2KRSA

Solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable enterotoxin
publication title Solution NMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A.
rcsb
source organism Clostridium perfringens
molecule tags Structural genomics, unknown function
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08239 SH3_3 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krsA01
2KRMA 1G2BA 2SEMA 2KXCA 1MUZA 1QKXA 1TG0A 4AFQC 4JJBA 4RTUA 3VS2A 2EKHA 1AEYA 2QDLA 2BTTA 4RTVA 2AZSA 1JU5C 2DL5A 1NLPC 4Z89A 4F16A 2LP5A 1IO6A 1K0SA 1Y57A 2AK5A 1HD3A 2RQUA 3THKA 2D8JA 1ABOA 2DRKA 4LUDA 1I1JA 1AWOA 5IXFA 2DX1A 1N5ZA 1E6HA 1W6XA 1U06A 2FPEA 2YDLA 4HVVA 1JXMA 2JM8A 5EC7A 3RBBB 2O9SA 3TSWA 3CQTA 1ZUYA 3C0CA 1Y0MA 1UG1A 2KGTA 2L3QA 4Z8AA 5IHNA 2YUQA 5IH2A 4F17A 1RI9A 1CSKA 2W0ZA 2EYXA 3VS5A 1VYVA 1X6GA 2LJ0A 1PRMC 4J9FA 1QCFA 4J9IA 1AZGB 2A08A 5IHKA 1NG2A 1K4US 1UGVA 4ORZA 3SHWA 2J6FA 1OPKA 1PHTA 1M30A 1NYGA 1UFFA 2G6FX 2EBPA 1VA7A 2W10A 2FO0A 2CT4A 2LMJA 3UF4A 2V1RA 1X69A 1G83A 2RN8A 1T0JA 1RLPC 2H8HA 2D1XA 1GBRA 2A28A 1GCPA 2YUNA 4E6RA 5IHIA 3R6NA 4OMQA 4IIOA 2KYMA 1FYNA 3REBB 3UA6A 4HCKA 1PKTA 1KFZA 2NUZA 1X27A 1Z9QA 3M0UA 4A63B 1X6BA 2FRWA 2K9GA 3EG2A 3VRYA 2CH4W 1UJYA 2EYWA 2JS2A 4OMOA 3I5RA 1UECA 2LQWA 1MV3A 1QWFA 1K1ZA 4AFSC 2RQRA 1X2QA 1I0CA 2ROLA 1KJWA 3EG3A 2PNIA 4Z88A 4LNPA 2EGCA 5I11A 4GLMA 2LQNA 1A0NB 4HXJA 2GQIA 3SEMA 1GCQA 1YWOA 1ARKA 1T0HA 2NWMA 3I5SA 2J6OA 1NEGA 2DM1A 2HSPA 1SRMA 5L23A 2CSQA 3M0SA 4J9CA 2SRCA 2J6KA 3QWYA 2HEQA 1PKSA 4RTYA 1K76A 2J7IA 2X3XD 5GJWB 2KNBB 2HCKA 1M3BA 1CKBA 2K2MA 2F2WA 2LX7A 2MOXA 2C0TA 2CSIA 3M0RA 1SHFA 2JMCA 1GBQA 2CREA 1YN8A 2EW3A 3VS6A 1WX6A 4OMPA 3UA7A 1KSWA 2B86A 2RMOA 5HCKA 2X3WD 3REAB 2ROTA 2J06A 3H41A 2GNCA 2DL8A 2O88A 3NPFA 4J9GA 3QWXX 2YSQA 4OMMA 1SEMA 1H3HA 1H8KA 2EVRA 4J9DA 1EFNA 2P4RA 2L0AA 1LCKA 2ED0A 1QWEA 2ED1A 1YNZA 2DF6A 4JZ3A 2CT3A 4AG1C 1PWTA 4AFZC 2V1QA 1AD5A 5FWBA 1QLYA 1ZSGA 4LE9A 2E5KA 2DBMA 1Z9ZA 1M8MA 1T3SA 2C0OA 3I35A 2RF0A 2DYBA 2YUPA 1NYFA 4GBQA 1X2KA 1UHFA 1RLQC 2DBKA 3KFVA 3LH5A 1ZUUA 2CH4A 1YP5A 4RTWA 3EG1A 2J05A 1VYUA 2OI3A 4JJDA 1SRLA 2OAWA 1WYXA 2RQTA 1SHGA 1GRIA 3ZL7C 2DJQA 1XOVA 3VS3A 2DRMA 2ESWA 1OEBA 2O2OA 3RNJA 3GBQA 2KRSA 3ULRB 2F2VA 2RPNA 3EGUA 1V1CA 1BU1A 2KEAA 4OMNA 2KT8A 4DEYA 2DL3A 2EYYA 1UHCA 4D8DA 2BZ8A 2DL7A 2IIMA 2JXBA 4AFUC 4M4ZA 4J9EA 2OJ2A 1HSQA 4KRTA 2K6DA 2LJ1A 2MIOA 1ABQA 4RTXA 1JEGA 2I0NA 1FMKA 4QT7A 3I9QA 4ZNXA 2DNUA 2A37A 1T3LA 2JMAA 4CC2A 1M3CA 3NMZC 2AZVA 2L3PA 2GBQA 4D8KA 2AKKA 2YT6A 3JV3A 1I07A 1W70A 3H0IA 1NEBA 2O9VA 2DMOA 1K9AA 2EYZA 2RQWA 1UTIA 1PNJA 2D8HA 5IXBA 2BZYA 2XMFA 3PVQA 1UE9A 2K3BA 2HDAA 1CKAA 1UJ0A 2FRYA 2JW4A 3VS0A 1OV3A 4WCIA 4AG2C 2DVJA 2FPFA 3PVLA 2LCSA 1WA7A 4HVWA 2GGRA 1J3TA 4HVUA 3TVTA 1WFWA 1WDXA 2RQVA 2JT4A 1GCQC 2KXDA 1OOTA 2MCNA 3UATA 2KT1A 2LZ6B 2VVKA 3IQLA 2K7AA 2KBTA 1AWXA 1ZUKA 3NHNA 2VKNA 2DA9A 1U3OA 2KRNA 3TSZA 2FPDA 1E7OA 4LN2A 4RTZA 2KR3A 3VS1A 2DLPA 4CC7A 1AOJA 1ZX6A 2M51A 3FJ5A 1UDLA 1WIEA 2CUBA 1JXOA 1QKWA 1MV0B 2AKLA 3VS4A 1K0XA 1BK2A 4RUGA 2RNAA 2PTKA 3VS7A 2JS0A 2FG0A 1GFDA 1UUEA 1AWWA 2VWFA 4J9BA 4JPBW 4ESRA 2CUDA 1NM7A 4EIKA 2C0IA 2DE0X 2D0NA 1JQQA 1B07A 1JO8A 3M0QA 4OMLA 4F14A 2M0YA 2ABLA 3M0TA 1E6GA 4K11A 4Y92A 1ZBJA 4J9HA 2A36A 1NLOC 4IIMA 3EHQA 1SPKA 2GTJA 2LJ3A 3EHRA 3M0PA 1BB9A 1TUCA 2EGEA 1X43A 1B3QA 2ENMA 3O5ZA 1AVZC 1M3AA 2ECZA 2EQIA 1GFCA 4X1VA 1U5SA 2EGAA 5FWCA 2PZ1A 3VRZA 1S1NA 4DEXA 1YWPA 1M27C 2BZXA 1TUDA 1WXTA 4JJCA 1AWJA 1WXUA 4CC3A 1H92A 4RTTA 1VYTA 2O31A 1SSHA 3A98A 5I22A 1GL5A 2YUOA 2KROA 2LNHB 2GTOA 4FSSA 4LUEA 3PE0A 2CDTA 1HJDA 1WXBA 1AZEA 2KE9A 2HBWA 2K79A 1YCSB 2F2XA 2KYBA 5FW9A 1WI7A 1RUWA 3NGPA 4CC4B 2FEIA 5GJVB 2L3SA 3U23A 1KIKA 5ECAA 1WLPB 1BBZA 1PRLC 2L2PA 1ZLMA 3H0FA 4JZ4A 3EG0A 2DL4A 3H0HA 4R0KA 1OPLA 2JTEA 1W1FA 2JM9A 2EPDA 2DILA
chains in the Genus database with same CATH superfamily
1YBYA 5A0LA 1UB4A 2H3JA 1MUZA 1WJRA 3E2UA 1QKXA 5GMKj 1RADB 2EIFA 1AEYA 2BTTA 1PD1A 2AZSA 5CKFA 5EG2A 4JRPA 1NLPC 2XDPA 3I55A 4M77E 2MWOA 1KD1U 2OTJA 1VQLA 4PJLA 5KE2A 1ABOA 2DRKA 4LUDA 1AWOA 3CCUQ 4B6MA 4M7AA 1N5ZA 3LWHA 2HQXA 4HVVA 1JXMA 2JM8A 3RBBB 2O9SA 3OW2A 2FL7A 3H6ZA 4EMHA 3CQTA 1V76A 4XTWA 3OYCA 2E4HA 2VYTA 2ZPIB 4BY6B 4LDWA 3CC2Q 4FYYB 1RI9A 1UGSB 2W0ZA 3CC7A 2LJ0A 1K8AU 4RCBA 1WGSA 2QA4T 2P84A 2A08A 2A7YA 2K3XA 1IRXA 2HL3A 2JTMA 3MP1A 3SHWA 1QCNA 1UFFA 4N0AA 1NJIR 4UC4A 2FO0A 1BCMA 3CCMA 2DO3A 4J6WA 2MPXC 2H8HA 2DFUA 2HNIA 1QMCA 4OMQA 1HK9A 4HCKA 2X4JA 1X27A 1Z9QA 4C8QE 4A63B 1X6BA 3VRYA 4J7FA 3CCJQ 5DY9A 3SWNB 1MV3A 1K73R 4BI3A 2RQRA 4FW2A 1I0CA 2ROLA 2WSEE 1Q7YC 1R0BG 3EG3A 4Z88A 4LNPA 4M7DF 4IUPA 2DERA 1OX9A 3OYBA 4C8QB 1M2VB 4A54A 1A0NB 2GQIA 4F7UA 2HKQB 1GCQA 5GANe 4PLLA 1ARKA 3HRTA 3V7SA 2J6OA 4C5EA 2E65A 5LJ3h 3EGDB 3OYYA 5GAMf 3QJ6A 3SDZA 5CKHA 1EX4A 4ZTFA 2CP6A 4OP0A 5I2MA 2LNVA 2HEQA 4RTYA 4FYVB 2L5QA 3VU3C 1CKBA 1VQ7Q 2NUPB 3M0RA 3S6WA 1YN8A 4M78B 2EW3A 3M57A 1PCXA 3BFMA 3CC2T 4JRIA 5KH6A 3VUZA 5GMKi 1M1FA 2B86A 2X3WD 2QG9B 4TVRA 3JCMQ 2GNCA 2O88A 3CMAQ 3RMQA 3OYNA 2YSQA 1YJNA 2EVRA 2MMPA 3INZA 2L0AA 1YHQQ 3WXMB 2KY9A 3CCEQ 4C92E 1OYXA 2VC8A 4JZ3A 3F70A 2IG0A 2ZPEB 3WVDB 1VQ8A 2ZPHB 4AG1C 4BB7A 2QDYB 4N4IA 3C4SA 2DETA 4M7DC 3FRNA 5D6YA 4E7HA 3EAEA 2KAFA 4M77F 1Y07A 4M7DD 1T3SA 3GLXA 1ACMB 4O6JA 1NYFA 3EFOB 3TQ7P 3OYDA 3CCJT 1H3ZA 3PFSA 1M5Q1 1G3WA 1RLQC 3JCMf 4M75C 2GFAA 5KYWA 3UWNA 1ZSZC 2YRVA 3EG1A 4C0DC 5C0MA 1IGUA 4M75D 2FHDA 2RQTA 3MEWA 1WYXA 2KDSA 3VS3A 2X9HA 2ESWA 1OEBA 4ZGJB 2L8DA 4KUIA 3NTIA 4L59A 3S3OA 1YIJA 2M16A 3EGUA 5CAIA 3LGFA 2JUFA 4E7KA 1QCOA 2DL7A 1NJIC 4LDVA 2KQWA 3OQ5A 1R77A 4AFUC 1VQ7T 4M4ZA 2K6DA 3M56A 3VV0A 2E70A 2I0NA 1ZHIA 3FIFA 2BE9B 4P5NA 1T3LA 4KH1B 2E3IA 4OGCA 5GAMh 3CMAT 3LWIA 2WSFE 2RHZA 4A4KA 5GAN2 4RMOA 1VQ4A 5GANd 4D8KA 1K73C 3BDLA 1YHQT 1UGRB 1OULA 2RQWA 1OZ3A 3CCET 5IXBA 1Y96B 2COZA 1JJ2A 3ME9A 1LVKA 1UJ0A 4NOYA 1OV3A 1VIEA 4FW1A 3JCMX 4IKFA 3UT1A 2LCSA 4II1A 3M59A 1WFWA 1K9MR 1SF9A 2JT4A 2MCNA 2LZ6B 2VVKA 3IQLA 1M1KC 2KBTA 1ZUKA 3OSVA 3CPWP 2WSCE 2GFUA 3FJ5A 5HK0A 4HCCA 4PJOA 1D0ZA 