3JCMX

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
70
Chain Sequence
MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINANNHQLGTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 7
structure length 70
sequence length 76
chains with identical sequence a
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmX00
4F7UF 5GMKh 2EAYA 5I21A 1M8VA 3V7CA 1WQ7A 4EMGA 3AHUA 5GAMg 5GAN5 1BIAA 5LJ3g 4M75F 4M75G 2RM4A 4M77C 4XU0A 4XU3A 2E10A 2DXTA 5GAN4 4M7AC 4F7UB 4F7UE 2DZCA 2EWNA 4J5YA 4M75D 4RCBA 2EJFA 4F7UA 5CAIA 3JCMJ 1H641 1TH7A 3FIFA 4XTWA 4EMKA 5LJ5f 3RKYA 1LJOA 5LJ3d 4HA8A 3SWNC 5GAMd 4XTZA 4M7DC 3JCMb 3QSUA 5GANd 4M78B 1U1TA 2DJZA 3JCMg 3JB9D 2Y90A 4PNOA 4MMKA 2E41A 4Y91A 5GAOr 4PJOB 2VXFA 4MMLA 4C92A 2EJGA 2I2LA 4NL2A 2RD1A 4X9DA 4M77D 5GMKm 3JCMW 3JCMf 4V2SA 3BW1A 3JCMP 4JRKA 3JCMX 1LNXA 1YCYA 4M77G 3JCMh 4M7DE 1JBMA 4JLIA 2DZ9A 3JB9J 4NOYA 2DEQA 1I8FA 5LJ5d 1HK9A 2E1HA 3HFOA 4N0AA 4NL3A 1N9RA 2JN0A 2YLBA 4M78D 4C92G 5GAMh 1M5Q1 5GAOn 4QVCA 3RKXA 5LJ3h 4X9CA 5GANf 3JB9H 4M78C 1KQ2A 2CGHA 1I4K1 3QO3A 4M7AF 4XU1A 5GANh 4M75C 1N9SA 3BDUA 5LJ5g 5GMKe 5GMKj 2DVEA 3L2ZA 3JB9F 4QVDA 4C8QC 1B34A 2DTHA 2K57A 3L1AA 4EMHA 4C92E 3SB2A 5GANe 3RUXA 1D3BA 5GANj 3RERA 1B34B 3JCMQ 4M7AE 4JRIA 5LJ5j 1Y96A 4XQ3A 2DXUA 3JCMd 4A53A 5GAMf 5GANg 4M77B 1Y96B 5LJ3f 5LJ5h 4M7DG 5GAOm 4M7DA 2FB7A 4M77A 5GAOl 1I81A 3RESA 4C8QA 2HNIA 4M75B 1I5LA 3GIBA 3HSBA 4EMKB 5GMKl 4C8QE 3VU3C 1X01A 4XTVA 4C92C 4XU2A 3RKWA 5GAN6 5GAN7 4M78A 3V7SA 4M78G 1WPYA 3RIRA 4XTUA 3V8LA 5GAN2 2VXEA 4DQ2A 3FJPA 5DY9A 4PJOF 4PJOG 5GAN3 4M7AA 5GAOq 4PJOA 4PJOD 3JB9I 4C92B 4J6WA 4C8QG 5GAOp 1KQ1A 2RA2A 1D3BB 3V7RA 2RB6A 2E64A 1MGQA 4M77E 3HFNA 3SWNA 5LJ5e 3BY7A 3M4GA 5GAMe 5GAMj 4N0AC 4C8QF 3JB9G 4C8QB 3INZA 5GAN8 4M7AG 4M7DF 4M75E 2DKGA 2EJ9A 4M78F 4M7AD 4HT8A 2DTIA 3BFMA 2DTOA 3JCMc 4WF2A 3PGGA 4J6YA 4XTYA 4M7AB 1LOJA 1U1SA 4PJOC 4M77F 3QUIA 2VC8A 4A54A 1HXDA 1WNLA 4C92D 4HT9A 3V8KA 4C92F 4C8QD 4F7UG 3QHSA 2QTXA 4M7DB 4RCCA 4EMKC 2FYKA 3JCMV 3SWNB 2YHTA 3JCMe 3EFRA 4JUVA 4M75A 5GMKi 4J6XA 2YLCA 4OP0A 5LJ3e 5LJ3j 4XTXA 4M7DD 2E65A 3FB9A 3V8JA 3EFSA 1JRIA 4PJOE 1WQWA 4M78E 2ZGWA 1BIBA
chains in the Genus database with same CATH superfamily
2FEIA 4DOWA 2ZZDA 3A8OB 3OYNA 1NG2A 3TCJA 1GBRA 4IKFA 1M2OA 1AOJA 1WXTA 2PUKB 1SKUB 3TU4K 2O31A 3F70A 4GLMA 1MNEA 5LJ5f 1KK7A 1YJ9Q 2OTLQ 3VS3A 1M90C 3O8VA 1R8OB 2H8HA 4J9HA 2K3YA 1UE9A 2K5FA 4F17A 1AT1B 1HJDA 1YFNA 1RL2A 2E6NA 1YN8A 3Q1JA 1YP5A 2MK5A 3VS6A 1I8FA 4Z8AA 2XK0A 2EQIA 1VQMT 2R5MA 3A8HB 3BDUA 3CC2A 1UGVA 3OMCA 3UPUA 4LNPA 1M90U 4HVVA 1M3BA 2R58A 1WLPB 4HVWA 3OS1A 4EMKB 1AD5A 1BI1A 5GMKl 3PVLA 2E70A 1YIJQ 1YJNQ 4L5GA 5C6SA 1Q86R 4C0DC 3RIRA 2C0IA 5IXBA 4PJOF 1TS9A 3JSCA 1RAEB 1EFNA 1WHKA 4J6WA 1D3BB 1W4SA 3PMIA 3CBMA 2KYMA 3X26B 2X4WA 3I56Q 2QXFA 4PJJA 1Q81R 2OAUA 4J83A 3BFMA 3PGGA 3RR6A 2KI7A 2CP5A 2C0TA 5FU7B 2JVVA 3OY9A 1R0CB 3DB3A 3JCMV 2EKHA 4L6V5 4LD6A 5GMKi 1MNDA 2KAFA 3CCJQ 2HCKA 1MMGA 2A37A 5CVIA 1G3SA 1ZX6A 2HEQA 5KE2A 4EMKA 1EIFA 3LWHA 3NGPA 2JMCA 3MCAB 2DJZA 3JCMg 2Y90A 4MDWA 2NUTA 2D6FA 3FLGA 4ZNXA 1ZSZB 2KY9A 4M77D 5GMKm 4V2SA 3CC7A 1VQPQ 1LNXA 1QW1A 1VQNA 2F2XA 2L3QA 4JLIA 1T3SA 2DEQA 3OS5A 2YLBA 1I5OB 2DYIA 5FWCA 2RNAA 1VYVA 4JJBA 4DBHA 2EYWA 4IUQA 5GANf 2RI2A 2RQTA 1N9SA 3QWYA 2X3XD 4QVDA 2QA4T 5FU7C 2ZPEB 2Y4YA 1B34B 2LT4A 1QVFP 4A53A 5D7UA 2PU9B 2CREA 4BI8B 3J80E 3CCRT 4C92C 5KYWB 1MUZA 2G3RA 2VXEA 4DQ2A 1X2QA 2JM9A 3CMAQ 5CKDA 5HY6A 4E47A 1N8RC 2BUDA 1UDLA 2E64A 3CCLA 4C0DB 1W70A 1MMNA 4QW2A 2RPNA 1KSWA 4M75E 1XQHA 1Z9QA 1OPLA 2OX7A 1GFCA 1IZ6A 3FEOA 3CCVA 5KYNA 2DX1A 2M16A 2DM1A 4JDSA 1N8RU 1YJ9T 4A54A 3JAME 2AT1B 2LMJA 4IURA 2QEXA 2DL5A 1PRLC 2E65A 1U3OA 2V8JA 3EFSA 4BE0A 4M78E 3ZL7C 1ZLMA 4IUTA 2M02A 3HPWA 4XK8E 3MO8A 2MWPA 2J05A 4M75G 5GJWB 4ME7A 1WGSA 2QQAA 3JCMJ 2K2VA 2QTVA 1NZ9A 1KC8R 1KD1U 2GQVA 4J9FA 2DAQA 4C0ZA 3I56A 1SEMA 1ZUKA 2DA9A 3L2QA 1YJWQ 5J26A 3JCMP 1VQ8T 2M1HA 1X6BA 2MMPA 2DZ9A 4LXCA 2LP5A 1YI2T 4M78D 1T3LA 3OBYA 1YITA 1QQJA 4P5NA 3QO3A 2KMTA 3G4SQ 2HQXA 4BI3A 3EAEA 3SHWA 2K57A 3OYHA 1WJSA 3CD6A 4M7AE 4XQ3A 3LX7A 5FW9A 4N4GA 2EBPA 5D6WA 4FSSA 2IVWA 1Q7YU 1RAGB 3A1PA 3EFOA 2WSCE 3SEMA 2Z0WA 4LN2A 1WPYA 2W10A 1M27C 3G71A 4BE1A 1Q81U 2DETA 1WI7A 2DVJA 3I5SA 1KHIA 1HYOA 2CYZB 3QZ9B 5CCAA 5IAYA 1UGRB 2MI6A 3BY7A 2NUZA 2XKOC 1AEYA 4OMMA 1Q82R 4C8QB 3CCEQ 1FXXA 4C5EA 3CD6T 1WHJA 4EPCA 1C1AA 3NMZC 4F14A 4LDYA 2L2PA 2JW4A 2DTOA 3OS2A 4CC4B 1Q86U 1G3YA 3MP8A 2BKDN 3QZ5B 1JU5C 1WXUA 5A0LA 4K11A 5KH6A 1ZUUA 2OTJQ 5IN1A 2FYKA 2RF0A 9ATCB 2RJEA 4CRIA 3CCST 2ROTA 1B7TA 1YIJA 5I21A 3EGDA 1VA7A 1WQ7A 3R6OA 2LZ6B 3CCSQ 1Y57A 3OW2S 1BIAA 1BI3A 3MPUB 1RABB 1KHCA 2DZCA 3I9QA 2EWNA 2XG8D 4J5YA 3PIOA 1HSQA 4F7UA 2OTJT 1WFWA 3FIFA 1JJ2A 3CCJA 2EQKA 1JJ2P 3I5RA 1NEBA 2CP6A 4Y91A 4JLGA 3VRYA 3CMEQ 4CC2A 2PVOB 1OULA 4KUDK 3QDFA 3QYGB 3UWNA 3JB9J 2E1HA 4BUGA 2AZSA 2CSQA 5CQYA 2DXCA 1YWOA 4J7FA 2YUOA 1WHHA 1GBQA 3PIPA 1B34A 2FHDA 2EQJA 5GANj 1V29B 5GAMf 5A2QE 5LJ5h 1D0YA 2KR3A 4M7DA 3OYAA 2CH4W 4E2FB 3CCLQ 2NUPB 1NPRA 4L59A 2F2VA 3OYFA 2LTOA 3E2UA 5HKCA 3V7SA 1NYFA 3CCRA 2MIOA 1K4US 4OB2B 5KE3A 2JJ9A 3HFNA 2ZPHB 2F69A 3FC3A 2O9SA 1VQ8Q 1WDXA 5AT1B 3REBB 5L8RE 1K8AC 2QQSA 3CCUQ 2G6FX 1K76A 1WHMA 3LWIA 1VQ6Q 3QHSA 4RCCA 1QMCA 2RN8A 3SWNB 3ULRB 1VQOA 4OMPA 4XAXB 4JJNK 2GFAA 3QYHB 1K1ZA 5D6XA 3OW2A 3EG9A 3VS0A 2ZGWA 2FRWA 1W1FA 4E7SA 3GNFB 1OX9A 2E4HA 1SHFA 3ASKA 1PKSA 2RO0A 2E10A 2DXTA 5FWBA 2RQVA 3VS4A 3SDZA 3J81E 4F7UE 1P92A 2EJFA 4B9XA 2PNIA 5CAIA 1UGQB 2K5IA 2CKKA 1ZA1B 2DLPA 2PVGB 1KQSS 1N6AA 3LGFA 5DLOA 4AMCA 1IHVA 2LDMA 1ZBJA 4MMLA 3OYEA 3JCMf 3L2VA 1AWJA 1T0HA 4A63B 4M7DE 5LJ5d 3HFOA 4DOVA 2GCXA 4X9CA 3LLRA 4M78C 2HKQB 2A7YA 4M7AF 2KQWA 4WTOB 3QG1A 4J9CA 3DLLA 3CCRQ 1OU9A 3P8DA 1N27A 5LJ3f 3FJ5A 4GLKA 3PNWC 4PK4A 2HMAA 5GAN7 2A08A 1U8RA 2RH2A 1AWWA 1M1KR 4DBRA 3OYBA 3CCUA 2RA2A 2JZ2A 3M59A 2QQBA 1Y7XA 3HHTB 4JS4A 2VGNA 5GAMe 3M0UA 1NM7A 4BY6B 4KH1B 4QVZA 2L89A 1K0SA 3MEWA 2GF7A 2QGGA 1UEBA 1X27A 1U1SA 3MEUA 4RUGA 2D8HA 2FZCB 3JCMe 5HK0A 3LH0A 3TSZA 2YLCA 3EG3A 2CUDA 2ECZA 4X1VA 3V8JA 2DXBA 1WQWA 3D7SB 1BI2A 3S6WA 2ZCFB 3C95A 1A0NB 3OYCA 1RLPC 1XTDA 1GCQC 3IQLA 3CCJT 1QVGS 4EMGA 4A4KA 4AG1C 5A0GA 3AHUA 4M75F 2COWA 2GQIA 5I22A 2QAZA 1LJOA 2KXCA 4PLIA 4XTZA 4M7DC 2JTEA 5HCKA 4M78B 2A28A 2LJ3A 3JB9D 4PNOA 4HCBA 2KT8A 1TU0B 4PJOB 1XNIA 1V1CA 3OBWA 1SSHA 3HTRA 2JMAA 2PTKA 3VUBA 2ESWA 2V1RA 1PG5B 1IGQA 1Q7YC 4JPBW 5CKFA 3QDRB 2CGHA 1QCFA 4AFZC 3MJXA 2JUFA 2DTHA 4C5GA 3WXMB 2RQRA 2J06A 3QBYA 3H9NA 1VQLQ 4C0FA 2DXUA 2QDYB 2OAWA 1YITQ 5D6YA 2B8AA 3VS7A 4RKUE 3RKWA 2LQ8A 5GAN2 4CC3A 2JXBA 2HL5C 4OGEA 4C92B 4C8QG 