2KRSA

Solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
b'MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable enterotoxin
publication title Solution NMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A.
rcsb
source organism Clostridium perfringens
molecule tags Structural genomics, unknown function
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08239 SH3_3 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krsA01
1SEMA 1J3TA 2F2WA 1HD3A 2RPNA 1GBRA 2M0YA 2EYWA 1E6HA 1T0JA 1PHTA 2CH4A 1PNJA 2JS2A 3NHNA 1BK2A 1QKWA 1OPLA 1W70A 2VVKA 1U06A 4Z89A 2EGEA 1SHGA 1I07A 2LP5A 3A98A 1Z9ZA 2DJQA 1RI9A 3VS6A 4ESRA 2P4RA 2W0ZA 2DM1A 4LN2A 2AZSA 2X3XD 2NUZA 2DLPA 2JW4A 4J9BA 3H0FA 1M27C 1UTIA 2CH4W 2J6OA 3M0RA 1AWOA 2EKHA 3UA6A 2AZVA 2I0NA 4QT7A 5HCKA 1WX6A 4EIKA 3NMZC 2DA9A 5I11A 2KEAA 1HSQA 1BB9A 1QWEA 1TUDA 4D8KA 2KR3A 2DL3A 1NYGA 2LX7A 4JZ4A 4R0KA 1H92A 4LE9A 1T0HA 2DRKA 2LJ1A 1GCQA 1SRMA 2GQIA 2KROA 2VWFA 2W10A 1KFZA 1WFWA 1G2BA 3CQTA 1BU1A 3R6NA 1YNZA 2JXBA 1ZUKA 2O88A 1WI7A 2HBWA 1BBZA 1YWOA 2DL7A 4AFQC 1KIKA 4OMOA 3SHWA 2C0IA 2PZ1A 3SEMA 1T3LA 1FMKA 4OMNA 1AWXA 1T3SA 5IH2A 1U3OA 2LQWA 2LQNA 2KBTA 4Z88A 4IIMA 4LNPA 1I1JA 3I35A 4J9CA 5IHKA 2ED1A 1K9AA 1QKXA 2CT4A 3H41A 2J05A 1NYFA 2KRMA 2DL4A 2FRWA 1A0NB 2D8HA 1QLYA 2EYYA 2RQTA 3LH5A 2SRCA 4HVUA 1H3HA 2YUNA 2BZXA 3IQLA 2D0NA 2J6FA 3UF4A 1G83A 2FO0A 2FPEA 2G6FX 1UUEA 1K76A 4J9EA 1B07A 1WXTA 2K7AA 5EC7A 4GLMA 2DE0X 4RTXA 2O9VA 5L23A 1KJWA 2LJ3A 3NPFA 2GBQA 2HCKA 2YDLA 2CSQA 1OV3A 4ZNXA 3VS7A 4J9DA 2D8JA 2OAWA 3VRZA 2HEQA 1M8MA 3M0TA 1YCSB 2H8HA 2GTOA 2K3BA 2LMJA 3NGPA 3M0SA 1GCPA 1QCFA 2RMOA 5GJWB 2CDTA 3THKA 3VS3A 1MV0B 2A37A 2ENMA 4CC3A 1X2KA 2EQIA 2OJ2A 2LCSA 1MV3A 2K2MA 2CREA 3I9QA 2B86A 2AKKA 4HVVA 1WXUA 2JM8A 2ED0A 2DNUA 2BZ8A 1AZGB 5FWCA 2KRSA 2JM9A 2J6KA 1UG1A 3EHRA 1Y0MA 1VYTA 4RTWA 1K1ZA 1X69A 2MIOA 2BZYA 2NWMA 2K9GA 3QWXX 1JXMA 1UJYA 2KE9A 1S1NA 2PTKA 2M51A 4RUGA 2RQWA 4DEXA 4OMPA 2KYBA 2QDLA 3RBBB 3M0QA 2DL5A 1SHFA 2BTTA 2KGTA 4Z8AA 2EGCA 2X3WD 1VA7A 2DF6A 4RTUA 2VKNA 5FWBA 1B3QA 1ARKA 1X43A 1UGVA 1X6GA 4GBQA 2GNCA 1HJDA 1E7OA 5IXFA 1K0XA 1OPKA 2JMCA 3VS1A 3M0UA 2V1RA 1AWWA 2A28A 4A63B 4J9FA 4FSSA 3EGUA 2HSPA 1NEBA 4F14A 2RQRA 1KSWA 4E6RA 2L0AA 4IIOA 4RTTA 2RN8A 5FW9A 2C0TA 2PNIA 1AVZC 1ZSGA 1I0CA 1GRIA 3PE0A 3ULRB 2LJ0A 3U23A 4HVWA 1SRLA 1Y57A 2YUOA 2XMFA 2DRMA 2DL8A 1X27A 2L3SA 4AG2C 4X1VA 5IHIA 2AK5A 2F2VA 2KYMA 2CSIA 2LNHB 1ZUYA 3H0IA 4HXJA 3REAB 1GL5A 2DBKA 1CSKA 1CKAA 3EG3A 3I5RA 4J9IA 4M4ZA 1WLPB 3GBQA 4J9GA 4K11A 2DVJA 1PWTA 2JT4A 1PRMC 5GJVB 1UE9A 1NM7A 1M30A 2ROTA 3VS4A 2LZ6B 2JMAA 3VS5A 4AFSC 1GFCA 2L3QA 2DBMA 2V1QA 3EG0A 4JJBA 2OI3A 1ZUUA 2YUQA 1M3CA 2FG0A 2O9SA 2AKLA 2DMOA 2YSQA 1TG0A 1UDLA 1QWFA 1WYXA 1VYUA 2CUDA 2EVRA 2RQVA 1E6GA 4JPBW 1AWJA 1GCQC 2YT6A 1NEGA 1N5ZA 1YN8A 2MCNA 4J9HA 2DYBA 5I22A 4OMMA 1GBQA 1PRLC 4AG1C 2FPDA 2ABLA 1AOJA 1GFDA 2JS0A 2L2PA 2EPDA 1NLOC 2ECZA 2YUPA 3VRYA 3I5SA 3QWYA 2O2OA 4HCKA 3TVTA 4JJDA 2DX1A 2RNAA 2A36A 1X2QA 1V1CA 1AEYA 1UHFA 4CC2A 3VS0A 4OMQA 1RUWA 4F17A 1IO6A 1W6XA 1AD5A 1NG2A 4JJCA 1W1FA 1JEGA 1X6BA 1ZLMA 3PVLA 4LUDA 4CC7A 1K4US 1PKTA 1ZX6A 2O31A 3REBB 2A08A 2KRNA 2EYZA 1ABQA 1UJ0A 1Z9QA 4RTZA 3PVQA 1JXOA 2J7IA 1U5SA 2GGRA 1RLQC 4WCIA 1SSHA 5IXBA 2FEIA 3EG2A 1OOTA 1JU5C 1TUCA 5IHNA 2EGAA 2JTEA 2DILA 2KXDA 2CT3A 4KRTA 2RQUA 1WXBA 4DEYA 1WIEA 2FPFA 2KNBB 2L3PA 4RTYA 1VYVA 3EHQA 1ABOA 3TSWA 3TSZA 2RF0A 1UECA 2EW3A 2SEMA 1WDXA 4AFZC 1SPKA 1OEBA 2D1XA 1UFFA 2MOXA 2C0OA 1K0SA 4Y92A 1ZBJA 4D8DA 1AZEA 1RLPC 2E5KA 3UA7A 3EG1A 4LUEA 1EFNA 3JV3A 2ROLA 2K79A 2IIMA 2EBPA 3VS2A 3UATA 4OMLA 1XOVA 3FJ5A 2J06A 1LCKA 2EYXA 2CUBA 2K6DA 4AFUC 3ZL7C 4JZ3A 4F16A 1M3BA 1CKBA 1NLPC 2F2XA 3H0HA 1MUZA 2KT8A 4RTVA 2FRYA 1FYNA 3O5ZA 1JQQA 1PKSA 2HDAA 1H8KA 2ESWA 2KXCA 1YWPA 1M3AA 5ECAA 2GTJA 3RNJA 1YP5A 3C0CA 4CC4B 1UHCA 3M0PA 1JO8A 1WA7A 2KT1A 3KFVA 4ORZA
chains in the Genus database with same CATH superfamily
2VB6A 2O4XB 4C0DC 1T0JA 1PNJA 3HRSA 3NHNA 2KDSA 1M9SA 3UPUA 2VVKA 1VQLQ 1SHGA 1I07A 1Z9ZA 4PKCC 1RI9A 2RHYA 3MP8A 3I56Q 1M1KR 3X25B 2VGNA 4J9BA 3CBPA 2J6OA 3M0RA 4KGXB 3UA6A 3RIRA 1PCXA 1MHNA 1WX6A 2HQXA 4EIKA 2X35A 3JCMb 3G6EQ 5I11A 5D6YA 4FYVB 3E9FA 2FVUA 5CO7A 3I55Q 3NTKA 3N5BB 4R0KA 4LE9A 2DRKA 2RI5A 1ZSZC 1VQ4Q 4ME7A 2LCCA 4M7AA 2RH2A 2K5FA 1YJWT 2OTJA 1YNZA 2JXBA 3S3MA 4J8OA 2OTLT 1F1BB 1BBZA 5AYFA 3OYEA 2PZ1A 2QA4Q 2BE7D 4J6WA 4OMNA 1QP2A 1U3OA 2LQNA 4M77D 2KBTA 2ZCFB 1VQLA 2BKDN 4Y91A 4EMKC 1PD1A 2VYTA 1XJWB 4E7LA 2IPOB 3KBGA 5IHKA 3I56A 1M90R 3OS1A 1D0ZA 2K5IA 2KRMA 3J80E 1LNXA 3LH5A 2SRCA 1VQMQ 3DLMA 2HMAA 1X75C 3SDZA 3G6EA 5KYWA 3QO3A 3UF4A 4M7DB 2VASA 2G6FX 4Z02A 1B7TA 1WXTA 4E7KA 1VQ4A 2HL5C 4FM4B 4IURA 5FU6C 1KJWA 1VQ5Q 2GBQA 2XKOC 5J3BA 4ZNXA 3HRUA 1YITQ 4LD6A 5GAMd 2OAWA 2HEQA 4C92G 1YCSB 4MDXA 4M7DF 2LMJA 1BYMA 2QA4A 3M0SA 2OX7A 5GJWB 1I8FA 3VS3A 3EH2A 2A37A 2ENMA 4CC3A 4QW2A 2LCSA 2LDMA 2GQVA 5IT9E 3E1SA 1TWBA 1WXUA 5LJ5e 2DNUA 2BZ8A 2J6KA 1Y0MA 1ZA1B 3QG1A 3CD6Q 4RTWA 3CBMA 5CVIA 3VUBA 1M2OA 4WTOB 2NWMA 4PL6A 2QTVA 5KYXB 1VQMA 4R56A 2EQKA 3A8GB 5CQXA 4IKFA 3M0QA 2QDYB 2LNVA 4X9DA 1ZBXA 4PJLA 4ZGDB 1K9MC 1W2BA 1IGUA 2DTHA 4KGVB 1TU0B 4F04B 3VYHB 5CKBA 1VQ5A 2GNCA 1HJDA 1E7OA 1VQ6T 2RM4A 1YITA 3M0UA 3CCVT 2F5TX 3RESA 3F70A 4HKEA 1KSWA 1VQ7T 4RG8A 2CP7A 3G4ST 2CP0A 1G3TA 3JCMe 4PLLA 1VQNT 2DXTA 1RAGB 2C0TA 2LX9A 2PNIA 4IUPA 5FW9A 3JB9H 1WZOA 3QHSA 4FT4A 1I0CA 3QDFA 1DJ7B 4A4GA 3CD6A 2MWOA 3GNGA 3QJ6A 5IAYA 2DXUA 1V29B 3RKXA 5LJ3e 1NJIR 2L3SA 4AG2C 4X1VA 1Y71A 3SD4A 1KK7A 5IHIA 3A5ZB 3G7ZA 2DEUA 1K73U 3J7AF 1GL5A 3M55A 3CCRQ 4N0AC 4KGZB 1W2BP 4JUVA 5DLOA 4OGEA 1WLPB 3GBQA 4J9GA 2DVJA 3HFNA 2JT4A 3EH1A 2R5AA 2VXEA 1NE8A 2ROTA 2D0QB 3VS4A 1VQKQ 2DXBA 4Y28E 3V8LA 5D7UA 3OS2A 2FZKB 2LT1A 1XNIA 2E6NA 4QVCA 3VV0A 5LJ5f 2KVQG 4UC4A 3L2VA 4KUIA 1OI1A 4M7AG 3A8LB 1BKBA 1QWFA 4KH1B 2CUDA 3RKYA 1PC0A 4QQGA 3PIOA 5EG2A 3A8MB 3PNWC 1AWJA 2YT6A 2X4WA 4M7DD 2DYIA 4J9HA 4FW1A 5I22A 4OMMA 2NUTA 4C8QB 1C1AA 1KC8R 1GBQA 4AG1C 2QXFA 3AT1B 3FEOA 2Y4XA 2JS0A 1RADB 1W2BS 4LDXA 3URGA 1SF9A 1KQ2A 