2CP3A

Solution structure of the 2nd cap-gly domain in human clip-115/cyln2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
GSSGSSGLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLIP-115
publication title Solution structure of the 2nd CAP-Gly domain in human CLIP-115/CYLN2
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp3A00
1WHKA 1TXQA 2HKNA 3RDVA 1WHMA 2HL5C 2CP6A 1WHHA 2E4HA 2HQHA 2E3IA 2Z0WA 2HL3A 1LPLA 2CP2A 3E2UA 2HKQB 2COYA 1TOVA 2COZA 2CP7A 2CP5A 2CP3A 2MPXC 1IXDA 1WHJA 1WHLA 2E3HA 2QK0A 1WHGA 2M02A 2CP0A 4B6MA 2COWA 3TQ7P
chains in the Genus database with same CATH superfamily
5CKFA 3EFOA 2V8IA 5J3BA 4C8QC 4ZGDB 3PIOA 1IHWA 1NJIR 2LQWA 4ANJA 1YJ9A 3OS2A 2NUPB 3CCUA 2LTOA 3H0IA 2LNHB 2RJFA 2LQ8A 4J7FA 2Y4XA 3V7RA 4DBQA 2DTOA 3EG9A 5GAMe 2EGAA 4QVZA 2J05A 1X43A 1GCQC 4QQ6A 1QP2A 1M1FA 1TUCA 2AKKA 3EHRA 3DKMA 2F69A 3ER0A 3OYFA 2YRDA 4XTYA 4RMOA 4C0DB 2COYA 2E12A 3HPWA 1ZUKA 3JB9H 4EMGA 1PRLC 4C0ZA 1AWJA 2CZ6B 2A3LA 1ZX6A 2MK5A 2KRMA 2E3HA 3L2RA 2GNCA 4DEYA 1K73C 2ENMA 2CUBA 1WXBA 2JMAA 1NEGA 1K8AU 4YTLA 2CP2A 5IHKA 5KCOA 1VYVA 3FB9A 3SD4A 3N5BB 3THKA 1K0SA 2L3RA 3JB9J 1IXDA 4LN2A 4OMQA 5GJWB 2ZPFB 2A7YA 4KT0E 1R8OB 2DXCA 1KC8C 4J9CA 2RA2A 3CD6T 1M1GA 2DVEA 1M90U 2X3XD 4XU1A 2Y4YA 3QWYA 3HHTB 4TVRA 5C6SA 4C92E 5KCHA 1C1AA 1R0CB 4Y28E 3OW2A 5FWCA 2OTLT 2M16A 1P92A 2FHDA 1NYFA 4ATOA 1OPLA 1NYGA 2B8AA 4HVWA 3SWNA 1AZEA 4OGCA 3NGPA 3CD6Q 1JJ2P 1IB8A 3HRUA 3I9QA 3M4YA 1YFNA 1JU5C 4BE1A 2F2XA 4BI4A 2F2WA 2L3SA 2HDAA 1YHQA 2OTLQ 4FYXB 4IUPA 4XU3A 4C8QA 2KR3A 3GNGA 2DVJA 2KE9A 3H8ZA 1PWTA 1WA7A 2D6FA 4M7DC 4RG8A 3QG1A 4OB2B 5KE2A 1UDLA 2RHUA 3QWXX 1U1SA 3M0RA 2K5FA 4GLMA 2X9HA 1YITA 4BE0A 3LWHA 1D09B 2QYZA 4IIOA 3HP9A 4EMKB 1MHNA 1OOTA 5D6WA 3HL8A 3V8JA 1OULA 2LQNA 1VUBA 1NJIC 4PLIA 3OW2S 4EMHA 2FRWA 2E41A 3QDFA 4FL6A 5KYUB 3C4SA 8ATCB 4BI3A 3A8HB 1LCKA 4C92G 2DL7A 4Q5WA 4O5VA 2O31A 3OYAA 3M0QA 2YUQA 4F7UF 5FU6C 4J9DA 3EFRA 2DL4A 4PFPA 1W1FA 3H9NA 4GLKA 2WSFE 5HK3A 4II1A 3HKSA 4KUIA 4XAXB 1AEYA 3FIFA 4M77D 2B86A 4OMPA 4E2FB 4JS4A 4ZGEB 2L89A 3HSBA 2HZYA 5KYWA 1YWPA 1AZGB 1VQ9T 4JLIA 2FO0A 1N27A 5FW9A 2RD1A 4A4HA 4VUBA 4PNOA 4F7UA 4M77B 2DAQA 2KYBA 2LX9A 3QUIA 1AWXA 1BU1A 3CCET 2CP7A 2K7AA 2E64A 5ECAA 3RMQA 5DM7R 2COWA 1E7OA 2KI7A 3KXTA 2HQEA 3JCMJ 1VQ9Q 4CC7A 2E6NA 2YWWA 1BCMA 3NHNA 1QVFP 3CCEQ 4HKEA 1NM7A 5LJ3h 4ELZC 1B07A 2DYBA 5AT1B 3RNJA 5KYYB 4OMNA 2QK0A 4DQ2A 2ED1A 3H41A 1N8RR 3GOXA 5LJ5f 2QA4T 3JCMf 1G3WA 1M8MA 2HL5C 5GAOl 3VYGA 1VQNT 1WYXA 2KXDA 1YJWT 1EX4A 1XNIA 2NYSA 2LJ1A 2VVKA 3EHQA 5GAOn 1SG5A 2ED0A 3ZL7C 3I55T 2EYXA 2GTJA 1D3BB 4LDVA 2QA4Q 1X27A 1Q81U 1OEBA 4M78F 3H6ZA 2VUBA 4M75C 1TUDA 3RKXA 1VQNQ 1IHVA 1YJWQ 1PRMC 2P84A 1WXUA 4A4KA 2MWPA 4OGEA 3CC2T 1ZQ1A 3NPFA 1RUWA 4C92F 1H3HA 4QW2A 2FG0A 3G6EA 2IPOB 3I55Q 3OYYA 3L42A 2DF6A 2QDYB 4QVCA 1UHCA 1UJ0A 4M78A 1HK9A 4PJOG 5LJ5d 3JCMd 2AZVA 1K0XA 2FPFA 1S72A 2X4XA 2ZPGB 3CC2Q 4XU0A 3LH5A 2BZYA 1M3CA 1VQ7A 1GRIA 1MMAA 1UHFA 2Y90A 2KMTA 1B34A 2DXUA 3UF4A 4DOVA 1IGQA 1VIFA 1ZBJA 2BZXA 2F5KA 2FZCB 1TXQA 5GAMf 5GANf 2ABLA 5GAN2 1WPYA 2RQRA 4PFOA 4XTUA 4M7DD 3EG1A 1SKUB 2L2PA 3I56T 3EG0A 4OB3B 2L0AA 5CQYA 3FEOA 2EJ9A 2E5QA 1UGPB 2DIGA 1KK7A 2DD5A 2LT1A 3RR6A 1OZ2A 1YN8A 4AMCA 5GAN7 4M7DB 3CCLT 2DERA 3KUFA 4J9EA 1IGUA 2DZCA 4FCYA 2J7IA 1VOMA 2AZSA 5IT9E 3G7ZA 2BIVA 3BDUA 3I56Q 4LE9A 1Q86R 2OAWA 3CBPA 3CC7A 2COZA 3RKYA 3FDRA 3JSCA 3JB9G 3CCLQ 5GMKe 3OYEA 2DTIA 4A4EA 4ESRA 1KQSP 1BIBA 3CXCS 1K4US 5GAMd 5GANd 1JXMA 2GFAA 1XTDA 2XHCA 3UT1A 1ZLMA 2RMOA 1Y07A 3CCMA 1UGQB 4BUGA 3OYGA 5FU6B 2CP3A 4HVVA 4E7JA 1I81A 4HXJA 1LVKA 2K5IA 1UJYA 2LC4A 2J6OA 3C94A 4AFUC 3X25B 2DX1A 3QO3A 1N8RC 2RF0A 3E2UA 1I4K1 2JS2A 4M7AA 2ROLA 1QP3A 3EH2A 1VQPA 4RUGA 4PL6A 4IKFA 3OSVA 1GFCA 2GGRA 3CBOA 1VQ8T 4AG1C 2JUFA 1VQ6Q 5DLQE 1VQKT 2DRMA 1M2VA 5HY6A 2X4YA 2KVQG 2YUOA 2HL3A 4C8QE 3O5ZA 1BI2A 2KYMA 2KT1A 3CCJA 2EGCA 2LT4A 2BE9B 4A63B 3TSZA 3PGGA 3OS5A 3X28B 3J7AF 1VQ8Q 5IN1A 2JM9A 2NUPA 3OBWA 1RAGB 3G4ST 4LUEA 1PNJA 2P4TA 3SB2A 2QG9B 1JEGA 1YI2A 1YIJT 2O2OA 1X75C 