2KRSA

Solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Probable enterotoxin
publication title Solution NMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A.
rcsb
source organism Clostridium perfringens
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08239 SH3_3 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krsA01
1FMKA 4CC2A 1MV0B 1SEMA 2GBQA 1QWFA 2DMOA 2EW3A 2DA9A 4KRTA 5IHKA 4R0KA 3M0QA 1WFWA 4HXJA 2KRNA 2J05A 1GL5A 4ZNXA 2O88A 2A08A 4HVWA 1UFFA 1NLOC 1T3LA 1JU5C 2NWMA 3I35A 1XOVA 1AWJA 4D8DA 2RNAA 1Y57A 2O31A 4JZ3A 1KFZA 1VA7A 3I9QA 1PRLC 3VS2A 2IIMA 5IXBA 1V1CA 2K9GA 1SHGA 4J9HA 4JPBW 2ED1A 4HCKA 2ECZA 2AZVA 2DVJA 1ZX6A 4OMLA 4RUGA 2MCNA 1NYFA 1PNJA 2F2WA 1BBZA 1T0JA 3VS4A 1YWPA 4F14A 3H0HA 3EG2A 1S1NA 1WI7A 1AWWA 1W1FA 5I11A 3UA7A 1UE9A 4J9GA 1SHFA 1QWEA 1KIKA 2E5KA 3JV3A 2LZ6B 2JM9A 2DRKA 1I1JA 2O9SA 2JT4A 5I22A 4CC4B 2DL4A 2H8HA 3H41A 4J9EA 2L3QA 2CSQA 1Y0MA 3H0IA 4LNPA 4LUDA 4JJDA 2LCSA 1WXTA 4OMMA 3ULRB 2LJ3A 4DEXA 2JMAA 3QWYA 4ESRA 2QDLA 3TSWA 1E7OA 1AVZC 1BK2A 1JO8A 2YUPA 2AKKA 2RF0A 1VYUA 2ROLA 5L23A 2EYXA 3CQTA 2GQIA 1WYXA 2SEMA 2G6FX 4AG2C 3UA6A 2RQTA 2OJ2A 2OAWA 2KRMA 1Z9QA 1G2BA 5IHIA 2AZSA 3GBQA 4RTXA 1WA7A 2ESWA 4AFSC 3M0SA 1JQQA 2CREA 1B07A 1GBRA 2CDTA 2LJ1A 1VYTA 4RTVA 4F17A 2KROA 1W6XA 1M8MA 1KJWA 1WDXA 2HSPA 1TG0A 3VS6A 1ZUUA 2D0NA 4D8KA 3UF4A 2V1QA 2OI3A 1UTIA 2A28A 2LMJA 2J6KA 4Z89A 2YUOA 1GCPA 4GBQA 1NEGA 4OMOA 1NEBA 4JJBA 3LH5A 2A37A 1ZBJA 2EQIA 1UGVA 1X27A 5FWBA 2MOXA 1GCQC 1KSWA 1N5ZA 2J6OA 4RTYA 5EC7A 2EYYA 2KXCA 1UG1A 1PKTA 2VWFA 4LN2A 2EKHA 3RNJA 1WX6A 2JS2A 2C0OA 2HEQA 3EGUA 1JXOA 1BU1A 3NMZC 2LX7A 2KEAA 4M4ZA 3TVTA 1ZSGA 2DILA 4K11A 2KYMA 1RI9A 2J6FA 1ZUKA 3M0PA 2RPNA 2KRSA 2PNIA 2L0AA 2GNCA 2SRCA 1AEYA 2KXDA 3PVLA 2DF6A 1UHFA 1WXBA 1E6GA 1RUWA 1UJ0A 3FJ5A 2P4RA 1GFDA 2MIOA 2RN8A 1T3SA 1QKWA 4Z8AA 5IXFA 2YUQA 2DX1A 1CKAA 1JXMA 3KFVA 2K6DA 4F16A 1SSHA 2LNHB 1A0NB 2CT4A 1PKSA 2A36A 2YUNA 2YT6A 4RTZA 2DL5A 2DL7A 2CUDA 1GRIA 2K7AA 2HCKA 3SHWA 1HSQA 2D8HA 2B86A 2DJQA 1K0SA 2W0ZA 2J7IA 2K2MA 3VS0A 2V1RA 3REAB 1OV3A 2DNUA 1X43A 2I0NA 4CC3A 1BB9A 2FPFA 2L2PA 4ORZA 1EFNA 3R6NA 1M30A 1U3OA 4OMQA 4LUEA 2PZ1A 1K76A 1VYVA 2CUBA 4HVVA 1YN8A 3UATA 2ENMA 3VS3A 3EG1A 2LQNA 2KYBA 1X2QA 2BZ8A 4OMPA 3NHNA 4RTUA 1TUCA 2KT8A 2RQUA 3I5RA 1RLQC 3VRZA 1RLPC 1J3TA 2D1XA 2EBPA 3VS5A 3VRYA 2LJ0A 2DYBA 3PE0A 3IQLA 4GLMA 2X3WD 1PWTA 2GTOA 1OPLA 2KGTA 3PVQA 1FYNA 2YDLA 2KE9A 1H8KA 2ED0A 4J9BA 1UUEA 3U23A 1Z9ZA 4LE9A 2RMOA 1UJYA 1M27C 2BZYA 3C0CA 1AD5A 4J9CA 2LQWA 1SRMA 1HJDA 1QCFA 4AG1C 2O2OA 1NG2A 1UDLA 1ABOA 1U5SA 2K79A 1MUZA 3EG3A 1X6BA 2BZXA 2C0IA 2GTJA 1K0XA 2EPDA 1X6GA 5ECAA 1ABQA 3I5SA 4WCIA 2VKNA 3TSZA 2LP5A 4E6RA 4RTWA 4QT7A 3RBBB 3SEMA 1CKBA 3A98A 1X69A 2KNBB 1AZEA 2EGCA 2EYWA 3NGPA 2FG0A 2JTEA 2KR3A 4CC7A 1LCKA 1ARKA 2RQRA 1WIEA 2JMCA 5FWCA 1G83A 4IIOA 4AFZC 4JJCA 5FW9A 1NLPC 1AWXA 2ABLA 2CT3A 2HDAA 1PRMC 1AOJA 2GGRA 2FPEA 3THKA 2DE0X 2M51A 1IO6A 1GBQA 2XMFA 2W10A 1AZGB 3O5ZA 1CSKA 2DM1A 1NM7A 1M3CA 1WXUA 1QLYA 2JS0A 1GFCA 1TUDA 4FSSA 4A63B 1ZLMA 2RQVA 4IIMA 1SPKA 1UHCA 2FPDA 1MV3A 2L3SA 2EGAA 5GJVB 3M0TA 1YNZA 1OOTA 1H92A 3NPFA 2CSIA 2M0YA 4Y92A 1M3AA 1YP5A 1ZUYA 1QKXA 2DL8A 3EG0A 2CH4W 1PHTA 2CH4A 2NUZA 2J06A 3M0UA 2D8JA 2DL3A 2FRYA 2FO0A 2X3XD 4J9FA 3H0FA 3QWXX 1B3QA 5IH2A 3EHRA 3VS1A 1OPKA 4OMNA 4J9IA 1GCQA 2JW4A 4DEYA 1YWOA 1UECA 2BTTA 2HBWA 1H3HA 2AKLA 2C0TA 4J9DA 2DBMA 1T0HA 1K4US 1HD3A 4JZ4A 2DBKA 1U06A 4EIKA 4X1VA 2K3BA 2EVRA 4Z88A 2FEIA 4AFUC 2RQWA 1X2KA 1WLPB 2DLPA 2F2XA 5GJWB 3M0RA 2VVKA 5HCKA 3ZL7C 1SRLA 1YCSB 2EYZA 2FRWA 2KT1A 2F2VA 5IHNA 1M3BA 1NYGA 2AK5A 1K1ZA 2ROTA 1AWOA 4HVUA 1E6HA 2JXBA 1K9AA 2EGEA 4RTTA 3EHQA 2KBTA 2O9VA 1JEGA 2JM8A 2L3PA 3REBB 2PTKA 3VS7A 1I0CA 1I07A 4AFQC 2YSQA 1W70A 1OEBA 2DRMA
chains in the Genus database with same CATH superfamily
5FRMA 2YLBA 3F70A 2RH2A 2QQBA 2EW3A 3L2UA 1ZA1B 4HXJA 4HA8A 4MZTA 2VASA 2QG9B 4Y91A 5GAMe 1K9MC 1R0BG 3KBGA 4M7AE 3CBPA 1AWJA 2RNAA 1Q86R 1RAFB 1KFZA 4QVCA 2XD0A 3RIRA 1FMWA 2CZ7B 1D0XA 2ED1A 1ACMB 4Q5WA 2XDPA 2JUFA 3OYJA 1NYFA 1K73R 1BBZA 1VQMT 1YWPA 4F14A 1WI7A 2QK0A 1AWWA 3UA7A 1IB8A 1UE9A 2WSEE 4M75F 5GAN8 1NJIR 1SHFA 1YI2A 1I4K1 1KIKA 4CRIA 4FSXA 2DKGA 2LZ6B 3E9GA 1VQ7Q 3LLRA 4QQGA 2DEQA 4L59A 2H8HA 2CSQA 1Y0MA 2CZ0B 2P0PA 4A4GA 4OP0A 5EG2A 3HTRA 4ANJA 1K8AR 5GAOl 1WXTA 1TTHB 3ULRB 3I56T 4GLKA 2A3LA 3RERA 2OTJQ 4NL2A 5DLQE 2YUPA 1VYUA 2ROLA 4FU6A 3JCMQ 3CC2A 4M75A 1LJOA 2SEMA 4AG2C 3UA6A 3V7RA 1WJQA 8ATCB 2FVUA 2Z0WA 1G2BA 5IHIA 4WF2A 2QASA 4RTXA 4C92C 4AFSC 2CREA 1GBRA 4J5YA 1KQSP 4RTVA 3RMQA 2QAZA 1JB0E 4NOYA 1VQ8Q 1KJWA 1MNEA 1WDXA 1TG0A 1ZUUA 4M78E 4O6JA 4D8KA 3UF4A 2V1QA 2OI3A 3MO8A 3J80E 4PLIA 4XTWA 1Q81C 3CPFA 1NPRA 3QIIA 3L2ZA 2JTFA 2XG8D 3FDRA 1X27A 3QUIA 2KY9A 4E2FB 1KSWA 4RTYA 2XICA 1IHWA 1UG1A 4JRKA 4IUVA 4J6YA 2JS2A 5FRNA 2HEQA 3CBOA 3EGUA 3E9FA 1W2BS 1PCXA 2KEAA 1B7TA 2IG0A 3TVTA 1ZSGA 2EQMA 2RK2A 4KUIA 2RHYA 1ZUKA 2F5KA 2FL7A 2ZAEA 1RADB 1ZQ1A 4BACA 4HCCA 2PUOB 2VGMA 3CMAA 1WXBA 1KHIA 5GAOp 1E6GA 3CPWP 2P4RA 3C4SA 4J6WA 4AT1B 2CP0A 4Z8AA 2M16A 4C8QG 3V8LA 2YUQA 2OAUA 1MMAA 5LJ3j 1CKAA 4AMCA 1VQKA 3BY7A 1SSHA 3RDVA 3H9NA 1Q82U 2V8IA 2CT4A 1PKSA 4LD6A 2YT6A 4RTZA 3M4YA 2DL5A 2CP2A 4LXCA 2DTIA 3UT1A 5KYXB 2FZCB 3OYBA 3SHWA 4E7SA 3FLGA 4FIBA 1HSQA 4Z02A 3JCMd 4UC4A 3CC4A 1QCNA 4LDUA 3REAB 2DFUA 2DNUA 2VXFA 3QXEB 2RHUA 1SSFA 1PG5B 3LWHA 1Q86C 4KUDK 2YHTA 1M30A 1U3OA 4A54A 3S3OA 4LUEA 3VUZA 3M54A 3M58A 3MEWA 1VQLA 1VYVA 2CUBA 4HVVA 1LVKA 1YJWT 1X2QA 1VQ4A 4A4HA 5HKCA 1VQ5T 3VV0A 5LJ3e 2H3JA 5D7UA 3OYHA 1TUCA 3OSSC 3CC7A 3G6EA 1JJ2S 2HBPA 1NE8A 2D1XA 2EBPA 5KH6A 3PE0A 4OVAA 4MMKA 1K73U 2HD0A 3VYHB 1PSEA 2KGTA 3GNGA 2EAYA 2QEXT 2DERA 4C8QB 1NJIU 2ATCB 3U23A 2LT4A 4OGCA 1Z9ZA 5GAN3 2RMOA 4PJJA 1K8AC 2OTLQ 3C0CA 4L5GA 4E7ZA 2K3XA 4M75C 4MZPA 2F1LA 5D6XA 3VYGA 1SRMA 3SWNC 1OULA 5KCOA 3HSBA 3L1AA 2RI3A 4O5VA 1UDLA 1M9SA 3EG9A 2R58A 3OYCA 1M1FA 2EPDA 3QBYA 1BI0A 4IURA 1IGQA 5DY9A 4E6RA 2DD4A 4RTWA 1TU0B 2EWNA 1VOMA 1AZEA 2EGCA 1M1KC 4LDXA 1ARKA 2RQRA 5FWCA 2VV5A 2BIVA 3INZA 