2ROTA

Structure of chimeric variant of sh3 domain- shh
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the chimeric SH3 domains, SHH- and SHA-"Bergeracs".
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Spectrin alpha chain, brain
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rotA00
1HJDA 2C0IA 5HCKA 1RLQC 3LH5A 4R0KA 1AWJA 2L3SA 1OOTA 4JJCA 2LJ1A 3M0RA 5IHNA 1TUDA 2F2WA 2PTKA 2K6DA 1AWWA 2AZVA 2FEIA 4JJDA 1B07A 3RBBB 1JXOA 2JW4A 3M0SA 3EG2A 1X27A 3UA6A 2MIOA 1GFCA 2KYBA 1B3QA 4OMMA 2A28A 4DEYA 4OMPA 1T0HA 1Y57A 1RI9A 1I07A 2A36A 3NPFA 4JPBW 2ED1A 1OEBA 1UTIA 2LQNA 2YUQA 2EYZA 3REBB 4OMQA 2DRMA 5I11A 1YNZA 2DL5A 2RQVA 3FJ5A 2CSIA 1KIKA 2J6KA 4A63B 1BB9A 1I1JA 1QCFA 4AFQC 2F2VA 2DJQA 3VS5A 1JO8A 2CH4A 1HD3A 2DL3A 4FSSA 1WDXA 1NYFA 2L2PA 1NEBA 1IO6A 1WI7A 1CKBA 2YUNA 4RTTA 2VKNA 2LNHB 4LUEA 3I9QA 4J9BA 4KRTA 1T3LA 2LZ6B 2JM8A 2EGAA 1H8KA 4HCKA 3VRZA 2YUPA 2KYMA 1GCQA 2ROLA 3EG0A 2HSPA 2M51A 2GBQA 1GBQA 2GTJA 2J6OA 1SRLA 1NM7A 2FO0A 1K1ZA 1GFDA 2XMFA 1SHFA 1Z9QA 1MV0B 2KGTA 2KR3A 5IHKA 2LQWA 1M30A 1K4US 1MUZA 3C0CA 2O2OA 2KT1A 4IIOA 4E6RA 2DMOA 3O5ZA 1N5ZA 2DE0X 4RTWA 2DRKA 4JJBA 1BU1A 1VYTA 2B86A 2EYXA 2C0TA 2EKHA 3KFVA 2W0ZA 2O9SA 2EYYA 1T3SA 2FPDA 4J9IA 4Z88A 1UJ0A 1UE9A 2EGEA 4ESRA 1SEMA 1WYXA 2ABLA 1ABOA 1K76A 2P4RA 1V1CA 4EIKA 1VYVA 2YT6A 4JZ4A 1YP5A 3PE0A 2OJ2A 1PKSA 2IIMA 2ED0A 2JT4A 4GLMA 1YWPA 3M0TA 2AKLA 2GQIA 4LNPA 5FWBA 1H92A 2D0NA 2KROA 2X3XD 1YCSB 4RTVA 4J9FA 4ORZA 1BBZA 2L3QA 4HVUA 1SHGA 3A98A 1AWXA 4LN2A 2FRWA 3NHNA 2X3WD 3EHQA 2YSQA 1I0CA 2EVRA 2DILA 3VS7A 2ENMA 3EHRA 2F2XA 4LUDA 2DNUA 4ZNXA 2CUBA 1OPKA 1PKTA 1U3OA 4RTZA 2K2MA 2A37A 4OMNA 1K0XA 2CDTA 1KSWA 1JU5C 4HVWA 2DBMA 1E6HA 2AKKA 1X6GA 1RLPC 1CKAA 5IHIA 3I5RA 4AG2C 3EG1A 3QWXX 1OV3A 2J6FA 3I5SA 3UATA 2D1XA 2KE9A 1LCKA 5IXBA 2CT3A 4J9EA 4CC7A 4CC2A 1AZGB 2KRNA 1M27C 3U23A 2LJ0A 2BZXA 2D8JA 3PVLA 3THKA 2ROTA 1PRLC 1XOVA 1SRMA 3SHWA 5ECAA 3ZL7C 3TSZA 2LX7A 1FYNA 2KT8A 1WFWA 3RNJA 1WX6A 1U5SA 1AWOA 1SPKA 1NYGA 2DYBA 2BZYA 3UF4A 2I0NA 1CSKA 2VWFA 4K11A 4J9HA 1TG0A 1WXUA 2O9VA 1E6GA 1Y0MA 2EW3A 2K9GA 2O31A 2DX1A 1UHCA 4HVVA 2FPFA 1GCQC 2CT4A 1AOJA 1RUWA 3REAB 2G6FX 3H41A 2JTEA 4J9DA 2KBTA 2K79A 2DL7A 4D8KA 2FG0A 2GNCA 2J06A 1VYUA 1WXTA 1AVZC 4OMLA 4JZ3A 3QWYA 2DLPA 2BTTA 1ZUKA 1ZSGA 2EGCA 2PZ1A 1PWTA 2GGRA 2K7AA 2LP5A 2LJ3A 1EFNA 4WCIA 2KNBB 4F17A 4J9GA 1YWOA 3R6NA 3NMZC 3NGPA 2OI3A 2DL4A 1UUEA 2O88A 4QT7A 4X1VA 2RN8A 2DL8A 1W6XA 1M3BA 3EGUA 1AEYA 4OMOA 4Z8AA 1T0JA 1ZUYA 2LMJA 2DA9A 1QWFA 2JM9A 1JQQA 2HDAA 3H0IA 1AZEA 3VS0A 1ABQA 4GBQA 3SEMA 2AK5A 1GRIA 4AFZC 2DBKA 2W10A 3TSWA 1G83A 1NG2A 2L3PA 3JV3A 2SEMA 2K3BA 1UG1A 1AD5A 1GCPA 2E5KA 3VS1A 1ZLMA 1A0NB 1WA7A 2EQIA 2DVJA 2KEAA 2KXDA 4AG1C 1VA7A 2EYWA 1X43A 1QKWA 1UJYA 1QWEA 4RTYA 2ECZA 4CC3A 5FWCA 2HEQA 4RTXA 2MCNA 3M0UA 4F16A 2HBWA 2KRMA 3M0PA 1G2BA 1HSQA 3VS4A 1W70A 1Z9ZA 2NUZA 1QKXA 3EG3A 1SSHA 1WXBA 2JMAA 2RQUA 2CREA 2LCSA 1K9AA 2GTOA 2VVKA 1GL5A 1PNJA 2EBPA 4J9CA 1UECA 2RF0A 1UFFA 5FW9A 5GJWB 1U06A 1K0SA 2J7IA 5I22A 2HCKA 4HXJA 2AZSA 2A08A 2JXBA 1KFZA 2V1QA 2FPEA 3I35A 2CH4W 2RQRA 1NEGA 1E7OA 5EC7A 3VS3A 2RQTA 1ZUUA 2RMOA 4IIMA 4Z89A 3TVTA 1J3TA 1GBRA 1YN8A 2L0AA 3VS2A 1UHFA 3H0FA 1M8MA 5IXFA 2QDLA 3H0HA 3ULRB 2ESWA 4CC4B 4F14A 1X69A 2FRYA 2JS0A 3M0QA 1H3HA 1S1NA 2V1RA 1BK2A 1UGVA 2OAWA 2M0YA 2J05A 2YDLA 4LE9A 3IQLA 1PRMC 2PNIA 3VRYA 1JEGA 2JS2A 4AFSC 2YUOA 2H8HA 2DM1A 1UDLA 3VS6A 2MOXA 1WLPB 2CUDA 4AFUC 1WIEA 4RTUA 1M3AA 1X2QA 2KRSA 1PHTA 1JXMA 2JMCA 2RQWA 1W1FA 5GJVB 2D8HA 1MV3A 1NLOC 1ZBJA 2BZ8A 3PVQA 2CSQA 5IH2A 2EPDA 4M4ZA 1FMKA 3CQTA 1KJWA 1QLYA 5L23A 1X6BA 1TUCA 2C0OA 4DEXA 1X2KA 4RUGA 1M3CA 1NLPC 2NWMA 1ZX6A 1OPLA 3UA7A 2DF6A 2KXCA 1ARKA 2RNAA 2SRCA 3GBQA 4D8DA 4Y92A 2RPNA
chains in the Genus database with same CATH superfamily
2PUOB 2VC8A 2C0IA 3E19A 4QQGA 4QVZA 5IAYA 3CCVA 3LH5A 4IUUA 1NPRA 4R0KA 4KH1B 1OOTA 1TUDA 4M7DA 4R56A 2PTKA 2AZVA 3BDUA 1PD1A 1JXOA 3VUBA 1N6AA 3EG2A 2EQUA 1B3QA 3CCQT 5HKCA 4M7AF 2QTXA 2LX9A 1T0HA 1RI9A 1I07A 3NPFA 1U1TA 2NUTA 4J7IA 1B34B 2QQSA 2DRMA 3SWNA 4ZN1A 4M75G 2RB6A 5D6YA 1WHGA 4A63B 4CI0C 4L5GA 2F2VA 3UPUA 1HD3A 1QCNA 1WDXA 1OQKA 5DM7R 1NYFA 3PTAA 4AT1B 3L1AA 2L2PA 2YUNA 3JCMc 2VKNA 3G4SA 3BDLA 4DBQA 4PJOD 3I9QA 2VYTA 4ZTJA 3GIBA 4FCYA 4QVCA 4OB0B 2JM8A 3CCQA 5FU7B 3CD6T 1VQOA 4LDYA 3CC7Q 3FB9A 3VRZA 1OZ3A 4A4KA 1MNEA 2EQJA 3CCUT 3DKMA 1K9MU 2QTVA 4AMCA 2HSPA 2COZA 2GBQA 2GQVA 1SRLA 3OMCA 4OB2B 1ZSZB 2ZPHB 1GFDA 3CC2Q 1SHFA 1KK7A 1Z9QA 4MZPA 3EFSA 1MV0B 2LQWA 4J6YA 4IIOA 4E6RA 1ZQ1A 3O5ZA 5KYYB 3X20B 1WGSA 3D7SB 1VYTA 2HL5C 3JCMh 1OULA 2P84A 1O9SA 2B86A 3QBYA 2C0TA 4BI3A 3MP1A 3OY9A 4J9IA 5CKDA 2FHDA 3M57A 2EGEA 3A8HB 1JJ2A 2ZZDA 1SEMA 1QCOA 3OYNA 3CCJQ 3WXMB 1Q82R 4EIKA 1VYVA 2YT6A 3CCRT 1B34A 2L89A 4BI8B 2DTOA 2OJ2A 1PKSA 4DBFA 3HKSA 1K73U 1YWPA 1FXXA 1VQNQ 4M78G 1H92A 3EH2A 3G7ZA 2X3XD 4ZTFA 1PSEA 1KQSS 5GAOr 4RTVA 1SKUB 2L3QA 2E64A 1WQ7A 1YJWT 5LJ3h 4LN2A 4A4FA 3NHNA 3C12A 2X3WD 3CCST 1JJ2P 1KC8U 1I0CA 1M90C 2LRQA 2QQBA 2DILA 4WTOB 2CP3A 2VXFA 4B6MA 4LUDA 1M1KR 4X9DA 4LDVA 2B8AA 2OTJA 1U3OA 1D3BB 4PJMA 2A37A 4OMNA 4VUBA 2PVGB 2CDTA 3C4SA 3MP6A 1X6OA 5FRNA 4XTZA 2QG9B 4LDXA 1RAHB 1M1KU 1QVFA 2DBMA 2X35A 1IZ6A 1VQOT 2AKKA 3I5RA 4M78B 1OV3A 1XNIA 2J6FA 1IXDA 2D1XA 2KE9A 2CT3A 4M77D 4EMKA 4J9EA 2KAFA 1IB8A 2KRNA 1M27C 1WJRA 2BZXA 1KD1C 2ZPIB 1C6VX 1G3WA 1PM3A 1KD1U 2MMPA 3NTIA 1QP2A 2QQRA 4M75E 1PRLC 3E9FA 1TUGB 3MEWA 1XOVA 1VQ9A 2D6FA 4PNOA 3SHWA 3TSZA 2LX7A 3Q1JA 3AHUA 3RNJA 2YHTA 1XTDA 1WX6A 4FT4A 4FT2A 4XU1A 2BZYA 1CSKA 2VWFA 4K11A 4C0DB 1B7TA 2RJCA 2O9VA 1E6GA 2P0PA 3M55A 2K9GA 3V8KA 4TVRA 4JLIA 4F7UF 2EQMA 3H41A 2VV5A 4J9DA 5A0GA 2RHUA 2CZ0B 2KY9A 4F7UE 5HK0A 3VU3C 1VQ9Q 4FYVB 1MNDA 2EGCA 1Q81R 2DO3A 2LP5A 1P92A 2LJ3A 2LTOA 4M77B 1NBEB 3M53A 4C5GA 3S3MA 3E1SA 4F17A 1Q81C 4ELZC 1D1AA 3EFOA 4OVAA 1YWOA 3G6ET 1VQ6A 1NE8A 2DL4A 2EIFA 4X1VA 2R5AA 3OYGA 1AT1B 4BE2A 2LC4A 3EGUA 2K5IA 2XICA 3KUFA 2RHYA 3G6EA 3OBYA 2DA9A 2JM9A 3GOXA 2O4XB 1UGPB 2HD0A 3HRUA 5LJ5d 5GAOl 1S72Q 1ABQA 4GBQA 2V26A 5CCAA 3M9QA 