3RKWA 3VRYA 3RMSA 3QWYA 3OSSC 3CCRA 5GAMj 2OTJT 5HK3A 4JJDA 2A3LA 2L3RA 1N8RR 1YIJT 5GANg 1BCMA 4HCZA 2XG8D 4J7FA 1UHFA 3WVEB 3JB9I 4OMQA 4C8QF 3FB9A 2RJDA 1VQKA 3JB9G 2XI9A 3O8VA 2G3RA 2X51A 1AD5A 1VQLT 4PJOB 2QQSA 5GAN5 3JCMf 3I56T 1ZLMA 5DLQE 4CC7A 2AHJB 1ABQA 1MMDA 2AIRB 2R5MA 1VQPQ 3CC4T 4M78B 1UJ0A 8ATCB 4NL3A 3VKIA 3PVQA 5LJ3f 2J7IA 2GGRA 4PJOF 3OSVA 2P84A 3SWNB 1P92A 5IHNA 3MEVA 2KXDA 1SKUB 2DPPB 1WXBA 2YHTA 1D1CA 1VQ4T 3CMEA 2FPFA 4JJNK 1IHVA 5HY6A 1ABOA 3OMCA 3TSZA 2EW3A 2XDPA 3HHTB 4M78F 1OZ2A 2H3JA 2FB7A 2B8AA 4QVDA 5CCAA 2EIFA 1K0SA 3E9GA 1G3YA 1RLPC 2E5KA 5C6SA 4LUEA 1EFNA 4FL6A 2RHXA 2ROLA 1IZ6A 2K79A 1JB0E 2EBPA 3RDVA 3QDRB 3UATA 5CKDA 4L59A 2DXCA 2MK5A 3FJ5A 2HD0A 1H641 2P0QA 4J5YA 3ZL7C 3EGDA 3FJPA 1QVFA 2Z0WA 2FRYA 2JOYA 1VQPA 2V8JA 4VUBA 1VIEA 3QIIA 4BACA 1UGQB 2KXCA 3ZBDA 4BDZA 4E7JA 1M3AA 1VQ8Q 5ECAA 2DAQA 1YJNQ 2RK1A 1UHCA 3M0PA 4M77C 5GAN8 1Q86R 3JCMc 4OB1B 3JCMJ 1QCOA 1J3TA 2F2WA 1VOMA 3OS0A 2E6ZA 2M0YA 2EYWA 1E6HA 2HL3A 2PVGB 1PHTA 3JRZA 6AT1B 1OPLA 2VV5A 1U8RA 3CC2Q 4Z89A 2RI3A 2EGEA 3X20B 2LP5A 3A98A 1BI0A 3D7SB 4X9CA 3C95A 4GY5A 2W0ZA 2X3XD 4OP0A 3PT9A 1O9SA 3DB3A 1AWOA 4DBQA 3L2WA 4QT7A 1X01A 2VGMA 2QTXA 2DA9A 2MAMA 2KEAA 5J26A 2XDDA 2EKOA 4JS5A 2C06A 2M16A 1QWEA 3CMAQ 1QVFP 4C8QD 4QQDA 2DL3A 2HQHA 2LX7A 4NS5A 1H92A 1T0HA 4C92B 4KT0E 2QK0A 2BE9B 1GCQA 2GQIA 3RUXA 2VWFA 1VQ8A 1YJNA 1Q81R 4OMFB 3QJYA 3BE3A 1BU1A 5DY9A 2XICA 1K9MU 3J81E 1ZUKA 4HT8A 5GMKm 3ASKA 4OMOA 3L2RA 3SEMA 4XU1A 1T3LA 2DZ9A 5IH2A 2DK3A 3BDUA 4L6V5 3MEUA 4C92F 3V7RA 3EGXB 3CC2A 4E47A 4IIMA 4PJOD 5GANh 4LNPA 1I1JA 2PVOB 3H41A 3CCMQ 2L89A 4BB7A 2J05A 2LC4A 2RO0A 3VUZA 2V8IA 4XU0A 4M78D 4DOWA 1H3HA 2YUNA 1QVFS 3IQLA 1JJ2P 1I5OB 2A0FB 1LVKA 2FPEA 3CMAA 1Q82R 4KUDK 4J9EA 3OA6A 3GPLA 2QGFB 3P8HA 5EC7A 1VQ9T 4FYXB 3G71Q 5L23A 1YJ9Q 3QUIA 3RERA 1OV3A 3CCRT 5CR2A 1M8MA 3M0TA 2GTOA 4JRPA 1KC8C 1GCPA 3THKA 2RMOA 1Y7XA 4M7DE 1MV3A 1IREB 1U1SA 3I9QA 3OW2A 3DLLA 1AT1B 1WJRA 2ED0A 4OB0B 5FWCA 2E4HA 2HNIA 2PQWA 1N9SA 3EHRA 4PK4A 3CCMA 2CZ0B 4RG2A 2E64A 4EMHA 2K9GA 3QWXX 3TEEA 1UJYA 3WXMB 1YI2T 2PTKA 1XTDA 2M51A 3FC3A 2RQWA 2IG0A 2DL5A 2COWA 2KGTA 2X3WD 4GLKA 1M1KU 5LJ5g 4J6XA 3OYLA 5A0GA 4RTUA 2VKNA 1ARKA 1B3QA 3GLXA 3G71A 2E5QA 2CP5A 3META 3CEYA 3CMET 4GBQA 1YJ9A 2K3XA 2XHCA 1K0XA 3S3NA 1G5VA 3A8OB 1AWWA 3ME9A 4M7AB 2A28A 4BI4A 5LJ5d 3QZ5B 2EWNA 4M7DC 5GMKl 3JCMW 4E6RA 4RKUE 4ZN3A 4ZGEB 3OW2P 4IIOA 3PGGA 1TS9A 2EJFA 1ZSGA 1R77A 2K2VA 4YTLA 2QASA 2QEXQ 3ULRB 3M53A 4A53A 1IB8A 4M7AF 2V8KA 2XMFA 2LT4A 4ELZC 3HRTA 2DRMA 2QGGA 4C92D 5I2MA 2CYZB 2AK5A 2F2VA 3JCMg 4HXJA 3H0IA 3REAB 2RK2A 5GAMg 2DBKA 1CKAA 3I5RA 4J9IA 5KYWB 1Q7YC 3I55A 1ZSZA 2R57A 1VQOQ 5GJVB 1M5Q1 4MZTA 5LJ3g 1PD0A 2ZZDA 1I4K1 3FRNA 1GFCA 1K8AC 2DBMA 1W4SA 3JCMd 5GAN4 2XDBA 4M75D 2OI3A 4A4HA 2O9SA 4LDYA 3OW2S 3JB9F 1OQKA 2DIGA 1TH7A 5GMKh 3MKDA 2ZPHB 5LJ3d 4EMKA 3TCJA 3BDLA 2HKQB 1VYUA 5GMKj 2RQVA 4IUVA 1E6GA 4JPBW 2QEXA 2L8DA 1NEGA 2QQRA 1AHJB 2RD1A 1YN8A 2QI2A 3H6ZA 4PFZA 1IHWA 2FL7A 2CGHA 1PRLC 3DKMA 4D6WA 2YRCA 1AOJA 3CC7Q 2VXFA 3A8HB 1M1FA 3S3OA 4MZMA 1YJNT 3I5SA 2O2OA 3H8ZA 4O6JA 3GIBA 2DX1A 2A36A 1QP3A 1VQOA 1YBYA 2DERA 3X26B 3HPWA 4CC2A 4EMGA 4F17A 3OYKA 3OYIA 4LD9K 3M9QA 1YHQQ 1X6BA 2WSEE 2KRNA 3OYNA 2EYZA 7AT1B 3P8DA 3RMQA 2QQAA 2M02A 4RTZA 4A4EA 3X28B 5C0MA 4KULA 1WQWA 4B9WA 2FHDA 1LPLA 4KH0B 3A1PA 1OU9A 3EG2A 3CMAT 3SB2A 4BI8B 1JU5C 4C0ZA 3CCEQ 9ATCB 2JTEA 1BI2A 4KRTA 3LWIA 3CC7A 3MHXA 3R6OA 1TXQA 2KNBB 1VYVA 2KQWA 5LJ5h 2ZPBB 4XQ3A 2FYKA 1UECA 1WDXA 4JDSA 4M7AD 1S72Q 5LJ5j 3HP9A 3LYIA 4Y92A 1K73R 1KG1A 3UA7A 3L1AA 4CI0C 2IIMA 4E2FB 4FYYB 5KYYA 2YXYA 4C8QC 4A54A 2LQKA 2RB6A 1WJQA 2J06A 1LCKA 2DD5A 5J39A 3WVDB 4RMOA 1N9RA 1YHQA 1SG5A 4BY6B 4AFUC 3CCMT 1KD1C 1MUZA 4RTVA 1C0MA 4FT2A 4QVZA 1FYNA 1BIAA 2HDAA 1H8KA 2QAZA 4FCYA 2GTJA 4F7UE 1YP5A 2DTIA 4CC4B 3JB9D 1KQ1A 1WA7A 1UGSB 2KT1A 3HL8A 4DBFA 3OYCA 4PJOC 5GAOl 3CCEA 1M1KC 3P8BB 1SEMA 1HD3A 3G71T 2RPNA 3OYYA 4ZN1A 2NUTB 3JCMh 2M0OA 2JS2A 2PUKB 5GAMh 4N0AA 1BK2A 1QKWA 4M78C 2EQJA 1EZZB 1S72A 2HQEA 1W70A 1U06A 3ZEHA 2NUPA 5I21A 2DJQA 1KC8U 4XTVA 5LJ3h 2CP2A 4XTXA 2NUZA 1G3WA 2DLPA 4DOVA 3SWNC 1UGPB 1M27C 1UTIA 2CH4W 1WNLA 3H0FA 3TREA 5LJ3j 2EKHA 2I0NA 5HCKA 2V26A 1WHKA 2E3IA 2JN0A 3E2UA 3EFRA 4C5IA 1D0XA 3SFMA 1YJWQ 3UDCA 1HSQA 1BB9A 1TUDA 2OTLQ 1JBMA 2KR3A 4ZTJA 1NYGA 4ZTFA 2KROA 2W10A 1KFZA 1WFWA 1G2BA 1C6VX 3G6ET 3DB4A 2YLBA 3R6NA 1BCOA 4LDWA 2KSSA 1M90C 1WI7A 3C12A 2YLCA 2HBWA 1BI3A 1YWOA 3I55T 2XU8A 5KYUA 2MYSA 3SHWA 2C0IA 4M77E 4L5GA 1FMKA 3PTAA 1T3SA 3TQ7P 2LQWA 3L2QA 3OQ5A 3NFCA 3G1JA 3AHUA 3I35A 2HZYA 5IN1A 4J9CA 2ED1A 2R58A 1KHIA 4HA8A 1KHCA 4AMCA 3MO8A 1NYFA 2QA4T 3M58A 4ELYC 1KQSA 1IXDA 1TUGB 2FRWA 1A0NB 4DA4A 1QLYA 2RQTA 2IVWA 4HVUA 4BDYA 4OB2B 2CKKA 4MMLA 1QVGA 2KK4A 1BI1A 2BZXA 1PG5B 1MMNA 2KY9A 2D0NA 1YJWA 3CPWA 2BIVA 2FO0A 2OTLA 5FU7B 1UUEA 3EGDB 1K76A 3JAME 1B07A 3ER0A 2DE0X 2O9VA 2COYA 4IUTA 4M75E 3JCMQ 1VQMT 4X34A 2M1HA 5CKHA 3NPFA 2HCKA 1H3ZA 3KUFA 1Q7YU 3LX7A 3VS7A 4J9DA 2JJ9A 1FX7A 2H8HA 3OYGA 5CKFA 2O01E 1EX4A 1MV0B 3OB9A 3FLGA 3ZFJA 2I2LA 1WHHA 1K8AU 2OJ2A 3CCQQ 2JUFA 2K2MA 1VQ5T 4C92C 3VJPA 2AKKA 2WSFE 1YITT 2JM8A 4FU6A 2KRSA 2JM9A 3JCMV 1VYTA 5GANe 1K1ZA 1X69A 2MIOA 1KQSP 1JXMA 5KCOA 1OX9A 1S1NA 4DEXA 2RHUA 2KYBA 4OMPA 3RBBB 1QVGP 1RAAB 2BTTA 4Z8AA 5KE2A 1VQ6Q 3CPWP 2EGCA 3EFOA 1VA7A 3M5AA 2LTOA 3CCVQ 1JJ2A 3CD6T 3X24B 1WQ7A 2EFIA 2DF6A 4M75C 3T9NA 5FROA 3OYBA 5FWBA 4WF2A 1X43A 1VQ7Q 1D1AA 2M9UA 4PJMA 1X6GA 1ACMB 3G4SQ 4M77A 1OULA 2COZA 1OPKA 1ZA2B 2JMCA 2QYZA 2V1RA 1NZ9A 1V76A 3HSBA 4TVRA 4EPCA 2E70A 3CXCA 2FZGB 1K9MR 1NEBA 2K3YA 2RQRA 1NJIC 1Y07A 5D6WA 3CCUQ 3CCQA 1JRIA 1HK9A 3JSCA 4RTTA 2P0PA 2RN8A 2KI7A 4LDVA 3OYHA 1AVZC 1YHQT 2DVEA 1KQSS 2H3EB 1QQJA 3PE0A 2LJ0A 2EQUA 3U23A 4HVWA 1SRLA 1Y57A 3CCSQ 2F5KA 2Y4YA 1Y96A 3MCAB 1LJOA 2PVDB 3CPWS 4C5EA 3QPHA 4II1A 2KYMA 2LNHB 1VQ6A 1YCYA 5A0LA 2RA2A 1ZUYA 3EG3A 2X9HA 2AT1B 4M4ZA 2XK0A 4R55A 3CCET 1RACB 2DKGA 1VQ7A 3JCMP 4IUUA 3G4SA 1NM7A 5KH6A 1M30A 5LL6S 1PM3A 1SSFA 3PMTA 4C5GA 2LZ6B 2JMAA 3FIFA 4AFSC 1D0YA 4XTWA 3TU4K 3INZA 