4JJCA 3OA6A 1AWXA 4JUVA 2MAMA 3MEUA 2FPEA 3FRNA 2JZ2A 2E4HA 3CCRT 1IO6A 1YI2T 3TCJA 4XU0A 1AZGB 3LGLA 2DM1A 3QYHB 1WXUA 4JLIA 1QLYA 1TUDA 2DZ9A 1VQMA 3OQ5A 4IIMA 4KT0E 1BIBA 1UHCA 4BB7A 2DXUA 3SDZA 2MPXC 3M0TA 4OGEA 3CCEQ 3QZ9B 3EGXA 1OOTA 2FB7A 4OB3B 3JB9D 3NPFA 4FW2A 2CSIA 2M0YA 3A5ZB 1YITA 1YP5A 3CC2T 2R5MA 4M7AD 4M77F 2NLUA 2EJ9A 3MPUB 2ZPHB 2D8JA 1WHLA 2FO0A 2E41A 3DKMA 1BKBA 3QWXX 4OMNA 4J9IA 1EX4A 1GCQA 3M57A 4DEYA 1YWOA 2XDBA 1H3HA 1VQPQ 1LOJA 2DBMA 4BI3A 1BI3A 4C8QE 1K9MR 4PL6A 4Z88A 2FEIA 5KYWB 5GAMh 2LRQA 4L6V5 5GJWB 3WXMB 4M77A 2JOYA 5HCKA 1SRLA 2EYZA 3UPUA 2K57A 1NZ9A 2FRWA 5IHNA 1M3BA 5A0LA 2XHCA 2D6FA 2AK5A 1K1ZA 1AWOA 4XTVA 3PNWC 3AHUA 1E6HA 2RI5A 4ZGDB 4PJOF 1XJWB 3J7AF 2QA4A 2KBTA 2O9VA 1QP3A 2HSEB 3EFSA 3E1SA 3JCMb 1X75C 4AFQC 4ZN3A 2DRMA 3DLLA 3HL8A 1SEMA 2FZGB 4WTOB 3OYIA 2DA9A 2O01E 4KRTA 3CMAT 1WFWA 2DTHA 3CCVQ 5GMKm 1IXDA 1G5VA 3OMGA 2A08A 3L42A 2EJFA 4HVWA 4J7IA 1JU5C 4PJOA 1XOVA 4M78D 1Y57A 4FT4A 1VA7A 1VQKT 2HNIA 3I9QA 3V7SA 4QKUA 5IXBA 1EIFA 1IZ6A 4HCKA 3HFNA 3QDFA 2ECZA 2L3RA 3FEOA 1MHNA 4RUGA 1KC8U 3QJ6A 1I5LA 2NUTA 2HQHA 3JCMV 1MNDA 4C0DC 3MJXA 1YIJQ 3VJPA 4M7DF 3OS5A 2RJCA 1W1FA 5I11A 4J9GA 1QQJA 2YRVA 2K5LA 1QWEA 3CC4T 2YWWA 3JV3A 4EPCA 5GMKi 3OYYA 1I1JA 1FXXA 1XTDA 1Q81R 3I55A 4EMKA 4F7UF 3RESA 2FYKA 3M5AA 4J9EA 5GAMf 3H0IA 4LNPA 4JJDA 1DJ7B 4MDXA 1MMNA 2RJEA 3G4SQ 5GANd 3L2RA 4PFOA 2LJ3A 1WHMA 1OZ3A 3CMEQ 2KQWA 1VQ4T 2JMAA 1E7OA 4M7DA 2AKKA 3CCSA 5GAN7 5D6YA 1U1SA 5L23A 3CC7T 2QXFA 2EYXA 2GQIA 1WYXA 4R55A 2G6FX 3CCQQ 2RQTA 2OJ2A 1S72A 3NTKA 3FB9A 3GBQA 5M9OA 4F7UA 1VQ5A 1VIFA 1KD1R 3CCJA 4JJNK 3M0SA 1B07A 2DK3A 4A4FA 1TH7A 1VYTA 2MF2A 2KDSA 3RKWA 4XAXB 2KROA 2LCLA 2HSPA 4FYYB 5AYFA 3EGDA 1QVFP 2A28A 2LMJA 2J6KA 2CP5A 2LVMA 4Z89A 1D1CA 1OYXA 1NEBA 2KI7A 3LH5A 1YJ9Q 5CAIA 1G3WA 1UGVA 2MOXA 2PVOB 1G3SA 2FZKB 3SWNB 1GCQC 1WHJA 2PU9B 1N5ZA 2EYYA 2HL3A 3A1PA 5GANj 1C6VX 1PKTA 2QQ9A 3RNJA 2KVQG 1WHGA 2ZCFB 1ZSZB 3NMZC 5KYNA 2IPOB 1N8RU 1VQNQ 1YHQA 3L2WA 1QW1A 1QVGA 1RI9A 4M77C 2CP3A 3P8DA 1YJNA 5CKEA 2DTOA 4E7HA 2GNCA 1QVPA 1UGPB 2E10A 5L8RE 1IRXA 2DF6A 3PGGA 1VQ6Q 3KUFA 4IUUA 1K9MU 3CXCP 5GAMg 3CCLA 3DB4A 3VU3C 1GFDA 5IN1A 2MIOA 2BE9B 3OW2S 1QKWA 2EFIA 1UB4A 1SKUB 1R77A 2ZPGB 1JJ2A 1Q7YC 2RM4A 1VIEA 1JXMA 3V8KA 3KFVA 2QQRA 1A0NB 3CCRA 3GP8A 1VQOQ 5LJ3h 3RR6A 3X26B 5GANe 1TOVA 3EAEA 2XK0A 2DL7A 1PD0A 3EFOA 4E7IA 1YITT 4PJOC 2D8HA 1N27A 2DJQA 3C94A 1K0SA 3LYIA 2W0ZA 3EH1A 1WJRA 1C0MA 1OV3A 1OX9A 1X43A 2RD1A 2VB6A 2I0NA 4CC3A 2CYZB 3TREA 1EFNA 4X34A 3M59A 3C95A 3MP1A 3NFCA 4CI0C 3SFMA 3LWIA 3VS3A 2LQNA 4JRQA 1M5Q1 3NHNA 2D9TA 3CCUQ 2GCXA 2QGGA 3JB9J 2BUDA 2KT8A 2LCCA 1RLQC 4EMHA 4XTUA 1M1KR 3V7CA 2YXYA 2X3WD 4DBRA 2GTOA 3PVQA 4DBQA 1FYNA 2KE9A 3JCMX 1H8KA 4J9BA 4C5IA 2CGHA 2QA4T 2RJFA 2JTMA 1UUEA 3O8VA 1TXQA 4ELYC 4M7DC 1M27C 3S6WA 1AD5A 4J9CA 1VQ7A 1UGRB 4EDUA 4BY6B 1NBEB 1SG5A 3G71T 3FIFA 2P4TA 3OYLA 1HJDA 1KG1A 5A0GA 3DB3A 6AT1B 1U5SA 2K79A 2HL5C 2DJZA 2GTJA 1VQ9Q 1K0XA 1QP2A 3A8LB 3MHXA 5ECAA 2OTJA 3LX7A 5LJ3f 3TSZA 4KGZB 3HPWA 1KK7A 2L5QA 4PFPA 1KD1C 4C8QD 3SEMA 2DO3A 3TU4K 1CKBA 3A98A 1N6AA 2AHJB 3OS0A 3BDUA 2FG0A 2JTEA 3UDCA 2KR3A 4CC7A 2X51A 3HRTA 3QJYA 1G83A 5CQXA 2CT3A 1VQLQ 4RG2A 2HDAA 1VQ8A 1AOJA 3EG9B 2DE0X 1OU9A 5GAN4 2W10A 3O5ZA 1CSKA 1NM7A 2JS0A 3I55T 2DD5A 3BFMA 3EFRA 3SD4A 1SPKA 1KHCA 1B34A 2FPDA 3CXCS 2EGAA 4ZTJA 2LTOA 4FM4B 1AT1B 4M77G 3P8BB 3CCST 2VXEA 1QKXA 2E5QA 2K4YA 2CH4W 2J06A 3M0UA 1S72T 1Q86U 1P92A 3CCMQ 2YRDA 3H0FA 1WGSA 3CCJT 1OPKA 4PJNA 4XK8E 2CP7A 2JW4A 2COYA 2HBWA 2AKLA 4J9DA 1RAAB 1K4US 3JCMJ 1FX7A 5GAOq 1SF9A 2EVRA 5LJ3g 5GAOr 2H3EB 3OB9A 2RQWA 2EQJA 5J39A 4PK4A 5GMKl 1YCSB 2D0QB 3OBWA 2KT1A 1AHJB 2F2VA 1NYGA 4PJOG 4J83A 3QZ5B 3GNFB 4XU1A 4R56A 1K8AU 3A8HB 4HVUA 4OMFB 4C5EA 4GY5A 1KQ1A 1Y07A 1ZBXA 2O4XA 1JEGA 1KQSS 2JM8A 2L3PA 3OMCA 1YHQT 5HY6A 4PLLA 4C5GA 3REBB 5DM7R 1YJNT 1WQ7A 4FYVB 1OEBA 3ZFJA 2P84A 3CCQT 2GBQA 4M77B 4A4EA 5IHKA 3SB2A 1RABB 4C92G 3CCLT 4J6XA 2J05A 2Y4XA 1M1GA 4PKCC 4JS5A 1UFFA 2NWMA 1PC0A 1M1KU 1QMCA 4D8DA 2O31A 3I56Q 1WPYA 3BDLA 3C12A 2IIMA 2K9GA 1R8OB 1SHGA 2X9HA 4JPBW 1Q95G 3JCMe 1TUGB 2AZVA 1YJ9T 2DVJA 4OMLA 1PD1A 2OTLA 1RAIB 1PNJA 2RK1A 4YTLA 3OYNA 1T0JA 3MP6A 3VS4A 2GQVA 3H0HA 5KCHA 2XI9A 3EG2A 3CPWS 1S1NA 4BI8B 2ZPBB 1YCYA 4P5NA 2E5KA 1D1BA 2X4WA 4PJOB 2DRKA 2BKDN 2O9SA 2JT4A 3PTAA 5I22A 4CC4B 3H41A 4XTXA 2R5AA 2VYTA 3T9NA 1OI1A 2QQSA 2NUTB 3QWYA 1G3YA 2QDLA 1M90R 1AVZC 1M2VB 1JO8A 4C0GA 2QQAA 2WSFE 2E1HA 3MEAA 4C92B 1I81A 1Z9QA 3GIBA 2COWA 1WA7A 1O9SA 1BI2A 5KYYB 1JQQA 2CDTA 2LJ1A 3M56A 3OW2A 4F17A 2QTXA 1W6XA 1VQ7T 1M8MA 5HK3A 2IVWA 1LNXA 5GAN2 3MCAB 4HT9A 2QI2A 4BI4A 2E3IA 2YUOA 4RMOA 1Q7YR 4OMOA 2YRCA 1NEGA 2HKNA 4GBQA 4JJBA 4X9CA 4JRIA 2A37A 5GMKj 1ZBJA 2EQKA 2EQIA 3G1JA 2CZ1B 3CCEA 2J6OA 2OTJT 2KXCA 3G71A 4M77E 5LJ5d 4BE0A 2EKHA 2NUPB 5CK9A 3PIOA 2C0OA 5GANh 3FC3A 2CP6A 1JXOA 1BU1A 2LX7A 2LNVA 4MMLA 2X4YA 2DETA 1WHKA 4LDWA 3MKDA 2RB6A 1YFNA 3M0PA 2DZCA 5I2MA 1HXDA 2M0OA 3TQ7P 1VQPA 2SRCA 1OQKA 1VQ8T 1Y96B 1AEYA 4X9DA 1JRIA 4V2SA 3PVLA 2RA2A 1RAEB 3RKXA 4E7KA 1UJ0A 2LQKA 4BD3A 2MYSA 2WACA 2RN8A 2AIRB 1T3SA 1U8RA 1MMDA 3M9QA 2LX9A 4C5HA 1QCOA 4M75G 2DX1A 1Y7XA 1YJWQ 3N5BB 5GMKe 1KQ2A 2K6DA 4EMGA 4PJOE 3CD6Q 4N4HA 4IUQA 2YUNA 5CKBA 1RACB 2RHXA 4FL6A 5DLOA 4N0AA 5GAMd 5FU7C 4B9XA 4TVRA 2CUDA 2P0QA 3PT9A 3S3MA 5LJ5j 2HCKA 4OF1A 2NYSA 2RJDA 5C0MA 2QEXQ 3HP9A 3AT1B 2EQUA 1G3TA 4PNOA 3DLMA 1WHHA 2J7IA 2K2MA 2CZ6B 2VUBA 2KAFA 2M02A 2XDDA 1W2BA 2EKOA 5D6WA 3OYMA 5KE2A 3CCVA 1BB9A 4C92E 4A53A 2FPFA 2L2PA 4N4GA 5KYWA 1OX8A 2BE7D 3R6OA 1K76A 1G8XA 4JLGA 1YN8A 2ENMA 2KYBA 1M8VA 1X6OA 3QHSA 4ELZC 1BYMA 1D3BA 3ZBDA 4RTUA 2RQUA 5GANf 4J8OA 3VUBA 3VRZA 1RLPC 1J3TA 3JB9F 2DYBA 2GFUA 3IQLA 1PM3A 4GLMA 4M7AF 1YIJA 2PVDB 4E47A 4IKFA 1OPLA 2VGNA 2MWOA 1D0ZA 2CS7A 5IT9E 3LGFA 4M75B 2RO0A 4KBMB 1UJYA 2BZYA 4J7FA 1RAGB 2M9UA 2LQWA 4BDYA 1LPLA 1Q82R 3CCRQ 4II1A 1M90C 1YI2Q 1X01A 3RMSA 3G4SA 4AG1C 4ZGJB 3HRUA 4RKUE 3HKSA 3CMEA 1PSFA 3M53A 4A4KA 3QSUA 3OS1A 4M7AA 1X6GA 4WCIA 3L2VA 3MP8A 1N8RC 3BE3A 3OBYA 3CCQA 4JRPA 