1K0XA 3I56Q 2PTKA 2QAZA 2FYKA 3RR6A 1GFDA 2COWA 2EQMA 1EZZB 2IPOB 2LC4A 2CUDA 1NM7A 2DE0X 2LT1A 5LL6S 1U1TA 1JQQA 3M0QA 1MMDA 1M90U 4FYWB 4ZN1A 2RI5A 3JCMh 4J9HA 5GAOl 5GAOq 4C92F 3EHQA 4ZGDB 3DLMA 3X25B 5LJ3g 1MMNA 3JCMc 1WZOA 1BB9A 3CPWS 1RAAB 4BI4A 3VJPA 4M78A 2ENMA 3O5ZA 1WHGA 3KXTA 1TOVA 2ECZA 2QTXA 5GAN7 4X1VA 1U5SA 3OA6A 1VQ5Q 3FLGA 2HAXA 4O5VA 2EQUA 4OB0B 2ZPFB 1I5LA 3EH1A 4PJOC 1W2BP 2BZXA 1TUDA 5LJ5e 1VQKQ 2VV5A 4PJOD 4CC3A 1H92A 4PFOA 2JNGA 3G4SQ 2DYIA 4ANJA 2LDMA 5KYYA 2O31A 1N27A 4E7ZA 2WACA 3A98A 4M77G 3J7AF 1RL2A 5DLQE 2GTOA 2MYSA 4XTZA 3CMEA 2L3RA 4J83A 1YCSB 2CP0A 5FW9A 1IXDA 2R57A 1WI7A 4CC4B 2MWPA 1VQ9A 3SB2A 3U23A 1WLPB 2HSEB 4KT0E 1X6OA 1ZLMA 2Y4XA 3LX7A 3EG0A 1LJOA 3V7CA 3E9FA 4ELZC 1S72Q 2JM9A 3I56T 1JB0E 4XU0A 4IUTA 1B34A 3BE3A 4AFQC 4RTUA 3VS2A 1IZ6A 2XIDA 2EKHA 4RTVA 2V8JA 1JU5C 4Z89A 1IO6A 1K0SA 3QG1A 4QVZA 2AK5A 3CC4A 2RQUA 5CKDA 2RO0A 2D8JA 3THKA 4Y91A 4A4GA 3CCQT 2QEXQ 4JUVA 4RCCA 4L5GA 2VASA 4XAXB 4QVCA 4FU6A 3OYEA 4A4EA 5EC7A 3H8ZA 4JRKA 4HA8A 4C8QG 1PSEA 1M9SA 1ZUYA 1VQ5T 3RKXA 4HCBA 1K9MC 4AT1B 2RHUA 4DBRA 1D0YA 5D6WA 1D09B 3VS5A 3JB9H 1VYVA 3MHXA 3SD4A 5I2SA 1YI2A 4J9FA 3G4ST 1N6AA 1QCFA 1AZGB 3M4YA 1G8XA 2NUTA 5IHKA 1NG2A 4RG2A 1K4US 5GAMg 2QQAA 1NYGA 2ZAEA 3V8LA 4M7DE 1VA7A 2W10A 3QDRB 4BI8B 2CT4A 1Q82R 1YITA 3OMCA 1Q86U 3P8HA 4E6RA 1KG1A 5IHIA 2KYMA 3UA6A 4J8OA 4M7DB 4XTYA 4M75E 1KFZA 2NUZA 1YJWQ 1VQOA 4LD6A 4C0FA 1LOJA 3EG2A 2EYWA 3JRZA 5GAN8 1UECA 2LQWA 5D7UA 1S72T 1QWFA 3G6EA 3X28B 5LJ5d 3CD6A 2P0QA 4M75B 4BDYA 2EGCA 1VQMA 4DA4A 2RHIA 3AHUA 4PLIA 1ZSZB 2QYZA 4C0DB 5FU7C 4QW2A 4EDUA 5CQXA 2AHJB 4C92G 2NWMA 4J5YA 5FLXE 3MO8A 1BI1A 1TWBA 1NEGA 2DM1A 4OB3B 1Q81U 1BI0A 2HSPA 1FX7A 2BUDA 1KD1R 2QEXT 4N4HA 5J26A 4J9CA 2O01E 3QWYA 3CCLQ 2QQSA 1FMWA 1KQSS 4BACA 4WF2A 2X3XD 1PD0A 2KNBB 2PUKB 3CBMA 3X26B 3QUIA 2LX7A 4DQ2A 3PGGA 2C0TA 3JCMg 5GMKe 1SHFA 1BI2A 3RESA 2FVUA 4EMKB 5C6SA 2X4YA 4OB2B 1NE8A 3TU4K 5D6XA 3V7RA 5HCKA 5CKBA 3I55Q 3META 3RIRA 1MGQA 3L2UA 1G3SA 2OTJQ 2DL8A 3NPFA 3JB9D 2XDBA 1VQLQ 5A0DA 4CRIA 1SSFA 1H3HA 1H8KA 4J9DA 1QVFP 2P4RA 4IUVA 4M77B 4ATOA 1QWEA 2HZYA 2ED1A 1WJQA 1YNZA 3OYFA 5DLOA 3CCUA 4C5IA 4RG8A 1PWTA 4AFZC 2V1QA 1N8RU 3JCMP 2B8AA 1XTDA 4KGVB 4LD9K 5FWBA 2O4XA 3GNFB 2LCCA 2PUOB 4LE9A 1RAHB 2EJGA 5KCHA 2E5KA 2LVMA 1YJWT 4JLGA 2RHYA 4MDXA 1C1AA 2C0OA 3CC7Q 2EKOA 2X4XA 3LW5E 4OB1B 2YUPA 5A2QE 5GMKl 1X2KA 2VXFA 3MKDA 5GAMj 4AMCA 2DBKA 3MP8A 3KFVA 2RA2A 2AIRB 3LH5A 5CCAA 3CCSA 1QVFS 2CH4A 1OI1A 9ATCB 4M7AC 5GAOm 2ZPGB 1SHGA 5KYXB 3CCMQ 2C06A 1KQ2A 4F7UF 4M7AD 2VGNA 2DRMA 4A4HA 1IGQA 1KQSA 1FXXA 2CZ6B 1RI0A 4MZPA 3FB9A 1V1CA 1BU1A 1F1BB 3CCRA 2KT8A 3CCLT 2EYYA 1UHCA 3MEUA 2BZ8A 2E12A 2MAMA 1MNDA 2JXBA 2E5QA 2RHXA 3UPUA 1HSQA 2LJ1A 1Q82C 4A53A 1PC0A 3PNWC 2CP7A 4N0AC 5A0GA 4PJOE 3OYLA 1ZA2B 4E7IA 2AT1B 4M75F 2DK3A 5IN1A 3I55T 3E1SA 3GP8A 3RERA 4EPCA 1G3YA 4CC2A 3L2QA 2VB6A 2OTJT 1VQLT 4J6YA 1M1KR 2JVVA 1MMGA 2L3PA 3JSCA 2YT6A 3H0IA 1NEBA 1NZ9A 2DMOA 1UTIA 1PNJA 2QQBA 3PVQA 1N9SA 4OF1A 3A5ZB 4ME7A 2BE7D 3OMGA 1WA7A 4HVWA 2GGRA 3UDCA 3CCVA 3CC7T 2D0QB 1WHKA 1GCQC 1KD1C 4FT4A 3RUXA 3PMTA 2DA9A 1U3OA 1YJNQ 3RKWA 1BIBA 1ZA1B 3TSZA 3VYHB 2KR3A 3PT9A 3EG9B 2QQ9A 2DLPA 1VIFA 4KBMB 2M51A 4KGXB 1VQ8Q 5GANf 2AKLA 3CCMT 1BK2A 4ELYC 2RNAA 1YJ9A 3EGXB 3VS7A 2VXEA 1YCYA 4MMLA 4C92B 4PFZA 1AWWA 1QW1A 2VWFA 3TCJA 3ASKA 1WPYA 5IT9E 1K8AC 4EIKA 3CXCP 1B07A 2X4WA 2YLBA 1O75A 2ABLA 1E6GA 1ZBJA 3M4GA 2A36A 1AHJB 2GTJA 2LCLA 4LDUA 3DLLA 4EMKA 3JCMV 4HT9A 1AVZC 1KHCA 1IREB 1YIJQ 1I5OB 1YWPA 1VQPA 4FYXB 1M27C 5AYFA 1WXUA 3HFOA 4M77A 5DM7R 3GNGA 2XI9A 4RTTA 1QVGP 5GAOr 2DXCA 1GL5A 2YUOA 4PK4A 4EMGA 4RKUE 3OYJA 4LUEA 3PE0A 3QBYA 3M5AA 2QXFA 3QO3A 1WXBA 1NBEB 3C12A 2DXUA 2ZCFB 2YHTA 1IB8A 2YLCA 4PFPA 2LTOA 1UEBA 1IHVA 1RUWA 1YJNT 4BDZA 2OAUA 2CZ7B 3HP9A 4GY5A 2GF7A 2OTLA 2L2PA 3G71A 2HL5C 3ZBDA 3H0FA 2DIQA 4MZTA 3H0HA 1VQ8T 4R0KA 4BE1A 1OPLA 5KYXA 1W1FA 1QVGS 3MP6A 3FEOA 2EPDA 4PJOF 2KXCA 4YTLA 1QP2A 2X35A 1GXIE 3L2WA 4JJBA 1YJ9T 1BI3A 2DZ9A 3OYAA 2QDLA 3OYHA 5GAN5 2CP2A 3JCMJ 4M7DG 5FU7B 2DL5A 3SWNA 1HYOA 2MF2A 2I2LA 2HMAA 1I8FA 3NFCA 3C95A 1M90R 4DBHA 4C8QA 2DX1A 1C0MA 1M2VA 4DBQA 5FU6C 3E9GA 1W6XA 1U06A 4M75G 2FPEA 4MZMA 2YRDA 5GANh 1M4ZA 3EGDA 3TSWA 5M9OA 2RK2A 1Y0MA 2DAQA 2P0KA 2DKGA 3JCMW 2KGTA 2L3QA 4Z8AA 2YUQA 3MJXA 1YIJT 4F17A 4QQGA 2EYXA 1QVPA 3HFNA 1HXDA 1D3BB 1PRMC 2EAYA 4QQDA 2V8IA 3BY7A 3CCQQ 3OYMA 1MMAA 2NUPA 5CQYA 4J7IA 1UGVA 2JOYA 4JLIA 4JS4A 4DOVA 3GIBA 4KUDK 1PHTA 5GMKm 2G6FX 1RAEB 1OX8A 2LMJA 4PJJA 1QP3A 1G83A 1VQNA 1T0JA 4V2SA 2DJZA 2D1XA 2CZ0B 1GBRA 2A28A 2YUNA 3R6NA 1FYNA 3REBB 3RMSA 1VQ4T 2QQRA 3JB9I 2LX9A 1M8VA 5KYUB 3M0UA 2DPPB 2FRWA 2K9GA 5GAN3 4Z02A 1UJYA 4M7AE 3I5RA 1VQKA 1K1ZA 2XDDA 1X2QA 2KSSA 2GCXA 3EGXA 2PNIA 3CBPA 1KC8U 1BCOA 2H3EB 2PQWA 5I11A 4GLMA 2LQNA 2PU9B 2A3LA 4M78C 3CMEQ 3EFOA 4M7AB 3OSSC 3SEMA 2RI2A 1YWOA 1T0HA 2P4TA 4M78D 2CYZB 1W2BS 4OMFB 2LRQA 1VQ9Q 1WJSA 2YRCA 3QXEB 2J6KA 3M53A 1K76A 2J7IA 2HCKA 3KUFA 3L2RA 2K2MA 3TREA 2F2WA 3T9NA 2MOXA 4KGZB 2E10A 2JMCA 3A8MB 1GBQA 5CR2A 3VS6A 2BIVA 3CPWA 2P0PA 2JTFA 5LJ5f 2XG8D 3L42A 1WX6A 1MHNA 4OMPA 3UA7A 1KSWA 2CS7A 2M0OA 2RMOA 3REAB 2J06A 3H41A 3CC4Q 2FZCB 1U1SA 4XQ3A 2EFIA 1EFNA 1FMVA 1LCKA 3VKIA 2ED0A 1VQ6A 2CT3A 2K5LA 1M1GA 4FM4B 4F7UE 3V8KA 5I21A 3OY9A 1QLYA 2M02A 3HPWA 3V8JA 5L8RE 3OYIA 1Q86R 1XJWB 5CO7A 1M8MA 3PTAA 4LDXA 2E41A 1Y96A 1M90C 1YI2Q 5LJ3j 3QYGB 4PJOG 2RB6A 3OW2P 4F7UB 5LJ3e 3BDUA 2Y90A 1G5VA 4RTWA 3JB9F 1W2BA 2ATCB 4JJDA 3O8VA 2EQJA 1SRLA 2XU8A 3CMET 4KH0B 4BUGA 4IUUA 2F69A 1YITQ 1XOVA 1D1AA 4A4FA 1X01A 4FCYA 2KRSA 3ULRB 2F2VA 1VQ9T 1VQOQ 4XK8E 4QVDA 4OMNA 2L89A 4DEYA 1Q81R 2K57A 1OU9A 2QGGA 2RJDA 2QA4A 2FB7A 2E64A 3G6EQ 2QK0A 2IIMA 3CD6Q 2DD5A 3L2ZA 2OJ2A 4KRTA 2MIOA 1ABQA 4RTXA 1Q7YU 1VQMQ 3QHSA 2X51A 1FMKA 3CPFA 3I9QA 2QASA 4ZNXA 1O9SA 3RKYA 5GANg 2K3YA 3HRSA 3QYHB 3CC4T 5J39A 4M7AF 3NMZC 2AZVA 2GBQA 4F04B 1WHMA 2AKKA 1I07A 3FC3A 4X34A 2EYZA 2D8HA 2XMFA 2DVEA 1UE9A 2K3BA 3LYIA 3VS0A 3LLRA 1X75C 2HD0A 2DVJA 1N8RR 5KYWB 3PVLA 4J6XA 2K4YA 5LJ5h 1UGPB 1J3TA 2PVOB 