5FRNA 1VQOT 2EFIA 2P0PA 5GAOq 1KFZA 3JRZA 4M75D 4FW1A 1PD0A 4RTUA 4Y92A 4JUVA 3G4SQ 1WJSA 1WIEA 4ZTFA 5LJ3g 1N9RA 3M57A 2O4XB 4J7IA 3UDCA 3JB9F 1GBQA 1YIJQ 4M75B 1VQOQ 1GFDA 2RI3A 3VS4A 3RMSA 3OYKA 2V1QA 1SRLA 3PE0A 1QWFA 4CC4B 3CCVA 1MMGA 1G5VA 1Q7YU 3OMGA 2LVMA 3QYGB 1SRMA 5C0MA 1RAFB 2HSPA 4IURA 1A0NB 1AVZC 3ZFJA 4F17A 3L2ZA 1PD1A 4F7UE 1TOVA 3CCQT 4DBFA 3I5SA 4C8QG 1M8VA 3ULRB 1Q82R 1Q86C 2L5QA 2QQRA 3G71T 1YJNT 2K57A 2M0OA 1PC0A 4BDYA 1NLPC 2ESWA 4M77C 1IREB 5FROA 4PJOD 4HT9A 1M27C 4N0AC 2AHJB 5CKDA 2EJGA 2QDLA 2OTJT 3FJ5A 1UUEA 3CCUT 2R58A 1M90C 2EKOA 5IH2A 1OX8A 4FT4A 2EPDA 1WI7A 2YRCA 4PJOB 3CCQQ 2JXBA 2EBPA 4RTXA 1G8XA 2CP0A 3G71Q 1YJNQ 3L2QA 4JRQA 1JXOA 1B7TA 2OTJQ 2PVOB 3CQTA 5GMKl 3ZEHA 3CCUQ 4X9CA 2OI3A 1CKAA 1Q81R 2K2VA 3V8LA 1TU0B 1I0CA 2K4YA 1JJ2A 4WCIA 2FPEA 1KQ2A 2LX7A 3R6OA 2AT1B 2XK0A 5CAIA 2QI2A 2DBMA 2PVGB 4PK4A 1LJOA 4IUQA 2CDTA 2CZ1B 4C0FA 4J9IA 4C5GA 1G3TA 1I8FA 4MDWA 3EGDB 4JJCA 3TCJA 1G3YA 5CKEA 2RHYA 1M9SA 4KGVB 4PJNA 2RJDA 4F7UG 2EJFA 2V26A 1Q86U 2DL5A 4L6V5 2K9GA 4EMKA 2LJ0A 4DA4A 2R5MA 4EIKA 4M78E 3ZBDA 2PUOB 5HK0A 3E19A 2XU8A 2JM8A 5KYUA 4JRKA 2DTHA 2D0NA 3C95A 3M0PA 5KYXB 5I2MA 2J06A 5GAOr 1KSWA 2RN8A 3MEAA 3S3NA 3P8HA 2RQVA 4OMMA 3RDVA 5GAOm 2E5KA 3VUBA 4C8QF 2NLUA 3EFOB 1ZHIA 4FSXA 2SRCA 3E9FA 1JJ2S 3CD6A 3DB4A 2RH2A 3QKJA 1UGSB 2HKQB 2YLBA 3RESA 4FYYB 2GBQA 2W10A 1ZSGA 3JCMW 2E6ZA 5D6YA 2V8JA 2VV5A 3EG9B 2OTLA 1JRIA 3CCRT 5EC7A 2DL8A 1WJQA 2EVRA 1WHKA 1VYUA 1M3AA 3S3OA 5I11A 1K9AA 2CS7A 4AT1B 2DE0X 3VS0A 2QASA 2PVDB 4FYWB 1XQHA 3QDRB 2DK3A 3JCMX 1UGVA 4C5IA 2MMPA 2K5LA 5GAN6 1GL5A 2VGMA 1XOVA 1N9SA 3CMAT 2LCCA 1I07A 2FPDA 1HSQA 1QCNA 3CCRQ 2KAFA 3HTRA 1GCQA 2F5TX 2DKGA 1Q82C 2O9VA 2XD0A 2RHXA 3OBYA 1ZA2B 1LPLA 5KYYA 4BD3A 2MF2A 1QVFA 4M78G 4OMFB 3MEWA 4OMLA 3CMAQ 3X20B 1K9MU 5D7UA 4DEXA 4J6XA 4HA8A 1WHMA 3OA6A 2DZ9A 3VKIA 4DBRA 1G3SA 1QCOA 1UG1A 2M9UA 3LX7A 1FX7A 4R56A 1JB0E 9ATCB 3GP8A 2WACA 2NUTB 3JCMb 4J6YA 1RI9A 2IVWA 3NMZC 2RJEA 3REAB 4JJNK 4E47A 2JS0A 1YP5A 1D3BA 2ATCB 3OW2P 2DD4A 2D9TA 4FT2A 4M7AE 1RLQC 1H92A 3MHXA 1Q81C 1RAAB 2KT8A 3QSUA 5LJ5h 2X3WD 1Y57A 2G6FX 2KSSA 1BI0A 1TTHB 5KH6A 2OJ2A 3X24B 5IHNA 2ZPBB 4C92C 1H3ZA 1FWZA 1FMWA 2DA9A 3L2WA 3LYIA 1W6XA 3CC4T 4RKUE 3MCAB 2EQKA 1MGQA 3VRYA 2R5AA 1VQ9A 1UGRB 5GAOp 3UATA 2E4HA 2HMAA 2DFUA 4L5GA 4XU2A 1ZSZC 2XMFA 3CCEA 1Q82U 3CCST 1Z9QA 3S3MA 3M0SA 4KUDK 4ZTJA 3RBBB 2BKDN 2D0QB 3CC4Q 3V8KA 1LOJA 1X2KA 3GPLA 1UB4A 4XTXA 1VQ4T 5KYNA 1WNLA 2FVUA 1J3TA 1OYXA 2CT4A 4LUDA 4HCBA 4J9BA 3VS2A 3CCSQ 1G2BA 1Q7YR 3PMIA 1BIAA 1H8KA 1RL2A 4LDXA 3OYNA 3BW1A 1M1KR 2YDLA 4M7DA 2FZKB 2L8DA 1T3LA 2ZCFB 1O9SA 2QA4A 4NL2A 3TEEA 5GMKi 1GBRA 1VQ4Q 1M4ZA 4ORZA 4F16A 5GAMh 5GANh 1VQNA 5CQXA 4RTTA 4CI0C 4M7AG 1YJWA 3KFVA 2LJ3A 2HEQA 2EYZA 2FYKA 1TUGB 4ZN3A 2EQJA 2MYSA 4P5NA 3X26B 4JS5A 3I55A 2X4WA 3G6ET 4JDSA 1QVGA 4HT8A 2QGFB 4JJDA 5CKBA 2MI6A 3WVDB 3M59A 1VIEA 1OV3A 1S72T 1IO6A 3CC2A 3MKDA 1W70A 4L59A 4E7IA 2XDBA 4F7UB 2YUPA 1VQ7T 4AG2C 3OSSC 1AOJA 4PJJA 3G6EQ 2GCXA 4X1VA 1TSFA 1RAEB 3VRZA 2YRVA 3CPWA 1V1CA 2DM1A 3KBGA 5A0LA 1S72Q 2DMOA 3RERA 4PJOC 2E10A 4FSSA 1Y71A 1W2BA 1YWOA 1VQ5A 4JRIA 2QQAA 2P0QA 4BY6C 2JMCA 1VQ7Q 3PMTA 5CR2A 1OU8A 1QKWA 5A0DA 4BDZA 4V2SA 1WGSA 2J6FA 3I56A 3SDZA 5DLOA 4DOWA 1VQLA 2XKOC 1QVGS 2D8JA 3WVEB 3CC7T 2DLPA 2NUZA 2KROA 2JTEA 2QEXT 3LH0A 1PM3A 4Z8AA 2DNUA 1D0YA 4EDUA 4MZPA 1ZUYA 2CP6A 2L3QA 5AYFA 2QQBA 3INZA 1X01A 3OYMA 1Y96B 1WXTA 3A8OB 4B9WA 4M7AF 3CCMT 2KXCA 3CC7Q 4M78D 4M4ZA 4XTZA 3OYCA 4OB0B 3CPWS 2QEXQ 1OZ3A 3TREA 3VV0A 3PVLA 4DBHA 1NPRA 3PVQA 2HKNA 4C0GA 2O4XA 1VQ6T 1R77A 1OX9A 1W2BS 2ZPHB 4E7KA 2M51A 4C92D 3CXCP 4M75A 3OS0A 4QT7A 1BCOA 5GMKm 1OI1A 2QTXA 2HNIA 1LNXA 2R57A 3QJ6A 3CCMQ 5CKHA 4ELYC 4C92B 3MEVA 4MMLA 1Q7YC 1WHGA 4B6MA 2J6KA 2LCLA 1KG1A 1M1KC 3EH1A 4QVDA 4JLGA 4LXCA 2A36A 3VU3C 2GQVA 4M77E 2DILA 2PTKA 1U1TA 2QTVA 1BI1A 2QQSA 1W4SA 2JVVA 5LJ5g 4C5EA 3JCMg 3CCJT 1ZSZB 1YCYA 4QQDA 2BUDA 2VASA 2MCNA 3CMEA 5IXFA 1VQ8A 1KHIA 4JJBA 2WSCE 1VQKA 1MNDA 3A8GB 1VQMT 3I5RA 2LP5A 5FWBA 3AHUA 2ZPIB 4GBQA 