3RBBB 1X69A 4FT2A 4QW2A 1D1AA 2PUKB 4ZN1A 1LCKA 4E7LA 3CC2Q 4IIOA 2X4XA 2OTLT 5FW9A 4BE1A 2ABLA 3GLXA 5LL6S 2DXCA 1N9SA 1PRMC 3THKA 5J26A 2HZYA 1GBQA 1WZOA 2XMFA 1Q7YU 4FYWB 3KXTA 1C1AA 2HQXA 1YJ9A 1M3CA 3PIPA 1GFCA 1QVGP 3QO3A 4QQ6A 1D09B 4FSSA 4A63B 1ZLMA 2C06A 2JJ9A 4M78F 5GANg 9ATCB 1N9RA 4F04B 1MV3A 3JB9I 5GJVB 1YNZA 4OB0B 1KQSA 1VQNA 1OZ2A 4HCZA 2HMAA 1H92A 3JRZA 2XIDA 3D7SB 2DXTA 2XKOC 3H6ZA 1JJ2P 3WVEB 5CVIA 3EG0A 1ZA2B 3H8ZA 1JBMA 2NUZA 2X4JA 2DL3A 1HK9A 5KYUA 2X3XD 4J9FA 2E70A 1VQ6A 1B3QA 3M4GA 4N0AC 4ZTFA 4DBFA 4M78A 4EMKC 2BTTA 1UECA 2C0TA 1B34B 1T0HA 2E3HA 2QTVA 1HD3A 1TS9A 2DBKA 1U06A 3SWNA 3OY9A 4BDZA 3LW5E 4M75E 4X1VA 1OU8A 3EH2A 3CMAQ 3X28B 1XQHA 3A8GB 2VC8A 1X2KA 1WLPB 1VQOA 5FLXE 3OYDA 4D6WA 2CKKA 1ZSZA 1I8FA 1H641 2VVKA 3CCET 2WSCE 4ZGEB 1Q81U 1BCOA 1VQKQ 1VUBA 2ROTA 2G3RA 4B6MA 5FU6C 5IAYA 3GPLA 3QYGB 3CPWA 3JCMh 2JXBA 4XTZA 1K9AA 2EGEA 4QVZA 5LJ3d 3EHQA 3A8MB 2A7YA 3VS7A 1I0CA 1M4ZA 3J81E 1I07A 1W70A 1QVFS 3OS2A 4DQ2A 1UGQB 1VQPT 1FMKA 4CC2A 1MV0B 2EJGA 3CC4Q 1QWFA 2DMOA 7AT1B 4R0KA 3M0QA 2DXBA 2E6NA 2KRNA 3OYAA 3CCUA 4KH0B 1KD1U 1GL5A 3JSCA 4ZNXA 2O88A 4QVDA 2LC4A 5HK0A 3WVDB 2OX7A 1NLOC 2E6ZA 1T3LA 3I35A 4KULA 2O4XB 4JZ3A 1UGSB 1VQ4Q 1PRLC 4XU2A 2JN0A 3VS2A 1FMVA 1V1CA 3G7ZA 4J9HA 3X24B 4C0DB 2ZZDA 3CC7Q 2K3YA 3G6EQ 4HKEA 1ZX6A 3GF5A 2MCNA 4M7AC 1Q82C 2F2WA 4OB2B 4M77D 3JCMP 5FU7B 4LD9K 1XNIA 4JDSA 2JM9A 2R57A 3PMIA 3CCVT 4ME7A 5A0DA 4XQ3A 1VQ9A 4DOWA 2DL4A 1WJSA 2L3QA 4LUDA 2LCSA 4OMMA 1W4SA 1Y71A 4LDYA 4DEXA 4ESRA 3OYKA 1QVGS 2EIFA 3TSWA 5GAN6 2KK4A 1U1TA 1BK2A 2RF0A 3JCMf 4RCBA 3CQTA 2LQ8A 4DBHA 5GAOn 2OAWA 2KRMA 4XTYA 3A8OB 3ZEHA 3EGXB 1YIJT 4PJOD 2AZSA 3E2UA 2ESWA 3OSVA 3QG1A 3CD6T 1K73C 3ASKA 4MDWA 5GAOm 3BW1A 1IREB 1NJIC 3VS6A 2D0NA 3GOXA 1UTIA 3META 3HHTB 1GCPA 3G4ST 3Q1JA 4HCBA 1KC8R 5FWBA 3CMET 4C92D 1VQMQ 4M78C 5EC7A 5CR2A 5GMKh 2COZA 2VWFA 4LN2A 2RHIA 1WX6A 4M4ZA 5A2QE 2B8AA 2V26A 2ZGWA 1RI0A 3CCMA 2DILA 4K11A 5FROA 2KYMA 1ZSZC 2J6FA 1YITQ 2RPNA 2KRSA 4BE2A 2PNIA 3VKIA 2L0AA 2MI6A 4M7DD 1TSFA 1UEBA 5KYXA 1I5OB 2KXDA 1UHFA 3NTIA 1RUWA 3FJ5A 2HAXA 1M2OA 4M7DG 5I21A 2K5FA 5IXFA 4LDVA 2V8KA 4F16A 2GF7A 3JCMg 5CKDA 1EZZB 4C8QF 2LNHB 2AT1B 2A36A 2F69A 4F7UG 4MZMA 1IHVA 2X35A 1VQNT 1GRIA 3OYEA 2K7AA 1HYOA 2PVGB 2HQEA 5LJ5h 2B86A 1F1BB 3S3NA 4NL3A 2QA4Q 3VS0A 3P8HA 2I2LA 2V1RA 2ZPFB 5CKFA 3TEEA 1WNLA 1VQ6T 1O75A 3CEYA 3FJPA 4ORZA 4C8QA 3G71Q 3R6NA 4OMQA 2PZ1A 2RHZA 2LDMA 3UATA 3EG1A 4KGVB 3I56A 1N8RR 2BZ8A 4OMPA 4EMKB 3RUXA 1RL2A 3JB9G 1VQOT 2MK5A 3I5RA 4M7AG 4Y28E 4IUTA 2E12A 3VS5A 3VRYA 2LJ0A 3QPHA 4QQDA 5CO7A 1PWTA 3JCMc 5C6SA 4KGXB 2YDLA 4M7DB 4PJLA 2ED0A 2Y90A 4E7JA 4LE9A 4PJMA 2KSSA 5FU6B 3MEVA 2XU8A 3OYFA 1V76A 3OYGA 4ATOA 3V8JA 4F7UB 1BIAA 4DA4A 1V29B 2KMTA 1D3BB 1YBYA 1QCFA 2O2OA 1NG2A 4BY6C 1ABOA 1MUZA 3EG3A 3I55Q 1X6BA 2BZXA 2C0IA 4FW1A 2QYZA 3E19A 3M55A 3CCUT 1MMGA 3PFSA 1ABQA 3EGDB 3I5SA 2VKNA 1MGQA 2LP5A 3OW2P 4C0FA 3JCMW 3UWNA 4FCYA 2DIQA 1BCMA 2ZPEB 1GXIE 4QT7A 1IGUA 4M75D 4FYXB 1WQWA 3X20B 4C0ZA 2KNBB 3JB9H 2DYIA 2EYWA 2F5TX 3NGPA 4OB1B 5LJ5f 3CCSQ 1H3ZA 1WIEA 2JMCA 2DEUA 5GAN5 4AFZC 4C92F 5CKHA 1NLPC 1S72Q 2DPPB 4B9WA 2GGRA 1KC8C 1VQ5Q 3CBMA 4M7AB 2M51A 3CCJQ 3PMTA 2JNGA 4JS4A 2P0KA 1R0CB 2K5IA 4M78G 2PQWA 2LT1A 1VQ9T 3HRSA 2RQVA 1M2VA 2JVVA 2DAQA 3QKJA 1NPPA 2V8JA 2EYQA 2L3SA 5CCAA 4VUBA 4C92A 3JAME 4BUGA 5J3BA 3QDRB 2L8DA 4RG8A 3LH0A 1ZHIA 3RKYA 5KYYA 4Y92A 1M3AA 1ZUYA 1QVFA 2DL8A 1PHTA 2CH4A 1VQLT 2FRYA 1FWZA 1YHQQ 3EFOB 4PFZA 5I2SA 5IH2A 3EHRA 3VS1A 1YJNQ 2HKQB 3G6ET 2E65A 2QDYB 4M7DE 1D0YA 5CQYA 4JZ4A 3ER0A 4EIKA 1YJWA 2L89A 3NTHA 2K3BA 5GAMj 5LJ5e 3CCLQ 3URGA 2MWPA 4AFUC 8AT1B 3CD6A 4N4IA 2DLPA 2NUPA 2F2XA 3X25B 4NS5A 4IUPA 1W2BP 2FHDA 3M0RA 4F7UE 2DVEA 3ZL7C 4C8QC 4DOVA 2A0FB 4RCCA 5LJ5g 5KYUB 2M1HA 1RAHB 2QEXA 2GFAA 3CXCA 2RI2A 4M78B 4RTTA 3L2QA 1BI1A 4XU3A 1Y96A 2ZPIB 3ME9A 3CCMT 2E64A 2DIGA 2YLCA 5KE3A 5CIUA 2PTKA 4KH1B 1M90U 1TWBA 2MMPA 2Y4YA 5AT1B 2YSQA 2QGFB 4HT8A 2K2VA 3HFOA
chains in the Genus database with same CATH topology
1FMKA 4CC2A 1MV0B 1SEMA 2GBQA 1QWFA 2DMOA 2EW3A 2DA9A 4KRTA 5IHKA 4R0KA 3M0QA 1WFWA 4HXJA 2KRNA 2J05A 1GL5A 4ZNXA 2O88A 2A08A 4HVWA 1UFFA 1NLOC 1T3LA 1JU5C 2NWMA 3I35A 1XOVA 1AWJA 4D8DA 2RNAA 1Y57A 2O31A 4JZ3A 1KFZA 1VA7A 3I9QA 1PRLC 3VS2A 2IIMA 5IXBA 1V1CA 2K9GA 1SHGA 4J9HA 4JPBW 2ED1A 4HCKA 2ECZA 2AZVA 2DVJA 1ZX6A 4OMLA 4RUGA 2MCNA 1NYFA 1PNJA 2F2WA 1BBZA 1T0JA 3VS4A 1YWPA 4F14A 3H0HA 3EG2A 1S1NA 1WI7A 1AWWA 1W1FA 5I11A 3UA7A 1UE9A 4J9GA 1SHFA 1QWEA 1KIKA 2E5KA 3JV3A 2LZ6B 2JM9A 2DRKA 1I1JA 2O9SA 2JT4A 5I22A 4CC4B 2DL4A 2H8HA 3H41A 4J9EA 2L3QA 2CSQA 1Y0MA 3H0IA 4LNPA 4LUDA 4JJDA 2LCSA 1WXTA 4OMMA 3ULRB 2LJ3A 4DEXA 2JMAA 3QWYA 4ESRA 2QDLA 3TSWA 1E7OA 1AVZC 1BK2A 1JO8A 2YUPA 2AKKA 2RF0A 1VYUA 2ROLA 5L23A 2EYXA 3CQTA 2GQIA 1WYXA 2SEMA 2G6FX 4AG2C 3UA6A 2RQTA 2OJ2A 2OAWA 2KRMA 1Z9QA 1G2BA 5IHIA 2AZSA 3GBQA 4RTXA 1WA7A 2ESWA 4AFSC 3M0SA 1JQQA 2CREA 1B07A 1GBRA 2CDTA 2LJ1A 1VYTA 4RTVA 4F17A 2KROA 1W6XA 1M8MA 1KJWA 1WDXA 2HSPA 1TG0A 3VS6A 1ZUUA 2D0NA 4D8KA 3UF4A 2V1QA 2OI3A 1UTIA 2A28A 2LMJA 2J6KA 4Z89A 2YUOA 1GCPA 4GBQA 1NEGA 4OMOA 1NEBA 4JJBA 3LH5A 2A37A 1ZBJA 2EQIA 1UGVA 1X27A 5FWBA 2MOXA 1GCQC 1KSWA 1N5ZA 2J6OA 4RTYA 5EC7A 2EYYA 2KXCA 1UG1A 1PKTA 2VWFA 4LN2A 2EKHA 3RNJA 1WX6A 2JS2A 2C0OA 2HEQA 3EGUA 1JXOA 1BU1A 3NMZC 2LX7A 2KEAA 4M4ZA 3TVTA 1ZSGA 2DILA 4K11A 2KYMA 1RI9A 2J6FA 1ZUKA 3M0PA 2RPNA 2KRSA 2PNIA 2L0AA 2GNCA 2SRCA 1AEYA 2KXDA 3PVLA 2DF6A 1UHFA 1WXBA 1E6GA 1RUWA 1UJ0A 3FJ5A 2P4RA 1GFDA 2MIOA 2RN8A 1T3SA 1QKWA 4Z8AA 5IXFA 2YUQA 2DX1A 1CKAA 1JXMA 3KFVA 2K6DA 4F16A 1SSHA 2LNHB 1A0NB 2CT4A 1PKSA 2A36A 2YUNA 2YT6A 4RTZA 2DL5A 2DL7A 2CUDA 1GRIA 2K7AA 2HCKA 3SHWA 1HSQA 2D8HA 2B86A 2DJQA 1K0SA 2W0ZA 2J7IA 2K2MA 3VS0A 2V1RA 3REAB 1OV3A 2DNUA 1X43A 2I0NA 4CC3A 1BB9A 2FPFA 2L2PA 4ORZA 1EFNA 3R6NA 1M30A 1U3OA 4OMQA 4LUEA 2PZ1A 1K76A 1VYVA 2CUBA 4HVVA 1YN8A 3UATA 2ENMA 3VS3A 3EG1A 2LQNA 2KYBA 1X2QA 2BZ8A 4OMPA 3NHNA 4RTUA 1TUCA 2KT8A 2RQUA 3I5RA 1RLQC 3VRZA 1RLPC 1J3TA 2D1XA 2EBPA 3VS5A 3VRYA 2LJ0A 2DYBA 3PE0A 