4C8QB

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qB00
1N9SA 5GAMf 4M7DG 3BDUA 3BY7A 4XTZA 2DVEA 4Y91A 3JB9G 1U1SA 2E10A 4M75E 3V7CA 2QTXA 4C8QG 4XU3A 3L2ZA 3BW1A 5I21A 5GMKl 5LJ3e 1YCYA 3QO3A 2E65A 4C92C 4XU1A 3JCMX 3SWNA 3JCMV 4A53A 4RCCA 3INZA 3JCMg 3V8LA 4M78A 1X01A 4M77A 4M7AC 4C92D 4WF2A 2DZ9A 5LJ3j 2DJZA 1D3BB 5LJ5f 3RERA 4HT9A 4PJOD 4M7DF 3HSBA 1WNLA 3FB9A 3JB9F 3GIBA 4C8QB 2DXTA 5LJ3f 1BIAA 5GAOn 3BFMA 4M77C 4XTXA 3RKWA 5LJ5j 3EFSA 5GANj 4M7AA 1Y96B 1U1TA 4EMHA 5GANg 4XQ3A 5GAN6 4C92G 5GMKj 5GMKe 5CAIA 2DKGA 2CGHA 3JCMe 3RKYA 4M75C 1JBMA 3PGGA 3SWNB 3JCMP 5LJ5e 4XU0A 4A54A 5GAOm 4EMKA 4M77B 5LJ5g 4M78B 2ZGWA 5GAMe 4M7DB 4M75G 3M4GA 4XTUA 5GAMh 5GAOp 3V7SA 2K57A 5LJ5d 3JB9J 2E64A 4M77D 4MMLA 3JB9D 3FIFA 1KQ1A 3JCMQ 2Y90A 3RKXA 2E41A 3SB2A 4N0AC 4QVCA 3RIRA 2RD1A 4J6XA 4M7DD 4PJOA 1N9RA 5GAOr 3JCMh 4M77G 4XTVA 4PJOG 5GAOq 2EJFA 2DTHA 4M77F 2DXUA 4M7AB 4C92F 5LJ5h 1LNXA 5GANh 5GANe 4XU2A 5GAN8 5DY9A 4XTYA 2HNIA 4PJOE 1I81A 3VU3C 5GAN5 1MGQA 4N0AA 4M78G 2DZCA 2VXEA 5GAN3 4PJOB 4F7UB 5GMKi 4M7AE 5GAMd 5GANd 1TH7A 2YLCA 3V8JA 2DTOA 1WQ7A 3FJPA 5GAN4 4F7UE 3JCMb 5GAMg 4OP0A 5LJ3h 5GAMj 3AHUA 2E1HA 4J6WA 4X9DA 3JCMd 1I4K1 3HFNA 4QVDA 3V7RA 1M5Q1 2EWNA 2EJGA 2YHTA 4M75D 4M7DA 4JRIA 4PJOF 2VC8A 3SWNC 5LJ3d 4F7UF 4M7DC 2FYKA 4C8QF 2EAYA 4NOYA 4JUVA 1Y96A 5LJ3g 1WQWA 4JRKA 3RUXA 5GMKh 5GAN7 4C8QC 1HXDA 4DQ2A 5GAOl 4C8QA 4EMGA 3JCMJ 2YLBA 5GMKm 4PNOA 4F7UA 2DTIA 4C92E 4HA8A 1M8VA 3EFRA 4J6YA 4NL3A 3JB9H 1D3BA 3QUIA 1B34A 3HFOA 4RCBA 4X9CA 3JB9I 4NL2A 2VXFA 5GANf 1LOJA 1BIBA 4EMKC 3V8KA 4V2SA 4C92B 4M7AF 4M75B 2RA2A 3L1AA 2RB6A 4J5YA 4HT8A 4PJOC 3QSUA 4F7UG 2I2LA 4M75A 4M78C 1WPYA 2DEQA 2RM4A 3JCMc 1H641 2EJ9A 4MMKA 3JCMW 4M7DE 1KQ2A 4M78F 4EMKB 3QHSA 4JLIA 4M78D 4XTWA 4C92A 2JN0A 1HK9A 4C8QD 1I5LA 1JRIA 4C8QE 3JCMf 4M75F 5GAN2 1B34B 4M7AG 4M77E 4M78E 2FB7A 1I8FA 4M7AD 1LJOA 3RESA
chains in the Genus database with same CATH superfamily
4K11A 1VQ4Q 1X27A 3CCQA 1WHLA 1D0ZA 4A4HA 2DD5A 3CCSQ 3JCMV 3JCMg 2KRNA 3PT9A 2RH2A 5LJ5f 2YUPA 3M54A 5A0GA 4OB0B 2LQWA 3EFSA 1SKUB 4PL6A 5GAN6 5GMKe 4L5GA 2K5FA 4QVZA 4DEYA 3D7SB 5LJ5g 1WHHA 2V8IA 1P92A 3JCMQ 3KXTA 4J6XA 3VRZA 9ATCB 2DX1A 3VS5A 5GAOq 5LJ5h 2R5AA 4HVUA 3HRTA 1GCQC 1UGRB 3URGA 4BY6C 2JJ9A 5CKFA 2DRKA 3V8JA 2KRMA 2CP3A 3TSZA 1VQ5T 3CMAT 1UFFA 3V7RA 1IHVA 4WCIA 4IUQA 4OMPA 2VC8A 2DILA 4ELYC 4LDYA 4AG1C 2D9TA 4Z8AA 4A4EA 4F14A 2PTKA 1GFDA 3GLXA 3G71Q 1Q81C 2YT6A 1LOJA 1BIBA 2FRYA 1PSFA 2RI5A 5AYFA 1MMNA 4MZMA 1VQMT 1T3SA 2DIGA 3EG0A 1WHMA 4Q5WA 2X4XA 1M30A 2XDPA 3CBOA 3J80E 3KFVA 3G6EQ 1PRMC 4B6MA 2NUZA 2L2PA 2SEMA 5GAN2 1BU1A 1KIKA 1NM7A 3OYLA 4JRQA 1RUWA 1M1GA 2WSFE 4RMOA 1I1JA 2Y4XA 3I5RA 1BYMA 5A0LA 1ZUYA 1FMKA 2K6DA 3MJXA 5CCAA 2EKOA 4RUGA 2YDLA 2ROTA 3ZEHA 1R0CB 2NUTA 3CQTA 3M58A 1AOJA 5LJ3f 4II1A 2L3PA 2K3YA 1OYXA 1YI2Q 1VQKT 5GAOm 2J6FA 2CH4W 2HSEB 5AT1B 3I5SA 2JS0A 4KUDK 5LJ5d 2E64A 4M77D 4PLIA 2Y90A 4PFZA 4XTVA 1VYUA 4PJOG 2ZPFB 2DTHA 1IGUA 3E2UA 3JSCA 1DJ7B 3TSWA 2RO0A 3ASKA 4LDVA 4LN2A 1OULA 4M7AE 3S6WA 1WQ7A 2PNIA 2XK0A 2OX7A 2HCKA 1FYNA 2YWWA 3HFNA 3A8GB 5I22A 2DBMA 2OTJT 2EAYA 3U23A 4KBMB 1QW1A 2XG8D 1QCOA 5GAOl 1KSWA 1OZ2A 4C92E 2LT4A 3I56Q 2DL4A 2ED1A 4Z02A 1VQLA 3CCJA 2DJQA 1KC8C 2EFIA 3E19A 1NYFA 2ABLA 5IT9E 3NGPA 3PIOA 2QDLA 2JOYA 4BB7A 2EJ9A 2ED0A 4E7KA 2J06A 2I0NA 3G6ET 2M0YA 2DL8A 1M1KC 2M0OA 3UWNA 1I8FA 4D6WA 1LJOA 5IHIA 3UF4A 4KT0E 2X4YA 3X25B 3L2ZA 1YJWA 4XK8E 5FWCA 1UG1A 1X6GA 4JRPA 3O5ZA 2DE0X 2F69A 5LJ3j 3X20B 2QAZA 3NTKA 2XICA 3RERA 5J3BA 3QKJA 1WNLA 5C0MA 3G7ZA 2DFUA 5HK3A 4MZPA 1ABQA 2AZSA 2PVGB 1T0JA 2ENMA 5A0DA 1XQHA 1MUZA 5J26A 1RAHB 2JZ2A 3CC4A 1SPKA 5GAOp 3S3MA 2HMAA 2BZ8A 2QQBA 3FEOA 1ZLMA 2LCCA 2HAXA 1N5ZA 5CQXA 4E2FB 3I56A 4PK4A 4AMCA 3HKSA 1WHJA 3J81E 1QVPA 3EFOB 5FRNA 2EGEA 4JJBA 3CMAQ 1M27C 1TH7A 1TS9A 1VIFA 2BE7D 2YLCA 3SFMA 4OMNA 2QA4T 3AHUA 2GNCA 1I07A 4Y92A 2KI7A 1BK2A 2EJGA 4PJOF 4OMMA 5HKCA 2LT1A 5KYXB 1AWWA 3X24B 2COZA 1RACB 5GAN7 1AVZC 2K7AA 2KQWA 1ZBJA 2K2MA 2GGRA 1YHQQ 3LWIA 5KYNA 3ZL7C 2X3WD 1QKWA 1OV3A 2JTEA 3CMEQ 2COYA 1M3BA 1GXIE 4M78C 4A4GA 2JTMA 4C0GA 1KD1R 1NZ9A 4MMKA 5D6XA 4M78F 3CC4Q 2M1HA 4XTWA 1K9AA 3CCMT 3VS0A 2CP0A 3JCMf 1AZEA 1ZUUA 1M90R 3C12A 4MDWA 4ORZA 2FB7A 1PHTA 4DBHA 3PE0A 1YJNT 1BI0A 4M75E 4ZGJB 3LH0A 3CXCA 3REAB 3M59A 3OYAA 3A8LB 4CI0C 1H3HA 4FYXB 2QDYB 3CCRQ 3FB9A 3M57A 4ZGDB 1VA7A 3BFMA 3AT1B 5GANj 1D09B 3VS1A 1VQOT 1M2VA 2AK5A 1VQPT 3MPUB 2K79A 4CC7A 5GMKj 1VQ6Q 4OVAA 3NHNA 4KRTA 1BI3A 4EMKA 5KE2A 1AT1B 3TREA 1B3QA 1N27A 2RNAA 5CKEA 3CMEA 2LQNA 3ER0A 3CCMQ 2RN8A 1Q95G 3GP8A 3N5BB 1A0NB 5CK9A 1LPLA 2ROLA 2EJFA 4C92F 5A2QE 1WLPB 1V1CA 3GNFB 1GBQA 5LL6S 1RAIB 4F7UB 4MDXA 1V76A 2RI3A 3OYHA 3CC7A 1K0XA 2KXDA 2E5QA 2OTLA 3VJPA 5CIUA 1UB4A 1M90U 2RJCA 4YTLA 3CCET 2YXYA 1Z9QA 4FT4A 4JRIA 4M7DC 4PFPA 2DERA 2DBKA 2DLPA 2YLBA 4F7UA 3CCVT 2CT4A 2RHIA 4J9CA 1QVGA 1ZBXA 2QK0A 3CPFA 4HXJA 2NUPB 1VQ7T 1X69A 1D0YA 3LH5A 1O75A 3QWYA 4IUPA 1VIEA 2A7YA 4ESRA 4P5NA 2DEQA 4AFSC 3UPUA 2LQ8A 3CPWS 4M78D 3PNWC 4PLLA 2DM1A 4QT7A 1YHQA 1OZ3A 3HP9A 1HJDA 2V1QA 5I2MA 4A53A 3BDUA 5M9OA 1JQQA 2QTXA 1EFNA 2LC4A 3S3OA 2M02A 3THKA 3UT1A 3C95A 5KYUB 1XNIA 1S72A 1K0SA 3OSSC 2ZCFB 2DZ9A 1M1KR 4KULA 2DJZA 3OYEA 4PJOD 2OTJQ 2QG9B 2J05A 4AFUC 1WX6A 4HVVA 4PJJA 1XTDA 3WXMB 3EH1A 1KC8R 3TEEA 5GAMh 3EGXB 3H0FA 2LMJA 3P8DA 1S72Q 2KR3A 3UA6A 2G3RA 4OMLA 2LJ0A 4DA4A 1TWBA 4DOWA 1H3ZA 5CKBA 2RK1A 1UGQB 2RPNA 1K73R 1IXDA 1C1AA 2WACA 1I5OB 4J6WA 1PSEA 2IVWA 2LCSA 5FLXE 2AIRB 1Z9ZA 1VQ7A 1KHIA 1QP3A 2PU9B 4AFQC 1RAFB 3H9NA 3SWNC 4J7FA 3H0IA 2EPDA 1WJRA 4JRKA 1QVGP 2F2WA 3PTAA 3E9FA 1H92A 4EMGA 2JUFA 2P84A 2CZ0B 5L8RE 2KBTA 2HQHA 4X9CA 1YITA 3V8KA 3EGDB 4FSXA 2COWA 3L1AA 2RB6A 1W2BP 1F1BB 1X6BA 3L2VA 1SF9A 1C0MA 1W70A 3HRUA 1G3TA 3LYIA 