2ROTA

Structure of chimeric variant of sh3 domain- shh
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Spectrin alpha chain, brain
publication title Solution structure and dynamics of the chimeric SH3 domains, SHH- and SHA-"Bergeracs".
pubmed doi rcsb
source organism Gallus gallus
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rotA00
2F2VA 2P4RA 3NMZC 4AFUC 2EQIA 3VS4A 2CUBA 1V1CA 2A37A 3RBBB 1XOVA 2ECZA 4AG1C 4Z89A 1UHCA 2FEIA 2L3SA 2GTJA 3VS6A 2LZ6B 2F2WA 1ZBJA 1VA7A 1SPKA 3QWXX 3U23A 2MOXA 1ZLMA 2SEMA 4JJBA 4F14A 2CSIA 1GRIA 2I0NA 3M0QA 5IXBA 1YCSB 3QWYA 1GCQA 2DL8A 3UA6A 2KT1A 3UATA 4F16A 2CDTA 1JEGA 2JW4A 1JQQA 2D1XA 2RQTA 1WXTA 3NPFA 2JXBA 2RQWA 3GBQA 2KNBB 4ORZA 3I35A 2AK5A 2LCSA 2DMOA 1YWOA 1X6GA 4E6RA 4A63B 3H41A 3VS3A 2HEQA 5FWCA 1JU5C 1Z9QA 2KYBA 4OMQA 2EYWA 2LMJA 1BB9A 1GL5A 2KRMA 2LNHB 3PVQA 1X43A 3IQLA 1GFCA 2J6KA 1E6GA 2VKNA 2KT8A 3CQTA 1NYFA 4RTTA 1GCQC 3VS5A 1QCFA 2OI3A 1E7OA 3REBB 1OV3A 2A08A 1ABQA 4IIOA 2CUDA 2ED0A 3O5ZA 1H8KA 1UDLA 3EGUA 2HSPA 4HVUA 5FW9A 2RN8A 1LCKA 1Y57A 2EBPA 3I5RA 2ENMA 2RF0A 1ARKA 2L3PA 3I9QA 1QWEA 1K4US 2K79A 2FPEA 2JS0A 2FG0A 1YP5A 4CC3A 2CT3A 3PVLA 1NEBA 1VYUA 2W10A 4X1VA 3KFVA 4J9GA 3JV3A 2DYBA 3FJ5A 3RNJA 1WDXA 2ROTA 2A28A 1QKXA 2L0AA 1ZUUA 2RNAA 2YUQA 2HCKA 3TSZA 4LUEA 1FYNA 2J7IA 2KROA 2SRCA 1I07A 1UFFA 2PZ1A 2YUNA 2K9GA 2OAWA 2KBTA 2O31A 1M27C 2DA9A 4OMMA 2ESWA 1T3LA 2BZ8A 2RQUA 3TSWA 5GJWB 1K76A 4J9DA 2GQIA 2K7AA 2LJ0A 2KEAA 2O9SA 2GNCA 2RQVA 2GBQA 1U3OA 4LN2A 4RTZA 1GCPA 4QT7A 4ESRA 1MV0B 1X2QA 5EC7A 1RLPC 2GGRA 1PHTA 4D8DA 3M0UA 4LNPA 1PKTA 4K11A 1UGVA 1WXBA 1HJDA 2DBMA 1SRLA 2AZSA 2EGAA 1JO8A 2DBKA 4DEYA 2KR3A 2XMFA 3ULRB 1SSHA 4Z8AA 1CKAA 1W1FA 2V1RA 2MIOA 4EIKA 3M0RA 4HVVA 3VRZA 4FSSA 5I22A 5I11A 2LJ3A 1SEMA 4RTWA 1M3CA 1I0CA 3VS7A 1G2BA 5IHIA 1FMKA 1MV3A 2JS2A 2RPNA 1ZX6A 4GBQA 5IHKA 2HBWA 2DJQA 4JJCA 2ABLA 2X3XD 1AEYA 5IH2A 1T0HA 1KSWA 3EHQA 1RUWA 2KRSA 2FRYA 4LE9A 1CSKA 1AWJA 1YWPA 5ECAA 2PTKA 1WXUA 2M51A 1AWXA 1K0SA 1X6BA 3UF4A 3H0IA 4JZ3A 1W6XA 1SRMA 4OMOA 2JM9A 3NGPA 2H8HA 2HDAA 3PE0A 3VS0A 2EYZA 1NG2A 2BZXA 1UECA 3VRYA 1AZEA 2C0OA 1AWWA 2E5KA 1WYXA 1WI7A 1KJWA 1TUDA 2ED1A 4KRTA 1PKSA 2D8HA 2LX7A 4WCIA 4AFZC 1EFNA 1UTIA 2W0ZA 2NWMA 4M4ZA 2CREA 2J05A 4OMNA 2KGTA 1NM7A 1ABOA 4OMLA 1M3AA 4J9EA 1SHFA 1AD5A 4AG2C 4D8KA 2FO0A 2DILA 1OPKA 2D0NA 3R6NA 3VS2A 1PRMC 4JZ4A 1AWOA 2EW3A 1SHGA 3EG0A 1CKBA 2V1QA 2BTTA 2J06A 2AZVA 1NLPC 1E6HA 2LQWA 1B3QA 4AFQC 1H3HA 1M8MA 1WLPB 1K0XA 2FRWA 4JJDA 1NLOC 1AOJA 1UUEA 2DM1A 1TUCA 2CSQA 1T3SA 1PRLC 2EKHA 1B07A 1J3TA 2DVJA 1M30A 1RI9A 1GBRA 1T0JA 1H92A 1AZGB 5L23A 2B86A 1KFZA 3I5SA 2KYMA 2YUPA 1RLQC 2AKLA 3SEMA 1UJYA 1PWTA 1JXOA 1QLYA 2K2MA 2FPDA 1VYVA 1ZUKA 1WA7A 2EPDA 4OMPA 4HVWA 2EGCA 3H0FA 2C0IA 2LP5A 2LJ1A 2KXCA 3THKA 4Y92A 3A98A 3UA7A 4GLMA 2RMOA 1Y0MA 2BZYA 3REAB 2DL5A 5FWBA 2EYXA 2L2PA 2K6DA 1WFWA 2VVKA 5IHNA 2KE9A 5IXFA 3M0PA 2FPFA 1BU1A 4JPBW 4RUGA 1WIEA 2IIMA 2MCNA 4CC7A 4DEXA 2J6FA 1K9AA 1JXMA 4LUDA 1IO6A 1N5ZA 2C0TA 3EHRA 4CC4B 2DLPA 2CT4A 2DRKA 2JTEA 2DL7A 1ZUYA 2OJ2A 1UJ0A 1W70A 2YDLA 1WX6A 5GJVB 2ROLA 2DRMA 3EG2A 2NUZA 1NYGA 1UE9A 4RTYA 2DNUA 3ZL7C 2K3BA 3H0HA 1K1ZA 1OEBA 2L3QA 4HXJA 1PNJA 2X3WD 2LQNA 2CH4W 2A36A 2DE0X 2DX1A 4R0KA 1HSQA 3EG1A 5HCKA 1GBQA 1UHFA 4J9BA 1BBZA 4RTXA 2JM8A 4J9IA 2DL4A 4RTVA 2CH4A 2O88A 1YNZA 1MUZA 2RQRA 2EYYA 2G6FX 3M0SA 4CC2A 2EVRA 3SHWA 4Z88A 2QDLA 1X2KA 1QKWA 4J9CA 2O9VA 2DF6A 3TVTA 3LH5A 4J9FA 2J6OA 3M0TA 1S1NA 2VWFA 4J9HA 2PNIA 3VS1A 1X27A 4F17A 4RTUA 2JMCA 1TG0A 2DL3A 1OPLA 4HCKA 2YT6A 1G83A 2JT4A 2KRNA 3EG3A 2KXDA 2GTOA 1Z9ZA 2AKKA 1YN8A 2D8JA 1M3BA 2F2XA 2YSQA 1A0NB 1U06A 1VYTA 1KIKA 2O2OA 1OOTA 4IIMA 1HD3A 1BK2A 2M0YA 1ZSGA 1AVZC 1GFDA 1NEGA 1QWFA 1U5SA 2EGEA 2JMAA 1I1JA 1UG1A 3C0CA 1X69A 4AFSC 2YUOA 4ZNXA 3NHNA
chains in the Genus database with same CATH superfamily
5GMKi 1VQ7A 4AFUC 2K2VA 3LGFA 5DLQE 1UHCA 2GQVA 2L3SA 2QG9B 4CRIA 3QIIA 1VA7A 2HBPA 4C8QD 1ZLMA 1VQLT 1JBMA 2I0NA 3E9FA 3CPWA 3X28B 4JS5A 1QP2A 3L2VA 3M4GA 1WJQA 1XJWB 4F7UE 3VUZA 4JRKA 2CDTA 1KC8C 2JW4A 4M7DB 2D1XA 1Q86C 2JXBA 3GBQA 3CCST 2FZCB 5IN1A 1OI1A 3CMAQ 2LCSA 5KYNA 3M58A 1KQ1A 3QUIA 2M1HA 2CKKA 2CGHA 2M9UA 3CMAA 1Z9QA 3V8JA 4OMQA 4O5VA 2EYWA 5KH6A 5HKCA 2LMJA 5C6SA 3QYHB 4XK8E 3PVQA 3ZFJA 1I4K1 3NTKA 5M9OA 1GCQC 5LJ5d 1E7OA 1H641 4BE2A 2A08A 1Q81U 2ED0A 5GAOl 1H8KA 3MEUA 4HVUA 5FW9A 3H6ZA 1F1BB 1LCKA 5DY9A 4E7IA 2DD4A 2ZCFB 3I9QA 3V7SA 3ZBDA 2JS0A 2FG0A 1YP5A 4CC3A 1K73R 2OAUA 1QVGS 1NEBA 3QHSA 1Y7XA 4A4EA 3JV3A 2QQ9A 1AHJB 3FJ5A 1VQ9A 2ROTA 4FL6A 5KYYA 4IURA 2JTMA 1VQKT 3HKSA 3ER0A 4LUEA 1FYNA 2SRCA 1I07A 2YUNA 3I56T 2K9GA 2D6FA 2ZAEA 3V7RA 2ESWA 1ZBXA 1ACMB 2RQUA 1Q81C 1K76A 4M78F 1BI3A 2GQIA 3EFSA 4M7DG 1XTDA 4NS5A 4FYWB 1X75C 3CPFA 2LJ0A 1O9SA 4XU0A 1OX9A 1M1KU 2O9SA 3CBOA 4LN2A 1U3OA 3V8KA 3CXCA 3A8LB 1LOJA 4L5GA 5EC7A 2GGRA 4D8DA 3OYKA 2XHCA 3HTRA 3M0UA 1PKTA 3I56A 2WSFE 1UGVA 4O6JA 1WHGA 3QO3A 4A4FA 4ZN3A 3CCRT 2LQ8A 1YJWA 3ULRB 3ZEHA 3L42A 1W1FA 1B34B 1HYOA 4Q5WA 5I22A 5GMKe 2MWPA 1W2BP 3JB9I 1VQMT 1JJ2A 4EDUA 1RAGB 2DYIA 1FMKA 2MK5A 1MV3A 2RK2A 4C0ZA 3OW2A 4PJNA 5LL6S 4R55A 1C0MA 4M78E 4F7UG 4C8QC 3RMQA 2LC4A 1UGRB 4M77F 2VGMA 1RUWA 2E12A 4PLLA 1PD0A 2ZPEB 2NUPA 3CCRA 1YITA 1AWJA 4PFZA 1YWPA 4X9DA 2PTKA 1WXUA 2YWWA 3OYDA 1AWXA 2V8IA 5GAOp 1K0SA 3JCMV 3V7CA 1VQNT 2QK0A 1M9SA 3MJXA 4OMOA 2DEUA 2HDAA 1VQMA 3VS0A 1KHCA 1Q7YU 2EYZA 2GFAA 1RABB 2XKOC 1UECA 2C0OA 5GANd 1AWWA 3NTIA 2E5KA 1WYXA 3NTHA 1TUDA 5FRMA 1WPYA 4KRTA 3ASKA 4E47A 3A8GB 1UTIA 2W0ZA 3CC7Q 2NWMA 4R56A 2R5MA 3CCQT 2WACA 3CC7A 5J26A 2DTOA 4M75F 1AD5A 1VQNA 3CCET 1VQ6Q 4AG2C 4OGEA 5HK3A 4M77E 2RO0A 5CKHA 3C12A 2D0NA 1VQ6A 4KGXB 2EW3A 3SWNC 1I5LA 1CKBA 2V1QA 1RL2A 2BTTA 3QBYA 2AZVA 1B3QA 1TH7A 3L2ZA 1H3HA 4C0DB 2QEXT 4C0GA 3OS0A 2FRWA 4JJDA 3C94A 3DB4A 4J6YA 1UUEA 3JB9F 1TUCA 2CSQA 3OS2A 3CCQA 1GBRA 1M1GA 3PT9A 3FJPA 3CCEA 4C8QA 4HKEA 2X35A 1KFZA 2YUPA 3GNFB 2D0QB 3PMTA 2EQJA 2FPDA 1ZSZA 5GANf 4C92C 2C0IA 4M75E 5GAOq 4Y92A 2E41A 3A98A 3BFMA 1EX4A 1VQ4T 2EIFA 4M77D 3S3OA 2BZYA 3AHUA 4JRIA 5FWBA 