3JCMX

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
70
Chain Sequence
MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINANNHQLGTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 7
structure length 70
sequence length 76
chains with identical sequence a
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmX00
4M75C 4EMHA 2E64A 4NOYA 5LJ5j 3FIFA 3HFNA 4M75G 4JRIA 4MMLA 2FYKA 1X01A 1Y96A 4M77E 3V7SA 3JCMQ 2YLCA 2ZGWA 5LJ5d 1M8VA 4M77D 1KQ1A 5GAOr 2E10A 2DTHA 4F7UB 4HT8A 4M7DA 2FB7A 4C92G 4X9CA 3RKXA 1H641 3SWNB 2EAYA 1U1SA 3BFMA 4C92F 4NL3A 2DTIA 5GMKl 2CGHA 5CAIA 4M7AA 4RCBA 5GAN4 2DZ9A 5GAN6 3JB9D 3EFSA 1JBMA 3QO3A 4JLIA 4M78B 1I4K1 5GMKe 3JB9J 2VXFA 4XQ3A 5LJ3g 4A54A 2RM4A 2JN0A 4C92E 3VU3C 1YCYA 4A53A 3V8LA 1BIAA 3JCMJ 5GAOq 4M78D 4PJOC 5LJ5e 2DEQA 5LJ3d 4EMKA 3V7CA 3HFOA 2QTXA 4M75F 5GAOm 4XTVA 4C92B 5I21A 2Y90A 5GAN5 2VC8A 4XU0A 3JCMd 4HT9A 4M7DD 2I2LA 4PJOG 1Y96B 5GAMd 4C8QA 3PGGA 3FB9A 4M7DE 3JCMX 3QHSA 2DKGA 4F7UA 4C8QF 1B34B 4Y91A 4EMKC 4V2SA 3SWNA 2DXUA 1WQWA 5LJ5h 4M77A 2DXTA 3RERA 3QSUA 2HNIA 4XU3A 2DTOA 2E1HA 4M77F 3QUIA 2E41A 1TH7A 4C8QC 5GAN2 3JB9F 1WPYA 4PJOE 4J6WA 4QVCA 4M7DG 4XTWA 4M78C 5LJ5f 2EJGA 2EWNA 4JUVA 4X9DA 5LJ3j 4PJOD 4QVDA 2DZCA 1LNXA 2DJZA 5GAN7 1B34A 3JCMW 5GAN3 4XU1A 2YHTA 4M7AC 4M7DC 1MGQA 4PJOF 4PJOB 4N0AA 4C8QD 3FJPA 4HA8A 4M78A 4C92A 3RESA 2E65A 4J5YA 5GANf 3M4GA 5LJ3h 4WF2A 5GANh 1WQ7A 3RUXA 2RD1A 3V7RA 4M7AG 1JRIA 1M5Q1 5GAMj 2EJFA 3SB2A 4M75A 5LJ5g 4M7DB 3RKWA 4XTZA 3JCMc 4C92C 4M77B 4DQ2A 5GANd 4M7AF 5LJ3f 4EMGA 4PJOA 5GMKi 5GMKh 3JCMg 4N0AC 4F7UE 5GAOp 3HSBA 1N9SA 5LJ3e 3BY7A 4XTXA 2RA2A 1BIBA 4C8QB 1N9RA 1D3BA 5GAOn 5GAMh 4M77G 4JRKA 3JCMf 5GMKm 1WNLA 4M77C 4C92D 1HXDA 4XTUA 5GANe 4M75B 3L1AA 1U1TA 3L2ZA 4M78E 3SWNC 5GMKj 3JCMb 4F7UG 4M7AB 1I5LA 4J6YA 3RIRA 1KQ2A 3JB9G 4XU2A 4M7DF 1LOJA 1I81A 3GIBA 3V8JA 4NL2A 3BDUA 3V8KA 1D3BB 5GANg 2YLBA 3JCMe 2EJ9A 3BW1A 2VXEA 5DY9A 2K57A 2DVEA 1LJOA 4M78F 4OP0A 3JCMP 4RCCA 1I8FA 5GAOl 3AHUA 4M78G 5GAMf 4C8QG 3JB9H 3JCMh 4MMKA 4M75D 5GANj 4M7AE 5GAN8 4M75E 4F7UF 4M7AD 4PNOA 5GAMg 1HK9A 2RB6A 3EFRA 3INZA 4J6XA 4XTYA 3JCMV 3RKYA 4C8QE 4EMKB 5GAMe 3JB9I
chains in the Genus database with same CATH superfamily
1YWOA 2KRMA 3FIFA 1QVGP 3JCMQ 5LJ5d 1NBEB 4O6JA 4OMNA 1VQ8A 2J6OA 2KXDA 2DZ9A 2F69A 4L6V5 2A08A 1I4K1 4BI3A 1MNDA 2KQWA 4A54A 3OYBA 2EYYA 5C0MA 2SEMA 2BE7D 4YTLA 1OULA 2XKOC 5DLQE 5LJ3d 3CCVT 2J6KA 1KC8C 5GJVB 3JCMd 3CBPA 2YUOA 1K73R 2LC4A 5CKFA 3QSUA 3PNWC 1WPYA 3EHQA 2BIVA 3VYGA 4M7DG 3GOXA 4M78C 1K8AC 2VASA 1LNXA 1UG1A 4IUPA 3CCMT 2R5MA 3DB3A 1AEYA 1ZSZA 4JJDA 4M7DC 4PJLA 1BB9A 1PNJA 1RAEB 4WF2A 4JRPA 5KYWB 4QQDA 1NJIC 1AVZC 1Y57A 4J9BA 1UGVA 4JDSA 1G3SA 4JZ4A 2QTVA 2RA2A 1VQ7Q 4ZNXA 1M2VB 2A37A 5HK3A 5GAMh 2DD4A 3HTRA 2HDAA 2DMOA 1HXDA 4LDVA 4XTUA 1KJWA 3L1AA 4M78E 1VQ8T 1Q7YU 4ATOA 1YIJQ 2O9VA 3R6OA 1VQ5T 1UHCA 2FVUA 1VQLQ 2K3XA 3LX7A 1U3OA 3CC2T 4QKUA 2K2VA 5CQYA 2ZPIB 2EGCA 1M3BA 2LTOA 3ASKA 1VQ4Q 2P84A 5GANj 2DL5A 2A7YA 1ZBJA 4ZGEB 2IIMA 3M0UA 2YUNA 1B7TA 1GCQC 3RKYA 3VUBA 2EQUA 2E64A 2HKQB 5I22A 2C0OA 2DYIA 2GTOA 4FU6A 5CKDA 5GAOr 1VUBA 3OA6A 1KSWA 1C0MA 2EAYA 4Q5WA 4DA4A 1M4ZA 3PMIA 3OW2S 3D7SB 1Q86U 3EH2A 3FC3A 2VUBA 4BB7A 2ZPFB 4VUBA 2X3XD 1VQ9Q 1YNZA 3PE0A 2WACA 4EMKA 2HMAA 1QVFA 3M54A 3PGGA 4D8DA 1SG5A 1GBRA 2KRSA 4XU3A 1WHMA 2FPDA 3QUIA 3NHNA 1VQ7A 5CQXA 3JRZA 2W0ZA 4PJOD 4X9DA 4C0DB 4M4ZA 4A4HA 1B34A 2LQWA 3BE3A 3CXCA 4XU1A 3CCLQ 4MDWA 2GTJA 4JJNK 2FPFA 3OS5A 2D6FA 2C0IA 3VJPA 2EPDA 1PM3A 2MWOA 2RHUA 1UJ0A 2X4XA 1VQLT 4E7HA 4J8OA 2MI6A 2HZYA 1NEGA 1RI0A 1R0BG 4LDXA 2F5KA 3CMEQ 3JCMf 2R5AA 1UJYA 1QMCA 1RLQC 1OZ3A 3GIBA 1Z9ZA 3V8JA 5HY6A 2ROTA 3X26B 2YLBA 3JCMe 2CP2A 3LGLA 1WLPB 3RNJA 3VUZA 5GAMf 3I55T 2YUPA 3UPUA 3OYDA 2M02A 1VQKQ 1HK9A 1OI1A 2XDBA 5FROA 1M30A 1V76A 1HD3A 2K2MA 3LWHA 1YWPA 2KAFA 1VQOQ 1GFCA 2P0KA 3C4SA 2VGMA 4HT8A 2PNIA 2ED1A 2D8HA 4LD6A 2K4YA 2CGHA 1MMAA 4M7AA 4RCBA 1KG1A 2QAZA 3E19A 1MUZA 5A0LA 3VS2A 1FMVA 2CYZB 2X3WD 1HSQA 2RM4A 2ZPBB 2IPOB 1RABB 2BZYA 2JMCA 2P0PA 4M75F 5KYXB 2VC8A 2EKOA 2DKGA 4F7UA 4AG2C 2CP7A 2EYZA 2LX7A 1IHWA 1RUWA 4M77A 3O8VA 5IAYA 2PU9B 1RAFB 2FZGB 3DKMA 3CCMA 2D8JA 1VQ4A 1RAGB 2COYA 3E2UA 2E5KA 4BI4A 1WX6A 1M1KC 3CMET 4N0AA 3LGFA 1QCNA 4DOVA 5GANh 2XDDA 2GQVA 2HKNA 1M5Q1 5IHIA 2EJFA 5FU6C 4IUTA 2CREA 1NM7A 3L2UA 5CVIA 3CCST 2GFAA 1SF9A 3VS5A 3HRSA 5FLXE 1PD0A 3OBWA 1UFFA 4J9IA 1VQPA 4HVVA 5GMKj 1PKTA 2O31A 4NL2A 4FT2A 3V8KA 2DL7A 4MZPA 5DY9A 1N27A 2F2WA 1YIJT 1WI7A 2KE9A 3KBGA 1X27A 3A98A 3RBBB 3JCMh 4J7IA 1X6BA 4NS5A 4GLKA 5GAN8 2AT1B 2EYWA 3NPFA 2RB6A 3EFRA 2L3RA 2YXYA 1M3AA 2KYMA 4L5GA 3EG0A 5GAMe 1M8VA 4NOYA 3G6EA 5CKBA 3C12A 5IXBA 1T0JA 1IXDA 2OAUA 1AD5A 2DTIA 4Y28E 3C95A 2DXBA 3MP1A 2H8HA 1WYXA 2GF7A 2K9GA 2VXFA 3BDLA 2JN0A 3ULRB 1BIAA 3JCMJ 3QPHA 1K9MR 5LJ5e 5KCHA 2DEQA 2FEIA 3HFOA 8ATCB 3OB9A 4C0FA 1N5ZA 1AHJB 3MP6A 3OYCA 3NTKA 4J9GA 4V2SA 2QA4A 4JS5A 4PK4A 2CZ0B 5KYNA 2E41A 4IURA 3UA7A 3CCMQ 1W2BS 5FRNA 4AT1B 4IUQA 2LCLA 2HBPA 1SRLA 1Q7YC 2FG0A 3OYMA 4RTZA 2E12A 2E5QA 1YITT 3FRNA 1XTDA 1M1KR 1K1ZA 2E70A 5FU7C 1AWWA 5LJ5g 4M7DB 1QVFP 1GCPA 4J9CA 4PJOA 4CI0C 3R6NA 2K5IA 1OU8A 4FW1A 3CCVQ 2LX9A 3T9NA 2DERA 2RHZA 2K5LA 3HHTB 4M75B 3JCMb 2OTLQ 4C0ZA 4FIBA 3HP9A 1QWFA 2M9UA 1LOJA 1J3TA 2V8IA 2K3YA 2PVDB 3DB4A 1VOMA 5GAOl 1KD1C 1BCOA 3H6ZA 4BD3A 1YBYA 4M7AD 4RTTA 1PWTA 5GAMg 2ABLA 5CKHA 5FRMA 2KBTA 1E6GA 3OYFA 1TTHB 1VQLA 1SPKA 2L3SA 1X01A 1YIJA 2HD0A 1BKBA 1YITA 5FWCA 3G4ST 2FHDA 2D0NA 4EPCA 2EGEA 1NLPC 1BI2A 3JB9J 3P8DA 1IGQA 3OYHA 4JPBW 1KC8U 1Z9QA 3OY9A 1HYOA 3EG2A 2FRYA 2F5TX 4IIOA 3TSZA 5D6XA 1VIFA 4LE9A 4C5IA 2NUZA 2HSPA 3QHSA 2QI2A 4C8QF 4OMLA 1GFDA 3QYGB 5FWBA 3RERA 1D0XA 2RQWA 2E1HA 3KXTA 4FCYA 4E7ZA 3ZBDA 2EQMA 1YCSB 2E6ZA 2LJ0A 5LL6S 3CPWA 2DZCA 1H3ZA 3CCSA 1KFZA 4F16A 2LVMA 3WVEB 4AFQC 2CP3A 2LP5A 2KDSA 5KYUB 2G3RA 4JZ3A 1TG0A 4C0DC 2NUPB 4A63B 1NYGA 4OB2B 2KRNA 4B6MA 1VQ9A 2CZ1B 3CPWP 2ZZDA 1QVGS 3QWYA 4TVRA 2GGRA 3CC2Q 2PVOB 2YDLA 1FXXA 1ARKA 4J83A 1SHFA 1QLYA 2EQJA 3LWIA 1WNLA 3OYJA 2NLUA 2COZA 4OB1B 2KNBB 2ESWA 3M0RA 3A8OB 3RMSA 3CCLA 4R56A 3EHRA 1K0SA 3L2QA 3JB9H 3HRUA 4ME7A 1K9MU 4MMKA 1Y7XA 1LPLA 2RH2A 3ZFJA 3M0PA 3QXEB 1WJSA 3PVQA 3FDRA 3NMZC 3HFNA 4JRIA 1I5OB 4LD9K 1WHLA 1YJNQ 4DBHA 1KD1U 1BK2A 3G7ZA 1ZA2B 6AT1B 4X9CA 3SWNB 2PUKB 2X35A 4E7LA 1ZSGA 5A0GA 1JB0E 2A3LA 2YWWA 4A4KA 4JLIA 1SSFA 4ZGDB 4KBMB 2YSQA 3OMCA 4R55A 4KH1B 2M16A 1M1KU 3GPLA 1OU9A 4HT9A 3CC4A 2RJCA 3NTHA 1ZLMA 2CP0A 3UATA 2JTFA 3SWNA 3GF5A 4KUIA 2X9HA 3OYIA 3M56A 1WFWA 1VQMQ 1QKXA 3REBB 4RG8A 2YUQA 2ECZA 3QWXX 3X20B 5LJ3j 1QVFS 4OMPA 5GAN7 3TCJA 1K73U 3QDRB 1JJ2A 1KK7A 1P92A 2QQSA 