1G5VA 4LDXA 2EW3A 3E1SA 4JLIA 1VQ8T 1I5LA 1YWPA 1PWTA 2KDSA 4CC4B 1RABB 3RNJA 1JJ2P 1LVKA 4ZN1A 4XTZA 1FXXA 4A4KA 3BW1A 1MV0B 1CSKA 4XU1A 1JO8A 3PMTA 2NLUA 1YJ9A 1M1KU 1TTHB 3PVLA 2A0FB 3M56A 4M7DF 1N6AA 5FU6B 4DOVA 1PD0A 4M77C 4D8DA 2FZKB 2D8HA 2KNBB 4C92G 3UDCA 2NUTB 5FU6C 5LJ5e 4A54A 3CC7Q 4M7DB 4D8KA 2HKNA 4EPCA 2LX7A 1X75C 2KY9A 3PFSA 1E6HA 2NWMA 4XU2A 4XTYA 2HNIA 2V1RA 2KXCA 4QQGA 1JEGA 2YSQA 2RHYA 4FW1A 2FO0A 1Q82C 1Y57A 2E1HA 4RTYA 3TU4K 3RDVA 1VQOQ 1TXQA 1WHGA 2E6NA 2QYZA 1Y71A 3PMIA 3G1JA 3REBB 3CCLA 3H41A 1YJWT 1EZZB 2CP2A 2XDBA 2XHCA 4Z88A 4J8OA 1RI9A 2Y4YA 2A36A 2LCLA 5IN1A 3A5ZB 1NJIC 4CC2A 4NL2A 4EMKC 3G6EA 3FC3A 1KQSA 2RHXA 2DIQA 4ZTFA 2W10A 2HD0A 3CCRA 3EGUA 1KQ2A 1M2VB 2EQKA 2EYXA 2P4RA 4ELZC 1HK9A 5IH2A 1CKBA 4TVRA 3CBMA 4L59A 2D0NA 2YRVA 4JPBW 1D1AA 3L2QA 3VYHB 1Q86C 1K9MC 1XJWB 4M78E 4FU6A 2QA4A 2MK5A 2O01E 2E10A 2C0IA 3NMZC 3VS4A 3VYGA 4QKUA 3JAME 2LZ6B 4OB3B 1SHGA 4M7AC 4LD6A 2MYSA 3J7AF 1WXBA 2ZPIB 1PCXA 1IB8A 2E70A 3R6NA 3GBQA 5L23A 4LDUA 2F5TX 3CCRT 3V7SA 2EGCA 4MMLA 4EDUA 1ACMB 3JCMh 1K1ZA 3CCUA 4M77F 2GQVA 4R0KA 3OS1A 3VRYA 1Q81R 4C5GA 5GAN3 3M9QA 3HRSA 4BE0A 1Y07A 4FL6A 1WA7A 3JCMb 2OAUA 1X2KA 3QBYA 3CCUT 2DVJA 3HPWA 1NG2A 2VGMA 3MO8A 4C5EA 2H3JA 4HVWA 2VWFA 2W0ZA 4NOYA 1VQNQ 1Y96A 3OSVA 3OA6A 3OW2P 4GLKA 2PUKB 4ATOA 5GMKm 2L0AA 4HA8A 1TSFA 1IO6A 2EVRA 2R57A 2JTFA 2MI6A 1BCMA 2VXFA 1KQSS 4BY6B 3LGLA 3P8HA 4C92B 2RA2A 3L2RA 3MP6A 1IZ6A 3G71A 1QVFS 2OAWA 3L2WA 2LVMA 1VQ9Q 3OS0A 2RHUA 2PVOB 2O4XA 5FRMA 4J9GA 3RESA 4M7DG 3CC7T 2E12A 3BY7A 2OTJA 4Y91A 4C8QG 1VQKA 1PRLC 1OI1A 2NYSA 2XMFA 2VVKA 5FU7C 1NPRA 3CXCS 3OYBA 4M78A 2A3LA 2D6FA 4WF2A 2QQ9A 1VUBA 3QIIA 3C4SA 4IIOA 3ZBDA 1IREB 3HSBA 2GF7A 2CUDA 2XKOC 2KSSA 5LJ5j 4JS5A 1BB9A 2EKHA 3OS2A 3A98A 1TOVA 1K9MU 4M78B 5KYYA 4M75G 3ULRB 4IUVA 1ZSZB 3JB9D 5DLQE 4BACA 2RD1A 4PJOA 1KJWA 4F04B 1NBEB 4JZ3A 2BIVA 5CVIA 4C5HA 1QCNA 1G3WA 1ZSZC 1OPKA 1V29B 2QXFA 1U06A 1GCQA 3QYGB 3G4ST 5LJ3h 2HDAA 4J9DA 4JS4A 1YI2T 1UEBA 2K4YA 4C0DB 5D6WA 2WSCE 4X1VA 5LJ3g 2DMOA 3GPLA 2VV5A 3G4SA 1VQPA 4E47A 4XAXB 3OYDA 1UGPB 1M4ZA 3M0TA 1FMWA 2VKNA 2CUBA 2XI9A 2DO3A 2VUBA 2KYMA 1R8OB 1TU0B 1BI2A 1YITQ 4J9BA 1SHFA 1U5SA 4OF1A 4VUBA 3QJ6A 4C8QE 1S72T 3SD4A 1NPPA 3EG2A 3H6ZA 2MCNA 4M7AG 3OYNA 3OMGA 2DA9A 1AHJB 2DXCA 2E65A 4JLGA 2RF0A 3SHWA 1K8AR 2QQSA 2FPDA 5KYYB 2XDDA 1PD1A 1IRXA 2ZAEA 3CCVQ 2HBWA 4OB2B 2E4HA 3CC2Q 4LE9A 2CP7A 3MEAA 2XIDA 2DXTA 3M0PA 1JXOA 1KG1A 3VS6A 2LQKA 4PJNA 2VB6A 2GCXA 3E9GA 2CS7A 3HL8A 1FX7A 1VQ7Q 1JBMA 2K9GA 3PGGA 2R5MA 3JCMP 1WXTA 2LRQA 2ZGWA 3PIPA 4XTUA 2GTOA 1Q86U 3CCSA 1VQ8A 2QTVA 1OPLA 5GAOr 1YITT 2ECZA 3LX7A 1KD1U 5FW9A 2HL3A 1RLPC 2V8KA 3M53A 5GMKi 2PUOB 4WTOB 2QGFB 5GAN4 3O8VA 3WVEB 4J83A 4RTTA 2QEXA 1YFNA 4KH1B 4ZNXA 1ZUKA 2RK2A 1SSHA 5I2SA 1K8AC 2L89A 4KH0B 1NEGA 1UGVA 1TG0A 2J6OA 4QQ6A 3JCMJ 2V26A 1Q82U 4NL3A 1D3BA 2B8AA 1UE9A 2J6KA 3JB9I 5GANf 4V2SA 4N4IA 3NFCA 3CCLT 2YUOA 1BBZA 4F7UG 3CPWP 2CT3A 2MWOA 1FMVA 2MMPA 1N8RU 1M3CA 2EGAA 5IHNA 3VS7A 3CC4T 4RTVA 2J7IA 2CKKA 2X35A 1UGSB 2SRCA 3WVDB 3CD6A 3M4YA 3OY9A 1ZSZA 1OQKA 4KUIA 3RBBB 1XOVA 3CCVA 3M5AA 3FRNA 3V8LA 4RG2A 4FM4B 4KGZB 3CD6T 4HT9A 2JS2A 1QLYA 2KVQG 2H8HA 3OYJA 3OYKA 1T3LA 2KYBA 2PQWA 1VQMQ 4EIKA 4M77B 2LP5A 1YHQT 2KT8A 2LNVA 3CCJT 3DKMA 2L3QA 3A1PA 3CCQT 3X26B 2HSPA 3QXEB 3CCJQ 1ZHIA 3LLRA 5GANd 3SDZA 3CCUQ 2KGTA 2A08A 5GJWB 3KBGA 1VQMA 1U8RA 3ZFJA 2X51A 4BI3A 4LNPA 3EGDA 3OYMA 2FYKA 5EG2A 2O31A 2RQWA 2PZ1A 3OMCA 2P0PA 3CD6Q 4DQ2A 1KK7A 4PNOA 3A8MB 3DB4A 4BD3A 2DTIA 4J6YA 1PKTA 2LTOA 3QG1A 2B86A 4KGXB 4RKUE 1W2BA 5KE3A 1W1FA 4ZGEB 2RHZA 3OS5A 4HCZA 2CDTA 4M7AF 2HBPA 7AT1B 2RQRA 2MOXA 4PJOC 1VQ6T 2O9SA 2FRWA 1Q7YR 3OYYA 4RTUA 3FJ5A 4EMKB 2EIFA 2M16A 5HK0A 4J9EA 4IKFA 3GOXA 1VQ4A 4GBQA 1PG5B 5CQYA 1Y7XA 1KHCA 2QGGA 3CMAA 4PJLA 3KUFA 1VOMA 3RMQA 4M7AD 4R55A 4DBQA 1OX8A 3ME9A 1M3AA 1OOTA 5CKDA 4XU3A 5GMKl 2L5QA 1YCYA 4ME7A 3FLGA 3RR6A 4Y28E 2QASA 4IUUA 3INZA 1VQLT 2CZ6B 2EYYA 1HSQA 5IHKA 2XU8A 5ECAA 5EC7A 3JB9F 4BUGA 3RKWA 3HTRA 2DL3A 4FW2A 2X9HA 3I35A 4OMOA 3CCLQ 2IG0A 3RKYA 2AKKA 4J7IA 4ANJA 2FEIA 4XU0A 3H0HA 3C94A 3M4GA 1X6OA 4RG8A 3RKXA 2E41A 4QVCA 1N9RA 2ZPEB 3M55A 1GFCA 2H3EB 5GANh 5GAN8 5DY9A 1MGQA 1PNJA 4N0AA 1YJ9T 3UATA 4JJNK 2FG0A 2DL5A 3I55A 4J9IA 1G83A 1NLOC 5GAMj 5IXBA 2X4JA 4M4ZA 2K2VA 3QWXX 2JM9A 2JT4A 2JW4A 4F7UF 4UC4A 3A8OB 5KH6A 1G3YA 2E6ZA 3NPFA 1WJSA 2YUQA 3R6OA 2DF6A 2GQIA 1ZQ1A 2G6FX 1VQKQ 3JB9H 3QUIA 1QQJA 4FYWB 2EQUA 5DLOA 3I56T 1ZX6A 2Z0WA 3L42A 2I2LA 4R56A 1WPYA 2C0OA 1TUGB 1JXMA 1ZA2B 2O9VA 3OW2A 1R0BG 4C92A 1YBYA 1VYTA 2EQMA 2MF2A 3QYHB 2MPXC 2CREA 4CRIA 1NYGA 2FVUA 1WHKA 2EQJA 2DAQA 1MNDA 6AT1B 1OX9A 3MEWA 3OYFA 1YI2A 2KROA 4X34A 2HQXA 4FIBA 1D0XA 3SWNA 1QMCA 4C0DC 3CC2T 1X01A 4AT1B 2KRSA 3MKDA 4IUTA 5HY6A 2F1LA 4C8QB 1BIAA 4RTWA 3EFOA 2RQUA 2VASA 4OGCA 1PKSA 2JMAA 1MV3A 2CGHA 3MHXA 2AZVA 3SWNB 1M9SA 1UDLA 3G71T 2DPPB 8AT1B 5KYUA 1GL5A 3FIFA 3TCJA 4N0AC 1IGQA 2KEAA 1JB0E 3HHTB 1T0HA 1X2QA 3VU3C 4M78G 2DZCA 2VXEA 4F17A 3VUZA 2D8JA 2C06A 1R77A 1K9MR 2HEQA 4OP0A 1YJNA 5IAYA 2DD4A 4IIMA 2E5KA 4X9DA 1QWEA 1GBRA 4QVDA 1M5Q1 2FZCB 3M0RA 2EYWA 1G8XA 4M7DA 4E6RA 2GFAA 3M0SA 5FROA 2EBPA 2CZ1B 2BZYA 4PFOA 1QVFA 1HXDA 4C8QA 3LW5E 3MEVA 1Y0MA 1KQSP 3VS3A 4RCBA 2KAFA 3HFOA 4LUDA 1MHNA 2LX9A 1O9SA 4HT8A 1VQNA 4GLMA 2RM4A 1NE8A 1H641 4MZTA 4GY5A 2JN0A 2L3SA 3H8ZA 3BE3A 2EYQA 2CSIA 4M77E 4A4FA 1SRMA 4QQDA 2FZGB 1VQOA 1K73U 2XD0A 2KMTA 3JB9G 3V7CA 1ARKA 5LJ3e 3QO3A 3VKIA 3OBYA 2RQVA 2FPEA 3EAEA 1VQ5A 4RCCA 4F16A 1WJQA 3X28B 4JDSA 3JV3A 1AD5A 1UJYA 3L2UA 3EG3A 1WFWA 1VQLQ 2DK3A 2P4TA 1BCOA 4XTXA 3MEUA 3QDFA 1W2BS 2P0KA 4EMHA 3NTHA 2KK4A 4XQ3A 1HYOA 1NLPC 2AKLA 4IURA 4LXCA 3I55T 4M75C 2D1XA 2LJ1A 3OYGA 1SSFA 2BTTA 2K57A 2FPFA 2CSQA 3DB3A 3RIRA 4M7DD 2L3RA 4J9FA 2PVDB 