3JCMX

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
70
Chain Sequence
MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINANNHQLGTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 7
structure length 70
sequence length 76
chains with identical sequence a
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmX00
5GAN5 1Y96B 4M7AE 1BIAA 2E64A 2YLCA 4M77C 4XTUA 4C92B 2YHTA 4M75E 1JBMA 2E41A 5GANh 5GANd 4XTVA 4M77A 3JCMW 2QTXA 2VXEA 4J6WA 4OP0A 5GAN8 3V8KA 3V7SA 5GAOm 5GMKe 1N9RA 3HFOA 5GAMg 4N0AC 5GAOn 4NL3A 4XU0A 4PJOC 5GAN7 2DEQA 4N0AA 4PJOE 4PJOA 3L2ZA 4M77F 4XTXA 3PGGA 4J6YA 5LJ3d 5LJ3h 1M5Q1 5LJ5f 5LJ5e 4M7DB 1B34A 3JCMc 5GMKl 4M7DD 3JCMX 3JCMh 2RM4A 2DVEA 3JCMV 4XTZA 2CGHA 2DTIA 4J5YA 4PNOA 4EMKB 5GAOp 3QO3A 2YLBA 3VU3C 4C8QG 3RIRA 1I5LA 1M8VA 5GAN3 3RERA 4Y91A 3RESA 5GAMf 5GAMe 4M7AC 4C8QA 2E65A 2Y90A 3BFMA 4HA8A 4M77G 4M75C 4M7AA 4NOYA 1WQWA 4C92D 4M75A 2EJFA 3FJPA 2DZCA 3SB2A 2HNIA 5GAN2 4WF2A 1H641 4JRKA 1HK9A 4RCBA 5GANj 4HT9A 4M78B 4M7DE 1X01A 2RB6A 4M78D 5LJ5d 3V8LA 4PJOG 4C8QF 4XU2A 4F7UB 4M7AF 3RKXA 4HT8A 1D3BB 4M75F 2DKGA 5GAOl 3EFSA 3EFRA 3FIFA 2FB7A 3HFNA 4DQ2A 5GANg 3BY7A 2E1HA 1LNXA 2DXUA 2FYKA 3SWNB 4C92C 5GAMd 5LJ3j 1Y96A 3V7CA 2K57A 4C92E 3JCMP 4C92A 3JB9F 3JB9J 3FB9A 2DXTA 2DJZA 5GMKi 4XTYA 4PJOF 4JUVA 4M78C 5I21A 4M7AG 2VXFA 1I81A 4M78E 4M75G 3RUXA 5GMKh 4EMGA 5LJ3g 5GAOr 4F7UE 2EAYA 2E10A 3INZA 5GMKj 3JCMg 3GIBA 4QVDA 1I4K1 3V8JA 4M7DC 4XTWA 5GANe 4M77B 3JB9G 4M77D 5GAN6 4A54A 5LJ5h 4M7DA 3V7RA 4QVCA 2DTOA 1YCYA 4EMKC 4XU3A 5LJ5j 2DTHA 4EMKA 5GAOq 1WQ7A 5DY9A 2VC8A 3RKWA 4V2SA 2I2LA 3AHUA 3BDUA 3QSUA 4C92G 4EMHA 5GAMh 4A53A 5GAN4 5LJ3e 3JCMQ 4M7DF 4MMLA 2RA2A 1B34B 1N9SA 3JB9I 5GAMj 2EJ9A 3JCMf 3JCMe 3M4GA 2RD1A 4M78G 3JCMb 4JLIA 4M77E 4NL2A 2DZ9A 4F7UG 3JB9H 4M78A 1WPYA 3QHSA 1KQ1A 1WNLA 4C8QB 4X9CA 4F7UA 1BIBA 4C8QD 4C92F 4M7AB 1I8FA 4J6XA 4M7DG 1D3BA 4M7AD 3BW1A 3RKYA 4M75B 5GMKm 5GANf 2EWNA 3QUIA 1HXDA 4JRIA 4M75D 4RCCA 4X9DA 2EJGA 4XQ3A 2JN0A 3SWNC 5CAIA 1JRIA 3L1AA 3SWNA 4M78F 1MGQA 3HSBA 1KQ2A 4F7UF 3JCMd 1LJOA 3JB9D 1U1SA 4XU1A 1TH7A 4PJOB 3JCMJ 4PJOD 1U1TA 5LJ3f 4C8QC 2ZGWA 4MMKA 4C8QE 1LOJA 5LJ5g
chains in the Genus database with same CATH superfamily
2DBMA 1YWPA 4WTOB 2L0AA 3SD4A 2DL8A 2EIFA 4JRQA 1Q81U 4OMMA 1K0SA 3OW2A 4C0DB 4NL3A 4ANJA 1AWWA 1WIEA 1NBEB 3VYHB 2E12A 1XQHA 4Q5WA 2ESWA 1GRIA 2GTJA 1YITA 1QCFA 4AFZC 3KUFA 2K6DA 3QPHA 2H8HA 2CH4A 1PNJA 2DTIA 4EMKB 5GAOp 1X2QA 2MWPA 3CCMA 2J6KA 2R5AA 3UT1A 1J3TA 3CXCP 3L42A 2DIGA 4C8QF 3CCST 1K8AU 2JS2A 3M55A 2X4JA 4HT8A 1WXBA 2V26A 1GCQC 4AT1B 2JTMA 1XTDA 1VQ8A 2KYBA 1WJQA 1QVGA 4C92A 3QIIA 2KE9A 3CD6T 2KEAA 3OSVA 1I0CA 2OTJT 5KYUA 4KGZB 4M7DC 1R0CB 3DLLA 2EPDA 3TQ7P 1G8XA 4BI4A 2DTOA 1JB0E 2DERA 1YJ9T 3AHUA 3QG1A 1Q7YC 2RA2A 2COZA 1NLOC 2NWMA 3M0UA 5FU6B 4C8QB 1D0YA 1CSKA 4C8QD 4J6XA 1D1BA 2LMJA 3I9QA 5GMKm 3VS2A 3LW5E 2DILA 3O5ZA 2NUTB 1CKAA 3PT9A 2D0NA 1OI1A 3CC7Q 1B07A 2KXCA 2KR3A 4LE9A 1Z9ZA 1FXXA 2PVDB 4KUIA 4M77C 4M75E 1GBQA 4PFOA 1TWBA 2CUDA 3CMAA 4CC7A 2XICA 1YFNA 4HCCA 1E6HA 3MEAA 3J80E 3EH1A 3CCSA 3PGGA 4J6YA 1B34A 4A4FA 4B9WA 2X4XA 1IXDA 2QEXA 2DL7A 3VS1A 5GAN3 2CZ7B 1JJ2A 2JW4A 3CMET 4TVRA 4NOYA 2K5LA 3OYAA 1TUGB 5FLXE 1WXTA 3PIOA 3CD6A 1OOTA 3P8DA 3ULRB 4HXJA 2OTJA 1JXMA 1YBYA 2ZPFB 3RNJA 3GNGA 2RI5A 1T0HA 2KK4A 3EGXA 1B7TA 4DBQA 1YJ9A 2BUDA 3ZFJA 1Y71A 5HK0A 5KYNA 2YRVA 1G2BA 1SHGA 2OJ2A 3G6EQ 4FT4A 5GAN6 2GQVA 5KYYA 1Q86R 2DO3A 1VQ4A 4IUUA 4M7DF 4FYXB 1ZX6A 1M1GA 1VQMT 4OMQA 2A36A 4X9CA 2XD0A 3VS7A 4DBRA 1M9SA 2KAFA 2RH2A 4JRIA 3SWNC 2EJGA 4M78F 3G71Q 2AHJB 3H0HA 5AT1B 3C0CA 4F7UF 4R55A 3CCUQ 1AWJA 1ZSGA 2RK1A 1NEGA 1VQKT 1K9MU 1UB4A 5CQYA 2YLCA 3OYNA 4PKCC 3PMIA 4A63B 1UHCA 1WX6A 1VQ6T 4OP0A 3CMEA 2DPPB 1M1KC 2L3RA 3P8BB 4OMLA 2VASA 2KRSA 4M77F 1PD0A 4M7DB 1S1NA 4M7DD 2DRKA 3JCMh 3JCMV 3MHXA 2CGHA 1IO6A 4Y28E 3I5RA 1D0ZA 3RERA 2YUQA 2NUPA 1NZ9A 3OY9A 2MI6A 2RF0A 4JJNK 4IUPA 1ZSZA 2AT1B 1H641 1VQNQ 4GLKA 4M78B 5LJ5d 4M78D 3V8LA 4PJOG 4F7UB 4BY6C 2RJDA 3GNFB 2E5QA 3H8ZA 2DRMA 3HRSA 1OX8A 4IIOA 4A4EA 4C92C 1SRLA 2ATCB 3JCMP 1G3SA 4C92E 3FB9A 2KROA 3URGA 1ARKA 2VXFA 2LDMA 2FPFA 4M75G 1W2BA 3VRYA 3I56Q 2Y4XA 1OV3A 3VUZA 3Q1JA 1XJWB 2E10A 5GMKj 1I4K1 2R58A 1VQMA 4M77B 4RTTA 4M77D 1YP5A 2F2XA 2GGRA 4LUEA 1PRLC 1TUCA 2EKOA 4HKEA 3A8MB 4MZPA 4Y92A 1Q7YU 5CCAA 3JCMe 3JSCA 1IZ6A 3CC4T 1VQKA 3JRZA 3JB9H 4C5GA 1JO8A 1G3TA 4E7SA 2ROTA 4FM4B 4ORZA 3CPFA 3VRZA 3NPFA 1IHWA 5IHIA 1YIJQ 1X69A 4HVWA 5FROA 3BDLA 3FJ5A 2HZYA 1QKXA 4FT2A 4A4KA 1BI0A 3CCVQ 1TS9A 4ZGJB 2M9UA 3H6ZA 2SEMA 5L23A 4PLIA 3CXCS 3QO3A 2DE0X 2CDTA 2MK5A 2XDDA 4JJDA 4ZGEB 2DIQA 3GP8A 1BKBA 2AKLA 4J9CA 1PD1A 1M90U 3QWYA 1K76A 4DA4A 2LRQA 2QDLA 3UA6A 3H41A 2ABLA 1NEBA 5D6WA 4RMOA 2C0IA 1TOVA 4X1VA 3SWNB 5GAMd 1OYXA 2GCXA 3V7CA 4LDYA 3M4YA 4O6JA 2O31A 1Z9QA 3CCEQ 4DEYA 4J9DA 4E6RA 2CZ6B 3CC4A 1VIFA 2DMOA 3TREA 4B6MA 2XDBA 2J05A 2JXBA 4JZ4A 2RK2A 3LWIA 2MIOA 1UGQB 1YHQT 4MZMA 3VUBA 4C0ZA 1RI0A 3OW2P 4E7JA 4O5VA 1WHGA 5GAN4 4RG8A 1K73R 1RAHB 3OS2A 2LC4A 2PTKA 4F16A 1NE8A 5J39A 2CSQA 4FYWB 1M3AA 3QHSA 1NG2A 4FYYB 4MZTA 4R0KA 3CBOA 1D3BA 3BW1A 3DLMA 2KI7A 2EYXA 1VA7A 2JT4A 3HKSA 3HPWA 3PFSA 1D1CA 1TUDA 3CPWA 3GOXA 1SSHA 4XU1A 1QCOA 1PSEA 3NGPA 1UGSB 4BY6B 2C0OA 2VUBA 2X3XD 2ZPEB 1MV3A 2HQXA 2C06A 3QDRB 2BZXA 4J7FA 4C92B 2XDPA 4Z89A 3THKA 2VXEA 1QVGP 3SDZA 1N9RA 1M1KU 4BI8B 1VOMA 3UA7A 5KYUB 4PJOA 1GFDA 1PM3A 2LQNA 1OZ3A 4XTZA 2BKDN 1KK7A 4Z88A 3HRUA 3OYGA 1I5LA 3QJYA 4BDYA 3CCJT 2A28A 1ZSZC 2ZCFB 2HEQA 4M75A 2EJFA 2LVMA 3SB2A 2DD5A 5HCKA 1WJRA 3OYKA 4XK8E 2W0ZA 2IVWA 4LNPA 3EG3A 4XU2A 4BACA 2VV5A 3EFSA 2FB7A 1X43A 1YHQA 3CBPA 3OYDA 1Y96A 1EFNA 4BE2A 1ZQ1A 3S3MA 1VQ5Q 5I21A 3FC3A 2QG9B 1UGPB 1IREB 2OI3A 2A7YA 3EGDA 3RMSA 2BTTA 1RLPC 1QCNA 1RL2A 2GNCA 1YI2T 1S72T 3PTAA 3CEYA 2HKNA 1NLPC 2QQ9A 3LH0A 4CC3A 3A8OB 1ACMB 4OGEA 4GLMA 1RADB 4A53A 3CCMT 3OQ5A 1B34B 5IH2A 5D7UA 1VQLQ 2KY9A 1M8MA 1VQPT 1X6BA 1OU9A 4JRPA 2KQWA 4OMPA 2D0QB 3VS5A 3HSBA 4DOWA 3CD6Q 4LDXA 3MP8A 2K79A 1VQ7A 2OTJQ 3ZL7C 3JCMJ 1B3QA 5J3BA 2DVJA 2E70A 5GAN5 3EGXB 1XNIA 1JBMA 2EYQA 4GBQA 4LN2A 3CCJA 1UE9A 3V8KA 3HFOA 5GAN7 1RAEB 1YCSB 4HVUA 2MMPA 1X75C 2PQWA 3NFCA 3EHQA 5DLOA 1WDXA 5KYYB 3CC2T 5CR2A 3LGFA 5CIUA 2VB6A 4DEXA 2QA4Q 4KH0B 1LCKA 2EYWA 1NJIU 3I35A 4DBHA 1X01A 2RB6A 3QWXX 1AOJA 4OB1B 5GJWB 2QQRA 3VKIA 1KD1R 1UECA 1YI2A 4E47A 1S72A 4N4GA 1M30A 2HD0A 3HTRA 1SEMA 4KGXB 3EG0A 2QAZA 4VUBA 1C1AA 4AFUC 2G3RA 1IGUA 3D7SB 3L2UA 2QQAA 1QWFA 1ZHIA 3CMAT 2QK0A 2DL3A 4FSSA 1VQPA 2J6FA 3LH5A 2HMAA 3T9NA 2GF7A 4LD6A 4OMFB 3V7RA 3OYFA 1G3YA 1BBZA 1GBRA 1Q86C 1TSFA 3CMEQ 2RQWA 1NYFA 4FYVB 2DX1A 4PJNA 2QEXT 3E9FA 