4C8QB

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qB00
1X01A 3JCMg 3QSUA 5GANj 4A53A 3QO3A 2CGHA 2DTHA 4M77C 1I4K1 4J6YA 4M77G 2E10A 1LOJA 1WNLA 4JUVA 5LJ5e 4PJOE 4QVCA 2QTXA 4M77F 5LJ3j 4M7AE 4XU2A 3SB2A 3JB9G 4M75D 5GAOn 3JB9F 2DXUA 2DTIA 4F7UA 5LJ5f 1HXDA 5GANe 3HSBA 2YLBA 2Y90A 4OP0A 4XTZA 5CAIA 4C8QA 3QHSA 5GMKi 3FJPA 4N0AA 5GMKj 4F7UG 4JRKA 1WPYA 2RB6A 4M77D 4M78B 4RCBA 3SWNA 4C92E 4QVDA 5LJ3e 4F7UF 5LJ5j 3JCMP 4WF2A 4X9DA 2VXFA 4C8QC 4XTVA 3QUIA 4N0AC 4C8QG 5GAN4 3SWNC 1N9RA 3JCMd 3JB9D 4JRIA 4XTUA 2E1HA 4C8QF 3JB9H 2DXTA 4M75F 5GAMd 4HT9A 3BY7A 2VXEA 5GAMg 5LJ3f 3V8KA 4M7DA 4M7DB 3V7CA 3JCMe 2E41A 2ZGWA 3JCMV 5GMKe 2RM4A 4M7DG 4XU0A 3V8LA 5GAN3 2RA2A 2FB7A 5GAOr 2EJ9A 4M75E 4DQ2A 4C8QD 2E65A 3JCMf 3JCMQ 4M7AB 4EMKB 2VC8A 2I2LA 2YHTA 2DTOA 1LJOA 3RKXA 3HFNA 2DVEA 1B34B 2DZ9A 2DKGA 4M77E 4XTWA 3JB9I 1D3BB 1H641 1D3BA 4M78A 4M7DD 5GAN7 3RKYA 4NL2A 1M5Q1 3RESA 2K57A 3AHUA 4C92B 1U1SA 3BFMA 1JBMA 4M78C 4XU3A 1MGQA 4XU1A 4M78G 1WQ7A 1Y96B 1Y96A 1YCYA 4J5YA 2YLCA 4M78F 5GAOl 3M4GA 4EMHA 3HFOA 5GAMe 4J6XA 4A54A 4F7UE 2RD1A 4XTYA 3RUXA 4Y91A 4M7DC 3JB9J 3GIBA 3JCMc 4NOYA 5GANg 5GAOm 4C8QE 1I5LA 3RKWA 4PNOA 4M7DF 4MMKA 2DEQA 5GAN6 4NL3A 5GAMf 4PJOB 4PJOA 3L2ZA 3RERA 5GAOq 1M8VA 4M78D 3FIFA 4EMKA 4M7AA 5LJ3g 3V7RA 2FYKA 4PJOC 1WQWA 2EAYA 4PJOG 3JCMJ 5GMKm 4M7AC 4EMKC 5LJ5h 1B34A 2DZCA 5GAMj 2JN0A 4M7AG 4X9CA 5GAN8 4M7AF 3V7SA 3L1AA 4M77B 4HA8A 5GAN2 1TH7A 3PGGA 4C92A 5GAN5 1KQ2A 5LJ5d 3FB9A 5GANh 4HT8A 1HK9A 5LJ5g 1I81A 5DY9A 4C92C 4JLIA 4XTXA 4C92G 1BIBA 4PJOD 4C92F 5LJ3h 4V2SA 1JRIA 4M7AD 4J6WA 5GANd 2E64A 3RIRA 3JCMW 4F7UB 2EJFA 3VU3C 2HNIA 5GMKl 1LNXA 1BIAA 4M78E 3V8JA 1U1TA 2EJGA 5LJ3d 4C8QB 1N9SA 4M75B 4M75A 3SWNB 4RCCA 3JCMh 4EMGA 3EFRA 5GMKh 5GAOp 4C92D 3INZA 5GANf 1KQ1A 3BW1A 2EWNA 3EFSA 3BDUA 4M75C 4PJOF 3JCMb 3JCMX 4M75G 4M7DE 2DJZA 4MMLA 4XQ3A 5GAMh 1I8FA 4M77A 5I21A
chains in the Genus database with same CATH superfamily
1X69A 4PJNA 3QSUA 3CCJT 1PG5B 1KK7A 4KGVB 4LUDA 1MMDA 3DLLA 4HCCA 4F16A 1X27A 3EHQA 2J6FA 1BKBA 1W1FA 2XDBA 4IUUA 4JS4A 2DTIA 1RI9A 1HXDA 3PMTA 1PRLC 4OMQA 3X24B 3M0RA 3HHTB 3ER0A 4PK4A 2CT4A 1TXQA 3VS0A 1CKAA 3Q1JA 3JB9H 4LDYA 3WVEB 3UPUA 2KRMA 2HL5C 3BY7A 3CPWS 1KQSP 3TCJA 2LQWA 2HDAA 1YHQA 4LXCA 1QKWA 2OTLT 4Z88A 2K9GA 3CCVA 2VB6A 1KHIA 1K8AR 3ME9A 2YHTA 5CKEA 3C94A 1J3TA 1KFZA 5FROA 1C6VX 1PNJA 3P8DA 4FU6A 2K57A 1YIJT 3C12A 2DK3A 3JCMb 5GAOl 2QQSA 3L2RA 1NE8A 1X43A 5CIUA 4MDWA 3KFVA 4NL3A 3G71T 5DLOA 1M3CA 4A4FA 1NEBA 1YITT 1WIEA 4HA8A 5I22A 1KQ2A 2BIVA 4KT0E 4A63B 1YJWA 4IUPA 2KT1A 5GJWB 3JCMW 3EG1A 2KYMA 4PFPA 1UDLA 2R57A 4FT4A 2AK5A 2HL3A 4RKUE 2K5LA 4EMGA 1VQLQ 1ARKA 2F2XA 5DLQE 4M75G 4E2FB 2K2VA 2MF2A 2CGHA 1GL5A 1W70A 1O75A 2QTXA 3QYHB 3GF5A 1OU9A 3E9GA 4FSSA 2OTJT 4M75D 2K5IA 2DXUA 2YWWA 5IHIA 5LJ5f 3CPWA 2YLBA 1M30A 3OYMA 1NG2A 2VASA 3KXTA 7AT1B 1QKXA 1OYXA 3G4SA 3O8VA 3JCMP 1E6GA 2KNBB 1ABOA 5A0LA 4ZN3A 5HY6A 3FDRA 2V8JA 3QXEB 3MP6A 3JCMV 1FMVA 3M56A 2RA2A 4CC7A 4XAXB 4C0FA 3EGXB 3EG2A 3HFNA 2KT8A 5EC7A 3CCMQ 2VV5A 3HP9A 2L5QA 1M1GA 2XICA 3CCRA 2YSQA 1Y96B 3CCEQ 3M4GA 2RI2A 1ZBJA 3D7SB 2GF7A 4QW2A 1UECA 2IVWA 3M55A 1IREB 2HBWA 2AKKA 5CKDA 4C8QE 3A8LB 1RLPC 1R8OB 2E70A 1S72T 2QI2A 2LP5A 2ABLA 1VQ8T 4J9HA 4QQ6A 2COWA 1RAEB 4FYWB 3MCAB 3EFOB 5FU6C 2LCSA 3CXCS 3CCQT 1X75C 4D6WA 2DXBA 1AWOA 4ZN1A 1XTDA 3CD6Q 3CC4Q 4F7UB 3H0FA 3VU3C 1G83A 2EVRA 4M78E 2EJGA 1FYNA 1BB9A 2FVUA 2A0FB 2EQJA 1G2BA 2DL3A 3M4YA 2HQEA 3MHXA 1T0HA 2HAXA 2LC4A 3E2UA 1KC8R 4JRPA 1BCOA 2LX9A 2QGFB 5GANe 2XDPA 1PRMC 4OVAA 4XTZA 2D6FA 1VQKT 1BBZA 3LH5A 4JJBA 2OTLA 5GMKj 1TS9A 4C92E 2PUKB 2RB6A 1WJQA 3EH2A 4QVDA 4BACA 3DLMA 5A0DA 2ZPEB 2AIRB 4JRIA 3I9QA 1Y7XA 2DXTA 5LJ3f 1HYOA 1G3TA 2PNIA 2XK0A 1Y71A 4M7DG 1YIJA 4D8DA 1MMGA 5HKCA 3NFCA 1IB8A 2C0IA 2E65A 2J6OA 2VGMA 1MMAA 2XDDA 1RADB 3QIIA 1ZSZC 5IN1A 5CQYA 1K0XA 1D1BA 1NJIR 4M7DD 3G71A 4JRQA 4LD9K 3CC7Q 1LCKA 4FW2A 3HRSA 3QWXX 5KYWB 4A54A 1EX4A 4J7IA 2HQHA 3GIBA 4C5IA 3JAME 2D8JA 4F17A 3CXCA 4LDXA 2DEQA 2CYZB 4PJOA 1G8XA 4EMKA 5IHKA 1OPKA 5J26A 3EG3A 2CH4A 2EIFA 1TH7A 4Y92A 2ATCB 1N8RR 1WHKA 3CCUT 4E7JA 4BI8B 4AFQC 2QG9B 2ZAEA 3A8MB 5GMKh 4FSXA 2OTJA 3BW1A 4IIMA 2MPXC 1T3LA 3GPLA 4M77A 2FPEA 2GQIA 1X6GA 3QO3A 4YTLA 2QA4T 2MMPA 3HPWA 5DM7R 2RK1A 2CP2A 2EFIA 1X2KA 1UGVA 5FWBA 3P8BB 2DX1A 1V1CA 3I5RA 4F7UG 2K3BA 2XMFA 2XHCA 2M9UA 3PFSA 4F7UF 1QMCA 2DIQA 2QQAA 1PM3A 2QDYB 2KI7A 3LH0A 2J06A 2DRKA 3M5AA 3GOXA 1OOTA 2HSPA 3THKA 5FW9A 4FT2A 1VQOQ 2A08A 2FB7A 2P4RA 3UA6A 2V26A 3GNGA 1NYGA 1U3OA 3CCLQ 3OW2P 2FRYA 1K9MC 2BE7D 2CKKA 2COZA 4D8KA 2E6ZA 4E7ZA 1VQ8A 1JBMA 1TUGB 1FWZA 1Q86U 2YUNA 1AT1B 2EKOA 1KQSS 3TEEA 5HK0A 4PL6A 2K3XA 3CCQA 4AT1B 5GAOq 5HCKA 3JCMJ 1B34A 2V1QA 3NMZC 2SEMA 2E5QA 1JQQA 1GXIE 2HKNA 3WVDB 2RN8A 2J05A 2W10A 4HT8A 1HK9A 3CCVT 3L2QA 5KYYB 1Q81U 2RJEA 3I5SA 2L2PA 1LPLA 2E6NA 5C6SA 5GMKl 2KK4A 4DEYA 1M2VB 3OSSC 1WA7A 2QXFA 2BZXA 1SG5A 3UF4A 1KQ1A 1GCPA 2EQMA 1IHWA 3JV3A 5FRNA 1NZ9A 4AG1C 1VQKA 1FX7A 4HVWA 1QVPA 4MDXA 4VUBA 2LJ1A 1UJYA 3SD4A 5KYNA 2A36A 2X4YA 4J7FA 1ZSZB 1VQ9T 3RBBB 1IZ6A 3S3OA 3HSBA 2OAWA 5GMKi 2OX7A 4BE1A 5GAMh 2EGCA 3CMAQ 1YJWT 1JXOA 2A7YA 2HKQB 5GAMd 2LDMA 4AFSC 1M3AA 1FXXA 4X1VA 3QYGB 4PLIA 2DMOA 1DJ7B 4M75E 4DQ2A 2ZPHB 5IHNA 1WXTA 3JCMf 4AFUC 3BDLA 2ENMA 2VUBA 2A37A 1IHVA 1WXUA 3MPUB 3CPFA 2O4XA 2Y4XA 4XTWA 2FRWA 1KQSA 1ZBXA 3M54A 3G6EQ 1U1SA 3BFMA 2ROTA 3SFMA 1WGSA 1M1KR 3EGDB 2EW3A 1I0CA 2KBTA 4M7DC 2ROLA 1Q7YC 1HJDA 1ZQ1A 3CCUA 1Q82C 3C4SA 3RMQA 2V8KA 2M0YA 4FYYB 4BDZA 2CDTA 5LJ3g 4OGEA 4PJOC 4J9CA 4EMKC 2LRQA 3J7AF 1H92A 5C0MA 1FMKA 3E19A 1PWTA 1ZHIA 4JLIA 2GQVA 4NS5A 1IXDA 2HCKA 1SHGA 4IUVA 1T0JA 1B07A 1M4ZA 2L8DA 4BE2A 3OYDA 2IIMA 2QA4A 1KG1A 4M75B 1PD1A 3OB9A 1RLQC 3VRYA 5GANf 3A1PA 3NTKA 2ZPBB 3WXMB 2IPOB 3JCMX 1KHCA 3MEWA 1YI2T 4M77C 1KD1U 4J6YA 1C1AA 2M16A 1RAFB 4CI0C 2YRCA 4RG8A 1HD3A 2WSEE 1QVGS 5KCOA 2MOXA 3ZFJA 2KE9A 3OYGA 3P8HA 1R0CB 1YCSB 2E1HA 2ESWA 2QGGA 4TVRA 3RNJA 1TWBA 4HKEA 1SHFA 4ANJA 3VS6A 4PFOA 1MMNA 1K73U 1UHCA 2LMJA 2L89A 3CEYA 4HCKA 1W4SA 4MZMA 1H3ZA 3C95A 4RTTA 3H0HA 1GFCA 3NGPA 3CBMA 1D3BA 2JM9A 2QEXQ 1OV3A 4CC3A 1YNZA 3ZEHA 1QVFP 1WHLA 2DJQA 4J5YA 3S3MA 2PTKA 3HFOA 1RACB 2O31A 4LD6A 3OS2A 1AZEA 4E7LA 4A4EA 2FL7A 2EAYA 5LJ5h 5GAN8 5A0GA 1C0MA 1JU5C 3L1AA 2E5KA 3OS0A 2I0NA 2YUOA 3MEVA 2ZPFB 5LJ5d 3GNFB 1IRXA 1ZA1B 3ZBDA 3VYGA 3O5ZA 4RTYA 1MV0B 1GCQA 2YT6A 1W2BS 1LNXA 1BIAA 3NPFA 2P84A 3CC2Q 2GNCA 3VUZA 1VQ9A 1QW1A 1D09B 1RAIB 2JTEA 4E7KA 4RTUA 4A53A 3I55Q 1QVGA 4P5NA 2HBPA 5LJ3j 5M9OA 2YUPA 2DBKA 5EG2A 1N6AA 3S6WA 4OB0B 4PKCC 3FJPA 2PQWA 1D0ZA 4BUGA 4X9DA 2J6KA 4XTVA 1VQOT 