3JCMX

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
70
Chain Sequence
MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINANNHQLGTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 7
structure length 70
sequence length 76
chains with identical sequence a
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmX00
5GAMf 5LJ5d 1LOJA 4EMHA 3RIRA 1KQ1A 3JB9H 3JCMg 3JCMP 4OP0A 5GANd 2EWNA 2VXEA 2DEQA 4JRKA 4M75G 4XTZA 1N9SA 5GAMd 3BY7A 5GAOp 3JCMV 1Y96A 4PJOB 3JCMf 2I2LA 2RD1A 2ZGWA 2FB7A 3V8JA 3V7RA 3BDUA 4C92E 3QUIA 4M75D 4PJOD 4XU1A 3BW1A 1M8VA 1I81A 4M78F 4M75C 3INZA 2DKGA 1WQWA 4M77C 5GMKh 4M7AF 4V2SA 3V8KA 4J6XA 4M78A 1Y96B 1WQ7A 4X9CA 5CAIA 4M7DF 4JLIA 3L2ZA 4N0AA 4M78C 4M7AA 4XTYA 4M77G 4C8QF 4XQ3A 3JCMX 4N0AC 4M7DA 3JB9I 1U1TA 2EJ9A 2K57A 3SWNA 4F7UG 4M7DC 5GAN7 4C8QA 5LJ3j 2DZCA 4M78B 5GAOl 3BFMA 4PJOA 4JRIA 3JCMb 2E1HA 1WNLA 5LJ3f 4NL3A 4M7AB 3VU3C 4M78D 2DXUA 3RUXA 4F7UE 4M7DB 4XTUA 4PJOG 5LJ3d 3SWNB 1LJOA 2FYKA 2E65A 3GIBA 4M7DD 4C8QB 4C92F 1HK9A 2HNIA 4XU3A 2Y90A 2DTOA 2RA2A 3FIFA 4DQ2A 3HFOA 4J5YA 3JB9F 4M75E 2JN0A 4PJOE 3JCMJ 2EAYA 5GAOr 4C92A 1WPYA 2DZ9A 5LJ3e 4X9DA 5GAN6 3JCMQ 3JCMc 3EFSA 3L1AA 1I5LA 4J6WA 2YHTA 4QVCA 4M7AC 1BIBA 1I8FA 3RKYA 5LJ5h 5GMKe 4C92B 5GMKm 5LJ3g 3EFRA 1KQ2A 4M78G 2QTXA 4M77E 3SWNC 5GANh 5GAMh 2DXTA 2RM4A 4XTWA 4EMKA 1D3BA 4C8QC 4XU2A 5GAN3 4M7AG 3V7SA 4QVDA 1YCYA 2DTHA 4F7UF 4WF2A 5DY9A 5GMKj 5GAN2 4M7DG 4JUVA 4M78E 4M7AD 4HT8A 3V8LA 3JCMh 4NL2A 3PGGA 2EJGA 3RESA 4A53A 4C8QG 3QHSA 1HXDA 3M4GA 4EMKB 4M7DE 1D3BB 4XTVA 4M75F 3V7CA 4C8QD 3RKWA 5GAN8 5GANf 5LJ5j 3AHUA 3QSUA 2YLBA 3HFNA 2E10A 1MGQA 4M75A 4C92C 5GAOq 3JCMW 5GANj 4J6YA 1JRIA 4F7UB 3FJPA 1JBMA 4XU0A 2DTIA 2VXFA 2DJZA 5GMKl 5GAOm 4C92G 1TH7A 2E64A 3SB2A 3JB9G 1BIAA 4M77F 4M75B 3HSBA 4C92D 5I21A 1H641 5LJ3h 3JB9D 4Y91A 4NOYA 4EMKC 2CGHA 3QO3A 4M77A 4HT9A 3JCMd 5LJ5e 5GAN5 3JB9J 1B34A 2RB6A 4EMGA 4M7AE 4HA8A 5GAN4 1M5Q1 4F7UA 3RKXA 5GANe 1U1SA 4MMLA 4A54A 5GAMe 5GMKi 4PJOF 3RERA 4RCBA 5LJ5g 1I4K1 4C8QE 1LNXA 4M77B 2EJFA 4PNOA 5GAOn 4RCCA 5GANg 1B34B 5LJ5f 4XTXA 3JCMe 2YLCA 1N9RA 5GAMj 4M77D 2E41A 4MMKA 5GAMg 3FB9A 2DVEA 4PJOC 1X01A 2VC8A
chains in the Genus database with same CATH superfamily
2CZ7B 2YRCA 2DEUA 4OMFB 2ROTA 3JCMg 5GANd 2MIOA 2XDPA 4JRKA 4PJOB 2FB7A 1UGQB 3CC7Q 1WJRA 1M8VA 1QVFP 2YRDA 2DKGA 3EHRA 2DD4A 4DBQA 2AIRB 3L2ZA 4XQ3A 2K57A 1UTIA 3KBGA 3I55T 3IQLA 3L2RA 3OYYA 2DXUA 3RUXA 1K9MU 4M7DB 1VQ6T 3C0CA 5LJ3d 1V76A 4JLGA 5FRNA 1XTDA 1IGQA 4DOWA 1E6HA 5J3BA 3CCJA 2E6ZA 3M0SA 1K8AR 2X9HA 1YI2A 2K3BA 3JCMc 3BE3A 2EYYA 4M7AC 2YUOA 1ZSZC 1AVZC 5IXBA 3GPLA 2BE9B 3SWNC 4D6WA 4HCBA 2GTJA 1I07A 5IXFA 2QGGA 1PRLC 3EG9B 3MP1A 4KBMB 4QKUA 2EJGA 3FC3A 3OYMA 1W2BP 1WLPB 1VQNA 2RK2A 4M75F 1OX9A 3H0IA 3HFNA 3PT9A 1BB9A 1WYXA 1YI2Q 3JCMW 3FJPA 1OYXA 4BE1A 4C92G 3QDRB 1EX4A 2DL8A 3RDVA 2D6FA 3HRSA 5KYXA 4EMGA 4Z88A 4M7AE 1AHJB 4A54A 2LNHB 2PUOB 2QXFA 1KSWA 4RCBA 1RLPC 4E7SA 1D1BA 1PRMC 2X4WA 4RCCA 4PK4A 5LJ5f 3CEYA 5CKBA 2XD0A 4O6JA 5GAMd 3QYHB 3CC2A 2Y4XA 4BE0A 4KUIA 5FROA 4XU1A 4ESRA 3CMAA 1VQ7T 1WHKA 1K76A 5CAIA 1JJ2S 2OTJA 1TWBA 3FDRA 1MMGA 4FYYB 4F7UG 2QI2A 3X26B 1VQKA 3J80E 2RK1A 4DEXA 2DO3A 3CC2Q 2JMCA 5IH2A 3TVTA 1QVFA 2P4RA 4XTUA 2CP3A 1GFCA 1FMKA 3CMAQ 2HQXA 2L3PA 2RH2A 4CC3A 5FW9A 2GFUA 1GCPA 1YHQA 2YUNA 2DZ9A 5A0LA 3CXCA 2OTJQ 2DL5A 4D8DA 2HL5C 2PU9B 2XG8D 5LJ5h 1KQSP 1VQKQ 2KY9A 4LDXA 3KXTA 2CSIA 3QYGB 5ECAA 2M0YA 4C0DB 1IXDA 3OYEA 2GFAA 3PTAA 1KHCA 4F7UF 4HT8A 4ZTJA 4ME7A 4DOVA 4BI8B 4C8QG 4A53A 3JV3A 2K2MA 1YHQQ 1YWPA 2F5TX 2PVOB 3EAEA 3OBWA 2YLBA 2V26A 4BI4A 4WTOB 1RAFB 2JM8A 1M1FA 1H3ZA 2MI6A 2HAXA 3SD4A 3EFOA 3OYDA 3MP8A 1ACMB 2JS0A 3JB9D 1W4SA 2L89A 4Z8AA 4HT9A 3JCMd 4RTWA 1W70A 2RMOA 1DJ7B 4LD6A 1NJIU 3M0RA 2ZPEB 3CCQA 1N6AA 2A08A 2ZCFB 2X35A 5KYXB 1QWEA 2YLCA 1VQOA 5CR2A 4UC4A 2IIMA 2RM4A 4M4ZA 3OB9A 2CT3A 3I9QA 3E9FA 1QW1A 2D8HA 4IIOA 2FVUA 1G3TA 2JUFA 3PVLA 1W1FA 3OYBA 2O88A 1WHJA 2F2VA 2HSEB 4L5GA 1QVGP 4DBHA 3CCQQ 2BZ8A 2DX1A 2ROLA 1VQOQ 2RJEA 2EJ9A 3CCJT 2K3YA 4PKCC 5LJ3j 3CCMA 3H6ZA 1M1KC 2EYQA 1YJ9A 5L8RE 3DKMA 2GGRA 1H8KA 1AWWA 4FSXA 1P92A 1V1CA 2FYKA 4R0KA 1HK9A 2KE9A 2DPPB 2YUQA 1SPKA 1B7TA 3CPWS 2DRKA 2ZPIB 2JZ2A 4IIMA 1G3SA 1VQNT 2LT1A 4QVCA 1MMAA 3CCMQ 4IUQA 2K5IA 3M57A 1KQ2A 1QLYA 1TG0A 2BE7D 2DXTA 1YJ9Q 6AT1B 4QVDA 1YCYA 5DY9A 3OYNA 2L0AA 2MOXA 2KQWA 3PGGA 3L2QA 2ECZA 1M27C 4KT0E 2H3EB 2QA4A 3VS4A 1Q82U 1I5OB 1KQSA 2DAQA 4C5GA 3X24B 1M3CA 1MGQA 1O75A 1WXUA 3VYHB 1QCOA 5CVIA 4C0DC 2MYSA 1TH7A 1J3TA 4BY6B 4ZN3A 3HSBA 3H41A 4CC4B 2NWMA 2J6KA 1RAEB 4M77A 4NS5A 1JXOA 2KNBB 1N8RU 3EFOB 1Q86R 2XU8A 5GANe 4ZGDB 2PQWA 1CSKA 1PM3A 3R6OA 4PLIA 2IG0A 5GAMj 4M77D 3CMAT 1G8XA 3OYIA 1FX7A 2E6NA 4LD9K 2E12A 3EGDA 3THKA 5D6YA 1YITA 2CP7A 3F70A 2ZGWA 4HVUA 3V8JA 4VUBA 5GMKh 1AWXA 2D9TA 3ZL7C 2HCKA 3G4SA 3OS2A 1UJ0A 2JM9A 4N4IA 1K8AC 3QZ9B 4EDUA 1Q7YU 2CZ6B 1VIFA 2M16A 2DNUA 2XK0A 1WHLA 1PSEA 2ATCB 4R55A 5GAOl 1G2BA 1YITQ 2YUPA 2AKKA 1QVGA 1YJNT 3FEOA 2BTTA 1BI0A 2JS2A 2RJDA 4X34A 4DBFA 5KYYA 2EGCA 1NJIR 1RACB 3HTRA 2FG0A 2RQTA 3C4SA 1UDLA 1ZSZA 5CKFA 3RKYA 2KRSA 2ESWA 3EFRA 2KI7A 4X1VA 4KRTA 3OS5A 1U8RA 1TUCA 4M7AD 1NYGA 4PL6A 3OYGA 1KD1R 1VIEA 1ZUYA 2O01E 3NTIA 3V7CA 2LDMA 4AT1B 1QCNA 2E5QA 3AHUA 2MF2A 2NLUA 4MZMA 4M75A 2RJFA 2P0KA 3O5ZA 4DEYA 1N5ZA 3JB9G 4CRIA 3CCQT 1VQOT 3QJ6A 2KK4A 3UF4A 1UGRB 2RPNA 1RLQC 4LDYA 5GAMe 3RERA 5CKHA 2HBPA 5LJ5g 2LC4A 5DLOA 1YWOA 4M77B 2X3WD 3G71A 4BY6C 3OYJA 3OYFA 1AD5A 2FL7A 2VC8A 1EFNA 3NMZC 1MV3A 1UECA 2J05A 1W6XA 2FPEA 4BE2A 3OW2S 3CCLA 2E70A 3BDUA 3QUIA 1RL2A 3CCMT 3E2UA 2K7AA 3U23A 3CPFA 4OMMA 1BI2A 2MCNA 1GBQA 2XKOC 1QP3A 3VS6A 5GJWB 3JB9I 1U1TA 1XQHA 1M1GA 1TUGB 2A0FB 4JRIA 2LQ8A 1Q81U 2LZ6B 2PUKB 4J9CA 3CCLQ 2VKNA 1NE8A 2ZPBB 4FL6A 3M0UA 2KT1A 2Y90A 1VYTA 1PCXA 2KAFA 2CZ1B 3EG0A 3VRYA 2YT6A 2JXBA 2P0PA 4GBQA 2QA4T 4J9GA 4M78G 1K73U 1LVKA 5KYYB 2FZCB 2HKQB 1S72A 2L2PA 3PIOA 4F04B 4LNPA 3GP8A 1YBYA 4II1A 3PE0A 2XHCA 2COWA 2ZAEA 2LJ1A 2GTOA 5CKEA 1Q7YR 4KH0B 3EG9A 2CREA 3UDCA 2VV5A 4M75B 1OI1A 1TTHB 2J7IA 2R5AA 3M0TA 1S72Q 2CT4A 2HQHA 2CUBA 3REBB 1RAGB 4OB0B 2EYZA 1GRIA 2FEIA 1M2VA 1WI7A 2W10A 2E41A 3ZFJA 1PC0A 2V1RA 5KE2A 3G6EA 4RKUE 3G4ST 1NLOC 2D0NA 1UHCA 1E7OA 1SSHA 4J8OA 4ZGJB 5J39A 4Y92A 4FW2A 1MV0B 2X4YA 4M77C 5GJVB 2PTKA 3C95A 4FT2A 3CCUA 4E7JA 3G6EQ 1JEGA 1OX8A 1AOJA 1YJWT 4BDYA 1KC8C 4N4HA 4J5YA 2CP2A 3UA7A 2KBTA 2HBWA 1WGSA 5KE3A 1BIBA 5KCOA 3CXCP 2DBKA 3GNGA 3CMEA 2E3HA 4M77E 4C0FA 3WVDB 4M7AG 1QWFA 3QDFA 7AT1B 2HZYA 3QHSA 1Q86C 3N5BB 4IURA 5GAN8 2HD0A 1OZ3A 1M90U 1JJ2P 3I5SA 4LE9A 2LQWA 4F7UB 3S3NA 1UUEA 4OMNA 4XU0A 2DJZA 3I5RA 3OSVA 5GMKl 3CMEQ 4BB7A 