2ZPHB 2QEXT 4A63B 1K8AU 4M7AB 2HZYA 1C6VX 2X3XD 2NUPA 4PJOB 1RI0A 3MCAB 3VS2A 2DTOA 3PVQA 1OEBA 1I4K1 4C0FA 2ZZDA 2JXBA 4ZN3A 4JZ4A 4JUVA 2QI2A 1VQNT 4E7SA 5KYWA 2K5IA 1UECA 4NS5A 1NEBA 2DYBA 1AEYA 1UUEA 4C5IA 3CMET 2FL7A 4HKEA 5I11A 4HCCA 3P8BB 2MAMA 2OTLQ 2OJ2A 2RJDA 3LGFA 1U3OA 4LDWA 4C0ZA 4JJCA 3QSUA 2K5LA 4M7DE 1OU9A 3QHSA 3CBPA 2GTJA 2F2VA 5C6SA 3CCEA 2EYZA 5GAMf 2VYTA 3GF5A 3EG9B 2DVEA 1U1SA 5I21A 3TVTA 1VQ4T 4C92C 3MP8A 3SEMA 5D7UA 1UHFA 2ZPGB 1D3BB 3OBWA 1PM3A 1YJWQ 1N8RR 3QDRB 5GAOn 3NTIA 4M7AA 2EQIA 1Y96B 1FWZA 1U1TA 2X4WA 2O4XB 1AWJA 1QVGS 3QJYA 2DKGA 4AFZC 5CAIA 2IIMA 5J39A 5GJVB 3GIBA 3I9QA 1MMAA 1W4SA 2CYZB 5FU7B 3QZ5B 3EH2A 2GFUA 2BKDN 5GANe 1K73C 4HCBA 1N8RC 4Z89A 5KYWB 1I0CA 8ATCB 2ATCB 2VGNA 1YN8A 1S1NA 2K3XA 3G4SQ 4B9XA 4F7UE 2WSEE 1JJ2S 2GBQA 1E7OA 1RADB 4B9WA 1Q81U 1VYVA 4N4HA 4O6JA 1AWOA 3EHRA 2R58A 1NJIU 1NJIR 1UHCA 2E3HA 1WQWA 3DLMA 3RUXA 2MIOA 5GMKh 3M0QA 2HQEA 4BI8B 2DL7A 1YWOA 1EX4A 4PJMA 2CP6A 1M1FA 3OQ5A 1SG5A 5DM7R 2QA4Q 4E7LA 4J9HA 1GCPA 2ZPBB 1MMGA 1QKXA 2A28A 2A37A 3OYIA 4J5YA 1G2BA 4QW2A 1YIJQ 4M75A 1YNZA 2E3IA 2DRMA 3CPWA 1VQ8Q 2RI2A 5FWBA 5D6YA 2D0QB 4DBRA 2IPOB 1QP2A 1N9SA 1WZOA 2F5KA 1M2OA 4FT2A 1RAGB 2KT1A 4E7JA 2JMCA 3DLLA 2BZXA 4FYYB 2V8JA 3OW2S 2C0TA 2YUNA 4HCKA 4M77A 4C92D 1TUCA 1Q86R 4E7HA 2DETA 1Q7YU 4BE2A 3UA7A 1B07A 1PC0A 1BI1A 3LWHA 3BDLA 2RMOA 4LD9K 3JCMe 1QVFP 2M9UA 2JM8A 5GAMe 4PKCC 5KCHA 3JB9J 1KQ1A 1ABOA 1WIEA 2BUDA 4M77G 2JNGA 2RJEA 2DXUA 2QQAA 1X43A 1LNXA 1RLQC 2RQTA 3A8HB 2O2OA 4LUEA 4PJOE 2OI3A 3F70A 1RL2A 5CR2A 2BE9B 1KC8U 5GAMd 3CXCP 2CP5A 1BKBA 1GRIA 3JCMd 2F2XA 2YHTA 2L8DA 4M75D 4DBFA 5LJ3d 4RTZA 3QZ9B 4E7IA 2DNUA 1EIFA 4AG2C 1JU5C 3EG9A 3EFRA 2CZ7B 3FDRA 1ZSGA 1B34A 2LDMA 1RAEB 1VQPQ 1JJ2A 1LCKA 4OB1B 3CCQQ 4BE1A 1UJ0A 3JCMc 1TUDA 3JCMW 1Q7YC 5CKHA 4RTXA 4C8QD 3JRZA 1VQ5Q 4ZTJA 5HCKA 2LNHB 1B34B 3OYCA 1KFZA 1CKAA 3IQLA 1QCFA 5KCOA 4E7ZA 1YJ9Q 3GNGA 1G3SA 4L6V5 1UTIA 4FYVB 4FSSA 2OTLT 1QWFA 2HKQB 3JCMX 2HL5C 4OGEA 4KGVB 2DXBA 3C0CA 4OMFB 3M0UA 2QQRA 4BDZA 1VQ9A 4FCYA 1M8MA 3TQ7P 3QPHA 5GANg 2P0QA 3RMSA 1YIJT 1YCSB 3EHQA 4N4GA 3EG1A 3CCMA 2AT1B 1VQ9T 5CO7A 2RJFA 3SB2A 1AWXA 1K4US 4DEXA 1SRLA 1J3TA 1YP5A 2KE9A 1SEMA 1I81A 5GAN5 3T9NA 1YJNQ 5IXFA 2DEUA 1OU8A 1ZA1B 3FJPA 2O88A 3EGXA 5GAMg 1RAAB 4BI4A 3META 1VQ6A 2FHDA 2EWNA 3CC2A 4CC3A 1WYXA 1D1CA 1E6GA 2ESWA 2MWPA 2AHJB 4BDYA 1HD3A 4C8QF 1WGSA 1MNEA 1M90C 4C8QC 1B7TA 3CCEQ 3Q1JA 1D1BA 1WXUA 3VUBA 1WI7A 2JVVA 1M8VA 1AZGB 2DYIA 3CEYA 1YIJA 2CH4A 4O5VA 2K3BA 4OMQA 1WDXA 3I55Q 4M75B 2YRCA 1Q82R 3S3NA 1KD1C 1H8KA 1K76A 3MP1A 3OB9A 2QEXQ 1JRIA 1W6XA 2LJ3A 2M51A 4M75F 2YRDA 4JJDA 1IHWA 3VV0A 5KYXA 1MMDA 3CCST
chains in the Genus database with same CATH topology
3BDUA 5M9OA 2XD0A 2KMTA 3JB9G 1AHJB 3V7CA 2QTXA 3CCQA 2DXCA 2LC4A 5LJ3e 3S3OA 4A4HA 3UT1A 3QO3A 2E65A 3C95A 3VKIA 3OBYA 4JLGA 2DD5A 1S72A 1XNIA 3JCMV 3EAEA 1VQ5A 4RCCA 3JCMg 2QQSA 1WJQA 3X28B 2XDDA 3PT9A 3OSSC 4JDSA 2ZCFB 2DZ9A 4KULA 2DJZA 2RH2A 4OB2B 3OYEA 5LJ5f 4PJOD 3M54A 3MEAA 2XIDA 5A0GA 3L2UA 4OB0B 2DXTA 2DK3A 2P4TA 1KG1A 4XTXA 3EFSA 2LQKA 3MEUA 1W2BS 2P0KA 4EMHA 3NTHA 4PL6A 2GCXA 2KK4A 3E9GA 4XQ3A 2CS7A 5GAN6 3HL8A 5GMKe 4IURA 3I55T 1FX7A 4M75C 1JBMA 1XTDA 4L5GA 2K5FA 3PGGA 2R5MA 4QVZA 3JCMP 3WXMB 3OYGA 2LRQA 3TEEA 2V8IA 1SSFA 2ZGWA 5LJ5g 3PIPA 5GAMh 4XTUA 2K57A 1P92A 3P8DA 1K73U 3JCMQ 3DB3A 1Q86U 3KXTA 3CCSA 1VQ8A 3RIRA 4J6XA 4M7DD 2L3RA 2G3RA 5GAOr 1YITT 2PVDB 2ZPHB 3LX7A 5GAOq 2QEXT 1K8AU 1KD1U 4M7AB 5LJ5h 2R5AA 4DA4A 3HRTA 4DOWA 1UGRB 3URGA 1H3ZA 2V8KA 3M53A 5CKBA 2RK1A 4BY6C 4PJOB 5GMKi 5CKFA 1RI0A 3MCAB 2PUOB 1UGQB 3V8JA 2DTOA 5GAN4 3O8VA 3WVEB 2WACA 4J83A 4J6WA 1PSEA 2QEXA 2IVWA 1VQ5T 3CMAT 1I4K1 4C0FA 5FLXE 3V7RA 2ZZDA 4IUQA 1VQ7A 1KHIA 1QP3A 2PU9B 2VC8A 3SWNC 4ZN3A 2RK2A 4J7FA 5I2SA 1K8AC 4ELYC 4JUVA 4LDYA 1WJRA 2L89A 2QI2A 4JRKA 1VQNT 3PTAA 4QQ6A 3E9FA 2K5IA 4NS5A 4EMGA 2JUFA 3JCMJ 2D9TA 4C5IA 4A4EA 1Q82U 2CZ0B 3CMET 5L8RE 2FL7A 4NL3A 4HKEA 1D3BA 3GLXA 4HCCA 2B8AA 3P8BB 1Q81C 4X9CA 3JB9I 2MAMA 5GANf 1LOJA 1YITA 1BIBA 1PSFA 2RJDA 3V8KA 4N4IA 2RI5A 4FSXA 5AYFA 4V2SA 4MZMA 3LGFA 1VQMT 3L1AA 2RB6A 3NFCA 4LDWA 3CCLT 4C0ZA 2DIGA 3L2VA 4Q5WA 3QSUA 4F7UG 2X4XA 2K5LA 2MWOA 2XDPA 3CBOA 2MMPA 3HRUA 1G3TA 3J80E 4M7DE 3LYIA 1G5VA 3QHSA 3CBPA 3E1SA 1N8RU 4JLIA 4LDXA 1VQ8T 1I5LA 5C6SA 5GAN2 3CC4T 2KDSA 2CKKA 2X35A 3CCEA 1UGSB 3OYLA 3WVDB 4JRQA 1M1GA 5GAMf 2VYTA 2WSFE 3GF5A 3CD6A 4ZN1A 3M4YA 4XTZA 4RMOA 2DVEA 3OY9A 1FXXA 1U1SA 2Y4XA 4KUIA 1BYMA 5I21A 4A4KA 3BW1A 5A0LA 1XOVA 1VQ4T 3CCVA 4C92C 4XU1A 3M5AA 3MP8A 3PMTA 3FRNA 2NLUA 3V8LA 2EKOA 5CCAA 1YJ9A 4RG2A 1M1KU 2ZPGB 4FM4B 3ZEHA 1D3BB 3OBWA 3M56A 3CD6T 4HT9A 4M7DF 1N6AA 3M58A 3QDRB 5FU6B 4DOVA 2KVQG 3NTIA 5LJ3f 4II1A 5GAOn 4M77C 4M7AA 3OYJA 1Y96B 1U1TA 1FWZA 2X4WA 2O4XB 2K3YA 3OYKA 4C92G 1QVGS 3UDCA 2PQWA 1OYXA 2DKGA 3QJYA 5CAIA 5FU6C 5J39A 1VQKT 5LJ5e 4A54A 5GAOm 4M77B 1YHQT 4M7DB 4KUDK 5LJ5d 3GIBA 2LNVA 2E64A 4M77D 4PLIA 3CCJT 2CYZB 1W4SA 2Y90A 5FU7B 3QZ5B 3DKMA 4EPCA 1X75C 2KY9A 4XTVA 4PJOG 2GFUA 2ZPFB 3PFSA 2DTHA 3CCQT 2BKDN 3X26B 5GANe 1K73C 4XU2A 3QXEB 1N8RC 4HCBA 4XTYA 2HNIA 3JSCA 1DJ7B 1ZHIA 2RO0A 3ASKA 4LDVA 4QQGA 3LLRA 2VGNA 4M7AE 3S6WA 2RHYA 5GANd 3SDZA 2K3XA 1WQ7A 4B9XA 3KBGA 2XK0A 4F7UE 1Q82C 2E1HA 1VQMA 2WSEE 3ZFJA 1U8RA 1JJ2S 4BI3A 3HFNA 4B9WA 3TU4K 3A8GB 1Q81U 4N4HA 3OYMA 2E6NA 4O6JA 1Y71A 2FYKA 2R58A 3PMIA 1NJIU 5EG2A 2OTJT 2EAYA 1WQWA 3DLMA 3RUXA 5GMKh 3OMCA 1QW1A 2HQEA 2P0PA 4KBMB 4BI8B 1YJWT 2XG8D 4DQ2A 2XHCA 5GAOl 2XDBA 1M1FA 1OZ2A 3A8MB 3DB4A 3OQ5A 2DTIA 4J8OA 4PNOA 4BD3A 4C92E 2Y4YA 4J6YA 2LT4A 5DM7R 4E7LA 2LCLA 5IN1A 3A5ZB 2LTOA 3QG1A 4Z02A 3CCJA 1NJIC 4RKUE 1VQLA 2ZPBB 1W2BA 5KE3A 4ZGEB 4NL2A 2RHZA 4EMKC 1KC8C 2EFIA 3E19A 3OS5A 4HCZA 3G6EA 5IT9E 4M7AF 2HBPA 3PIOA 3OYIA 4J5YA 