2KRSA

Solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
b'MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable enterotoxin
publication title Solution NMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A.
rcsb
source organism Clostridium perfringens
molecule tags Structural genomics, unknown function
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08239 SH3_3 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krsA01
2DNUA 1JO8A 2DF6A 2J7IA 2O31A 1RLQC 4OMOA 2L0AA 1PWTA 2DLPA 1GFCA 3IQLA 2D1XA 2JM9A 1KIKA 4LE9A 1UTIA 3M0SA 1X6BA 2KT8A 3UA7A 2GBQA 1W6XA 4AG2C 2VWFA 4JZ4A 1SSHA 2DA9A 3M0QA 1CKBA 2GQIA 4CC3A 2LJ0A 2RQTA 2LJ3A 2DL4A 1WIEA 2OAWA 1GFDA 2J05A 4QT7A 3M0PA 2FRWA 2DX1A 4JPBW 3GBQA 2MIOA 2DVJA 2M0YA 4J9HA 1U06A 2QDLA 2ABLA 3RBBB 1TUCA 2SEMA 1GCQA 4AFQC 2V1QA 1X43A 2DL5A 1AWOA 1EFNA 1MV3A 1K76A 1KSWA 1M3CA 2DILA 2EQIA 2F2XA 2RQVA 2JT4A 4OMPA 2LZ6B 2GTOA 2LJ1A 4RTUA 2O9VA 1YNZA 2AK5A 5GJWB 1NEGA 2OJ2A 2V1RA 2L3PA 1TG0A 1T3LA 1FMKA 3VS6A 1J3TA 4OMQA 2A28A 2JW4A 3CQTA 1AEYA 2YDLA 2EYZA 5FWBA 4J9BA 4HVWA 1VYVA 1WYXA 4J9GA 1K9AA 1M3BA 2YSQA 1X2KA 2DL8A 2FPDA 2ROTA 1SEMA 4Z89A 2JS0A 2VKNA 1JQQA 1OOTA 2FPFA 3NMZC 1ZBJA 2FEIA 4F17A 2H8HA 2DRKA 4LN2A 1NG2A 4CC2A 2LNHB 1K0SA 2K3BA 1WXUA 1AVZC 2EPDA 2YUQA 2C0TA 1OPKA 1NEBA 2JS2A 3EG2A 2AKKA 3EGUA 2GGRA 1QCFA 4F16A 2CH4A 5I11A 3KFVA 3NHNA 1YN8A 2LP5A 2J6KA 2P4RA 3TSWA 5FW9A 3H41A 3UATA 2KBTA 1WXTA 1CSKA 1U5SA 2X3XD 2W10A 1WDXA 1T3SA 1UJYA 2A37A 2O9SA 4RUGA 1NLOC 1GCPA 2YUOA 3TVTA 4CC4B 3EG0A 2EW3A 1UG1A 2AZSA 2CUBA 1NYGA 2B86A 1PNJA 2IIMA 4DEYA 3UA6A 1UECA 1FYNA 1AZGB 4FSSA 1X27A 2C0OA 1YP5A 4AFUC 1GL5A 1BK2A 2L3SA 3NPFA 1X2QA 2KYBA 1T0JA 5IHIA 1HD3A 3REAB 2YUNA 1ABQA 3RNJA 1AWWA 1WLPB 2BZXA 4GLMA 4JZ3A 2EYYA 1HSQA 3EHQA 4A63B 2M51A 2CSIA 1RUWA 2FO0A 2LQWA 1HJDA 3SEMA 2MCNA 1E6HA 2DE0X 3VRYA 1ZX6A 2KROA 4IIOA 2ENMA 2HSPA 2HBWA 1AWJA 2D0NA 2BZYA 3M0TA 1WXBA 1KFZA 2RNAA 1PRLC 1MUZA 1SHFA 2PZ1A 1H92A 2GTJA 4KRTA 4Y92A 3C0CA 1I07A 1E6GA 1M30A 1UE9A 1E7OA 1PHTA 2KYMA 2HEQA 2LMJA 1T0HA 4RTTA 4RTXA 2DL3A 4RTWA 5I22A 2CDTA 2D8JA 2EGCA 1PRMC 1SRMA 2NWMA 1UUEA 1Y57A 2MOXA 1PKTA 2ECZA 2GNCA 5EC7A 1ZUUA 2FRYA 2K2MA 4WCIA 2PNIA 2DBKA 3I9QA 1XOVA 2RQUA 2JMCA 2RPNA 1S1NA 4X1VA 3M0RA 2OI3A 1QKXA 1UJ0A 5GJVB 4AFZC 3UF4A 1WX6A 2KGTA 2J6OA 2KXDA 1OV3A 2LQNA 4IIMA 2K79A 2HDAA 4JJBA 1UDLA 2CUDA 2G6FX 1H8KA 4RTYA 4J9IA 2SRCA 4HVUA 1GBQA 2ED0A 2KXCA 3I5SA 2JM8A 1K4US 2ROLA 2DYBA 2HCKA 4OMLA 1MV0B 2JTEA 4M4ZA 1I1JA 2J6FA 1SHGA 2K7AA 2LCSA 2F2VA 2DMOA 1VYUA 5L23A 2JXBA 2K9GA 2EKHA 2RF0A 4AFSC 1ARKA 2YT6A 1WFWA 1QWEA 2DJQA 1BB9A 1BBZA 3PVLA 3NGPA 1VA7A 2KT1A 5IXBA 3ZL7C 3VS5A 4Z88A 3I5RA 1UGVA 2EBPA 2CH4W 4J9DA 2K6DA 2DL7A 2KRMA 1Z9ZA 2AZVA 1AOJA 1U3OA 1K1ZA 2BZ8A 1AD5A 1YCSB 2AKLA 4J9CA 4K11A 1NYFA 1NM7A 1ZUYA 4RTVA 2FG0A 4HCKA 1SRLA 2EYXA 2RQRA 4ORZA 2CSQA 5IH2A 1QKWA 4JJCA 3TSZA 4GBQA 3EG3A 2D8HA 1AZEA 2E5KA 2EVRA 1M8MA 1NLPC 1WA7A 4J9EA 5IHNA 1QLYA 1ZLMA 2DM1A 2LX7A 3H0FA 2KRSA 2L3QA 4RTZA 3R6NA 3VS4A 2L2PA 3H0HA 1X69A 4ZNXA 4Z8AA 1M27C 3THKA 3QWYA 4D8DA 2A36A 2FPEA 3ULRB 4HXJA 4LUDA 2KE9A 4R0KA 3VS7A 2RQWA 2ED1A 1UHCA 1AWXA 3LH5A 4D8KA 4OMNA 1SPKA 1K0XA 3FJ5A 1OEBA 3EG1A 3PVQA 2RN8A 1TUDA 2EGEA 1JXMA 4J9FA 2KNBB 2JMAA 4JJDA 1JU5C 2I0NA 3EHRA 2O88A 1GCQC 2F2WA 3VS2A 2EYWA 2KEAA 4EIKA 2RMOA 4LUEA 4LNPA 2EGAA 4F14A 1Y0MA 2X3WD 3VS3A 1IO6A 1GBRA 3VRZA 1VYTA 1KJWA 1WI7A 1H3HA 3M0UA 3PE0A 1YWOA 3REBB 2NUZA 1G2BA 1UFFA 2YUPA 3A98A 2CT3A 4HVVA 1PKSA 1ZSGA 5ECAA 3QWXX 1UHFA 2W0ZA 2VVKA 2J06A 4DEXA 4CC7A 3O5ZA 4ESRA 1RI9A 2A08A 1A0NB 1JEGA 1CKAA 5HCKA 5IHKA 1JXOA 1G83A 2CREA 1W70A 1M3AA 1B07A 2O2OA 2KR3A 3VS0A 3JV3A 1RLPC 2PTKA 1W1FA 2ESWA 3I35A 1GRIA 2CT4A 1YWPA 1BU1A 1I0CA 2DRMA 4E6RA 5FWCA 2XMFA 3SHWA 2BTTA 1ZUKA 4OMMA 3VS1A 2KRNA 2C0IA 1LCKA 1ABOA 1N5ZA 1B3QA 1OPLA 2DBMA 1QWFA 3U23A 3H0IA 1Z9QA 4AG1C 5IXFA 1X6GA 1V1CA
chains in the Genus database with same CATH superfamily
5KCHA 2K4YA 3VKIA 1OYXA 2L0AA 3WVEB 3FLGA 3OYAA 1TSFA 2BE7D 3WVDB 1M5Q1 5GANf 1U1TA 4F7UB 4II1A 4IKFA 4ZGJB 1UTIA 4NOYA 1X6BA 2KT8A 2GBQA 1PG5B 1Q86C 1K73U 4M77F 1SSHA 2DA9A 2Z0WA 3CPWS 5GANe 2X4JA 2DEQA 2LCCA 3EG9B 4LDXA 4TVRA 1K9MC 4M77A 3L2RA 4BDZA 1RI0A 5KH6A 1K8AC 3OYJA 1U06A 5GAOp 4C92A 1RABB 1JJ2S 3JB9D 3OYIA 4FYWB 3EGDA 4MZTA 5C0MA 1AWOA 2RQVA 1M3CA 1RACB 2E3IA 2VXEA 3CC7Q 1KHIA 5L8RE 3CMAT 1UEBA 2O9VA 1IRXA 2DEUA 1D09B 3L2VA 3CC7A 4FW1A 1B34B 3MKDA 1QMCA 3CBPA 3G1JA 1T3LA 2D6FA 4XTZA 2VGNA 3CQTA 4A53A 2YDLA 3A8OB 3E2UA 3QDFA 3CC4Q 1MHNA 3PNWC 3DB3A 4BUGA 3PIOA 3CC4A 5KYUA 1HK9A 4GLKA 2YSQA 3CCSQ 1F1BB 2D9TA 2ROTA 3CCSA 2JS0A 2VKNA 3NMZC 3VYHB 1VQ8Q 4F17A 2KK4A 2DRKA 5GMKh 3OYGA 1K0SA 1WXUA 2EPDA 3CXCS 2C0TA 1M2VA 3JCMQ 3GIBA 1PSEA 2JS2A 3UPUA 2CH4A 2LP5A 2MI6A 3TEEA 1VQOQ 5FW9A 3UATA 2QK0A 2DTHA 4OP0A 1VQOA 1U5SA 2X3XD 4EDUA 1WHKA 3M5AA 4LDVA 1N9RA 1UJYA 4B6MA 2RHXA 1PM3A 1NLOC 3TVTA 3EG0A 1YBYA 2EW3A 4B9XA 1KC8U 1KG1A 2EQUA 1Q86U 4M78D 5A0LA 1O75A 2AZSA 4BACA 3NTHA 4DEYA 2LT4A 4M7AC 3TCJA 1AZGB 4NL2A 3RDVA 3OYYA 4LXCA 1WJQA 1R77A 5KCOA 1X27A 5GAMe 2C0OA 4AFUC 1LOJA 1BK2A 1Q82C 3MJXA 3QJ6A 4DQ2A 4BE1A 1K8AU 2KYBA 2E4HA 3QO3A 3CCJQ 2XHCA 4HA8A 2MYSA 1W2BA 1HD3A 3REAB 3JCMd 1VQ7Q 4OF1A 2YUNA 3RNJA 3RUXA 2BZXA 4PJOE 2HZYA 2X51A 2EYYA 3MCAB 1VQ7A 2M51A 2OTJT 3CCEA 3ASKA 3CCUQ 3SEMA 4IUVA 4PJOG 2QQ9A 3OSVA 3E9GA 2MCNA 2RJDA 3CCUA 4C0DC 4J7FA 3KXTA 4N0AA 3MEVA 4J6WA 4IIOA 3EFOB 1YHQQ 1IXDA 1QVFA 3R6OA 1ZSZB 4XTUA 1QVPA 4CRIA 5GANd 3QKJA 2RO0A 3CCRQ 1PRLC 3HKSA 1RAEB 4F7UF 5DM7R 3CCRA 2ZPGB 3MO8A 3AT1B 1E6GA 3META 3OS1A 1PHTA 2KVQG 3ME9A 2HEQA 1T0HA 2DL3A 2DD4A 3G71Q 2D8JA 2EGCA 2MF2A 3G71A 1ZUUA 4A4HA 2FRYA 2BKDN 2CP6A 3FIFA 3EG9A 4ZN1A 5GAOn 3S3OA 3G4SQ 1SKUB 3G4SA 3UF4A 2KGTA 2KXDA 1OV3A 4IIMA 4BB7A 2IVWA 4F7UG 3G6ET 4BI4A 1G3YA 1VQ6T 2G6FX 1WHGA 2QA4A 4J9IA 2OAUA 2E5QA 4AT1B 2FZGB 3MEAA 1QP3A 5LJ3g 4M4ZA 1I1JA 2J6FA 4PLIA 1VQ5T 4C0ZA 1YIJQ 1YJWT 2C06A 5FRMA 2K9GA 2HD0A 2JUFA 1BCMA 4JLIA 4AFSC 3A8LB 5CVIA 3FC3A 2QEXQ 1Q82U 5GAN2 1VQ4T 1BI1A 1BB9A 2K5FA 3PVLA 4X9CA 4KT0E 2QEXA 2RJCA 