3IQLA 4GLMA 2X3WD 1PWTA 2GTOA 1OPLA 2KGTA 3PVQA 1FYNA 2YDLA 2KE9A 1H8KA 2ED0A 4J9BA 1UUEA 3U23A 1Z9ZA 4LE9A 2RMOA 1UJYA 1M27C 2BZYA 3C0CA 1AD5A 4J9CA 2LQWA 1SRMA 1HJDA 1QCFA 4AG1C 2O2OA 1NG2A 1UDLA 1ABOA 1U5SA 2K79A 1MUZA 3EG3A 1X6BA 2BZXA 2C0IA 2GTJA 1K0XA 2EPDA 1X6GA 5ECAA 1ABQA 3I5SA 4WCIA 2VKNA 3TSZA 2LP5A 4E6RA 4RTWA 4QT7A 3RBBB 3SEMA 1CKBA 3A98A 1X69A 2KNBB 1AZEA 2EGCA 2EYWA 3NGPA 2FG0A 2JTEA 2KR3A 4CC7A 1LCKA 1ARKA 2RQRA 1WIEA 2JMCA 5FWCA 1G83A 4IIOA 4AFZC 4JJCA 5FW9A 1NLPC 1AWXA 2ABLA 2CT3A 2HDAA 1PRMC 1AOJA 2GGRA 2FPEA 3THKA 2DE0X 2M51A 1IO6A 1GBQA 2XMFA 2W10A 1AZGB 3O5ZA 1CSKA 2DM1A 1NM7A 1M3CA 1WXUA 1QLYA 2JS0A 1GFCA 1TUDA 4FSSA 4A63B 1ZLMA 2RQVA 4IIMA 1SPKA 1UHCA 2FPDA 1MV3A 2L3SA 2EGAA 5GJVB 3M0TA 1YNZA 1OOTA 1H92A 3NPFA 2CSIA 2M0YA 4Y92A 1M3AA 1YP5A 1ZUYA 1QKXA 2DL8A 3EG0A 2CH4W 1PHTA 2CH4A 2NUZA 2J06A 3M0UA 2D8JA 2DL3A 2FRYA 2FO0A 2X3XD 4J9FA 3H0FA 3QWXX 1B3QA 5IH2A 3EHRA 3VS1A 1OPKA 4OMNA 4J9IA 1GCQA 2JW4A 4DEYA 1YWOA 1UECA 2BTTA 2HBWA 1H3HA 2AKLA 2C0TA 4J9DA 2DBMA 1T0HA 1K4US 1HD3A 4JZ4A 2DBKA 1U06A 4EIKA 4X1VA 2K3BA 2EVRA 4Z88A 2FEIA 4AFUC 2RQWA 1X2KA 1WLPB 2DLPA 2F2XA 5GJWB 3M0RA 2VVKA 5HCKA 3ZL7C 1SRLA 1YCSB 2EYZA 2FRWA 2KT1A 2F2VA 5IHNA 1M3BA 1NYGA 2AK5A 1K1ZA 2ROTA 1AWOA 4HVUA 1E6HA 2JXBA 1K9AA 2EGEA 4RTTA 3EHQA 2KBTA 2O9VA 1JEGA 2JM8A 2L3PA 3REBB 2PTKA 3VS7A 1I0CA 1I07A 4AFQC 2YSQA 1W70A 1OEBA 2DRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMK A;  4CC2 A;  1MV0 B;  1SEM A;  2GBQ A;  1QWF A;  2DMO A;  2EW3 A;  2DA9 A;  4KRT A;  5IHK A;  4R0K A;  3M0Q A;  1WFW A;  4HXJ A;  2KRN A;  2J05 A;  1GL5 A;  4ZNX A;  2O88 A;  2A08 A;  4HVW A;  1UFF A;  1NLO C;  1T3L A;  1JU5 C;  2NWM A;  3I35 A;  1XOV A;  1AWJ A;  4D8D A;  2RNA A;  1Y57 A;  2O31 A;  4JZ3 A;  1KFZ A;  1VA7 A;  3I9Q A;  1PRL C;  3VS2 A;  2IIM A;  5IXB A;  1V1C A;  2K9G A;  1SHG A;  4J9H A;  4JPB W;  2ED1 A;  4HCK A;  2ECZ A;  2AZV A;  2DVJ A;  1ZX6 A;  4OML A;  4RUG A;  2MCN A;  1NYF A;  1PNJ A;  2F2W A;  1BBZ A;  1T0J A;  3VS4 A;  1YWP A;  4F14 A;  3H0H A;  3EG2 A;  1S1N A;  1WI7 A;  1AWW A;  1W1F A;  5I11 A;  3UA7 A;  1UE9 A;  4J9G A;  1SHF A;  1QWE A;  1KIK A;  2E5K A;  3JV3 A;  2LZ6 B;  2JM9 A;  2DRK A;  1I1J A;  2O9S A;  2JT4 A;  5I22 A;  4CC4 B;  2DL4 A;  2H8H A;  3H41 A;  4J9E A;  2L3Q A;  2CSQ A;  1Y0M A;  3H0I A;  4LNP A;  4LUD A;  4JJD A;  2LCS A;  1WXT A;  4OMM A;  3ULR B;  2LJ3 A;  4DEX A;  2JMA A;  3QWY A;  4ESR A;  2QDL A;  3TSW A;  1E7O A;  1AVZ C;  1BK2 A;  1JO8 A;  2YUP A;  2AKK A;  2RF0 A;  1VYU A;  2ROL A;  5L23 A;  2EYX A;  3CQT A;  2GQI A;  1WYX A;  2SEM A;  2G6F X;  4AG2 C;  3UA6 A;  2RQT A;  2OJ2 A;  2OAW A;  2KRM A;  1Z9Q A;  1G2B A;  5IHI A;  2AZS A;  3GBQ A;  4RTX A;  1WA7 A;  2ESW A;  4AFS C;  3M0S A;  1JQQ A;  2CRE A;  1B07 A;  1GBR A;  2CDT A;  2LJ1 A;  1VYT A;  4RTV A;  4F17 A;  2KRO A;  1W6X A;  1M8M A;  1KJW A;  1WDX A;  2HSP A;  1TG0 A;  3VS6 A;  1ZUU A;  2D0N A;  4D8K A;  3UF4 A;  2V1Q A;  2OI3 A;  1UTI A;  2A28 A;  2LMJ A;  2J6K A;  4Z89 A;  2YUO A;  1GCP A;  4GBQ A;  1NEG A;  4OMO A;  1NEB A;  4JJB A;  3LH5 A;  2A37 A;  1ZBJ A;  2EQI A;  1UGV A;  1X27 A;  5FWB A;  2MOX A;  1GCQ C;  1KSW A;  1N5Z A;  2J6O A;  4RTY A;  5EC7 A;  2EYY A;  2KXC A;  1UG1 A;  1PKT A;  2VWF A;  4LN2 A;  2EKH A;  3RNJ A;  1WX6 A;  2JS2 A;  2C0O A;  2HEQ A;  3EGU A;  1JXO A;  1BU1 A;  3NMZ C;  2LX7 A;  2KEA A;  4M4Z A;  3TVT A;  1ZSG A;  2DIL A;  4K11 A;  2KYM A;  1RI9 A;  2J6F A;  1ZUK A;  3M0P A;  2RPN A;  2KRS A;  2PNI A;  2L0A A;  2GNC A;  2SRC A;  1AEY A;  2KXD A;  3PVL A;  2DF6 A;  1UHF A;  1WXB A;  1E6G A;  1RUW A;  1UJ0 A;  3FJ5 A;  2P4R A;  1GFD A;  2MIO A;  2RN8 A;  1T3S A;  1QKW A;  4Z8A A;  5IXF A;  2YUQ A;  2DX1 A;  1CKA A;  1JXM A;  3KFV A;  2K6D A;  4F16 A;  1SSH A;  2LNH B;  1A0N B;  2CT4 A;  1PKS A;  2A36 A;  2YUN A;  2YT6 A;  4RTZ A;  2DL5 A;  2DL7 A;  2CUD A;  1GRI A;  2K7A A;  2HCK A;  3SHW A;  1HSQ A;  2D8H A;  2B86 A;  2DJQ A;  1K0S A;  2W0Z A;  2J7I A;  2K2M A;  3VS0 A;  2V1R A;  3REA B;  1OV3 A;  2DNU A;  1X43 A;  2I0N A;  4CC3 A;  1BB9 A;  2FPF A;  2L2P A;  4ORZ A;  1EFN A;  3R6N A;  1M30 A;  1U3O A;  4OMQ A;  4LUE A;  2PZ1 A;  1K76 A;  1VYV A;  2CUB A;  4HVV A;  1YN8 A;  3UAT A;  2ENM A;  3VS3 A;  3EG1 A;  2LQN A;  2KYB A;  1X2Q A;  2BZ8 A;  4OMP A;  3NHN A;  4RTU A;  1TUC A;  2KT8 A;  2RQU A;  3I5R A;  1RLQ C;  3VRZ A;  1RLP C;  1J3T A;  2D1X A;  2EBP A;  3VS5 A;  3VRY A;  2LJ0 A;  2DYB A;  3PE0 A;  3IQL A;  4GLM A;  2X3W D;  1PWT A;  2GTO A;  1OPL A;  2KGT A;  3PVQ A;  1FYN A;  2YDL A;  2KE9 A;  1H8K A;  2ED0 A;  4J9B A;  1UUE A;  3U23 A;  1Z9Z A;  4LE9 A;  2RMO A;  1UJY A;  1M27 C;  2BZY A;  3C0C A;  1AD5 A;  4J9C A;  2LQW A;  1SRM A;  1HJD A;  1QCF A;  4AG1 C;  2O2O A;  1NG2 A;  1UDL A;  1ABO A;  1U5S A;  2K79 A;  1MUZ A;  3EG3 A;  1X6B A;  2BZX A;  2C0I A;  2GTJ A;  1K0X A;  2EPD A;  1X6G A;  5ECA A;  1ABQ A;  3I5S A;  4WCI A;  2VKN A;  3TSZ A;  2LP5 A;  4E6R A;  4RTW A;  4QT7 A;  3RBB B;  3SEM A;  1CKB A;  3A98 A;  1X69 A;  2KNB B;  1AZE A;  2EGC A;  2EYW A;  3NGP A;  2FG0 A;  2JTE A;  2KR3 A;  4CC7 A;  1LCK A;  1ARK A;  2RQR A;  1WIE A;  2JMC A;  5FWC A;  1G83 A;  4IIO A;  4AFZ C;  4JJC A;  5FW9 A;  1NLP C;  1AWX A;  2ABL A;  2CT3 A;  2HDA A;  1PRM C;  1AOJ A;  2GGR A;  2FPE A;  3THK A;  2DE0 X;  2M51 A;  1IO6 A;  1GBQ A;  2XMF A;  2W10 A;  1AZG B;  3O5Z A;  1CSK A;  2DM1 A;  1NM7 A;  1M3C A;  1WXU A;  1QLY A;  2JS0 A;  1GFC A;  1TUD A;  4FSS A;  4A63 B;  1ZLM A;  2RQV A;  4IIM A;  1SPK A;  1UHC A;  2FPD A;  1MV3 A;  2L3S A;  2EGA A;  5GJV B;  3M0T A;  1YNZ A;  1OOT A;  1H92 A;  3NPF A;  2CSI A;  2M0Y A;  4Y92 A;  1M3A A;  1YP5 A;  1ZUY A;  1QKX A;  2DL8 A;  3EG0 A;  2CH4 W;  1PHT A;  2CH4 A;  2NUZ A;  2J06 A;  3M0U A;  2D8J A;  2DL3 A;  2FRY A;  2FO0 A;  2X3X D;  4J9F A;  3H0F A;  3QWX X;  1B3Q A;  5IH2 A;  3EHR A;  3VS1 A;  1OPK A;  4OMN A;  4J9I A;  1GCQ A;  2JW4 A;  4DEY A;  1YWO A;  1UEC A;  2BTT A;  2HBW A;  1H3H A;  2AKL A;  2C0T A;  4J9D A;  2DBM A;  1T0H A;  1K4U S;  1HD3 A;  4JZ4 A;  2DBK A;  1U06 A;  4EIK A;  4X1V A;  2K3B A;  2EVR A;  4Z88 A;  2FEI A;  4AFU C;  2RQW A;  1X2K A;  1WLP B;  2DLP A;  2F2X A;  5GJW B;  3M0R A;  2VVK A;  5HCK A;  3ZL7 C;  1SRL A;  1YCS B;  2EYZ A;  2FRW A;  2KT1 A;  2F2V A;  5IHN A;  1M3B A;  1NYG A;  2AK5 A;  1K1Z A;  2ROT A;  1AWO A;  4HVU A;  1E6H A;  2JXB A;  1K9A A;  2EGE A;  4RTT A;  3EHQ A;  2KBT A;  2O9V A;  1JEG A;  2JM8 A;  2L3P A;  3REB B;  2PTK A;  3VS7 A;  1I0C A;  1I07 A;  4AFQ C;  2YSQ A;  1W70 A;  1OEB A;  2DRM A; 