2COWA 1N9SA 3M4GA 1YJNQ 1R77A 2VGMA 4QW2A 1UJYA 1Y7XA 2AIRB 4LDVA 2OTLT 3PVQA 1Q82R 2RJEA 2NUPB 3P8HA 5FRNA 4RTUA 1ZSZB 1K1ZA 3CCQT 2L89A 2XI9A 4ELYC 2VGNA 1TH7A 3BE3A 4L6V5 3S6WA 3CC2A 1QW1A 3QXEB 3A8LB 1LOJA 2DD4A 4M4ZA 3MCAB 2BE7D 3VS4A 1YWOA 6AT1B 1BYMA 2X4WA 2HSEB 3M56A 4HCZA 2EGEA 1UG1A 5KYXA 4JDSA 1M2VA 4PJOC 1W2BP 4PJOE 1E6GA 2PU9B 2L5QA 1VQ4T 2V1RA 3JCMX 1VQMQ 4F04B 2DVEA 2PZ1A 1M8VA 4C8QG 1FYNA 3BFMA 2FVUA 4M75C 1ZLMA 1PKTA 3FJPA 5C6SA 4WF2A 4E2FB 4E7HA 4KRTA 1SHFA 4K11A 3FDRA 1ZA1B 1BCMA 2M1HA 1VQ6Q 1TTHB 1OEBA 3X26B 3MEWA 2CZ1B 3LYIA 3QKJA 2DJZA 2LP5A 5GMKi 2D9TA 4J7IA 4IIMA 4ZTJA 4PJMA 3M0PA 1WJSA 2JUFA 1M90C 4ZNXA 4J9GA 1SPKA 5CQXA 2RO0A 2PUOB 3OW2S 3JB9G 2OTLA 4BI3A 2FEIA 5ECAA 2KXDA 2LCSA 4OB0B 5GAOq 4FU6A 3CCQA 1IHVA 3BDUA 1WGSA 1ABOA 2AKKA 2ZPGB 2D8JA 5CKHA 3OS0A 2DETA 1NPRA 1KQSA 1X27A 2AZVA 2EQUA 4NL2A 2MYSA 2KNBB 1UUEA 3G1JA 1M27C 3EFOA 4WCIA 3OA6A 3F70A 1HXDA 3M58A 1M3CA 3UDCA 3TVTA 3JCMd 3AT1B 4D8DA 2K3XA 2CKKA 1DJ7B 2K4YA 2QQSA 2JJ9A 4MMKA 1OPKA 2RN8A 2O4XA 4OMOA 4M7AE 1T0JA 1BIAA 5GANd 3JCMW 3LLRA 3IQLA 2JS0A 1YJWT 1M3BA 3PVLA 4NS5A 4N4HA 2M0YA 3CC4Q 3GBQA 5LJ3d 4IUQA 2FZCB 3NHNA 3TEEA 4LXCA 2JM8A 3VU3C 1HJDA 4AFSC 1QVFA 2EQKA 2CP3A 2RI2A 2F2VA 1HD3A 2L3PA 1FMWA 4BE1A 1VYVA 3RKXA 1D3BB 1UGRB 4M75F 2DKGA 5GAOl 2ED0A 3G4SQ 4OF1A 5GANg 2E1HA 1BB9A 3FEOA 2P4TA 4MDXA 2DXTA 4PJJA 3E9GA 4AFQC 4XTYA 3H0IA 1V1CA 3X24B 4F17A 3QBYA 3CPWP 5GMKh 2R57A 3ER0A 5LJ3g 2RNAA 2XK0A 3INZA 3CCLQ 1N8RR 3GIBA 1MNDA 2HL5C 4XTWA 5IHNA 1RLQC 1I07A 3M0SA 2CT3A 4X34A 3I55T 2ECZA 1Q86U 1WQ7A 2LNVA 2I2LA 2HDAA 4CI0C 2LT4A 4RUGA 3JCMQ 3OYEA 1K73C 1JJ2S 4M78G 1WFWA 2E3IA 2KBTA 4F7UG 5IHKA 2DXBA 1KQ1A 3E1SA 1BIBA 3KFVA 2RHUA 4M75B 4M75D 5I22A 4XQ3A 4GY5A 2LCCA 4P5NA 2PUKB 1MGQA 1YJWA 2V8JA 3HL8A 4OGCA 3G6ET 2WSCE 2K9GA 4IUTA 4KH1B 1KC8R 5LJ5g 1IRXA 1Y96B 3UWNA 2LJ1A 2MOXA 3MP6A 1W1FA 4JZ3A 3RDVA 5GMKe 4ME7A 2F2WA 3EGDB 2GBQA 2LQKA 3LGLA 1UDLA 4XTXA 3WVEB 3META 4ESRA 3A8HB 2MF2A 1AZGB 2RM4A 4KGVB 2YLBA 3TU4K 2E65A 2VKNA 3UATA 2WSEE 1M2OA 2FZGB 2FRYA 4AG1C 2E5KA 4KT0E 2LX7A 2WACA 2HBWA 2RPNA 4HCBA 2CH4W 2BIVA 4DQ2A 3I55A 2DXUA 1AT1B 1WI7A 2GFUA 3GLXA 4M7AG 3L2QA 3OBWA 3U23A 4FIBA 2QYZA 1NJIC 2DL4A 1N27A 2EBPA 2O01E 3CCRT 2FL7A 5LJ5j 1H3HA 4V2SA 3QZ9B 3M9QA 5DY9A 1RAFB 3RKWA 4BE0A 4E7KA 4J83A 1VQ9Q 2CS7A 3G6EA 2DL5A 2EJ9A 2LZ6B 2JTEA 3REAB 4BDZA 3QJ6A 4OB3B 5CVIA 1K9AA 5AYFA 2YSQA 2DFUA 2IPOB 3GF5A 1O75A 4C92F 2F5KA 4X9DA 5GAN8 1WA7A 1FWZA 3EG9A 4BUGA 1QQJA 1RABB 2P84A 1U06A 2QXFA 2P4RA 1UEBA 2EYYA 2A08A 2CYZB 1RAAB 3WVDB 1YITQ 1W2BS 3M5AA 4F14A 2E41A 3A1PA 2EW3A 2MAMA 1MMAA 5IN1A 5A2QE 5GAOm 5GAMg 3CCMQ 2CZ0B 2V8IA 2QTVA 2L2PA 3VJPA 2MCNA 1C0MA 1VQPQ 1GXIE 2RJCA 1RI9A 4JLGA 1VQ8Q 4C92D 8AT1B 3NTKA 2DZCA 4J9FA 4QT7A 2JMAA 3OBYA 2XKOC 2MPXC 2PNIA 1QMCA 3C95A 3FRNA 1YIJT 1X2KA 3LWHA 3CCRA 4C0FA 1ZA2B 1VQ7T 3CCVT 1OQKA 4ZN3A 3TSWA 3PMTA 4D6WA 3S3NA 4JS5A 5KCOA 1AVZC 2EAYA 2XHCA 5C0MA 4QVDA 4J9EA 3OYMA 1LVKA 1WLPB 4QVCA 1EIFA 5KYXB 1AD5A 2RI3A 1M2VB 3MKDA 3I56A 4E7IA 1EX4A 3DKMA 2YT6A 1UFFA 5GAMj 1MHNA 1K73U 1BK2A 2RD1A 1XOVA 2KRNA 8ATCB 1VUBA 3KBGA 3A98A 1X6OA 3CCET 4RCCA 4RTZA 4HVVA 2K5FA 2KMTA 1KG1A 1KHIA 3O8VA 3CMAQ 5FU6C 4C8QC 4C8QE 2KYMA 5D6XA 3CCSQ 2DYIA 2QTXA 1Q81R 2QEXQ 3NTHA 5HK3A 3V7SA 5GAOn 4XU0A 2F5TX 2K5IA 1OX9A 2DEQA 5CKEA 2FPDA 2ROLA 4KBMB 1M5Q1 5LJ5f 3RMQA 1YIJA 3OYCA 2BZYA 2OTLQ 5HY6A 2D6FA 3EGUA 2E4HA 2IIMA 3CCVA 2G6FX 1PG5B 4ELZC 2Y90A 3CCQQ 4QKUA 1G83A 4M7AA 3SHWA 2COYA 1Q95G 2AZSA 1YJ9Q 2RMOA 1OULA 1K8AR 2NUZA 3N5BB 1KQSP 1BI3A 5FRMA 3EFOB 3MPUB 1UHFA 1T3SA 2JM9A 4RTYA 1U3OA 2CUBA 3FIFA 4PFPA 1VYUA 3CPWS 1SG5A 1G5VA 2LQ8A 3OS5A 2B8AA 4C5EA 4II1A 1M1FA 1YN8A 2DBKA 3KXTA 3X25B 2JOYA 1I81A 5D6YA 2LJ3A 2KSSA 1VQ4Q 3QZ5B 2EQMA 1NYGA 2VYTA 1CKBA 2C0TA 2HCKA 3V8JA 3OYBA 2YXYA 4BB7A 2DYBA 4PL6A 4BD3A 4CRIA 2YUPA 1SSFA 2DJQA 5I2SA 3CCEA 2XG8D 1KHCA 2QI2A 3OYJA 2XU8A 5GJVB 3A8GB 2EGCA 3EG2A 5FU7C 2Z0WA 4JLIA 3E19A 1VQOT 2QQBA 4A4HA 1U8RA 4QQGA 1FMVA 4OVAA 2ZPIB 1PHTA 4KUDK 1VQ5T 1KFZA 3QUIA 5A0LA 1QVFP 2ZPHB 3NMZC 2EYZA 1WHHA 5EC7A 1ZBJA 3C94A 4EPCA 1NM7A 4AMCA 2PVOB 3MO8A 5CKBA 3SEMA 2FRWA 4XTUA 4JJBA 4IUVA 4XTVA 2HL3A 2D8HA 3TSZA 1HSQA 5DLQE 3M59A 1VQLT 2HKQB 3NTIA 3L2ZA 1PC0A 2PVGB 2L3SA 1AWOA 2FPEA 1OPLA 2A37A 1JXOA 1KIKA 2CP0A 3QYHB 5GAMf 3G7ZA 2EFIA 1OU8A 1N5ZA 5KE3A 4RCBA 4M7DE 2JZ2A 5FWCA 2XIDA 1PWTA 1SF9A 1KD1U 1YNZA 3OYLA 4KULA 4ZGDB 3HFNA 1F1BB 5L8RE 3JB9F 1YJWQ 1HYOA 2X35A 4M78C 2QGFB 1TU0B 3RUXA 4M78E 2KT1A 1KSWA 1QVPA 4F7UE 1N8RC 1VIEA 4A4GA 1VQOA 1VQKQ 5CO7A 4JJCA 2I0NA 2QA4T 1VQ5A 5LL6S 2VC8A 4EMHA 3QYGB 3R6OA 4L5GA 2RHIA 4M77E 2OAUA 2VVKA 2DZ9A 3X20B 1WNLA 4RTXA 3I5SA 2O9SA 4JS4A 2KGTA 1Q82U 4QQDA 2OX7A 3OYYA 1D1AA 5CAIA 3J7AF 2FHDA 1JQQA 1VQLA 3JB9D 1U1SA 2L8DA 1K9MR 2RQVA 3ZBDA 2M0OA 1U1TA 2A0FB 1MV0B 1KC8C 1ZBXA 2E64A 1BI2A 3I55Q 3M0TA 3DB3A 4PJLA 5DM7R 5CKDA 1E7OA 1D09B 2JNGA 1YJNT 4N0AA 3H0FA 4JPBW 2LCLA 2M51A 1VYTA 2HQHA 4J5YA 2YDLA 1QVGS 3RIRA 4M7AC 3L2VA 4DBFA 2EVRA 3C12A 2HNIA 1AEYA 5FU7B 4IKFA 4QVZA 2DXCA 3EHRA 4PK4A 2YRCA 3PIPA 3VYGA 1LPLA 2CP7A 3LX7A 5KYWA 2L3QA 2QA4A 3EG9B 2ED1A 2GFAA 1IB8A 1K0XA 4PJOF 4JUVA 4N4IA 2ZPBB 4FW2A 3JCMg 3HHTB 1ZUKA 2GQIA 3CC7T 1A0NB 2DF6A 4A54A 2HSPA 3M53A 3ZEHA 3OS1A 1YCYA 1T3LA 1AHJB 3R6NA 9ATCB 2DTHA 1RAIB 4EMKA 5A0GA 1Q7YR 3CXCA 4EIKA 2DA9A 3JB9I 2KVQG 2RJFA 1V76A 1V29B 1PCXA 2H3EB 4LDUA 1P92A 4M7DG 1TXQA 1WHLA 2Y4YA 1W6XA 1YJNA 1QP2A 3EG1A 4FL6A 4QQ6A 4PJOB 2LQWA 5KE2A 4PJOD 1K4US 3S3OA 4XAXB 1WHJA 3CCRQ 1H8KA 1D0XA 4ZTFA 3MJXA 2DK3A 2X3WD 2YHTA 5GANh 2NYSA 2J7IA 4LD9K 3EH2A 4UC4A 3CQTA 3FLGA 1QLYA 5LJ3h 1X6GA 3VV0A 3VS0A 2RHZA 3JCMc 3VS3A 1KJWA 1MUZA 2CREA 2DAQA 2SRCA 4PNOA 5KH6A 3RR6A 3E2UA 4Y91A 1ZUUA 4C8QA 3HRTA 2NLUA 3QDFA 4M77G 1KQSS 2ZAEA 2YUNA 1YHQQ 1RAGB 1M90R 2O2OA 2IG0A 3WXMB 2CSIA 3SFMA 1N6AA 5GANj 2LNHB 2P0QA 3OYIA 2NUTA 4M7AF 3CC7A 5A0DA 1SKUB 1LNXA 2K3BA 1WZOA 5LJ3j 1W4SA 2K57A 4YTLA 3OSSC 2RHYA 2QGGA 2BZ8A 3G71T 2RQRA 3CCUT 5GAOr 4HCKA 1VQ6A 5GANe 1N8RU 5LJ5h 2XMFA 3CBMA 1AWXA 3OMCA 1R8OB 1OZ2A 2GTOA 3GPLA 1GFCA 2WSFE 5LJ3e 4MMLA 4CC2A 3OMGA 3J81E 4C5IA 2ENMA 3G4ST 1MMDA 1QVFS 2CT4A 2JMCA 1JU5C 1VQ7Q 5FW9A 4M7AB 4M7AD 3RKYA 2EWNA 3L2RA 5EG2A 2JN0A 1JRIA 3L1AA 4C0GA 3ME9A 2F69A 2K2VA 1O9SA 3CCJQ 4ZN1A 3CCLT 1LJOA 4EDUA 1VQNT 4LUDA 2K2MA 2B86A 1KC8U 3TCJA 2FG0A 2YRDA 2EKHA 2ZZDA 3MEVA 4AG2C 1Q81C 3M57A 2K7AA 5CKFA 1M1KR 2HQEA 4MDWA 4N0AC 1BI1A 5KCHA 2LJ0A 3I56T 2J6OA 5LJ5e 1GCPA 3M0RA 1QP3A 3OB9A 1YI2Q 1S72Q 3RESA 4ATOA 2QASA 1RUWA 1JEGA 4RTWA 1Y57A 1WYXA 5IXFA 1WQWA 3G71A 2YUOA 5GAN2 1UTIA 1Y0MA 3CCUA 1HK9A 1K8AC 2O88A 3UF4A 1PRMC 3X28B 1GCQA 2FYKA 5CK9A 