2D9TA 4E7IA 3CXCP 1M3CA 3CCUA 3LW5E 4XTUA 1RAFB 5D6XA 2E65A 1UDLA 1VQKT 3M59A 1WYXA 3OYMA 1KD1U 4O5VA 1N5ZA 2OTJQ 3CCSA 2BUDA 4M7AC 1N8RC 2O4XA 1YIJQ 3VYGA 3QKJA 2FPDA 2ABLA 1JJ2S 2RI2A 4JS4A 1GFDA 2L2PA 2VC8A 5CKEA 3MPUB 4A4FA 2CZ6B 4N4HA 1RAIB 2CP3A 4NL2A 1M4ZA 5A0DA 1X2QA 4XK8E 1V1CA 2LCLA 4LXCA 3OY9A 2NYSA 2RJEA 3VS0A 3CBOA 4C0GA 2Y90A 1D09B 3CXCS 3CC4Q 1W6XA 1NG2A 4F7UG 2KAFA 2LQ8A 5FLXE 3PVLA 1PKTA 1ZX6A 4B6MA 3REBB 3RR6A 1XQHA 3KXTA 4C0DB 1M8VA 4J83A 3JB9J 4PFPA 2VUBA 1LOJA 3QSUA 3CCJQ 5GMKe 3BFMA 4DBRA 2JTFA 4V2SA 4FIBA 2E10A 5IXBA 1OOTA 1YIJA 1TUCA 2DD4A 2MWPA 1MGQA 2RQUA 1VQPT 1WIEA 2L3PA 4RTYA 2CS7A 4E7ZA 3EHQA 2P0KA 3TSWA 3HTRA 2RF0A 2GF7A 1MMAA 2SEMA 5GAOr 3V8KA 4AFZC 1M90U 1OEBA 2D1XA 1UFFA 1NPRA 2CZ7B 1ZBJA 1AZEA 5L8RE 2ZGWA 3EG1A 4DQ2A 1ZSZB 3VS2A 3CPFA 3CC4A 1XOVA 3JCMX 4XAXB 3VU3C 2EYXA 4JRQA 4E7HA 4M7DA 2K6DA 2RJCA 1Q86C 1CKBA 1M3BA 1NBEB 1NLPC 4FW2A 2F2XA 3QYGB 4J6YA 5HKCA 4M77G 3MP1A 2MI6A 1JQQA 3BW1A 1PKSA 3V7CA 3CCJA 3V7SA 2ESWA 1YWPA 1TSFA 4EMKB 3MJXA 3PFSA 3RNJA 3C0CA 5CQYA 2X4XA 3OBYA 5GAOm 4HCBA 2HSEB 1BIBA 2ZAEA 3GNFB 1M1GA 1GBRA 4QQ6A 2CH4A 4HT9A 1VQ8T 2ZPFB 4N4GA 4FSXA 3MEWA 1MNEA 3VS6A 4ESRA 2P4RA 2DM1A 2MF2A 4LN2A 2AZSA 2PU9B 4PFOA 4JLIA 5KYXA 2JW4A 5FU6B 3CCQT 2AZVA 1R0CB 4M75G 1QVPA 1G8XA 1ZHIA 1Q81C 3CC2T 2RJFA 3NMZC 4C8QE 4CRIA 2XD0A 1WHGA 2FZCB 3QYHB 2A7YA 1B34A 5GAN3 2F69A 1U1TA 4D8KA 3QZ9B 1B34B 4JZ4A 2F1LA 3EAEA 3OS5A 4BUGA 2LJ1A 1SRMA 3M57A 3M56A 2JTMA 1FXXA 4XTZA 2ZPGB 2CZ1B 3GF5A 3L2ZA 3CQTA 4MDWA 2DTOA 2RHZA 5KCHA 1OYXA 3L2UA 4BY6C 2O88A 3OYDA 2DL7A 4AFQC 1KIKA 4PJOE 1AWXA 1RAHB 2OAUA 4MMKA 5GAMe 4Z88A 2GFAA 3S6WA 3H9NA 3CCLQ 1K9AA 1QKXA 2CT4A 1Q82C 4M78E 1NJIU 1RABB 1WHJA 5DM7R 3CCUT 2DL4A 5GAOn 2D8HA 3HKSA 1VQ9Q 2EYYA 4C5HA 5KYYB 2D6FA 2CP6A 2EJGA 4RCCA 1VIFA 3UT1A 2J6FA 1G83A 2YRVA 2ATCB 1D3BA 3CCST 1WHMA 2EQMA 1D3BB 4XTYA 4PNOA 2K7AA 4GLMA 4RTXA 4BD3A 5FRMA 5CAIA 4P5NA 2NLUA 2LJ3A 2LRQA 2YDLA 2CSQA 2HKNA 2MMPA 2D8JA 3VRZA 2WSCE 1I81A 1OU8A 3UWNA 5CIUA 3LWHA 2DETA 2K3BA 3OMGA 3NGPA 1QCFA 2CDTA 3EG9A 1N6AA 1X2KA 1YI2Q 1YJ9T 1MNDA 2EQIA 3EG9B 2CREA 1UB4A 2B86A 4HVVA 3CCLA 1AZGB 3C4SA 4DBHA 1UG1A 4C8QA 2NUPB 2BZYA 3M4GA 1VQ9A 2DIQA 2KE9A 4ANJA 4RUGA 1WGSA 4ZGJB 3CMEQ 2QDLA 1SHFA 1QW1A 1YFNA 1PSEA 2ZPIB 1N8RU 5KYNA 3QBYA 3E19A 1UGVA 3LGLA 2GFUA 5IXFA 4M7DG 4PJOA 5I2SA 2K4YA 3VS1A 1OX8A 4A63B 4J9FA 4FSSA 3EGUA 2HSPA 4C0FA 5GAMf 2PUOB 4F14A 5FU7C 5GANd 1NPPA 4M78A 2L0AA 5KYUB 1YI2A 3Q1JA 5GAOp 2L5QA 3NTIA 4JRKA 4BE0A 5AT1B 3LLRA 1GRIA 4EDUA 4C92E 4KBMB 3SWNA 1RI0A 4PLIA 1WPYA 2YUOA 8AT1B 2DL8A 1OZ3A 1X27A 2X4JA 1FMWA 3HFOA 1X6OA 3CCJT 4OVAA 1MMGA 2DO3A 2CSIA 1IGQA 2QEXT 2K57A 2HAXA 1CSKA 4LDUA 2E12A 4QKUA 4F7UA 2E41A 4K11A 3MP6A 4F7UB 1PWTA 4JLGA 1PRMC 3OYJA 4NOYA 1UE9A 2QG9B 2QQ9A 2YRDA 3VS5A 2L3QA 2E3HA 1D1BA 2V1QA 3EG0A 4JJBA 1ZUUA 4B9XA 2JNGA 2YWWA 2YUQA 1Q7YR 3GP8A 5GAN6 2FG0A 4XU3A 1VQOT 2AKLA 1R8OB 2DMOA 3QXEB 4F7UF 2YSQA 1TG0A 2JZ2A 1TOVA 4BE1A 1N27A 4BE2A 3EFSA 3M4YA 2EVRA 1Q86U 1K8AR 1GCQC 2K5LA 1FWZA 2MCNA 5A2QE 2DYBA 2KMTA 1TTHB 5GAOq 4OF1A 3OBWA 3OYFA 1PSFA 2EPDA 2JVVA 1NLOC 2ECZA 4FYWB 2YUPA 5M9OA 4HCKA 5HK0A 5GMKi 3TVTA 2RNAA 4XU2A 4OGCA 2EJ9A 3EFOB 3OYAA 3LH0A 2RHIA 4PJJA 1AEYA 1ZQ1A 2E1HA 3CC7T 4J7IA 1HYOA 1R0BG 1RUWA 4Q5WA 1IO6A 2X4YA 4M77B 1VQNQ 4JJCA 1W1FA 3LGFA 1JEGA 2HBPA 4A4KA 4JRIA 1G3SA 4LUDA 2LVMA 1K4US 2O31A 1WHLA 2A08A 4C92A 3MEAA 3NTHA 5CK9A 1UEBA 2ZPEB 4HCCA 2DEQA 1Q81U 4E7SA 1I5LA 5KE3A 1Z9QA 1QMCA 1O75A 1JXOA 3C94A 1M2VA 1U5SA 1M2VB 1RLQC 4M77F 4WCIA 1K73C 1SSHA 2FEIA 4IUQA 5GAN7 1UGRB 4PJNA 1VUBA 1QVGS 2EGAA 2DILA 2CT3A 4DEYA 1Y96B 4M7AE 3EGXA 4N4IA 4AT1B 4M75A 1IRXA 1SPKA 1GXIE 1Q95G 3CCVA 4C8QG 4M75B 2MOXA 2C0OA 1FMVA 2DFUA 4D8DA 1EIFA 4ATOA 5GANj 3JV3A 5FRNA 4OMLA 2MPXC 3M54A 3PIPA 2QQBA 3FDRA 1VQNA 2CUBA 2WACA 1S72T 4RCBA 3CCLT 4JZ3A 2EYQA 1Q82U 4F16A 4MZPA 4OB3B 2DZCA 3H0HA 4M75F 2KT8A 3L42A 1QCNA 3PMIA 3GOXA 3O5ZA 1RAEB 4PJOG 5GANf 2DJZA 4BI3A 2GCXA 5GAN2 2XIDA 3V8JA 1WJSA 2P4TA 3BY7A 1JO8A 3KFVA 1HXDA 1RL2A 4ORZA 1KD1R 2EAYA 4M78G
chains in the Genus database with same CATH topology
1SEMA 1J3TA 2F2WA 1HD3A 2RPNA 1GBRA 2M0YA 2EYWA 1E6HA 1T0JA 1PHTA 2CH4A 1PNJA 2JS2A 3NHNA 1BK2A 1QKWA 1OPLA 1W70A 2VVKA 1U06A 4Z89A 2EGEA 1SHGA 1I07A 2LP5A 3A98A 1Z9ZA 2DJQA 1RI9A 3VS6A 4ESRA 2P4RA 2W0ZA 2DM1A 4LN2A 2AZSA 2X3XD 2NUZA 2DLPA 2JW4A 4J9BA 3H0FA 1M27C 1UTIA 2CH4W 2J6OA 3M0RA 1AWOA 2EKHA 3UA6A 2AZVA 2I0NA 4QT7A 5HCKA 1WX6A 4EIKA 3NMZC 2DA9A 5I11A 2KEAA 1HSQA 1BB9A 1QWEA 1TUDA 4D8KA 2KR3A 2DL3A 1NYGA 2LX7A 4JZ4A 4R0KA 1H92A 4LE9A 1T0HA 2DRKA 2LJ1A 1GCQA 1SRMA 2GQIA 2KROA 2VWFA 2W10A 1KFZA 1WFWA 1G2BA 3CQTA 1BU1A 3R6NA 1YNZA 2JXBA 1ZUKA 2O88A 1WI7A 2HBWA 1BBZA 1YWOA 2DL7A 4AFQC 1KIKA 4OMOA 3SHWA 2C0IA 2PZ1A 3SEMA 1T3LA 1FMKA 4OMNA 1AWXA 1T3SA 5IH2A 1U3OA 2LQWA 2LQNA 2KBTA 4Z88A 4IIMA 4LNPA 1I1JA 3I35A 4J9CA 5IHKA 2ED1A 1K9AA 1QKXA 2CT4A 3H41A 2J05A 1NYFA 2KRMA 2DL4A 2FRWA 1A0NB 2D8HA 1QLYA 2EYYA 2RQTA 3LH5A 2SRCA 4HVUA 1H3HA 2YUNA 2BZXA 3IQLA 2D0NA 2J6FA 3UF4A 1G83A 2FO0A 2FPEA 2G6FX 1UUEA 1K76A 4J9EA 1B07A 1WXTA 2K7AA 5EC7A 4GLMA 2DE0X 4RTXA 2O9VA 5L23A 1KJWA 2LJ3A 3NPFA 2GBQA 2HCKA 2YDLA 2CSQA 1OV3A 4ZNXA 3VS7A 4J9DA 2D8JA 2OAWA 3VRZA 2HEQA 1M8MA 3M0TA 1YCSB 2H8HA 2GTOA 2K3BA 2LMJA 3NGPA 3M0SA 1GCPA 1QCFA 2RMOA 5GJWB 2CDTA 3THKA 3VS3A 1MV0B 2A37A 2ENMA 4CC3A 1X2KA 2EQIA 2OJ2A 2LCSA 1MV3A 2K2MA 2CREA 3I9QA 2B86A 2AKKA 4HVVA 1WXUA 2JM8A 2ED0A 2DNUA 2BZ8A 1AZGB 5FWCA 2KRSA 2JM9A 2J6KA 1UG1A 3EHRA 1Y0MA 1VYTA 4RTWA 1K1ZA 1X69A 2MIOA 2BZYA 2NWMA 2K9GA 3QWXX 1JXMA 1UJYA 2KE9A 1S1NA 2PTKA 2M51A 4RUGA 2RQWA 4DEXA 4OMPA 2KYBA 2QDLA 3RBBB 3M0QA 2DL5A 1SHFA 2BTTA 2KGTA 4Z8AA 2EGCA 2X3WD 1VA7A 2DF6A 4RTUA 2VKNA 5FWBA 1B3QA 1ARKA 1X43A 1UGVA 1X6GA 4GBQA 2GNCA 1HJDA 1E7OA 5IXFA 1K0XA 1OPKA 2JMCA 3VS1A 3M0UA 2V1RA 1AWWA 2A28A 4A63B 4J9FA 4FSSA 3EGUA 2HSPA 1NEBA 4F14A 2RQRA 1KSWA 4E6RA 2L0AA 4IIOA 4RTTA 2RN8A 5FW9A 2C0TA 2PNIA 1AVZC 1ZSGA 1I0CA 1GRIA 3PE0A 3ULRB 2LJ0A 3U23A 4HVWA 1SRLA 1Y57A 2YUOA 2XMFA 2DRMA 2DL8A 1X27A 2L3SA 4AG2C 4X1VA 