1G83A 4J9DA 5FU6B 3QIIA 2F5KA 3G71T 2RI3A 2GQIA 3H0FA 2FHDA 1Q81R 2PNIA 2R57A 2FRYA 3A1PA 2YDLA 2JTEA 3ZBDA 1OU9A 3RKXA 3CCJQ 2M9UA 3LX7A 4PJJA 2HSPA 3CCLT 1I4K1 4PNOA 2V8IA 4XTXA 4MMKA 2CP6A 3FB9A 3VUBA 4M75C 3ZEHA 5GANf 1PKSA 2O4XA 1I0CA 3OBYA 1R0BG 2BZYA 2KGTA 2R5MA 3Q1JA 1M2VB 4CC2A 2E3IA 1QP2A 3RMQA 4A63B 4F14A 3V7RA 1K73R 3OYAA 3DB3A 4BDZA 1VQNQ 3M0PA 1UE9A 2BKDN 3RMSA 4R56A 4X9CA 2QQBA 5I11A 1D0XA 1NLPC 2GBQA 3HRUA 2RQVA 3CCRA 3OMCA 4L59A 4ELZC 2RO0A 2EGEA 1VQLT 5LJ3f 4NL3A 1JO8A 4PJOG 1VYUA 4GLMA 1C6VX 4C92F 4XU3A 2RHIA 1KD1C 3GLXA 2BZXA 3HL8A 1UG1A 3OY9A 4M75E 3CBOA 3UA6A 1WPYA 2O31A 3DB4A 2LTOA 1S72T 1I5LA 3A98A 3CCRQ 4J6WA 2YHTA 3S3MA 5GMKm 2X3XD 2J6OA 1RUWA 3LGFA 5GANh 2YWWA 2EKHA 1D3BA 4MDWA 4WF2A 4M7DG 1KJWA 3S6WA 3P8BB 5D7UA 2QTVA 4NL2A 2P84A 1HXDA 3VV0A 3J81E 3HHTB 1U06A 2DA9A 4A4FA 3CC4A 2K2VA 3M0QA 2CSQA 3X25B 3UATA 2NUZA 3EH1A 1YJNA 2EW3A 2QGFB 3A5ZB 5I21A 5LJ3h 1SSFA 1X75C 2QK0A 2CGHA 4NOYA 2LX9A 2G6FX 1IO6A 3G6ET 1JJ2A 1W2BS 2KSSA 2MAMA 4KH1B 2V8KA 1TXQA 3CC4Q 2EQMA 9ATCB 3A8OB 5FU6C 1X01A 3H8ZA 4J9FA 1G3WA 5GAMf 1YJNQ 1KQ1A 4XTZA 3GF5A 2L3QA 3JCMV 3RNJA 3CCUT 2AKLA 1I81A 2XI9A 2O4XB 4ZNXA 1K9MR 1SEMA 1U5SA 1Y0MA 1JQQA 2MMPA 1KHIA 4C8QF 1OOTA 5EG2A 2DZCA 2KRNA 2WSEE 1AZGB 1WNLA 3QXEB 2DVJA 4F7UE 2RHXA 2EQUA 3LWIA 4DQ2A 3OYLA 3CMET 2DTOA 2NUTA 5CO7A 2D0QB 4P5NA 1PWTA 4BUGA 4QT7A 1FWZA 3L2VA 1S1NA 1TSFA 2M1HA 4RTXA 3HP9A 3OSSC 2DL7A 2KEAA 2FPDA 1Q7YC 2EYWA 5GAMh 4EMKA 2QQAA 1R8OB 1XJWB 1SKUB 2V8JA 2LJ0A 4OB3B 1QQJA 4E7KA 2COZA 3V8LA 2C0OA 4HVVA 1HYOA 3EH2A 3TEEA 1D3BB 1NG2A 2B86A 2H3JA 5LJ5j 1B3QA 5DM7R 4E47A 2RHUA 1KQSS 4JRPA 2D1XA 5CCAA 3PIPA 1N27A 1Z9ZA 4LN2A 3M53A 1GL5A 3P8HA 1VQ4T 1QCFA 2DMOA 3CCVA 5GAN5 3O8VA 4FM4B 2WACA 2JW4A 4MMLA 2J06A 2DE0X 2KVQG 4RTYA 2XIDA 2OTLA 2EPDA 4ATOA 4RUGA 4GLKA 3MEAA 1SHFA 1Y71A 1JU5C 2JNGA 2DEQA 4IUTA 4OMOA 2DERA 3CCRT 2DBMA 3CPWA 3CCVQ 1TS9A 1WXBA 2LP5A 3UPUA 5CIUA 4J6XA 2QA4Q 2K5FA 2OTLQ 2ABLA 1R0CB 2KDSA 3LYIA 5A0GA 2JT4A 2SRCA 1KIKA 4OVAA 3DLMA 5CQYA 2DETA 1CKBA 3CBPA 3VU3C 1MNDA 3VRZA 3A8MB 2R58A 4ZTFA 2ENMA 1SRMA 1X43A 1X6BA 4ZN1A 2EAYA 1QVGS 2QQRA 3REAB 5LJ3e 4X9DA 2NUTB 2QAZA 1I8FA 4FT4A 4BACA 2QTXA 3A8HB 3FJ5A 1ZA2B 4XTWA 3FRNA 4HCKA 3JRZA 4JS4A 3CC4T 3V7SA 4KGZB 2LMJA 1Q81C 1T3SA 2V1QA 4EMKB 2CH4W 3RKWA 3VS7A 3E19A 4PJLA 3G4SQ 2DIGA 2AHJB 1YJWA 1MHNA 1ZQ1A 1M1KU 1JBMA 3I35A 3HRTA 2BUDA 3R6NA 2LCSA 2L3RA 4QW2A 3VYGA 2LVMA 4LDWA 1HD3A 4E7IA 4ZGEB 1WDXA 3A8GB 1UEBA 1NZ9A 3LH0A 5HK3A 1UGPB 1YJWQ 3URGA 3MEUA 5GANg 3QKJA 1T3LA 1VUBA 1X27A 2DVEA 3OQ5A 1RI0A 1NBEB 1G3YA 3META 3GOXA 4C0ZA 1Y96A 2O9SA 1EIFA 1ZUUA 2MWPA 4M75D 3PNWC 1UB4A 3L42A 2DYIA 1RAAB 2DIQA 1BCMA 4RTUA 1HSQA 3SFMA 2LCLA 3VS0A 3JCMX 5KCHA 3NGPA 1AEYA 2K5LA 3C94A 1YCSB 2EVRA 2RQWA 3SDZA 2G3RA 2KROA 1LJOA 1RAIB 1OPLA 3FIFA 3JB9F 2JMAA 2WSCE 3QPHA 4C92A 3T9NA 1JXMA 2A28A 2EGAA 2E5KA 2JJ9A 4B9WA 4D8KA 2FPFA 5GAN6 3EFSA 2AT1B 3G71Q 1Q82R 2HQEA 2CYZB 1OEBA 2M0OA 3DLLA 2JTFA 1PNJA 3LLRA 1UGVA 4C5HA 2DF6A 4E7ZA 3RESA 1K8AU 3M4GA 3CCET 1LCKA 4XTVA 1VQPT 1N8RR 2E10A 2RI2A 2K4YA 1VQLA 3CCVT 1BBZA 1JRIA 2EQIA 4JZ4A 4MZPA 5KYNA 1WIEA 2JOYA 3EGUA 2KRMA 2OTLT 1YN8A 3X20B 1H641 4EMKC 4AMCA 4GY5A 1K9MC 4HA8A 3MHXA 4F7UA 1PG5B 2A36A 1T0JA 5D6WA 2X4JA 2KMTA 1VQLQ 1PSFA 2CUDA 1ZBXA 5GAMg 1LPLA 3JCMe 4FW1A 2YSQA 5IN1A 1LOJA 4O5VA 4EMHA 1VQ5A 2EWNA 2DD5A 2I2LA 2PVDB 2DYBA 2RHYA 4M78F 3X28B 4K11A 4FU6A 3INZA 2DXBA 1Z9QA 3TCJA 4EPCA 1Y96B 3VS1A 1RI9A 4M78C 2FO0A 2DFUA 4M77G 2OJ2A 1ZBJA 4FYXB 3JSCA 5CKDA 1VQ9T 4C8QA 4IUVA 1VQ5Q 4PJNA 3MCAB 2PVGB 3JCMb 1H92A 3M4YA 1WJQA 3L2WA 1VQMA 4JDSA 1H3HA 5FWCA 1I1JA 2E65A 3PVQA 4IKFA 1VQ8A 1X69A 3JCMJ 3M59A 1WFWA 1ZLMA 2GF7A 2DRMA 3OYKA 3WXMB 4C92B 4FIBA 1FYNA 2EBPA 4XU2A 1Y57A 1VQMQ 4Z02A 4LUEA 1QKXA 1AWJA 3VS5A 2RQUA 3MPUB 4M78E 1ZHIA 4HCZA 5FRMA 8AT1B 1VQ8Q 2OI3A 2OX7A 3VKIA 1BI3A 2C0TA 1R77A 1PHTA 2RHZA 1U3OA 2VGNA 1GXIE 2DTIA 3CCUQ 2H8HA 4A4HA 4AFZC 1VYVA 4E7HA 2RF0A 3ME9A 3M5AA 5KH6A 4A4KA 3SHWA 3EG3A 1YP5A 4OMLA 2OAWA 3EG1A 4WCIA 5GMKi 2VB6A 5CK9A 1LNXA 5GAOn 2A3LA 2VYTA 1N9RA 3VS3A 3TQ7P 2WSFE 2YXYA 4BI3A 5I2SA 1YNZA 5LJ5d 3RIRA 4F17A 3JCMP 1IZ6A 1QMCA 1UFFA 4M75G 2KXDA 1MUZA 1IB8A 1M3AA 4ANJA 2K79A 3GBQA 3ER0A 4M7AF 3QWYA 4A4EA 3ASKA 3CCSA 1KK7A 5DLQE 4HCCA 2EQKA 1C0MA 1VQ4A 1YIJT 5KYWA 3TSZA 3BFMA 8ATCB 1A0NB 4MZTA 1FMWA 3EHQA 2QQSA 1M3BA 4C8QB 2AZSA 1UHFA 3OMGA 2ED1A 3AT1B 4MDXA 2X4XA 4XK8E 2K9GA 3CCSQ 3M56A 1VQ4Q 1NJIC 1NM7A 3M9QA 2DXCA 1MMNA 1AWOA 5GAN2 1SG5A 2K3XA 4J83A 2KYMA 1QVFS 1BKBA 2ED0A 2MK5A 4JPBW 2COYA 2EQJA 1V29B 4C92C 4CI0C 4Q5WA 2LNVA 4OMQA 2PZ1A 2DL4A 1KC8U 3CXCS 2VXFA 4J9HA 5FLXE 5J26A 3SB2A 1K0XA 1BIAA 1B07A 4OB1B 1AT1B 3NTHA 2VGMA 1NPRA 1VQ5T 1ABQA 2EKOA 1IGUA 4PJOF 2GQVA 4JRQA 5EC7A 1D1AA 4J7FA 3UT1A 2HKNA 1AZEA 4OGEA 3FLGA 3NHNA 4PJOC 4QQGA 3JB9H 2K6DA 2LQKA 4OP0A 2LCCA 4LUDA 5GAOp 1Q86U 3LGLA 1WJSA 4C92E 1PKTA 3D7SB 1WQWA 2QDLA 1ABOA 1X6OA 1OU8A 4JZ3A 1VQMT 1HJDA 4M7DF 3CPWP 2FZGB 4XTYA 2Y4YA 3OS1A 3M58A 1VQ8T 4N0AC 1K9AA 5IHNA 2KYBA 2L8DA 2ZPHB 1Q82C 2LT4A 4M7DC 2KXCA 5GAN7 1ZA1B 3MP6A 4B9XA 2DL3A 1GCQA 1QVPA 3VJPA 1TU0B 1Y07A 3MKDA 2FRWA 2QDYB 5KYWB 4PJOE 4JJNK 2VWFA 1N8RC 3CC7T 2DK3A 1WA7A 3JCMQ 1IRXA 2CKKA 3HKSA 4IUUA 1M90R 4C5IA 1BYMA 3S3OA 4QQDA 5FU7B 1M9SA 1W2BA 4C8QC 3H9NA 1E6GA 4JUVA 1PD0A 4EIKA 3PMIA 3PMTA 2AZVA 2OAUA 1BI1A 2XICA 2B8AA 1WZOA 4M7DE 3C12A 1MMDA 2J6FA 5GANj 3E9GA 4ELYC 2Z0WA 2GCXA 2QASA 5LL6S 1D09B 4HKEA 1TUDA 3J7AF 1BK2A 2O2OA 2E64A 1X2KA 1TOVA 1KD1U 2M02A 4Y91A 3QG1A 1SRLA 2P4TA 5AYFA 3VUZA 1M5Q1 4C0GA 4RG8A 3SEMA 1IHWA 4RG2A 1Y7XA 5HKCA 4C8QE 4KULA 2EJFA 3EG2A 4J9BA 2P0QA 1GBRA 3QO3A 2NUPA 5GAN4 3MJXA 2QYZA 1VA7A 2F2XA 3CCST 1YI2T 3NTKA 2LRQA 2VXEA 3CCEA 1VQPA 3BY7A 3QJYA 5HCKA 2RD1A 3JCMf 5HK0A 3QZ5B 2QEXA 1IHVA 2EFIA 2I0NA 3TU4K 5A0DA 1KFZA 4PFZA 4M78A 2X51A 2AK5A 4XAXB 3H0HA 2IVWA 2L5QA 3CQTA 1KC8R 4AG2C 3CCEQ 4M78D 5C6SA 1VQPQ 4AG1C 2QEXQ 3GIBA 3PFSA 2YRVA 3MO8A 3I56A 1YFNA 5GAOr 1WX6A 3WVEB 3OYCA 2LQNA 1X2QA 4B6MA 1O9SA 2EIFA 2CP0A 2F1LA 2VUBA 2QG9B 1ZUKA 4KGXB 2LX7A 1M2OA 2RNAA 2DTHA 2HMAA 5IT9E 4RMOA 3JCMh 1FMVA 3I56Q 5M9OA 4HVWA 3CC2T 1IREB 2E4HA 1M4ZA 1VQ9A 2DJQA 4LDVA 1KG1A 4JS5A 3LH5A 4N4GA 2CZ0B 1QKWA 5FU7C 2KT8A 4FCYA 3RBBB 2OTJT 4OGCA 4CC7A 3OW2P 1PD1A 4QVZA 3NPFA 1VQKT 5LJ5e 5AT1B 2RB6A 4AFQC 1FXXA 1U1SA 4RTVA 1VQ9Q 4JJDA 5IHIA 2DLPA 1OPKA 1YHQT 3CD6A 4OB2B 3QSUA 1N9SA 3EGXA 1D0ZA 2MWOA 1K73C 2NUPB 3BW1A 5I22A 1K1ZA 5CQXA 2W0ZA 4OF1A 3RR6A 3V8KA 4AFUC 1WQ7A 5HY6A 4JLIA 4M7AA 4PLLA 2NYSA 1UGSB 2QQ9A 3OS0A 2L3SA 1OZ2A 2ZZDA 3SWNA 3OA6A 4A4GA 5IHKA 3CD6Q 4QQ6A 4M78B 2C06A 1RABB 4KUDK 4DBRA 4IUPA 5KYUA 4J9IA 5IAYA 2RI5A 