#chains in the Genus database with same CATH topology
 5FRM A;  2YLB A;  3F70 A;  2RH2 A;  2QQB A;  2EW3 A;  3L2U A;  1ZA1 B;  4HXJ A;  4HA8 A;  4MZT A;  2VAS A;  2QG9 B;  4Y91 A;  5GAM e;  1K9M C;  1R0B G;  3KBG A;  4M7A E;  3CBP A;  1AWJ A;  2RNA A;  1Q86 R;  1RAF B;  1KFZ A;  4QVC A;  2XD0 A;  3RIR A;  1FMW A;  2CZ7 B;  1D0X A;  2ED1 A;  1ACM B;  4Q5W A;  2XDP A;  2JUF A;  3OYJ A;  1NYF A;  1K73 R;  1BBZ A;  1VQM T;  1YWP A;  4F14 A;  1WI7 A;  2QK0 A;  1AWW A;  3UA7 A;  1IB8 A;  1UE9 A;  2WSE E;  4M75 F;  5GAN 8;  1NJI R;  1SHF A;  1YI2 A;  1I4K 1;  1KIK A;  4CRI A;  4FSX A;  2DKG A;  2LZ6 B;  3E9G A;  1VQ7 Q;  3LLR A;  4QQG A;  2DEQ A;  4L59 A;  2H8H A;  2CSQ A;  1Y0M A;  2CZ0 B;  2P0P A;  4A4G A;  4OP0 A;  5EG2 A;  3HTR A;  4ANJ A;  1K8A R;  5GAO l;  1WXT A;  1TTH B;  3ULR B;  3I56 T;  4GLK A;  2A3L A;  3RER A;  2OTJ Q;  4NL2 A;  5DLQ E;  2YUP A;  1VYU A;  2ROL A;  4FU6 A;  3JCM Q;  3CC2 A;  4M75 A;  1LJO A;  2SEM A;  4AG2 C;  3UA6 A;  3V7R A;  1WJQ A;  8ATC B;  2FVU A;  2Z0W A;  1G2B A;  5IHI A;  4WF2 A;  2QAS A;  4RTX A;  4C92 C;  4AFS C;  2CRE A;  1GBR A;  4J5Y A;  1KQS P;  4RTV A;  3RMQ A;  2QAZ A;  1JB0 E;  4NOY A;  1VQ8 Q;  1KJW A;  1MNE A;  1WDX A;  1TG0 A;  1ZUU A;  4M78 E;  4O6J A;  4D8K A;  3UF4 A;  2V1Q A;  2OI3 A;  3MO8 A;  3J80 E;  4PLI A;  4XTW A;  1Q81 C;  3CPF A;  1NPR A;  3QII A;  3L2Z A;  2JTF A;  2XG8 D;  3FDR A;  1X27 A;  3QUI A;  2KY9 A;  4E2F B;  1KSW A;  4RTY A;  2XIC A;  1IHW A;  1UG1 A;  4JRK A;  4IUV A;  4J6Y A;  2JS2 A;  5FRN A;  2HEQ A;  3CBO A;  3EGU A;  3E9F A;  1W2B S;  1PCX A;  2KEA A;  1B7T A;  2IG0 A;  3TVT A;  1ZSG A;  2EQM A;  2RK2 A;  4KUI A;  2RHY A;  1ZUK A;  2F5K A;  2FL7 A;  2ZAE A;  1RAD B;  1ZQ1 A;  4BAC A;  4HCC A;  2PUO B;  2VGM A;  3CMA A;  1WXB A;  1KHI A;  5GAO p;  1E6G A;  3CPW P;  2P4R A;  3C4S A;  4J6W A;  4AT1 B;  2CP0 A;  4Z8A A;  2M16 A;  4C8Q G;  3V8L A;  2YUQ A;  2OAU A;  1MMA A;  5LJ3 j;  1CKA A;  4AMC A;  1VQK A;  3BY7 A;  1SSH A;  3RDV A;  3H9N A;  1Q82 U;  2V8I A;  2CT4 A;  1PKS A;  4LD6 A;  2YT6 A;  4RTZ A;  3M4Y A;  2DL5 A;  2CP2 A;  4LXC A;  2DTI A;  3UT1 A;  5KYX B;  2FZC B;  3OYB A;  3SHW A;  4E7S A;  3FLG A;  4FIB A;  1HSQ A;  4Z02 A;  3JCM d;  4UC4 A;  3CC4 A;  1QCN A;  4LDU A;  3REA B;  2DFU A;  2DNU A;  2VXF A;  3QXE B;  2RHU A;  1SSF A;  1PG5 B;  3LWH A;  1Q86 C;  4KUD K;  2YHT A;  1M30 A;  1U3O A;  4A54 A;  3S3O A;  4LUE A;  3VUZ A;  3M54 A;  3M58 A;  3MEW A;  1VQL A;  1VYV A;  2CUB A;  4HVV A;  1LVK A;  1YJW T;  1X2Q A;  1VQ4 A;  4A4H A;  5HKC A;  1VQ5 T;  3VV0 A;  5LJ3 e;  2H3J A;  5D7U A;  3OYH A;  1TUC A;  3OSS C;  3CC7 A;  3G6E A;  1JJ2 S;  2HBP A;  1NE8 A;  2D1X A;  2EBP A;  5KH6 A;  3PE0 A;  4OVA A;  4MMK A;  1K73 U;  2HD0 A;  3VYH B;  1PSE A;  2KGT A;  3GNG A;  2EAY A;  2QEX T;  2DER A;  4C8Q B;  1NJI U;  2ATC B;  3U23 A;  2LT4 A;  4OGC A;  1Z9Z A;  5GAN 3;  2RMO A;  4PJJ A;  1K8A C;  2OTL Q;  3C0C A;  4L5G A;  4E7Z A;  2K3X A;  4M75 C;  4MZP A;  2F1L A;  5D6X A;  3VYG A;  1SRM A;  3SWN C;  1OUL A;  5KCO A;  3HSB A;  3L1A A;  2RI3 A;  4O5V A;  1UDL A;  1M9S A;  3EG9 A;  2R58 A;  3OYC A;  1M1F A;  2EPD A;  3QBY A;  1BI0 A;  4IUR A;  1IGQ A;  5DY9 A;  4E6R A;  2DD4 A;  4RTW A;  1TU0 B;  2EWN A;  1VOM A;  1AZE A;  2EGC A;  1M1K C;  4LDX A;  1ARK A;  2RQR A;  5FWC A;  2VV5 A;  2BIV A;  3INZ A;  4JJC A;  3OA6 A;  1AWX A;  4JUV A;  2MAM A;  3MEU A;  2FPE A;  3FRN A;  2JZ2 A;  2E4H A;  3CCR T;  1IO6 A;  1YI2 T;  3TCJ A;  4XU0 A;  1AZG B;  3LGL A;  2DM1 A;  3QYH B;  1WXU A;  4JLI A;  1QLY A;  1TUD A;  2DZ9 A;  1VQM A;  3OQ5 A;  4IIM A;  4KT0 E;  1BIB A;  1UHC A;  4BB7 A;  2DXU A;  3SDZ A;  2MPX C;  3M0T A;  4OGE A;  3CCE Q;  3QZ9 B;  3EGX A;  1OOT A;  2FB7 A;  4OB3 B;  3JB9 D;  3NPF A;  4FW2 A;  2CSI A;  2M0Y A;  3A5Z B;  1YIT A;  1YP5 A;  3CC2 T;  2R5M A;  4M7A D;  4M77 F;  2NLU A;  2EJ9 A;  3MPU B;  2ZPH B;  2D8J A;  1WHL A;  2FO0 A;  2E41 A;  3DKM A;  1BKB A;  3QWX X;  4OMN A;  4J9I A;  1EX4 A;  1GCQ A;  3M57 A;  4DEY A;  1YWO A;  2XDB A;  1H3H A;  1VQP Q;  1LOJ A;  2DBM A;  4BI3 A;  1BI3 A;  4C8Q E;  1K9M R;  4PL6 A;  4Z88 A;  2FEI A;  5KYW B;  5GAM h;  2LRQ A;  4L6V 5;  5GJW B;  3WXM B;  4M77 A;  2JOY A;  5HCK A;  1SRL A;  2EYZ A;  3UPU A;  2K57 A;  1NZ9 A;  2FRW A;  5IHN A;  1M3B A;  5A0L A;  2XHC A;  2D6F A;  2AK5 A;  1K1Z A;  1AWO A;  4XTV A;  3PNW C;  3AHU A;  1E6H A;  2RI5 A;  4ZGD B;  4PJO F;  1XJW B;  3J7A F;  2QA4 A;  2KBT A;  2O9V A;  1QP3 A;  2HSE B;  3EFS A;  3E1S A;  3JCM b;  1X75 C;  4AFQ C;  4ZN3 A;  2DRM A;  3DLL A;  3HL8 A;  1SEM A;  2FZG B;  4WTO B;  3OYI A;  2DA9 A;  2O01 E;  4KRT A;  3CMA T;  1WFW A;  2DTH A;  3CCV Q;  5GMK m;  1IXD A;  1G5V A;  3OMG A;  2A08 A;  3L42 A;  2EJF A;  4HVW A;  4J7I A;  1JU5 C;  4PJO A;  1XOV A;  4M78 D;  1Y57 A;  4FT4 A;  1VA7 A;  1VQK T;  2HNI A;  3I9Q A;  3V7S A;  4QKU A;  5IXB A;  1EIF A;  1IZ6 A;  4HCK A;  3HFN A;  3QDF A;  2ECZ A;  2L3R A;  3FEO A;  1MHN A;  4RUG A;  1KC8 U;  3QJ6 A;  1I5L A;  2NUT A;  2HQH A;  3JCM V;  1MND A;  4C0D C;  3MJX A;  1YIJ Q;  3VJP A;  4M7D F;  3OS5 A;  2RJC A;  1W1F A;  5I11 A;  4J9G A;  1QQJ A;  2YRV A;  2K5L A;  1QWE A;  3CC4 T;  2YWW A;  3JV3 A;  4EPC A;  5GMK i;  3OYY A;  1I1J A;  1FXX A;  1XTD A;  1Q81 R;  3I55 A;  4EMK A;  4F7U F;  3RES A;  2FYK A;  3M5A A;  4J9E A;  5GAM f;  3H0I A;  4LNP A;  4JJD A;  1DJ7 B;  4MDX A;  1MMN A;  2RJE A;  3G4S Q;  5GAN d;  3L2R A;  4PFO A;  2LJ3 A;  1WHM A;  1OZ3 A;  3CME