4QW2A 3FC3A 4PJOC 2JOYA 1KQSA 1VQ6T 2RHXA 4M75A 2DIQA 4BB7A 4ZTFA 2EJ9A 3CCRA 2HD0A 3OYYA 1KQ2A 4EMKB 2EQKA 4ELZC 2EIFA 2M16A 5HK0A 4IKFA 3GOXA 1HK9A 4E7KA 3CPWA 1VQ4A 2RI2A 4TVRA 5CQYA 3CBMA 4L59A 3G6ET 2YRVA 1Y7XA 1KHCA 3CMAA 1M1KC 5D6YA 2D0QB 3VYHB 3L2QA 1Q86C 3KUFA 4M78E 2M0OA 3UWNA 1I8FA 3RMQA 1QP2A 1LJOA 4D6WA 4R55A 4M7AD 1N9SA 4FU6A 3ME9A 4KT0E 2QA4A 2F5KA 2O01E 4FT2A 5CKDA 2X4YA 2E10A 3X25B 4XU3A 3L2ZA 3VYGA 4E7JA 5GMKl 1YJWA 2L5QA 1YCYA 4XK8E 3JAME 4ME7A 3FLGA 3DLLA 4Y28E 2V8JA 3OW2S 4IUUA 3INZA 4OB3B 1VQLT 4JRPA 2CZ6B 4M77A 4M7AC 4C92D 2F69A 5LJ3j 3X20B 4LD6A 3NTKA 2XICA 3RERA 5J3BA 4E7HA 3QKJA 3J7AF 2XU8A 1WNLA 5C0MA 2ZPIB 3G7ZA 1Q7YU 4BUGA 4BE2A 3JB9F 5HK3A 4MZPA 3RKWA 1BI1A 3LWHA 2PVGB 2E70A 3BDLA 4LD9K 2IG0A 3JCMe 3RKYA 5A0DA 1XQHA 4J7IA 2M9UA 5J26A 4XU0A 3C94A 2JZ2A 4LDUA 2F5TX 3CC4A 5GAMe 3M4GA 5GAOp 3S3MA 3CCRT 3V7SA 4PKCC 5KCHA 3JB9J 4MMLA 1X6OA 2QQBA 1KQ1A 3FEOA 4RG8A 2BUDA 2E41A 3RKXA 4EDUA 4QVCA 2LCCA 2HAXA 1N9RA 2ZPEB 5CQXA 3JCMh 3I56A 4M77G 2JNGA 3M55A 3CCUA 2RJEA 4M77F 2DXUA 3HKSA 2GQVA 2QQAA 1LNXA 5GANh 3OS1A 3A8HB 5GAN8 5DY9A 3J81E 1QVPA 4PJOE 3F70A 1RL2A 5CR2A 1MGQA 4C5GA 5FRNA 4N0AA 5GAN3 4JJNK 1YJ9T 3M9QA 1KC8U 3HRSA 5GAMd 3I55A 3CCLA 1TH7A 4BE0A 1Y07A 1VIFA 2YLCA 4FL6A 3JCMb 3SFMA 2QA4T 1BKBA 2OAUA 3QBYA 5GAMj 3AHUA 2X4JA 2K2VA 3CCUT 3JCMd 3HPWA 1YJNA 2EJGA 2VGMA 2YHTA 2L8DA 4M75D 3MO8A 4C5EA 4PJOF 5HKCA 2H3JA 5LJ3d 4F7UF 2LT1A 4UC4A 3A8OB 4NOYA 3QZ9B 1Y96A 3OSVA 3X24B 5KH6A 4E7IA 1G3YA 1EIFA 3OA6A 5GAN7 4GLKA 2E6ZA 1WJSA 2PUKB 3R6OA 2KQWA 4ATOA 5GMKm 1ZQ1A 4HA8A 3EFRA 2CZ7B 3LWIA 3JB9H 3QUIA 3FDRA 1B34A 2JTFA 2R57A 2EQUA 2LDMA 5DLOA 2VXFA 2MI6A 3I56T 1KQSS 1JJ2A 4BY6B 3LGLA 3P8HA 4C92B 4OB1B 2RA2A 1GXIE 3L42A 3L2RA 3MP6A 1IZ6A 2I2LA 4M78C 1WPYA 4A4GA 4R56A 2JTMA 4C0GA 3G71A 4BE1A 1NZ9A 1Q7YC 3JCMc 4MMKA 3JCMW 1QVFS 5D6XA 4M78F 5CKHA 3OW2A 3L2WA 2M1HA 2LVMA 4XTWA 1YBYA 4C92A 2EQMA 3QYHB 2MF2A 4C8QD 3OS0A 3CCMT 3JRZA 3JCMf 4ZTJA 1B34B 2RHUA 2PVOB 3C12A 2O4XA 4MDWA 4CRIA 3OYCA 5FRMA 2FVUA 2FB7A 2EQJA 2DAQA 3RESA 5KCOA 4M7DG 3CC7T 3GNGA 1YJNT 2E12A 3BY7A 2OTJA 4Y91A 3MEWA 3OYFA 1BI0A 4M75E 4C8QG 1G3SA 4ZGJB 4L6V5 1YI2A 3LH0A 4X34A 1VQKA 1OI1A 3CXCA 2HQXA 4FIBA 3M59A 2OTLT 3OYAA 5FU7C 3JCMX 4OGEA 3SWNA 1NPRA 4C0DC 3CXCS 3OYBA 3CC2T 4M78A 1X01A 2A3LA 2DXBA 3A8LB 4CI0C 2D6FA 4WF2A 2QQ9A 1VUBA 3QIIA 2QDYB 3C4SA 4IUTA 3ZBDA 1IREB 3HSBA 2GF7A 5HY6A 4OMFB 2XKOC 3FB9A 2KSSA 3M57A 2QQRA 4ZGDB 4C8QB 4BDZA 1BIAA 1VQ9A 3BFMA 5LJ5j 5GANj 3QPHA 4JS5A 5GANg 2P0QA 4OGCA 1VQOT 3RMSA 1VQPT 5GMKj 1YIJT 2CGHA 3MHXA 4OVAA 4N4GA 3OS2A 3SWNB 3CCMA 1M9SA 1K9MU 1BI3A 4EMKA 5KE2A 3G71T 3TREA 4M78B 1N27A 2DPPB 4M75G 5CKEA 3CMEA 3ER0A 1VQ9T 4IUVA 3JB9D 3FIFA 5CO7A 2RJFA 3TCJA 3GP8A 5DLQE 3SB2A 4N0AC 3N5BB 4BACA 2RD1A 4PJOA 5CK9A 1JB0E 3HHTB 2BIVA 2EJFA 4C92F 5A2QE 5CVIA 3GNFB 4C5HA 1G3WA 1I81A 5LL6S 3VU3C 5GAN5 3T9NA 4M78G 2DZCA 2VXEA 3VUZA 4F7UB 4MDXA 2C06A 1V29B 2RI3A 3OYHA 2QXFA 3CC7A 3FJPA 2E5QA 3QYGB 4OP0A 5IAYA 5GAMg 2DD4A 5LJ3h 3VJPA 5CIUA 3G4ST 1UB4A 2OTLA 4X9DA 1K9MC 4JS4A 1YI2T 1UEBA 2K4YA 4C0DB 1M90U 4QVDA 4BI4A 3META 2RJCA 1M5Q1 2FHDA 2EWNA 4YTLA 3CC2A 3CCET 1VQ6A 4M7DA 4FT4A 4JRIA 2MWPA 4M7DC 2AHJB 2GFAA 4BDYA 4C8QF 5D6WA 1WGSA 2WSCE 5FROA 5LJ3g 2CZ1B 1M90C 4C8QC 1HXDA 1QVFA 3Q1JA 3GPLA 4C8QA 2VV5A 3VUBA 2YLBA 3G4SA 4F7UA 3CCVT 2RHIA 2JVVA 1QVGA 1M8VA 1VQPA 1ZBXA 3LW5E 3CEYA 3CPFA 3MEVA 4E47A 1YIJA 4O5VA 4XAXB 4RCBA 2KAFA 3HFOA 3OYDA 1VQ7T 1UGPB 1M4ZA 1MHNA 2LX9A 1O9SA 1O75A 2XI9A 2DO3A 4M75B 2VUBA 4HT8A 1VQNA 4IUPA 3S3NA 1R8OB 1VIEA 2A7YA 4P5NA 2DEQA 2RM4A 1BI2A 1KD1C 1NE8A 3UPUA 1H641 4MZTA 2LQ8A 3CPWS 4OF1A 4VUBA 3MP1A 4GY5A 3OB9A 4M78D 3PNWC 2JN0A 4PLLA 3QJ6A 1JRIA 4C8QE 3H8ZA 1S72T 3SD4A 4M75F 1NPPA 3H6ZA 1YHQA 2EYQA 1OZ3A 3HP9A 4M7AG 4M77E 4A4FA 3OYNA 3VV0A 3OMGA 4QQDA 5I2MA 4A53A 1VQOA 3CCST
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9S A;  5GAM f;  4M7D G;  3BDU A;  3BY7 A;  4XTZ A;  2DVE A;  4Y91 A;  3JB9 G;  1U1S A;  2E10 A;  4M75 E;  3V7C A;  2QTX A;  4C8Q G;  4XU3 A;  3L2Z A;  3BW1 A;  5I21 A;  5GMK l;  5LJ3 e;  1YCY A;  3QO3 A;  2E65 A;  4C92 C;  4XU1 A;  3JCM X;  3SWN A;  3JCM V;  4A53 A;  4RCC A;  3INZ A;  3JCM g;  3V8L A;  4M78 A;  1X01 A;  4M77 A;  4M7A C;  4C92 D;  4WF2 A;  2DZ9 A;  5LJ3 j;  2DJZ A;  1D3B B;  5LJ5 f;  3RER A;  4HT9 A;  4PJO D;  4M7D F;  3HSB A;  1WNL A;  3FB9 A;  3JB9 F;  3GIB A;  4C8Q B;  2DXT A;  5LJ3 f;  1BIA A;  5GAO n;  3BFM A;  4M77 C;  4XTX A;  3RKW A;  5LJ5 j;  3EFS A;  5GAN j;  4M7A A;  1Y96 B;  1U1T A;  4EMH A;  5GAN g;  4XQ3 A;  5GAN 6;  4C92 G;  5GMK j;  5GMK e;  5CAI A;  2DKG A;  2CGH A;  3JCM e;  3RKY A;  4M75 C;  1JBM A;  3PGG A;  3SWN B;  3JCM P;  5LJ5 e;  4XU0 A;  4A54 A;  5GAO m;  4EMK A;  4M77 B;  5LJ5 g;  4M78 B;  2ZGW A;  5GAM e;  4M7D B;  4M75 G;  3M4G A;  4XTU A;  5GAM h;  5GAO p;  3V7S A;  2K57 A;  5LJ5 d;  3JB9 J;  2E64 A;  4M77 D;  4MML A;  3JB9 D;  3FIF A;  1KQ1 A;  3JCM Q;  2Y90 A;  3RKX A;  2E41 A;  3SB2 A;  4N0A C;  4QVC A;  3RIR A;  2RD1 A;  4J6X A;  4M7D D;  4PJO A;  1N9R A;  5GAO r;  3JCM h;  4M77 G;  4XTV A;  4PJO G;  5GAO q;  2EJF A;  2DTH A;  4M77 F;  2DXU A;  4M7A B;  4C92 F;  5LJ5 h;  1LNX A;  5GAN h;  5GAN e;  4XU2 A;  5GAN 8;  5DY9 A;  4XTY A;  2HNI A;  4PJO E;  1I81 A;  3VU3 C;  5GAN 5;  1MGQ A;  4N0A A;  4M78 G;  2DZC A;  2VXE A;  5GAN 3;  4PJO B;  4F7U B;  5GMK i;  4M7A E;  5GAM d;  5GAN d;  1TH7 A;  2YLC A;  3V8J A;  2DTO A;  1WQ7 A;  3FJP A;  5GAN 4;  4F7U E;  3JCM b;  5GAM g;  4OP0 A;  5LJ3 h;  5GAM j;  3AHU A;  2E1H A;  4J6W A;  4X9D A;  3JCM d;  1I4K 1;  3HFN A;  4QVD A;  3V7R A;  1M5Q 1;  2EWN A;  2EJG A;  2YHT A;  4M75 D;  4M7D A;  4JRI A;  4PJO F;  2VC8 A;  3SWN C;  5LJ3 d;  4F7U F;  4M7D C;  2FYK A;  