2EYXA 2ATCB 1SF9A 2L2PA 3SFMA 2R57A 2PU9B 2FPFA 4XQ3A 1BI0A 2F69A 2VYTA 2DPPB 2IIMA 4BB7A 2LT1A 1NPRA 2XK0A 4FYYB 2M02A 3E19A 1K9AA 1JXMA 1D09B 5CIUA 2NUTA 1YJNT 1OZ2A 4M7AB 2KDSA 4M78G 4RCBA 1TS9A 5FRNA 1VQ4A 3G1JA 2ROLA 4KH1B 2DRMA 2NUZA 4RTYA 3E9GA 3TREA 1BIAA 1V76A 2E5QA 5CO7A 4XTZA 3S6WA 4LD9K 1VQPQ 3EGXA 2DE0X 1WHHA 4C5EA 4R0KA 4KBMB 5GAN3 2GFUA 1WHJA 2LDMA 3GLXA 3BDUA 4XTVA 5GMKj 1BBZA 4RTXA 2JM8A 4PJOF 2KK4A 2L5QA 4J9IA 2DL4A 4F04B 4RTVA 1YJNA 1YNZA 1MUZA 2RM4A 2RQRA 3RKXA 3M0SA 1K9MC 3SHWA 1KC8R 2ZGWA 1QKWA 4J9CA 4D6WA 1Q86R 3CD6T 1MNDA 3M0TA 4J9HA 2PNIA 1NJIU 1WHLA 2O01E 3VS1A 2HQXA 2HD0A 2P0KA 3HFOA 1YJ9A 1TG0A 2DL3A 1PSFA 3G71Q 2IVWA 4HCKA 2DETA 2YT6A 3P8DA 5FU7C 3EG3A 2B8AA 5GANh 2DVEA 1BI1A 1D1CA 2CP0A 3BY7A 2LT4A 3CC2A 1M2VB 1WJRA 1N27A 3G4ST 1I8FA 3HHTB 2X51A 2YSQA 4J7FA 1MMDA 1A0NB 4E7KA 1KIKA 1R77A 1OOTA 3JSCA 1WQWA 1AVZC 1GFDA 1QWFA 4PJOE 3CCUQ 1KQSP 2QYZA 4ELYC 5GAMe 1RAHB 1SKUB 1NJIC 2YXYA 3OS1A 2K3YA 1VQOT 2A37A 1IZ6A 3A8OB 3BE3A 1QVFP 1XOVA 4AG1C 1K8AU 3G4SA 2F2WA 2YRCA 3QWXX 1M90U 4V2SA 4JJBA 2DZ9A 2E4HA 3C4SA 4M75G 3JCMg 1D0XA 3M0QA 3PIOA 2P0PA 2QGFB 3EFOA 3QWYA 5GMKh 4JDSA 3TEEA 4ZGDB 3OW2S 2HQEA 3E2UA 1VQ5T 1JEGA 2CZ6B 8ATCB 1Q81R 1JQQA 1NE8A 2ZPGB 2KNBB 2QDYB 4E6RA 4KT0E 3HRUA 3JB9G 5CKBA 2HEQA 5FWCA 3CPWP 4PJOD 3OYGA 1RAIB 2E65A 1K8AC 1GL5A 4UC4A 2LNHB 4QVZA 3RKWA 3M9QA 1D0ZA 2FVUA 2VKNA 2DXUA 1TSFA 3LLRA 2MAMA 4OB2B 3VS5A 1VQ5A 2OI3A 1S72Q 2P84A 2RHXA 3RDVA 1OV3A 4FW1A 2HQHA 1ABQA 2HSEB 2CUDA 2P4TA 2ENMA 2VASA 2CZ7B 1ARKA 2L3PA 4OVAA 2PVDB 1QWEA 2OTLT 1O75A 2QGGA 3OYLA 2NUPB 3UPUA 1X01A 3D7SB 5A2QE 2MPXC 3RNJA 1NPPA 2Y90A 4CI0C 5J39A 1LNXA 2M16A 4M7DE 3TSZA 2VGNA 4GY5A 3META 1UFFA 2PZ1A 3JCMX 4HT8A 4OMFB 1M27C 3GNGA 3PFSA 4BI4A 1U1TA 2DD5A 3TSWA 5LJ5e 2OTLA 4JRPA 1G5VA 4J9DA 2K7AA 1QP3A 2KEAA 4HCZA 2ZPFB 4M77A 1RAAB 4IUQA 2A0FB 2RHIA 2HL5C 3MHXA 4PJOG 3OYHA 1MV0B 1RLPC 1PHTA 3CMAT 1TTHB 4JS4A 4LNPA 4VUBA 3QJYA 2JVVA 2A7YA 2Z0WA 2DBKA 2K5FA 3LYIA 1XNIA 2KR3A 5DLOA 1SSHA 1FX7A 3H9NA 4FM4B 5GMKm 4KUDK 3M0RA 4HVVA 4FSSA 2OX7A 4M7DD 4MZTA 4RTWA 1WNLA 3CXCP 1I0CA 4Y91A 2K57A 5IHIA 3I55Q 4GBQA 5IHKA 1YBYA 2DJQA 1KSWA 5GAMj 3OSSC 1W4SA 4J7IA 2EYQA 2QQSA 4LE9A 1CSKA 1NZ9A 5ECAA 3JCMc 9ATCB 1Y71A 1VQ9T 1X6BA 1JJ2P 1VQLQ 1OQKA 1W6XA 1SRMA 2CP6A 2COYA 3M57A 1D3BA 3OW2P 2JM9A 3OMGA 2LQKA 3FEOA 1G3YA 2H8HA 3PE0A 2RJFA 2BZXA 3TQ7P 1ZA1B 2YRDA 3A1PA 4LDWA 2YRVA 3FC3A 2KQWA 5D6XA 2ED1A 1PKSA 3EGDA 2NUTB 3CCSQ 4M4ZA 2AT1B 4QVDA 1VUBA 5CAIA 3C95A 3QJ6A 2EAYA 4OMLA 1IHWA 4J9EA 1QW1A 4KGVB 1OPKA 3SWNB 1RACB 3VS2A 4ME7A 4JZ4A 1AWOA 4XAXB 3EG0A 2FB7A 1WHKA 5CKEA 3UDCA 1IXDA 1UGQB 4A4HA 4AFQC 3JCMe 1YJWT 1AOJA 2DM1A 1Q82U 2JJ9A 1BCMA 1T3SA 2HMAA 3CEYA 1B07A 2DVJA 5L23A 3PGGA 2QQRA 4MZMA 3MP1A 3L1AA 3OYYA 2KAFA 1VQ8Q 4C92B 2RI3A 2AKLA 5GAMh 1V29B 3SEMA 3M55A 1K9MR 1VYVA 2EPDA 1WA7A 4OMPA 2QTVA 4HVWA 1VQ8A 1KD1U 2EGCA 1VQKQ 2COZA 2E64A 3H0FA 5LJ3e 1YITT 1H3ZA 3HSBA 2CZ0B 3QG1A 6AT1B 3THKA 1QCOA 4JUVA 3UA7A 2XICA 3N5BB 2OTJQ 2CP5A 2RMOA 1Y0MA 3REAB 2DL5A 1FWZA 1RAEB 5I21A 5A0GA 2X4WA 5IHNA 4PJOA 2O4XA 3M0PA 1N9RA 1Q95G 1M1KC 1G8XA 4EMKA 1IREB 3LWIA 3WXMB 5GAMg 2FL7A 2HL3A 1GXIE 1Y96A 2GF7A 2RJCA 4E7LA 1ZSZC 3CC7T 2DIQA 3OSVA 2DRKA 1OULA 1ZUYA 1UJ0A 1KD1C 4M7DC 4RKUE 1QQJA 2PVGB 4HA8A 3EG2A 8AT1B 1LVKA 1NJIR 2HKNA 2PUKB 1VQ6T 1UE9A 5KYWA 4M7AF 3ZL7C 2K3BA 2CS7A 4A53A 4ATOA 4N0AA 1YHQQ 1OEBA 2L3QA 2X3WD 2LQNA 2DX1A 3X25B 3OYNA 3EG1A 4LDXA 2V26A 4J9BA 3OBYA 5KYXA 2QASA 5D6YA 2ZPBB 3OS5A 2O88A 3RKYA 3QDFA 1N8RU 3JCMJ 3NFCA 3OYIA 4PK4A 3OQ5A 1BIBA 4C92G 1YIJQ 4Z88A 3JCMP 2DXTA 4M78D 3CCLQ 3TVTA 3CCVQ 4J9FA 2J6OA 1YI2Q 4XU2A 3L2UA 2XD0A 2DO3A 1X27A 5FU7B 4F17A 3DKMA 1OPLA 1Q7YC 1K8AR 4EPCA 1Z9ZA 4M7AE 3KBGA 4J8OA 3EG9B 2A3LA 3R6OA 1QVGP 2F2XA 2CYZB 5KE3A 2QQAA 4X34A 1SG5A 3MEWA 2E1HA 1BK2A 3S3MA 2M0YA 1N8RC 1NEGA 1U5SA 2BE9B 2JUFA 3J80E 1UG1A 3CC4Q 3S3NA 2E6NA 2F1LA 1K73U 2DXBA 3GF5A 3SD4A 4OB1B 1N6AA 1TWBA 4IUUA 4M7DA 2P4RA 3NMZC 2EQIA 1V1CA 1W2BA 4Z89A 2LZ6B 1ZBJA 3OMCA 2RK1A 3U23A 2MOXA 4F14A 2QEXQ 5LJ5g 4E7ZA 4BY6C 5IXBA 2DFUA 3AT1B 2DL8A 5CQXA 3V8LA 1VQPT 5CKFA 2DERA 2KT1A 4F16A 4M7AD 2MF2A 1WXTA 3NPFA 2RQWA 1M1FA 4ORZA 2GCXA 2DMOA 1YWOA 1X6GA 5C0MA 3VYGA 4A63B 2VXFA 3H41A 5CQYA 3VS3A 3DLMA 1JU5C 5GAN4 2KI7A 5GAN6 5LJ3j 3VKIA 4FSXA 3BDLA 4F7UA 4FT4A 1TOVA 5KYUA 1YJ9T 4M75D 4QQ6A 2QA4Q 2J6KA 5CCAA 4P5NA 3QPHA 4QKUA 2X4JA 1VQPA 1NYFA 3WVDB 4II1A 5GAN8 2QA4A 4OGCA 3A8HB 3CC2T 2RJEA 3HPWA 5GAN2 4IIOA 2FZKB 4ZGEB 4WF2A 1BCOA 5FLXE 2EBPA 2RF0A 1K4US 1UGPB 3JB9D 3CCJQ 4IUPA 4J83A 3PVLA 4X1VA 3KFVA 4J9GA 2HAXA 2DTIA 2RB6A 2A28A 3TCJA 2RHYA 1KK7A 1ZUUA 3G71A 1VIFA 2MMPA 3QSUA 2HCKA 2KROA 2QI2A 3JCMh 4JLGA 2OAWA 3LGLA 3OYFA 4M78C 4DBFA 2KBTA 1MNEA 1PD1A 3HP9A 2AHJB 2E3IA 1PG5B 5GJWB 3JRZA 1OU9A 1NBEB 4BD3A 4M7AG 4PJJA 4IUTA 4TVRA 3CCUA 5KYYB 2RQVA 3CD6Q 4N4IA 2GBQA 3OYAA 1VIEA 4MDWA 1HK9A 2EJFA 1X2QA 4JLIA 1WQ7A 5KCOA 1HJDA 2MI6A 2AZSA 2EGAA 1M4ZA 1ZQ1A 2PQWA 2V1RA 2MIOA 4EIKA 3SDZA 3VRZA 2JZ2A 4XU1A 2EJGA 1IHVA 2K5IA 1SEMA 1M3CA 3MEAA 1IRXA 4M77C 1WHMA 2JS2A 2RPNA 3EAEA 5FU6C 1ZHIA 2X3XD 4A54A 1G3WA 5IH2A 1T0HA 3LW5E 3J7AF 3G6EQ 2KRSA 5LJ3g 1M5Q1 1VQOQ 3GIBA 1KHIA 3QXEB 4N4HA 5GAOr 1M90C 3CCMQ 2YHTA 2M51A 3UF4A 3H0IA 4JZ3A 5GMKl 2L8DA 3CBMA 4LXCA 2RI2A 2KVQG 4M78A 4PFOA 2X4YA 1S72A 2EQKA 1AZEA 2AIRB 1MMNA 4B9XA 4B6MA 2D8HA 2LX7A 4WCIA 4AFZC 1M1KR 1YFNA 4N4GA 4M75C 2CREA 1ZA2B 2J05A 2PUOB 4OMNA 5CVIA 2KGTA 1NM7A 3CMEQ 1ABOA 3JB9J 4D8KA 5GAMd 2FO0A 2DILA 3OB9A 3CMEA 2MYSA 3R6NA 4GLKA 1SHGA 1KD1R 2BIVA 3VJPA 3OY9A 2J06A 2L3RA 1E6HA 3PNWC 2PVOB 1OU8A 1KQSA 1WLPB 1BKBA 3URGA 1I5OB 2CP7A 1DJ7B 1NLOC 4HT9A 5KYXB 4PKCC 3KUFA 1JB0E 5IAYA 2P0QA 1R0CB 1PRLC 1UEBA 2RA2A 2EKHA 1J3TA 1QVFA 5GAN7 1MGQA 1IGUA 2R5AA 1KG1A 2B86A 2I2LA 3I5SA 2NYSA 1TU0B 4PJLA 4E7HA 1UJYA 1M8VA 1JXOA 3P8BB 1ZUKA 1VQ7Q 3M5AA 1W2BS 1QVPA 1M2OA 1UGSB 3H8ZA 2WSCE 4NOYA 4M7AA 2F5KA 4C92F 2LRQA 4GLMA 3MO8A 1Q7YR 3RERA 3OYMA 1JRIA 5FROA 4MDXA 1WFWA 4C8QB 2VVKA 5GAMf 2DXCA 2F5TX 3M4YA 1BU1A 3M56A 3WVEB 3I55A 5AYFA 2MCNA 4DEXA 4M75A 2BE7D 