2HL5C 5IXBA 3CCMT 3I5RA 5FRNA 2YWWA 4J9DA 2CZ0B 4LDUA 2AZVA 2LTOA 3M59A 1U3OA 1K1ZA 2BZ8A 1LNXA 4PL6A 1YCSB 3OYDA 3CBOA 4K11A 3EGXB 4GY5A 2BIVA 3A1PA 3L1AA 1C6VX 3CCQT 2COWA 4M7DE 3V8KA 4JJCA 3OA6A 2F1LA 1D0YA 3PMIA 1VQMA 4M7DG 2E5KA 5GAMd 5CK9A 1M8MA 1NLPC 5KYWB 4LDYA 3H6ZA 3OYMA 3H0FA 4OB0B 4RTZA 3M9QA 2VUBA 3VS4A 1WZOA 4D8DA 1TUGB 5GAN5 2GFUA 2EYQA 3OW2A 1AWXA 1RAFB 3LH5A 3CMEQ 4M77C 3CMEA 1YJ9Q 3D7SB 4FU6A 3A8MB 1YJ9A 2G3RA 1TUDA 1QCOA 1JXMA 4J9FA 4C92C 4A54A 2O88A 4M78B 3QHSA 2RK1A 1BI0A 2DFUA 3KBGA 4F14A 5D7UA 3VRZA 2A7YA 2CYZB 3EFOA 3JCMh 3PE0A 4C8QD 2RH2A 1G2BA 5EG2A 5KYXA 2QYZA 1ZSZA 2Y4YA 4QQDA 2CT3A 2RK2A 1W2BS 4RCCA 5ECAA 2RHUA 4DBRA 3NFCA 1VIEA 1UHFA 3OSSC 2W0ZA 4CC7A 1PCXA 1M1KC 4M75A 1JEGA 5HCKA 5IHKA 1JXOA 1G83A 1OULA 4XU1A 4ZGEB 4M7AA 1VQKA 1M3AA 5GANh 1KC8R 2VB6A 2O2OA 5KYNA 2CZ6B 3JCMX 8AT1B 4PJLA 4XTWA 2CT4A 1TH7A 3SHWA 3SWNC 2BTTA 2R58A 2DO3A 2DXUA 1K8AR 2CP5A 4DOVA 1KD1C 4ATOA 5IXFA 1X6GA 3MHXA 1S1NA 5J26A 2DNUA 4NS5A 4F04B 4X9DA 1JO8A 1IGQA 4HCCA 4OMOA 1QW1A 2DLPA 1GFCA 3IQLA 2QQSA 2E65A 2D1XA 1OQKA 2JM9A 1KIKA 1YJNT 1PSFA 3M0SA 3L2UA 4JRKA 3URGA 3C12A 3CCVT 4JZ4A 1CKBA 3AHUA 1VQLQ 3JRZA 2F5KA 1AT1B 4CC3A 3JB9H 1VQLA 2RQTA 3LWHA 2L5QA 3CEYA 4FSXA 2NUTA 2JTMA 5GAN7 1M2OA 2OAWA 1GFDA 4QT7A 2FRWA 2DX1A 3GBQA 4OB2B 2DVJA 2M0YA 4J9HA 1GCQA 2P0QA 4AFQC 4FT2A 1TWBA 2V1QA 1VIFA 3CC2A 1MMAA 2DERA 2IG0A 1EFNA 1M90R 2Y90A 3LH0A 1QVGP 2GTOA 4RTUA 3JB9G 2HQEA 3A5ZB 4N0AC 1YNZA 2AK5A 5DLQE 1S72Q 2DXTA 2ZPBB 2DYIA 1S72A 4ZTFA 3J81E 4OMQA 5CR2A 2A28A 2JW4A 1M1KU 2EYZA 4WF2A 5KYWA 4J9BA 4HVWA 5I21A 3HHTB 4J9GA 4HCBA 1M3BA 1VQ9Q 1X2KA 2E41A 2EWNA 2OTLQ 2YLCA 2FPDA 4EPCA 2ZPIB 1VQ9A 2EJGA 2OTLA 2JTFA 3CC7T 3EFRA 2QAZA 4LN2A 5GAMh 4BD3A 2K3BA 2KMTA 3OS5A 2RI5A 3EG2A 1Q82R 5KYYA 1Y07A 3EGUA 2GGRA 5I11A 3KFVA 1KD1U 4M78F 1KQ2A 1YN8A 1NJIC 3VU3C 2DIQA 2HSEB 1WXTA 2QASA 1QQJA 1EIFA 2HQHA 2RD1A 4OVAA 2W10A 3CCST 2FZKB 2HMAA 2A37A 4RUGA 4EMKA 1D3BB 2YUOA 2VXFA 3C94A 4N4HA 2XIDA 3OMGA 3DLMA 2LQ8A 1UG1A 2CUBA 1NYGA 2B86A 1H641 1I4K1 4E7JA 4M7AD 2O4XB 1UECA 1Y7XA 4M78E 1D1AA 2AT1B 4PNOA 2VYTA 1I5OB 4M78G 3VV0A 3E9FA 7AT1B 3LGLA 1N8RR 2Y4XA 4KULA 2KDSA 1WLPB 1AWWA 2PU9B 1HSQA 3EHQA 3EH2A 4A63B 2CSIA 1RUWA 1MMGA 2LDMA 2RI3A 1E6HA 2DE0X 3GNGA 1ZX6A 2K3XA 1YFNA 2D0NA 4XU2A 2BZYA 1YI2Q 2RJFA 4ZGDB 1YI2A 4XAXB 4R55A 2PZ1A 1H92A 1D1BA 3BDUA 4Y92A 4FM4B 4J5YA 3CCET 1E7OA 2XDPA 1OI1A 2LMJA 4RTTA 1WHLA 1TTHB 2CP7A 2V8IA 4FYYB 1Y71A 1PRMC 3M54A 1AHJB 3CBMA 4RCBA 2NWMA 1N9SA 4WTOB 4QW2A 2HL3A 2DBKA 2EQJA 1C0MA 2QGFB 2DZCA 2JMCA 1TOVA 2ZGWA 2LRQA 3CCRT 4M7DB 4A4FA 1VQPQ 1NJIU 4E7LA 5GJVB 2E64A 3OW2P 1VQ8A 1MNDA 4XK8E 3CPFA 2ZCFB 4O5VA 2EQMA 5DLOA 3SWNA 4JJBA 1UDLA 2CUDA 3OYLA 1H8KA 2R5MA 2SRCA 4HVUA 2LT1A 2KXCA 4A4KA 2HCKA 2HKNA 2IPOB 1M4ZA 4JS4A 2LCSA 5LL6S 2FB7A 3G4ST 5LJ5g 1ZSZC 5HY6A 3JCMV 2JXBA 2NUPA 3EFSA 2CZ1B 2EQKA 1KQ1A 4PJOF 4OGCA 3ZBDA 1QWEA 3S6WA 3ER0A 2QXFA 5LJ3f 3NGPA 4J6YA 4M75C 4QKUA 5GAMf 2QA4T 3TQ7P 3VS5A 3MP6A 3RMSA 4PJOA 3LYIA 3HRSA 1UGVA 2EBPA 3L2WA 1K9MU 3JB9J 1V76A 5LJ3e 3PMTA 1IHWA 1AD5A 2WSCE 2M9UA 1BI2A 2XKOC 4J83A 4VUBA 3VJPA 3EH1A 1ZUYA 3CCJA 4IUQA 4PJMA 1QVGA 1JJ2P 2QEXT 4HCKA 1WHJA 3M56A 2EYXA 5IH2A 3OYHA 1QKWA 1G3TA 4L5GA 1IHVA 2JVVA 1WA7A 1QLYA 3CMAQ 5GAN4 4KGZB 1YHQA 1D3BA 2KRSA 2JN0A 4ZNXA 3G7ZA 5A0GA 1IZ6A 3QWYA 3X28B 2FPEA 3ULRB 5AYFA 3LX7A 3VS7A 2P4TA 3KUFA 1WQWA 2VGMA 1UHCA 4M77D 9ATCB 3BFMA 1K0XA 4F7UA 2EIFA 1VQMT 1M1KR 1R0CB 3EG1A 4C5GA 2LC4A 4C92D 4ELYC 1ZA1B 2KNBB 2JMAA 1PC0A 1Q81C 4DBHA 3OB9A 2E6NA 1GCQC 3VS2A 2HNIA 2EYWA 3C4SA 4N4IA 5KE2A 2JZ2A 4AMCA 3CD6Q 1EZZB 3RMQA 1YCYA 1Y0MA 3CD6A 2X3WD 2ZAEA 4E7SA 4B9WA 5GAN6 1WI7A 2PVGB 3M0UA 3CMET 2NUZA 4BE2A 1KD1R 1RAGB 2EJ9A 2E6ZA 3A98A 5D6XA 1YJ9T 1OZ3A 3HTRA 1ZSGA 2XDBA 4C8QE 3PGGA 2XDDA 1V29B 3O5ZA 1B34A 4C8QG 4HCZA 2A08A 5LJ5j 4Z02A 2OX7A 2CREA 2FHDA 2P0KA 1W70A 1YIJA 4IUUA 1WJRA 3QYGB 2KR3A 1RLPC 1W1FA 4ANJA 4M7DF 1GRIA 1OU9A 1MMDA 1QCNA 4E6RA 3SB2A 2XMFA 1OU8A 1ZUKA 4M7DA 1LCKA 2QTXA 5GANj 1B3QA 1K73R 2DBMA 4BI3A 5J39A 2EKOA 4AG1C 3OYBA 2OTJQ 1YITQ 1VQKT 1V1CA 2E70A 1KHCA 4JLGA 1YITA 3HRTA 2DF6A 2J7IA 3HL8A 2O31A 1RLQC 3VUZA 4EMKC 2X9HA 1PWTA 2DXCA 4BI8B 1D0XA 3OYEA 4LE9A 3UA7A 2EFIA 1BYMA 5LJ3d 3I56Q 2VV5A 3M0QA 2V26A 3N5BB 5DY9A 1N6AA 1SF9A 3I56A 1X6OA 4QQ6A 1VQNQ 2LJ0A 2M0OA 5CIUA 3OQ5A 2DL4A 1VQNA 1WIEA 4ME7A 2L89A 4C0GA 3M0PA 3QG1A 4XTYA 3PIPA 2MIOA 1Q81U 2QDLA 3RBBB 1TUCA 3RR6A 4OMFB 2SEMA 3UT1A 4KBMB 2COZA 2A0FB 4DBQA 1X43A 1MV3A 1K76A 2DILA 2MWOA 2JT4A 4OMPA 4PJJA 2LZ6B 2LJ1A 1VQLT 1Q95G 1UGRB 2A3LA 4C5EA 3M4GA 1WNLA 3P8DA 2H3JA 1NJIR 1NEGA 3QZ9B 1KQSP 3G6EQ 2V1RA 1NPPA 1FWZA 1TG0A 4JUVA 3X25B 1FMKA 2QGGA 1J3TA 4IURA 3HP9A 1AEYA 4LDWA 3CC2T 5FWBA 1WYXA 4JRQA 3V8JA 1D0ZA 4Z89A 2LX9A 1OOTA 4MZPA 2CS7A 2FEIA 3QPHA 2RM4A 5CKBA 2E1HA 4OGEA 4CC2A 4MZMA 1VQ4Q 3NTKA 1S72T 4PK4A 1HXDA 2YUQA 1OPKA 1VQ4A 4XTVA 1NEBA 2D0QB 4F16A 1QCFA 3HSBA 4ZTJA 1Q86R 3NHNA 1QVFS 2J6KA 1JJ2A 3H41A 2CGHA 2KBTA 5CKEA 4KGVB 1VQ9T 1K9MR 2OTLT 1T3SA 3PT9A 2GFAA 2ZPFB 4C5HA 5CCAA 4CC4B 4BY6B 2PVDB 3OS0A 3P8BB 3CCQQ 5FU6B 2I2LA 4MMLA 3CCQA 1PNJA 3UA6A 4C92B 4KH0B 2FVUA 1OX9A 1FX7A 2FL7A 3EGDB 3NTIA 5HK3A 2ZPHB 4M7AE 4RG8A 1YP5A 3M4YA 3JB9F 3NPFA 4M7AG 3T9NA 1BIAA 4L59A 3RERA 1FMVA 1T0JA 3GPLA 3OBWA 4PJOC 3CCLT 1ABQA 4JZ3A 1HJDA 1RAIB 4J7IA 3GNFB 3OBYA 2KROA 2HBWA 1M1GA 1AWJA 5KYUB 3M0TA 5HK0A 4PLLA 1KFZA 1MUZA 5CO7A 3EGXA 3TREA 2GTJA 4RMOA 3C0CA 3SDZA 1M30A 2KYMA 4LD6A 4X34A 4OB3B 3FJPA 3RKYA 3QJYA 4RKUE 5I22A 2CDTA 3QDRB 1SRMA 4N4GA 1G3SA 1UUEA 1Y57A 3LW5E 3OYKA 2LQKA 2ECZA 5EC7A 5FLXE 3I55Q 4KUIA 2QI2A 4WCIA 2RQUA 3I55A 2QQAA 1NBEB 1YI2T 3M0RA 2WSFE 1MNEA 2EJFA 1HYOA 4AFZC 2DAQA 1WX6A 3V7CA 5LJ3h 2J6OA 1X75C 2GQVA 2H3EB 1B7TA 1Y96B 5M9OA 1G3WA 4IUTA 5CKDA 4RTYA 2ED0A 5GMKj 3I5SA 3CC4T 2P0PA 2ROLA 4OMLA 1QP2A 4M78A 4E47A 2DMOA 1VYUA 1ACMB 1VQ8T 2RF0A 1IGUA 3OW2S 1ARKA 1W4SA 2YT6A 1WFWA 2DJQA 4M75D 2AHJB 1BBZA 3C95A 4EMHA 1VA7A 3ZL7C 3ZEHA 3UWNA 3SFMA 1C1AA 2GCXA 1LJOA 1O9SA 4C5IA 2DVEA 1VQOT 2DL7A 5GAOm 1Z9ZA 1AOJA 2COYA 4QQGA 5CKHA 3MP8A 1I81A 5LJ5e 