3M0QA 4IURA 2RHXA 3JB9J 3MP1A 1FMKA 2CP5A 2LX9A 4C0DC 4FW1A 2EGAA 1ZUYA 4EMGA 1H3ZA 2O9VA 2MWOA 7AT1B 3G4SA 1I1JA 2CP2A 2R5MA 1R0BG 1G3WA 2LTOA 1PKSA 4M7DA 1ABQA 1UGVA 2BE9B 1KD1C 4EMKC 5IT9E 2DM1A 2H3JA 1PSFA 4C92G 5GAMh 2DLPA 3CCLA 4Z02A 3RBBB 3JCMf 1VQNA 3L2WA 3REBB 4PLLA 3JCMb 1RACB 4C5HA 2J06A 4M78A 4CC4B 2X4YA 2E6NA 4F7UA 3VS6A 3CC2Q 2M02A 2RQTA 1U5SA 4B9XA 5GANf 1SRMA 1AZEA 4RTVA 1QWEA 1KQ2A 1MMNA 2X51A 2DNUA 5LJ3f 5IAYA 2YWWA 3UPUA 2F1LA 4M77A 4J6WA 1VQ9T 3EAEA 2OAWA 1C6VX 1Q82C 3PE0A 4RKUE 1NPPA 2K3YA 1WHMA 3JAME 1H92A 1FX7A 1I5OB 2JVVA 4DOVA 2KDSA 5GMKl 1BU1A 1VQOQ 4OMNA 2QDYB 2FZKB 5I2MA 5GAMe 4HA8A 2JTFA 3ASKA 1MNEA 2RQUA 2VWFA 1BCOA 3A5ZB 1NJIR 1TG0A 2E3HA 4JRKA 4HT9A 4R56A 2LT1A 2HBPA 1GL5A 4J8OA 5J26A 1UJ0A 1YITT 4E7LA 1Y07A 3EFRA 3BY7A 4J9IA 3C4SA 3JV3A 4FSXA 5IXBA 3MEUA 1M4ZA 3HP9A 5M9OA 3H9NA 2P0PA 2EQIA 2P0KA 4D8KA 1QKWA 1JJ2P 4E7ZA 5I11A 2DEUA 2E6ZA 1VQ8T 4XU3A 2FO0A 5HKCA 3QSUA 2KT8A 2M16A 2W10A 2EQJA 2AK5A 5FWBA 1IGQA 2X9HA 1WXUA 1WPYA 4Z8AA 1EZZB 2A3LA 4J9BA 2D1XA 2O4XB 1I8FA 3M54A 1VQ9A 2V1QA 4PFZA 4L59A 3SWNA 3OYHA 2CP6A 2V8KA 1WHKA 4FCYA 3DB4A 1K9MC 1W70A 2HAXA 3PNWC 5KYWB 2ZGWA 4RG2A 4OB2B 4LDWA 2KRMA 4J9HA 1MMGA
chains in the Genus database with same CATH topology
3QDRB 1KC8C 1Y96B 1ZBXA 2E64A 4J7FA 3UWNA 1BI2A 4C92B 2XDPA 3SD4A 3DB3A 3MP6A 2VXEA 2EIFA 5DM7R 5CKDA 4JRQA 3SDZA 1Q81U 5GMKe 1N9RA 3OW2A 2JNGA 4ME7A 4C0DB 4NL3A 1M1KU 4BI8B 1YJNT 4N0AA 3VYHB 2E12A 1XQHA 4PJOA 2LQKA 3LGLA 4XTXA 3WVEB 4Q5WA 3META 2LCLA 1YITA 3A8HB 2MF2A 3KUFA 2RM4A 3QPHA 1OZ3A 4XTZA 2BKDN 4J5YA 2DTIA 4EMKB 3HRUA 5GAOp 3OYGA 2YLBA 1QVGS 1I5LA 2MWPA 3RIRA 3QJYA 3CCMA 3TU4K 4M7AC 4BDYA 2E65A 3CCJT 2R5AA 3L2VA 3UT1A 1KG1A 2ZCFB 2WSEE 4M75A 2EJFA 2LVMA 3SB2A 3C12A 2HNIA 2DD5A 3OYKA 1WJRA 4XK8E 5FU7B 3L42A 4IKFA 2IVWA 2DIGA 4QVZA 4C8QF 3CCST 4KT0E 1K8AU 2DXCA 2WACA 4XU2A 3M55A 4BACA 4HCBA 2X4JA 4HT8A 2VV5A 3PIPA 2BIVA 3EFSA 3VYGA 2FB7A 3LX7A 2JTMA 4DQ2A 1XTDA 1YHQA 1VQ8A 3I55A 2DXUA 3CBPA 2QA4A 1WJQA 3OYDA 1Y96A 1QVGA 2GFUA 4C92A 3GLXA 2GFAA 4BE2A 1ZQ1A 3QIIA 3S3MA 4PJOF 4JUVA 5I21A 3L2QA 3FC3A 4N4IA 3OBWA 4M7AG 3CD6T 2ZPBB 1UGPB 4FIBA 1IREB 3OSVA 2A7YA 1NJIC 3JCMg 3HHTB 3RMSA 2OTJT 1N27A 4M7DC 2O01E 3DLLA 3CC7T 1RL2A 1YI2T 1S72T 4A54A 3PTAA 3CEYA 3CCRT 3M53A 4BI4A 2QQ9A 3LH0A 2DTOA 1YCYA 3A8OB 3ZEHA 3OS1A 1JB0E 1AHJB 2FL7A 5LJ5j 4OGEA 2DTHA 4EMKA 4V2SA 3QZ9B 3M9QA 5DY9A 3RKWA 5A0GA 4BE0A 4E7KA 1YJ9T 3AHUA 3QG1A 4J83A 3CXCA 4A53A 1Q7YC 3CCMT 3OQ5A 2CS7A 3G6EA 2RA2A 1B34B 3JB9I 2KVQG 2EJ9A 2RJFA 4BDZA 3QJ6A 2KY9A 1V29B 4OB3B 5CVIA 5FU6B 5AYFA 1VQPT 4LDUA 4JRPA 1P92A 4C8QB 3GF5A 1O75A 4C8QD 4C92F 4J6XA 2KQWA 4M7DG 2F5KA 5GMKm 4X9DA 2Y4YA 3LW5E 2D0QB 5GAN8 1FWZA 3HSBA 4DOWA 1YJNA 4BUGA 4LDXA 1QP2A 4FL6A 3MP8A 4QQ6A 3PT9A 4PJOB 2QXFA 5KE2A 3JCMJ 1VQ7A 4PJOD 3S3OA 1OI1A 1UEBA 4XAXB 5J3BA 2CYZB 4ZTFA 5GAN5 2E70A 1FXXA 3WVDB 2PVDB 4KUIA 4M77C 2DK3A 1XNIA 2YHTA 3M5AA 1JBMA 4M75E 1W2BS 2E41A 2EYQA 5GANh 3CCJA 2MAMA 3CMAA 5IN1A 3V8KA 5A2QE 5GAOm 2XICA 3HFOA 5GAMg 4LD9K 2CZ0B 2V8IA 4HCCA 3MEAA 5GAN7 3J80E 4UC4A 2MMPA 3VJPA 1X75C 2PQWA 3FLGA 3NFCA 3CCSA 3PGGA 4J6YA 5LJ3h 5DLOA 3VV0A 2RHZA 1B34A 3JCMc 4A4FA 3CC2T 5CR2A 4B9WA 1GXIE 2X4XA 2DAQA 4PNOA 5KH6A 2QEXA 3LGFA 5CIUA 2RJCA 5GAN3 4JLGA 4Y91A 2CZ7B 1JJ2A 4C8QA 3HRTA 2NLUA 3CMET 4M77G 1KQSS 4TVRA 4NOYA 2K5LA 3OYAA 4C92D 5FLXE 3NTKA 2DZCA 2IG0A 3PIOA 3WXMB 3CD6A 1NJIU 3OBYA 3SFMA 2XKOC 3P8DA 1N6AA 5GANj 1X01A 2RB6A 2P0QA 4OB1B 3C95A 2QQRA 3VKIA 3OYIA 2OTJA 3FRNA 4M7AF 1YIJT 3CC7A 1YBYA 1YI2A 4E47A 1S72A 4N4GA 2ZPFB 3LWHA 5A0DA 3CCRA 4C0FA 2HD0A 3GNGA 1VQ7T 3CCVT 1LNXA 2RI5A 4VUBA 2KK4A 5LJ3j 1W4SA 2K57A 4ZN3A 1YJ9A 2BUDA 4YTLA 2G3RA 3OSSC 3ZFJA 2RHYA 3L2UA 3PMTA 4D6WA 3S3NA 1Y71A 5HK0A 3G71T 2QQAA 2YRVA 4JS5A 3CCUT 1ZHIA 5KCOA 5GAOr 3CMAT 2EAYA 2XHCA 5C0MA 1VQ6A 4QVDA 4FT4A 5GANe 3OYMA 1VQPA 1N8RU 3T9NA 2GF7A 4LD6A 5GAN6 4OMFB 3CBMA 2GQVA 3V7RA 4QVCA 5LJ5h 3OYFA 1EIFA 1G3YA 3OMCA 1R8OB 2DO3A 1Q86C 2RI3A 1OZ2A 3GPLA 3I56A 2QEXT 4E7IA 1VQ4A 2WSFE 3DKMA 5LJ3e 3E9FA 4IUUA 4M7DF 4MMLA 1N9SA 3OMGA 5GAMj 1MHNA 3J81E 1K73U 3M4GA 4C5IA 2RD1A 3G4ST 1QVFS 2VGMA 4QW2A 1XOVA 1M1GA 1VUBA 3KBGA 1Y7XA 4LDVA 1X6OA 1VQMT 2OTLT 4X9CA 2RJEA 2XD0A 3P8HA 4M7AB 5FRNA 4M7AD 3RKYA 1M9SA 2KAFA 2EWNA 2RH2A 4JRIA 3SWNC 4RCCA 3CCET 3L2RA 2EJGA 5EG2A 2JN0A 1JRIA 3L1AA 3CCQT 4M78F 2AHJB 2K5FA 2KMTA 2L89A 2XI9A 1KHIA 3ME9A 2F69A 2K2VA 1O9SA 4ELYC 4F7UF 4R55A 3O8VA 4ZN1A 2VGNA 1LJOA 3CCLT 4EDUA 2RK1A 5FU6C 1VQNT 1TH7A 1VQKT 1K9MU 4L6V5 3S6WA 4C8QC 3CC2A 1QW1A 3QXEB 3A8LB 1LOJA 2DD4A 5D6XA 4C8QE 1UB4A 5CQYA 3MCAB 2YLCA 1KC8U 3OYNA 4PKCC 3TCJA 3PMIA 1BYMA 1VQ6T 2QTXA 2X4WA 2ZZDA 4OP0A 3M56A 3MEVA 3CMEA 1Q81C 4HCZA 3M57A 2DPPB 3NTHA 5HK3A 5CKFA 3V7SA 2HQEA 1M1KC 4MDWA 4N0AC 5GAOn 4XU0A 2L3RA 4JDSA 1BI1A 2F5TX 4PJOC 2K5IA 2DEQA 5CKEA 5KCHA 3P8BB 4PJOE 4M77F 3I56T 2PU9B 2L5QA 4KBMB 1VQ4T 1M5Q1 5LJ5f 3RMQA 5LJ5e 1YIJA 4M7DB 4M7DD 3OYCA 3JCMX 1QP3A 3JCMh 2DVEA 5HY6A 3JCMV 2D6FA 3MHXA 2CGHA 3OB9A 4Y28E 1M8VA 4C8QG 3CCVA 3RERA 4ATOA 3RESA 4ELZC 2Y90A 2FVUA 3BFMA 4M75C 4M7AA 1NZ9A 3OY9A 1WQWA 2MI6A 3FJPA 3G71A 4JJNK 4IUPA 5C6SA 5GAN2 4WF2A 1H641 3CCUA 1HK9A 4GLKA 4M78B 4E7HA 5LJ5d 4M78D 1K8AC 3V8LA 3N5BB 4PJOG 4F7UB 1BI3A 5FRMA 4BY6C 2RJDA 3GNFB 2E5QA 3FDRA 3H8ZA 4C0GA 3FIFA 3HRSA 3X28B 2M1HA 3CPWS 1G5VA 2FYKA 2LQ8A 4A4EA 4C92C 5CK9A 3X26B 3OS5A 3MEWA 4IURA 2B8AA 2CZ1B 1G3SA 3LYIA 3QKJA 4II1A 2RHXA 4C5EA 1M1FA 3FB9A 4C92E 3MP1A 3JB9J 2DJZA 5GMKi 2D9TA 3URGA 4J7IA 3KXTA 3X25B 4ZTJA 2VXFA 2LX9A 2LDMA 2JOYA 4C0DC 1I81A 4M75G 5D6YA 1W2BA 2Y4XA 4EMGA 2KSSA 1H3ZA 3VUZA 3QZ5B 1WJSA 2EQMA 2JUFA 2MWOA 3Q1JA 2E10A 3G4SA 2VYTA 5GMKj 5CQXA 1M90C 2R5MA 2RO0A 2PUOB 1I4K1 3V8JA 2R58A 3OW2S 1VQMA 4M77B 3JB9G 1G3WA 2LTOA 4M77D 2OTLA 3OYBA 4M7DA 4BB7A 4PL6A 1KD1C 4BD3A 4EMKC 5IT9E 2EKOA 4HKEA 1SSFA 4BI3A 4CRIA 5I2SA 2H3JA 2XG8D 4OB0B 5GAOq 3A8MB 3CCEA 1KHCA 2QI2A 4FU6A 3CCQA 3BDUA 1PSFA 4C92G 2XU8A 4MZPA 5GAMh 3OYJA 1WGSA 3A8GB 1Q7YU 3CCLA 2ZPGB 5CKHA 3OS0A 4Z02A 5CCAA 3JCMf 3JCMe 1VQNA 3JSCA 5FU7C 1IZ6A 3CC4T 1NPRA 1VQKA 3L2WA 1KQSA 3JCMb 4PLLA 2EQUA 3JRZA 4JLIA 4NL2A 3JB9H 4C5HA 4M78A 2X4YA 3E19A 1VQOT 2QQBA 4A4HA 2E6NA 1U8RA 4F7UA 4QQGA 4OVAA 2ZPIB 4B9XA 4KUDK 5GANf 3OA6A 3F70A 3QUIA 1HXDA 5A0LA 4C5GA 1VQ5T 2ZPHB 3M58A 1KQ2A 3C94A 3UDCA 1G3TA 3JCMd 2K3XA 4EPCA 2CKKA 4FM4B 2K4YA 5LJ3f 2PVOB 3CPFA 2QQSA 4MMKA 3MO8A 5IAYA 5CKBA 2O4XA 4M7AE 1BIAA 4XTUA 3UPUA 5FROA 3BDLA 4IUVA 5GANd 4XTVA 4M77A 3JCMW 4J6WA 1VQ9T 3EAEA 4FT2A 3LLRA 4A4KA 1BI0A 5DLQE 1Q82C 4RKUE 1YJWT 3M59A 1NPPA 2K3YA 3JAME 4NS5A 4N4HA 1VQLT 3NTIA 4ZGJB 1FX7A 2M9UA 2PVGB 3L2ZA 2JVVA 4DOVA 