1ZSZB 4ELZC 4LUDA 1N8RR 4L59A 2EWNA 2C0TA 3EHRA 2CT4A 2EJ9A 3JCMb 2JTEA 1OX8A 2DL7A 2M0OA 2OJ2A 2XDDA 2YDLA 2ZPHB 5GJVB 4EMGA 4EMHA 3QZ9B 3HRSA 1NYGA 1PSEA 1VQLA 2KY9A 3H0HA 4HXJA 3Q1JA 5GAN5 1VOMA 2CH4W 2A36A 3SB2A 4C5IA 2XDBA 2NLUA 2WSEE 4C92E 4PJOC 5HCKA 1GBQA 2K3XA 4EMKC 1X6OA 2K5LA 4C5GA 3JB9H 1FMVA 3KXTA 1M2VA 4BI8B 3VV0A 2EYYA 4FYVB 4CC2A 3OYEA 3CCSA 3TU4K 2VC8A 2EKOA 3RUXA 2QDLA 2X4XA 2O9VA 2VB6A 4KH0B 2DF6A 2EQUA 5AT1B 2XI9A 4DBRA 4FU6A 4XU3A 4F7UB 1VQ9Q 3EGXB 5KYUB 1VQ8T 4N0AC 2JMCA 4ZN1A 1LPLA 2IPOB 5DM7R 1U1SA 1G83A 2KRNA 4KGZB 4QW2A 2RI5A 1I81A 2GTOA 2AKKA 4RG2A 5HY6A 4C8QG 1YN8A 2XG8D 5GAOn 2D8JA 5A0DA 7AT1B 1M3BA 3PTAA 3MKDA 5GANe 2X9HA 4OF1A 2OTJT 2JTFA 3LH0A 4RMOA 4IIMA 1HD3A 4C92D 1ZSGA 4OP0A 2V8JA 2HZYA 2RHUA 2JMAA 1Y07A 1HXDA 3C0CA 4E2FB 2LNVA 1X69A 2YUOA 2F2VA 3VS4A 3OA6A 2CUBA 3RBBB 4QVCA 1VQKA 4AT1B 2ECZA 2FZGB 3EH2A 5LJ5f 2JOYA 3I56Q 2FEIA 4MMKA 2GTJA 3VS6A 4PL6A 1SPKA 2SEMA 2R58A 4BY6B 2OTJA 2XDPA 2CSIA 1YJWQ 2HKQB 1Q82C 1GRIA 5LJ5j 2DJZA 1YCSB 2BKDN 4A4GA 1YHQT 1GCQA 3UA6A 4BE0A 2Y4XA 2Y4YA 3UATA 4RG8A 3FIFA 1RADB 4IKFA 2RQTA 5GAOm 3I35A 4ZTFA 2AK5A 3RESA 2VUBA 2XIDA 3UT1A 4DBHA 4FCYA 1UB4A 3HL8A 3RR6A 3CCRQ 2KYBA 3QDRB 1YIJT 1YITQ 1FMWA 4QQDA 1BB9A 3CCLT 3CCVT 2KRMA 1QMCA 1YI2T 3EFOB 4LDYA 1X43A 3O8VA 3IQLA 1GFCA 1YHQA 1E6GA 2JNGA 2RH2A 2KT8A 3G7ZA 4XTXA 3CQTA 1VQMQ 3A5ZB 5I2SA 4RTTA 3JCMd 1MHNA 1QCFA 2FHDA 2RJDA 3REBB 3O5ZA 1UDLA 3EGUA 2COWA 2HSPA 3MCAB 1WGSA 3HRTA 2RN8A 1Y57A 3I5RA 3L2RA 4FW2A 4QQGA 2K79A 2MWOA 1YIJA 2FPEA 2XU8A 4Z02A 3RMSA 4J6XA 2CT3A 2YLBA 4FYXB 3CCLA 3CCVA 1VYUA 2W10A 2G3RA 1YI2A 1VQNQ 4ZTJA 4BDYA 2JN0A 4BDZA 2DYBA 2K4YA 4KULA 3CC4T 1WDXA 1D1BA 4A4KA 4AMCA 1QKXA 2L0AA 5LJ3d 2RNAA 2YUQA 4X9CA 4PNOA 1M90R 4M78B 5D7UA 2J7IA 3QKJA 3DLLA 3FDRA 1KQSS 1P92A 5LJ5h 4Y28E 2DAQA 2O31A 2DA9A 3VUBA 4OMMA 4PJMA 3GOXA 1T3LA 1D1AA 2BZ8A 3FB9A 4MZPA 3X24B 1QVFS 2BUDA 3CCQQ 4E7SA 3OBWA 2HNIA 3CCEQ 2CP3A 2GNCA 3CC4A 3JCMf 3GP8A 4RTZA 1GCPA 4QT7A 4DBQA 4YTLA 4DOVA 3L2WA 4ESRA 1EZZB 3J81E 1QCNA 1WJSA 4K11A 1WXBA 1RI0A 2DBMA 1SRLA 2DKGA 5D6WA 1JO8A 4OB0B 4DEYA 1OZ3A 4LD6A 2C06A 2QEXA 2XMFA 4KUIA 4Z8AA 3FRNA 1CKAA 2H3EB 4BACA 5GANj 3CPWS 5I11A 2QA4T 2LJ3A 4M77B 3PIPA 3VS7A 1G2BA 3X26B 5FU6B 5LJ3f 1K73C 1PC0A 1ZX6A 3F70A 2HBWA 3T9NA 3MP6A 4JJCA 2ABLA 1B7TA 1BI2A 3QZ5B 4NL3A 1AEYA 2L89A 3INZA 4MMLA 4XTWA 3EHQA 3L2QA 1G3SA 1K9MU 2KMTA 2FRYA 1PM3A 4NL2A 5A0LA 1VQ4Q 4BUGA 3CCJT 3E1SA 2EQMA 2DZCA 1KQ2A 2DEQA 2CP2A 2ZZDA 4WTOB 3JCMQ 4RCCA 3G71T 1R8OB 2E10A 4JJNK 2QQBA 3SWNA 3NGPA 2E70A 1NG2A 5KCHA 4XTYA 3VRYA 3PMIA 4FIBA 3LWHA 1WI7A 1KJWA 4M75B 5J3BA 1YJNQ 4ZGJB 1EFNA 4BE1A 1XQHA 3CCJA 1MMAA 3CCUT 1M3AA 1SHFA 3M53A 2VXEA 3HFNA 1C1AA 1QVGA 1D3BB 1C6VX 5L8RE 2RD1A 3VYHB 5CK9A 4DA4A 1PRMC 2LX9A 1YJ9Q 4C92A 4DOWA 2E3HA 2LCCA 3VU3C 1NLPC 2LQWA 5I2MA 3CC2Q 1M8MA 1K0XA 4M77G 3EGDB 1R0BG 3LX7A 4LDUA 4C0DC 1B34A 4JRQA 1M30A 1RI9A 4HCBA 1T0JA 1H92A 1TXQA 2RHZA 1AZGB 4J5YA 1U8RA 2KYMA 3CD6A 1RLQC 2CZ1B 4BI3A 1IGQA 1PWTA 5LJ3h 1QLYA 2K2MA 3JAME 3CXCS 2H3JA 3UWNA 2LP5A 3QYGB 3OYBA 3G6ET 2LJ1A 2KXCA 3G4SQ 2IG0A 3CCMT 2ZPIB 5GANg 2K6DA 1G3TA 2KSSA 5HK0A 1IB8A 2QTXA 4PLIA 1S72T 3EH1A 2KE9A 2QAZA 5IXFA 4PFPA 3A8MB 4JPBW 4RUGA 1WIEA 1JJ2S 3CBPA 2EFIA 4CC7A 3DB3A 4HCCA 2J6FA 4C8QF 3MEVA 1IO6A 1D0YA 1N5ZA 2DK3A 4CC4B 2LTOA 2DLPA 5IT9E 4DQ2A 3G6EA 3JCMW 4LDVA 3M54A 1VQOA 1W70A 4M7AC 1WX6A 1OYXA 1N9SA 3CCMA 3CMET 4M7DF 2DNUA 2DTHA 3OYCA 5KE2A 1K1ZA 4PJOB 2O4XB 1PNJA 1LJOA 4FT2A 4EMKB 2FYKA 1VQ5Q 4E7JA 1HSQA 5CKDA 4C0FA 1Q82R 1UHFA 2QXFA 1Y96B 2CH4A 3EG9A 3P8HA 2G6FX 2E6ZA 2EVRA 1X2KA 1SSFA 4ANJA 1AT1B 2YLCA 5KYWB 3LH5A 3X20B 4C8QE 5EG2A 1S1NA 3OYJA 2VWFA 3ME9A 2LCLA 1MMGA 4C5HA 4XTUA 4RTUA 5CR2A 1PCXA 4B9WA 1VQ7T 2JT4A 2D9TA 2KXDA 2V8KA 1BYMA 3FLGA 4F7UF 3MPUB 3RIRA 2LVMA 1TUGB 1U06A 1VYTA 1FXXA 2O2OA 2OTLQ 1EIFA 3BW1A 4J6WA 3GPLA 4IUVA 4OB3B 2DIGA 1KC8U 3EFRA 1YCYA 3I55T 2VV5A 3M59A 2EGEA 1I1JA 1Q86U 1RAFB 1WZOA 4AFSC 3MP8A 4ZNXA 4L6V5 3NHNA
chains in the Genus database with same CATH topology
2F2VA 2P4RA 3NMZC 4AFUC 2EQIA 3VS4A 2CUBA 1V1CA 2A37A 3RBBB 1XOVA 2ECZA 4AG1C 4Z89A 1UHCA 2FEIA 2L3SA 2GTJA 3VS6A 2LZ6B 2F2WA 1ZBJA 1VA7A 1SPKA 3QWXX 3U23A 2MOXA 1ZLMA 2SEMA 4JJBA 4F14A 2CSIA 1GRIA 2I0NA 3M0QA 5IXBA 1YCSB 3QWYA 1GCQA 2DL8A 3UA6A 2KT1A 3UATA 4F16A 2CDTA 1JEGA 2JW4A 1JQQA 2D1XA 2RQTA 1WXTA 3NPFA 2JXBA 2RQWA 3GBQA 2KNBB 4ORZA 3I35A 2AK5A 2LCSA 2DMOA 1YWOA 1X6GA 4E6RA 4A63B 3H41A 3VS3A 2HEQA 5FWCA 1JU5C 1Z9QA 2KYBA 4OMQA 2EYWA 2LMJA 1BB9A 1GL5A 2KRMA 2LNHB 3PVQA 1X43A 3IQLA 1GFCA 2J6KA 1E6GA 2VKNA 2KT8A 3CQTA 1NYFA 4RTTA 1GCQC 3VS5A 1QCFA 2OI3A 1E7OA 3REBB 1OV3A 2A08A 1ABQA 4IIOA 2CUDA 2ED0A 3O5ZA 1H8KA 1UDLA 3EGUA 2HSPA 4HVUA 5FW9A 2RN8A 1LCKA 1Y57A 2EBPA 3I5RA 2ENMA 2RF0A 1ARKA 2L3PA 3I9QA 1QWEA 1K4US 2K79A 2FPEA 2JS0A 2FG0A 1YP5A 4CC3A 2CT3A 3PVLA 1NEBA 1VYUA 2W10A 4X1VA 3KFVA 4J9GA 3JV3A 2DYBA 3FJ5A 3RNJA 1WDXA 2ROTA 2A28A 1QKXA 2L0AA 1ZUUA 2RNAA 2YUQA 2HCKA 3TSZA 4LUEA 1FYNA 2J7IA 2KROA 2SRCA 1I07A 1UFFA 2PZ1A 2YUNA 2K9GA 2OAWA 2KBTA 2O31A 1M27C 2DA9A 4OMMA 2ESWA 1T3LA 2BZ8A 2RQUA 3TSWA 5GJWB 1K76A 4J9DA 2GQIA 2K7AA 2LJ0A 2KEAA 2O9SA 2GNCA 2RQVA 2GBQA 1U3OA 4LN2A 4RTZA 1GCPA 4QT7A 4ESRA 1MV0B 1X2QA 5EC7A 1RLPC 2GGRA 1PHTA 4D8DA 3M0UA 4LNPA 1PKTA 4K11A 1UGVA 1WXBA 1HJDA 2DBMA 1SRLA 2AZSA 2EGAA 1JO8A 2DBKA 4DEYA 2KR3A 2XMFA 3ULRB 1SSHA 4Z8AA 1CKAA 1W1FA 2V1RA 2MIOA 4EIKA 3M0RA 4HVVA 3VRZA 4FSSA 5I22A 5I11A 2LJ3A 1SEMA 4RTWA 1M3CA 1I0CA 3VS7A 1G2BA 5IHIA 1FMKA 1MV3A 2JS2A 2RPNA 1ZX6A 4GBQA 5IHKA 2HBWA 2DJQA 4JJCA 2ABLA 2X3XD 1AEYA 5IH2A 1T0HA 1KSWA 3EHQA 1RUWA 2KRSA 2FRYA 4LE9A 1CSKA 1AWJA 1YWPA 5ECAA 2PTKA 1WXUA 2M51A 1AWXA 1K0SA 1X6BA 3UF4A 3H0IA 4JZ3A 1W6XA 1SRMA 4OMOA 2JM9A 3NGPA 2H8HA 2HDAA 3PE0A 3VS0A 2EYZA 1NG2A 2BZXA 1UECA 3VRYA 1AZEA 2C0OA 1AWWA 2E5KA 1WYXA 1WI7A 1KJWA 1TUDA 2ED1A 4KRTA 1PKSA 2D8HA 2LX7A 4WCIA 4AFZC 1EFNA 1UTIA 2W0ZA 2NWMA 4M4ZA 2CREA 2J05A 4OMNA 2KGTA 1NM7A 1ABOA 4OMLA 1M3AA 4J9EA 1SHFA 1AD5A 4AG2C 4D8KA 2FO0A 2DILA 1OPKA 2D0NA 3R6NA 3VS2A 1PRMC 4JZ4A 1AWOA 