4BE1A 2XDPA 3RESA 2HQEA 2DILA 1OPKA 2E3IA 5DM7R 3RKWA 4LDYA 5L23A 4M77B 2B8AA 2K6DA 4HVUA 2F2VA 2CZ6B 4P5NA 3CC2A 1VQ8Q 2KR3A 2MIOA 2MF2A 4OGCA 2PTKA 4ZTJA 1VQNA 3SWNC 1QWEA 1H92A 3RIRA 1RL2A 1TSFA 2KK4A 3VRZA 3HPWA 4RUGA 3JCMP 1D1AA 1C1AA 1C6VX 2VB6A 2XMFA 2WSCE 2D9TA 2H3EB 1D1BA 5KCOA 4M75E 2X51A 4FW2A 1PG5B 5A0DA 2GBQA 1KHIA 4ESRA 2PQWA 3J81E 2L0AA 3VS1A 1AZEA 1YJWA 3THKA 1WJQA 4M77D 1ZUUA 5KYYA 4EIKA 4C92G 1ZQ1A 1OZ2A 1YN8A 3CCJQ 3CCQQ 3A8MB 5HCKA 3CCRA 2NUTA 1G8XA 3CCUQ 1Q81U 2X4YA 3VU3C 4C5GA 3VV0A 1WXUA 3EG9B 4ORZA 1Y96B 1VA7A 2CSIA 2DYBA 3O5ZA 2DXUA 3CCUA 4FYYB 2BE9B 3CCQA 3EGXA 2J05A 1JXOA 2KEAA 4D6WA 3JCMW 5GAN3 1MGQA 2O4XB 3TEEA 1IHVA 4M78A 9ATCB 2LMJA 3M4GA 5LJ3h 4II1A 3RUXA 4M7AG 2DEUA 1E7OA 2KGTA 2JW4A 1PC0A 4C92C 4OVAA 1BI0A 3X24B 4JJBA 2ZAEA 3BY7A 5LJ3e 3NTIA 1VQ4T 5GAOn 1KHCA 3UT1A 1X2KA 1PSFA 5KYXA 1X2QA 3M53A 3VRYA 1I81A 4HXJA 3PT9A 4X1VA 1VQNQ 1BI1A 1LVKA 2KSSA 2RJFA 1ZSZC 1BCMA 1WGSA 2RJDA 4ZN1A 1WHKA 5ECAA 5D6WA 2RNAA 2OTJA 1VQ5A 2P4RA 3CCEQ 2QA4Q 3LYIA 2PVGB 4EMHA 2SRCA 5LJ5j 1K8AU 3H9NA 3AHUA 2QA4T 1MV0B 1RACB 4CC7A 5CCAA 2ED0A 1SHGA 3S6WA 2LCSA 4E7KA 1W1FA 2L89A 3CC7A 5CAIA 2CT3A 3CXCP 2MMPA 3TU4K 4IUUA 3C94A 2RF0A 4Z02A 2GNCA 3MEVA 3EAEA 2EGAA 1E6HA 2RQRA 4UC4A 4MDXA 4C92B 1QQJA 3OS0A 3FB9A 4E7JA 1M3CA 5J26A 1UGRB 2HBWA 4C8QC 1KD1R 4PJOE 1EZZB 5KYWA 4QVCA 2EBPA 1ZUKA 2FZKB 4ZN3A 1YJ9Q 1ZSZB 2LJ3A 1M90C 3VKIA 1BBZA 2AIRB 4DBFA 2MAMA 1QCFA 3G71T 1JU5C 1KQSA 2OTLT 3M4YA 4OMOA 5AYFA 3JCMg 1OEBA 5GMKh 1FMWA 1RAAB 2EKHA 2JTMA 2F1LA 1M1FA 5GMKm 3WVDB 1Q86C 4GY5A 2DETA 4M7AB 3DLMA 4XU2A 1N8RC 2YT6A 2QQBA 2AKLA 2CP6A 2JS2A 3J80E 3SHWA 2RHIA 2AK5A 2DVEA 3JAME 4RCCA 2CZ7B 4KGZB 2J6FA 5FU6B 2DD5A 4C8QG 1VQKT 1IB8A 5IXFA 4DBRA 2CDTA 2DF6A 2XG8D 2ENMA 2C0TA 1N6AA 2RPNA 1MMGA 2DK3A 4HCBA 2P4TA 4D8KA 2L3PA 1MHNA 3X25B 3CPWS 3OYLA 4HCCA 3E1SA 3OS2A 5IN1A 2E10A 4CC4B 2B86A 4QQ6A 4RTYA 2RMOA 3KFVA 4JJCA 1NPPA 1VQ7T 4J7FA 2RO0A 3ME9A 2MYSA 2Y90A 1K8AR 2JNGA 2RK2A 2RI5A 1VQPQ 1R8OB 1UECA 3N5BB 5LJ5h 2RQUA 2HNIA 1XNIA 3M0TA 2OX7A 1MMNA 1UGPB 1XOVA 3G4SA 1YI2A 1G2BA 2QDYB 2RI3A 2QGFB 1FYNA 1QVGA 2IVWA 4DEYA 1QCOA 2Z0WA 4PJOF 1OPLA 2CH4A 3I9QA 2DRMA 1GCQA 3I56Q 3PIOA 3REAB 4E7IA 4M75A 1JJ2S 3CMEA 2J7IA 1VQMA 3OSVA 1D0ZA 4XAXB 4PJMA 1S72Q 1RADB 2O88A 3CCRT 4M77G 7AT1B 3LLRA 4PJJA 1SEMA 4M77C 4C92D 2EQKA 3S3NA 5GANe 1TU0B 3NFCA 3CC4Q 3EGUA 1KQ2A 3EFOB 3EGXB 5GANg 3BW1A 1PKSA 2VXEA 4J9HA 1IREB 4PFPA 4F14A 1TUGB 2QXFA 1WIEA 2ZPHB 1N8RR 1IO6A 3CCVA 1G5VA 2HSEB 2DIQA 2JT4A 4M75D 4WTOB 2FRWA 3SD4A 3CBMA 4E47A 2DPPB 3META 3QG1A 3CBOA 4LNPA 3OYYA 4XTYA 3I56T 3M59A 2YRDA 4M75C 5EG2A 5KE3A 1VQOA 4OMQA 1YJWQ 2L5QA 1Y96A 4M77E 1NG2A 3HL8A 3E9GA 1K4US 4DEXA 1VQKA 5GAN4 5GAN6 1VYUA 1JBMA 2NUTB 5LJ3g 2LQNA 4BACA 1WXBA 3MCAB 4E2FB 1D1CA 1O75A 4PJOC 4FYXB 3S3MA 1VYTA 2EVRA 2CT4A 1O9SA 2JZ2A 1QW1A 5GAOm 3QDFA 1NEBA 5GJWB 4C8QA 2QYZA 1NZ9A 2JS0A 3G1JA 2MWPA 2LRQA 4ELYC 1UGSB 2DVJA 1VQNT 3JB9F 3HKSA 4J9DA 4J6WA 1F1BB 3I55Q 1LCKA 2L3QA 1U5SA 1GBQA 1JXMA 1RAIB 4Z8AA 2NYSA 2RD1A 4WCIA 2VWFA 1YFNA 3M57A 3CXCS 3CC4T 1I1JA 3H8ZA 1VQ5Q 1NE8A 3TREA 4EMGA 3H0IA 4OB0B 1OX9A 2DBKA 1V29B 1RI9A 4IKFA 2H3JA 3L42A 4KULA 4CC2A 1M1GA 1Y71A 2FO0A 2VVKA 1LJOA 1G83A 1PSEA 2QEXA 4QVZA 3VYHB 3I55A 4M7AE 2QEXT 2XICA 3DLLA 1JJ2P 2XU8A 1K76A 1GXIE 3QYHB 3CEYA 3MO8A 1YITQ 1ACMB 3ZL7C 2V8KA 3CCUT 2DBMA 2HQXA 1W2BA 2LQ8A 5FW9A 3NGPA 1KQ1A 2AHJB 3FJ5A 2DTHA 1BU1A 1H641 3RKXA 2XD0A 3E9FA 3BFMA 2KY9A 3OSSC 3F70A 1VQPT 4FSSA 8AT1B 4RTUA 2RHXA 2EYQA 5KYUA 4KUDK 3SDZA 1QP3A 2KXCA 1JO8A 4AMCA 1GRIA 2X4JA 3M0QA 4M78D 1TUDA 1S72T 3V7CA 1YJNT 2DX1A 3L2VA 4BUGA 1V1CA 2JJ9A 5FU7B 3CCJT 4C0GA 2O2OA 2JUFA 1AWXA 3MPUB 3QJYA 3H0HA 5DLOA 2LDMA 4KH0B 2DJQA 4C8QD 1MNEA 4C92A 2E65A 4J5YA 5KH6A 2K79A 1AWJA 1KC8R 2COWA 3A1PA 4XTZA 4Z89A 4M7AF 4RG2A 3UDCA 4AFUC 4A4FA 1CKAA 5GAOp 3A8LB 3CQTA 4XTXA 1OQKA 1S1NA 1Q81C 3PFSA 1U1TA 2O4XA 1T3LA 3EGDA 3MKDA 3LH0A 1X6OA 3FEOA 1PRMC 2LT4A 1CSKA 1M2VA 3GNFB 1YJWT 1S72A 4HCZA 2HQHA 2EFIA 4HVWA 3OQ5A 3L2RA 1SSHA 2CP5A 4F7UF 3G4SQ 1PCXA 1OX8A 2V1QA 3EG3A 3URGA 4K11A 1G3WA 4Z88A 4KT0E 1NPRA 1M90R 2E6NA 2QK0A 1OOTA 3CPFA 3GBQA 3CCSQ 2JMAA 2LZ6B 1JQQA 2GQIA 3GNGA 4IUVA 4M78B 1ZX6A 4C92E 4A53A 1AOJA 3V8LA 5IHKA 4PFOA 1JEGA 5I21A 4J9EA 5GAN5 2OTLA 4CRIA 5GAMd 1SRMA 4A4EA 2BKDN 2DLPA 3CCQT 2EW3A 4FYVB 2Y4YA 3VS4A 3G71Q 1NJIU 4RKUE 3EGDB 3UA6A 4DBQA 2EWNA 2QQ9A 4GLMA 4EDUA 4QVDA 1U06A 4FYWB 1GL5A 4PJNA 4LN2A 1YJNA 4L59A 2EIFA 5HK0A 3EG9A 3OW2P 2YRCA 2G6FX 3V7RA 1Y0MA 5GAMj 2O9SA 3JCMc 2M51A 4LUEA 1Q7YR 4F7UE 2CUBA 4FL6A 1IGUA 5HKCA 4OF1A 4C8QB 1D3BA 1WHJA 4AFZC 3QZ9B 5KYYB 3PTAA 3L2ZA 4LDUA 1W70A 1WXTA 2WSFE 1YHQT 1BI3A 4M7DF 2QQRA 1Q81R 4QQGA 2RJEA 1NYFA 2K57A 2JM9A 5IH2A 1YHQA 3LW5E 2AZSA 2HAXA 1UEBA 2EQIA 2BUDA 3M9QA 4RTXA 1VYVA 2VV5A 3CCET 3INZA 2L2PA 3OBYA 3RMQA 3JCMV 4C8QE 2D0QB 4E6RA 4BE0A 4C5HA 5CIUA 2KYBA 4MMLA 5KE2A 2YLCA 2ZGWA 3EG1A 4LDWA 2FB7A 4BDYA 1YI2T 1VIEA 3SFMA 5GMKl 4QW2A 4AFSC 4B9WA 2KMTA 3Q1JA 2HCKA 1H8KA 3QO3A 4AG1C 2DL8A 3VS0A 2PZ1A 3CC7Q 2HL3A 1WZOA 1XJWB 3CCLT 4M7DD 4BY6C 4Y91A 5EC7A 2BTTA 2M0OA 4RTWA 1X75C 2LQKA 1TH7A 3PIPA 1IRXA 4KGXB 2GCXA 2OTJQ 1NLOC 2DJZA 1CKBA 1FWZA 2V26A 3MJXA 2QEXQ 2YHTA 1PHTA 4R0KA 3MEUA 5C6SA 3P8HA 2RQVA 2KVQG 4JS4A 1QKWA 3VS7A 3CCEA 4BE2A 1JRIA 3MHXA 1W4SA 3RR6A 3GP8A 5LJ3f 4FM4B 3CC7T 2XK0A 4PFZA 3CD6A 2NUPA 1M90U 4CC3A 1TOVA 3TQ7P 2E4HA 1AZGB 2OJ2A 5CK9A 1I0CA 4OP0A 1RAHB 4M78G 2JM8A 2J06A 1TXQA 2RK1A 3PMTA 4Y92A 3L2WA 3VS3A 2QGGA 4BY6B 2QG9B 3OYNA 1Q82U 3UWNA 3OYEA 5I11A 4M75G 2FYKA 1NJIR 2DL4A 2OAWA 4ZGJB 1AT1B 4FSXA 2K5FA 1BYMA 4ANJA 3S3OA 1U1SA 2L8DA 2R57A 3JB9D 1B3QA 3EFSA 2MPXC 2OI3A 2K3BA 1TS9A 3WXMB 2QASA 3A8GB 2LNHB 4PKCC 3VS6A 1A0NB 2JTEA 1VQ6A 4BI8B 3M55A 3I56A 4XU0A 2CSQA 4PJOG 3I5RA 1B34B 2DXCA 4EMKC 1WQWA 2DXTA 4JRQA 4M77F 3U23A 3CCJA 4XTWA 2JXBA 3LH5A 3PVLA 4RTVA 2V1RA 1R77A 2VGNA 2CS7A 4N4IA 1ABQA 2RN8A 2X4WA 3ZEHA 3I5SA 4F17A 4PJOB 1MMDA 1X69A 3G6EQ 1ZUYA 2QDLA 1K9MC 4F04B 3HRTA 5GANf 3OS1A 3I35A 4C5EA 1ZA1B 2I0NA 4HCKA 1PRLC 4KRTA 4E7SA 5CO7A 2OTJT 5GANd 1OV3A 2NWMA 4DOWA 1HJDA 4MZMA 5M9OA 4N0AC 1N9SA 2PUOB 3M5AA 4JLGA 1BIBA 2WSEE 4JRKA 3QBYA 2V8JA 1I5LA 1ZBXA 2RI2A 4J6YA 2HEQA 1W6XA 3QJ6A 4PL6A 2KT8A 2ZPEB 1VQ6Q 3MEWA 4M78F 1VQOT 2CUDA 3CD6T 2ATCB 1I07A 2LCCA 3OMGA 2K7AA 1UB4A 1D0YA 2JVVA 1YJ9T 1T0HA 1YI2Q 1EX4A 2ZPGB 1MV3A 3SEMA 4LXCA 3H0FA 1KIKA 1Y07A 4EMKB 2DO3A 2C06A 2DA9A 3V7SA 5A2QE 4F7UB 4M7DA 4MZTA 2LJ1A 1G3TA 1M27C 4C92F 4NL3A 1D09B 2E3HA 2GFUA 1N8RU 2R58A 4XK8E 1KQSS 2AZVA 4LUDA 2KROA 1B07A 1VQMT 4OB3B 2MOXA 1Q82C 2QTXA 4XTVA 2I2LA 4M7DE 3KUFA 2HL5C 1K0XA 2DTOA 1AWOA 1WJRA 3M0SA 1WA7A 