5LJ3d 2KDSA 4IUQA 3H6ZA 5GMKl 3TEEA 4PLIA 3CXCS 2QDYB 3QO3A 3VU3C 2XDDA 4ZGEB 5I2MA 2DIQA 3QYHB 5GAMf 5GAMe 3G7ZA 1QVFA 2EQKA 2JTFA 2RI2A 3ASKA 4HA8A 2EFIA 3GP8A 1BKBA 3A5ZB 1M90U 5KE3A 4BE1A 4JRKA 4RCBA 2LRQA 4DA4A 4HT9A 4R56A 2LT1A 2JZ2A 4M7DE 2HBPA 4J8OA 5J26A 2XIDA 1YITT 1KD1U 3RKXA 4E7LA 1Y07A 5D6WA 4RMOA 1D3BB 1UGRB 4M75F 2DKGA 5GAOl 3OYLA 3EFRA 4KULA 4ZGDB 3HFNA 4OF1A 5GANg 3BY7A 2E1HA 3SWNB 5GAMd 1OYXA 2GCXA 3FEOA 2P4TA 3V7CA 5L8RE 4LDYA 4MDXA 3JB9F 3C4SA 2DXTA 2X35A 3E9GA 3M4YA 4FSXA 3MEUA 4O6JA 4XTYA 4M78C 1M4ZA 3HP9A 5M9OA 3RUXA 4M78E 3QBYA 3X24B 5GMKh 2R57A 2CZ6B 2P0PA 3ER0A 5LJ3g 3CC4A 1QVPA 1VIFA 2P0KA 2XK0A 4F7UE 3INZA 3GIBA 3TREA 1N8RC 1VIEA 4A4GA 2XDBA 4XTWA 1VQOA 2RK2A 2C06A 3LWIA 5CO7A 1UGQB 4X34A 2E6ZA 1YHQT 1VQ8T 3I55T 4XU3A 2QA4T 1VQ5A 4MZMA 3VUBA 1Q86U 4C0ZA 1WQ7A 5LL6S 2LNVA 2VC8A 2I2LA 1RI0A 5HKCA 4E7JA 4CI0C 4O5VA 2LT4A 3QYGB 4EMHA 5GAN4 3QSUA 3R6OA 2M16A 3JCMQ 4RG8A 3OS2A 3OYEA 1K73C 2LC4A 2EQJA 1JJ2S 4L5GA 4M78G 2RHIA 1NE8A 5J39A 4M77E 2OAUA 4F7UG 2DZ9A 3X20B 2DXBA 1WPYA 3QHSA 1KQ1A 1WNLA 4MZTA 2A3LA 3E1SA 1BIBA 2O4XB 3CBOA 4JS4A 1I8FA 1Q82U 2RHUA 1D3BA 4QQDA 3BW1A 3DLMA 3M54A 4M75B 3OYYA 1VQ9A 4M75D 4XQ3A 4GY5A 3JCMP 2LCCA 5CAIA 3J7AF 3HKSA 2PUKB 3HPWA 1MGQA 3PFSA 2FHDA 4L59A 4P5NA 3SWNA 2V8JA 3OYHA 1YJWA 1VQLA 3HL8A 4OGCA 2V8KA 3G6ET 3CPWA 3GOXA 3JB9D 2WSCE 1U1SA 2L8DA 4XU1A 1PSEA 3DB4A 1UGSB 2M0OA 3ZBDA 4BY6B 2VUBA 1U1TA 2ZPEB 4IUTA 3PNWC 1K9MC 2HAXA 2ZGWA 4RG2A 4OB2B 4LDWA 1DJ7B 2HQXA 5LJ5g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 5;  1Y96 B;  4M7A E;  1BIA A;  2E64 A;  2YLC A;  4M77 C;  4XTU A;  4C92 B;  2YHT A;  4M75 E;  1JBM A;  2E41 A;  5GAN h;  5GAN d;  4XTV A;  4M77 A;  3JCM W;  2QTX A;  2VXE A;  4J6W A;  4OP0 A;  5GAN 8;  3V8K A;  3V7S A;  5GAO m;  5GMK e;  1N9R A;  3HFO A;  5GAM g;  4N0A C;  5GAO n;  4NL3 A;  4XU0 A;  4PJO C;  5GAN 7;  2DEQ A;  4N0A A;  4PJO E;  4PJO A;  3L2Z A;  4M77 F;  4XTX A;  3PGG A;  4J6Y A;  5LJ3 d;  5LJ3 h;  1M5Q 1;  5LJ5 f;  5LJ5 e;  4M7D B;  1B34 A;  3JCM c;  5GMK l;  4M7D D;  3JCM X;  3JCM h;  2RM4 A;  2DVE A;  3JCM V;  4XTZ A;  2CGH A;  2DTI A;  4J5Y A;  4PNO A;  4EMK B;  5GAO p;  3QO3 A;  2YLB A;  3VU3 C;  4C8Q G;  3RIR A;  1I5L A;  1M8V A;  5GAN 3;  3RER A;  4Y91 A;  3RES A;  5GAM f;  5GAM e;  4M7A C;  4C8Q A;  2E65 A;  2Y90 A;  3BFM A;  4HA8 A;  4M77 G;  4M75 C;  4M7A A;  4NOY A;  1WQW A;  4C92 D;  4M75 A;  2EJF A;  3FJP A;  2DZC A;  3SB2 A;  2HNI A;  5GAN 2;  4WF2 A;  1H64 1;  4JRK A;  1HK9 A;  4RCB A;  5GAN j;  4HT9 A;  4M78 B;  4M7D E;  1X01 A;  2RB6 A;  4M78 D;  5LJ5 d;  3V8L A;  4PJO G;  4C8Q F;  4XU2 A;  4F7U B;  4M7A F;  3RKX A;  4HT8 A;  1D3B B;  4M75 F;  2DKG A;  5GAO l;  3EFS A;  3EFR A;  3FIF A;  2FB7 A;  3HFN A;  4DQ2 A;  5GAN g;  3BY7 A;  2E1H A;  1LNX A;  2DXU A;  2FYK A;  3SWN B;  4C92 C;  5GAM d;  5LJ3 j;  1Y96 A;  3V7C A;  2K57 A;  4C92 E;  3JCM P;  4C92 A;  3JB9 F;  3JB9 J;  3FB9 A;  2DXT A;  2DJZ A;  5GMK i;  4XTY A;  4PJO F;  4JUV A;  4M78 C;  5I21 A;  4M7A G;  2VXF A;  1I81 A;  4M78 E;  4M75 G;  3RUX A;  5GMK h;  4EMG A;  5LJ3 g;  5GAO r;  4F7U E;  2EAY A;  2E10 A;  3INZ A;  5GMK j;  3JCM g;  3GIB A;  4QVD A;  1I4K 1;  3V8J A;  4M7D C;  4XTW A;  5GAN e;  4M77 B;  3JB9 G;  4M77 D;  5GAN 6;  4A54 A;  5LJ5 h;  4M7D A;  3V7R A;  4QVC A;  2DTO A;  1YCY A;  4EMK C;  4XU3 A;  5LJ5 j;  2DTH A;  4EMK A;  5GAO q;  1WQ7 A;  5DY9 A;  2VC8 A;  3RKW A;  4V2S A;  2I2L A;  3AHU A;  3BDU A;  3QSU A;  4C92 G;  4EMH A;  5GAM h;  4A53 A;  5GAN 4;  5LJ3 e;  3JCM Q;  4M7D F;  4MML A;  2RA2 A;  1B34 B;  1N9S A;  3JB9 I;  5GAM j;  2EJ9 A;  3JCM f;  3JCM e;  3M4G A;  2RD1 A;  4M78 G;  3JCM b;  4JLI A;  4M77 E;  4NL2 A;  2DZ9 A;  4F7U G;  3JB9 H;  4M78 A;  1WPY A;  3QHS A;  1KQ1 A;  1WNL A;  4C8Q B;  4X9C A;  4F7U A;  1BIB A;  4C8Q D;  4C92 F;  4M7A B;  1I8F A;  4J6X A;  4M7D G;  1D3B A;  4M7A D;  3BW1 A;  3RKY A;  4M75 B;  5GMK m;  5GAN f;  2EWN A;  3QUI A;  1HXD A;  4JRI A;  4M75 D;  4RCC A;  4X9D A;  2EJG A;  4XQ3 A;  2JN0 A;  3SWN C;  5CAI A;  1JRI A;  3L1A A;  3SWN A;  4M78 F;  1MGQ A;  3HSB A;  1KQ2 A;  4F7U F;  3JCM d;  1LJO A;  3JB9 D;  1U1S A;  4XU1 A;  1TH7 A;  4PJO B;  3JCM J;  4PJO D;  1U1T A;  5LJ3 f;  4C8Q C;  2ZGW A;  4MMK A;  4C8Q E;  1LOJ A;  5LJ5 g; 
#chains in the Genus database with same CATH topology
 2DBM A;  1YWP A;  4WTO B;  2L0A A;  3SD4 A;  2DL8 A;  2EIF A;  4JRQ A;  1Q81 U;  4OMM A;  1K0S A;  3OW2 A;  4C0D B;  4NL3 A;  4ANJ A;  1AWW A;  1WIE A;  1NBE B;  3VYH B;  2E12 A;  1XQH A;  4Q5W A;  2ESW A;  1GRI A;  2GTJ A;  1YIT A;  1QCF A;  4AFZ C;  3KUF A;  2K6D A;  3QPH A;  2H8H A;  2CH4 A;  1PNJ A;  2DTI A;  4EMK B;  5GAO p;  1X2Q A;  2MWP A;  3CCM A;  2J6K A;  2R5A A;  3UT1 A;  1J3T A;  3CXC P;  3L42 A;  2DIG A;  4C8Q F;  3CCS T;  1K8A U;  2JS2 A;  3M55 A;  2X4J A;  4HT8 A;  1WXB A;  2V26 A;  1GCQ C;  4AT1 B;  2JTM A;  1XTD A;  1VQ8 A;  2KYB A;  1WJQ A;  1QVG A;  4C92 A;  3QII A;  2KE9 A;  3CD6 T;  2KEA A;  3OSV A;  1I0C A;  2OTJ T;  5KYU A;  4KGZ B;  4M7D C;  1R0C B;  3DLL A;  2EPD A;  3TQ7 P;  1G8X A;  4BI4 A;  2DTO A;  1JB0 E;  2DER A;  1YJ9 T;  3AHU A;  3QG1 A;  1Q7Y C;  2RA2 A;  2COZ A;  1NLO C;  2NWM A;  3M0U A;  5FU6 B;  4C8Q B;  1D0Y A;  1CSK A;  4C8Q D;  4J6X A;  1D1B A;  2LMJ A;  3I9Q A;  5GMK m;  3VS2 A;  3LW5 E;  2DIL A;  3O5Z A;  2NUT B;  1CKA A;  3PT9 A;  2D0N A;  1OI1 A;  3CC7 Q;  1B07 A;  2KXC A;  2KR3 A;  4LE9 A;  1Z9Z A;  1FXX A;  2PVD B;  4KUI A;  4M77 C;  4M75 E;  1GBQ A;  4PFO A;  1TWB A;  2CUD A;  3CMA A;  4CC7 A;  2XIC A;  1YFN A;  4HCC A;  1E6H A;  3MEA A;  3J80 E;  3EH1 A;  3CCS A;  3PGG A;  4J6Y A;  1B34 A;  4A4F A;  4B9W A;  2X4X A;  1IXD A;  2QEX A;  2DL7 A;  3VS1 A;  5GAN 3;  2CZ7 B;  1JJ2 A;  2JW4 A;  3CME T;  4TVR A;  4NOY A;  2K5L A;  3OYA A;  1TUG B;  5FLX E;  1WXT A;  3PIO A;  3CD6 A;  1OOT A;  3P8D A;  3ULR B;  4HXJ A;  2OTJ A;  1JXM A;  1YBY A;  2ZPF B;  3RNJ A;  3GNG A;  2RI5 A;  1T0H A;  2KK4 A;  3EGX A;  1B7T A;  4DBQ A;  1YJ9 A;  2BUD A;  3ZFJ A;  1Y71 A;  5HK0 A;  5KYN A;  2YRV A;  1G2B A;  1SHG A;  2OJ2 A;  3G6E Q;  4FT4 A;  5GAN 6;  2GQV A;  5KYY A;  1Q86 R;  2DO3 A;  1VQ4 A;  4IUU A;  4M7D F;  4FYX B;  1ZX6 A;  1M1G A;  1VQM T;  4OMQ A;  2A36 A;  4X9C A;  2XD0 A;  3VS7 A;  4DBR A;  1M9S A;  2KAF A;  2RH2 A;  4JRI A;  3SWN C;  2EJG A;  4M78 F;  3G71 Q;  2AHJ B;  3H0H A;  5AT1 B;  3C0C A;  4F7U F;  4R55 A;  3CCU Q;  1AWJ A;  1ZSG A;  2RK1 A;  1NEG A;  1VQK T;  1K9M U;  1UB4 A;  5CQY A;  2YLC A;  3OYN A;  4PKC C;  3PMI A;  4A63 B;  1UHC A;  1WX6 A;  1VQ6 T;  4OP0 A;  3CME A;  2DPP