2DPPB 4XQ3A 1EX4A 5GMKi 4YTLA 5AT1B 1NM7A 4RTVA 2QTVA 5FU7B 2KY9A 4RG2A 3M57A 4M7DC 2L3RA 1JRIA 1JBMA 4C8QB 1UGSB 5GAN3 1Q7YC 1Q81R 4E7HA 3TSZA 4GBQA 1KQSA 2D8HA 1AZEA 1KC8C 1X01A 2VC8A 2EVRA 4MDXA 4J9EA 5IHNA 1ZLMA 2DK3A 1VOMA 2YRVA 1NE8A 2LX7A 4C92F 3GOXA 4PFPA 2L2PA 5GAOl 3H0HA 4PJNA 2CP3A 3BDLA 3FB9A 1G5VA 1M27C 3CCJT 2KQWA 4LUDA 2DIGA 3MPUB 2KE9A 1VQ7T 4JS5A 1WJSA 3MP1A 2RQWA 4D8KA 1SPKA 3CCUT 3FJ5A 1OEBA 3HFNA 3H9NA 4E7KA 4M77E 1R8OB 2RN8A 4HT9A 1YHQT 2MMPA 4HT8A 2I0NA 1SSFA 2JOYA 4M77G 2KEAA 4C92E 1FXXA 3L2QA 2XK0A 2EGAA 4PKCC 4J6XA 4C92G 2X35A 1VQPA 1NPRA 4L6V5 2KSSA 5FROA 1GBRA 2DD5A 4Q5WA 2ATCB 3RKWA 3JCMb 3O8VA 1H3HA 1YWOA 2CP2A 1UFFA 2YUPA 3G71T 4C0FA 4QVZA 1PKSA 5CQYA 1ZQ1A 2NLUA 1UGPB 1GXIE 3WXMB 2VVKA 4MMKA 1XJWB 3HFOA 2ZZDA 1M90C 4ESRA 1A0NB 3F70A 2QDYB 3JCMg 3CD6T 2DETA 1H3ZA 2K57A 1B07A 3VS0A 2PTKA 1BU1A 2DRMA 3M58A 5CKFA 4JDSA 4OMMA 3VS1A 2F5TX 3X20B 4HKEA 3CPWP 1ABOA 4BDYA 4A4GA 3MEUA 1Q7YU 5GANg 2QG9B 4FYVB 3U23A 4JJNK 2HAXA 1YIJT 4FW2A 1Y96A 4FYXB 4OB1B 2K5LA 2VASA 1RAHB 2R5AA 4ELZC 3RIRA 5IT9E 2DXBA 3LGFA 5I2MA 1U1SA 1WHHA 1W6XA 4AG2C 1XTDA 2VWFA 1G8XA 2GQIA 2DZ9A 3V7RA 5LJ5d 2LJ3A 2DTIA 3CMAA 3CCEQ 2GF7A 1D1CA 2JJ9A 2J05A 4JRPA 1YITT 4JPBW 1SG5A 3OMCA 2PUKB 2JNGA 3INZA 2O4XA 2ABLA 5KE3A 4DA4A 5KYXB 2O01E 2DL5A 3GP8A 1KSWA 2EQIA 2F2XA 3I56T 3E19A 1JB0E 4C8QF 3EAEA 2F69A 2RHIA 1I8FA 3BY7A 1WPYA 1VQNT 3QIIA 5CAIA 4M75B 5GJWB 1ZBXA 2OJ2A 3CXCP 4C8QA 2AIRB 4M7AB 2L3PA 1XQHA 1N8RC 2QQBA 4J8OA 3VS6A 3V8LA 5GMKm 1M90U 4DBFA 4FL6A 2RHYA 1VYVA 4PFZA 1K9AA 3FEOA 2HBPA 2E12A 2DL8A 4IUPA 1SEMA 1IREB 3OYFA 1U8RA 1JQQA 4P5NA 2FPFA 4F7UE 1ZBJA 5J3BA 2H8HA 3OY9A 3J7AF 1NG2A 2LNHB 2WSEE 3V7SA 1KQSS 3ZFJA 1AVZC 4C0DB 1LPLA 1OX8A 2QA4Q 5GAOq 3DB4A 2AKKA 2NYSA 2P4RA 3VUBA 4XU0A 3TSWA 5GMKl 3OYCA 1CSKA 5GAMg 3DLLA 5A0DA 1WDXA 3RKXA 3FDRA 2O9SA 1GCPA 2NUTB 8ATCB 1WHMA 1DJ7B 4MDWA 2K5IA 1BI3A 2LCLA 4CI0C 3JCMc 2OTJA 3QSUA 4M78C 2XG8D 3SD4A 2B8AA 1ZA2B 2IIMA 2X4XA 4R56A 1FYNA 4FSSA 5GMKe 4KH1B 4LD9K 1GL5A 1MGQA 3FRNA 1M8VA 2L3SA 1X2QA 4PJOD 1LVKA 5IHIA 5D6YA 2MPXC 3L42A 2K2VA 2M02A 4GLMA 2HKQB 2KI7A 2FO0A 2DKGA 2LQWA 2HQXA 1VQMQ 3A8HB 2RHZA 2L8DA 3VRYA 2ENMA 2HSPA 3HRUA 3MEWA 1BIBA 3JAME 5HKCA 1N8RU 1WXBA 2CZ7B 2RNAA 1SHFA 4E7IA 3LLRA 4KRTA 2CKKA 1I07A 5GAOr 1UE9A 3QBYA 1RADB 4RTXA 4BY6C 1VQ6Q 4RTWA 4EMGA 3G6EA 2MWPA 4UC4A 5KYYB 1VQ6A 4BE0A 2CP0A 5FU6C 4E2FB 2BE9B 4DOWA 2MOXA 1RL2A 2FZCB 1PKTA 2GNCA 2YRDA 2QQRA 3UDCA 2K2MA 3HPWA 2PNIA 3I9QA 1XOVA 1VQ5Q 4PFOA 2RPNA 2ZPEB 4X1VA 1VQ5A 4Y91A 3JCMJ 2M1HA 2OI3A 1QKXA 1UJ0A 1QVGS 1YJWQ 4EMKB 1NZ9A 3GF5A 1YJWA 3CPWA 2LQNA 2EAYA 2K79A 3JSCA 3TU4K 5LJ5h 3S3NA 2HDAA 1PD0A 3QUIA 3CCMQ 1UGQB 1M9SA 3QYHB 1MMNA 2YLBA 4M75F 3CCMA 1GBQA 3PTAA 4FIBA 2RI2A 5LJ3j 2JM8A 4M7AF 1K4US 5GAMj 3I55T 2DYBA 1MV0B 2JTEA 1FMWA 1SHGA 2K7AA 2R57A 2F2VA 1VQKQ 5L23A 1Q7YR 2PUOB 3RESA 2YXYA 2EKHA 1UB4A 5CQXA 4M77B 1TU0B 3BW1A 4D6WA 1IB8A 2KT1A 2X4YA 4Z88A 4XTXA 2WACA 3M55A 2YHTA 4M75E 2DJZA 3JCMW 5IAYA 2DTOA 2CH4W 2K6DA 4O6JA 4ZN3A 3JB9I 3QXEB 4M75G 2KRMA 2RJEA 1M1FA 2AKLA 4J9CA 1XNIA 3JCMP 1NYFA 4M7DD 2FG0A 1N27A 1SRLA 4E7ZA 2RQRA 4ORZA 2CSQA 2RB6A 3EG3A 3CXCA 3X24B 2MK5A 3L2ZA 4QVDA 6AT1B 2KAFA 2DM1A 4A4EA 4JRIA 2M16A 3OS2A 2L3QA 2V8KA 3R6NA 1R0BG 1X69A 4Z8AA 2X4WA 2PQWA 1ZHIA 3THKA 2A36A 3Q1JA 3H8ZA 4HXJA 1K73C 3DKMA 4R0KA 3OYNA 2K3YA 3CC2Q 2ED1A 3PFSA 1M2VB 3SWNB 4OMNA 4QVCA 3GLXA 2PVOB 2XI9A 5A2QE 3PVQA 2XICA 5IN1A 1W2BP 2EGEA 2V8JA 4V2SA 2XU8A 4JJDA 2MAMA 3P8HA 1JU5C 3EHRA 2F2WA 4KGXB 2RA2A 4EIKA 3S3MA 2RMOA 4LUEA 4LNPA 2NUPB 4FT4A 3A8GB 3VS3A 4XU3A 1IO6A 4FCYA 1PD1A 3LWIA 1QVFP 1VYTA 3BE3A 5FU7C 1KJWA 1RAAB 3QZ5B 2YRCA 3REBB 1P92A 1TXQA 4C8QC 4PJOB 4HVVA 1OZ2A 3QWXX 4Y28E 2P84A 3J80E 2J06A 3VYGA 4DEXA 5GAN8 1RI9A 4NL3A 1VUBA 1CKAA 1VQPT 2LNVA 1I5LA 2FYKA 1TS9A 1WGSA 1BKBA 3JV3A 2ESWA 3I35A 5D6WA 2E3HA 2XD0A 1YJNQ 2BUDA 1YWPA 1I0CA 3X26B 5FWCA 1YJNA 1BCOA 3CCVQ 5LJ5f 3JCMf 4KUDK 3CCVA 2KRNA 2C0IA 1WQ7A 5C6SA 3CCLQ 1KK7A 1N5ZA 3E1SA 1OPLA 3M53A 3CCLA 1QWFA 3H0IA 1Z9QA 2E10A 3JCMe 2LVMA 5I2SA
chains in the Genus database with same CATH topology
2DNUA 1JO8A 2DF6A 2J7IA 2O31A 1RLQC 4OMOA 2L0AA 1PWTA 2DLPA 1GFCA 3IQLA 2D1XA 2JM9A 1KIKA 4LE9A 1UTIA 3M0SA 1X6BA 2KT8A 3UA7A 2GBQA 1W6XA 4AG2C 2VWFA 4JZ4A 1SSHA 2DA9A 3M0QA 1CKBA 2GQIA 4CC3A 2LJ0A 2RQTA 2LJ3A 2DL4A 1WIEA 2OAWA 1GFDA 2J05A 4QT7A 3M0PA 2FRWA 2DX1A 4JPBW 3GBQA 2MIOA 2DVJA 2M0YA 4J9HA 1U06A 2QDLA 2ABLA 3RBBB 1TUCA 2SEMA 1GCQA 4AFQC 2V1QA 1X43A 2DL5A 1AWOA 1EFNA 1MV3A 1K76A 1KSWA 1M3CA 2DILA 2EQIA 2F2XA 2RQVA 2JT4A 4OMPA 2LZ6B 2GTOA 2LJ1A 4RTUA 2O9VA 1YNZA 2AK5A 5GJWB 1NEGA 2OJ2A 2V1RA 2L3PA 1TG0A 1T3LA 1FMKA 3VS6A 1J3TA 4OMQA 2A28A 2JW4A 3CQTA 1AEYA 2YDLA 2EYZA 5FWBA 4J9BA 4HVWA 1VYVA 1WYXA 4J9GA 1K9AA 1M3BA 2YSQA 1X2KA 2DL8A 2FPDA 2ROTA 1SEMA 4Z89A 2JS0A 2VKNA 1JQQA 1OOTA 2FPFA 3NMZC 1ZBJA 2FEIA 4F17A 2H8HA 2DRKA 4LN2A 1NG2A 4CC2A 2LNHB 1K0SA 2K3BA 1WXUA 1AVZC 2EPDA 2YUQA 2C0TA 1OPKA 1NEBA 2JS2A 3EG2A 2AKKA 3EGUA 2GGRA 1QCFA 4F16A 2CH4A 5I11A 3KFVA 3NHNA 1YN8A 2LP5A 2J6KA 2P4RA 3TSWA 5FW9A 3H41A 3UATA 2KBTA 1WXTA 1CSKA 1U5SA 2X3XD 2W10A 1WDXA 1T3SA 1UJYA 2A37A 2O9SA 4RUGA 1NLOC 1GCPA 2YUOA 3TVTA 4CC4B 3EG0A 2EW3A 1UG1A 2AZSA 2CUBA 1NYGA 2B86A 1PNJA 2IIMA 4DEYA 3UA6A 1UECA 1FYNA 1AZGB 4FSSA 1X27A 2C0OA 1YP5A 4AFUC 1GL5A 1BK2A 2L3SA 3NPFA 1X2QA 2KYBA 1T0JA 5IHIA 1HD3A 3REAB 2YUNA 1ABQA 3RNJA 1AWWA 1WLPB 2BZXA 4GLMA 4JZ3A 2EYYA 1HSQA 3EHQA 4A63B 2M51A 2CSIA 1RUWA 2FO0A 2LQWA 1HJDA 3SEMA 2MCNA 1E6HA 2DE0X 3VRYA 1ZX6A 2KROA 4IIOA 2ENMA 2HSPA 2HBWA 1AWJA 2D0NA 2BZYA 3M0TA 1WXBA 1KFZA 2RNAA 1PRLC 1MUZA 1SHFA 2PZ1A 1H92A 2GTJA 4KRTA 4Y92A 3C0CA 1I07A 1E6GA 1M30A 1UE9A 1E7OA 1PHTA 2KYMA 2HEQA 2LMJA 1T0HA 4RTTA 4RTXA 2DL3A 4RTWA 5I22A 2CDTA 2D8JA 2EGCA 1PRMC 1SRMA 2NWMA 1UUEA 1Y57A 2MOXA 1PKTA 2ECZA 2GNCA 5EC7A 1ZUUA 2FRYA 2K2MA 4WCIA 2PNIA 2DBKA 3I9QA 1XOVA 2RQUA 2JMCA 2RPNA 1S1NA 4X1VA 3M0RA 2OI3A 1QKXA 1UJ0A 5GJVB 4AFZC 3UF4A 1WX6A 2KGTA 2J6OA 2KXDA 1OV3A 2LQNA 4IIMA 2K79A 2HDAA 4JJBA 1UDLA 2CUDA 2G6FX 1H8KA 4RTYA 4J9IA 2SRCA 4HVUA 