2ROTA

Structure of chimeric variant of sh3 domain- shh
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
70
structure length
70
Chain Sequence
b'MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Solution structure and dynamics of the chimeric SH3 domains, SHH- and SHA-"Bergeracs".
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 9
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rotA00
2JMCA 1N5ZA 1X2KA 3A98A 1X27A 4JJBA 1ZLMA 4AFSC 2ABLA 1SEMA 1PRLC 4JJCA 2C0TA 5IHIA 2HDAA 2PZ1A 4F16A 3VS6A 2BZYA 5L23A 2RF0A 1YWOA 1B07A 3U23A 2L3QA 2GQIA 2I0NA 1H92A 2DL5A 1TUCA 3EG3A 3FJ5A 4LUEA 1OV3A 1JQQA 2KXDA 4IIMA 1IO6A 2HSPA 2KNBB 2J6OA 1UDLA 2CDTA 4JJDA 5EC7A 4HCKA 1LCKA 2JW4A 2FEIA 1TUDA 2RQTA 4AFZC 5IH2A 3VS4A 1OPLA 1NLPC 3QWYA 2JM9A 2J6FA 2BTTA 4CC2A 1UTIA 1ZUKA 1UHFA 3EG2A 1RLPC 1WX6A 4GBQA 1VYVA 2X3XD 4LN2A 2NUZA 4QT7A 1SSHA 1KFZA 5GJVB 3I9QA 2EGEA 4OMOA 4J9GA 5GJWB 1I0CA 2DL7A 2EQIA 2DVJA 2JTEA 1QLYA 2AZSA 2O9VA 1HD3A 3VRYA 1VYUA 2SRCA 5FWCA 1JO8A 2LZ6B 1ZX6A 2GNCA 2DLPA 4J9BA 1YP5A 2LJ0A 1W6XA 4OMMA 1G83A 2FRYA 1ZBJA 3RNJA 2RN8A 5HCKA 2L0AA 2LNHB 4J9IA 2JXBA 3PVQA 1W1FA 3M0QA 2F2WA 2K6DA 4LE9A 4OMPA 1Z9QA 4Z89A 2D0NA 2KROA 3RBBB 1YN8A 1OEBA 2EW3A 2MCNA 1UUEA 1E7OA 2K79A 4FSSA 1NLOC 2ROTA 1K4US 4KRTA 3NPFA 4WCIA 2OI3A 3VS3A 2KXCA 4HVVA 1E6HA 2DJQA 2EYYA 1WXUA 2LP5A 4AG2C 3GBQA 2DE0X 2CH4W 4RTWA 4F17A 2KT8A 1QKWA 2JS0A 1G2BA 1QCFA 3O5ZA 2EYWA 2BZ8A 2J06A 4D8KA 1VYTA 2K2MA 2CUDA 2KRNA 4DEYA 2LCSA 3QWXX 1WLPB 1SHGA 3UATA 2RNAA 1AVZC 4R0KA 2DL8A 2FG0A 2GTJA 2M51A 4RTVA 4A63B 4RUGA 2JM8A 4CC4B 4OMLA 4OMQA 1NYFA 4M4ZA 2LJ3A 1X6GA 1UGVA 1WYXA 2L3SA 3M0PA 3UA6A 1BU1A 1PKSA 2DX1A 2VKNA 1VA7A 3I5SA 2VVKA 2F2VA 4J9DA 1V1CA 2V1RA 1X6BA 4RTTA 5IHKA 2LQWA 1EFNA 3SEMA 2KE9A 2BZXA 4CC3A 3PE0A 1HSQA 4IIOA 4RTXA 4AFQC 1CKBA 4Z88A 4JPBW 1TG0A 1UE9A 1JU5C 1GL5A 3ZL7C 1GBRA 4JZ4A 1WIEA 1SHFA 3NGPA 2GBQA 1UJYA 2W10A 2EPDA 2DBMA 2RQUA 4HXJA 1U5SA 3VRZA 1AD5A 3I35A 1NEBA 4D8DA 3SHWA 2O88A 2AZVA 2PNIA 2ROLA 3UA7A 1T3SA 5IHNA 2F2XA 2M0YA 2DA9A 1PWTA 1MV3A 2O31A 1SRMA 1WDXA 3M0UA 4LNPA 1X2QA 2LX7A 1QWEA 1AZEA 1M8MA 4RTYA 2GTOA 1WFWA 2DF6A 3CQTA 1HJDA 2AKKA 3H0HA 2EGAA 2H8HA 4AFUC 4RTZA 2D8JA 4HVUA 3TVTA 2JT4A 1FMKA 2P4RA 5I22A 1SRLA 2XMFA 1XOVA 1M30A 1ABOA 3THKA 4AG1C 1ARKA 2YUOA 1MV0B 1YWPA 4GLMA 2KRMA 2ED1A 2AK5A 2O2OA 4CC7A 2W0ZA 1PRMC 2CH4A 2ECZA 3VS7A 1RI9A 2KYMA 1ZUUA 2J6KA 1RLQC 2DNUA 1NEGA 2KYBA 1GCPA 2KBTA 3UF4A 1S1NA 1MUZA 3M0SA 2A28A 2JS2A 1A0NB 5IXFA 1BK2A 2EVRA 5ECAA 2AKLA 5FWBA 4F14A 1U06A 2EGCA 2LQNA 1AWXA 1PNJA 2DL4A 2LJ1A 1I07A 2EBPA 2L3PA 1Z9ZA 3VS0A 3REAB 4RTUA 4X1VA 4J9HA 2CSIA 1AZGB 3M0RA 2OJ2A 1UHCA 4ESRA 1ZSGA 2YDLA 1UFFA 4ORZA 2RQWA 2KGTA 3EG0A 1K9AA 2HCKA 1KSWA 2EYZA 2B86A 1K0SA 1I1JA 1PHTA 3EHRA 2LMJA 1OPKA 2DYBA 2E5KA 4JZ3A 1T0JA 2D1XA 2NWMA 1CKAA 4Y92A 1UG1A 2KEAA 1GBQA 1RUWA 2D8HA 4OMNA 2FO0A 3H41A 2CUBA 2FPDA 1UECA 2A08A 1JXOA 1T3LA 2IIMA 1K0XA 1PKTA 3C0CA 1U3OA 3NHNA 1GFCA 2RPNA 1J3TA 1QWFA 2DRKA 3M0TA 2GGRA 5FW9A 1E6GA 3PVLA 4HVWA 2ENMA 1X69A 2K7AA 1AOJA 1AEYA 3REBB 2JMAA 2DMOA 2X3WD 1YCSB 3IQLA 1WXBA 2RQRA 1BBZA 2RQVA 2EKHA 1K76A 2J05A 3H0FA 2CSQA 1M27C 2RMOA 1GFDA 1AWOA 1JXMA 1W70A 1Y0MA 2MOXA 2ED0A 1OOTA 1B3QA 4J9FA 1KJWA 2MIOA 3LH5A 2YUQA 4LUDA 1X43A 2G6FX 2QDLA 2C0IA 2YSQA 1M3CA 1ZUYA 3VS1A 1AWJA 3TSZA 1JEGA 3EHQA 4J9EA 2DRMA 2PTKA 1FYNA 1UJ0A 2HBWA 1QKXA 1H3HA 2V1QA 2C0OA 4K11A 3EGUA 3JV3A 3VS2A 2L2PA 5IXBA 2CT3A 2HEQA 1WA7A 2YUNA 3VS5A 1WXTA 1NYGA 1M3AA 2DBKA 2J7IA 2SEMA 2YUPA 2FPFA 1NG2A 2CREA 4J9CA 3KFVA 2CT4A 3I5RA 1BB9A 1YNZA 2FPEA 2KT1A 2VWFA 1CSKA 1Y57A 1NM7A 2K3BA 2DILA 2YT6A 2A37A 4ZNXA 2EYXA 2DM1A 1WI7A 2KRSA 2K9GA 3ULRB 1KIKA 1K1ZA 1GCQC 2A36A 4DEXA 2DL3A 1H8KA 4E6RA 4EIKA 4Z8AA 3NMZC 2KR3A 1SPKA 1ABQA 5I11A 1AWWA 3TSWA 3R6NA 2OAWA 1GCQA 1GRIA 3H0IA 3EG1A 2FRWA 2O9SA 1M3BA 2ESWA 1T0HA
chains in the Genus database with same CATH superfamily
4C92D 1N5ZA 2JTFA 4UC4A 3A98A 5GAOm 1X27A 1VQ8T 1O75A 1I81A 2R5AA 3Q1JA 4M78D 2LNVA 3INZA 1BCMA 4F16A 2VUBA 2BZYA 5L23A 1FMVA 1KD1R 3U23A 2L3QA 2I0NA 5L8RE 2EIFA 3ZFJA 1MHNA 2NUTB 3CCRQ 1ZA1B 1OV3A 1BI0A 2COWA 2DD5A 2J6OA 2KNBB 4JJDA 5EC7A 4FL6A 2COZA 4C5HA 5KYYA 4BY6B 2FEIA 5LJ3j 4N0AC 4AFZC 1Q81U 3C4SA 1WQ7A 3LW5E 2P0KA 1FX7A 1JJ2P 1ZSZC 1C1AA 3CC7T 4GBQA 1TTHB 5KYNA 1R0BG 3M53A 4A4GA 4QT7A 3CCRT 2R5MA 3A1PA 4E7KA 1N27A 4RCCA 3G6EQ 1SSHA 4XU1A 5GAN7 2DL7A 2EQIA 4M77D 2AZSA 4C0FA 4O6JA 3R6OA 1UGPB 4PJNA 2DLPA 3MP1A 5GMKl 2DEUA 1RADB 1UEBA 4C0ZA 2CP2A 2HMAA 1G83A 1ZSZB 2KI7A 3CPWA 1YJ9A 4J9IA 2JXBA 1R0CB 2F2WA 4RG8A 1Y71A 8ATCB 4Z89A 2D0NA 1NPRA 2FZKB 5EG2A 4B9WA 3RBBB 2E41A 2E3HA 1YN8A 1OEBA 2MCNA 4FSSA 2ROTA 4OF1A 4HVVA 4C8QC 1TXQA 1YHQA 2I2LA 2CH4W 4RTWA 4C8QG 4ZGDB 2JS0A 1WJRA 4L6V5 2BZ8A 2X35A 1FWZA 3OW2S 4DEYA 4J8OA 3BFMA 2HL3A 3WXMB 5LJ5j 3QBYA 4EPCA 3JCMX 5IAYA 2HBPA 3UATA 2FL7A 1M1KR 2PUKB 1KD1U 1SKUB 2GTJA 2FG0A 4A63B 2RI2A 4KBMB 4BDZA 5GAMd 1WQWA 2OTJQ 3EH1A 4PLIA 1QQJA 2OAUA 2RJDA 3CMAQ 1WYXA 3M0PA 4KT0E 1PKSA 1NBEB 1HK9A 2VKNA 4C8QB 1N9RA 1VA7A 4M7AF 4JRIA 4OB2B 4M7DE 2DK3A 2VVKA 3L2ZA 2X51A 4HCBA 2V8KA 2HSEB 1M9SA 1BCOA 2QQRA 1KQSS 3QDRB 2HZYA 2OTJT 4FW2A 3CMAT 1CKBA 4Z88A 1N8RU 2CP7A 1GL5A 5HK0A 3ZL7C 4ANJA 3EAEA 3MKDA 3NGPA 2GBQA 4MZPA 1NJIC 1UJYA 4KULA 2FB7A 2RQUA 1YIJA 3SWNA 1VIEA 1D1CA 4ZN1A 4FCYA 1QW1A 1TWBA 2DIGA 3I55A 5IHNA 4FYWB 5GMKm 1MV3A 4M75A 1SRMA 4LNPA 1X2QA 1WJSA 1QVFP 3X26B 3JCMP 2LX7A 2VYTA 1PD0A 2LCLA 1Y96A 3MJXA 4WF2A 2V8JA 3PMIA 1RAHB 4QQGA 2VB6A 3TEEA 4M7DA 3URGA 3CCEA 1VQMA 3A8MB 3M54A 2RJCA 1H3ZA 2ZAEA 3HFNA 3LYIA 2JT4A 2FYKA 2P4RA 4DBRA 4XTUA 7AT1B 4KUIA 1Y7XA 3CPWP 3L1AA 1M30A 1X6OA 1ABOA 5CKDA 3QG1A 1M1KU 1OYXA 2ZGWA 4RG2A 2DXUA 2YUOA 4PJOE 1QCOA 3EG9A 2QEXA 2CH4A 4FIBA 4C92F 3VS7A 1RI9A 1ZUUA 4M78F 1D0XA 1GCPA 3UF4A 3PNWC 3LGLA 1YJ9Q 2RHIA 2GFUA 3M0SA 4EMGA 2JS2A 5IXFA 1BK2A 1G5VA 3GIBA 3JCMJ 4J6YA 2AKLA 3L2WA 2D9TA 3QYGB 4C5EA 1PNJA 1I07A 3V7CA 3VS0A 3A8GB 2O4XA 2QYZA 5C0MA 1KC8U 5FROA 1VQ4A 1YJ9T 2L89A 1AZGB 3GLXA 3M0RA 5LJ5d 2YDLA 3GPLA 4J6XA 3M58A 3EG0A 2RHZA 1KSWA 2EYZA 2B86A 