3H6ZA 1VQLT 1G83A 2L3PA 3SWNB 4D6WA 2SEMA 5C0MA 1UG1A 4NS5A 4E47A 1MMGA 3OW2A 3KBGA 2R5MA 3VS1A 1ZSZC 2L5QA 4XU0A 1RAIB 2DVJA 4M77G 2CS7A 2KXDA 1VQMQ 4BACA 4AG1C 1VA7A 4LD9K 3FC3A 5KYYA 3LLRA 3HFNA 4RTYA 3INZA 2DERA 1VQ4Q 5J3BA 3V8LA 3CCLT 1M2VA 4OGEA 2HEQA 2BKDN 4RTXA 2MCNA 3DB4A 3JSCA 3CMET 2CZ1B 1VQ8Q 5GAOn 3EG3A 2QQAA 3N5BB 1SG5A 2LCSA 2CP6A 2GTOA 1GL5A 4E7HA 2EBPA 3DLLA 3OS0A 4J9CA 1UECA 3GLXA 2QDYB 5FLXE 1K0SA 1Y96A 4B9WA 3V7RA 2JXBA 3I55A 1KFZA 3PIOA 1E7OA 4PL6A 4L6V5 3CXCP 1ZUUA 9ATCB 3GP8A 1J3TA 1GBRA 2L0AA 3VS2A 3TCJA 4BDZA 5M9OA 3H0HA 4CC4B 5GAN3 3CC2A 1SF9A 2DD4A 3AT1B 2FRYA 2V1RA 1N8RR 3FEOA 4ATOA 1N9RA 3VUZA 2J05A 2YDLA 4LE9A 3RDVA 1JEGA 2JS2A 4HKEA 3CCRQ 1N8RC 4F7UA 4EMKC 3M54A 4WF2A 2X4JA 1Q7YC 4L59A 1IHVA 5CKHA 1VQKA 3LYIA 3HPWA 2QXFA 2JMCA 5FROA 2RQWA 2E12A 3OSSC 2D8HA 4XTVA 1DJ7B 4M4ZA 3JB9G 2K4YA 2A3LA 1KJWA 3LH0A 1QW1A 1VQMT 3O8VA 3META 1M3CA 1ZX6A 5LJ5j 4FL6A 3GBQA 1XQHA 4HCBA 2RPNA 4LDUA 2JJ9A 2NUPA 1D1CA 1PD0A 4X9CA 2LJ1A 3V7CA 1RAFB 2F2WA 2WACA 2XG8D 4FU6A 2A0FB 3RBBB 3WVEB 4M77E 4A4GA 2CZ6B 2KYBA 4BUGA 4XU3A 3L2RA 2XDBA 5HK3A 3MKDA 4JPBW 1VQPQ 1Q82U 2EAYA 4PJOA 4EMKB 1QVGP 2YUQA 2OTLQ 4KBMB 2FVUA 5I11A 4M78A 1YIJQ 2O01E 3QKJA 2F1LA 4JLGA 1KIKA 5KYXB 1BB9A 1QCFA 2H3JA 1OU8A 1LNXA 3MEUA 2DJQA 2CH4A 2RI5A 2NUPB 4FSSA 1YHQQ 2DIQA 2E6ZA 4JRIA 5HY6A 4PJLA 1VIEA 2MAMA 1ACMB 1CKBA 3X25B 3JCMP 4KRTA 2QGFB 3QXEB 4C0GA 2EGAA 2YLBA 5AT1B 4J6WA 1IHWA 4HCKA 4C8QD 3JB9F 4KGVB 3QDRB 2BE9B 1VQ8T 2ROLA 1EIFA 5GAOm 4PLIA 3EG0A 4M7DD 4BI4A 1OZ2A 3JB9D 4OB3B 2GTJA 4C8QE 4QVDA 4C8QG 2HAXA 4OMFB 2KGTA 5IHKA 2RI2A 4M78D 1K4US 3G71Q 5LJ3j 1MUZA 1I5OB 1TOVA 3C0CA 1UGRB 4RTWA 4HT8A 3PFSA 4N0AA 4OB1B 2RHZA 3CBOA 1UB4A 5GMKm 2DEUA 3G1JA 1PCXA 3CCJA 2DXUA 1T3SA 5GAN8 2FPDA 1YCYA 3JB9H 4ESRA 5LJ5f 5FRMA 2HMAA 2ABLA 3X28B 4C0FA 1K76A 2P4RA 3QJYA 3CMAQ 2RJDA 4M7DB 4IUQA 2GF7A 1LPLA 5CVIA 2ZGWA 3BY7A 1QP3A 5GMKh 3GNFB 2JT4A 4GLMA 1Q86C 4J5YA 5CO7A 1VQLA 1YBYA 4DBRA 2AKLA 3P8BB 4C5HA 1UEBA 4DQ2A 1M4ZA 4BE1A 4YTLA 1M9SA 2JVVA 2RK1A 4JS5A 4ORZA 3UWNA 3MEAA 3I56A 4N0AC 3A98A 1AWXA 5GANg 1M2VB 2CP5A 3CCEQ 4PJOE 4C92F 3EGDA 3G71A 2EVRA 2ENMA 1VQKQ 3QJ6A 1XJWB 1WHJA 3EHRA 2MI6A 2QEXQ 2DNUA 1IGUA 2QA4T 3SB2A 1K8AU 2JTMA 3MJXA 4MDWA 4RG2A 1OPKA 2FB7A 4GLKA 3EH1A 4Y91A 5CKEA 8AT1B 1W2BS 1KSWA 4A4EA 3C95A 5I2MA 2HQEA 3I55Q 1X6GA 1RLPC 4C8QA 2R58A 2CP0A 3I56T 2L8DA 1KD1R 3UATA 3M56A 4V2SA 2EWNA 4CC7A 4CC2A 4JS4A 1AZGB 3QIIA 3CPFA 1IGQA 2R57A 2LJ0A 3PVLA 1BCOA 4Z02A 1YJNQ 4Q5WA 5GMKi 1SRMA 2NYSA 3A8MB 2CZ7B 3ZL7C 1VQ6T 1FYNA 1U5SA 1AWOA 1SPKA 1NYGA 1KQ2A 1UGSB 2I0NA 5GAOq 1ZSZA 3TREA 4BDYA 3OYFA 2H3EB 1YJWA 2K3YA 2DX1A 4EPCA 4N4GA 3VYHB 3SWNC 1QQJA 2CT4A 1RUWA 4C92C 4X34A 1KQSA 2RJFA 2K79A 1C0MA 2GNCA 2J06A 1VYUA 5KE3A 4KT0E 4KGZB 1MMDA 5A0LA 3HL8A 1W2BP 2HQXA 2I2LA 2JN0A 5FU6C 1RAAB 2KNBB 1BKBA 3GNGA 3R6NA 3NMZC 4N4IA 4J7FA 2DJZA 4C0ZA 3A8LB 1OU9A 3HRSA 2VASA 1VOMA 2DL8A 2RO0A 1YI2A 2VB6A 4OMOA 1TWBA 1T0JA 4Z8AA 5KYUA 8ATCB 4ANJA 3ASKA 2QEXA 3BW1A 1H3ZA 2LMJA 3QZ5B 1Q7YU 2XDDA 4FW2A 1FX7A 3OYJA 1GRIA 4XU2A 4E7ZA 4RMOA 1OX9A 3I56Q 1NG2A 2V8KA 3OS5A 3MCAB 2E1HA 3OYMA 2XIDA 3CCEA 3EFRA 2AT1B 5GAMh 2IVWA 3A1PA 2KEAA 3PMTA 2FZGB 2WSEE 5FU6B 1QKWA 1BI0A 4BB7A 4IURA 4ELYC 3CPWP 3R6OA 2ECZA 3ZEHA 2XHCA 5GANe 4FSXA 3JCMg 1BYMA 3M0UA 4F16A 2CP2A 5CQXA 2X4XA 1W70A 4M75B 2MYSA 3H9NA 5J26A 3FJPA 1SSHA 1VQ8A 2RQUA 4XTUA 1F1BB 2FL7A 3OYCA 2RF0A 3CC2T 2M16A 4M7DE 3OYEA 4C8QF 5GJWB 3HRTA 2AZSA 3L2UA 2V1QA 2FPEA 2RA2A 2CH4W 2VXEA 5LJ5h 1VQMA 1IRXA 2FZKB 4IIMA 1O75A 1YN8A 3JB9J 3H0FA 1M8MA 1YHQT 2OX7A 5LJ3f 2JTFA 1LJOA 1H3HA 4HCZA 1I4K1 5L8RE 1BK2A 4M7AD 2OAWA 1MMAA 3IQLA 1PRMC 2PNIA 1M1FA 3EAEA 4AFSC 2CKKA 2WSFE 5KYWB 3VS6A 1I81A 3CCUQ 2DAQA 2MOXA 2XI9A 2DZ9A 5GAN2 5A0DA 4AFUC 1X2QA 2ZPFB 3M59A 2PVOB 1PHTA 3ZFJA 2KDSA 1W1FA 1MV3A 4XQ3A 2BZ8A 3PVQA 1K9MR 2EPDA 5GAMe 2OTLA 1C1AA 2NLUA 1QLYA 1M8VA 1X6BA 2C0OA 5KYUB 5FU7C 2EFIA 1Y7XA 4B9XA 1D1BA 3CC4A 3L42A 3NTKA 3QDFA 3UA7A 1M5Q1 2DXBA 3OYIA 2RNAA 1NJIU 4D8DA 1VQKT 4MMKA 1WQWA 4M78F 4LD6A 2K5FA 4Y92A 4C92E 4XTXA 2JUFA 5GAN6 1HJDA 2QA4Q 4N4HA 5GANf 2Y90A 3RMSA 2PQWA 5CR2A 1NPPA 3M0RA 5IHNA 2K6DA 2FEIA 4JJDA 3JCMV 5AYFA 1D0ZA 1B07A 3PNWC 2JW4A 3MO8A 3M0SA 3QYHB 1MGQA 1GFCA 1YJNA 4FYYB 2A28A 4OMMA 4BY6C 1G5VA 4E7IA 4OMPA 1Y57A 2ED1A 1QMCA 1Q86U 3E9GA 2WSCE 1HYOA 3OYLA 2RQVA 1S72A 1YIJT 4C5IA 1I1JA 4AFQC 3TU4K 4FW1A 3VS5A 1JO8A 4BY6B 5GAN7 3PGGA 2HNIA 5D6WA 4PKCC 3CD6A 2QASA 2LVMA 1NEBA 3G4SQ 4LUEA 1VQ6Q 2F5KA 3PIPA 3CD6Q 3CCLQ 1WNLA 2M1HA 3QSUA 4M75C 1SSFA 1YJ9A 4OP0A 3DLMA 3HP9A 5DLOA 2YUPA 2KYMA 3M4YA 1GCQA 2LQ8A 4A53A 1N8RU 1GBQA 2CGHA 5KYXA 4P5NA 1JB0E 1WHLA 2FO0A 1M2OA 1RABB 1KG1A 2RHXA 2Z0WA 3JCMW 5CIUA 3UT1A 3CC4T 1WJSA 4XTWA 3OSVA 2KR3A 3M5AA 1M30A 1VQ9T 2K57A 3H8ZA 1VQ7A 2BE7D 3A8GB 2KT1A 1LOJA 1OX8A 2DRKA 3WVDB 4XK8E 4PFPA 2EJFA 3OYDA 1M1GA 2RH2A 1VIFA 4GY5A 1RACB 2EYXA 1IREB 4PK4A 3CMAA 2QI2A 2W0ZA 2EYYA 4Z88A 1UJ0A 3CXCS 1N27A 1YI2T 3VKIA 1ABOA 3CCSA 2E65A 2KI7A 3CMAT 4IUPA 4ZGEB 2C06A 2MWOA 3PMIA 1EX4A 4JUVA 4M77F 3T9NA 2IPOB 2OAUA 1Q86R 4JZ4A 1YP5A 3PE0A 5GAMf 3NTHA 1FMVA 1S72T 2E41A 3RKYA 3RUXA 3MPUB 3GF5A 1RL2A 2GQIA 4LNPA 5GANd 4A54A 5FWBA 5KCOA 4QQDA 3RMQA 2KROA 2DTIA 3RKWA 2Y4XA 1YCSB 4C5EA 2COYA 1BBZA 4LXCA 4HVUA 2DXTA 1G8XA 1M90U 2RJEA 4IUVA 1VUBA 1VQ7Q 2DVEA 1I8FA 3VS7A 4M7AB 3G6EQ 2E10A 3CCUA 2F2XA 3HFOA 4ZNXA 2CUBA 4M7AA 3KXTA 3S3NA 1K0XA 1QVGS 3CPWS 1JU5C 4PJOC 2VUBA 2AHJB 3OYHA 5D7UA 2Y4YA 1CKAA 1VQOQ 4AG2C 3CCQQ 1VQNA 3QWXX 2DEQA 2RK2A 4ME7A 3I5SA 3QUIA 1ZA2B 3SDZA 4JRQA 1RADB 4JRKA 5LJ3e 4FYWB 5LJ3d 2XDPA 5LJ5g 2ROTA 4NL2A 5ECAA 3LWIA 1QVFS 3OMGA 5J39A 2DYBA 2EYQA 2LQKA 4CRIA 3CC7T 1JBMA 1Y0MA 4R55A 2M02A 3HTRA 2EW3A 4PJNA 3CMEQ 2O31A 5IN1A 6AT1B 1WHMA 4Y28E 4M78C 2KK4A 1U1SA 5KE2A 2G6FX 1AHJB 4KGXB 2JTEA 2MPXC 3JRZA 2QA4A 3F70A 4C0DC 2XU8A 4D8KA 2D9TA 2FG0A 1WXTA 2QGGA 1G3YA 4JJNK 1KHCA 2RI3A 2AIRB 4OMLA 4KUIA 4PJOG 5GANh 3EFOB 2GGRA 4PFZA 5KCHA 4WCIA 4PJOF 5CKFA 4C92B 2OI3A 2YRCA 2P0KA 2EJGA 2RN8A 1M3BA 4OGCA 1AEYA 1ZUYA 3UDCA 3JCMe 3JCMd 1JQQA 