3TVTA 2M9UA 1N9RA 1K8AR 1YI2T 2DTIA 5KYUA 2KXDA 2EJ9A 3UATA 2KT1A 5HK3A 3NHNA 2KRNA 3OBYA 1E7OA 4LN2A 1I4K1 3H9NA 5CK9A 1ZX6A 4XU1A 2CUBA 1JXOA 2JJ9A 1MV0B 3NTHA 3VS4A 1YITT 4RUGA 1OQKA 4E7JA 2JS0A 2YXYA 2FG0A 5HKCA 4L6V5 4ESRA 3CC2A 4NS5A 3DKMA 4D6WA 1VQOT 2C0IA 3MCAB 4XTXA 1PM3A 5GAOn 4F14A 3HSBA 4K11A 2DIGA 3G6ET 5GAMe 2RK1A 3CD6T 3CCSQ 3BW1A 1KK7A 2LJ3A 4E47A 3M0PA 1VQMT 1TUCA 5GAOp 3QZ5B 1X43A 5FU6B 1B3QA 2VUBA 5LJ3d 1Q95G 5CIUA 2EQIA 1GFCA 1Q86C 5GAN4 1JBMA 2EJFA 6AT1B 1PSFA 2JZ2A 1S1NA 1TTHB 3PIPA 3A8LB 4DEXA 3P8DA 1KHIA 3S3MA 3CCRQ 1D1CA 4R55A 3G1JA 2QI2A 4JS5A 1EIFA 3P8BB 3OS2A 4ZGEB 4IUQA 3CCJA 3C94A 3MEAA 3EH2A 1SSHA 2QTVA 1NJIU 5I22A 2KROA 4GLKA 3JB9J 1R8OB 3X24B 2V26A 1B7TA 1HJDA 1AZEA 2KE9A 2RJFA 4LXCA 3VYGA 2K79A 3D7SB 5GANj 1H641 2GQVA 2F2XA 4PJOB 1Q81C 3NGPA 3JB9G 1R0CB 2FEIA 5GJVB 2L3SA 1SKUB 4DBFA 2KI7A 1BBZA 1PRLC 1K73U 4JZ4A 2DL4A 3CCUT 1Y71A 2E6ZA 2JTEA 4M78E 2ZZDA 4E7LA 2KRMA 3JCMe 1G2BA 2SEMA 1VQ7A 4M7DA 2K5FA 2EYQA 1TG0A 1QVFA 3GOXA 4Q5WA 3OYKA 3CCVQ 1C6VX 3QDFA 4IURA 1JJ2P 4F16A 2LP5A 2IVWA 4NL2A 1Y57A 1TUGB 1HD3A 3CMAA 4M75A 2R58A 1TH7A 3CCST 1M1KU 1I1JA 1WHLA 1ZSZA 5IXFA 4XU3A 1BIAA 1YHQA 1E6HA 3CCEA 2YDLA 5FROA 1N8RC 5FRNA 1YJ9Q 3C0CA 4M7AG 1DJ7B 5KYYB 1UG1A 5IHNA 3HHTB 2K5IA 5IH2A 1I81A 1CSKA 3CCRT 2OX7A 3OBWA 1X6GA 1JJ2S 2NLUA 3OS0A 4J9IA 1PG5B 3JCMb 1BYMA 2F5KA 4C5GA 2JN0A 3VUBA 5GMKh 2RM4A 4ORZA 1OPKA 2J6FA 1M30A 4FIBA 3Q1JA 2K2VA 4QKUA 2EBPA 3NTKA 3UF4A 5GAMd 2V1RA 3EFRA 1X69A 3QKJA 2DEUA 2RN8A 4B9WA 1RLPC 1Y7XA 2XD0A 1GCPA 4X9CA 3CXCS 3QSUA 4IIOA 1B34B 1PKTA 1VQPQ 4JDSA 2DXTA 4CI0C 5LJ5g 2CH4W 1OZ2A 4N4GA 2Y4YA 2JS2A 4OMOA 2HKNA 5FRMA 4AFSC 1V29B 1KJWA 3ZFJA 2RJEA 5KCOA 4KULA 4EMKC 3CCVT 4HXJA 3AT1B 1U8RA 1VQ4Q 3I5SA 3GF5A 2EQKA 4WTOB 3G7ZA 4F7UG 2M1HA 1SRMA 5L23A 1IHWA 2G3RA 2CSQA 2FZKB 2KK4A 2MK5A 3M0SA 4C8QF 2OTLQ 2SRCA 3G71Q 5AT1B 4M77C 1PKSA 5GJWB 4R56A 1M3BA 1YFNA 1XNIA 1JRIA 3ER0A 4M77D 2XICA 4BY6C 2NUTB 3LGLA 2CSIA 2CREA 1RAIB 3JCMd 4PL6A 4HKEA 2ROTA 3CEYA 2COYA 4J9GA 3QWXX 4OMMA 1SEMA 1WNLA 2QGFB 4M78F 3M54A 2CKKA 2XK0A 3KBGA 3CXCA 2PVGB 2DF6A 3OS1A 2NYSA 3I56A 1AD5A 2RI3A 1K9MU 1TSFA 1ZSGA 1FWZA 2YWWA 4FL6A 1VQPT 2DBMA 1RAFB 1Z9ZA 1LNXA 3OS5A 3I35A 4HCZA 2RF0A 2DYBA 2XHCA 5KE3A 3SWNC 1BKBA 3HTRA 4GBQA 5KYNA 3L2VA 1UHFA 1WQWA 2F5TX 2D6FA 2A0FB 2E3HA 1RAGB 3CCQA 1ZUUA 1YP5A 3LH0A 4C8QC 2J05A 1VYUA 2RJCA 2OI3A 2OAWA 1KC8R 3R6OA 4C8QD 1GRIA 3ZL7C 2DJQA 1M2OA 1VQNQ 2DEQA 1VQ5A 2O2OA 1QVGA 3EFSA 2BKDN 3RNJA 3GBQA 3QJYA 3EG9A 4C0GA 1D0XA 2RPNA 2XKOC 2KEAA 1KQ1A 3N5BB 3FDRA 5LJ5j 2OTLT 4E2FB 2DL3A 2MI6A 3G71T 2EWNA 4LDYA 3G4SA 2DTHA 2DXBA 4D8DA 2LQ8A 4OGEA 4C92A 1OU8A 2KVQG 3PMIA 3WVEB 4J9EA 2F1LA 4DOWA 2HQHA 4C0ZA 1JEGA 1VUBA 1WHHA 4QT7A 1MNEA 2DNUA 2A37A 1SG5A 2JMAA 4FSXA 3ZEHA 3HRUA 1TS9A 8ATCB 1M3CA 3HKSA 3S3NA 2O4XB 4XTUA 4BE0A 3JV3A 1W70A 2O9VA 4MMKA 1K9AA 2HQEA 2R5MA 2BZYA 2CP3A 3X20B 1S72A 2HDAA 1CKAA 3A8HB 2FRYA 2JW4A 4WCIA 4C5HA 4AG2C 2FPFA 4C92C 3E19A 1AT1B 3M9QA 4HVUA 1WDXA 1TXQA 4C92D 2RQVA 3JAME 4PNOA 2DD4A 2DZCA 1OOTA 5GAN6 3L1AA 2K7AA 1AWXA 3QZ9B 2VKNA 2FPDA 4RTZA 3VS1A 2QEXA 2CZ1B 4BE2A 4CC7A 1AOJA 2ZGWA 3OB9A 1ZQ1A 2FZGB 5CKEA 1VQ6Q 2DTOA 1UDLA 1WIEA 1QKWA 3QIIA 3DB3A 4E7SA 3CBOA 1NPPA 1VQNT 3HL8A 4PKCC 3QPHA 4VUBA 1UUEA 4J9BA 4JPBW 2RD1A 2RH2A 3PIOA 4B9XA 3MPUB 2LQKA 2D0NA 3DB4A 4PJNA 1JO8A 1TU0B 4OMLA 5J3BA 4BD3A 2M0YA 3M0TA 4Y28E 4Y92A 1VQKT 1WHJA 1NLOC 1P92A 4IIMA 8AT1B 1WQ7A 3FJPA 7AT1B 3M55A 1NPRA 1SPKA 4XU2A 3EHRA 2VGMA 2EGEA 2E6NA 1UGQB 2CGHA 3A1PA 1Q7YR 1M3AA 2ZPBB 2EGAA 4FT2A 5FWCA 1RABB 3GPLA 2PZ1A 1VOMA 3VRZA 3URGA 4XTVA 4M78G 2R5AA 2LT4A 3MEVA 5CVIA 3OW2S 2CP5A 1YJWA 5IAYA 3OYGA 1WXTA 4JJCA 4PJMA 1AWJA 3SFMA 1LPLA 3J80E 4MDWA 2QA4Q 2KMTA 1ZBXA 4QQ6A 2PVDB 1RACB 4OVAA 1VYTA 1KQSP 1KC8C 3M58A 4JRQA 4ZN3A 1XQHA 2LNHB 4FSSA 3TEEA 1D3BA 1Q82U 2CDTA 4NL3A 2E1HA 1QQJA 2Z0WA 5HY6A 2HBWA 3A8OB 2KYBA 4JJNK 4ZTJA 5LJ3f 3A8GB 1W4SA 3RDVA 2D9TA 1G3TA 3J81E 2V8KA 1KIKA 5ECAA 3CCLA 1D1BA 4X9DA 1VQ6T 4HT8A 2HBPA 2DILA
chains in the Genus database with same CATH topology
2KRMA 1G2BA 2SEMA 2KXCA 1MUZA 1QKXA 1TG0A 4AFQC 4JJBA 4RTUA 3VS2A 2EKHA 1AEYA 2QDLA 2BTTA 4RTVA 2AZSA 1JU5C 2DL5A 1NLPC 4Z89A 4F16A 2LP5A 1IO6A 1K0SA 1Y57A 2AK5A 1HD3A 2RQUA 3THKA 2D8JA 1ABOA 2DRKA 4LUDA 1I1JA 1AWOA 5IXFA 2DX1A 1N5ZA 1E6HA 1W6XA 1U06A 2FPEA 2YDLA 4HVVA 1JXMA 2JM8A 5EC7A 3RBBB 2O9SA 3TSWA 3CQTA 1ZUYA 3C0CA 1Y0MA 1UG1A 2KGTA 2L3QA 4Z8AA 5IHNA 2YUQA 5IH2A 4F17A 1RI9A 1CSKA 2W0ZA 2EYXA 3VS5A 1VYVA 1X6GA 2LJ0A 1PRMC 4J9FA 1QCFA 4J9IA 1AZGB 2A08A 5IHKA 1NG2A 1K4US 1UGVA 4ORZA 3SHWA 2J6FA 1OPKA 1PHTA 1M30A 1NYGA 1UFFA 2G6FX 2EBPA 1VA7A 2W10A 2FO0A 2CT4A 2LMJA 3UF4A 2V1RA 1X69A 1G83A 2RN8A 1T0JA 1RLPC 2H8HA 2D1XA 1GBRA 2A28A 1GCPA 2YUNA 4E6RA 5IHIA 3R6NA 4OMQA 4IIOA 2KYMA 1FYNA 3REBB 3UA6A 4HCKA 1PKTA 1KFZA 2NUZA 1X27A 1Z9QA 3M0UA 4A63B 1X6BA 2FRWA 2K9GA 3EG2A 3VRYA 2CH4W 1UJYA 2EYWA 2JS2A 4OMOA 3I5RA 1UECA 2LQWA 1MV3A 1QWFA 1K1ZA 4AFSC 2RQRA 1X2QA 1I0CA 2ROLA 1KJWA 3EG3A 2PNIA 4Z88A 4LNPA 2EGCA 5I11A 4GLMA 2LQNA 1A0NB 4HXJA 2GQIA 3SEMA 1GCQA 1YWOA 1ARKA 1T0HA 2NWMA 3I5SA 2J6OA 1NEGA 2DM1A 2HSPA 1SRMA 5L23A 2CSQA 3M0SA 4J9CA 2SRCA 2J6KA 3QWYA 2HEQA 1PKSA 4RTYA 1K76A 2J7IA 2X3XD 5GJWB 2KNBB 2HCKA 1M3BA 1CKBA 2K2MA 2F2WA 2LX7A 2MOXA 2C0TA 2CSIA 3M0RA 1SHFA 2JMCA 1GBQA 2CREA 1YN8A 2EW3A 3VS6A 1WX6A 4OMPA 3UA7A 1KSWA 2B86A 2RMOA 5HCKA 2X3WD 3REAB 2ROTA 2J06A 3H41A 2GNCA 2DL8A 2O88A 3NPFA 4J9GA 3QWXX 2YSQA 4OMMA 1SEMA 1H3HA 1H8KA 2EVRA 4J9DA 1EFNA 2P4RA 2L0AA 1LCKA 2ED0A 1QWEA 2ED1A 1YNZA 2DF6A 4JZ3A 2CT3A 4AG1C 1PWTA 4AFZC 2V1QA 1AD5A 5FWBA 1QLYA 1ZSGA 4LE9A 2E5KA 2DBMA 1Z9ZA 1M8MA 1T3SA 2C0OA 3I35A 2RF0A 2DYBA 2YUPA 1NYFA 4GBQA 1X2KA 1UHFA 1RLQC 2DBKA 3KFVA 3LH5A 1ZUUA 2CH4A 1YP5A 4RTWA 3EG1A 2J05A 1VYUA 2OI3A 4JJDA 1SRLA 2OAWA 1WYXA 2RQTA 1SHGA 1GRIA 3ZL7C 2DJQA 1XOVA 3VS3A 2DRMA 2ESWA 1OEBA 2O2OA 3RNJA 3GBQA 2KRSA 3ULRB 2F2VA 2RPNA 3EGUA 1V1CA 1BU1A 2KEAA 4OMNA 2KT8A 4DEYA 2DL3A 2EYYA 1UHCA 4D8DA 2BZ8A 2DL7A 2IIMA 2JXBA 4AFUC 4M4ZA 4J9EA 2OJ2A 1HSQA 4KRTA 2K6DA 2LJ1A 