2PUKB 1K9MR 5LJ5j 1SSHA 1V29B 2JOYA 3JCMc 2RPNA 4A4FA 3CCJQ 4LDUA 7AT1B 1KD1U 4A54A 2BTTA 5GAN3 1IZ6A 4Z02A 1KC8R 3PIPA 2EQMA 3G4SA 1D1CA 1WDXA 3OS1A 4ZN1A 4OP0A 2DEUA 1VQMQ 1ABOA 2VGNA 3FJPA 3GIBA 2LNVA 1I1JA 3DLLA 3L2UA 2FEIA 1YIJA 3EGXB 2VKNA 1QKXA 2C0OA 5LJ5e 3TU4K 3LW5E 4MZMA 3HRSA 4J9FA 2V1RA 3NTHA 1G83A 1U8RA 1M3BA 3C12A 2CKKA 4ZNXA 1I5LA 3NTKA 4CRIA 1X6OA 1D0ZA 5LJ3j 1KJWA 1MMDA 2EQIA 1M1KU 2EAYA 3JV3A 2RQUA 3RKWA 3GLXA 3MPUB 3JCMV 2GFUA 3EGDA 2EW3A 3F70A 2LRQA 3L1AA 5M9OA 1UEBA 1FYNA 2K3BA 3LGLA 2GTOA 2FZGB 5GAMg 5GANg 3VS1A 4IUUA 3TSWA 2EQUA 3M56A 3A8MB 2WSEE 5L8RE 2L3PA 2E70A 3VYHB 1CSKA 1WHHA 1RLPC 4RTZA 3SWNC 2E3IA 5LJ3e 4LD9K 1YJ9T 2LDMA 5KYXA 1AD5A 5I2SA 5DY9A 3LLRA 4B9XA 5GAMj 3CCQA 1WZOA 5GANj 3R6NA 4LD6A 3Q1JA 4OMOA 3EFSA 1YJNA 5CK9A 1EIFA 2VB6A 4BY6B 1E6GA 1PKSA 1AHJB 2P4RA 2OTJA 2A28A 2SEMA 1YJ9Q 2D8HA 4R55A 2QAZA 1N5ZA 2K3YA 3UPUA 3QPHA 2KDSA 4D8DA 5GANe 2DXTA 5HCKA 2XG8D 2CREA 4M7DE 1FMVA 2DL3A 2RHZA 3J80E 1U06A 3O8VA 3DB3A 1I5OB 2YUNA 2XDDA 3T9NA 5J26A 1D0XA 1BYMA 4AFZC 3ASKA 1EZZB 4O6JA 1HD3A 2V8KA 1NZ9A 5CCAA 4WTOB 3QZ9B 3OYIA 4JZ4A 2AK5A 3OYBA 2OX7A 2M02A 3JB9D 5EG2A 2CGHA 2LZ6B 2YLCA 3PFSA 1PG5B 3UWNA 2JZ2A 2RI2A 1RACB 2HAXA 3MEUA 1Q95G 3D7SB 3QZ5B 1K9MC 4IIMA 2G3RA 3MJXA 1B3QA 4JRPA 2VC8A 2DBKA 2NUTA 5FRMA 3SEMA 3QJYA 1QCFA 4M77F 1ZUUA 4RTVA 5GMKh 2DXBA 3P8DA 4N4HA 3ME9A 3M9QA 2CH4W 5IXBA 1AWWA 3EAEA 2EKHA 2K79A 1ARKA 5GJVB 3OY9A 1M2OA 2O88A 3QIIA 1X2QA 1CKBA 4MDXA 4E7ZA 1YHQT 3HRTA 4E7HA 2DJZA 4KGZB 4M77A 4M7DG 2MAMA 3OYLA 1C6VX 5GAN4 4N0AA 1RAIB 4QQGA 4E6RA 2JW4A 2X4JA 2JNGA 2CH4A 4RTYA 1TG0A 1E6HA 1WHLA 4UC4A 4CC3A 3CCRA 3QBYA 1GXIE 1V76A 5CIUA 3A5ZB 1YHQQ 4IUVA 4RCCA 2H8HA 1K73U 3M55A 1YITT 2E1HA 1Z9ZA 2CSQA 2HBWA 2KBTA 2P0KA 2KNBB 2LCSA 2C0IA 3CMAA 3JCMQ 3VS5A 3P8BB 1NPPA 2RI5A 1H641 1RADB 4FW2A 4XTVA 1GCPA 1DJ7B 1BB9A 1YITQ 3OMCA 4KULA 1JBMA 4PFZA 5HKCA 2EYWA 4PLLA 4M75E 1JO8A 3M58A 1K76A 3QHSA 1KC8U 5GAN5 2EIFA 1U5SA 2JT4A 4E7SA 2ECZA 2IG0A 3OB9A 4M78C 4X34A 2C0TA 3JCMh 4JZ3A 1PKTA 1T3SA 4XTWA 4BI8B 4GY5A 2HSEB 2RQTA 3HFOA 3GNFB 3BY7A 3SWNB 4KGXB 1D1BA 1AT1B 1WHJA 2M1HA 4C8QD 1NLOC 3TQ7P 2DETA 5FU7C 3VS7A 4PJMA 2JN0A 1QW1A 2CYZB 4E7LA 4LNPA 1WLPB 4F04B 1KD1R 1QVFS 2ZPEB 4C8QB 3JCMP 2PNIA 3CC4A 4PJOE 2KGTA 1HJDA 4M7DF 2NWMA 1M5Q1 2H3EB 1KIKA 1RI0A 2KEAA 3QXEB 2GQIA 3META 3PT9A 3S6WA 3UA7A 1ACMB 4J9HA 1BK2A 5I21A 1N6AA 3OYDA 3CCSA 2ROTA 2ZZDA 1KQ1A 4PKCC 2RJCA 3MP8A 1PCXA 1C0MA 3BE3A 1NJIU 3LGFA 2DPPB 3EG3A 2AIRB 3MP6A 5CVIA 4M75G 2RM4A 1VQ4A 2H3JA 4OB1B 3C0CA 5IHIA 3L2VA 2DEQA 3E1SA 2D1XA 5J39A 4F14A 2XI9A 4KH1B 4NL3A 1M30A 1QVPA 1SHGA 2YHTA 4FU6A 4EPCA 1OU9A 4BACA 3BFMA 1WFWA 2ZAEA 4WF2A 2RNAA 3HFNA 2XDPA 2GF7A 4PJLA 4BB7A 1X6GA 1HXDA 2OAUA 1FMKA 3GF5A 2VWFA 2KRNA 3V7CA 3M53A 1SHFA 4IUTA 6AT1B 3OYHA 1NG2A 5KYWB 1KQSA 4MMKA 1Y96A 2DO3A 1MUZA 4M7AC 2JTFA 3GBQA 2XIDA 5LJ3f 1PSFA 2I2LA 2KQWA 5A2QE 4X9DA 1Y0MA 2A37A 3VS3A 2C06A 4HCZA 4J5YA 1QWEA 4NOYA 3CPFA 3SHWA 3CXCA 4BE2A 3A98A 1IRXA 4FIBA 1MMNA 1AWOA 1VQ5T 4C92A 5KE3A 3H0FA 1ZA1B 2YXYA 2QGGA 2A08A 1WJRA 4NS5A 1TH7A 4ME7A 3JAME 1RAHB 1SPKA 3PTAA 1SSFA 4OVAA 1O75A 2F1LA 1FXXA 3DLMA 4HCKA 1ZSZA 1VQLT 2AKLA 1Y7XA 5I22A 1VQ5Q 4N4IA 3SFMA 5LJ3d 3UA6A 3A8LB 1BBZA 4Y91A 2JJ9A 1K8AR 5GMKj 3CCLA 5FLXE 1KQSS 3AT1B 4FYVB 2DRKA 2MIOA 1TS9A 4C0DC 3EG2A 1R0BG 3U23A 1WQ7A 1PSEA 4M75F 2DYIA 2BE7D 8AT1B 4LDWA 4JPBW 1TWBA 1VQLQ 2RQWA 2QXFA 1QVGP 2O01E 1KD1C 4R0KA 2QEXA 1BKBA 1X69A 2MPXC 3FC3A 2PQWA 2VXEA 4XK8E 1NBEB 1M90R 1OPKA 2RK2A 1NE8A 4RTWA 2DIQA 5LL6S 3H0HA 2PU9B 3A1PA 1QLYA 1XJWB 3EGXA 3WXMB 2CUDA 4HVUA 1ZBXA 2YSQA 4M78B 1U3OA 1WQWA 3EGUA 1MV0B 1MNEA 1WX6A 2LQKA 3G1JA 1JQQA 3REBB 1VQPT 5IAYA 3VJPA 2VXFA 3CPWP 3I35A 1B34B 1VQ6A 1D1AA 1X6BA 4D6WA 2K6DA 4LDYA 2O9SA 3URGA 1W2BP 5L23A 4ZGJB 5FU7B 3FRNA 1PHTA 4PJOF 1SF9A 1KHCA 1F1BB 1S1NA 3LWIA 5D6XA 2RB6A 3NTIA 3OYJA 1K73R 2CZ7B 4HCCA 2CP5A 1VQPQ 3CMET 2I0NA 3MP1A 5GAN8 4C5HA 4KRTA 1QQJA 4J9GA 1NEBA 2EYQA 3RUXA 1K1ZA 4QKUA 2VYTA 2KY9A 1T0JA 4OF1A 4K11A 2Z0WA 3JB9I 4XQ3A 1SEMA 1T0HA 