B;  1M1K C;  2L3R A;  3P8B B;  4OML A;  2VAS A;  2KRS A;  4M77 F;  1PD0 A;  4M7D B;  1S1N A;  4M7D D;  2DRK A;  3JCM h;  3JCM V;  3MHX A;  2CGH A;  1IO6 A;  4Y28 E;  3I5R A;  1D0Z A;  3RER A;  2YUQ A;  2NUP A;  1NZ9 A;  3OY9 A;  2MI6 A;  2RF0 A;  4JJN K;  4IUP A;  1ZSZ A;  2AT1 B;  1H64 1;  1VQN Q;  4GLK A;  4M78 B;  5LJ5 d;  4M78 D;  3V8L A;  4PJO G;  4F7U B;  4BY6 C;  2RJD A;  3GNF B;  2E5Q A;  3H8Z A;  2DRM A;  3HRS A;  1OX8 A;  4IIO A;  4A4E A;  4C92 C;  1SRL A;  2ATC B;  3JCM P;  1G3S A;  4C92 E;  3FB9 A;  2KRO A;  3URG A;  1ARK A;  2VXF A;  2LDM A;  2FPF A;  4M75 G;  1W2B A;  3VRY A;  3I56 Q;  2Y4X A;  1OV3 A;  3VUZ A;  3Q1J A;  1XJW B;  2E10 A;  5GMK j;  1I4K 1;  2R58 A;  1VQM A;  4M77 B;  4RTT A;  4M77 D;  1YP5 A;  2F2X A;  2GGR A;  4LUE A;  1PRL C;  1TUC A;  2EKO A;  4HKE A;  3A8M B;  4MZP A;  4Y92 A;  1Q7Y U;  5CCA A;  3JCM e;  3JSC A;  1IZ6 A;  3CC4 T;  1VQK A;  3JRZ A;  3JB9 H;  4C5G A;  1JO8 A;  1G3T A;  4E7S A;  2ROT A;  4FM4 B;  4ORZ A;  3CPF A;  3VRZ A;  3NPF A;  1IHW A;  5IHI A;  1YIJ Q;  1X69 A;  4HVW A;  5FRO A;  3BDL A;  3FJ5 A;  2HZY A;  1QKX A;  4FT2 A;  4A4K A;  1BI0 A;  3CCV Q;  1TS9 A;  4ZGJ B;  2M9U A;  3H6Z A;  2SEM A;  5L23 A;  4PLI A;  3CXC S;  3QO3 A;  2DE0 X;  2CDT A;  2MK5 A;  2XDD A;  4JJD A;  4ZGE B;  2DIQ A;  3GP8 A;  1BKB A;  2AKL A;  4J9C A;  1PD1 A;  1M90 U;  3QWY A;  1K76 A;  4DA4 A;  2LRQ A;  2QDL A;  3UA6 A;  3H41 A;  2ABL A;  1NEB A;  5D6W A;  4RMO A;  2C0I A;  1TOV A;  4X1V A;  3SWN B;  5GAM d;  1OYX A;  2GCX A;  3V7C A;  4LDY A;  3M4Y A;  4O6J A;  2O31 A;  1Z9Q A;  3CCE Q;  4DEY A;  4J9D A;  4E6R A;  2CZ6 B;  3CC4 A;  1VIF A;  2DMO A;  3TRE A;  4B6M A;  2XDB A;  2J05 A;  2JXB A;  4JZ4 A;  2RK2 A;  3LWI A;  2MIO A;  1UGQ B;  1YHQ T;  4MZM A;  3VUB A;  4C0Z A;  1RI0 A;  3OW2 P;  4E7J A;  4O5V A;  1WHG A;  5GAN 4;  4RG8 A;  1K73 R;  1RAH B;  3OS2 A;  2LC4 A;  2PTK A;  4F16 A;  1NE8 A;  5J39 A;  2CSQ A;  4FYW B;  1M3A A;  3QHS A;  1NG2 A;  4FYY B;  4MZT A;  4R0K A;  3CBO A;  1D3B A;  3BW1 A;  3DLM A;  2KI7 A;  2EYX A;  1VA7 A;  2JT4 A;  3HKS A;  3HPW A;  3PFS A;  1D1C A;  1TUD A;  3CPW A;  3GOX A;  1SSH A;  4XU1 A;  1QCO A;  1PSE A;  3NGP A;  1UGS B;  4BY6 B;  2C0O A;  2VUB A;  2X3X D;  2ZPE B;  1MV3 A;  2HQX A;  2C06 A;  3QDR B;  2BZX A;  4J7F A;  4C92 B;  2XDP A;  4Z89 A;  3THK A;  2VXE A;  1QVG P;  3SDZ A;  1N9R A;  1M1K U;  4BI8 B;  1VOM A;  3UA7 A;  5KYU B;  4PJO A;  1GFD A;  1PM3 A;  2LQN A;  1OZ3 A;  4XTZ A;  2BKD N;  1KK7 A;  4Z88 A;  3HRU A;  3OYG A;  1I5L A;  3QJY A;  4BDY A;  3CCJ T;  2A28 A;  1ZSZ C;  2ZCF B;  2HEQ A;  4M75 A;  2EJF A;  2LVM A;  3SB2 A;  2DD5 A;  5HCK A;  1WJR A;  3OYK A;  4XK8 E;  2W0Z A;  2IVW A;  4LNP A;  3EG3 A;  4XU2 A;  4BAC A;  2VV5 A;  3EFS A;  2FB7 A;  1X43 A;  1YHQ A;  3CBP A;  3OYD A;  1Y96 A;  1EFN A;  4BE2 A;  1ZQ1 A;  3S3M A;  1VQ5 Q;  5I21 A;  3FC3 A;  2QG9 B;  1UGP B;  1IRE B;  2OI3 A;  2A7Y A;  3EGD A;  3RMS A;  2BTT A;  1RLP C;  1QCN A;  1RL2 A;  2GNC A;  1YI2 T;  1S72 T;  3PTA A;  3CEY A;  2HKN A;  1NLP C;  2QQ9 A;  3LH0 A;  4CC3 A;  3A8O B;  1ACM B;  4OGE A;  4GLM A;  1RAD B;  4A53 A;  3CCM T;  3OQ5 A;  1B34 B;  5IH2 A;  5D7U A;  1VQL Q;  2KY9 A;  1M8M A;  1VQP T;  1X6B A;  1OU9 A;  4JRP A;  2KQW A;  4OMP A;  2D0Q B;  3VS5 A;  3HSB A;  4DOW A;  3CD6 Q;  4LDX A;  3MP8 A;  2K79 A;  1VQ7 A;  2OTJ Q;  3ZL7 C;  3JCM J;  1B3Q A;  5J3B A;  2DVJ A;  2E70 A;  5GAN 5;  3EGX B;  1XNI A;  1JBM A;  2EYQ A;  4GBQ A;  4LN2 A;  3CCJ A;  1UE9 A;  3V8K A;  3HFO A;  5GAN 7;  1RAE B;  1YCS B;  4HVU A;  2MMP A;  1X75 C;  2PQW A;  3NFC A;  3EHQ A;  5DLO A;  1WDX A;  5KYY B;  3CC2 T;  5CR2 A;  3LGF A;  5CIU A;  2VB6 A;  4DEX A;  2QA4 Q;  4KH0 B;  1LCK A;  2EYW A;  1NJI U;  3I35 A;  4DBH A;  1X01 A;  2RB6 A;  3QWX X;  1AOJ A;  4OB1 B;  5GJW B;  2QQR A;  3VKI A;  1KD1 R;  1UEC A;  1YI2 A;  4E47 A;  1S72 A;  4N4G A;  1M30 A;  2HD0 A;  3HTR A;  1SEM A;  4KGX B;  3EG0 A;  2QAZ A;  4VUB A;  1C1A A;  4AFU C;  2G3R A;  1IGU A;  3D7S B;  3L2U A;  2QQA A;  1QWF A;  1ZHI A;  3CMA T;  2QK0 A;  2DL3 A;  4FSS A;  1VQP A;  2J6F A;  3LH5 A;  2HMA A;  3T9N A;  2GF7 A;  4LD6 A;  4OMF B;  3V7R A;  3OYF A;  1G3Y A;  1BBZ A;  1GBR A;  1Q86 C;  1TSF A;  3CME Q;  2RQW A;  1NYF A;  4FYV B;  2DX1 A;  4PJN A;  2QEX T;  3E9F A;  2COW A;  1N9S A;  3M4G A;  1YJN Q;  1R77 A;  2VGM A;  4QW2 A;  1UJY A;  1Y7X A;  2AIR B;  4LDV A;  2OTL T;  3PVQ A;  1Q82 R;  2RJE A;  2NUP B;  3P8H A;  5FRN A;  4RTU A;  1ZSZ B;  1K1Z A;  3CCQ T;  2L89 A;  2XI9 A;  4ELY C;  2VGN A;  1TH7 A;  3BE3 A;  4L6V 5;  3S6W A;  3CC2 A;  1QW1 A;  3QXE B;  3A8L B;  1LOJ A;  2DD4 A;  4M4Z A;  3MCA B;  2BE7 D;  3VS4 A;  1YWO A;  6AT1 B;  1BYM A;  2X4W A;  2HSE B;  3M56 A;  4HCZ A;  2EGE A;  1UG1 A;  5KYX A;  4JDS A;  1M2V A;  4PJO C;  1W2B P;  4PJO E;  1E6G A;  2PU9 B;  2L5Q A;  1VQ4 T;  2V1R A;  3JCM X;  1VQM Q;  4F04 B;  2DVE A;  2PZ1 A;  1M8V A;  4C8Q G;  1FYN A;  3BFM A;  2FVU A;  4M75 C;  1ZLM A;  1PKT A;  3FJP A;  5C6S A;  4WF2 A;  4E2F B;  4E7H A;  4KRT A;  1SHF A;  4K11 A;  3FDR A;  1ZA1 B;  1BCM A;  2M1H A;  1VQ6 Q;  1TTH B;  1OEB A;  3X26 B;  3MEW A;  2CZ1 B;  3LYI A;  3QKJ A;  2DJZ A;  2LP5 A;  5GMK i;  2D9T A;  4J7I A;  4IIM A;  4ZTJ A;  4PJM A;  3M0P A;  1WJS A;  2JUF A;  1M90 C;  4ZNX A;  4J9G A;  1SPK A;  5CQX A;  2RO0 A;  2PUO B;  3OW2 S;  3JB9 G;  2OTL A;  4BI3 A;  2FEI A;  5ECA A;  2KXD A;  2LCS A;  4OB0 B;  5GAO q;  4FU6 A;  3CCQ A;  1IHV A;  3BDU A;  1WGS A;  1ABO A;  2AKK A;  2ZPG B;  2D8J A;  5CKH A;  3OS0 A;  2DET A;  1NPR A;  1KQS A;  1X27 A;  2AZV A;  2EQU A;  4NL2 A;  2MYS A;  2KNB B;  1UUE A;  3G1J A;  1M27 C;  3EFO A;  4WCI A;  3OA6 A;  3F70 A;  1HXD A;  3M58 A;  1M3C A;  3UDC A;  3TVT A;  3JCM d;  3AT1 B;  4D8D A;  2K3X A;  2CKK A;  1DJ7 B;  2K4Y A;  2QQS A;  2JJ9 A;  4MMK A;  1OPK A;  2RN8 A;  2O4X A;  4OMO A;  4M7A E;  1T0J A;  1BIA A;  5GAN d;  3JCM W;  3LLR A;  3IQL A;  2JS0 A;  1YJW T;  1M3B A;  3PVL A;  4NS5 A;  4N4H A;  2M0Y A;  3CC4 Q;  3GBQ A;  5LJ3 d;  4IUQ A;  2FZC B;  3NHN A;  3TEE A;  4LXC A;  2JM8 A;  3VU3 C;  1HJD A;  4AFS C;  1QVF A;  2EQK A;  2CP3 A;  2RI2 A;  2F2V A;  1HD3 A;  2L3P A;  1FMW A;  4BE1 A;  1VYV A;  3RKX A;  1D3B B;  1UGR B;  4M75 F;  2DKG A;  5GAO l;  2ED0 A;  3G4S Q;  4OF1 A;  5GAN g;  2E1H A;  1BB9 A;  3FEO A;  2P4T A;  4MDX A;  2DXT A;  4PJJ A;  3E9G A;  4AFQ C;  4XTY A;  3H0I A;  1V1C A;  3X24 B;  4F17 A;  3QBY A;  3CPW P;  5GMK h;  2R57 A;  3ER0 A;  5LJ3 g;  2RNA A;  2XK0 A;  3INZ A;  3CCL Q;  1N8R R;  3GIB A;  1MND A;  2HL5 C;  4XTW A;  5IHN A;  1RLQ C;  1I07 