2EW3A 1SHGA 3EG0A 1CKBA 2V1QA 2BTTA 2J06A 2AZVA 1NLPC 1E6HA 2LQWA 1B3QA 4AFQC 1H3HA 1M8MA 1WLPB 1K0XA 2FRWA 4JJDA 1NLOC 1AOJA 1UUEA 2DM1A 1TUCA 2CSQA 1T3SA 1PRLC 2EKHA 1B07A 1J3TA 2DVJA 1M30A 1RI9A 1GBRA 1T0JA 1H92A 1AZGB 5L23A 2B86A 1KFZA 3I5SA 2KYMA 2YUPA 1RLQC 2AKLA 3SEMA 1UJYA 1PWTA 1JXOA 1QLYA 2K2MA 2FPDA 1VYVA 1ZUKA 1WA7A 2EPDA 4OMPA 4HVWA 2EGCA 3H0FA 2C0IA 2LP5A 2LJ1A 2KXCA 3THKA 4Y92A 3A98A 3UA7A 4GLMA 2RMOA 1Y0MA 2BZYA 3REAB 2DL5A 5FWBA 2EYXA 2L2PA 2K6DA 1WFWA 2VVKA 5IHNA 2KE9A 5IXFA 3M0PA 2FPFA 1BU1A 4JPBW 4RUGA 1WIEA 2IIMA 2MCNA 4CC7A 4DEXA 2J6FA 1K9AA 1JXMA 4LUDA 1IO6A 1N5ZA 2C0TA 3EHRA 4CC4B 2DLPA 2CT4A 2DRKA 2JTEA 2DL7A 1ZUYA 2OJ2A 1UJ0A 1W70A 2YDLA 1WX6A 5GJVB 2ROLA 2DRMA 3EG2A 2NUZA 1NYGA 1UE9A 4RTYA 2DNUA 3ZL7C 2K3BA 3H0HA 1K1ZA 1OEBA 2L3QA 4HXJA 1PNJA 2X3WD 2LQNA 2CH4W 2A36A 2DE0X 2DX1A 4R0KA 1HSQA 3EG1A 5HCKA 1GBQA 1UHFA 4J9BA 1BBZA 4RTXA 2JM8A 4J9IA 2DL4A 4RTVA 2CH4A 2O88A 1YNZA 1MUZA 2RQRA 2EYYA 2G6FX 3M0SA 4CC2A 2EVRA 3SHWA 4Z88A 2QDLA 1X2KA 1QKWA 4J9CA 2O9VA 2DF6A 3TVTA 3LH5A 4J9FA 2J6OA 3M0TA 1S1NA 2VWFA 4J9HA 2PNIA 3VS1A 1X27A 4F17A 4RTUA 2JMCA 1TG0A 2DL3A 1OPLA 4HCKA 2YT6A 1G83A 2JT4A 2KRNA 3EG3A 2KXDA 2GTOA 1Z9ZA 2AKKA 1YN8A 2D8JA 1M3BA 2F2XA 2YSQA 1A0NB 1U06A 1VYTA 1KIKA 2O2OA 1OOTA 4IIMA 1HD3A 1BK2A 2M0YA 1ZSGA 1AVZC 1GFDA 1NEGA 1QWFA 1U5SA 2EGEA 2JMAA 1I1JA 1UG1A 3C0CA 1X69A 4AFSC 2YUOA 4ZNXA 3NHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2V A;  2P4R A;  3NMZ C;  4AFU C;  2EQI A;  3VS4 A;  2CUB A;  1V1C A;  2A37 A;  3RBB B;  1XOV A;  2ECZ A;  4AG1 C;  4Z89 A;  1UHC A;  2FEI A;  2L3S A;  2GTJ A;  3VS6 A;  2LZ6 B;  2F2W A;  1ZBJ A;  1VA7 A;  1SPK A;  3QWX X;  3U23 A;  2MOX A;  1ZLM A;  2SEM A;  4JJB A;  4F14 A;  2CSI A;  1GRI A;  2I0N A;  3M0Q A;  5IXB A;  1YCS B;  3QWY A;  1GCQ A;  2DL8 A;  3UA6 A;  2KT1 A;  3UAT A;  4F16 A;  2CDT A;  1JEG A;  2JW4 A;  1JQQ A;  2D1X A;  2RQT A;  1WXT A;  3NPF A;  2JXB A;  2RQW A;  3GBQ A;  2KNB B;  4ORZ A;  3I35 A;  2AK5 A;  2LCS A;  2DMO A;  1YWO A;  1X6G A;  4E6R A;  4A63 B;  3H41 A;  3VS3 A;  2HEQ A;  5FWC A;  1JU5 C;  1Z9Q A;  2KYB A;  4OMQ A;  2EYW A;  2LMJ A;  1BB9 A;  1GL5 A;  2KRM A;  2LNH B;  3PVQ A;  1X43 A;  3IQL A;  1GFC A;  2J6K A;  1E6G A;  2VKN A;  2KT8 A;  3CQT A;  1NYF A;  4RTT A;  1GCQ C;  3VS5 A;  1QCF A;  2OI3 A;  1E7O A;  3REB B;  1OV3 A;  2A08 A;  1ABQ A;  4IIO A;  2CUD A;  2ED0 A;  3O5Z A;  1H8K A;  1UDL A;  3EGU A;  2HSP A;  4HVU A;  5FW9 A;  2RN8 A;  1LCK A;  1Y57 A;  2EBP A;  3I5R A;  2ENM A;  2RF0 A;  1ARK A;  2L3P A;  3I9Q A;  1QWE A;  1K4U S;  2K79 A;  2FPE A;  2JS0 A;  2FG0 A;  1YP5 A;  4CC3 A;  2CT3 A;  3PVL A;  1NEB A;  1VYU A;  2W10 A;  4X1V A;  3KFV A;  4J9G A;  3JV3 A;  2DYB A;  3FJ5 A;  3RNJ A;  1WDX A;  2ROT A;  2A28 A;  1QKX A;  2L0A A;  1ZUU A;  2RNA A;  2YUQ A;  2HCK A;  3TSZ A;  4LUE A;  1FYN A;  2J7I A;  2KRO A;  2SRC A;  1I07 A;  1UFF A;  2PZ1 A;  2YUN A;  2K9G A;  2OAW A;  2KBT A;  2O31 A;  1M27 C;  2DA9 A;  4OMM A;  2ESW A;  1T3L A;  2BZ8 A;  2RQU A;  3TSW A;  5GJW B;  1K76 A;  4J9D A;  2GQI A;  2K7A A;  2LJ0 A;  2KEA A;  2O9S A;  2GNC A;  2RQV A;  2GBQ A;  1U3O A;  4LN2 A;  4RTZ A;  1GCP A;  4QT7 A;  4ESR A;  1MV0 B;  1X2Q A;  5EC7 A;  1RLP C;  2GGR A;  1PHT A;  4D8D A;  3M0U A;  4LNP A;  1PKT A;  4K11 A;  1UGV A;  1WXB A;  1HJD A;  2DBM A;  1SRL A;  2AZS A;  2EGA A;  1JO8 A;  2DBK A;  4DEY A;  2KR3 A;  2XMF A;  3ULR B;  1SSH A;  4Z8A A;  1CKA A;  1W1F A;  2V1R A;  2MIO A;  4EIK A;  3M0R A;  4HVV A;  3VRZ A;  4FSS A;  5I22 A;  5I11 A;  2LJ3 A;  1SEM A;  4RTW A;  1M3C A;  1I0C A;  3VS7 A;  1G2B A;  5IHI A;  1FMK A;  1MV3 A;  2JS2 A;  2RPN A;  1ZX6 A;  4GBQ A;  5IHK A;  2HBW A;  2DJQ A;  4JJC A;  2ABL A;  2X3X D;  1AEY A;  5IH2 A;  1T0H A;  1KSW A;  3EHQ A;  1RUW A;  2KRS A;  2FRY A;  4LE9 A;  1CSK A;  1AWJ A;  1YWP A;  5ECA A;  2PTK A;  1WXU A;  2M51 A;  1AWX A;  1K0S A;  1X6B A;  3UF4 A;  3H0I A;  4JZ3 A;  1W6X A;  1SRM A;  4OMO A;  2JM9 A;  3NGP A;  2H8H A;  2HDA A;  3PE0 A;  3VS0 A;  2EYZ A;  1NG2 A;  2BZX A;  1UEC A;  3VRY A;  1AZE A;  2C0O A;  1AWW A;  2E5K A;  1WYX A;  1WI7 A;  1KJW A;  1TUD A;  2ED1 A;  4KRT A;  1PKS A;  2D8H A;  2LX7 A;  4WCI A;  4AFZ C;  1EFN A;  1UTI A;  2W0Z A;  2NWM A;  4M4Z A;  2CRE A;  2J05 A;  4OMN A;  2KGT A;  1NM7 A;  1ABO A;  4OML A;  1M3A A;  4J9E A;  1SHF A;  1AD5 A;  4AG2 C;  4D8K A;  2FO0 A;  2DIL A;  1OPK A;  2D0N A;  3R6N A;  3VS2 A;  1PRM C;  4JZ4 A;  1AWO A;  2EW3 A;  1SHG A;  3EG0 A;  1CKB A;  2V1Q A;  2BTT A;  2J06 A;  2AZV A;  1NLP C;  1E6H A;  2LQW A;  1B3Q A;  4AFQ C;  1H3H A;  1M8M A;  1WLP B;  1K0X A;  2FRW A;  4JJD A;  1NLO C;  1AOJ A;  1UUE A;  2DM1 A;  1TUC A;  2CSQ A;  1T3S A;  1PRL C;  2EKH A;  1B07 A;  1J3T A;  2DVJ A;  1M30 A;  1RI9 A;  1GBR A;  1T0J A;  1H92 A;  1AZG B;  5L23 A;  2B86 A;  1KFZ A;  3I5S A;  2KYM A;  2YUP A;  1RLQ C;  2AKL A;  3SEM A;  1UJY A;  1PWT A;  1JXO A;  1QLY A;  2K2M A;  2FPD A;  1VYV A;  1ZUK A;  1WA7 A;  2EPD A;  4OMP A;  4HVW A;  2EGC A;  3H0F A;  2C0I A;  2LP5 A;  2LJ1 A;  2KXC A;  3THK A;  4Y92 A;  3A98 A;  3UA7 A;  4GLM A;  2RMO A;  1Y0M A;  2BZY A;  3REA B;  2DL5 A;  5FWB A;  2EYX A;  2L2P A;  2K6D A;  1WFW A;  2VVK A;  5IHN A;  2KE9 A;  5IXF A;  3M0P A;  2FPF A;  1BU1 A;  4JPB W;  4RUG A;  1WIE A;  2IIM A;  2MCN A;  4CC7 A;  4DEX A;  2J6F A;  1K9A A;  1JXM A;  4LUD A;  1IO6 A;  1N5Z A;  2C0T A;  3EHR A;  4CC4 B;  2DLP A;  2CT4 A;  2DRK A;  2JTE A;  2DL7 A;  1ZUY A;  2OJ2 A;  1UJ0 A;  1W70 A;  2YDL A;  1WX6 A;  5GJV B;  2ROL A;  2DRM A;  3EG2 A;  2NUZ A;  1NYG A;  1UE9 A;  4RTY A;  2DNU A;  3ZL7 C;  2K3B A;  3H0H A;  1K1Z A;  1OEB A;  2L3Q A;  4HXJ A;  1PNJ A;  2X3W D;  2LQN A;  2CH4 W;  2A36 A;  2DE0 X;  2DX1 A;  4R0K A;  1HSQ A;  3EG1 A;  5HCK A;  1GBQ A;  1UHF A;  4J9B A;  1BBZ A;  4RTX A;  2JM8 A;  4J9I A;  2DL4 A;  4RTV A;  2CH4 A;  2O88 A;  1YNZ A;  1MUZ A;  2RQR A;  2EYY A;  2G6F X;  3M0S A;  4CC2 A;  2EVR A;  3SHW A;  4Z88 A;  2QDL A;  1X2K A;  1QKW A;  4J9C A;  2O9V A;  2DF6 A;  3TVT A;  3LH5 A;  4J9F A;  2J6O A;  3M0T A;  1S1N A;  2VWF A;  4J9H A;  2PNI A;  3VS1 A;  1X27 A;  4F17 A;  4RTU A;  2JMC A;  1TG0 A;  2DL3 A;  1OPL A;  4HCK A;  2YT6 A;  1G83 A;  2JT4 A;  2KRN A;  3EG3 A;  2KXD A;  2GTO A;  1Z9Z A;  2AKK A;  1YN8 A;  2D8J A;  1M3B A;  2F2X A;  2YSQ A;  1A0N B;  1U06 A;  1VYT A;  1KIK A;  2O2O A;  1OOT A;  4IIM A;  1HD3 A;  1BK2 A;  2M0Y A;  1ZSG A;  1AVZ C;  1GFD A;  1NEG A;  1QWF A;  1U5S A;  2EGE A;  2JMA A;  1I1J A;  1UG1 A;  3C0C A;  1X69 A;  4AFS C;  2YUO A;  4ZNX A;  3NHN A; 