2MIOA 1ABQA 4RTXA 1JEGA 2I0NA 1FMKA 4QT7A 3I9QA 4ZNXA 2DNUA 2A37A 1T3LA 2JMAA 4CC2A 1M3CA 3NMZC 2AZVA 2L3PA 2GBQA 4D8KA 2AKKA 2YT6A 3JV3A 1I07A 1W70A 3H0IA 1NEBA 2O9VA 2DMOA 1K9AA 2EYZA 2RQWA 1UTIA 1PNJA 2D8HA 5IXBA 2BZYA 2XMFA 3PVQA 1UE9A 2K3BA 2HDAA 1CKAA 1UJ0A 2FRYA 2JW4A 3VS0A 1OV3A 4WCIA 4AG2C 2DVJA 2FPFA 3PVLA 2LCSA 1WA7A 4HVWA 2GGRA 1J3TA 4HVUA 3TVTA 1WFWA 1WDXA 2RQVA 2JT4A 1GCQC 2KXDA 1OOTA 2MCNA 3UATA 2KT1A 2LZ6B 2VVKA 3IQLA 2K7AA 2KBTA 1AWXA 1ZUKA 3NHNA 2VKNA 2DA9A 1U3OA 2KRNA 3TSZA 2FPDA 1E7OA 4LN2A 4RTZA 2KR3A 3VS1A 2DLPA 4CC7A 1AOJA 1ZX6A 2M51A 3FJ5A 1UDLA 1WIEA 2CUBA 1JXOA 1QKWA 1MV0B 2AKLA 3VS4A 1K0XA 1BK2A 4RUGA 2RNAA 2PTKA 3VS7A 2JS0A 2FG0A 1GFDA 1UUEA 1AWWA 2VWFA 4J9BA 4JPBW 4ESRA 2CUDA 1NM7A 4EIKA 2C0IA 2DE0X 2D0NA 1JQQA 1B07A 1JO8A 3M0QA 4OMLA 4F14A 2M0YA 2ABLA 3M0TA 1E6GA 4K11A 4Y92A 1ZBJA 4J9HA 2A36A 1NLOC 4IIMA 3EHQA 1SPKA 2GTJA 2LJ3A 3EHRA 3M0PA 1BB9A 1TUCA 2EGEA 1X43A 1B3QA 2ENMA 3O5ZA 1AVZC 1M3AA 2ECZA 2EQIA 1GFCA 4X1VA 1U5SA 2EGAA 5FWCA 2PZ1A 3VRZA 1S1NA 4DEXA 1YWPA 1M27C 2BZXA 1TUDA 1WXTA 4JJCA 1AWJA 1WXUA 4CC3A 1H92A 4RTTA 1VYTA 2O31A 1SSHA 3A98A 5I22A 1GL5A 2YUOA 2KROA 2LNHB 2GTOA 4FSSA 4LUEA 3PE0A 2CDTA 1HJDA 1WXBA 1AZEA 2KE9A 2HBWA 2K79A 1YCSB 2F2XA 2KYBA 5FW9A 1WI7A 1RUWA 3NGPA 4CC4B 2FEIA 5GJVB 2L3SA 3U23A 1KIKA 5ECAA 1WLPB 1BBZA 1PRLC 2L2PA 1ZLMA 3H0FA 4JZ4A 3EG0A 2DL4A 3H0HA 4R0KA 1OPLA 2JTEA 1W1FA 2JM9A 2EPDA 2DILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRM A;  1G2B A;  2SEM A;  2KXC A;  1MUZ A;  1QKX A;  1TG0 A;  4AFQ C;  4JJB A;  4RTU A;  3VS2 A;  2EKH A;  1AEY A;  2QDL A;  2BTT A;  4RTV A;  2AZS A;  1JU5 C;  2DL5 A;  1NLP C;  4Z89 A;  4F16 A;  2LP5 A;  1IO6 A;  1K0S A;  1Y57 A;  2AK5 A;  1HD3 A;  2RQU A;  3THK A;  2D8J A;  1ABO A;  2DRK A;  4LUD A;  1I1J A;  1AWO A;  5IXF A;  2DX1 A;  1N5Z A;  1E6H A;  1W6X A;  1U06 A;  2FPE A;  2YDL A;  4HVV A;  1JXM A;  2JM8 A;  5EC7 A;  3RBB B;  2O9S A;  3TSW A;  3CQT A;  1ZUY A;  3C0C A;  1Y0M A;  1UG1 A;  2KGT A;  2L3Q A;  4Z8A A;  5IHN A;  2YUQ A;  5IH2 A;  4F17 A;  1RI9 A;  1CSK A;  2W0Z A;  2EYX A;  3VS5 A;  1VYV A;  1X6G A;  2LJ0 A;  1PRM C;  4J9F A;  1QCF A;  4J9I A;  1AZG B;  2A08 A;  5IHK A;  1NG2 A;  1K4U S;  1UGV A;  4ORZ A;  3SHW A;  2J6F A;  1OPK A;  1PHT A;  1M30 A;  1NYG A;  1UFF A;  2G6F X;  2EBP A;  1VA7 A;  2W10 A;  2FO0 A;  2CT4 A;  2LMJ A;  3UF4 A;  2V1R A;  1X69 A;  1G83 A;  2RN8 A;  1T0J A;  1RLP C;  2H8H A;  2D1X A;  1GBR A;  2A28 A;  1GCP A;  2YUN A;  4E6R A;  5IHI A;  3R6N A;  4OMQ A;  4IIO A;  2KYM A;  1FYN A;  3REB B;  3UA6 A;  4HCK A;  1PKT A;  1KFZ A;  2NUZ A;  1X27 A;  1Z9Q A;  3M0U A;  4A63 B;  1X6B A;  2FRW A;  2K9G A;  3EG2 A;  3VRY A;  2CH4 W;  1UJY A;  2EYW A;  2JS2 A;  4OMO A;  3I5R A;  1UEC A;  2LQW A;  1MV3 A;  1QWF A;  1K1Z A;  4AFS C;  2RQR A;  1X2Q A;  1I0C A;  2ROL A;  1KJW A;  3EG3 A;  2PNI A;  4Z88 A;  4LNP A;  2EGC A;  5I11 A;  4GLM A;  2LQN A;  1A0N B;  4HXJ A;  2GQI A;  3SEM A;  1GCQ A;  1YWO A;  1ARK A;  1T0H A;  2NWM A;  3I5S A;  2J6O A;  1NEG A;  2DM1 A;  2HSP A;  1SRM A;  5L23 A;  2CSQ A;  3M0S A;  4J9C A;  2SRC A;  2J6K A;  3QWY A;  2HEQ A;  1PKS A;  4RTY A;  1K76 A;  2J7I A;  2X3X D;  5GJW B;  2KNB B;  2HCK A;  1M3B A;  1CKB A;  2K2M A;  2F2W A;  2LX7 A;  2MOX A;  2C0T A;  2CSI A;  3M0R A;  1SHF A;  2JMC A;  1GBQ A;  2CRE A;  1YN8 A;  2EW3 A;  3VS6 A;  1WX6 A;  4OMP A;  3UA7 A;  1KSW A;  2B86 A;  2RMO A;  5HCK A;  2X3W D;  3REA B;  2ROT A;  2J06 A;  3H41 A;  2GNC A;  2DL8 A;  2O88 A;  3NPF A;  4J9G A;  3QWX X;  2YSQ A;  4OMM A;  1SEM A;  1H3H A;  1H8K A;  2EVR A;  4J9D A;  1EFN A;  2P4R A;  2L0A A;  1LCK A;  2ED0 A;  1QWE A;  2ED1 A;  1YNZ A;  2DF6 A;  4JZ3 A;  2CT3 A;  4AG1 C;  1PWT A;  4AFZ C;  2V1Q A;  1AD5 A;  5FWB A;  1QLY A;  1ZSG A;  4LE9 A;  2E5K A;  2DBM A;  1Z9Z A;  1M8M A;  1T3S A;  2C0O A;  3I35 A;  2RF0 A;  2DYB A;  2YUP A;  1NYF A;  4GBQ A;  1X2K A;  1UHF A;  1RLQ C;  2DBK A;  3KFV A;  3LH5 A;  1ZUU A;  2CH4 A;  1YP5 A;  4RTW A;  3EG1 A;  2J05 A;  1VYU A;  2OI3 A;  4JJD A;  1SRL A;  2OAW A;  1WYX A;  2RQT A;  1SHG A;  1GRI A;  3ZL7 C;  2DJQ A;  1XOV A;  3VS3 A;  2DRM A;  2ESW A;  1OEB A;  2O2O A;  3RNJ A;  3GBQ A;  2KRS A;  3ULR B;  2F2V A;  2RPN A;  3EGU A;  1V1C A;  1BU1 A;  2KEA A;  4OMN A;  2KT8 A;  4DEY A;  2DL3 A;  2EYY A;  1UHC A;  4D8D A;  2BZ8 A;  2DL7 A;  2IIM A;  2JXB A;  4AFU C;  4M4Z A;  4J9E A;  2OJ2 A;  1HSQ A;  4KRT A;  2K6D A;  2LJ1 A;  2MIO A;  1ABQ A;  4RTX A;  1JEG A;  2I0N A;  1FMK A;  4QT7 A;  3I9Q A;  4ZNX A;  2DNU A;  2A37 A;  1T3L A;  2JMA A;  4CC2 A;  1M3C A;  3NMZ C;  2AZV A;  2L3P A;  2GBQ A;  4D8K A;  2AKK A;  2YT6 A;  3JV3 A;  1I07 A;  1W70 A;  3H0I A;  1NEB A;  2O9V A;  2DMO A;  1K9A A;  2EYZ A;  2RQW A;  1UTI A;  1PNJ A;  2D8H A;  5IXB A;  2BZY A;  2XMF A;  3PVQ A;  1UE9 A;  2K3B A;  2HDA A;  1CKA A;  1UJ0 A;  2FRY A;  2JW4 A;  3VS0 A;  1OV3 A;  4WCI A;  4AG2 C;  2DVJ A;  2FPF A;  3PVL A;  2LCS A;  1WA7 A;  4HVW A;  2GGR A;  1J3T A;  4HVU A;  3TVT A;  1WFW A;  1WDX A;  2RQV A;  2JT4 A;  1GCQ C;  2KXD A;  1OOT A;  2MCN A;  3UAT A;  2KT1 A;  2LZ6 B;  2VVK A;  3IQL A;  2K7A A;  2KBT A;  1AWX A;  1ZUK A;  3NHN A;  2VKN A;  2DA9 A;  1U3O A;  2KRN A;  3TSZ A;  2FPD A;  1E7O A;  4LN2 A;  4RTZ A;  2KR3 A;  3VS1 A;  2DLP A;  4CC7 A;  1AOJ A;  1ZX6 A;  2M51 A;  3FJ5 A;  1UDL A;  1WIE A;  2CUB A;  1JXO A;  1QKW A;  1MV0 B;  2AKL A;  3VS4 A;  1K0X A;  1BK2 A;  4RUG A;  2RNA A;  2PTK A;  3VS7 A;  2JS0 A;  2FG0 A;  1GFD A;  1UUE A;  1AWW A;  2VWF A;  4J9B A;  4JPB W;  4ESR A;  2CUD A;  1NM7 A;  4EIK A;  2C0I A;  2DE0 X;  2D0N A;  1JQQ A;  1B07 A;  1JO8 A;  3M0Q A;  4OML A;  4F14 A;  2M0Y A;  2ABL A;  3M0T A;  1E6G A;  4K11 A;  4Y92 A;  1ZBJ A;  4J9H A;  2A36 A;  1NLO C;  4IIM A;  3EHQ A;  1SPK A;  2GTJ A;  2LJ3 A;  3EHR A;  3M0P A;  1BB9 A;  1TUC A;  2EGE A;  1X43 A;  1B3Q A;  2ENM A;  3O5Z A;  1AVZ C;  1M3A A;  2ECZ A;  2EQI A;  1GFC A;  4X1V A;  1U5S A;  2EGA A;  5FWC A;  2PZ1 A;  3VRZ A;  1S1N A;  4DEX A;  1YWP A;  1M27 C;  2BZX A;  1TUD A;  1WXT A;  4JJC A;  1AWJ A;  1WXU A;  4CC3 A;  1H92 A;  4RTT A;  1VYT A;  2O31 A;  1SSH A;  3A98 A;  5I22 A;  1GL5 A;  2YUO A;  2KRO A;  2LNH B;  2GTO A;  4FSS A;  4LUE A;  3PE0 A;  2CDT A;  1HJD A;  1WXB A;  1AZE A;  2KE9 A;  2HBW A;  2K79 A;  1YCS B;  2F2X A;  2KYB A;  5FW9 A;  1WI7 A;  1RUW A;  3NGP A;  4CC4 B;  2FEI A;  5GJV B;  2L3S A;  3U23 A;  1KIK A;  5ECA A;  1WLP B;  1BBZ A;  1PRL C;  2L2P A;  1ZLM A;  3H0F A;  4JZ4 A;  3EG0 A;  2DL4 A;  3H0H A;  4R0K A;  1OPL A;  2JTE A;  1W1F A;  2JM9 A;  2EPD A;  2DIL A; 