A;  3M0S A;  2CT3 A;  4X34 A;  3I55 T;  2ECZ A;  1Q86 U;  1WQ7 A;  2LNV A;  2I2L A;  2HDA A;  4CI0 C;  2LT4 A;  4RUG A;  3JCM Q;  3OYE A;  1K73 C;  1JJ2 S;  4M78 G;  1WFW A;  2E3I A;  2KBT A;  4F7U G;  5IHK A;  2DXB A;  1KQ1 A;  3E1S A;  1BIB A;  3KFV A;  2RHU A;  4M75 B;  4M75 D;  5I22 A;  4XQ3 A;  4GY5 A;  2LCC A;  4P5N A;  2PUK B;  1MGQ A;  1YJW A;  2V8J A;  3HL8 A;  4OGC A;  3G6E T;  2WSC E;  2K9G A;  4IUT A;  4KH1 B;  1KC8 R;  5LJ5 g;  1IRX A;  1Y96 B;  3UWN A;  2LJ1 A;  2MOX A;  3MP6 A;  1W1F A;  4JZ3 A;  3RDV A;  5GMK e;  4ME7 A;  2F2W A;  3EGD B;  2GBQ A;  2LQK A;  3LGL A;  1UDL A;  4XTX A;  3WVE B;  3MET A;  4ESR A;  3A8H B;  2MF2 A;  1AZG B;  2RM4 A;  4KGV B;  2YLB A;  3TU4 K;  2E65 A;  2VKN A;  3UAT A;  2WSE E;  1M2O A;  2FZG B;  2FRY A;  4AG1 C;  2E5K A;  4KT0 E;  2LX7 A;  2WAC A;  2HBW A;  2RPN A;  4HCB A;  2CH4 W;  2BIV A;  4DQ2 A;  3I55 A;  2DXU A;  1AT1 B;  1WI7 A;  2GFU A;  3GLX A;  4M7A G;  3L2Q A;  3OBW A;  3U23 A;  4FIB A;  2QYZ A;  1NJI C;  2DL4 A;  1N27 A;  2EBP A;  2O01 E;  3CCR T;  2FL7 A;  5LJ5 j;  1H3H A;  4V2S A;  3QZ9 B;  3M9Q A;  5DY9 A;  1RAF B;  3RKW A;  4BE0 A;  4E7K A;  4J83 A;  1VQ9 Q;  2CS7 A;  3G6E A;  2DL5 A;  2EJ9 A;  2LZ6 B;  2JTE A;  3REA B;  4BDZ A;  3QJ6 A;  4OB3 B;  5CVI A;  1K9A A;  5AYF A;  2YSQ A;  2DFU A;  2IPO B;  3GF5 A;  1O75 A;  4C92 F;  2F5K A;  4X9D A;  5GAN 8;  1WA7 A;  1FWZ A;  3EG9 A;  4BUG A;  1QQJ A;  1RAB B;  2P84 A;  1U06 A;  2QXF A;  2P4R A;  1UEB A;  2EYY A;  2A08 A;  2CYZ B;  1RAA B;  3WVD B;  1YIT Q;  1W2B S;  3M5A A;  4F14 A;  2E41 A;  3A1P A;  2EW3 A;  2MAM A;  1MMA A;  5IN1 A;  5A2Q E;  5GAO m;  5GAM g;  3CCM Q;  2CZ0 B;  2V8I A;  2QTV A;  2L2P A;  3VJP A;  2MCN A;  1C0M A;  1VQP Q;  1GXI E;  2RJC A;  1RI9 A;  4JLG A;  1VQ8 Q;  4C92 D;  8AT1 B;  3NTK A;  2DZC A;  4J9F A;  4QT7 A;  2JMA A;  3OBY A;  2XKO C;  2MPX C;  2PNI A;  1QMC A;  3C95 A;  3FRN A;  1YIJ T;  1X2K A;  3LWH A;  3CCR A;  4C0F A;  1ZA2 B;  1VQ7 T;  3CCV T;  1OQK A;  4ZN3 A;  3TSW A;  3PMT A;  4D6W A;  3S3N A;  4JS5 A;  5KCO A;  1AVZ C;  2EAY A;  2XHC A;  5C0M A;  4QVD A;  4J9E A;  3OYM A;  1LVK A;  1WLP B;  4QVC A;  1EIF A;  5KYX B;  1AD5 A;  2RI3 A;  1M2V B;  3MKD A;  3I56 A;  4E7I A;  1EX4 A;  3DKM A;  2YT6 A;  1UFF A;  5GAM j;  1MHN A;  1K73 U;  1BK2 A;  2RD1 A;  1XOV A;  2KRN A;  8ATC B;  1VUB A;  3KBG A;  3A98 A;  1X6O A;  3CCE T;  4RCC A;  4RTZ A;  4HVV A;  2K5F A;  2KMT A;  1KG1 A;  1KHI A;  3O8V A;  3CMA Q;  5FU6 C;  4C8Q C;  4C8Q E;  2KYM A;  5D6X A;  3CCS Q;  2DYI A;  2QTX A;  1Q81 R;  2QEX Q;  3NTH A;  5HK3 A;  3V7S A;  5GAO n;  4XU0 A;  2F5T X;  2K5I A;  1OX9 A;  2DEQ A;  5CKE A;  2FPD A;  2ROL A;  4KBM B;  1M5Q 1;  5LJ5 f;  3RMQ A;  1YIJ A;  3OYC A;  2BZY A;  2OTL Q;  5HY6 A;  2D6F A;  3EGU A;  2E4H A;  2IIM A;  3CCV A;  2G6F X;  1PG5 B;  4ELZ C;  2Y90 A;  3CCQ Q;  4QKU A;  1G83 A;  4M7A A;  3SHW A;  2COY A;  1Q95 G;  2AZS A;  1YJ9 Q;  2RMO A;  1OUL A;  1K8A R;  2NUZ A;  3N5B B;  1KQS P;  1BI3 A;  5FRM A;  3EFO B;  3MPU B;  1UHF A;  1T3S A;  2JM9 A;  4RTY A;  1U3O A;  2CUB A;  3FIF A;  4PFP A;  1VYU A;  3CPW S;  1SG5 A;  1G5V A;  2LQ8 A;  3OS5 A;  2B8A A;  4C5E A;  4II1 A;  1M1F A;  1YN8 A;  2DBK A;  3KXT A;  3X25 B;  2JOY A;  1I81 A;  5D6Y A;  2LJ3 A;  2KSS A;  1VQ4 Q;  3QZ5 B;  2EQM A;  1NYG A;  2VYT A;  1CKB A;  2C0T A;  2HCK A;  3V8J A;  3OYB A;  2YXY A;  4BB7 A;  2DYB A;  4PL6 A;  4BD3 A;  4CRI A;  2YUP A;  1SSF A;  2DJQ A;  5I2S A;  3CCE A;  2XG8 D;  1KHC A;  2QI2 A;  3OYJ A;  2XU8 A;  5GJV B;  3A8G B;  2EGC A;  3EG2 A;  5FU7 C;  2Z0W A;  4JLI A;  3E19 A;  1VQO T;  2QQB A;  4A4H A;  1U8R A;  4QQG A;  1FMV A;  4OVA A;  2ZPI B;  1PHT A;  4KUD K;  1VQ5 T;  1KFZ A;  3QUI A;  5A0L A;  1QVF P;  2ZPH B;  3NMZ C;  2EYZ A;  1WHH A;  5EC7 A;  1ZBJ A;  3C94 A;  4EPC A;  1NM7 A;  4AMC A;  2PVO B;  3MO8 A;  5CKB A;  3SEM A;  2FRW A;  4XTU A;  4JJB A;  4IUV A;  4XTV A;  2HL3 A;  2D8H A;  3TSZ A;  1HSQ A;  5DLQ E;  3M59 A;  1VQL T;  2HKQ B;  3NTI A;  3L2Z A;  1PC0 A;  2PVG B;  2L3S A;  1AWO A;  2FPE A;  1OPL A;  2A37 A;  1JXO A;  1KIK A;  2CP0 A;  3QYH B;  5GAM f;  3G7Z A;  2EFI A;  1OU8 A;  1N5Z A;  5KE3 A;  4RCB A;  4M7D E;  2JZ2 A;  5FWC A;  2XID A;  1PWT A;  1SF9 A;  1KD1 U;  1YNZ A;  3OYL A;  4KUL A;  4ZGD B;  3HFN A;  1F1B B;  5L8R E;  3JB9 F;  1YJW Q;  1HYO A;  2X35 A;  4M78 C;  2QGF B;  1TU0 B;  3RUX A;  4M78 E;  2KT1 A;  1KSW A;  1QVP A;  4F7U E;  1N8R C;  1VIE A;  4A4G A;  1VQO A;  1VQK Q;  5CO7 A;  4JJC A;  2I0N A;  2QA4 T;  1VQ5 A;  5LL6 S;  2VC8 A;  4EMH A;  3QYG B;  3R6O A;  4L5G A;  2RHI A;  4M77 E;  2OAU A;  2VVK A;  2DZ9 A;  3X20 B;  1WNL A;  4RTX A;  3I5S A;  2O9S A;  4JS4 A;  2KGT A;  1Q82 U;  4QQD A;  2OX7 A;  3OYY A;  1D1A A;  5CAI A;  3J7A F;  2FHD A;  1JQQ A;  1VQL A;  3JB9 D;  1U1S A;  2L8D A;  1K9M R;  2RQV A;  3ZBD A;  2M0O A;  1U1T A;  2A0F B;  1MV0 B;  1KC8 C;  1ZBX A;  2E64 A;  1BI2 A;  3I55 Q;  3M0T A;  3DB3 A;  4PJL A;  5DM7 R;  5CKD A;  1E7O A;  1D09 B;  2JNG A;  1YJN T;  4N0A A;  3H0F A;  4JPB W;  2LCL A;  2M51 A;  1VYT A;  2HQH A;  4J5Y A;  2YDL A;  1QVG S;  3RIR A;  4M7A C;  3L2V A;  4DBF A;  2EVR A;  3C12 A;  2HNI A;  1AEY A;  5FU7 B;  4IKF A;  4QVZ A;  2DXC A;  3EHR A;  4PK4 A;  2YRC A;  3PIP A;  3VYG A;  1LPL A;  2CP7 A;  3LX7 A;  5KYW A;  2L3Q A;  2QA4 A;  3EG9 B;  2ED1 A;  2GFA A;  1IB8 A;  1K0X A;  4PJO F;  4JUV A;  4N4I A;  2ZPB B;  4FW2 A;  3JCM g;  3HHT B;  1ZUK A;  2GQI A;  3CC7 T;  1A0N B;  2DF6 A;  4A54 A;  2HSP A;  3M53 A;  3ZEH A;  3OS1 A;  1YCY A;  1T3L A;  1AHJ B;  3R6N A;  9ATC B;  2DTH A;  1RAI B;  4EMK A;  5A0G A;  1Q7Y R;  3CXC A;  4EIK A;  2DA9 A;  3JB9 I;  2KVQ G;  2RJF A;  1V76 A;  1V29 B;  1PCX A;  2H3E B;  4LDU A;  1P92 A;  4M7D G;  1TXQ A;  1WHL A;  2Y4Y A;  1W6X A;  1YJN A;  1QP2 A;  3EG1 A;  4FL6 A;  4QQ6 A;  4PJO B;  2LQW A;  5KE2 A;  4PJO D;  1K4U S;  3S3O A;  4XAX B;  1WHJ A;  3CCR Q;  1H8K A;  1D0X A;  4ZTF A;  3MJX A;  2DK3 A;  2X3W D;  2YHT A;  5GAN h;  2NYS A;  2J7I A;  4LD9 K;  3EH2 A;  4UC4 A;  3CQT A;  3FLG A;  1QLY A;  5LJ3 h;  1X6G A;  3VV0 A;  3VS0 A;  2RHZ A;  3JCM c;  3VS3 A;  1KJW A;  1MUZ A;  2CRE A;  2DAQ A;  2SRC A;  4PNO A;  5KH6 A;  3RR6 A;  3E2U A;  4Y91 A;  1ZUU A;  4C8Q A;  3HRT A;  2NLU A;  3QDF A;  4M77 G;  1KQS S;  2ZAE A;  2YUN A;  1YHQ Q;  1RAG B;  1M90 R;  2O2O A;  2IG0 A;  3WXM B;  2CSI A;  3SFM A;  1N6A A;  5GAN j;  2LNH B;  2P0Q A;  3OYI A;  2NUT A;  4M7A F;  3CC7 A;  5A0D A;  1SKU B;  1LNX A;  2K3B A;  1WZO A;  5LJ3 j;  1W4S A;  2K57 A;  4YTL A;  3OSS C;  2RHY A;  2QGG A;  2BZ8 A;  3G71 T;  2RQR A;  