5IHIA 2AK5A 2F2VA 2KYMA 2CSIA 2LNHB 1ZUYA 3H0IA 4HXJA 3REAB 1GL5A 2DBKA 1CSKA 1CKAA 3EG3A 3I5RA 4J9IA 4M4ZA 1WLPB 3GBQA 4J9GA 4K11A 2DVJA 1PWTA 2JT4A 1PRMC 5GJVB 1UE9A 1NM7A 1M30A 2ROTA 3VS4A 2LZ6B 2JMAA 3VS5A 4AFSC 1GFCA 2L3QA 2DBMA 2V1QA 3EG0A 4JJBA 2OI3A 1ZUUA 2YUQA 1M3CA 2FG0A 2O9SA 2AKLA 2DMOA 2YSQA 1TG0A 1UDLA 1QWFA 1WYXA 1VYUA 2CUDA 2EVRA 2RQVA 1E6GA 4JPBW 1AWJA 1GCQC 2YT6A 1NEGA 1N5ZA 1YN8A 2MCNA 4J9HA 2DYBA 5I22A 4OMMA 1GBQA 1PRLC 4AG1C 2FPDA 2ABLA 1AOJA 1GFDA 2JS0A 2L2PA 2EPDA 1NLOC 2ECZA 2YUPA 3VRYA 3I5SA 3QWYA 2O2OA 4HCKA 3TVTA 4JJDA 2DX1A 2RNAA 2A36A 1X2QA 1V1CA 1AEYA 1UHFA 4CC2A 3VS0A 4OMQA 1RUWA 4F17A 1IO6A 1W6XA 1AD5A 1NG2A 4JJCA 1W1FA 1JEGA 1X6BA 1ZLMA 3PVLA 4LUDA 4CC7A 1K4US 1PKTA 1ZX6A 2O31A 3REBB 2A08A 2KRNA 2EYZA 1ABQA 1UJ0A 1Z9QA 4RTZA 3PVQA 1JXOA 2J7IA 1U5SA 2GGRA 1RLQC 4WCIA 1SSHA 5IXBA 2FEIA 3EG2A 1OOTA 1JU5C 1TUCA 5IHNA 2EGAA 2JTEA 2DILA 2KXDA 2CT3A 4KRTA 2RQUA 1WXBA 4DEYA 1WIEA 2FPFA 2KNBB 2L3PA 4RTYA 1VYVA 3EHQA 1ABOA 3TSWA 3TSZA 2RF0A 1UECA 2EW3A 2SEMA 1WDXA 4AFZC 1SPKA 1OEBA 2D1XA 1UFFA 2MOXA 2C0OA 1K0SA 4Y92A 1ZBJA 4D8DA 1AZEA 1RLPC 2E5KA 3UA7A 3EG1A 4LUEA 1EFNA 3JV3A 2ROLA 2K79A 2IIMA 2EBPA 3VS2A 3UATA 4OMLA 1XOVA 3FJ5A 2J06A 1LCKA 2EYXA 2CUBA 2K6DA 4AFUC 3ZL7C 4JZ3A 4F16A 1M3BA 1CKBA 1NLPC 2F2XA 3H0HA 1MUZA 2KT8A 4RTVA 2FRYA 1FYNA 3O5ZA 1JQQA 1PKSA 2HDAA 1H8KA 2ESWA 2KXCA 1YWPA 1M3AA 5ECAA 2GTJA 3RNJA 1YP5A 3C0CA 4CC4B 1UHCA 3M0PA 1JO8A 1WA7A 2KT1A 3KFVA 4ORZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEM A;  1J3T A;  2F2W A;  1HD3 A;  2RPN A;  1GBR A;  2M0Y A;  2EYW A;  1E6H A;  1T0J A;  1PHT A;  2CH4 A;  1PNJ A;  2JS2 A;  3NHN A;  1BK2 A;  1QKW A;  1OPL A;  1W70 A;  2VVK A;  1U06 A;  4Z89 A;  2EGE A;  1SHG A;  1I07 A;  2LP5 A;  3A98 A;  1Z9Z A;  2DJQ A;  1RI9 A;  3VS6 A;  4ESR A;  2P4R A;  2W0Z A;  2DM1 A;  4LN2 A;  2AZS A;  2X3X D;  2NUZ A;  2DLP A;  2JW4 A;  4J9B A;  3H0F A;  1M27 C;  1UTI A;  2CH4 W;  2J6O A;  3M0R A;  1AWO A;  2EKH A;  3UA6 A;  2AZV A;  2I0N A;  4QT7 A;  5HCK A;  1WX6 A;  4EIK A;  3NMZ C;  2DA9 A;  5I11 A;  2KEA A;  1HSQ A;  1BB9 A;  1QWE A;  1TUD A;  4D8K A;  2KR3 A;  2DL3 A;  1NYG A;  2LX7 A;  4JZ4 A;  4R0K A;  1H92 A;  4LE9 A;  1T0H A;  2DRK A;  2LJ1 A;  1GCQ A;  1SRM A;  2GQI A;  2KRO A;  2VWF A;  2W10 A;  1KFZ A;  1WFW A;  1G2B A;  3CQT A;  1BU1 A;  3R6N A;  1YNZ A;  2JXB A;  1ZUK A;  2O88 A;  1WI7 A;  2HBW A;  1BBZ A;  1YWO A;  2DL7 A;  4AFQ C;  1KIK A;  4OMO A;  3SHW A;  2C0I A;  2PZ1 A;  3SEM A;  1T3L A;  1FMK A;  4OMN A;  1AWX A;  1T3S A;  5IH2 A;  1U3O A;  2LQW A;  2LQN A;  2KBT A;  4Z88 A;  4IIM A;  4LNP A;  1I1J A;  3I35 A;  4J9C A;  5IHK A;  2ED1 A;  1K9A A;  1QKX A;  2CT4 A;  3H41 A;  2J05 A;  1NYF A;  2KRM A;  2DL4 A;  2FRW A;  1A0N B;  2D8H A;  1QLY A;  2EYY A;  2RQT A;  3LH5 A;  2SRC A;  4HVU A;  1H3H A;  2YUN A;  2BZX A;  3IQL A;  2D0N A;  2J6F A;  3UF4 A;  1G83 A;  2FO0 A;  2FPE A;  2G6F X;  1UUE A;  1K76 A;  4J9E A;  1B07 A;  1WXT A;  2K7A A;  5EC7 A;  4GLM A;  2DE0 X;  4RTX A;  2O9V A;  5L23 A;  1KJW A;  2LJ3 A;  3NPF A;  2GBQ A;  2HCK A;  2YDL A;  2CSQ A;  1OV3 A;  4ZNX A;  3VS7 A;  4J9D A;  2D8J A;  2OAW A;  3VRZ A;  2HEQ A;  1M8M A;  3M0T A;  1YCS B;  2H8H A;  2GTO A;  2K3B A;  2LMJ A;  3NGP A;  3M0S A;  1GCP A;  1QCF A;  2RMO A;  5GJW B;  2CDT A;  3THK A;  3VS3 A;  1MV0 B;  2A37 A;  2ENM A;  4CC3 A;  1X2K A;  2EQI A;  2OJ2 A;  2LCS A;  1MV3 A;  2K2M A;  2CRE A;  3I9Q A;  2B86 A;  2AKK A;  4HVV A;  1WXU A;  2JM8 A;  2ED0 A;  2DNU A;  2BZ8 A;  1AZG B;  5FWC A;  2KRS A;  2JM9 A;  2J6K A;  1UG1 A;  3EHR A;  1Y0M A;  1VYT A;  4RTW A;  1K1Z A;  1X69 A;  2MIO A;  2BZY A;  2NWM A;  2K9G A;  3QWX X;  1JXM A;  1UJY A;  2KE9 A;  1S1N A;  2PTK A;  2M51 A;  4RUG A;  2RQW A;  4DEX A;  4OMP A;  2KYB A;  2QDL A;  3RBB B;  3M0Q A;  2DL5 A;  1SHF A;  2BTT A;  2KGT A;  4Z8A A;  2EGC A;  2X3W D;  1VA7 A;  2DF6 A;  4RTU A;  2VKN A;  5FWB A;  1B3Q A;  1ARK A;  1X43 A;  1UGV A;  1X6G A;  4GBQ A;  2GNC A;  1HJD A;  1E7O A;  5IXF A;  1K0X A;  1OPK A;  2JMC A;  3VS1 A;  3M0U A;  2V1R A;  1AWW A;  2A28 A;  4A63 B;  4J9F A;  4FSS A;  3EGU A;  2HSP A;  1NEB A;  4F14 A;  2RQR A;  1KSW A;  4E6R A;  2L0A A;  4IIO A;  4RTT A;  2RN8 A;  5FW9 A;  2C0T A;  2PNI A;  1AVZ C;  1ZSG A;  1I0C A;  1GRI A;  3PE0 A;  3ULR B;  2LJ0 A;  3U23 A;  4HVW A;  1SRL A;  1Y57 A;  2YUO A;  2XMF A;  2DRM A;  2DL8 A;  1X27 A;  2L3S A;  4AG2 C;  4X1V A;  5IHI A;  2AK5 A;  2F2V A;  2KYM A;  2CSI A;  2LNH B;  1ZUY A;  3H0I A;  4HXJ A;  3REA B;  1GL5 A;  2DBK A;  1CSK A;  1CKA A;  3EG3 A;  3I5R A;  4J9I A;  4M4Z A;  1WLP B;  3GBQ A;  4J9G A;  4K11 A;  2DVJ A;  1PWT A;  2JT4 A;  1PRM C;  5GJV B;  1UE9 A;  1NM7 A;  1M30 A;  2ROT A;  3VS4 A;  2LZ6 B;  2JMA A;  3VS5 A;  4AFS C;  1GFC A;  2L3Q A;  2DBM A;  2V1Q A;  3EG0 A;  4JJB A;  2OI3 A;  1ZUU A;  2YUQ A;  1M3C A;  2FG0 A;  2O9S A;  2AKL A;  2DMO A;  2YSQ A;  1TG0 A;  1UDL A;  1QWF A;  1WYX A;  1VYU A;  2CUD A;  2EVR A;  2RQV A;  1E6G A;  4JPB W;  1AWJ A;  1GCQ C;  2YT6 A;  1NEG A;  1N5Z A;  1YN8 A;  2MCN A;  4J9H A;  2DYB A;  5I22 A;  4OMM A;  1GBQ A;  1PRL C;  4AG1 C;  2FPD A;  2ABL A;  1AOJ A;  1GFD A;  2JS0 A;  2L2P A;  2EPD A;  1NLO C;  2ECZ A;  2YUP A;  3VRY A;  3I5S A;  3QWY A;  2O2O A;  4HCK A;  3TVT A;  4JJD A;  2DX1 A;  2RNA A;  2A36 A;  1X2Q A;  1V1C A;  1AEY A;  1UHF A;  4CC2 A;  3VS0 A;  4OMQ A;  1RUW A;  4F17 A;  1IO6 A;  1W6X A;  1AD5 A;  1NG2 A;  4JJC A;  1W1F A;  1JEG A;  1X6B A;  1ZLM A;  3PVL A;  4LUD A;  4CC7 A;  1K4U S;  1PKT A;  1ZX6 A;  2O31 A;  3REB B;  2A08 A;  2KRN A;  2EYZ A;  1ABQ A;  1UJ0 A;  1Z9Q A;  4RTZ A;  3PVQ A;  1JXO A;  2J7I A;  1U5S A;  2GGR A;  1RLQ C;  4WCI A;  1SSH A;  5IXB A;  2FEI A;  3EG2 A;  1OOT A;  1JU5 C;  1TUC A;  5IHN A;  2EGA A;  2JTE A;  2DIL A;  2KXD A;  2CT3 A;  4KRT A;  2RQU A;  1WXB A;  4DEY A;  1WIE A;  2FPF A;  2KNB B;  2L3P A;  4RTY A;  1VYV A;  3EHQ A;  1ABO A;  3TSW A;  3TSZ A;  2RF0 A;  1UEC A;  2EW3 A;  2SEM A;  1WDX A;  4AFZ C;  1SPK A;  1OEB A;  2D1X A;  1UFF A;  2MOX A;  2C0O A;  1K0S A;  4Y92 A;  1ZBJ A;  4D8D A;  1AZE A;  1RLP C;  2E5K A;  3UA7 A;  3EG1 A;  4LUE A;  1EFN A;  3JV3 A;  2ROL A;  2K79 A;  2IIM A;  2EBP A;  3VS2 A;  3UAT A;  4OML A;  1XOV A;  3FJ5 A;  2J06 A;  1LCK A;  2EYX A;  2CUB A;  2K6D A;  4AFU C;  3ZL7 C;  4JZ3 A;  4F16 A;  1M3B A;  1CKB A;  1NLP C;  2F2X A;  3H0H A;  1MUZ A;  2KT8 A;  4RTV A;  2FRY A;  1FYN A;  3O5Z A;  1JQQ A;  1PKS A;  2HDA A;  1H8K A;  2ESW A;  2KXC A;  1YWP A;  1M3A A;  5ECA A;  2GTJ A;  3RNJ A;  1YP5 A;  3C0C A;  4CC4 B;  1UHC A;  3M0P A;  1JO8 A;  1WA7 A;  2KT1 A;  3KFV A;  4ORZ A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  2O4X B;  4C0D C;  1T0J A;  1PNJ A;  3HRS A;  3NHN A;  2KDS A;  1M9S A;  3UPU A;  2VVK A;  1VQL Q;  1SHG A;  1I07 A;  1Z9Z A;  4PKC C;  1RI9 A;  2RHY A;  3MP8 A;  3I56 Q;  1M1K R;  3X25 B;  2VGN A;  4J9B A;  3CBP A;  2J6O A;  3M0R A;  4KGX B;  3UA6 A;  3RIR A;  1PCX A;  1MHN A;  1WX6 A;  2HQX A;  4EIK A;  2X35 A;  3JCM b;  3G6E Q;  5I11 A;  5D6Y A;  4FYV B;  3E9F A;  2FVU A;  5CO7 A;  3I55 Q;  3NTK A;  3N5B B;  4R0K A;  4LE9 A;  2DRK A;  2RI5 A;  1ZSZ C;  1VQ4 Q;  4ME7 A;  2LCC A;  4M7A A;  2RH2 A;  2K5F A;  1YJW T;  2OTJ A;  1YNZ A;  2JXB A;  3S3M A;  4J8O A;  2OTL T;  1F1B B;  1BBZ A;  5AYF A;  3OYE A;  2PZ1 A;  2QA4 Q;  2BE7 D;  4J6W A;  4OMN A;  1QP2 A;  1U3O A;  2LQN A;  4M77 D;  2KBT A;  2ZCF B;  1VQL A;  2BKD N;  4Y91 A;  4EMK C;  1PD1 A;  2VYT A;  1XJW B;  4E7L A;  2IPO B;  3KBG A;  5IHK A;  3I56 A;  1M90 R;  3OS1 A;  1D0Z A;  2K5I A;  2KRM A;  3J80 E;  1LNX A;  3LH5 A;  2SRC A;  1VQM Q;  3DLM A;  2HMA A;  1X75 C;  3SDZ A;  3G6E A;  5KYW A;  3QO3 A;  3UF4 A;  4M7D B;  2VAS A;  2G6F X;  4Z02 A;  1B7T A;  1WXT A;  4E7K A;  1VQ4 A;  2HL5 C;  4FM4 B;  4IUR A;  5FU6 C;  1KJW A;  1VQ5 Q;  2GBQ A;  2XKO C;  5J3B A;  4ZNX A;  3HRU A;  1YIT Q;  4LD6 A;  5GAM d;  2OAW A;  2HEQ A;  4C92 G;  1YCS B;  4MDX A;  4M7D F;  2LMJ A;  1BYM A;  2QA4 A;  3M0S A;  2OX7 A;  5GJW B;  1I8F A;  3VS3 A;  3EH2 A;  2A37 A;  2ENM A;  4CC3 A;  4QW2 A;  2LCS A;  2LDM A;  2GQV A;  5IT9 E;  3E1S A;  1TWB A;  1WXU A;  5LJ5 e;  2DNU A;  2BZ8 A;  2J6K A;  1Y0M A;  1ZA1 B;  3QG1 A;  3CD6 Q;  4RTW A;  3CBM A;  5CVI A;  3VUB A;  1M2O A;  4WTO B;  2NWM A;  4PL6 A;  2QTV A;  5KYX B;  1VQM A;  4R56 A;  2EQK A;  3A8G B;  5CQX A;  4IKF A;  3M0Q A;  2QDY B;  2LNV A;  4X9D A;  1ZBX A;  4PJL A;  4ZGD B;  1K9M C;  1W2B A;  1IGU A;  2DTH A;  4KGV B;  1TU0 B;  4F04 B;  3VYH B;  5CKB A;  1VQ5 A;  2GNC A;  1HJD A;  1E7O A;  1VQ6 T;  2RM4 A;  1YIT A;  3M0U A;  3CCV T;  2F5T X;  3RES A;  3F70 A;  4HKE A;  1KSW A;  1VQ7 T;  4RG8 A;  2CP7 A;  3G4S T;  2CP0 A;  1G3T A;  3JCM e;  4PLL A;  1VQN T;  2DXT A;  1RAG B;  2C0T A;  2LX9 A;  2PNI A;  4IUP A;  5FW9 A;  3JB9 H;  1WZO A;  3QHS A;  4FT4 A;  1I0C A;  3QDF A;  1DJ7 B;  4A4G A;  3CD6 A;  2MWO A;  3GNG A;  3QJ6 A;  5IAY A;  2DXU A;  1V29 B;  3RKX A;  5LJ3 e;  1NJI R;  2L3S A;  4AG2 C;  4X1V A;  1Y71 A;  3SD4 A;  1KK7 A;  5IHI A;  3A5Z B;  3G7Z A;  2DEU A;  1K73 U;  3J7A F;  1GL5 A;  3M55 A;  3CCR Q;  4N0A C;  4KGZ B;  1W2B P;  4JUV A;  5DLO A;  4OGE A;  1WLP B;  3GBQ A;  4J9G A;  2DVJ A;  3HFN A;  2JT4 A;  3EH1 A;  2R5A A;  2VXE A;  1NE8 A;  2ROT A;  2D0Q B;  3VS4 A;  1VQK Q;  2DXB A;  4Y28 E;  3V8L A;  5D7U A;  3OS2 A;  2FZK B;  2LT1 A;  1XNI A;  2E6N A;  4QVC A;  3VV0 A;  5LJ5 f;  2KVQ G;  4UC4 A;  3L2V A;  4KUI A;  1OI1 A;  4M7A G;  3A8L B;  1BKB A;  1QWF A;  4KH1 B;  2CUD A;  3RKY A;  1PC0 A;  4QQG A;  3PIO A;  5EG2 A;  3A8M B;  3PNW C;  1AWJ A;  2YT6 A;  2X4W A;  4M7D D;  2DYI A;  4J9H A;  4FW1 A;  5I22 A;  4OMM A;  2NUT A;  4C8Q B;  1C1A A;  1KC8 R;  1GBQ A;  4AG1 C;  2QXF A;  3AT1 B;  3FEO A;  2Y4X A;  2JS0 A;  1RAD B;  1W2B S;  4LDX A;  3URG A;  1SF9 A;  1KQ2 A;  3RKW A;  3VRY A;  3RMS A;  3QWY A;  3OSS C;  3CCR A;  5GAM j;  2OTJ T;  5HK3 A;  4JJD A;  2A3L A;  2L3R A;  1N8R R;  1YIJ T;  5GAN g;  1BCM A;  4HCZ A;  2XG8 D;  4J7F A;  1UHF A;  3WVE B;  3JB9 I;  4OMQ A;  4C8Q F;  3FB9 A;  2RJD A;  1VQK A;  3JB9 G;  2XI9 A;  3O8V A;  2G3R A;  2X51 A;  1AD5 A;  1VQL T;  4PJO B;  2QQS A;  5GAN 5;  3JCM f;  3I56 T;  1ZLM A;  5DLQ E;  4CC7 A;  2AHJ B;  1ABQ A;  1MMD A;  2AIR B;  2R5M A;  1VQP Q;  3CC4 T;  4M78 B;  1UJ0 A;  8ATC B;  4NL3 A;  3VKI A;  3PVQ A;  5LJ3 f;  2J7I A;  2GGR A;  4PJO F;  3OSV A;  2P84 A;  3SWN B;  1P92 A;  5IHN A;  3MEV A;  2KXD A;  1SKU B;  2DPP B;  1WXB A;  2YHT A;  1D1C A;  1VQ4 T;  3CME A;  2FPF A;  4JJN K;  1IHV A;  5HY6 A;  1ABO A;  3OMC A;  3TSZ A;  2EW3 A;  2XDP A;  3HHT B;  4M78 F;  1OZ2 A;  2H3J A;  2FB7 A;  2B8A A;  4QVD A;  5CCA A;  2EIF A;  1K0S A;  3E9G A;  1G3Y A;  1RLP C;  2E5K A;  5C6S A;  4LUE A;  1EFN A;  4FL6 A;  2RHX A;  2ROL A;  1IZ6 A;  2K79 A;  1JB0 E;  2EBP A;  3RDV A;  3QDR B;  3UAT A;  5CKD A;  4L59 A;  2DXC A;  2MK5 A;  3FJ5 A;  2HD0 A;  1H64 1;  2P0Q A;  4J5Y A;  3ZL7 C;  3EGD A;  3FJP A;  1QVF A;  2Z0W A;  2FRY A;  2JOY A;  1VQP A;  2V8J A;  4VUB A;  1VIE A;  3QII A;  4BAC A;  1UGQ B;  2KXC A;  3ZBD A;  4BDZ A;  4E7J A;  1M3A A;  1VQ8 Q;  5ECA A;  2DAQ A;  1YJN Q;  2RK1 A;  1UHC A;  3M0P A;  4M77 C;  5GAN 8;  1Q86 R;  3JCM c;  4OB1 B;  3JCM J;  1QCO A;  1J3T A;  2F2W A;  1VOM A;  3OS0 A;  2E6Z A;  2M0Y A;  2EYW A;  1E6H A;  2HL3 A;  2PVG B;  1PHT A;  3JRZ A;  6AT1 B;  1OPL A;  2VV5 A;  1U8R A;  3CC2 Q;  4Z89 A;  2RI3 A;  2EGE A;  3X20 B;  2LP5 A;  3A98 A;  1BI0 A;  3D7S B;  4X9C A;  3C95 A;  4GY5 A;  2W0Z A;  2X3X D;  4OP0 A;  3PT9 A;  1O9S A;  3DB3 A;  1AWO A;  4DBQ A;  3L2W A;  4QT7 A;  1X01 A;  2VGM A;  2QTX A;  2DA9 A;  2MAM A;  2KEA A;  5J26 A;  2XDD A;  2EKO A;  4JS5 A;  2C06 A;  2M16 A;  1QWE A;  3CMA Q;  1QVF P;  4C8Q D;  4QQD A;  2DL3 A;  2HQH A;  2LX7 A;  4NS5 A;  1H92 A;  1T0H A;  4C92 B;  4KT0 E;  2QK0 A;  2BE9 B;  1GCQ A;  2GQI A;  3RUX A;  2VWF A;  1VQ8 A;  1YJN A;  1Q81 R;  4OMF B;  3QJY A;  3BE3 A;  1BU1 A;  5DY9 A;  2XIC A;  1K9M U;  3J81 E;  1ZUK A;  4HT8 A;  5GMK m;  3ASK A;  4OMO A;  3L2R A;  3SEM A;  4XU1 