1K0SA 1I1JA 4XAXB 1OPKA 4LDWA 4M77F 1Q7YC 3RUXA 1VIFA 2KEAA 1RUWA 3M59A 4OMNA 3H41A 1YHQT 4F7UA 1RAEB 2KQWA 5KYXB 2IIMA 4OGEA 2VXEA 1PKTA 3OBYA 1GFCA 2RPNA 1J3TA 3M0TA 1NPPA 3BDUA 4HVWA 3CBOA 2ENMA 2L8DA 3EFRA 4M7AG 1AOJA 1AEYA 2FZGB 3G7ZA 3BW1A 2XICA 2RQRA 4B6MA 1D0ZA 2EAYA 1KQ2A 2H3EB 3VKIA 5I2SA 5KYWB 1IRXA 1JXMA 2HD0A 1VQ7A 2CZ1B 5KE2A 1UGSB 2CZ7B 1YIJQ 3M5AA 2YUQA 1VQPA 2BE7D 2DPPB 2QDLA 2C0IA 2RD1A 4DQ2A 3G4SA 4R55A 1YJWQ 4ELZC 5GAN8 1AWJA 1TS9A 3I55Q 2HQXA 1B34A 3QXEB 1RAFB 1UJ0A 3OW2P 1KK7A 2OTLA 1K73U 1Q82U 4KGXB 1QKXA 2WSCE 3HKSA 1OX8A 5I2MA 2ZPBB 1H3HA 3OYJA 1RAGB 1BYMA 3VS2A 2L2PA 1YIJT 2CT3A 1K8AU 5LL6S 1F1BB 1PSFA 2RH2A 1M3AA 3CCEQ 3CCJA 5KE3A 2SEMA 5HKCA 1VQMQ 3I55T 2CREA 3KFVA 4N4IA 3CCMA 5GAN4 5J26A 3L2VA 1CSKA 2K3BA 3PIPA 3I56A 2DERA 2KY9A 1D3BA 2A37A 4QKUA 4XTWA 3HFOA 2KRSA 4PJOF 1C0MA 2RB6A 3P8HA 1KQSP 2A36A 2A7YA 4DEXA 5GAOn 2DZCA 2XU8A 4Z8AA 4NOYA 3CCET 1FXXA 2QEXQ 2QXFA 3H6ZA 5D6XA 1VQNQ 2DXTA 4C92G 3HPWA 3TSWA 3EFOB 3LGFA 1GCQA 3EG1A 4M78G 4ME7A 4IUTA 1ZLMA 4AFSC 2ABLA 1SEMA 2C06A 2O01E 2C0TA 2QEXT 1UB4A 2PVGB 1YITA 1OI1A 4KH0B 3VS6A 5DLOA 2RF0A 1B07A 1OZ2A 1TUCA 1VQ4Q 1M2VB 4FYVB 1JJ2A 2KXDA 2DTHA 2HSPA 3A8OB 3CC2A 4HCKA 3UPUA 4C5GA 3NTHA 3QWYA 4KUDK 2EQMA 4CC2A 1ZUKA 2CS7A 1UHFA 1W4SA 1WX6A 4BB7A 5AT1B 4M77G 1VQ4T 1VOMA 2WSEE 4ZN3A 1LPLA 2KVQG 4LDUA 1I0CA 2JTEA 2YLCA 2ZPGB 1QLYA 2O9VA 3VRYA 1QP3A 1VYUA 2VGNA 2QTVA 2RHUA 1ZX6A 2NUPA 2GNCA 3OYKA 5IT9E 5AYFA 5KYUB 3QO3A 1YP5A 4BE1A 3CCLQ 5GMKe 2FRYA 1K73C 1ZBJA 3CC4A 3NFCA 3RNJA 4B9XA 4MDWA 1KHCA 4XU3A 2Y4XA 3M0QA 3LWIA 2K6DA 4LE9A 1D1AA 1VQ7Q 3OMGA 3DB3A 2KROA 1XTDA 3HTRA 3TU4K 3BE3A 2K79A 6AT1B 2R58A 3QZ5B 1VQPQ 4WCIA 3G4SQ 3VYGA 2KXCA 5D6WA 4RKUE 2E6ZA 2DJQA 2EYYA 1WXUA 2KAFA 2EWNA 1S72A 4F17A 2RK2A 2KT8A 4A4FA 4QVDA 3QSUA 2P0PA 2QQAA 1EZZB 3PGGA 1M4ZA 4J83A 4QVZA 1VQ7T 2J06A 4D8KA 2DKGA 1VYTA 2KRNA 4DBHA 1UGRB 3QJYA 3QUIA 2LCSA 1WLPB 2RNAA 3TQ7P 2HQHA 4CC4B 4IUPA 4OMLA 4OMQA 1NYFA 1SG5A 5FU7C 3CCJQ 2EQKA 2LJ3A 2LDMA 2L3SA 3CCMQ 3UA6A 3KUFA 1BU1A 3RDVA 5KCHA 3J81E 2OTLT 3QPHA 3I5SA 4PJOC 2DZ9A 5FLXE 4J9DA 4Z02A 4RTTA 3OYYA 2LC4A 3LLRA 4PJOG 3X25B 2KE9A 3CCJT 4A54A 4RTXA 3CCMT 4JPBW 1SSFA 4OVAA 1UE9A 3I56T 2CZ0B 4JZ4A 1M2OA 5FU7B 4OB1B 3OYGA 2WACA 5CIUA 2EPDA 2DBMA 1U5SA 3QIIA 1TOVA 1K9MC 3VU3C 3JB9D 4CRIA 3I35A 4O5VA 1NZ9A 1B7TA 4PLLA 5CAIA 1QVFA 4PJOB 1YITQ 5FRNA 3C94A 2DA9A 5J39A 2VGMA 1WDXA 1ZQ1A 3M0UA 1EX4A 4M7AA 3A8LB 4V2SA 1FMWA 3CC2Q 1QWEA 1RL2A 1AZEA 1M8MA 3LX7A 2LT4A 1M90U 4RTYA 3D7SB 1Q7YR 5GAOp 2Z0WA 1PM3A 1ZA2B 3CQTA 2CKKA 4M7DD 3G6ET 4JLGA 4AFUC 2QDYB 4RTZA 2D8JA 4HVUA 5GANd 3TVTA 3LH0A 1FMKA 4XQ3A 3EGXB 3CC2T 2PQWA 1SRLA 5GANe 1MMAA 4QW2A 4AG1C 1Q86C 1MV0B 1Q95G 3M57A 4HCZA 3MEWA 2DYIA 3AT1B 2ECZA 3M4YA 1ZBXA 4CI0C 1IB8A 4WTOB 3CC4Q 1MUZA 2K3XA 2A3LA 4E7JA 3E19A 1NE8A 2EVRA 5ECAA 5FWBA 2MWPA 4M75E 4F14A 2EGCA 4FU6A 3JCMV 2VXFA 2DL4A 2LCCA 2EBPA 2QTXA 5GAMe 2CP6A 4X1VA 3HRUA 2L3RA 2CSIA 3CC4T 2HQEA 3E2UA 1S72Q 2OJ2A 1QVGS 1QCNA 2K2VA 2M1HA 2PU9B 1YJNQ 3SB2A 1PD1A 1W2BS 3MO8A 3OQ5A 2LMJA 4KGZB 4EDUA 4C92A 2NWMA 2F5TX 4Y92A 4PJOD 2FO0A 2E10A 3PTAA 2CUBA 5GAOr 1UECA 2V26A 3N5BB 1S72T 1Q81C 2ZPIB 3S6WA 1JXOA 1T3LA 2RI5A 1UGQB 4FT2A 3OS2A 5C6SA 3C0CA 1U3OA 2XD0A 2FHDA 2DRKA 1G3YA 5DY9A 3OYBA 1E6GA 1YJWA 1AT1B 3PFSA 1KG1A 5LJ3d 2DMOA 2X3WD 3JCMd 1G3WA 2RQVA 2EKHA 2QQ9A 5LJ3e 2J05A 2CSQA 2WSFE 2RMOA 3EGDA 3JCMe 2DIQA 2QGGA 1W70A 1VQ6A 1VQLA 4JS5A 1OOTA 1YBYA 2MIOA 4M77A 3OW2A 2JNGA 2ATCB 3SDZA 4LUDA 1X43A 2G6FX 3JCMQ 1ZUYA 2BIVA 3VS1A 4FT4A 3OYHA 4J9EA 2DRMA 1D1BA 1PSEA 3M55A 3V8JA 2DETA 5CVIA 1VQKA 1GXIE 4F7UE 2C0OA 4K11A 4XTXA 4LDVA 3CXCS 2X4WA 2AIRB 1VQNA 4J7IA 2QASA 4C0DC 1NYGA 4J7FA 2P0QA 3OYDA 2DBKA 3V8KA 1NG2A 2M0OA 1WHGA 4J9CA 1KQSA 3I5RA 4EMKA 1Y57A 4LDYA 1YI2A 3RMQA 1KD1C 4ZNXA 1WI7A 3L2UA 3DLMA 2XKOC 4E6RA 4EIKA 1SPKA 2XHCA 1WZOA 3JB9F 4J5YA 1ABQA 1QP2A 4JJNK 5I11A 2EQJA 2CGHA 4MZMA 4C0DB 3MPUB 5LJ5e 4QQDA 2FRWA 1WHKA 2LT1A 2NUTA 4BUGA 3HHTB 1OQKA 2YWWA 3FDRA 4JJBA 4FW1A 3OYEA 1N8RC 1PRLC 1M1GA 4Y28E 2HDAA 2DO3A 1YWOA 4II1A 3CPFA 2X4YA 2GQIA 4M7DF 1VQ5A 1ACMB 4JRKA 4EMHA 1XJWB 1KHIA 4OB3B 1JQQA 4IIMA 1UDLA 3CD6A 2BKDN 5LJ5f 3CCSQ 3VS4A 1OPLA 1NLPC 3CCLA 2JM9A 2J6FA 5CQYA 1UTIA 5CQXA 3TCJA 3DB4A 3L2RA 4J6WA 4MZTA 4E7ZA 2NUZA 4BACA 4N0AA 5KYYB 3HL8A 3MEVA 1KFZA 4C8QE 2EGEA 1ZSZA 2E4HA 5GJWB 2DVJA 3OBWA 3MHXA 1HD3A 5IN1A 5D7UA 1JO8A 2LZ6B 1VQOA 4Y91A 2XDDA 3G71Q 4NS5A 2LJ0A 1W6XA 1M1KC 1XNIA 2M02A 2GQVA 3RR6A 1WHMA 5FU6C 2L0AA 2LNHB 5KCOA 1Z9QA 1VQ6Q 5GAN6 1VQLQ 1YJWT 5GMKi 1E7OA 3ZBDA 1NLOC 4KRTA 1R77A 2YHTA 3NPFA 4JDSA 4F04B 2OI3A 2EFIA 1VQ8A 2MI6A 1QVGP 2JVVA 2JN0A 2LP5A 3CBPA 3OS5A 2DE0X 4A4HA 3OYLA 1D09B 4PK4A 5A0DA 5CO7A 1W2BP 3O5ZA 1G3TA 2RM4A 1WHJA 2GFAA 4F7UF 3DLLA 1VQKQ 5DM7R 2FZCB 1VQ6T 2K2MA 1BIBA 2CUDA 2HNIA 3UT1A 3JB9J 1O9SA 1VQMT 4C8QA 1KC8C 3GOXA 2RA2A 5FU6B 2YRVA 2E70A 5GMKh 4RUGA 2JM8A 1M8VA 3CC7A 2DXCA 2KSSA 4MDXA 3CEYA 2DX1A 1YI2Q 2COYA 2ZPEB 2X4JA 3OSVA 4A4KA 1Q86R 5CK9A 1V1CA 3O8VA 4MMKA 1VQNT 4JRPA 5IHKA 2LQWA 3ZEHA 2BZXA 4CC3A 3PE0A 4IIOA 4AFQC 2MWOA 3P8BB 3J80E 3SWNC 2K5LA 5GAOq 4ZGEB 2HKNA 1YI2T 3JB9G 3ME9A 1WIEA 1SHFA 2MAMA 1V29B 4X9DA 1I8FA 2M9UA 4M75C 4HXJA 4E47A 1AD5A 1NEBA 4D8DA 4M75G 4BI3A 2R57A 2AZVA 3JCMW 3A8HB 1WNLA 1T3SA 2P84A 2F2XA 2M0YA 3NTIA 1PWTA 4A53A 4M7DC 1VQ5Q 2O31A 4BDYA 2QI2A 3JRZA 3QZ9B 5FRMA 3CXCP 1WGSA 4M7DG 3CD6Q 3SWNB 2DTOA 3X20B 4L5GA 2GTOA 1WFWA 3X28B 5I21A 1Q82C 2AKKA 4M75B 2HAXA 3H0HA 4PKCC 3C95A 2H8HA 1Q81R 1NJIR 3FRNA 3VUBA 1VQ5T 4HKEA 4LD9K 4IUVA 2K4YA 2RK1A 1Y96B 1K8AC 3CD6T 2XMFA 3E9FA 1XOVA 2NYSA 3P8DA 3THKA 4FM4B 3H9NA 4M7DB 1ARKA 2KRMA 2ED1A 3CCLT 4E2FB 4CC7A 2W0ZA 3RMSA 2MK5A 1PCXA 1VQOQ 3HSBA 4GY5A 4DBFA 2J6KA 1RLQC 2DNUA 1NEGA 2KYBA 4NL3A 1YJNA 3CMEA 4PFZA 1MNEA 2VASA 2A28A 3NTKA 2K5FA 1LNXA 2DJZA 2QGFB 2PUOB 1VQPT 4D6WA 2E5QA 3EG9B 3G4ST 2YRDA 1U06A 4JLIA 5A2QE 4M7AE 2L3PA 5A0LA 1N6AA 1VQ8Q 2VC8A 3T9NA 1YCYA 3X24B 3GF5A 4XK8E 5GANh 1MMGA 4AT1B 3VJPA 3ER0A 2M16A 2DEQA 1VQ9A 1ZSGA 1PC0A 1IGQA 1U1SA 5M9OA 2G3RA 5GAN2 5KYXA 1N9SA 5CKFA 1IZ6A 