3CCU T;  5GAO r;  4HCK A;  1VQ6 A;  5GAN e;  1N8R U;  5LJ5 h;  2XMF A;  3CBM A;  1AWX A;  3OMC A;  1R8O B;  1OZ2 A;  2GTO A;  3GPL A;  1GFC A;  2WSF E;  5LJ3 e;  4MML A;  4CC2 A;  3OMG A;  3J81 E;  4C5I A;  2ENM A;  3G4S T;  1MMD A;  1QVF S;  2CT4 A;  2JMC A;  1JU5 C;  1VQ7 Q;  5FW9 A;  4M7A B;  4M7A D;  3RKY A;  2EWN A;  3L2R A;  5EG2 A;  2JN0 A;  1JRI A;  3L1A A;  4C0G A;  3ME9 A;  2F69 A;  2K2V A;  1O9S A;  3CCJ Q;  4ZN1 A;  3CCL T;  1LJO A;  4EDU A;  1VQN T;  4LUD A;  2K2M A;  2B86 A;  1KC8 U;  3TCJ A;  2FG0 A;  2YRD A;  2EKH A;  2ZZD A;  3MEV A;  4AG2 C;  1Q81 C;  3M57 A;  2K7A A;  5CKF A;  1M1K R;  2HQE A;  4MDW A;  4N0A C;  1BI1 A;  5KCH A;  2LJ0 A;  3I56 T;  2J6O A;  5LJ5 e;  1GCP A;  3M0R A;  1QP3 A;  3OB9 A;  1YI2 Q;  1S72 Q;  3RES A;  4ATO A;  2QAS A;  1RUW A;  1JEG A;  4RTW A;  1Y57 A;  1WYX A;  5IXF A;  1WQW A;  3G71 A;  2YUO A;  5GAN 2;  1UTI A;  1Y0M A;  3CCU A;  1HK9 A;  1K8A C;  2O88 A;  3UF4 A;  1PRM C;  3X28 B;  1GCQ A;  2FYK A;  5CK9 A;  3M0Q A;  4IUR A;  2RHX A;  3JB9 J;  3MP1 A;  1FMK A;  2CP5 A;  2LX9 A;  4C0D C;  4FW1 A;  2EGA A;  1ZUY A;  4EMG A;  1H3Z A;  2O9V A;  2MWO A;  7AT1 B;  3G4S A;  1I1J A;  2CP2 A;  2R5M A;  1R0B G;  1G3W A;  2LTO A;  1PKS A;  4M7D A;  1ABQ A;  1UGV A;  2BE9 B;  1KD1 C;  4EMK C;  5IT9 E;  2DM1 A;  2H3J A;  1PSF A;  4C92 G;  5GAM h;  2DLP A;  3CCL A;  4Z02 A;  3RBB B;  3JCM f;  1VQN A;  3L2W A;  3REB B;  4PLL A;  3JCM b;  1RAC B;  4C5H A;  2J06 A;  4M78 A;  4CC4 B;  2X4Y A;  2E6N A;  4F7U A;  3VS6 A;  3CC2 Q;  2M02 A;  2RQT A;  1U5S A;  4B9X A;  5GAN f;  1SRM A;  1AZE A;  4RTV A;  1QWE A;  1KQ2 A;  1MMN A;  2X51 A;  2DNU A;  5LJ3 f;  5IAY A;  2YWW A;  3UPU A;  2F1L A;  4M77 A;  4J6W A;  1VQ9 T;  3EAE A;  2OAW A;  1C6V X;  1Q82 C;  3PE0 A;  4RKU E;  1NPP A;  2K3Y A;  1WHM A;  3JAM E;  1H92 A;  1FX7 A;  1I5O B;  2JVV A;  4DOV A;  2KDS A;  5GMK l;  1BU1 A;  1VQO Q;  4OMN A;  2QDY B;  2FZK B;  5I2M A;  5GAM e;  4HA8 A;  2JTF A;  3ASK A;  1MNE A;  2RQU A;  2VWF A;  1BCO A;  3A5Z B;  1NJI R;  1TG0 A;  2E3H A;  4JRK A;  4HT9 A;  4R56 A;  2LT1 A;  2HBP A;  1GL5 A;  4J8O A;  5J26 A;  1UJ0 A;  1YIT T;  4E7L A;  1Y07 A;  3EFR A;  3BY7 A;  4J9I A;  3C4S A;  3JV3 A;  4FSX A;  5IXB A;  3MEU A;  1M4Z A;  3HP9 A;  5M9O A;  3H9N A;  2P0P A;  2EQI A;  2P0K A;  4D8K A;  1QKW A;  1JJ2 P;  4E7Z A;  5I11 A;  2DEU A;  2E6Z A;  1VQ8 T;  4XU3 A;  2FO0 A;  5HKC A;  3QSU A;  2KT8 A;  2M16 A;  2W10 A;  2EQJ A;  2AK5 A;  5FWB A;  1IGQ A;  2X9H A;  1WXU A;  1WPY A;  4Z8A A;  1EZZ B;  2A3L A;  4J9B A;  2D1X A;  2O4X B;  1I8F A;  3M54 A;  1VQ9 A;  2V1Q A;  4PFZ A;  4L59 A;  3SWN A;  3OYH A;  2CP6 A;  2V8K A;  1WHK A;  4FCY A;  3DB4 A;  1K9M C;  1W70 A;  2HAX A;  3PNW C;  5KYW B;  2ZGW A;  4RG2 A;  4OB2 B;  4LDW A;  2KRM A;  4J9H A;  1MMG A; 
#chains in the Genus database with same CATH homology
 3QDR B;  1KC8 C;  1Y96 B;  1ZBX A;  2E64 A;  4J7F A;  3UWN A;  1BI2 A;  4C92 B;  2XDP A;  3SD4 A;  3DB3 A;  3MP6 A;  2VXE A;  2EIF A;  5DM7 R;  5CKD A;  4JRQ A;  3SDZ A;  1Q81 U;  5GMK e;  1N9R A;  3OW2 A;  2JNG A;  4ME7 A;  4C0D B;  4NL3 A;  1M1K U;  4BI8 B;  1YJN T;  4N0A A;  3VYH B;  2E12 A;  1XQH A;  4PJO A;  2LQK A;  3LGL A;  4XTX A;  3WVE B;  4Q5W A;  3MET A;  2LCL A;  1YIT A;  3A8H B;  2MF2 A;  3KUF A;  2RM4 A;  3QPH A;  1OZ3 A;  4XTZ A;  2BKD N;  4J5Y A;  2DTI A;  4EMK B;  3HRU A;  5GAO p;  3OYG A;  2YLB A;  1QVG S;  1I5L A;  2MWP A;  3RIR A;  3QJY A;  3CCM A;  3TU4 K;  4M7A C;  4BDY A;  2E65 A;  3CCJ T;  2R5A A;  3L2V A;  3UT1 A;  1KG1 A;  2ZCF B;  2WSE E;  4M75 A;  2EJF A;  2LVM A;  3SB2 A;  3C12 A;  2HNI A;  2DD5 A;  3OYK A;  1WJR A;  4XK8 E;  5FU7 B;  3L42 A;  4IKF A;  2IVW A;  2DIG A;  4QVZ A;  4C8Q F;  3CCS T;  4KT0 E;  1K8A U;  2DXC A;  2WAC A;  4XU2 A;  3M55 A;  4BAC A;  4HCB A;  2X4J A;  4HT8 A;  2VV5 A;  3PIP A;  2BIV A;  3EFS A;  3VYG A;  2FB7 A;  3LX7 A;  2JTM A;  4DQ2 A;  1XTD A;  1YHQ A;  1VQ8 A;  3I55 A;  2DXU A;  3CBP A;  2QA4 A;  1WJQ A;  3OYD A;  1Y96 A;  1QVG A;  2GFU A;  4C92 A;  3GLX A;  2GFA A;  4BE2 A;  1ZQ1 A;  3QII A;  3S3M A;  4PJO F;  4JUV A;  5I21 A;  3L2Q A;  3FC3 A;  4N4I A;  3OBW A;  4M7A G;  3CD6 T;  2ZPB B;  1UGP B;  4FIB A;  1IRE B;  3OSV A;  2A7Y A;  1NJI C;  3JCM g;  3HHT B;  3RMS A;  2OTJ T;  1N27 A;  4M7D C;  2O01 E;  3DLL A;  3CC7 T;  1RL2 A;  1YI2 T;  1S72 T;  4A54 A;  3PTA A;  3CEY A;  3CCR T;  3M53 A;  4BI4 A;  2QQ9 A;  3LH0 A;  2DTO A;  1YCY A;  3A8O B;  3ZEH A;  3OS1 A;  1JB0 E;  1AHJ B;  2FL7 A;  5LJ5 j;  4OGE A;  2DTH A;  4EMK A;  4V2S A;  3QZ9 B;  3M9Q A;  5DY9 A;  3RKW A;  5A0G A;  4BE0 A;  4E7K A;  1YJ9 T;  3AHU A;  3QG1 A;  4J83 A;  3CXC A;  4A53 A;  1Q7Y C;  3CCM T;  3OQ5 A;  2CS7 A;  3G6E A;  2RA2 A;  1B34 B;  3JB9 I;  2KVQ G;  2EJ9 A;  2RJF A;  4BDZ A;  3QJ6 A;  2KY9 A;  1V29 B;  4OB3 B;  5CVI A;  5FU6 B;  5AYF A;  1VQP T;  4LDU A;  4JRP A;  1P92 A;  4C8Q B;  3GF5 A;  1O75 A;  4C8Q D;  4C92 F;  4J6X A;  2KQW A;  4M7D G;  2F5K A;  5GMK m;  4X9D A;  2Y4Y A;  3LW5 E;  2D0Q B;  5GAN 8;  1FWZ A;  3HSB A;  4DOW A;  1YJN A;  4BUG A;  4LDX A;  1QP2 A;  4FL6 A;  3MP8 A;  4QQ6 A;  3PT9 A;  4PJO B;  2QXF A;  5KE2 A;  3JCM J;  1VQ7 A;  4PJO D;  3S3O A;  1OI1 A;  1UEB A;  4XAX B;  5J3B A;  2CYZ B;  4ZTF A;  5GAN 5;  2E70 A;  1FXX A;  3WVD B;  2PVD B;  4KUI A;  4M77 C;  2DK3 A;  1XNI A;  2YHT A;  3M5A A;  1JBM A;  4M75 E;  1W2B S;  2E41 A;  2EYQ A;  5GAN h;  3CCJ A;  2MAM A;  3CMA A;  5IN1 A;  3V8K A;  5A2Q E;  5GAO m;  2XIC A;  3HFO A;  5GAM g;  4LD9 K;  2CZ0 B;  2V8I A;  4HCC A;  3MEA A;  5GAN 7;  3J80 E;  4UC4 A;  2MMP A;  3VJP A;  1X75 C;  2PQW A;  3FLG A;  3NFC A;  3CCS A;  3PGG A;  4J6Y A;  5LJ3 h;  5DLO A;  3VV0 A;  2RHZ A;  1B34 A;  3JCM c;  4A4F A;  3CC2 T;  5CR2 A;  4B9W A;  1GXI E;  2X4X A;  2DAQ A;  4PNO A;  5KH6 A;  2QEX A;  3LGF A;  5CIU A;  2RJC A;  5GAN 3;  4JLG A;  4Y91 A;  2CZ7 B;  1JJ2 A;  4C8Q A;  3HRT A;  2NLU A;  3CME T;  4M77 G;  1KQS S;  4TVR A;  4NOY A;  2K5L A;  3OYA A;  4C92 D;  5FLX E;  3NTK A;  2DZC A;  2IG0 A;  3PIO A;  3WXM B;  3CD6 A;  1NJI U;  3OBY A;  3SFM A;  2XKO C;  3P8D A;  1N6A A;  5GAN j;  1X01 A;  2RB6 A;  2P0Q A;  4OB1 B;  3C95 A;  2QQR A;  3VKI A;  3OYI A;  2OTJ A;  3FRN A;  4M7A F;  1YIJ T;  3CC7 A;  1YBY A;  1YI2 A;  4E47 A;  1S72 A;  4N4G A;  2ZPF B;  3LWH A;  5A0D A;  3CCR A;  4C0F A;  2HD0 A;  3GNG A;  1VQ7 T;  3CCV T;  1LNX A;  2RI5 A;  4VUB A;  2KK4 A;  5LJ3 j;  1W4S A;  2K57 A;  4ZN3 A;  1YJ9 A;  2BUD A;  4YTL A;  2G3R A;  3OSS C;  3ZFJ A;  2RHY A;  3L2U A;  3PMT A;  4D6W A;  3S3N A;  1Y71 A;  5HK0 A;  3G71 T;  2QQA