2RHYA 2FPEA 1QP2A 5LJ5f 2EJGA 3H41A 4JUVA 4QT7A 1ZHIA 3ER0A 4J9FA 2MK5A 4M7AC 2FZCB 4A4GA 5J39A 1KQSP 2DFUA 2DE0X 3FJPA 1UGQB 2BZ8A 4N4HA 4ELZC 1WQ7A 2EYXA 3SB2A 4DQ2A 3EH1A 2XHCA 4OMFB 5GMKi 1QVPA 1WHHA 1X6GA 3HSBA 3EFOA 4BDZA 2YRVA 3CCRQ 4KGVB 2RQTA 1N9RA 1UHFA 3RDVA 3BDUA 5D7UA 1X43A 1I8FA 2DIGA 3OYKA 3QIIA 4HKEA 1UDLA 3X28B 4ZTFA 2ROLA 1H3HA 5CR2A 2O01E 3G71A 4B9XA 5I2SA 3JV3A 5IHNA 2MCNA 3J7AF 3A5ZB 3JB9I 4OMMA 3GLXA 5D6YA 1VQ9T 3TSWA 3JSCA 3MP8A 3QZ5B 3UF4A 5I2MA 2QQAA 1K9AA 2AKKA 2W10A 1W2BP 2A28A 1YP5A 4GBQA 1U8RA 2M1HA 1G3YA 2A0FB 1M9SA 5AT1B 3MEAA 5GMKe 1TUCA 1FMKA 4OGEA 4XQ3A 5CKEA 4PLLA 1YHQQ 1YCYA 4PLIA 1UE9A 1XQHA 5GAOq 2DAQA 2P0QA 1K73C 4FT4A 1IZ6A 1WDXA 1T3SA 3TVTA 3OYGA 3JCMX 1Q82R 1TWBA 3G6ET 5GAN2 1FX7A 4X34A 2CKKA 2VKNA 1M8MA 2A36A 2KT1A 2XIDA 2DNUA 1PD1A 3CMAT 1EIFA 3A8HB 1R0CB 2BZXA 4HA8A 3CMAQ 3QKJA 3CMAA 3OYAA 2LT1A 1UUEA 2FL7A 1SKUB 3FLGA 2D1XA 1RLPC 2VYTA 1VQ6T 5IT9E 2JOYA 3C0CA 3P8BB 1M2OA 3IQLA 1WHGA 3M58A 1OYXA 5L8RE 2DM1A 3AT1B 2KI7A 4F7UG 4RMOA 4N4GA 4O5VA 3JB9G 4IIMA 1Q95G 2F2XA 2DL3A 1EFNA 1D3BB 2EJ9A 1ABOA 1YJ9A 1DJ7B 2IG0A 2DRKA 1Q86R 3CD6Q 5J3BA 1UTIA 2LNVA 4PNOA 2Y4XA 2XI9A 4J6XA 2CH4W 2M0YA 3OW2A 2ZCFB
chains in the Genus database with same CATH topology
4C5HA 2P4TA 3FIFA 5CIUA 3X25B 1MHNA 4MMLA 5KE2A 1X01A 3JCMQ 1YIJA 3CPWS 2HD0A 2YLCA 2ZGWA 1BKBA 5LJ5d 3OYLA 3E1SA 4LDWA 3OS2A 1YITA 4HCCA 4O6JA 5IN1A 2E10A 2FB7A 4BDYA 1YI2T 3G4ST 1VIEA 2FHDA 3SFMA 5GMKl 4EPCA 4QW2A 1VQ8A 4B9WA 2DZ9A 2KMTA 3Q1JA 2F69A 1BI2A 4L6V5 3QO3A 4QQ6A 1I4K1 4BI3A 3JB9J 2KQWA 3P8DA 3OYHA 4A54A 3OYBA 1KC8U 3OY9A 5C0MA 1NPPA 4YTLA 1VQ7T 2F5TX 2XKOC 4J7FA 5DLQE 5LJ3d 3CCVT 2RO0A 3ME9A 5D6XA 2Y90A 3CCLT 1KC8C 3JCMd 1VIFA 4M7DD 4C5IA 3CBPA 2JNGA 2RK2A 2RI5A 3QHSA 1R8OB 4BY6C 2QI2A 4C8QF 4Y91A 1BYMA 3N5BB 2LC4A 3QYGB 5CKFA 5LJ5h 2M0OA 3RERA 3QSUA 2HNIA 1X75C 3PNWC 1XNIA 2E1HA 2LQKA 3KXTA 1TH7A 3PIPA 3G4SA 1UGPB 1XOVA 3ZBDA 1YI2A 1WPYA 2EQMA 2BIVA 2GCXA 3VYGA 4M7DG 3GOXA 4M78C 2E6ZA 2QDYB 5LL6S 1K8AC 2RI3A 3CPWA 2DZCA 1H3ZA 1LNXA 2DJZA 3CCSA 1FWZA 4IUPA 3CCMT 2R5MA 3DB3A 1QVGA 2IVWA 2YHTA 2LVMA 4M7DC 3WVEB 4PJOF 2KDSA 3MEUA 5C6SA 3P8HA 2G3RA 2KVQG 4JS4A 4C0DC 4WF2A 4JRPA 3PIOA 3CCEA 4OB2B 4QQDA 4BE2A 1JRIA 3MHXA 1NJIC 1VQ9A 1W4SA 4M75A 4E7IA 1JJ2S 2CZ1B 3GP8A 3CMEA 2ZZDA 5LJ3f 1QVGS 4FM4B 4JDSA 4TVRA 3CC7T 2XK0A 3CD6A 1VQMA 3OSVA 2PVOB 1G3SA 2RA2A 4XAXB 1FXXA 5HK3A 4J83A 5GAMh 3CCRT 4M77G 2EQJA 1M90U 3LWIA 2DD4A 1WNLA 3LLRA 4M77C 4C92D 2EQKA 3S3NA 1HXDA 4LDVA 4XTUA 5GANe 3L1AA 3NFCA 4M78E 3OYJA 1Q7YU 2NLUA 1VQ8T 4OB1B 4ATOA 1KQ2A 3R6OA 1VQ5T 5CK9A 5GANg 2FVUA 3BW1A 2VXEA 3A8OB 1IREB 2K3XA 3LX7A 3RMSA 2QXFA 4OP0A 3CC2T 2ZPHB 3CCLA 2K2VA 4M78G 3CCVA 4R56A 5CQYA 3L2QA 3JB9H 2ZPIB 2LTOA 3ASKA 3HRUA 4ME7A 2DIQA 4MMKA 1K9MU 4M75D 5GANj 1G5VA 2A7YA 3SD4A 4ZGEB 1Y7XA 3CBMA 4E47A 2RK1A 2DPPB 3META 2RH2A 3PMTA 3L2WA 3QG1A 3ZFJA 4BY6B 3OYNA 3CBOA 4XTYA 3OYYA 3RKYA 1Q82U 3I56T 3M59A 3UWNA 3QXEB 3VUBA 1WJSA 4M75C 2EQUA 5EG2A 2E64A 3FDRA 5KE3A 3OYEA 1VQOA 3HFNA 4M75G 4JRIA 2L5QA 2FYKA 1Y96A 4M77E 4LD9K 1KD1U 4FU6A 5CKDA 5GAOr 1VUBA 4ZGJB 3G7ZA 3OA6A 4FSXA 2K5FA 4X9CA 2PUKB 3HL8A 2X35A 2EAYA 1U1SA 3E9GA 4Q5WA 3SWNB 4DA4A 2L8DA 1M4ZA 4E7LA 3PMIA 2R57A 3OW2S 1VQKA 5GAN4 5GAN6 5A0GA 1JB0E 2A3LA 3JB9D 3EFSA 1JBMA 4JLIA 4A4KA 1Q86U 5LJ3g 3FC3A 2VUBA 3WXMB 4BACA 3MCAB 4BB7A 1SSFA 4ZGDB 2ZPFB 4KBMB 1O75A 4VUBA 4PJOC 3OMCA 4R55A 3A8GB 4PKCC 2M16A 3S3MA 1M1KU 2WACA 4EMKA 3GPLA 1O9SA 1VQ6A 4BI8B 2JZ2A 1QW1A 5GAOm 3M55A 3I56A 1QVFA 3M54A 4XU0A 4HT9A 4PJOG 2RJCA 3CC4A 3NTHA 4C8QA 3PGGA 1B34B 2DXCA 1NZ9A 4EMKC 2JTFA 3SWNA 3GF5A 1WQWA 2MWPA 2DXTA 4KUIA 3S3OA 2LRQA 4XU3A 4ELYC 4JRQA 1UGSB 3OYIA 4M77F 1VQ7A 3M56A 3QUIA 1VQNT 5CQXA 3JB9F 3HKSA 3JRZA 4J6WA 3CCJA 4RG8A 4XTWA 1QVFS 4PJOD 4X9DA 3X20B 4C0DB 5LJ3j 4A4HA 2VGNA 5GAN7 3TCJA 1B34A 2CS7A 4N4IA 1K73U 3CXCA 4XU1A 3QDRB 4MDWA 2X4WA 3ZEHA 4JJNK 1JJ2A 4PJOB 1P92A 2QQSA 3OS5A 4BE1A 2D6FA 2XDPA 3RESA 5GANf 3HRTA 3OS1A 1K9MC 2HQEA 2RD1A 3VJPA 4C5EA 3M57A 3CXCS 3CC4T 2MWOA 2RHUA 5DM7R 3H8ZA 1NE8A 5CO7A 2OTJT 3RKWA 2X4XA 4LDYA 3TREA 4M77B 5GANd 1VQLT 2B8AA 4EMGA 4DOWA 4MZMA 4E7HA 4J8OA 2MI6A 5M9OA 4N0AC 1N9SA 2CZ6B 2PUOB 1RI0A 3M5AA 4P5NA 3CC2A 4JLGA 1BIBA 4OB0B 4LDXA 1V29B 2F5KA 2WSEE 4JRKA 2MF2A 4OGCA 3JCMf 4ZTJA 3QBYA 4IKFA 2H3JA 2R5AA 2V8JA 1VQNA 3L42A 1I5LA 3SWNC 1ZBXA 2RI2A 4KULA 1M1GA 4J6YA 3RIRA 1RL2A 1OZ3A 3QJ6A 3GIBA 4PL6A 3V8JA 2KK4A 2ZPEB 5HY6A 3MEWA 2YLBA 3X26B 3JCMe 1Y71A 3LGLA 3HPWA 1LJOA 1PSEA 4M78F 2QEXA 3JCMP 1VQOT 3VUZA 3CD6T 5GAMf 2LCCA 3I55T 4QVZA 3VYHB 3OMGA 2WSCE 2D9TA 3I55A 1UB4A 3UPUA 4M7AE 2JVVA 5KCOA 3OYDA 1YJ9T 2QEXT 4M75E 2XICA 3DLLA 2XU8A 2ZPGB 1HK9A 1OI1A 5A0DA 1GXIE 2XDBA 3QYHB 1KHIA 3CEYA 5FROA 1Y07A 3MO8A 4EMKB 2PQWA 2DO3A 3J81E 2C06A 3LWHA 2V8KA 3CCUT 1YJWA 2KAFA 2HQXA 1W2BA 2LQ8A 3V7SA 5A2QE 2P0KA 1WJQA 3C4SA 1KQ1A 2AHJB 2VGMA 4M77D 2DTHA 4F7UB 4HT8A 4MZTA 4M7DA 4C92G 3RKXA 1H641 2XD0A 3E9FA 4LD6A 1G3TA 1ZQ1A 2KY9A 3BFMA 1OZ2A 2K4YA 3F70A 3OSSC 4C92F 2CGHA 4NL3A 2GFUA 4RCBA 4M7AA 1VQPT 3E19A 1KG1A 1N8RU 2R58A 5A0LA 3A8MB 2RHXA 4XK8E 2EYQA 4KUDK 1KQSS 3SDZA 1QP3A 2CYZB 3CCRA 2RM4A 2ZPBB 1Q81U 2X4JA 2X4YA 3VU3C 1VQMT 4M78D 4OB3B 2P0PA 4C5GA 3VV0A 1S72T 3V7CA 1Q82C 1YJNT 2QTXA 4M75F 4XTVA 3L2VA 4BUGA 2VC8A 2I2LA 1Y96B 2EKOA 4M7DE 5FU7B 2DKGA 4F7UA 2DXUA 3KUFA 4C0GA 3CCJT 3CCUA 4M77A 2JUFA 3O8VA 5IAYA 2DTOA 2PU9B 1WJRA 3DKMA 3CCMA 3CCQA 3QJYA 2RHYA 1QP2A 5LJ5f 2EJGA 4JUVA 5DLOA 1VQ4A 1ZHIA 3ER0A 2LDMA 4D6WA 3JCMW 5GAN3 4M7AC 4BI4A 1MGQA 4A4GA 2O4XB 3TEEA 5J39A 4N0AA 4C8QD 3CMET 3FJPA 1M1KC 1UGQB 3LGFA 4M78A 4C92A 4ELZC 4N4HA 2E65A 4J5YA 4DOVA 5KH6A 3M4GA 5LJ3h 5GANh 1WQ7A 4II1A 3RUXA 2XDDA 4M7AG 2GQVA 1M5Q1 2EJFA 3SB2A 5FU6C 4IUTA 4DQ2A 4XTZA 2XHCA 4C92C 4M7AF 4OVAA 4RG2A 3UDCA 1BI0A 4OMFB 3X24B 4A4FA 5GMKi 1QVPA 3L2UA 3HSBA 5GAOp 3A8LB 5LJ3e 2YRVA 3BY7A 4XTXA 4BDZA 5CVIA 3CCST 3NTIA 2GFAA 1N9RA 1VQ4T 5GAOn 3HRSA 1KHCA 5FLXE 3OBWA 3UT1A 1Q81C 3PFSA 1VQPA 1U1TA 2O4XA 5GMKj 1PSFA 3LH0A 3M53A 1X6OA 1I81A 3FEOA 3PT9A 3BDUA 2LT4A 4FT2A 4NL2A 3V8KA 4MZPA 3GNFB 1BI1A 1N27A 2KSSA 2RJFA 5DY9A 1YIJT 1YJWT 1I8FA 2DIGA 3KBGA 3OYKA 1WGSA 2RJDA 1S72A 3QIIA 4HCZA 4ZN1A 4HKEA 3JCMh 4J7IA 2EFIA 3OQ5A 3X28B 5D6WA 2OTJA 4NS5A 4GLKA 3L2RA 5GAN8 4ZTFA 4F7UF 5CR2A 2O01E 2RB6A 3EFRA 3G71A 2L3RA 1VQ5A 4B9XA 5I2SA 3URGA 4L5GA 5GAMe 3J7AF 3A5ZB 3LYIA 2PVGB 3JB9I 1M8VA 4EMHA 3GLXA 1G3WA 4NOYA 5D6YA 5LJ5j 1K8AU 1VQ9T 4KT0E 3AHUA 3JSCA 3MP8A 3QZ5B 3G6EA 2QA4T 5CKBA 5I2MA 5CCAA 1NPRA 2E6NA 2QQAA 3C12A 3CPFA 3S6WA 4E7KA 2OAUA 2L89A 2DTIA 3CC7A 5CAIA 1U8RA 2M1HA 4Y28E 1G3YA 1M9SA 3GNGA 3MEAA 4IUVA 2MMPA 