2ZGWA 1YI2T 4PJOA 4FM4B 2YT6A 3V7SA 2FRYA 3CBMA 3CMEQ 2A0FB 3M4GA 4AFQC 2XICA 3CEYA 2MOXA 2HCKA 1ABQA 3OQ5A 4J8OA 1VQKQ 1VQMA 2CZ0B 2RO0A 2W0ZA 4RCBA 1BI3A 3VS6A 2QQ9A 2EGEA 4Z88A 3M54A 2X35A 4KBMB 1MV3A 1OQKA 1YI2Q 1VQOA 2HQXA 3QYHB 3JCMe 3IQLA 4N4GA 2FB7A 2KK4A 1HYOA 2DJQA 1YNZA 2K3XA 4EMKC 2RHIA 1UECA 3CCVT 3FLGA 2E65A 1YBYA 4J6WA 3M0TA 3MO8A 1QMCA 2BZ8A 2HQHA 3BDLA 4M7AD 2HBPA 2EYYA 2IIMA 3RIRA 3M5AA 4D8KA 1RABB 1N8RU 2M0YA 5CO7A 2F2VA 1UFFA 3PNWC 1VYTA 4KH0B 5A0GA 4CC2A 3E9GA 4M77G 2HD0A 4M7AB 4RG2A 1UE9A 4A53A 2CSIA 1YCSB 3CCVQ 2RK1A 3TVTA 3M0UA 1EFNA 4A4GA 2EWNA 3NFCA 1K8AC 4AFSC 4Z89A 2MWOA 1M2VB 4J83A 2FL7A 2KRSA 3J81E 4MZTA 2K2MA 2X51A 1VA7A 2LMJA 2JTMA 3G71A 2PZ1A 3VUZA 2CT3A 1UTIA
chains in the Genus database with same CATH topology
1WHKA 1TXQA 2HKNA 3RDVA 1WHMA 2HL5C 2CP6A 1WHHA 2E4HA 2HQHA 2E3IA 2Z0WA 2HL3A 1LPLA 2CP2A 3E2UA 2HKQB 2COYA 1TOVA 2COZA 2CP7A 2CP5A 2CP3A 2MPXC 1IXDA 1WHJA 1WHLA 2E3HA 2QK0A 1WHGA 2M02A 2CP0A 4B6MA 2COWA 3TQ7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHK A;  1TXQ A;  2HKN A;  3RDV A;  1WHM A;  2HL5 C;  2CP6 A;  1WHH A;  2E4H A;  2HQH A;  2E3I A;  2Z0W A;  2HL3 A;  1LPL A;  2CP2 A;  3E2U A;  2HKQ B;  2COY A;  1TOV A;  2COZ A;  2CP7 A;  2CP5 A;  2CP3 A;  2MPX C;  1IXD A;  1WHJ A;  1WHL A;  2E3H A;  2QK0 A;  1WHG A;  2M02 A;  2CP0 A;  4B6M A;  2COW A;  3TQ7 P; 
#chains in the Genus database with same CATH topology
 5CKF A;  3EFO A;  2V8I A;  5J3B A;  4C8Q C;  4ZGD B;  3PIO A;  1IHW A;  1NJI R;  2LQW A;  4ANJ A;  1YJ9 A;  3OS2 A;  2NUP B;  3CCU A;  2LTO A;  3H0I A;  2LNH B;  2RJF A;  2LQ8 A;  4J7F A;  2Y4X A;  3V7R A;  4DBQ A;  2DTO A;  3EG9 A;  5GAM e;  2EGA A;  4QVZ A;  2J05 A;  1X43 A;  1GCQ C;  4QQ6 A;  1QP2 A;  1M1F A;  1TUC A;  2AKK A;  3EHR A;  3DKM A;  2F69 A;  3ER0 A;  3OYF A;  2YRD A;  4XTY A;  4RMO A;  4C0D B;  2COY A;  2E12 A;  3HPW A;  1ZUK A;  3JB9 H;  4EMG A;  1PRL C;  4C0Z A;  1AWJ A;  2CZ6 B;  2A3L A;  1ZX6 A;  2MK5 A;  2KRM A;  2E3H A;  3L2R A;  2GNC A;  4DEY A;  1K73 C;  2ENM A;  2CUB A;  1WXB A;  2JMA A;  1NEG A;  1K8A U;  4YTL A;  2CP2 A;  5IHK A;  5KCO A;  1VYV A;  3FB9 A;  3SD4 A;  3N5B B;  3THK A;  1K0S A;  2L3R A;  3JB9 J;  1IXD A;  4LN2 A;  4OMQ A;  5GJW B;  2ZPF B;  2A7Y A;  4KT0 E;  1R8O B;  2DXC A;  1KC8 C;  4J9C A;  2RA2 A;  3CD6 T;  1M1G A;  2DVE A;  1M90 U;  2X3X D;  4XU1 A;  2Y4Y A;  3QWY A;  3HHT B;  4TVR A;  5C6S A;  4C92 E;  5KCH A;  1C1A A;  1R0C B;  4Y28 E;  3OW2 A;  5FWC A;  2OTL T;  2M16 A;  1P92 A;  2FHD A;  1NYF A;  4ATO A;  1OPL A;  1NYG A;  2B8A A;  4HVW A;  3SWN A;  1AZE A;  4OGC A;  3NGP A;  3CD6 Q;  1JJ2 P;  1IB8 A;  3HRU A;  3I9Q A;  3M4Y A;  1YFN A;  1JU5 C;  4BE1 A;  2F2X A;  4BI4 A;  2F2W A;  2L3S A;  2HDA A;  1YHQ A;  2OTL Q;  4FYX B;  4IUP A;  4XU3 A;  4C8Q A;  2KR3 A;  3GNG A;  2DVJ A;  2KE9 A;  3H8Z A;  1PWT A;  1WA7 A;  2D6F A;  4M7D C;  4RG8 A;  3QG1 A;  4OB2 B;  5KE2 A;  1UDL A;  2RHU A;  3QWX X;  1U1S A;  3M0R A;  2K5F A;  4GLM A;  2X9H A;  1YIT A;  4BE0 A;  3LWH A;  1D09 B;  2QYZ A;  4IIO A;  3HP9 A;  4EMK B;  1MHN A;  1OOT A;  5D6W A;  3HL8 A;  3V8J A;  1OUL A;  2LQN A;  1VUB A;  1NJI C;  4PLI A;  3OW2 S;  4EMH A;  2FRW A;  2E41 A;  3QDF A;  4FL6 A;  5KYU B;  3C4S A;  8ATC B;  4BI3 A;  3A8H B;  1LCK A;  4C92 G;  2DL7 A;  4Q5W A;  4O5V A;  2O31 A;  3OYA A;  3M0Q A;  2YUQ A;  4F7U F;  5FU6 C;  4J9D A;  3EFR A;  2DL4 A;  4PFP A;  1W1F A;  3H9N A;  4GLK A;  2WSF E;  5HK3 A;  4II1 A;  3HKS A;  4KUI A;  4XAX B;  1AEY A;  3FIF A;  4M77 D;  2B86 A;  4OMP A;  4E2F B;  4JS4 A;  4ZGE B;  2L89 A;  3HSB A;  2HZY A;  5KYW A;  1YWP A;  1AZG B;  1VQ9 T;  4JLI A;  2FO0 A;  1N27 A;  5FW9 A;  2RD1 A;  4A4H A;  4VUB A;  4PNO A;  4F7U A;  4M77 B;  2DAQ A;  2KYB A;  2LX9 A;  3QUI A;  1AWX A;  1BU1 A;  3CCE T;  2CP7 A;  2K7A A;  2E64 A;  5ECA A;  3RMQ A;  5DM7 R;  2COW A;  1E7O A;  2KI7 A;  3KXT A;  2HQE A;  3JCM J;  1VQ9 Q;  4CC7 A;  2E6N A;  2YWW A;  1BCM A;  3NHN A;  1QVF P;  3CCE Q;  4HKE A;  1NM7 A;  5LJ3 h;  4ELZ C;  