1GBQA 2ED0A 2KXCA 3I5SA 2JM8A 1K4US 2ROLA 2DYBA 2HCKA 4OMLA 1MV0B 2JTEA 4M4ZA 1I1JA 2J6FA 1SHGA 2K7AA 2LCSA 2F2VA 2DMOA 1VYUA 5L23A 2JXBA 2K9GA 2EKHA 2RF0A 4AFSC 1ARKA 2YT6A 1WFWA 1QWEA 2DJQA 1BB9A 1BBZA 3PVLA 3NGPA 1VA7A 2KT1A 5IXBA 3ZL7C 3VS5A 4Z88A 3I5RA 1UGVA 2EBPA 2CH4W 4J9DA 2K6DA 2DL7A 2KRMA 1Z9ZA 2AZVA 1AOJA 1U3OA 1K1ZA 2BZ8A 1AD5A 1YCSB 2AKLA 4J9CA 4K11A 1NYFA 1NM7A 1ZUYA 4RTVA 2FG0A 4HCKA 1SRLA 2EYXA 2RQRA 4ORZA 2CSQA 5IH2A 1QKWA 4JJCA 3TSZA 4GBQA 3EG3A 2D8HA 1AZEA 2E5KA 2EVRA 1M8MA 1NLPC 1WA7A 4J9EA 5IHNA 1QLYA 1ZLMA 2DM1A 2LX7A 3H0FA 2KRSA 2L3QA 4RTZA 3R6NA 3VS4A 2L2PA 3H0HA 1X69A 4ZNXA 4Z8AA 1M27C 3THKA 3QWYA 4D8DA 2A36A 2FPEA 3ULRB 4HXJA 4LUDA 2KE9A 4R0KA 3VS7A 2RQWA 2ED1A 1UHCA 1AWXA 3LH5A 4D8KA 4OMNA 1SPKA 1K0XA 3FJ5A 1OEBA 3EG1A 3PVQA 2RN8A 1TUDA 2EGEA 1JXMA 4J9FA 2KNBB 2JMAA 4JJDA 1JU5C 2I0NA 3EHRA 2O88A 1GCQC 2F2WA 3VS2A 2EYWA 2KEAA 4EIKA 2RMOA 4LUEA 4LNPA 2EGAA 4F14A 1Y0MA 2X3WD 3VS3A 1IO6A 1GBRA 3VRZA 1VYTA 1KJWA 1WI7A 1H3HA 3M0UA 3PE0A 1YWOA 3REBB 2NUZA 1G2BA 1UFFA 2YUPA 3A98A 2CT3A 4HVVA 1PKSA 1ZSGA 5ECAA 3QWXX 1UHFA 2W0ZA 2VVKA 2J06A 4DEXA 4CC7A 3O5ZA 4ESRA 1RI9A 2A08A 1A0NB 1JEGA 1CKAA 5HCKA 5IHKA 1JXOA 1G83A 2CREA 1W70A 1M3AA 1B07A 2O2OA 2KR3A 3VS0A 3JV3A 1RLPC 2PTKA 1W1FA 2ESWA 3I35A 1GRIA 2CT4A 1YWPA 1BU1A 1I0CA 2DRMA 4E6RA 5FWCA 2XMFA 3SHWA 2BTTA 1ZUKA 4OMMA 3VS1A 2KRNA 2C0IA 1LCKA 1ABOA 1N5ZA 1B3QA 1OPLA 2DBMA 1QWFA 3U23A 3H0IA 1Z9QA 4AG1C 5IXFA 1X6GA 1V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNU A;  1JO8 A;  2DF6 A;  2J7I A;  2O31 A;  1RLQ C;  4OMO A;  2L0A A;  1PWT A;  2DLP A;  1GFC A;  3IQL A;  2D1X A;  2JM9 A;  1KIK A;  4LE9 A;  1UTI A;  3M0S A;  1X6B A;  2KT8 A;  3UA7 A;  2GBQ A;  1W6X A;  4AG2 C;  2VWF A;  4JZ4 A;  1SSH A;  2DA9 A;  3M0Q A;  1CKB A;  2GQI A;  4CC3 A;  2LJ0 A;  2RQT A;  2LJ3 A;  2DL4 A;  1WIE A;  2OAW A;  1GFD A;  2J05 A;  4QT7 A;  3M0P A;  2FRW A;  2DX1 A;  4JPB W;  3GBQ A;  2MIO A;  2DVJ A;  2M0Y A;  4J9H A;  1U06 A;  2QDL A;  2ABL A;  3RBB B;  1TUC A;  2SEM A;  1GCQ A;  4AFQ C;  2V1Q A;  1X43 A;  2DL5 A;  1AWO A;  1EFN A;  1MV3 A;  1K76 A;  1KSW A;  1M3C A;  2DIL A;  2EQI A;  2F2X A;  2RQV A;  2JT4 A;  4OMP A;  2LZ6 B;  2GTO A;  2LJ1 A;  4RTU A;  2O9V A;  1YNZ A;  2AK5 A;  5GJW B;  1NEG A;  2OJ2 A;  2V1R A;  2L3P A;  1TG0 A;  1T3L A;  1FMK A;  3VS6 A;  1J3T A;  4OMQ A;  2A28 A;  2JW4 A;  3CQT A;  1AEY A;  2YDL A;  2EYZ A;  5FWB A;  4J9B A;  4HVW A;  1VYV A;  1WYX A;  4J9G A;  1K9A A;  1M3B A;  2YSQ A;  1X2K A;  2DL8 A;  2FPD A;  2ROT A;  1SEM A;  4Z89 A;  2JS0 A;  2VKN A;  1JQQ A;  1OOT A;  2FPF A;  3NMZ C;  1ZBJ A;  2FEI A;  4F17 A;  2H8H A;  2DRK A;  4LN2 A;  1NG2 A;  4CC2 A;  2LNH B;  1K0S A;  2K3B A;  1WXU A;  1AVZ C;  2EPD A;  2YUQ A;  2C0T A;  1OPK A;  1NEB A;  2JS2 A;  3EG2 A;  2AKK A;  3EGU A;  2GGR A;  1QCF A;  4F16 A;  2CH4 A;  5I11 A;  3KFV A;  3NHN A;  1YN8 A;  2LP5 A;  2J6K A;  2P4R A;  3TSW A;  5FW9 A;  3H41 A;  3UAT A;  2KBT A;  1WXT A;  1CSK A;  1U5S A;  2X3X D;  2W10 A;  1WDX A;  1T3S A;  1UJY A;  2A37 A;  2O9S A;  4RUG A;  1NLO C;  1GCP A;  2YUO A;  3TVT A;  4CC4 B;  3EG0 A;  2EW3 A;  1UG1 A;  2AZS A;  2CUB A;  1NYG A;  2B86 A;  1PNJ A;  2IIM A;  4DEY A;  3UA6 A;  1UEC A;  1FYN A;  1AZG B;  4FSS A;  1X27 A;  2C0O A;  1YP5 A;  4AFU C;  1GL5 A;  1BK2 A;  2L3S A;  3NPF A;  1X2Q A;  2KYB A;  1T0J A;  5IHI A;  1HD3 A;  3REA B;  2YUN A;  1ABQ A;  3RNJ A;  1AWW A;  1WLP B;  2BZX A;  4GLM A;  4JZ3 A;  2EYY A;  1HSQ A;  3EHQ A;  4A63 B;  2M51 A;  2CSI A;  1RUW A;  2FO0 A;  2LQW A;  1HJD A;  3SEM A;  2MCN A;  1E6H A;  2DE0 X;  3VRY A;  1ZX6 A;  2KRO A;  4IIO A;  2ENM A;  2HSP A;  2HBW A;  1AWJ A;  2D0N A;  2BZY A;  3M0T A;  1WXB A;  1KFZ A;  2RNA A;  1PRL C;  1MUZ A;  1SHF A;  2PZ1 A;  1H92 A;  2GTJ A;  4KRT A;  4Y92 A;  3C0C A;  1I07 A;  1E6G A;  1M30 A;  1UE9 A;  1E7O A;  1PHT A;  2KYM A;  2HEQ A;  2LMJ A;  1T0H A;  4RTT A;  4RTX A;  2DL3 A;  4RTW A;  5I22 A;  2CDT A;  2D8J A;  2EGC A;  1PRM C;  1SRM A;  2NWM A;  1UUE A;  1Y57 A;  2MOX A;  1PKT A;  2ECZ A;  2GNC A;  5EC7 A;  1ZUU A;  2FRY A;  2K2M A;  4WCI A;  2PNI A;  2DBK A;  3I9Q A;  1XOV A;  2RQU A;  2JMC A;  2RPN A;  1S1N A;  4X1V A;  3M0R A;  2OI3 A;  1QKX A;  1UJ0 A;  5GJV B;  4AFZ C;  3UF4 A;  1WX6 A;  2KGT A;  2J6O A;  2KXD A;  1OV3 A;  2LQN A;  4IIM A;  2K79 A;  2HDA A;  4JJB A;  1UDL A;  2CUD A;  2G6F X;  1H8K A;  4RTY A;  4J9I A;  2SRC A;  4HVU A;  1GBQ A;  2ED0 A;  2KXC A;  3I5S A;  2JM8 A;  1K4U S;  2ROL A;  2DYB A;  2HCK A;  4OML A;  1MV0 B;  2JTE A;  4M4Z A;  1I1J A;  2J6F A;  1SHG A;  2K7A A;  2LCS A;  2F2V A;  2DMO A;  1VYU A;  5L23 A;  2JXB A;  2K9G A;  2EKH A;  2RF0 A;  4AFS C;  1ARK A;  2YT6 A;  1WFW A;  1QWE A;  2DJQ A;  1BB9 A;  1BBZ A;  3PVL A;  3NGP A;  1VA7 A;  2KT1 A;  5IXB A;  3ZL7 C;  3VS5 A;  4Z88 A;  3I5R A;  1UGV A;  2EBP A;  2CH4 W;  4J9D A;  2K6D A;  2DL7 A;  2KRM A;  1Z9Z A;  2AZV A;  1AOJ A;  1U3O A;  1K1Z A;  2BZ8 A;  1AD5 A;  1YCS B;  2AKL A;  4J9C A;  4K11 A;  1NYF A;  1NM7 A;  1ZUY A;  4RTV A;  2FG0 A;  4HCK A;  1SRL A;  2EYX A;  2RQR A;  4ORZ A;  2CSQ A;  5IH2 A;  1QKW A;  4JJC A;  3TSZ A;  4GBQ A;  3EG3 A;  2D8H A;  1AZE A;  2E5K A;  2EVR A;  1M8M A;  1NLP C;  1WA7 A;  4J9E A;  5IHN A;  1QLY A;  1ZLM A;  2DM1 A;  2LX7 A;  3H0F A;  2KRS A;  2L3Q A;  4RTZ A;  3R6N A;  3VS4 A;  2L2P A;  3H0H A;  1X69 A;  4ZNX A;  4Z8A A;  1M27 C;  3THK A;  3QWY A;  4D8D A;  2A36 A;  2FPE A;  3ULR B;  4HXJ A;  4LUD A;  2KE9 A;  4R0K A;  3VS7 A;  2RQW A;  2ED1 A;  1UHC A;  1AWX A;  3LH5 A;  4D8K A;  4OMN A;  1SPK A;  1K0X A;  3FJ5 A;  1OEB A;  3EG1 A;  3PVQ A;  2RN8 A;  1TUD A;  2EGE A;  1JXM A;  4J9F A;  2KNB B;  2JMA A;  4JJD A;  1JU5 C;  2I0N A;  3EHR A;  2O88 A;  1GCQ C;  2F2W A;  3VS2 A;  2EYW A;  2KEA A;  4EIK A;  2RMO A;  4LUE A;  4LNP A;  2EGA A;  4F14 A;  1Y0M A;  2X3W D;  3VS3 A;  1IO6 A;  1GBR A;  3VRZ A;  1VYT A;  1KJW A;  1WI7 A;  1H3H A;  3M0U A;  3PE0 A;  1YWO A;  3REB B;  2NUZ A;  1G2B A;  1UFF A;  2YUP A;  3A98 A;  2CT3 A;  4HVV A;  1PKS A;  1ZSG A;  5ECA A;  3QWX X;  1UHF A;  2W0Z A;  2VVK A;  2J06 A;  4DEX A;  4CC7 A;  3O5Z A;  4ESR A;  1RI9 A;  2A08 A;  1A0N B;  1JEG A;  1CKA A;  5HCK A;  5IHK A;  1JXO A;  1G83 A;  2CRE A;  1W70 A;  1M3A A;  1B07 A;  2O2O A;  2KR3 A;  3VS0 A;  3JV3 A;  1RLP C;  2PTK A;  1W1F A;  2ESW A;  3I35 A;  1GRI A;  2CT4 A;  1YWP A;  1BU1 A;  1I0C A;  2DRM A;  4E6R A;  5FWC A;  2XMF A;  3SHW A;  2BTT A;  1ZUK A;  4OMM A;  3VS1 A;  2KRN A;  2C0I A;  1LCK A;  1ABO A;  1N5Z A;  1B3Q A;  1OPL A;  2DBM A;  1QWF A;  3U23 A;  3H0I A;  1Z9Q A;  4AG1 C;  5IXF A;  1X6G A;  1V1C A; 