5GMKe 3TU4K 4M78B 3C95A 4OGEA 3C94A 2DXBA 3MP1A 4IUUA 2GF7A 2VXFA 4XQ3A 3BDLA 2JN0A 5CKEA 4PLLA 4Z02A 4C92E 1YCYA 4PLIA 3V8LA 1BIAA 3EAEA 1XQHA 3MEVA 4A53A 5GAOq 3JCMJ 4M7DF 3QPHA 2DAQA 2P0QA 5LJ5e 5KCHA 2DEQA 4UC4A 4MDXA 3HFOA 1K73C 4C92B 5I21A 3OB9A 3OS0A 4FT4A 5GAN5 2OTLA 1IZ6A 4C0FA 4CRIA 5GAMd 3OYGA 1AHJB 3FB9A 3MP6A 3JCMX 3OYCA 3NTKA 2BKDN 4A4EA 4V2SA 3G6ET 2QA4A 4JS5A 4E7JA 5J26A 3CCQT 2Y4YA 2CZ0B 1UGRB 1NJIU 2E41A 4RKUE 4IURA 4C8QC 1FX7A 5GAN2 4X34A 4PJOE 2CKKA 4QVCA 2EWNA 2XIDA 2QQ9A 1W2BS 5FRNA 4EDUA 4QVDA 4IUQA 3CMAT 2LCLA 1EIFA 4ZN3A 2HBPA 3A8HB 1Q7YC 3OYMA 1YJNA 4L59A 2EIFA 5HK0A 4HA8A 1M90C 3VKIA 2E12A 3QKJA 2MAMA 3CMAA 2E5QA 1YITT 3OYAA 3V7RA 3G71T 1KQSA 2LT1A 3FRNA 1XTDA 5GAMj 2E70A 2FL7A 5FU7C 2OTLT 3M4YA 5LJ5g 3FLGA 4M7DB 3JCMc 2VYTA 1VQ6T 4PJOA 5AYFA 3JCMg 5GMKh 4F7UE 5IT9E 2JOYA 4FL6A 4CI0C 3P8BB 5HKCA 4OF1A 4C8QB 2K5IA 1D3BA 3M58A 1OYXA 2JTMA 3QZ9B 2LX9A 1YHQT 3T9NA 1M1FA 5L8RE 2RHZA 5GMKm 3PTAA 2K5LA 3HHTB 3WVDB 4M75B 3L2ZA 4LDUA 1Q86C 4GY5A 3JCMb 4F7UG 4M7AB 4RMOA 4N4GA 2WSFE 3DLMA 1BI3A 3HP9A 2M9UA 4FIBA 4O5VA 1LOJA 4XU2A 2QQRA 2QQBA 3JB9G 1N8RC 4QQGA 2RJEA 3J80E 1D3BB 2EJ9A 2RHIA 2V8IA 2K57A 2K3YA 2DVEA 3JAME 4RCCA 2PVDB 2CZ7B 3DB4A 3LW5E 5GAOl 1YJ9A 1YHQA 1KD1C 1DJ7B 5FU6B 4C8QG 2DD5A 2HAXA 1VQKT 2IG0A 1UEBA 3H6ZA 4BD3A 1YBYA 2BUDA 3M9QA 5J3BA 4M7AD 2VV5A 2LNVA 4PNOA 5GAMg 3CCET 2Y4XA 4C0ZA 2XG8D 5CKHA 3INZA 5FRMA 2XI9A 1N6AA 3OBYA 3RMQA 2DK3A 4J6XA 3OW2A 3JCMV 4C8QE 2D0QB 3OYFA 1VQLA 4HCBA 2ZCFB 4BE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  4EMH A;  2E64 A;  4NOY A;  5LJ5 j;  3FIF A;  3HFN A;  4M75 G;  4JRI A;  4MML A;  2FYK A;  1X01 A;  1Y96 A;  4M77 E;  3V7S A;  3JCM Q;  2YLC A;  2ZGW A;  5LJ5 d;  1M8V A;  4M77 D;  1KQ1 A;  5GAO r;  2E10 A;  2DTH A;  4F7U B;  4HT8 A;  4M7D A;  2FB7 A;  4C92 G;  4X9C A;  3RKX A;  1H64 1;  3SWN B;  2EAY A;  1U1S A;  3BFM A;  4C92 F;  4NL3 A;  2DTI A;  5GMK l;  2CGH A;  5CAI A;  4M7A A;  4RCB A;  5GAN 4;  2DZ9 A;  5GAN 6;  3JB9 D;  3EFS A;  1JBM A;  3QO3 A;  4JLI A;  4M78 B;  1I4K 1;  5GMK e;  3JB9 J;  2VXF A;  4XQ3 A;  5LJ3 g;  4A54 A;  2RM4 A;  2JN0 A;  4C92 E;  3VU3 C;  1YCY A;  4A53 A;  3V8L A;  1BIA A;  3JCM J;  5GAO q;  4M78 D;  4PJO C;  5LJ5 e;  2DEQ A;  5LJ3 d;  4EMK A;  3V7C A;  3HFO A;  2QTX A;  4M75 F;  5GAO m;  4XTV A;  4C92 B;  5I21 A;  2Y90 A;  5GAN 5;  2VC8 A;  4XU0 A;  3JCM d;  4HT9 A;  4M7D D;  2I2L A;  4PJO G;  1Y96 B;  5GAM d;  4C8Q A;  3PGG A;  3FB9 A;  4M7D E;  3JCM X;  3QHS A;  2DKG A;  4F7U A;  4C8Q F;  1B34 B;  4Y91 A;  4EMK C;  4V2S A;  3SWN A;  2DXU A;  1WQW A;  5LJ5 h;  4M77 A;  2DXT A;  3RER A;  3QSU A;  2HNI A;  4XU3 A;  2DTO A;  2E1H A;  4M77 F;  3QUI A;  2E41 A;  1TH7 A;  4C8Q C;  5GAN 2;  3JB9 F;  1WPY A;  4PJO E;  4J6W A;  4QVC A;  4M7D G;  4XTW A;  4M78 C;  5LJ5 f;  2EJG A;  2EWN A;  4JUV A;  4X9D A;  5LJ3 j;  4PJO D;  4QVD A;  2DZC A;  1LNX A;  2DJZ A;  5GAN 7;  1B34 A;  3JCM W;  5GAN 3;  4XU1 A;  2YHT A;  4M7A C;  4M7D C;  1MGQ A;  4PJO F;  4PJO B;  4N0A A;  4C8Q D;  3FJP A;  4HA8 A;  4M78 A;  4C92 A;  3RES A;  2E65 A;  4J5Y A;  5GAN f;  3M4G A;  5LJ3 h;  4WF2 A;  5GAN h;  1WQ7 A;  3RUX A;  2RD1 A;  3V7R A;  4M7A G;  1JRI A;  1M5Q 1;  5GAM j;  2EJF A;  3SB2 A;  4M75 A;  5LJ5 g;  4M7D B;  3RKW A;  4XTZ A;  3JCM c;  4C92 C;  4M77 B;  4DQ2 A;  5GAN d;  4M7A F;  5LJ3 f;  4EMG A;  4PJO A;  5GMK i;  5GMK h;  3JCM g;  4N0A C;  4F7U E;  5GAO p;  3HSB A;  1N9S A;  5LJ3 e;  3BY7 A;  4XTX A;  2RA2 A;  1BIB A;  4C8Q B;  1N9R A;  1D3B A;  5GAO n;  5GAM h;  4M77 G;  4JRK A;  3JCM f;  5GMK m;  1WNL A;  4M77 C;  4C92 D;  1HXD A;  4XTU A;  5GAN e;  4M75 B;  3L1A A;  1U1T A;  3L2Z A;  4M78 E;  3SWN C;  5GMK j;  3JCM b;  4F7U G;  4M7A B;  1I5L A;  4J6Y A;  3RIR A;  1KQ2 A;  3JB9 G;  4XU2 A;  4M7D F;  1LOJ A;  1I81 A;  3GIB A;  3V8J A;  4NL2 A;  3BDU A;  3V8K A;  1D3B B;  5GAN g;  2YLB A;  3JCM e;  2EJ9 A;  3BW1 A;  2VXE A;  5DY9 A;  2K57 A;  2DVE A;  1LJO A;  4M78 F;  4OP0 A;  3JCM P;  4RCC A;  1I8F A;  5GAO l;  3AHU A;  4M78 G;  5GAM f;  4C8Q G;  3JB9 H;  3JCM h;  4MMK A;  4M75 D;  5GAN j;  4M7A E;  5GAN 8;  4M75 E;  4F7U F;  4M7A D;  4PNO A;  5GAM g;  1HK9 A;  2RB6 A;  3EFR A;  3INZ A;  4J6X A;  4XTY A;  3JCM V;  3RKY A;  4C8Q E;  4EMK B;  5GAM e;  3JB9 I; 
#chains in the Genus database with same CATH topology
 1YWO A;  2KRM A;  3FIF A;  1QVG P;  3JCM Q;  5LJ5 d;  1NBE B;  4O6J A;  4OMN A;  1VQ8 A;  2J6O A;  2KXD A;  2DZ9 A;  2F69 A;  4L6V 5;  2A08 A;  1I4K 1;  4BI3 A;  1MND A;  2KQW A;  4A54 A;  3OYB A;  2EYY A;  5C0M A;  2SEM A;  2BE7 D;  4YTL A;  1OUL A;  2XKO C;  5DLQ E;  5LJ3 d;  3CCV T;  2J6K A;  1KC8 C;  5GJV B;  3JCM d;  3CBP A;  2YUO A;  1K73 R;  2LC4 A;  5CKF A;  3QSU A;  3PNW C;  1WPY A;  3EHQ A;  2BIV A;  3VYG A;  4M7D G;  3GOX A;  4M78 C;  1K8A C;  2VAS A;  1LNX A;  1UG1 A;  4IUP A;  3CCM T;  2R5M A;  3DB3 A;  1AEY A;  1ZSZ A;  4JJD A;  4M7D C;  4PJL A;  1BB9 A;  1PNJ A;  1RAE B;  4WF2 A;  4JRP A;  5KYW B;  4QQD A;  1NJI C;  1AVZ C;  1Y57 A;  4J9B A;  1UGV A;  4JDS A;  1G3S A;  4JZ4 A;  2QTV A;  2RA2 A;  1VQ7 Q;  4ZNX A;  1M2V B;  2A37 A;  5HK3 A;  5GAM h;  2DD4 A;  3HTR A;  2HDA A;  2DMO A;  1HXD A;  4LDV A;  4XTU A;  1KJW A;  3L1A A;  4M78 E;  1VQ8 T;  1Q7Y U;  4ATO A;  1YIJ Q;  2O9V A;  3R6O A;  1VQ5 T;  1UHC A;  2FVU A;  1VQL Q;  2K3X A;  3LX7 A;  1U3O A;  3CC2 T;  4QKU A;  2K2V A;  5CQY A;  2ZPI B;  2EGC A;  1M3B A;  2LTO A;  3ASK A;  1VQ4 Q;  2P84 A;  5GAN j;  2DL5 A;  2A7Y A;  1ZBJ A;  4ZGE B;  2IIM A;  3M0U A;  2YUN A;  1B7T A;  1GCQ C;  3RKY A;  3VUB A;  2EQU A;  2E64 A;  2HKQ B;  5I22 A;  2C0O A;  2DYI A;  2GTO A;  4FU6 A;  5CKD A;  5GAO r;  1VUB A;  3OA6 A;  1KSW A;  1C0M A;  2EAY A;  4Q5W A;  4DA4 A;  1M4Z A;  3PMI A;  3OW2 S;  3D7S B;  1Q86 U;  3EH2 A;  3FC3 A;  2VUB A;  4BB7 A;  2ZPF B;  4VUB A;  2X3X D;  1VQ9 Q;  1YNZ A;  3PE0 A;  2WAC A;  4EMK A;  2HMA A;  1QVF A;  3M54 A;  3PGG A;  4D8D A;  1SG5 A;  1GBR A;  2KRS A;  4XU3 A;  1WHM A;  2FPD A;  3QUI A;  3NHN A;  1VQ7 A;  5CQX A;  3JRZ A;  2W0Z A;  4PJO D;  4X9D A;  4C0D B;  4M4Z A;  4A4H A;  1B34 A;  2LQW A;  3BE3 A;  3CXC A;  4XU1 A;  3CCL Q;  4MDW A;  2GTJ A;  4JJN K;  2FPF A;  3OS5 A;  2D6F A;  2C0I A;  3VJP A;  2EPD A;  1PM3 A;  2MWO A;  2RHU A;  1UJ0 A;  2X4X A;  1VQL T;  4E7H A;  4J8O A;  2MI6 A;  2HZY A;  1NEG A;  1RI0 A;  1R0B G;  4LDX A;  2F5K A;  3CME Q;  3JCM f;  2R5A A;  1UJY A;  1QMC A;  1RLQ C;  1OZ3 A;  3GIB A;  1Z9Z A;  3V8J A;  5HY6 A;  2ROT A;  3X26 B;  2YLB A;  3JCM e;  2CP2 A;  3LGL A;  1WLP B;  3RNJ A;  3VUZ A;  5GAM f;  3I55 T;  2YUP A;  3UPU A;  3OYD A;  2M02 A;  1VQK Q;  1HK9 A;  1OI1 A;  2XDB A;  5FRO A;  1M30 A;  1V76 A;  1HD3 A;  2K2M A;  3LWH A;  1YWP A;  2KAF A;  1VQO Q;  1GFC A;  2P0K A;  3C4S A;  2VGM A;  4HT8 A;  2PNI A;  2ED1 A;  2D8H A;  4LD6 A;  2K4Y A;  2CGH A;  1MMA A;  4M7A A;  4RCB A;  1KG1 A;  2QAZ A;  3E19 A;  1MUZ A;  5A0L A;  3VS2 A;  1FMV A;  2CYZ B;  2X3W D;  1HSQ A;  2RM4 A;  2ZPB B;  2IPO B;  1RAB B;  2BZY A;  2JMC A;  2P0P A;  4M75 F;  5KYX B;  2VC8 A;  2EKO A;  2DKG A;  4F7U A;  4AG2 C;  2CP7 A;  2EYZ A;  2LX7 A;  1IHW A;  1RUW A;  4M77 A;  3O8V A;  5IAY A;  2PU9 B;  1RAF B;  2FZG B;  3DKM A;  3CCM A;  2D8J A;  1VQ4 A;  1RAG B;  2COY A;  3E2U A;  2E5K A;  4BI4 A;  1WX6 A;  1M1K C;  3CME T;  4N0A A;  3LGF A;  1QCN A;  4DOV A;  5GAN h;  2XDD A;  2GQV A;  2HKN A;  1M5Q 1;  5IHI A;  2EJF A;  5FU6 C;  4IUT A;  2CRE A;  1NM7 A;  3L2U A;  5CVI A;  3CCS T;  2GFA A;  1SF9 A;  3VS5 A;  3HRS A;  5FLX E;  1PD0 A;  3OBW A;  1UFF A;  4J9I A;  1VQP A;  4HVV A;  5GMK j;  1PKT A;  2O31 A;  4NL2 A;  4FT2 A;  3V8K A;  2DL7 A;  4MZP A;  5DY9 A;  1N27 A;  2F2W A;  1YIJ T;  1WI7 A;  2KE9 A;  3KBG A;  1X27 A;  3A98 A;  3RBB B;  3JCM h;  4J7I A;  1X6B A;  4NS5 A;  4GLK A;  5GAN 8;  2AT1 B;  2EYW A;  3NPF A;  2RB6 A;  3EFR A;  2L3R A;  2YXY A;  1M3A A;  2KYM A;  4L5G A;  3EG0 A;  5GAM e;  1M8V A;  4NOY A;  3G6E A;  5CKB A;  3C12 A;  5IXB A;  1T0J A;  1IXD A;  2OAU A;  1AD5 A;  2DTI A;  4Y28 E;  3C95 A;  2DXB A;  3MP1 A;  2H8H A;  1WYX A;  2GF7 A;  2K9G A;  2VXF A;  3BDL A;  2JN0 A;  3ULR B;  1BIA A;  3JCM J;  3QPH A;  1K9M R;  5LJ5 e;  5KCH A;  2DEQ A;  2FEI A;  3HFO A;  8ATC B;  3OB9 A;  4C0F A;  1N5Z A;  1AHJ B;  3MP6 A;  3OYC A;  3NTK A;  4J9G A;  4V2S A;  2QA4 A;  4JS5 A;  4PK4 A;  2CZ0 B;  5KYN A;  2E41 A;  4IUR A;  3UA7 A;  3CCM Q;  1W2B S;  5FRN A;  4AT1 B;  4IUQ A;  2LCL A;  2HBP A;  1SRL A;  1Q7Y C;  2FG0 A;  3OYM A;  4RTZ A;  2E12 A;  2E5Q A;  1YIT T;  3FRN A;  1XTD A;  1M1K R;  1K1Z A;  2E70 A;  5FU7 C;  1AWW A;  5LJ5 g;  4M7D B;  1QVF P;  1GCP A;  4J9C A;  4PJO A;  4CI0 C;  3R6N A;  2K5I A;  1OU8 A;  4FW1 A;  3CCV Q;  2LX9 A;  3T9N A;  2DER A;  2RHZ A;  2K5L A;  3HHT B;  4M75 B;  3JCM b;  2OTL Q;  4C0Z A;  4FIB A;  3HP9 A;  1QWF A;  2M9U A;  1LOJ A;  1J3T A;  2V8I A;  2K3Y A;  2PVD B;  3DB4 A;  1VOM A;  5GAO l;  1KD1 C;  1BCO A;  3H6Z A;  4BD3 A;  1YBY A;  4M7A D;  4RTT A;  1PWT A;  5GAM g;  2ABL A;  5CKH A;  5FRM A;  2KBT A;  1E6G A;  3OYF A;  1TTH B;  1VQL A;  1SPK A;  2L3S A;  1X01 A;  1YIJ A;  2HD0 A;  1BKB A;  1YIT A;  5FWC A;  3G4S T;  2FHD A;  2D0N A;  4EPC A;  2EGE A;  1NLP C;  1BI2 A;  3JB9 J;  3P8D A;  1IGQ A;  3OYH A;  4JPB W;  1KC8 U;  1Z9Q A;  3OY9 A;  1HYO A;  3EG2 A;  2FRY A;  2F5T X;  4IIO A;  3TSZ A;  5D6X A;  1VIF A;  4LE9 A;  4C5I A;  2NUZ A;  2HSP A;  3QHS A;  2QI2 A;  4C8Q F;  4OML A;  1GFD A;  3QYG B;  5FWB A;  3RER A;  1D0X A;  2RQW A;  2E1H A;  3KXT A;  4FCY A;  4E7Z A;  3ZBD A;  2EQM A;  1YCS B;  2E6Z A;  2LJ0 A;  5LL6 S;  3CPW A;  2DZC A;  1H3Z A;  3CCS A;  1KFZ A;  4F16 A;  2LVM A;  3WVE B;  4AFQ C;  2CP3 A;  2LP5 A;  2KDS A;  5KYU B;  2G3R A;  4JZ3 A;  1TG0 A;  4C0D C;  2NUP B;  4A63 B;  1NYG A;  4OB2 B;  2KRN A;  4B6M A;  1VQ9 A;  2CZ1 B;  3CPW P;  2ZZD A;  1QVG S;  3QWY A;  4TVR A;  2GGR A;  3CC2 Q;  2PVO B;  2YDL A;  1FXX A;  1ARK A;  4J83 A;  1SHF A;  1QLY A;  2EQJ A;  3LWI A;  1WNL A;  3OYJ A;  2NLU A;  2COZ A;  4OB1 B;  2KNB B;  2ESW A;  3M0R A;  3A8O B;  3RMS A;  3CCL A;  4R56 A;  3EHR A;  1K0S A;  3L2Q A;  3JB9 H;  3HRU A;  4ME7 A;  1K9M U;  4MMK A;  1Y7X A;  1LPL A;  2RH2 A;  3ZFJ A;  3M0P A;  3QXE B;  1WJS A;  3PVQ A;  3FDR A;  3NMZ C;  3HFN A;  4JRI A;  1I5O B;  4LD9 K;  1WHL A;  1YJN Q;  4DBH A;  1KD1 U;  1BK2 A;  3G7Z A;  1ZA2 B;  6AT1 B;  4X9C A;  3SWN B;  2PUK B;  2X35 A;  4E7L A;  1ZSG A;  5A0G A;  1JB0 E;  2A3L A;  2YWW A;  4A4K A;  4JLI A;  1SSF A;  4ZGD B;  4KBM B;  2YSQ A;  3OMC A;  4R55 A;  4KH1 B;  2M16 A;  1M1K U;  3GPL A;  1OU9 A;  4HT9 A;  3CC4 A;  2RJC A;  3NTH A;  1ZLM A;  2CP0 A;  3UAT A;  2JTF A;  3SWN A;  3GF5 A;  4KUI A;  2X9H A;  3OYI A;  3M56 A;  1WFW A;  1VQM Q;  1QKX A;  3REB B;  4RG8 A;  2YUQ A;  2ECZ A;  3QWX X;  3X20 B;  5LJ3 j;  1QVF S;  4OMP A;  5GAN 7;  3TCJ A;  1K73 U;  3QDR B;  1JJ2 A;  1KK7 A;  1P92 A;  2QQS A;  4BE1 A;  2XDP A;  3RES A;  2HQE A;  2DIL A;  1OPK A;  2E3I A;  5DM7 R;  3RKW A;  4LDY A;  5L23 A;  4M77 B;  2B8A A;  2K6D A;  4HVU A;  2F2V A;  2CZ6 B;  4P5N A;  3CC2 A;  1VQ8 Q;  2KR3 A;  2MIO A;  2MF2 A;  4OGC A;  2PTK A;  4ZTJ A;  1VQN A;  3SWN C;  1QWE A;  1H92 A;  3RIR A;  1RL2 A;  1TSF A;  2KK4 A;  3VRZ A;  3HPW A;  4RUG A;  3JCM P;  1D1A A;  1C1A A;  1C6V X;  2VB6 A;  2XMF A;  2WSC E;  2D9T A;  2H3E B;  1D1B A;  5KCO A;  4M75 E;  2X51 A;  4FW2 A;  1PG5 B;  5A0D A;  2GBQ A;  1KHI A;  4ESR A;  2PQW A;  3J81 E;  2L0A A;  3VS1 A;  1AZE A;  1YJW A;  3THK A;  1WJQ A;  4M77 D;  1ZUU A;  5KYY A;  4EIK A;  4C92 G;  1ZQ1 A;  1OZ2 A;  1YN8 A;  3CCJ Q;  3CCQ Q;  3A8M B;  5HCK A;  3CCR A;  2NUT A;  1G8X A;  3CCU Q;  1Q81 U;  2X4Y A;  3VU3 C;  4C5G A;  3VV0 A;  1WXU A;  3EG9 B;  4ORZ A;  1Y96 B;  1VA7 A;  2CSI A;  2DYB A;  3O5Z A;  2DXU A;  3CCU A;  4FYY B;  2BE9 B;  3CCQ A;  3EGX A;  2J05 A;  1JXO A;  2KEA A;  4D6W A;  3JCM W;  5GAN 3;  1MGQ A;  2O4X B;  3TEE A;  1IHV A;  4M78 A;  9ATC B;  2LMJ A;  3M4G A;  5LJ3 h;  4II1 A;  3RUX A;  4M7A G;  2DEU A;  1E7O A;  2KGT A;  2JW4 A;  1PC0 A;  4C92 C;  4OVA A;  1BI0 A;  3X24 B;  4JJB A;  2ZAE A;  3BY7 A;  5LJ3 e;  3NTI A;  1VQ4 T;  5GAO n;  1KHC A;  3UT1 A;  1X2K A;  1PSF A;  5KYX A;  1X2Q A;  3M53 A;  3VRY A;  1I81 A;  4HXJ A;  3PT9 A;  4X1V A;  1VQN Q;  1BI1 A;  1LVK A;  2KSS A;  2RJF A;  1ZSZ C;  1BCM A;  1WGS A;  2RJD A;  4ZN1 A;  1WHK A;  5ECA A;  5D6W A;  2RNA A;  2OTJ A;  1VQ5 A;  2P4R A;  3CCE Q;  2QA4 Q;  3LYI A;  2PVG B;  4EMH A;  2SRC A;  5LJ5 j;  1K8A U;  3H9N A;  3AHU A;  2QA4 T;  1MV0 B;  1RAC B;  4CC7 A;  5CCA A;  2ED0 A;  1SHG A;  3S6W A;  2LCS A;  4E7K A;  1W1F A;  2L89 A;  3CC7 A;  5CAI A;  2CT3 A;  3CXC P;  2MMP A;  3TU4 K;  4IUU A;  3C94 A;  2RF0 A;  4Z02 A;  2GNC A;  3MEV A;  3EAE A;  2EGA A;  1E6H A;  2RQR A;  4UC4 A;  4MDX A;  4C92 B;  1QQJ A;  3OS0 A;  3FB9 A;  4E7J A;  1M3C A;  5J26 A;  1UGR B;  2HBW A;  4C8Q C;  1KD1 R;  4PJO E;  1EZZ B;  5KYW A;  4QVC A;  2EBP A;  1ZUK A;  2FZK B;  4ZN3 A;  1YJ9 Q;  1ZSZ B;  2LJ3 A;  1M90 C;  3VKI A;  1BBZ A;  2AIR B;  4DBF A;  2MAM A;  1QCF A;  3G71 T;  1JU5 C;  1KQS A;  2OTL T;  3M4Y A;  4OMO A;  5AYF A;  3JCM g;  1OEB A;  5GMK h;  1FMW A;  1RAA B;  2EKH A;  2JTM A;  