1B07 A;  2DYB A;  5AT1 B;  3RNJ A;  5KYY B;  4OMN A;  2QK0 A;  4DQ2 A;  2ED1 A;  3H41 A;  1N8R R;  3GOX A;  5LJ5 f;  2QA4 T;  3JCM f;  1G3W A;  1M8M A;  2HL5 C;  5GAO l;  3VYG A;  1VQN T;  1WYX A;  2KXD A;  1YJW T;  1EX4 A;  1XNI A;  2NYS A;  2LJ1 A;  2VVK A;  3EHQ A;  5GAO n;  1SG5 A;  2ED0 A;  3ZL7 C;  3I55 T;  2EYX A;  2GTJ A;  1D3B B;  4LDV A;  2QA4 Q;  1X27 A;  1Q81 U;  1OEB A;  4M78 F;  3H6Z A;  2VUB A;  4M75 C;  1TUD A;  3RKX A;  1VQN Q;  1IHV A;  1YJW Q;  1PRM C;  2P84 A;  1WXU A;  4A4K A;  2MWP A;  4OGE A;  3CC2 T;  1ZQ1 A;  3NPF A;  1RUW A;  4C92 F;  1H3H A;  4QW2 A;  2FG0 A;  3G6E A;  2IPO B;  3I55 Q;  3OYY A;  3L42 A;  2DF6 A;  2QDY B;  4QVC A;  1UHC A;  1UJ0 A;  4M78 A;  1HK9 A;  4PJO G;  5LJ5 d;  3JCM d;  2AZV A;  1K0X A;  2FPF A;  1S72 A;  2X4X A;  2ZPG B;  3CC2 Q;  4XU0 A;  3LH5 A;  2BZY A;  1M3C A;  1VQ7 A;  1GRI A;  1MMA A;  1UHF A;  2Y90 A;  2KMT A;  1B34 A;  2DXU A;  3UF4 A;  4DOV A;  1IGQ A;  1VIF A;  1ZBJ A;  2BZX A;  2F5K A;  2FZC B;  1TXQ A;  5GAM f;  5GAN f;  2ABL A;  5GAN 2;  1WPY A;  2RQR A;  4PFO A;  4XTU A;  4M7D D;  3EG1 A;  1SKU B;  2L2P A;  3I56 T;  3EG0 A;  4OB3 B;  2L0A A;  5CQY A;  3FEO A;  2EJ9 A;  2E5Q A;  1UGP B;  2DIG A;  1KK7 A;  2DD5 A;  2LT1 A;  3RR6 A;  1OZ2 A;  1YN8 A;  4AMC A;  5GAN 7;  4M7D B;  3CCL T;  2DER A;  3KUF A;  4J9E A;  1IGU A;  2DZC A;  4FCY A;  2J7I A;  1VOM A;  2AZS A;  5IT9 E;  3G7Z A;  2BIV A;  3BDU A;  3I56 Q;  4LE9 A;  1Q86 R;  2OAW A;  3CBP A;  3CC7 A;  2COZ A;  3RKY A;  3FDR A;  3JSC A;  3JB9 G;  3CCL Q;  5GMK e;  3OYE A;  2DTI A;  4A4E A;  4ESR A;  1KQS P;  1BIB A;  3CXC S;  1K4U S;  5GAM d;  5GAN d;  1JXM A;  2GFA A;  1XTD A;  2XHC A;  3UT1 A;  1ZLM A;  2RMO A;  1Y07 A;  3CCM A;  1UGQ B;  4BUG A;  3OYG A;  5FU6 B;  2CP3 A;  4HVV A;  4E7J A;  1I81 A;  4HXJ A;  1LVK A;  2K5I A;  1UJY A;  2LC4 A;  2J6O A;  3C94 A;  4AFU C;  3X25 B;  2DX1 A;  3QO3 A;  1N8R C;  2RF0 A;  3E2U A;  1I4K 1;  2JS2 A;  4M7A A;  2ROL A;  1QP3 A;  3EH2 A;  1VQP A;  4RUG A;  4PL6 A;  4IKF A;  3OSV A;  1GFC A;  2GGR A;  3CBO A;  1VQ8 T;  4AG1 C;  2JUF A;  1VQ6 Q;  5DLQ E;  1VQK T;  2DRM A;  1M2V A;  5HY6 A;  2X4Y A;  2KVQ G;  2YUO A;  2HL3 A;  4C8Q E;  3O5Z A;  1BI2 A;  2KYM A;  2KT1 A;  3CCJ A;  2EGC A;  2LT4 A;  2BE9 B;  4A63 B;  3TSZ A;  3PGG A;  3OS5 A;  3X28 B;  3J7A F;  1VQ8 Q;  5IN1 A;  2JM9 A;  2NUP A;  3OBW A;  1RAG B;  3G4S T;  4LUE A;  1PNJ A;  2P4T A;  3SB2 A;  2QG9 B;  1JEG A;  1YI2 A;  1YIJ T;  2O2O A;  1X75 C;  5FRN A;  1VQO T;  2EFI A;  2P0P A;  5GAO q;  1KFZ A;  3JRZ A;  4M75 D;  4FW1 A;  1PD0 A;  4RTU A;  4Y92 A;  4JUV A;  3G4S Q;  1WJS A;  1WIE A;  4ZTF A;  5LJ3 g;  1N9R A;  3M57 A;  2O4X B;  4J7I A;  3UDC A;  3JB9 F;  1GBQ A;  1YIJ Q;  4M75 B;  1VQO Q;  1GFD A;  2RI3 A;  3VS4 A;  3RMS A;  3OYK A;  2V1Q A;  1SRL A;  3PE0 A;  1QWF A;  4CC4 B;  3CCV A;  1MMG A;  1G5V A;  1Q7Y U;  3OMG A;  2LVM A;  3QYG B;  1SRM A;  5C0M A;  1RAF B;  2HSP A;  4IUR A;  1A0N B;  1AVZ C;  3ZFJ A;  4F17 A;  3L2Z A;  1PD1 A;  4F7U E;  1TOV A;  3CCQ T;  4DBF A;  3I5S A;  4C8Q G;  1M8V A;  3ULR B;  1Q82 R;  1Q86 C;  2L5Q A;  2QQR A;  3G71 T;  1YJN T;  2K57 A;  2M0O A;  1PC0 A;  4BDY A;  1NLP C;  2ESW A;  4M77 C;  1IRE B;  5FRO A;  4PJO D;  4HT9 A;  1M27 C;  4N0A C;  2AHJ B;  5CKD A;  2EJG A;  2QDL A;  2OTJ T;  3FJ5 A;  1UUE A;  3CCU T;  2R58 A;  1M90 C;  2EKO A;  5IH2 A;  1OX8 A;  4FT4 A;  2EPD A;  1WI7 A;  2YRC A;  4PJO B;  3CCQ Q;  2JXB A;  2EBP A;  4RTX A;  1G8X A;  2CP0 A;  3G71 Q;  1YJN Q;  3L2Q A;  4JRQ A;  1JXO A;  1B7T A;  2OTJ Q;  2PVO B;  3CQT A;  5GMK l;  3ZEH A;  3CCU Q;  4X9C A;  2OI3 A;  1CKA A;  1Q81 R;  2K2V A;  3V8L A;  1TU0 B;  1I0C A;  2K4Y A;  1JJ2 A;  4WCI A;  2FPE A;  1KQ2 A;  2LX7 A;  3R6O A;  2AT1 B;  2XK0 A;  5CAI A;  2QI2 A;  2DBM A;  2PVG B;  4PK4 A;  1LJO A;  4IUQ A;  2CDT A;  2CZ1 B;  4C0F A;  4J9I A;  4C5G A;  1G3T A;  1I8F A;  4MDW A;  3EGD B;  4JJC A;  3TCJ A;  1G3Y A;  5CKE A;  2RHY A;  1M9S A;  4KGV B;  4PJN A;  2RJD A;  4F7U G;  2EJF A;  2V26 