#chains in the Genus database with same CATH topology
 5GMK i;  1VQ7 A;  4AFU C;  2K2V A;  3LGF A;  5DLQ E;  1UHC A;  2GQV A;  2L3S A;  2QG9 B;  4CRI A;  3QII A;  1VA7 A;  2HBP A;  4C8Q D;  1ZLM A;  1VQL T;  1JBM A;  2I0N A;  3E9F A;  3CPW A;  3X28 B;  4JS5 A;  1QP2 A;  3L2V A;  3M4G A;  1WJQ A;  1XJW B;  4F7U E;  3VUZ A;  4JRK A;  2CDT A;  1KC8 C;  2JW4 A;  4M7D B;  2D1X A;  1Q86 C;  2JXB A;  3GBQ A;  3CCS T;  2FZC B;  5IN1 A;  1OI1 A;  3CMA Q;  2LCS A;  5KYN A;  3M58 A;  1KQ1 A;  3QUI A;  2M1H A;  2CKK A;  2CGH A;  2M9U A;  3CMA A;  1Z9Q A;  3V8J A;  4OMQ A;  4O5V A;  2EYW A;  5KH6 A;  5HKC A;  2LMJ A;  5C6S A;  3QYH B;  4XK8 E;  3PVQ A;  3ZFJ A;  1I4K 1;  3NTK A;  5M9O A;  1GCQ C;  5LJ5 d;  1E7O A;  1H64 1;  4BE2 A;  2A08 A;  1Q81 U;  2ED0 A;  5GAO l;  1H8K A;  3MEU A;  4HVU A;  5FW9 A;  3H6Z A;  1F1B B;  1LCK A;  5DY9 A;  4E7I A;  2DD4 A;  2ZCF B;  3I9Q A;  3V7S A;  3ZBD A;  2JS0 A;  2FG0 A;  1YP5 A;  4CC3 A;  1K73 R;  2OAU A;  1QVG S;  1NEB A;  3QHS A;  1Y7X A;  4A4E A;  3JV3 A;  2QQ9 A;  1AHJ B;  3FJ5 A;  1VQ9 A;  2ROT A;  4FL6 A;  5KYY A;  4IUR A;  2JTM A;  1VQK T;  3HKS A;  3ER0 A;  4LUE A;  1FYN A;  2SRC A;  1I07 A;  2YUN A;  3I56 T;  2K9G A;  2D6F A;  2ZAE A;  3V7R A;  2ESW A;  1ZBX A;  1ACM B;  2RQU A;  1Q81 C;  1K76 A;  4M78 F;  1BI3 A;  2GQI A;  3EFS A;  4M7D G;  1XTD A;  4NS5 A;  4FYW B;  1X75 C;  3CPF A;  2LJ0 A;  1O9S A;  4XU0 A;  1OX9 A;  1M1K U;  2O9S A;  3CBO A;  4LN2 A;  1U3O A;  3V8K A;  3CXC A;  3A8L B;  1LOJ A;  4L5G A;  5EC7 A;  2GGR A;  4D8D A;  3OYK A;  2XHC A;  3HTR A;  3M0U A;  1PKT A;  3I56 A;  2WSF E;  1UGV A;  4O6J A;  1WHG A;  3QO3 A;  4A4F A;  4ZN3 A;  3CCR T;  2LQ8 A;  1YJW A;  3ULR B;  3ZEH A;  3L42 A;  1W1F A;  1B34 B;  1HYO A;  4Q5W A;  5I22 A;  5GMK e;  2MWP A;  1W2B P;  3JB9 I;  1VQM T;  1JJ2 A;  4EDU A;  1RAG B;  2DYI A;  1FMK A;  2MK5 A;  1MV3 A;  2RK2 A;  4C0Z A;  3OW2 A;  4PJN A;  5LL6 S;  4R55 A;  1C0M A;  4M78 E;  4F7U G;  4C8Q C;  3RMQ A;  2LC4 A;  1UGR B;  4M77 F;  2VGM A;  1RUW A;  2E12 A;  4PLL A;  1PD0 A;  2ZPE B;  2NUP A;  3CCR A;  1YIT A;  1AWJ A;  4PFZ A;  1YWP A;  4X9D A;  2PTK A;  1WXU A;  2YWW A;  3OYD A;  1AWX A;  2V8I A;  5GAO p;  1K0S A;  3JCM V;  3V7C A;  1VQN T;  2QK0 A;  1M9S A;  3MJX A;  4OMO A;  2DEU A;  2HDA A;  1VQM A;  3VS0 A;  1KHC A;  1Q7Y U;  2EYZ A;  2GFA A;  1RAB B;  2XKO C;  1UEC A;  2C0O A;  5GAN d;  1AWW A;  3NTI A;  2E5K A;  1WYX A;  3NTH A;  1TUD A;  5FRM A;  1WPY A;  4KRT A;  3ASK A;  4E47 A;  3A8G B;  1UTI A;  2W0Z A;  3CC7 Q;  2NWM A;  4R56 A;  2R5M A;  3CCQ T;  2WAC A;  3CC7 A;  5J26 A;  2DTO A;  4M75 F;  1AD5 A;  1VQN A;  3CCE T;  1VQ6 Q;  4AG2 C;  4OGE A;  5HK3 A;  4M77 E;  2RO0 A;  5CKH A;  3C12 A;  2D0N A;  1VQ6 A;  4KGX B;  2EW3 A;  3SWN C;  1I5L A;  1CKB A;  2V1Q A;  1RL2 A;  2BTT A;  3QBY A;  2AZV A;  1B3Q A;  1TH7 A;  3L2Z A;  1H3H A;  4C0D B;  2QEX T;  4C0G A;  3OS0 A;  2FRW A;  4JJD A;  3C94 A;  3DB4 A;  4J6Y A;  1UUE A;  3JB9 F;  1TUC A;  2CSQ A;  3OS2 A;  3CCQ A;  1GBR A;  1M1G A;  3PT9 A;  3FJP A;  3CCE A;  4C8Q A;  4HKE A;  2X35 A;  1KFZ A;  2YUP A;  3GNF B;  2D0Q B;  3PMT A;  2EQJ A;  2FPD A;  1ZSZ A;  5GAN f;  4C92 C;  2C0I A;  4M75 E;  5GAO q;  4Y92 A;  2E41 A;  3A98 A;  3BFM A;  1EX4 A;  1VQ4 T;  2EIF A;  4M77 D;  3S3O A;  2BZY A;  3AHU A;  4JRI A;  5FWB A;  2EYX A;  2ATC B;  1SF9 A;  2L2P A;  3SFM A;  2R57 A;  2PU9 B;  2FPF A;  4XQ3 A;  1BI0 A;  2F69 A;  2VYT A;  2DPP B;  2IIM A;  4BB7 A;  2LT1 A;  1NPR A;  2XK0 A;  4FYY B;  2M02 A;  3E19 A;  1K9A A;  1JXM A;  1D09 B;  5CIU A;  2NUT A;  1YJN T;  1OZ2 A;  4M7A B;  2KDS A;  4M78 G;  4RCB A;  1TS9 A;  5FRN A;  1VQ4 A;  3G1J A;  2ROL A;  4KH1 B;  2DRM A;  2NUZ A;  4RTY A;  3E9G A;  3TRE A;  1BIA A;  1V76 A;  2E5Q A;  5CO7 A;  4XTZ A;  3S6W A;  4LD9 K;  1VQP Q;  3EGX A;  2DE0 X;  1WHH A;  4C5E A;  4R0K A;  4KBM B;  5GAN 3;  2GFU A;  1WHJ A;  2LDM A;  3GLX A;  3BDU A;  4XTV A;  5GMK j;  1BBZ A;  4RTX A;  2JM8 A;  4PJO F;  2KK4 A;  2L5Q A;  4J9I A;  2DL4 A;  4F04 B;  4RTV A;  1YJN A;  1YNZ A;  1MUZ A;  2RM4 A;  2RQR A;  3RKX A;  3M0S A;  1K9M C;  3SHW A;  1KC8 R;  2ZGW A;  1QKW A;  4J9C A;  4D6W A;  1Q86 R;  3CD6 T;  1MND A;  3M0T A;  4J9H A;  2PNI A;  1NJI U;  1WHL A;  2O01 E;  3VS1 A;  2HQX A;  2HD0 A;  2P0K A;  3HFO A;  1YJ9 A;  1TG0 A;  2DL3 A;  1PSF A;  3G71 Q;  2IVW A;  4HCK A;  2DET A;  2YT6 A;  3P8D A;  5FU7 C;  3EG3 A;  2B8A A;  5GAN h;  2DVE A;  1BI1 A;  1D1C A;  2CP0 A;  3BY7 A;  2LT4 A;  3CC2 A;  1M2V B;  1WJR A;  1N27 A;  3G4S T;  1I8F A;  3HHT B;  2X51 A;  2YSQ A;  4J7F A;  1MMD A;  1A0N B;  4E7K A;  1KIK A;  1R77 A;  1OOT A;  3JSC A;  1WQW A;  1AVZ C;  1GFD A;  1QWF A;  4PJO E;  3CCU Q;  1KQS P;  2QYZ A;  4ELY C;  5GAM e;  1RAH B;  1SKU B;  1NJI C;  2YXY A;  3OS1 A;  2K3Y A;  1VQO T;  2A37 A;  1IZ6 A;  3A8O B;  3BE3 A;  1QVF P;  1XOV A;  4AG1 C;  1K8A U;  3G4S A;  2F2W A;  2YRC A;  3QWX X;  1M90 U;  4V2S A;  4JJB A;  2DZ9 A;  2E4H A;  3C4S A;  4M75 G;  3JCM g;  1D0X A;  3M0Q A;  3PIO A;  2P0P A;  2QGF B;  3EFO A;  3QWY A;  5GMK h;  4JDS A;  3TEE A;  4ZGD B;  3OW2 S;  2HQE A;  3E2U A;  1VQ5 T;  1JEG A;  2CZ6 B;  8ATC B;  1Q81 R;  1JQQ A;  1NE8 A;  2ZPG B;  2KNB B;  2QDY B;  4E6R A;  4KT0 E;  3HRU A;  3JB9 G;  5CKB A;  2HEQ A;  5FWC A;  3CPW P;  4PJO D;  3OYG A;  1RAI B;  2E65 A;  1K8A C;  1GL5 A;  4UC4 A;  2LNH B;  4QVZ A;  3RKW A;  3M9Q A;  1D0Z A;  2FVU A;  2VKN A;  2DXU A;  1TSF A;  3LLR A;  2MAM A;  4OB2 B;  