2F1L A;  1M1F A;  5GMK m;  3WVD B;  1Q86 C;  4GY5 A;  2DET A;  4M7A B;  3DLM A;  4XU2 A;  1N8R C;  2YT6 A;  2QQB A;  2AKL A;  2CP6 A;  2JS2 A;  3J80 E;  3SHW A;  2RHI A;  2AK5 A;  2DVE A;  3JAM E;  4RCC A;  2CZ7 B;  4KGZ B;  2J6F A;  5FU6 B;  2DD5 A;  4C8Q G;  1VQK T;  1IB8 A;  5IXF A;  4DBR A;  2CDT A;  2DF6 A;  2XG8 D;  2ENM A;  2C0T A;  1N6A A;  2RPN A;  1MMG A;  2DK3 A;  4HCB A;  2P4T A;  4D8K A;  2L3P A;  1MHN A;  3X25 B;  3CPW S;  3OYL A;  4HCC A;  3E1S A;  3OS2 A;  5IN1 A;  2E10 A;  4CC4 B;  2B86 A;  4QQ6 A;  4RTY A;  2RMO A;  3KFV A;  4JJC A;  1NPP A;  1VQ7 T;  4J7F A;  2RO0 A;  3ME9 A;  2MYS A;  2Y90 A;  1K8A R;  2JNG A;  2RK2 A;  2RI5 A;  1VQP Q;  1R8O B;  1UEC A;  3N5B B;  5LJ5 h;  2RQU A;  2HNI A;  1XNI A;  3M0T A;  2OX7 A;  1MMN A;  1UGP B;  1XOV A;  3G4S A;  1YI2 A;  1G2B A;  2QDY B;  2RI3 A;  2QGF B;  1FYN A;  1QVG A;  2IVW A;  4DEY A;  1QCO A;  2Z0W A;  4PJO F;  1OPL A;  2CH4 A;  3I9Q A;  2DRM A;  1GCQ A;  3I56 Q;  3PIO A;  3REA B;  4E7I A;  4M75 A;  1JJ2 S;  3CME A;  2J7I A;  1VQM A;  3OSV A;  1D0Z A;  4XAX B;  4PJM A;  1S72 Q;  1RAD B;  2O88 A;  3CCR T;  4M77 G;  7AT1 B;  3LLR A;  4PJJ A;  1SEM A;  4M77 C;  4C92 D;  2EQK A;  3S3N A;  5GAN e;  1TU0 B;  3NFC A;  3CC4 Q;  3EGU A;  1KQ2 A;  3EFO B;  3EGX B;  5GAN g;  3BW1 A;  1PKS A;  2VXE A;  4J9H A;  1IRE B;  4PFP A;  4F14 A;  1TUG B;  2QXF A;  1WIE A;  2ZPH B;  1N8R R;  1IO6 A;  3CCV A;  1G5V A;  2HSE B;  2DIQ A;  2JT4 A;  4M75 D;  4WTO B;  2FRW A;  3SD4 A;  3CBM A;  4E47 A;  2DPP B;  3MET A;  3QG1 A;  3CBO A;  4LNP A;  3OYY A;  4XTY A;  3I56 T;  3M59 A;  2YRD A;  4M75 C;  5EG2 A;  5KE3 A;  1VQO A;  4OMQ A;  1YJW Q;  2L5Q A;  1Y96 A;  4M77 E;  1NG2 A;  3HL8 A;  3E9G A;  1K4U S;  4DEX A;  1VQK A;  5GAN 4;  5GAN 6;  1VYU A;  1JBM A;  2NUT B;  5LJ3 g;  2LQN A;  4BAC A;  1WXB A;  3MCA B;  4E2F B;  1D1C A;  1O75 A;  4PJO C;  4FYX B;  3S3M A;  1VYT A;  2EVR A;  2CT4 A;  1O9S A;  2JZ2 A;  1QW1 A;  5GAO m;  3QDF A;  1NEB A;  5GJW B;  4C8Q A;  2QYZ A;  1NZ9 A;  2JS0 A;  3G1J A;  2MWP A;  2LRQ A;  4ELY C;  1UGS B;  2DVJ A;  1VQN T;  3JB9 F;  3HKS A;  4J9D A;  4J6W A;  1F1B B;  3I55 Q;  1LCK A;  2L3Q A;  1U5S A;  1GBQ A;  1JXM A;  1RAI B;  4Z8A A;  2NYS A;  2RD1 A;  4WCI A;  2VWF A;  1YFN A;  3M57 A;  3CXC S;  3CC4 T;  1I1J A;  3H8Z A;  1VQ5 Q;  1NE8 A;  3TRE A;  4EMG A;  3H0I A;  4OB0 B;  1OX9 A;  2DBK A;  1V29 B;  1RI9 A;  4IKF A;  2H3J A;  3L42 A;  4KUL A;  4CC2 A;  1M1G A;  1Y71 A;  2FO0 A;  2VVK A;  1LJO A;  1G83 A;  1PSE A;  2QEX A;  4QVZ A;  3VYH B;  3I55 A;  4M7A E;  2QEX T;  2XIC A;  3DLL A;  1JJ2 P;  2XU8 A;  1K76 A;  1GXI E;  3QYH B;  3CEY A;  3MO8 A;  1YIT Q;  1ACM B;  3ZL7 C;  2V8K A;  3CCU T;  2DBM A;  2HQX A;  1W2B A;  2LQ8 A;  5FW9 A;  3NGP A;  1KQ1 A;  2AHJ B;  3FJ5 A;  2DTH A;  1BU1 A;  1H64 1;  3RKX A;  2XD0 A;  3E9F A;  3BFM A;  2KY9 A;  3OSS C;  3F70 A;  1VQP T;  4FSS A;  8AT1 B;  4RTU A;  2RHX A;  2EYQ A;  5KYU A;  4KUD K;  3SDZ A;  1QP3 A;  2KXC A;  1JO8 A;  4AMC A;  1GRI A;  2X4J A;  3M0Q A;  4M78 D;  1TUD A;  1S72 T;  3V7C A;  1YJN T;  2DX1 A;  3L2V A;  4BUG A;  1V1C A;  2JJ9 A;  5FU7 B;  3CCJ T;  4C0G A;  2O2O A;  2JUF A;  1AWX A;  3MPU B;  3QJY A;  3H0H A;  5DLO A;  2LDM A;  4KH0 B;  2DJQ A;  4C8Q D;  1MNE A;  4C92 A;  2E65 A;  4J5Y A;  5KH6 A;  2K79 A;  1AWJ A;  1KC8 R;  2COW A;  3A1P A;  4XTZ A;  4Z89 A;  4M7A F;  4RG2 A;  3UDC A;  4AFU C;  4A4F A;  1CKA A;  5GAO p;  3A8L B;  3CQT A;  4XTX A;  1OQK A;  1S1N A;  1Q81 C;  3PFS A;  1U1T A;  2O4X A;  1T3L A;  3EGD A;  3MKD A;  3LH0 A;  1X6O A;  3FEO A;  1PRM C;  2LT4 A;  1CSK A;  1M2V A;  3GNF B;  1YJW T;  1S72 A;  4HCZ A;  2HQH A;  2EFI A;  4HVW A;  3OQ5 A;  3L2R A;  1SSH A;  2CP5 A;  4F7U F;  3G4S Q;  1PCX A;  1OX8 A;  2V1Q A;  3EG3 A;  3URG A;  4K11 A;  1G3W A;  4Z88 A;  4KT0 E;  1NPR A;  1M90 R;  2E6N A;  2QK0 A;  1OOT A;  3CPF A;  3GBQ A;  3CCS Q;  2JMA A;  2LZ6 B;  1JQQ A;  2GQI A;  3GNG A;  4IUV A;  4M78 B;  1ZX6 A;  4C92 E;  4A53 A;  1AOJ A;  3V8L A;  5IHK A;  4PFO A;  1JEG A;  5I21 A;  4J9E A;  5GAN 5;  2OTL A;  4CRI A;  5GAM d;  1SRM A;  4A4E A;  2BKD N;  2DLP A;  3CCQ T;  2EW3 A;  4FYV B;  2Y4Y A;  3VS4 A;  3G71 Q;  1NJI U;  4RKU E;  3EGD B;  3UA6 A;  4DBQ A;  2EWN A;  2QQ9 A;  4GLM A;  4EDU A;  4QVD A;  1U06 A;  4FYW B;  1GL5 A;  4PJN A;  4LN2 A;  1YJN A;  4L59 A;  2EIF A;  5HK0 A;  3EG9 A;  3OW2 P;  2YRC A;  2G6F X;  3V7R A;  1Y0M A;  5GAM j;  2O9S A;  3JCM c;  2M51 A;  4LUE A;  1Q7Y R;  4F7U E;  2CUB A;  4FL6 A;  1IGU A;  5HKC A;  4OF1 A;  4C8Q B;  1D3B A;  1WHJ A;  4AFZ C;  3QZ9 B;  5KYY B;  3PTA A;  3L2Z A;  4LDU A;  1W70 A;  1WXT A;  2WSF E;  1YHQ T;  1BI3 A;  4M7D F;  2QQR A;  1Q81 R;  4QQG A;  2RJE A;  1NYF A;  2K57 A;  2JM9 A;  5IH2 A;  1YHQ A;  3LW5 E;  2AZS A;  2HAX A;  1UEB A;  2EQI A;  2BUD A;  3M9Q A;  4RTX A;  1VYV A;  2VV5 A;  3CCE T;  3INZ A;  2L2P A;  3OBY A;  3RMQ A;  3JCM V;  4C8Q E;  2D0Q B;  4E6R A;  4BE0 A;  4C5H A;  5CIU A;  2KYB A;  4MML A;  5KE2 A;  2YLC A;  2ZGW A;  3EG1 A;  4LDW A;  2FB7 A;  4BDY A;  1YI2 T;  1VIE A;  3SFM A;  5GMK l;  4QW2 A;  4AFS C;  4B9W A;  2KMT A;  3Q1J A;  2HCK A;  1H8K A;  3QO3 A;  4AG1 C;  2DL8 A;  3VS0 A;  2PZ1 A;  3CC7 Q;  2HL3 A;  1WZO A;  1XJW B;  3CCL T;  4M7D D;  4BY6 C;  4Y91 A;  5EC7 A;  2BTT A;  2M0O A;  4RTW A;  1X75 C;  2LQK A;  1TH7 A;  3PIP A;  1IRX A;  4KGX B;  2GCX A;  2OTJ Q;  1NLO C;  2DJZ A;  1CKB A;  1FWZ A;  2V26 A;  3MJX A;  2QEX Q;  2YHT A;  1PHT A;  4R0K A;  3MEU A;  5C6S A;  3P8H A;  2RQV A;  2KVQ G;  4JS4 A;  1QKW A;  3VS7 A;  3CCE A;  4BE2 A;  1JRI A;  3MHX A;  1W4S A;  3RR6 A;  3GP8 A;  5LJ3 f;  4FM4 B;  3CC7 T;  2XK0 A;  4PFZ A;  3CD6 A;  2NUP A;  1M90 U;  4CC3 A;  1TOV A;  3TQ7 P;  2E4H A;  1AZG B;  2OJ2 A;  5CK9 A;  1I0C A;  4OP0 A;  1RAH B;  4M78 G;  2JM8 A;  2J06 A;  1TXQ A;  2RK1 A;  3PMT A;  4Y92 A;  3L2W A;  3VS3 A;  2QGG A;  4BY6 B;  2QG9 B;  3OYN A;  1Q82 U;  3UWN A;  3OYE A;  5I11 A;  4M75 G;  2FYK A;  1NJI R;  2DL4 A;  2OAW A;  4ZGJ B;  1AT1 B;  4FSX A;  2K5F A;  1BYM A;  4ANJ A;  3S3O A;  1U1S A;  2L8D A;  2R57 A;  3JB9 D;  1B3Q A;  3EFS A;  2MPX C;  2OI3 A;  2K3B A;  1TS9 A;  3WXM B;  2QAS A;  3A8G B;  2LNH B;  4PKC C;  3VS6 A;  1A0N B;  2JTE A;  1VQ6 A;  4BI8 B;  3M55 A;  3I56 A;  4XU0 A;  2CSQ A;  4PJO G;  3I5R A;  1B34 B;  2DXC A;  4EMK C;  1WQW A;  2DXT A;  4JRQ A;  4M77 F;  3U23 A;  3CCJ A;  4XTW A;  2JXB A;  3LH5 A;  3PVL A;  4RTV A;  2V1R A;  1R77 A;  2VGN A;  2CS7 A;  4N4I A;  1ABQ A;  2RN8 A;  2X4W A;  3ZEH A;  3I5S A;  4F17 A;  4PJO B;  1MMD A;  1X69 A;  3G6E Q;  1ZUY A;  2QDL