2HNIA 3MEWA 2GNCA 3HPWA 2A37A 3I55A 3OYHA 2ZPGB 1BCOA 1SHGA 1K0SA 1M8MA 1VQ6A 3G7ZA 5LJ3g 3MEVA 5GAN3 3QBYA 1GCQC 3KUFA 1K4US 1OULA 4OMPA 5GMKj 4J9EA 3TREA 4ORZA 1JB0E 1YIJA 5L23A 2EYXA 3I55Q 2LJ3A 2C0IA 1RAHB 2XMFA 3LWHA 1T0HA 1X6GA 1VQ6Q 4PFOA 1WXTA 1UJYA 4FYWB 2SEMA 5GAOm 2RN8A 2XDDA 1WHGA 5I2MA 4C92D 2RJCA 4E2FB 2F2WA 1NEBA 1EZZB 1OQKA 1B34A 3EGDB 4Y28E 4TVRA 4C5EA 2ZPFB 1YIJQ 1YJ9T 2MPXC 1XOVA 2CH4A 3VS2A 4E7LA 1MNEA 1ARKA 1GFDA 2QEXT 4PFPA 3M54A 4PJOA 1F1BB 4KGVB 3A8LB 3OW2A 1WHHA 1NYFA 2HEQA 3M55A 2CDTA 4FYVB 1WHMA 4L6V5 3ULRB 4JJCA 1VOMA 1ZSGA 1NPPA 4BD3A 4PJOD 3BDLA 4V2SA 2DM1A 3EGXB 5A2QE 1C1AA 2KR3A 4N0AA 4J7IA 4LDUA 3L2UA 4HXJA 4AFSC 3UWNA 4M7DA 3I56T 5D6XA 1M90C 4FSSA 2E1HA 1VQ7A 4M7AB 2CS7A 3TSWA 1ZSZB 5FWBA 5C0MA 2JVVA 3SWNB 1G5VA 3E1SA 4M7DD 1CKAA 2RA2A 3HFOA 2JN0A 2M51A 4PJMA 5KYUB 1D1CA 3GNFB 4Z89A 2VVKA 3L1AA 5GMKe 1ZX6A 1VQ7Q 3CBMA 1M1KR 1BU1A 2CP5A 1Q95G 2FZKB 2F69A 1M30A 3LW5E 1YITT 1XNIA 3G1JA 4C8QD 2IPOB 2DILA 1D0YA 5GAOq 4J6YA 2JTMA 2BIVA 4RTTA 4E6RA 4RTZA 4M77F 2XDBA 3KFVA 3JAME 4JJBA 3NFCA 3JB9J 3CD6T 3CC7A 2D8JA 2RQRA 2A7YA 3P8DA 3QWXX 1SF9A 1NEGA 2O9VA 2VASA 2HDAA 4DA4A 4LXCA 1RADB 4YTLA 1B34B 2HL3A 4F16A 1OV3A
chains in the Genus database with same CATH topology
2CZ7B 4OMFB 3JB9H 2LQKA 3JCMg 1Y71A 4OP0A 5GANd 2JNGA 2DEQA 2LCCA 2XDPA 4IUTA 4JRKA 5GAOp 4BE2A 3OW2S 1VQ9T 1Q86U 4PJOB 3CCLA 3LGLA 2FB7A 1WJSA 2E70A 3BDUA 3CPWA 4C92E 3QUIA 3CCRT 1RL2A 1UGQB 1WJRA 3CCMT 1M8VA 3UPUA 2DKGA 1WQWA 1X6OA 5CIUA 3CPFA 4J6XA 2DD4A 1VQMT 1BI2A 2K5FA 4M7DF 3L2ZA 4XTYA 2XKOC 1QP3A 2Y4YA 3M58A 4XQ3A 4N0AC 3OS1A 1VQ8T 3JB9I 2L8DA 1U1TA 2K57A 2ZPHB 1XQHA 1Q82C 2KDSA 2LT4A 3LYIA 5A0GA 4M7DC 5GAN7 4OVAA 3MP6A 3KBGA 1M1GA 3DLMA 5CQYA 4B9XA 3I55T 4JRIA 2LQ8A 1QVPA 3VJPA 3CBPA 2PUKB 1Q81U 3VU3C 1KG1A 1Y07A 3L2RA 3OYYA 2DXUA 3RUXA 1K9MU 4M7DB 1VQ6T 1NE8A 5LJ3d 4JLGA 3A8MB 2ZPBB 1XTDA 2QDYB 4FL6A 4DOWA 5FRNA 2Y90A 2R58A 4ZTFA 4PJOE 5J3BA 3CCJA 4ZN1A 2EAYA 1QVGS 2QQRA 2E6ZA 4JJNK 2KAFA 2CZ1B 1N8RC 5LJ3e 3CC7T 2DK3A 4X9DA 1YI2A 3JCMQ 3JCMc 2CKKA 3HKSA 4IUUA 2P0PA 4M7AC 1I8FA 4C5IA 4FT4A 4BACA 1BYMA 3GPLA 2QA4T 4M78G 2QTXA 3A8HB 3SWNC 4QQDA 4D6WA 3S3OA 4XTWA 5FU7B 1M9SA 1W2BA 3FRNA 4C8QC 4HCBA 3JRZA 4JS4A 3CC4T 3V7SA 4JUVA 1Q81C 3PMIA 3MP1A 3PMTA 4KBMB 2EJGA 3FC3A 1S72A 3OYMA 2OAUA 1BI1A 3PIOA 1VQNA 2XICA 4EMKB 2B8AA 2RK2A 4M7DE 4M75F 3RKWA 3C12A 3E19A 3GP8A 1VQPA 1YBYA 3HFNA 3PT9A 2DIGA 2AHJB 4II1A 1YJWA 2XHCA 1MHNA 1ZQ1A 3JCMW 5GANj 3E9GA 4ELYC 1M1KU 3FJPA 1JBMA 5CKEA 1OYXA 2GCXA 4BE1A 5LL6S 4HKEA 4C92G 3J7AF 2E64A 3HRTA 3UDCA 2VV5A 4M75B 2BUDA 1KD1U 1OI1A 2L3RA 4QW2A 3VYGA 2R5AA 4Y91A 3QDRB 3CCRA 2D6FA 3HRSA 3QG1A 2LVMA 2P4TA 4EMGA 4OB0B 4LDWA 5AYFA 3VUZA 4M7AE 1M5Q1 4E7IA 4ZGEB 1AHJB 3A8GB 4RG8A 4A54A 1UEBA 2PUOB 1NZ9A 3LH0A 2QXFA 4C0GA 5HK3A 4RCBA 4RG2A 1UGPB 1Y7XA 3URGA 5HKCA 4C8QE 4KULA 2EJFA 3MEUA 2X4WA 4RCCA 5GANg 5LJ5f 2P0QA 3QKJA 3CEYA 2E41A 5CKBA 1VUBA 3OQ5A 2DVEA 3QO3A 1RI0A 3ZFJA 2XD0A 5GAN4 5KE2A 3G6EA 4RKUE 3G4ST 4O6JA 1G3YA 3CCST 1YI2T 3META 3NTKA 2LRQA 2VXEA 3QYHB 5GAMd 2Y4XA 4C0ZA 3GOXA 3CCEA 3BY7A 3QJYA 4BE0A 1Y96A 4J8OA 4KUIA 2RD1A 3JCMf 5HK0A 4ZGJB 5J39A 1EIFA 2MWPA 5FROA 4M75D 3QZ5B 4XU1A 2QEXA 3PNWC 2EFIA 1UB4A 3L42A 3CMAA 2X4YA 3TU4K 1VQ7T 4M77C 5A0DA 4M78A 5CAIA 2DIQA 1JJ2S 3C95A 2OTJA 3FDRA 4FT2A 2LCLA 3SFMA 3JCMX 4XAXB 3CCUA 2IVWA 4F7UG 5KCHA 2QI2A 4E7JA 3X26B 1VQKA 3J80E 2L5QA 2RK1A 1YJWT 4BDYA 2K5LA 1KC8C 2DO3A 3C94A 4M78D 5C6SA 1QVFA 3SDZA 4XTUA 2G3RA 4N4HA 1LJOA 3GIBA 3PFSA 2YRVA 3FIFA 2HQXA 3JB9F 2RH2A 3MO8A 4J5YA 3I56A 2GFUA 1YHQA 2WSCE 3QPHA 5GAOr 4C92A 3T9NA 2DZ9A 5A0LA 3CXCA 4B9WA 3WVEB 3OYCA 5GAN6 3EFSA 2PU9B 1WGSA 2XG8D 5KE3A 2HQEA 1O9SA 1BIBA 2CYZB 2EIFA 5KCOA 5LJ5h 4LDXA 2KY9A 3KXTA 2VUBA 3GNGA 3CMEA 3QYGB 4M77E 2M0OA 4C0FA 3WVDB 4C0DB 4M7AG 3OYEA 3DLLA 2GFAA 3PTAA 2DTHA 1KHCA 4F7UF 5IT9E 2JTFA 4RMOA 3LLRA 4HT8A 4ZTJA 4ME7A 3JCMh 4BI8B 4C5HA 4DOVA 4C8QG 3RESA 4A53A 1K8AU 3QHSA 3M4GA 1Q86C 3CCET 5M9OA 3N5BB 3CC2T 1IREB 4IURA 4XTVA 1VQPT 1M4ZA 2HD0A 5GAN8 2F5TX 2PVOB 1OZ3A 3EAEA 3OBWA 4LDVA 2YLBA 4JS5A 1M90U 1VQ9A 2E10A 2RI2A 2K4YA 2CZ0B 4N4GA 3CCVT 1VQLA 1JRIA 4BI4A 4MZPA 4F7UB 2JOYA 3S3NA 5FU7C 4XU0A 2DJZA 3OSVA 5GMKl 1M1FA 1H3ZA 2MI6A 4BB7A 3SD4A 2HAXA 2OTJT 3OYDA 4OGCA 5FU6B 3MP8A 2OTLT 3QIIA 2F5KA 3X20B 1H641 3G71T 1W4SA 3JB9D 2RI3A 4EMKC 2L89A 2FHDA 4QVZA 1VQKT 4HT9A 2R57A 4GY5A 5LJ5e 3JCMd 2RB6A 1K9MC 1FXXA 4HA8A 3ZBDA 3MHXA 4F7UA 3RKXA 1U1SA 1DJ7B 4LD6A 5D6WA 1NJIU 2M9UA 3LX7A 2X4JA 2KMTA 2ZPEB 3CCLT 1I4K1 1PSFA 4PNOA 1N6AA 3CCQA 1ZBXA 2V8IA 2X35A 2ZCFB 4XTXA 2YLCA 3JCMe 5GAMg 1VQOA 4MMKA 5CR2A 4UC4A 3FB9A 3VUBA 1YHQT 4M75C 3ZEHA 2RM4A 5GANf 5IN1A 1LOJA 4O5VA 3CD6A 2O4XA 3OB9A 4EMHA 1VQ5A 3OBYA 3E9FA 4OB2B 1QW1A 2R5MA 3Q1JA 2EWNA 2FVUA 3QSUA 1QP2A 1N9SA 2DD5A 3RMQA 2I2LA 3V7RA 2PVDB 2MWOA 1G3TA 1K73C 2JUFA 2RHYA 3BW1A 5CQXA 3OYAA 3DB3A 4M78F 3X28B 4BDZA 4FU6A 3INZA 2DXBA 3OYBA 4OF1A 2BKDN 4L5GA 3V8KA 3RMSA 3TCJA 4EPCA 4R56A 1Y96B 1WQ7A 4X9CA 5HY6A 4JLIA 2QQBA 4M78C 4M7AA 4PLLA 4M77G 1UGSB 2QQ9A 2RJEA 3OS0A 3HRUA 1OZ2A 2EJ9A 2ZZDA 3JSCA 3SWNA 5CKDA 2K3YA 4PKCC 3OA6A 3OMCA 4A4GA 4L59A 4C8QA 2RO0A 4IUVA 4M78B 4QQ6A 3MCAB 4ELZC 5LJ3j 3CCMA 2PVGB 2C06A 1VQLT 3JCMb 3H6ZA 1M1KC 5LJ3f 4NL3A 4KUDK 2EYQA 3M4YA 5L8RE 1WJQA 1YJ9A 3L2WA 3DKMA 4IUPA 1VQMA 4PJOG 4JDSA 5IAYA 4FSXA 1P92A 2E65A 2FYKA 4IKFA 4C92F 1HK9A 2HNIA 2RI5A 3MEWA 2RHIA 4XU3A 1KD1C 1VQ8A 3GLXA 3HL8A 3OY9A 2DPPB 4M75E 3CBOA 3JCMJ 3HPWA 1WPYA 3M59A 3CPWS 3I55A 2ZPIB 3DB4A 2LTOA 3OYHA 2ZPGB 2JZ2A 1S72T 1G3SA 2GF7A 1I5LA 1VQ6A 4J6WA 3OYKA 2LT1A 2YHTA 4QVCA 3G7ZA 1VQNT 3WXMB 3S3MA 4IUQA 4C92B 5GMKm 2K5IA 5LJ3g 3M57A 3MEVA 1KQ2A 4FIBA 5GANh 3LGFA 2DXTA 5GAN3 1D3BA 4XU2A 3QBYA 4Z02A 3KUFA 4MDWA 4QVDA 1YCYA 4WF2A 5DY9A 5GMKj 3S6WA 4M7DG 4M78E 1ZHIA 4HCZA 3TREA 3OYNA 3P8BB 5FRMA 4NL2A 2KQWA 3PGGA 3L2QA 1HXDA 1JB0E 3VV0A 3J81E 3VKIA 1BI3A 1YIJA 4KT0E 3HHTB 2QA4A 1Q82U 1KQSA 2DAQA 4C5GA 2RHZA 3X24B 1MGQA 1O75A 3LWHA 4A4FA 2VGNA 3CC4A 3VYHB 2K2VA 1GXIE 5CVIA 2DTIA 4C0DC 5GAOm 3X25B 1K73U 1TH7A 4A4HA 1YJNA 2XDDA 4BY6B 4ZN3A 4E7HA 5I2MA 3HSBA 4C92D 3A5ZB 3ME9A 2RJCA 5I21A 5LJ3h 1SSFA 1X75C 3M5AA 2CGHA 4NOYA 4A4KA 5KH6A 4M77A 2LX9A 4NS5A 1JJ2A 3G6ET 1B34A 4Y28E 1W2BS 4TVRA 2KSSA 4C5EA 2MAMA 2ZPFB 1N8RU 1YJ9T 2XU8A 5GANe 4ZGDB 1XOVA 5GMKi 4E7LA 2PQWA 5CK9A 1LNXA 2V8KA 3R6OA 2QEXT 4PLIA 5GAOn 2IG0A 2A3LA 2VYTA 3M54A 4PJOA 1N9RA 2EQMA 4M77D 5GAMj 3CMAT 3A8OB 2WSFE 5FU6C 1FX7A 3A8LB 1X01A 3H8ZA 3OYIA 2E6NA 3OW2A 4LD9K 1G3WA 4BI3A 2E12A 5GAMf 5I2SA 5LJ5d 3RIRA 1KQ1A 3M55A 5D6YA 3JCMP 4L6V5 1IZ6A 4XTZA 3GF5A 4M75G 1YITA 3JCMV 3F70A 2ZGWA 3V8JA 