Q;  2KQW A;  1VQ4 T;  2JMA A;  1E7O A;  4M7D A;  2AKK A;  3CCS A;  5GAN 7;  5D6Y A;  1U1S A;  5L23 A;  3CC7 T;  2QXF A;  2EYX A;  2GQI A;  1WYX A;  4R55 A;  2G6F X;  3CCQ Q;  2RQT A;  2OJ2 A;  1S72 A;  3NTK A;  3FB9 A;  3GBQ A;  5M9O A;  4F7U A;  1VQ5 A;  1VIF A;  1KD1 R;  3CCJ A;  4JJN K;  3M0S A;  1B07 A;  2DK3 A;  4A4F A;  1TH7 A;  1VYT A;  2MF2 A;  2KDS A;  3RKW A;  4XAX B;  2KRO A;  2LCL A;  2HSP A;  4FYY B;  5AYF A;  3EGD A;  1QVF P;  2A28 A;  2LMJ A;  2J6K A;  2CP5 A;  2LVM A;  4Z89 A;  1D1C A;  1OYX A;  1NEB A;  2KI7 A;  3LH5 A;  1YJ9 Q;  5CAI A;  1G3W A;  1UGV A;  2MOX A;  2PVO B;  1G3S A;  2FZK B;  3SWN B;  1GCQ C;  1WHJ A;  2PU9 B;  1N5Z A;  2EYY A;  2HL3 A;  3A1P A;  5GAN j;  1C6V X;  1PKT A;  2QQ9 A;  3RNJ A;  2KVQ G;  1WHG A;  2ZCF B;  1ZSZ B;  3NMZ C;  5KYN A;  2IPO B;  1N8R U;  1VQN Q;  1YHQ A;  3L2W A;  1QW1 A;  1QVG A;  1RI9 A;  4M77 C;  2CP3 A;  3P8D A;  1YJN A;  5CKE A;  2DTO A;  4E7H A;  2GNC A;  1QVP A;  1UGP B;  2E10 A;  5L8R E;  1IRX A;  2DF6 A;  3PGG A;  1VQ6 Q;  3KUF A;  4IUU A;  1K9M U;  3CXC P;  5GAM g;  3CCL A;  3DB4 A;  3VU3 C;  1GFD A;  5IN1 A;  2MIO A;  2BE9 B;  3OW2 S;  1QKW A;  2EFI A;  1UB4 A;  1SKU B;  1R77 A;  2ZPG B;  1JJ2 A;  1Q7Y C;  2RM4 A;  1VIE A;  1JXM A;  3V8K A;  3KFV A;  2QQR A;  1A0N B;  3CCR A;  3GP8 A;  1VQO Q;  5LJ3 h;  3RR6 A;  3X26 B;  5GAN e;  1TOV A;  3EAE A;  2XK0 A;  2DL7 A;  1PD0 A;  3EFO A;  4E7I A;  1YIT T;  4PJO C;  2D8H A;  1N27 A;  2DJQ A;  3C94 A;  1K0S A;  3LYI A;  2W0Z A;  3EH1 A;  1WJR A;  1C0M A;  1OV3 A;  1OX9 A;  1X43 A;  2RD1 A;  2VB6 A;  2I0N A;  4CC3 A;  2CYZ B;  3TRE A;  1EFN A;  4X34 A;  3M59 A;  3C95 A;  3MP1 A;  3NFC A;  4CI0 C;  3SFM A;  3LWI A;  3VS3 A;  2LQN A;  4JRQ A;  1M5Q 1;  3NHN A;  2D9T A;  3CCU Q;  2GCX A;  2QGG A;  3JB9 J;  2BUD A;  2KT8 A;  2LCC A;  1RLQ C;  4EMH A;  4XTU A;  1M1K R;  3V7C A;  2YXY A;  2X3W D;  4DBR A;  2GTO A;  3PVQ A;  4DBQ A;  1FYN A;  2KE9 A;  3JCM X;  1H8K A;  4J9B A;  4C5I A;  2CGH A;  2QA4 T;  2RJF A;  2JTM A;  1UUE A;  3O8V A;  1TXQ A;  4ELY C;  4M7D C;  1M27 C;  3S6W A;  1AD5 A;  4J9C A;  1VQ7 A;  1UGR B;  4EDU A;  4BY6 B;  1NBE B;  1SG5 A;  3G71 T;  3FIF A;  2P4T A;  3OYL A;  1HJD A;  1KG1 A;  5A0G A;  3DB3 A;  6AT1 B;  1U5S A;  2K79 A;  2HL5 C;  2DJZ A;  2GTJ A;  1VQ9 Q;  1K0X A;  1QP2 A;  3A8L B;  3MHX A;  5ECA A;  2OTJ A;  3LX7 A;  5LJ3 f;  3TSZ A;  4KGZ B;  3HPW A;  1KK7 A;  2L5Q A;  4PFP A;  1KD1 C;  4C8Q D;  3SEM A;  2DO3 A;  3TU4 K;  1CKB A;  3A98 A;  1N6A A;  2AHJ B;  3OS0 A;  3BDU A;  2FG0 A;  2JTE A;  3UDC A;  2KR3 A;  4CC7 A;  2X51 A;  3HRT A;  3QJY A;  1G83 A;  5CQX A;  2CT3 A;  1VQL Q;  4RG2 A;  2HDA A;  1VQ8 A;  1AOJ A;  3EG9 B;  2DE0 X;  1OU9 A;  5GAN 4;  2W10 A;  3O5Z A;  1CSK A;  1NM7 A;  2JS0 A;  3I55 T;  2DD5 A;  3BFM A;  3EFR A;  3SD4 A;  1SPK A;  1KHC A;  1B34 A;  2FPD A;  3CXC S;  2EGA A;  4ZTJ A;  2LTO A;  4FM4 B;  1AT1 B;  4M77 G;  3P8B B;  3CCS T;  2VXE A;  1QKX A;  2E5Q A;  2K4Y A;  2CH4 W;  2J06 A;  3M0U A;  1S72 T;  1Q86 U;  1P92 A;  3CCM Q;  2YRD A;  3H0F A;  1WGS A;  3CCJ T;  1OPK A;  4PJN A;  4XK8 E;  2CP7 A;  2JW4 A;  2COY A;  2HBW A;  2AKL A;  4J9D A;  1RAA B;  1K4U S;  3JCM J;  1FX7 A;  5GAO q;  1SF9 A;  2EVR A;  5LJ3 g;  5GAO r;  2H3E B;  3OB9 A;  2RQW A;  2EQJ A;  5J39 A;  4PK4 A;  5GMK l;  1YCS B;  2D0Q B;  3OBW A;  2KT1 A;  1AHJ B;  2F2V A;  1NYG A;  4PJO G;  4J83 A;  3QZ5 B;  3GNF B;  4XU1 A;  4R56 A;  1K8A U;  3A8H B;  4HVU A;  4OMF B;  4C5E A;  4GY5 A;  1KQ1 A;  1Y07 A;  1ZBX A;  2O4X A;  1JEG A;  1KQS S;  2JM8 A;  2L3P A;  3OMC A;  1YHQ T;  5HY6 A;  4PLL A;  4C5G A;  3REB B;  5DM7 R;  1YJN T;  1WQ7 A;  4FYV B;  1OEB A;  3ZFJ A;  2P84 A;  3CCQ T;  2GBQ A;  4M77 B;  4A4E A;  5IHK A;  3SB2 A;  1RAB B;  4C92 G;  3CCL T;  4J6X A;  2J05 A;  2Y4X A;  1M1G A;  4PKC C;  4JS5 A;  1UFF A;  2NWM A;  1PC0 A;  1M1K U;  1QMC A;  4D8D A;  2O31 A;  3I56 Q;  1WPY A;  3BDL A;  3C12 A;  2IIM A;  2K9G A;  1R8O B;  1SHG A;  2X9H A;  4JPB W;  1Q95 G;  3JCM e;  1TUG B;  2AZV A;  1YJ9 T;  2DVJ A;  4OML A;  1PD1 A;  2OTL A;  1RAI B;  1PNJ A;  2RK1 A;  4YTL A;  3OYN A;  1T0J A;  3MP6 A;  3VS4 A;  2GQV A;  3H0H A;  5KCH A;  2XI9 A;  3EG2 A;  3CPW S;  1S1N A;  4BI8 B;  2ZPB B;  1YCY A;  4P5N A;  2E5K A;  1D1B A;  2X4W A;  4PJO B;  2DRK A;  2BKD N;  2O9S A;  2JT4 A;  3PTA A;  5I22 A;  4CC4 B;  3H41 A;  4XTX A;  2R5A A;  2VYT A;  3T9N A;  1OI1 A;  2QQS A;  2NUT B;  3QWY A;  1G3Y A;  2QDL A;  1M90 R;  1AVZ C;  1M2V B;  1JO8 A;  4C0G A;  2QQA A;  2WSF E;  2E1H A;  3MEA A;  4C92 B;  1I81 A;  1Z9Q A;  3GIB A;  2COW A;  1WA7 A;  1O9S A;  1BI2 A;  5KYY B;  1JQQ A;  2CDT A;  2LJ1 A;  3M56 A;  3OW2 A;  4F17 A;  2QTX A;  1W6X A;  1VQ7 T;  1M8M A;  5HK3 A;  2IVW A;  1LNX A;  5GAN 2;  3MCA B;  4HT9 A;  2QI2 A;  4BI4 A;  2E3I A;  2YUO A;  4RMO A;  1Q7Y R;  4OMO A;  2YRC A;  1NEG A;  2HKN A;  4GBQ A;  4JJB A;  4X9C A;  4JRI A;  2A37 A;  5GMK j;  1ZBJ A;  2EQK A;  2EQI A;  3G1J A;  2CZ1 B;  3CCE A;  2J6O A;  2OTJ T;  2KXC A;  3G71 A;  4M77 E;  5LJ5 d;  4BE0 A;  2EKH A;  2NUP B;  5CK9 A;  3PIO A;  2C0O A;  5GAN h;  3FC3 A;  2CP6 A;  1JXO A;  1BU1 A;  2LX7 A;  2LNV A;  4MML A;  2X4Y A;  2DET A;  1WHK A;  4LDW A;  3MKD A;  2RB6 A;  1YFN A;  3M0P A;  2DZC A;  5I2M A;  1HXD A;  2M0O A;  3TQ7 P;  1VQP A;  2SRC A;  1OQK A;  1VQ8 T;  1Y96 B;  1AEY A;  4X9D A;  1JRI A;  4V2S A;  3PVL A;  2RA2 A;  1RAE B;  3RKX A;  4E7K A;  1UJ0 A;  2LQK A;  4BD3 A;  2MYS A;  2WAC A;  2RN8 A;  2AIR B;  1T3S A;  1U8R A;  1MMD A;  3M9Q A;  2LX9 A;  4C5H A;  1QCO A;  4M75 G;  2DX1 A;  1Y7X A;  1YJW Q;  3N5B B;  5GMK e;  1KQ2 A;  2K6D A;  4EMG A;  4PJO E;  3CD6 Q;  4N4H A;  4IUQ A;  2YUN A;  5CKB A;  1RAC B;  2RHX A;  4FL6 A;  5DLO A;  4N0A A;  5GAM d;  5FU7 C;  4B9X A;  4TVR A;  2CUD A;  2P0Q A;  3PT9 A;  3S3M A;  5LJ5 j;  2HCK A;  4OF1 A;  2NYS A;  2RJD A;  5C0M A;  2QEX Q;  3HP9 A;  3AT1 B;  2EQU A;  1G3T A;  4PNO A;  3DLM A;  1WHH A;  2J7I A;  2K2M A;  2CZ6 B;  2VUB A;  2KAF A;  2M02 A;  2XDD A;  