 A;  3H41 A;  2KRO A;  1U5S A;  2A28 A;  2DLP A;  1UE9 A;  2L2P A;  3VS2 A;  2RQU A;  4DEX A;  2OJ2 A;  2H8H A;  1WX6 A;  1QCF A;  3NHN A;  1VYT A;  3PVL A;  2PZ1 A;  2DMO A;  4WCI A;  1AOJ A;  1I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...