2HCKA 2RHYA 1MNDA 2RHXA 4F7UG 2O4XB 2E5KA 4JZ3A 1T0JA 2D8HA 2F1LA 3OMCA 1AHJB 2XIDA 4LDXA 4DBQA 3CC7Q 2MYSA 1RI0A 1D0YA 3JCMb 3OS1A 4FYXB 2ZCFB 1K0XA 2KMTA 2QA4A 2IVWA 1QWFA 2GGRA 4X34A 5FW9A 3PVLA 4TVRA 4PJLA 5KYWA 1X69A 5GAMh 2ZPHB 1YFNA 4F7UB 2IG0A 2KDSA 1NJIU 2JMAA 4M75D 3IQLA 3MCAB 2CZ6B 3H0FA 3VUZA 1M27C 3FB9A 3UDCA 4DOVA 1GFDA 1HYOA 1Y0MA 2RO0A 3OSSC 1YITT 1B3QA 1N8RR 3RKWA 2YSQA 5A0GA 4XTZA 2QG9B 3CCVA 3PIOA 3KBGA 3EHQA 3H8ZA 4XTYA 3RIRA 4C92E 4E7IA 1BKBA 4M78E 2V1QA 3GNFB 2Y90A 3EGUA 5IXBA 9ATCB 2HEQA 2XDBA 3QJ6A 2A0FB 3RKXA 3L42A 4YTLA 2J7IA 1B34B 3E1SA 2YUPA 2FPFA 5LJ3h 3DKMA 2HKQB 1BB9A 3J7AF 3JCMh 2DFUA 2FPEA 2MMPA 1NM7A 2P4TA 5GANf 2E64A 4OB0B 2DM1A 3EFOA 4RMOA 2K9GA 3FIFA 3ULRB 1KIKA 4PNOA 1K1ZA 3PT9A 1JB0E 1GCQC 1H8KA 3PMTA 2E12A 3NMZC 2KR3A 3UWNA 2CP5A 2EYQA 2JZ2A 1RAIB 4XTVA 3V8LA 3OS0A 1D3BB 1TU0B 3BDLA 4M77E 3M9QA 1LVKA 3CMEQ 4P5NA 5D6YA 2OAWA 3CCSA 3H0IA 2O9SA 2ESWA 1M2VA 3OY9A 4X9CA 3QHSA 4LXCA 2PVOB 1T0HA 1LJOA 2JMCA 1A0NB 1WHLA 1OULA 1X2KA 3FC3A 4E7SA 4M78A 2RJFA 1I4K1 4JJCA 2RJEA 5IHIA 2PZ1A 5GAMf 3AHUA 1I5LA 4LD6A 1H92A 1BI2A 1YJNT 3CMET 2DL5A 8AT1B 3EG3A 1Q7YU 3FJ5A 4LUEA 2CP0A 1IO6A 1VQ9Q 2CDTA 1ZHIA 1LCKA 2JW4A 4IUUA 3CCQA 1TUDA 2RQTA 1KC8R 5IH2A 3G71A 2NLUA 4BI8B 2BTTA 3EG2A 1IHVA 1RLPC 3JAME 1RACB 1VYVA 2X3XD 4LN2A 4NL2A 5LJ5h 1M90C 5KYUA 5CKHA 3LWHA 4ZTFA 4N4GA 1VQ9T 5GJVB 3I9QA 4OMOA 2QA4Q 4J9GA 1LOJA 4PJJA 2GF7A 1U8RA 3QDFA 2RI3A 2SRCA 3WVDB 3HRTA 4RCBA 2LTOA 1BI1A 5FWCA 2IPOB 5CKBA 1BIAA 1MGQA 3JCMc 4J9BA 2JTMA 5GAN3 4OMMA 5LJ3f 2RN8A 2DXBA 2QQSA 3FLGA 3JCMf 5HCKA 2QA4T 2ZPFB 3GP8A 2FVUA 3PVQA 1W1FA 1QVGA 4OMPA 2NUPB 5CR2A 3TREA 1KQ1A 3CCUA 1W2BA 2EW3A 2LQ8A 1UUEA 3MEUA 1K4US 3VS3A 1E6HA 3CCVQ 2LX9A 4AG2C 2LQKA 3GBQA 2E65A 4OP0A 1QKWA 3OYFA 1G2BA 2KK4A 1QCFA 2EYWA 3MEAA 3JSCA 4XU2A 2CP3A 3QWXX 4L59A 3OYNA 4C8QD 1SHGA 4HT8A 2DVEA 1AVZC 5HK3A 4R0KA 1K73R 1Q82R 2DL8A 2M51A 4RTVA 4R56A 3WVEB 3ASKA 4M4ZA 3CCVT 2H3JA 3BY7A 1X6GA 1UGVA 3C12A 3S3MA 1K8AR 4M75F 1YHQQ 3V7SA 4HA8A 2F2VA 2V1RA 1X6BA 2EQUA 2QAZA 4KH1B 2EJGA 3EFSA 3QKJA 4A4EA 4BE2A 1EFNA 3SEMA 1PG5B 1HSQA 4DA4A 1TG0A 3GNGA 1VUBA 2AT1B 4PJOA 3VYHB 2DTIA 1JU5C 2YRCA 2BE9B 1GBRA 4XU0A 1OU8A 3RERA 4OMFB 4C5IA 3M56A 2W10A 4PFPA 1I5OB 2L5QA 1EIFA 3VRZA 4JUVA 2Y4YA 1IGUA 4M7AC 5KH6A 3CXCA 3SHWA 2O88A 2PNIA 2ROLA 1MMDA 3UA7A 1P92A 3S3OA 3CCST 2PVDB 3JB9I 1G3SA 5GMKj 2LVMA 4MMLA 3HRSA 3CCQQ 3EGXA 2DF6A 4Q5WA 2OX7A 1HJDA 4N4HA 4KGVB 2EGAA 1JJ2S 2XI9A 3FEOA 3OYCA 4M7AB 2K57A 1WPYA 1HXDA 5GANg 1RAAB 1K9MR 1JRIA 2K5IA 5I22A 4IUQA 3FJPA 3CCQT 1RABB 2V8IA 1OZ3A 1YWPA 4GLMA 3G71T 2AK5A 2O2OA 2MPXC 1PRMC 4PJMA 2BUDA 2KYMA 2AHJB 2LRQA 1TH7A 2KBTA 1WHHA 1X75C 1S1NA 2EJ9A 2HL5C 1VQLT 4ZGJB 3A5ZB 3V7RA 3META 4DOWA 1QVPA 2LQNA 3KXTA 5GAMg 3CCUQ 1AWXA 3CBMA 1IREB 2F5KA 2LJ1A 1DJ7B 1Z9ZA 3REAB 4FSXA 2CYZB 4RTUA 1SF9A 2E1HA 4J9HA 3S3NA 1VQKT 2E3IA 2EKOA 4C92C 3CCRA 3E9GA 2B8AA 3F70A 1UHCA 4ESRA 4BI4A 3OB9A 3OYMA 4M78C 3L2QA 2E6NA 5GAN5 1UFFA 4ORZA 1H641 4PL6A 2RQWA 1V76A 2KGTA 1K9AA 5HY6A 1XQHA 2ZZDA 1PHTA 3EHRA 4ELYC 3OYAA 3CCUT 1QMCA 2DYBA 2D0QB 2D1XA 1CKAA 2XDPA 1UG1A 1GBQA 2JOYA 2FPDA 3EH2A 3G1JA 2A08A 5J3BA 3M4GA 2JUFA 3MP6A 3G6EA 2DD4A 1MMNA 5GAOl 4QQ6A 3NHNA 2MF2A 4BD3A 4C92B 5DLQE 4AMCA 1WJQA 1X01A 4JS4A 4E7HA 2YLBA 4M78B 2K7AA 2EJFA 3RESA 4FYYB 3REBB 4IKFA 5LJ3g 3OA6A 1C6VX 1YCSB 1WXBA 4M77C 1K9MU 1BBZA 1TUGB 3RKYA 3JCMg 4M7AD 2QQBA 3JB9H 1K76A 4HCCA 3HP9A 4VUBA 2F69A 4E7LA 3OYIA 2X9HA 2YXYA 4GLKA 3SD4A 1AWOA 4JRQA 3SFMA 2X4XA 2MOXA 2ED0A 4J9FA 1KJWA 3LH5A 2XK0A 5GANj 1M5Q1 1M3CA 4C8QF 1M1FA 3TSZA 5CCAA 1JEGA 3EGDB 2PTKA 1Y07A 1R8OB 1FYNA 4QVCA 4HT9A 2JJ9A 2D6FA 2HBWA 1JBMA 2XG8D 4M77B 4EMKC 3JV3A 1QVFS 4OGCA 4PFOA 1WA7A 2YUNA 3VS5A 4C0GA 1WXTA 2OTJA 1OX9A 4IURA 3QYHB 1M90R 3CMAA 2CT4A 1Q86U 2DAQA 1YNZA 2KT1A 2VWFA 2DILA 5GAMj 2YT6A 2EYXA 5CKEA 2QK0A 1IHWA 4ATOA 1VQOT 2OTLQ 3CPWS 2DL3A 4ZTJA 2K3YA 4EMKB 1U1TA 1IXDA 1G8XA 2VV5A 5LJ5g 4BY6C 1BI3A 1AWWA 1TSFA 1OU9A 3R6NA 3VV0A 2GCXA 4BE0A 1GRIA 1M3BA 3MP8A 3I56Q
chains in the Genus database with same CATH topology
2JMCA 1N5ZA 1X2KA 3A98A 1X27A 4JJBA 1ZLMA 4AFSC 2ABLA 1SEMA 1PRLC 4JJCA 2C0TA 5IHIA 2HDAA 2PZ1A 4F16A 3VS6A 2BZYA 5L23A 2RF0A 1YWOA 1B07A 3U23A 2L3QA 2GQIA 2I0NA 1H92A 2DL5A 1TUCA 3EG3A 3FJ5A 4LUEA 1OV3A 1JQQA 2KXDA 4IIMA 1IO6A 2HSPA 2KNBB 2J6OA 1UDLA 2CDTA 4JJDA 5EC7A 4HCKA 1LCKA 2JW4A 2FEIA 1TUDA 2RQTA 4AFZC 5IH2A 3VS4A 1OPLA 1NLPC 3QWYA 2JM9A 2J6FA 2BTTA 4CC2A 1UTIA 1ZUKA 1UHFA 3EG2A 1RLPC 1WX6A 4GBQA 1VYVA 2X3XD 4LN2A 2NUZA 4QT7A 1SSHA 1KFZA 5GJVB 3I9QA 2EGEA 4OMOA 4J9GA 5GJWB 1I0CA 2DL7A 2EQIA 2DVJA 2JTEA 1QLYA 2AZSA 2O9VA 1HD3A 3VRYA 1VYUA 2SRCA 5FWCA 1JO8A 2LZ6B 1ZX6A 2GNCA 2DLPA 4J9BA 1YP5A 2LJ0A 1W6XA 4OMMA 1G83A 2FRYA 1ZBJA 3RNJA 2RN8A 5HCKA 2L0AA 2LNHB 4J9IA 2JXBA 3PVQA 1W1FA 3M0QA 2F2WA 2K6DA 4LE9A 4OMPA 1Z9QA 4Z89A 2D0NA 2KROA 3RBBB 1YN8A 1OEBA 2EW3A 2MCNA 1UUEA 1E7OA 2K79A 4FSSA 1NLOC 2ROTA 1K4US 4KRTA 3NPFA 4WCIA 2OI3A 3VS3A 2KXCA 4HVVA 1E6HA 2DJQA 2EYYA 1WXUA 2LP5A 4AG2C 3GBQA 2DE0X 2CH4W 4RTWA 4F17A 2KT8A 1QKWA 2JS0A 1G2BA 1QCFA 3O5ZA 2EYWA 2BZ8A 2J06A 4D8KA 1VYTA 2K2MA 2CUDA 2KRNA 4DEYA 2LCSA 3QWXX 1WLPB 1SHGA 3UATA 2RNAA 1AVZC 4R0KA 2DL8A 2FG0A 2GTJA 2M51A 4RTVA 4A63B 4RUGA 2JM8A 4CC4B 4OMLA 4OMQA 1NYFA 4M4ZA 2LJ3A 1X6GA 1UGVA 1WYXA 2L3SA 3M0PA 3UA6A 1BU1A 1PKSA 2DX1A 2VKNA 1VA7A 3I5SA 2VVKA 2F2VA 4J9DA 1V1CA 2V1RA 1X6BA 4RTTA 5IHKA 2LQWA 1EFNA 3SEMA 2KE9A 2BZXA 4CC3A 3PE0A 1HSQA 4IIOA 4RTXA 4AFQC 1CKBA 4Z88A 4JPBW 1TG0A 1UE9A 1JU5C 1GL5A 3ZL7C 1GBRA 4JZ4A 1WIEA 1SHFA 3NGPA 2GBQA 1UJYA 2W10A 2EPDA 2DBMA 2RQUA 4HXJA 1U5SA 3VRZA 1AD5A 3I35A 1NEBA 4D8DA 3SHWA 2O88A 2AZVA 2PNIA 2ROLA 3UA7A 1T3SA 5IHNA 2F2XA 2M0YA 2DA9A 1PWTA 1MV3A 2O31A 1SRMA 1WDXA 3M0UA 4LNPA 1X2QA 2LX7A 1QWEA 1AZEA 1M8MA 4RTYA 2GTOA 1WFWA 2DF6A 3CQTA 1HJDA 2AKKA 3H0HA 2EGAA 2H8HA 4AFUC 4RTZA 2D8JA 4HVUA 3TVTA 2JT4A 1FMKA 2P4RA 5I22A 1SRLA 2XMFA 1XOVA 1M30A 1ABOA 3THKA 4AG1C 1ARKA 2YUOA 1MV0B 1YWPA 4GLMA 2KRMA 2ED1A 2AK5A 2O2OA 4CC7A 2W0ZA 1PRMC 2CH4A 2ECZA 3VS7A 1RI9A 2KYMA 1ZUUA 