1W2B A;  2EKO A;  5D6W A;  3OYM A;  5KE2 A;  3CCV A;  1BB9 A;  4C92 E;  4A53 A;  2FPF A;  2L2P A;  4N4G A;  5KYW A;  1OX8 A;  2BE7 D;  3R6O A;  1K76 A;  1G8X A;  4JLG A;  1YN8 A;  2ENM A;  2KYB A;  1M8V A;  1X6O A;  3QHS A;  4ELZ C;  1BYM A;  1D3B A;  3ZBD A;  4RTU A;  2RQU A;  5GAN f;  4J8O A;  3VUB A;  3VRZ A;  1RLP C;  1J3T A;  3JB9 F;  2DYB A;  2GFU A;  3IQL A;  1PM3 A;  4GLM A;  4M7A F;  1YIJ A;  2PVD B;  4E47 A;  4IKF A;  1OPL A;  2VGN A;  2MWO A;  1D0Z A;  2CS7 A;  5IT9 E;  3LGF A;  4M75 B;  2RO0 A;  4KBM B;  1UJY A;  2BZY A;  4J7F A;  1RAG B;  2M9U A;  2LQW A;  4BDY A;  1LPL A;  1Q82 R;  3CCR Q;  4II1 A;  1M90 C;  1YI2 Q;  1X01 A;  3RMS A;  3G4S A;  4AG1 C;  4ZGJ B;  3HRU A;  4RKU E;  3HKS A;  3CME A;  1PSF A;  3M53 A;  4A4K A;  3QSU A;  3OS1 A;  4M7A A;  1X6G A;  4WCI A;  3L2V A;  3MP8 A;  1N8R C;  3BE3 A;  3OBY A;  3CCQ A;  4JRP A;  3RBB B;  1X69 A;  4FT2 A;  4QW2 A;  1D1A A;  2PUK B;  4ZN1 A;  1LCK A;  4E7L A;  3CC2 Q;  4IIO A;  2X4X A;  2OTL T;  5FW9 A;  4BE1 A;  2ABL A;  3GLX A;  5LL6 S;  2DXC A;  1N9S A;  1PRM C;  3THK A;  5J26 A;  2HZY A;  1GBQ A;  1WZO A;  2XMF A;  1Q7Y U;  4FYW B;  3KXT A;  1C1A A;  2HQX A;  1YJ9 A;  1M3C A;  3PIP A;  1GFC A;  1QVG P;  3QO3 A;  4QQ6 A;  1D09 B;  4FSS A;  4A63 B;  1ZLM A;  2C06 A;  2JJ9 A;  4M78 F;  5GAN g;  9ATC B;  1N9R A;  4F04 B;  1MV3 A;  3JB9 I;  5GJV B;  1YNZ A;  4OB0 B;  1KQS A;  1VQN A;  1OZ2 A;  4HCZ A;  2HMA A;  1H92 A;  3JRZ A;  2XID A;  3D7S B;  2DXT A;  2XKO C;  3H6Z A;  1JJ2 P;  3WVE B;  5CVI A;  3EG0 A;  1ZA2 B;  3H8Z A;  1JBM A;  2NUZ A;  2X4J A;  2DL3 A;  1HK9 A;  5KYU A;  2X3X D;  4J9F A;  2E70 A;  1VQ6 A;  1B3Q A;  3M4G A;  4N0A C;  4ZTF A;  4DBF A;  4M78 A;  4EMK C;  2BTT A;  1UEC A;  2C0T A;  1B34 B;  1T0H A;  2E3H A;  2QTV A;  1HD3 A;  1TS9 A;  2DBK A;  1U06 A;  3SWN A;  3OY9 A;  4BDZ A;  3LW5 E;  4M75 E;  4X1V A;  1OU8 A;  3EH2 A;  3CMA Q;  3X28 B;  1XQH A;  3A8G B;  2VC8 A;  1X2K A;  1WLP B;  1VQO A;  5FLX E;  3OYD A;  4D6W A;  2CKK A;  1ZSZ A;  1I8F A;  1H64 1;  2VVK A;  3CCE T;  2WSC E;  4ZGE B;  1Q81 U;  1BCO A;  1VQK Q;  1VUB A;  2ROT A;  2G3R A;  4B6M A;  5FU6 C;  5IAY A;  3GPL A;  3QYG B;  3CPW A;  3JCM h;  2JXB A;  4XTZ A;  1K9A A;  2EGE A;  4QVZ A;  5LJ3 d;  3EHQ A;  3A8M B;  2A7Y A;  3VS7 A;  1I0C A;  1M4Z A;  3J81 E;  1I07 A;  1W70 A;  1QVF S;  3OS2 A;  4DQ2 A;  1UGQ B;  1VQP T;  1FMK A;  4CC2 A;  1MV0 B;  2EJG A;  3CC4 Q;  1QWF A;  2DMO A;  7AT1 B;  4R0K A;  3M0Q A;  2DXB A;  2E6N A;  2KRN A;  3OYA A;  3CCU A;  4KH0 B;  1KD1 U;  1GL5 A;  3JSC A;  4ZNX A;  2O88 A;  4QVD A;  2LC4 A;  5HK0 A;  3WVD B;  2OX7 A;  1NLO C;  2E6Z A;  1T3L A;  3I35 A;  4KUL A;  2O4X B;  4JZ3 A;  1UGS B;  1VQ4 Q;  1PRL C;  4XU2 A;  2JN0 A;  3VS2 A;  1FMV A;  1V1C A;  3G7Z A;  4J9H A;  3X24 B;  4C0D B;  2ZZD A;  3CC7 Q;  2K3Y A;  3G6E Q;  4HKE A;  1ZX6 A;  3GF5 A;  2MCN A;  4M7A C;  1Q82 C;  2F2W A;  4OB2 B;  4M77 D;  3JCM P;  5FU7 B;  4LD9 K;  1XNI A;  4JDS A;  2JM9 A;  2R57 A;  3PMI A;  3CCV T;  4ME7 A;  5A0D A;  4XQ3 A;  1VQ9 A;  4DOW A;  2DL4 A;  1WJS A;  2L3Q A;  4LUD A;  2LCS A;  4OMM A;  1W4S A;  1Y71 A;  4LDY A;  4DEX A;  4ESR A;  3OYK A;  1QVG S;  2EIF A;  3TSW A;  5GAN 6;  2KK4 A;  1U1T A;  1BK2 A;  2RF0 A;  3JCM f;  4RCB A;  3CQT A;  2LQ8 A;  4DBH A;  5GAO n;  2OAW A;  2KRM A;  4XTY A;  3A8O B;  3ZEH A;  3EGX B;  1YIJ T;  4PJO D;  2AZS A;  3E2U A;  2ESW A;  3OSV A;  3QG1 A;  3CD6 T;  1K73 C;  3ASK A;  4MDW A;  5GAO m;  3BW1 A;  1IRE B;  1NJI C;  3VS6 A;  2D0N A;  3GOX A;  1UTI A;  3MET A;  3HHT B;  1GCP A;  3G4S T;  3Q1J A;  4HCB A;  1KC8 R;  5FWB A;  3CME T;  4C92 D;  1VQM Q;  4M78 C;  5EC7 A;  5CR2 A;  5GMK h;  2COZ A;  2VWF A;  4LN2 A;  2RHI A;  1WX6 A;  4M4Z A;  5A2Q E;  2B8A A;  2V26 A;  2ZGW A;  1RI0 A;  3CCM A;  2DIL A;  4K11 A;  5FRO A;  2KYM A;  1ZSZ C;  2J6F A;  1YIT Q;  2RPN A;  2KRS A;  4BE2 A;  2PNI A;  3VKI A;  2L0A A;  2MI6 A;  4M7D D;  1TSF A;  1UEB A;  5KYX A;  1I5O B;  2KXD A;  1UHF A;  3NTI A;  1RUW A;  3FJ5 A;  2HAX A;  1M2O A;  4M7D G;  5I21 A;  2K5F A;  5IXF A;  4LDV A;  2V8K A;  4F16 A;  2GF7 A;  3JCM g;  5CKD A;  1EZZ B;  4C8Q F;  2LNH B;  2AT1 B;  2A36 A;  2F69 A;  4F7U G;  4MZM A;  1IHV A;  2X35 A;  1VQN T;  1GRI A;  3OYE A;  2K7A A;  1HYO A;  2PVG B;  2HQE A;  5LJ5 h;  2B86 A;  1F1B B;  3S3N A;  4NL3 A;  2QA4 Q;  3VS0 A;  3P8H A;  2I2L A;  2V1R A;  2ZPF B;  5CKF A;  3TEE A;  1WNL A;  1VQ6 T;  1O75 A;  3CEY A;  3FJP A;  4ORZ A;  4C8Q A;  3G71 Q;  3R6N A;  4OMQ A;  2PZ1 A;  2RHZ A;  2LDM A;  3UAT A;  3EG1 A;  4KGV B;  3I56 A;  1N8R R;  2BZ8 A;  4OMP A;  4EMK B;  3RUX A;  1RL2 A;  3JB9 G;  1VQO T;  2MK5 A;  3I5R A;  4M7A G;  4Y28 E;  4IUT A;  2E12 A;  3VS5 A;  3VRY A;  2LJ0 A;  3QPH A;  4QQD A;  5CO7 A;  1PWT A;  3JCM c;  5C6S A;  4KGX B;  2YDL A;  4M7D B;  4PJL A;  2ED0 A;  2Y90 A;  4E7J A;  4LE9 A;  4PJM A;  2KSS A;  5FU6 B;  3MEV A;  2XU8 A;  3OYF A;  1V76 A;  3OYG A;  4ATO A;  3V8J A;  4F7U B;  1BIA A;  4DA4 A;  1V29 B;  2KMT A;  1D3B B;  1YBY A;  1QCF A;  2O2O A;  1NG2 A;  4BY6 C;  1ABO A;  1MUZ A;  3EG3 A;  3I55 Q;  1X6B A;  2BZX A;  2C0I A;  4FW1 A;  2QYZ A;  3E19 A;  3M55 A;  3CCU T;  1MMG A;  3PFS A;  1ABQ A;  3EGD B;  3I5S A;  2VKN A;  1MGQ A;  2LP5 A;  3OW2 P;  4C0F A;  3JCM W;  3UWN A;  4FCY A;  2DIQ A;  1BCM A;  2ZPE B;  1GXI E;  4QT7 A;  1IGU A;  4M75 D;  4FYX B;  1WQW A;  3X20 B;  4C0Z A;  2KNB B;  3JB9 H;  2DYI A;  2EYW A;  2F5T X;  3NGP A;  4OB1 B;  5LJ5 f;  3CCS Q;  1H3Z A;  1WIE A;  2JMC A;  2DEU A;  5GAN 5;  4AFZ C;  4C92 F;  5CKH A;  1NLP C;  1S72 Q;  2DPP B;  4B9W A;  2GGR A;  1KC8 C;  1VQ5 Q;  3CBM A;  4M7A B;  2M51 A;  3CCJ Q;  3PMT A;  2JNG A;  4JS4 A;  2P0K A;  1R0C B;  2K5I A;  4M78 G;  2PQW A;  2LT1 A;  1VQ9 T;  3HRS A;  2RQV A;  1M2V A;  2JVV A;  2DAQ A;  3QKJ A;  1NPP A;  2V8J A;  2EYQ A;  2L3S A;  5CCA A;  4VUB A;  4C92 A;  3JAM E;  4BUG A;  5J3B A;  3QDR B;  2L8D A;  4RG8 A;  3LH0 A;  1ZHI A;  3RKY A;  5KYY A;  4Y92 A;  1M3A A;  1ZUY A;  1QVF A;  2DL8 A;  1PHT A;  2CH4 A;  1VQL T;  2FRY A;  1FWZ A;  1YHQ Q;  3EFO B;  4PFZ A;  5I2S A;  5IH2 A;  3EHR A;  3VS1 A;  1YJN Q;  2HKQ B;  3G6E T;  2E65 A;  2QDY B;  4M7D E;  1D0Y A;  5CQY A;  4JZ4 A;  3ER0 A;  4EIK A;  1YJW A;  2L89 A;  3NTH A;  2K3B A;  5GAM j;  5LJ5 e;  3CCL Q;  3URG A;  2MWP A;  4AFU C;  8AT1 B;  3CD6 A;  4N4I A;  2DLP A;  2NUP A;  2F2X A;  3X25 B;  4NS5 A;  4IUP A;  1W2B P;  2FHD A;  3M0R A;  4F7U E;  2DVE A;  3ZL7 C;  4C8Q C;  4DOV A;  2A0F B;  4RCC A;  5LJ5 g;  5KYU B;  2M1H A;  1RAH B;  2QEX A;  2GFA A;  3CXC A;  2RI2 A;  4M78 B;  4RTT A;  3L2Q A;  1BI1 A;  4XU3 A;  1Y96 A;  2ZPI B;  3ME9 A;  3CCM T;  2E64 A;  2DIG A;  2YLC A;  5KE3 A;  5CIU A;  2PTK A;  4KH1 B;  1M90 U;  1TWB A;  2MMP A;  2Y4Y A;  5AT1 B;  2YSQ A;  2QGF B;  4HT8 A;  2K2V A;  3HFO A; 