1NPPA 3CCUT 4VUBA 4BD3A 4PJOD 3BDLA 1I81A 2XI9A 2O4XB 3ER0A 5GMKh 4M7AF 4V2SA 2D9TA 4A4EA 5A2QE 3ASKA 3G4SA 3OS2A 4N4IA 3CCSA 4N0AA 5DLQE 1K8AC 3QZ9B 4HCCA 2MMPA 2EQKA 1KHIA 4C8QF 2CZ6B 4J7IA 1VIFA 4LDUA 2M16A 4EDUA 3UWNA 3L2UA 1Q7YU 3I56T 4M7DA 1VQ4A 2XK0A 5D6XA 5EG2A 1YIJT 1PSEA 1M90C 4R55A 5GAOl 2DZCA 2WSEE 3BFMA 3CC2A 2E1HA 1WNLA 3QXEB 1VQ7A 4M7AB 2CS7A 4MZTA 4F7UE 2QQSA 2RHXA 5C0MA 2JVVA 3SWNB 1G5VA 1QVGA 3E1SA 4QQGA 2EQUA 3LWIA 4M7DD 4C8QB 4DQ2A 3OYLA 3CMET 1YJNT 2DTOA 2RA2A 3HFOA 5CO7A 2JN0A 2D0QB 4P5NA 3OMGA 3FEOA 4MDXA 2X4XA 4BUGA 1BI0A 4XK8E 1FWZA 3L2VA 3GNFB 2RJDA 4X34A 3M56A 2M1HA 3L1AA 3C4SA 1NJIC 3HP9A 5CKFA 3OSSC 3RKYA 3M9QA 2DXCA 5GMKe 1Q7YC 3EFRA 3CBMA 5GAMh 4EMKA 2QQAA 3OS5A 1R8OB 1U8RA 2V8JA 5GAN2 2K3XA 4J83A 4OB3B 4E7KA 2F69A 4M7AD 3V8LA 4PL6A 3OYGA 1VIEA 3LW5E 1QVFS 1BKBA 2O01E 3TEEA 1YITT 1D3BB 1XNIA 3NTIA 3V7CA 2LDMA 4C8QD 2H3JA 5LJ5j 2E5QA 3AHUA 2MF2A 2EQJA 2NLUA 1V29B 4MZMA 4M75A 2RJFA 4C92C 4Q5WA 4CI0C 4J6YA 5DM7R 2LNVA 4E47A 5GAOq 2RHUA 2P0KA 2JTMA 1KC8U 1KQSS 2BIVA 3CXCS 3CCJT 2VXFA 4JRPA 5CCAA 3PIPA 5FLXE 1N27A 5J26A 3SB2A 3JB9G 1BIAA 4CRIA 3M53A 4M77F 3CCQT 3P8HA 2XDBA 1VQ4T 3JAME 4OB1B 3QJ6A 1VQOT 2KK4A 3NTHA 2VGMA 3NFCA 3CCVA 1NPRA 5GAN5 1UGRB 3JB9J 3CD6T 3O8VA 3CC7A 1VQ5T 4FM4B 4LDYA 2A7YA 2WACA 2EKOA 4MMLA 5GAMe 3P8DA 4PJOF 3RERA 2GQVA 5CKHA 2HBPA 5LJ5g 4JRQA 2KVQG 2LC4A 2XIDA 5DLOA 4J7FA 4M77B 4DA4A 3UT1A 4YTLA 2OTLA 1B34B 3G71A 4ATOA 4GLKA 3MEAA 4OGEA 4BY6C 3FLGA 3OYFA 3OYJA 4PJOC 2FL7A 2VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM f;  5LJ5 d;  1LOJ A;  4EMH A;  3RIR A;  1KQ1 A;  3JB9 H;  3JCM g;  3JCM P;  4OP0 A;  5GAN d;  2EWN A;  2VXE A;  2DEQ A;  4JRK A;  4M75 G;  4XTZ A;  1N9S A;  5GAM d;  3BY7 A;  5GAO p;  3JCM V;  1Y96 A;  4PJO B;  3JCM f;  2I2L A;  2RD1 A;  2ZGW A;  2FB7 A;  3V8J A;  3V7R A;  3BDU A;  4C92 E;  3QUI A;  4M75 D;  4PJO D;  4XU1 A;  3BW1 A;  1M8V A;  1I81 A;  4M78 F;  4M75 C;  3INZ A;  2DKG A;  1WQW A;  4M77 C;  5GMK h;  4M7A F;  4V2S A;  3V8K A;  4J6X A;  4M78 A;  1Y96 B;  1WQ7 A;  4X9C A;  5CAI A;  4M7D F;  4JLI A;  3L2Z A;  4N0A A;  4M78 C;  4M7A A;  4XTY A;  4M77 G;  4C8Q F;  4XQ3 A;  3JCM X;  4N0A C;  4M7D A;  3JB9 I;  1U1T A;  2EJ9 A;  2K57 A;  3SWN A;  4F7U G;  4M7D C;  5GAN 7;  4C8Q A;  5LJ3 j;  2DZC A;  4M78 B;  5GAO l;  3BFM A;  4PJO A;  4JRI A;  3JCM b;  2E1H A;  1WNL A;  5LJ3 f;  4NL3 A;  4M7A B;  3VU3 C;  4M78 D;  2DXU A;  3RUX A;  4F7U E;  4M7D B;  4XTU A;  4PJO G;  5LJ3 d;  3SWN B;  1LJO A;  2FYK A;  2E65 A;  3GIB A;  4M7D D;  4C8Q B;  4C92 F;  1HK9 A;  2HNI A;  4XU3 A;  2Y90 A;  2DTO A;  2RA2 A;  3FIF A;  4DQ2 A;  3HFO A;  4J5Y A;  3JB9 F;  4M75 E;  2JN0 A;  4PJO E;  3JCM J;  2EAY A;  5GAO r;  4C92 A;  1WPY A;  2DZ9 A;  5LJ3 e;  4X9D A;  5GAN 6;  3JCM Q;  3JCM c;  3EFS A;  3L1A A;  1I5L A;  4J6W A;  2YHT A;  4QVC A;  4M7A C;  1BIB A;  1I8F A;  3RKY A;  5LJ5 h;  5GMK e;  4C92 B;  5GMK m;  5LJ3 g;  3EFR A;  1KQ2 A;  4M78 G;  2QTX A;  4M77 E;  3SWN C;  5GAN h;  5GAM h;  2DXT A;  2RM4 A;  4XTW A;  4EMK A;  1D3B A;  4C8Q C;  4XU2 A;  5GAN 3;  4M7A G;  3V7S A;  4QVD A;  1YCY A;  2DTH A;  4F7U F;  4WF2 A;  5DY9 A;  5GMK j;  5GAN 2;  4M7D G;  4JUV A;  4M78 E;  4M7A D;  4HT8 A;  3V8L A;  3JCM h;  4NL2 A;  3PGG A;  2EJG A;  3RES A;  4A53 A;  4C8Q G;  3QHS A;  1HXD A;  3M4G A;  4EMK B;  4M7D E;  1D3B B;  4XTV A;  4M75 F;  3V7C A;  4C8Q D;  3RKW A;  5GAN 8;  5GAN f;  5LJ5 j;  3AHU A;  3QSU A;  2YLB A;  3HFN A;  2E10 A;  1MGQ A;  4M75 A;  4C92 C;  5GAO q;  3JCM W;  5GAN j;  4J6Y A;  1JRI A;  4F7U B;  3FJP A;  1JBM A;  4XU0 A;  2DTI A;  2VXF A;  2DJZ A;  5GMK l;  5GAO m;  4C92 G;  1TH7 A;  2E64 A;  3SB2 A;  3JB9 G;  1BIA A;  4M77 F;  4M75 B;  3HSB A;  4C92 D;  5I21 A;  1H64 1;  5LJ3 h;  3JB9 D;  4Y91 A;  4NOY A;  4EMK C;  2CGH A;  3QO3 A;  4M77 A;  4HT9 A;  3JCM d;  5LJ5 e;  5GAN 5;  3JB9 J;  1B34 A;  2RB6 A;  4EMG A;  4M7A E;  4HA8 A;  5GAN 4;  1M5Q 1;  4F7U A;  3RKX A;  5GAN e;  1U1S A;  4MML A;  4A54 A;  5GAM e;  5GMK i;  4PJO F;  3RER A;  4RCB A;  5LJ5 g;  1I4K 1;  4C8Q E;  1LNX A;  4M77 B;  2EJF A;  4PNO A;  5GAO n;  4RCC A;  5GAN g;  1B34 B;  5LJ5 f;  4XTX A;  3JCM e;  2YLC A;  1N9R A;  5GAM j;  4M77 D;  2E41 A;  4MMK A;  5GAM g;  3FB9 A;  2DVE A;  4PJO C;  1X01 A;  2VC8 A; 
#chains in the Genus database with same CATH topology
 2CZ7 B;  2YRC A;  2DEU A;  4OMF B;  2ROT A;  3JCM g;  5GAN d;  2MIO A;  2XDP A;  4JRK A;  4PJO B;  2FB7 A;  1UGQ B;  3CC7 Q;  1WJR A;  1M8V A;  1QVF P;  2YRD A;  2DKG A;  3EHR A;  2DD4 A;  4DBQ A;  2AIR B;  3L2Z A;  4XQ3 A;  2K57 A;  1UTI A;  3KBG A;  3I55 T;  3IQL A;  3L2R A;  3OYY A;  2DXU A;  3RUX A;  1K9M U;  4M7D B;  1VQ6 T;  3C0C A;  5LJ3 d;  1V76 A;  4JLG A;  5FRN A;  1XTD A;  1IGQ A;  4DOW A;  1E6H A;  5J3B A;  3CCJ A;  2E6Z A;  3M0S A;  1K8A R;  2X9H A;  1YI2 A;  2K3B A;  3JCM c;  3BE3 A;  2EYY A;  4M7A C;  2YUO A;  1ZSZ C;  1AVZ C;  5IXB A;  3GPL A;  2BE9 B;  3SWN C;  4D6W A;  4HCB A;  2GTJ A;  1I07 A;  5IXF A;  2QGG A;  1PRL C;  3EG9 B;  3MP1 A;  4KBM B;  4QKU A;  2EJG A;  3FC3 A;  3OYM A;  1W2B P;  1WLP B;  1VQN A;  2RK2 A;  4M75 F;  1OX9 A;  3H0I A;  3HFN A;  3PT9 A;  1BB9 A;  1WYX A;  1YI2 Q;  3JCM W;  3FJP A;  1OYX A;  4BE1 A;  4C92 G;  3QDR B;  1EX4 A;  2DL8 A;  3RDV A;  2D6F A;  3HRS A;  5KYX A;  4EMG A;  4Z88 A;  4M7A E;  1AHJ B;  4A54 A;  2LNH B;  2PUO B;  2QXF A;  1KSW A;  4RCB A;  1RLP C;  4E7S A;  1D1B A;  1PRM C;  2X4W A;  4RCC A;  4PK4 A;  5LJ5 f;  3CEY A;  5CKB A;  2XD0 A;  4O6J A;  5GAM d;  3QYH B;  3CC2 A;  2Y4X A;  4BE0 A;  4KUI A;  5FRO A;  4XU1 A;  4ESR A;  3CMA A;  1VQ7 T;  1WHK A;  1K76 A;  5CAI A;  1JJ2 S;  2OTJ A;  1TWB A;  3FDR A;  1MMG A;  4FYY B;  4F7U G;  2QI2 A;  3X26 B;  1VQK A;  3J80 E;  2RK1 A;  4DEX A;  2DO3 A;  3CC2 Q;  2JMC A;  5IH2 A;  3TVT A;  1QVF A;  2P4R A;  4XTU A;  2CP3 A;  1GFC A;  1FMK A;  3CMA Q;  2HQX A;  2L3P A;  2RH2 A;  4CC3 A;  5FW9 A;  2GFU A;  1GCP A;  1YHQ A;  2YUN A;  2DZ9 A;  5A0L A;  3CXC A;  2OTJ Q;  2DL5 A;  4D8D A;  2HL5 C;  2PU9 B;  2XG8 D;  5LJ5 h;  1KQS P;  1VQK Q;  2KY9 A;  4LDX A;  3KXT A;  2CSI A;  3QYG B;  5ECA A;  2M0Y A;  4C0D B;  1IXD A;  3OYE A;  2GFA A;  3PTA A;  1KHC A;  4F7U F;  4HT8 A;  4ZTJ A;  4ME7 A;  4DOV A;  4BI8 B;  4C8Q G;  4A53 A;  3JV3 A;  2K2M A;  1YHQ Q;  1YWP A;  2F5T X;  2PVO B;  3EAE A;  3OBW A;  2YLB A;  2V26 A;  4BI4 A;  4WTO B;  1RAF B;  2JM8 A;  1M1F A;  1H3Z A;  2MI6 A;  2HAX A;  3SD4 A;  3EFO A;  3OYD A;  3MP8 A;  1ACM B;  2JS0 A;  3JB9 D;  1W4S A;  2L89 A;  4Z8A A;  4HT9 A;  3JCM d;  4RTW A;  1W70 A;  2RMO A;  1DJ7 B;  4LD6 