4ZGJB 5GMKe 5KYNA 2COWA 3VS0A 2OTJT 3ER0A 2MK5A 3S3OA 2OTJQ 2F5TX 2W10A 3JV3A 1BI1A 4MZTA 1G3TA 4J6XA 2GFUA 5GAMd 1GXIE 4MZMA 3FDRA 1HXDA 1FMWA 1A0NB 4O6JA 1YIJA 2EQIA 1YJWQ 3FRNA 4KULA 3VV0A 4M77C 2EYWA 3MEVA 4PFOA 1EZZB 1UJYA 4PJOB 2CYZB 2K2VA 2MWPA 4CC3A 1I5LA 2YRVA 2MF2A 3G4ST 1ZHIA 2ZAEA 1HK9A 4C92G 1BI3A 1NZ9A 1NJIR 2HBWA 3M0PA 3VS4A 1Z9ZA 2CP7A 2NUZA 3OYAA 3BFMA 7AT1B 3CCMA 1WXBA 4FIBA 1BI2A 1K9AA 4E7LA 3DB3A 3I55T 4MMLA 3L2ZA 1PSFA 3P8HA 4EDUA 1UFFA 2KSSA 1U06A 3CCVT 2HCKA 2A08A 1KC8R 2RQRA 2QQ9A 4M7DF 5EC7A 3VS3A 2RQTA 3J80E 2RMOA 4Z89A 1KC8C 3FLGA 4M7AC 1UHFA 3HSBA 1R8OB 2QDLA 1BCMA 3ULRB 3CPWA 5I21A 3EG9A 2GCXA 1S1NA 4QKUA 1W4SA 2DKGA 1UGVA 1H641 2ATCB 3JCMf 4C92A 3VRYA 3C94A 1TS9A 5GMKj 2H8HA 3SFMA 4HCCA 2BUDA 2CUDA 4PJJA 2P4TA 1K9MC 5GMKl 2A7YA 2PUKB 5GJVB 4M7DG 2LNVA 1NLOC 1ZBJA 2CSQA 2DYIA 1R0CB 2E5QA 4FYXB 3CQTA 3OYKA 5L23A 1TUCA 4DEXA 2HKNA 4RUGA 4RG8A 2GFAA 2RHIA 1OYXA 4F7UG 3CMEA 2DXCA 3A8OB 5HCKA 3CCMT 1RLQC 1WZOA 1AWJA 4M7AG 3CCMQ 5GANj 2L3SA 3S6WA 2QEXT 4JJCA 3OW2P 1YJ9T 2EQKA 1AWWA 1K73R 2BIVA 1JRIA 1V76A 1X27A 3UA6A 5KYWA 2MIOA 1K73C 3CEYA 3OBWA 4DEYA 2A36A 3OS1A 1OEBA 3CCVQ 1UTIA 2LQNA 1Q82C 2EYZA 3REBB 4OMQA 1YNZA 2DL5A 3FJ5A 2CSIA 2J6KA 5C6SA 2HSEB 2HL3A 2XKOC 1RI0A 2RM4A 2DL3A 4F7UB 2YLCA 4BD3A 2X51A 1VQ5Q 5LJ3g 4E7JA 1WI7A 1IO6A 4RTTA 2LNHB 3QPHA 4J9BA 1T3LA 3RERA 2KMTA 2LZ6B 2NUTB 4RKUE 5CAIA 1H8KA 1D0YA 3QZ9B 2ZPBB 1BIAA 3OS2A 3OYBA 2M51A 4M75A 4FM4B 1M1KC 5CK9A 2J6OA 1NM7A 1K1ZA 1VQPA 2E3IA 3EGDB 3VJPA 2XMFA 4M77A 5GAMj 2QK0A 5LL6S 2M0OA 2O2OA 1D3BA 2DMOA 1N5ZA 4IKFA 2DE0X 4JJBA 1BU1A 1YJNT 5KH6A 2FZCB 5DY9A 1Q95G 3BE3A 2EKHA 3TQ7P 3KFVA 4KH0B 2O9SA 2XD0A 1UE9A 4J83A 3J7AF 4QW2A 2V8JA 4E7KA 3X26B 1TTHB 3QHSA 1WYXA 1V1CA 3JB9I 3M58A 3LGFA 3CCJT 1TSFA 2JOYA 3L2QA 2DZCA 2LDMA 3LWHA 2IIMA 2M9UA 1QVPA 2ED0A 2KVQG 2HKQB 1VQNT 3M0TA 2OTLT 4II1A 4IUTA 2D0NA 5IT9E 1U8RA 4J9FA 2VGMA 1X75C 1SHGA 4ZGDB 1K8AR 2FRWA 2V8IA 5DLQE 2O4XA 3EHQA 2E3HA 3JAME 2YSQA 2DTHA 4KUDK 1PG5B 2LCLA 1K8AC 1Q81U 2JZ2A 3PT9A 2X9HA 1M90R 3CCLA 2HBPA 2PU9B 2LT4A 3EGXB 1WPYA 1PKTA 4OF1A 1YITQ 4RTZA 2K2MA 3RKXA 4EMHA 3L2VA 4HVWA 2DD5A 5D6XA 1E6HA 4RCBA 1D09B 5IHIA 2HZYA 3EG1A 1VQLQ 3NFCA 2P0QA 3V7SA 1LCKA 5IXBA 3U23A 3OA6A 1VQ5A 2D8JA 3EGXA 2DPPB 3THKA 3CXCA 3GPLA 1D0XA 5GAN5 2DETA 1VQ5T 2KT8A 1WFWA 3UF4A 2X4YA 3RR6A 4J9HA 1TG0A 5GAN4 1WXUA 4C8QB 1UHCA 4HVVA 1Y07A 1Y96B 1GCQC 2FPFA 3VYGA 1VQ4A 1Y71A 2QYZA 1AOJA 3REAB 4LDWA 2DFUA 3RESA 3OB9A 4UC4A 2KBTA 2DL7A 1LVKA 3G71T 1TXQA 3TEEA 3QG1A 1AVZC 4JZ3A 1WHHA 3QWYA 2DLPA 2BTTA 1ZUKA 1ZSGA 2PZ1A 1PWTA 2JNGA 2E70A 2K7AA 1EFNA 5I2SA 1ZA1B 3OW2S 2F69A 3CBPA 4J9GA 4NL3A 3RIRA 1MMNA 3NGPA 4M78E 1UUEA 1QVGA 4QT7A 2O88A 4XTYA 1W6XA 1W2BA 1YHQA 3CC7A 2IG0A 2HQHA 2DIGA 2YWWA 1YJ9Q 1QWFA 2QAZA 2HDAA 3CCRA 4E2FB 3H0IA 1AZEA 3SEMA 4HT9A 2AK5A 4AFZC 2G3RA 2XK0A 5CQYA 4DOWA 3LX7A 3JCMJ 1YITA 1KQSP 4XAXB 2DBKA 3TSWA 1PC0A 3JCMb 3OQ5A 4F04B 2K3BA 2LCCA 1AD5A 4J8OA 1GCPA 2E4HA 2VGNA 2EKOA 3X24B 5A2QE 1V29B 2E5KA 3L2WA 1ZLMA 1WA7A 5GAOp 1X01A 4A4HA 3QYGB 1KHIA 1RAEB 5LJ5e 1X43A 4NOYA 2ZPEB 1QWEA 4HA8A 1RAGB 5FWCA 3LW5E 1VQ4T 3SD4A 1YITT 2KRMA 1UGQB 1G2BA 1HSQA 3P8DA 3QO3A 1QKXA 3URGA 1KQ1A 2JMAA 2L3RA 3HHTB 2CREA 4QQ6A 1JJ2S 2VVKA 1ZBXA 1PNJA 3E2UA 4C8QC 1FWZA 4MDXA 3J81E 5FW9A 3CC4Q 4JRPA 1R77A 1VQPT 2J7IA 5I22A 4HXJA 1TU0B 3M4GA 3LGLA 3JCMQ 4M7DC 3I35A 2FYKA 1NEGA 4C92D 3A5ZB 1YFNA 3OYYA 2RD1A 4EMGA 2ZCFB 2DK3A 3TVTA 1MHNA 4ZN3A 1G3SA 4M75D 5GAMg 5IXFA 1WHKA 3ME9A 2K3XA 4DBHA 3MHXA 2ESWA 4F14A 3V8JA 1X69A 1WJQA 2JS0A 3M0QA 4M75F 1YI2Q 3FIFA 2M0YA 2D0QB 2YRDA 4DOVA 5EG2A 2K5LA 1QVFP 2YUOA 4BE0A 2DM1A 1TH7A 1UDLA 2YXYA 4DA4A 4JDSA 2E6NA 1WLPB 2PVDB 2ZPGB 1WIEA 4RTUA 1M3AA 2KRSA 1JXMA 1Q7YR 4M7AE 5IH2A 2LT1A 1FMKA 1BIBA 2X4WA 3ZBDA 4PLLA 4E7SA 1N9SA 3JCMX 1R0BG 4O5VA 1OI1A 3CBMA 3EG9B 1X2KA 1NJIC 3MP8A 2KQWA 1NLPC 3CCSQ 2NWMA 1OPLA 4RCCA 2DF6A 2KXCA 5CKBA 2EJ9A 2SRCA 3CCET 1ARKA 1VQ7T
chains in the Genus database with same CATH topology
1HJDA 2C0IA 5HCKA 1RLQC 3LH5A 4R0KA 1AWJA 2L3SA 1OOTA 4JJCA 2LJ1A 3M0RA 5IHNA 1TUDA 2F2WA 2PTKA 2K6DA 1AWWA 2AZVA 2FEIA 4JJDA 1B07A 3RBBB 1JXOA 2JW4A 3M0SA 3EG2A 1X27A 3UA6A 2MIOA 1GFCA 2KYBA 1B3QA 4OMMA 2A28A 4DEYA 4OMPA 1T0HA 1Y57A 1RI9A 1I07A 2A36A 3NPFA 4JPBW 2ED1A 1OEBA 1UTIA 2LQNA 2YUQA 2EYZA 3REBB 4OMQA 2DRMA 5I11A 1YNZA 2DL5A 2RQVA 3FJ5A 2CSIA 1KIKA 2J6KA 4A63B 1BB9A 1I1JA 1QCFA 4AFQC 2F2VA 2DJQA 3VS5A 1JO8A 2CH4A 1HD3A 2DL3A 4FSSA 1WDXA 1NYFA 2L2PA 1NEBA 1IO6A 1WI7A 1CKBA 2YUNA 4RTTA 2VKNA 2LNHB 4LUEA 3I9QA 4J9BA 4KRTA 1T3LA 2LZ6B 2JM8A 2EGAA 1H8KA 4HCKA 3VRZA 2YUPA 2KYMA 1GCQA 2ROLA 3EG0A 2HSPA 2M51A 2GBQA 1GBQA 2GTJA 2J6OA 1SRLA 1NM7A 2FO0A 1K1ZA 1GFDA 2XMFA 1SHFA 1Z9QA 1MV0B 2KGTA 2KR3A 5IHKA 2LQWA 1M30A 1K4US 1MUZA 3C0CA 2O2OA 2KT1A 4IIOA 4E6RA 2DMOA 3O5ZA 1N5ZA 2DE0X 4RTWA 2DRKA 4JJBA 1BU1A 1VYTA 2B86A 2EYXA 2C0TA 2EKHA 3KFVA 2W0ZA 2O9SA 2EYYA 1T3SA 2FPDA 4J9IA 4Z88A 1UJ0A 1UE9A 2EGEA 4ESRA 1SEMA 1WYXA 2ABLA 1ABOA 1K76A 2P4RA 1V1CA 4EIKA 1VYVA 2YT6A 4JZ4A 1YP5A 3PE0A 2OJ2A 1PKSA 2IIMA 2ED0A 2JT4A 4GLMA 1YWPA 3M0TA 2AKLA 2GQIA 4LNPA 5FWBA 1H92A 2D0NA 2KROA 2X3XD 1YCSB 4RTVA 4J9FA 4ORZA 1BBZA 2L3QA 4HVUA 1SHGA 3A98A 1AWXA 4LN2A 2FRWA 3NHNA 2X3WD 3EHQA 2YSQA 1I0CA 2EVRA 2DILA 3VS7A 2ENMA 3EHRA 2F2XA 4LUDA 2DNUA 4ZNXA 2CUBA 1OPKA 1PKTA 1U3OA 4RTZA 2K2MA 2A37A 4OMNA 1K0XA 2CDTA 1KSWA 1JU5C 4HVWA 2DBMA 1E6HA 2AKKA 1X6GA 1RLPC 1CKAA 5IHIA 3I5RA 4AG2C 3EG1A 3QWXX 1OV3A 2J6FA 3I5SA 3UATA 2D1XA 2KE9A 1LCKA 5IXBA 2CT3A 4J9EA 4CC7A 4CC2A 1AZGB 2KRNA 1M27C 3U23A 2LJ0A 2BZXA 2D8JA 3PVLA 3THKA 2ROTA 1PRLC 1XOVA 1SRMA 3SHWA 5ECAA 3ZL7C 3TSZA 2LX7A 1FYNA 2KT8A 1WFWA 3RNJA 1WX6A 1U5SA 1AWOA 1SPKA 1NYGA 2DYBA 2BZYA 3UF4A 2I0NA 1CSKA 2VWFA 4K11A 4J9HA 1TG0A 1WXUA 2O9VA 1E6GA 1Y0MA 2EW3A 2K9GA 2O31A 2DX1A 1UHCA 4HVVA 2FPFA 1GCQC 2CT4A 1AOJA 1RUWA 3REAB 2G6FX 3H41A 2JTEA 4J9DA 2KBTA 2K79A 2DL7A 4D8KA 2FG0A 2GNCA 2J06A 1VYUA 1WXTA 1AVZC 4OMLA 4JZ3A 3QWYA 2DLPA 2BTTA 1ZUKA 1ZSGA 2EGCA 2PZ1A 1PWTA 2GGRA 2K7AA 2LP5A 2LJ3A 1EFNA 4WCIA 2KNBB 