4M75F 1D1CA 2VXEA 4M7DB 3EH1A 3CCEA 1VQ6Q 5GMKe 2EPDA 1VIFA 5GAN3 1NPPA 4EMKB 4X34A 1LJOA 1G3SA 1NLPC 3RESA 4EPCA 4XU3A 3I56Q 4BI3A 1QWEA 5FLXE 4HVUA 2LQKA 3RDVA 2GFAA 1K8AU 4AFZC 4F7UE 5KH6A 4ZGEB 2X51A 2KSSA 3CD6A 3PTAA 3CC4A 2K79A 4J8OA 1QCNA 4JZ3A 4M7AA 3OYCA 1M8VA 4PLLA 1TUCA 1ZX6A 1OULA 3PT9A 3RMSA 1SF9A 2CP6A 2M51A 5D6WA 4M77B 3VUBA 2RJDA 1W2BA 1YFNA 2DYIA 1RABB 5CQXA 5DY9A 2O88A 2MK5A 4BI4A 1PC0A 5LJ3h 1YI2A 4OB3B 4PJMA 2FPDA 3RIRA 1VOMA 1M3BA 2PUOB 5CKBA 5LJ3d 5IXBA 4DOWA 3PVLA 4R56A 4OMFB 3BDUA 4J9IA 5CR2A 3META 2EBPA 3CQTA 5KYXA 4MZTA 2DTHA 2E10A 3G1JA 4JZ4A 2ZPIB 2WACA 2Y90A 2GTOA 4LDWA 3QHSA 4N0AA 4FL6A 2EYWA 3HL8A 1P92A 5GAMg 2Y4YA 2FZGB 4J9FA 2DYBA 3X26B 4RG2A 2LJ3A 5KYUA 2KR3A 3OY9A 3QKJA 1E6HA 2BKDN 2KQWA 3A8GB 3X25B 2P0KA 1AWWA 3G6ET 3JB9I 1B34B 2DZ9A 2X3WD 1UGPB 1TOVA 2QYZA 3AHUA 1M90U 4XU1A 1VQ5Q 4C5HA 2OJ2A 3OQ5A 3PNWC 1VQMQ 2RQRA 4OMNA 5GAMe 4KUIA 3M0PA 2JXBA 1VQ4T 5CKHA 3JCMc 1ZSGA 3QZ9B 4PNOA 3OW2A 1R0BG 3MP8A 4M7DF 5GAN6 3QWYA 1ABQA 1BK2A 4C0DC 4PJOG 3CMET 1JB0E 1M2OA 2JN0A 1MHNA 4JPBW 4R55A 3EAEA 3L2WA 3OBWA 1YWOA 3FB9A 1VQ7T 1QLYA 2VVKA 2XKOC 4PJOD 2ED0A 3CCJQ 3X20B 4J6WA 2GBQA 1WX6A 2DBMA 2LJ0A 4C0GA 1GCQC 2DF6A 2K4YA 3LX7A 2CP5A 3EFRA 2NYSA 5FRMA 2EWNA 2FZCB 4B9WA 3LWIA 5D6XA 1JJ2P 4KGXB 3H41A 4O6JA 2ZZDA 2CZ0B 1OZ3A 2M02A 2KGTA 4M77G 2COYA 2K5FA 2PVDB 1MNDA 1YBYA 3A98A 4M77F 4QVCA 1VQNT 3SB2A 3HRTA 1VQOA 2DERA 2KEAA 4N4IA 2OTLQ 3VS2A 1VYTA 3OMGA 3OS1A 3FLGA 2LT1A 4JRKA 1WPYA 4M77D 2RF0A 2FZKB 3M0TA 3FJ5A 2RPNA 3TSZA 1Y57A 2L3QA 4GLKA 1KC8U 1SKUB 3X28B 5CVIA 1SPKA 3VS1A 3CCSQ 1YIJQ 1K9MR 4DBQA 3VS4A 3CBOA 4JS5A 2DL7A 3UT1A 4DA4A 1WHMA 1WLPB 3EGXA 2CSIA 1OEBA 2O9VA 4N4GA 3NTIA 3LW5E 5FWCA 2B86A 3M0QA 3G71Q 1YJNQ 4BY6C 2EQUA 2HQXA 3N5BB 4KH1B 1Q86C 1WQ7A 1Y96A 2YLCA 1YITQ 2RH2A 4DBRA 3JB9J 2CZ6B 4FYVB 3QZ5B 1Y07A 4L5GA 1NJIU 3ASKA 2FYKA 1EIFA 2GGRA 5FU6B 3VRZA 4M7AC 5GAMj 3OMCA 3EFOA 3QBYA 1Z9ZA 2IG0A 2LCCA 3C0CA 1K0SA 5GAN2 2YXYA 1Q81C 3PGGA 1WHGA 3NHNA 1N5ZA 2VKNA 5LJ5g 2CP7A 3UWNA 4LNPA 1LVKA 1RL2A 2NUPB 2R58A 1I1JA 1K4US 4KBMB 1WDXA 1UGRB 2OTJQ 3JCMh 2CUBA 1N8RU 5GAOp 1RAGB 3INZA 3I55T 2JW4A 2GCXA 2DJZA 1I8FA 3JCMd 1VQPQ 3PIPA 5AYFA 1LOJA 5LJ5e 1TG0A 3HRUA 4EDUA 2KRNA 1VQLT 3GP8A 3M59A 1WZOA 3CXCP 4OP0A 4J83A 1VIEA 1XJWB 2B8AA 4C8QA 3LYIA 3R6OA 5KCHA 2AKLA 5IT9E 2L0AA 3VS3A 1VQ6T 4N0AC 4KGZB 4XTUA 4HT9A 3KBGA 3G6EA 3PIOA 3PVQA 2RHXA 3OYFA 3V8LA 3M0UA 2XD0A 3DKMA 2RQWA 5LL6S 4II1A 1UGSB 1OPLA 2I2LA 3TQ7P 1VQ4A 2X4XA 3OYIA 1S72Q 2NUTA 4M78A 1VQ8Q 3VJPA 2HSEB 1Q7YR 1Q82R 1TTHB 5KYWA 4PJJA 3CMEA 4OMOA 4ORZA 3REBB 1Q95G 1H8KA 2KMTA 1WI7A 2D9TA 2LQ8A 4FM4B 1ZLMA 1ZA2B 1BI1A 3MJXA 3CCMT 1VQ7A 3RERA 4BE0A 3J81E 2JVVA 4RTZA 2EYYA 4LN2A 5KE3A 2JTFA 3CCET 1W6XA 3V7SA 2RQVA 5CCAA 2MWPA 4C92A 3OYYA 3JSCA 4CC4B 1JRIA 1K73R 2MIOA 4GY5A 3OYKA 1U1TA 2RHUA 3UATA 1RUWA 1VQNA 1K1ZA 5I11A 1UFFA 4JDSA 2CP3A 1X01A 1KJWA 3CD6T 2DVJA 3MO8A 3CC4T 2XIDA 2DL8A 2GTJA 2ECZA 1XOVA 3JB9G 4DBHA 3JB9F 2VYTA 2K2MA 2C0OA 1VYVA 4BD3A 2LNVA 5LJ3e 2KROA 5LJ5j 3JB9D 2CUDA 3H0IA 2H8HA 5HK3A 1K9AA 1K73C 1OI1A 1MNEA 4FIBA 5GAOr 2BE9B 2RK2A 4O5VA 4M7AB 1V76A 3PE0A 2F69A 5CKFA 1SSFA 2JTMA 2CZ7B 1VQ5T 1BI0A 1M1FA 2EQKA 1UB4A 1VQMT 3EG9A 3IQLA 2OI3A 2P4TA 4OGCA 1VUBA 2RD1A 3CCUQ 1RI0A 2R5MA 2VGNA 5L8RE 2W0ZA 3M53A 1R77A 1I5LA 1JEGA 4E47A 4RTXA 2CP0A 3S3NA 4PJLA 4RUGA 3QDFA 3CC7T 1IGUA 1QQJA 2RJCA 3CC2A 1PKSA 5J3BA 1M1KU 5ECAA 1D1AA 2G3RA 2QAZA 4Q5WA 4RMOA 1E7OA 2CSQA 3QJYA 1YJ9Q 2AZSA 3I55A 5KYYA 3M0SA 3DB4A 4JLGA 1IGQA 2XI9A 4V2SA 1VYUA 4A4GA 1QP3A 5J39A 2QA4Q 2EJFA 1JXMA 2LVMA 1KSWA 1M2VA 2QK0A 2DL5A 3CBPA 2BTTA 1VQLA 3EFSA 4M7DE 1BU1A 2F2WA 2DD5A 2R5AA 1WHHA 2RMOA 2DEUA 2BZ8A 2L3SA 1AD5A 5KYUB 1WNLA 1AHJB 2ED1A 1VQ6A 1X6OA 4PJOE 2XG8D 1G5VA 6AT1B 2KDSA 4LDUA 5GAOn 1ZSZA 3VS5A 2A3LA 2LX7A 2SRCA 2QQRA 2KY9A 4WF2A 4C8QC 2DLPA 2DM1A 3ZL7C 3CCST 5IAYA 1TUDA 1OX8A 3I56A 3MKDA 1QCOA 2DETA 2LT4A 3BE3A 1JJ2S 1NPRA 3JCMQ 3VYHB 1YJNT 1RAAB 1UJ0A 3RKXA 2YDLA 5I2SA 1JO8A 4M77E 2J7IA 2JT4A 2EYZA 3CCMA 4OB2B 1M5Q1 8AT1B 1K8AC 4M78C 4C0ZA 5A2QE 3SEMA 2JMAA 1YHQQ 1PSFA 1KIKA 4OMMA 3EGDA 2P0QA 2DFUA 2RHIA 3CCVQ 3CCLT 2E12A 3RKWA 4DOVA 4J9DA 4HCBA 4PJOB 2EGAA 4LUEA 3TVTA 2O01E 2O2OA 3FIFA 2OAUA 4RTWA 3EGUA 2E4HA 3QPHA 2V8IA 5CO7A 4M7AG 4ZTFA 9ATCB 4M7AF 2QASA 8ATCB 5GAN5 2HD0A 3OS5A 1I81A 3KUFA 4C92C 4N4HA 1BIBA 2RHYA 4M7AD 4E7SA 1CKBA 2MWOA 3GBQA 1N9SA 2LQNA 4M75A 5KE2A 1VQPT 2JJ9A 1VQ9Q 3LLRA 1QCFA 4F04B 1ACMB 3OW2S 1O9SA 3JCMg 4Z89A 1YJWQ 4C5GA 4J9EA 1I4K1 2RQUA 1M90R 5FU7C 1GFDA 2QQBA 5IH2A 2D0NA 3SWNA 4A4KA 1JJ2A 1CSKA 3OSVA 3L2VA 4CC2A 5GAN4 2HEQA 2DIGA 1N9RA 1U5SA 5D6YA 1B3QA 1D0YA 2NWMA 1VQ5A 3JCMe 1VQMA 4FYXB 1GBQA 2EJ9A 4IUTA 1GBRA 2EGEA 1UTIA 1Y0MA 3CMAT 5GJVB 1AWJA 5I2MA 1M8MA 3G4SQ 4Y28E 1M90C 2NUZA 1MUZA 2MI6A 2C06A 3CC7A 2RI5A 3ULRB 1VA7A 4EMHA 4JJNK 2YRDA 2JOYA 1QVGP 3OYJA 4XTYA 2F5KA 2D1XA 2K7AA 3A8OB 5GANg 3TU4K 2C0TA 3CCJA 1OU8A 2X4JA 2RO0A 3U23A 2LCLA 2O9SA 3HTRA 2AT1B 2M1HA 2CT3A 2DD4A 4QQGA 1UUEA 3CCRQ 2YRVA 1D0XA 1GRIA 3NTHA 2EKHA 1UEBA 1PCXA 1XNIA 1U06A 1YI2Q 2P0PA 2E64A 2JNGA 2LNHB 3TREA 3V8JA 4MZPA 2VWFA 4C8QB 2X4WA 2X3XD 3UA7A 4ESRA 3CPWP 2H3JA 1A0NB 2JS2A 1AEYA 4PJOF 1OX9A 2CREA 2KAFA 2AZVA 4ME7A 3H8ZA 1AVZC 4ELYC 3RR6A 2V1RA 3FC3A 3M57A 3CCSA 3SDZA 4C5EA 4L59A 2YUQA 2DPPB 1NEGA 2PZ1A 1SRMA 2BUDA 2D0QB 2EYQA 5CAIA 2RHZA 2DAQA 4ZGJB 1V29B 2NUTB 3I35A 2X9HA 1KC8C 4M78B 1ZUYA 2ZPGB 5AT1B 3AT1B 4J9BA 4LE9A 4CRIA 1G3YA 1YJNA 4AMCA 3UDCA 3REAB 1RAHB 3V8KA 4M7DA 3V7CA 1W2BP 2X35A 2E41A 3F70A 4E7IA 1YITA 2RM4A 1N27A 4IUQA 4XU0A 2EYXA 1X6BA 4HVVA 2F5TX 1Q86R 1AZGB 4IURA 3MEAA 3OYEA 4DEXA 4Z02A 1Z9QA 2O4XB 2DVEA 2JZ2A 3CCLA 1NBEB 4GLMA 5GAN7 3RKYA 4NL2A 4C92B 3VS7A 2FO0A 3DB3A 3H6ZA 1PSEA 1S1NA 3RUXA 4Y91A 1NJIC 4NOYA 2PU9B 4ZNXA 1Q81R 3LWHA 4HCZA 4ZTJA 4R0KA 2QEXT 3JRZA 4BDYA 2RI3A 1WQWA 5GMKm 2M0OA 1WYXA 1BI2A 1YJ9T 2H3EB 3OYNA 4QQDA 1PHTA 5FU7B 4OMLA 4JJCA 1VQPA 4XTXA 3URGA 4K11A 4F14A 2PVOB 1EFNA 1WFWA 1M9SA 2DILA 1N8RC 4Z8AA 4M75C 2MAMA 5L23A 3FEOA 3E9FA 4PFZA 4JJDA 3VKIA 5GANj 3OBYA 1F1BB 4JUVA 4E7HA 1HSQA 4KULA 1BI3A 1PKTA 4J9GA 4XU2A 1UG1A 2G6FX 1QVFS 1QP2A 2FEIA 1FMWA 2MYSA 3CC2T 4F7UA 4A4HA 2QQ9A 3GLXA 2CH4W 4RCBA 1S72A 2DRMA 2VXFA 3EG9B 3QUIA 4C8QG 4ATOA 4OF1A 3SWNC 2KXDA 4UC4A 3CMAA 4C8QF 2PVGB 3MP1A 4KH0B 2NLUA 2ZGWA 2JMCA 2LZ6B 2DA9A 2KXCA 3QG1A 3E1SA 4FCYA 2KRSA 4C8QD 4XK8E 1BCMA 1TU0B 2DTOA 4ZGDB 1H3HA 1K76A 1D3BB 1YHQT 1SRLA 2DO3A 1WXBA 3H9NA 1K9MU 2F1LA 3SHWA 4IIOA 4M78G 1ZUKA 1B7TA 4M78F 1QWFA 2E3IA 4MMKA 2DNUA 3FRNA 3L2ZA 4L6V5 1UHFA 4C0DB 2K6DA 4M78D 4B9XA 3VV0A 4EIKA 1WJRA 3V7RA 1AWXA 