5IXFA 4JRQA 2EYZA 2AZVA 4II1A 1EX4A 3LYIA 1TTHB 1RAFB 4DEYA 3M57A 3CC4Q 4M78F 2KE9A 2HL3A 3H0IA 3CMEA 4IUVA 4J6YA 1TOVA 4D8DA 3CCQA 1K73R 2DD4A 4HVUA 4MDXA 1VQKQ 4BDZA 3H6ZA 1QKXA 4MZPA 3S3OA 3FB9A 3E9GA 1JRIA 2KDSA 1UG1A 1M8VA 1IHWA 5AYFA 2GTOA 5KYYA 5GAN5 5LJ5j 5LJ3g 2YRDA 2RM4A 4RCBA 1H641 3DLMA 4ZGJB 1NE8A 3RKYA 5GJVB 2GFUA 5EC7A 2LNVA 3HRUA 4J8OA 1NLPC 1OQKA 1T0JA 3OA6A 3JCMX 2LQKA 4D8KA 4FYXB 2JT4A 3DKMA 2JTFA 2R5AA 1OPKA 4QVCA 1IGUA 4Y28E 2SRCA 1G8XA 1RI0A 3OYMA 2DERA 4IIMA 4C5HA 2RJCA 3M56A 5GMKj 3CPWS 4PL6A 4C92E 1KD1C 1D3BA 5KYYB 2K4YA 4RG8A 2OTLT 4A4FA 4RTYA 2K9GA 2QQ9A 5GAOm 2FPDA 1XOVA 2EKOA 1N5ZA 3FDRA 1G2BA 1BB9A 2DIGA 4LDUA 1UGPB 2E5QA 4M78G 5GAN3 1PD0A 2HKNA 1RI9A 2LX7A 2VKNA 4M7AA 2VGMA 1NEGA 1WA7A 2CUBA 3EG2A 4M77E 1Q7YR 5IHIA 4LDXA 5IHKA 3I55Q 3HKSA 2QA4A 1Y0MA 2J6OA 4KGZB 2FZGB 1UFFA 1RLQC 1FWZA 1RAIB 2E6ZA 2NYSA 2AKKA 3OYIA 1VQ6T 1AWOA 2F5TX 2AIRB 1WZOA 3CC7T 2EYXA 5I11A 1JJ2S 1MHNA 2D1XA 4RTZA 1VUBA 5LJ3j 2ZAEA 4E6RA 3OQ5A 4NS5A 1I1JA 2HBWA 2CDTA 2O4XA 2OJ2A 2ED1A 1TG0A 2EYYA 2DPPB 4QQDA 2JM8A 1E6GA 2LJ1A 1VQPA 2R57A 2MOXA 1LPLA 2RJFA 2RK2A 3QSUA 1E7OA 2GGRA 2MWOA 1AWXA 3X20B 4RTUA 2XMFA 3JCMW 4FT4A 3JRZA 1C0MA 2JS0A 3G6EA 2P0QA 4OB1B 1JO8A 3REAB 5A0DA 8AT1B 1QVPA 1M90R 2EVRA 3URGA 3J7AF 2RHZA 5KYWA 1N8RR 3CMET 1MV3A 1GFDA 2F1LA 4LE9A 2XHCA 1KC8U 1KD1R 1JQQA 2E3HA 1Y96A 3M0SA 3QXEB 5GANg 1M2VA 3NHNA 4R0KA 1C6VX 5CO7A 1NBEB 2KRSA 4ELZC 1X01A 4RTWA 2IPOB 3TSWA 5CR2A 3CC4A 4OMFB 1PC0A 2P0KA 1LVKA 4DBFA 4C5IA 1Q95G 3EH1A 2CZ6B 1ARKA 2XIDA 1BYMA 1BCOA 2L8DA 3M4GA 1X6OA 2NUPA 2AHJB 4JJDA 1VQ4Q 3CCMT 3PE0A 3CC2T 2ZPBB 1AZEA 1QVGA 1VQ9T 3OSVA 1VQMA 3M9QA 5ECAA 2B86A 4A4EA 5FRMA 4WCIA 4M77F 4ORZA 3T9NA 2VC8A 2LQNA 4JS5A 5CKHA 4Z89A 1M2VB 4C8QD 3A8LB 2ED0A 1X69A 4HKEA 1BI0A 3CEYA 3PT9A 3M0QA 1IRXA 1QWEA 2MPXC 3VS5A 3CPWP 4F7UF 3CCET 3CD6Q 3I55T 4C0GA 4A4HA 4XU0A 4XU3A 4OMOA 3ZEHA 4CI0C 1MV0B 3HP9A 2O2OA 2WSEE 4IIOA 3CCEA 2FG0A 4ANJA 5KYXA 1KIKA 4EDUA 1KQSA 1WYXA 4MMKA 3G4ST 2XD0A 1ABQA 1G83A 5KYUB 1IREB 1JBMA 1W2BS 3A8GB 1ZSZC 1HK9A 1QVFS 3QKJA 1S72A 4X34A 3RKXA 2BZ8A 4ESRA 3KFVA 4YTLA 4KGVB 5GANh 1VQ9A 2ZPIB 3O5ZA 6AT1B 2CZ1B 2XI9A 1M4ZA 4EMHA 1M3AA 1SG5A 2NLUA 3LH5A 2YDLA 3CC7Q 1D0ZA 4LDWA 1OOTA 5HK3A 1PRMC 1UHFA 2KBTA 1KG1A 3MP6A 2COZA 2HQHA 2KK4A 4OMQA 3RESA 3UT1A 4C8QA 1I5LA 1GRIA 1M8MA 4FYYB 4ZTJA 4JZ4A 5GAN6 4DEXA 4RMOA 2KROA 2DFUA 3VKIA 3EGUA 1YJWA 2KYBA 3CBOA 1FMVA 4QQ6A 3KXTA 1M30A 1X43A 3OS0A 4N0AC 3BE3A 2WACA 1K0XA 2D9TA 1GXIE 1EZZB 3L2UA 1RUWA 4XTYA 4PFPA 1LOJA 5KYUA 2P84A 3TREA 3KUFA 4C92D 4OVAA 4HT9A 1UHCA 4FCYA 2EQUA 1BU1A 1OU8A 3EFRA 2EGAA 4XTXA 2HQEA 3N5BB 2DKGA 1Y07A 1OYXA 2EW3A 2K3XA 5CK9A 5GAMg 1R77A 4GY5A 2L3PA 3QJYA 2A0FB 5CQXA 1JXOA 4M75D 1VYUA 3E1SA 1VQKA 1CKAA 2WSFE 3EFOB 4O6JA 1S72Q 4HXJA 2K5LA 1X2KA 3OW2P 2QA4Q 1D0XA 1TSFA 2YRVA 2LT1A 2KSSA 2V1QA 3CXCS 3RNJA 2CT4A 2KNBB 3L2RA 3X28B 2KRNA 3DB4A 2O88A 3EHQA 2L5QA 1KC8C 1ACMB 5I2SA 1YHQT 2VASA 1YJNA 1AHJB 4FM4B 3L2ZA 2HDAA 4BY6C 2GNCA 3RUXA 2YRCA 5C0MA 2V26A 3JCMd 1HD3A 4OMNA 3OYGA 2O01E 1NLOC 2FL7A 2QYZA 2RHUA 3OYLA 2RMOA 3CXCA 3C4SA 3E19A 5DY9A 2RI3A 2PQWA 2W0ZA 3JB9I 1D1BA 4BDYA 4B9WA 3ER0A 3SWNA 2QI2A 1M1KU 1K8AU 1IO6A 2V8IA 4N4IA 1M3CA 2DTIA 2K2MA 2FPFA 4WF2A 3CBPA 2X35A 3E9FA 3C94A 3VYGA 2ENMA 2BZXA 4MZMA 1WNLA 3GF5A 4BI4A 3UDCA 3VJPA 3G1JA 1VQ4A 1PCXA 1I07A 2DF6A 2DBKA 2CP2A 4ZTFA 2HBPA 1UB4A 4FW2A 4DBQA 1UECA 2P4TA 1U06A 4GBQA 3ME9A 4XTWA 3RDVA 3TVTA 1YBYA 3M54A 3QJ6A 4OB0B 1FX7A 1U1TA 1YIJT 4J9EA 2E3IA 2KGTA 4E7IA 2E41A 1ZHIA 1ABOA 3CCSA 2I2LA 2L0AA 4X9DA 3JCMh 3SFMA 3CCQT 1SF9A 2RHIA 3QIIA 2F2WA 3MEVA 3NTKA 1E6HA 2JN0A 4BACA 2FVUA 2CH4A 3MP1A 3M55A 1VQOQ 1VQMQ 5LJ5g 3M58A 1ZUYA 2AK5A 2RK1A 3OYDA 3OSSC 3RERA 1K9MU 2D0NA 4JRIA 4PJNA 1H3ZA 2FB7A 4M77A 5GAOl 3A98A 1W2BA 2QQRA 4C8QE 4UC4A 3GPLA 3G71T 4HCKA 2P0PA 2V8KA 1OEBA 4XTUA 2FO0A 1YWPA 4RTTA 2O9VA 2HSEB 3GNGA 5FU6C 3L42A 1OZ3A 2EIFA 4ZN3A 2VVKA 1TXQA 2RHXA 3L2WA 2HAXA 2JS2A 1NJIR 2X51A 4PFOA 3LW5E 2PVDB 3INZA 2KXDA 4M7AG 3QWXX 2EJ9A 1K9MR 3ZBDA 3P8HA 2BE9B 4BD3A 4M7AB 1SPKA 3A5ZB 4QKUA 1H8KA 1TUCA 2QASA 3PTAA 2AKLA 4N4HA 1VQ5T 2YUPA 1VQ8A 1SHGA 2BTTA 1QCOA 4E7KA 4M75A 2LVMA 3EG0A 4E7HA 2ZPFB 4BB7A 2YT6A 5L23A 2KEAA 2OI3A 2JNGA 2RHYA 3GOXA 3M4YA 1CSKA 1K73C 1K9MC 2MF2A 1VQ5Q 3CPFA 2DBMA 1WXBA 2QG9B 4QT7A 4Q5WA 5GANd 3RBBB 2LQWA 1Q82U 1K9AA 2QDLA 7AT1B 1JB0E 3BW1A 4JRKA 4D6WA 4M77G 4M4ZA 1GL5A 1GCQA 4ZN1A 4NL3A 4RTVA 4FU6A 4C92G 5LJ3h 1RAAB 1Z9ZA 4M75C 1WX6A 4C8QC 4ZGEB 3L1AA 5GANe 4KGXB 2H3EB 4PKCC 1Y96B 3VUZA 4R55A 2HNIA 4M75B 3CCUT 1O75A 1JXMA 1U5SA 4XU2A 1VQ9Q 5M9OA 4LUEA 3V8LA 2JTMA 1KJWA 3OB9A 1YCSB 3CCMQ 3FJPA 1WHGA 2XDBA 3UA7A 2C06A 1UTIA 3V7RA 1FYNA 5FRNA 4Z88A 1PHTA 1MMDA 3G7ZA 3CCQQ 1WJQA 3MKDA 1KFZA 4Y92A 1QP3A 1S1NA 2RJDA 4M7DF 2DJQA 1KQSP 1PM3A 1G5VA 1YHQA 2X4JA 2EGEA 1ZA2B 2DE0X 1UJYA 2HD0A 1SRLA 3V8KA 1VQNT 2J7IA 2CS7A 4J7IA 4J6XA 1M9SA 1D1CA 3S3NA 2DL7A 1BIBA 2K79A 4FYWB 3G71Q 4J9GA 4KUIA 1VQKT 4M7AC 5CIUA 4PLLA 4FSXA 4RTXA 2KVQG 3PFSA 1TUDA 3TQ7P 1RAHB 3M0RA 1XJWB 1YNZA 2ATCB 2BIVA 3EHRA 3CXCP 2DRMA 2D0QB 1FMWA 4R56A 1K8AR 4C92A 4NL2A 3CCVQ 4OB3B 2DMOA 1VQOT 2PZ1A 4FW1A 2ABLA 3VRZA 2DK3A 1BBZA 2VYTA 4N0AA 2RI5A 1M5Q1 2L3RA 1IB8A 2QEXQ 2YSQA 4MZTA 3JB9H 1KQ2A 3KBGA 5DM7R 2E5KA 2PUOB 3SB2A 1K73U 2C0OA 2XU8A 4M77B 3NPFA 4M7DG 1YJWT 1I81A 2X9HA 4VUBA 5FROA 4ZGDB 3WVDB 1NYGA 4XTVA 2SEMA 2MYSA 3MHXA 1G3WA 4E7LA 3UF4A 4J9DA 3HRTA 4A4GA 5KCHA 3JV3A 4F04B 4KRTA 2DL8A 5GAMj 2YXYA 2M0OA 2A36A 2EQMA 2NWMA 4M7AD 1JEGA 4HT8A 3A8MB 5FLXE 4PJMA 1S72T 1CKBA 4PFZA 3G6EQ 3QUIA 3BDLA 3GP8A 3HRSA 1QKWA 3FRNA 5J39A 1VIEA 3EG1A 1X75C 2D8JA 3G4SA 1BKBA 4PJOE 4O5VA 2MCNA 2EYQA 4KBMB 2DRKA 2EPDA 4LDVA 1D09B 1F1BB 4J9BA 1YI2Q 3GLXA 2HSPA 5GAN4 4M77C 2OTJA 4LD9K 3QPHA 1D1AA 3GBQA 4OF1A 1BCMA 3NTHA 5IT9E 1PSEA 5KCOA 4JZ3A 4HA8A 1W6XA 3I55A 3MEAA 1WHLA 1W2BP 1B3QA 3JCMb 3X25B 3R6NA 3CPWA 1M1GA 3VYHB 2GBQA 4KULA 1YHQQ 1VQ7Q 2EGCA 3M5AA 2DD5A 1UGSB 1VOMA 1VQ5A 3AT1B 2I0NA 2J6KA 4PJLA 1I4K1 1VYTA 2LCCA 2DEUA 3EG9B 2DVEA 2IIMA 5EG2A 4AG2C 4FL6A 3EGDB 3CCMA 1TUGB 2ZPGB 4KH0B 1NJIU 1ZSGA 3H8ZA 3M0TA 1VQ7T 3RMSA 2CT3A 2M51A 3H41A 3HSBA 1QLYA 3VU3C 2E12A 2XDDA 2A3LA 2O4XB 3CC4T 1LCKA 4PJOG 5GAOq 1AZGB 1VIFA 2COYA 3OYJA 1KQ1A 2H3JA 3NFCA 1ZBXA 3NTIA 2M0YA 3CMAT 3JB9G 1QCNA 1I0CA 1O9SA 4TVRA 3EGXA 2L3SA 1UUEA 4FIBA 2M9UA 4DA4A 1YITT 4PJOC 3M53A 4J9IA 1YI2A 1HXDA 1PKTA 4F7UG 4M7DB 3G6ET 3VS2A 4EMKC 1VQLT 2YHTA 1Q86C 5IHNA 1OZ2A 1NPPA 3THKA 1QVGP 3I56T 2DO3A 2YUNA 3V7CA 2EFIA 5LJ5e 3EH2A 2Y4XA 3META 1GCPA 1WJRA 1VQPT 2LX9A 1OV3A 2CP7A 2VB6A 1TH7A 5I2MA 5LJ3d 8ATCB 2DIQA 4BE2A 2DYBA 2VWFA 2VXFA 3CC2Q 2P4RA 