A;  1NJI U;  3M0R A;  2ZPE B;  3CCQ A;  1N6A A;  2A08 A;  2ZCF B;  2X35 A;  5KYX B;  1QWE A;  2YLC A;  1VQO A;  5CR2 A;  4UC4 A;  2IIM A;  2RM4 A;  4M4Z A;  3OB9 A;  2CT3 A;  3I9Q A;  3E9F A;  1QW1 A;  2D8H A;  4IIO A;  2FVU A;  1G3T A;  2JUF A;  3PVL A;  1W1F A;  3OYB A;  2O88 A;  1WHJ A;  2F2V A;  2HSE B;  4L5G A;  1QVG P;  4DBH A;  3CCQ Q;  2BZ8 A;  2DX1 A;  2ROL A;  1VQO Q;  2RJE A;  2EJ9 A;  3CCJ T;  2K3Y A;  4PKC C;  5LJ3 j;  3CCM A;  3H6Z A;  1M1K C;  2EYQ A;  1YJ9 A;  5L8R E;  3DKM A;  2GGR A;  1H8K A;  1AWW A;  4FSX A;  1P92 A;  1V1C A;  2FYK A;  4R0K A;  1HK9 A;  2KE9 A;  2DPP B;  2YUQ A;  1SPK A;  1B7T A;  3CPW S;  2DRK A;  2ZPI B;  2JZ2 A;  4IIM A;  1G3S A;  1VQN T;  2LT1 A;  4QVC A;  1MMA A;  3CCM Q;  4IUQ A;  2K5I A;  3M57 A;  1KQ2 A;  1QLY A;  1TG0 A;  2BE7 D;  2DXT A;  1YJ9 Q;  6AT1 B;  4QVD A;  1YCY A;  5DY9 A;  3OYN A;  2L0A A;  2MOX A;  2KQW A;  3PGG A;  3L2Q A;  2ECZ A;  1M27 C;  4KT0 E;  2H3E B;  2QA4 A;  3VS4 A;  1Q82 U;  1I5O B;  1KQS A;  2DAQ A;  4C5G A;  3X24 B;  1M3C A;  1MGQ A;  1O75 A;  1WXU A;  3VYH B;  1QCO A;  5CVI A;  4C0D C;  2MYS A;  1TH7 A;  1J3T A;  4BY6 B;  4ZN3 A;  3HSB A;  3H41 A;  4CC4 B;  2NWM A;  2J6K A;  1RAE B;  4M77 A;  4NS5 A;  1JXO A;  2KNB B;  1N8R U;  3EFO B;  1Q86 R;  2XU8 A;  5GAN e;  4ZGD B;  2PQW A;  1CSK A;  1PM3 A;  3R6O A;  4PLI A;  2IG0 A;  5GAM j;  4M77 D;  3CMA T;  1G8X A;  3OYI A;  1FX7 A;  2E6N A;  4LD9 K;  2E12 A;  3EGD A;  3THK A;  5D6Y A;  1YIT A;  2CP7 A;  3F70 A;  2ZGW A;  4HVU A;  3V8J A;  4VUB A;  5GMK h;  1AWX A;  2D9T A;  3ZL7 C;  2HCK A;  3G4S A;  3OS2 A;  1UJ0 A;  2JM9 A;  4N4I A;  1K8A C;  3QZ9 B;  4EDU A;  1Q7Y U;  2CZ6 B;  1VIF A;  2M16 A;  2DNU A;  2XK0 A;  1WHL A;  1PSE A;  2ATC B;  4R55 A;  5GAO l;  1G2B A;  1YIT Q;  2YUP A;  2AKK A;  1QVG A;  1YJN T;  3FEO A;  2BTT A;  1BI0 A;  2JS2 A;  2RJD A;  4X34 A;  4DBF A;  5KYY A;  2EGC A;  1NJI R;  1RAC B;  3HTR A;  2FG0 A;  2RQT A;  3C4S A;  1UDL A;  1ZSZ A;  5CKF A;  3RKY A;  2KRS A;  2ESW A;  3EFR A;  2KI7 A;  4X1V A;  4KRT A;  3OS5 A;  1U8R A;  1TUC A;  4M7A D;  1NYG A;  4PL6 A;  3OYG A;  1KD1 R;  1VIE A;  1ZUY A;  2O01 E;  3NTI A;  3V7C A;  2LDM A;  4AT1 B;  1QCN A;  2E5Q A;  3AHU A;  2MF2 A;  2NLU A;  4MZM A;  4M75 A;  2RJF A;  2P0K A;  3O5Z A;  4DEY A;  1N5Z A;  3JB9 G;  4CRI A;  3CCQ T;  1VQO T;  3QJ6 A;  2KK4 A;  3UF4 A;  1UGR B;  2RPN A;  1RLQ C;  4LDY A;  5GAM e;  3RER A;  5CKH A;  2HBP A;  5LJ5 g;  2LC4 A;  5DLO A;  1YWO A;  4M77 B;  2X3W D;  3G71 A;  4BY6 C;  3OYJ A;  3OYF A;  1AD5 A;  2FL7 A;  2VC8 A;  1EFN A;  3NMZ C;  1MV3 A;  1UEC A;  2J05 A;  1W6X A;  2FPE A;  4BE2 A;  3OW2 S;  3CCL A;  2E70 A;  3BDU A;  3QUI A;  1RL2 A;  3CCM T;  3E2U A;  2K7A A;  3U23 A;  3CPF A;  4OMM A;  1BI2 A;  2MCN A;  1GBQ A;  2XKO C;  1QP3 A;  3VS6 A;  5GJW B;  3JB9 I;  1U1T A;  1XQH A;  1M1G A;  1TUG B;  2A0F B;  4JRI A;  2LQ8 A;  1Q81 U;  2LZ6 B;  2PUK B;  4J9C A;  3CCL Q;  2VKN A;  1NE8 A;  2ZPB B;  4FL6 A;  3M0U A;  2KT1 A;  2Y90 A;  1VYT A;  1PCX A;  2KAF A;  2CZ1 B;  3EG0 A;  3VRY A;  2YT6 A;  2JXB A;  2P0P A;  4GBQ A;  2QA4 T;  4J9G A;  4M78 G;  1K73 U;  1LVK A;  5KYY B;  2FZC B;  2HKQ B;  1S72 A;  2L2P A;  3PIO A;  4F04 B;  4LNP A;  3GP8 A;  1YBY A;  4II1 A;  3PE0 A;  2XHC A;  2COW A;  2ZAE A;  2LJ1 A;  2GTO A;  5CKE A;  1Q7Y R;  4KH0 B;  3EG9 A;  2CRE A;  3UDC A;  2VV5 A;  4M75 B;  1OI1 A;  1TTH B;  2J7I A;  2R5A A;  3M0T A;  1S72 Q;  2CT4 A;  2HQH A;  2CUB A;  3REB B;  1RAG B;  4OB0 B;  2EYZ A;  1GRI A;  2FEI A;  1M2V A;  1WI7 A;  2W10 A;  2E41 A;  3ZFJ A;  1PC0 A;  2V1R A;  5KE2 A;  3G6E A;  4RKU E;  3G4S T;  1NLO C;  2D0N A;  1UHC A;  1E7O A;  1SSH A;  4J8O A;  4ZGJ B;  5J39 A;  4Y92 A;  4FW2 A;  1MV0 B;  2X4Y A;  4M77 C;  5GJV B;  2PTK A;  3C95 A;  4FT2 A;  3CCU A;  4E7J A;  3G6E Q;  1JEG A;  1OX8 A;  1AOJ A;  1YJW T;  4BDY A;  1KC8 C;  4N4H A;  4J5Y A;  2CP2 A;  3UA7 A;  2KBT A;  2HBW A;  1WGS A;  5KE3 A;  1BIB A;  5KCO A;  3CXC P;  2DBK A;  3GNG A;  3CME A;  2E3H A;  4M77 E;  4C0F A;  3WVD B;  4M7A G;  1QWF A;  3QDF A;  7AT1 B;  2HZY A;  3QHS A;  1Q86 C;  3N5B B;  4IUR A;  5GAN 8;  2HD0 A;  1OZ3 A;  1M90 U;  1JJ2 P;  3I5S A;  4LE9 A;  2LQW A;  4F7U B;  3S3N A;  1UUE A;  4OMN A;  4XU0 A;  2DJZ A;  3I5R A;  3OSV A;  5GMK l;  3CME Q;  4BB7 A;  1G83 A;  4J9D A;  5FU6 B;  3QII A;  2F5K A;  3G71 T;  2RI3 A;  2GQI A;  3H0F A;  2FHD A;  1Q81 R;  2PNI A;  2R57 A;  2FRY A;  3A1P A;  2YDL A;  2JTE A;  3ZBD A;  1OU9 A;  3RKX A;  3CCJ Q;  2M9U A;  3LX7 A;  4PJJ A;  2HSP A;  3CCL T;  1I4K 1;  4PNO A;  2V8I A;  4XTX A;  4MMK A;  2CP6 A;  3FB9 A;  3VUB A;  4M75 C;  3ZEH A;  5GAN f;  1PKS A;  2O4X A;  1I0C A;  3OBY A;  1R0B G;  2BZY A;  2KGT A;  2R5M A;  3Q1J A;  1M2V B;  4CC2 A;  2E3I A;  1QP2 A;  3RMQ A;  4A63 B;  4F14 A;  3V7R A;  1K73 R;  3OYA A;  3DB3 A;  4BDZ A;  1VQN Q;  3M0P A;  1UE9 A;  2BKD N;  3RMS A;  4R56 A;  4X9C A;  2QQB A;  5I11 A;  1D0X A;  1NLP C;  2GBQ A;  3HRU A;  2RQV A;  3CCR A;  3OMC A;  4L59 A;  4ELZ C;  2RO0 A;  2EGE A;  1VQL T;  5LJ3 f;  4NL3 A;  1JO8 A;  4PJO G;  1VYU A;  4GLM A;  1C6V X;  4C92 F;  4XU3 A;  2RHI A;  1KD1 C;  3GLX A;  2BZX A;  3HL8 A;  1UG1 A;  3OY9 A;  4M75 E;  3CBO A;  3UA6 A;  1WPY A;  2O31 A;  3DB4 A;  2LTO A;  1S72 T;  1I5L A;  3A98 A;  3CCR Q;  4J6W A;  2YHT A;  3S3M A;  5GMK m;  2X3X D;  2J6O A;  1RUW A;  3LGF A;  5GAN h;  2YWW A;  2EKH A;  1D3B A;  4MDW A;  4WF2 A;  4M7D G;  1KJW A;  3S6W A;  3P8B B;  5D7U A;  2QTV A;  4NL2 A;  2P84 A;  1HXD A;  3VV0 A;  3J81 E;  3HHT B;  1U06 A;  2DA9 A;  4A4F A;  3CC4 A;  2K2V A;  3M0Q A;  2CSQ A;  3X25 B;  3UAT A;  2NUZ A;  3EH1 A;  1YJN A;  2EW3 A;  2QGF B;  3A5Z B;  5I21 A;  5LJ3 h;  1SSF A;  1X75 C;  2QK0 A;  2CGH A;  4NOY A;  2LX9 A;  2G6F X;  1IO6 A;  3G6E T;  1JJ2 A;  1W2B S;  2KSS A;  2MAM A;  4KH1 B;  2V8K A;  1TXQ A;  3CC4 Q;  2EQM A;  9ATC B;  3A8O B;  5FU6 C;  1X01 A;  3H8Z A;  4J9F A;  1G3W A;  5GAM f;  1YJN Q;  1KQ1 A;  4XTZ A;  3GF5 A;  2L3Q A;  3JCM V;  3RNJ A;  3CCU T;  2AKL A;  1I81 A;  2XI9 A;  2O4X B;  4ZNX A;  1K9M R;  1SEM A;  1U5S A;  1Y0M A;  1JQQ A;  2MMP A;  1KHI A;  4C8Q F;  1OOT A;  5EG2 A;  2DZC A;  2KRN A;  2WSE E;  1AZG B;  1WNL A;  3QXE B;  2DVJ A;  4F7U E;  2RHX A;  2EQU A;  3LWI A;  4DQ2 A;  3OYL A;  3CME T;  2DTO A;  2NUT A;  5CO7 A;  2D0Q B;  4P5N A;  1PWT A;  4BUG A;  4QT7 A;  1FWZ A;  3L2V A;  1S1N A;  1TSF A;  2M1H A;  4RTX A;  3HP9 A;  3OSS C;  2DL7 A;  2KEA A;  2FPD A;  1Q7Y C;  2EYW A;  5GAM h;  4EMK A;  2QQA A;  1R8O B;  1XJW B;  1SKU B;  2V8J A;  2LJ0 A;  4OB3 B;  1QQJ A;  4E7K A;  2COZ A;  3V8L A;  2C0O A;  4HVV A;  1HYO A;  3EH2 A;  3TEE A;  1D3B B;  1NG2 A;  2B86 A;  2H3J A;  5LJ5 j;  1B3Q A;  5DM7 R;  4E47 A;  2RHU A;  1KQS S;  4JRP A;  2D1X A;  5CCA A;  3PIP A;  1N27 A;  1Z9Z A;  4LN2 A;  3M53 A;  1GL5 A;  3P8H A;  1VQ4 T;  1QCF A;  2DMO A;  3CCV A;  5GAN 5;  3O8V A;  4FM4 B;  2WAC A;  2JW4 A;  4MML A;  2J06 A;  2DE0 X;  2KVQ G;  4RTY A;  2XID A;  2OTL A;  2EPD A;  4ATO A;  4RUG A;  4GLK A;  3MEA A;  1SHF A;  1Y71 A;  1JU5 C;  2JNG A;  2DEQ A;  4IUT A;  4OMO A;  2DER A;  3CCR T;  2DBM A;  3CPW A;  3CCV Q;  1TS9 A;  1WXB A;  2LP5 A;  3UPU A;  5CIU A;  4J6X A;  2QA4 Q;  2K5F A;  2OTL Q;  2ABL A;  1R0C B;  2KDS A;  3LYI A;  5A0G A;  2JT4 A;  2SRC A;  1KIK A;  4OVA A;  3DLM A;  5CQY A;  2DET A;  1CKB A;  3CBP A;  3VU3 C;  1MND A;  3VRZ A;  3A8M B;  2R58 A;  4ZTF A;  2ENM A;  1SRM A;  1X43 A;  1X6B A;  4ZN1 A;  2EAY A;  1QVG S;  2QQR A;  3REA B;  5LJ3 e;  4X9D A;  2NUT B;  2QAZ A;  1I8F A;  4FT4 A;  4BAC A;  2QTX A;  3A8H B;  3FJ5 A;  1ZA2 B;  4XTW A;  3FRN A;  4HCK A;  3JRZ A;  4JS4 A;  3CC4 T;  3V7S A;  4KGZ B;  2LMJ A;  1Q81 C;  1T3S A;  2V1Q A;  4EMK B;  2CH4 W;  3RKW A;  3VS7 A;  3E19 A;  4PJL A;  3G4S Q;  2DIG A;  2AHJ B;  1YJW A;  1MHN A;  1ZQ1 A;  1M1K U;  1JBM A;  3I35 A;  3HRT A;  2BUD A;  3R6N A;  2LCS A;  2L3R A;  4QW2 A;  3VYG A;  2LVM A;  4LDW A;  1HD3 A;  4E7I A;  4ZGE B;  1WDX A;  3A8G B;  1UEB A;  1NZ9 A;  3LH0 A;  5HK3 A;  1UGP B;  1YJW Q;  3URG A;  3MEU A;  5GAN g;  3QKJ A;  1T3L A;  1VUB A;  1X27 A;  2DVE A;  3OQ5 A;  1RI0 A;  1NBE B;  1G3Y A;  3MET A;  3GOX A;  4C0Z A;  1Y96 A;  2O9S A;  1EIF A;  1ZUU A;  2MWP A;  4M75 D;  3PNW C;  1UB4 A;  3L42 A;  2DYI A;  1RAA B;  2DIQ A;  1BCM A;  4RTU A;  1HSQ A;  3SFM A;  2LCL A;  3VS0 A;  3JCM X;  5KCH A;  3NGP A;  1AEY A;  2K5L A;  3C94 A;  1YCS B;  2EVR A;  2RQW A;  3SDZ A;  2G3R A;  2KRO A;  1LJO A;  1RAI B;  1OPL A;  3FIF A;  3JB9 F;  2JMA A;  2WSC E;  3QPH A;  4C92 A;  3T9N A;  1JXM A;  2A28 A;  2EGA A;  2E5K A;  2JJ9 A;  4B9W A;  4D8K A;  2FPF A;  5GAN 6;  3EFS A;  2AT1 B;  3G71 Q;  1Q82 R;  2HQE A;  2CYZ B;  1OEB A;  2M0O A;  3DLL A;  2JTF A;  1PNJ A;  3LLR A;  1UGV A;  4C5H A;  2DF6 A;  4E7Z A;  3RES A;  1K8A U;  3M4G A;  3CCE T;  1LCK A;  4XTV A;  1VQP T;  1N8R R;  2E10 A;  2RI2 A;  2K4Y A;  1VQL A;  3CCV T;  1BBZ A;  1JRI A;  2EQI A;  4JZ4 A;  4MZP A;  5KYN A;  1WIE A;  2JOY A;  3EGU A;  2KRM A;  2OTL T;  1YN8 A;  3X20 B;  1H64 1;  4EMK C;  4AMC A;  4GY5 A;  1K9M C;  4HA8 A;  3MHX A;  4F7U A;  1PG5 B;  2A36 A;  1T0J A;  5D6W A;  2X4J A;  2KMT A;  1VQL Q;  1PSF A;  2CUD A;  1ZBX A;  5GAM g;  1LPL A;  3JCM e;  4FW1 A;  2YSQ A;  5IN1 A;  1LOJ A;  4O5V A;  4EMH A;  1VQ5 A;  2EWN A;  2DD5 A;  2I2L A;  2PVD B;  2DYB A;  2RHY A;  4M78 F;  3X28 B;  4K11 A;  4FU6 A;  3INZ A;  2DXB A;  1Z9Q A;  3TCJ A;  4EPC A;  1Y96 B;  3VS1 A;  1RI9 A;  4M78 C;  2FO0 A;  2DFU A;  4M77 G;  2OJ2 A;  1ZBJ A;  4FYX B;  3JSC A;  5CKD A;  1VQ9 T;  4C8Q A;  4IUV A;  1VQ5 Q;  4PJN A;  3MCA B;  2PVG B;  3JCM b;  1H92 A;  3M4Y A;  1WJQ A;  3L2W A;  1VQM A;  4JDS A;  1H3H A;  5FWC A;  1I1J A;  2E65 A;  3PVQ A;  4IKF A;  1VQ8 A;  1X69 A;  3JCM J;  3M59 A;  1WFW A;  1ZLM A;  2GF7 A;  2DRM A;  3OYK A;  3WXM B;  4C92 B;  4FIB A;  1FYN A;  2EBP A;  4XU2 A;  1Y57 A;  1VQM Q;  4Z02 A;  4LUE A;  1QKX A;  1AWJ A;  3VS5 A;  2RQU A;  3MPU B;  4M78 E;  1ZHI A;  4HCZ A;  5FRM A;  8AT1 B;  1VQ8 Q;  2OI3 A;  2OX7 A;  3VKI A;  1BI3 A;  2C0T A;  1R77 A;  1PHT A;  2RHZ A;  1U3O A;  2VGN A;  1GXI E;  2DTI A;  3CCU Q;  2H8H A;  4A4H A;  4AFZ C;  1VYV A;  4E7H A;  2RF0 A;  3ME9 A;  3M5A A;  5KH6 A;  4A4K A;  3SHW A;  3EG3 A;  1YP5 A;  4OML A;  2OAW A;  3EG1 A;  4WCI A;  5GMK i;  2VB6 A;  5CK9 A;  1LNX A;  5GAO n;  2A3L A;  2VYT A;  1N9R A;  3VS3 A;  3TQ7 P;  2WSF E;  2YXY A;  4BI3 A;  5I2S A;  1YNZ A;  5LJ5 d;  3RIR A;  4F17 A;  3JCM P;  1IZ6 A;  1QMC A;  1UFF A;  4M75 G;  2KXD A;  1MUZ A;  1IB8 A;  1M3A A;  4ANJ A;  2K79 A;  3GBQ A;  3ER0 A;  4M7A F;  3QWY A;  4A4E A;  3ASK A;  3CCS A;  1KK7 A;  5DLQ E;  4HCC A;  2EQK A;  1C0M A;  1VQ4 A;  1YIJ T;  5KYW A;  3TSZ A;  3BFM A;  8ATC B;  1A0N B;  4MZT A;  1FMW A;  3EHQ A;  2QQS A;  1M3B A;  4C8Q B;  2AZS A;  1UHF A;  3OMG A;  2ED1 A;  3AT1 B;  4MDX A;  2X4X A;  4XK8 E;  2K9G A;  3CCS Q;  3M56 A;  1VQ4 Q;  1NJI C;  1NM7 A;  3M9Q A;  2DXC A;  1MMN A;  1AWO A;  5GAN 2;  1SG5 A;  2K3X A;  4J83 A;  2KYM A;  1QVF S;  1BKB A;  2ED0 A;  2MK5 A;  4JPB W;  2COY A;  2EQJ A;  1V29 B;  4C92 C;  4CI0 C;  4Q5W A;  2LNV A;  4OMQ A;  2PZ1 A;  2DL4 A;  1KC8 U;  3CXC S;  2VXF A;  4J9H A;  5FLX E;  5J26 A;  3SB2 A;  1K0X A;  1BIA A;  1B07 A;  4OB1 B;  1AT1 B;  3NTH A;  2VGM A;  1NPR A;  1VQ5 T;  1ABQ A;  2EKO A;  1IGU A;  4PJO F;  2GQV A;  4JRQ A;  5EC7 A;  1D1A A;  4J7F A;  3UT1 A;  2HKN A;  1AZE A;  4OGE A;  3FLG A;  3NHN A;  4PJO C;  4QQG A;  3JB9 H;  2K6D A;  2LQK A;  4OP0 A;  2LCC A;  4LUD A;  5GAO p;  1Q86 U;  3LGL A;  1WJS A;  4C92 E;  1PKT A;  3D7S B;  1WQW A;  2QDL A;  1ABO A;  1X6O A;  1OU8 A;  4JZ3 A;  1VQM T;  1HJD A;  4M7D F;  3CPW P;  2FZG B;  4XTY A;  2Y4Y A;  3OS1 A;  3M58 A;  1VQ8 T;  4N0A C;  1K9A A;  5IHN A;  2KYB A;  2L8D A;  2ZPH B;  1Q82 C;  2LT4 A;  4M7D C;  2KXC A;  5GAN 7;  1ZA1 B;  3MP6 A;  4B9X A;  2DL3 A;  1GCQ A;  1QVP A;  3VJP A;  1TU0 B;  1Y07 A;  3MKD A;  2FRW A;  2QDY B;  5KYW B;  4PJO E;  4JJN K;  2VWF A;  1N8R C;  3CC7 T;  2DK3 A;  1WA7 A;  3JCM Q;  1IRX A;  2CKK A;  3HKS A;  4IUU A;  1M90 R;  4C5I A;  1BYM A;  3S3O A;  4QQD A;  5FU7 B;  1M9S A;  1W2B A;  4C8Q C;  3H9N A;  1E6G A;  4JUV A;  1PD0 A;  4EIK A;  3PMI A;  3PMT A;  2AZV A;  2OAU A;  1BI1 A;  2XIC A;  2B8A A;  1WZO A;  4M7D E;  3C12 A;  1MMD A;  2J6F A;  5GAN j;  3E9G A;  4ELY C;  2Z0W A;  2GCX A;  2QAS A;  5LL6 S;  1D09 B;  4HKE A;  1TUD A;  3J7A F;  1BK2 A;  2O2O A;  2E64 A;  1X2K A;  1TOV A;  1KD1 U;  2M02 A;  4Y91 A;  3QG1 A;  1SRL A;  2P4T A;  5AYF A;  3VUZ A;  1M5Q 1;  4C0G A;  4RG8 A;  3SEM A;  1IHW A;  4RG2 A;  1Y7X A;  5HKC A;  4C8Q E;  4KUL A;  2EJF A;  3EG2 A;  4J9B A;  2P0Q A;  1GBR A;  3QO3 A;  2NUP A;  5GAN 4;  3MJX A;  2QYZ A;  1VA7 A;  2F2X A;  3CCS T;  1YI2 T;  3NTK A;  2LRQ A;  2VXE A;  3CCE A;  1VQP A;  3BY7 A;  3QJY A;  5HCK A;  2RD1 A;  3JCM f;  5HK0 A;  3QZ5 B;  2QEX A;  1IHV A;  2EFI A;  2I0N A;  3TU4 K;  5A0D A;  1KFZ A;  4PFZ A;  4M78 A;  2X51 A;  2AK5 A;  4XAX B;  3H0H A;  2IVW A;  2L5Q A;  3CQT A;  1KC8 R;  4AG2 C;  3CCE Q;  4M78 D;  5C6S A;  1VQP Q;  4AG1 C;  2QEX Q;  3GIB A;  3PFS A;  2YRV A;  3MO8 A;  3I56 A;  1YFN A;  5GAO r;  1WX6 A;  3WVE