3VS5 A;  1VQ5 A;  2OI3 A;  1S72 Q;  2P84 A;  2RHX A;  3RDV A;  1OV3 A;  4FW1 A;  2HQH A;  1ABQ A;  2HSE B;  2CUD A;  2P4T A;  2ENM A;  2VAS A;  2CZ7 B;  1ARK A;  2L3P A;  4OVA A;  2PVD B;  1QWE A;  2OTL T;  1O75 A;  2QGG A;  3OYL A;  2NUP B;  3UPU A;  1X01 A;  3D7S B;  5A2Q E;  2MPX C;  3RNJ A;  1NPP A;  2Y90 A;  4CI0 C;  5J39 A;  1LNX A;  2M16 A;  4M7D E;  3TSZ A;  2VGN A;  4GY5 A;  3MET A;  1UFF A;  2PZ1 A;  3JCM X;  4HT8 A;  4OMF B;  1M27 C;  3GNG A;  3PFS A;  4BI4 A;  1U1T A;  2DD5 A;  3TSW A;  5LJ5 e;  2OTL A;  4JRP A;  1G5V A;  4J9D A;  2K7A A;  1QP3 A;  2KEA A;  4HCZ A;  2ZPF B;  4M77 A;  1RAA B;  4IUQ A;  2A0F B;  2RHI A;  2HL5 C;  3MHX A;  4PJO G;  3OYH A;  1MV0 B;  1RLP C;  1PHT A;  3CMA T;  1TTH B;  4JS4 A;  4LNP A;  4VUB A;  3QJY A;  2JVV A;  2A7Y A;  2Z0W A;  2DBK A;  2K5F A;  3LYI A;  1XNI A;  2KR3 A;  5DLO A;  1SSH A;  1FX7 A;  3H9N A;  4FM4 B;  5GMK m;  4KUD K;  3M0R A;  4HVV A;  4FSS A;  2OX7 A;  4M7D D;  4MZT A;  4RTW A;  1WNL A;  3CXC P;  1I0C A;  4Y91 A;  2K57 A;  5IHI A;  3I55 Q;  4GBQ A;  5IHK A;  1YBY A;  2DJQ A;  1KSW A;  5GAM j;  3OSS C;  1W4S A;  4J7I A;  2EYQ A;  2QQS A;  4LE9 A;  1CSK A;  1NZ9 A;  5ECA A;  3JCM c;  9ATC B;  1Y71 A;  1VQ9 T;  1X6B A;  1JJ2 P;  1VQL Q;  1OQK A;  1W6X A;  1SRM A;  2CP6 A;  2COY A;  3M57 A;  1D3B A;  3OW2 P;  2JM9 A;  3OMG A;  2LQK A;  3FEO A;  1G3Y A;  2H8H A;  3PE0 A;  2RJF A;  2BZX A;  3TQ7 P;  1ZA1 B;  2YRD A;  3A1P A;  4LDW A;  2YRV A;  3FC3 A;  2KQW A;  5D6X A;  2ED1 A;  1PKS A;  3EGD A;  2NUT B;  3CCS Q;  4M4Z A;  2AT1 B;  4QVD A;  1VUB A;  5CAI A;  3C95 A;  3QJ6 A;  2EAY A;  4OML A;  1IHW A;  4J9E A;  1QW1 A;  4KGV B;  1OPK A;  3SWN B;  1RAC B;  3VS2 A;  4ME7 A;  4JZ4 A;  1AWO A;  4XAX B;  3EG0 A;  2FB7 A;  1WHK A;  5CKE A;  3UDC A;  1IXD A;  1UGQ B;  4A4H A;  4AFQ C;  3JCM e;  1YJW T;  1AOJ A;  2DM1 A;  1Q82 U;  2JJ9 A;  1BCM A;  1T3S A;  2HMA A;  3CEY A;  1B07 A;  2DVJ A;  5L23 A;  3PGG A;  2QQR A;  4MZM A;  3MP1 A;  3L1A A;  3OYY A;  2KAF A;  1VQ8 Q;  4C92 B;  2RI3 A;  2AKL A;  5GAM h;  1V29 B;  3SEM A;  3M55 A;  1K9M R;  1VYV A;  2EPD A;  1WA7 A;  4OMP A;  2QTV A;  4HVW A;  1VQ8 A;  1KD1 U;  2EGC A;  1VQK Q;  2COZ A;  2E64 A;  3H0F A;  5LJ3 e;  1YIT T;  1H3Z A;  3HSB A;  2CZ0 B;  3QG1 A;  6AT1 B;  3THK A;  1QCO A;  4JUV A;  3UA7 A;  2XIC A;  3N5B B;  2OTJ Q;  2CP5 A;  2RMO A;  1Y0M A;  3REA B;  2DL5 A;  1FWZ A;  1RAE B;  5I21 A;  5A0G A;  2X4W A;  5IHN A;  4PJO A;  2O4X A;  3M0P A;  1N9R A;  1Q95 G;  1M1K C;  1G8X A;  4EMK A;  1IRE B;  3LWI A;  3WXM B;  5GAM g;  2FL7 A;  2HL3 A;  1GXI E;  1Y96 A;  2GF7 A;  2RJC A;  4E7L A;  1ZSZ C;  3CC7 T;  2DIQ A;  3OSV A;  2DRK A;  1OUL A;  1ZUY A;  1UJ0 A;  1KD1 C;  4M7D C;  4RKU E;  1QQJ A;  2PVG B;  4HA8 A;  3EG2 A;  8AT1 B;  1LVK A;  1NJI R;  2HKN A;  2PUK B;  1VQ6 T;  1UE9 A;  5KYW A;  4M7A F;  3ZL7 C;  2K3B A;  2CS7 A;  4A53 A;  4ATO A;  4N0A A;  1YHQ Q;  1OEB A;  2L3Q A;  2X3W D;  2LQN A;  2DX1 A;  3X25 B;  3OYN A;  3EG1 A;  4LDX A;  2V26 A;  4J9B A;  3OBY A;  5KYX A;  2QAS A;  5D6Y A;  2ZPB B;  3OS5 A;  2O88 A;  3RKY A;  3QDF A;  1N8R U;  3JCM J;  3NFC A;  3OYI A;  4PK4 A;  3OQ5 A;  1BIB A;  4C92 G;  1YIJ Q;  4Z88 A;  3JCM P;  2DXT A;  4M78 D;  3CCL Q;  3TVT A;  3CCV Q;  4J9F A;  2J6O A;  1YI2 Q;  4XU2 A;  3L2U A;  2XD0 A;  2DO3 A;  1X27 A;  5FU7 B;  4F17 A;  3DKM A;  1OPL A;  1Q7Y C;  1K8A R;  4EPC A;  1Z9Z A;  4M7A E;  3KBG A;  4J8O A;  3EG9 B;  2A3L A;  3R6O A;  1QVG P;  2F2X A;  2CYZ B;  5KE3 A;  2QQA A;  4X34 A;  1SG5 A;  3MEW A;  2E1H A;  1BK2 A;  3S3M A;  2M0Y A;  1N8R C;  1NEG A;  1U5S A;  2BE9 B;  2JUF A;  3J80 E;  1UG1 A;  3CC4 Q;  3S3N A;  2E6N A;  2F1L A;  1K73 U;  2DXB A;  3GF5 A;  3SD4 A;  4OB1 B;  1N6A A;  1TWB A;  4IUU A;  4M7D A;  2P4R A;  3NMZ C;  2EQI A;  1V1C A;  1W2B A;  4Z89 A;  2LZ6 B;  1ZBJ A;  3OMC A;  2RK1 A;  3U23 A;  2MOX A;  4F14 A;  2QEX Q;  5LJ5 g;  4E7Z A;  4BY6 C;  5IXB A;  2DFU A;  3AT1 B;  2DL8 A;  5CQX A;  3V8L A;  1VQP T;  5CKF A;  2DER A;  2KT1 A;  4F16 A;  4M7A D;  2MF2 A;  1WXT A;  3NPF A;  2RQW A;  1M1F A;  4ORZ A;  2GCX A;  2DMO A;  1YWO A;  1X6G A;  5C0M A;  3VYG A;  4A63 B;  2VXF A;  3H41 A;  5CQY A;  3VS3 A;  3DLM A;  1JU5 C;  5GAN 4;  2KI7 A;  5GAN 6;  5LJ3 j;  3VKI A;  4FSX A;  3BDL A;  4F7U A;  4FT4 A;  1TOV A;  5KYU A;  1YJ9 T;  4M75 D;  4QQ6 A;  2QA4 Q;  2J6K A;  5CCA A;  4P5N A;  3QPH A;  4QKU A;  2X4J A;  1VQP A;  1NYF A;  3WVD B;  4II1 A;  5GAN 8;  2QA4 A;  4OGC A;  3A8H B;  3CC2 T;  2RJE A;  3HPW A;  5GAN 2;  4IIO A;  2FZK B;  4ZGE B;  4WF2 A;  1BCO A;  5FLX E;  2EBP A;  2RF0 A;  1K4U S;  1UGP B;  3JB9 D;  3CCJ Q;  4IUP A;  4J83 A;  3PVL A;  4X1V A;  3KFV A;  4J9G A;  2HAX A;  2DTI A;  2RB6 A;  2A28 A;  3TCJ A;  2RHY A;  1KK7 A;  1ZUU A;  3G71 A;  1VIF A;  2MMP A;  3QSU A;  2HCK A;  2KRO A;  2QI2 A;  3JCM h;  4JLG A;  2OAW A;  3LGL A;  3OYF A;  4M78 C;  4DBF A;  2KBT A;  1MNE A;  1PD1 A;  3HP9 A;  2AHJ B;  2E3I A;  1PG5 B;  5GJW B;  3JRZ A;  1OU9 A;  1NBE B;  4BD3 A;  4M7A G;  4PJJ A;  4IUT A;  4TVR A;  3CCU A;  5KYY B;  2RQV A;  3CD6 Q;  4N4I A;  2GBQ A;  3OYA A;  1VIE A;  4MDW A;  1HK9 A;  2EJF A;  1X2Q A;  4JLI A;  1WQ7 A;  5KCO A;  1HJD A;  2MI6 A;  2AZS A;  2EGA A;  1M4Z A;  1ZQ1 A;  2PQW A;  2V1R A;  2MIO A;  4EIK A;  3SDZ A;  3VRZ A;  2JZ2 A;  4XU1 A;  2EJG A;  1IHV A;  2K5I A;  1SEM A;  1M3C A;  3MEA A;  1IRX A;  4M77 C;  1WHM A;  2JS2 A;  2RPN A;  3EAE A;  5FU6 C;  1ZHI A;  2X3X D;  4A54 A;  1G3W A;  5IH2 A;  1T0H A;  3LW5 E;  3J7A F;  3G6E Q;  2KRS A;  5LJ3 g;  1M5Q 1;  1VQO Q;  3GIB A;  1KHI A;  3QXE B;  4N4H A;  5GAO r;  1M90 C;  3CCM Q;  2YHT A;  2M51 A;  3UF4 A;  3H0I A;  4JZ3 A;  5GMK l;  2L8D A;  3CBM A;  4LXC A;  2RI2 A;  2KVQ G;  4M78 A;  4PFO A;  2X4Y A;  1S72 A;  2EQK A;  1AZE A;  2AIR B;  1MMN A;  4B9X A;  4B6M A;  2D8H A;  2LX7 A;  4WCI A;  4AFZ C;  1M1K R;  1YFN A;  4N4G A;  4M75 C;  2CRE A;  1ZA2 B;  2J05 A;  2PUO B;  4OMN A;  5CVI A;  2KGT A;  1NM7 A;  3CME Q;  1ABO A;  3JB9 J;  4D8K A;  5GAM d;  