2RD1A 1SSFA 1VQ4T 2QEXT 2X3WD 2MAMA 2FPEA 1YCYA 3HL8A 1B07A 2VV5A 4NOYA 1VQ6A 1PNJA 1YJ9A 5GAOn 5GAMh 3S3MA 2FZKB 1V76A 4AFSC 3EGXB 1QP2A 1WIEA 4AFQC 3CCVT 4XU1A 3OMGA 3C12A 2DL3A 2YWWA 5GMKe 1QWFA 2FRYA 2F5KA 2DILA 3JCMQ 3UA6A 2LRQA 2X4YA 3CCLT 2LCSA 5IH2A 3C0CA 2XICA 1DJ7B 4RG2A 3M0PA 4EIKA 1PWTA 3X24B 3ZFJA 4KT0E 1M1FA 2DL4A 3VV0A 1RADB 3I35A 1Q82C 4PJOA 4PJOD 3TEEA 2K6DA 3OYYA 5GAOp 1X6GA 4E7ZA 2RB6A 1G3TA 1MGQA 2CSIA 2OTLA 1QVFA 2KT1A 4C8QF 1SRMA 5GAN8 3SD4A 5KYXB 3PVQA 4IUPA 1YJNT 3JCMc 2CP0A 1VQNQ 4IUUA 3UATA 4C92F 3VS1A 3WVEB 5FU6B 3RMQA 4HCZA 4JUVA 5LJ3e 4JRPA 4Z02A 2LCLA 2QK0A 5GMKh 1H92A 2EAYA 2KRMA 2XDPA 2YUQA 2DNUA 2GTJA 1Y71A 1AVZC 2IG0A 1ZQ1A 4F7UB 1FMKA 2CZ0B 2RQUA 4QQGA 2J6FA 3SWNC 3OYKA 5GAMd 4FT2A 2K3BA 2QGFB 5GAOr 1Q81C 2K7AA 2EJGA 2NUTB 2RQWA 1ZSZA 1VQLA 4JJCA 4OMLA 1NJIC 2BE7D 5CKBA 1H3HA 1BK2A 1N9RA 1RACB 4LUDA 2BZYA 4ELYC 4E7JA 3JB9F 3CMAA 4AT1B 4HCCA 2LJ0A 3H0HA 3P8BB 1IXDA 2LC4A 3GIBA 4M78A 4AFUC 2HZYA 3LGLA 5DLQE 2CZ7B 4FYVB 2ROLA 1VQ7A 2X4XA 1UJ0A 4B6MA 4CC7A 4OGCA 1J3TA 1R0BG 2JOYA 1M1KC 1TWBA 1OX8A 2LNHB 3H0FA 5J3BA 3CQTA 1OI1A 1MMAA 2QTXA 3PMTA 2CP3A 5CKEA 5LL6S 4OP0A 4M7DD 2VUBA 4F16A 4ATOA 3U23A 1PD1A 1PSFA
chains in the Genus database with same CATH topology
4F7UF 3CCET 3GNFB 3I55T 4DOWA 4C0GA 3ASKA 4A4HA 2ZZDA 3A8OB 3OYNA 2RO0A 4XU0A 4XU3A 4KUIA 2E10A 2DXTA 3TCJA 1VQKT 4M7AC 3SDZA 3ZEHA 5CIUA 4F7UE 3J81E 4IKFA 1P92A 2PUKB 4PLLA 2EJFA 3TU4K 4FSXA 4B9XA 5CAIA 4CI0C 1UGQB 2K5IA 3F70A 2KVQG 3PFSA 2CKKA 3HP9A 2PVGB 5LJ5f 1KQSS 1N6AA 3LGFA 5DLOA 2WSEE 1M90C 3O8VA 1R8OB 3CCEA 2K3YA 2BIVA 4EDUA 1KQSA 4MMKA 2D0QB 2K5FA 2LDMA 3G4ST 4R56A 4MMLA 4C92A 4NL2A 4OB3B 2XD0A 1RL2A 3OYEA 2E6NA 3JCMf 1VQOT 3L2VA 3Q1JA 1IREB 4M7DE 1JBMA 2DK3A 1W2BS 3A8GB 1I8FA 5LJ5d 1HK9A 2VYTA 3HFOA 4N0AA 4DOVA 1QVFS 2XK0A 2RI5A 3QKJA 2GCXA 1M5Q1 2L3RA 4X34A 3RKXA 1S72A 4X9CA 3LLRA 4MZTA 3JB9H 4M78C 1KQ2A 1VQMT 2A7YA 2R5MA 3KBGA 4YTLA 3A8HB 5GANh 3BDUA 1VQ9A 5DM7R 2KQWA 2ZPIB 3CC2A 2CZ1B 2PUOB 3QG1A 2XI9A 1M4ZA 4EMHA 3SB2A 2NLUA 3DLLA 1K73U 3UPUA 4LDWA 5HK3A 1M90U 4BACA 3P8DA 1N27A 2XU8A 4M77B 5LJ3f 4M7DG 2R58A 3MP6A 1KG1A 2KK4A 1YJWT 1I81A 4VUBA 4GLKA 3RESA 5FROA 3UT1A 4C8QA 4ZGDB 3OS1A 1I5LA 3WVDB 4EMKB 5GMKl 1BI1A 3PNWC 4XTVA 2E70A 4ZTJA 5GAN6 3MHXA 4L5GA 5C6SA 1G3WA 4C0DC 5GAN7 1U8RA 4RMOA 2RH2A 3RIRA 4E7LA 4PJOF 3HRTA 3JSCA 3OYBA 3CCUA 3VKIA 4J6WA 2RA2A 4A4GA 1D3BB 5KCHA 1W4SA 1YJWA 3PMIA 3CBOA 2JZ2A 3M59A 2QQBA 1Y7XA 3HHTB 4QQ6A 3CBMA 3OS0A 3KXTA 4JS4A 2VGNA 5GAMe 5GAMj 4N0AC 2WACA 4BY6B 2M0OA 2D9TA 3X26B 1GXIE 2X4WA 2L89A 4QVZA 2EQMA 2QXFA 3L2UA 4M7AD 3MEWA 4HT8A 2OAUA 4J83A 3BFMA 2GF7A 1UEBA 3PGGA 4XTYA 3A8MB 5FLXE 1LOJA 1U1SA 1S72T 3MEUA 3QUIA 5FU7B 3TREA 3KUFA 3BDLA 4OVAA 4C92D 4HT9A 3GP8A 3HRSA 2JVVA 3FRNA 3OY9A 2EQUA 5J39A 3DB3A 3JCMV 3JCMe 4L6V5 5HK0A 3EFRA 3LH0A 4LD6A 5GMKi 2YLCA 1VIEA 2KAFA 4XTXA 1X75C 3V8JA 3G4SA 1BKBA 2DXBA 4O5VA 4PJOE 1WQWA 2EYQA 2HQEA 4M7AF 1BI2A 3N5BB 2ZCFB 2DKGA 3C95A 4KBMB 1Y07A 3S6WA 1OYXA 3OYCA 1XTDA 5CVIA 4LDVA 3CCJT 1QVGS 4EMGA 4A4KA 2K3XA 5A0GA 1G3SA 5CK9A 3AHUA 5GAMg 3GLXA 4GY5A 4M75F 5GAN4 4M77C 2OTJA 5KE2A 4LD9K 3QJYA 3QPHA 5CQXA 4M75D 4OF1A 3E1SA 1VQKA 3NTHA 4EMKA 1EIFA 3LWHA 2WSFE 1PSEA 5KCOA 5IT9E 1LJOA 4HA8A 4O6JA 4PLIA 3MEAA 3I55A 4XTZA 2K5LA 4M7DC 3JCMb 3X25B 3MCAB 4M78B 2DJZA 3JCMg 3CPWA 3JB9D 2Y90A 1M1GA 2YRVA 4PNOA 4MDWA 4HCBA 2D6FA 2LT1A 2KSSA 3FLGA 3VYHB 4PJOB 4KULA 2KY9A 1XNIA 3M5AA 3OBWA 4M77D 5GMKm 3CXCS 2DD5A 1UGSB 4V2SA 3L2RA 3CC7A 1VQ5A 1LNXA 1QW1A 3VUBA 1VQNA 3X28B 4JLIA 3DB4A 2DEQA 3OS5A 1Q7YC 2YLBA 2L5QA 1KC8C 4IUQA 5CKFA 5I2SA 5GANf 3QDRB 2CGHA 1I4K1 2RI2A 2LCCA 1YHQT 1YJNA 1N9SA 1AHJB 2DVEA 4FM4B 5EG2A 3L2ZA 4FL6A 2JUFA 4QVDA 2QA4T 2DTHA 4BY6C 3WXMB 4C5GA 3CCMA 3QBYA 2ZPGB 5FU7C 2ZPEB 2Y4YA 1B34B 3RUXA 5C0MA 2LT4A 4C0FA 2DXUA 3JCMd 1NJIU 4A53A 3H8ZA 3OYGA 2PU9B 2O01E 2QDYB 1VQ7T 4BI8B 5D6YA 2FL7A 2RHUA 3RMSA 3OYLA 3J80E 2B8AA 3HSBA 3CCRT 3VU3C 4RKUE 2E12A 4C92C 2XDDA 3CXCA 3RKWA 2A3LA 3C4SA 2LQ8A 2O4XB 3E19A 2G3RA 5GAN2 3CC4T 2VXEA 4DQ2A 5DY9A 4PJOG 5GAOq 2RI3A 1VIFA 2PQWA 4OGEA 4C92B 5CKDA 4C8QG 3JB9I 1KQ1A 5HY6A 4E47A 3OYJA 1N8RC 2BUDA 4JRQA 2E64A 4II1A 2H3JA 4B9WA 3LYIA 3NFCA 4BDYA 3CCLA 3ER0A 3SWNA 1ZBXA 4C0DB 3NTIA 2QI2A 3CMAT 3JB9G 1M1KU 1K8AU 4QW2A 1O9SA 2V8IA 4M75E 4N4IA 1XQHA 3M57A 4TVRA 4M78F 4FIBA 1IZ6A 2DTIA 3FEOA 3CMEA 4IUVA 3CCVA 4WF2A 4J6YA 3CBPA 2M9UA 2X35A 4DA4A 3E9FA 1YITT 3C94A 2M16A 3M53A 4PJOC 3VYGA 4MZMA 4JDSA 1YI2A 1YJ9T 4A54A 1HXDA 1WNLA 1N8RU 3GF5A 4BI4A 3JAME 3CCQA 4F7UG 3UDCA 4M7DB 3G6ET 2DD4A 3VJPA 4EMKC 1VQLT 2YHTA 4IURA 2QEXA 4MDXA 4BDZA 1VQ4A 3H6ZA 1Q86C 4MZPA 3S3OA 1OZ2A 2E65A 1NPPA 3E9GA 2V8JA 1JRIA 3EFSA 3FB9A 3I56T 4BE0A 4M78E 2KDSA 2DO3A 4ZTFA 4IUTA 3V7CA 2HBPA 1M8VA 1UB4A 5AYFA 3HPWA 4XK8E 5GAN5 3MO8A 2EFIA 2MWPA 5LJ3g 5LJ5j 4M75G 2RM4A 2Y4XA 3META 4ME7A 5LJ5e 2P4TA 1WJRA 1VQPT 2LX9A 1WGSA 4RCBA 2QQAA 3JCMJ 1H641 2K2VA 3DLMA 1TH7A 3ME9A 4XTWA 4ZGJB 1NE8A 3RKYA 1YBYA 3M54A 5I2MA 1NZ9A 3QJ6A 4OB0B 5LJ3d 2DIQA 2GFUA 1KD1U 1FX7A 4BE2A 2GQVA 1U1TA 2LNVA 2DAQA 1YIJT 4C0ZA 3I56A 3HRUA 4E7IA 4J8OA 2E41A 1ZHIA 2VXFA 3CCSA 2I2LA 3L2QA 2RD1A 1SSFA 1VQ4T 4X9DA 2QEXT 3OA6A 5J26A 3JCMP 2MAMA 1VQ8T 3JCMX 1YCYA 2LQKA 3HL8A 2M1HA 3JCMh 3SFMA 2VV5A 3CCQT 2MMPA 2DZ9A 2RHIA 3QIIA 4NOYA 1VQ6A 1YJ9A 3MEVA 1YI2T 3NTKA 2JN0A 3DKMA 2JTFA 2R5AA 2FVUA 3OBYA 4M78D 3MP1A 4QVCA 5GAMh 3M55A 5GAOn 4Y28E 3S3MA 1YITA 4P5NA 1QP2A 1RI0A 3OYMA 3QO3A 3CCVT 4XU1A 4C5HA 2RJCA 2KMTA 5LJ5g 3M56A 3OMGA 3C12A 3M58A 2HQXA 4BI3A 5GMKe 5GMKj 3EAEA 3CPWS 2K57A 3OYHA 2RK1A 2F5KA 4PL6A 3OSSC 4C92E 3OYDA 1D3BA 1WJSA 1KD1C 1K9MU 3JCMQ 2K4YA 4JRIA 3CD6A 4M7AE 4XQ3A 3LX7A 4RG8A 2OTLT 4A4FA 2LRQA 4N4GA 2X4YA 3CCLT 1PSFA 1H3ZA 2QQ9A 5GAOm 3RERA 5D6WA 2FB7A 1XOVA 4M77A 5GAOl 2EKOA 2IVWA 1W2BA 1Q7YU 2XICA 1DJ7B 3FDRA 4RG2A 2QQRA 4C8QE 4UC4A 3X24B 2DIGA 2WSCE 3ZFJA 4LDUA 3GPLA 4KT0E 1UGPB 3G71T 1M1FA 2P0PA 2V8KA 2E5QA 1WPYA 4M78G 4XTUA 3VV0A 3G71A 4BE1A 1Q82C 5GAN3 1Q81U 4M7AA 2VGMA 3GNGA 3TEEA 4PJOA 3L42A 3OYYA 5FU6C 4PJOD 1OZ3A 2EIFA 4ZN3A 5GAOp 2RHXA 3L2WA 2RB6A 2HAXA 1G3TA 1KHIA 2CYZB 3QZ9B 5CCAA 5IAYA 1MGQA 1UGRB 4M77E 2MI6A 4LDXA 3BY7A 2OTLA 2XKOC 1QVFA 3LW5E 2PVDB 4C8QF 3CD6T 4C8QB 1FXXA 3INZA 3HKSA 4C5EA 5GAN8 4EPCA 4M7AG 2QA4A 3SD4A 2EJ9A 4LDYA 4IUPA 1YJNT 3ZBDA 3P8HA 2DTOA 3JCMc 3OS2A 1Q86U 1FWZA 1G3YA 3MP8A 2BKDN 3QZ5B 4BD3A 4M7AB 3A5ZB 3PTAA 4IUUA 2E6ZA 5A0LA 3OYIA 1VQ6T 5KH6A 4C92F 3WVEB 2F5TX 4N4HA 5IN1A 1VQ5T 5FU6B 3RMQA 1VQ8A 2FYKA 3CC7T 1JJ2S 1MHNA 2RJEA 4CRIA 4E7KA 4HCZA 4JUVA 4M75A 2LVMA 5LJ3e 1VUBA 5LJ3j 3CCST 4JRPA 4E7HA 4Z02A 3OQ5A 2ZPFB 4BB7A 2LCLA 1YIJA 