#chains in the Genus database with same CATH topology
 5KCH A;  2K4Y A;  3VKI A;  1OYX A;  2L0A A;  3WVE B;  3FLG A;  3OYA A;  1TSF A;  2BE7 D;  3WVD B;  1M5Q 1;  5GAN f;  1U1T A;  4F7U B;  4II1 A;  4IKF A;  4ZGJ B;  1UTI A;  4NOY A;  1X6B A;  2KT8 A;  2GBQ A;  1PG5 B;  1Q86 C;  1K73 U;  4M77 F;  1SSH A;  2DA9 A;  2Z0W A;  3CPW S;  5GAN e;  2X4J A;  2DEQ A;  2LCC A;  3EG9 B;  4LDX A;  4TVR A;  1K9M C;  4M77 A;  3L2R A;  4BDZ A;  1RI0 A;  5KH6 A;  1K8A C;  3OYJ A;  1U06 A;  5GAO p;  4C92 A;  1RAB B;  1JJ2 S;  3JB9 D;  3OYI A;  4FYW B;  3EGD A;  4MZT A;  5C0M A;  1AWO A;  2RQV A;  1M3C A;  1RAC B;  2E3I A;  2VXE A;  3CC7 Q;  1KHI A;  5L8R E;  3CMA T;  1UEB A;  2O9V A;  1IRX A;  2DEU A;  1D09 B;  3L2V A;  3CC7 A;  4FW1 A;  1B34 B;  3MKD A;  1QMC A;  3CBP A;  3G1J A;  1T3L A;  2D6F A;  4XTZ A;  2VGN A;  3CQT A;  4A53 A;  2YDL A;  3A8O B;  3E2U A;  3QDF A;  3CC4 Q;  1MHN A;  3PNW C;  3DB3 A;  4BUG A;  3PIO A;  3CC4 A;  5KYU A;  1HK9 A;  4GLK A;  2YSQ A;  3CCS Q;  1F1B B;  2D9T A;  2ROT A;  3CCS A;  2JS0 A;  2VKN A;  3NMZ C;  3VYH B;  1VQ8 Q;  4F17 A;  2KK4 A;  2DRK A;  5GMK h;  3OYG A;  1K0S A;  1WXU A;  2EPD A;  3CXC S;  2C0T A;  1M2V A;  3JCM Q;  3GIB A;  1PSE A;  2JS2 A;  3UPU A;  2CH4 A;  2LP5 A;  2MI6 A;  3TEE A;  1VQO Q;  5FW9 A;  3UAT A;  2QK0 A;  2DTH A;  4OP0 A;  1VQO A;  1U5S A;  2X3X D;  4EDU A;  1WHK A;  3M5A A;  4LDV A;  1N9R A;  1UJY A;  4B6M A;  2RHX A;  1PM3 A;  1NLO C;  3TVT A;  3EG0 A;  1YBY A;  2EW3 A;  4B9X A;  1KC8 U;  1KG1 A;  2EQU A;  1Q86 U;  4M78 D;  5A0L A;  1O75 A;  2AZS A;  4BAC A;  3NTH A;  4DEY A;  2LT4 A;  4M7A C;  3TCJ A;  1AZG B;  4NL2 A;  3RDV A;  3OYY A;  4LXC A;  1WJQ A;  1R77 A;  5KCO A;  1X27 A;  5GAM e;  2C0O A;  4AFU C;  1LOJ A;  1BK2 A;  1Q82 C;  3MJX A;  3QJ6 A;  4DQ2 A;  4BE1 A;  1K8A U;  2KYB A;  2E4H A;  3QO3 A;  3CCJ Q;  2XHC A;  4HA8 A;  2MYS A;  1W2B A;  1HD3 A;  3REA B;  3JCM d;  1VQ7 Q;  4OF1 A;  2YUN A;  3RNJ A;  3RUX A;  2BZX A;  4PJO E;  2HZY A;  2X51 A;  2EYY A;  3MCA B;  1VQ7 A;  2M51 A;  2OTJ T;  3CCE A;  3ASK A;  3CCU Q;  3SEM A;  4IUV A;  4PJO G;  2QQ9 A;  3OSV A;  3E9G A;  2MCN A;  2RJD A;  3CCU A;  4C0D C;  4J7F A;  3KXT A;  4N0A A;  3MEV A;  4J6W A;  4IIO A;  3EFO B;  1YHQ Q;  1IXD A;  1QVF A;  3R6O A;  1ZSZ B;  4XTU A;  1QVP A;  4CRI A;  5GAN d;  3QKJ A;  2RO0 A;  3CCR Q;  1PRL C;  3HKS A;  1RAE B;  4F7U F;  5DM7 R;  3CCR A;  2ZPG B;  3MO8 A;  3AT1 B;  1E6G A;  3MET A;  3OS1 A;  1PHT A;  2KVQ G;  3ME9 A;  2HEQ A;  1T0H A;  2DL3 A;  2DD4 A;  3G71 Q;  2D8J A;  2EGC A;  2MF2 A;  3G71 A;  1ZUU A;  4A4H A;  2FRY A;  2BKD N;  2CP6 A;  3FIF A;  3EG9 A;  4ZN1 A;  5GAO n;  3S3O A;  3G4S Q;  1SKU B;  3G4S A;  3UF4 A;  2KGT A;  2KXD A;  1OV3 A;  4IIM A;  4BB7 A;  2IVW A;  4F7U G;  3G6E T;  4BI4 A;  1G3Y A;  1VQ6 T;  2G6F X;  1WHG A;  2QA4 A;  4J9I A;  2OAU A;  2E5Q A;  4AT1 B;  2FZG B;  3MEA A;  1QP3 A;  5LJ3 g;  4M4Z A;  1I1J A;  2J6F A;  4PLI A;  1VQ5 T;  4C0Z A;  1YIJ Q;  1YJW T;  2C06 A;  5FRM A;  2K9G A;  2HD0 A;  2JUF A;  1BCM A;  4JLI A;  4AFS C;  3A8L B;  5CVI A;  3FC3 A;  2QEX Q;  1Q82 U;  5GAN 2;  1VQ4 T;  1BI1 A;  1BB9 A;  2K5F A;  3PVL A;  4X9C A;  4KT0 E;  2QEX A;  2RJC A;  2HL5 C;  5IXB A;  3CCM T;  3I5R A;  5FRN A;  2YWW A;  4J9D A;  2CZ0 B;  4LDU A;  2AZV A;  2LTO A;  3M59 A;  1U3O A;  1K1Z A;  2BZ8 A;  1LNX A;  4PL6 A;  1YCS B;  3OYD A;  3CBO A;  4K11 A;  3EGX B;  4GY5 A;  2BIV A;  3A1P A;  3L1A A;  1C6V X;  3CCQ T;  2COW A;  4M7D E;  3V8K A;  4JJC A;  3OA6 A;  2F1L A;  1D0Y A;  3PMI A;  1VQM A;  4M7D G;  2E5K A;  5GAM d;  5CK9 A;  1M8M A;  1NLP C;  5KYW B;  4LDY A;  3H6Z A;  3OYM A;  3H0F A;  4OB0 B;  4RTZ A;  3M9Q A;  2VUB A;  3VS4 A;  1WZO A;  4D8D A;  1TUG B;  5GAN 5;  2GFU A;  2EYQ A;  3OW2 A;  1AWX A;  1RAF B;  3LH5 A;  3CME Q;  4M77 C;  3CME A;  1YJ9 Q;  3D7S B;  4FU6 A;  3A8M B;  1YJ9 A;  2G3R A;  1TUD A;  1QCO A;  1JXM A;  4J9F A;  4C92 C;  4A54 A;  2O88 A;  4M78 B;  3QHS A;  2RK1 A;  1BI0 A;  2DFU A;  3KBG A;  4F14 A;  5D7U A;  3VRZ A;  2A7Y A;  2CYZ B;  3EFO A;  3JCM h;  3PE0 A;  4C8Q D;  2RH2 A;  1G2B A;  5EG2 A;  5KYX A;  2QYZ A;  1ZSZ A;  2Y4Y A;  4QQD A;  2CT3 A;  2RK2 A;  1W2B S;  4RCC A;  5ECA A;  2RHU A;  4DBR A;  3NFC A;  1VIE A;  1UHF A;  3OSS C;  2W0Z A;  4CC7 A;  1PCX A;  1M1K C;  4M75 A;  1JEG A;  5HCK A;  5IHK A;  1JXO A;  1G83 A;  1OUL A;  4XU1 A;  4ZGE B;  4M7A A;  1VQK A;  1M3A A;  5GAN h;  1KC8 R;  2VB6 A;  2O2O A;  5KYN A;  2CZ6 B;  3JCM X;  8AT1 B;  4PJL A;  4XTW A;  2CT4 A;  1TH7 A;  3SHW A;  3SWN C;  2BTT A;  2R58 A;  2DO3 A;  2DXU A;  1K8A R;  2CP5 A;  4DOV A;  1KD1 C;  4ATO A;  5IXF A;  1X6G A;  3MHX A;  1S1N A;  5J26 A;  2DNU A;  4NS5 A;  4F04 B;  4X9D A;  1JO8 A;  1IGQ A;  4HCC A;  4OMO A;  1QW1 A;  2DLP A;  1GFC A;  3IQL A;  2QQS A;  2E65 A;  2D1X A;  1OQK A;  2JM9 A;  1KIK A;  1YJN T;  1PSF A;  3M0S A;  3L2U A;  4JRK A;  3URG A;  3C12 A;  3CCV T;  4JZ4 A;  1CKB A;  3AHU A;  1VQL Q;  3JRZ A;  2F5K A;  1AT1 B;  4CC3 A;  3JB9 H;  1VQL A;  2RQT A;  3LWH A;  2L5Q A;  3CEY A;  4FSX A;  2NUT A;  2JTM A;  5GAN 7;  1M2O A;  2OAW A;  1GFD A;  4QT7 A;  2FRW A;  2DX1 A;  3GBQ A;  4OB2 B;  2DVJ A;  2M0Y A;  4J9H A;  1GCQ A;  2P0Q A;  4AFQ C;  4FT2 A;  1TWB A;  2V1Q A;  1VIF A;  3CC2 A;  1MMA A;  2DER A;  2IG0 A;  1EFN A;  1M90 R;  2Y90 A;  3LH0 A;  1QVG P;  2GTO A;  4RTU A;  3JB9 G;  2HQE A;  3A5Z B;  4N0A C;  1YNZ A;  2AK5 A;  5DLQ E;  1S72 Q;  