4C8Q F;  2EAY A;  4NOY A;  4JUV A;  1Y96 A;  5LJ3 g;  1WQW A;  4JRK A;  3RUX A;  5GMK h;  5GAN 7;  4C8Q C;  1HXD A;  4DQ2 A;  5GAO l;  4C8Q A;  4EMG A;  3JCM J;  2YLB A;  5GMK m;  4PNO A;  4F7U A;  2DTI A;  4C92 E;  4HA8 A;  1M8V A;  3EFR A;  4J6Y A;  4NL3 A;  3JB9 H;  1D3B A;  3QUI A;  1B34 A;  3HFO A;  4RCB A;  4X9C A;  3JB9 I;  4NL2 A;  2VXF A;  5GAN f;  1LOJ A;  1BIB A;  4EMK C;  3V8K A;  4V2S A;  4C92 B;  4M7A F;  4M75 B;  2RA2 A;  3L1A A;  2RB6 A;  4J5Y A;  4HT8 A;  4PJO C;  3QSU A;  4F7U G;  2I2L A;  4M75 A;  4M78 C;  1WPY A;  2DEQ A;  2RM4 A;  3JCM c;  1H64 1;  2EJ9 A;  4MMK A;  3JCM W;  4M7D E;  1KQ2 A;  4M78 F;  4EMK B;  3QHS A;  4JLI A;  4M78 D;  4XTW A;  4C92 A;  2JN0 A;  1HK9 A;  4C8Q D;  1I5L A;  1JRI A;  4C8Q E;  3JCM f;  4M75 F;  5GAN 2;  1B34 B;  4M7A G;  4M77 E;  4M78 E;  2FB7 A;  1I8F A;  4M7A D;  1LJO A;  3RES A; 
#chains in the Genus database with same CATH topology
 4K11 A;  1VQ4 Q;  1X27 A;  3CCQ A;  1WHL A;  1D0Z A;  4A4H A;  2DD5 A;  3CCS Q;  3JCM V;  3JCM g;  2KRN A;  3PT9 A;  2RH2 A;  5LJ5 f;  2YUP A;  3M54 A;  5A0G A;  4OB0 B;  2LQW A;  3EFS A;  1SKU B;  4PL6 A;  5GAN 6;  5GMK e;  4L5G A;  2K5F A;  4QVZ A;  4DEY A;  3D7S B;  5LJ5 g;  1WHH A;  2V8I A;  1P92 A;  3JCM Q;  3KXT A;  4J6X A;  3VRZ A;  9ATC B;  2DX1 A;  3VS5 A;  5GAO q;  5LJ5 h;  2R5A A;  4HVU A;  3HRT A;  1GCQ C;  1UGR B;  3URG A;  4BY6 C;  2JJ9 A;  5CKF A;  2DRK A;  3V8J A;  2KRM A;  2CP3 A;  3TSZ A;  1VQ5 T;  3CMA T;  1UFF A;  3V7R A;  1IHV A;  4WCI A;  4IUQ A;  4OMP A;  2VC8 A;  2DIL A;  4ELY C;  4LDY A;  4AG1 C;  2D9T A;  4Z8A A;  4A4E A;  4F14 A;  2PTK A;  1GFD A;  3GLX A;  3G71 Q;  1Q81 C;  2YT6 A;  1LOJ A;  1BIB A;  2FRY A;  1PSF A;  2RI5 A;  5AYF A;  1MMN A;  4MZM A;  1VQM T;  1T3S A;  2DIG A;  3EG0 A;  1WHM A;  4Q5W A;  2X4X A;  1M30 A;  2XDP A;  3CBO A;  3J80 E;  3KFV A;  3G6E Q;  1PRM C;  4B6M A;  2NUZ A;  2L2P A;  2SEM A;  5GAN 2;  1BU1 A;  1KIK A;  1NM7 A;  3OYL A;  4JRQ A;  1RUW A;  1M1G A;  2WSF E;  4RMO A;  1I1J A;  2Y4X A;  3I5R A;  1BYM A;  5A0L A;  1ZUY A;  1FMK A;  2K6D A;  3MJX A;  5CCA A;  2EKO A;  4RUG A;  2YDL A;  2ROT A;  3ZEH A;  1R0C B;  2NUT A;  3CQT A;  3M58 A;  1AOJ A;  5LJ3 f;  4II1 A;  2L3P A;  2K3Y A;  1OYX A;  1YI2 Q;  1VQK T;  5GAO m;  2J6F A;  2CH4 W;  2HSE B;  5AT1 B;  3I5S A;  2JS0 A;  4KUD K;  5LJ5 d;  2E64 A;  4M77 D;  4PLI A;  2Y90 A;  4PFZ A;  4XTV A;  1VYU A;  4PJO G;  2ZPF B;  2DTH A;  1IGU A;  3E2U A;  3JSC A;  1DJ7 B;  3TSW A;  2RO0 A;  3ASK A;  4LDV A;  4LN2 A;  1OUL A;  4M7A E;  3S6W A;  1WQ7 A;  2PNI A;  2XK0 A;  2OX7 A;  2HCK A;  1FYN A;  2YWW A;  3HFN A;  3A8G B;  5I22 A;  2DBM A;  2OTJ T;  2EAY A;  3U23 A;  4KBM B;  1QW1 A;  2XG8 D;  1QCO A;  5GAO l;  1KSW A;  1OZ2 A;  4C92 E;  2LT4 A;  3I56 Q;  2DL4 A;  2ED1 A;  4Z02 A;  1VQL A;  3CCJ A;  2DJQ A;  1KC8 C;  2EFI A;  3E19 A;  1NYF A;  2ABL A;  5IT9 E;  3NGP A;  3PIO A;  2QDL A;  2JOY A;  4BB7 A;  2EJ9 A;  2ED0 A;  4E7K A;  2J06 A;  2I0N A;  3G6E T;  2M0Y A;  2DL8 A;  1M1K C;  2M0O A;  3UWN A;  1I8F A;  4D6W A;  1LJO A;  5IHI A;  3UF4 A;  4KT0 E;  2X4Y A;  3X25 B;  3L2Z A;  1YJW A;  4XK8 E;  5FWC A;  1UG1 A;  1X6G A;  4JRP A;  3O5Z A;  2DE0 X;  2F69 A;  5LJ3 j;  3X20 B;  2QAZ A;  3NTK A;  2XIC A;  3RER A;  5J3B A;  3QKJ A;  1WNL A;  5C0M A;  3G7Z A;  2DFU A;  5HK3 A;  4MZP A;  1ABQ A;  2AZS A;  2PVG B;  1T0J A;  2ENM A;  5A0D A;  1XQH A;  1MUZ A;  5J26 A;  1RAH B;  2JZ2 A;  3CC4 A;  1SPK A;  5GAO p;  3S3M A;  2HMA A;  2BZ8 A;  2QQB A;  3FEO A;  1ZLM A;  2LCC A;  2HAX A;  1N5Z A;  5CQX A;  4E2F B;  3I56 A;  4PK4 A;  4AMC A;  3HKS A;  1WHJ A;  3J81 E;  1QVP A;  3EFO B;  5FRN A;  2EGE A;  4JJB A;  3CMA Q;  1M27 C;  1TH7 A;  1TS9 A;  1VIF A;  2BE7 D;  2YLC A;  3SFM A;  4OMN A;  2QA4 T;  3AHU A;  2GNC A;  1I07 A;  4Y92 A;  2KI7 A;  1BK2 A;  2EJG A;  4PJO F;  4OMM A;  5HKC A;  2LT1 A;  5KYX B;  1AWW A;  3X24 B;  2COZ A;  1RAC B;  5GAN 7;  1AVZ C;  2K7A A;  2KQW A;  1ZBJ A;  2K2M A;  2GGR A;  1YHQ Q;  3LWI A;  5KYN A;  3ZL7 C;  2X3W D;  1QKW A;  1OV3 A;  2JTE A;  3CME Q;  2COY A;  1M3B A;  1GXI E;  4M78 C;  4A4G A;  2JTM A;  4C0G A;  1KD1 R;  1NZ9 A;  4MMK A;  5D6X A;  4M78 F;  3CC4 Q;  2M1H A;  4XTW A;  1K9A A;  3CCM T;  3VS0 A;  2CP0 A;  3JCM f;  1AZE A;  1ZUU A;  1M90 R;  3C12 A;  4MDW A;  4ORZ A;  2FB7 A;  1PHT A;  4DBH A;  3PE0 A;  1YJN T;  1BI0 A;  4M75 E;  4ZGJ B;  3LH0 A;  3CXC A;  3REA B;  3M59 A;  3OYA A;  3A8L B;  4CI0 C;  1H3H A;  4FYX B;  2QDY B;  3CCR Q;  3FB9 A;  3M57 A;  4ZGD B;  1VA7 A;  3BFM A;  3AT1 B;  5GAN j;  1D09 B;  3VS1 A;  1VQO T;  1M2V A;  2AK5 A;  1VQP T;  3MPU B;  2K79 A;  4CC7 A;  5GMK j;  1VQ6 Q;  4OVA A;  3NHN A;  4KRT A;  1BI3 A;  4EMK A;  5KE2 A;  1AT1 B;  3TRE A;  1B3Q A;  1N27 A;  2RNA A;  5CKE A;  3CME A;  2LQN A;  3ER0 A;  3CCM Q;  2RN8 A;  1Q95 G;  3GP8 A;  3N5B B;  1A0N B;  5CK9 A;  1LPL A;  2ROL A;  2EJF A;  4C92 F;  5A2Q E;  1WLP B;  1V1C A;  3GNF B;  1GBQ A;  5LL6 S;  1RAI B;  4F7U B;  4MDX A;  1V76 A;  2RI3 A;  3OYH A;  3CC7 A;  1K0X A;  2KXD A;  2E5Q A;  2OTL A;  3VJP A;  5CIU A;  1UB4 A;  1M90 U;  2RJC A;  4YTL A;  3CCE T;  2YXY A;  1Z9Q A;  4FT4 A;  4JRI A;  4M7D C;  4PFP A;  2DER A;  2DBK A;  2DLP A;  2YLB A;  4F7U A;  3CCV T;  2CT4 A;  2RHI A;  4J9C A;  1QVG A;  1ZBX A;  2QK0 A;  3CPF A;  4HXJ A;  2NUP B;  1VQ7 T;  1X69 A;  1D0Y A;  3LH5 A;  1O75 A;  3QWY A;  4IUP A;  1VIE A;  2A7Y A;  4ESR A;  4P5N A;  2DEQ A;  4AFS C;  3UPU A;  2LQ8 A;  3CPW S;  4M78 D;  3PNW C;  4PLL A;  2DM1 A;  4QT7 A;  1YHQ A;  1OZ3 A;  3HP9 A;  1HJD A;  2V1Q A;  5I2M A;  4A53 A;  3BDU A;  5M9O A;  1JQQ A;  2QTX A;  1EFN A;  2LC4 A;  3S3O A;  2M02 A;  3THK A;  3UT1 A;  3C95 A;  5KYU B;  1XNI A;  1S72 A;  1K0S