2FO0 A;  2DIL A;  3OB9 A;  3CME A;  2MYS A;  3R6N A;  4GLK A;  1SHG A;  1KD1 R;  2BIV A;  3VJP A;  3OY9 A;  2J06 A;  2L3R A;  1E6H A;  3PNW C;  2PVO B;  1OU8 A;  1KQS A;  1WLP B;  1BKB A;  3URG A;  1I5O B;  2CP7 A;  1DJ7 B;  1NLO C;  4HT9 A;  5KYX B;  4PKC C;  3KUF A;  1JB0 E;  5IAY A;  2P0Q A;  1R0C B;  1PRL C;  1UEB A;  2RA2 A;  2EKH A;  1J3T A;  1QVF A;  5GAN 7;  1MGQ A;  1IGU A;  2R5A A;  1KG1 A;  2B86 A;  2I2L A;  3I5S A;  2NYS A;  1TU0 B;  4PJL A;  4E7H A;  1UJY A;  1M8V A;  1JXO A;  3P8B B;  1ZUK A;  1VQ7 Q;  3M5A A;  1W2B S;  1QVP A;  1M2O A;  1UGS B;  3H8Z A;  2WSC E;  4NOY A;  4M7A A;  2F5K A;  4C92 F;  2LRQ A;  4GLM A;  3MO8 A;  1Q7Y R;  3RER A;  3OYM A;  1JRI A;  5FRO A;  4MDX A;  1WFW A;  4C8Q B;  2VVK A;  5GAM f;  2DXC A;  2F5T X;  3M4Y A;  1BU1 A;  3M56 A;  3WVE B;  3I55 A;  5AYF A;  2MCN A;  4DEX A;  4M75 A;  2BE7 D;  1ZSZ B;  4ELZ C;  4LUD A;  1N8R R;  4L59 A;  2EWN A;  2C0T A;  3EHR A;  2CT4 A;  2EJ9 A;  3JCM b;  2JTE A;  1OX8 A;  2DL7 A;  2M0O A;  2OJ2 A;  2XDD A;  2YDL A;  2ZPH B;  5GJV B;  4EMG A;  4EMH A;  3QZ9 B;  3HRS A;  1NYG A;  1PSE A;  1VQL A;  2KY9 A;  3H0H A;  4HXJ A;  3Q1J A;  5GAN 5;  1VOM A;  2CH4 W;  2A36 A;  3SB2 A;  4C5I A;  2XDB A;  2NLU A;  2WSE E;  4C92 E;  4PJO C;  5HCK A;  1GBQ A;  2K3X A;  4EMK C;  1X6O A;  2K5L A;  4C5G A;  3JB9 H;  1FMV A;  3KXT A;  1M2V A;  4BI8 B;  3VV0 A;  2EYY A;  4FYV B;  4CC2 A;  3OYE A;  3CCS A;  3TU4 K;  2VC8 A;  2EKO A;  3RUX A;  2QDL A;  2X4X A;  2O9V A;  2VB6 A;  4KH0 B;  2DF6 A;  2EQU A;  5AT1 B;  2XI9 A;  4DBR A;  4FU6 A;  4XU3 A;  4F7U B;  1VQ9 Q;  3EGX B;  5KYU B;  1VQ8 T;  4N0A C;  2JMC A;  4ZN1 A;  1LPL A;  2IPO B;  5DM7 R;  1U1S A;  1G83 A;  2KRN A;  4KGZ B;  4QW2 A;  2RI5 A;  1I81 A;  2GTO A;  2AKK A;  4RG2 A;  5HY6 A;  4C8Q G;  1YN8 A;  2XG8 D;  5GAO n;  2D8J A;  5A0D A;  7AT1 B;  1M3B A;  3PTA A;  3MKD A;  5GAN e;  2X9H A;  4OF1 A;  2OTJ T;  2JTF A;  3LH0 A;  4RMO A;  4IIM A;  1HD3 A;  4C92 D;  1ZSG A;  4OP0 A;  2V8J A;  2HZY A;  2RHU A;  2JMA A;  1Y07 A;  1HXD A;  3C0C A;  4E2F B;  2LNV A;  1X69 A;  2YUO A;  2F2V A;  3VS4 A;  3OA6 A;  2CUB A;  3RBB B;  4QVC A;  1VQK A;  4AT1 B;  2ECZ A;  2FZG B;  3EH2 A;  5LJ5 f;  2JOY A;  3I56 Q;  2FEI A;  4MMK A;  2GTJ A;  3VS6 A;  4PL6 A;  1SPK A;  2SEM A;  2R58 A;  4BY6 B;  2OTJ A;  2XDP A;  2CSI A;  1YJW Q;  2HKQ B;  1Q82 C;  1GRI A;  5LJ5 j;  2DJZ A;  1YCS B;  2BKD N;  4A4G A;  1YHQ T;  1GCQ A;  3UA6 A;  4BE0 A;  2Y4X A;  2Y4Y A;  3UAT A;  4RG8 A;  3FIF A;  1RAD B;  4IKF A;  2RQT A;  5GAO m;  3I35 A;  4ZTF A;  2AK5 A;  3RES A;  2VUB A;  2XID A;  3UT1 A;  4DBH A;  4FCY A;  1UB4 A;  3HL8 A;  3RR6 A;  3CCR Q;  2KYB A;  3QDR B;  1YIJ T;  1YIT Q;  1FMW A;  4QQD A;  1BB9 A;  3CCL T;  3CCV T;  2KRM A;  1QMC A;  1YI2 T;  3EFO B;  4LDY A;  1X43 A;  3O8V A;  3IQL A;  1GFC A;  1YHQ A;  1E6G A;  2JNG A;  2RH2 A;  2KT8 A;  3G7Z A;  4XTX A;  3CQT A;  1VQM Q;  3A5Z B;  5I2S A;  4RTT A;  3JCM d;  1MHN A;  1QCF A;  2FHD A;  2RJD A;  3REB B;  3O5Z A;  1UDL A;  3EGU A;  2COW A;  2HSP A;  3MCA B;  1WGS A;  3HRT A;  2RN8 A;  1Y57 A;  3I5R A;  3L2R A;  4FW2 A;  4QQG A;  2K79 A;  2MWO A;  1YIJ A;  2FPE A;  2XU8 A;  4Z02 A;  3RMS A;  4J6X A;  2CT3 A;  2YLB A;  4FYX B;  3CCL A;  3CCV A;  1VYU A;  2W10 A;  2G3R A;  1YI2 A;  1VQN Q;  4ZTJ A;  4BDY A;  2JN0 A;  4BDZ A;  2DYB A;  2K4Y A;  4KUL A;  3CC4 T;  1WDX A;  1D1B A;  4A4K A;  4AMC A;  1QKX A;  2L0A A;  5LJ3 d;  2RNA A;  2YUQ A;  4X9C A;  4PNO A;  1M90 R;  4M78 B;  5D7U A;  2J7I A;  3QKJ A;  3DLL A;  3FDR A;  1KQS S;  1P92 A;  5LJ5 h;  4Y28 E;  2DAQ A;  2O31 A;  2DA9 A;  3VUB A;  4OMM A;  4PJM A;  3GOX A;  1T3L A;  1D1A A;  2BZ8 A;  3FB9 A;  4MZP A;  3X24 B;  1QVF S;  2BUD A;  3CCQ Q;  4E7S A;  3OBW A;  2HNI A;  3CCE Q;  2CP3 A;  2GNC A;  3CC4 A;  3JCM f;  3GP8 A;  4RTZ A;  1GCP A;  4QT7 A;  4DBQ A;  4YTL A;  4DOV A;  3L2W A;  4ESR A;  1EZZ B;  3J81 E;  1QCN A;  1WJS A;  4K11 A;  1WXB A;  1RI0 A;  2DBM A;  1SRL A;  2DKG A;  5D6W A;  1JO8 A;  4OB0 B;  4DEY A;  1OZ3 A;  4LD6 A;  2C06 A;  2QEX A;  2XMF A;  4KUI A;  4Z8A A;  3FRN A;  1CKA A;  2H3E B;  4BAC A;  5GAN j;  3CPW S;  5I11 A;  2QA4 T;  2LJ3 A;  4M77 B;  3PIP A;  3VS7 A;  1G2B A;  3X26 B;  5FU6 B;  5LJ3 f;  1K73 C;  1PC0 A;  1ZX6 A;  3F70 A;  2HBW A;  3T9N A;  3MP6 A;  4JJC A;  2ABL A;  1B7T A;  1BI2 A;  3QZ5 B;  4NL3 A;  1AEY A;  2L89 A;  3INZ A;  4MML A;  4XTW A;  3EHQ A;  3L2Q A;  1G3S A;  1K9M U;  2KMT A;  2FRY A;  1PM3 A;  4NL2 A;  5A0L A;  1VQ4 Q;  4BUG A;  3CCJ T;  3E1S A;  2EQM A;  2DZC A;  1KQ2 A;  2DEQ A;  2CP2 A;  2ZZD A;  4WTO B;  3JCM Q;  4RCC A;  3G71 T;  1R8O B;  2E10 A;  4JJN K;  2QQB A;  3SWN A;  3NGP A;  2E70 A;  1NG2 A;  5KCH A;  4XTY A;  3VRY A;  3PMI A;  4FIB A;  3LWH A;  1WI7 A;  1KJW A;  4M75 B;  5J3B A;  1YJN Q;  4ZGJ B;  1EFN A;  4BE1 A;  1XQH A;  3CCJ A;  1MMA A;  3CCU T;  1M3A A;  1SHF A;  3M53 A;  2VXE A;  3HFN A;  1C1A A;  1QVG A;  1D3B B;  1C6V X;  5L8R E;  2RD1 A;  3VYH B;  5CK9 A;  4DA4 A;  1PRM C;  2LX9 A;  1YJ9 Q;  4C92 A;  4DOW A;  2E3H A;  2LCC A;  3VU3 C;  1NLP C;  2LQW A;  5I2M A;  3CC2 Q;  1M8M A;  1K0X A;  4M77 G;  3EGD B;  1R0B G;  3LX7 A;  4LDU A;  4C0D C;  1B34 A;  4JRQ A;  1M30 A;  1RI9 A;  4HCB A;  1T0J A;  1H92 A;  1TXQ A;  2RHZ A;  1AZG B;  4J5Y A;  1U8R A;  2KYM A;  3CD6 A;  1RLQ C;  2CZ1 B;  4BI3 A;  1IGQ A;  1PWT A;  5LJ3 h;  1QLY A;  2K2M A;  3JAM E;  3CXC S;  2H3J A;  3UWN A;  2LP5 A;  3QYG B;  3OYB A;  3G6E T;  2LJ1 A;  2KXC A;  3G4S Q;  2IG0 A;  3CCM T;  2ZPI B;  5GAN g;  2K6D A;  1G3T A;  2KSS A;  5HK0 A;  1IB8 A;  2QTX A;  4PLI A;  1S72 T;  3EH1 A;  2KE9 A;  2QAZ A;  5IXF A;  4PFP A;  3A8M B;  4JPB W;  4RUG A;  1WIE A;  1JJ2 S;  3CBP A;  2EFI A;  4CC7 A;  3DB3 A;  4HCC A;  2J6F A;  4C8Q F;  3MEV A;  1IO6 A;  1D0Y A;  1N5Z A;  2DK3 A;  4CC4 B;  2LTO A;  2DLP A;  5IT9 E;  4DQ2 A;  3G6E A;  3JCM W;  4LDV A;  3M54 A;  1VQO A;  1W70 A;  4M7A C;  1WX6 A;  1OYX A;  1N9S A;  3CCM A;  3CME T;  4M7D F;  2DNU A;  2DTH A;  3OYC A;  5KE2 A;  1K1Z A;  4PJO B;  2O4X B;  1PNJ A;  1LJO A;  4FT2 A;  4EMK B;  2FYK A;  1VQ5 Q;  4E7J A;  1HSQ A;  5CKD A;  4C0F A;  1Q82 R;  1UHF A;  2QXF A;  1Y96 B;  2CH4 A;  3EG9 A;  3P8H A;  2G6F X;  2E6Z A;  2EVR A;  1X2K A;  1SSF A;  4ANJ A;  1AT1 B;  2YLC A;  5KYW B;  3LH5 A;  3X20 B;  4C8Q E;  5EG2 A;  1S1N A;  3OYJ A;  2VWF A;  3ME9 A;  2LCL A;  1MMG A;  4C5H A;  4XTU A;  4RTU A;  5CR2 A;  1PCX A;  4B9W A;  1VQ7 T;  2JT4 A;  2D9T A;  2KXD A;  2V8K A;  1BYM A;  3FLG A;  4F7U F;  3MPU B;  3RIR A;  2LVM A;  1TUG B;  1U06 A;  1VYT A;  1FXX A;  2O2O A;  2OTL Q;  1EIF A;  3BW1 A;  4J6W A;  3GPL A;  4IUV A;  4OB3 B;  2DIG A;  1KC8 U;  3EFR A;  1YCY A;  3I55 T;  2VV5 A;  3M59 A;  2EGE A;  1I1J A;  1Q86 U;  1RAF B;  1WZO A;  4AFS C;  3MP8 A;  4ZNX A;  4L6V 5;  3NHN A; 