2DXT A;  2ZPB B;  2DYI A;  1S72 A;  4ZTF A;  3J81 E;  4OMQ A;  5CR2 A;  2A28 A;  2JW4 A;  1M1K U;  2EYZ A;  4WF2 A;  5KYW A;  4J9B A;  4HVW A;  5I21 A;  3HHT B;  4J9G A;  4HCB A;  1M3B A;  1VQ9 Q;  1X2K A;  2E41 A;  2EWN A;  2OTL Q;  2YLC A;  2FPD A;  4EPC A;  2ZPI B;  1VQ9 A;  2EJG A;  2OTL A;  2JTF A;  3CC7 T;  3EFR A;  2QAZ A;  4LN2 A;  5GAM h;  4BD3 A;  2K3B A;  2KMT A;  3OS5 A;  2RI5 A;  3EG2 A;  1Q82 R;  5KYY A;  1Y07 A;  3EGU A;  2GGR A;  5I11 A;  3KFV A;  1KD1 U;  4M78 F;  1KQ2 A;  1YN8 A;  1NJI C;  3VU3 C;  2DIQ A;  2HSE B;  1WXT A;  2QAS A;  1QQJ A;  1EIF A;  2HQH A;  2RD1 A;  4OVA A;  2W10 A;  3CCS T;  2FZK B;  2HMA A;  2A37 A;  4RUG A;  4EMK A;  1D3B B;  2YUO A;  2VXF A;  3C94 A;  4N4H A;  2XID A;  3OMG A;  3DLM A;  2LQ8 A;  1UG1 A;  2CUB A;  1NYG A;  2B86 A;  1H64 1;  1I4K 1;  4E7J A;  4M7A D;  2O4X B;  1UEC A;  1Y7X A;  4M78 E;  1D1A A;  2AT1 B;  4PNO A;  2VYT A;  1I5O B;  4M78 G;  3VV0 A;  3E9F A;  7AT1 B;  3LGL A;  1N8R R;  2Y4X A;  4KUL A;  2KDS A;  1WLP B;  1AWW A;  2PU9 B;  1HSQ A;  3EHQ A;  3EH2 A;  4A63 B;  2CSI A;  1RUW A;  1MMG A;  2LDM A;  2RI3 A;  1E6H A;  2DE0 X;  3GNG A;  1ZX6 A;  2K3X A;  1YFN A;  2D0N A;  4XU2 A;  2BZY A;  1YI2 Q;  2RJF A;  4ZGD B;  1YI2 A;  4XAX B;  4R55 A;  2PZ1 A;  1H92 A;  1D1B A;  3BDU A;  4Y92 A;  4FM4 B;  4J5Y A;  3CCE T;  1E7O A;  2XDP A;  1OI1 A;  2LMJ A;  4RTT A;  1WHL A;  1TTH B;  2CP7 A;  2V8I A;  4FYY B;  1Y71 A;  1PRM C;  3M54 A;  1AHJ B;  3CBM A;  4RCB A;  2NWM A;  1N9S A;  4WTO B;  4QW2 A;  2HL3 A;  2DBK A;  2EQJ A;  1C0M A;  2QGF B;  2DZC A;  2JMC A;  1TOV A;  2ZGW A;  2LRQ A;  3CCR T;  4M7D B;  4A4F A;  1VQP Q;  1NJI U;  4E7L A;  5GJV B;  2E64 A;  3OW2 P;  1VQ8 A;  1MND A;  4XK8 E;  3CPF A;  2ZCF B;  4O5V A;  2EQM A;  5DLO A;  3SWN A;  4JJB A;  1UDL A;  2CUD A;  3OYL A;  1H8K A;  2R5M A;  2SRC A;  4HVU A;  2LT1 A;  2KXC A;  4A4K A;  2HCK A;  2HKN A;  2IPO B;  1M4Z A;  4JS4 A;  2LCS A;  5LL6 S;  2FB7 A;  3G4S T;  5LJ5 g;  1ZSZ C;  5HY6 A;  3JCM V;  2JXB A;  2NUP A;  3EFS A;  2CZ1 B;  2EQK A;  1KQ1 A;  4PJO F;  4OGC A;  3ZBD A;  1QWE A;  3S6W A;  3ER0 A;  2QXF A;  5LJ3 f;  3NGP A;  4J6Y A;  4M75 C;  4QKU A;  5GAM f;  2QA4 T;  3TQ7 P;  3VS5 A;  3MP6 A;  3RMS A;  4PJO A;  3LYI A;  3HRS A;  1UGV A;  2EBP A;  3L2W A;  1K9M U;  3JB9 J;  1V76 A;  5LJ3 e;  3PMT A;  1IHW A;  1AD5 A;  2WSC E;  2M9U A;  1BI2 A;  2XKO C;  4J83 A;  4VUB A;  3VJP A;  3EH1 A;  1ZUY A;  3CCJ A;  4IUQ A;  4PJM A;  1QVG A;  1JJ2 P;  2QEX T;  4HCK A;  1WHJ A;  3M56 A;  2EYX A;  5IH2 A;  3OYH A;  1QKW A;  1G3T A;  4L5G A;  1IHV A;  2JVV A;  1WA7 A;  1QLY A;  3CMA Q;  5GAN 4;  4KGZ B;  1YHQ A;  1D3B A;  2KRS A;  2JN0 A;  4ZNX A;  3G7Z A;  5A0G A;  1IZ6 A;  3QWY A;  3X28 B;  2FPE A;  3ULR B;  5AYF A;  3LX7 A;  3VS7 A;  2P4T A;  3KUF A;  1WQW A;  2VGM A;  1UHC A;  4M77 D;  9ATC B;  3BFM A;  1K0X A;  4F7U A;  2EIF A;  1VQM T;  1M1K R;  1R0C B;  3EG1 A;  4C5G A;  2LC4 A;  4C92 D;  4ELY C;  1ZA1 B;  2KNB B;  2JMA A;  1PC0 A;  1Q81 C;  4DBH A;  3OB9 A;  2E6N A;  1GCQ C;  3VS2 A;  2HNI A;  2EYW A;  3C4S A;  4N4I A;  5KE2 A;  2JZ2 A;  4AMC A;  3CD6 Q;  1EZZ B;  3RMQ A;  1YCY A;  1Y0M A;  3CD6 A;  2X3W D;  2ZAE A;  4E7S A;  4B9W A;  5GAN 6;  1WI7 A;  2PVG B;  3M0U A;  3CME T;  2NUZ A;  4BE2 A;  1KD1 R;  1RAG B;  2EJ9 A;  2E6Z A;  3A98 A;  5D6X A;  1YJ9 T;  1OZ3 A;  3HTR A;  1ZSG A;  2XDB A;  4C8Q E;  3PGG A;  2XDD A;  1V29 B;  3O5Z A;  1B34 A;  4C8Q G;  4HCZ A;  2A08 A;  5LJ5 j;  4Z02 A;  2OX7 A;  2CRE A;  2FHD A;  2P0K A;  1W70 A;  1YIJ A;  4IUU A;  1WJR A;  3QYG B;  2KR3 A;  1RLP C;  1W1F A;  4ANJ A;  4M7D F;  1GRI A;  1OU9 A;  1MMD A;  1QCN A;  4E6R A;  3SB2 A;  2XMF A;  1OU8 A;  1ZUK A;  4M7D A;  1LCK A;  2QTX A;  5GAN j;  1B3Q A;  1K73 R;  2DBM A;  4BI3 A;  5J39 A;  2EKO A;  4AG1 C;  3OYB A;  2OTJ Q;  1YIT Q;  1VQK T;  1V1C A;  2E70 A;  1KHC A;  4JLG A;  1YIT A;  3HRT A;  2DF6 A;  2J7I A;  3HL8 A;  2O31 A;  1RLQ C;  3VUZ A;  4EMK C;  2X9H A;  1PWT A;  2DXC A;  4BI8 B;  1D0X A;  3OYE A;  4LE9 A;  3UA7 A;  2EFI A;  1BYM A;  5LJ3 d;  3I56 Q;  2VV5 A;  3M0Q A;  2V26 A;  3N5B B;  5DY9 A;  1N6A A;  1SF9 A;  3I56 A;  1X6O A;  4QQ6 A;  1VQN Q;  2LJ0 A;  2M0O A;  5CIU A;  3OQ5 A;  2DL4 A;  1VQN A;  1WIE A;  4ME7 A;  2L89 A;  4C0G A;  3M0P A;  3QG1 A;  4XTY A;  3PIP A;  2MIO A;  1Q81 U;  2QDL A;  3RBB B;  1TUC A;  3RR6 A;  4OMF B;  2SEM A;  3UT1 A;  4KBM B;  2COZ A;  2A0F B;  4DBQ A;  1X43 A;  1MV3 A;  1K76 A;  2DIL A;  2MWO A;  2JT4 A;  4OMP A;  4PJJ A;  2LZ6 B;  2LJ1 A;  1VQL T;  1Q95 G;  1UGR B;  2A3L A;  4C5E A;  3M4G A;  1WNL A;  3P8D A;  2H3J A;  1NJI R;  1NEG A;  3QZ9 B;  1KQS P;  3G6E Q;  2V1R A;  1NPP A;  1FWZ A;  1TG0 A;  4JUV A;  3X25 B;  1FMK A;  2QGG A;  1J3T A;  4IUR A;  3HP9 A;  1AEY A;  4LDW A;  3CC2 T;  5FWB A;  1WYX A;  4JRQ A;  3V8J A;  1D0Z A;  4Z89 A;  2LX9 A;  1OOT A;  4MZP A;  2CS7 A;  2FEI A;  3QPH A;  2RM4 A;  5CKB A;  2E1H A;  4OGE A;  4CC2 A;  4MZM A;  1VQ4 Q;  3NTK A;  1S72 T;  4PK4 A;  1HXD A;  2YUQ A;  1OPK A;  1VQ4 A;  4XTV A;  1NEB A;  2D0Q B;  4F16 A;  1QCF A;  3HSB A;  4ZTJ A;  1Q86 R;  3NHN A;  1QVF S;  2J6K A;  1JJ2 A;  3H41 A;  2CGH A;  2KBT A;  5CKE A;  4KGV B;  1VQ9 T;  1K9M R;  2OTL T;  1T3S A;  3PT9 A;  2GFA A;  2ZPF B;  4C5H A;  5CCA A;  4CC4 B;  4BY6 B;  2PVD B;  3OS0 A;  3P8B B;  3CCQ Q;  5FU6 B;  2I2L A;  4MML A;  3CCQ A;  1PNJ A;  3UA6 A;  4C92 B;  4KH0 B;  2FVU A;  1OX9 A;  1FX7 A;  2FL7 A;  3EGD B;  3NTI A;  5HK3 A;  2ZPH B;  4M7A E;  4RG8 A;  1YP5 A;  3M4Y A;  3JB9 F;  3NPF A;  4M7A G;  3T9N A;  1BIA A;  4L59 A;  3RER A;  1FMV A;  1T0J A;  3GPL A;  3OBW A;  4PJO C;  3CCL T;  1ABQ A;  4JZ3 A;  1HJD A;  1RAI B;  4J7I A;  3GNF B;  3OBY A;  2KRO A;  2HBW A;  1M1G A;  1AWJ A;  5KYU B;  3M0T A;  5HK0 A;  4PLL A;  1KFZ A;  1MUZ A;  5CO7 A;  3EGX A;  3TRE A;  2GTJ A;  4RMO A;  3C0C A;  3SDZ A;  1M30 A;  2KYM A;  4LD6 A;  4X34 A;  4OB3 B;  3FJP A;  3RKY A;  3QJY A;  4RKU E;  5I22 A;  2CDT A;  3QDR B;  1SRM A;  4N4G A;  1G3S A;  1UUE A;  1Y57 A;  3LW5 