2J6KA 1RLQC 2DNUA 1NEGA 2KYBA 1GCPA 2KBTA 3UF4A 1S1NA 1MUZA 3M0SA 2A28A 2JS2A 1A0NB 5IXFA 1BK2A 2EVRA 5ECAA 2AKLA 5FWBA 4F14A 1U06A 2EGCA 2LQNA 1AWXA 1PNJA 2DL4A 2LJ1A 1I07A 2EBPA 2L3PA 1Z9ZA 3VS0A 3REAB 4RTUA 4X1VA 4J9HA 2CSIA 1AZGB 3M0RA 2OJ2A 1UHCA 4ESRA 1ZSGA 2YDLA 1UFFA 4ORZA 2RQWA 2KGTA 3EG0A 1K9AA 2HCKA 1KSWA 2EYZA 2B86A 1K0SA 1I1JA 1PHTA 3EHRA 2LMJA 1OPKA 2DYBA 2E5KA 4JZ3A 1T0JA 2D1XA 2NWMA 1CKAA 4Y92A 1UG1A 2KEAA 1GBQA 1RUWA 2D8HA 4OMNA 2FO0A 3H41A 2CUBA 2FPDA 1UECA 2A08A 1JXOA 1T3LA 2IIMA 1K0XA 1PKTA 3C0CA 1U3OA 3NHNA 1GFCA 2RPNA 1J3TA 1QWFA 2DRKA 3M0TA 2GGRA 5FW9A 1E6GA 3PVLA 4HVWA 2ENMA 1X69A 2K7AA 1AOJA 1AEYA 3REBB 2JMAA 2DMOA 2X3WD 1YCSB 3IQLA 1WXBA 2RQRA 1BBZA 2RQVA 2EKHA 1K76A 2J05A 3H0FA 2CSQA 1M27C 2RMOA 1GFDA 1AWOA 1JXMA 1W70A 1Y0MA 2MOXA 2ED0A 1OOTA 1B3QA 4J9FA 1KJWA 2MIOA 3LH5A 2YUQA 4LUDA 1X43A 2G6FX 2QDLA 2C0IA 2YSQA 1M3CA 1ZUYA 3VS1A 1AWJA 3TSZA 1JEGA 3EHQA 4J9EA 2DRMA 2PTKA 1FYNA 1UJ0A 2HBWA 1QKXA 1H3HA 2V1QA 2C0OA 4K11A 3EGUA 3JV3A 3VS2A 2L2PA 5IXBA 2CT3A 2HEQA 1WA7A 2YUNA 3VS5A 1WXTA 1NYGA 1M3AA 2DBKA 2J7IA 2SEMA 2YUPA 2FPFA 1NG2A 2CREA 4J9CA 3KFVA 2CT4A 3I5RA 1BB9A 1YNZA 2FPEA 2KT1A 2VWFA 1CSKA 1Y57A 1NM7A 2K3BA 2DILA 2YT6A 2A37A 4ZNXA 2EYXA 2DM1A 1WI7A 2KRSA 2K9GA 3ULRB 1KIKA 1K1ZA 1GCQC 2A36A 4DEXA 2DL3A 1H8KA 4E6RA 4EIKA 4Z8AA 3NMZC 2KR3A 1SPKA 1ABQA 5I11A 1AWWA 3TSWA 3R6NA 2OAWA 1GCQA 1GRIA 3H0IA 3EG1A 2FRWA 2O9SA 1M3BA 2ESWA 1T0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMC A;  1N5Z A;  1X2K A;  3A98 A;  1X27 A;  4JJB A;  1ZLM A;  4AFS C;  2ABL A;  1SEM A;  1PRL C;  4JJC A;  2C0T A;  5IHI A;  2HDA A;  2PZ1 A;  4F16 A;  3VS6 A;  2BZY A;  5L23 A;  2RF0 A;  1YWO A;  1B07 A;  3U23 A;  2L3Q A;  2GQI A;  2I0N A;  1H92 A;  2DL5 A;  1TUC A;  3EG3 A;  3FJ5 A;  4LUE A;  1OV3 A;  1JQQ A;  2KXD A;  4IIM A;  1IO6 A;  2HSP A;  2KNB B;  2J6O A;  1UDL A;  2CDT A;  4JJD A;  5EC7 A;  4HCK A;  1LCK A;  2JW4 A;  2FEI A;  1TUD A;  2RQT A;  4AFZ C;  5IH2 A;  3VS4 A;  1OPL A;  1NLP C;  3QWY A;  2JM9 A;  2J6F A;  2BTT A;  4CC2 A;  1UTI A;  1ZUK A;  1UHF A;  3EG2 A;  1RLP C;  1WX6 A;  4GBQ A;  1VYV A;  2X3X D;  4LN2 A;  2NUZ A;  4QT7 A;  1SSH A;  1KFZ A;  5GJV B;  3I9Q A;  2EGE A;  4OMO A;  4J9G A;  5GJW B;  1I0C A;  2DL7 A;  2EQI A;  2DVJ A;  2JTE A;  1QLY A;  2AZS A;  2O9V A;  1HD3 A;  3VRY A;  1VYU A;  2SRC A;  5FWC A;  1JO8 A;  2LZ6 B;  1ZX6 A;  2GNC A;  2DLP A;  4J9B A;  1YP5 A;  2LJ0 A;  1W6X A;  4OMM A;  1G83 A;  2FRY A;  1ZBJ A;  3RNJ A;  2RN8 A;  5HCK A;  2L0A A;  2LNH B;  4J9I A;  2JXB A;  3PVQ A;  1W1F A;  3M0Q A;  2F2W A;  2K6D A;  4LE9 A;  4OMP A;  1Z9Q A;  4Z89 A;  2D0N A;  2KRO A;  3RBB B;  1YN8 A;  1OEB A;  2EW3 A;  2MCN A;  1UUE A;  1E7O A;  2K79 A;  4FSS A;  1NLO C;  2ROT A;  1K4U S;  4KRT A;  3NPF A;  4WCI A;  2OI3 A;  3VS3 A;  2KXC A;  4HVV A;  1E6H A;  2DJQ A;  2EYY A;  1WXU A;  2LP5 A;  4AG2 C;  3GBQ A;  2DE0 X;  2CH4 W;  4RTW A;  4F17 A;  2KT8 A;  1QKW A;  2JS0 A;  1G2B A;  1QCF A;  3O5Z A;  2EYW A;  2BZ8 A;  2J06 A;  4D8K A;  1VYT A;  2K2M A;  2CUD A;  2KRN A;  4DEY A;  2LCS A;  3QWX X;  1WLP B;  1SHG A;  3UAT A;  2RNA A;  1AVZ C;  4R0K A;  2DL8 A;  2FG0 A;  2GTJ A;  2M51 A;  4RTV A;  4A63 B;  4RUG A;  2JM8 A;  4CC4 B;  4OML A;  4OMQ A;  1NYF A;  4M4Z A;  2LJ3 A;  1X6G A;  1UGV A;  1WYX A;  2L3S A;  3M0P A;  3UA6 A;  1BU1 A;  1PKS A;  2DX1 A;  2VKN A;  1VA7 A;  3I5S A;  2VVK A;  2F2V A;  4J9D A;  1V1C A;  2V1R A;  1X6B A;  4RTT A;  5IHK A;  2LQW A;  1EFN A;  3SEM A;  2KE9 A;  2BZX A;  4CC3 A;  3PE0 A;  1HSQ A;  4IIO A;  4RTX A;  4AFQ C;  1CKB A;  4Z88 A;  4JPB W;  1TG0 A;  1UE9 A;  1JU5 C;  1GL5 A;  3ZL7 C;  1GBR A;  4JZ4 A;  1WIE A;  1SHF A;  3NGP A;  2GBQ A;  1UJY A;  2W10 A;  2EPD A;  2DBM A;  2RQU A;  4HXJ A;  1U5S A;  3VRZ A;  1AD5 A;  3I35 A;  1NEB A;  4D8D A;  3SHW A;  2O88 A;  2AZV A;  2PNI A;  2ROL A;  3UA7 A;  1T3S A;  5IHN A;  2F2X A;  2M0Y A;  2DA9 A;  1PWT A;  1MV3 A;  2O31 A;  1SRM A;  1WDX A;  3M0U A;  4LNP A;  1X2Q A;  2LX7 A;  1QWE A;  1AZE A;  1M8M A;  4RTY A;  2GTO A;  1WFW A;  2DF6 A;  3CQT A;  1HJD A;  2AKK A;  3H0H A;  2EGA A;  2H8H A;  4AFU C;  4RTZ A;  2D8J A;  4HVU A;  3TVT A;  2JT4 A;  1FMK A;  2P4R A;  5I22 A;  1SRL A;  2XMF A;  1XOV A;  1M30 A;  1ABO A;  3THK A;  4AG1 C;  1ARK A;  2YUO A;  1MV0 B;  1YWP A;  4GLM A;  2KRM A;  2ED1 A;  2AK5 A;  2O2O A;  4CC7 A;  2W0Z A;  1PRM C;  2CH4 A;  2ECZ A;  3VS7 A;  1RI9 A;  2KYM A;  1ZUU A;  2J6K A;  1RLQ C;  2DNU A;  1NEG A;  2KYB A;  1GCP A;  2KBT A;  3UF4 A;  1S1N A;  1MUZ A;  3M0S A;  2A28 A;  2JS2 A;  1A0N B;  5IXF A;  1BK2 A;  2EVR A;  5ECA A;  2AKL A;  5FWB A;  4F14 A;  1U06 A;  2EGC A;  2LQN A;  1AWX A;  1PNJ A;  2DL4 A;  2LJ1 A;  1I07 A;  2EBP A;  2L3P A;  1Z9Z A;  3VS0 A;  3REA B;  4RTU A;  4X1V A;  4J9H A;  2CSI A;  1AZG B;  3M0R A;  2OJ2 A;  1UHC A;  4ESR A;  1ZSG A;  2YDL A;  1UFF A;  4ORZ A;  2RQW A;  2KGT A;  3EG0 A;  1K9A A;  2HCK A;  1KSW A;  2EYZ A;  2B86 A;  1K0S A;  1I1J A;  1PHT A;  3EHR A;  2LMJ A;  1OPK A;  2DYB A;  2E5K A;  4JZ3 A;  1T0J A;  2D1X A;  2NWM A;  1CKA A;  4Y92 A;  1UG1 A;  2KEA A;  1GBQ A;  1RUW A;  2D8H A;  4OMN A;  2FO0 A;  3H41 A;  2CUB A;  2FPD A;  1UEC A;  2A08 A;  1JXO A;  1T3L A;  2IIM A;  1K0X A;  1PKT A;  3C0C A;  1U3O A;  3NHN A;  1GFC A;  2RPN A;  1J3T A;  1QWF A;  2DRK A;  3M0T A;  2GGR A;  5FW9 A;  1E6G A;  3PVL A;  4HVW A;  2ENM A;  1X69 A;  2K7A A;  1AOJ A;  1AEY A;  3REB B;  2JMA A;  2DMO A;  2X3W D;  1YCS B;  3IQL A;  1WXB A;  2RQR A;  1BBZ A;  2RQV A;  2EKH A;  1K76 A;  2J05 A;  3H0F A;  2CSQ A;  1M27 C;  2RMO A;  1GFD A;  1AWO A;  1JXM A;  1W70 A;  1Y0M A;  2MOX A;  2ED0 A;  1OOT A;  1B3Q A;  4J9F A;  1KJW A;  2MIO A;  3LH5 A;  2YUQ A;  4LUD A;  1X43 A;  2G6F X;  2QDL A;  2C0I A;  2YSQ A;  1M3C A;  1ZUY A;  3VS1 A;  1AWJ A;  3TSZ A;  1JEG A;  3EHQ A;  4J9E A;  2DRM A;  2PTK A;  1FYN A;  1UJ0 A;  2HBW A;  1QKX A;  1H3H A;  2V1Q A;  2C0O A;  4K11 A;  3EGU A;  3JV3 A;  3VS2 A;  2L2P A;  5IXB A;  2CT3 A;  2HEQ A;  1WA7 A;  2YUN A;  3VS5 A;  1WXT A;  1NYG A;  1M3A A;  2DBK A;  2J7I A;  2SEM A;  2YUP A;  2FPF A;  1NG2 A;  2CRE A;  4J9C A;  3KFV A;  2CT4 A;  3I5R A;  1BB9 A;  1YNZ A;  2FPE A;  2KT1 A;  2VWF A;  1CSK A;  1Y57 A;  1NM7 A;  2K3B A;  2DIL A;  2YT6 A;  2A37 A;  4ZNX A;  2EYX A;  2DM1 A;  1WI7 A;  2KRS A;  2K9G A;  3ULR B;  1KIK A;  1K1Z A;  1GCQ C;  2A36 A;  4DEX A;  2DL3 A;  1H8K A;  4E6R A;  4EIK A;  4Z8A A;  3NMZ C;  2KR3 A;  1SPK A;  1ABQ A;  5I11 A;  1AWW A;  3TSW A;  3R6N A;  2OAW A;  1GCQ A;  1GRI A;  3H0I A;  3EG1 A;  2FRW A;  2O9S A;  1M3B A;  2ESW A;  1T0H A; 