4NS5A 2O4XA 5GMKh 2EAYA 2XDPA 5I21A 1WQ7A 3R6OA 1Y71A 2JNGA 3OW2S 2RHYA 3GOXA 1BIAA 3M4YA 1BI3A 2DPPB 2IG0A 1K73C 1ZQ1A 4QQDA 2MF2A 4F7UB 1K9MC 1KHCA 2DZCA 2EWNA 4J5YA 2XG8D 3CPFA 2R57A 3PIOA 1VQPA 4F7UA 2CZ0B 2OTJT 3FIFA 4QQGA 3SWNC 1JJ2A 3OYKA 2EQKA 2RJFA 5GAMd 3CCJA 2RK2A 3QSUA 4Q5WA 5GANd 2MWOA 4FT2A 3X20B 4Y91A 4JLGA 5GAOr 1Q81C 1Q82U 2EJGA 3JCMW 2PVOB 4FT4A 3JRZA 1JB0E 3BW1A 1VQLA 4KUDK 4JRKA 4D6WA 3G6EA 1NJIC 2P0QA 3QYGB 4OB1B 4M77G 3UWNA 5A0DA 3JB9J 4ZN1A 1QVPA 5CKBA 2E1HA 4NL3A 4BUGA 1N9RA 4FU6A 4C92G 3URGA 5CQYA 5LJ3h 3J7AF 2RHZA 2DXCA 4ELYC 3CMET 4M75C 4J7FA 4E7JA 2XHCA 1KC8U 3JB9F 3PIPA 4C8QC 1B34A 4ZGEB 2FHDA 3L1AA 2EQJA 5GANe 5GANj 3CMAA 1V29B 1Y96A 4PKCC 5GAMf 3QXEB 5GANg 1Y96B 5A2QE 5LJ5h 4HCCA 4M7DA 3VUZA 3OYAA 3P8BB 4R55A 5CO7A 2HNIA 1NPRA 4L59A 4M75B 2LC4A 4ELZC 3OYFA 3GIBA 3CCUT 1O75A 1X01A 2LTOA 4XU2A 5M9OA 5CR2A 4M78A 5HKCA 3CC4A 3V7SA 2JTMA 4OMFB 3V8LA 3OB9A 3LGLA 2P0KA 5DLQE 3FJPA 4C5IA 2XDBA 3CCRA 2CZ7B 2C06A 2CZ6B 3V7RA 5FRNA 1VQ7A 2X4XA 4OB2B 5KE3A 2XIDA 1BYMA 3HFNA 2ZPHB 2F69A 3G7ZA 1WJQA 2L8DA 3M4GA 3FC3A 1X6OA 1QP3A 4OGCA 2AHJB 2RJDA 4M7DF 3CCMT 3CC2T 2JOYA 5L8RE 1K8AC 1G5VA 1M1KC 2ZPBB 1QVGA 1VQ9T 1YHQA 3OSVA 2X4JA 1VQMA 3M9QA 2QQSA 4A4EA 5FRMA 5J3BA 2HD0A 4M77F 3T9NA 2VC8A 4JS5A 5CKHA 3V8KA 3LWIA 1OI1A 4C8QD 3A8LB 3QHSA 2QTXA 1VQNT 4RCCA 3PMTA 3SWNB 1VQOA 5CKEA 5LL6S 2CS7A 4J7IA 4HKEA 1BI0A 3CEYA 4J6XA 1M9SA 4OP0A 4M7DD 2VUBA 3PT9A 4XAXB 4JJNK 2GFAA 3QYHB 3S3NA 5D6XA 4ATOA 3OW2A 3OMCA 2ZGWA 1BIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U F;  5GMK h;  2EAY A;  5I21 A;  1M8V A;  3V7C A;  1WQ7 A;  4EMG A;  3AHU A;  5GAM g;  5GAN 5;  1BIA A;  5LJ3 g;  4M75 F;  4M75 G;  2RM4 A;  4M77 C;  4XU0 A;  4XU3 A;  2E10 A;  2DXT A;  5GAN 4;  4M7A C;  4F7U B;  4F7U E;  2DZC A;  2EWN A;  4J5Y A;  4M75 D;  4RCB A;  2EJF A;  4F7U A;  5CAI A;  3JCM J;  1H64 1;  1TH7 A;  3FIF A;  4XTW A;  4EMK A;  5LJ5 f;  3RKY A;  1LJO A;  5LJ3 d;  4HA8 A;  3SWN C;  5GAM d;  4XTZ A;  4M7D C;  3JCM b;  3QSU A;  5GAN d;  4M78 B;  1U1T A;  2DJZ A;  3JCM g;  3JB9 D;  2Y90 A;  4PNO A;  4MMK A;  2E41 A;  4Y91 A;  5GAO r;  4PJO B;  2VXF A;  4MML A;  4C92 A;  2EJG A;  2I2L A;  4NL2 A;  2RD1 A;  4X9D A;  4M77 D;  5GMK m;  3JCM W;  3JCM f;  4V2S A;  3BW1 A;  3JCM P;  4JRK A;  3JCM X;  1LNX A;  1YCY A;  4M77 G;  3JCM h;  4M7D E;  1JBM A;  4JLI A;  2DZ9 A;  3JB9 J;  4NOY A;  2DEQ A;  1I8F A;  5LJ5 d;  1HK9 A;  2E1H A;  3HFO A;  4N0A A;  4NL3 A;  1N9R A;  2JN0 A;  2YLB A;  4M78 D;  4C92 G;  5GAM h;  1M5Q 1;  5GAO n;  4QVC A;  3RKX A;  5LJ3 h;  4X9C A;  5GAN f;  3JB9 H;  4M78 C;  1KQ2 A;  2CGH A;  1I4K 1;  3QO3 A;  4M7A F;  4XU1 A;  5GAN h;  4M75 C;  1N9S A;  3BDU A;  5LJ5 g;  5GMK e;  5GMK j;  2DVE A;  3L2Z A;  3JB9 F;  4QVD A;  4C8Q C;  1B34 A;  2DTH A;  2K57 A;  3L1A A;  4EMH A;  4C92 E;  3SB2 A;  5GAN e;  3RUX A;  1D3B A;  5GAN j;  3RER A;  1B34 B;  3JCM Q;  4M7A E;  4JRI A;  5LJ5 j;  1Y96 A;  4XQ3 A;  2DXU A;  3JCM d;  4A53 A;  5GAM f;  5GAN g;  4M77 B;  1Y96 B;  5LJ3 f;  5LJ5 h;  4M7D G;  5GAO m;  4M7D A;  2FB7 A;  4M77 A;  5GAO l;  1I81 A;  3RES A;  4C8Q A;  2HNI A;  4M75 B;  1I5L A;  3GIB A;  3HSB A;  4EMK B;  5GMK l;  4C8Q E;  3VU3 C;  1X01 A;  4XTV A;  4C92 C;  4XU2 A;  3RKW A;  5GAN 6;  5GAN 7;  4M78 A;  3V7S A;  4M78 G;  1WPY A;  3RIR A;  4XTU A;  3V8L A;  5GAN 2;  2VXE A;  4DQ2 A;  3FJP A;  5DY9 A;  4PJO F;  4PJO G;  5GAN 3;  4M7A A;  5GAO q;  4PJO A;  4PJO D;  3JB9 I;  4C92 B;  4J6W A;  4C8Q G;  5GAO p;  1KQ1 A;  2RA2 A;  1D3B B;  3V7R A;  2RB6 A;  2E64 A;  1MGQ A;  4M77 E;  3HFN A;  3SWN A;  5LJ5 e;  3BY7 A;  3M4G A;  5GAM e;  5GAM j;  4N0A C;  4C8Q F;  3JB9 G;  4C8Q B;  3INZ A;  5GAN 8;  4M7A G;  4M7D F;  4M75 E;  2DKG A;  2EJ9 A;  4M78 F;  4M7A D;  4HT8 A;  2DTI A;  3BFM A;  2DTO A;  3JCM c;  4WF2 A;  3PGG A;  4J6Y A;  4XTY A;  4M7A B;  1LOJ A;  1U1S A;  4PJO C;  4M77 F;  3QUI A;  2VC8 A;  4A54 A;  1HXD A;  1WNL A;  4C92 D;  4HT9 A;  3V8K A;  4C92 F;  4C8Q D;  4F7U G;  3QHS A;  2QTX A;  4M7D B;  4RCC A;  4EMK C;  2FYK A;  3JCM V;  3SWN B;  2YHT A;  3JCM e;  3EFR A;  4JUV A;  4M75 A;  5GMK i;  4J6X A;  2YLC A;  4OP0 A;  5LJ3 e;  5LJ3 j;  4XTX A;  4M7D D;  2E65 A;  3FB9 A;  3V8J A;  3EFS A;  1JRI A;  4PJO E;  1WQW A;  4M78 E;  2ZGW A;  1BIB A; 
#chains in the Genus database with same CATH topology
 2FEI A;  4DOW A;  2ZZD A;  3A8O B;  3OYN A;  1NG2 A;  3TCJ A;  1GBR A;  4IKF A;  1M2O A;  1AOJ A;  1WXT A;  2PUK B;  1SKU B;  3TU4 K;  2O31 A;  3F70 A;  4GLM A;  1MNE A;  5LJ5 f;  1KK7 A;  1YJ9 Q;  2OTL Q;  3VS3 A;  1M90 C;  3O8V A;  1R8O B;  2H8H A;  4J9H A;  2K3Y A;  1UE9 A;  2K5F A;  4F17 A;  1AT1 B;  1HJD A;  1YFN A;  1RL2 A;  2E6N A;  1YN8 A;  3Q1J A;  1YP5 A;  2MK5 A;  3VS6 A;  1I8F A;  4Z8A A;  2XK0 A;  2EQI A;  1VQM T;  2R5M A;  3A8H B;  3BDU A;  3CC2 A;  1UGV A;  3OMC A;  3UPU A;  4LNP A;  1M90 U;  4HVV A;  1M3B A;  2R58 A;  1WLP B;  4HVW A;  3OS1 A;  4EMK B;  1AD5 A;  1BI1 A;  5GMK l;  3PVL A;  2E70 A;  1YIJ Q;  1YJN Q;  4L5G A;  5C6S A;  1Q86 R;  4C0D C;  3RIR A;  2C0I A;  5IXB A;  4PJO F;  1TS9 A;  3JSC A;  1RAE B;  1EFN A;  1WHK A;  4J6W A;  1D3B B;  1W4S A;  3PMI A;  3CBM A;  2KYM A;  3X26 B;  2X4W A;  3I56 Q;  2QXF A;  4PJJ A;  1Q81 R;  2OAU A;  4J83 A;  3BFM A;  3PGG A;  3RR6 A;  2KI7 A;  2CP5 A;  2C0T A;  5FU7 B;  2JVV A;  3OY9 A;  1R0C B;  3DB3 A;  3JCM V;  2EKH A;  4L6V 5;  4LD6 A;  5GMK i;  1MND A;  2KAF A;  3CCJ Q;  2HCK A;  1MMG A;  2A37 A;  5CVI A;  1G3S A;  1ZX6 A;  2HEQ A;  5KE2 A;  4EMK A;  1EIF A;  3LWH A;  3NGP A;  2JMC A;  3MCA B;  2DJZ A;  3JCM g;  2Y90 A;  4MDW A;  2NUT A;  2D6F A;  3FLG A;  4ZNX A;  1ZSZ B;  2KY9 A;  4M77 D;  5GMK m;  4V2S A;  3CC7 A;  1VQP Q;  1LNX A;  1QW1 A;  1VQN A;  2F2X A;  2L3Q A;  4JLI A;  1T3S A;  2DEQ A;  3OS5 A;  2YLB A;  1I5O B;  2DYI A;  5FWC A;  2RNA A;  1VYV A;  4JJB A;  4DBH A;  2EYW A;  4IUQ A;  5GAN f;  2RI2 A;  2RQT A;  1N9S A;  3QWY A;  2X3X D;  4QVD A;  2QA4 T;  5FU7 C;  2ZPE B;  2Y4Y A;  1B34 B;  2LT4 A;  1QVF P;  4A53 A;  5D7U A;  2PU9 B;  2CRE A;  4BI8 B;  3J80 E;  3CCR T;  4C92 C;  5KYW B;  1MUZ A;  2G3R A;  2VXE A;  4DQ2 A;  1X2Q A;  2JM9 A;  3CMA Q;  5CKD A;  5HY6 A;  4E47 A;  1N8R C;  2BUD A;  1UDL A;  2E64 A;  3CCL A;  4C0D B;  1W70 A;  1MMN A;  4QW2 A;  2RPN A;  1KSW A;  4M75 E;  1XQH A;  1Z9Q A;  1OPL A;  2OX7 A;  1GFC A;  1IZ6 A;  3FEO A;  3CCV A;  5KYN A;  2DX1 A;  2M16 A;  2DM1 A;  4JDS A;  1N8R U;  1YJ9 T;  4A54 A;  3JAM E;  2AT1 B;  2LMJ A;  4IUR A;  2QEX A;  2DL5 A;  1PRL C;  2E65 A;  1U3O A;  2V8J A;  3EFS A;  4BE0 A;  4M78 E;  3ZL7 C;  1ZLM