4F17A 4J9GA 1YWOA 3R6NA 3NMZC 3NGPA 2OI3A 2DL4A 1UUEA 2O88A 4QT7A 4X1VA 2RN8A 2DL8A 1W6XA 1M3BA 3EGUA 1AEYA 4OMOA 4Z8AA 1T0JA 1ZUYA 2LMJA 2DA9A 1QWFA 2JM9A 1JQQA 2HDAA 3H0IA 1AZEA 3VS0A 1ABQA 4GBQA 3SEMA 2AK5A 1GRIA 4AFZC 2DBKA 2W10A 3TSWA 1G83A 1NG2A 2L3PA 3JV3A 2SEMA 2K3BA 1UG1A 1AD5A 1GCPA 2E5KA 3VS1A 1ZLMA 1A0NB 1WA7A 2EQIA 2DVJA 2KEAA 2KXDA 4AG1C 1VA7A 2EYWA 1X43A 1QKWA 1UJYA 1QWEA 4RTYA 2ECZA 4CC3A 5FWCA 2HEQA 4RTXA 2MCNA 3M0UA 4F16A 2HBWA 2KRMA 3M0PA 1G2BA 1HSQA 3VS4A 1W70A 1Z9ZA 2NUZA 1QKXA 3EG3A 1SSHA 1WXBA 2JMAA 2RQUA 2CREA 2LCSA 1K9AA 2GTOA 2VVKA 1GL5A 1PNJA 2EBPA 4J9CA 1UECA 2RF0A 1UFFA 5FW9A 5GJWB 1U06A 1K0SA 2J7IA 5I22A 2HCKA 4HXJA 2AZSA 2A08A 2JXBA 1KFZA 2V1QA 2FPEA 3I35A 2CH4W 2RQRA 1NEGA 1E7OA 5EC7A 3VS3A 2RQTA 1ZUUA 2RMOA 4IIMA 4Z89A 3TVTA 1J3TA 1GBRA 1YN8A 2L0AA 3VS2A 1UHFA 3H0FA 1M8MA 5IXFA 2QDLA 3H0HA 3ULRB 2ESWA 4CC4B 4F14A 1X69A 2FRYA 2JS0A 3M0QA 1H3HA 1S1NA 2V1RA 1BK2A 1UGVA 2OAWA 2M0YA 2J05A 2YDLA 4LE9A 3IQLA 1PRMC 2PNIA 3VRYA 1JEGA 2JS2A 4AFSC 2YUOA 2H8HA 2DM1A 1UDLA 3VS6A 2MOXA 1WLPB 2CUDA 4AFUC 1WIEA 4RTUA 1M3AA 1X2QA 2KRSA 1PHTA 1JXMA 2JMCA 2RQWA 1W1FA 5GJVB 2D8HA 1MV3A 1NLOC 1ZBJA 2BZ8A 3PVQA 2CSQA 5IH2A 2EPDA 4M4ZA 1FMKA 3CQTA 1KJWA 1QLYA 5L23A 1X6BA 1TUCA 2C0OA 4DEXA 1X2KA 4RUGA 1M3CA 1NLPC 2NWMA 1ZX6A 1OPLA 3UA7A 2DF6A 2KXCA 1ARKA 2RNAA 2SRCA 3GBQA 4D8DA 4Y92A 2RPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJD A;  2C0I A;  5HCK A;  1RLQ C;  3LH5 A;  4R0K A;  1AWJ A;  2L3S A;  1OOT A;  4JJC A;  2LJ1 A;  3M0R A;  5IHN A;  1TUD A;  2F2W A;  2PTK A;  2K6D A;  1AWW A;  2AZV A;  2FEI A;  4JJD A;  1B07 A;  3RBB B;  1JXO A;  2JW4 A;  3M0S A;  3EG2 A;  1X27 A;  3UA6 A;  2MIO A;  1GFC A;  2KYB A;  1B3Q A;  4OMM A;  2A28 A;  4DEY A;  4OMP A;  1T0H A;  1Y57 A;  1RI9 A;  1I07 A;  2A36 A;  3NPF A;  4JPB W;  2ED1 A;  1OEB A;  1UTI A;  2LQN A;  2YUQ A;  2EYZ A;  3REB B;  4OMQ A;  2DRM A;  5I11 A;  1YNZ A;  2DL5 A;  2RQV A;  3FJ5 A;  2CSI A;  1KIK A;  2J6K A;  4A63 B;  1BB9 A;  1I1J A;  1QCF A;  4AFQ C;  2F2V A;  2DJQ A;  3VS5 A;  1JO8 A;  2CH4 A;  1HD3 A;  2DL3 A;  4FSS A;  1WDX A;  1NYF A;  2L2P A;  1NEB A;  1IO6 A;  1WI7 A;  1CKB A;  2YUN A;  4RTT A;  2VKN A;  2LNH B;  4LUE A;  3I9Q A;  4J9B A;  4KRT A;  1T3L A;  2LZ6 B;  2JM8 A;  2EGA A;  1H8K A;  4HCK A;  3VRZ A;  2YUP A;  2KYM A;  1GCQ A;  2ROL A;  3EG0 A;  2HSP A;  2M51 A;  2GBQ A;  1GBQ A;  2GTJ A;  2J6O A;  1SRL A;  1NM7 A;  2FO0 A;  1K1Z A;  1GFD A;  2XMF A;  1SHF A;  1Z9Q A;  1MV0 B;  2KGT A;  2KR3 A;  5IHK A;  2LQW A;  1M30 A;  1K4U S;  1MUZ A;  3C0C A;  2O2O A;  2KT1 A;  4IIO A;  4E6R A;  2DMO A;  3O5Z A;  1N5Z A;  2DE0 X;  4RTW A;  2DRK A;  4JJB A;  1BU1 A;  1VYT A;  2B86 A;  2EYX A;  2C0T A;  2EKH A;  3KFV A;  2W0Z A;  2O9S A;  2EYY A;  1T3S A;  2FPD A;  4J9I A;  4Z88 A;  1UJ0 A;  1UE9 A;  2EGE A;  4ESR A;  1SEM A;  1WYX A;  2ABL A;  1ABO A;  1K76 A;  2P4R A;  1V1C A;  4EIK A;  1VYV A;  2YT6 A;  4JZ4 A;  1YP5 A;  3PE0 A;  2OJ2 A;  1PKS A;  2IIM A;  2ED0 A;  2JT4 A;  4GLM A;  1YWP A;  3M0T A;  2AKL A;  2GQI A;  4LNP A;  5FWB A;  1H92 A;  2D0N A;  2KRO A;  2X3X D;  1YCS B;  4RTV A;  4J9F A;  4ORZ A;  1BBZ A;  2L3Q A;  4HVU A;  1SHG A;  3A98 A;  1AWX A;  4LN2 A;  2FRW A;  3NHN A;  2X3W D;  3EHQ A;  2YSQ A;  1I0C A;  2EVR A;  2DIL A;  3VS7 A;  2ENM A;  3EHR A;  2F2X A;  4LUD A;  2DNU A;  4ZNX A;  2CUB A;  1OPK A;  1PKT A;  1U3O A;  4RTZ A;  2K2M A;  2A37 A;  4OMN A;  1K0X A;  2CDT A;  1KSW A;  1JU5 C;  4HVW A;  2DBM A;  1E6H A;  2AKK A;  1X6G A;  1RLP C;  1CKA A;  5IHI A;  3I5R A;  4AG2 C;  3EG1 A;  3QWX X;  1OV3 A;  2J6F A;  3I5S A;  3UAT A;  2D1X A;  2KE9 A;  1LCK A;  5IXB A;  2CT3 A;  4J9E A;  4CC7 A;  4CC2 A;  1AZG B;  2KRN A;  1M27 C;  3U23 A;  2LJ0 A;  2BZX A;  2D8J A;  3PVL A;  3THK A;  2ROT A;  1PRL C;  1XOV A;  1SRM A;  3SHW A;  5ECA A;  3ZL7 C;  3TSZ A;  2LX7 A;  1FYN A;  2KT8 A;  1WFW A;  3RNJ A;  1WX6 A;  1U5S A;  1AWO A;  1SPK A;  1NYG A;  2DYB A;  2BZY A;  3UF4 A;  2I0N A;  1CSK A;  2VWF A;  4K11 A;  4J9H A;  1TG0 A;  1WXU A;  2O9V A;  1E6G A;  1Y0M A;  2EW3 A;  2K9G A;  2O31 A;  2DX1 A;  1UHC A;  4HVV A;  2FPF A;  1GCQ C;  2CT4 A;  1AOJ A;  1RUW A;  3REA B;  2G6F X;  3H41 A;  2JTE A;  4J9D A;  2KBT A;  2K79 A;  2DL7 A;  4D8K A;  2FG0 A;  2GNC A;  2J06 A;  1VYU A;  1WXT A;  1AVZ C;  4OML A;  4JZ3 A;  3QWY A;  2DLP A;  2BTT A;  1ZUK A;  1ZSG A;  2EGC A;  2PZ1 A;  1PWT A;  2GGR A;  2K7A A;  2LP5 A;  2LJ3 A;  1EFN A;  4WCI A;  2KNB B;  4F17 A;  4J9G A;  1YWO A;  3R6N A;  3NMZ C;  3NGP A;  2OI3 A;  2DL4 A;  1UUE A;  2O88 A;  4QT7 A;  4X1V A;  2RN8 A;  2DL8 A;  1W6X A;  1M3B A;  3EGU A;  1AEY A;  4OMO A;  4Z8A A;  1T0J A;  1ZUY A;  2LMJ A;  2DA9 A;  1QWF A;  2JM9 A;  1JQQ A;  2HDA A;  3H0I A;  1AZE A;  3VS0 A;  1ABQ A;  4GBQ A;  3SEM A;  2AK5 A;  1GRI A;  4AFZ C;  2DBK A;  2W10 A;  3TSW A;  1G83 A;  1NG2 A;  2L3P A;  3JV3 A;  2SEM A;  2K3B A;  1UG1 A;  1AD5 A;  1GCP A;  2E5K A;  3VS1 A;  1ZLM A;  1A0N B;  1WA7 A;  2EQI A;  2DVJ A;  2KEA A;  2KXD A;  4AG1 C;  1VA7 A;  2EYW A;  1X43 A;  1QKW A;  1UJY A;  1QWE A;  4RTY A;  2ECZ A;  4CC3 A;  5FWC A;  2HEQ A;  4RTX A;  2MCN A;  3M0U A;  4F16 A;  2HBW A;  2KRM A;  3M0P A;  1G2B A;  1HSQ A;  3VS4 A;  1W70 A;  1Z9Z A;  2NUZ A;  1QKX A;  3EG3 A;  1SSH A;  1WXB A;  2JMA A;  2RQU A;  2CRE A;  2LCS A;  1K9A A;  2GTO A;  2VVK A;  1GL5 A;  1PNJ A;  2EBP A;  4J9C A;  1UEC A;  2RF0 A;  1UFF A;  5FW9 A;  5GJW B;  1U06 A;  1K0S A;  2J7I A;  5I22 A;  2HCK A;  4HXJ A;  2AZS A;  2A08 A;  2JXB A;  1KFZ A;  2V1Q A;  2FPE A;  3I35 A;  2CH4 W;  2RQR A;  1NEG A;  1E7O A;  5EC7 A;  3VS3 A;  2RQT A;  1ZUU A;  2RMO A;  4IIM A;  4Z89 A;  3TVT A;  1J3T A;  1GBR A;  1YN8 A;  2L0A A;  3VS2 A;  1UHF A;  3H0F A;  1M8M A;  5IXF A;  2QDL A;  3H0H A;  3ULR B;  2ESW A;  4CC4 B;  4F14 A;  1X69 A;  2FRY A;  2JS0 A;  3M0Q A;  1H3H A;  1S1N A;  2V1R A;  1BK2 A;  1UGV A;  2OAW A;  2M0Y A;  2J05 A;  2YDL A;  4LE9 A;  3IQL A;  1PRM C;  2PNI A;  3VRY A;  1JEG A;  2JS2 A;  4AFS C;  2YUO A;  2H8H A;  2DM1 A;  1UDL A;  3VS6 A;  2MOX A;  1WLP B;  2CUD A;  4AFU C;  1WIE A;  4RTU A;  1M3A A;  1X2Q A;  2KRS A;  1PHT A;  1JXM A;  2JMC A;  2RQW A;  1W1F A;  5GJV B;  2D8H A;  1MV3 A;  1NLO C;  1ZBJ A;  2BZ8 A;  3PVQ A;  2CSQ A;  5IH2 A;  2EPD A;  4M4Z A;  1FMK A;  3CQT A;  1KJW A;  1QLY A;  5L23 A;  1X6B A;  1TUC A;  2C0O A;  4DEX A;  1X2K A;  4RUG A;  1M3C A;  1NLP C;  2NWM A;  1ZX6 A;  1OPL A;  3UA7 A;  2DF6 A;  2KXC A;  1ARK A;  2RNA A;  2SRC A;  3GBQ A;  4D8D A;  4Y92 A;  2RPN A; 