#chains in the Genus database with same CATH topology
 4C92 D;  1N5Z A;  2JTF A;  4UC4 A;  3A98 A;  5GAO m;  1X27 A;  1VQ8 T;  1O75 A;  1I81 A;  2R5A A;  3Q1J A;  4M78 D;  2LNV A;  3INZ A;  1BCM A;  4F16 A;  2VUB A;  2BZY A;  5L23 A;  1FMV A;  1KD1 R;  3U23 A;  2L3Q A;  2I0N A;  5L8R E;  2EIF A;  3ZFJ A;  1MHN A;  2NUT B;  3CCR Q;  1ZA1 B;  1OV3 A;  1BI0 A;  2COW A;  2DD5 A;  2J6O A;  2KNB B;  4JJD A;  5EC7 A;  4FL6 A;  2COZ A;  4C5H A;  5KYY A;  4BY6 B;  2FEI A;  5LJ3 j;  4N0A C;  4AFZ C;  1Q81 U;  3C4S A;  1WQ7 A;  3LW5 E;  2P0K A;  1FX7 A;  1JJ2 P;  1ZSZ C;  1C1A A;  3CC7 T;  4GBQ A;  1TTH B;  5KYN A;  1R0B G;  3M53 A;  4A4G A;  4QT7 A;  3CCR T;  2R5M A;  3A1P A;  4E7K A;  1N27 A;  4RCC A;  3G6E Q;  1SSH A;  4XU1 A;  5GAN 7;  2DL7 A;  2EQI A;  4M77 D;  2AZS A;  4C0F A;  4O6J A;  3R6O A;  1UGP B;  4PJN A;  2DLP A;  3MP1 A;  5GMK l;  2DEU A;  1RAD B;  1UEB A;  4C0Z A;  2CP2 A;  2HMA A;  1G83 A;  1ZSZ B;  2KI7 A;  3CPW A;  1YJ9 A;  4J9I A;  2JXB A;  1R0C B;  2F2W A;  4RG8 A;  1Y71 A;  8ATC B;  4Z89 A;  2D0N A;  1NPR A;  2FZK B;  5EG2 A;  4B9W A;  3RBB B;  2E41 A;  2E3H A;  1YN8 A;  1OEB A;  2MCN A;  4FSS A;  2ROT A;  4OF1 A;  4HVV A;  4C8Q C;  1TXQ A;  1YHQ A;  2I2L A;  2CH4 W;  4RTW A;  4C8Q G;  4ZGD B;  2JS0 A;  1WJR A;  4L6V 5;  2BZ8 A;  2X35 A;  1FWZ A;  3OW2 S;  4DEY A;  4J8O A;  3BFM A;  2HL3 A;  3WXM B;  5LJ5 j;  3QBY A;  4EPC A;  3JCM X;  5IAY A;  2HBP A;  3UAT A;  2FL7 A;  1M1K R;  2PUK B;  1KD1 U;  1SKU B;  2GTJ A;  2FG0 A;  4A63 B;  2RI2 A;  4KBM B;  4BDZ A;  5GAM d;  1WQW A;  2OTJ Q;  3EH1 A;  4PLI A;  1QQJ A;  2OAU A;  2RJD A;  3CMA Q;  1WYX A;  3M0P A;  4KT0 E;  1PKS A;  1NBE B;  1HK9 A;  2VKN A;  4C8Q B;  1N9R A;  1VA7 A;  4M7A F;  4JRI A;  4OB2 B;  4M7D E;  2DK3 A;  2VVK A;  3L2Z A;  2X51 A;  4HCB A;  2V8K A;  2HSE B;  1M9S A;  1BCO A;  2QQR A;  1KQS S;  3QDR B;  2HZY A;  2OTJ T;  4FW2 A;  3CMA T;  1CKB A;  4Z88 A;  1N8R U;  2CP7 A;  1GL5 A;  5HK0 A;  3ZL7 C;  4ANJ A;  3EAE A;  3MKD A;  3NGP A;  2GBQ A;  4MZP A;  1NJI C;  1UJY A;  4KUL A;  2FB7 A;  2RQU A;  1YIJ A;  3SWN A;  1VIE A;  1D1C A;  4ZN1 A;  4FCY A;  1QW1 A;  1TWB A;  2DIG A;  3I55 A;  5IHN A;  4FYW B;  5GMK m;  1MV3 A;  4M75 A;  1SRM A;  4LNP A;  1X2Q A;  1WJS A;  1QVF P;  3X26 B;  3JCM P;  2LX7 A;  2VYT A;  1PD0 A;  2LCL A;  1Y96 A;  3MJX A;  4WF2 A;  2V8J A;  3PMI A;  1RAH B;  4QQG A;  2VB6 A;  3TEE A;  4M7D A;  3URG A;  3CCE A;  1VQM A;  3A8M B;  3M54 A;  2RJC A;  1H3Z A;  2ZAE A;  3HFN A;  3LYI A;  2JT4 A;  2FYK A;  2P4R A;  4DBR A;  4XTU A;  7AT1 B;  4KUI A;  1Y7X A;  3CPW P;  3L1A A;  1M30 A;  1X6O A;  1ABO A;  5CKD A;  3QG1 A;  1M1K U;  1OYX A;  2ZGW A;  4RG2 A;  2DXU A;  2YUO A;  4PJO E;  1QCO A;  3EG9 A;  2QEX A;  2CH4 A;  4FIB A;  4C92 F;  3VS7 A;  1RI9 A;  1ZUU A;  4M78 F;  1D0X A;  1GCP A;  3UF4 A;  3PNW C;  3LGL A;  1YJ9 Q;  2RHI A;  2GFU A;  3M0S A;  4EMG A;  2JS2 A;  5IXF A;  1BK2 A;  1G5V A;  3GIB A;  3JCM J;  4J6Y A;  2AKL A;  3L2W A;  2D9T A;  3QYG B;  4C5E A;  1PNJ A;  1I07 A;  3V7C A;  3VS0 A;  3A8G B;  2O4X A;  2QYZ A;  5C0M A;  1KC8 U;  5FRO A;  1VQ4 A;  1YJ9 T;  2L89 A;  1AZG B;  3GLX A;  3M0R A;  5LJ5 d;  2YDL A;  3GPL A;  4J6X A;  3M58 A;  3EG0 A;  2RHZ A;  1KSW A;  2EYZ A;  2B86 A;  1K0S A;  1I1J A;  4XAX B;  1OPK A;  4LDW A;  4M77 F;  1Q7Y C;  3RUX A;  1VIF A;  2KEA A;  1RUW A;  3M59 A;  4OMN A;  3H41 A;  1YHQ T;  4F7U A;  1RAE B;  2KQW A;  5KYX B;  2IIM A;  4OGE A;  2VXE A;  1PKT A;  3OBY A;  1GFC A;  2RPN A;  1J3T A;  3M0T A;  1NPP A;  3BDU A;  4HVW A;  3CBO A;  2ENM A;  2L8D A;  3EFR A;  4M7A G;  1AOJ A;  1AEY A;  2FZG B;  3G7Z A;  3BW1 A;  2XIC A;  2RQR A;  4B6M A;  1D0Z A;  2EAY A;  1KQ2 A;  2H3E B;  3VKI A;  5I2S A;  5KYW B;  1IRX A;  1JXM A;  2HD0 A;  1VQ7 A;  2CZ1 B;  5KE2 A;  1UGS B;  2CZ7 B;  1YIJ Q;  3M5A A;  2YUQ A;  1VQP A;  2BE7 D;  2DPP B;  2QDL A;  2C0I A;  2RD1 A;  4DQ2 A;  3G4S A;  4R55 A;  1YJW Q;  4ELZ C;  5GAN 8;  1AWJ A;  1TS9 A;  3I55 Q;  2HQX A;  1B34 A;  3QXE B;  1RAF B;  1UJ0 A;  3OW2 P;  1KK7 A;  2OTL A;  1K73 U;  1Q82 U;  4KGX B;  1QKX A;  2WSC E;  3HKS A;  1OX8 A;  5I2M A;  2ZPB B;  1H3H A;  3OYJ A;  1RAG B;  1BYM A;  3VS2 A;  2L2P A;  1YIJ T;  2CT3 A;  1K8A U;  5LL6 S;  1F1B B;  1PSF A;  2RH2 A;  1M3A A;  3CCE Q;  3CCJ A;  5KE3 A;  2SEM A;  5HKC A;  1VQM Q;  3I55 T;  2CRE A;  3KFV A;  4N4I A;  3CCM A;  5GAN 4;  5J26 A;  3L2V A;  1CSK A;  2K3B A;  3PIP A;  3I56 A;  2DER A;  2KY9 A;  1D3B A;  2A37 A;  4QKU A;  4XTW A;  3HFO A;  2KRS A;  4PJO F;  1C0M A;  2RB6 A;  3P8H A;  1KQS P;  2A36 A;  2A7Y A;  4DEX A;  5GAO n;  2DZC A;  2XU8 A;  4Z8A A;  4NOY A;  3CCE T;  1FXX A;  2QEX Q;  2QXF A;  3H6Z A;  5D6X A;  1VQN Q;  2DXT A;  4C92 G;  3HPW A;  3TSW A;  3EFO B;  3LGF A;  1GCQ A;  3EG1 A;  4M78 G;  4ME7 A;  4IUT A;  1ZLM A;  4AFS C;  2ABL A;  1SEM A;  2C06 A;  2O01 E;  2C0T A;  2QEX T;  1UB4 A;  2PVG B;  1YIT A;  1OI1 A;  4KH0 B;  3VS6 A;  5DLO A;  2RF0 A;  1B07 A;  1OZ2 A;  1TUC A;  1VQ4 Q;  1M2V B;  4FYV B;  1JJ2 A;  2KXD A;  2DTH A;  2HSP A;  3A8O B;  3CC2 A;  4HCK A;  3UPU A;  4C5G A;  3NTH A;  3QWY A;  4KUD K;  2EQM A;  4CC2 A;  1ZUK A;  2CS7 A;  1UHF A;  1W4S A;  1WX6 A;  4BB7 A;  5AT1 B;  4M77 G;  1VQ4 T;  1VOM A;  2WSE E;  4ZN3 A;  1LPL A;  2KVQ G;  4LDU A;  1I0C A;  2JTE A;  2YLC A;  2ZPG B;  1QLY A;  2O9V A;  3VRY A;  1QP3 A;  1VYU A;  2VGN A;  2QTV A;  2RHU A;  1ZX6 A;  2NUP A;  2GNC A;  3OYK A;  5IT9 E;  5AYF