#chains in the Genus database with same CATH topology
 1YBY A;  5A0L A;  1UB4 A;  2H3J A;  1MUZ A;  1WJR A;  3E2U A;  1QKX A;  5GMK j;  1RAD B;  2EIF A;  1AEY A;  2BTT A;  1PD1 A;  2AZS A;  5CKF A;  5EG2 A;  4JRP A;  1NLP C;  2XDP A;  3I55 A;  4M77 E;  2MWO A;  1KD1 U;  2OTJ A;  1VQL A;  4PJL A;  5KE2 A;  1ABO A;  2DRK A;  4LUD A;  1AWO A;  3CCU Q;  4B6M A;  4M7A A;  1N5Z A;  3LWH A;  2HQX A;  4HVV A;  1JXM A;  2JM8 A;  3RBB B;  2O9S A;  3OW2 A;  2FL7 A;  3H6Z A;  4EMH A;  3CQT A;  1V76 A;  4XTW A;  3OYC A;  2E4H A;  2VYT A;  2ZPI B;  4BY6 B;  4LDW A;  3CC2 Q;  4FYY B;  1RI9 A;  1UGS B;  2W0Z A;  3CC7 A;  2LJ0 A;  1K8A U;  4RCB A;  1WGS A;  2QA4 T;  2P84 A;  2A08 A;  2A7Y A;  2K3X A;  1IRX A;  2HL3 A;  2JTM A;  3MP1 A;  3SHW A;  1QCN A;  1UFF A;  4N0A A;  1NJI R;  4UC4 A;  2FO0 A;  1BCM A;  3CCM A;  2DO3 A;  4J6W A;  2MPX C;  2H8H A;  2DFU A;  2HNI A;  1QMC A;  4OMQ A;  1HK9 A;  4HCK A;  2X4J A;  1X27 A;  1Z9Q A;  4C8Q E;  4A63 B;  1X6B A;  3VRY A;  4J7F A;  3CCJ Q;  5DY9 A;  3SWN B;  1MV3 A;  1K73 R;  4BI3 A;  2RQR A;  4FW2 A;  1I0C A;  2ROL A;  2WSE E;  1Q7Y C;  1R0B G;  3EG3 A;  4Z88 A;  4LNP A;  4M7D F;  4IUP A;  2DER A;  1OX9 A;  3OYB A;  4C8Q B;  1M2V B;  4A54 A;  1A0N B;  2GQI A;  4F7U A;  2HKQ B;  1GCQ A;  5GAN e;  4PLL A;  1ARK A;  3HRT A;  3V7S A;  2J6O A;  4C5E A;  2E65 A;  5LJ3 h;  3EGD B;  3OYY A;  5GAM f;  3QJ6 A;  3SDZ A;  5CKH A;  1EX4 A;  4ZTF A;  2CP6 A;  4OP0 A;  5I2M A;  2LNV A;  2HEQ A;  4RTY A;  4FYV B;  2L5Q A;  3VU3 C;  1CKB A;  1VQ7 Q;  2NUP B;  3M0R A;  3S6W A;  1YN8 A;  4M78 B;  2EW3 A;  3M57 A;  1PCX A;  3BFM A;  3CC2 T;  4JRI A;  5KH6 A;  3VUZ A;  5GMK i;  1M1F A;  2B86 A;  2X3W D;  2QG9 B;  4TVR A;  3JCM Q;  2GNC A;  2O88 A;  3CMA Q;  3RMQ A;  3OYN A;  2YSQ A;  1YJN A;  2EVR A;  2MMP A;  3INZ A;  2L0A A;  1YHQ Q;  3WXM B;  2KY9 A;  3CCE Q;  4C92 E;  1OYX A;  2VC8 A;  4JZ3 A;  3F70 A;  2IG0 A;  2ZPE B;  3WVD B;  1VQ8 A;  2ZPH B;  4AG1 C;  4BB7 A;  2QDY B;  4N4I A;  3C4S A;  2DET A;  4M7D C;  3FRN A;  5D6Y A;  4E7H A;  3EAE A;  2KAF A;  4M77 F;  1Y07 A;  4M7D D;  1T3S A;  3GLX A;  1ACM B;  4O6J A;  1NYF A;  3EFO B;  3TQ7 P;  3OYD A;  3CCJ T;  1H3Z A;  3PFS A;  1M5Q 1;  1G3W A;  1RLQ C;  3JCM f;  4M75 C;  2GFA A;  5KYW A;  3UWN A;  1ZSZ C;  2YRV A;  3EG1 A;  4C0D C;  5C0M A;  1IGU A;  4M75 D;  2FHD A;  2RQT A;  3MEW A;  1WYX A;  2KDS A;  3VS3 A;  2X9H A;  2ESW A;  1OEB A;  4ZGJ B;  2L8D A;  4KUI A;  3NTI A;  4L59 A;  3S3O A;  1YIJ A;  2M16 A;  3EGU A;  5CAI A;  3LGF A;  2JUF A;  4E7K A;  1QCO A;  2DL7 A;  1NJI C;  4LDV A;  2KQW A;  3OQ5 A;  1R77 A;  4AFU C;  1VQ7 T;  4M4Z A;  2K6D A;  3M56 A;  3VV0 A;  2E70 A;  2I0N A;  1ZHI A;  3FIF A;  2BE9 B;  4P5N A;  1T3L A;  4KH1 B;  2E3I A;  4OGC A;  5GAM h;  3CMA T;  3LWI A;  2WSF E;  2RHZ A;  4A4K A;  5GAN 2;  4RMO A;  1VQ4 A;  5GAN d;  4D8K A;  1K73 C;  3BDL A;  1YHQ T;  1UGR B;  1OUL A;  2RQW A;  1OZ3 A;  3CCE T;  5IXB A;  1Y96 B;  2COZ A;  1JJ2 A;  3ME9 A;  1LVK A;  1UJ0 A;  4NOY A;  1OV3 A;  1VIE A;  4FW1 A;  3JCM X;  4IKF A;  3UT1 A;  2LCS A;  4II1 A;  3M59 A;  1WFW A;  1K9M R;  1SF9 A;  2JT4 A;  2MCN A;  2LZ6 B;  2VVK A;  3IQL A;  1M1K C;  2KBT A;  1ZUK A;  3OSV A;  3CPW P;  2WSC E;  2GFU A;  3FJ5 A;  5HK0 A;  4HCC A;  4PJO A;  1D0Z A;  1K0X A;  3I56 Q;  2PTK A;  2QAZ A;  2FYK A;  3RR6 A;  1GFD A;  2COW A;  2EQM A;  1EZZ B;  2IPO B;  2LC4 A;  2CUD A;  1NM7 A;  2DE0 X;  2LT1 A;  5LL6 S;  1U1T A;  1JQQ A;  3M0Q A;  1MMD A;  1M90 U;  4FYW B;  4ZN1 A;  2RI5 A;  3JCM h;  4J9H A;  5GAO l;  5GAO q;  4C92 F;  3EHQ A;  4ZGD B;  3DLM A;  3X25 B;  5LJ3 g;  1MMN A;  3JCM c;  1WZO A;  1BB9 A;  3CPW S;  1RAA B;  4BI4 A;  3VJP A;  4M78 A;  2ENM A;  3O5Z A;  1WHG A;  3KXT A;  1TOV A;  2ECZ A;  2QTX A;  5GAN 7;  4X1V A;  1U5S A;  3OA6 A;  1VQ5 Q;  3FLG A;  2HAX A;  4O5V A;  2EQU A;  4OB0 B;  2ZPF B;  1I5L A;  3EH1 A;  4PJO C;  1W2B P;  2BZX A;  1TUD A;  5LJ5 e;  1VQK Q;  2VV5 A;  4PJO D;  4CC3 A;  1H92 A;  4PFO A;  2JNG A;  3G4S Q;  2DYI A;  4ANJ A;  2LDM A;  5KYY A;  2O31 A;  1N27 A;  4E7Z A;  2WAC A;  3A98 A;  4M77 G;  3J7A F;  1RL2 A;  5DLQ E;  2GTO A;  2MYS A;  4XTZ A;  3CME A;  2L3R A;  4J83 A;  1YCS B;  2CP0 A;  5FW9 A;  1IXD A;  2R57 A;  1WI7 A;  4CC4 B;  2MWP A;  1VQ9 A;  3SB2 A;  3U23 A;  1WLP B;  2HSE B;  4KT0 E;  1X6O A;  1ZLM A;  2Y4X A;  3LX7 A;  3EG0 A;  1LJO A;  3V7C A;  3E9F A;  4ELZ C;  1S72 Q;  2JM9 A;  3I56 T;  1JB0 E;  4XU0 A;  4IUT A;  1B34 A;  3BE3 A;  4AFQ C;  4RTU A;  3VS2 A;  1IZ6 A;  2XID A;  2EKH A;  4RTV A;  2V8J A;  1JU5 C;  4Z89 A;  1IO6 A;  1K0S A;  3QG1 A;  4QVZ A;  2AK5 A;  3CC4 A;  2RQU A;  5CKD A;  2RO0 A;  2D8J A;  3THK A;  4Y91 A;  4A4G A;  3CCQ T;  2QEX Q;  4JUV A;  4RCC A;  4L5G A;  2VAS A;  4XAX B;  4QVC A;  4FU6 A;  3OYE A;  4A4E A;  5EC7 A;  3H8Z A;  4JRK A;  4HA8 A;  4C8Q G;  1PSE A;  1M9S A;  1ZUY A;  1VQ5 T;  3RKX A;  4HCB A;  1K9M C;  4AT1 B;  2RHU A;  4DBR A;  1D0Y A;  5D6W A;  1D09 B;  3VS5 A;  3JB9 H;  1VYV A;  3MHX A;  3SD4 A;  5I2S A;  1YI2 A;  4J9F A;  3G4S T;  1N6A A;  1QCF A;  1AZG B;  3M4Y A;  1G8X A;  2NUT A;  5IHK A;  1NG2 A;  4RG2 A;  1K4U S;  5GAM g;  2QQA A;  1NYG A;  2ZAE A;  3V8L A;  4M7D E;  1VA7 A;  2W10 A;  3QDR B;  4BI8 B;  2CT4 A;  1Q82 R;  1YIT A;  3OMC A;  1Q86 U;  3P8H A;  4E6R A;  1KG1 A;  5IHI A;  2KYM A;  3UA6 A;  4J8O A;  4M7D B;  4XTY A;  4M75 E;  1KFZ A;  2NUZ A;  1YJW Q;  1VQO A;  4LD6 A;  4C0F A;  1LOJ A;  3EG2 A;  2EYW