A;  1K9M C;  4F04 B;  3HRT A;  5GAN f;  3OS1 A;  3I35 A;  4C5E A;  1ZA1 B;  2I0N A;  4HCK A;  1PRL C;  4KRT A;  4E7S A;  5CO7 A;  2OTJ T;  5GAN d;  1OV3 A;  2NWM A;  4DOW A;  1HJD A;  4MZM A;  5M9O A;  4N0A C;  1N9S A;  2PUO B;  3M5A A;  4JLG A;  1BIB A;  2WSE E;  4JRK A;  3QBY A;  2V8J A;  1I5L A;  1ZBX A;  2RI2 A;  4J6Y A;  2HEQ A;  1W6X A;  3QJ6 A;  4PL6 A;  2KT8 A;  2ZPE B;  1VQ6 Q;  3MEW A;  4M78 F;  1VQO T;  2CUD A;  3CD6 T;  2ATC B;  1I07 A;  2LCC A;  3OMG A;  2K7A A;  1UB4 A;  1D0Y A;  2JVV A;  1YJ9 T;  1T0H A;  1YI2 Q;  1EX4 A;  2ZPG B;  1MV3 A;  3SEM A;  4LXC A;  3H0F A;  1KIK A;  1Y07 A;  4EMK B;  2DO3 A;  2C06 A;  2DA9 A;  3V7S A;  5A2Q E;  4F7U B;  4M7D A;  4MZT A;  2LJ1 A;  1G3T A;  1M27 C;  4C92 F;  4NL3 A;  1D09 B;  2E3H A;  2GFU A;  1N8R U;  2R58 A;  4XK8 E;  1KQS S;  2AZV A;  4LUD A;  2KRO A;  1B07 A;  1VQM T;  4OB3 B;  2MOX A;  1Q82 C;  2QTX A;  4XTV A;  2I2L A;  4M7D E;  3KUF A;  2HL5 C;  1K0X A;  2DTO A;  1AWO A;  1WJR A;  3M0S A;  1WA7 A;  2RHY A;  2FPE A;  1QP2 A;  5LJ5 f;  2EJG A;  3H41 A;  4JUV A;  4QT7 A;  1ZHI A;  3ER0 A;  4J9F A;  2MK5 A;  4M7A C;  2FZC B;  4A4G A;  5J39 A;  1KQS P;  2DFU A;  2DE0 X;  3FJP A;  1UGQ B;  2BZ8 A;  4N4H A;  4ELZ C;  1WQ7 A;  2EYX A;  3SB2 A;  4DQ2 A;  3EH1 A;  2XHC A;  4OMF B;  5GMK i;  1QVP A;  1WHH A;  1X6G A;  3HSB A;  3EFO A;  4BDZ A;  2YRV A;  3CCR Q;  4KGV B;  2RQT A;  1N9R A;  1UHF A;  3RDV A;  3BDU A;  5D7U A;  1X43 A;  1I8F A;  2DIG A;  3OYK A;  3QII A;  4HKE A;  1UDL A;  3X28 B;  4ZTF A;  2ROL A;  1H3H A;  5CR2 A;  2O01 E;  3G71 A;  4B9X A;  5I2S A;  3JV3 A;  5IHN A;  2MCN A;  3J7A F;  3A5Z B;  3JB9 I;  4OMM A;  3GLX A;  5D6Y A;  1VQ9 T;  3TSW A;  3JSC A;  3MP8 A;  3QZ5 B;  3UF4 A;  5I2M A;  2QQA A;  1K9A A;  2AKK A;  2W10 A;  1W2B P;  2A28 A;  1YP5 A;  4GBQ A;  1U8R A;  2M1H A;  1G3Y A;  2A0F B;  1M9S A;  5AT1 B;  3MEA A;  5GMK e;  1TUC A;  1FMK A;  4OGE A;  4XQ3 A;  5CKE A;  4PLL A;  1YHQ Q;  1YCY A;  4PLI A;  1UE9 A;  1XQH A;  5GAO q;  2DAQ A;  2P0Q A;  1K73 C;  4FT4 A;  1IZ6 A;  1WDX A;  1T3S A;  3TVT A;  3OYG A;  3JCM X;  1Q82 R;  1TWB A;  3G6E T;  5GAN 2;  1FX7 A;  4X34 A;  2CKK A;  2VKN A;  1M8M A;  2A36 A;  2KT1 A;  2XID A;  2DNU A;  1PD1 A;  3CMA T;  1EIF A;  3A8H B;  1R0C B;  2BZX A;  4HA8 A;  3CMA Q;  3QKJ A;  3CMA A;  3OYA A;  2LT1 A;  1UUE A;  2FL7 A;  1SKU B;  3FLG A;  2D1X A;  1RLP C;  2VYT A;  1VQ6 T;  5IT9 E;  2JOY A;  3C0C A;  3P8B B;  1M2O A;  3IQL A;  1WHG A;  3M58 A;  1OYX A;  5L8R E;  2DM1 A;  3AT1 B;  2KI7 A;  4F7U G;  4RMO A;  4N4G A;  4O5V A;  3JB9 G;  4IIM A;  1Q95 G;  2F2X A;  2DL3 A;  1EFN A;  1D3B B;  2EJ9 A;  1ABO A;  1YJ9 A;  1DJ7 B;  2IG0 A;  2DRK A;  1Q86 R;  3CD6 Q;  5J3B A;  1UTI A;  2LNV A;  4PNO A;  2Y4X A;  2XI9 A;  4J6X A;  2CH4 W;  2M0Y A;  3OW2 A;  2ZCF B; 
#chains in the Genus database with same CATH homology
 4C5H A;  2P4T A;  3FIF A;  5CIU A;  3X25 B;  1MHN A;  4MML A;  5KE2 A;  1X01 A;  3JCM Q;  1YIJ A;  3CPW S;  2HD0 A;  2YLC A;  2ZGW A;  1BKB A;  5LJ5 d;  3OYL A;  3E1S A;  4LDW A;  3OS2 A;  1YIT A;  4HCC A;  4O6J A;  5IN1 A;  2E10 A;  2FB7 A;  4BDY A;  1YI2 T;  3G4S T;  1VIE A;  2FHD A;  3SFM A;  5GMK l;  4EPC A;  4QW2 A;  1VQ8 A;  4B9W A;  2DZ9 A;  2KMT A;  3Q1J A;  2F69 A;  1BI2 A;  4L6V 5;  3QO3 A;  4QQ6 A;  1I4K 1;  4BI3 A;  3JB9 J;  2KQW A;  3P8D A;  3OYH A;  4A54 A;  3OYB A;  1KC8 U;  3OY9 A;  5C0M A;  1NPP A;  4YTL A;  1VQ7 T;  2F5T X;  2XKO C;  4J7F A;  5DLQ E;  5LJ3 d;  3CCV T;  2RO0 A;  3ME9 A;  5D6X A;  2Y90 A;  3CCL T;  1KC8 C;  3JCM d;  1VIF A;  4M7D D;  4C5I A;  3CBP A;  2JNG A;  2RK2 A;  2RI5 A;  3QHS A;  1R8O B;  4BY6 C;  2QI2 A;  4C8Q F;  4Y91 A;  1BYM A;  3N5B B;  2LC4 A;  3QYG B;  5CKF A;  5LJ5 h;  2M0O A;  3RER A;  3QSU A;  2HNI A;  1X75 C;  3PNW C;  1XNI A;  2E1H A;  2LQK A;  3KXT A;  1TH7 A;  3PIP A;  3G4S A;  1UGP B;  1XOV A;  3ZBD A;  1YI2 A;  1WPY A;  2EQM A;  2BIV A;  2GCX A;  3VYG A;  4M7D G;  3GOX A;  4M78 C;  2E6Z A;  2QDY B;  5LL6 S;  1K8A C;  2RI3 A;  3CPW A;  2DZC A;  1H3Z A;  1LNX A;  2DJZ A;  3CCS A;  1FWZ A;  4IUP A;  3CCM T;  2R5M A;  3DB3 A;  1QVG A;  2IVW A;  2YHT A;  2LVM A;  4M7D C;  3WVE B;  4PJO F;  2KDS A;  3MEU A;  5C6S A;  3P8H A;  2G3R A;  2KVQ G;  4JS4 A;  4C0D C;  4WF2 A;  4JRP A;  3PIO A;  3CCE A;  4OB2 B;  4QQD A;  4BE2 A;  1JRI A;  3MHX A;  1NJI C;  1VQ9 A;  1W4S A;  4M75 A;  4E7I A;  1JJ2 S;  2CZ1 B;  3GP8 A;  3CME A;  2ZZD A;  5LJ3 f;  1QVG S;  4FM4 B;  4JDS A;  4TVR A;  3CC7 T;  2XK0 A;  3CD6 A;  1VQM A;  3OSV A;  2PVO B;  1G3S A;  2RA2 A;  4XAX B;  1FXX A;  5HK3 A;  4J83 A;  5GAM h;  3CCR T;  4M77 G;  2EQJ A;  1M90 U;  3LWI A;  2DD4 A;  1WNL A;  3LLR A;  4M77 C;  4C92 D;  2EQK A;  3S3N A;  1HXD A;  4LDV A;  4XTU A;  5GAN e;  3L1A A;  3NFC A;  4M78 E;  3OYJ A;  1Q7Y U;  2NLU A;  1VQ8 T;  4OB1 B;  4ATO A;  1KQ2 A;  3R6O A;  1VQ5 T;  5CK9 A;  5GAN g;  2FVU A;  3BW1 A;  2VXE A;  3A8O B;  1IRE B;  2K3X A;  3LX7 A;  3RMS A;  2QXF A;  4OP0 A;  3CC2 T;  2ZPH B;  3CCL A;  2K2V A;  4M78 G;  3CCV A;  4R56 A;  5CQY A;  3L2Q A;  3JB9 H;  2ZPI B;  2LTO A;  3ASK A;  3HRU A;  4ME7 A;  2DIQ A;  4MMK A;  1K9M U;  4M75 D;  5GAN j;  1G5V A;  2A7Y A;  3SD4 A;  4ZGE B;  1Y7X A;  3CBM A;  4E47 A;  2RK1 A;  2DPP B;  3MET A;  2RH2 A;  3PMT A;  3L2W A;  3QG1 A;  3ZFJ A;  4BY6 B;  3OYN A;  3CBO A;  4XTY A;  3OYY A;  3RKY A;  1Q82 U;  3I56 T;  3M59 A;  3UWN A;  3QXE B;  3VUB A;  1WJS A;  4M75 C;  2EQU A;  5EG2 A;  2E64 A;  3FDR A;  5KE3 A;  3OYE A;  1VQO A;  3HFN A;  4M75 G;  4JRI A;  2L5Q A;  2FYK A;  1Y96 A;  4M77 E;  4LD9 K;  1KD1 U;  4FU6 A;  5CKD A;  5GAO r;  1VUB A;  4ZGJ B;  3G7Z A;  3OA6 A;  4FSX A;  2K5F A;  4X9C A;  2PUK B;  3HL8 A;  2X35 A;  2EAY A;  1U1S A;  3E9G A;  4Q5W A;  3SWN B;  4DA4 A;  2L8D A;  1M4Z A;  4E7L A;  3PMI A;  2R57 A;  3OW2 S;  1VQK A;  5GAN 4;  5GAN 6;  5A0G A;  1JB0 E;  2A3L A;  3JB9 D;  3EFS A;  1JBM A;  4JLI A;  4A4K A;  1Q86 U;  5LJ3 g;  3FC3 A;  2VUB A;  3WXM B;  4BAC A;  3MCA B;  4BB7 A;  1SSF A;  4ZGD B;  2ZPF B;  4KBM B;  1O75 A;  4VUB A;  4PJO C;  3OMC A;  4R55 A;  3A8G B;  4PKC C;  2M16 A;  3S3M A;  1M1K U;  2WAC A;  4EMK A;  3GPL A;  1O9S A;  1VQ6 A;  4BI8 B;  2JZ2 A;  1QW1 A;  5GAO m;  3M55 A;  3I56 A;  1QVF A;  3M54 A;  4XU0 A;  4HT9 A;  4PJO G;  2RJC A;  3CC4 A;  3NTH A;  4C8Q A;  3PGG A;  1B34 B;  2DXC A;  1NZ9 A;  4EMK C;  2JTF A;  3SWN A;  3GF5 A;  1WQW A;  2MWP A;  2DXT A;  4KUI A;  3S3O A;  2LRQ A;  4XU3 A;  4ELY C;  4JRQ A;  1UGS B;  3OYI A;  4M77 F;  1VQ7 A;  3M56 A;  3QUI A;  1VQN T;  5CQX A;  3JB9 F;  3HKS A;  3JRZ A;  4J6W A;  3CCJ A;  4RG8 A;  4XTW A;  1QVF S;  4PJO D;  4X9D A;  3X20 B;  4C0D B;  5LJ3 j;  4A4H A;  2VGN A;  5GAN 7;  3TCJ A;  1B34 A;  2CS7 A;  4N4I A;  1K73 U;  3CXC A;  4XU1 A;  3QDR B;  4MDW A;  2X4W A;  3ZEH A;  4JJN K;  1JJ2 A;  4PJO B;  1P92 A;  2QQS A;  3OS5 A;  4BE1 A;  2D6F A;  2XDP A;  3RES A;  5GAN f;  3HRT A;  3OS1 A;  1K9M C;  2HQE A;  2RD1 A;  3VJP A;  4C5E A;  3M57 A;  3CXC S;  3CC4 T;  2MWO A;  2RHU A;  5DM7 R;  3H8Z A;  1NE8 A;  5CO7 A;  2OTJ T;  3RKW A;  2X4X A;  4LDY A;  3TRE A;  4M77 B;  5GAN d;  1VQL T;  2B8A A;  4EMG A;  4DOW A;  4MZM A;  4E7H A;  4J8O A;  2MI6 A;  5M9O A;  4N0A C;  1N9S A;  2CZ6 B;  2PUO B;  1RI0 A;  3M5A A;  4P5N A;  3CC2 A;  4JLG A;  1BIB A;  4OB0 B;  4LDX A;  1V29 B;  2F5K A;  2WSE E;  4JRK A;  2MF2 A;  4OGC A;  3JCM f;  4ZTJ A;  3QBY A;  4IKF A;  2H3J A;  2R5A A;  2V8J A;  1VQN A;  3L42 A;  1I5L A;  3SWN C;  1ZBX A;  2RI2 A;  4KUL A;  1M1G A;  4J6Y A;  3RIR A;  1RL2 A;  1OZ3 A;  3QJ6 A;  3GIB A;  4PL6 A;  3V8J A;  2KK4 A;  2ZPE B;  5HY6 A;  3MEW A;  2YLB A;  3X26 B;  3JCM e;  1Y71 A;  3LGL A;  3HPW A;  1LJO A;  1PSE A;  4M78 F;  2QEX A;  3JCM P;  1VQO T;  3VUZ A;  3CD6 T;  5GAM f;  2LCC A;  3I55 T;  4QVZ A;  3VYH B;  3OMG A;  2WSC E;  2D9T A;  3I55 A;  1UB4 A;  3UPU A;  4M7A E;  2JVV A;  5KCO A;  3OYD A;  1YJ9 T;  2QEX T;  4M75 E;  2XIC A;  3DLL A;  2XU8 A;  2ZPG B;  1HK9 A;  1OI1 A;  5A0D A;  1GXI E;  2XDB A;  3QYH B;  1KHI A;  3CEY A;  5FRO A;  1Y07 A;  3MO8 A;  4EMK B;  2PQW A;  2DO3 A;  3J81 E;  2C06 A;  3LWH A;  2V8K A;  3CCU T;  1YJW A;  2KAF A;  2HQX A;  1W2B A;  2LQ8 A;  3V7S A;  5A2Q E;  2P0K A;  1WJQ A;  3C4S A;  1KQ1 A;  2AHJ B;  2VGM A;  4M77 D;  2DTH A;  4F7U B;  4HT8 A;  4MZT A;  4M7D A;  4C92 G;  3RKX A;  1H64 1;  2XD0 A;  3E9F A;  4LD6 A;  1G3T A;  1ZQ1 A;  2KY9 A;  3BFM A;  1OZ2 A;  2K4Y A;  3F70 A;  3OSS C;  4C92 F;  2CGH A;  4NL3 A;  2GFU A;  4RCB A;  4M7A A;  1VQP T;  3E19 A;  1KG1 A;  1N8R U;  2R58 A;  5A0L A;  3A8M B;  2RHX A;  4XK8 E;  2EYQ A;  4KUD K;  1KQS S;  3SDZ A;  1QP3 A;  2CYZ B;  3CCR A;  2RM4 A;  2ZPB B;  1Q81 U;  2X4J A;  2X4Y A;  3VU3 C;  1VQM T;  4M78 D;  4OB3 B;  2P0P A;  4C5G A;  3VV0 A;  1S72 T;  3V7C A;  1Q82 C;  1YJN T;  2QTX A;  4M75 F;  4XTV A;  3L2V A;  4BUG A;  2VC8 A;  2I2L A;  1Y96 B;  2EKO A;  4M7D E;  5FU7 B;  2DKG A;  4F7U A;  2DXU A;  3KUF A;  4C0G A;  3CCJ T;  3CCU A;  4M77 A;  2JUF A;  3O8V A;  5IAY A;  2DTO A;  2PU9 B;  1WJR A;  3DKM A;  3CCM A;  3CCQ A;  3QJY A;  2RHY A;  1QP2 A;  5LJ5 f;  2EJG A;  4JUV A;  5DLO A;  1VQ4 A;  1ZHI A;  3ER0 A;  2LDM A;  4D6W A;  3JCM W;  5GAN 3;  4M7A C;  4BI4 A;  1MGQ A;  4A4G A;  2O4X B;  3TEE A;  5J39 A;  4N0A A;  4C8Q D;  3CME T;  3FJP A;  1M1K C;  1UGQ B;  3LGF A;  4M78 A;  4C92 A;  4ELZ C;  4N4H A;  2E65 A;  4J5Y A;  4DOV A;  5KH6 A;  3M4G A;  5LJ3 h;  5GAN h;  1WQ7 A;  4II1 A;  3RUX A;  2XDD A;  4M7A G;  2GQV A;  1M5Q 1;  2EJF A;  3SB2 A;  5FU6 C;  4IUT A;  4DQ2 A;  4XTZ A;  2XHC A;  4C92 C;  4M7A F;  4OVA A;  4RG2 A;  3UDC A;  1BI0 A;  4OMF B;  3X24 B;  4A4F A;  5GMK i;  1QVP A;  3L2U A;  3HSB A;  5GAO p;  3A8L B;  5LJ3 e;  2YRV A;  3BY7 A;  4XTX A;  4BDZ A;  5CVI A;  3CCS T;  3NTI A;  2GFA A;  1N9R A;  1VQ4 T;  5GAO n;  3HRS A;  1KHC A;  5FLX E;  3OBW A;  3UT1 A;  1Q81 C;  3PFS A;  1VQP A;  1U1T A;  2O4X A;  5GMK j;  1PSF A;  3LH0 A;  3M53 A;  1X6O A;  1I81 A;  3FEO A;  3PT9 A;  3BDU A;  2LT4 A;  4FT2 A;  4NL2 A;  3V8K A;  4MZP A;  3GNF B;  1BI1 A;  1N27 A;  2KSS A;  2RJF A;  5DY9 A;  1YIJ T;  1YJW T;  1I8F A;  2DIG A;  3KBG A;  3OYK A;  1WGS A;  2RJD A;  1S72 A;  3QII A;  4HCZ A;  4ZN1 A;  4HKE A;  3JCM h;  4J7I A;  2EFI A;  3OQ5 A;  3X28 B;  5D6W A;  2OTJ A;  4NS5 A;  4GLK A;  3L2R A;  5GAN 8;  4ZTF A;  4F7U F;  5CR2 A;  2O01 E;  2RB6 A;  3EFR A;  3G71 A;  2L3R A;  1VQ5 A;  4B9X A;  5I2S A;  3URG A;  4L5G A;  5GAM e;  3J7A F;  3A5Z B;  3LYI A;  2PVG B;  3JB9 I;  1M8V A;  4EMH A;  3GLX A;  1G3W A;  4NOY A;  5D6Y A;  5LJ5 j;  1K8A U;  1VQ9 T;  4KT0 E;  3AHU A;  3JSC A;  3MP8 A;  3QZ5 B;  3G6E A;  2QA4 T;  5CKB A;  5I2M A;  5CCA A;  1NPR A;  2E6N A;  2QQA A;  3C12 A;  3CPF A;  3S6W A;  4E7K A;  2OAU A;  2L89 A;  2DTI A;  3CC7 A;  5CAI A;  1U8R A;  2M1H A;  4Y28 E;  1G3Y A;  1M9S A;  3GNG A;  3MEA A;  4IUV A;  2MMP A;  5GMK e;  3TU4 K;  4M78 B;  3C95 A;  4OGE A;  3C94 A;  2DXB A;  3MP1 A;  4IUU A;  2GF7 A;  2VXF A;  4XQ3 A;  3BDL A;  2JN0 A;  5CKE A;  4PLL A;  4Z02 A;  4C92 E;  1YCY A;  4PLI A;  3V8L A;  1BIA A;  3EAE A;  1XQH A;  3MEV A;  4A53 A;  5GAO q;  3JCM J;  4M7D F;  3QPH A;  2DAQ A;  2P0Q A;  5LJ5 e;  5KCH A;  2DEQ A;  4UC4 A;  4MDX A;  3HFO A;  1K73 C;  4C92 B;  5I21 A;  3OB9 A;  3OS0 A;  4FT4 A;  5GAN 5;  2OTL A;  1IZ6 A;  4C0F A;  4CRI A;  5GAM d;  3OYG A;  1AHJ B;  3FB9 A;  3MP6 A;  3JCM X;  3OYC A;  3NTK A;  2BKD N;  4A4E A;  4V2S A;  3G6E T;  2QA4 A;  4JS5 A;  4E7J A;  5J26 A;  3CCQ T;  2Y4Y A;  2CZ0 B;  1UGR B;  1NJI U;  2E41 A;  4RKU E;  4IUR A;  4C8Q C;  1FX7 A;  5GAN 2;  4X34 A;  4PJO E;  2CKK A;  4QVC A;  2EWN A;  2XID A;  2QQ9 A;  1W2B S;  5FRN A;  4EDU A;  4QVD A;  4IUQ A;  3CMA T;  2LCL A;  1EIF A;  4ZN3 A;  2HBP A;  3A8H B;  1Q7Y C;  3OYM A;  1YJN A;  4L59 A;  2EIF A;  5HK0 A;  4HA8 A;  1M90 C;  3VKI A;  2E12 A;  3QKJ A;  2MAM A;  3CMA A;  2E5Q A;  1YIT T;  3OYA A;  3V7R A;  3G71 T;  1KQS A;  2LT1 A;  3FRN A;  1XTD A;  5GAM j;  2E70 A;  2FL7 A;  5FU7 C;  2OTL T;  3M4Y A;  5LJ5 g;  3FLG A;  4M7D B;  3JCM c;  2VYT A;  1VQ6 T;  4PJO A;  5AYF A;  3JCM g;  5GMK h;  4F7U E;  5IT9 E;  2JOY A;  4FL6 A;  4CI0 C;  3P8B B;  5HKC A;  4OF1 A;  4C8Q B;  2K5I A;  1D3B A;  3M58 A;  1OYX A;  2JTM A;  3QZ9 B;  2LX9 A;  1YHQ T;  3T9N A;  1M1F A;  5L8R E;  2RHZ A;  5GMK m;  3PTA A;  2K5L A;  3HHT B;  3WVD B;  4M75 B;  3L2Z A;  4LDU A;  1Q86 C;  4GY5 A;  3JCM b;  4F7U G;  4M7A B;  4RMO A;  4N4G A;  2WSF E;  3DLM A;  1BI3 A;  3HP9 A;  2M9U A;  4FIB A;  4O5V A;  1LOJ A;  4XU2 A;  2QQR A;  2QQB A;  3JB9 G;  1N8R C;  4QQG A;  2RJE A;  3J80 E;  1D3B B;  2EJ9 A;  2RHI A;  2V8I A;  2K57 A;  2K3Y A;  2DVE A;  3JAM E;  4RCC A;  2PVD B;  2CZ7 B;  3DB4 A;  3LW5 E;  5GAO l;  1YJ9 A;  1YHQ A;  1KD1 C;  1DJ7 B;  5FU6 B;  4C8Q G;  2DD5 A;  2HAX A;  1VQK T;  2IG0 A;  1UEB A;  3H6Z A;  4BD3 A;  1YBY A;  2BUD A;  3M9Q A;  5J3B A;  4M7A D;  2VV5 A;  2LNV A;  4PNO A;  5GAM g;  3CCE T;  2Y4X A;  4C0Z A;  2XG8 D;  5CKH A;  3INZ A;  5FRM A;  2XI9 A;  1N6A A;  3OBY A;  3RMQ A;  2DK3 A;  4J6X A;  3OW2 A;  3JCM V;  4C8Q E;  2D0Q B;  3OYF A;  1VQL A;  4HCB A;  2ZCF B;  4BE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...