A;  5KYU B;  3QO3 A;  1YP5 A;  4BE1 A;  3CCL Q;  5GMK e;  2FRY A;  1K73 C;  1ZBJ A;  3CC4 A;  3NFC A;  3RNJ A;  4B9X A;  4MDW A;  1KHC A;  4XU3 A;  2Y4X A;  3M0Q A;  3LWI A;  2K6D A;  4LE9 A;  1D1A A;  1VQ7 Q;  3OMG A;  3DB3 A;  2KRO A;  1XTD A;  3HTR A;  3TU4 K;  3BE3 A;  2K79 A;  6AT1 B;  2R58 A;  3QZ5 B;  1VQP Q;  4WCI A;  3G4S Q;  3VYG A;  2KXC A;  5D6W A;  4RKU E;  2E6Z A;  2DJQ A;  2EYY A;  1WXU A;  2KAF A;  2EWN A;  1S72 A;  4F17 A;  2RK2 A;  2KT8 A;  4A4F A;  4QVD A;  3QSU A;  2P0P A;  2QQA A;  1EZZ B;  3PGG A;  1M4Z A;  4J83 A;  4QVZ A;  1VQ7 T;  2J06 A;  4D8K A;  2DKG A;  1VYT A;  2KRN A;  4DBH A;  1UGR B;  3QJY A;  3QUI A;  2LCS A;  1WLP B;  2RNA A;  3TQ7 P;  2HQH A;  4CC4 B;  4IUP A;  4OML A;  4OMQ A;  1NYF A;  1SG5 A;  5FU7 C;  3CCJ Q;  2EQK A;  2LJ3 A;  2LDM A;  2L3S A;  3CCM Q;  3UA6 A;  3KUF A;  1BU1 A;  3RDV A;  5KCH A;  3J81 E;  2OTL T;  3QPH A;  3I5S A;  4PJO C;  2DZ9 A;  5FLX E;  4J9D A;  4Z02 A;  4RTT A;  3OYY A;  2LC4 A;  3LLR A;  4PJO G;  3X25 B;  2KE9 A;  3CCJ T;  4A54 A;  4RTX A;  3CCM T;  4JPB W;  1SSF A;  4OVA A;  1UE9 A;  3I56 T;  2CZ0 B;  4JZ4 A;  1M2O A;  5FU7 B;  4OB1 B;  3OYG A;  2WAC A;  5CIU A;  2EPD A;  2DBM A;  1U5S A;  3QII A;  1TOV A;  1K9M C;  3VU3 C;  3JB9 D;  4CRI A;  3I35 A;  4O5V A;  1NZ9 A;  1B7T A;  4PLL A;  5CAI A;  1QVF A;  4PJO B;  1YIT Q;  5FRN A;  3C94 A;  2DA9 A;  5J39 A;  2VGM A;  1WDX A;  1ZQ1 A;  3M0U A;  1EX4 A;  4M7A A;  3A8L B;  4V2S A;  1FMW A;  3CC2 Q;  1QWE A;  1RL2 A;  1AZE A;  1M8M A;  3LX7 A;  2LT4 A;  1M90 U;  4RTY A;  3D7S B;  1Q7Y R;  5GAO p;  2Z0W A;  1PM3 A;  1ZA2 B;  3CQT A;  2CKK A;  4M7D D;  3G6E T;  4JLG A;  4AFU C;  2QDY B;  4RTZ A;  2D8J A;  4HVU A;  5GAN d;  3TVT A;  3LH0 A;  1FMK A;  4XQ3 A;  3EGX B;  3CC2 T;  2PQW A;  1SRL A;  5GAN e;  1MMA A;  4QW2 A;  4AG1 C;  1Q86 C;  1MV0 B;  1Q95 G;  3M57 A;  4HCZ A;  3MEW A;  2DYI A;  3AT1 B;  2ECZ A;  3M4Y A;  1ZBX A;  4CI0 C;  1IB8 A;  4WTO B;  3CC4 Q;  1MUZ A;  2K3X A;  2A3L A;  4E7J A;  3E19 A;  1NE8 A;  2EVR A;  5ECA A;  5FWB A;  2MWP A;  4M75 E;  4F14 A;  2EGC A;  4FU6 A;  3JCM V;  2VXF A;  2DL4 A;  2LCC A;  2EBP A;  2QTX A;  5GAM e;  2CP6 A;  4X1V A;  3HRU A;  2L3R A;  2CSI A;  3CC4 T;  2HQE A;  3E2U A;  1S72 Q;  2OJ2 A;  1QVG S;  1QCN A;  2K2V A;  2M1H A;  2PU9 B;  1YJN Q;  3SB2 A;  1PD1 A;  1W2B S;  3MO8 A;  3OQ5 A;  2LMJ A;  4KGZ B;  4EDU A;  4C92 A;  2NWM A;  2F5T X;  4Y92 A;  4PJO D;  2FO0 A;  2E10 A;  3PTA A;  2CUB A;  5GAO r;  1UEC A;  2V26 A;  3N5B B;  1S72 T;  1Q81 C;  2ZPI B;  3S6W A;  1JXO A;  1T3L A;  2RI5 A;  1UGQ B;  4FT2 A;  3OS2 A;  5C6S A;  3C0C A;  1U3O A;  2XD0 A;  2FHD A;  2DRK A;  1G3Y A;  5DY9 A;  3OYB A;  1E6G A;  1YJW A;  1AT1 B;  3PFS A;  1KG1 A;  5LJ3 d;  2DMO A;  2X3W D;  3JCM d;  1G3W A;  2RQV A;  2EKH A;  2QQ9 A;  5LJ3 e;  2J05 A;  2CSQ A;  2WSF E;  2RMO A;  3EGD A;  3JCM e;  2DIQ A;  2QGG A;  1W70 A;  1VQ6 A;  1VQL A;  4JS5 A;  1OOT A;  1YBY A;  2MIO A;  4M77 A;  3OW2 A;  2JNG A;  2ATC B;  3SDZ A;  4LUD A;  1X43 A;  2G6F X;  3JCM Q;  1ZUY A;  2BIV A;  3VS1 A;  4FT4 A;  3OYH A;  4J9E A;  2DRM A;  1D1B A;  1PSE A;  3M55 A;  3V8J A;  2DET A;  5CVI A;  1VQK A;  1GXI E;  4F7U E;  2C0O A;  4K11 A;  4XTX A;  4LDV A;  3CXC S;  2X4W A;  2AIR B;  1VQN A;  4J7I A;  2QAS A;  4C0D C;  1NYG A;  4J7F A;  2P0Q A;  3OYD A;  2DBK A;  3V8K A;  1NG2 A;  2M0O A;  1WHG A;  4J9C A;  1KQS A;  3I5R A;  4EMK A;  1Y57 A;  4LDY A;  1YI2 A;  3RMQ A;  1KD1 C;  4ZNX A;  1WI7 A;  3L2U A;  3DLM A;  2XKO C;  4E6R A;  4EIK A;  1SPK A;  2XHC A;  1WZO A;  3JB9 F;  4J5Y A;  1ABQ A;  1QP2 A;  4JJN K;  5I11 A;  2EQJ A;  2CGH A;  4MZM A;  4C0D B;  3MPU B;  5LJ5 e;  4QQD A;  2FRW A;  1WHK A;  2LT1 A;  2NUT A;  4BUG A;  3HHT B;  1OQK A;  2YWW A;  3FDR A;  4JJB A;  4FW1 A;  3OYE A;  1N8R C;  1PRL C;  1M1G A;  4Y28 E;  2HDA A;  2DO3 A;  1YWO A;  4II1 A;  3CPF A;  2X4Y A;  2GQI A;  4M7D F;  1VQ5 A;  1ACM B;  4JRK A;  4EMH A;  1XJW B;  1KHI A;  4OB3 B;  1JQQ A;  4IIM A;  1UDL A;  3CD6 A;  2BKD N;  5LJ5 f;  3CCS Q;  3VS4 A;  1OPL A;  1NLP C;  3CCL A;  2JM9 A;  2J6F A;  5CQY A;  1UTI A;  5CQX A;  3TCJ A;  3DB4 A;  3L2R A;  4J6W A;  4MZT A;  4E7Z A;  2NUZ A;  4BAC A;  4N0A A;  5KYY B;  3HL8 A;  3MEV A;  1KFZ A;  4C8Q E;  2EGE A;  1ZSZ A;  2E4H A;  5GJW B;  2DVJ A;  3OBW A;  3MHX A;  1HD3 A;  5IN1 A;  5D7U A;  1JO8 A;  2LZ6 B;  1VQO A;  4Y91 A;  2XDD A;  3G71 Q;  4NS5 A;  2LJ0 A;  1W6X A;  1M1K C;  1XNI A;  2M02 A;  2GQV A;  3RR6 A;  1WHM A;  5FU6 C;  2L0A A;  2LNH B;  5KCO A;  1Z9Q A;  1VQ6 Q;  5GAN 6;  1VQL Q;  1YJW T;  5GMK i;  1E7O A;  3ZBD A;  1NLO C;  4KRT A;  1R77 A;  2YHT A;  3NPF A;  4JDS A;  4F04 B;  2OI3 A;  2EFI A;  1VQ8 A;  2MI6 A;  1QVG P;  2JVV A;  2JN0 A;  2LP5 A;  3CBP A;  3OS5 A;  2DE0 X;  4A4H A;  3OYL A;  1D09 B;  4PK4 A;  5A0D A;  5CO7 A;  1W2B P;  3O5Z A;  1G3T A;  2RM4 A;  1WHJ A;  2GFA A;  4F7U F;  3DLL A;  1VQK Q;  5DM7 R;  2FZC B;  1VQ6 T;  2K2M A;  1BIB A;  2CUD A;  2HNI A;  3UT1 A;  3JB9 J;  1O9S A;  1VQM T;  4C8Q A;  1KC8 C;  3GOX A;  2RA2 A;  5FU6 B;  2YRV A;  2E70 A;  5GMK h;  4RUG A;  2JM8 A;  1M8V A;  3CC7 A;  2DXC A;  2KSS A;  4MDX A;  3CEY A;  2DX1 A;  1YI2 Q;  2COY A;  2ZPE B;  2X4J A;  3OSV A;  4A4K A;  1Q86 R;  5CK9 A;  1V1C A;  3O8V A;  4MMK A;  1VQN T;  4JRP A;  5IHK A;  2LQW A;  3ZEH A;  2BZX A;  4CC3 A;  3PE0 A;  4IIO A;  4AFQ C;  2MWO A;  3P8B B;  3J80 E;  3SWN C;  2K5L A;  5GAO q;  4ZGE B;  2HKN A;  1YI2 T;  3JB9 G;  3ME9 A;  1WIE A;  1SHF A;  2MAM A;  1V29 B;  4X9D A;  1I8F A;  2M9U A;  4M75 C;  4HXJ A;  4E47 A;  1AD5 A;  1NEB A;  4D8D A;  4M75 G;  4BI3 A;  2R57 A;  2AZV A;  3JCM W;  3A8H B;  1WNL A;  1T3S A;  2P84 A;  2F2X A;  2M0Y A;  3NTI A;  1PWT A;  4A53 A;  4M7D C;  1VQ5 Q;  2O31 A;  4BDY A;  2QI2 A;  3JRZ A;  3QZ9 B;  5FRM A;  3CXC P;  1WGS A;  4M7D G;  3CD6 Q;  3SWN B;  2DTO A;  3X20 B;  4L5G A;  2GTO A;  1WFW A;  3X28 B;  5I21 A;  1Q82 C;  2AKK A;  4M75 B;  2HAX A;  3H0H A;  4PKC C;  3C95 A;  2H8H A;  1Q81 R;  1NJI R;  3FRN A;  3VUB A;  1VQ5 