A;  1T3L A;  2DZ9 A;  5IH2 A;  2DK3 A;  3BDU A;  4L6V 5;  3MEU A;  4C92 F;  3V7R A;  3EGX B;  3CC2 A;  4E47 A;  4IIM A;  4PJO D;  5GAN h;  4LNP A;  1I1J A;  2PVO B;  3H41 A;  3CCM Q;  2L89 A;  4BB7 A;  2J05 A;  2LC4 A;  2RO0 A;  3VUZ A;  2V8I A;  4XU0 A;  4M78 D;  4DOW A;  1H3H A;  2YUN A;  1QVF S;  3IQL A;  1JJ2 P;  1I5O B;  2A0F B;  1LVK A;  2FPE A;  3CMA A;  1Q82 R;  4KUD K;  4J9E A;  3OA6 A;  3GPL A;  2QGF B;  3P8H A;  5EC7 A;  1VQ9 T;  4FYX B;  3G71 Q;  5L23 A;  1YJ9 Q;  3QUI A;  3RER A;  1OV3 A;  3CCR T;  5CR2 A;  1M8M A;  3M0T A;  2GTO A;  4JRP A;  1KC8 C;  1GCP A;  3THK A;  2RMO A;  1Y7X A;  4M7D E;  1MV3 A;  1IRE B;  1U1S A;  3I9Q A;  3OW2 A;  3DLL A;  1AT1 B;  1WJR A;  2ED0 A;  4OB0 B;  5FWC A;  2E4H A;  2HNI A;  2PQW A;  1N9S A;  3EHR A;  4PK4 A;  3CCM A;  2CZ0 B;  4RG2 A;  2E64 A;  4EMH A;  2K9G A;  3QWX X;  3TEE A;  1UJY A;  3WXM B;  1YI2 T;  2PTK A;  1XTD A;  2M51 A;  3FC3 A;  2RQW A;  2IG0 A;  2DL5 A;  2COW A;  2KGT A;  2X3W D;  4GLK A;  1M1K U;  5LJ5 g;  4J6X A;  3OYL A;  5A0G A;  4RTU A;  2VKN A;  1ARK A;  1B3Q A;  3GLX A;  3G71 A;  2E5Q A;  2CP5 A;  3MET A;  3CEY A;  3CME T;  4GBQ A;  1YJ9 A;  2K3X A;  2XHC A;  1K0X A;  3S3N A;  1G5V A;  3A8O B;  1AWW A;  3ME9 A;  4M7A B;  2A28 A;  4BI4 A;  5LJ5 d;  3QZ5 B;  2EWN A;  4M7D C;  5GMK l;  3JCM W;  4E6R A;  4RKU E;  4ZN3 A;  4ZGE B;  3OW2 P;  4IIO A;  3PGG A;  1TS9 A;  2EJF A;  1ZSG A;  1R77 A;  2K2V A;  4YTL A;  2QAS A;  2QEX Q;  3ULR B;  3M53 A;  4A53 A;  1IB8 A;  4M7A F;  2V8K A;  2XMF A;  2LT4 A;  4ELZ C;  3HRT A;  2DRM A;  2QGG A;  4C92 D;  5I2M A;  2CYZ B;  2AK5 A;  2F2V A;  3JCM g;  4HXJ A;  3H0I A;  3REA B;  2RK2 A;  5GAM g;  2DBK A;  1CKA A;  3I5R A;  4J9I A;  5KYW B;  1Q7Y C;  3I55 A;  1ZSZ A;  2R57 A;  1VQO Q;  5GJV B;  1M5Q 1;  4MZT A;  5LJ3 g;  1PD0 A;  2ZZD A;  1I4K 1;  3FRN A;  1GFC A;  1K8A C;  2DBM A;  1W4S A;  3JCM d;  5GAN 4;  2XDB A;  4M75 D;  2OI3 A;  4A4H A;  2O9S A;  4LDY A;  3OW2 S;  3JB9 F;  1OQK A;  2DIG A;  1TH7 A;  5GMK h;  3MKD A;  2ZPH B;  5LJ3 d;  4EMK A;  3TCJ A;  3BDL A;  2HKQ B;  1VYU A;  5GMK j;  2RQV A;  4IUV A;  1E6G A;  4JPB W;  2QEX A;  2L8D A;  1NEG A;  2QQR A;  1AHJ B;  2RD1 A;  1YN8 A;  2QI2 A;  3H6Z A;  4PFZ A;  1IHW A;  2FL7 A;  2CGH A;  1PRL C;  3DKM A;  4D6W A;  2YRC A;  1AOJ A;  3CC7 Q;  2VXF A;  3A8H B;  1M1F A;  3S3O A;  4MZM A;  1YJN T;  3I5S A;  2O2O A;  3H8Z A;  4O6J A;  3GIB A;  2DX1 A;  2A36 A;  1QP3 A;  1VQO A;  1YBY A;  2DER A;  3X26 B;  3HPW A;  4CC2 A;  4EMG A;  4F17 A;  3OYK A;  3OYI A;  4LD9 K;  3M9Q A;  1YHQ Q;  1X6B A;  2WSE E;  2KRN A;  3OYN A;  2EYZ A;  7AT1 B;  3P8D A;  3RMQ A;  2QQA A;  2M02 A;  4RTZ A;  4A4E A;  3X28 B;  5C0M A;  4KUL A;  1WQW A;  4B9W A;  2FHD A;  1LPL A;  4KH0 B;  3A1P A;  1OU9 A;  3EG2 A;  3CMA T;  3SB2 A;  4BI8 B;  1JU5 C;  4C0Z A;  3CCE Q;  9ATC B;  2JTE A;  1BI2 A;  4KRT A;  3LWI A;  3CC7 A;  3MHX A;  3R6O A;  1TXQ A;  2KNB B;  1VYV A;  2KQW A;  5LJ5 h;  2ZPB B;  4XQ3 A;  2FYK A;  1UEC A;  1WDX A;  4JDS A;  4M7A D;  1S72 Q;  5LJ5 j;  3HP9 A;  3LYI A;  4Y92 A;  1K73 R;  1KG1 A;  3UA7 A;  3L1A A;  4CI0 C;  2IIM A;  4E2F B;  4FYY B;  5KYY A;  2YXY A;  4C8Q C;  4A54 A;  2LQK A;  2RB6 A;  1WJQ A;  2J06 A;  1LCK A;  2DD5 A;  5J39 A;  3WVD B;  4RMO A;  1N9R A;  1YHQ A;  1SG5 A;  4BY6 B;  4AFU C;  3CCM T;  1KD1 C;  1MUZ A;  4RTV A;  1C0M A;  4FT2 A;  4QVZ A;  1FYN A;  1BIA A;  2HDA A;  1H8K A;  2QAZ A;  4FCY A;  2GTJ A;  4F7U E;  1YP5 A;  2DTI A;  4CC4 B;  3JB9 D;  1KQ1 A;  1WA7 A;  1UGS B;  2KT1 A;  3HL8 A;  4DBF A;  3OYC A;  4PJO C;  5GAO l;  3CCE A;  1M1K C;  3P8B B;  1SEM A;  1HD3 A;  3G71 T;  2RPN A;  3OYY A;  4ZN1 A;  2NUT B;  3JCM h;  2M0O A;  2JS2 A;  2PUK B;  5GAM h;  4N0A A;  1BK2 A;  1QKW A;  4M78 C;  2EQJ A;  1EZZ B;  1S72 A;  2HQE A;  1W70 A;  1U06 A;  3ZEH A;  2NUP A;  5I21 A;  2DJQ A;  1KC8 U;  4XTV A;  5LJ3 h;  2CP2 A;  4XTX A;  2NUZ A;  1G3W A;  2DLP A;  4DOV A;  3SWN C;  1UGP B;  1M27 C;  1UTI A;  2CH4 W;  1WNL A;  3H0F A;  3TRE A;  5LJ3 j;  2EKH A;  2I0N A;  5HCK A;  2V26 A;  1WHK A;  2E3I A;  2JN0 A;  3E2U A;  3EFR A;  4C5I A;  1D0X A;  3SFM A;  1YJW Q;  3UDC A;  1HSQ A;  1BB9 A;  1TUD A;  2OTL Q;  1JBM A;  2KR3 A;  4ZTJ A;  1NYG A;  4ZTF A;  2KRO A;  2W10 A;  1KFZ A;  1WFW A;  1G2B A;  1C6V X;  3G6E T;  3DB4 A;  2YLB A;  3R6N A;  1BCO A;  4LDW A;  2KSS A;  1M90 C;  1WI7 A;  3C12 A;  2YLC A;  2HBW A;  1BI3 A;  1YWO A;  3I55 T;  2XU8 A;  5KYU A;  2MYS A;  3SHW A;  2C0I A;  4M77 E;  4L5G A;  1FMK A;  3PTA A;  1T3S A;  3TQ7 P;  2LQW A;  3L2Q A;  3OQ5 A;  3NFC A;  3G1J A;  3AHU A;  3I35 A;  2HZY A;  5IN1 A;  4J9C A;  2ED1 A;  2R58 A;  1KHI A;  4HA8 A;  1KHC A;  4AMC A;  3MO8 A;  1NYF A;  2QA4 T;  3M58 A;  4ELY C;  1KQS A;  1IXD A;  1TUG B;  2FRW A;  1A0N B;  4DA4 A;  1QLY A;  2RQT A;  2IVW A;  4HVU A;  4BDY A;  4OB2 B;  2CKK A;  4MML A;  1QVG A;  2KK4 A;  1BI1 A;  2BZX A;  1PG5 B;  1MMN A;  2KY9 A;  2D0N A;  1YJW A;  3CPW A;  2BIV A;  2FO0 A;  2OTL A;  5FU7 B;  1UUE A;  3EGD B;  1K76 A;  3JAM E;  1B07 A;  3ER0 A;  2DE0 X;  2O9V A;  2COY A;  4IUT A;  4M75 E;  3JCM Q;  1VQM T;  4X34 A;  2M1H A;  5CKH A;  3NPF A;  2HCK A;  1H3Z A;  3KUF A;  1Q7Y U;  3LX7 A;  3VS7 A;  4J9D A;  2JJ9 A;  1FX7 A;  2H8H A;  3OYG A;  5CKF A;  2O01 E;  1EX4 A;  1MV0 B;  3OB9 A;  3FLG A;  3ZFJ A;  2I2L A;  1WHH A;  1K8A U;  2OJ2 A;  3CCQ Q;  2JUF A;  2K2M A;  1VQ5 T;  4C92 C;  3VJP A;  2AKK A;  2WSF E;  1YIT T;  2JM8 A;  4FU6 A;  2KRS A;  2JM9 A;  3JCM V;  1VYT A;  5GAN e;  1K1Z A;  1X69 A;  2MIO A;  1KQS P;  1JXM A;  5KCO A;  1OX9 A;  1S1N A;  4DEX A;  2RHU A;  2KYB A;  4OMP A;  3RBB B;  1QVG P;  1RAA B;  2BTT A;  4Z8A A;  5KE2 A;  1VQ6 Q;  3CPW P;  2EGC A;  3EFO A;  1VA7 A;  3M5A A;  2LTO A;  3CCV Q;  1JJ2 A;  3CD6 T;  3X24 B;  1WQ7 A;  2EFI A;  2DF6 A;  4M75 C;  3T9N A;  5FRO A;  3OYB A;  5FWB A;  4WF2 A;  1X43 A;  1VQ7 Q;  1D1A A;  2M9U A;  4PJM A;  1X6G A;  1ACM B;  3G4S Q;  4M77 A;  1OUL A;  2COZ A;  1OPK A;  1ZA2 B;  2JMC A;  2QYZ A;  2V1R A;  1NZ9 A;  1V76 