#chains in the Genus database with same CATH topology
 2PUO B;  2VC8 A;  2C0I A;  3E19 A;  4QQG A;  4QVZ A;  5IAY A;  3CCV A;  3LH5 A;  4IUU A;  1NPR A;  4R0K A;  4KH1 B;  1OOT A;  1TUD A;  4M7D A;  4R56 A;  2PTK A;  2AZV A;  3BDU A;  1PD1 A;  1JXO A;  3VUB A;  1N6A A;  3EG2 A;  2EQU A;  1B3Q A;  3CCQ T;  5HKC A;  4M7A F;  2QTX A;  2LX9 A;  1T0H A;  1RI9 A;  1I07 A;  3NPF A;  1U1T A;  2NUT A;  4J7I A;  1B34 B;  2QQS A;  2DRM A;  3SWN A;  4ZN1 A;  4M75 G;  2RB6 A;  5D6Y A;  1WHG A;  4A63 B;  4CI0 C;  4L5G A;  2F2V A;  3UPU A;  1HD3 A;  1QCN A;  1WDX A;  1OQK A;  5DM7 R;  1NYF A;  3PTA A;  4AT1 B;  3L1A A;  2L2P A;  2YUN A;  3JCM c;  2VKN A;  3G4S A;  3BDL A;  4DBQ A;  4PJO D;  3I9Q A;  2VYT A;  4ZTJ A;  3GIB A;  4FCY A;  4QVC A;  4OB0 B;  2JM8 A;  3CCQ A;  5FU7 B;  3CD6 T;  1VQO A;  4LDY A;  3CC7 Q;  3FB9 A;  3VRZ A;  1OZ3 A;  4A4K A;  1MNE A;  2EQJ A;  3CCU T;  3DKM A;  1K9M U;  2QTV A;  4AMC A;  2HSP A;  2COZ A;  2GBQ A;  2GQV A;  1SRL A;  3OMC A;  4OB2 B;  1ZSZ B;  2ZPH B;  1GFD A;  3CC2 Q;  1SHF A;  1KK7 A;  1Z9Q A;  4MZP A;  3EFS A;  1MV0 B;  2LQW A;  4J6Y A;  4IIO A;  4E6R A;  1ZQ1 A;  3O5Z A;  5KYY B;  3X20 B;  1WGS A;  3D7S B;  1VYT A;  2HL5 C;  3JCM h;  1OUL A;  2P84 A;  1O9S A;  2B86 A;  3QBY A;  2C0T A;  4BI3 A;  3MP1 A;  3OY9 A;  4J9I A;  5CKD A;  2FHD A;  3M57 A;  2EGE A;  3A8H B;  1JJ2 A;  2ZZD A;  1SEM A;  1QCO A;  3OYN A;  3CCJ Q;  3WXM B;  1Q82 R;  4EIK A;  1VYV A;  2YT6 A;  3CCR T;  1B34 A;  2L89 A;  4BI8 B;  2DTO A;  2OJ2 A;  1PKS A;  4DBF A;  3HKS A;  1K73 U;  1YWP A;  1FXX A;  1VQN Q;  4M78 G;  1H92 A;  3EH2 A;  3G7Z A;  2X3X D;  4ZTF A;  1PSE A;  1KQS S;  5GAO r;  4RTV A;  1SKU B;  2L3Q A;  2E64 A;  1WQ7 A;  1YJW T;  5LJ3 h;  4LN2 A;  4A4F A;  3NHN A;  3C12 A;  2X3W D;  3CCS T;  1JJ2 P;  1KC8 U;  1I0C A;  1M90 C;  2LRQ A;  2QQB A;  2DIL A;  4WTO B;  2CP3 A;  2VXF A;  4B6M A;  4LUD A;  1M1K R;  4X9D A;  4LDV A;  2B8A A;  2OTJ A;  1U3O A;  1D3B B;  4PJM A;  2A37 A;  4OMN A;  4VUB A;  2PVG B;  2CDT A;  3C4S A;  3MP6 A;  1X6O A;  5FRN A;  4XTZ A;  2QG9 B;  4LDX A;  1RAH B;  1M1K U;  1QVF A;  2DBM A;  2X35 A;  1IZ6 A;  1VQO T;  2AKK A;  3I5R A;  4M78 B;  1OV3 A;  1XNI A;  2J6F A;  1IXD A;  2D1X A;  2KE9 A;  2CT3 A;  4M77 D;  4EMK A;  4J9E A;  2KAF A;  1IB8 A;  2KRN A;  1M27 C;  1WJR A;  2BZX A;  1KD1 C;  2ZPI B;  1C6V X;  1G3W A;  1PM3 A;  1KD1 U;  2MMP A;  3NTI A;  1QP2 A;  2QQR A;  4M75 E;  1PRL C;  3E9F A;  1TUG B;  3MEW A;  1XOV A;  1VQ9 A;  2D6F A;  4PNO A;  3SHW A;  3TSZ A;  2LX7 A;  3Q1J A;  3AHU A;  3RNJ A;  2YHT A;  1XTD A;  1WX6 A;  4FT4 A;  4FT2 A;  4XU1 A;  2BZY A;  1CSK A;  2VWF A;  4K11 A;  4C0D B;  1B7T A;  2RJC A;  2O9V A;  1E6G A;  2P0P A;  3M55 A;  2K9G A;  3V8K A;  4TVR A;  4JLI A;  4F7U F;  2EQM A;  3H41 A;  2VV5 A;  4J9D A;  5A0G A;  2RHU A;  2CZ0 B;  2KY9 A;  4F7U E;  5HK0 A;  3VU3 C;  1VQ9 Q;  4FYV B;  1MND A;  2EGC A;  1Q81 R;  2DO3 A;  2LP5 A;  1P92 A;  2LJ3 A;  2LTO A;  4M77 B;  1NBE B;  3M53 A;  4C5G A;  3S3M A;  3E1S A;  4F17 A;  1Q81 C;  4ELZ C;  1D1A A;  3EFO A;  4OVA A;  1YWO A;  3G6E T;  1VQ6 A;  1NE8 A;  2DL4 A;  2EIF A;  4X1V A;  2R5A A;  3OYG A;  1AT1 B;  4BE2 A;  2LC4 A;  3EGU A;  2K5I A;  2XIC A;  3KUF A;  2RHY A;  3G6E A;  3OBY A;  2DA9 A;  2JM9 A;  3GOX A;  2O4X B;  1UGP B;  2HD0 A;  3HRU A;  5LJ5 d;  5GAO l;  1S72 Q;  1ABQ A;  4GBQ A;  2V26 A;  5CCA A;  3M9Q A;  3H6Z A;  1VQL T;  1G83 A;  2L3P A;  3SWN B;  4D6W A;  2SEM A;  5C0M A;  1UG1 A;  4NS5 A;  4E47 A;  1MMG A;  3OW2 A;  3KBG A;  2R5M A;  3VS1 A;  1ZSZ C;  2L5Q A;  4XU0 A;  1RAI B;  2DVJ A;  4M77 G;  2CS7 A;  2KXD A;  1VQM Q;  4BAC A;  4AG1 C;  1VA7 A;  4LD9 K;  3FC3 A;  5KYY A;  3LLR A;  3HFN A;  4RTY A;  3INZ A;  2DER A;  1VQ4 Q;  5J3B A;  3V8L A;  3CCL T;  1M2V A;  4OGE A;  2HEQ A;  2BKD N;  4RTX A;  2MCN A;  3DB4 A;  3JSC A;  3CME T;  2CZ1 B;  1VQ8 Q;  5GAO n;  3EG3 A;  2QQA A;  3N5B B;  1SG5 A;  2LCS A;  2CP6 A;  2GTO A;  1GL5 A;  4E7H A;  2EBP A;  3DLL A;  3OS0 A;  4J9C A;  1UEC A;  3GLX A;  2QDY B;  5FLX E;  1K0S A;  1Y96 A;  4B9W A;  3V7R A;  2JXB A;  3I55 A;  1KFZ A;  3PIO A;  1E7O A;  4PL6 A;  4L6V 5;  3CXC P;  1ZUU A;  9ATC B;  3GP8 A;  1J3T A;  1GBR A;  2L0A A;  3VS2 A;  3TCJ A;  4BDZ A;  5M9O A;  3H0H A;  4CC4 B;  5GAN 3;  3CC2 A;  1SF9 A;  2DD4 A;  3AT1 B;  2FRY A;  2V1R A;  1N8R R;  3FEO A;  4ATO A;  1N9R A;  3VUZ A;  2J05 A;  2YDL A;  4LE9 A;  3RDV A;  1JEG A;  2JS2 A;  4HKE A;  3CCR Q;  1N8R C;  4F7U A;  4EMK C;  3M54 A;  4WF2 A;  2X4J A;  1Q7Y C;  4L59 A;  1IHV A;  5CKH A;  1VQK A;  3LYI A;  3HPW A;  2QXF A;  2JMC A;  5FRO A;  2RQW A;  2E12 A;  3OSS C;  2D8H A;  4XTV A;  1DJ7 B;  4M4Z A;  3JB9 G;  2K4Y A;  2A3L A;  1KJW A;  3LH0 A;  1QW1 A;  1VQM T;  3O8V A;  3MET A;  1M3C A;  1ZX6 A;  5LJ5 j;  4FL6 A;  3GBQ A;  1XQH A;  4HCB A;  2RPN A;  4LDU A;  2JJ9 A;  2NUP A;  1D1C A;  1PD0 A;  4X9C A;  2LJ1 A;  3V7C A;  1RAF B;  2F2W A;  2WAC A;  2XG8 D;  4FU6 A;  2A0F B;  3RBB B;  3WVE B;  4M77 E;  4A4G A;  2CZ6 B;  2KYB A;  4BUG A;  4XU3 A;  3L2R A;  2XDB A;  5HK3 A;  3MKD A;  4JPB W;  1VQP Q;  1Q82 U;  2EAY A;  4PJO A;  4EMK B;  1QVG P;  2YUQ A;  2OTL Q;  4KBM B;  2FVU A;  5I11 A;  4M78 A;  1YIJ Q;  2O01 E;  3QKJ A;  2F1L A;  4JLG A;  1KIK A;  5KYX B;  1BB9 A;  1QCF A;  2H3J A;  1OU8 A;  1LNX A;  3MEU A;  2DJQ A;  2CH4 A;  2RI5 A;  2NUP B;  4FSS A;  1YHQ Q;  2DIQ A;  2E6Z A;  4JRI A;  5HY6 A;  4PJL A;  1VIE A;  2MAM A;  1ACM B;  1CKB A;  3X25 B;  3JCM P;  4KRT A;  