3I56T 2DZCA 3M9QA 4QT7A 4X9CA 2DL4A 3A8HB 4QVZA 1TSFA 2DE0X 5CK9A 2QTVA 5GANh 4C92G 3MEUA 2AHJB 3T9NA 4C92F 3CCQQ 5GANd 4E6RA 4KRTA 4ELZC 1KD1R 1YP5A 3OYHA 1SSHA 2HMAA 3QDRB 4RCCA 1BYMA 1YN8A 4C92D 2JS0A 2BZYA 1EZZB 2WSFE 4FW1A 1QVFA 1NYFA 3OYAA 4IKFA 3G7ZA 1M27C 3A5ZB 5I21A 1SEMA 2CS7A 3L42A 2L3RA 3EG0A 4M7AE 2JM8A 2JUFA 4KUDK 3LGFA 4OB1B 3LGLA 2LTOA 3J80E 2HZYA 2ZCFB 5D7UA 3OYBA 2E3HA 1XQHA 1OZ2A 1ZUUA 4QKUA 1VQKQ 2FG0A 1AOJA 1KD1C 2L3PA 1WJSA 1OQKA 4WCIA 4M4ZA 1G3WA 3L2UA 5IXFA 2K3YA 3G4ST 4B6MA 4HXJA 2VC8A 1VQ4Q 3OA6A 3M58A 2RNAA 2Z0WA 2RQTA 4BB7A 4BY6B 4DBFA 2DKGA 4GBQA 4OMPA 1H641 3OYLA 2RJFA 2FPFA 3HKSA 2QDLA 2QEXA 1I07A 1YWPA 3CMEQ 1NLOC 2KVQG 1MGQA 1YCYA 3PMIA 3R6NA 1X2QA 1YJ9A 4J6XA 2MCNA 1VQ7Q 2XU8A 5GAOm 2WSCE 5GAMf 2D8HA 2FHDA 3CCRT 1Q7YU 1M1KC 2CZ1B 2F2VA 1Q82U 1IO6A 1NM7A 2EQIA 2KYBA 4RTVA 4WTOB 2GFUA 1UE9A 1U8RA 3EHRA 3QJ6A 1WHJA 1PD0A 4AG2C 1MV3A 2NUPA 2HNIA 4LDVA 1VQNQ 3SWNB 1T3SA 3TSWA 2A28A 2DXCA 5KYXB 4MMLA 4XQ3A 1I5OB 1UGQB
chains in the Genus database with same CATH topology
3JCMg 3QSUA 4O6JA 3CCJT 2ZZDA 2CZ0B 4C5GA 1FX7A 1OZ3A 1I4K1 4M77G 1QVPA 4MDXA 2K5FA 2PVDB 4VUBA 1YBYA 4M77F 5FU7C 4QVCA 3DLLA 4HCCA 1VQNT 3SD4A 3SB2A 1G5VA 2QQBA 3HRTA 1VQOA 1BKBA 2XDBA 2X4YA 4J7FA 4IUUA 4JS4A 4N4IA 1VQ9T 2DTIA 1IZ6A 1HXDA 3S3OA 3HSBA 3PMTA 3X24B 3OMGA 5GMKi 3HHTB 3OS1A 3ER0A 4BE1A 3FLGA 5GAMh 2LT1A 4JRKA 1WPYA 4M77D 3SWNA 4A4KA 1JJ2A 3OSVA 3L2VA 3Q1JA 5GAN4 1YJWT 2DIGA 3JB9H 1N9RA 2A7YA 1KC8U 4GLKA 4LDYA 3WVEB 3UPUA 5GAMd 5D6YA 2LDMA 3BY7A 3CPWS 3TCJA 1VQ5A 3X28B 3JCMe 5CVIA 1YHQA 1VQMA 1FXXA 3QYGB 2OTLT 4PLIA 3CBOA 4JS5A 2EJ9A 4DA4A 1DJ7B 3UT1A 4IUTA 4M75E 4DQ2A 2ZPHB 3CCVA 1KHIA 3JCMf 3BDLA 2VUBA 4N4GA 3CMAT 3ME9A 2YHTA 3NTIA 5CKEA 3C94A 5I2MA 3CPFA 3LW5E 2O4XA 2Y4XA 5FROA 4XTWA 4Y28E 1M90C 4BY6C 2EQUA 1KQSA 2HQXA 3P8DA 1ZBXA 3N5BB 4FU6A 2K57A 3M54A 2MI6A 3C12A 1YIJT 1Q86C 1U1SA 3BFMA 2DK3A 3JCMb 1WQ7A 1Y96A 3SFMA 2C06A 1WGSA 2YLCA 3CC7A 5GAOl 2RI5A 2QQSA 4EMHA 3L2RA 4JJNK 1NE8A 2JOYA 3OYJA 4XTYA 5CIUA 2F5KA 2RH2A 4M7DC 3JB9J 4MDWA 2CZ6B 3A8OB 5GANg 1Q7YC 3TU4K 3CCJA 1ZQ1A 3CCUA 4NL3A 3QZ5B 3G71T 1Q82C 1Y07A 3C4SA 4L5GA 2V8KA 3RMQA 5DLOA 4BDZA 2X4JA 1NJIU 2RO0A 5LJ3g 3ASKA 4OGEA 4A4FA 2FYKA 4PJOC 1EIFA 5FU6B 2LCLA 4M7AC 4EMKC 5GAMj 2M1HA 3OMCA 2LRQA 3QBYA 2DD4A 2IG0A 2LCCA 1YITT 3J7AF 4QQGA 5GAN2 4HA8A 1Q81C 3PGGA 2YRVA 5C0MA 3E19A 3NTHA 1KQ2A 1UEBA 5LJ5g 1XNIA 2BIVA 1ZHIA 4JLIA 2GQVA 4KT0E 4NS5A 3UWNA 1YJWA 4IUVA 4IUPA 2P0PA 1M4ZA 1RL2A 2E64A 2JNGA 2L8DA 3JCMW 4BE2A 3TREA 3OYDA 2R58A 3V8JA 4MZPA 2R57A 2QA4A 4C8QB 2X4WA 4FT4A 1KG1A 4KBMB 1UGRB 4M75B 4RKUE 2K5LA 3JCMh 4EMGA 1N8RU 5GAOp 3OB9A 2H3JA 3INZA 5DLQE 3NTKA 5GANf 5GAOm 3I55T 2ZPBB 4PJOF 3WXMB 3JCMX 4M75G 1KHCA 2GCXA 2KAFA 2DJZA 2K2VA 3MEWA 1YI2T 1I8FA 3JCMd 2MF2A 3H8ZA 4ME7A 4ELYC 3PIPA 2CGHA 4M77C 3FC3A 1KD1U 4J6YA 3M57A 5AYFA 1LOJA 2M16A 5LJ5e 1O75A 2QTXA 3CCSA 3QYHB 3HRUA 3GF5A 3SDZA 4C5EA 4EDUA 3E9GA 4CI0C 2OTJT 1VQLT 4M75D 2K5IA 4L59A 4RG8A 2DPPB 2DXUA 3GP8A 3M59A 5LJ5f 2BUDA 3CPWA 2D0QB 2WSEE 2YLBA 2EYQA 3OYMA 4OP0A 4J83A 5CAIA 2RHZA 1VIEA 2B8AA 2DAQA 4C8QA 3LYIA 4ZGJB 5KCOA 3ZFJA 1V29B 3KXTA 3R6OA 1KC8C 5KCHA 4M78B 5IT9E 2ZPGB 3OYGA 3P8HA 1OYXA 3G4SA 3O8VA 4CRIA 1G3YA 3JCMP 1VQ6T 1YJNA 4N0AC 5A0LA 4ZN3A 4XTUA 3UDCA 2E1HA 4HT9A 3KBGA 5HY6A 3G6EA 4TVRA 3V8KA 4M7DA 4HKEA 3PIOA 3FDRA 3V7CA 2X35A 2V8JA 2RHXA 3QXEB 2E41A 3F70A 3MP6A 3M56A 2RM4A 3JCMV 4E7IA 1YITA 1N27A 4IUQA 3OYFA 1K73U 4XU0A 3V8LA 2XD0A 2RA2A 3CEYA 2L89A 1W4SA 4XAXB 2F5TX 4MZMA 3DKMA 3C95A 4C0FA 4IURA 1H3ZA 5LL6S 3MEAA 4II1A 1UGSB 3OYEA 2I2LA 4Z02A 2O4XB 3HFNA 2DVEA 1VQ4A 2X4XA 2JZ2A 3OYIA 3CBMA 3CCLA 1D3BA 2VV5A 3HP9A 2L5QA 4M78A 1M1GA 3VJPA 5GAN7 3RKYA 4NL2A 4C92B 2XICA 3ZEHA 3CCRA 1Y96B 4J5YA 3DB3A 4BACA 3S3MA 3H6ZA 3CMEA 3M4GA 2RI2A 2GF7A 3HFOA 2KMTA 2D9TA 4QW2A 2IVWA 2LQ8A 1PSEA 1IREB 3M55A 4FM4B 4LD6A 3RUXA 4Y91A 5CKDA 1BI1A 3OS2A 4NOYA 1NJIC 4C8QE 2PU9B 3A8LB 3LWHA 4HCZA 3CCMT 1R8OB 2E70A 4ZTJA 1S72T 2QI2A 1VQ7A 3RERA 2QEXT 4E7LA 1VQ8T 3JRZA 4A4EA 3J81E 4BDYA 4BE0A 2FL7A 2JVVA 2RI3A 4QQ6A 1WQWA 2EAYA 5GMKm 2M0OA 5LJ5h 5KE3A 2JTFA 3MCAB 3CCET 1BI2A 1YJ9T 5GAN8 3OYNA 5FU6C 3V7SA 5A0GA 3L1AA 4QQDA 3CXCS 5CCAA 2MWPA 4C92A 3CCQT 1X75C 5FU7B 3OS0A 4D6WA 3MEVA 5LJ5d 2ZPFB 3OYYA 1VQPA 2DXBA 3GNFB 3JSCA 4XTXA 3URGA 3ZBDA 2PVOB 3VYGA 1XTDA 1M9SA 4ZN1A 1JRIA 4F7UB 3VU3C 1N8RC 1W2BS 1LNXA 1BIAA 4GY5A 4M78E 3OYKA 1QVGS 1U1TA 2EJGA 2RHUA 2FVUA 1VQNA 3VUZA 2EQJA 4M75C 2MAMA 1VQ9A 3FEOA 4JDSA 3E9FA 4E7KA 1X01A 3VKIA 5GANj 3M4YA 4A53A 1QVGA 3CD6T 2HQEA 3MHXA 3MO8A 4P5NA 3CC4T 2HAXA 2HBPA 2LC4A 2XIDA 3OBYA 1KQSS 4JUVA 4E7HA 4KULA 5LJ3j 1BI3A 1XOVA 4XU2A 4JRPA 1QVFS 1QP2A 3JB9G 2LX9A 5M9OA 5EG2A 3CC2T 2VYTA 3JB9F 4F7UA 4A4HA 5GANe 1N6AA 2XDPA 2QQ9A 4OVAA 3GLXA 3S6WA 4OB0B 4XTZA 4PKCC 1VQKT 2D6FA 2OTLA 3FJPA 4BD3A 5GMKj 4C92E 2PUKB 2LNVA 1WJQA 2PQWA 2RB6A 4RCBA 4BUGA 4QVDA 3DLMA 5A0DA 5LJ3e 5LJ5j 4X9DA 2ZPEB 2VXFA 1S72A 4XTVA 3QUIA 4C8QG 4ATOA 4OF1A 3SWNC 3JB9D 4JRIA 4UC4A 3CMAA 4C8QF 1Y7XA 2DXTA 1VQOT 4M75F 5HK3A 2PVGB 2VXEA 3MP1A 5LJ3f 1K73C 4M7DB 1OI1A 3CCEA 1G3TA 2NLUA 2ZGWA 5GMKe 2XK0A 1Y71A 4M7DG 1VIFA 4FIBA 5GAN3 5GAOr 5HKCA 3QG1A 3E1SA 1YIJA 2RK2A 3NFCA 1NPPA 4C8QD 4XK8E 2E65A 2VGMA 4O5VA 2XDDA 4M7AB 4EMKB 4X34A 2F69A 5CKFA 2DTOA 3QIIA 4ZGDB 1LJOA 1SSFA 2JTMA 2CZ7B 1G3SA 1BI0A 1D3BB 1M1FA 1VQ5T 1YHQT 5IN1A 2EQKA 5CQYA 1UB4A 2DO3A 1VQMT 4M7DD 3G71A 4JRQA 3RESA 4EPCA 1K9MU 4LD9K 4XU3A 4BI3A 5FLXE 4M78G 3HRSA 4OGCA 2P4TA 2LQKA 4M78F 2GFAA 1K8AU 4A54A 1VUBA 4F7UE 2RD1A 4J7IA 5KH6A 4ZGEB 1RI0A 2R5MA 2VGNA 3GIBA 4C5IA 5L8RE 2KSSA 3JAME 3M53A 1I5LA 3CD6A 3CXCA 4E47A 4MMKA 2DEQA 3PTAA 3CC4A 4LDXA 2CYZB 4J8OA 4PJOA 3FRNA 3L2ZA 4L6V5 4C0DB 1M8VA 4M78D 4EMKA 3OYCA 4B9XA 4PLLA 3VV0A 3S3NA 1WJRA 4M7AA 3V7RA 3CC7T 3PT9A 3RMSA 3I56T 2DZCA 3M9QA 2RJCA 5J26A 4X9CA 3CC2A 3A8HB 5J3BA 1M1KU 5D6WA 4QVZA 2G3RA 2EIFA 4M77B 4Q5WA 3VUBA 1TH7A 5CK9A 2RJDA 4RMOA 1W2BA 3QJYA 5CQXA 5GANh 3CCUT 5DY9A 3I55A 4C92G 3DB4A 4E7JA 4BI8B 4BI4A 4JLGA 3MEUA 2AHJB 2XI9A 3T9NA 5LJ3h 4A4GA 4C92F 4V2SA 1YI2A 4OB3B 5GANd 1QP3A 4ELZC 5J39A 3RIRA 2EJFA 3OYHA 2PUOB 2LVMA 5CKBA 5LJ3d 4DOWA 3QDRB 4RCCA 3A8MB 4R56A 3CBPA 5GMKh 1BYMA 4FSXA 4C92D 4OMFB 2OTJA 1VQLA 2WSFE 3BW1A 3EFSA 3BDUA 1QVFA 3OYAA 4M7DE 5CR2A 4IKFA 3META 3G7ZA 2DD5A 2R5AA 3GPLA 4M77A 3A5ZB 4MZTA 5I21A 2CS7A 3L42A 2L3RA 3QO3A 2DTHA 4YTLA 2E10A 1WNLA 1AHJB 2MMPA 3CCQA 1X6OA 3HPWA 2XG8D 5DM7R 2RK1A 1VQ6A 4PJOE 4M7AE 2JUFA 4KUDK 3LGFA 2KDSA 4LDUA 4OB1B 2EFIA 2ZPIB 3LGLA 2LTOA 5GAOn 3J80E 1VQKA 3P8BB 2WACA 2A3LA 2Y90A 2ZCFB 3OYBA 4LDWA 3QHSA 1XQHA 2QQRA 4N0AA 4F7UG 1OZ2A 2KY9A 2M9UA 2XHCA 3PFSA 4F7UF 4WF2A 4C8QC 2DIQA 4FL6A 2QQAA 2QDYB 3CCST 3HL8A 5IAYA 3LH0A 1P92A 3M5AA 3GOXA 1WJSA 1KD1C 5GAMg 2Y4YA 3I56A 3X26B 4RG2A 2LT4A 4FT2A 1JJ2S 1NPRA 1G3WA 2FB7A 3GNGA 3L2UA 3OY9A 2K3YA 3QKJA 3G4ST 3JCMQ 3VYHB 1YJNT 2BKDN 2KQWA 2VC8A 3A8GB 3X25B 3OA6A 3M58A 2P0KA 4BB7A 3RKXA 4BY6B 5I2SA 3G6ET 3JB9I 1B34B 2DZ9A 2DKGA 4M77E 1K9MC 1H641 2CKKA 1UGPB 3OYLA 3CCMA 2RJFA 4OB2B 3HKSA 2E6ZA 1M5Q1 2QEXA 3AHUA 1VQ8A 1K8AC 1JBMA 4M78C 4C0ZA 2KVQG 1MGQA 4XU1A 5A2QE 1YCYA 1M90U 4C5HA 1FWZA 3OQ5A 1PSFA 3PNWC 3PMIA 1Q86U 5GAMe 1YJ9A 5HK0A 4KUIA 4J6XA 2P0QA 2RHIA 2EKOA 1VQ4T 5CKHA 3JCMc 3CCLT 3TEEA 2XU8A 3QZ9B 2E12A 2K3XA 4PL6A 4PNOA 3RKWA 2WSCE 3MP8A 4DOVA 5GAN6 3OW2A 4HCBA 5GAMf 4M7DF 4PJOB 5GAOq 2O01E 3FIFA 2FHDA 3CCRT 2OAUA 1Q7YU 1M1KC 2CZ1B 4C0DC 4PJOG 1Q82U 3JCMJ 3CMET 3QPHA 1B34A 2V8IA 5CO7A 1JB0E 2JN0A 4M7AG 4ZTFA 1MHNA 2E5QA 4M7AF 4R55A 3EAEA 1GXIE 3L2WA 2GFUA 3OBWA 3WVDB 1U8RA 5GAN5 3FB9A 4HT8A 1HK9A 2HD0A 3OS5A 1I81A 3KUFA 3L2QA 3CCVT 1VQ7T 4C92C 1Q81U 4N4HA 2RJEA 1BIBA 2XKOC 4PJOD 3QJ6A 2QA4T 2RHYA 4M7AD 3X20B 4J6WA 2E6NA 2HNIA 2MWOA 5C6SA 4LDVA 4C0GA 5GMKl 2KK4A 1N9SA 2K4YA 3LX7A 4M75A 3SWNB 3OSSC 5KE2A 1VQPT 2QXFA 3EFRA 5FRMA 1KQ1A 2EWNA 2DXCA 2EQMA 3LLRA 5FRNA 4B9WA 3LWIA 1NZ9A 4MMLA 4XQ3A 5D6XA 3OW2S 1QW1A 1O9SA 1UGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X01 A;  3JCM g;  3QSU A;  5GAN j;  4A53 A;  3QO3 A;  2CGH A;  2DTH A;  4M77 C;  1I4K 1;  4J6Y A;  4M77 G;  2E10 A;  1LOJ A;  1WNL A;  4JUV A;  5LJ5 e;  4PJO E;  4QVC A;  2QTX A;  4M77 F;  5LJ3 j;  4M7A E;  4XU2 A;  3SB2 A;  3JB9 G;  4M75 D;  5GAO n;  3JB9 F;  2DXU A;  2DTI A;  4F7U A;  5LJ5 f;  1HXD A;  5GAN e;  3HSB A;  2YLB A;  2Y90 A;  4OP0 A;  4XTZ A;  5CAI A;  4C8Q A;  3QHS A;  5GMK i;  3FJP A;  4N0A A;  5GMK j;  4F7U G;  4JRK A;  1WPY A;  2RB6 A;  4M77 D;  4M78 B;  4RCB A;  3SWN A;  4C92 E;  4QVD A;  5LJ3 e;  4F7U F;  5LJ5 j;  3JCM P;  4WF2 A;  4X9D A;  2VXF A;  4C8Q C;  4XTV A;  3QUI A;  4N0A C;  4C8Q G;  5GAN 4;  3SWN C;  1N9R A;  3JCM d;  3JB9 D;  4JRI A;  4XTU A;  2E1H A;  4C8Q F;  3JB9 H;  2DXT A;  4M75 F;  5GAM d;  4HT9 A;  3BY7 A;  2VXE A;  5GAM g;  5LJ3 f;  3V8K A;  4M7D A;  4M7D B;  3V7C A;  3JCM e;  2E41 A;  2ZGW A;  3JCM V;  5GMK e;  2RM4 A;  4M7D G;  4XU0 A;  3V8L A;  5GAN 3;  2RA2 A;  2FB7 A;  5GAO r;  2EJ9 A;  4M75 E;  4DQ2 A;  4C8Q D;  2E65 A;  3JCM f;  3JCM Q;  4M7A B;  4EMK B;  2VC8 A;  2I2L A;  2YHT A;  2DTO A;  1LJO A;  3RKX A;  3HFN A;  2DVE A;  1B34 B;  2DZ9 A;  2DKG A;  4M77 E;  4XTW A;  3JB9 I;  1D3B B;  1H64 1;  1D3B A;  4M78 A;  4M7D D;  5GAN 7;  3RKY A;  4NL2 A;  1M5Q 1;  3RES A;  2K57 A;  3AHU A;  4C92 B;  1U1S A;  3BFM A;  1JBM A;  4M78 C;  4XU3 A;  1MGQ A;  4XU1 A;  4M78 G;  1WQ7 A;  1Y96 B;  1Y96 A;  1YCY A;  4J5Y A;  2YLC A;  4M78 F;  5GAO l;  3M4G A;  4EMH A;  3HFO A;  5GAM e;  4J6X A;  4A54 A;  4F7U E;  2RD1 A;  4XTY A;  3RUX A;  4Y91 A;  4M7D C;  3JB9 J;  3GIB A;  3JCM c;  4NOY A;  5GAN g;  5GAO m;  4C8Q E;  1I5L A;  3RKW A;  4PNO A;  4M7D F;  4MMK A;  2DEQ A;  5GAN 6;  4NL3 A;  5GAM f;  4PJO B;  4PJO A;  3L2Z A;  3RER A;  5GAO q;  1M8V A;  4M78 D;  3FIF A;  4EMK A;  4M7A A;  5LJ3 g;  3V7R A;  2FYK A;  4PJO C;  1WQW A;  2EAY A;  4PJO G;  3JCM J;  5GMK m;  4M7A C;  4EMK C;  5LJ5 h;  1B34 A;  2DZC A;  5GAM j;  2JN0 A;  4M7A G;  4X9C A;  5GAN 8;  4M7A F;  3V7S A;  3L1A A;  4M77 B;  4HA8 A;  5GAN 2;  1TH7 A;  3PGG A;  4C92 A;  5GAN 5;  1KQ2 A;  5LJ5 d;  3FB9 A;  5GAN h;  4HT8 A;  1HK9 A;  5LJ5 g;  1I81 A;  5DY9 A;  4C92 C;  4JLI A;  4XTX A;  4C92 G;  1BIB A;  4PJO D;  4C92 F;  5LJ3 h;  4V2S A;  1JRI A;  4M7A D;  4J6W A;  5GAN d;  2E64 A;  3RIR A;  3JCM W;  4F7U B;  2EJF A;  3VU3 C;  2HNI A;  5GMK l;  1LNX A;  1BIA A;  4M78 E;  3V8J A;  1U1T A;  2EJG A;  5LJ3 d;  4C8Q B;  1N9S A;  4M75 B;  4M75 A;  3SWN B;  4RCC A;  3JCM h;  4EMG A;  3EFR A;  5GMK h;  5GAO p;  4C92 D;  3INZ A;  5GAN f;  1KQ1 A;  3BW1 A;  2EWN A;  3EFS A;  3BDU A;  4M75 C;  4PJO F;  3JCM b;  3JCM X;  4M75 G;  4M7D E;  2DJZ A;  4MML A;  4XQ3 A;  5GAM h;  1I8F A;  4M77 A;  5I21 A; 
#chains in the Genus database with same CATH topology
 1X69 A;  4PJN A;  3QSU A;  3CCJ T;  1PG5 B;  1KK7 A;  4KGV B;  4LUD A;  1MMD A;  3DLL A;  4HCC A;  4F16 A;  1X27 A;  3EHQ A;  2J6F A;  1BKB A;  1W1F A;  2XDB A;  4IUU A;  4JS4 A;  2DTI A;  1RI9 A;  1HXD A;  3PMT A;  1PRL C;  4OMQ A;  3X24 B;  3M0R A;  3HHT B;  3ER0 A;  4PK4 A;  2CT4 A;  1TXQ A;  3VS0 A;  1CKA A;  3Q1J A;  3JB9 H;  4LDY A;  3WVE B;  3UPU A;  2KRM A;  2HL5 C;  3BY7 A;  3CPW S;  1KQS P;  3TCJ A;  2LQW A;  2HDA A;  1YHQ A;  4LXC A;  1QKW A;  2OTL T;  4Z88 A;  2K9G A;  3CCV A;  2VB6 A;  1KHI A;  1K8A R;  3ME9 A;  2YHT A;  5CKE A;  3C94 A;  1J3T A;  1KFZ A;  5FRO A;  1C6V X;  1PNJ A;  3P8D A;  4FU6 A;  2K57 A;  1YIJ T;  3C12 A;  2DK3 A;  3JCM b;  5GAO l;  2QQS A;  3L2R A;  1NE8 A;  1X43 A;  5CIU A;  4MDW A;  3KFV A;  4NL3 A;  3G71 T;  5DLO A;  1M3C A;  4A4F A;  1NEB A;  1YIT T;  1WIE A;  4HA8 A;  5I22 A;  1KQ2 A;  2BIV A;  4KT0 E;  4A63 B;  1YJW A;  4IUP A;  2KT1 A;  5GJW B;  3JCM W;  3EG1 A;  2KYM A;  4PFP A;  1UDL A;  2R57 A;  4FT4 A;  2AK5 A;  2HL3 A;  4RKU E;  2K5L A;  4EMG A;  1VQL Q;  1ARK A;  2F2X A;  5DLQ E;  4M75 G;  4E2F B;  2K2V A;  2MF2 A;  2CGH A;  1GL5 A;  1W70 A;  1O75 A;  2QTX A;  3QYH B;  3GF5 A;  1OU9 A;  3E9G A;  4FSS A;  2OTJ T;  4M75 D;  2K5I A;  2DXU A;  2YWW A;  5IHI A;  5LJ5 f;  3CPW A;  2YLB A;  1M30 A;  3OYM A;  1NG2 A;  2VAS A;  3KXT A;  7AT1 B;  1QKX A;  1OYX A;  3G4S A;  3O8V A;  3JCM P;  1E6G A;  2KNB B;  1ABO A;  5A0L A;  4ZN3 A;  5HY6 A;  3FDR A;  2V8J A;  3QXE B;  3MP6 A;  3JCM V;  1FMV A;  3M56 A;  2RA2 A;  4CC7 A;  4XAX B;  4C0F A;  3EGX B;  3EG2 A;  3HFN A;  2KT8 A;  5EC7 A;  3CCM Q;  2VV5 A;  3HP9 A;  2L5Q A;  1M1G A;  2XIC A;  3CCR A;  2YSQ A;  1Y96 B;  3CCE Q;  3M4G A;  2RI2 A;  1ZBJ A;  3D7S B;  2GF7 A;  4QW2 A;  1UEC A;  2IVW A;  3M55 A;  1IRE B;  2HBW A;  2AKK A;  5CKD A;  4C8Q E;  3A8L B;  1RLP C;  1R8O B;  2E70 A;  1S72 T;  2QI2 A;  2LP5 A;  2ABL A;  1VQ8 T;  4J9H A;  4QQ6 A;  2COW A;  1RAE B;  4FYW B;  3MCA B;  3EFO B;  5FU6 C;  2LCS A;  3CXC S;  3CCQ T;  1X75 C;  4D6W A;  2DXB A;  1AWO A;  4ZN1 A;  1XTD A;  3CD6 Q;  3CC4 Q;  4F7U B;  3H0F A;  3VU3 C;  1G83 A;  2EVR A;  4M78 E;  2EJG A;  1FYN A;  1BB9 A;  2FVU A;  2A0F B;  2EQJ A;  1G2B A;  2DL3 A;  3M4Y A;  2HQE A;  3MHX A;  1T0H A;  2HAX A;  2LC4 A;  3E2U A;  1KC8 R;  4JRP A;  1BCO A;  2LX9 A;  2QGF B;  5GAN e;  2XDP A;  1PRM C;  4OVA A;  4XTZ A;  