A;  3OSS C;  2ZCF B;  2DZ9 A;  1M1K R;  4KUL A;  2DJZ A;  3OYE A;  4PJO D;  2OTJ Q;  2QG9 B;  2J05 A;  4AFU C;  1WX6 A;  4HVV A;  4PJJ A;  1XTD A;  3WXM B;  3EH1 A;  1KC8 R;  3TEE A;  5GAM h;  3EGX B;  3H0F A;  2LMJ A;  3P8D A;  1S72 Q;  2KR3 A;  3UA6 A;  2G3R A;  4OML A;  2LJ0 A;  4DA4 A;  1TWB A;  4DOW A;  1H3Z A;  5CKB A;  2RK1 A;  1UGQ B;  2RPN A;  1K73 R;  1IXD A;  1C1A A;  2WAC A;  1I5O B;  4J6W A;  1PSE A;  2IVW A;  2LCS A;  5FLX E;  2AIR B;  1Z9Z A;  1VQ7 A;  1KHI A;  1QP3 A;  2PU9 B;  4AFQ C;  1RAF B;  3H9N A;  3SWN C;  4J7F A;  3H0I A;  2EPD A;  1WJR A;  4JRK A;  1QVG P;  2F2W A;  3PTA A;  3E9F A;  1H92 A;  4EMG A;  2JUF A;  2P84 A;  2CZ0 B;  5L8R E;  2KBT A;  2HQH A;  4X9C A;  1YIT A;  3V8K A;  3EGD B;  4FSX A;  2COW A;  3L1A A;  2RB6 A;  1W2B P;  1F1B B;  1X6B A;  3L2V A;  1SF9 A;  1C0M A;  1W70 A;  3HRU A;  1G3T A;  3LYI A;  1G5V A;  4LDX A;  2EW3 A;  3E1S A;  4JLI A;  1VQ8 T;  1I5L A;  1YWP A;  1PWT A;  2KDS A;  4CC4 B;  1RAB B;  3RNJ A;  1JJ2 P;  1LVK A;  4ZN1 A;  4XTZ A;  1FXX A;  4A4K A;  3BW1 A;  1MV0 B;  1CSK A;  4XU1 A;  1JO8 A;  3PMT A;  2NLU A;  1YJ9 A;  1M1K U;  1TTH B;  3PVL A;  2A0F B;  3M56 A;  4M7D F;  1N6A A;  5FU6 B;  4DOV A;  1PD0 A;  4M77 C;  4D8D A;  2FZK B;  2D8H A;  2KNB B;  4C92 G;  3UDC A;  2NUT B;  5FU6 C;  5LJ5 e;  4A54 A;  3CC7 Q;  4M7D B;  4D8K A;  2HKN A;  4EPC A;  2LX7 A;  1X75 C;  2KY9 A;  3PFS A;  1E6H A;  2NWM A;  4XU2 A;  4XTY A;  2HNI A;  2V1R A;  2KXC A;  4QQG A;  1JEG A;  2YSQ A;  2RHY A;  4FW1 A;  2FO0 A;  1Q82 C;  1Y57 A;  2E1H A;  4RTY A;  3TU4 K;  3RDV A;  1VQO Q;  1TXQ A;  1WHG A;  2E6N A;  2QYZ A;  1Y71 A;  3PMI A;  3G1J A;  3REB B;  3CCL A;  3H41 A;  1YJW T;  1EZZ B;  2CP2 A;  2XDB A;  2XHC A;  4Z88 A;  4J8O A;  1RI9 A;  2Y4Y A;  2A36 A;  2LCL A;  5IN1 A;  3A5Z B;  1NJI C;  4CC2 A;  4NL2 A;  4EMK C;  3G6E A;  3FC3 A;  1KQS A;  2RHX A;  2DIQ A;  4ZTF A;  2W10 A;  2HD0 A;  3CCR A;  3EGU A;  1KQ2 A;  1M2V B;  2EQK A;  2EYX A;  2P4R A;  4ELZ C;  1HK9 A;  5IH2 A;  1CKB A;  4TVR A;  3CBM A;  4L59 A;  2D0N A;  2YRV A;  4JPB W;  1D1A A;  3L2Q A;  3VYH B;  1Q86 C;  1K9M C;  1XJW B;  4M78 E;  4FU6 A;  2QA4 A;  2MK5 A;  2O01 E;  2E10 A;  2C0I A;  3NMZ C;  3VS4 A;  3VYG A;  4QKU A;  3JAM E;  2LZ6 B;  4OB3 B;  1SHG A;  4M7A C;  4LD6 A;  2MYS A;  3J7A F;  1WXB A;  2ZPI B;  1PCX A;  1IB8 A;  2E70 A;  3R6N A;  3GBQ A;  5L23 A;  4LDU A;  2F5T X;  3CCR T;  3V7S A;  2EGC A;  4MML A;  4EDU A;  1ACM B;  3JCM h;  1K1Z A;  3CCU A;  4M77 F;  2GQV A;  4R0K A;  3OS1 A;  3VRY A;  1Q81 R;  4C5G A;  5GAN 3;  3M9Q A;  3HRS A;  4BE0 A;  1Y07 A;  4FL6 A;  1WA7 A;  3JCM b;  2OAU A;  1X2K A;  3QBY A;  3CCU T;  2DVJ A;  3HPW A;  1NG2 A;  2VGM A;  3MO8 A;  4C5E A;  2H3J A;  4HVW A;  2VWF A;  2W0Z A;  4NOY A;  1VQN Q;  1Y96 A;  3OSV A;  3OA6 A;  3OW2 P;  4GLK A;  2PUK B;  4ATO A;  5GMK m;  2L0A A;  4HA8 A;  1TSF A;  1IO6 A;  2EVR A;  2R57 A;  2JTF A;  2MI6 A;  1BCM A;  2VXF A;  1KQS S;  4BY6 B;  3LGL A;  3P8H A;  4C92 B;  2RA2 A;  3L2R A;  3MP6 A;  1IZ6 A;  3G71 A;  1QVF S;  2OAW A;  3L2W A;  2LVM A;  1VQ9 Q;  3OS0 A;  2RHU A;  2PVO B;  2O4X A;  5FRM A;  4J9G A;  3RES A;  4M7D G;  3CC7 T;  2E12 A;  3BY7 A;  2OTJ A;  4Y91 A;  4C8Q G;  1VQK A;  1PRL C;  1OI1 A;  2NYS A;  2XMF A;  2VVK A;  5FU7 C;  1NPR A;  3CXC S;  3OYB A;  4M78 A;  2A3L A;  2D6F A;  4WF2 A;  2QQ9 A;  1VUB A;  3QII A;  3C4S A;  4IIO A;  3ZBD A;  1IRE B;  3HSB A;  2GF7 A;  2CUD A;  2XKO C;  2KSS A;  5LJ5 j;  4JS5 A;  1BB9 A;  2EKH A;  3OS2 A;  3A98 A;  1TOV A;  1K9M U;  4M78 B;  5KYY A;  4M75 G;  3ULR B;  4IUV A;  1ZSZ B;  3JB9 D;  5DLQ E;  4BAC A;  2RD1 A;  4PJO A;  1KJW A;  4F04 B;  1NBE B;  4JZ3 A;  2BIV A;  5CVI A;  4C5H A;  1QCN A;  1G3W A;  1ZSZ C;  1OPK A;  1V29 B;  2QXF A;  1U06 A;  1GCQ A;  3QYG B;  3G4S T;  5LJ3 h;  2HDA A;  4J9D A;  4JS4 A;  1YI2 T;  1UEB A;  2K4Y A;  4C0D B;  5D6W A;  2WSC E;  4X1V A;  5LJ3 g;  2DMO A;  3GPL A;  2VV5 A;  3G4S A;  1VQP A;  4E47 A;  4XAX B;  3OYD A;  1UGP B;  1M4Z A;  3M0T A;  1FMW A;  2VKN A;  2CUB A;  2XI9 A;  2DO3 A;  2VUB A;  2KYM A;  1R8O B;  1TU0 B;  1BI2 A;  1YIT Q;  4J9B A;  1SHF A;  1U5S A;  4OF1 A;  4VUB A;  3QJ6 A;  4C8Q E;  1S72 T;  3SD4 A;  1NPP A;  3EG2 A;  3H6Z A;  2MCN A;  4M7A G;  3OYN A;  3OMG A;  2DA9 A;  1AHJ B;  2DXC A;  2E65 A;  4JLG A;  2RF0 A;  3SHW A;  1K8A R;  2QQS A;  2FPD A;  5KYY B;  2XDD A;  1PD1 A;  1IRX A;  2ZAE A;  3CCV Q;  2HBW A;  4OB2 B;  2E4H A;  3CC2 Q;  4LE9 A;  2CP7 A;  3MEA A;  2XID A;  2DXT A;  3M0P A;  1JXO A;  1KG1 A;  3VS6 A;  2LQK A;  4PJN A;  2VB6 A;  2GCX A;  3E9G A;  2CS7 A;  3HL8 A;  1FX7 A;  1VQ7 Q;  1JBM A;  2K9G A;  3PGG A;  2R5M A;  3JCM P;  1WXT A;  2LRQ A;  2ZGW A;  3PIP A;  4XTU A;  2GTO A;  1Q86 U;  3CCS A;  1VQ8 A;  2QTV A;  1OPL A;  5GAO r;  1YIT T;  2ECZ A;  3LX7 A;  1KD1 U;  5FW9 A;  2HL3 A;  1RLP C;  2V8K A;  3M53 A;  5GMK i;  2PUO B;  4WTO B;  2QGF B;  5GAN 4;  3O8V A;  3WVE B;  4J83 A;  4RTT A;  2QEX A;  1YFN A;  4KH1 B;  4ZNX A;  1ZUK A;  2RK2 A;  1SSH A;  5I2S A;  1K8A C;  2L89 A;  4KH0 B;  1NEG A;  1UGV A;  1TG0 A;  2J6O A;  4QQ6 A;  3JCM J;  2V26 A;  1Q82 U;  4NL3 A;  1D3B A;  2B8A A;  1UE9 A;  2J6K A;  3JB9 I;  5GAN f;  4V2S A;  4N4I A;  3NFC A;  3CCL T;  2YUO A;  1BBZ A;  4F7U G;  3CPW P;  2CT3 A;  2MWO A;  1FMV A;  2MMP A;  1N8R U;  1M3C A;  2EGA A;  5IHN A;  3VS7 A;  3CC4 T;  4RTV A;  2J7I A;  2CKK A;  2X35 A;  1UGS B;  2SRC A;  3WVD B;  3CD6 A;  3M4Y A;  3OY9 A;  1ZSZ A;  1OQK A;  4KUI A;  3RBB B;  1XOV A;  3CCV A;  3M5A A;  3FRN A;  3V8L A;  4RG2 A;  4FM4 B;  4KGZ B;  3CD6 T;  4HT9 A;  2JS2 A;  1QLY A;  2KVQ G;  2H8H A;  3OYJ A;  3OYK A;  1T3L A;  2KYB A;  2PQW A;  1VQM Q;  4EIK A;  4M77 B;  2LP5 A;  1YHQ T;  