A;  3JRZ A;  5GAN 8;  1UEC A;  2LQW A;  5D7U A;  1S72 T;  1QWF A;  3G6E A;  3X28 B;  5LJ5 d;  3CD6 A;  2P0Q A;  4M75 B;  4BDY A;  2EGC A;  1VQM A;  4DA4 A;  2RHI A;  3AHU A;  4PLI A;  1ZSZ B;  2QYZ A;  4C0D B;  5FU7 C;  4QW2 A;  4EDU A;  5CQX A;  2AHJ B;  4C92 G;  2NWM A;  4J5Y A;  5FLX E;  3MO8 A;  1BI1 A;  1TWB A;  1NEG A;  2DM1 A;  4OB3 B;  1Q81 U;  1BI0 A;  2HSP A;  1FX7 A;  2BUD A;  1KD1 R;  2QEX T;  4N4H A;  5J26 A;  4J9C A;  2O01 E;  3QWY A;  3CCL Q;  2QQS A;  1FMW A;  1KQS S;  4BAC A;  4WF2 A;  2X3X D;  1PD0 A;  2KNB B;  2PUK B;  3CBM A;  3X26 B;  3QUI A;  2LX7 A;  4DQ2 A;  3PGG A;  2C0T A;  3JCM g;  5GMK e;  1SHF A;  1BI2 A;  3RES A;  2FVU A;  4EMK B;  5C6S A;  2X4Y A;  4OB2 B;  1NE8 A;  3TU4 K;  5D6X A;  3V7R A;  5HCK A;  5CKB A;  3I55 Q;  3MET A;  3RIR A;  1MGQ A;  3L2U A;  1G3S A;  2OTJ Q;  2DL8 A;  3NPF A;  3JB9 D;  2XDB A;  1VQL Q;  5A0D A;  4CRI A;  1SSF A;  1H3H A;  1H8K A;  4J9D A;  1QVF P;  2P4R A;  4IUV A;  4M77 B;  4ATO A;  1QWE A;  2HZY A;  2ED1 A;  1WJQ A;  1YNZ A;  3OYF A;  5DLO A;  3CCU A;  4C5I A;  4RG8 A;  1PWT A;  4AFZ C;  2V1Q A;  1N8R U;  3JCM P;  2B8A A;  1XTD A;  4KGV B;  4LD9 K;  5FWB A;  2O4X A;  3GNF B;  2LCC A;  2PUO B;  4LE9 A;  1RAH B;  2EJG A;  5KCH A;  2E5K A;  2LVM A;  1YJW T;  4JLG A;  2RHY A;  4MDX A;  1C1A A;  2C0O A;  3CC7 Q;  2EKO A;  2X4X A;  3LW5 E;  4OB1 B;  2YUP A;  5A2Q E;  5GMK l;  1X2K A;  2VXF A;  3MKD A;  5GAM j;  4AMC A;  2DBK A;  3MP8 A;  3KFV A;  2RA2 A;  2AIR B;  3LH5 A;  5CCA A;  3CCS A;  1QVF S;  2CH4 A;  1OI1 A;  9ATC B;  4M7A C;  5GAO m;  2ZPG B;  1SHG A;  5KYX B;  3CCM Q;  2C06 A;  1KQ2 A;  4F7U F;  4M7A D;  2VGN A;  2DRM A;  4A4H A;  1IGQ A;  1KQS A;  1FXX A;  2CZ6 B;  1RI0 A;  4MZP A;  3FB9 A;  1V1C A;  1BU1 A;  1F1B B;  3CCR A;  2KT8 A;  3CCL T;  2EYY A;  1UHC A;  3MEU A;  2BZ8 A;  2E12 A;  2MAM A;  1MND A;  2JXB A;  2E5Q A;  2RHX A;  3UPU A;  1HSQ A;  2LJ1 A;  1Q82 C;  4A53 A;  1PC0 A;  3PNW C;  2CP7 A;  4N0A C;  5A0G A;  4PJO E;  3OYL A;  1ZA2 B;  4E7I A;  2AT1 B;  4M75 F;  2DK3 A;  5IN1 A;  3I55 T;  3E1S A;  3GP8 A;  3RER A;  4EPC A;  1G3Y A;  4CC2 A;  3L2Q A;  2VB6 A;  2OTJ T;  1VQL T;  4J6Y A;  1M1K R;  2JVV A;  1MMG A;  2L3P A;  3JSC A;  2YT6 A;  3H0I A;  1NEB A;  1NZ9 A;  2DMO A;  1UTI A;  1PNJ A;  2QQB A;  3PVQ A;  1N9S A;  4OF1 A;  3A5Z B;  4ME7 A;  2BE7 D;  3OMG A;  1WA7 A;  4HVW A;  2GGR A;  3UDC A;  3CCV A;  3CC7 T;  2D0Q B;  1WHK A;  1GCQ C;  1KD1 C;  4FT4 A;  3RUX A;  3PMT A;  2DA9 A;  1U3O A;  1YJN Q;  3RKW A;  1BIB A;  1ZA1 B;  3TSZ A;  3VYH B;  2KR3 A;  3PT9 A;  3EG9 B;  2QQ9 A;  2DLP A;  1VIF A;  4KBM B;  2M51 A;  4KGX B;  1VQ8 Q;  5GAN f;  2AKL A;  3CCM T;  1BK2 A;  4ELY C;  2RNA A;  1YJ9 A;  3EGX B;  3VS7 A;  2VXE A;  1YCY A;  4MML A;  4C92 B;  4PFZ A;  1AWW A;  1QW1 A;  2VWF A;  3TCJ A;  3ASK A;  1WPY A;  5IT9 E;  1K8A C;  4EIK A;  3CXC P;  1B07 A;  2X4W A;  2YLB A;  1O75 A;  2ABL A;  1E6G A;  1ZBJ A;  3M4G A;  2A36 A;  1AHJ B;  2GTJ A;  2LCL A;  4LDU A;  3DLL A;  4EMK A;  3JCM V;  4HT9 A;  1AVZ C;  1KHC A;  1IRE B;  1YIJ Q;  1I5O B;  1YWP A;  1VQP A;  4FYX B;  1M27 C;  5AYF A;  1WXU A;  3HFO A;  4M77 A;  5DM7 R;  3GNG A;  2XI9 A;  4RTT A;  1QVG P;  5GAO r;  2DXC A;  1GL5 A;  2YUO A;  4PK4 A;  4EMG A;  4RKU E;  3OYJ A;  4LUE A;  3PE0 A;  3QBY A;  3M5A A;  2QXF A;  3QO3 A;  1WXB A;  1NBE B;  3C12 A;  2DXU A;  2ZCF B;  2YHT A;  1IB8 A;  2YLC A;  4PFP A;  2LTO A;  1UEB A;  1IHV A;  1RUW A;  1YJN T;  4BDZ A;  2OAU A;  2CZ7 B;  3HP9 A;  4GY5 A;  2GF7 A;  2OTL A;  2L2P A;  3G71 A;  2HL5 C;  3ZBD A;  3H0F A;  2DIQ A;  4MZT A;  3H0H A;  1VQ8 T;  4R0K A;  4BE1 A;  1OPL A;  5KYX A;  1W1F A;  1QVG S;  3MP6 A;  3FEO A;  2EPD A;  4PJO F;  2KXC A;  4YTL A;  1QP2 A;  2X35 A;  1GXI E;  3L2W A;  4JJB A;  1YJ9 T;  1BI3 A;  2DZ9 A;  3OYA A;  2QDL A;  3OYH A;  5GAN 5;  2CP2 A;  3JCM J;  4M7D G;  5FU7 B;  2DL5 A;  3SWN A;  1HYO A;  2MF2 A;  2I2L A;  2HMA A;  1I8F A;  3NFC A;  3C95 A;  1M90 R;  4DBH A;  4C8Q A;  2DX1 A;  1C0M A;  1M2V A;  4DBQ A;  5FU6 C;  3E9G A;  1W6X A;  1U06 A;  4M75 G;  2FPE A;  4MZM A;  2YRD A;  5GAN h;  1M4Z A;  3EGD A;  3TSW A;  5M9O A;  2RK2 A;  1Y0M A;  2DAQ A;  2P0K A;  2DKG A;  3JCM W;  2KGT A;  2L3Q A;  4Z8A A;  2YUQ A;  3MJX A;  1YIJ T;  4F17 A;  4QQG A;  2EYX A;  1QVP A;  3HFN A;  1HXD A;  1D3B B;  1PRM C;  2EAY A;  4QQD A;  2V8I A;  3BY7 A;  3CCQ Q;  3OYM A;  1MMA A;  2NUP A;  5CQY A;  4J7I A;  1UGV A;  2JOY A;  4JLI A;  4JS4 A;  4DOV A;  3GIB A;  4KUD K;  1PHT A;  5GMK m;  2G6F X;  1RAE B;  1OX8 A;  2LMJ A;  4PJJ A;  1QP3 A;  1G83 A;  1VQN A;  1T0J A;  4V2S A;  2DJZ A;  2D1X A;  2CZ0 B;  1GBR A;  2A28 A;  2YUN A;  3R6N A;  1FYN A;  3REB B;  3RMS A;  1VQ4 T;  2QQR A;  3JB9 I;  2LX9 A;  1M8V A;  5KYU B;  3M0U A;  2DPP B;  2FRW A;  2K9G A;  5GAN 3;  4Z02 A;  1UJY A;  4M7A E;  3I5R A;  1VQK A;  1K1Z A;  2XDD A;  1X2Q A;  2KSS A;  2GCX A;  3EGX A;  2PNI A;  3CBP A;  1KC8 U;  1BCO A;  2H3E B;  2PQW A;  5I11 A;  4GLM A;  2LQN A;  2PU9 B;  2A3L A;  4M78 C;  3CME Q;  3EFO A;  4M7A B;  3OSS C;  3SEM A;  2RI2 A;  1YWO A;  1T0H A;  2P4T A;  4M78 D;  2CYZ B;  1W2B S;  4OMF B;  2LRQ A;  1VQ9 Q;  1WJS A;  2YRC A;  3QXE B;  2J6K A;  3M53 A;  1K76 A;  2J7I A;  2HCK A;  3KUF A;  3L2R A;  2K2M A;  3TRE A;  2F2W A;  3T9N A;  2MOX A;  4KGZ B;  2E10 A;  2JMC A;  3A8M B;  1GBQ A;  5CR2 A;  3VS6 A;  2BIV A;  3CPW A;  2P0P A;  2JTF A;  5LJ5 f;  2XG8 D;  3L42 A;  1WX6 A;  1MHN A;  4OMP A;  3UA7 A;  1KSW A;  2CS7 A;  2M0O A;  2RMO A;  3REA B;  2J06 A;  3H41 A;  3CC4 Q;  2FZC B;  1U1S A;  4XQ3 A;  2EFI A;  1EFN A;  1FMV A;  1LCK A;  3VKI A;  2ED0 A;  1VQ6 A;  2CT3 A;  2K5L A;  1M1G A;  4FM4 B;  4F7U E;  3V8K A;  5I21 A;  3OY9 A;  1QLY A;  2M02 A;  3HPW A;  3V8J A;  5L8R E;  3OYI A;  1Q86 R;  1XJW B;  5CO7 A;  1M8M A;  3PTA A;  4LDX A;  2E41 A;  1Y96 A;  1M90 C;  1YI2 Q;  5LJ3 j;  3QYG B;  4PJO G;  2RB6 A;  3OW2 P;  4F7U B;  5LJ3 e;  3BDU A;  2Y90 A;  1G5V A;  4RTW A;  3JB9 F;  1W2B A;  2ATC B;  4JJD A;  3O8V A;  2EQJ A;  