2D6F A;  1VQK T;  1BBZ A;  3LH5 A;  4JJB A;  2OTL A;  5GMK j;  1TS9 A;  4C92 E;  2PUK B;  2RB6 A;  1WJQ A;  3EH2 A;  4QVD A;  4BAC A;  3DLM A;  5A0D A;  2ZPE B;  2AIR B;  4JRI A;  3I9Q A;  1Y7X A;  2DXT A;  5LJ3 f;  1HYO A;  1G3T A;  2PNI A;  2XK0 A;  1Y71 A;  4M7D G;  1YIJ A;  4D8D A;  1MMG A;  5HKC A;  3NFC A;  1IB8 A;  2C0I A;  2E65 A;  2J6O A;  2VGM A;  1MMA A;  2XDD A;  1RAD B;  3QII A;  1ZSZ C;  5IN1 A;  5CQY A;  1K0X A;  1D1B A;  1NJI R;  4M7D D;  3G71 A;  4JRQ A;  4LD9 K;  3CC7 Q;  1LCK A;  4FW2 A;  3HRS A;  3QWX X;  5KYW B;  4A54 A;  1EX4 A;  4J7I A;  2HQH A;  3GIB A;  4C5I A;  3JAM E;  2D8J A;  4F17 A;  3CXC A;  4LDX A;  2DEQ A;  2CYZ B;  4PJO A;  1G8X A;  4EMK A;  5IHK A;  1OPK A;  5J26 A;  3EG3 A;  2CH4 A;  2EIF A;  1TH7 A;  4Y92 A;  2ATC B;  1N8R R;  1WHK A;  3CCU T;  4E7J A;  4BI8 B;  4AFQ C;  2QG9 B;  2ZAE A;  3A8M B;  5GMK h;  4FSX A;  2OTJ A;  3BW1 A;  4IIM A;  2MPX C;  1T3L A;  3GPL A;  4M77 A;  2FPE A;  2GQI A;  1X6G A;  3QO3 A;  4YTL A;  2QA4 T;  2MMP A;  3HPW A;  5DM7 R;  2RK1 A;  2CP2 A;  2EFI A;  1X2K A;  1UGV A;  5FWB A;  3P8B B;  2DX1 A;  1V1C A;  3I5R A;  4F7U G;  2K3B A;  2XMF A;  2XHC A;  2M9U A;  3PFS A;  4F7U F;  1QMC A;  2DIQ A;  2QQA A;  1PM3 A;  2QDY B;  2KI7 A;  3LH0 A;  2J06 A;  2DRK A;  3M5A A;  3GOX A;  1OOT A;  2HSP A;  3THK A;  5FW9 A;  4FT2 A;  1VQO Q;  2A08 A;  2FB7 A;  2P4R A;  3UA6 A;  2V26 A;  3GNG A;  1NYG A;  1U3O A;  3CCL Q;  3OW2 P;  2FRY A;  1K9M C;  2BE7 D;  2CKK A;  2COZ A;  4D8K A;  2E6Z A;  4E7Z A;  1VQ8 A;  1JBM A;  1TUG B;  1FWZ A;  1Q86 U;  2YUN A;  1AT1 B;  2EKO A;  1KQS S;  3TEE A;  5HK0 A;  4PL6 A;  2K3X A;  3CCQ A;  4AT1 B;  5GAO q;  5HCK A;  3JCM J;  1B34 A;  2V1Q A;  3NMZ C;  2SEM A;  2E5Q A;  1JQQ A;  1GXI E;  2HKN A;  3WVD B;  2RN8 A;  2J05 A;  2W10 A;  4HT8 A;  1HK9 A;  3CCV T;  3L2Q A;  5KYY B;  1Q81 U;  2RJE A;  3I5S A;  2L2P A;  1LPL A;  2E6N A;  5C6S A;  5GMK l;  2KK4 A;  4DEY A;  1M2V B;  3OSS C;  1WA7 A;  2QXF A;  2BZX A;  1SG5 A;  3UF4 A;  1KQ1 A;  1GCP A;  2EQM A;  1IHW A;  3JV3 A;  5FRN A;  1NZ9 A;  4AG1 C;  1VQK A;  1FX7 A;  4HVW A;  1QVP A;  4MDX A;  4VUB A;  2LJ1 A;  1UJY A;  3SD4 A;  5KYN A;  2A36 A;  2X4Y A;  4J7F A;  1ZSZ B;  1VQ9 T;  3RBB B;  1IZ6 A;  3S3O A;  3HSB A;  2OAW A;  5GMK i;  2OX7 A;  4BE1 A;  5GAM h;  2EGC A;  3CMA Q;  1YJW T;  1JXO A;  2A7Y A;  2HKQ B;  5GAM d;  2LDM A;  4AFS C;  1M3A A;  1FXX A;  4X1V A;  3QYG B;  4PLI A;  2DMO A;  1DJ7 B;  4M75 E;  4DQ2 A;  2ZPH B;  5IHN A;  1WXT A;  3JCM f;  4AFU C;  3BDL A;  2ENM A;  2VUB A;  2A37 A;  1IHV A;  1WXU A;  3MPU B;  3CPF A;  2O4X A;  2Y4X A;  4XTW A;  2FRW A;  1KQS A;  1ZBX A;  3M54 A;  3G6E Q;  1U1S A;  3BFM A;  2ROT A;  3SFM A;  1WGS A;  1M1K R;  3EGD B;  2EW3 A;  1I0C A;  2KBT A;  4M7D C;  2ROL A;  1Q7Y C;  1HJD A;  1ZQ1 A;  3CCU A;  1Q82 C;  3C4S A;  3RMQ A;  2V8K A;  2M0Y A;  4FYY B;  4BDZ A;  2CDT A;  5LJ3 g;  4OGE A;  4PJO C;  4J9C A;  4EMK C;  2LRQ A;  3J7A F;  1H92 A;  5C0M A;  1FMK A;  3E19 A;  1PWT A;  1ZHI A;  4JLI A;  2GQV A;  4NS5 A;  1IXD A;  2HCK A;  1SHG A;  4IUV A;  1T0J A;  1B07 A;  1M4Z A;  2L8D A;  4BE2 A;  3OYD A;  2IIM A;  2QA4 A;  1KG1 A;  4M75 B;  1PD1 A;  3OB9 A;  1RLQ C;  3VRY A;  5GAN f;  3A1P A;  3NTK A;  2ZPB B;  3WXM B;  2IPO B;  3JCM X;  1KHC A;  3MEW A;  1YI2 T;  4M77 C;  1KD1 U;  4J6Y A;  1C1A A;  2M16 A;  1RAF B;  4CI0 C;  2YRC A;  4RG8 A;  1HD3 A;  2WSE E;  1QVG S;  5KCO A;  2MOX A;  3ZFJ A;  2KE9 A;  3OYG A;  3P8H A;  1R0C B;  1YCS B;  2E1H A;  2ESW A;  2QGG A;  4TVR A;  3RNJ A;  1TWB A;  4HKE A;  1SHF A;  4ANJ A;  3VS6 A;  4PFO A;  1MMN A;  1K73 U;  1UHC A;  2LMJ A;  2L89 A;  3CEY A;  4HCK A;  1W4S A;  4MZM A;  1H3Z A;  3C95 A;  4RTT A;  3H0H A;  1GFC A;  3NGP A;  3CBM A;  1D3B A;  2JM9 A;  2QEX Q;  1OV3 A;  4CC3 A;  1YNZ A;  3ZEH A;  1QVF P;  1WHL A;  2DJQ A;  4J5Y A;  3S3M A;  2PTK A;  3HFO A;  1RAC B;  2O31 A;  4LD6 A;  3OS2 A;  1AZE A;  4E7L A;  4A4E A;  2FL7 A;  2EAY A;  5LJ5 h;  5GAN 8;  5A0G A;  1C0M A;  1JU5 C;  3L1A A;  2E5K A;  3OS0 A;  2I0N A;  2YUO A;  3MEV A;  2ZPF B;  5LJ5 d;  3GNF B;  1IRX A;  1ZA1 B;  3ZBD A;  3VYG A;  3O5Z A;  4RTY A;  1MV0 B;  1GCQ A;  2YT6 A;  1W2B S;  1LNX A;  1BIA A;  3NPF A;  2P84 A;  3CC2 Q;  2GNC A;  3VUZ A;  1VQ9 A;  1QW1 A;  1D09 B;  1RAI B;  2JTE A;  4E7K A;  4RTU A;  4A53 A;  3I55 Q;  1QVG A;  4P5N A;  2HBP A;  5LJ3 j;  5M9O A;  2YUP A;  2DBK A;  5EG2 A;  1N6A A;  3S6W A;  4OB0 B;  4PKC C;  3FJP A;  2PQW A;  1D0Z A;  4BUG A;  4X9D A;  2J6K A;  4XTV A;  1VQO T;  4M75 F;  1D1C A;  2VXE A;  4M7D B;  3EH1 A;  3CCE A;  1VQ6 Q;  5GMK e;  2EPD A;  1VIF A;  5GAN 3;  1NPP A;  4EMK B;  4X34 A;  1LJO A;  1G3S A;  1NLP C;  3RES A;  4EPC A;  4XU3 A;  3I56 Q;  4BI3 A;  1QWE A;  5FLX E;  4HVU A;  2LQK A;  3RDV A;  2GFA A;  1K8A U;  4AFZ C;  4F7U E;  5KH6 A;  4ZGE B;  2X51 A;  2KSS A;  3CD6 A;  3PTA A;  3CC4 A;  2K79 A;  4J8O A;  1QCN A;  4JZ3 A;  4M7A A;  3OYC A;  1M8V A;  4PLL A;  1TUC A;  1ZX6 A;  1OUL A;  3PT9 A;  3RMS A;  1SF9 A;  2CP6 A;  2M51 A;  5D6W A;  4M77 B;  3VUB A;  2RJD A;  1W2B A;  1YFN A;  2DYI A;  1RAB B;  5CQX A;  5DY9 A;  2O88 A;  2MK5 A;  4BI4 A;  1PC0 A;  5LJ3 h;  1YI2 A;  4OB3 B;  4PJM A;  2FPD A;  3RIR A;  1VOM A;  1M3B A;  2PUO B;  5CKB A;  5LJ3 d;  5IXB A;  4DOW A;  3PVL A;  4R56 A;  4OMF B;  3BDU A;  4J9I A;  5CR2 A;  3MET A;  2EBP A;  3CQT A;  5KYX A;  4MZT A;  2DTH A;  2E10 A;  3G1J A;  4JZ4 A;  2ZPI B;  2WAC A;  2Y90 A;  2GTO A;  4LDW A;  3QHS A;  4N0A A;  4FL6 A;  2EYW A;  3HL8 A;  1P92 A;  5GAM g;  2Y4Y A;  2FZG B;  4J9F A;  2DYB A;  3X26 B;  4RG2 A;  2LJ3 A;  5KYU A;  2KR3 A;  3OY9 A;  3QKJ A;  1E6H A;  2BKD N;  2KQW A;  3A8G B;  3X25 B;  2P0K A;  1AWW A;  3G6E T;  3JB9 I;  1B34 B;  2DZ9 A;  2X3W D;  1UGP B;  1TOV A;  2QYZ A;  3AHU A;  1M90 U;  4XU1 A;  1VQ5 Q;  4C5H A;  2OJ2 A;  3OQ5 A;  3PNW C;  1VQM Q;  2RQR A;  4OMN A;  5GAM e;  4KUI A;  3M0P A;  2JXB A;  1VQ4 T;  5CKH A;  3JCM c;  1ZSG A;  3QZ9 B;  4PNO A;  3OW2 A;  1R0B G;  3MP8 A;  4M7D F;  5GAN 6;  3QWY A;  1ABQ A;  1BK2 A;  4C0D C;  4PJO G;  3CME T;  1JB0 E;  1M2O A;  2JN0 A;  1MHN A;  4JPB W;  4R55 A;  3EAE A;  3L2W A;  3OBW A;  1YWO A;  3FB9 A;  1VQ7 T;  1QLY A;  2VVK A;  2XKO C;  4PJO D;  2ED0 A;  3CCJ Q;  3X20 B;  4J6W A;  2GBQ A;  1WX6 A;  2DBM A;  2LJ0 A;  4C0G A;  1GCQ C;  2DF6 A;  2K4Y A;  3LX7 A;  2CP5 A;  3EFR A;  2NYS A;  5FRM A;  2EWN A;  2FZC B;  4B9W A;  3LWI A;  5D6X A;  1JJ2 P;  4KGX B;  3H41 A;  4O6J A;  2ZZD A;  2CZ0 B;  1OZ3 A;  2M02 A;  2KGT A;  4M77 G;  2COY A;  2K5F A;  2PVD