A;  4IUT A;  2M02 A;  3HPW A;  4XK8 E;  3MO8 A;  2MWP A;  2J05 A;  4M75 G;  5GJW B;  4ME7 A;  1WGS A;  2QQA A;  3JCM J;  2K2V A;  2QTV A;  1NZ9 A;  1KC8 R;  1KD1 U;  2GQV A;  4J9F A;  2DAQ A;  4C0Z A;  3I56 A;  1SEM A;  1ZUK A;  2DA9 A;  3L2Q A;  1YJW Q;  5J26 A;  3JCM P;  1VQ8 T;  2M1H A;  1X6B A;  2MMP A;  2DZ9 A;  4LXC A;  2LP5 A;  1YI2 T;  4M78 D;  1T3L A;  3OBY A;  1YIT A;  1QQJ A;  4P5N A;  3QO3 A;  2KMT A;  3G4S Q;  2HQX A;  4BI3 A;  3EAE A;  3SHW A;  2K57 A;  3OYH A;  1WJS A;  3CD6 A;  4M7A E;  4XQ3 A;  3LX7 A;  5FW9 A;  4N4G A;  2EBP A;  5D6W A;  4FSS A;  2IVW A;  1Q7Y U;  1RAG B;  3A1P A;  3EFO A;  2WSC E;  3SEM A;  2Z0W A;  4LN2 A;  1WPY A;  2W10 A;  1M27 C;  3G71 A;  4BE1 A;  1Q81 U;  2DET A;  1WI7 A;  2DVJ A;  3I5S A;  1KHI A;  1HYO A;  2CYZ B;  3QZ9 B;  5CCA A;  5IAY A;  1UGR B;  2MI6 A;  3BY7 A;  2NUZ A;  2XKO C;  1AEY A;  4OMM A;  1Q82 R;  4C8Q B;  3CCE Q;  1FXX A;  4C5E A;  3CD6 T;  1WHJ A;  4EPC A;  1C1A A;  3NMZ C;  4F14 A;  4LDY A;  2L2P A;  2JW4 A;  2DTO A;  3OS2 A;  4CC4 B;  1Q86 U;  1G3Y A;  3MP8 A;  2BKD N;  3QZ5 B;  1JU5 C;  1WXU A;  5A0L A;  4K11 A;  5KH6 A;  1ZUU A;  2OTJ Q;  5IN1 A;  2FYK A;  2RF0 A;  9ATC B;  2RJE A;  4CRI A;  3CCS T;  2ROT A;  1B7T A;  1YIJ A;  5I21 A;  3EGD A;  1VA7 A;  1WQ7 A;  3R6O A;  2LZ6 B;  3CCS Q;  1Y57 A;  3OW2 S;  1BIA A;  1BI3 A;  3MPU B;  1RAB B;  1KHC A;  2DZC A;  3I9Q A;  2EWN A;  2XG8 D;  4J5Y A;  3PIO A;  1HSQ A;  4F7U A;  2OTJ T;  1WFW A;  3FIF A;  1JJ2 A;  3CCJ A;  2EQK A;  1JJ2 P;  3I5R A;  1NEB A;  2CP6 A;  4Y91 A;  4JLG A;  3VRY A;  3CME Q;  4CC2 A;  2PVO B;  1OUL A;  4KUD K;  3QDF A;  3QYG B;  3UWN A;  3JB9 J;  2E1H A;  4BUG A;  2AZS A;  2CSQ A;  5CQY A;  2DXC A;  1YWO A;  4J7F A;  2YUO A;  1WHH A;  1GBQ A;  3PIP A;  1B34 A;  2FHD A;  2EQJ A;  5GAN j;  1V29 B;  5GAM f;  5A2Q E;  5LJ5 h;  1D0Y A;  2KR3 A;  4M7D A;  3OYA A;  2CH4 W;  4E2F B;  3CCL Q;  2NUP B;  1NPR A;  4L59 A;  2F2V A;  3OYF A;  2LTO A;  3E2U A;  5HKC A;  3V7S A;  1NYF A;  3CCR A;  2MIO A;  1K4U S;  4OB2 B;  5KE3 A;  2JJ9 A;  3HFN A;  2ZPH B;  2F69 A;  3FC3 A;  2O9S A;  1VQ8 Q;  1WDX A;  5AT1 B;  3REB B;  5L8R E;  1K8A C;  2QQS A;  3CCU Q;  2G6F X;  1K76 A;  1WHM A;  3LWI A;  1VQ6 Q;  3QHS A;  4RCC A;  1QMC A;  2RN8 A;  3SWN B;  3ULR B;  1VQO A;  4OMP A;  4XAX B;  4JJN K;  2GFA A;  3QYH B;  1K1Z A;  5D6X A;  3OW2 A;  3EG9 A;  3VS0 A;  2ZGW A;  2FRW A;  1W1F A;  4E7S A;  3GNF B;  1OX9 A;  2E4H A;  1SHF A;  3ASK A;  1PKS A;  2RO0 A;  2E10 A;  2DXT A;  5FWB A;  2RQV A;  3VS4 A;  3SDZ A;  3J81 E;  4F7U E;  1P92 A;  2EJF A;  4B9X A;  2PNI A;  5CAI A;  1UGQ B;  2K5I A;  2CKK A;  1ZA1 B;  2DLP A;  2PVG B;  1KQS S;  1N6A A;  3LGF A;  5DLO A;  4AMC A;  1IHV A;  2LDM A;  1ZBJ A;  4MML A;  3OYE A;  3JCM f;  3L2V A;  1AWJ A;  1T0H A;  4A63 B;  4M7D E;  5LJ5 d;  3HFO A;  4DOV A;  2GCX A;  4X9C A;  3LLR A;  4M78 C;  2HKQ B;  2A7Y A;  4M7A F;  2KQW A;  4WTO B;  3QG1 A;  4J9C A;  3DLL A;  3CCR Q;  1OU9 A;  3P8D A;  1N27 A;  5LJ3 f;  3FJ5 A;  4GLK A;  3PNW C;  4PK4 A;  2HMA A;  5GAN 7;  2A08 A;  1U8R A;  2RH2 A;  1AWW A;  1M1K R;  4DBR A;  3OYB A;  3CCU A;  2RA2 A;  2JZ2 A;  3M59 A;  2QQB A;  1Y7X A;  3HHT B;  4JS4 A;  2VGN A;  5GAM e;  3M0U A;  1NM7 A;  4BY6 B;  4KH1 B;  4QVZ A;  2L89 A;  1K0S A;  3MEW A;  2GF7 A;  2QGG A;  1UEB A;  1X27 A;  1U1S A;  3MEU A;  4RUG A;  2D8H A;  2FZC B;  3JCM e;  5HK0 A;  3LH0 A;  3TSZ A;  2YLC A;  3EG3 A;  2CUD A;  2ECZ A;  4X1V A;  3V8J A;  2DXB A;  1WQW A;  3D7S B;  1BI2 A;  3S6W A;  2ZCF B;  3C95 A;  1A0N B;  3OYC A;  1RLP C;  1XTD A;  1GCQ C;  3IQL A;  3CCJ T;  1QVG S;  4EMG A;  4A4K A;  4AG1 C;  5A0G A;  3AHU A;  4M75 F;  2COW A;  2GQI A;  5I22 A;  2QAZ A;  1LJO A;  2KXC A;  4PLI A;  4XTZ A;  4M7D C;  2JTE A;  5HCK A;  4M78 B;  2A28 A;  2LJ3 A;  3JB9 D;  4PNO A;  4HCB A;  2KT8 A;  1TU0 B;  4PJO B;  1XNI A;  1V1C A;  3OBW A;  1SSH A;  3HTR A;  2JMA A;  2PTK A;  3VUB A;  2ESW A;  2V1R A;  1PG5 B;  1IGQ A;  1Q7Y C;  4JPB W;  5CKF A;  3QDR B;  2CGH A;  1QCF A;  4AFZ C;  3MJX A;  2JUF A;  2DTH A;  4C5G A;  3WXM B;  2RQR A;  2J06 A;  3QBY A;  3H9N A;  1VQL Q;  4C0F A;  2DXU A;  2QDY B;  2OAW A;  1YIT Q;  5D6Y A;  2B8A A;  3VS7 A;  4RKU E;  3RKW A;  2LQ8 A;  5GAN 2;  4CC3 A;  2JXB A;  2HL5 C;  4OGE A;  4C92 B;  4C8Q G;  5IXF A;  4JRQ A;  2EYZ A;  2AZV A;  4II1 A;  1EX4 A;  3LYI A;  1TTH B;  1RAF B;  4DEY A;  3M57 A;  3CC4 Q;  4M78 F;  2KE9 A;  2HL3 A;  3H0I A;  3CME A;  4IUV A;  4J6Y A;  1TOV A;  4D8D A;  3CCQ A;  1K73 R;  2DD4 A;  4HVU A;  4MDX A;  1VQK Q;  4BDZ A;  3H6Z A;  1QKX A;  4MZP A;  3S3O A;  3FB9 A;  3E9G A;  1JRI A;  2KDS A;  1UG1 A;  1M8V A;  1IHW A;  5AYF A;  2GTO A;  5KYY A;  5GAN 5;  5LJ5 j;  5LJ3 g;  2YRD A;  2RM4 A;  4RCB A;  1H64 1;  3DLM A;  4ZGJ B;  1NE8 A;  3RKY A;  5GJV B;  2GFU A;  5EC7 A;  2LNV A;  3HRU A;  4J8O A;  1NLP C;  1OQK A;  1T0J A;  3OA6 A;  3JCM X;  2LQK A;  4D8K A;  4FYX B;  2JT4 A;  3DKM A;  2JTF A;  2R5A A;  1OPK A;  4QVC A;  1IGU A;  4Y28 E;  2SRC A;  1G8X A;  1RI0 A;  3OYM A;  2DER A;  4IIM A;  4C5H A;  2RJC A;  3M56 A;  5GMK j;  3CPW S;  4PL6 A;  4C92 E;  1KD1 C;  1D3B A;  5KYY B;  2K4Y A;  4RG8 A;  2OTL T;  4A4F A;  4RTY A;  2K9G A;  2QQ9 A;  5GAO m;  2FPD A;  1XOV A;  2EKO A;  1N5Z A;  3FDR A;  1G2B A;  1BB9 A;  2DIG A;  4LDU A;  1UGP B;  2E5Q A;  4M78 G;  5GAN 3;  1PD0 A;  2HKN A;  1RI9 A;  2LX7 A;  2VKN A;  4M7A A;  2VGM A;  1NEG A;  1WA7 A;  2CUB A;  3EG2 A;  4M77 E;  1Q7Y R;  5IHI A;  4LDX A;  5IHK A;  3I55 Q;  3HKS A;  2QA4 A;  1Y0M A;  2J6O A;  4KGZ B;  2FZG B;  1UFF A;  1RLQ C;  1FWZ A;  1RAI B;  2E6Z A;  2NYS A;  2AKK A;  3OYI A;  1VQ6 T;  1AWO A;  2F5T X;  2AIR B;  1WZO A;  3CC7 T;  2EYX A;  5I11 A;  1JJ2 S;  1MHN A;  2D1X A;  4RTZ A;  1VUB A;  5LJ3 j;  2ZAE A;  4E6R A;  3OQ5 A;  4NS5 A;  1I1J A;  2HBW A;  2CDT A;  2O4X A;  2OJ2 A;  2ED1 A;  1TG0 A;  2EYY A;  2DPP B;  4QQD A;  2JM8 A;  1E6G A;  2LJ1 A;  1VQP A;  2R57 A;  2MOX A;  1LPL A;  2RJF A;  2RK2 A;  3QSU A;  1E7O A;  2GGR A;  2MWO A;  1AWX A;  3X20 B;  4RTU A;  2XMF A;  3JCM W;  4FT4 A;  3JRZ A;  1C0M A;  2JS0 A;  3G6E A;  2P0Q A;  4OB1 B;  1JO8 A;  3REA B;  5A0D A;  8AT1 B;  1QVP A;  1M90 R;  2EVR A;  3URG A;  3J7A F;  2RHZ A;  5KYW A;  1N8R R;  3CME T;  1MV3 A;  1GFD A;  2F1L A;  4LE9 A;  2XHC A;  1KC8 U;  1KD1 R;  1JQQ A;  2E3H A;  1Y96 A;  3M0S A;  3QXE B;  5GAN g;  1M2V A;  3NHN A;  4R0K A;  1C6V X;  5CO7 A;  1NBE B;  2KRS A;  4ELZ C;  1X01 A;  4RTW A;  2IPO B;  3TSW A;  5CR2 A;  3CC4 A;  4OMF B;  1PC0 A;  2P0K A;  1LVK A;  4DBF A;  4C5I A;  1Q95 G;  3EH1 A;  2CZ6 