2KT8 A;  2LNV A;  3CCJ T;  3DKM A;  2L3Q A;  3A1P A;  3CCQ T;  3X26 B;  2HSP A;  3QXE B;  3CCJ Q;  1ZHI A;  3LLR A;  5GAN d;  3SDZ A;  3CCU Q;  2KGT A;  2A08 A;  5GJW B;  3KBG A;  1VQM A;  1U8R A;  3ZFJ A;  2X51 A;  4BI3 A;  4LNP A;  3EGD A;  3OYM A;  2FYK A;  5EG2 A;  2O31 A;  2RQW A;  2PZ1 A;  3OMC A;  2P0P A;  3CD6 Q;  4DQ2 A;  1KK7 A;  4PNO A;  3A8M B;  3DB4 A;  4BD3 A;  2DTI A;  4J6Y A;  1PKT A;  2LTO A;  3QG1 A;  2B86 A;  4KGX B;  4RKU E;  1W2B A;  5KE3 A;  1W1F A;  4ZGE B;  2RHZ A;  3OS5 A;  4HCZ A;  2CDT A;  4M7A F;  2HBP A;  7AT1 B;  2RQR A;  2MOX A;  4PJO C;  1VQ6 T;  2O9S A;  2FRW A;  1Q7Y R;  3OYY A;  4RTU A;  3FJ5 A;  4EMK B;  2EIF A;  2M16 A;  5HK0 A;  4J9E A;  4IKF A;  3GOX A;  1VQ4 A;  4GBQ A;  1PG5 B;  5CQY A;  1Y7X A;  1KHC A;  2QGG A;  3CMA A;  4PJL A;  3KUF A;  1VOM A;  3RMQ A;  4M7A D;  4R55 A;  4DBQ A;  1OX8 A;  3ME9 A;  1M3A A;  1OOT A;  5CKD A;  4XU3 A;  5GMK l;  2L5Q A;  1YCY A;  4ME7 A;  3FLG A;  3RR6 A;  4Y28 E;  2QAS A;  4IUU A;  3INZ A;  1VQL T;  2CZ6 B;  2EYY A;  1HSQ A;  5IHK A;  2XU8 A;  5ECA A;  5EC7 A;  3JB9 F;  4BUG A;  3RKW A;  3HTR A;  2DL3 A;  4FW2 A;  2X9H A;  3I35 A;  4OMO A;  3CCL Q;  2IG0 A;  3RKY A;  2AKK A;  4J7I A;  4ANJ A;  2FEI A;  4XU0 A;  3H0H A;  3C94 A;  3M4G A;  1X6O A;  4RG8 A;  3RKX A;  2E41 A;  4QVC A;  1N9R A;  2ZPE B;  3M55 A;  1GFC A;  2H3E B;  5GAN h;  5GAN 8;  5DY9 A;  1MGQ A;  1PNJ A;  4N0A A;  1YJ9 T;  3UAT A;  4JJN K;  2FG0 A;  2DL5 A;  3I55 A;  4J9I A;  1G83 A;  1NLO C;  5GAM j;  5IXB A;  2X4J A;  4M4Z A;  2K2V A;  3QWX X;  2JM9 A;  2JT4 A;  2JW4 A;  4F7U F;  4UC4 A;  3A8O B;  5KH6 A;  1G3Y A;  2E6Z A;  3NPF A;  1WJS A;  2YUQ A;  3R6O A;  2DF6 A;  2GQI A;  1ZQ1 A;  2G6F X;  1VQK Q;  3JB9 H;  3QUI A;  1QQJ A;  4FYW B;  2EQU A;  5DLO A;  3I56 T;  1ZX6 A;  2Z0W A;  3L42 A;  2I2L A;  4R56 A;  1WPY A;  2C0O A;  1TUG B;  1JXM A;  1ZA2 B;  2O9V A;  3OW2 A;  1R0B G;  4C92 A;  1YBY A;  1VYT A;  2EQM A;  2MF2 A;  3QYH B;  2MPX C;  2CRE A;  4CRI A;  1NYG A;  2FVU A;  1WHK A;  2EQJ A;  2DAQ A;  1MND A;  6AT1 B;  1OX9 A;  3MEW A;  3OYF A;  1YI2 A;  2KRO A;  4X34 A;  2HQX A;  4FIB A;  1D0X A;  3SWN A;  1QMC A;  4C0D C;  3CC2 T;  1X01 A;  4AT1 B;  2KRS A;  3MKD A;  4IUT A;  5HY6 A;  2F1L A;  4C8Q B;  1BIA A;  4RTW A;  3EFO A;  2RQU A;  2VAS A;  4OGC A;  1PKS A;  2JMA A;  1MV3 A;  2CGH A;  3MHX A;  2AZV A;  3SWN B;  1M9S A;  1UDL A;  3G71 T;  2DPP B;  8AT1 B;  5KYU A;  1GL5 A;  3FIF A;  3TCJ A;  4N0A C;  1IGQ A;  2KEA A;  1JB0 E;  3HHT B;  1T0H A;  1X2Q A;  3VU3 C;  4M78 G;  2DZC A;  2VXE A;  4F17 A;  3VUZ A;  2D8J A;  2C06 A;  1R77 A;  1K9M R;  2HEQ A;  4OP0 A;  1YJN A;  5IAY A;  2DD4 A;  4IIM A;  2E5K A;  4X9D A;  1QWE A;  1GBR A;  4QVD A;  1M5Q 1;  2FZC B;  3M0R A;  2EYW A;  1G8X A;  4M7D A;  4E6R A;  2GFA A;  3M0S A;  5FRO A;  2EBP A;  2CZ1 B;  2BZY A;  4PFO A;  1QVF A;  1HXD A;  4C8Q A;  3LW5 E;  3MEV A;  1Y0M A;  1KQS P;  3VS3 A;  4RCB A;  2KAF A;  3HFO A;  4LUD A;  1MHN A;  2LX9 A;  1O9S A;  4HT8 A;  1VQN A;  4GLM A;  2RM4 A;  1NE8 A;  1H64 1;  4MZT A;  4GY5 A;  2JN0 A;  2L3S A;  3H8Z A;  3BE3 A;  2EYQ A;  2CSI A;  4M77 E;  4A4F A;  1SRM A;  4QQD A;  2FZG B;  1VQO A;  1K73 U;  2XD0 A;  2KMT A;  3JB9 G;  3V7C A;  1ARK A;  5LJ3 e;  3QO3 A;  3VKI A;  3OBY A;  2RQV A;  2FPE A;  3EAE A;  1VQ5 A;  4RCC A;  4F16 A;  1WJQ A;  3X28 B;  4JDS A;  3JV3 A;  1AD5 A;  1UJY A;  3L2U A;  3EG3 A;  1WFW A;  1VQL Q;  2DK3 A;  2P4T A;  1BCO A;  4XTX A;  3MEU A;  3QDF A;  1W2B S;  2P0K A;  4EMH A;  3NTH A;  2KK4 A;  4XQ3 A;  1HYO A;  1NLP C;  2AKL A;  4IUR A;  4LXC A;  3I55 T;  4M75 C;  2D1X A;  2LJ1 A;  3OYG A;  1SSF A;  2BTT A;  2K57 A;  2FPF A;  2CSQ A;  3DB3 A;  3RIR A;  4M7D D;  2L3R A;  4J9F A;  2PVD B;  2ZPH B;  2QEX T;  4A63 B;  1K8A U;  4M7A B;  2HZY A;  1C6V X;  2X3X D;  2NUP A;  4PJO B;  1RI0 A;  3MCA B;  3VS2 A;  2DTO A;  3PVQ A;  1OEB A;  1I4K 1;  4C0F A;  2ZZD A;  2JXB A;  4ZN3 A;  4JZ4 A;  4JUV A;  2QI2 A;  1VQN T;  4E7S A;  5KYW A;  2K5I A;  1UEC A;  4NS5 A;  1NEB A;  2DYB A;  1AEY A;  1UUE A;  4C5I A;  3CME T;  2FL7 A;  4HKE A;  5I11 A;  4HCC A;  3P8B B;  2MAM A;  2OTL Q;  2OJ2 A;  2RJD A;  3LGF A;  1U3O A;  4LDW A;  4C0Z A;  4JJC A;  3QSU A;  2K5L A;  4M7D E;  1OU9 A;  3QHS A;  3CBP A;  2GTJ A;  2F2V A;  5C6S A;  3CCE A;  2EYZ A;  5GAM f;  2VYT A;  3GF5 A;  3EG9 B;  2DVE A;  1U1S A;  5I21 A;  3TVT A;  1VQ4 T;  4C92 C;  3MP8 A;  3SEM A;  5D7U A;  1UHF A;  2ZPG B;  1D3B B;  3OBW A;  1PM3 A;  1YJW Q;  1N8R R;  3QDR B;  5GAO n;  3NTI A;  4M7A A;  2EQI A;  1Y96 B;  1FWZ A;  1U1T A;  2X4W A;  2O4X B;  1AWJ A;  1QVG S;  3QJY A;  2DKG A;  4AFZ C;  5CAI A;  2IIM A;  5J39 A;  5GJV B;  3GIB A;  3I9Q A;  1MMA A;  1W4S A;  2CYZ B;  5FU7 B;  3QZ5 B;  3EH2 A;  2GFU A;  2BKD N;  5GAN e;  1K73 C;  4HCB A;  1N8R C;  4Z89 A;  5KYW B;  1I0C A;  8ATC B;  2ATC B;  2VGN A;  1YN8 A;  1S1N A;  2K3X A;  3G4S Q;  4B9X A;  4F7U E;  2WSE E;  1JJ2 S;  2GBQ A;  1E7O A;  1RAD B;  4B9W A;  1Q81 U;  1VYV A;  4N4H A;  4O6J A;  1AWO A;  3EHR A;  2R58 A;  1NJI U;  1NJI R;  1UHC A;  2E3H A;  1WQW A;  3DLM A;  3RUX A;  2MIO A;  5GMK h;  3M0Q A;  2HQE A;  4BI8 B;  2DL7 A;  1YWO A;  1EX4 A;  4PJM A;  2CP6 A;  1M1F A;  3OQ5 A;  1SG5 A;  5DM7 R;  2QA4 Q;  4E7L A;  4J9H A;  1GCP A;  2ZPB B;  1MMG A;  1QKX A;  2A28 A;  2A37 A;  3OYI A;  4J5Y A;  1G2B A;  4QW2 A;  1YIJ Q;  4M75 A;  1YNZ A;  2E3I A;  2DRM A;  3CPW A;  1VQ8 Q;  2RI2 A;  5FWB A;  5D6Y A;  2D0Q B;  4DBR A;  2IPO B;  1QP2 A;  1N9S A;  1WZO A;  2F5K A;  1M2O A;  4FT2 A;  1RAG B;  2KT1 A;  4E7J A;  2JMC A;  3DLL A;  2BZX A;  4FYY B;  2V8J A;  3OW2 S;  2C0T A;  2YUN A;  4HCK A;  4M77 A;  4C92 D;  1TUC A;  1Q86 R;  4E7H A;  2DET A;  1Q7Y U;  4BE2 