A;  2YRV A;  4JS5 A;  3CCU T;  1ZHI A;  5KCO A;  5GAO r;  3CMA T;  2EAY A;  2XHC A;  5C0M A;  1VQ6 A;  4QVD A;  4FT4 A;  5GAN e;  3OYM A;  1VQP A;  1N8R U;  3T9N A;  2GF7 A;  4LD6 A;  5GAN 6;  4OMF B;  3CBM A;  2GQV A;  3V7R A;  4QVC A;  5LJ5 h;  3OYF A;  1EIF A;  1G3Y A;  3OMC A;  1R8O B;  2DO3 A;  1Q86 C;  2RI3 A;  1OZ2 A;  3GPL A;  3I56 A;  2QEX T;  4E7I A;  1VQ4 A;  2WSF E;  3DKM A;  5LJ3 e;  3E9F A;  4IUU A;  4M7D F;  4MML A;  1N9S A;  3OMG A;  5GAM j;  1MHN A;  3J81 E;  1K73 U;  3M4G A;  4C5I A;  2RD1 A;  3G4S T;  1QVF S;  2VGM A;  4QW2 A;  1XOV A;  1M1G A;  1VUB A;  3KBG A;  1Y7X A;  4LDV A;  1X6O A;  1VQM T;  2OTL T;  4X9C A;  2RJE A;  2XD0 A;  3P8H A;  4M7A B;  5FRN A;  4M7A D;  3RKY A;  1M9S A;  2KAF A;  2EWN A;  2RH2 A;  4JRI A;  3SWN C;  4RCC A;  3CCE T;  3L2R A;  2EJG A;  5EG2 A;  2JN0 A;  1JRI A;  3L1A A;  3CCQ T;  4M78 F;  2AHJ B;  2K5F A;  2KMT A;  2L89 A;  2XI9 A;  1KHI A;  3ME9 A;  2F69 A;  2K2V A;  1O9S A;  4ELY C;  4F7U F;  4R55 A;  3O8V A;  4ZN1 A;  2VGN A;  1LJO A;  3CCL T;  4EDU A;  2RK1 A;  5FU6 C;  1VQN T;  1TH7 A;  1VQK T;  1K9M U;  4L6V 5;  3S6W A;  4C8Q C;  3CC2 A;  1QW1 A;  3QXE B;  3A8L B;  1LOJ A;  2DD4 A;  5D6X A;  4C8Q E;  1UB4 A;  5CQY A;  3MCA B;  2YLC A;  1KC8 U;  3OYN A;  4PKC C;  3TCJ A;  3PMI A;  1BYM A;  1VQ6 T;  2QTX A;  2X4W A;  2ZZD A;  4OP0 A;  3M56 A;  3MEV A;  3CME A;  1Q81 C;  4HCZ A;  3M57 A;  2DPP B;  3NTH A;  5HK3 A;  5CKF A;  3V7S A;  2HQE A;  1M1K C;  4MDW A;  4N0A C;  5GAO n;  4XU0 A;  2L3R A;  4JDS A;  1BI1 A;  2F5T X;  4PJO C;  2K5I A;  2DEQ A;  5CKE A;  5KCH A;  3P8B B;  4PJO E;  4M77 F;  3I56 T;  2PU9 B;  2L5Q A;  4KBM B;  1VQ4 T;  1M5Q 1;  5LJ5 f;  3RMQ A;  5LJ5 e;  1YIJ A;  4M7D B;  4M7D D;  3OYC A;  3JCM X;  1QP3 A;  3JCM h;  2DVE A;  5HY6 A;  3JCM V;  2D6F A;  3MHX A;  2CGH A;  3OB9 A;  4Y28 E;  1M8V A;  4C8Q G;  3CCV A;  3RER A;  4ATO A;  3RES A;  4ELZ C;  2Y90 A;  2FVU A;  3BFM A;  4M75 C;  4M7A A;  1NZ9 A;  3OY9 A;  1WQW A;  2MI6 A;  3FJP A;  3G71 A;  4JJN K;  4IUP A;  5C6S A;  5GAN 2;  4WF2 A;  1H64 1;  3CCU A;  1HK9 A;  4GLK A;  4M78 B;  4E7H A;  5LJ5 d;  4M78 D;  1K8A C;  3V8L A;  3N5B B;  4PJO G;  4F7U B;  1BI3 A;  5FRM A;  4BY6 C;  2RJD A;  3GNF B;  2E5Q A;  3FDR A;  3H8Z A;  4C0G A;  3FIF A;  3HRS A;  3X28 B;  2M1H A;  3CPW S;  1G5V A;  2FYK A;  2LQ8 A;  4A4E A;  4C92 C;  5CK9 A;  3X26 B;  3OS5 A;  3MEW A;  4IUR A;  2B8A A;  2CZ1 B;  1G3S A;  3LYI A;  3QKJ A;  4II1 A;  2RHX A;  4C5E A;  1M1F A;  3FB9 A;  4C92 E;  3MP1 A;  3JB9 J;  2DJZ A;  5GMK i;  2D9T A;  3URG A;  4J7I A;  3KXT A;  3X25 B;  4ZTJ A;  2VXF A;  2LX9 A;  2LDM A;  2JOY A;  4C0D C;  1I81 A;  4M75 G;  5D6Y A;  1W2B A;  2Y4X A;  4EMG A;  2KSS A;  1H3Z A;  3VUZ A;  3QZ5 B;  1WJS A;  2EQM A;  2JUF A;  2MWO A;  3Q1J A;  2E10 A;  3G4S A;  2VYT A;  5GMK j;  5CQX A;  1M90 C;  2R5M A;  2RO0 A;  2PUO B;  1I4K 1;  3V8J A;  2R58 A;  3OW2 S;  1VQM A;  4M77 B;  3JB9 G;  1G3W A;  2LTO A;  4M77 D;  2OTL A;  3OYB A;  4M7D A;  4BB7 A;  4PL6 A;  1KD1 C;  4BD3 A;  4EMK C;  5IT9 E;  2EKO A;  4HKE A;  1SSF A;  4BI3 A;  4CRI A;  5I2S A;  2H3J A;  2XG8 D;  4OB0 B;  5GAO q;  3A8M B;  3CCE A;  1KHC A;  2QI2 A;  4FU6 A;  3CCQ A;  3BDU A;  1PSF A;  4C92 G;  2XU8 A;  4MZP A;  5GAM h;  3OYJ A;  1WGS A;  3A8G B;  1Q7Y U;  3CCL A;  2ZPG B;  5CKH A;  3OS0 A;  4Z02 A;  5CCA A;  3JCM f;  3JCM e;  1VQN A;  3JSC A;  5FU7 C;  1IZ6 A;  3CC4 T;  1NPR A;  1VQK A;  3L2W A;  1KQS A;  3JCM b;  4PLL A;  2EQU A;  3JRZ A;  4JLI A;  4NL2 A;  3JB9 H;  4C5H A;  4M78 A;  2X4Y A;  3E19 A;  1VQO T;  2QQB A;  4A4H A;  2E6N A;  1U8R A;  4F7U A;  4QQG A;  4OVA A;  2ZPI B;  4B9X A;  4KUD K;  5GAN f;  3OA6 A;  3F70 A;  3QUI A;  1HXD A;  5A0L A;  4C5G A;  1VQ5 T;  2ZPH B;  3M58 A;  1KQ2 A;  3C94 A;  3UDC A;  1G3T A;  3JCM d;  2K3X A;  4EPC A;  2CKK A;  4FM4 B;  2K4Y A;  5LJ3 f;  2PVO B;  3CPF A;  2QQS A;  4MMK A;  3MO8 A;  5IAY A;  5CKB A;  2O4X A;  4M7A E;  1BIA A;  4XTU A;  3UPU A;  5FRO A;  3BDL A;  4IUV A;  5GAN d;  4XTV A;  4M77 A;  3JCM W;  4J6W A;  1VQ9 T;  3EAE A;  4FT2 A;  3LLR A;  4A4K A;  1BI0 A;  5DLQ E;  1Q82 C;  4RKU E;  1YJW T;  3M59 A;  1NPP A;  2K3Y A;  3JAM E;  4NS5 A;  4N4H A;  1VQL T;  3NTI A;  4ZGJ B;  1FX7 A;  2M9U A;  2PVG B;  3L2Z A;  2JVV A;  4DOV A;  5LJ3 d;  2KDS A;  4IUQ A;  3H6Z A;  5GMK l;  3TEE A;  4PLI A;  3CXC S;  2QDY B;  3QO3 A;  3VU3 C;  2XDD A;  4ZGE B;  5I2M A;  2DIQ A;  3QYH B;  5GAM f;  5GAM e;  3G7Z A;  1QVF A;  2EQK A;  2JTF A;  2RI2 A;  3ASK A;  4HA8 A;  2EFI A;  3GP8 A;  1BKB A;  3A5Z B;  1M90 U;  5KE3 A;  4BE1 A;  4JRK A;  4RCB A;  2LRQ A;  4DA4 A;  4HT9 A;  4R56 A;  2LT1 A;  2JZ2 A;  4M7D E;  2HBP A;  4J8O A;  5J26 A;  2XID A;  1YIT T;  1KD1 U;  3RKX A;  4E7L A;  1Y07 A;  5D6W A;  4RMO A;  1D3B B;  1UGR B;  4M75 F;  2DKG A;  5GAO l;  3OYL A;  3EFR A;  4KUL A;  4ZGD B;  3HFN A;  4OF1 A;  5GAN g;  3BY7 A;  2E1H A;  3SWN B;  5GAM d;  1OYX A;  2GCX A;  3FEO A;  2P4T A;  3V7C A;  5L8R E;  4LDY A;  4MDX A;  3JB9 F;  3C4S A;  2DXT A;  2X35 A;  3E9G A;  3M4Y A;  4FSX A;  3MEU A;  4O6J A;  4XTY A;  4M78 C;  1M4Z A;  3HP9 A;  5M9O A;  3RUX A;  4M78 E;  3QBY A;  3X24 B;  5GMK h;  2R57 A;  2CZ6 B;  2P0P A;  3ER0 A;  5LJ3 g;  3CC4 A;  1QVP A;  1VIF A;  2P0K A;  2XK0 A;  4F7U E;  3INZ A;  3GIB A;  3TRE A;  1N8R C;  1VIE A;  4A4G A;  2XDB A;  4XTW A;  1VQO A;  2RK2 A;  2C06 A;  3LWI A;  5CO7 A;  1UGQ B;  4X34 A;  2E6Z A;  1YHQ T;  1VQ8 T;  3I55 T;  4XU3 A;  2QA4 T;  1VQ5 A;  4MZM A;  3VUB A;  1Q86 U;  4C0Z A;  1WQ7 A;  5LL6 S;  2LNV A;  2VC8 A;  2I2L A;  1RI0 A;  5HKC A;  4E7J A;  4CI0 C;  4O5V A;  2LT4 A;  3QYG B;  4EMH A;  5GAN 4;  3QSU A;  3R6O A;  2M16 A;  3JCM Q;  4RG8 A;  3OS2 A;  3OYE A;  1K73 C;  2LC4 A;  2EQJ A;  1JJ2 S;  4L5G A;  4M78 G;  2RHI A;  1NE8 A;  5J39 A;  4M77 E;  2OAU A;  4F7U G;  2DZ9 A;  3X20 B;  2DXB A;  1WPY A;  3QHS A;  1KQ1 A;  1WNL A;  4MZT A;  2A3L A;  3E1S A;  1BIB A;  2O4X B;  3CBO A;  4JS4 A;  1I8F A;  1Q82 U;  2RHU A;  1D3B A;  4QQD A;  3BW1 A;  3DLM A;  3M54 A;  4M75 B;  3OYY A;  1VQ9 A;  4M75 D;  4XQ3 A;  4GY5 A;  3JCM P;  2LCC A;  5CAI A;  3J7A F;  3HKS A;  2PUK B;  3HPW A;  1MGQ A;  3PFS A;  2FHD A;  4L59 A;  4P5N A;  3SWN A;  2V8J A;  3OYH A;  1YJW A;  1VQL A;  3HL8 A;  4OGC A;  2V8K A;  3G6E T;  3CPW A;  3GOX A;  3JB9 D;  2WSC E;  1U1S A;  2L8D A;  4XU1 A;  1PSE A;  3DB4 A;  1UGS B;  2M0O A;  3ZBD A;  4BY6 B;  2VUB A;  1U1T A;  2ZPE B;  4IUT A;  3PNW C;  1K9M C;  2HAX A;  2ZGW A;  4RG2 A;  4OB2 B;  4LDW A;  1DJ7 B;  2HQX A;  5LJ5 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...