B;  1ARK A;  2XID A;  1BYM A;  1BCO A;  2L8D A;  3M4G A;  1X6O A;  2NUP A;  2AHJ B;  4JJD A;  1VQ4 Q;  3CCM T;  3PE0 A;  3CC2 T;  2ZPB B;  1AZE A;  1QVG A;  1VQ9 T;  3OSV A;  1VQM A;  3M9Q A;  5ECA A;  2B86 A;  4A4E A;  5FRM A;  4WCI A;  4M77 F;  4ORZ A;  3T9N A;  2VC8 A;  2LQN A;  4JS5 A;  5CKH A;  4Z89 A;  1M2V B;  4C8Q D;  3A8L B;  2ED0 A;  1X69 A;  4HKE A;  1BI0 A;  3CEY A;  3PT9 A;  3M0Q A;  1IRX A;  1QWE A;  2MPX C;  3VS5 A;  3CPW P;  4F7U F;  3CCE T;  3CD6 Q;  3I55 T;  4C0G A;  4A4H A;  4XU0 A;  4XU3 A;  4OMO A;  3ZEH A;  4CI0 C;  1MV0 B;  3HP9 A;  2O2O A;  2WSE E;  4IIO A;  3CCE A;  2FG0 A;  4ANJ A;  5KYX A;  1KIK A;  4EDU A;  1KQS A;  1WYX A;  4MMK A;  3G4S T;  2XD0 A;  1ABQ A;  1G83 A;  5KYU B;  1IRE B;  1JBM A;  1W2B S;  3A8G B;  1ZSZ C;  1HK9 A;  1QVF S;  3QKJ A;  1S72 A;  4X34 A;  3RKX A;  2BZ8 A;  4ESR A;  3KFV A;  4YTL A;  4KGV B;  5GAN h;  1VQ9 A;  2ZPI B;  3O5Z A;  6AT1 B;  2CZ1 B;  2XI9 A;  1M4Z A;  4EMH A;  1M3A A;  1SG5 A;  2NLU A;  3LH5 A;  2YDL A;  3CC7 Q;  1D0Z A;  4LDW A;  1OOT A;  5HK3 A;  1PRM C;  1UHF A;  2KBT A;  1KG1 A;  3MP6 A;  2COZ A;  2HQH A;  2KK4 A;  4OMQ A;  3RES A;  3UT1 A;  4C8Q A;  1I5L A;  1GRI A;  1M8M A;  4FYY B;  4ZTJ A;  4JZ4 A;  5GAN 6;  4DEX A;  4RMO A;  2KRO A;  2DFU A;  3VKI A;  3EGU A;  1YJW A;  2KYB A;  3CBO A;  1FMV A;  4QQ6 A;  3KXT A;  1M30 A;  1X43 A;  3OS0 A;  4N0A C;  3BE3 A;  2WAC A;  1K0X A;  2D9T A;  1GXI E;  1EZZ B;  3L2U A;  1RUW A;  4XTY A;  4PFP A;  1LOJ A;  5KYU A;  2P84 A;  3TRE A;  3KUF A;  4C92 D;  4OVA A;  4HT9 A;  1UHC A;  4FCY A;  2EQU A;  1BU1 A;  1OU8 A;  3EFR A;  2EGA A;  4XTX A;  2HQE A;  3N5B B;  2DKG A;  1Y07 A;  1OYX A;  2EW3 A;  2K3X A;  5CK9 A;  5GAM g;  1R77 A;  4GY5 A;  2L3P A;  3QJY A;  2A0F B;  5CQX A;  1JXO A;  4M75 D;  1VYU A;  3E1S A;  1VQK A;  1CKA A;  2WSF E;  3EFO B;  4O6J A;  1S72 Q;  4HXJ A;  2K5L A;  1X2K A;  3OW2 P;  2QA4 Q;  1D0X A;  1TSF A;  2YRV A;  2LT1 A;  2KSS A;  2V1Q A;  3CXC S;  3RNJ A;  2CT4 A;  2KNB B;  3L2R A;  3X28 B;  2KRN A;  3DB4 A;  2O88 A;  3EHQ A;  2L5Q A;  1KC8 C;  1ACM B;  5I2S A;  1YHQ T;  2VAS A;  1YJN A;  1AHJ B;  4FM4 B;  3L2Z A;  2HDA A;  4BY6 C;  2GNC A;  3RUX A;  2YRC A;  5C0M A;  2V26 A;  3JCM d;  1HD3 A;  4OMN A;  3OYG A;  2O01 E;  1NLO C;  2FL7 A;  2QYZ A;  2RHU A;  3OYL A;  2RMO A;  3CXC A;  3C4S A;  3E19 A;  5DY9 A;  2RI3 A;  2PQW A;  2W0Z A;  3JB9 I;  1D1B A;  4BDY A;  4B9W A;  3ER0 A;  3SWN A;  2QI2 A;  1M1K U;  1K8A U;  1IO6 A;  2V8I A;  4N4I A;  1M3C A;  2DTI A;  2K2M A;  2FPF A;  4WF2 A;  3CBP A;  2X35 A;  3E9F A;  3C94 A;  3VYG A;  2ENM A;  2BZX A;  4MZM A;  1WNL A;  3GF5 A;  4BI4 A;  3UDC A;  3VJP A;  3G1J A;  1VQ4 A;  1PCX A;  1I07 A;  2DF6 A;  2DBK A;  2CP2 A;  4ZTF A;  2HBP A;  1UB4 A;  4FW2 A;  4DBQ A;  1UEC A;  2P4T A;  1U06 A;  4GBQ A;  3ME9 A;  4XTW A;  3RDV A;  3TVT A;  1YBY A;  3M54 A;  3QJ6 A;  4OB0 B;  1FX7 A;  1U1T A;  1YIJ T;  4J9E A;  2E3I A;  2KGT A;  4E7I A;  2E41 A;  1ZHI A;  1ABO A;  3CCS A;  2I2L A;  2L0A A;  4X9D A;  3JCM h;  3SFM A;  3CCQ T;  1SF9 A;  2RHI A;  3QII A;  2F2W A;  3MEV A;  3NTK A;  1E6H A;  2JN0 A;  4BAC A;  2FVU A;  2CH4 A;  3MP1 A;  3M55 A;  1VQO Q;  1VQM Q;  5LJ5 g;  3M58 A;  1ZUY A;  2AK5 A;  2RK1 A;  3OYD A;  3OSS C;  3RER A;  1K9M U;  2D0N A;  4JRI A;  4PJN A;  1H3Z A;  2FB7 A;  4M77 A;  5GAO l;  3A98 A;  1W2B A;  2QQR A;  4C8Q E;  4UC4 A;  3GPL A;  3G71 T;  4HCK A;  2P0P A;  2V8K A;  1OEB A;  4XTU A;  2FO0 A;  1YWP A;  4RTT A;  2O9V A;  2HSE B;  3GNG A;  5FU6 C;  3L42 A;  1OZ3 A;  2EIF A;  4ZN3 A;  2VVK A;  1TXQ A;  2RHX A;  3L2W A;  2HAX A;  2JS2 A;  1NJI R;  2X51 A;  4PFO A;  3LW5 E;  2PVD B;  3INZ A;  2KXD A;  4M7A G;  3QWX X;  2EJ9 A;  1K9M R;  3ZBD A;  3P8H A;  2BE9 B;  4BD3 A;  4M7A B;  1SPK A;  3A5Z B;  4QKU A;  1H8K A;  1TUC A;  2QAS A;  3PTA A;  2AKL A;  4N4H A;  1VQ5 T;  2YUP A;  1VQ8 A;  1SHG A;  2BTT A;  1QCO A;  4E7K A;  4M75 A;  2LVM A;  3EG0 A;  4E7H A;  2ZPF B;  4BB7 A;  2YT6 A;  5L23 A;  2KEA A;  2OI3 A;  2JNG A;  2RHY A;  3GOX A;  3M4Y A;  1CSK A;  1K73 C;  1K9M C;  2MF2 A;  1VQ5 Q;  3CPF A;  2DBM A;  1WXB A;  2QG9 B;  4QT7 A;  4Q5W A;  5GAN d;  3RBB B;  2LQW A;  1Q82 U;  1K9A A;  2QDL A;  7AT1 B;  1JB0 E;  3BW1 A;  4JRK A;  4D6W A;  4M77 G;  4M4Z A;  1GL5 A;  1GCQ A;  4ZN1 A;  4NL3 A;  4RTV A;  4FU6 A;  4C92 G;  5LJ3 h;  1RAA B;  1Z9Z A;  4M75 C;  1WX6 A;  4C8Q C;  4ZGE B;  3L1A A;  5GAN e;  4KGX B;  2H3E B;  4PKC C;  1Y96 B;  3VUZ A;  4R55 A;  2HNI A;  4M75 B;  3CCU T;  1O75 A;  1JXM A;  1U5S A;  4XU2 A;  1VQ9 Q;  5M9O A;  4LUE A;  3V8L A;  2JTM A;  1KJW A;  3OB9 A;  1YCS B;  3CCM Q;  3FJP A;  1WHG A;  2XDB A;  3UA7 A;  2C06 A;  1UTI A;  3V7R A;  1FYN A;  5FRN A;  4Z88 A;  1PHT A;  1MMD A;  3G7Z A;  3CCQ Q;  1WJQ A;  3MKD A;  1KFZ A;  4Y92 A;  1QP3 A;  1S1N A;  2RJD A;  4M7D F;  2DJQ A;  1KQS P;  1PM3 A;  1G5V A;  1YHQ A;  2X4J A;  2EGE A;  1ZA2 B;  2DE0 X;  1UJY A;  2HD0 A;  1SRL A;  3V8K A;  1VQN T;  2J7I A;  2CS7 A;  4J7I A;  4J6X A;  1M9S A;  1D1C A;  3S3N A;  2DL7 A;  1BIB A;  2K79 A;  4FYW B;  3G71 Q;  4J9G A;  4KUI A;  1VQK T;  4M7A C;  5CIU A;  4PLL A;  4FSX A;  4RTX A;  2KVQ G;  3PFS A;  1TUD A;  3TQ7 P;  1RAH B;  3M0R A;  1XJW B;  1YNZ A;  2ATC B;  2BIV A;  3EHR A;  3CXC P;  2DRM A;  2D0Q B;  1FMW A;  4R56 A;  1K8A R;  4C92 A;  4NL2 A;  3CCV Q;  4OB3 B;  2DMO A;  1VQO T;  2PZ1 A;  4FW1 A;  2ABL A;  3VRZ A;  2DK3 A;  1BBZ A;  2VYT A;  4N0A A;  2RI5 A;  1M5Q 1;  2L3R A;  1IB8 A;  2QEX Q;  2YSQ A;  4MZT A;  3JB9 H;  1KQ2 A;  3KBG A;  5DM7 R;  2E5K A;  2PUO B;  3SB2 A;  1K73 U;  2C0O A;  2XU8 A;  4M77 B;  3NPF A;  4M7D G;  1YJW T;  1I81 A;  2X9H A;  4VUB A;  5FRO A;  4ZGD B;  3WVD B;  1NYG A;  4XTV A;  2SEM A;  2MYS A;  3MHX A;  1G3W A;  4E7L A;  3UF4 A;  4J9D A;  3HRT A;  4A4G A;  5KCH A;  3JV3 A;  4F04 B;  4KRT A;  2DL8 A;  5GAM j;  2YXY A;  2M0O A;  2A36 A;  2EQM A;  2NWM A;  4M7A D;  1JEG A;  4HT8 A;  3A8M B;  5FLX E;  4PJM A;  1S72 T;  1CKB A;  4PFZ A;  3G6E Q;  3QUI A;  3BDL A;  3GP8 A;  3HRS A;  1QKW A;  3FRN A;  5J39 A;  1VIE A;  3EG1 A;  1X75 C;  2D8J A;  3G4S A;  1BKB A;  4PJO E;  4O5V A;  2MCN A;  2EYQ A;  4KBM B;  2DRK A;  2EPD A;  4LDV A;  1D09 B;  1F1B B;  4J9B A;  1YI2 Q;  3GLX A;  2HSP A;  5GAN 4;  4M77 C;  2OTJ A;  4LD9 K;  3QPH A;  1D1A A;  3GBQ A;  4OF1 A;  1BCM A;  3NTH A;  5IT9 E;  1PSE A;  5KCO A;  4JZ3 A;  4HA8 A;  1W6X A;  3I55 A;  3MEA A;  1WHL A;  1W2B P;  1B3Q A;  3JCM b;  3X25 B;  3R6N A;  3CPW A;  1M1G A;  3VYH B;  2GBQ A;  4KUL A;  1YHQ Q;  1VQ7 Q;  2EGC A;  3M5A A;  2DD5 A;  1UGS B;  1VOM A;  1VQ5 