B;  3OYC A;  2LQN A;  1X2Q A;  4B6M A;  1O9S A;  2EIF A;  2CP0 A;  2F1L A;  2VUB A;  2QG9 B;  1ZUK A;  4KGX B;  2LX7 A;  1M2O A;  2RNA A;  2DTH A;  2HMA A;  5IT9 E;  4RMO A;  3JCM h;  1FMV A;  3I56 Q;  5M9O A;  4HVW A;  3CC2 T;  1IRE B;  2E4H A;  1M4Z A;  1VQ9 A;  2DJQ A;  4LDV A;  1KG1 A;  4JS5 A;  3LH5 A;  4N4G A;  2CZ0 B;  1QKW A;  5FU7 C;  2KT8 A;  4FCY A;  3RBB B;  2OTJ T;  4OGC A;  4CC7 A;  3OW2 P;  1PD1 A;  4QVZ A;  3NPF A;  1VQK T;  5LJ5 e;  5AT1 B;  2RB6 A;  4AFQ C;  1FXX A;  1U1S A;  4RTV A;  1VQ9 Q;  4JJD A;  5IHI A;  2DLP A;  1OPK A;  1YHQ T;  3CD6 A;  4OB2 B;  3QSU A;  1N9S A;  3EGX A;  1D0Z A;  2MWO A;  1K73 C;  2NUP B;  3BW1 A;  5I22 A;  1K1Z A;  5CQX A;  2W0Z A;  4OF1 A;  3RR6 A;  3V8K A;  4AFU C;  1WQ7 A;  5HY6 A;  4JLI A;  4M7A A;  4PLL A;  2NYS A;  1UGS B;  2QQ9 A;  3OS0 A;  2L3S A;  1OZ2 A;  2ZZD A;  3SWN A;  3OA6 A;  4A4G A;  5IHK A;  3CD6 Q;  4QQ6 A;  4M78 B;  2C06 A;  1RAB B;  4KUD K;  4DBR A;  4IUP A;  5KYU A;  4J9I A;  5IAY A;  2RI5 A;  2HNI A;  3MEW A;  2GNC A;  3HPW A;  2A37 A;  3I55 A;  3OYH A;  2ZPG B;  1BCO A;  1SHG A;  1K0S A;  1M8M A;  1VQ6 A;  3G7Z A;  5LJ3 g;  3MEV A;  5GAN 3;  3QBY A;  1GCQ C;  3KUF A;  1K4U S;  1OUL A;  4OMP A;  5GMK j;  4J9E A;  3TRE A;  4ORZ A;  1JB0 E;  1YIJ A;  5L23 A;  2EYX A;  3I55 Q;  2LJ3 A;  2C0I A;  1RAH B;  2XMF A;  3LWH A;  1T0H A;  1X6G A;  1VQ6 Q;  4PFO A;  1WXT A;  1UJY A;  4FYW B;  2SEM A;  5GAO m;  2RN8 A;  2XDD A;  1WHG A;  5I2M A;  4C92 D;  2RJC A;  4E2F B;  2F2W A;  1NEB A;  1EZZ B;  1OQK A;  1B34 A;  3EGD B;  4Y28 E;  4TVR A;  4C5E A;  2ZPF B;  1YIJ Q;  1YJ9 T;  2MPX C;  1XOV A;  2CH4 A;  3VS2 A;  4E7L A;  1MNE A;  1ARK A;  1GFD A;  2QEX T;  4PFP A;  3M54 A;  4PJO A;  1F1B B;  4KGV B;  3A8L B;  3OW2 A;  1WHH A;  1NYF A;  2HEQ A;  3M55 A;  2CDT A;  4FYV B;  1WHM A;  4L6V 5;  3ULR B;  4JJC A;  1VOM A;  1ZSG A;  1NPP A;  4BD3 A;  4PJO D;  3BDL A;  4V2S A;  2DM1 A;  3EGX B;  5A2Q E;  1C1A A;  2KR3 A;  4N0A A;  4J7I A;  4LDU A;  3L2U A;  4HXJ A;  4AFS C;  3UWN A;  4M7D A;  3I56 T;  5D6X A;  1M90 C;  4FSS A;  2E1H A;  1VQ7 A;  4M7A B;  2CS7 A;  3TSW A;  1ZSZ B;  5FWB A;  5C0M A;  2JVV A;  3SWN B;  1G5V A;  3E1S A;  4M7D D;  1CKA A;  2RA2 A;  3HFO A;  2JN0 A;  2M51 A;  4PJM A;  5KYU B;  1D1C A;  3GNF B;  4Z89 A;  2VVK A;  3L1A A;  5GMK e;  1ZX6 A;  1VQ7 Q;  3CBM A;  1M1K R;  1BU1 A;  2CP5 A;  1Q95 G;  2FZK B;  2F69 A;  1M30 A;  3LW5 E;  1YIT T;  1XNI A;  3G1J A;  4C8Q D;  2IPO B;  2DIL A;  1D0Y A;  5GAO q;  4J6Y A;  2JTM A;  2BIV A;  4RTT A;  4E6R A;  4RTZ A;  4M77 F;  2XDB A;  3KFV A;  3JAM E;  4JJB A;  3NFC A;  3JB9 J;  3CD6 T;  3CC7 A;  2D8J A;  2RQR A;  2A7Y A;  3P8D A;  3QWX X;  1SF9 A;  1NEG A;  2O9V A;  2VAS A;  2HDA A;  4DA4 A;  4LXC A;  1RAD B;  4YTL A;  1B34 B;  2HL3 A;  4F16 A;  1OV3 A; 
#chains in the Genus database with same CATH homology
 2CZ7 B;  4OMF B;  3JB9 H;  2LQK A;  3JCM g;  1Y71 A;  4OP0 A;  5GAN d;  2JNG A;  2DEQ A;  2LCC A;  2XDP A;  4IUT A;  4JRK A;  5GAO p;  4BE2 A;  3OW2 S;  1VQ9 T;  1Q86 U;  4PJO B;  3CCL A;  3LGL A;  2FB7 A;  1WJS A;  2E70 A;  3BDU A;  3CPW A;  4C92 E;  3QUI A;  3CCR T;  1RL2 A;  1UGQ B;  1WJR A;  3CCM T;  1M8V A;  3UPU A;  2DKG A;  1WQW A;  1X6O A;  5CIU A;  3CPF A;  4J6X A;  2DD4 A;  1VQM T;  1BI2 A;  2K5F A;  4M7D F;  3L2Z A;  4XTY A;  2XKO C;  1QP3 A;  2Y4Y A;  3M58 A;  4XQ3 A;  4N0A C;  3OS1 A;  1VQ8 T;  3JB9 I;  2L8D A;  1U1T A;  2K57 A;  2ZPH B;  1XQH A;  1Q82 C;  2KDS A;  2LT4 A;  3LYI A;  5A0G A;  4M7D C;  5GAN 7;  4OVA A;  3MP6 A;  3KBG A;  1M1G A;  3DLM A;  5CQY A;  4B9X A;  3I55 T;  4JRI A;  2LQ8 A;  1QVP A;  3VJP A;  3CBP A;  2PUK B;  1Q81 U;  3VU3 C;  1KG1 A;  1Y07 A;  3L2R A;  3OYY A;  2DXU A;  3RUX A;  1K9M U;  4M7D B;  1VQ6 T;  1NE8 A;  5LJ3 d;  4JLG A;  3A8M B;  2ZPB B;  1XTD A;  2QDY B;  4FL6 A;  4DOW A;  5FRN A;  2Y90 A;  2R58 A;  4ZTF A;  4PJO E;  5J3B A;  3CCJ A;  4ZN1 A;  2EAY A;  1QVG S;  2QQR A;  2E6Z A;  4JJN K;  2KAF A;  2CZ1 B;  1N8R C;  5LJ3 e;  3CC7 T;  2DK3 A;  4X9D A;  1YI2 A;  3JCM Q;  3JCM c;  2CKK A;  3HKS A;  4IUU A;  2P0P A;  4M7A C;  1I8F A;  4C5I A;  4FT4 A;  4BAC A;  1BYM A;  3GPL A;  2QA4 T;  4M78 G;  2QTX A;  3A8H B;  3SWN C;  4QQD A;  4D6W A;  3S3O A;  4XTW A;  5FU7 B;  1M9S A;  1W2B A;  3FRN A;  4C8Q C;  4HCB A;  3JRZ A;  4JS4 A;  3CC4 T;  3V7S A;  4JUV A;  1Q81 C;  3PMI A;  3MP1 A;  3PMT A;  4KBM B;  2EJG A;  3FC3 A;  1S72 A;  3OYM A;  2OAU A;  1BI1 A;  3PIO A;  1VQN A;  2XIC A;  4EMK B;  2B8A A;  2RK2 A;  4M7D E;  4M75 F;  3RKW A;  3C12 A;  3E19 A;  3GP8 A;  1VQP A;  1YBY A;  3HFN A;  3PT9 A;  2DIG A;  2AHJ B;  4II1 A;  1YJW A;  2XHC A;  1MHN A;  1ZQ1 A;  3JCM W;  5GAN j;  3E9G A;  4ELY C;  1M1K U;  3FJP A;  1JBM A;  5CKE A;  1OYX A;  2GCX A;  4BE1 A;  5LL6 S;  4HKE A;  4C92 G;  3J7A F;  2E64 A;  3HRT A;  3UDC A;  2VV5 A;  4M75 B;  2BUD A;  1KD1 U;  1OI1 A;  2L3R A;  4QW2 A;  3VYG A;  2R5A A;  4Y91 A;  3QDR B;  3CCR A;  2D6F A;  3HRS A;  3QG1 A;  2LVM A;  2P4T A;  4EMG A;  4OB0 B;  4LDW A;  5AYF A;  3VUZ A;  4M7A E;  1M5Q 1;  4E7I A;  4ZGE B;  1AHJ B;  3A8G B;  4RG8 A;  4A54 A;  1UEB A;  2PUO B;  1NZ9 A;  3LH0 A;  2QXF A;  4C0G A;  5HK3 A;  4RCB A;  4RG2 A;  1UGP B;  1Y7X A;  3URG A;  5HKC A;  4C8Q E;  4KUL A;  2EJF A;  3MEU A;  2X4W A;  4RCC A;  5GAN g;  5LJ5 f;  2P0Q A;  3QKJ A;  3CEY A;  2E41 A;  5CKB A;  1VUB A;  3OQ5 A;  2DVE A;  3QO3 A;  1RI0 A;  3ZFJ A;  2XD0 A;  5GAN 4;  5KE2 A;  3G6E A;  4RKU E;  3G4S T;  4O6J A;  1G3Y A;  3CCS T;  1YI2 T;  3MET A;  3NTK A;  2LRQ A;  2VXE A;  3QYH B;  5GAM d;  2Y4X A;  4C0Z A;  3GOX A;  3CCE A;  3BY7 A;  3QJY A;  4BE0 A;  1Y96 A;  4J8O A;  4KUI A;  2RD1 A;  3JCM f;  5HK0 A;  4ZGJ B;  5J39 A;  1EIF A;  2MWP A;  5FRO A;  4M75 D;  3QZ5 B;  4XU1 A;  2QEX A;  3PNW C;  2EFI A;  1UB4 A;  3L42 A;  3CMA A;  2X4Y A;  3TU4 K;  1VQ7 T;  4M77 C;  5A0D A;  4M78 A;  5CAI A;  2DIQ A;  1JJ2 S;  3C95 A;  2OTJ A;  3FDR A;  4FT2 A;  2LCL A;  3SFM A;  3JCM X;  4XAX B;  3CCU A;  2IVW A;  4F7U G;  5KCH A;  2QI2 A;  4E7J A;  3X26 B;  1VQK A;  3J80 E;  2L5Q A;  2RK1 A;  1YJW T;  4BDY A;  2K5L A;  1KC8 C;  2DO3 A;  3C94 A;  4M78 D;  5C6S A;  1QVF A;  3SDZ A;  4XTU A;  2G3R A;  4N4H A;  1LJO A;  3GIB A;  3PFS A;  2YRV A;  3FIF A;  2HQX A;  3JB9 F;  2RH2 A;  3MO8 A;  4J5Y A;  3I56 A;  2GFU A;  1YHQ A;  2WSC E;  3QPH A;  5GAO r;  4C92 A;  3T9N A;  2DZ9 A;  5A0L A;  3CXC A;  4B9W A;  3WVE B;  3OYC A;  5GAN 6;  3EFS A;  2PU9 B;  1WGS A;  2XG8 D;  5KE3 A;  2HQE A;  1O9S A;  1BIB A;  2CYZ B;  2EIF A;  5KCO A;  5LJ5 h;  4LDX A;  2KY9 A;  3KXT A;  2VUB A;  3GNG