2QGF B;  3QXE B;  4C0G A;  2EGA A;  2YLB A;  5AT1 B;  4J6W A;  1IHW A;  4HCK A;  4C8Q D;  3JB9 F;  4KGV B;  3QDR B;  2BE9 B;  1VQ8 T;  2ROL A;  1EIF A;  5GAO m;  4PLI A;  3EG0 A;  4M7D D;  4BI4 A;  1OZ2 A;  3JB9 D;  4OB3 B;  2GTJ A;  4C8Q E;  4QVD A;  4C8Q G;  2HAX A;  4OMF B;  2KGT A;  5IHK A;  2RI2 A;  4M78 D;  1K4U S;  3G71 Q;  5LJ3 j;  1MUZ A;  1I5O B;  1TOV A;  3C0C A;  1UGR B;  4RTW A;  4HT8 A;  3PFS A;  4N0A A;  4OB1 B;  2RHZ A;  3CBO A;  1UB4 A;  5GMK m;  2DEU A;  3G1J A;  1PCX A;  3CCJ A;  2DXU A;  1T3S A;  5GAN 8;  2FPD A;  1YCY A;  3JB9 H;  4ESR A;  5LJ5 f;  5FRM A;  2HMA A;  2ABL A;  3X28 B;  4C0F A;  1K76 A;  2P4R A;  3QJY A;  3CMA Q;  2RJD A;  4M7D B;  4IUQ A;  2GF7 A;  1LPL A;  5CVI A;  2ZGW A;  3BY7 A;  1QP3 A;  5GMK h;  3GNF B;  2JT4 A;  4GLM A;  1Q86 C;  4J5Y A;  5CO7 A;  1VQL A;  1YBY A;  4DBR A;  2AKL A;  3P8B B;  4C5H A;  1UEB A;  4DQ2 A;  1M4Z A;  4BE1 A;  4YTL A;  1M9S A;  2JVV A;  2RK1 A;  4JS5 A;  4ORZ A;  3UWN A;  3MEA A;  3I56 A;  4N0A C;  3A98 A;  1AWX A;  5GAN g;  1M2V B;  2CP5 A;  3CCE Q;  4PJO E;  4C92 F;  3EGD A;  3G71 A;  2EVR A;  2ENM A;  1VQK Q;  3QJ6 A;  1XJW B;  1WHJ A;  3EHR A;  2MI6 A;  2QEX Q;  2DNU A;  1IGU A;  2QA4 T;  3SB2 A;  1K8A U;  2JTM A;  3MJX A;  4MDW A;  4RG2 A;  1OPK A;  2FB7 A;  4GLK A;  3EH1 A;  4Y91 A;  5CKE A;  8AT1 B;  1W2B S;  1KSW A;  4A4E A;  3C95 A;  5I2M A;  2HQE A;  3I55 Q;  1X6G A;  1RLP C;  4C8Q A;  2R58 A;  2CP0 A;  3I56 T;  2L8D A;  1KD1 R;  3UAT A;  3M56 A;  4V2S A;  2EWN A;  4CC7 A;  4CC2 A;  4JS4 A;  1AZG B;  3QII A;  3CPF A;  1IGQ A;  2R57 A;  2LJ0 A;  3PVL A;  1BCO A;  4Z02 A;  1YJN Q;  4Q5W A;  5GMK i;  1SRM A;  2NYS A;  3A8M B;  2CZ7 B;  3ZL7 C;  1VQ6 T;  1FYN A;  1U5S A;  1AWO A;  1SPK A;  1NYG A;  1KQ2 A;  1UGS B;  2I0N A;  5GAO q;  1ZSZ A;  3TRE A;  4BDY A;  3OYF A;  2H3E B;  1YJW A;  2K3Y A;  2DX1 A;  4EPC A;  4N4G A;  3VYH B;  3SWN C;  1QQJ A;  2CT4 A;  1RUW A;  4C92 C;  4X34 A;  1KQS A;  2RJF A;  2K79 A;  1C0M A;  2GNC A;  2J06 A;  1VYU A;  5KE3 A;  4KT0 E;  4KGZ B;  1MMD A;  5A0L A;  3HL8 A;  1W2B P;  2HQX A;  2I2L A;  2JN0 A;  5FU6 C;  1RAA B;  2KNB B;  1BKB A;  3GNG A;  3R6N A;  3NMZ C;  4N4I A;  4J7F A;  2DJZ A;  4C0Z A;  3A8L B;  1OU9 A;  3HRS A;  2VAS A;  1VOM A;  2DL8 A;  2RO0 A;  1YI2 A;  2VB6 A;  4OMO A;  1TWB A;  1T0J A;  4Z8A A;  5KYU A;  8ATC B;  4ANJ A;  3ASK A;  2QEX A;  3BW1 A;  1H3Z A;  2LMJ A;  3QZ5 B;  1Q7Y U;  2XDD A;  4FW2 A;  1FX7 A;  3OYJ A;  1GRI A;  4XU2 A;  4E7Z A;  4RMO A;  1OX9 A;  3I56 Q;  1NG2 A;  2V8K A;  3OS5 A;  3MCA B;  2E1H A;  3OYM A;  2XID A;  3CCE A;  3EFR A;  2AT1 B;  5GAM h;  2IVW A;  3A1P A;  2KEA A;  3PMT A;  2FZG B;  2WSE E;  5FU6 B;  1QKW A;  1BI0 A;  4BB7 A;  4IUR A;  4ELY C;  3CPW P;  3R6O A;  2ECZ A;  3ZEH A;  2XHC A;  5GAN e;  4FSX A;  3JCM g;  1BYM A;  3M0U A;  4F16 A;  2CP2 A;  5CQX A;  2X4X A;  1W70 A;  4M75 B;  2MYS A;  3H9N A;  5J26 A;  3FJP A;  1SSH A;  1VQ8 A;  2RQU A;  4XTU A;  1F1B B;  2FL7 A;  3OYC A;  2RF0 A;  3CC2 T;  2M16 A;  4M7D E;  3OYE A;  4C8Q F;  5GJW B;  3HRT A;  2AZS A;  3L2U A;  2V1Q A;  2FPE A;  2RA2 A;  2CH4 W;  2VXE A;  5LJ5 h;  1VQM A;  1IRX A;  2FZK B;  4IIM A;  1O75 A;  1YN8 A;  3JB9 J;  3H0F A;  1M8M A;  1YHQ T;  2OX7 A;  5LJ3 f;  2JTF A;  1LJO A;  1H3H A;  4HCZ A;  1I4K 1;  5L8R E;  1BK2 A;  4M7A D;  2OAW A;  1MMA A;  3IQL A;  1PRM C;  2PNI A;  1M1F A;  3EAE A;  4AFS C;  2CKK A;  2WSF E;  5KYW B;  3VS6 A;  1I81 A;  3CCU Q;  2DAQ A;  2MOX A;  2XI9 A;  2DZ9 A;  5GAN 2;  5A0D A;  4AFU C;  1X2Q A;  2ZPF B;  3M59 A;  2PVO B;  1PHT A;  3ZFJ A;  2KDS A;  1W1F A;  1MV3 A;  4XQ3 A;  2BZ8 A;  3PVQ A;  1K9M R;  2EPD A;  5GAM e;  2OTL A;  1C1A A;  2NLU A;  1QLY A;  1M8V A;  1X6B A;  2C0O A;  5KYU B;  5FU7 C;  2EFI A;  1Y7X A;  4B9X A;  1D1B A;  3CC4 A;  3L42 A;  3NTK A;  3QDF A;  3UA7 A;  1M5Q 1;  2DXB A;  3OYI A;  2RNA A;  1NJI U;  4D8D A;  1VQK T;  4MMK A;  1WQW A;  4M78 F;  4LD6 A;  2K5F A;  4Y92 A;  4C92 E;  4XTX A;  2JUF A;  5GAN 6;  1HJD A;  2QA4 Q;  4N4H A;  5GAN f;  2Y90 A;  3RMS A;  2PQW A;  5CR2 A;  1NPP A;  3M0R A;  5IHN A;  2K6D A;  2FEI A;  4JJD A;  3JCM V;  5AYF A;  1D0Z A;  1B07 A;  3PNW C;  2JW4 A;  3MO8 A;  3M0S A;  3QYH B;  1MGQ A;  1GFC A;  1YJN A;  4FYY B;  2A28 A;  4OMM A;  4BY6 C;  1G5V A;  4E7I A;  4OMP A;  1Y57 A;  2ED1 A;  1QMC A;  1Q86 U;  3E9G A;  2WSC E;  1HYO A;  3OYL A;  2RQV A;  1S72 A;  1YIJ T;  4C5I A;  1I1J A;  4AFQ C;  3TU4 K;  4FW1 A;  3VS5 A;  1JO8 A;  4BY6 B;  5GAN 7;  3PGG A;  2HNI A;  5D6W A;  4PKC C;  3CD6 A;  2QAS A;  2LVM A;  1NEB A;  3G4S Q;  4LUE A;  1VQ6 Q;  2F5K A;  3PIP A;  3CD6 Q;  3CCL Q;  1WNL A;  2M1H A;  3QSU A;  4M75 C;  1SSF A;  1YJ9 A;  4OP0 A;  3DLM A;  3HP9 A;  5DLO A;  2YUP A;  2KYM A;  3M4Y A;  1GCQ A;  2LQ8 A;  4A53 A;  1N8R U;  1GBQ A;  2CGH A;  5KYX A;  4P5N A;  1JB0 E;  1WHL A;  2FO0 A;  1M2O A;  1RAB B;  1KG1 A;  2RHX A;  2Z0W A;  3JCM W;  5CIU A;  3UT1 A;  3CC4 T;  1WJS A;  4XTW A;  3OSV A;  2KR3 A;  3M5A A;  1M30 A;  1VQ9 T;  2K57 A;  3H8Z A;  1VQ7 A;  2BE7 D;  3A8G B;  2KT1 A;  1LOJ A;  1OX8 A;  2DRK A;  3WVD B;  4XK8 E;  4PFP A;  2EJF A;  3OYD A;  1M1G A;  2RH2 A;  1VIF A;  4GY5 A;  1RAC B;  2EYX A;  1IRE B;  4PK4 A;  3CMA A;  2QI2 A;  2W0Z A;  2EYY A;  4Z88 A;  1UJ0 A;  3CXC S;  1N27 A;  1YI2 T;  3VKI A;  1ABO A;  3CCS A;  2E65 A;  2KI7 A;  3CMA T;  4IUP A;  4ZGE B;  2C06 A;  2MWO A;  3PMI A;  1EX4 A;  4JUV A;  4M77 F;  3T9N A;  2IPO B;  2OAU A;  1Q86 R;  4JZ4 A;  1YP5 A;  3PE0 A;  5GAM f;  3NTH A;  1FMV A;  1S72 T;  2E41 A;  3RKY A;  3RUX A;  3MPU B;  3GF5 A;  1RL2 A;  2GQI A;  4LNP A;  5GAN d;  4A54 A;  5FWB A;  5KCO A;  4QQD A;  3RMQ A;  2KRO A;  2DTI A;  3RKW A;  2Y4X A;  1YCS B;  4C5E A;  2COY A;  1BBZ A;  4LXC A;  4HVU A;  2DXT A;  1G8X A;  1M90 U;  2RJE A;  4IUV A;  1VUB A;  1VQ7 Q;  2DVE A;  1I8F A;  3VS7 A;  4M7A B;  3G6E Q;  2E10 A;  3CCU A;  2F2X A;  3HFO A;  4ZNX A;  2CUB A;  4M7A A;  3KXT A;  3S3N A;  1K0X A;  1QVG S;  3CPW S;  1JU5 C;  4PJO C;  2VUB A;  2AHJ B;  3OYH A;  5D7U A;  2Y4Y A;  1CKA A;  1VQO Q;  4AG2 C;  3CCQ Q;  1VQN A;  3QWX X;  2DEQ A;  2RK2 A;  4ME7 A;  3I5S A;  3QUI A;  1ZA2 B;  3SDZ A;  4JRQ A;  1RAD B;  4JRK A;  5LJ3 e;  4FYW B;  5LJ3 d;  2XDP A;  5LJ5 g;  2ROT A;  4NL2 A;  5ECA A;  3LWI A;  1QVF S;  3OMG A;  5J39 A;  2DYB A;  2EYQ A;  2LQK A;  4CRI A;  3CC7 T;  1JBM A;  1Y0M A;  4R55 A;  2M02 A;  3HTR A;  2EW3 A;  4PJN A;  3CME Q;  2O31 A;  5IN1 A;  6AT1 B;  1WHM A;  4Y28 E;  4M78 C;  2KK4 A;  1U1S A;  5KE2 A;  2G6F X;  1AHJ B;  4KGX B;  2JTE A;  2MPX C;  3JRZ A;  2QA4 A;  3F70 A;  4C0D C;  2XU8 A;  4D8K A;  2D9T A;  2FG0 A;  1WXT A;  2QGG A;  1G3Y A;  4JJN K;  1KHC A;  2RI3 A;  2AIR B;  4OML A;  4KUI A;  4PJO G;  5GAN h;  3EFO B;  2GGR A;  4PFZ A;  5KCH A;  4WCI A;  4PJO F;  5CKF A;  4C92 B;  2OI3 A;  2YRC A;  2P0K A;  2EJG A;  2RN8 A;  1M3B A;  4OGC A;  1AEY A;  1ZUY A;  3UDC A;  3JCM e;  3JCM d;  1JQQ A;  4ZGJ B;  5GMK e;  5KYN A;  2COW A;  3VS0 A;  2OTJ T;  3ER0 A;  2MK5 A;  3S3O A;  2OTJ Q;  2F5T X;  2W10 A;  3JV3 A;  1BI1 A;  4MZT A;  1G3T A;  4J6X A;  2GFU A;  5GAM d;  1GXI E;  4MZM A;  3FDR A;  1HXD A;  1FMW A;  1A0N B;  4O6J A;  1YIJ A;  2EQI A;  1YJW Q;  3FRN A;  4KUL A;  3VV0 A;  4M77 C;  2EYW A;  3MEV A;  4PFO A;  1EZZ B;  1UJY A;  4PJO B;  2CYZ B;  2K2V A;  2MWP A;  4CC3 A;  1I5L A;  2YRV A;  2MF2 A;  3G4S T;  1ZHI A;  2ZAE A;  1HK9 A;  4C92 G;  1BI3 A;  1NZ9 A;  1NJI R;  2HBW A;  3M0P A;  3VS4 A;  1Z9Z A;  2CP7 A;  2NUZ A;  3OYA A;  3BFM A;  7AT1 B;  3CCM A;  1WXB A;  4FIB A;  1BI2 A;  1K9A A;  4E7L A;  3DB3 A;  3I55 T;  4MML A;  3L2Z A;  1PSF A;  3P8H A;  4EDU A;  1UFF A;  2KSS A;  1U06 A;  3CCV T;  2HCK A;  2A08 A;  1KC8 R;  2RQR A;  2QQ9 A;  4M7D F;  5EC7 A;  3VS3 A;  2RQT A;  3J80 E;  2RMO A;  4Z89 A;  1KC8 C;  3FLG A;  4M7A C;  1UHF A;  3HSB A;  1R8O B;  2QDL A;  1BCM A;  3ULR B;  3CPW A;  5I21 A;  3EG9 A;  2GCX A;  1S1N A;  4QKU A;  1W4S A;  2DKG A;  1UGV A;  1H64 1;  2ATC B;  3JCM f;  4C92 A;  3VRY A;  3C94 A;  1TS9 A;  5GMK j;  2H8H A;  3SFM A;  4HCC A;  2BUD A;  2CUD A;  4PJJ A;  2P4T A;  1K9M C;  5GMK l;  2A7Y A;  2PUK B;  5GJV B;  4M7D G;  2LNV A;  1NLO C;  1ZBJ A;  2CSQ A;  2DYI A;  1R0C B;  2E5Q A;  4FYX B;  3CQT A;  3OYK A;  5L23 A;  1TUC A;  4DEX A;  2HKN A;  4RUG A;  4RG8 A;  2GFA A;  2RHI A;  1OYX A;  4F7U G;  3CME A;  2DXC A;  3A8O B;  5HCK A;  3CCM T;  1RLQ C;  1WZO A;  1AWJ A;  4M7A G;  3CCM Q;  5GAN j;  2L3S A;  3S6W A;  2QEX T;  4JJC A;  3OW2 P;  1YJ9 T;  2EQK A;  1AWW A;  1K73 R;  2BIV A;  1JRI A;  1V76 A;  1X27 A;  3UA6 A;  5KYW A;  2MIO A;  1K73 C;  3CEY A;  3OBW A;  4DEY A;  2A36 A;  3OS1 A;  1OEB A;  3CCV Q;  1UTI A;  2LQN A;  1Q82 C;  2EYZ A;  3REB B;  4OMQ A;  1YNZ A;  2DL5 A;  3FJ5 A;  2CSI A;  2J6K A;  5C6S A;  2HSE B;  2HL3 A;  2XKO C;  1RI0 A;  2RM4 A;  2DL3 A;  4F7U B;  2YLC A;  4BD3 A;  2X51 A;  1VQ5 Q;  5LJ3 g;  4E7J A;  1WI7 A;  1IO6 A;  4RTT A;  2LNH B;  3QPH A;  4J9B A;  1T3L A;  3RER A;  2KMT A;  2LZ6 B;  2NUT B;  4RKU E;  5CAI A;  1H8K A;  1D0Y A;  3QZ9 B;  2ZPB B;  1BIA A;  3OS2 A;  3OYB A;  2M51 A;  4M75 A;  4FM4 B;  1M1K C;  5CK9 A;  2J6O A;  1NM7 A;  1K1Z A;  1VQP A;  2E3I A;  3EGD B;  3VJP A;  2XMF A;  4M77 A;  5GAM j;  2QK0 A;  5LL6 S;  2M0O A;  2O2O A;  1D3B A;  2DMO A;  1N5Z A;  4IKF A;  2DE0 X;  4JJB A;  1BU1 A;  1YJN T;  5KH6 A;  2FZC B;  5DY9 A;  1Q95 G;  3BE3 A;  2EKH A;  3TQ7 P;  3KFV A;  4KH0 B;  2O9S A;  2XD0 A;  1UE9 A;  4J83 A;  3J7A F;  4QW2 A;  2V8J A;  4E7K A;  3X26 B;  1TTH B;  3QHS A;  1WYX A;  1V1C A;  3JB9 I;  3M58 A;  3LGF A;  3CCJ T;  1TSF A;  2JOY A;  3L2Q A;  2DZC A;  2LDM A;  3LWH A;  2IIM A;  2M9U A;  1QVP A;  2ED0 A;  2KVQ G;  2HKQ B;  1VQN T;  3M0T A;  2OTL T;  4II1 A;  4IUT A;  2D0N A;  5IT9 E;  1U8R A;  4J9F A;  2VGM A;  1X75 C;  1SHG A;  4ZGD B;  1K8A R;  2FRW A;  2V8I A;  5DLQ E;  2O4X A;  3EHQ A;  2E3H A;  3JAM E;  2YSQ A;  2DTH A;  4KUD K;  1PG5 B;  2LCL A;  1K8A C;  1Q81 U;  2JZ2 A;  3PT9 A;  2X9H A;  1M90 R;  3CCL A;  2HBP A;  2PU9 B;  2LT4 A;  3EGX B;  1WPY A;  1PKT A;  4OF1 A;  1YIT Q;  4RTZ A;  2K2M A;  3RKX A;  4EMH A;  3L2V A;  4HVW A;  2DD5 A;  5D6X A;  1E6H A;  4RCB A;  1D09 B;  5IHI A;  2HZY A;  3EG1 A;  1VQL Q;  3NFC A;  2P0Q A;  3V7S A;  1LCK A;  5IXB A;  3U23 A;  3OA6 A;  1VQ5 A;  2D8J A;  3EGX A;  2DPP B;  3THK A;  3CXC A;  3GPL A;  1D0X A;  5GAN 5;  2DET A;  1VQ5 T;  2KT8 A;  1WFW A;  3UF4 A;  2X4Y A;  3RR6 A;  4J9H A;  1TG0 A;  5GAN 4;  1WXU A;  4C8Q B;  1UHC A;  4HVV A;  1Y07 A;  1Y96 B;  1GCQ C;  2FPF A;  3VYG A;  1VQ4 A;  1Y71 A;  2QYZ A;  1AOJ A;  3REA B;  4LDW A;  2DFU A;  3RES A;  3OB9 A;  4UC4 A;  2KBT A;  2DL7 A;  1LVK A;  3G71 T;  1TXQ A;  3TEE A;  3QG1 A;  1AVZ C;  4JZ3 A;  1WHH A;  3QWY A;  2DLP A;  2BTT A;  1ZUK A;  1ZSG A;  2PZ1 A;  1PWT A;  2JNG A;  2E70 A;  2K7A A;  1EFN A;  5I2S A;  1ZA1 B;  3OW2 S;  2F69 A;  3CBP A;  4J9G A;  4NL3 A;  3RIR A;  1MMN A;  3NGP A;  4M78 E;  1UUE A;  1QVG A;  4QT7 A;  2O88 A;  4XTY A;  1W6X A;  1W2B A;  1YHQ A;  3CC7 A;  2IG0 A;  2HQH A;  2DIG A;  2YWW A;  1YJ9 Q;  1QWF A;  2QAZ A;  2HDA A;  3CCR A;  4E2F B;  3H0I A;  1AZE A;  3SEM A;  4HT9 A;  2AK5 A;  4AFZ C;  2G3R A;  2XK0 A;  5CQY A;  4DOW A;  3LX7 A;  3JCM J;  1YIT A;  1KQS P;  4XAX B;  2DBK A;  3TSW A;  1PC0 A;  3JCM b;  3OQ5 A;  4F04 B;  2K3B A;  2LCC A;  1AD5 A;  4J8O A;  1GCP A;  2E4H A;  2VGN A;  2EKO A;  3X24 B;  5A2Q E;  1V29 B;  2E5K A;  3L2W A;  1ZLM A;  1WA7 A;  5GAO p;  1X01 A;  4A4H A;  3QYG B;  1KHI A;  1RAE B;  5LJ5 e;  1X43 A;  4NOY A;  2ZPE B;  1QWE A;  4HA8 A;  1RAG B;  5FWC A;  3LW5 E;  1VQ4 T;  3SD4 A;  1YIT T;  2KRM A;  1UGQ B;  1G2B A;  1HSQ A;  3P8D A;  3QO3 A;  1QKX A;  3URG A;  1KQ1 A;  2JMA A;  2L3R A;  3HHT B;  2CRE A;  4QQ6 A;  1JJ2 S;  2VVK A;  1ZBX A;  1PNJ A;  3E2U A;  4C8Q C;  1FWZ A;  4MDX A;  3J81 E;  5FW9 A;  3CC4 Q;  4JRP A;  1R77 A;  1VQP T;  2J7I A;  5I22 A;  4HXJ A;  1TU0 B;  3M4G A;  3LGL A;  3JCM Q;  4M7D C;  3I35 A;  2FYK A;  1NEG A;  4C92 D;  3A5Z B;  1YFN A;  3OYY A;  2RD1 A;  4EMG A;  2ZCF B;  2DK3 A;  3TVT A;  1MHN A;  4ZN3 A;  1G3S A;  4M75 D;  5GAM g;  5IXF A;  1WHK A;  3ME9 A;  2K3X A;  4DBH A;  3MHX A;  2ESW A;  4F14 A;  3V8J A;  1X69 A;  1WJQ A;  2JS0 A;  3M0Q A;  4M75 F;  1YI2 Q;  3FIF A;  2M0Y A;  2D0Q B;  2YRD A;  4DOV A;  5EG2 A;  2K5L A;  1QVF P;  2YUO A;  4BE0 A;  2DM1 A;  1TH7 A;  1UDL A;  2YXY A;  4DA4 A;  4JDS A;  2E6N A;  1WLP B;  2PVD B;  2ZPG B;  1WIE A;  4RTU A;  1M3A A;  2KRS A;  1JXM A;  1Q7Y R;  4M7A E;  5IH2 A;  2LT1 A;  1FMK A;  1BIB A;  2X4W A;  3ZBD A;  4PLL A;  4E7S A;  1N9S A;  3JCM X;  1R0B G;  4O5V A;  1OI1 A;  3CBM A;  3EG9 B;  1X2K A;  1NJI C;  3MP8 A;  2KQW A;  1NLP C;  3CCS Q;  2NWM A;  1OPL A;  4RCC A;  2DF6 A;  2KXC A;  5CKB A;  2EJ9 A;  2SRC A;  3CCE T;  1ARK A;  1VQ7 T; 