A;  3AT1 B;  2I0N A;  2J6K A;  4PJL A;  1I4K 1;  1VYT A;  2LCC A;  2DEU A;  3EG9 B;  2DVE A;  2IIM A;  5EG2 A;  4AG2 C;  4FL6 A;  3EGD B;  3CCM A;  1TUG B;  2ZPG B;  4KH0 B;  1NJI U;  1ZSG A;  3H8Z A;  3M0T A;  1VQ7 T;  3RMS A;  2CT3 A;  2M51 A;  3H41 A;  3HSB A;  1QLY A;  3VU3 C;  2E12 A;  2XDD A;  2A3L A;  2O4X B;  3CC4 T;  1LCK A;  4PJO G;  5GAO q;  1AZG B;  1VIF A;  2COY A;  3OYJ A;  1KQ1 A;  2H3J A;  3NFC A;  1ZBX A;  3NTI A;  2M0Y A;  3CMA T;  3JB9 G;  1QCN A;  1I0C A;  1O9S A;  4TVR A;  3EGX A;  2L3S A;  1UUE A;  4FIB A;  2M9U A;  4DA4 A;  1YIT T;  4PJO C;  3M53 A;  4J9I A;  1YI2 A;  1HXD A;  1PKT A;  4F7U G;  4M7D B;  3G6E T;  3VS2 A;  4EMK C;  1VQL T;  2YHT A;  1Q86 C;  5IHN A;  1OZ2 A;  1NPP A;  3THK A;  1QVG P;  3I56 T;  2DO3 A;  2YUN A;  3V7C A;  2EFI A;  5LJ5 e;  3EH2 A;  2Y4X A;  3MET A;  1GCP A;  1WJR A;  1VQP T;  2LX9 A;  1OV3 A;  2CP7 A;  2VB6 A;  1TH7 A;  5I2M A;  5LJ3 d;  8ATC B;  2DIQ A;  4BE2 A;  2DYB A;  2VWF A;  2VXF A;  3CC2 Q;  2P4R A;  2RD1 A;  1SSF A;  1VQ4 T;  2QEX T;  2X3W D;  2MAM A;  2FPE A;  1YCY A;  3HL8 A;  1B07 A;  2VV5 A;  4NOY A;  1VQ6 A;  1PNJ A;  1YJ9 A;  5GAO n;  5GAM h;  3S3M A;  2FZK B;  1V76 A;  4AFS C;  3EGX B;  1QP2 A;  1WIE A;  4AFQ C;  3CCV T;  4XU1 A;  3OMG A;  3C12 A;  2DL3 A;  2YWW A;  5GMK e;  1QWF A;  2FRY A;  2F5K A;  2DIL A;  3JCM Q;  3UA6 A;  2LRQ A;  2X4Y A;  3CCL T;  2LCS A;  5IH2 A;  3C0C A;  2XIC A;  1DJ7 B;  4RG2 A;  3M0P A;  4EIK A;  1PWT A;  3X24 B;  3ZFJ A;  4KT0 E;  1M1F A;  2DL4 A;  3VV0 A;  1RAD B;  3I35 A;  1Q82 C;  4PJO A;  4PJO D;  3TEE A;  2K6D A;  3OYY A;  5GAO p;  1X6G A;  4E7Z A;  2RB6 A;  1G3T A;  1MGQ A;  2CSI A;  2OTL A;  1QVF A;  2KT1 A;  4C8Q F;  1SRM A;  5GAN 8;  3SD4 A;  5KYX B;  3PVQ A;  4IUP A;  1YJN T;  3JCM c;  2CP0 A;  1VQN Q;  4IUU A;  3UAT A;  4C92 F;  3VS1 A;  3WVE B;  5FU6 B;  3RMQ A;  4HCZ A;  4JUV A;  5LJ3 e;  4JRP A;  4Z02 A;  2LCL A;  2QK0 A;  5GMK h;  1H92 A;  2EAY A;  2KRM A;  2XDP A;  2YUQ A;  2DNU A;  2GTJ A;  1Y71 A;  1AVZ C;  2IG0 A;  1ZQ1 A;  4F7U B;  1FMK A;  2CZ0 B;  2RQU A;  4QQG A;  2J6F A;  3SWN C;  3OYK A;  5GAM d;  4FT2 A;  2K3B A;  2QGF B;  5GAO r;  1Q81 C;  2K7A A;  2EJG A;  2NUT B;  2RQW A;  1ZSZ A;  1VQL A;  4JJC A;  4OML A;  1NJI C;  2BE7 D;  5CKB A;  1H3H A;  1BK2 A;  1N9R A;  1RAC B;  4LUD A;  2BZY A;  4ELY C;  4E7J A;  3JB9 F;  3CMA A;  4AT1 B;  4HCC A;  2LJ0 A;  3H0H A;  3P8B B;  1IXD A;  2LC4 A;  3GIB A;  4M78 A;  4AFU C;  2HZY A;  3LGL A;  5DLQ E;  2CZ7 B;  4FYV B;  2ROL A;  1VQ7 A;  2X4X A;  1UJ0 A;  4B6M A;  4CC7 A;  4OGC A;  1J3T A;  1R0B G;  2JOY A;  1M1K C;  1TWB A;  1OX8 A;  2LNH B;  3H0F A;  5J3B A;  3CQT A;  1OI1 A;  1MMA A;  2QTX A;  3PMT A;  2CP3 A;  5CKE A;  5LL6 S;  4OP0 A;  4M7D D;  2VUB A;  4F16 A;  4ATO A;  3U23 A;  1PD1 A;  1PSF A; 
#chains in the Genus database with same CATH homology
 4F7U F;  3CCE T;  3GNF B;  3I55 T;  4DOW A;  4C0G A;  3ASK A;  4A4H A;  2ZZD A;  3A8O B;  3OYN A;  2RO0 A;  4XU0 A;  4XU3 A;  4KUI A;  2E10 A;  2DXT A;  3TCJ A;  1VQK T;  4M7A C;  3SDZ A;  3ZEH A;  5CIU A;  4F7U E;  3J81 E;  4IKF A;  1P92 A;  2PUK B;  4PLL A;  2EJF A;  3TU4 K;  4FSX A;  4B9X A;  5CAI A;  4CI0 C;  1UGQ B;  2K5I A;  3F70 A;  2KVQ G;  3PFS A;  2CKK A;  3HP9 A;  2PVG B;  5LJ5 f;  1KQS S;  1N6A A;  3LGF A;  5DLO A;  2WSE E;  1M90 C;  3O8V A;  1R8O B;  3CCE A;  2K3Y A;  2BIV A;  4EDU A;  1KQS A;  4MMK A;  2D0Q B;  2K5F A;  2LDM A;  3G4S T;  4R56 A;  4MML A;  4C92 A;  4NL2 A;  4OB3 B;  2XD0 A;  1RL2 A;  3OYE A;  2E6N A;  3JCM f;  1VQO T;  3L2V A;  3Q1J A;  1IRE B;  4M7D E;  1JBM A;  2DK3 A;  1W2B S;  3A8G B;  1I8F A;  5LJ5 d;  1HK9 A;  2VYT A;  3HFO A;  4N0A A;  4DOV A;  1QVF S;  2XK0 A;  2RI5 A;  3QKJ A;  2GCX A;  1M5Q 1;  2L3R A;  4X34 A;  3RKX A;  1S72 A;  4X9C A;  3LLR A;  4MZT A;  3JB9 H;  4M78 C;  1KQ2 A;  1VQM T;  2A7Y A;  2R5M A;  3KBG A;  4YTL A;  3A8H B;  5GAN h;  3BDU A;  1VQ9 A;  5DM7 R;  2KQW A;  2ZPI B;  3CC2 A;  2CZ1 B;  2PUO B;  3QG1 A;  2XI9 A;  1M4Z A;  4EMH A;  3SB2 A;  2NLU A;  3DLL A;  1K73 U;  3UPU A;  4LDW A;  5HK3 A;  1M90 U;  4BAC A;  3P8D A;  1N27 A;  2XU8 A;  4M77 B;  5LJ3 f;  4M7D G;  2R58 A;  3MP6 A;  1KG1 A;  2KK4 A;  1YJW T;  1I81 A;  4VUB A;  4GLK A;  3RES A;  5FRO A;  3UT1 A;  4C8Q A;  4ZGD B;  3OS1 A;  1I5L A;  3WVD B;  4EMK B;  5GMK l;  1BI1 A;  3PNW C;  4XTV A;  2E70 A;  4ZTJ A;  5GAN 6;  3MHX A;  4L5G A;  5C6S A;  1G3W A;  4C0D C;  5GAN 7;  1U8R A;  4RMO A;  2RH2 A;  3RIR A;  4E7L A;  4PJO F;  3HRT A;  3JSC A;  3OYB A;  3CCU A;  3VKI A;  4J6W A;  2RA2 A;  4A4G A;  1D3B B;  5KCH A;  1W4S A;  1YJW A;  3PMI A;  3CBO A;  2JZ2 A;  3M59 A;  2QQB A;  1Y7X A;  3HHT B;  4QQ6 A;  3CBM A;  3OS0 A;  3KXT A;  4JS4 A;  2VGN A;  5GAM e;  5GAM j;  4N0A C;  2WAC A;  4BY6 B;  2M0O A;  2D9T A;  3X26 B;  1GXI E;  2X4W A;  2L89 A;  4QVZ A;  2EQM A;  2QXF A;  3L2U A;  4M7A D;  3MEW A;  4HT8 A;  2OAU A;  4J83 A;  3BFM A;  2GF7 A;  1UEB A;  3PGG A;  4XTY A;  3A8M B;  5FLX E;  1LOJ A;  1U1S A;  1S72 T;  3MEU A;  3QUI A;  5FU7 B;  3TRE A;  3KUF A;  3BDL A;  4OVA A;  4C92 D;  4HT9 A;  3GP8 A;  3HRS A;  2JVV A;  3FRN A;  3OY9 A;  2EQU A;  5J39 A;  3DB3 A;  3JCM V;  3JCM e;  4L6V 5;  5HK0 A;  3EFR A;  3LH0 A;  4LD6 A;  5GMK i;  2YLC A;  1VIE A;  2KAF A;  4XTX A;  1X75 C;  3V8J A;  3G4S A;  1BKB A;  2DXB A;  4O5V A;  4PJO E;  1WQW A;  2EYQ A;  2HQE A;  4M7A F;  1BI2 A;  3N5B B;  2ZCF B;  2DKG A;  3C95 A;  4KBM B;  1Y07 A;  3S6W A;  1OYX A;  3OYC A;  1XTD A;  5CVI A;  4LDV A;  3CCJ T;  1QVG S;  4EMG A;  4A4K A;  2K3X A;  5A0G A;  1G3S A;  5CK9 A;  3AHU A;  5GAM g;  3GLX A;  4GY5 A;  4M75 F;  5GAN 4;  4M77 C;  2OTJ A;  5KE2 A;  4LD9 K;  3QJY A;  3QPH A;  5CQX A;  4M75 D;  4OF1 A;  3E1S A;  1VQK A;  3NTH A;  4EMK A;  1EIF A;  3LWH A;  2WSF E;  1PSE A;  5KCO A;  5IT9 E;  1LJO A;  4HA8 A;  4O6J A;  4PLI A;  3MEA A;  3I55 A;  4XTZ A;  2K5L A;  4M7D C;  3JCM b;  3X25 B;  3MCA B;  4M78 B;  2DJZ A;  3JCM g;  3CPW A;  3JB9 D;  2Y90 A;  1M1G A;  2YRV A;  4PNO A;  4MDW A;  4HCB A;  2D6F A;  2LT1 A;  2KSS A;  3FLG A;  3VYH B;  4PJO B;  4KUL A;  2KY9 A;  1XNI A;  3M5A A;  3OBW A;  4M77 D;  5GMK m;  3CXC S;  2DD5 A;  1UGS B;  4V2S A;  3L2R A;  3CC7 A;  1VQ5 A;  1LNX A;  1QW1 A;  3VUB A;  1VQN A;  3X28 B;  4JLI A;  3DB4 A;  2DEQ A;  3OS5 A;  1Q7Y C;  2YLB A;  2L5Q A;  1KC8 C;  4IUQ A;  5CKF A;  5I2S A;  5GAN f;  3QDR B;  2CGH A;  1I4K 1;  2RI2 A;  2LCC A;  1YHQ T;  1YJN A;  1N9S A;  1AHJ B;  2DVE A;  4FM4 B;  5EG2 A;  3L2Z A;  4FL6 A;  2JUF A;  4QVD A;  2QA4 T;  2DTH A;  4BY6 C;  3WXM B;  4C5G A;  3CCM A;  3QBY