T;  4HKE A;  4LD9 K;  4IUV A;  2K4Y A;  2RK1 A;  1Y96 B;  1K8A C;  3CD6 T;  2XMF A;  3E9F A;  1XOV A;  2NYS A;  3P8D A;  3THK A;  4FM4 B;  3H9N A;  4M7D B;  1ARK A;  2KRM A;  2ED1 A;  3CCL T;  4E2F B;  4CC7 A;  2W0Z A;  3RMS A;  2MK5 A;  1PCX A;  1VQO Q;  3HSB A;  4GY5 A;  4DBF A;  2J6K A;  1RLQ C;  2DNU A;  1NEG A;  2KYB A;  4NL3 A;  1YJN A;  3CME A;  4PFZ A;  1MNE A;  2VAS A;  2A28 A;  3NTK A;  2K5F A;  1LNX A;  2DJZ A;  2QGF B;  2PUO B;  1VQP T;  4D6W A;  2E5Q A;  3EG9 B;  3G4S T;  2YRD A;  1U06 A;  4JLI A;  5A2Q E;  4M7A E;  2L3P A;  5A0L A;  1N6A A;  1VQ8 Q;  2VC8 A;  3T9N A;  1YCY A;  3X24 B;  3GF5 A;  4XK8 E;  5GAN h;  1MMG A;  4AT1 B;  3VJP A;  3ER0 A;  2M16 A;  2DEQ A;  1VQ9 A;  1ZSG A;  1PC0 A;  1IGQ A;  1U1S A;  5M9O A;  2G3R A;  5GAN 2;  5KYX A;  1N9S A;  5CKF A;  1IZ6 A;  2HCK A;  2RHY A;  1MND A;  2RHX A;  4F7U G;  2O4X B;  2E5K A;  4JZ3 A;  1T0J A;  2D8H A;  2F1L A;  3OMC A;  1AHJ B;  2XID A;  4LDX A;  4DBQ A;  3CC7 Q;  2MYS A;  1RI0 A;  1D0Y A;  3JCM b;  3OS1 A;  4FYX B;  2ZCF B;  1K0X A;  2KMT A;  2QA4 A;  2IVW A;  1QWF A;  2GGR A;  4X34 A;  5FW9 A;  3PVL A;  4TVR A;  4PJL A;  5KYW A;  1X69 A;  5GAM h;  2ZPH B;  1YFN A;  4F7U B;  2IG0 A;  2KDS A;  1NJI U;  2JMA A;  4M75 D;  3IQL A;  3MCA B;  2CZ6 B;  3H0F A;  3VUZ A;  1M27 C;  3FB9 A;  3UDC A;  4DOV A;  1GFD A;  1HYO A;  1Y0M A;  2RO0 A;  3OSS C;  1YIT T;  1B3Q A;  1N8R R;  3RKW A;  2YSQ A;  5A0G A;  4XTZ A;  2QG9 B;  3CCV A;  3PIO A;  3KBG A;  3EHQ A;  3H8Z A;  4XTY A;  3RIR A;  4C92 E;  4E7I A;  1BKB A;  4M78 E;  2V1Q A;  3GNF B;  2Y90 A;  3EGU A;  5IXB A;  9ATC B;  2HEQ A;  2XDB A;  3QJ6 A;  2A0F B;  3RKX A;  3L42 A;  4YTL A;  2J7I A;  1B34 B;  3E1S A;  2YUP A;  2FPF A;  5LJ3 h;  3DKM A;  2HKQ B;  1BB9 A;  3J7A F;  3JCM h;  2DFU A;  2FPE A;  2MMP A;  1NM7 A;  2P4T A;  5GAN f;  2E64 A;  4OB0 B;  2DM1 A;  3EFO A;  4RMO A;  2K9G A;  3FIF A;  3ULR B;  1KIK A;  4PNO A;  1K1Z A;  3PT9 A;  1JB0 E;  1GCQ C;  1H8K A;  3PMT A;  2E12 A;  3NMZ C;  2KR3 A;  3UWN A;  2CP5 A;  2EYQ A;  2JZ2 A;  1RAI B;  4XTV A;  3V8L A;  3OS0 A;  1D3B B;  1TU0 B;  3BDL A;  4M77 E;  3M9Q A;  1LVK A;  3CME Q;  4P5N A;  5D6Y A;  2OAW A;  3CCS A;  3H0I A;  2O9S A;  2ESW A;  1M2V A;  3OY9 A;  4X9C A;  3QHS A;  4LXC A;  2PVO B;  1T0H A;  1LJO A;  2JMC A;  1A0N B;  1WHL A;  1OUL A;  1X2K A;  3FC3 A;  4E7S A;  4M78 A;  2RJF A;  1I4K 1;  4JJC A;  2RJE A;  5IHI A;  2PZ1 A;  5GAM f;  3AHU A;  1I5L A;  4LD6 A;  1H92 A;  1BI2 A;  1YJN T;  3CME T;  2DL5 A;  8AT1 B;  3EG3 A;  1Q7Y U;  3FJ5 A;  4LUE A;  2CP0 A;  1IO6 A;  1VQ9 Q;  2CDT A;  1ZHI A;  1LCK A;  2JW4 A;  4IUU A;  3CCQ A;  1TUD A;  2RQT A;  1KC8 R;  5IH2 A;  3G71 A;  2NLU A;  4BI8 B;  2BTT A;  3EG2 A;  1IHV A;  1RLP C;  3JAM E;  1RAC B;  1VYV A;  2X3X D;  4LN2 A;  4NL2 A;  5LJ5 h;  1M90 C;  5KYU A;  5CKH A;  3LWH A;  4ZTF A;  4N4G A;  1VQ9 T;  5GJV B;  3I9Q A;  4OMO A;  2QA4 Q;  4J9G A;  1LOJ A;  4PJJ A;  2GF7 A;  1U8R A;  3QDF A;  2RI3 A;  2SRC A;  3WVD B;  3HRT A;  4RCB A;  2LTO A;  1BI1 A;  5FWC A;  2IPO B;  5CKB A;  1BIA A;  1MGQ A;  3JCM c;  4J9B A;  2JTM A;  5GAN 3;  4OMM A;  5LJ3 f;  2RN8 A;  2DXB A;  2QQS A;  3FLG A;  3JCM f;  5HCK A;  2QA4 T;  2ZPF B;  3GP8 A;  2FVU A;  3PVQ A;  1W1F A;  1QVG A;  4OMP A;  2NUP B;  5CR2 A;  3TRE A;  1KQ1 A;  3CCU A;  1W2B A;  2EW3 A;  2LQ8 A;  1UUE A;  3MEU A;  1K4U S;  3VS3 A;  1E6H A;  3CCV Q;  2LX9 A;  4AG2 C;  2LQK A;  3GBQ A;  2E65 A;  4OP0 A;  1QKW A;  3OYF A;  1G2B A;  2KK4 A;  1QCF A;  2EYW A;  3MEA A;  3JSC A;  4XU2 A;  2CP3 A;  3QWX X;  4L59 A;  3OYN A;  4C8Q D;  1SHG A;  4HT8 A;  2DVE A;  1AVZ C;  5HK3 A;  4R0K A;  1K73 R;  1Q82 R;  2DL8 A;  2M51 A;  4RTV A;  4R56 A;  3WVE B;  3ASK A;  4M4Z A;  3CCV T;  2H3J A;  3BY7 A;  1X6G A;  1UGV A;  3C12 A;  3S3M A;  1K8A R;  4M75 F;  1YHQ Q;  3V7S A;  4HA8 A;  2F2V A;  2V1R A;  1X6B A;  2EQU A;  2QAZ A;  4KH1 B;  2EJG A;  3EFS A;  3QKJ A;  4A4E A;  4BE2 A;  1EFN A;  3SEM A;  1PG5 B;  1HSQ A;  4DA4 A;  1TG0 A;  3GNG A;  1VUB A;  2AT1 B;  4PJO A;  3VYH B;  2DTI A;  1JU5 C;  2YRC A;  2BE9 B;  1GBR A;  4XU0 A;  1OU8 A;  3RER A;  4OMF B;  4C5I A;  3M56 A;  2W10 A;  4PFP A;  1I5O B;  2L5Q A;  1EIF A;  3VRZ A;  4JUV A;  2Y4Y A;  1IGU A;  4M7A C;  5KH6 A;  3CXC A;  3SHW A;  2O88 A;  2PNI A;  2ROL A;  1MMD A;  3UA7 A;  1P92 A;  3S3O A;  3CCS T;  2PVD B;  3JB9 I;  1G3S A;  5GMK j;  2LVM A;  4MML A;  3HRS A;  3CCQ Q;  3EGX A;  2DF6 A;  4Q5W A;  2OX7 A;  1HJD A;  4N4H A;  4KGV B;  2EGA A;  1JJ2 S;  2XI9 A;  3FEO A;  3OYC A;  4M7A B;  2K57 A;  1WPY A;  1HXD A;  5GAN g;  1RAA B;  1K9M R;  1JRI A;  2K5I A;  5I22 A;  4IUQ A;  3FJP A;  3CCQ T;  1RAB B;  2V8I A;  1OZ3 A;  1YWP A;  4GLM A;  3G71 T;  2AK5 A;  2O2O A;  2MPX C;  1PRM C;  4PJM A;  2BUD A;  2KYM A;  2AHJ B;  2LRQ A;  1TH7 A;  2KBT A;  1WHH A;  1X75 C;  1S1N A;  2EJ9 A;  2HL5 C;  1VQL T;  4ZGJ B;  3A5Z B;  3V7R A;  3MET A;  4DOW A;  1QVP A;  2LQN A;  3KXT A;  5GAM g;  3CCU Q;  1AWX A;  3CBM A;  1IRE B;  2F5K A;  2LJ1 A;  1DJ7 B;  1Z9Z A;  3REA B;  4FSX A;  2CYZ B;  4RTU A;  1SF9 A;  2E1H A;  4J9H A;  3S3N A;  1VQK T;  2E3I A;  2EKO A;  4C92 C;  3CCR A;  3E9G A;  2B8A A;  3F70 A;  1UHC A;  4ESR A;  4BI4 A;  3OB9 A;  3OYM A;  4M78 C;  3L2Q A;  2E6N A;  5GAN 5;  1UFF A;  4ORZ A;  1H64 1;  4PL6 A;  2RQW A;  1V76 A;  2KGT A;  1K9A A;  5HY6 A;  1XQH A;  2ZZD A;  1PHT A;  3EHR A;  4ELY C;  3OYA A;  3CCU T;  1QMC A;  2DYB A;  2D0Q B;  2D1X A;  1CKA A;  2XDP A;  1UG1 A;  1GBQ A;  2JOY A;  2FPD A;  3EH2 A;  3G1J A;  2A08 A;  5J3B A;  3M4G A;  2JUF A;  3MP6 A;  3G6E A;  2DD4 A;  1MMN A;  5GAO l;  4QQ6 A;  3NHN A;  2MF2 A;  4BD3 A;  4C92 B;  5DLQ E;  4AMC A;  1WJQ A;  1X01 A;  4JS4 A;  4E7H A;  2YLB A;  4M78 B;  2K7A A;  2EJF A;  3RES A;  4FYY B;  3REB B;  4IKF A;  5LJ3 g;  3OA6 A;  1C6V X;  1YCS B;  1WXB A;  4M77 C;  1K9M U;  1BBZ A;  1TUG B;  3RKY A;  3JCM g;  4M7A D;  2QQB A;  3JB9 H;  1K76 A;  4HCC A;  3HP9 A;  4VUB A;  2F69 A;  4E7L A;  3OYI A;  2X9H A;  2YXY A;  4GLK A;  3SD4 A;  1AWO A;  4JRQ A;  3SFM A;  2X4X A;  2MOX A;  2ED0 A;  4J9F A;  1KJW A;  3LH5 A;  2XK0 A;  5GAN j;  1M5Q 1;  1M3C A;  4C8Q F;  1M1F A;  3TSZ A;  5CCA A;  1JEG A;  3EGD B;  2PTK A;  1Y07 A;  1R8O B;  1FYN A;  4QVC A;  4HT9 A;  2JJ9 A;  2D6F A;  2HBW A;  1JBM A;  2XG8 D;  4M77 B;  4EMK C;  3JV3 A;  1QVF S;  4OGC A;  4PFO A;  1WA7 A;  2YUN A;  3VS5 A;  4C0G A;  1WXT A;  2OTJ A;  1OX9 A;  4IUR A;  3QYH B;  1M90 R;  3CMA A;  2CT4 A;  1Q86 U;  2DAQ A;  1YNZ A;  2KT1 A;  2VWF A;  2DIL A;  5GAM j;  2YT6 A;  2EYX A;  5CKE A;  2QK0 A;  1IHW A;  4ATO A;  1VQO T;  2OTL Q;  3CPW S;  2DL3 A;  4ZTJ A;  2K3Y A;  4EMK B;  1U1T A;  1IXD A;  1G8X A;  2VV5 A;  5LJ5 g;  4BY6 C;  1BI3 A;  1AWW A;  1TSF A;  1OU9 A;  3R6N A;  3VV0 A;  2GCX A;  4BE0 A;  1GRI A;  1M3B A;  3MP8 A;  3I56 Q; 