A;  3CME A;  3QYG B;  4M77 E;  2M0O A;  4C0F A;  3WVD B;  4C0D B;  4M7A G;  3OYE A;  3DLL A;  2GFA A;  3PTA A;  2DTH A;  1KHC A;  4F7U F;  5IT9 E;  2JTF A;  4RMO A;  3LLR A;  4HT8 A;  4ZTJ A;  4ME7 A;  3JCM h;  4BI8 B;  4C5H A;  4DOV A;  4C8Q G;  3RES A;  4A53 A;  1K8A U;  3QHS A;  3M4G A;  1Q86 C;  3CCE T;  5M9O A;  3N5B B;  3CC2 T;  1IRE B;  4IUR A;  4XTV A;  1VQP T;  1M4Z A;  2HD0 A;  5GAN 8;  2F5T X;  2PVO B;  1OZ3 A;  3EAE A;  3OBW A;  4LDV A;  2YLB A;  4JS5 A;  1M90 U;  1VQ9 A;  2E10 A;  2RI2 A;  2K4Y A;  2CZ0 B;  4N4G A;  3CCV T;  1VQL A;  1JRI A;  4BI4 A;  4MZP A;  4F7U B;  2JOY A;  3S3N A;  5FU7 C;  4XU0 A;  2DJZ A;  3OSV A;  5GMK l;  1M1F A;  1H3Z A;  2MI6 A;  4BB7 A;  3SD4 A;  2HAX A;  2OTJ T;  3OYD A;  4OGC A;  5FU6 B;  3MP8 A;  2OTL T;  3QII A;  2F5K A;  3X20 B;  1H64 1;  3G71 T;  1W4S A;  3JB9 D;  2RI3 A;  4EMK C;  2L89 A;  2FHD A;  4QVZ A;  1VQK T;  4HT9 A;  2R57 A;  4GY5 A;  5LJ5 e;  3JCM d;  2RB6 A;  1K9M C;  1FXX A;  4HA8 A;  3ZBD A;  3MHX A;  4F7U A;  3RKX A;  1U1S A;  1DJ7 B;  4LD6 A;  5D6W A;  1NJI U;  2M9U A;  3LX7 A;  2X4J A;  2KMT A;  2ZPE B;  3CCL T;  1I4K 1;  1PSF A;  4PNO A;  1N6A A;  3CCQ A;  1ZBX A;  2V8I A;  2X35 A;  2ZCF B;  4XTX A;  2YLC A;  3JCM e;  5GAM g;  1VQO A;  4MMK A;  5CR2 A;  4UC4 A;  3FB9 A;  3VUB A;  1YHQ T;  4M75 C;  3ZEH A;  2RM4 A;  5GAN f;  5IN1 A;  1LOJ A;  4O5V A;  3CD6 A;  2O4X A;  3OB9 A;  4EMH A;  1VQ5 A;  3OBY A;  3E9F A;  4OB2 B;  1QW1 A;  2R5M A;  3Q1J A;  2EWN A;  2FVU A;  3QSU A;  1QP2 A;  1N9S A;  2DD5 A;  3RMQ A;  2I2L A;  3V7R A;  2PVD B;  2MWO A;  1G3T A;  1K73 C;  2JUF A;  2RHY A;  3BW1 A;  5CQX A;  3OYA A;  3DB3 A;  4M78 F;  3X28 B;  4BDZ A;  4FU6 A;  3INZ A;  2DXB A;  3OYB A;  4OF1 A;  2BKD N;  4L5G A;  3V8K A;  3RMS A;  3TCJ A;  4EPC A;  4R56 A;  1Y96 B;  1WQ7 A;  4X9C A;  5HY6 A;  4JLI A;  2QQB A;  4M78 C;  4M7A A;  4PLL A;  4M77 G;  1UGS B;  2QQ9 A;  2RJE A;  3OS0 A;  3HRU A;  1OZ2 A;  2EJ9 A;  2ZZD A;  3JSC A;  3SWN A;  5CKD A;  2K3Y A;  4PKC C;  3OA6 A;  3OMC A;  4A4G A;  4L59 A;  4C8Q A;  2RO0 A;  4IUV A;  4M78 B;  4QQ6 A;  3MCA B;  4ELZ C;  5LJ3 j;  3CCM A;  2PVG B;  2C06 A;  1VQL T;  3JCM b;  3H6Z A;  1M1K C;  5LJ3 f;  4NL3 A;  4KUD K;  2EYQ A;  3M4Y A;  5L8R E;  1WJQ A;  1YJ9 A;  3L2W A;  3DKM A;  4IUP A;  1VQM A;  4PJO G;  4JDS A;  5IAY A;  4FSX A;  1P92 A;  2E65 A;  2FYK A;  4IKF A;  4C92 F;  1HK9 A;  2HNI A;  2RI5 A;  3MEW A;  2RHI A;  4XU3 A;  1KD1 C;  1VQ8 A;  3GLX A;  3HL8 A;  3OY9 A;  2DPP B;  4M75 E;  3CBO A;  3JCM J;  3HPW A;  1WPY A;  3M59 A;  3CPW S;  3I55 A;  2ZPI B;  3DB4 A;  2LTO A;  3OYH A;  2ZPG B;  2JZ2 A;  1S72 T;  1G3S A;  2GF7 A;  1I5L A;  1VQ6 A;  4J6W A;  3OYK A;  2LT1 A;  2YHT A;  4QVC A;  3G7Z A;  1VQN T;  3WXM B;  3S3M A;  4IUQ A;  4C92 B;  5GMK m;  2K5I A;  5LJ3 g;  3M57 A;  3MEV A;  1KQ2 A;  4FIB A;  5GAN h;  3LGF A;  2DXT A;  5GAN 3;  1D3B A;  4XU2 A;  3QBY A;  4Z02 A;  3KUF A;  4MDW A;  4QVD A;  1YCY A;  4WF2 A;  5DY9 A;  5GMK j;  3S6W A;  4M7D G;  4M78 E;  1ZHI A;  4HCZ A;  3TRE A;  3OYN A;  3P8B B;  5FRM A;  4NL2 A;  2KQW A;  3PGG A;  3L2Q A;  1HXD A;  1JB0 E;  3VV0 A;  3J81 E;  3VKI A;  1BI3 A;  1YIJ A;  4KT0 E;  3HHT B;  2QA4 A;  1Q82 U;  1KQS A;  2DAQ A;  4C5G A;  2RHZ A;  3X24 B;  1MGQ A;  1O75 A;  3LWH A;  4A4F A;  2VGN A;  3CC4 A;  3VYH B;  2K2V A;  1GXI E;  5CVI A;  2DTI A;  4C0D C;  5GAO m;  3X25 B;  1K73 U;  1TH7 A;  4A4H A;  1YJN A;  2XDD A;  4BY6 B;  4ZN3 A;  4E7H A;  5I2M A;  3HSB A;  4C92 D;  3A5Z B;  3ME9 A;  2RJC A;  5I21 A;  5LJ3 h;  1SSF A;  1X75 C;  3M5A A;  2CGH A;  4NOY A;  4A4K A;  5KH6 A;  4M77 A;  2LX9 A;  4NS5 A;  1JJ2 A;  3G6E T;  1B34 A;  4Y28 E;  1W2B S;  4TVR A;  2KSS A;  4C5E A;  2MAM A;  2ZPF B;  1N8R U;  1YJ9 T;  2XU8 A;  5GAN e;  4ZGD B;  1XOV A;  5GMK i;  4E7L A;  2PQW A;  5CK9 A;  1LNX A;  2V8K A;  3R6O A;  2QEX T;  4PLI A;  5GAO n;  2IG0 A;  2A3L A;  2VYT A;  3M54 A;  4PJO A;  1N9R A;  2EQM A;  4M77 D;  5GAM j;  3CMA T;  3A8O B;  2WSF E;  5FU6 C;  1FX7 A;  3A8L B;  1X01 A;  3H8Z A;  3OYI A;  2E6N A;  3OW2 A;  4LD9 K;  1G3W A;  4BI3 A;  2E12 A;  5GAM f;  5I2S A;  5LJ5 d;  3RIR A;  1KQ1 A;  3M55 A;  5D6Y A;  3JCM P;  4L6V 5;  1IZ6 A;  4XTZ A;  3GF5 A;  4M75 G;  1YIT A;  3JCM V;  3F70 A;  2ZGW A;  3V8J A;  1NPP A;  3CCU T;  4VUB A;  4BD3 A;  4PJO D;  3BDL A;  1I81 A;  2XI9 A;  2O4X B;  3ER0 A;  5GMK h;  4M7A F;  4V2S A;  2D9T A;  4A4E A;  5A2Q E;  3ASK A;  3G4S A;  3OS2 A;  4N4I A;  3CCS A;  4N0A A;  5DLQ E;  1K8A C;  3QZ9 B;  4HCC A;  2MMP A;  2EQK A;  1KHI A;  4C8Q F;  2CZ6 B;  4J7I A;  1VIF A;  4LDU A;  2M16 A;  4EDU A;  3UWN A;  3L2U A;  1Q7Y U;  3I56 T;  4M7D A;  1VQ4 A;  2XK0 A;  5D6X A;  5EG2 A;  1YIJ T;  1PSE A;  1M90 C;  4R55 A;  5GAO l;  2DZC A;  2WSE E;  3BFM A;  3CC2 A;  2E1H A;  1WNL A;  3QXE B;  1VQ7 A;  4M7A B;  2CS7 A;  4MZT A;  4F7U E;  2QQS A;  2RHX A;  5C0M A;  2JVV A;  3SWN B;  1G5V A;  1QVG A;  3E1S A;  4QQG A;  2EQU A;  3LWI A;  4M7D D;  4C8Q B;  4DQ2 A;  3OYL A;  3CME T;  1YJN T;  2DTO A;  2RA2 A;  3HFO A;  5CO7 A;  2JN0 A;  2D0Q B;  4P5N A;  3OMG A;  3FEO A;  4MDX A;  2X4X A;  4BUG A;  1BI0 A;  4XK8 E;  1FWZ A;  3L2V A;  3GNF B;  2RJD A;  4X34 A;  3M56 A;  2M1H A;  3L1A A;  3C4S A;  1NJI C;  3HP9 A;  5CKF A;  3OSS C;  3RKY A;  3M9Q A;  2DXC A;  5GMK e;  1Q7Y C;  3EFR A;  3CBM A;  5GAM h;  4EMK A;  2QQA A;  3OS5 A;  1R8O B;  1U8R A;  2V8J A;  5GAN 2;  2K3X A;  4J83 A;  4OB3 B;  4E7K A;  2F69 A;  4M7A D;  3V8L A;  4PL6 A;  3OYG A;  1VIE A;  3LW5 E;  1QVF S;  1BKB A;  2O01 E;  3TEE A;  1YIT T;  1D3B B;  1XNI A;  3NTI A;  3V7C A;  2LDM A;  4C8Q D;  2H3J A;  5LJ5 j;  2E5Q A;  3AHU A;  2MF2 A;  2EQJ A;  2NLU A;  1V29 B;  4MZM A;  4M75 A;  2RJF A;  4C92 C;  4Q5W A;  4CI0 C;  4J6Y A;  5DM7 R;  2LNV A;  4E47 A;  5GAO q;  2RHU A;  2P0K A;  2JTM A;  1KC8 U;  1KQS S;  2BIV A;  3CXC S;  3CCJ T;  2VXF A;  4JRP A;  5CCA A;  3PIP A;  5FLX E;  1N27 A;  5J26 A;  3SB2 A;  3JB9 G;  1BIA A;  4CRI A;  3M53 A;  4M77 F;  3CCQ T;  3P8H A;  2XDB A;  1VQ4 T;  3JAM E;  4OB1 B;  3QJ6 A;  1VQO T;  2KK4 A;  3NTH A;  2VGM A;  3NFC A;  3CCV A;  1NPR A;  5GAN 5;  1UGR B;  3JB9 J;  3CD6 T;  3O8V A;  3CC7 A;  1VQ5 T;  4FM4 B;  4LDY A;  2A7Y A;  2WAC A;  2EKO A;  4MML A;  5GAM e;  3P8D A;  4PJO F;  3RER A;  2GQV A;  5CKH A;  2HBP A;  5LJ5 g;  4JRQ A;  2KVQ G;  2LC4 A;  2XID A;  5DLO A;  4J7F A;  4M77 B;  4DA4 A;  3UT1 A;  4YTL A;  2OTL A;  1B34 B;  3G71 A;  4ATO A;  4GLK A;  3MEA A;  4OGE A;  4BY6 C;  3FLG A;  3OYF A;  3OYJ A;  4PJO C;  2FL7 A;  2VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...