A;  2ZPG B;  5FU7 C;  2ZPE B;  2Y4Y A;  1B34 B;  3RUX A;  5C0M A;  2LT4 A;  4C0F A;  2DXU A;  3JCM d;  1NJI U;  4A53 A;  3H8Z A;  3OYG A;  2PU9 B;  2O01 E;  2QDY B;  1VQ7 T;  4BI8 B;  5D6Y A;  2FL7 A;  2RHU A;  3RMS A;  3OYL A;  3J80 E;  2B8A A;  3HSB A;  3CCR T;  3VU3 C;  4RKU E;  2E12 A;  4C92 C;  2XDD A;  3CXC A;  3RKW A;  2A3L A;  3C4S A;  2LQ8 A;  2O4X B;  3E19 A;  2G3R A;  5GAN 2;  3CC4 T;  2VXE A;  4DQ2 A;  5DY9 A;  4PJO G;  5GAO q;  2RI3 A;  1VIF A;  2PQW A;  4OGE A;  4C92 B;  5CKD A;  4C8Q G;  3JB9 I;  1KQ1 A;  5HY6 A;  4E47 A;  3OYJ A;  1N8R C;  2BUD A;  4JRQ A;  2E64 A;  4II1 A;  2H3J A;  4B9W A;  3LYI A;  3NFC A;  4BDY A;  3CCL A;  3ER0 A;  3SWN A;  1ZBX A;  4C0D B;  3NTI A;  2QI2 A;  3CMA T;  3JB9 G;  1M1K U;  1K8A U;  4QW2 A;  1O9S A;  2V8I A;  4M75 E;  4N4I A;  1XQH A;  3M57 A;  4TVR A;  4M78 F;  4FIB A;  1IZ6 A;  2DTI A;  3FEO A;  3CME A;  4IUV A;  3CCV A;  4WF2 A;  4J6Y A;  3CBP A;  2M9U A;  2X35 A;  4DA4 A;  3E9F A;  1YIT T;  3C94 A;  2M16 A;  3M53 A;  4PJO C;  3VYG A;  4MZM A;  4JDS A;  1YI2 A;  1YJ9 T;  4A54 A;  1HXD A;  1WNL A;  1N8R U;  3GF5 A;  4BI4 A;  3JAM E;  3CCQ A;  4F7U G;  3UDC A;  4M7D B;  3G6E T;  2DD4 A;  3VJP A;  4EMK C;  1VQL T;  2YHT A;  4IUR A;  2QEX A;  4MDX A;  4BDZ A;  1VQ4 A;  3H6Z A;  1Q86 C;  4MZP A;  3S3O A;  1OZ2 A;  2E65 A;  1NPP A;  3E9G A;  2V8J A;  1JRI A;  3EFS A;  3FB9 A;  3I56 T;  4BE0 A;  4M78 E;  2KDS A;  2DO3 A;  4ZTF A;  4IUT A;  3V7C A;  2HBP A;  1M8V A;  1UB4 A;  5AYF A;  3HPW A;  4XK8 E;  5GAN 5;  3MO8 A;  2EFI A;  2MWP A;  5LJ3 g;  5LJ5 j;  4M75 G;  2RM4 A;  2Y4X A;  3MET A;  4ME7 A;  5LJ5 e;  2P4T A;  1WJR A;  1VQP T;  2LX9 A;  1WGS A;  4RCB A;  2QQA A;  3JCM J;  1H64 1;  2K2V A;  3DLM A;  1TH7 A;  3ME9 A;  4XTW A;  4ZGJ B;  1NE8 A;  3RKY A;  1YBY A;  3M54 A;  5I2M A;  1NZ9 A;  3QJ6 A;  4OB0 B;  5LJ3 d;  2DIQ A;  2GFU A;  1KD1 U;  1FX7 A;  4BE2 A;  2GQV A;  1U1T A;  2LNV A;  2DAQ A;  1YIJ T;  4C0Z A;  3I56 A;  3HRU A;  4E7I A;  4J8O A;  2E41 A;  1ZHI A;  2VXF A;  3CCS A;  2I2L A;  3L2Q A;  2RD1 A;  1SSF A;  1VQ4 T;  4X9D A;  2QEX T;  3OA6 A;  5J26 A;  3JCM P;  2MAM A;  1VQ8 T;  3JCM X;  1YCY A;  2LQK A;  3HL8 A;  2M1H A;  3JCM h;  3SFM A;  2VV5 A;  3CCQ T;  2MMP A;  2DZ9 A;  2RHI A;  3QII A;  4NOY A;  1VQ6 A;  1YJ9 A;  3MEV A;  1YI2 T;  3NTK A;  2JN0 A;  3DKM A;  2JTF A;  2R5A A;  2FVU A;  3OBY A;  4M78 D;  3MP1 A;  4QVC A;  5GAM h;  3M55 A;  5GAO n;  4Y28 E;  3S3M A;  1YIT A;  4P5N A;  1QP2 A;  1RI0 A;  3OYM A;  3QO3 A;  3CCV T;  4XU1 A;  4C5H A;  2RJC A;  2KMT A;  5LJ5 g;  3M56 A;  3OMG A;  3C12 A;  3M58 A;  2HQX A;  4BI3 A;  5GMK e;  5GMK j;  3EAE A;  3CPW S;  2K57 A;  3OYH A;  2RK1 A;  2F5K A;  4PL6 A;  3OSS C;  4C92 E;  3OYD A;  1D3B A;  1WJS A;  1KD1 C;  1K9M U;  3JCM Q;  2K4Y A;  4JRI A;  3CD6 A;  4M7A E;  4XQ3 A;  3LX7 A;  4RG8 A;  2OTL T;  4A4F A;  2LRQ A;  4N4G A;  2X4Y A;  3CCL T;  1PSF A;  1H3Z A;  2QQ9 A;  5GAO m;  3RER A;  5D6W A;  2FB7 A;  1XOV A;  4M77 A;  5GAO l;  2EKO A;  2IVW A;  1W2B A;  1Q7Y U;  2XIC A;  1DJ7 B;  3FDR A;  4RG2 A;  2QQR A;  4C8Q E;  4UC4 A;  3X24 B;  2DIG A;  2WSC E;  3ZFJ A;  4LDU A;  3GPL A;  4KT0 E;  1UGP B;  3G71 T;  1M1F A;  2P0P A;  2V8K A;  2E5Q A;  1WPY A;  4M78 G;  4XTU A;  3VV0 A;  3G71 A;  4BE1 A;  1Q82 C;  5GAN 3;  1Q81 U;  4M7A A;  2VGM A;  3GNG A;  3TEE A;  4PJO A;  3L42 A;  3OYY A;  5FU6 C;  4PJO D;  1OZ3 A;  2EIF A;  4ZN3 A;  5GAO p;  2RHX A;  3L2W A;  2RB6 A;  2HAX A;  1G3T A;  1KHI A;  2CYZ B;  3QZ9 B;  5CCA A;  5IAY A;  1MGQ A;  1UGR B;  4M77 E;  2MI6 A;  4LDX A;  3BY7 A;  2OTL A;  2XKO C;  1QVF A;  3LW5 E;  2PVD B;  4C8Q F;  3CD6 T;  4C8Q B;  1FXX A;  3INZ A;  3HKS A;  4C5E A;  5GAN 8;  4EPC A;  4M7A G;  2QA4 A;  3SD4 A;  2EJ9 A;  4LDY A;  4IUP A;  1YJN T;  3ZBD A;  3P8H A;  2DTO A;  3JCM c;  3OS2 A;  1Q86 U;  1FWZ A;  1G3Y A;  3MP8 A;  2BKD N;  3QZ5 B;  4BD3 A;  4M7A B;  3A5Z B;  3PTA A;  4IUU A;  2E6Z A;  5A0L A;  3OYI A;  1VQ6 T;  5KH6 A;  4C92 F;  3WVE B;  2F5T X;  4N4H A;  5IN1 A;  1VQ5 T;  5FU6 B;  3RMQ A;  1VQ8 A;  2FYK A;  3CC7 T;  1JJ2 S;  1MHN A;  2RJE A;  4CRI A;  4E7K A;  4HCZ A;  4JUV A;  4M75 A;  2LVM A;  5LJ3 e;  1VUB A;  5LJ3 j;  3CCS T;  4JRP A;  4E7H A;  4Z02 A;  3OQ5 A;  2ZPF B;  4BB7 A;  2LCL A;  1YIJ A;  4NS5 A;  2O4X A;  5GMK h;  2EAY A;  2XDP A;  5I21 A;  1WQ7 A;  3R6O A;  1Y71 A;  2JNG A;  3OW2 S;  2RHY A;  3GOX A;  1BIA A;  3M4Y A;  1BI3 A;  2DPP B;  2IG0 A;  1K73 C;  1ZQ1 A;  4QQD A;  2MF2 A;  4F7U B;  1K9M C;  1KHC A;  2DZC A;  2EWN A;  4J5Y A;  2XG8 D;  3CPF A;  2R57 A;  3PIO A;  1VQP A;  4F7U A;  2CZ0 B;  2OTJ T;  3FIF A;  4QQG A;  3SWN C;  1JJ2 A;  3OYK A;  2EQK A;  2RJF A;  5GAM d;  3CCJ A;  2RK2 A;  3QSU A;  4Q5W A;  5GAN d;  2MWO A;  4FT2 A;  3X20 B;  4Y91 A;  4JLG A;  5GAO r;  1Q81 C;  1Q82 U;  2EJG A;  3JCM W;  2PVO B;  4FT4 A;  3JRZ A;  1JB0 E;  3BW1 A;  1VQL A;  4KUD K;  4JRK A;  4D6W A;  3G6E A;  1NJI C;  2P0Q A;  3QYG B;  4OB1 B;  4M77 G;  3UWN A;  5A0D A;  3JB9 J;  4ZN1 A;  1QVP A;  5CKB A;  2E1H A;  4NL3 A;  4BUG A;  1N9R A;  4FU6 A;  4C92 G;  3URG A;  5CQY A;  5LJ3 h;  3J7A F;  2RHZ A;  2DXC A;  4ELY C;  3CME T;  4M75 C;  4J7F A;  4E7J A;  2XHC A;  1KC8 U;  3JB9 F;  3PIP A;  4C8Q C;  1B34 A;  4ZGE B;  2FHD A;  3L1A A;  2EQJ A;  5GAN e;  5GAN j;  3CMA A;  1V29 B;  1Y96 A;  4PKC C;  5GAM f;  3QXE B;  5GAN g;  1Y96 B;  5A2Q E;  5LJ5 h;  4HCC A;  4M7D A;  3VUZ A;  3OYA A;  3P8B B;  4R55 A;  5CO7 A;  2HNI A;  1NPR A;  4L59 A;  4M75 B;  2LC4 A;  4ELZ C;  3OYF A;  3GIB A;  3CCU T;  1O75 A;  1X01 A;  2LTO A;  4XU2 A;  5M9O A;  5CR2 A;  4M78 A;  5HKC A;  3CC4 A;  3V7S A;  2JTM A;  4OMF B;  3V8L A;  3OB9 A;  3LGL A;  2P0K A;  5DLQ E;  3FJP A;  4C5I A;  2XDB A;  3CCR A;  2CZ7 B;  2C06 A;  2CZ6 B;  3V7R A;  5FRN A;  1VQ7 A;  2X4X A;  4OB2 B;  5KE3 A;  2XID A;  1BYM A;  3HFN A;  2ZPH B;  2F69 A;  3G7Z A;  1WJQ A;  2L8D A;  3M4G A;  3FC3 A;  1X6O A;  1QP3 A;  4OGC A;  2AHJ B;  2RJD A;  4M7D F;  3CCM T;  3CC2 T;  2JOY A;  5L8R E;  1K8A C;  1G5V A;  1M1K C;  2ZPB B;  1QVG A;  1VQ9 T;  1YHQ A;  3OSV A;  2X4J A;  1VQM A;  3M9Q A;  2QQS A;  4A4E A;  5FRM A;  5J3B A;  2HD0 A;  4M77 F;  3T9N A;  2VC8 A;  4JS5 A;  5CKH A;  3V8K A;  3LWI A;  1OI1 A;  4C8Q D;  3A8L B;  3QHS A;  2QTX A;  1VQN T;  4RCC A;  3PMT A;  3SWN B;  1VQO A;  5CKE A;  5LL6 S;  2CS7 A;  4J7I A;  4HKE A;  1BI0 A;  3CEY A;  4J6X A;  1M9S A;  4OP0 A;  4M7D D;  2VUB A;  3PT9 A;  4XAX B;  4JJN K;  2GFA A;  3QYH B;  3S3N A;  5D6X A;  4ATO A;  3OW2 A;  3OMC A;  2ZGW A;  1BIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...