#chains in the Genus database with same CATH homology
 2JMC A;  1N5Z A;  1X2K A;  3A98 A;  1X27 A;  4JJB A;  1ZLM A;  4AFS C;  2ABL A;  1SEM A;  1PRL C;  4JJC A;  2C0T A;  5IHI A;  2HDA A;  2PZ1 A;  4F16 A;  3VS6 A;  2BZY A;  5L23 A;  2RF0 A;  1YWO A;  1B07 A;  3U23 A;  2L3Q A;  2GQI A;  2I0N A;  1H92 A;  2DL5 A;  1TUC A;  3EG3 A;  3FJ5 A;  4LUE A;  1OV3 A;  1JQQ A;  2KXD A;  4IIM A;  1IO6 A;  2HSP A;  2KNB B;  2J6O A;  1UDL A;  2CDT A;  4JJD A;  5EC7 A;  4HCK A;  1LCK A;  2JW4 A;  2FEI A;  1TUD A;  2RQT A;  4AFZ C;  5IH2 A;  3VS4 A;  1OPL A;  1NLP C;  3QWY A;  2JM9 A;  2J6F A;  2BTT A;  4CC2 A;  1UTI A;  1ZUK A;  1UHF A;  3EG2 A;  1RLP C;  1WX6 A;  4GBQ A;  1VYV A;  2X3X D;  4LN2 A;  2NUZ A;  4QT7 A;  1SSH A;  1KFZ A;  5GJV B;  3I9Q A;  2EGE A;  4OMO A;  4J9G A;  5GJW B;  1I0C A;  2DL7 A;  2EQI A;  2DVJ A;  2JTE A;  1QLY A;  2AZS A;  2O9V A;  1HD3 A;  3VRY A;  1VYU A;  2SRC A;  5FWC A;  1JO8 A;  2LZ6 B;  1ZX6 A;  2GNC A;  2DLP A;  4J9B A;  1YP5 A;  2LJ0 A;  1W6X A;  4OMM A;  1G83 A;  2FRY A;  1ZBJ A;  3RNJ A;  2RN8 A;  5HCK A;  2L0A A;  2LNH B;  4J9I A;  2JXB A;  3PVQ A;  1W1F A;  3M0Q A;  2F2W A;  2K6D A;  4LE9 A;  4OMP A;  1Z9Q A;  4Z89 A;  2D0N A;  2KRO A;  3RBB B;  1YN8 A;  1OEB A;  2EW3 A;  2MCN A;  1UUE A;  1E7O A;  2K79 A;  4FSS A;  1NLO C;  2ROT A;  1K4U S;  4KRT A;  3NPF A;  4WCI A;  2OI3 A;  3VS3 A;  2KXC A;  4HVV A;  1E6H A;  2DJQ A;  2EYY A;  1WXU A;  2LP5 A;  4AG2 C;  3GBQ A;  2DE0 X;  2CH4 W;  4RTW A;  4F17 A;  2KT8 A;  1QKW A;  2JS0 A;  1G2B A;  1QCF A;  3O5Z A;  2EYW A;  2BZ8 A;  2J06 A;  4D8K A;  1VYT A;  2K2M A;  2CUD A;  2KRN A;  4DEY A;  2LCS A;  3QWX X;  1WLP B;  1SHG A;  3UAT A;  2RNA A;  1AVZ C;  4R0K A;  2DL8 A;  2FG0 A;  2GTJ A;  2M51 A;  4RTV A;  4A63 B;  4RUG A;  2JM8 A;  4CC4 B;  4OML A;  4OMQ A;  1NYF A;  4M4Z A;  2LJ3 A;  1X6G A;  1UGV A;  1WYX A;  2L3S A;  3M0P A;  3UA6 A;  1BU1 A;  1PKS A;  2DX1 A;  2VKN A;  1VA7 A;  3I5S A;  2VVK A;  2F2V A;  4J9D A;  1V1C A;  2V1R A;  1X6B A;  4RTT A;  5IHK A;  2LQW A;  1EFN A;  3SEM A;  2KE9 A;  2BZX A;  4CC3 A;  3PE0 A;  1HSQ A;  4IIO A;  4RTX A;  4AFQ C;  1CKB A;  4Z88 A;  4JPB W;  1TG0 A;  1UE9 A;  1JU5 C;  1GL5 A;  3ZL7 C;  1GBR A;  4JZ4 A;  1WIE A;  1SHF A;  3NGP A;  2GBQ A;  1UJY A;  2W10 A;  2EPD A;  2DBM A;  2RQU A;  4HXJ A;  1U5S A;  3VRZ A;  1AD5 A;  3I35 A;  1NEB A;  4D8D A;  3SHW A;  2O88 A;  2AZV A;  2PNI A;  2ROL A;  3UA7 A;  1T3S A;  5IHN A;  2F2X A;  2M0Y A;  2DA9 A;  1PWT A;  1MV3 A;  2O31 A;  1SRM A;  1WDX A;  3M0U A;  4LNP A;  1X2Q A;  2LX7 A;  1QWE A;  1AZE A;  1M8M A;  4RTY A;  2GTO A;  1WFW A;  2DF6 A;  3CQT A;  1HJD A;  2AKK A;  3H0H A;  2EGA A;  2H8H A;  4AFU C;  4RTZ A;  2D8J A;  4HVU A;  3TVT A;  2JT4 A;  1FMK A;  2P4R A;  5I22 A;  1SRL A;  2XMF A;  1XOV A;  1M30 A;  1ABO A;  3THK A;  4AG1 C;  1ARK A;  2YUO A;  1MV0 B;  1YWP A;  4GLM A;  2KRM A;  2ED1 A;  2AK5 A;  2O2O A;  4CC7 A;  2W0Z A;  1PRM C;  2CH4 A;  2ECZ A;  3VS7 A;  1RI9 A;  2KYM A;  1ZUU A;  2J6K A;  1RLQ C;  2DNU A;  1NEG A;  2KYB A;  1GCP A;  2KBT A;  3UF4 A;  1S1N A;  1MUZ A;  3M0S A;  2A28 A;  2JS2 A;  1A0N B;  5IXF A;  1BK2 A;  2EVR A;  5ECA A;  2AKL A;  5FWB A;  4F14 A;  1U06 A;  2EGC A;  2LQN A;  1AWX A;  1PNJ A;  2DL4 A;  2LJ1 A;  1I07 A;  2EBP A;  2L3P A;  1Z9Z A;  3VS0 A;  3REA B;  4RTU A;  4X1V A;  4J9H A;  2CSI A;  1AZG B;  3M0R A;  2OJ2 A;  1UHC A;  4ESR A;  1ZSG A;  2YDL A;  1UFF A;  4ORZ A;  2RQW A;  2KGT A;  3EG0 A;  1K9A A;  2HCK A;  1KSW A;  2EYZ A;  2B86 A;  1K0S A;  1I1J A;  1PHT A;  3EHR A;  2LMJ A;  1OPK A;  2DYB A;  2E5K A;  4JZ3 A;  1T0J A;  2D1X A;  2NWM A;  1CKA A;  4Y92 A;  1UG1 A;  2KEA A;  1GBQ A;  1RUW A;  2D8H A;  4OMN A;  2FO0 A;  3H41 A;  2CUB A;  2FPD A;  1UEC A;  2A08 A;  1JXO A;  1T3L A;  2IIM A;  1K0X A;  1PKT A;  3C0C A;  1U3O A;  3NHN A;  1GFC A;  2RPN A;  1J3T A;  1QWF A;  2DRK A;  3M0T A;  2GGR A;  5FW9 A;  1E6G A;  3PVL A;  4HVW A;  2ENM A;  1X69 A;  2K7A A;  1AOJ A;  1AEY A;  3REB B;  2JMA A;  2DMO A;  2X3W D;  1YCS B;  3IQL A;  1WXB A;  2RQR A;  1BBZ A;  2RQV A;  2EKH A;  1K76 A;  2J05 A;  3H0F A;  2CSQ A;  1M27 C;  2RMO A;  1GFD A;  1AWO A;  1JXM A;  1W70 A;  1Y0M A;  2MOX A;  2ED0 A;  1OOT A;  1B3Q A;  4J9F A;  1KJW A;  2MIO A;  3LH5 A;  2YUQ A;  4LUD A;  1X43 A;  2G6F X;  2QDL A;  2C0I A;  2YSQ A;  1M3C A;  1ZUY A;  3VS1 A;  1AWJ A;  3TSZ A;  1JEG A;  3EHQ A;  4J9E A;  2DRM A;  2PTK A;  1FYN A;  1UJ0 A;  2HBW A;  1QKX A;  1H3H A;  2V1Q A;  2C0O A;  4K11 A;  3EGU A;  3JV3 A;  3VS2 A;  2L2P A;  5IXB A;  2CT3 A;  2HEQ A;  1WA7 A;  2YUN A;  3VS5 A;  1WXT A;  1NYG A;  1M3A A;  2DBK A;  2J7I A;  2SEM A;  2YUP A;  2FPF A;  1NG2 A;  2CRE A;  4J9C A;  3KFV A;  2CT4 A;  3I5R A;  1BB9 A;  1YNZ A;  2FPE A;  2KT1 A;  2VWF A;  1CSK A;  1Y57 A;  1NM7 A;  2K3B A;  2DIL A;  2YT6 A;  2A37 A;  4ZNX A;  2EYX A;  2DM1 A;  1WI7 A;  2KRS A;  2K9G A;  3ULR B;  1KIK A;  1K1Z A;  1GCQ C;  2A36 A;  4DEX A;  2DL3 A;  1H8K A;  4E6R A;  4EIK A;  4Z8A A;  3NMZ C;  2KR3 A;  1SPK A;  1ABQ A;  5I11 A;  1AWW A;  3TSW A;  3R6N A;  2OAW A;  1GCQ A;  1GRI A;  3H0I A;  3EG1 A;  2FRW A;  2O9S A;  1M3B A;  2ESW A;  1T0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...