1SRL A;  2XU8 A;  3CME T;  4KH0 B;  4BUG A;  4IUU A;  2F69 A;  1YIT Q;  1XOV A;  1D1A A;  4A4F A;  1X01 A;  4FCY A;  2KRS A;  3ULR B;  2F2V A;  1VQ9 T;  1VQO Q;  4XK8 E;  4QVD A;  4OMN A;  2L89 A;  4DEY A;  1Q81 R;  2K57 A;  1OU9 A;  2QGG A;  2RJD A;  2QA4 A;  2FB7 A;  2E64 A;  3G6E Q;  2QK0 A;  2IIM A;  3CD6 Q;  2DD5 A;  3L2Z A;  2OJ2 A;  4KRT A;  2MIO A;  1ABQ A;  4RTX A;  1Q7Y U;  1VQM Q;  3QHS A;  2X51 A;  1FMK A;  3CPF A;  3I9Q A;  2QAS A;  4ZNX A;  1O9S A;  3RKY A;  5GAN g;  2K3Y A;  3HRS A;  3QYH B;  3CC4 T;  5J39 A;  4M7A F;  3NMZ C;  2AZV A;  2GBQ A;  4F04 B;  1WHM A;  2AKK A;  1I07 A;  3FC3 A;  4X34 A;  2EYZ A;  2D8H A;  2XMF A;  2DVE A;  1UE9 A;  2K3B A;  3LYI A;  3VS0 A;  3LLR A;  1X75 C;  2HD0 A;  2DVJ A;  1N8R R;  5KYW B;  3PVL A;  4J6X A;  2K4Y A;  5LJ5 h;  1UGP B;  1J3T A;  2PVO B;  3TVT A;  2M9U A;  1N9R A;  1K8A R;  1YI2 T;  2DTI A;  5KYU A;  2KXD A;  2EJ9 A;  3UAT A;  2KT1 A;  5HK3 A;  3NHN A;  2KRN A;  3OBY A;  1E7O A;  4LN2 A;  1I4K 1;  3H9N A;  5CK9 A;  1ZX6 A;  4XU1 A;  2CUB A;  1JXO A;  2JJ9 A;  1MV0 B;  3NTH A;  3VS4 A;  1YIT T;  4RUG A;  1OQK A;  4E7J A;  2JS0 A;  2YXY A;  2FG0 A;  5HKC A;  4L6V 5;  4ESR A;  3CC2 A;  4NS5 A;  3DKM A;  4D6W A;  1VQO T;  2C0I A;  3MCA B;  4XTX A;  1PM3 A;  5GAO n;  4F14 A;  3HSB A;  4K11 A;  2DIG A;  3G6E T;  5GAM e;  2RK1 A;  3CD6 T;  3CCS Q;  3BW1 A;  1KK7 A;  2LJ3 A;  4E47 A;  3M0P A;  1VQM T;  1TUC A;  5GAO p;  3QZ5 B;  1X43 A;  5FU6 B;  1B3Q A;  2VUB A;  5LJ3 d;  1Q95 G;  5CIU A;  2EQI A;  1GFC A;  1Q86 C;  5GAN 4;  1JBM A;  2EJF A;  6AT1 B;  1PSF A;  2JZ2 A;  1S1N A;  1TTH B;  3PIP A;  3A8L B;  4DEX A;  3P8D A;  1KHI A;  3S3M A;  3CCR Q;  1D1C A;  4R55 A;  3G1J A;  2QI2 A;  4JS5 A;  1EIF A;  3P8B B;  3OS2 A;  4ZGE B;  4IUQ A;  3CCJ A;  3C94 A;  3MEA A;  3EH2 A;  1SSH A;  2QTV A;  1NJI U;  5I22 A;  2KRO A;  4GLK A;  3JB9 J;  1R8O B;  3X24 B;  2V26 A;  1B7T A;  1HJD A;  1AZE A;  2KE9 A;  2RJF A;  4LXC A;  3VYG A;  2K79 A;  3D7S B;  5GAN j;  1H64 1;  2GQV A;  2F2X A;  4PJO B;  1Q81 C;  3NGP A;  3JB9 G;  1R0C B;  2FEI A;  5GJV B;  2L3S A;  1SKU B;  4DBF A;  2KI7 A;  1BBZ A;  1PRL C;  1K73 U;  4JZ4 A;  2DL4 A;  3CCU T;  1Y71 A;  2E6Z A;  2JTE A;  4M78 E;  2ZZD A;  4E7L A;  2KRM A;  3JCM e;  1G2B A;  2SEM A;  1VQ7 A;  4M7D A;  2K5F A;  2EYQ A;  1TG0 A;  1QVF A;  3GOX A;  4Q5W A;  3OYK A;  3CCV Q;  1C6V X;  3QDF A;  4IUR A;  1JJ2 P;  4F16 A;  2LP5 A;  2IVW A;  4NL2 A;  1Y57 A;  1TUG B;  1HD3 A;  3CMA A;  4M75 A;  2R58 A;  1TH7 A;  3CCS T;  1M1K U;  1I1J A;  1WHL A;  1ZSZ A;  5IXF A;  4XU3 A;  1BIA A;  1YHQ A;  1E6H A;  3CCE A;  2YDL A;  5FRO A;  1N8R C;  5FRN A;  1YJ9 Q;  3C0C A;  4M7A G;  1DJ7 B;  5KYY B;  1UG1 A;  5IHN A;  3HHT B;  2K5I A;  5IH2 A;  1I81 A;  1CSK A;  3CCR T;  2OX7 A;  3OBW A;  1X6G A;  1JJ2 S;  2NLU A;  3OS0 A;  4J9I A;  1PG5 B;  3JCM b;  1BYM A;  2F5K A;  4C5G A;  2JN0 A;  3VUB A;  5GMK h;  2RM4 A;  4ORZ A;  1OPK A;  2J6F A;  1M30 A;  4FIB A;  3Q1J A;  2K2V A;  4QKU A;  2EBP A;  3NTK A;  3UF4 A;  5GAM d;  2V1R A;  3EFR A;  1X69 A;  3QKJ A;  2DEU A;  2RN8 A;  4B9W A;  1RLP C;  1Y7X A;  2XD0 A;  1GCP A;  4X9C A;  3CXC S;  3QSU A;  4IIO A;  1B34 B;  1PKT A;  1VQP Q;  4JDS A;  2DXT A;  4CI0 C;  5LJ5 g;  2CH4 W;  1OZ2 A;  4N4G A;  2Y4Y A;  2JS2 A;  4OMO A;  2HKN A;  5FRM A;  4AFS C;  1V29 B;  1KJW A;  3ZFJ A;  2RJE A;  5KCO A;  4KUL A;  4EMK C;  3CCV T;  4HXJ A;  3AT1 B;  1U8R A;  1VQ4 Q;  3I5S A;  3GF5 A;  2EQK A;  4WTO B;  3G7Z A;  4F7U G;  2M1H A;  1SRM A;  5L23 A;  1IHW A;  2G3R A;  2CSQ A;  2FZK B;  2KK4 A;  2MK5 A;  3M0S A;  4C8Q F;  2OTL Q;  2SRC A;  3G71 Q;  5AT1 B;  4M77 C;  1PKS A;  5GJW B;  4R56 A;  1M3B A;  1YFN A;  1XNI A;  1JRI A;  3ER0 A;  4M77 D;  2XIC A;  4BY6 C;  2NUT B;  3LGL A;  2CSI A;  2CRE A;  1RAI B;  3JCM d;  4PL6 A;  4HKE A;  2ROT A;  3CEY A;  2COY A;  4J9G A;  3QWX X;  4OMM A;  1SEM A;  1WNL A;  2QGF B;  4M78 F;  3M54 A;  2CKK A;  2XK0 A;  3KBG A;  3CXC A;  2PVG B;  2DF6 A;  3OS1 A;  2NYS A;  3I56 A;  1AD5 A;  2RI3 A;  1K9M U;  1TSF A;  1ZSG A;  1FWZ A;  2YWW A;  4FL6 A;  1VQP T;  2DBM A;  1RAF B;  1Z9Z A;  1LNX A;  3OS5 A;  3I35 A;  4HCZ A;  2RF0 A;  2DYB A;  2XHC A;  5KE3 A;  3SWN C;  1BKB A;  3HTR A;  4GBQ A;  5KYN A;  3L2V A;  1UHF A;  1WQW A;  2F5T X;  2D6F A;  2A0F B;  2E3H A;  1RAG B;  3CCQ A;  1ZUU A;  1YP5 A;  3LH0 A;  4C8Q C;  2J05 A;  1VYU A;  2RJC A;  2OI3 A;  2OAW A;  1KC8 R;  3R6O A;  4C8Q D;  1GRI A;  3ZL7 C;  2DJQ A;  1M2O A;  1VQN Q;  2DEQ A;  1VQ5 A;  2O2O A;  1QVG A;  3EFS A;  2BKD N;  3RNJ A;  3GBQ A;  3QJY A;  3EG9 A;  4C0G A;  1D0X A;  2RPN A;  2XKO C;  2KEA A;  1KQ1 A;  3N5B B;  3FDR A;  5LJ5 j;  2OTL T;  4E2F B;  2DL3 A;  2MI6 A;  3G71 T;  2EWN A;  4LDY A;  3G4S A;  2DTH A;  2DXB A;  4D8D A;  2LQ8 A;  4OGE A;  4C92 A;  1OU8 A;  2KVQ G;  3PMI A;  3WVE B;  4J9E A;  2F1L A;  4DOW A;  2HQH A;  4C0Z A;  1JEG A;  1VUB A;  1WHH A;  4QT7 A;  1MNE A;  2DNU A;  2A37 A;  1SG5 A;  2JMA A;  4FSX A;  3ZEH A;  3HRU A;  1TS9 A;  8ATC B;  1M3C A;  3HKS A;  3S3N A;  2O4X B;  4XTU A;  4BE0 A;  3JV3 A;  1W70 A;  2O9V A;  4MMK A;  1K9A A;  2HQE A;  2R5M A;  2BZY A;  2CP3 A;  3X20 B;  1S72 A;  2HDA A;  1CKA A;  3A8H B;  2FRY A;  2JW4 A;  4WCI A;  4C5H A;  4AG2 C;  2FPF A;  4C92 C;  3E19 A;  1AT1 B;  3M9Q A;  4HVU A;  1WDX A;  1TXQ A;  4C92 D;  2RQV A;  3JAM E;  4PNO A;  2DD4 A;  2DZC A;  1OOT A;  5GAN 6;  3L1A A;  2K7A A;  1AWX A;  3QZ9 B;  2VKN A;  2FPD A;  4RTZ A;  3VS1 A;  2QEX A;  2CZ1 B;  4BE2 A;  4CC7 A;  1AOJ A;  2ZGW A;  3OB9 A;  1ZQ1 A;  2FZG B;  5CKE A;  1VQ6 Q;  2DTO A;  1UDL A;  1WIE A;  1QKW A;  3QII A;  3DB3 A;  4E7S A;  3CBO A;  1NPP A;  1VQN T;  3HL8 A;  4PKC C;  3QPH A;  4VUB A;  1UUE A;  4J9B A;  4JPB W;  2RD1 A;  2RH2 A;  3PIO A;  4B9X A;  3MPU B;  2LQK A;  2D0N A;  3DB4 A;  4PJN A;  1JO8 A;  1TU0 B;  4OML A;  5J3B A;  4BD3 A;  2M0Y A;  3M0T A;  4Y28 E;  4Y92 A;  1VQK T;  1WHJ A;  1NLO C;  1P92 A;  4IIM A;  8AT1 B;  1WQ7 A;  3FJP A;  7AT1 B;  3M55 A;  1NPR A;  1SPK A;  4XU2 A;  3EHR A;  2VGM A;  2EGE A;  2E6N A;  1UGQ B;  2CGH A;  3A1P A;  1Q7Y R;  1M3A A;  2ZPB B;  2EGA A;  4FT2 A;  5FWC A;  1RAB B;  3GPL A;  2PZ1 A;  1VOM A;  3VRZ A;  3URG A;  4XTV A;  4M78 G;  2R5A A;  2LT4 A;  3MEV A;  5CVI A;  3OW2 S;  2CP5 A;  1YJW A;  5IAY A;  3OYG A;  1WXT A;  4JJC A;  4PJM A;  1AWJ A;  3SFM A;  1LPL A;  3J80 E;  4MDW A;  2QA4 Q;  2KMT A;  1ZBX A;  4QQ6 A;  2PVD B;  1RAC B;  4OVA A;  1VYT A;  1KQS P;  1KC8 C;  3M58 A;  4JRQ A;  4ZN3 A;  1XQH A;  2LNH B;  4FSS A;  3TEE A;  1D3B A;  1Q82 U;  2CDT A;  4NL3 A;  2E1H A;  1QQJ A;  2Z0W A;  5HY6 A;  2HBW A;  3A8O B;  2KYB A;  4JJN K;  4ZTJ A;  5LJ3 f;  3A8G B;  1W4S A;  3RDV A;  2D9T A;  1G3T A;  3J81 E;  2V8K A;  1KIK A;  5ECA A;  3CCL A;  1D1B A;  4X9D A;  1VQ6 T;  4HT8 A;  2HBP A;  2DIL A; 