B;  1MND A;  1YBY A;  3A98 A;  4M77 F;  4QVC A;  1VQN T;  3SB2 A;  3HRT A;  1VQO A;  2DER A;  2KEA A;  4N4I A;  2OTL Q;  3VS2 A;  1VYT A;  3OMG A;  3OS1 A;  3FLG A;  2LT1 A;  4JRK A;  1WPY A;  4M77 D;  2RF0 A;  2FZK B;  3M0T A;  3FJ5 A;  2RPN A;  3TSZ A;  1Y57 A;  2L3Q A;  4GLK A;  1KC8 U;  1SKU B;  3X28 B;  5CVI A;  1SPK A;  3VS1 A;  3CCS Q;  1YIJ Q;  1K9M R;  4DBQ A;  3VS4 A;  3CBO A;  4JS5 A;  2DL7 A;  3UT1 A;  4DA4 A;  1WHM A;  1WLP B;  3EGX A;  2CSI A;  1OEB A;  2O9V A;  4N4G A;  3NTI A;  3LW5 E;  5FWC A;  2B86 A;  3M0Q A;  3G71 Q;  1YJN Q;  4BY6 C;  2EQU A;  2HQX A;  3N5B B;  4KH1 B;  1Q86 C;  1WQ7 A;  1Y96 A;  2YLC A;  1YIT Q;  2RH2 A;  4DBR A;  3JB9 J;  2CZ6 B;  4FYV B;  3QZ5 B;  1Y07 A;  4L5G A;  1NJI U;  3ASK A;  2FYK A;  1EIF A;  2GGR A;  5FU6 B;  3VRZ A;  4M7A C;  5GAM j;  3OMC A;  3EFO A;  3QBY A;  1Z9Z A;  2IG0 A;  2LCC A;  3C0C A;  1K0S A;  5GAN 2;  2YXY A;  1Q81 C;  3PGG A;  1WHG A;  3NHN A;  1N5Z A;  2VKN A;  5LJ5 g;  2CP7 A;  3UWN A;  4LNP A;  1LVK A;  1RL2 A;  2NUP B;  2R58 A;  1I1J A;  1K4U S;  4KBM B;  1WDX A;  1UGR B;  2OTJ Q;  3JCM h;  2CUB A;  1N8R U;  5GAO p;  1RAG B;  3INZ A;  3I55 T;  2JW4 A;  2GCX A;  2DJZ A;  1I8F A;  3JCM d;  1VQP Q;  3PIP A;  5AYF A;  1LOJ A;  5LJ5 e;  1TG0 A;  3HRU A;  4EDU A;  2KRN A;  1VQL T;  3GP8 A;  3M59 A;  1WZO A;  3CXC P;  4OP0 A;  4J83 A;  1VIE A;  1XJW B;  2B8A A;  4C8Q A;  3LYI A;  3R6O A;  5KCH A;  2AKL A;  5IT9 E;  2L0A A;  3VS3 A;  1VQ6 T;  4N0A C;  4KGZ B;  4XTU A;  4HT9 A;  3KBG A;  3G6E A;  3PIO A;  3PVQ A;  2RHX A;  3OYF A;  3V8L A;  3M0U A;  2XD0 A;  3DKM A;  2RQW A;  5LL6 S;  4II1 A;  1UGS B;  1OPL A;  2I2L A;  3TQ7 P;  1VQ4 A;  2X4X A;  3OYI A;  1S72 Q;  2NUT A;  4M78 A;  1VQ8 Q;  3VJP A;  2HSE B;  1Q7Y R;  1Q82 R;  1TTH B;  5KYW A;  4PJJ A;  3CME A;  4OMO A;  4ORZ A;  3REB B;  1Q95 G;  1H8K A;  2KMT A;  1WI7 A;  2D9T A;  2LQ8 A;  4FM4 B;  1ZLM A;  1ZA2 B;  1BI1 A;  3MJX A;  3CCM T;  1VQ7 A;  3RER A;  4BE0 A;  3J81 E;  2JVV A;  4RTZ A;  2EYY A;  4LN2 A;  5KE3 A;  2JTF A;  3CCE T;  1W6X A;  3V7S A;  2RQV A;  5CCA A;  2MWP A;  4C92 A;  3OYY A;  3JSC A;  4CC4 B;  1JRI A;  1K73 R;  2MIO A;  4GY5 A;  3OYK A;  1U1T A;  2RHU A;  3UAT A;  1RUW A;  1VQN A;  1K1Z A;  5I11 A;  1UFF A;  4JDS A;  2CP3 A;  1X01 A;  1KJW A;  3CD6 T;  2DVJ A;  3MO8 A;  3CC4 T;  2XID A;  2DL8 A;  2GTJ A;  2ECZ A;  1XOV A;  3JB9 G;  4DBH A;  3JB9 F;  2VYT A;  2K2M A;  2C0O A;  1VYV A;  4BD3 A;  2LNV A;  5LJ3 e;  2KRO A;  5LJ5 j;  3JB9 D;  2CUD A;  3H0I A;  2H8H A;  5HK3 A;  1K9A A;  1K73 C;  1OI1 A;  1MNE A;  4FIB A;  5GAO r;  2BE9 B;  2RK2 A;  4O5V A;  4M7A B;  1V76 A;  3PE0 A;  2F69 A;  5CKF A;  1SSF A;  2JTM A;  2CZ7 B;  1VQ5 T;  1BI0 A;  1M1F A;  2EQK A;  1UB4 A;  1VQM T;  3EG9 A;  3IQL A;  2OI3 A;  2P4T A;  4OGC A;  1VUB A;  2RD1 A;  3CCU Q;  1RI0 A;  2R5M A;  2VGN A;  5L8R E;  2W0Z A;  3M53 A;  1R77 A;  1I5L A;  1JEG A;  4E47 A;  4RTX A;  2CP0 A;  3S3N A;  4PJL A;  4RUG A;  3QDF A;  3CC7 T;  1IGU A;  1QQJ A;  2RJC A;  3CC2 A;  1PKS A;  5J3B A;  1M1K U;  5ECA A;  1D1A A;  2G3R A;  2QAZ A;  4Q5W A;  4RMO A;  1E7O A;  2CSQ A;  3QJY A;  1YJ9 Q;  2AZS A;  3I55 A;  5KYY A;  3M0S A;  3DB4 A;  4JLG A;  1IGQ A;  2XI9 A;  4V2S A;  1VYU A;  4A4G A;  1QP3 A;  5J39 A;  2QA4 Q;  2EJF A;  1JXM A;  2LVM A;  1KSW A;  1M2V A;  2QK0 A;  2DL5 A;  3CBP A;  2BTT A;  1VQL A;  3EFS A;  4M7D E;  1BU1 A;  2F2W A;  2DD5 A;  2R5A A;  1WHH A;  2RMO A;  2DEU A;  2BZ8 A;  2L3S A;  1AD5 A;  5KYU B;  1WNL A;  1AHJ B;  2ED1 A;  1VQ6 A;  1X6O A;  4PJO E;  2XG8 D;  1G5V A;  6AT1 B;  2KDS A;  4LDU A;  5GAO n;  1ZSZ A;  3VS5 A;  2A3L A;  2LX7 A;  2SRC A;  2QQR A;  2KY9 A;  4WF2 A;  4C8Q C;  2DLP A;  2DM1 A;  3ZL7 C;  3CCS T;  5IAY A;  1TUD A;  1OX8 A;  3I56 A;  3MKD A;  1QCO A;  2DET A;  2LT4 A;  3BE3 A;  1JJ2 S;  1NPR A;  3JCM Q;  3VYH B;  1YJN T;  1RAA B;  1UJ0 A;  3RKX A;  2YDL A;  5I2S A;  1JO8 A;  4M77 E;  2J7I A;  2JT4 A;  2EYZ A;  3CCM A;  4OB2 B;  1M5Q 1;  8AT1 B;  1K8A C;  4M78 C;  4C0Z A;  5A2Q E;  3SEM A;  2JMA A;  1YHQ Q;  1PSF A;  1KIK A;  4OMM A;  3EGD A;  2P0Q A;  2DFU A;  2RHI A;  3CCV Q;  3CCL T;  2E12 A;  3RKW A;  4DOV A;  4J9D A;  4HCB A;  4PJO B;  2EGA A;  4LUE A;  3TVT A;  2O01 E;  2O2O A;  3FIF A;  2OAU A;  4RTW A;  3EGU A;  2E4H A;  3QPH A;  2V8I A;  5CO7 A;  4M7A G;  4ZTF A;  9ATC B;  4M7A F;  2QAS A;  8ATC B;  5GAN 5;  2HD0 A;  3OS5 A;  1I81 A;  3KUF A;  4C92 C;  4N4H A;  1BIB A;  2RHY A;  4M7A D;  4E7S A;  1CKB A;  2MWO A;  3GBQ A;  1N9S A;  2LQN A;  4M75 A;  5KE2 A;  1VQP T;  2JJ9 A;  1VQ9 Q;  3LLR A;  1QCF A;  4F04 B;  1ACM B;  3OW2 S;  1O9S A;  3JCM g;  4Z89 A;  1YJW Q;  4C5G A;  4J9E A;  1I4K 1;  2RQU A;  1M90 R;  5FU7 C;  1GFD A;  2QQB A;  5IH2 A;  2D0N A;  3SWN A;  4A4K A;  1JJ2 A;  1CSK A;  3OSV A;  3L2V A;  4CC2 A;  5GAN 4;  2HEQ A;  2DIG A;  1N9R A;  1U5S A;  5D6Y A;  1B3Q A;  1D0Y A;  2NWM A;  1VQ5 A;  3JCM e;  1VQM A;  4FYX B;  1GBQ A;  2EJ9 A;  4IUT A;  1GBR A;  2EGE A;  1UTI A;  1Y0M A;  3CMA T;  5GJV B;  1AWJ A;  5I2M A;  1M8M A;  3G4S Q;  4Y28 E;  1M90 C;  2NUZ A;  1MUZ A;  2MI6 A;  2C06 A;  3CC7 A;  2RI5 A;  3ULR B;  1VA7 A;  4EMH A;  4JJN K;  2YRD A;  2JOY A;  1QVG P;  3OYJ A;  4XTY A;  2F5K A;  2D1X A;  2K7A A;  3A8O B;  5GAN g;  3TU4 K;  2C0T A;  3CCJ A;  1OU8 A;  2X4J A;  2RO0 A;  3U23 A;  2LCL A;  2O9S A;  3HTR A;  2AT1 B;  2M1H A;  2CT3 A;  2DD4 A;  4QQG A;  1UUE A;  3CCR Q;  2YRV A;  1D0X A;  1GRI A;  3NTH A;  2EKH A;  1UEB A;  1PCX A;  1XNI A;  1U06 A;  1YI2 Q;  2P0P A;  2E64 A;  2JNG A;  2LNH B;  3TRE A;  3V8J A;  4MZP A;  2VWF A;  4C8Q B;  2X4W A;  2X3X D;  3UA7 A;  4ESR A;  3CPW P;  2H3J A;  1A0N B;  2JS2 A;  1AEY A;  4PJO F;  1OX9 A;  2CRE A;  2KAF A;  2AZV A;  4ME7 A;  3H8Z A;  1AVZ C;  4ELY C;  3RR6 A;  2V1R A;  3FC3 A;  3M57 A;  3CCS A;  3SDZ A;  4C5E A;  4L59 A;  2YUQ A;  2DPP B;  1NEG A;  2PZ1 A;  1SRM A;  2BUD A;  2D0Q B;  2EYQ A;  5CAI A;  2RHZ A;  2DAQ A;  4ZGJ B;  1V29 B;  2NUT B;  3I35 A;  2X9H A;  1KC8 C;  4M78 B;  1ZUY A;  2ZPG B;  5AT1 B;  3AT1 B;  4J9B A;  4LE9 A;  4CRI A;  1G3Y A;  1YJN A;  4AMC A;  3UDC A;  3REA B;  1RAH B;  3V8K A;  4M7D A;  3V7C A;  1W2B P;  2X35 A;  2E41 A;  3F70 A;  4E7I A;  1YIT A;  2RM4 A;  1N27 A;  4IUQ A;  4XU0 A;  2EYX A;  1X6B A;  4HVV A;  2F5T X;  1Q86 R;  1AZG B;  4IUR A;  3MEA A;  3OYE A;  4DEX A;  4Z02 A;  1Z9Q A;  2O4X B;  2DVE A;  2JZ2 A;  3CCL A;  1NBE B;  4GLM A;  5GAN 7;  3RKY A;  4NL2 A;  4C92 B;  3VS7 A;  2FO0 A;  3DB3 A;  3H6Z A;  1PSE A;  1S1N A;  3RUX A;  4Y91 A;  1NJI C;  4NOY A;  