#chains in the Genus database with same CATH homology
 2F2V A;  2P4R A;  3NMZ C;  4AFU C;  2EQI A;  3VS4 A;  2CUB A;  1V1C A;  2A37 A;  3RBB B;  1XOV A;  2ECZ A;  4AG1 C;  4Z89 A;  1UHC A;  2FEI A;  2L3S A;  2GTJ A;  3VS6 A;  2LZ6 B;  2F2W A;  1ZBJ A;  1VA7 A;  1SPK A;  3QWX X;  3U23 A;  2MOX A;  1ZLM A;  2SEM A;  4JJB A;  4F14 A;  2CSI A;  1GRI A;  2I0N A;  3M0Q A;  5IXB A;  1YCS B;  3QWY A;  1GCQ A;  2DL8 A;  3UA6 A;  2KT1 A;  3UAT A;  4F16 A;  2CDT A;  1JEG A;  2JW4 A;  1JQQ A;  2D1X A;  2RQT A;  1WXT A;  3NPF A;  2JXB A;  2RQW A;  3GBQ A;  2KNB B;  4ORZ A;  3I35 A;  2AK5 A;  2LCS A;  2DMO A;  1YWO A;  1X6G A;  4E6R A;  4A63 B;  3H41 A;  3VS3 A;  2HEQ A;  5FWC A;  1JU5 C;  1Z9Q A;  2KYB A;  4OMQ A;  2EYW A;  2LMJ A;  1BB9 A;  1GL5 A;  2KRM A;  2LNH B;  3PVQ A;  1X43 A;  3IQL A;  1GFC A;  2J6K A;  1E6G A;  2VKN A;  2KT8 A;  3CQT A;  1NYF A;  4RTT A;  1GCQ C;  3VS5 A;  1QCF A;  2OI3 A;  1E7O A;  3REB B;  1OV3 A;  2A08 A;  1ABQ A;  4IIO A;  2CUD A;  2ED0 A;  3O5Z A;  1H8K A;  1UDL A;  3EGU A;  2HSP A;  4HVU A;  5FW9 A;  2RN8 A;  1LCK A;  1Y57 A;  2EBP A;  3I5R A;  2ENM A;  2RF0 A;  1ARK A;  2L3P A;  3I9Q A;  1QWE A;  1K4U S;  2K79 A;  2FPE A;  2JS0 A;  2FG0 A;  1YP5 A;  4CC3 A;  2CT3 A;  3PVL A;  1NEB A;  1VYU A;  2W10 A;  4X1V A;  3KFV A;  4J9G A;  3JV3 A;  2DYB A;  3FJ5 A;  3RNJ A;  1WDX A;  2ROT A;  2A28 A;  1QKX A;  2L0A A;  1ZUU A;  2RNA A;  2YUQ A;  2HCK A;  3TSZ A;  4LUE A;  1FYN A;  2J7I A;  2KRO A;  2SRC A;  1I07 A;  1UFF A;  2PZ1 A;  2YUN A;  2K9G A;  2OAW A;  2KBT A;  2O31 A;  1M27 C;  2DA9 A;  4OMM A;  2ESW A;  1T3L A;  2BZ8 A;  2RQU A;  3TSW A;  5GJW B;  1K76 A;  4J9D A;  2GQI A;  2K7A A;  2LJ0 A;  2KEA A;  2O9S A;  2GNC A;  2RQV A;  2GBQ A;  1U3O A;  4LN2 A;  4RTZ A;  1GCP A;  4QT7 A;  4ESR A;  1MV0 B;  1X2Q A;  5EC7 A;  1RLP C;  2GGR A;  1PHT A;  4D8D A;  3M0U A;  4LNP A;  1PKT A;  4K11 A;  1UGV A;  1WXB A;  1HJD A;  2DBM A;  1SRL A;  2AZS A;  2EGA A;  1JO8 A;  2DBK A;  4DEY A;  2KR3 A;  2XMF A;  3ULR B;  1SSH A;  4Z8A A;  1CKA A;  1W1F A;  2V1R A;  2MIO A;  4EIK A;  3M0R A;  4HVV A;  3VRZ A;  4FSS A;  5I22 A;  5I11 A;  2LJ3 A;  1SEM A;  4RTW A;  1M3C A;  1I0C A;  3VS7 A;  1G2B A;  5IHI A;  1FMK A;  1MV3 A;  2JS2 A;  2RPN A;  1ZX6 A;  4GBQ A;  5IHK A;  2HBW A;  2DJQ A;  4JJC A;  2ABL A;  2X3X D;  1AEY A;  5IH2 A;  1T0H A;  1KSW A;  3EHQ A;  1RUW A;  2KRS A;  2FRY A;  4LE9 A;  1CSK A;  1AWJ A;  1YWP A;  5ECA A;  2PTK A;  1WXU A;  2M51 A;  1AWX A;  1K0S A;  1X6B A;  3UF4 A;  3H0I A;  4JZ3 A;  1W6X A;  1SRM A;  4OMO A;  2JM9 A;  3NGP A;  2H8H A;  2HDA A;  3PE0 A;  3VS0 A;  2EYZ A;  1NG2 A;  2BZX A;  1UEC A;  3VRY A;  1AZE A;  2C0O A;  1AWW A;  2E5K A;  1WYX A;  1WI7 A;  1KJW A;  1TUD A;  2ED1 A;  4KRT A;  1PKS A;  2D8H A;  2LX7 A;  4WCI A;  4AFZ C;  1EFN A;  1UTI A;  2W0Z A;  2NWM A;  4M4Z A;  2CRE A;  2J05 A;  4OMN A;  2KGT A;  1NM7 A;  1ABO A;  4OML A;  1M3A A;  4J9E A;  1SHF A;  1AD5 A;  4AG2 C;  4D8K A;  2FO0 A;  2DIL A;  1OPK A;  2D0N A;  3R6N A;  3VS2 A;  1PRM C;  4JZ4 A;  1AWO A;  2EW3 A;  1SHG A;  3EG0 A;  1CKB A;  2V1Q A;  2BTT A;  2J06 A;  2AZV A;  1NLP C;  1E6H A;  2LQW A;  1B3Q A;  4AFQ C;  1H3H A;  1M8M A;  1WLP B;  1K0X A;  2FRW A;  4JJD A;  1NLO C;  1AOJ A;  1UUE A;  2DM1 A;  1TUC A;  2CSQ A;  1T3S A;  1PRL C;  2EKH A;  1B07 A;  1J3T A;  2DVJ A;  1M30 A;  1RI9 A;  1GBR A;  1T0J A;  1H92 A;  1AZG B;  5L23 A;  2B86 A;  1KFZ A;  3I5S A;  2KYM A;  2YUP A;  1RLQ C;  2AKL A;  3SEM A;  1UJY A;  1PWT A;  1JXO A;  1QLY A;  2K2M A;  2FPD A;  1VYV A;  1ZUK A;  1WA7 A;  2EPD A;  4OMP A;  4HVW A;  2EGC A;  3H0F A;  2C0I A;  2LP5 A;  2LJ1 A;  2KXC A;  3THK A;  4Y92 A;  3A98 A;  3UA7 A;  4GLM A;  2RMO A;  1Y0M A;  2BZY A;  3REA B;  2DL5 A;  5FWB A;  2EYX A;  2L2P A;  2K6D A;  1WFW A;  2VVK A;  5IHN A;  2KE9 A;  5IXF A;  3M0P A;  2FPF A;  1BU1 A;  4JPB W;  4RUG A;  1WIE A;  2IIM A;  2MCN A;  4CC7 A;  4DEX A;  2J6F A;  1K9A A;  1JXM A;  4LUD A;  1IO6 A;  1N5Z A;  2C0T A;  3EHR A;  4CC4 B;  2DLP A;  2CT4 A;  2DRK A;  2JTE A;  2DL7 A;  1ZUY A;  2OJ2 A;  1UJ0 A;  1W70 A;  2YDL A;  1WX6 A;  5GJV B;  2ROL A;  2DRM A;  3EG2 A;  2NUZ A;  1NYG A;  1UE9 A;  4RTY A;  2DNU A;  3ZL7 C;  2K3B A;  3H0H A;  1K1Z A;  1OEB A;  2L3Q A;  4HXJ A;  1PNJ A;  2X3W D;  2LQN A;  2CH4 W;  2A36 A;  2DE0 X;  2DX1 A;  4R0K A;  1HSQ A;  3EG1 A;  5HCK A;  1GBQ A;  1UHF A;  4J9B A;  1BBZ A;  4RTX A;  2JM8 A;  4J9I A;  2DL4 A;  4RTV A;  2CH4 A;  2O88 A;  1YNZ A;  1MUZ A;  2RQR A;  2EYY A;  2G6F X;  3M0S A;  4CC2 A;  2EVR A;  3SHW A;  4Z88 A;  2QDL A;  1X2K A;  1QKW A;  4J9C A;  2O9V A;  2DF6 A;  3TVT A;  3LH5 A;  4J9F A;  2J6O A;  3M0T A;  1S1N A;  2VWF A;  4J9H A;  2PNI A;  3VS1 A;  1X27 A;  4F17 A;  4RTU A;  2JMC A;  1TG0 A;  2DL3 A;  1OPL A;  4HCK A;  2YT6 A;  1G83 A;  2JT4 A;  2KRN A;  3EG3 A;  2KXD A;  2GTO A;  1Z9Z A;  2AKK A;  1YN8 A;  2D8J A;  1M3B A;  2F2X A;  2YSQ A;  1A0N B;  1U06 A;  1VYT A;  1KIK A;  2O2O A;  1OOT A;  4IIM A;  1HD3 A;  1BK2 A;  2M0Y A;  1ZSG A;  1AVZ C;  1GFD A;  1NEG A;  1QWF A;  1U5S A;  2EGE A;  2JMA A;  1I1J A;  1UG1 A;  3C0C A;  1X69 A;  4AFS C;  2YUO A;  4ZNX A;  3NHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...