A;  1Q86 U;  2DL5 A;  4L6V 5;  2K9G A;  4EMK A;  2LJ0 A;  4DA4 A;  2R5M A;  4EIK A;  4M78 E;  3ZBD A;  2PUO B;  5HK0 A;  3E19 A;  2XU8 A;  2JM8 A;  5KYU A;  4JRK A;  2DTH A;  2D0N A;  3C95 A;  3M0P A;  5KYX B;  5I2M A;  2J06 A;  5GAO r;  1KSW A;  2RN8 A;  3MEA A;  3S3N A;  3P8H A;  2RQV A;  4OMM A;  3RDV A;  5GAO m;  2E5K A;  3VUB A;  4C8Q F;  2NLU A;  3EFO B;  1ZHI A;  4FSX A;  2SRC A;  3E9F A;  1JJ2 S;  3CD6 A;  3DB4 A;  2RH2 A;  3QKJ A;  1UGS B;  2HKQ B;  2YLB A;  3RES A;  4FYY B;  2GBQ A;  2W10 A;  1ZSG A;  3JCM W;  2E6Z A;  5D6Y A;  2V8J A;  2VV5 A;  3EG9 B;  2OTL A;  1JRI A;  3CCR T;  5EC7 A;  2DL8 A;  1WJQ A;  2EVR A;  1WHK A;  1VYU A;  1M3A A;  3S3O A;  5I11 A;  1K9A A;  2CS7 A;  4AT1 B;  2DE0 X;  3VS0 A;  2QAS A;  2PVD B;  4FYW B;  1XQH A;  3QDR B;  2DK3 A;  3JCM X;  1UGV A;  4C5I A;  2MMP A;  2K5L A;  5GAN 6;  1GL5 A;  2VGM A;  1XOV A;  1N9S A;  3CMA T;  2LCC A;  1I07 A;  2FPD A;  1HSQ A;  1QCN A;  3CCR Q;  2KAF A;  3HTR A;  1GCQ A;  2F5T X;  2DKG A;  1Q82 C;  2O9V A;  2XD0 A;  2RHX A;  3OBY A;  1ZA2 B;  1LPL A;  5KYY A;  4BD3 A;  2MF2 A;  1QVF A;  4M78 G;  4OMF B;  3MEW A;  4OML A;  3CMA Q;  3X20 B;  1K9M U;  5D7U A;  4DEX A;  4J6X A;  4HA8 A;  1WHM A;  3OA6 A;  2DZ9 A;  3VKI A;  4DBR A;  1G3S A;  1QCO A;  1UG1 A;  2M9U A;  3LX7 A;  1FX7 A;  4R56 A;  1JB0 E;  9ATC B;  3GP8 A;  2WAC A;  2NUT B;  3JCM b;  4J6Y A;  1RI9 A;  2IVW A;  3NMZ C;  2RJE A;  3REA B;  4JJN K;  4E47 A;  2JS0 A;  1YP5 A;  1D3B A;  2ATC B;  3OW2 P;  2DD4 A;  2D9T A;  4FT2 A;  4M7A E;  1RLQ C;  1H92 A;  3MHX A;  1Q81 C;  1RAA B;  2KT8 A;  3QSU A;  5LJ5 h;  2X3W D;  1Y57 A;  2G6F X;  2KSS A;  1BI0 A;  1TTH B;  5KH6 A;  2OJ2 A;  3X24 B;  5IHN A;  2ZPB B;  4C92 C;  1H3Z A;  1FWZ A;  1FMW A;  2DA9 A;  3L2W A;  3LYI A;  1W6X A;  3CC4 T;  4RKU E;  3MCA B;  2EQK A;  1MGQ A;  3VRY A;  2R5A A;  1VQ9 A;  1UGR B;  5GAO p;  3UAT A;  2E4H A;  2HMA A;  2DFU A;  4L5G A;  4XU2 A;  1ZSZ C;  2XMF A;  3CCE A;  1Q82 U;  3CCS T;  1Z9Q A;  3S3M A;  3M0S A;  4KUD K;  4ZTJ A;  3RBB B;  2BKD N;  2D0Q B;  3CC4 Q;  3V8K A;  1LOJ A;  1X2K A;  3GPL A;  1UB4 A;  4XTX A;  1VQ4 T;  5KYN A;  1WNL A;  2FVU A;  1J3T A;  1OYX A;  2CT4 A;  4LUD A;  4HCB A;  4J9B A;  3VS2 A;  3CCS Q;  1G2B A;  1Q7Y R;  3PMI A;  1BIA A;  1H8K A;  1RL2 A;  4LDX A;  3OYN A;  3BW1 A;  1M1K R;  2YDL A;  4M7D A;  2FZK B;  2L8D A;  1T3L A;  2ZCF B;  1O9S A;  2QA4 A;  4NL2 A;  3TEE A;  5GMK i;  1GBR A;  1VQ4 Q;  1M4Z A;  4ORZ A;  4F16 A;  5GAM h;  5GAN h;  1VQN A;  5CQX A;  4RTT A;  4CI0 C;  4M7A G;  1YJW A;  3KFV A;  2LJ3 A;  2HEQ A;  2EYZ A;  2FYK A;  1TUG B;  4ZN3 A;  2EQJ A;  2MYS A;  4P5N A;  3X26 B;  4JS5 A;  3I55 A;  2X4W A;  3G6E T;  4JDS A;  1QVG A;  4HT8 A;  2QGF B;  4JJD A;  5CKB A;  2MI6 A;  3WVD B;  3M59 A;  1VIE A;  1OV3 A;  1S72 T;  1IO6 A;  3CC2 A;  3MKD A;  1W70 A;  4L59 A;  4E7I A;  2XDB A;  4F7U B;  2YUP A;  1VQ7 T;  4AG2 C;  3OSS C;  1AOJ A;  4PJJ A;  3G6E Q;  2GCX A;  4X1V A;  1TSF A;  1RAE B;  3VRZ A;  2YRV A;  3CPW A;  1V1C A;  2DM1 A;  3KBG A;  5A0L A;  1S72 Q;  2DMO A;  3RER A;  4PJO C;  2E10 A;  4FSS A;  1Y71 A;  1W2B A;  1YWO A;  1VQ5 A;  4JRI A;  2QQA A;  2P0Q A;  4BY6 C;  2JMC A;  1VQ7 Q;  3PMT A;  5CR2 A;  1OU8 A;  1QKW A;  5A0D A;  4BDZ A;  4V2S A;  1WGS A;  2J6F A;  3I56 A;  3SDZ A;  5DLO A;  4DOW A;  1VQL A;  2XKO C;  1QVG S;  2D8J A;  3WVE B;  3CC7 T;  2DLP A;  2NUZ A;  2KRO A;  2JTE A;  2QEX T;  3LH0 A;  1PM3 A;  4Z8A A;  2DNU A;  1D0Y A;  4EDU A;  4MZP A;  1ZUY A;  2CP6 A;  2L3Q A;  5AYF A;  2QQB A;  3INZ A;  1X01 A;  3OYM A;  1Y96 B;  1WXT A;  3A8O B;  4B9W A;  4M7A F;  3CCM T;  2KXC A;  3CC7 Q;  4M78 D;  4M4Z A;  4XTZ A;  3OYC A;  4OB0 B;  3CPW S;  2QEX Q;  1OZ3 A;  3TRE A;  3VV0 A;  3PVL A;  4DBH A;  1NPR A;  3PVQ A;  2HKN A;  4C0G A;  2O4X A;  1VQ6 T;  1R77 A;  1OX9 A;  1W2B S;  2ZPH B;  4E7K A;  2M51 A;  4C92 D;  3CXC P;  4M75 A;  3OS0 A;  4QT7 A;  1BCO A;  5GMK m;  1OI1 A;  2QTX A;  2HNI A;  1LNX A;  2R57 A;  3QJ6 A;  3CCM Q;  5CKH A;  4ELY C;  