2PU9 B;  4ZNX A;  1Q81 R;  3LWH A;  4HCZ A;  4ZTJ A;  4R0K A;  2QEX T;  3JRZ A;  4BDY A;  2RI3 A;  1WQW A;  5GMK m;  2M0O A;  1WYX A;  1BI2 A;  1YJ9 T;  2H3E B;  3OYN A;  4QQD A;  1PHT A;  5FU7 B;  4OML A;  4JJC A;  1VQP A;  4XTX A;  3URG A;  4K11 A;  4F14 A;  2PVO B;  1EFN A;  1WFW A;  1M9S A;  2DIL A;  1N8R C;  4Z8A A;  4M75 C;  2MAM A;  5L23 A;  3FEO A;  3E9F A;  4PFZ A;  4JJD A;  3VKI A;  5GAN j;  3OBY A;  1F1B B;  4JUV A;  4E7H A;  1HSQ A;  4KUL A;  1BI3 A;  1PKT A;  4J9G A;  4XU2 A;  1UG1 A;  2G6F X;  1QVF S;  1QP2 A;  2FEI A;  1FMW A;  2MYS A;  3CC2 T;  4F7U A;  4A4H A;  2QQ9 A;  3GLX A;  2CH4 W;  4RCB A;  1S72 A;  2DRM A;  2VXF A;  3EG9 B;  3QUI A;  4C8Q G;  4ATO A;  4OF1 A;  3SWN C;  2KXD A;  4UC4 A;  3CMA A;  4C8Q F;  2PVG B;  3MP1 A;  4KH0 B;  2NLU A;  2ZGW A;  2JMC A;  2LZ6 B;  2DA9 A;  2KXC A;  3QG1 A;  3E1S A;  4FCY A;  2KRS A;  4C8Q D;  4XK8 E;  1BCM A;  1TU0 B;  2DTO A;  4ZGD B;  1H3H A;  1K76 A;  1D3B B;  1YHQ T;  1SRL A;  2DO3 A;  1WXB A;  3H9N A;  1K9M U;  2F1L A;  3SHW A;  4IIO A;  4M78 G;  1ZUK A;  1B7T A;  4M78 F;  1QWF A;  2E3I A;  4MMK A;  2DNU A;  3FRN A;  3L2Z A;  4L6V 5;  1UHF A;  4C0D B;  2K6D A;  4M78 D;  4B9X A;  3VV0 A;  4EIK A;  1WJR A;  3V7R A;  1AWX A;  3I56 T;  2DZC A;  3M9Q A;  4QT7 A;  4X9C A;  2DL4 A;  3A8H B;  4QVZ A;  1TSF A;  2DE0 X;  5CK9 A;  2QTV A;  5GAN h;  4C92 G;  3MEU A;  2AHJ B;  3T9N A;  4C92 F;  3CCQ Q;  5GAN d;  4E6R A;  4KRT A;  4ELZ C;  1KD1 R;  1YP5 A;  3OYH A;  1SSH A;  2HMA A;  3QDR B;  4RCC A;  1BYM A;  1YN8 A;  4C92 D;  2JS0 A;  2BZY A;  1EZZ B;  2WSF E;  4FW1 A;  1QVF A;  1NYF A;  3OYA A;  4IKF A;  3G7Z A;  1M27 C;  3A5Z B;  5I21 A;  1SEM A;  2CS7 A;  3L42 A;  2L3R A;  3EG0 A;  4M7A E;  2JM8 A;  2JUF A;  4KUD K;  3LGF A;  4OB1 B;  3LGL A;  2LTO A;  3J80 E;  2HZY A;  2ZCF B;  5D7U A;  3OYB A;  2E3H A;  1XQH A;  1OZ2 A;  1ZUU A;  4QKU A;  1VQK Q;  2FG0 A;  1AOJ A;  1KD1 C;  2L3P A;  1WJS A;  1OQK A;  4WCI A;  4M4Z A;  1G3W A;  3L2U A;  5IXF A;  2K3Y A;  3G4S T;  4B6M A;  4HXJ A;  2VC8 A;  1VQ4 Q;  3OA6 A;  3M58 A;  2RNA A;  2Z0W A;  2RQT A;  4BB7 A;  4BY6 B;  4DBF A;  2DKG A;  4GBQ A;  4OMP A;  1H64 1;  3OYL A;  2RJF A;  2FPF A;  3HKS A;  2QDL A;  2QEX A;  1I07 A;  1YWP A;  3CME Q;  1NLO C;  2KVQ G;  1MGQ A;  1YCY A;  3PMI A;  3R6N A;  1X2Q A;  1YJ9 A;  4J6X A;  2MCN A;  1VQ7 Q;  2XU8 A;  5GAO m;  2WSC E;  5GAM f;  2D8H A;  2FHD A;  3CCR T;  1Q7Y U;  1M1K C;  2CZ1 B;  2F2V A;  1Q82 U;  1IO6 A;  1NM7 A;  2EQI A;  2KYB A;  4RTV A;  4WTO B;  2GFU A;  1UE9 A;  1U8R A;  3EHR A;  3QJ6 A;  1WHJ A;  1PD0 A;  4AG2 C;  1MV3 A;  2NUP A;  2HNI A;  4LDV A;  1VQN Q;  3SWN B;  1T3S A;  3TSW A;  2A28 A;  2DXC A;  5KYX B;  4MML A;  4XQ3 A;  1I5O B;  1UGQ B; 
#chains in the Genus database with same CATH homology
 3JCM g;  3QSU A;  4O6J A;  3CCJ T;  2ZZD A;  2CZ0 B;  4C5G A;  1FX7 A;  1OZ3 A;  1I4K 1;  4M77 G;  1QVP A;  4MDX A;  2K5F A;  2PVD B;  4VUB A;  1YBY A;  4M77 F;  5FU7 C;  4QVC A;  3DLL A;  4HCC A;  1VQN T;  3SD4 A;  3SB2 A;  1G5V A;  2QQB A;  3HRT A;  1VQO A;  1BKB A;  2XDB A;  2X4Y A;  4J7F A;  4IUU A;  4JS4 A;  4N4I A;  1VQ9 T;  2DTI A;  1IZ6 A;  1HXD A;  3S3O A;  3HSB A;  3PMT A;  3X24 B;  3OMG A;  5GMK i;  3HHT B;  3OS1 A;  3ER0 A;  4BE1 A;  3FLG A;  5GAM h;  2LT1 A;  4JRK A;  1WPY A;  4M77 D;  3SWN A;  4A4K A;  1JJ2 A;  3OSV A;  3L2V A;  3Q1J A;  5GAN 4;  1YJW T;  2DIG A;  3JB9 H;  1N9R A;  2A7Y A;  1KC8 U;  4GLK A;  4LDY A;  3WVE B;  3UPU A;  5GAM d;  5D6Y A;  2LDM A;  3BY7 A;  3CPW S;  3TCJ A;  1VQ5 A;  3X28 B;  3JCM e;  5CVI A;  1YHQ A;  1VQM A;  1FXX A;  3QYG B;  2OTL T;  4PLI A;  3CBO A;  4JS5 A;  2EJ9 A;  4DA4 A;  1DJ7 B;  3UT1 A;  4IUT A;  4M75 E;  4DQ2 A;  2ZPH B;  3CCV A;  1KHI A;  3JCM f;  3BDL A;  2VUB A;  4N4G A;  3CMA T;  3ME9 A;  2YHT A;  3NTI A;  5CKE A;  3C94 A;  5I2M A;  3CPF A;  3LW5 E;  2O4X A;  2Y4X A;  5FRO A;  4XTW A;  4Y28 E;  1M90 C;  4BY6 C;  2EQU A;  1KQS A;  2HQX A;  3P8D A;  1ZBX A;  3N5B B;  4FU6 A;  2K57 A;  3M54 A;  2MI6 A;  3C12 A;  1YIJ T;  1Q86 C;  1U1S A;  3BFM A;  2DK3 A;  3JCM b;  1WQ7 A;  1Y96 A;  3SFM A;  2C06 A;  1WGS A;  2YLC A;  3CC7 A;  5GAO l;  2RI5 A;  2QQS A;  4EMH A;  3L2R A;  4JJN K;  1NE8 A;  2JOY A;  3OYJ A;  4XTY A;  5CIU A;  2F5K A;  2RH2 A;  4M7D C;  3JB9 J;  4MDW A;  2CZ6 B;  3A8O B;  5GAN g;  1Q7Y C;  3TU4 K;  3CCJ A;  1ZQ1 A;  3CCU A;  4NL3 A;  3QZ5 B;  3G71 T;  1Q82 C;  1Y07 A;  3C4S A;  4L5G A;  2V8K A;  3RMQ A;  5DLO A;  4BDZ A;  2X4J A;  1NJI U;  2RO0 A;  5LJ3 g;  3ASK A;  4OGE A;  4A4F A;  2FYK A;  4PJO C;  1EIF A;  5FU6 B;  2LCL A;  4M7A C;  4EMK C;  5GAM j;  2M1H A;  3OMC A;  2LRQ A;  3QBY A;  2DD4 A;  2IG0 A;  2LCC A;  1YIT T;  3J7A F;  4QQG A;  5GAN 2;  4HA8 A;  1Q81 C;  3PGG A;  2YRV A;  5C0M A;  3E19 A;  3NTH A;  1KQ2 A;  1UEB A;  5LJ5 g;  1XNI A;  2BIV A;  1ZHI A;  4JLI A;  2GQV A;  4KT0 E;  4NS5 A;  3UWN A;  1YJW A;  4IUV A;  4IUP A;  2P0P A;  1M4Z A;  1RL2 A;  2E64 A;  2JNG A;  2L8D A;  3JCM W;  4BE2 A;  3TRE A;  3OYD A;  2R58 A;  3V8J A;  4MZP A;  2R57 A;  2QA4 A;  4C8Q B;  2X4W A;  4FT4 A;  1KG1 A;  4KBM B;  1UGR B;  4M75 B;  4RKU E;  2K5L A;  3JCM h;  4EMG A;  1N8R U;  5GAO p;  3OB9 A;  2H3J A;  3INZ A;  5DLQ E;  3NTK A;  5GAN f;  5GAO m;  3I55 T;  2ZPB B;  4PJO F;  3WXM B;  3JCM X;  4M75 G;  1KHC A;  2GCX A;  2KAF A;  2DJZ A;  2K2V A;  3MEW A;  1YI2 T;  1I8F A;  3JCM d;  2MF2 A;  3H8Z A;  4ME7 A;  4ELY C;  3PIP A;  2CGH A;  4M77 C;  3FC3 A;  1KD1 U;  4J6Y A;  3M57 A;  5AYF A;  1LOJ A;  2M16 A;  5LJ5 e;  1O75 A;  2QTX A;  3CCS A;  3QYH B;  3HRU A;  3GF5 A;  3SDZ A;  4C5E A;  4EDU A;  3E9G A;  4CI0 C;  2OTJ T;  1VQL T;  4M75 D;  2K5I A;  4L59 A;  4RG8 A;  2DPP B;  2DXU A;  3GP8 A;  3M59 A;  5LJ5 f;  2BUD A;  3CPW A;  2D0Q B;  2WSE E;  2YLB A;  2EYQ A;  3OYM A;  4OP0 A;  4J83 A;  5CAI A;  2RHZ A;  1VIE A;  2B8A A;  2DAQ A;  4C8Q A;  3LYI A;  4ZGJ B;  5KCO A;  3ZFJ A;  1V29 B;  3KXT A;  3R6O A;  1KC8 C;  5KCH A;  4M78 B;  5IT9 E;  2ZPG B;  3OYG A;  3P8H A;  1OYX A;  3G4S A;  3O8V A;  4CRI A;  1G3Y A;  3JCM P;  1VQ6 T;  1YJN A;  4N0A C;  5A0L A;  4ZN3 A;  4XTU A;  3UDC A;  2E1H A;  4HT9 A;  3KBG A;  5HY6 A;  3G6E A;  4TVR A;  3V8K A;  4M7D A;  4HKE A;  3PIO A;  3FDR A;  3V7C A;  2X35 A;  2V8J A;  2RHX A;  3QXE B;  2E41 A;  3F70 A;  3MP6 A;  3M56 A;  2RM4 A;  3JCM V;  4E7I A;  1YIT A;  1N27 A;  4IUQ A;  3OYF A;  1K73 U;  4XU0 A;  3V8L A;  2XD0 A;  2RA2 A;  3CEY A;  2L89 A;  1W4S A;  4XAX B;  2F5T X;  4MZM A;  3DKM A;  3C95 A;  4C0F A;  4IUR A;  1H3Z A;  5LL6 S;  3MEA A;  