A;  3HSB A;  4TVR A;  4EPC A;  2E70 A;  3CXC A;  2FZG B;  1K9M R;  1NEB A;  2K3Y A;  2RQR A;  1NJI C;  1Y07 A;  5D6W A;  3CCU Q;  3CCQ A;  1JRI A;  1HK9 A;  3JSC A;  4RTT A;  2P0P A;  2RN8 A;  2KI7 A;  4LDV A;  3OYH A;  1AVZ C;  1YHQ T;  2DVE A;  1KQS S;  2H3E B;  1QQJ A;  3PE0 A;  2LJ0 A;  2EQU A;  3U23 A;  4HVW A;  1SRL A;  1Y57 A;  3CCS Q;  2F5K A;  2Y4Y A;  1Y96 A;  3MCA B;  1LJO A;  2PVD B;  3CPW S;  4C5E A;  3QPH A;  4II1 A;  2KYM A;  2LNH B;  1VQ6 A;  1YCY A;  5A0L A;  2RA2 A;  1ZUY A;  3EG3 A;  2X9H A;  2AT1 B;  4M4Z A;  2XK0 A;  4R55 A;  3CCE T;  1RAC B;  2DKG A;  1VQ7 A;  3JCM P;  4IUU A;  3G4S A;  1NM7 A;  5KH6 A;  1M30 A;  5LL6 S;  1PM3 A;  1SSF A;  3PMT A;  4C5G A;  2LZ6 B;  2JMA A;  3FIF A;  4AFS C;  1D0Y A;  4XTW A;  3TU4 K;  3INZ A;  2D9T A;  4E7I A;  3CXC P;  1M3C A;  3CCU A;  3LW5 E;  4XTU A;  1RAF B;  5D6X A;  2E65 A;  1UDL A;  1VQK T;  3M59 A;  1WYX A;  3OYM A;  1KD1 U;  4O5V A;  1N5Z A;  2OTJ Q;  3CCS A;  2BUD A;  4M7A C;  1N8R C;  2O4X A;  1YIJ Q;  3VYG A;  3QKJ A;  2FPD A;  2ABL A;  1JJ2 S;  2RI2 A;  4JS4 A;  1GFD A;  2L2P A;  2VC8 A;  5CKE A;  3MPU B;  4A4F A;  2CZ6 B;  4N4H A;  1RAI B;  2CP3 A;  4NL2 A;  1M4Z A;  5A0D A;  1X2Q A;  4XK8 E;  1V1C A;  2LCL A;  4LXC A;  3OY9 A;  2NYS A;  2RJE A;  3VS0 A;  3CBO A;  4C0G A;  2Y90 A;  1D09 B;  3CXC S;  3CC4 Q;  1W6X A;  1NG2 A;  4F7U G;  2KAF A;  2LQ8 A;  5FLX E;  3PVL A;  1PKT A;  1ZX6 A;  4B6M A;  3REB B;  3RR6 A;  1XQH A;  3KXT A;  4C0D B;  1M8V A;  4J83 A;  3JB9 J;  4PFP A;  2VUB A;  1LOJ A;  3QSU A;  3CCJ Q;  5GMK e;  3BFM A;  4DBR A;  2JTF A;  4V2S A;  4FIB A;  2E10 A;  5IXB A;  1OOT A;  1YIJ A;  1TUC A;  2DD4 A;  2MWP A;  1MGQ A;  2RQU A;  1VQP T;  1WIE A;  2L3P A;  4RTY A;  2CS7 A;  4E7Z A;  3EHQ A;  2P0K A;  3TSW A;  3HTR A;  2RF0 A;  2GF7 A;  1MMA A;  2SEM A;  5GAO r;  3V8K A;  4AFZ C;  1M90 U;  1OEB A;  2D1X A;  1UFF A;  1NPR A;  2CZ7 B;  1ZBJ A;  1AZE A;  5L8R E;  2ZGW A;  3EG1 A;  4DQ2 A;  1ZSZ B;  3VS2 A;  3CPF A;  3CC4 A;  1XOV A;  3JCM X;  4XAX B;  3VU3 C;  2EYX A;  4JRQ A;  4E7H A;  4M7D A;  2K6D A;  2RJC A;  1Q86 C;  1CKB A;  1M3B A;  1NBE B;  1NLP C;  4FW2 A;  2F2X A;  3QYG B;  4J6Y A;  5HKC A;  4M77 G;  3MP1 A;  2MI6 A;  1JQQ A;  3BW1 A;  1PKS A;  3V7C A;  3CCJ A;  3V7S A;  2ESW A;  1YWP A;  1TSF A;  4EMK B;  3MJX A;  3PFS A;  3RNJ A;  3C0C A;  5CQY A;  2X4X A;  3OBY A;  5GAO m;  4HCB A;  2HSE B;  1BIB A;  2ZAE A;  3GNF B;  1M1G A;  1GBR A;  4QQ6 A;  2CH4 A;  4HT9 A;  1VQ8 T;  2ZPF B;  4N4G A;  4FSX A;  3MEW A;  1MNE A;  3VS6 A;  4ESR A;  2P4R A;  2DM1 A;  2MF2 A;  4LN2 A;  2AZS A;  2PU9 B;  4PFO A;  4JLI A;  5KYX A;  2JW4 A;  5FU6 B;  3CCQ T;  2AZV A;  1R0C B;  4M75 G;  1QVP A;  1G8X A;  1ZHI A;  1Q81 C;  3CC2 T;  2RJF A;  3NMZ C;  4C8Q E;  4CRI A;  2XD0 A;  1WHG A;  2FZC B;  3QYH B;  2A7Y A;  1B34 A;  5GAN 3;  2F69 A;  1U1T A;  4D8K A;  3QZ9 B;  1B34 B;  4JZ4 A;  2F1L A;  3EAE A;  3OS5 A;  4BUG A;  2LJ1 A;  1SRM A;  3M57 A;  3M56 A;  2JTM A;  1FXX A;  4XTZ A;  2ZPG B;  2CZ1 B;  3GF5 A;  3L2Z A;  3CQT A;  4MDW A;  2DTO A;  2RHZ A;  5KCH A;  1OYX A;  3L2U A;  4BY6 C;  2O88 A;  3OYD A;  2DL7 A;  4AFQ C;  1KIK A;  4PJO E;  1AWX A;  1RAH B;  2OAU A;  4MMK A;  5GAM e;  4Z88 A;  2GFA A;  3S6W A;  3H9N A;  3CCL Q;  1K9A A;  1QKX A;  2CT4 A;  1Q82 C;  4M78 E;  1NJI U;  1RAB B;  1WHJ A;  5DM7 R;  3CCU T;  2DL4 A;  5GAO n;  2D8H A;  3HKS A;  1VQ9 Q;  2EYY A;  4C5H A;  5KYY B;  2D6F A;  2CP6 A;  2EJG A;  4RCC A;  1VIF A;  3UT1 A;  2J6F A;  1G83 A;  2YRV A;  2ATC B;  1D3B A;  3CCS T;  1WHM A;  2EQM A;  1D3B B;  4XTY A;  4PNO A;  2K7A A;  4GLM A;  4RTX A;  4BD3 A;  5FRM A;  5CAI A;  4P5N A;  2NLU A;  2LJ3 A;  2LRQ A;  2YDL A;  2CSQ A;  2HKN A;  2MMP A;  2D8J A;  3VRZ A;  2WSC E;  1I81 A;  1OU8 A;  3UWN A;  5CIU A;  3LWH A;  2DET A;  2K3B A;  3OMG A;  3NGP A;  1QCF A;  2CDT A;  3EG9 A;  1N6A A;  1X2K A;  1YI2 Q;  1YJ9 T;  1MND A;  2EQI A;  3EG9 B;  2CRE A;  1UB4 A;  2B86 A;  4HVV A;  3CCL A;  1AZG B;  3C4S A;  4DBH A;  1UG1 A;  4C8Q A;  2NUP B;  2BZY A;  3M4G A;  1VQ9 A;  2DIQ A;  2KE9 A;  4ANJ A;  4RUG A;  1WGS A;  4ZGJ B;  3CME Q;  2QDL A;  1SHF A;  1QW1 A;  1YFN A;  1PSE A;  2ZPI B;  1N8R U;  5KYN A;  3QBY A;  3E19 A;  1UGV A;  3LGL A;  2GFU A;  5IXF A;  4M7D G;  4PJO A;  5I2S A;  2K4Y A;  3VS1 A;  1OX8 A;  4A63 B;  4J9F A;  4FSS A;  3EGU A;  2HSP A;  4C0F A;  5GAM f;  2PUO B;  4F14 A;  5FU7 C;  5GAN d;  1NPP A;  4M78 A;  2L0A A;  5KYU B;  1YI2 A;  3Q1J A;  5GAO p;  2L5Q A;  3NTI A;  4JRK A;  4BE0 A;  5AT1 B;  3LLR A;  1GRI A;  4EDU A;  4C92 E;  4KBM B;  3SWN A;  1RI0 A;  4PLI A;  1WPY A;  2YUO A;  8AT1 B;  2DL8 A;  1OZ3 A;  1X27 A;  2X4J A;  1FMW A;  3HFO A;  1X6O A;  3CCJ T;  4OVA A;  1MMG A;  2DO3 A;  2CSI A;  1IGQ A;  2QEX T;  2K57 A;  2HAX A;  1CSK A;  4LDU A;  2E12 A;  4QKU A;  4F7U A;  2E41 A;  4K11 A;  3MP6 A;  4F7U B;  1PWT A;  4JLG A;  1PRM C;  3OYJ A;  4NOY A;  1UE9 A;  2QG9 B;  2QQ9 A;  2YRD A;  3VS5 A;  2L3Q A;  2E3H A;  1D1B A;  2V1Q A;  3EG0 A;  4JJB A;  1ZUU A;  4B9X A;  2JNG A;  2YWW A;  2YUQ A;  1Q7Y R;  3GP8 A;  5GAN 6;  2FG0 A;  4XU3 A;  1VQO T;  2AKL A;  1R8O B;  2DMO A;  3QXE B;  4F7U F;  2YSQ A;  1TG0 A;  2JZ2 A;  1TOV A;  4BE1 A;  1N27 A;  4BE2 A;  3EFS A;  3M4Y A;  2EVR A;  1Q86 U;  1K8A R;  1GCQ C;  2K5L A;  1FWZ A;  2MCN A;  5A2Q E;  2DYB A;  2KMT A;  1TTH B;  5GAO q;  4OF1 A;  3OBW A;  3OYF A;  1PSF A;  2EPD A;  2JVV A;  1NLO C;  2ECZ A;  4FYW B;  2YUP A;  5M9O A;  4HCK A;  5HK0 A;  5GMK i;  3TVT A;  2RNA A;  4XU2 A;  4OGC A;  2EJ9 A;  3EFO B;  3OYA A;  3LH0 A;  2RHI A;  4PJJ A;  1AEY A;  1ZQ1 A;  2E1H A;  3CC7 T;  4J7I A;  1HYO A;  1R0B G;  1RUW A;  4Q5W A;  1IO6 A;  2X4Y A;  4M77 B;  1VQN Q;  4JJC A;  1W1F A;  3LGF A;  1JEG A;  2HBP A;  4A4K A;  4JRI A;  1G3S A;  4LUD A;  2LVM A;  1K4U S;  2O31 A;  1WHL A;  2A08 A;  4C92 A;  3MEA A;  3NTH A;  5CK9 A;  1UEB A;  2ZPE B;  4HCC A;  2DEQ A;  1Q81 U;  4E7S A;  1I5L A;  5KE3 A;  1Z9Q A;  1QMC A;  1O75 A;  1JXO A;  3C94 A;  1M2V A;  1U5S A;  1M2V B;  1RLQ C;  4M77 F;  4WCI A;  1K73 C;  1SSH A;  2FEI A;  4IUQ A;  5GAN 7;  1UGR B;  4PJN A;  1VUB A;  1QVG S;  2EGA A;  2DIL A;  2CT3 A;  4DEY A;  1Y96 B;  4M7A E;  3EGX A;  4N4I A;  4AT1 B;  4M75 A;  1IRX A;  1SPK A;  1GXI E;  1Q95 G;  3CCV A;  4C8Q G;  4M75 B;  2MOX A;  2C0O A;  1FMV A;  2DFU A;  4D8D A;  1EIF A;  4ATO A;  5GAN j;  3JV3 A;  5FRN A;  4OML A;  2MPX C;  3M54 A;  3PIP A;  2QQB A;  3FDR A;  1VQN A;  2CUB A;  2WAC A;  1S72 T;  4RCB A;  3CCL T;  4JZ3 A;  2EYQ A;  1Q82 U;  4F16 A;  4MZP A;  4OB3 B;  2DZC A;  3H0H A;  4M75 F;  2KT8 A;  3L42 A;  1QCN A;  3PMI A;  3GOX A;  3O5Z A;  1RAE B;  4PJO G;  5GAN f;  2DJZ A;  4BI3 A;  2GCX A;  5GAN 2;  2XID A;  3V8J A;  1WJS A;  2P4T A;  3BY7 A;  1JO8 A;  3KFV A;  1HXD A;  1RL2 A;  4ORZ A;  1KD1 R;  2EAY A;  4M78 G; 