#chains in the Genus database with same CATH homology
 1FMK A;  4CC2 A;  1MV0 B;  1SEM A;  2GBQ A;  1QWF A;  2DMO A;  2EW3 A;  2DA9 A;  4KRT A;  5IHK A;  4R0K A;  3M0Q A;  1WFW A;  4HXJ A;  2KRN A;  2J05 A;  1GL5 A;  4ZNX A;  2O88 A;  2A08 A;  4HVW A;  1UFF A;  1NLO C;  1T3L A;  1JU5 C;  2NWM A;  3I35 A;  1XOV A;  1AWJ A;  4D8D A;  2RNA A;  1Y57 A;  2O31 A;  4JZ3 A;  1KFZ A;  1VA7 A;  3I9Q A;  1PRL C;  3VS2 A;  2IIM A;  5IXB A;  1V1C A;  2K9G A;  1SHG A;  4J9H A;  4JPB W;  2ED1 A;  4HCK A;  2ECZ A;  2AZV A;  2DVJ A;  1ZX6 A;  4OML A;  4RUG A;  2MCN A;  1NYF A;  1PNJ A;  2F2W A;  1BBZ A;  1T0J A;  3VS4 A;  1YWP A;  4F14 A;  3H0H A;  3EG2 A;  1S1N A;  1WI7 A;  1AWW A;  1W1F A;  5I11 A;  3UA7 A;  1UE9 A;  4J9G A;  1SHF A;  1QWE A;  1KIK A;  2E5K A;  3JV3 A;  2LZ6 B;  2JM9 A;  2DRK A;  1I1J A;  2O9S A;  2JT4 A;  5I22 A;  4CC4 B;  2DL4 A;  2H8H A;  3H41 A;  4J9E A;  2L3Q A;  2CSQ A;  1Y0M A;  3H0I A;  4LNP A;  4LUD A;  4JJD A;  2LCS A;  1WXT A;  4OMM A;  3ULR B;  2LJ3 A;  4DEX A;  2JMA A;  3QWY A;  4ESR A;  2QDL A;  3TSW A;  1E7O A;  1AVZ C;  1BK2 A;  1JO8 A;  2YUP A;  2AKK A;  2RF0 A;  1VYU A;  2ROL A;  5L23 A;  2EYX A;  3CQT A;  2GQI A;  1WYX A;  2SEM A;  2G6F X;  4AG2 C;  3UA6 A;  2RQT A;  2OJ2 A;  2OAW A;  2KRM A;  1Z9Q A;  1G2B A;  5IHI A;  2AZS A;  3GBQ A;  4RTX A;  1WA7 A;  2ESW A;  4AFS C;  3M0S A;  1JQQ A;  2CRE A;  1B07 A;  1GBR A;  2CDT A;  2LJ1 A;  1VYT A;  4RTV A;  4F17 A;  2KRO A;  1W6X A;  1M8M A;  1KJW A;  1WDX A;  2HSP A;  1TG0 A;  3VS6 A;  1ZUU A;  2D0N A;  4D8K A;  3UF4 A;  2V1Q A;  2OI3 A;  1UTI A;  2A28 A;  2LMJ A;  2J6K A;  4Z89 A;  2YUO A;  1GCP A;  4GBQ A;  1NEG A;  4OMO A;  1NEB A;  4JJB A;  3LH5 A;  2A37 A;  1ZBJ A;  2EQI A;  1UGV A;  1X27 A;  5FWB A;  2MOX A;  1GCQ C;  1KSW A;  1N5Z A;  2J6O A;  4RTY A;  5EC7 A;  2EYY A;  2KXC A;  1UG1 A;  1PKT A;  2VWF A;  4LN2 A;  2EKH A;  3RNJ A;  1WX6 A;  2JS2 A;  2C0O A;  2HEQ A;  3EGU A;  1JXO A;  1BU1 A;  3NMZ C;  2LX7 A;  2KEA A;  4M4Z A;  3TVT A;  1ZSG A;  2DIL A;  4K11 A;  2KYM A;  1RI9 A;  2J6F A;  1ZUK A;  3M0P A;  2RPN A;  2KRS A;  2PNI A;  2L0A A;  2GNC A;  2SRC A;  1AEY A;  2KXD A;  3PVL A;  2DF6 A;  1UHF A;  1WXB A;  1E6G A;  1RUW A;  1UJ0 A;  3FJ5 A;  2P4R A;  1GFD A;  2MIO A;  2RN8 A;  1T3S A;  1QKW A;  4Z8A A;  5IXF A;  2YUQ A;  2DX1 A;  1CKA A;  1JXM A;  3KFV A;  2K6D A;  4F16 A;  1SSH A;  2LNH B;  1A0N B;  2CT4 A;  1PKS A;  2A36 A;  2YUN A;  2YT6 A;  4RTZ A;  2DL5 A;  2DL7 A;  2CUD A;  1GRI A;  2K7A A;  2HCK A;  3SHW A;  1HSQ A;  2D8H A;  2B86 A;  2DJQ A;  1K0S A;  2W0Z A;  2J7I A;  2K2M A;  3VS0 A;  2V1R A;  3REA B;  1OV3 A;  2DNU A;  1X43 A;  2I0N A;  4CC3 A;  1BB9 A;  2FPF A;  2L2P A;  4ORZ A;  1EFN A;  3R6N A;  1M30 A;  1U3O A;  4OMQ A;  4LUE A;  2PZ1 A;  1K76 A;  1VYV A;  2CUB A;  4HVV A;  1YN8 A;  3UAT A;  2ENM A;  3VS3 A;  3EG1 A;  2LQN A;  2KYB A;  1X2Q A;  2BZ8 A;  4OMP A;  3NHN A;  4RTU A;  1TUC A;  2KT8 A;  2RQU A;  3I5R A;  1RLQ C;  3VRZ A;  1RLP C;  1J3T A;  2D1X A;  2EBP A;  3VS5 A;  3VRY A;  2LJ0 A;  2DYB A;  3PE0 A;  3IQL A;  4GLM A;  2X3W D;  1PWT A;  2GTO A;  1OPL A;  2KGT A;  3PVQ A;  1FYN A;  2YDL A;  2KE9 A;  1H8K A;  2ED0 A;  4J9B A;  1UUE A;  3U23 A;  1Z9Z A;  4LE9 A;  2RMO A;  1UJY A;  1M27 C;  2BZY A;  3C0C A;  1AD5 A;  4J9C A;  2LQW A;  1SRM A;  1HJD A;  1QCF A;  4AG1 C;  2O2O A;  1NG2 A;  1UDL A;  1ABO A;  1U5S A;  2K79 A;  1MUZ A;  3EG3 A;  1X6B A;  2BZX A;  2C0I A;  2GTJ A;  1K0X A;  2EPD A;  1X6G A;  5ECA A;  1ABQ A;  3I5S A;  4WCI A;  2VKN A;  3TSZ A;  2LP5 A;  4E6R A;  4RTW A;  4QT7 A;  3RBB B;  3SEM A;  1CKB A;  3A98 A;  1X69 A;  2KNB B;  1AZE A;  2EGC A;  2EYW A;  3NGP A;  2FG0 A;  2JTE A;  2KR3 A;  4CC7 A;  1LCK A;  1ARK A;  2RQR A;  1WIE A;  2JMC A;  5FWC A;  1G83 A;  4IIO A;  4AFZ C;  4JJC A;  5FW9 A;  1NLP C;  1AWX A;  2ABL A;  2CT3 A;  2HDA A;  1PRM C;  1AOJ A;  2GGR A;  2FPE A;  3THK A;  2DE0 X;  2M51 A;  1IO6 A;  1GBQ A;  2XMF A;  2W10 A;  1AZG B;  3O5Z A;  1CSK A;  2DM1 A;  1NM7 A;  1M3C A;  1WXU A;  1QLY A;  2JS0 A;  1GFC A;  1TUD A;  4FSS A;  4A63 B;  1ZLM A;  2RQV A;  4IIM A;  1SPK A;  1UHC A;  2FPD A;  1MV3 A;  2L3S A;  2EGA A;  5GJV B;  3M0T A;  1YNZ A;  1OOT A;  1H92 A;  3NPF A;  2CSI A;  2M0Y A;  4Y92 A;  1M3A A;  1YP5 A;  1ZUY A;  1QKX A;  2DL8 A;  3EG0 A;  2CH4 W;  1PHT A;  2CH4 A;  2NUZ A;  2J06 A;  3M0U A;  2D8J A;  2DL3 A;  2FRY A;  2FO0 A;  2X3X D;  4J9F A;  3H0F A;  3QWX X;  1B3Q A;  5IH2 A;  3EHR A;  3VS1 A;  1OPK A;  4OMN A;  4J9I A;  1GCQ A;  2JW4 A;  4DEY A;  1YWO A;  1UEC A;  2BTT A;  2HBW A;  1H3H A;  2AKL A;  2C0T A;  4J9D A;  2DBM A;  1T0H A;  1K4U S;  1HD3 A;  4JZ4 A;  2DBK A;  1U06 A;  4EIK A;  4X1V A;  2K3B A;  2EVR A;  4Z88 A;  2FEI A;  4AFU C;  2RQW A;  1X2K A;  1WLP B;  2DLP A;  2F2X A;  5GJW B;  3M0R A;  2VVK A;  5HCK A;  3ZL7 C;  1SRL A;  1YCS B;  2EYZ A;  2FRW A;  2KT1 A;  2F2V A;  5IHN A;  1M3B A;  1NYG A;  2AK5 A;  1K1Z A;  2ROT A;  1AWO A;  4HVU A;  1E6H A;  2JXB A;  1K9A A;  2EGE A;  4RTT A;  3EHQ A;  2KBT A;  2O9V A;  1JEG A;  2JM8 A;  2L3P A;  3REB B;  2PTK A;  3VS7 A;  1I0C A;  1I07 A;  4AFQ C;  2YSQ A;  1W70 A;  1OEB A;  2DRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...