4II1 A;  1UGS B;  3OYE A;  2I2L A;  4Z02 A;  2O4X B;  3HFN A;  2DVE A;  1VQ4 A;  2X4X A;  2JZ2 A;  3OYI A;  3CBM A;  3CCL A;  1D3B A;  2VV5 A;  3HP9 A;  2L5Q A;  4M78 A;  1M1G A;  3VJP A;  5GAN 7;  3RKY A;  4NL2 A;  4C92 B;  2XIC A;  3ZEH A;  3CCR A;  1Y96 B;  4J5Y A;  3DB3 A;  4BAC A;  3S3M A;  3H6Z A;  3CME A;  3M4G A;  2RI2 A;  2GF7 A;  3HFO A;  2KMT A;  2D9T A;  4QW2 A;  2IVW A;  2LQ8 A;  1PSE A;  1IRE B;  3M55 A;  4FM4 B;  4LD6 A;  3RUX A;  4Y91 A;  5CKD A;  1BI1 A;  3OS2 A;  4NOY A;  1NJI C;  4C8Q E;  2PU9 B;  3A8L B;  3LWH A;  4HCZ A;  3CCM T;  1R8O B;  2E70 A;  4ZTJ A;  1S72 T;  2QI2 A;  1VQ7 A;  3RER A;  2QEX T;  4E7L A;  1VQ8 T;  3JRZ A;  4A4E A;  3J81 E;  4BDY A;  4BE0 A;  2FL7 A;  2JVV A;  2RI3 A;  4QQ6 A;  1WQW A;  2EAY A;  5GMK m;  2M0O A;  5LJ5 h;  5KE3 A;  2JTF A;  3MCA B;  3CCE T;  1BI2 A;  1YJ9 T;  5GAN 8;  3OYN A;  5FU6 C;  3V7S A;  5A0G A;  3L1A A;  4QQD A;  3CXC S;  5CCA A;  2MWP A;  4C92 A;  3CCQ T;  1X75 C;  5FU7 B;  3OS0 A;  4D6W A;  3MEV A;  5LJ5 d;  2ZPF B;  3OYY A;  1VQP A;  2DXB A;  3GNF B;  3JSC A;  4XTX A;  3URG A;  3ZBD A;  2PVO B;  3VYG A;  1XTD A;  1M9S A;  4ZN1 A;  1JRI A;  4F7U B;  3VU3 C;  1N8R C;  1W2B S;  1LNX A;  1BIA A;  4GY5 A;  4M78 E;  3OYK A;  1QVG S;  1U1T A;  2EJG A;  2RHU A;  2FVU A;  1VQN A;  3VUZ A;  2EQJ A;  4M75 C;  2MAM A;  1VQ9 A;  3FEO A;  4JDS A;  3E9F A;  4E7K A;  1X01 A;  3VKI A;  5GAN j;  3M4Y A;  4A53 A;  1QVG A;  3CD6 T;  2HQE A;  3MHX A;  3MO8 A;  4P5N A;  3CC4 T;  2HAX A;  2HBP A;  2LC4 A;  2XID A;  3OBY A;  1KQS S;  4JUV A;  4E7H A;  4KUL A;  5LJ3 j;  1BI3 A;  1XOV A;  4XU2 A;  4JRP A;  1QVF S;  1QP2 A;  3JB9 G;  2LX9 A;  5M9O A;  5EG2 A;  3CC2 T;  2VYT A;  3JB9 F;  4F7U A;  4A4H A;  5GAN e;  1N6A A;  2XDP A;  2QQ9 A;  4OVA A;  3GLX A;  3S6W A;  4OB0 B;  4XTZ A;  4PKC C;  1VQK T;  2D6F A;  2OTL A;  3FJP A;  4BD3 A;  5GMK j;  4C92 E;  2PUK B;  2LNV A;  1WJQ A;  2PQW A;  2RB6 A;  4RCB A;  4BUG A;  4QVD A;  3DLM A;  5A0D A;  5LJ3 e;  5LJ5 j;  4X9D A;  2ZPE B;  2VXF A;  1S72 A;  4XTV A;  3QUI A;  4C8Q G;  4ATO A;  4OF1 A;  3SWN C;  3JB9 D;  4JRI A;  4UC4 A;  3CMA A;  4C8Q F;  1Y7X A;  2DXT A;  1VQO T;  4M75 F;  5HK3 A;  2PVG B;  2VXE A;  3MP1 A;  5LJ3 f;  1K73 C;  4M7D B;  1OI1 A;  3CCE A;  1G3T A;  2NLU A;  2ZGW A;  5GMK e;  2XK0 A;  1Y71 A;  4M7D G;  1VIF A;  4FIB A;  5GAN 3;  5GAO r;  5HKC A;  3QG1 A;  3E1S A;  1YIJ A;  2RK2 A;  3NFC A;  1NPP A;  4C8Q D;  4XK8 E;  2E65 A;  2VGM A;  4O5V A;  2XDD A;  4M7A B;  4EMK B;  4X34 A;  2F69 A;  5CKF A;  2DTO A;  3QII A;  4ZGD B;  1LJO A;  1SSF A;  2JTM A;  2CZ7 B;  1G3S A;  1BI0 A;  1D3B B;  1M1F A;  1VQ5 T;  1YHQ T;  5IN1 A;  2EQK A;  5CQY A;  1UB4 A;  2DO3 A;  1VQM T;  4M7D D;  3G71 A;  4JRQ A;  3RES A;  4EPC A;  1K9M U;  4LD9 K;  4XU3 A;  4BI3 A;  5FLX E;  4M78 G;  3HRS A;  4OGC A;  2P4T A;  2LQK A;  4M78 F;  2GFA A;  1K8A U;  4A54 A;  1VUB A;  4F7U E;  2RD1 A;  4J7I A;  5KH6 A;  4ZGE B;  1RI0 A;  2R5M A;  2VGN A;  3GIB A;  4C5I A;  5L8R E;  2KSS A;  3JAM E;  3M53 A;  1I5L A;  3CD6 A;  3CXC A;  4E47 A;  4MMK A;  2DEQ A;  3PTA A;  3CC4 A;  4LDX A;  2CYZ B;  4J8O A;  4PJO A;  3FRN A;  3L2Z A;  4L6V 5;  4C0D B;  1M8V A;  4M78 D;  4EMK A;  3OYC A;  4B9X A;  4PLL A;  3VV0 A;  3S3N A;  1WJR A;  4M7A A;  3V7R A;  3CC7 T;  3PT9 A;  3RMS A;  3I56 T;  2DZC A;  3M9Q A;  2RJC A;  5J26 A;  4X9C A;  3CC2 A;  3A8H B;  5J3B A;  1M1K U;  5D6W A;  4QVZ A;  2G3R A;  2EIF A;  4M77 B;  4Q5W A;  3VUB A;  1TH7 A;  5CK9 A;  2RJD A;  4RMO A;  1W2B A;  3QJY A;  5CQX A;  5GAN h;  3CCU T;  5DY9 A;  3I55 A;  4C92 G;  3DB4 A;  4E7J A;  4BI8 B;  4BI4 A;  4JLG A;  3MEU A;  2AHJ B;  2XI9 A;  3T9N A;  5LJ3 h;  4A4G A;  4C92 F;  4V2S A;  1YI2 A;  4OB3 B;  5GAN d;  1QP3 A;  4ELZ C;  5J39 A;  3RIR A;  2EJF A;  3OYH A;  2PUO B;  2LVM A;  5CKB A;  5LJ3 d;  4DOW A;  3QDR B;  4RCC A;  3A8M B;  4R56 A;  3CBP A;  5GMK h;  1BYM A;  4FSX A;  4C92 D;  4OMF B;  2OTJ A;  1VQL A;  2WSF E;  3BW1 A;  3EFS A;  3BDU A;  1QVF A;  3OYA A;  4M7D E;  5CR2 A;  4IKF A;  3MET A;  3G7Z A;  2DD5 A;  2R5A A;  3GPL A;  4M77 A;  3A5Z B;  4MZT A;  5I21 A;  2CS7 A;  3L42 A;  2L3R A;  3QO3 A;  2DTH A;  4YTL A;  2E10 A;  1WNL A;  1AHJ B;  2MMP A;  3CCQ A;  1X6O A;  3HPW A;  2XG8 D;  5DM7 R;  2RK1 A;  1VQ6 A;  4PJO E;  4M7A E;  2JUF A;  4KUD K;  3LGF A;  2KDS A;  4LDU A;  4OB1 B;  2EFI A;  2ZPI B;  3LGL A;  2LTO A;  5GAO n;  3J80 E;  1VQK A;  3P8B B;  2WAC A;  2A3L A;  2Y90 A;  2ZCF B;  3OYB A;  4LDW A;  3QHS A;  1XQH A;  2QQR A;  4N0A A;  4F7U G;  1OZ2 A;  2KY9 A;  2M9U A;  2XHC A;  3PFS A;  4F7U F;  4WF2 A;  4C8Q C;  2DIQ A;  4FL6 A;  2QQA A;  2QDY B;  3CCS T;  3HL8 A;  5IAY A;  3LH0 A;  1P92 A;  3M5A A;  3GOX A;  1WJS A;  1KD1 C;  5GAM g;  2Y4Y A;  3I56 A;  3X26 B;  4RG2 A;  2LT4 A;  4FT2 A;  1JJ2 S;  1NPR A;  1G3W A;  2FB7 A;  3GNG A;  3L2U A;  3OY9 A;  2K3Y A;  3QKJ A;  3G4S T;  3JCM Q;  3VYH B;  1YJN T;  2BKD N;  2KQW A;  2VC8 A;  3A8G B;  3X25 B;  3OA6 A;  3M58 A;  2P0K A;  4BB7 A;  3RKX A;  4BY6 B;  5I2S A;  3G6E T;  3JB9 I;  1B34 B;  2DZ9 A;  2DKG A;  4M77 E;  1K9M C;  1H64 1;  2CKK A;  1UGP B;  3OYL A;  3CCM A;  2RJF A;  4OB2 B;  3HKS A;  2E6Z A;  1M5Q 1;  2QEX A;  3AHU A;  1VQ8 A;  1K8A C;  1JBM A;  4M78 C;  4C0Z A;  2KVQ G;  1MGQ A;  4XU1 A;  5A2Q E;  1YCY A;  1M90 U;  4C5H A;  1FWZ A;  3OQ5 A;  1PSF A;  3PNW C;  3PMI A;  1Q86 U;  5GAM e;  1YJ9 A;  5HK0 A;  4KUI A;  4J6X A;  2P0Q A;  2RHI A;  2EKO A;  1VQ4 T;  5CKH A;  3JCM c;  3CCL T;  3TEE A;  2XU8 A;  3QZ9 B;  2E12 A;  2K3X A;  4PL6 A;  4PNO A;  3RKW A;  2WSC E;  3MP8 A;  4DOV A;  5GAN 6;  3OW2 A;  4HCB A;  5GAM f;  4M7D F;  4PJO B;  5GAO q;  2O01 E;  3FIF A;  2FHD A;  3CCR T;  2OAU A;  1Q7Y U;  1M1K C;  2CZ1 B;  4C0D C;  4PJO G;  1Q82 U;  3JCM J;  3CME T;  3QPH A;  1B34 A;  2V8I A;  5CO7 A;  1JB0 E;  2JN0 A;  4M7A G;  4ZTF A;  1MHN A;  2E5Q A;  4M7A F;  4R55 A;  3EAE A;  1GXI E;  3L2W A;  2GFU A;  3OBW A;  3WVD B;  1U8R A;  5GAN 5;  3FB9 A;  4HT8 A;  1HK9 A;  2HD0 A;  3OS5 A;  1I81 A;  3KUF A;  3L2Q A;  3CCV T;  1VQ7 T;  4C92 C;  1Q81 U;  4N4H A;  2RJE A;  1BIB A;  2XKO C;  4PJO D;  3QJ6 A;  2QA4 T;  2RHY A;  4M7A D;  3X20 B;  4J6W A;  2E6N A;  2HNI A;  2MWO A;  5C6S A;  4LDV A;  4C0G A;  5GMK l;  2KK4 A;  1N9S A;  2K4Y A;  3LX7 A;  4M75 A;  3SWN B;  3OSS C;  5KE2 A;  1VQP T;  2QXF A;  3EFR A;  5FRM A;  1KQ1 A;  2EWN A;  2DXC A;  2EQM A;  3LLR A;  5FRN A;  4B9W A;  3LWI A;  1NZ9 A;  4MML A;  4XQ3 A;  5D6X A;  3OW2 S;  1QW1 A;  1O9S A;  1UGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...