#chains in the Genus database with same CATH homology
 1HJD A;  2C0I A;  5HCK A;  1RLQ C;  3LH5 A;  4R0K A;  1AWJ A;  2L3S A;  1OOT A;  4JJC A;  2LJ1 A;  3M0R A;  5IHN A;  1TUD A;  2F2W A;  2PTK A;  2K6D A;  1AWW A;  2AZV A;  2FEI A;  4JJD A;  1B07 A;  3RBB B;  1JXO A;  2JW4 A;  3M0S A;  3EG2 A;  1X27 A;  3UA6 A;  2MIO A;  1GFC A;  2KYB A;  1B3Q A;  4OMM A;  2A28 A;  4DEY A;  4OMP A;  1T0H A;  1Y57 A;  1RI9 A;  1I07 A;  2A36 A;  3NPF A;  4JPB W;  2ED1 A;  1OEB A;  1UTI A;  2LQN A;  2YUQ A;  2EYZ A;  3REB B;  4OMQ A;  2DRM A;  5I11 A;  1YNZ A;  2DL5 A;  2RQV A;  3FJ5 A;  2CSI A;  1KIK A;  2J6K A;  4A63 B;  1BB9 A;  1I1J A;  1QCF A;  4AFQ C;  2F2V A;  2DJQ A;  3VS5 A;  1JO8 A;  2CH4 A;  1HD3 A;  2DL3 A;  4FSS A;  1WDX A;  1NYF A;  2L2P A;  1NEB A;  1IO6 A;  1WI7 A;  1CKB A;  2YUN A;  4RTT A;  2VKN A;  2LNH B;  4LUE A;  3I9Q A;  4J9B A;  4KRT A;  1T3L A;  2LZ6 B;  2JM8 A;  2EGA A;  1H8K A;  4HCK A;  3VRZ A;  2YUP A;  2KYM A;  1GCQ A;  2ROL A;  3EG0 A;  2HSP A;  2M51 A;  2GBQ A;  1GBQ A;  2GTJ A;  2J6O A;  1SRL A;  1NM7 A;  2FO0 A;  1K1Z A;  1GFD A;  2XMF A;  1SHF A;  1Z9Q A;  1MV0 B;  2KGT A;  2KR3 A;  5IHK A;  2LQW A;  1M30 A;  1K4U S;  1MUZ A;  3C0C A;  2O2O A;  2KT1 A;  4IIO A;  4E6R A;  2DMO A;  3O5Z A;  1N5Z A;  2DE0 X;  4RTW A;  2DRK A;  4JJB A;  1BU1 A;  1VYT A;  2B86 A;  2EYX A;  2C0T A;  2EKH A;  3KFV A;  2W0Z A;  2O9S A;  2EYY A;  1T3S A;  2FPD A;  4J9I A;  4Z88 A;  1UJ0 A;  1UE9 A;  2EGE A;  4ESR A;  1SEM A;  1WYX A;  2ABL A;  1ABO A;  1K76 A;  2P4R A;  1V1C A;  4EIK A;  1VYV A;  2YT6 A;  4JZ4 A;  1YP5 A;  3PE0 A;  2OJ2 A;  1PKS A;  2IIM A;  2ED0 A;  2JT4 A;  4GLM A;  1YWP A;  3M0T A;  2AKL A;  2GQI A;  4LNP A;  5FWB A;  1H92 A;  2D0N A;  2KRO A;  2X3X D;  1YCS B;  4RTV A;  4J9F A;  4ORZ A;  1BBZ A;  2L3Q A;  4HVU A;  1SHG A;  3A98 A;  1AWX A;  4LN2 A;  2FRW A;  3NHN A;  2X3W D;  3EHQ A;  2YSQ A;  1I0C A;  2EVR A;  2DIL A;  3VS7 A;  2ENM A;  3EHR A;  2F2X A;  4LUD A;  2DNU A;  4ZNX A;  2CUB A;  1OPK A;  1PKT A;  1U3O A;  4RTZ A;  2K2M A;  2A37 A;  4OMN A;  1K0X A;  2CDT A;  1KSW A;  1JU5 C;  4HVW A;  2DBM A;  1E6H A;  2AKK A;  1X6G A;  1RLP C;  1CKA A;  5IHI A;  3I5R A;  4AG2 C;  3EG1 A;  3QWX X;  1OV3 A;  2J6F A;  3I5S A;  3UAT A;  2D1X A;  2KE9 A;  1LCK A;  5IXB A;  2CT3 A;  4J9E A;  4CC7 A;  4CC2 A;  1AZG B;  2KRN A;  1M27 C;  3U23 A;  2LJ0 A;  2BZX A;  2D8J A;  3PVL A;  3THK A;  2ROT A;  1PRL C;  1XOV A;  1SRM A;  3SHW A;  5ECA A;  3ZL7 C;  3TSZ A;  2LX7 A;  1FYN A;  2KT8 A;  1WFW A;  3RNJ A;  1WX6 A;  1U5S A;  1AWO A;  1SPK A;  1NYG A;  2DYB A;  2BZY A;  3UF4 A;  2I0N A;  1CSK A;  2VWF A;  4K11 A;  4J9H A;  1TG0 A;  1WXU A;  2O9V A;  1E6G A;  1Y0M A;  2EW3 A;  2K9G A;  2O31 A;  2DX1 A;  1UHC A;  4HVV A;  2FPF A;  1GCQ C;  2CT4 A;  1AOJ A;  1RUW A;  3REA B;  2G6F X;  3H41 A;  2JTE A;  4J9D A;  2KBT A;  2K79 A;  2DL7 A;  4D8K A;  2FG0 A;  2GNC A;  2J06 A;  1VYU A;  1WXT A;  1AVZ C;  4OML A;  4JZ3 A;  3QWY A;  2DLP A;  2BTT A;  1ZUK A;  1ZSG A;  2EGC A;  2PZ1 A;  1PWT A;  2GGR A;  2K7A A;  2LP5 A;  2LJ3 A;  1EFN A;  4WCI A;  2KNB B;  4F17 A;  4J9G A;  1YWO A;  3R6N A;  3NMZ C;  3NGP A;  2OI3 A;  2DL4 A;  1UUE A;  2O88 A;  4QT7 A;  4X1V A;  2RN8 A;  2DL8 A;  1W6X A;  1M3B A;  3EGU A;  1AEY A;  4OMO A;  4Z8A A;  1T0J A;  1ZUY A;  2LMJ A;  2DA9 A;  1QWF A;  2JM9 A;  1JQQ A;  2HDA A;  3H0I A;  1AZE A;  3VS0 A;  1ABQ A;  4GBQ A;  3SEM A;  2AK5 A;  1GRI A;  4AFZ C;  2DBK A;  2W10 A;  3TSW A;  1G83 A;  1NG2 A;  2L3P A;  3JV3 A;  2SEM A;  2K3B A;  1UG1 A;  1AD5 A;  1GCP A;  2E5K A;  3VS1 A;  1ZLM A;  1A0N B;  1WA7 A;  2EQI A;  2DVJ A;  2KEA A;  2KXD A;  4AG1 C;  1VA7 A;  2EYW A;  1X43 A;  1QKW A;  1UJY A;  1QWE A;  4RTY A;  2ECZ A;  4CC3 A;  5FWC A;  2HEQ A;  4RTX A;  2MCN A;  3M0U A;  4F16 A;  2HBW A;  2KRM A;  3M0P A;  1G2B A;  1HSQ A;  3VS4 A;  1W70 A;  1Z9Z A;  2NUZ A;  1QKX A;  3EG3 A;  1SSH A;  1WXB A;  2JMA A;  2RQU A;  2CRE A;  2LCS A;  1K9A A;  2GTO A;  2VVK A;  1GL5 A;  1PNJ A;  2EBP A;  4J9C A;  1UEC A;  2RF0 A;  1UFF A;  5FW9 A;  5GJW B;  1U06 A;  1K0S A;  2J7I A;  5I22 A;  2HCK A;  4HXJ A;  2AZS A;  2A08 A;  2JXB A;  1KFZ A;  2V1Q A;  2FPE A;  3I35 A;  2CH4 W;  2RQR A;  1NEG A;  1E7O A;  5EC7 A;  3VS3 A;  2RQT A;  1ZUU A;  2RMO A;  4IIM A;  4Z89 A;  3TVT A;  1J3T A;  1GBR A;  1YN8 A;  2L0A A;  3VS2 A;  1UHF A;  3H0F A;  1M8M A;  5IXF A;  2QDL A;  3H0H A;  3ULR B;  2ESW A;  4CC4 B;  4F14 A;  1X69 A;  2FRY A;  2JS0 A;  3M0Q A;  1H3H A;  1S1N A;  2V1R A;  1BK2 A;  1UGV A;  2OAW A;  2M0Y A;  2J05 A;  2YDL A;  4LE9 A;  3IQL A;  1PRM C;  2PNI A;  3VRY A;  1JEG A;  2JS2 A;  4AFS C;  2YUO A;  2H8H A;  2DM1 A;  1UDL A;  3VS6 A;  2MOX A;  1WLP B;  2CUD A;  4AFU C;  1WIE A;  4RTU A;  1M3A A;  1X2Q A;  2KRS A;  1PHT A;  1JXM A;  2JMC A;  2RQW A;  1W1F A;  5GJV B;  2D8H A;  1MV3 A;  1NLO C;  1ZBJ A;  2BZ8 A;  3PVQ A;  2CSQ A;  5IH2 A;  2EPD A;  4M4Z A;  1FMK A;  3CQT A;  1KJW A;  1QLY A;  5L23 A;  1X6B A;  1TUC A;  2C0O A;  4DEX A;  1X2K A;  4RUG A;  1M3C A;  1NLP C;  2NWM A;  1ZX6 A;  1OPL A;  3UA7 A;  2DF6 A;  2KXC A;  1ARK A;  2RNA A;  2SRC A;  3GBQ A;  4D8D A;  4Y92 A;  2RPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...