E;  3OYK A;  2LQK A;  2ECZ A;  5EC7 A;  5FLX E;  3I55 Q;  4KUI A;  2QI2 A;  4WCI A;  2RQU A;  3I55 A;  2QQA A;  1NBE B;  1YI2 T;  3M0R A;  2WSF E;  1MNE A;  2EJF A;  1HYO A;  4AFZ C;  2DAQ A;  1WX6 A;  3V7C A;  5LJ3 h;  2J6O A;  1X75 C;  2GQV A;  2H3E B;  1B7T A;  1Y96 B;  5M9O A;  1G3W A;  4IUT A;  5CKD A;  4RTY A;  2ED0 A;  5GMK j;  3I5S A;  3CC4 T;  2P0P A;  2ROL A;  4OML A;  1QP2 A;  4M78 A;  4E47 A;  2DMO A;  1VYU A;  1ACM B;  1VQ8 T;  2RF0 A;  1IGU A;  3OW2 S;  1ARK A;  1W4S A;  2YT6 A;  1WFW A;  2DJQ A;  4M75 D;  2AHJ B;  1BBZ A;  3C95 A;  4EMH A;  1VA7 A;  3ZL7 C;  3ZEH A;  3UWN A;  3SFM A;  1C1A A;  2GCX A;  1LJO A;  1O9S A;  4C5I A;  2DVE A;  1VQO T;  2DL7 A;  5GAO m;  1Z9Z A;  1AOJ A;  2COY A;  4QQG A;  5CKH A;  3MP8 A;  1I81 A;  5LJ5 e;  2DPP B;  4XQ3 A;  1EX4 A;  5GMK i;  4YTL A;  5AT1 B;  1NM7 A;  4RTV A;  2QTV A;  5FU7 B;  2KY9 A;  4RG2 A;  3M57 A;  4M7D C;  2L3R A;  1JRI A;  1JBM A;  4C8Q B;  1UGS B;  5GAN 3;  1Q7Y C;  1Q81 R;  4E7H A;  3TSZ A;  4GBQ A;  1KQS A;  2D8H A;  1AZE A;  1KC8 C;  1X01 A;  2VC8 A;  2EVR A;  4MDX A;  4J9E A;  5IHN A;  1ZLM A;  2DK3 A;  1VOM A;  2YRV A;  1NE8 A;  2LX7 A;  4C92 F;  3GOX A;  4PFP A;  2L2P A;  5GAO l;  3H0H A;  4PJN A;  2CP3 A;  3BDL A;  3FB9 A;  1G5V A;  1M27 C;  3CCJ T;  2KQW A;  4LUD A;  2DIG A;  3MPU B;  2KE9 A;  1VQ7 T;  4JS5 A;  1WJS A;  3MP1 A;  2RQW A;  4D8K A;  1SPK A;  3CCU T;  3FJ5 A;  1OEB A;  3HFN A;  3H9N A;  4E7K A;  4M77 E;  1R8O B;  2RN8 A;  4HT9 A;  1YHQ T;  2MMP A;  4HT8 A;  2I0N A;  1SSF A;  2JOY A;  4M77 G;  2KEA A;  4C92 E;  1FXX A;  3L2Q A;  2XK0 A;  2EGA A;  4PKC C;  4J6X A;  4C92 G;  2X35 A;  1VQP A;  1NPR A;  4L6V 5;  2KSS A;  5FRO A;  1GBR A;  2DD5 A;  4Q5W A;  2ATC B;  3RKW A;  3JCM b;  3O8V A;  1H3H A;  1YWO A;  2CP2 A;  1UFF A;  2YUP A;  3G71 T;  4C0F A;  4QVZ A;  1PKS A;  5CQY A;  1ZQ1 A;  2NLU A;  1UGP B;  1GXI E;  3WXM B;  2VVK A;  4MMK A;  1XJW B;  3HFO A;  2ZZD A;  1M90 C;  4ESR A;  1A0N B;  3F70 A;  2QDY B;  3JCM g;  3CD6 T;  2DET A;  1H3Z A;  2K57 A;  1B07 A;  3VS0 A;  2PTK A;  1BU1 A;  2DRM A;  3M58 A;  5CKF A;  4JDS A;  4OMM A;  3VS1 A;  2F5T X;  3X20 B;  4HKE A;  3CPW P;  1ABO A;  4BDY A;  4A4G A;  3MEU A;  1Q7Y U;  5GAN g;  2QG9 B;  4FYV B;  3U23 A;  4JJN K;  2HAX A;  1YIJ T;  4FW2 A;  1Y96 A;  4FYX B;  4OB1 B;  2K5L A;  2VAS A;  1RAH B;  2R5A A;  4ELZ C;  3RIR A;  5IT9 E;  2DXB A;  3LGF A;  5I2M A;  1U1S A;  1WHH A;  1W6X A;  4AG2 C;  1XTD A;  2VWF A;  1G8X A;  2GQI A;  2DZ9 A;  3V7R A;  5LJ5 d;  2LJ3 A;  2DTI A;  3CMA A;  3CCE Q;  2GF7 A;  1D1C A;  2JJ9 A;  2J05 A;  4JRP A;  1YIT T;  4JPB W;  1SG5 A;  3OMC A;  2PUK B;  2JNG A;  3INZ A;  2O4X A;  2ABL A;  5KE3 A;  4DA4 A;  5KYX B;  2O01 E;  2DL5 A;  3GP8 A;  1KSW A;  2EQI A;  2F2X A;  3I56 T;  3E19 A;  1JB0 E;  4C8Q F;  3EAE A;  2F69 A;  2RHI A;  1I8F A;  3BY7 A;  1WPY A;  1VQN T;  3QII A;  5CAI A;  4M75 B;  5GJW B;  1ZBX A;  2OJ2 A;  3CXC P;  4C8Q A;  2AIR B;  4M7A B;  2L3P A;  1XQH A;  1N8R C;  2QQB A;  4J8O A;  3VS6 A;  3V8L A;  5GMK m;  1M90 U;  4DBF A;  4FL6 A;  2RHY A;  1VYV A;  4PFZ A;  1K9A A;  3FEO A;  2HBP A;  2E12 A;  2DL8 A;  4IUP A;  1SEM A;  1IRE B;  3OYF A;  1U8R A;  1JQQ A;  4P5N A;  2FPF A;  4F7U E;  1ZBJ A;  5J3B A;  2H8H A;  3OY9 A;  3J7A F;  1NG2 A;  2LNH B;  2WSE E;  3V7S A;  1KQS S;  3ZFJ A;  1AVZ C;  4C0D B;  1LPL A;  1OX8 A;  2QA4 Q;  5GAO q;  3DB4 A;  2AKK A;  2NYS A;  2P4R A;  3VUB A;  4XU0 A;  3TSW A;  5GMK l;  3OYC A;  1CSK A;  5GAM g;  3DLL A;  5A0D A;  1WDX A;  3RKX A;  3FDR A;  2O9S A;  1GCP A;  2NUT B;  8ATC B;  1WHM A;  1DJ7 B;  4MDW A;  2K5I A;  1BI3 A;  2LCL A;  4CI0 C;  3JCM c;  2OTJ A;  3QSU A;  4M78 C;  2XG8 D;  3SD4 A;  2B8A A;  1ZA2 B;  2IIM A;  2X4X A;  4R56 A;  1FYN A;  4FSS A;  5GMK e;  4KH1 B;  4LD9 K;  1GL5 A;  1MGQ A;  3FRN A;  1M8V A;  2L3S A;  1X2Q A;  4PJO D;  1LVK A;  5IHI A;  5D6Y A;  2MPX C;  3L42 A;  2K2V A;  2M02 A;  4GLM A;  2HKQ B;  2KI7 A;  2FO0 A;  2DKG A;  2LQW A;  2HQX A;  1VQM Q;  3A8H B;  2RHZ A;  2L8D A;  3VRY A;  2ENM A;  2HSP A;  3HRU A;  3MEW A;  1BIB A;  3JAM E;  5HKC A;  1N8R U;  1WXB A;  2CZ7 B;  2RNA A;  1SHF A;  4E7I A;  3LLR A;  4KRT A;  2CKK A;  1I07 A;  5GAO r;  1UE9 A;  3QBY A;  1RAD B;  4RTX A;  4BY6 C;  1VQ6 Q;  4RTW A;  4EMG A;  3G6E A;  2MWP A;  4UC4 A;  5KYY B;  1VQ6 A;  4BE0 A;  2CP0 A;  5FU6 C;  4E2F B;  2BE9 B;  4DOW A;  2MOX A;  1RL2 A;  2FZC B;  1PKT A;  2GNC A;  2YRD A;  2QQR A;  3UDC A;  2K2M A;  3HPW A;  2PNI A;  3I9Q A;  1XOV A;  1VQ5 Q;  4PFO A;  2RPN A;  2ZPE B;  4X1V A;  1VQ5 A;  4Y91 A;  3JCM J;  2M1H A;  2OI3 A;  1QKX A;  1UJ0 A;  1QVG S;  1YJW Q;  4EMK B;  1NZ9 A;  3GF5 A;  1YJW A;  3CPW A;  2LQN A;  2EAY A;  2K79 A;  3JSC A;  3TU4 K;  5LJ5 h;  3S3N A;  2HDA A;  1PD0 A;  3QUI A;  3CCM Q;  1UGQ B;  1M9S A;  3QYH B;  1MMN A;  2YLB A;  4M75 F;  3CCM A;  1GBQ A;  3PTA A;  4FIB A;  2RI2 A;  5LJ3 j;  2JM8 A;  4M7A F;  1K4U S;  5GAM j;  3I55 T;  2DYB A;  1MV0 B;  2JTE A;  1FMW A;  1SHG A;  2K7A A;  2R57 A;  2F2V A;  1VQK Q;  5L23 A;  1Q7Y R;  2PUO B;  3RES A;  2YXY A;  2EKH A;  1UB4 A;  5CQX A;  4M77 B;  1TU0 B;  3BW1 A;  4D6W A;  1IB8 A;  2KT1 A;  2X4Y A;  4Z88 A;  4XTX A;  2WAC A;  3M55 A;  2YHT A;  4M75 E;  2DJZ A;  3JCM W;  5IAY A;  2DTO A;  2CH4 W;  2K6D A;  4O6J A;  4ZN3 A;  3JB9 I;  3QXE B;  4M75 G;  2KRM A;  2RJE A;  1M1F A;  2AKL A;  4J9C A;  1XNI A;  3JCM P;  1NYF A;  4M7D D;  2FG0 A;  1N27 A;  1SRL A;  4E7Z A;  2RQR A;  4ORZ A;  2CSQ A;  2RB6 A;  3EG3 A;  3CXC A;  3X24 B;  2MK5 A;  3L2Z A;  4QVD A;  6AT1 B;  2KAF A;  2DM1 A;  4A4E A;  4JRI A;  2M16 A;  3OS2 A;  2L3Q A;  2V8K A;  3R6N A;  1R0B G;  1X69 A;  4Z8A A;  2X4W A;  2PQW A;  1ZHI A;  3THK A;  2A36 A;  3Q1J A;  3H8Z A;  4HXJ A;  1K73 C;  3DKM A;  4R0K A;  3OYN A;  2K3Y A;  3CC2 Q;  2ED1 A;  3PFS A;  1M2V B;  3SWN B;  4OMN A;  4QVC A;  3GLX A;  2PVO B;  2XI9 A;  5A2Q E;  3PVQ A;  2XIC A;  5IN1 A;  1W2B P;  2EGE A;  2V8J A;  4V2S A;  2XU8 A;  4JJD A;  2MAM A;  3P8H A;  1JU5 C;  3EHR A;  2F2W A;  4KGX B;  2RA2 A;  4EIK A;  3S3M A;  2RMO A;  4LUE A;  4LNP A;  2NUP B;  4FT4 A;  3A8G B;  3VS3 A;  4XU3 A;  1IO6 A;  4FCY A;  1PD1 A;  3LWI A;  1QVF P;  1VYT A;  3BE3 A;  5FU7 C;  1KJW A;  1RAA B;  3QZ5 B;  2YRC A;  3REB B;  1P92 A;  1TXQ A;  4C8Q C;  4PJO B;  4HVV A;  1OZ2 A;  3QWX X;  4Y28 E;  2P84 A;  3J80 E;  2J06 A;  3VYG A;  4DEX A;  5GAN 8;  1RI9 A;  4NL3 A;  1VUB A;  1CKA A;  1VQP T;  2LNV A;  1I5L A;  2FYK A;  1TS9 A;  1WGS A;  1BKB A;  3JV3 A;  2ESW A;  3I35 A;  5D6W A;  2E3H A;  2XD0 A;  1YJN Q;  2BUD A;  1YWP A;  1I0C A;  3X26 B;  5FWC A;  1YJN A;  1BCO A;  3CCV Q;  5LJ5 f;  3JCM f;  4KUD K;  3CCV A;  2KRN A;  2C0I A;  1WQ7 A;  5C6S A;  3CCL Q;  1KK7 A;  1N5Z A;  3E1S A;  1OPL A;  3M53 A;  3CCL A;  1QWF A;  3H0I A;  1Z9Q A;  2E10 A;  3JCM e;  2LVM A;  5I2S A; 