4C92 B;  3MEV A;  4MML A;  1Q7Y C;  1WHG A;  4B6M A;  2J6K A;  2LCL A;  1KG1 A;  1M1K C;  3EH1 A;  4QVD A;  4JLG A;  4LXC A;  2A36 A;  3VU3 C;  2GQV A;  4M77 E;  2DIL A;  2PTK A;  1U1T A;  2QTV A;  1BI1 A;  2QQS A;  1W4S A;  2JVV A;  5LJ5 g;  4C5E A;  3JCM g;  3CCJ T;  1ZSZ B;  1YCY A;  4QQD A;  2BUD A;  2VAS A;  2MCN A;  3CME A;  5IXF A;  1VQ8 A;  1KHI A;  4JJB A;  2WSC E;  1VQK A;  1MND A;  3A8G B;  1VQM T;  3I5R A;  2LP5 A;  5FWB A;  3AHU A;  2ZPI B;  4GBQ A;  2PUK B;  1K9M R;  5LJ5 j;  1SSH A;  1V29 B;  2JOY A;  3JCM c;  2RPN A;  4A4F A;  3CCJ Q;  4LDU A;  7AT1 B;  1KD1 U;  4A54 A;  2BTT A;  5GAN 3;  1IZ6 A;  4Z02 A;  1KC8 R;  3PIP A;  2EQM A;  3G4S A;  1D1C A;  1WDX A;  3OS1 A;  4ZN1 A;  4OP0 A;  2DEU A;  1VQM Q;  1ABO A;  2VGN A;  3FJP A;  3GIB A;  2LNV A;  1I1J A;  3DLL A;  3L2U A;  2FEI A;  1YIJ A;  3EGX B;  2VKN A;  1QKX A;  2C0O A;  5LJ5 e;  3TU4 K;  3LW5 E;  4MZM A;  3HRS A;  4J9F A;  2V1R A;  3NTH A;  1G83 A;  1U8R A;  1M3B A;  3C12 A;  2CKK A;  4ZNX A;  1I5L A;  3NTK A;  4CRI A;  1X6O A;  1D0Z A;  5LJ3 j;  1KJW A;  1MMD A;  2EQI A;  1M1K U;  2EAY A;  3JV3 A;  2RQU A;  3RKW A;  3GLX A;  3MPU B;  3JCM V;  2GFU A;  3EGD A;  2EW3 A;  3F70 A;  2LRQ A;  3L1A A;  5M9O A;  1UEB A;  1FYN A;  2K3B A;  3LGL A;  2GTO A;  2FZG B;  5GAM g;  5GAN g;  3VS1 A;  4IUU A;  3TSW A;  2EQU A;  3M56 A;  3A8M B;  2WSE E;  5L8R E;  2L3P A;  2E70 A;  3VYH B;  1CSK A;  1WHH A;  1RLP C;  4RTZ A;  3SWN C;  2E3I A;  5LJ3 e;  4LD9 K;  1YJ9 T;  2LDM A;  5KYX A;  1AD5 A;  5I2S A;  5DY9 A;  3LLR A;  4B9X A;  5GAM j;  3CCQ A;  1WZO A;  5GAN j;  3R6N A;  4LD6 A;  3Q1J A;  4OMO A;  3EFS A;  1YJN A;  5CK9 A;  1EIF A;  2VB6 A;  4BY6 B;  1E6G A;  1PKS A;  1AHJ B;  2P4R A;  2OTJ A;  2A28 A;  2SEM A;  1YJ9 Q;  2D8H A;  4R55 A;  2QAZ A;  1N5Z A;  2K3Y A;  3UPU A;  3QPH A;  2KDS A;  4D8D A;  5GAN e;  2DXT A;  5HCK A;  2XG8 D;  2CRE A;  4M7D E;  1FMV A;  2DL3 A;  2RHZ A;  3J80 E;  1U06 A;  3O8V A;  3DB3 A;  1I5O B;  2YUN A;  2XDD A;  3T9N A;  5J26 A;  1D0X A;  1BYM A;  4AFZ C;  3ASK A;  1EZZ B;  4O6J A;  1HD3 A;  2V8K A;  1NZ9 A;  5CCA A;  4WTO B;  3QZ9 B;  3OYI A;  4JZ4 A;  2AK5 A;  3OYB A;  2OX7 A;  2M02 A;  3JB9 D;  5EG2 A;  2CGH A;  2LZ6 B;  2YLC A;  3PFS A;  1PG5 B;  3UWN A;  2JZ2 A;  2RI2 A;  1RAC B;  2HAX A;  3MEU A;  1Q95 G;  3D7S B;  3QZ5 B;  1K9M C;  4IIM A;  2G3R A;  3MJX A;  1B3Q A;  4JRP A;  2VC8 A;  2DBK A;  2NUT A;  5FRM A;  3SEM A;  3QJY A;  1QCF A;  4M77 F;  1ZUU A;  4RTV A;  5GMK h;  2DXB A;  3P8D A;  4N4H A;  3ME9 A;  3M9Q A;  2CH4 W;  5IXB A;  1AWW A;  3EAE A;  2EKH A;  2K79 A;  1ARK A;  5GJV B;  3OY9 A;  1M2O A;  2O88 A;  3QII A;  1X2Q A;  1CKB A;  4MDX A;  4E7Z A;  1YHQ T;  3HRT A;  4E7H A;  2DJZ A;  4KGZ B;  4M77 A;  4M7D G;  2MAM A;  3OYL A;  1C6V X;  5GAN 4;  4N0A A;  1RAI B;  4QQG A;  4E6R A;  2JW4 A;  2X4J A;  2JNG A;  2CH4 A;  4RTY A;  1TG0 A;  1E6H A;  1WHL A;  4UC4 A;  4CC3 A;  3CCR A;  3QBY A;  1GXI E;  1V76 A;  5CIU A;  3A5Z B;  1YHQ Q;  4IUV A;  4RCC A;  2H8H A;  1K73 U;  3M55 A;  1YIT T;  2E1H A;  1Z9Z A;  2CSQ A;  2HBW A;  2KBT A;  2P0K A;  2KNB B;  2LCS A;  2C0I A;  3CMA A;  3JCM Q;  3VS5 A;  3P8B B;  1NPP A;  2RI5 A;  1H64 1;  1RAD B;  4FW2 A;  4XTV A;  1GCP A;  1DJ7 B;  1BB9 A;  1YIT Q;  3OMC A;  4KUL A;  1JBM A;  4PFZ A;  5HKC A;  2EYW A;  4PLL A;  4M75 E;  1JO8 A;  3M58 A;  1K76 A;  3QHS A;  1KC8 U;  5GAN 5;  2EIF A;  1U5S A;  2JT4 A;  4E7S A;  2ECZ A;  2IG0 A;  3OB9 A;  4M78 C;  4X34 A;  2C0T A;  3JCM h;  4JZ3 A;  1PKT A;  1T3S A;  4XTW A;  4BI8 B;  4GY5 A;  2HSE B;  2RQT A;  3HFO A;  3GNF B;  3BY7 A;  3SWN B;  4KGX B;  1D1B A;  1AT1 B;  1WHJ A;  2M1H A;  4C8Q D;  1NLO C;  3TQ7 P;  2DET A;  5FU7 C;  3VS7 A;  4PJM A;  2JN0 A;  1QW1 A;  2CYZ B;  4E7L A;  4LNP A;  1WLP B;  4F04 B;  1KD1 R;  1QVF S;  2ZPE B;  4C8Q B;  3JCM P;  2PNI A;  3CC4 A;  4PJO E;  2KGT A;  1HJD A;  4M7D F;  2NWM A;  1M5Q 1;  2H3E B;  1KIK A;  1RI0 A;  2KEA A;  3QXE B;  2GQI A;  3MET A;  3PT9 A;  3S6W A;  3UA7 A;  1ACM B;  4J9H