#chains in the Genus database with same CATH homology
 2KRM A;  1G2B A;  2SEM A;  2KXC A;  1MUZ A;  1QKX A;  1TG0 A;  4AFQ C;  4JJB A;  4RTU A;  3VS2 A;  2EKH A;  1AEY A;  2QDL A;  2BTT A;  4RTV A;  2AZS A;  1JU5 C;  2DL5 A;  1NLP C;  4Z89 A;  4F16 A;  2LP5 A;  1IO6 A;  1K0S A;  1Y57 A;  2AK5 A;  1HD3 A;  2RQU A;  3THK A;  2D8J A;  1ABO A;  2DRK A;  4LUD A;  1I1J A;  1AWO A;  5IXF A;  2DX1 A;  1N5Z A;  1E6H A;  1W6X A;  1U06 A;  2FPE A;  2YDL A;  4HVV A;  1JXM A;  2JM8 A;  5EC7 A;  3RBB B;  2O9S A;  3TSW A;  3CQT A;  1ZUY A;  3C0C A;  1Y0M A;  1UG1 A;  2KGT A;  2L3Q A;  4Z8A A;  5IHN A;  2YUQ A;  5IH2 A;  4F17 A;  1RI9 A;  1CSK A;  2W0Z A;  2EYX A;  3VS5 A;  1VYV A;  1X6G A;  2LJ0 A;  1PRM C;  4J9F A;  1QCF A;  4J9I A;  1AZG B;  2A08 A;  5IHK A;  1NG2 A;  1K4U S;  1UGV A;  4ORZ A;  3SHW A;  2J6F A;  1OPK A;  1PHT A;  1M30 A;  1NYG A;  1UFF A;  2G6F X;  2EBP A;  1VA7 A;  2W10 A;  2FO0 A;  2CT4 A;  2LMJ A;  3UF4 A;  2V1R A;  1X69 A;  1G83 A;  2RN8 A;  1T0J A;  1RLP C;  2H8H A;  2D1X A;  1GBR A;  2A28 A;  1GCP A;  2YUN A;  4E6R A;  5IHI A;  3R6N A;  4OMQ A;  4IIO A;  2KYM A;  1FYN A;  3REB B;  3UA6 A;  4HCK A;  1PKT A;  1KFZ A;  2NUZ A;  1X27 A;  1Z9Q A;  3M0U A;  4A63 B;  1X6B A;  2FRW A;  2K9G A;  3EG2 A;  3VRY A;  2CH4 W;  1UJY A;  2EYW A;  2JS2 A;  4OMO A;  3I5R A;  1UEC A;  2LQW A;  1MV3 A;  1QWF A;  1K1Z A;  4AFS C;  2RQR A;  1X2Q A;  1I0C A;  2ROL A;  1KJW A;  3EG3 A;  2PNI A;  4Z88 A;  4LNP A;  2EGC A;  5I11 A;  4GLM A;  2LQN A;  1A0N B;  4HXJ A;  2GQI A;  3SEM A;  1GCQ A;  1YWO A;  1ARK A;  1T0H A;  2NWM A;  3I5S A;  2J6O A;  1NEG A;  2DM1 A;  2HSP A;  1SRM A;  5L23 A;  2CSQ A;  3M0S A;  4J9C A;  2SRC A;  2J6K A;  3QWY A;  2HEQ A;  1PKS A;  4RTY A;  1K76 A;  2J7I A;  2X3X D;  5GJW B;  2KNB B;  2HCK A;  1M3B A;  1CKB A;  2K2M A;  2F2W A;  2LX7 A;  2MOX A;  2C0T A;  2CSI A;  3M0R A;  1SHF A;  2JMC A;  1GBQ A;  2CRE A;  1YN8 A;  2EW3 A;  3VS6 A;  1WX6 A;  4OMP A;  3UA7 A;  1KSW A;  2B86 A;  2RMO A;  5HCK A;  2X3W D;  3REA B;  2ROT A;  2J06 A;  3H41 A;  2GNC A;  2DL8 A;  2O88 A;  3NPF A;  4J9G A;  3QWX X;  2YSQ A;  4OMM A;  1SEM A;  1H3H A;  1H8K A;  2EVR A;  4J9D A;  1EFN A;  2P4R A;  2L0A A;  1LCK A;  2ED0 A;  1QWE A;  2ED1 A;  1YNZ A;  2DF6 A;  4JZ3 A;  2CT3 A;  4AG1 C;  1PWT A;  4AFZ C;  2V1Q A;  1AD5 A;  5FWB A;  1QLY A;  1ZSG A;  4LE9 A;  2E5K A;  2DBM A;  1Z9Z A;  1M8M A;  1T3S A;  2C0O A;  3I35 A;  2RF0 A;  2DYB A;  2YUP A;  1NYF A;  4GBQ A;  1X2K A;  1UHF A;  1RLQ C;  2DBK A;  3KFV A;  3LH5 A;  1ZUU A;  2CH4 A;  1YP5 A;  4RTW A;  3EG1 A;  2J05 A;  1VYU A;  2OI3 A;  4JJD A;  1SRL A;  2OAW A;  1WYX A;  2RQT A;  1SHG A;  1GRI A;  3ZL7 C;  2DJQ A;  1XOV A;  3VS3 A;  2DRM A;  2ESW A;  1OEB A;  2O2O A;  3RNJ A;  3GBQ A;  2KRS A;  3ULR B;  2F2V A;  2RPN A;  3EGU A;  1V1C A;  1BU1 A;  2KEA A;  4OMN A;  2KT8 A;  4DEY A;  2DL3 A;  2EYY A;  1UHC A;  4D8D A;  2BZ8 A;  2DL7 A;  2IIM A;  2JXB A;  4AFU C;  4M4Z A;  4J9E A;  2OJ2 A;  1HSQ A;  4KRT A;  2K6D A;  2LJ1 A;  2MIO A;  1ABQ A;  4RTX A;  1JEG A;  2I0N A;  1FMK A;  4QT7 A;  3I9Q A;  4ZNX A;  2DNU A;  2A37 A;  1T3L A;  2JMA A;  4CC2 A;  1M3C A;  3NMZ C;  2AZV A;  2L3P A;  2GBQ A;  4D8K A;  2AKK A;  2YT6 A;  3JV3 A;  1I07 A;  1W70 A;  3H0I A;  1NEB A;  2O9V A;  2DMO A;  1K9A A;  2EYZ A;  2RQW A;  1UTI A;  1PNJ A;  2D8H A;  5IXB A;  2BZY A;  2XMF A;  3PVQ A;  1UE9 A;  2K3B A;  2HDA A;  1CKA A;  1UJ0 A;  2FRY A;  2JW4 A;  3VS0 A;  1OV3 A;  4WCI A;  4AG2 C;  2DVJ A;  2FPF A;  3PVL A;  2LCS A;  1WA7 A;  4HVW A;  2GGR A;  1J3T A;  4HVU A;  3TVT A;  1WFW A;  1WDX A;  2RQV A;  2JT4 A;  1GCQ C;  2KXD A;  1OOT A;  2MCN A;  3UAT A;  2KT1 A;  2LZ6 B;  2VVK A;  3IQL A;  2K7A A;  2KBT A;  1AWX A;  1ZUK A;  3NHN A;  2VKN A;  2DA9 A;  1U3O A;  2KRN A;  3TSZ A;  2FPD A;  1E7O A;  4LN2 A;  4RTZ A;  2KR3 A;  3VS1 A;  2DLP A;  4CC7 A;  1AOJ A;  1ZX6 A;  2M51 A;  3FJ5 A;  1UDL A;  1WIE A;  2CUB A;  1JXO A;  1QKW A;  1MV0 B;  2AKL A;  3VS4 A;  1K0X A;  1BK2 A;  4RUG A;  2RNA A;  2PTK A;  3VS7 A;  2JS0 A;  2FG0 A;  1GFD A;  1UUE A;  1AWW A;  2VWF A;  4J9B A;  4JPB W;  4ESR A;  2CUD A;  1NM7 A;  4EIK A;  2C0I A;  2DE0 X;  2D0N A;  1JQQ A;  1B07 A;  1JO8 A;  3M0Q A;  4OML A;  4F14 A;  2M0Y A;  2ABL A;  3M0T A;  1E6G A;  4K11 A;  4Y92 A;  1ZBJ A;  4J9H A;  2A36 A;  1NLO C;  4IIM A;  3EHQ A;  1SPK A;  2GTJ A;  2LJ3 A;  3EHR A;  3M0P A;  1BB9 A;  1TUC A;  2EGE A;  1X43 A;  1B3Q A;  2ENM A;  3O5Z A;  1AVZ C;  1M3A A;  2ECZ A;  2EQI A;  1GFC A;  4X1V A;  1U5S A;  2EGA A;  5FWC A;  2PZ1 A;  3VRZ A;  1S1N A;  4DEX A;  1YWP A;  1M27 C;  2BZX A;  1TUD A;  1WXT A;  4JJC A;  1AWJ A;  1WXU A;  4CC3 A;  1H92 A;  4RTT A;  1VYT A;  2O31 A;  1SSH A;  3A98 A;  5I22 A;  1GL5 A;  2YUO A;  2KRO A;  2LNH B;  2GTO A;  4FSS A;  4LUE A;  3PE0 A;  2CDT A;  1HJD A;  1WXB A;  1AZE A;  2KE9 A;  2HBW A;  2K79 A;  1YCS B;  2F2X A;  2KYB A;  5FW9 A;  1WI7 A;  1RUW A;  3NGP A;  4CC4 B;  2FEI A;  5GJV B;  2L3S A;  3U23 A;  1KIK A;  5ECA A;  1WLP B;  1BBZ A;  1PRL C;  2L2P A;  1ZLM A;  3H0F A;  4JZ4 A;  3EG0 A;  2DL4 A;  3H0H A;  4R0K A;  1OPL A;  2JTE A;  1W1F A;  2JM9 A;  2EPD A;  2DIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...