#chains in the Genus database with same CATH homology
 1SEM A;  1J3T A;  2F2W A;  1HD3 A;  2RPN A;  1GBR A;  2M0Y A;  2EYW A;  1E6H A;  1T0J A;  1PHT A;  2CH4 A;  1PNJ A;  2JS2 A;  3NHN A;  1BK2 A;  1QKW A;  1OPL A;  1W70 A;  2VVK A;  1U06 A;  4Z89 A;  2EGE A;  1SHG A;  1I07 A;  2LP5 A;  3A98 A;  1Z9Z A;  2DJQ A;  1RI9 A;  3VS6 A;  4ESR A;  2P4R A;  2W0Z A;  2DM1 A;  4LN2 A;  2AZS A;  2X3X D;  2NUZ A;  2DLP A;  2JW4 A;  4J9B A;  3H0F A;  1M27 C;  1UTI A;  2CH4 W;  2J6O A;  3M0R A;  1AWO A;  2EKH A;  3UA6 A;  2AZV A;  2I0N A;  4QT7 A;  5HCK A;  1WX6 A;  4EIK A;  3NMZ C;  2DA9 A;  5I11 A;  2KEA A;  1HSQ A;  1BB9 A;  1QWE A;  1TUD A;  4D8K A;  2KR3 A;  2DL3 A;  1NYG A;  2LX7 A;  4JZ4 A;  4R0K A;  1H92 A;  4LE9 A;  1T0H A;  2DRK A;  2LJ1 A;  1GCQ A;  1SRM A;  2GQI A;  2KRO A;  2VWF A;  2W10 A;  1KFZ A;  1WFW A;  1G2B A;  3CQT A;  1BU1 A;  3R6N A;  1YNZ A;  2JXB A;  1ZUK A;  2O88 A;  1WI7 A;  2HBW A;  1BBZ A;  1YWO A;  2DL7 A;  4AFQ C;  1KIK A;  4OMO A;  3SHW A;  2C0I A;  2PZ1 A;  3SEM A;  1T3L A;  1FMK A;  4OMN A;  1AWX A;  1T3S A;  5IH2 A;  1U3O A;  2LQW A;  2LQN A;  2KBT A;  4Z88 A;  4IIM A;  4LNP A;  1I1J A;  3I35 A;  4J9C A;  5IHK A;  2ED1 A;  1K9A A;  1QKX A;  2CT4 A;  3H41 A;  2J05 A;  1NYF A;  2KRM A;  2DL4 A;  2FRW A;  1A0N B;  2D8H A;  1QLY A;  2EYY A;  2RQT A;  3LH5 A;  2SRC A;  4HVU A;  1H3H A;  2YUN A;  2BZX A;  3IQL A;  2D0N A;  2J6F A;  3UF4 A;  1G83 A;  2FO0 A;  2FPE A;  2G6F X;  1UUE A;  1K76 A;  4J9E A;  1B07 A;  1WXT A;  2K7A A;  5EC7 A;  4GLM A;  2DE0 X;  4RTX A;  2O9V A;  5L23 A;  1KJW A;  2LJ3 A;  3NPF A;  2GBQ A;  2HCK A;  2YDL A;  2CSQ A;  1OV3 A;  4ZNX A;  3VS7 A;  4J9D A;  2D8J A;  2OAW A;  3VRZ A;  2HEQ A;  1M8M A;  3M0T A;  1YCS B;  2H8H A;  2GTO A;  2K3B A;  2LMJ A;  3NGP A;  3M0S A;  1GCP A;  1QCF A;  2RMO A;  5GJW B;  2CDT A;  3THK A;  3VS3 A;  1MV0 B;  2A37 A;  2ENM A;  4CC3 A;  1X2K A;  2EQI A;  2OJ2 A;  2LCS A;  1MV3 A;  2K2M A;  2CRE A;  3I9Q A;  2B86 A;  2AKK A;  4HVV A;  1WXU A;  2JM8 A;  2ED0 A;  2DNU A;  2BZ8 A;  1AZG B;  5FWC A;  2KRS A;  2JM9 A;  2J6K A;  1UG1 A;  3EHR A;  1Y0M A;  1VYT A;  4RTW A;  1K1Z A;  1X69 A;  2MIO A;  2BZY A;  2NWM A;  2K9G A;  3QWX X;  1JXM A;  1UJY A;  2KE9 A;  1S1N A;  2PTK A;  2M51 A;  4RUG A;  2RQW A;  4DEX A;  4OMP A;  2KYB A;  2QDL A;  3RBB B;  3M0Q A;  2DL5 A;  1SHF A;  2BTT A;  2KGT A;  4Z8A A;  2EGC A;  2X3W D;  1VA7 A;  2DF6 A;  4RTU A;  2VKN A;  5FWB A;  1B3Q A;  1ARK A;  1X43 A;  1UGV A;  1X6G A;  4GBQ A;  2GNC A;  1HJD A;  1E7O A;  5IXF A;  1K0X A;  1OPK A;  2JMC A;  3VS1 A;  3M0U A;  2V1R A;  1AWW A;  2A28 A;  4A63 B;  4J9F A;  4FSS A;  3EGU A;  2HSP A;  1NEB A;  4F14 A;  2RQR A;  1KSW A;  4E6R A;  2L0A A;  4IIO A;  4RTT A;  2RN8 A;  5FW9 A;  2C0T A;  2PNI A;  1AVZ C;  1ZSG A;  1I0C A;  1GRI A;  3PE0 A;  3ULR B;  2LJ0 A;  3U23 A;  4HVW A;  1SRL A;  1Y57 A;  2YUO A;  2XMF A;  2DRM A;  2DL8 A;  1X27 A;  2L3S A;  4AG2 C;  4X1V A;  5IHI A;  2AK5 A;  2F2V A;  2KYM A;  2CSI A;  2LNH B;  1ZUY A;  3H0I A;  4HXJ A;  3REA B;  1GL5 A;  2DBK A;  1CSK A;  1CKA A;  3EG3 A;  3I5R A;  4J9I A;  4M4Z A;  1WLP B;  3GBQ A;  4J9G A;  4K11 A;  2DVJ A;  1PWT A;  2JT4 A;  1PRM C;  5GJV B;  1UE9 A;  1NM7 A;  1M30 A;  2ROT A;  3VS4 A;  2LZ6 B;  2JMA A;  3VS5 A;  4AFS C;  1GFC A;  2L3Q A;  2DBM A;  2V1Q A;  3EG0 A;  4JJB A;  2OI3 A;  1ZUU A;  2YUQ A;  1M3C A;  2FG0 A;  2O9S A;  2AKL A;  2DMO A;  2YSQ A;  1TG0 A;  1UDL A;  1QWF A;  1WYX A;  1VYU A;  2CUD A;  2EVR A;  2RQV A;  1E6G A;  4JPB W;  1AWJ A;  1GCQ C;  2YT6 A;  1NEG A;  1N5Z A;  1YN8 A;  2MCN A;  4J9H A;  2DYB A;  5I22 A;  4OMM A;  1GBQ A;  1PRL C;  4AG1 C;  2FPD A;  2ABL A;  1AOJ A;  1GFD A;  2JS0 A;  2L2P A;  2EPD A;  1NLO C;  2ECZ A;  2YUP A;  3VRY A;  3I5S A;  3QWY A;  2O2O A;  4HCK A;  3TVT A;  4JJD A;  2DX1 A;  2RNA A;  2A36 A;  1X2Q A;  1V1C A;  1AEY A;  1UHF A;  4CC2 A;  3VS0 A;  4OMQ A;  1RUW A;  4F17 A;  1IO6 A;  1W6X A;  1AD5 A;  1NG2 A;  4JJC A;  1W1F A;  1JEG A;  1X6B A;  1ZLM A;  3PVL A;  4LUD A;  4CC7 A;  1K4U S;  1PKT A;  1ZX6 A;  2O31 A;  3REB B;  2A08 A;  2KRN A;  2EYZ A;  1ABQ A;  1UJ0 A;  1Z9Q A;  4RTZ A;  3PVQ A;  1JXO A;  2J7I A;  1U5S A;  2GGR A;  1RLQ C;  4WCI A;  1SSH A;  5IXB A;  2FEI A;  3EG2 A;  1OOT A;  1JU5 C;  1TUC A;  5IHN A;  2EGA A;  2JTE A;  2DIL A;  2KXD A;  2CT3 A;  4KRT A;  2RQU A;  1WXB A;  4DEY A;  1WIE A;  2FPF A;  2KNB B;  2L3P A;  4RTY A;  1VYV A;  3EHQ A;  1ABO A;  3TSW A;  3TSZ A;  2RF0 A;  1UEC A;  2EW3 A;  2SEM A;  1WDX A;  4AFZ C;  1SPK A;  1OEB A;  2D1X A;  1UFF A;  2MOX A;  2C0O A;  1K0S A;  4Y92 A;  1ZBJ A;  4D8D A;  1AZE A;  1RLP C;  2E5K A;  3UA7 A;  3EG1 A;  4LUE A;  1EFN A;  3JV3 A;  2ROL A;  2K79 A;  2IIM A;  2EBP A;  3VS2 A;  3UAT A;  4OML A;  1XOV A;  3FJ5 A;  2J06 A;  1LCK A;  2EYX A;  2CUB A;  2K6D A;  4AFU C;  3ZL7 C;  4JZ3 A;  4F16 A;  1M3B A;  1CKB A;  1NLP C;  2F2X A;  3H0H A;  1MUZ A;  2KT8 A;  4RTV A;  2FRY A;  1FYN A;  3O5Z A;  1JQQ A;  1PKS A;  2HDA A;  1H8K A;  2ESW A;  2KXC A;  1YWP A;  1M3A A;  5ECA A;  2GTJ A;  3RNJ A;  1YP5 A;  3C0C A;  4CC4 B;  1UHC A;  3M0P A;  1JO8 A;  1WA7 A;  2KT1 A;  3KFV A;  4ORZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...