A;  1BK2 A;  5I21 A;  1N6A A;  3OYD A;  3CCS A;  2ROT A;  2ZZD A;  1KQ1 A;  4PKC C;  2RJC A;  3MP8 A;  1PCX A;  1C0M A;  3BE3 A;  1NJI U;  3LGF A;  2DPP B;  3EG3 A;  2AIR B;  3MP6 A;  5CVI A;  4M75 G;  2RM4 A;  1VQ4 A;  2H3J A;  4OB1 B;  3C0C A;  5IHI A;  3L2V A;  2DEQ A;  3E1S A;  2D1X A;  5J39 A;  4F14 A;  2XI9 A;  4KH1 B;  4NL3 A;  1M30 A;  1QVP A;  1SHG A;  2YHT A;  4FU6 A;  4EPC A;  1OU9 A;  4BAC A;  3BFM A;  1WFW A;  2ZAE A;  4WF2 A;  2RNA A;  3HFN A;  2XDP A;  2GF7 A;  4PJL A;  4BB7 A;  1X6G A;  1HXD A;  2OAU A;  1FMK A;  3GF5 A;  2VWF A;  2KRN A;  3V7C A;  3M53 A;  1SHF A;  4IUT A;  6AT1 B;  3OYH A;  1NG2 A;  5KYW B;  1KQS A;  4MMK A;  1Y96 A;  2DO3 A;  1MUZ A;  4M7A C;  2JTF A;  3GBQ A;  2XID A;  5LJ3 f;  1PSF A;  2I2L A;  2KQW A;  5A2Q E;  4X9D A;  1Y0M A;  2A37 A;  3VS3 A;  2C06 A;  4HCZ A;  4J5Y A;  1QWE A;  4NOY A;  3CPF A;  3SHW A;  3CXC A;  4BE2 A;  3A98 A;  1IRX A;  4FIB A;  1MMN A;  1AWO A;  1VQ5 T;  4C92 A;  5KE3 A;  3H0F A;  1ZA1 B;  2YXY A;  2QGG A;  2A08 A;  1WJR A;  4NS5 A;  1TH7 A;  4ME7 A;  3JAM E;  1RAH B;  1SPK A;  3PTA A;  1SSF A;  4OVA A;  1O75 A;  2F1L A;  1FXX A;  3DLM A;  4HCK A;  1ZSZ A;  1VQL T;  2AKL A;  1Y7X A;  5I22 A;  1VQ5 Q;  4N4I A;  3SFM A;  5LJ3 d;  3UA6 A;  3A8L B;  1BBZ A;  4Y91 A;  2JJ9 A;  1K8A R;  5GMK j;  3CCL A;  5FLX E;  1KQS S;  3AT1 B;  4FYV B;  2DRK A;  2MIO A;  1TS9 A;  4C0D C;  3EG2 A;  1R0B G;  3U23 A;  1WQ7 A;  1PSE A;  4M75 F;  2DYI A;  2BE7 D;  8AT1 B;  4LDW A;  4JPB W;  1TWB A;  1VQL Q;  2RQW A;  2QXF A;  1QVG P;  2O01 E;  1KD1 C;  4R0K A;  2QEX A;  1BKB A;  1X69 A;  2MPX C;  3FC3 A;  2PQW A;  2VXE A;  4XK8 E;  1NBE B;  1M90 R;  1OPK A;  2RK2 A;  1NE8 A;  4RTW A;  2DIQ A;  5LL6 S;  3H0H A;  2PU9 B;  3A1P A;  1QLY A;  1XJW B;  3EGX A;  3WXM B;  2CUD A;  4HVU A;  1ZBX A;  2YSQ A;  4M78 B;  1U3O A;  1WQW A;  3EGU A;  1MV0 B;  1MNE A;  1WX6 A;  2LQK A;  3G1J A;  1JQQ A;  3REB B;  1VQP T;  5IAY A;  3VJP A;  2VXF A;  3CPW P;  3I35 A;  1B34 B;  1VQ6 A;  1D1A A;  1X6B A;  4D6W A;  2K6D A;  4LDY A;  2O9S A;  3URG A;  1W2B P;  5L23 A;  4ZGJ B;  5FU7 B;  3FRN A;  1PHT A;  4PJO F;  1SF9 A;  1KHC A;  1F1B B;  1S1N A;  3LWI A;  5D6X A;  2RB6 A;  3NTI A;  3OYJ A;  1K73 R;  2CZ7 B;  4HCC A;  2CP5 A;  1VQP Q;  3CME T;  2I0N A;  3MP1 A;  5GAN 8;  4C5H A;  4KRT A;  1QQJ A;  4J9G A;  1NEB A;  2EYQ A;  3RUX A;  1K1Z A;  4QKU A;  2VYT A;  2KY9 A;  1T0J A;  4OF1 A;  4K11 A;  2Z0W A;  3JB9 I;  4XQ3 A;  1SEM A;  1T0H A;  2ZGW A;  1YI2 T;  4PJO A;  4FM4 B;  2YT6 A;  3V7S A;  2FRY A;  3CBM A;  3CME Q;  2A0F B;  3M4G A;  4AFQ C;  2XIC A;  3CEY A;  2MOX A;  2HCK A;  1ABQ A;  3OQ5 A;  4J8O A;  1VQK Q;  1VQM A;  2CZ0 B;  2RO0 A;  2W0Z A;  4RCB A;  1BI3 A;  3VS6 A;  2QQ9 A;  2EGE A;  4Z88 A;  3M54 A;  2X35 A;  4KBM B;  1MV3 A;  1OQK A;  1YI2 Q;  1VQO A;  2HQX A;  3QYH B;  3JCM e;  3IQL A;  4N4G A;  2FB7 A;  2KK4 A;  1HYO A;  2DJQ A;  1YNZ A;  2K3X A;  4EMK C;  2RHI A;  1UEC A;  3CCV T;  3FLG A;  2E65 A;  1YBY A;  4J6W A;  3M0T A;  3MO8 A;  1QMC A;  2BZ8 A;  2HQH A;  3BDL A;  4M7A D;  2HBP A;  2EYY A;  2IIM A;  3RIR A;  3M5A A;  4D8K A;  1RAB B;  1N8R U;  2M0Y A;  5CO7 A;  2F2V A;  1UFF A;  3PNW C;  1VYT A;  4KH0 B;  5A0G A;  4CC2 A;  3E9G A;  4M77 G;  2HD0 A;  4M7A B;  4RG2 A;  1UE9 A;  4A53 A;  2CSI A;  1YCS B;  3CCV Q;  2RK1 A;  3TVT A;  3M0U A;  1EFN A;  4A4G A;  2EWN A;  3NFC A;  1K8A C;  4AFS C;  4Z89 A;  2MWO A;  1M2V B;  4J83 A;  2FL7 A;  2KRS A;  3J81 E;  4MZT A;  2K2M A;  2X51 A;  1VA7 A;  2LMJ A;  2JTM A;  3G71 A;  2PZ1 A;  3VUZ A;  2CT3 A;  1UTI A; 
#chains in the Genus database with same CATH homology
 1WHK A;  1TXQ A;  2HKN A;  3RDV A;  1WHM A;  2HL5 C;  2CP6 A;  1WHH A;  2E4H A;  2HQH A;  2E3I A;  2Z0W A;  2HL3 A;  1LPL A;  2CP2 A;  3E2U A;  2HKQ B;  2COY A;  1TOV A;  2COZ A;  2CP7 A;  2CP5 A;  2CP3 A;  2MPX C;  1IXD A;  1WHJ A;  1WHL A;  2E3H A;  2QK0 A;  1WHG A;  2M02 A;  2CP0 A;  4B6M A;  2COW A;  3TQ7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...