#chains in the Genus database with same CATH homology
 2DNU A;  1JO8 A;  2DF6 A;  2J7I A;  2O31 A;  1RLQ C;  4OMO A;  2L0A A;  1PWT A;  2DLP A;  1GFC A;  3IQL A;  2D1X A;  2JM9 A;  1KIK A;  4LE9 A;  1UTI A;  3M0S A;  1X6B A;  2KT8 A;  3UA7 A;  2GBQ A;  1W6X A;  4AG2 C;  2VWF A;  4JZ4 A;  1SSH A;  2DA9 A;  3M0Q A;  1CKB A;  2GQI A;  4CC3 A;  2LJ0 A;  2RQT A;  2LJ3 A;  2DL4 A;  1WIE A;  2OAW A;  1GFD A;  2J05 A;  4QT7 A;  3M0P A;  2FRW A;  2DX1 A;  4JPB W;  3GBQ A;  2MIO A;  2DVJ A;  2M0Y A;  4J9H A;  1U06 A;  2QDL A;  2ABL A;  3RBB B;  1TUC A;  2SEM A;  1GCQ A;  4AFQ C;  2V1Q A;  1X43 A;  2DL5 A;  1AWO A;  1EFN A;  1MV3 A;  1K76 A;  1KSW A;  1M3C A;  2DIL A;  2EQI A;  2F2X A;  2RQV A;  2JT4 A;  4OMP A;  2LZ6 B;  2GTO A;  2LJ1 A;  4RTU A;  2O9V A;  1YNZ A;  2AK5 A;  5GJW B;  1NEG A;  2OJ2 A;  2V1R A;  2L3P A;  1TG0 A;  1T3L A;  1FMK A;  3VS6 A;  1J3T A;  4OMQ A;  2A28 A;  2JW4 A;  3CQT A;  1AEY A;  2YDL A;  2EYZ A;  5FWB A;  4J9B A;  4HVW A;  1VYV A;  1WYX A;  4J9G A;  1K9A A;  1M3B A;  2YSQ A;  1X2K A;  2DL8 A;  2FPD A;  2ROT A;  1SEM A;  4Z89 A;  2JS0 A;  2VKN A;  1JQQ A;  1OOT A;  2FPF A;  3NMZ C;  1ZBJ A;  2FEI A;  4F17 A;  2H8H A;  2DRK A;  4LN2 A;  1NG2 A;  4CC2 A;  2LNH B;  1K0S A;  2K3B A;  1WXU A;  1AVZ C;  2EPD A;  2YUQ A;  2C0T A;  1OPK A;  1NEB A;  2JS2 A;  3EG2 A;  2AKK A;  3EGU A;  2GGR A;  1QCF A;  4F16 A;  2CH4 A;  5I11 A;  3KFV A;  3NHN A;  1YN8 A;  2LP5 A;  2J6K A;  2P4R A;  3TSW A;  5FW9 A;  3H41 A;  3UAT A;  2KBT A;  1WXT A;  1CSK A;  1U5S A;  2X3X D;  2W10 A;  1WDX A;  1T3S A;  1UJY A;  2A37 A;  2O9S A;  4RUG A;  1NLO C;  1GCP A;  2YUO A;  3TVT A;  4CC4 B;  3EG0 A;  2EW3 A;  1UG1 A;  2AZS A;  2CUB A;  1NYG A;  2B86 A;  1PNJ A;  2IIM A;  4DEY A;  3UA6 A;  1UEC A;  1FYN A;  1AZG B;  4FSS A;  1X27 A;  2C0O A;  1YP5 A;  4AFU C;  1GL5 A;  1BK2 A;  2L3S A;  3NPF A;  1X2Q A;  2KYB A;  1T0J A;  5IHI A;  1HD3 A;  3REA B;  2YUN A;  1ABQ A;  3RNJ A;  1AWW A;  1WLP B;  2BZX A;  4GLM A;  4JZ3 A;  2EYY A;  1HSQ A;  3EHQ A;  4A63 B;  2M51 A;  2CSI A;  1RUW A;  2FO0 A;  2LQW A;  1HJD A;  3SEM A;  2MCN A;  1E6H A;  2DE0 X;  3VRY A;  1ZX6 A;  2KRO A;  4IIO A;  2ENM A;  2HSP A;  2HBW A;  1AWJ A;  2D0N A;  2BZY A;  3M0T A;  1WXB A;  1KFZ A;  2RNA A;  1PRL C;  1MUZ A;  1SHF A;  2PZ1 A;  1H92 A;  2GTJ A;  4KRT A;  4Y92 A;  3C0C A;  1I07 A;  1E6G A;  1M30 A;  1UE9 A;  1E7O A;  1PHT A;  2KYM A;  2HEQ A;  2LMJ A;  1T0H A;  4RTT A;  4RTX A;  2DL3 A;  4RTW A;  5I22 A;  2CDT A;  2D8J A;  2EGC A;  1PRM C;  1SRM A;  2NWM A;  1UUE A;  1Y57 A;  2MOX A;  1PKT A;  2ECZ A;  2GNC A;  5EC7 A;  1ZUU A;  2FRY A;  2K2M A;  4WCI A;  2PNI A;  2DBK A;  3I9Q A;  1XOV A;  2RQU A;  2JMC A;  2RPN A;  1S1N A;  4X1V A;  3M0R A;  2OI3 A;  1QKX A;  1UJ0 A;  5GJV B;  4AFZ C;  3UF4 A;  1WX6 A;  2KGT A;  2J6O A;  2KXD A;  1OV3 A;  2LQN A;  4IIM A;  2K79 A;  2HDA A;  4JJB A;  1UDL A;  2CUD A;  2G6F X;  1H8K A;  4RTY A;  4J9I A;  2SRC A;  4HVU A;  1GBQ A;  2ED0 A;  2KXC A;  3I5S A;  2JM8 A;  1K4U S;  2ROL A;  2DYB A;  2HCK A;  4OML A;  1MV0 B;  2JTE A;  4M4Z A;  1I1J A;  2J6F A;  1SHG A;  2K7A A;  2LCS A;  2F2V A;  2DMO A;  1VYU A;  5L23 A;  2JXB A;  2K9G A;  2EKH A;  2RF0 A;  4AFS C;  1ARK A;  2YT6 A;  1WFW A;  1QWE A;  2DJQ A;  1BB9 A;  1BBZ A;  3PVL A;  3NGP A;  1VA7 A;  2KT1 A;  5IXB A;  3ZL7 C;  3VS5 A;  4Z88 A;  3I5R A;  1UGV A;  2EBP A;  2CH4 W;  4J9D A;  2K6D A;  2DL7 A;  2KRM A;  1Z9Z A;  2AZV A;  1AOJ A;  1U3O A;  1K1Z A;  2BZ8 A;  1AD5 A;  1YCS B;  2AKL A;  4J9C A;  4K11 A;  1NYF A;  1NM7 A;  1ZUY A;  4RTV A;  2FG0 A;  4HCK A;  1SRL A;  2EYX A;  2RQR A;  4ORZ A;  2CSQ A;  5IH2 A;  1QKW A;  4JJC A;  3TSZ A;  4GBQ A;  3EG3 A;  2D8H A;  1AZE A;  2E5K A;  2EVR A;  1M8M A;  1NLP C;  1WA7 A;  4J9E A;  5IHN A;  1QLY A;  1ZLM A;  2DM1 A;  2LX7 A;  3H0F A;  2KRS A;  2L3Q A;  4RTZ A;  3R6N A;  3VS4 A;  2L2P A;  3H0H A;  1X69 A;  4ZNX A;  4Z8A A;  1M27 C;  3THK A;  3QWY A;  4D8D A;  2A36 A;  2FPE A;  3ULR B;  4HXJ A;  4LUD A;  2KE9 A;  4R0K A;  3VS7 A;  2RQW A;  2ED1 A;  1UHC A;  1AWX A;  3LH5 A;  4D8K A;  4OMN A;  1SPK A;  1K0X A;  3FJ5 A;  1OEB A;  3EG1 A;  3PVQ A;  2RN8 A;  1TUD A;  2EGE A;  1JXM A;  4J9F A;  2KNB B;  2JMA A;  4JJD A;  1JU5 C;  2I0N A;  3EHR A;  2O88 A;  1GCQ C;  2F2W A;  3VS2 A;  2EYW A;  2KEA A;  4EIK A;  2RMO A;  4LUE A;  4LNP A;  2EGA A;  4F14 A;  1Y0M A;  2X3W D;  3VS3 A;  1IO6 A;  1GBR A;  3VRZ A;  1VYT A;  1KJW A;  1WI7 A;  1H3H A;  3M0U A;  3PE0 A;  1YWO A;  3REB B;  2NUZ A;  1G2B A;  1UFF A;  2YUP A;  3A98 A;  2CT3 A;  4HVV A;  1PKS A;  1ZSG A;  5ECA A;  3QWX X;  1UHF A;  2W0Z A;  2VVK A;  2J06 A;  4DEX A;  4CC7 A;  3O5Z A;  4ESR A;  1RI9 A;  2A08 A;  1A0N B;  1JEG A;  1CKA A;  5HCK A;  5IHK A;  1JXO A;  1G83 A;  2CRE A;  1W70 A;  1M3A A;  1B07 A;  2O2O A;  2KR3 A;  3VS0 A;  3JV3 A;  1RLP C;  2PTK A;  1W1F A;  2ESW A;  3I35 A;  1GRI A;  2CT4 A;  1YWP A;  1BU1 A;  1I0C A;  2DRM A;  4E6R A;  5FWC A;  2XMF A;  3SHW A;  2BTT A;  1ZUK A;  4OMM A;  3VS1 A;  2KRN A;  2C0I A;  1LCK A;  1ABO A;  1N5Z A;  1B3Q A;  1OPL A;  2DBM A;  1QWF A;  3U23 A;  3H0I A;  1Z9Q A;  4AG1 C;  5IXF A;  1X6G A;  1V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...