A;  3UA7 A;  1B07 A;  1PC0 A;  1BI1 A;  3LWH A;  3BDL A;  2RMO A;  4LD9 K;  3JCM e;  1QVF P;  2M9U A;  2JM8 A;  5GAM e;  4PKC C;  5KCH A;  3JB9 J;  1KQ1 A;  1ABO A;  1WIE A;  2BUD A;  4M77 G;  2JNG A;  2RJE A;  2DXU A;  2QQA A;  1X43 A;  1LNX A;  1RLQ C;  2RQT A;  3A8H B;  2O2O A;  4LUE A;  4PJO E;  2OI3 A;  3F70 A;  1RL2 A;  5CR2 A;  2BE9 B;  1KC8 U;  5GAM d;  3CXC P;  2CP5 A;  1BKB A;  1GRI A;  3JCM d;  2F2X A;  2YHT A;  2L8D A;  4M75 D;  4DBF A;  5LJ3 d;  4RTZ A;  3QZ9 B;  4E7I A;  2DNU A;  1EIF A;  4AG2 C;  1JU5 C;  3EG9 A;  3EFR A;  2CZ7 B;  3FDR A;  1ZSG A;  1B34 A;  2LDM A;  1RAE B;  1VQP Q;  1JJ2 A;  1LCK A;  4OB1 B;  3CCQ Q;  4BE1 A;  1UJ0 A;  3JCM c;  1TUD A;  3JCM W;  1Q7Y C;  5CKH A;  4RTX A;  4C8Q D;  3JRZ A;  1VQ5 Q;  4ZTJ A;  5HCK A;  2LNH B;  1B34 B;  3OYC A;  1KFZ A;  1CKA A;  3IQL A;  1QCF A;  5KCO A;  4E7Z A;  1YJ9 Q;  3GNG A;  1G3S A;  4L6V 5;  1UTI A;  4FYV B;  4FSS A;  2OTL T;  1QWF A;  2HKQ B;  3JCM X;  2HL5 C;  4OGE A;  4KGV B;  2DXB A;  3C0C A;  4OMF B;  3M0U A;  2QQR A;  4BDZ A;  1VQ9 A;  4FCY A;  1M8M A;  3TQ7 P;  3QPH A;  5GAN g;  2P0Q A;  3RMS A;  1YIJ T;  1YCS B;  3EHQ A;  4N4G A;  3EG1 A;  3CCM A;  2AT1 B;  1VQ9 T;  5CO7 A;  2RJF A;  3SB2 A;  1AWX A;  1K4U S;  4DEX A;  1SRL A;  1J3T A;  1YP5 A;  2KE9 A;  1SEM A;  1I81 A;  5GAN 5;  3T9N A;  1YJN Q;  5IXF A;  2DEU A;  1OU8 A;  1ZA1 B;  3FJP A;  2O88 A;  3EGX A;  5GAM g;  1RAA B;  4BI4 A;  3MET A;  1VQ6 A;  2FHD A;  2EWN A;  3CC2 A;  4CC3 A;  1WYX A;  1D1C A;  1E6G A;  2ESW A;  2MWP A;  2AHJ B;  4BDY A;  1HD3 A;  4C8Q F;  1WGS A;  1MNE A;  1M90 C;  4C8Q C;  1B7T A;  3CCE Q;  3Q1J A;  1D1B A;  1WXU A;  3VUB A;  1WI7 A;  2JVV A;  1M8V A;  1AZG B;  2DYI A;  3CEY A;  1YIJ A;  2CH4 A;  4O5V A;  2K3B A;  4OMQ A;  1WDX A;  3I55 Q;  4M75 B;  2YRC A;  1Q82 R;  3S3N A;  1KD1 C;  1H8K A;  1K76 A;  3MP1 A;  3OB9 A;  2QEX Q;  1JRI A;  1W6X A;  2LJ3 A;  2M51 A;  4M75 F;  2YRD A;  4JJD A;  1IHW A;  3VV0 A;  5KYX A;  1MMD A;  3CCS T; 
#chains in the Genus database with same CATH homology
 3BDU A;  5M9O A;  2XD0 A;  2KMT A;  3JB9 G;  1AHJ B;  3V7C A;  2QTX A;  3CCQ A;  2DXC A;  2LC4 A;  5LJ3 e;  3S3O A;  4A4H A;  3UT1 A;  3QO3 A;  2E65 A;  3C95 A;  3VKI A;  3OBY A;  4JLG A;  2DD5 A;  1S72 A;  1XNI A;  3JCM V;  3EAE A;  1VQ5 A;  4RCC A;  3JCM g;  2QQS A;  1WJQ A;  3X28 B;  2XDD A;  3PT9 A;  3OSS C;  4JDS A;  2ZCF B;  2DZ9 A;  4KUL A;  2DJZ A;  2RH2 A;  4OB2 B;  3OYE A;  5LJ5 f;  4PJO D;  3M54 A;  3MEA A;  2XID A;  5A0G A;  3L2U A;  4OB0 B;  2DXT A;  2DK3 A;  2P4T A;  1KG1 A;  4XTX A;  3EFS A;  2LQK A;  3MEU A;  1W2B S;  2P0K A;  4EMH A;  3NTH A;  4PL6 A;  2GCX A;  2KK4 A;  3E9G A;  4XQ3 A;  2CS7 A;  5GAN 6;  3HL8 A;  5GMK e;  4IUR A;  3I55 T;  1FX7 A;  4M75 C;  1JBM A;  1XTD A;  4L5G A;  2K5F A;  3PGG A;  2R5M A;  4QVZ A;  3JCM P;  3WXM B;  3OYG A;  2LRQ A;  3TEE A;  2V8I A;  1SSF A;  2ZGW A;  5LJ5 g;  3PIP A;  5GAM h;  4XTU A;  2K57 A;  1P92 A;  3P8D A;  1K73 U;  3JCM Q;  3DB3 A;  1Q86 U;  3KXT A;  3CCS A;  1VQ8 A;  3RIR A;  4J6X A;  4M7D D;  2L3R A;  2G3R A;  5GAO r;  1YIT T;  2PVD B;  2ZPH B;  3LX7 A;  5GAO q;  2QEX T;  1K8A U;  1KD1 U;  4M7A B;  5LJ5 h;  2R5A A;  4DA4 A;  3HRT A;  4DOW A;  1UGR B;  3URG A;  1H3Z A;  2V8K A;  3M53 A;  5CKB A;  2RK1 A;  4BY6 C;  4PJO B;  5GMK i;  5CKF A;  1RI0 A;  3MCA B;  2PUO B;  1UGQ B;  3V8J A;  2DTO A;  5GAN 4;  3O8V A;  3WVE B;  2WAC A;  4J83 A;  4J6W A;  1PSE A;  2QEX A;  2IVW A;  1VQ5 T;  3CMA T;  1I4K 1;  4C0F A;  5FLX E;  3V7R A;  2ZZD A;  4IUQ A;  1VQ7 A;  1KHI A;  1QP3 A;  2PU9 B;  2VC8 A;  3SWN C;  4ZN3 A;  2RK2 A;  4J7F A;  5I2S A;  1K8A C;  4ELY C;  4JUV A;  4LDY A;  1WJR A;  2L89 A;  2QI2 A;  4JRK A;  1VQN T;  3PTA A;  4QQ6 A;  3E9F A;  2K5I A;  4NS5 A;  4EMG A;  2JUF A;  3JCM J;  2D9T A;  4C5I A;  4A4E A;  1Q82 U;  2CZ0 B;  3CME T;  5L8R E;  2FL7 A;  4NL3 A;  4HKE A;  1D3B A;  3GLX A;  4HCC A;  2B8A A;  3P8B B;  1Q81 C;  4X9C A;  3JB9 I;  2MAM A;  5GAN f;  1LOJ A;  1YIT A;  1BIB A;  1PSF A;  2RJD A;  3V8K A;  4N4I A;  2RI5 A;  4FSX A;  5AYF A;  4V2S A;  4MZM A;  3LGF A;  1VQM T;  3L1A A;  2RB6 A;  3NFC A;  4LDW A;  3CCL T;  4C0Z A;  2DIG A;  3L2V A;  4Q5W A;  3QSU A;  4F7U G;  2X4X A;  2K5L A;  2MWO A;  2XDP A;  3CBO A;  2MMP A;  3HRU A;  1G3T A;  3J80 E;  4M7D E;  3LYI A;  1G5V A;  3QHS A;  3CBP A;  3E1S A;  1N8R U;  4JLI A;  4LDX A;  1VQ8 T;  1I5L A;  5C6S A;  5GAN 2;  3CC4 T;  2KDS A;  2CKK A;  2X35 A;  3CCE A;  1UGS B;  3OYL A;  3WVD B;  4JRQ A;  1M1G A;  5GAM f;  2VYT A;  2WSF E;  3GF5 A;  3CD6 A;  4ZN1 A;  3M4Y A;  4XTZ A;  4RMO A;  2DVE A;  3OY9 A;  1FXX A;  1U1S A;  2Y4X A;  4KUI A;  1BYM A;  5I21 A;  4A4K A;  3BW1 A;  5A0L A;  1XOV A;  1VQ4 T;  3CCV A;  4C92 C;  4XU1 A;  3M5A A;  3MP8 A;  3PMT A;  3FRN A;  2NLU A;  3V8L A;  2EKO A;  5CCA A;  1YJ9 A;  4RG2 A;  1M1K U;  2ZPG B;  4FM4 B;  3ZEH A;  1D3B B;  3OBW A;  3M56 A;  3CD6 T;  4HT9 A;  4M7D F;  1N6A A;  3M58 A;  3QDR B;  5FU6 B;  4DOV A;  2KVQ G;  3NTI A;  5LJ3 f;  4II1 A;  5GAO n;  4M77 C;  4M7A A;  3OYJ A;  1Y96 B;  1U1T A;  1FWZ A;  2X4W A;  2O4X B;  2K3Y A;  3OYK A;  4C92 G;  1QVG S;  3UDC A;  2PQW A;  1OYX A;  2DKG A;  3QJY A;  5CAI A;  5FU6 C;  5J39 A;  1VQK T;  5LJ5 e;  4A54 A;  5GAO m;  4M77 B;  1YHQ T;  4M7D B;  4KUD K;  5LJ5 d;  3GIB A;  2LNV A;  2E64 A;  4M77 D;  4PLI A;  3CCJ T;  2CYZ B;  1W4S A;  2Y90 A;  5FU7 B;  3QZ5 B;  3DKM A;  4EPC A;  1X75 C;  2KY9 A;  4XTV A;  4PJO G;  2GFU A;  2ZPF B;  3PFS A;  2DTH A;  3CCQ T;  2BKD N;  3X26 B;  5GAN e;  1K73 C;  4XU2 A;  3QXE B;  1N8R C;  4HCB A;  4XTY A;  2HNI A;  3JSC A;  1DJ7 B;  1ZHI A;  2RO0 A;  3ASK A;  4LDV A;  4QQG A;  3LLR A;  2VGN A;  4M7A E;  3S6W A;  2RHY A;  5GAN d;  3SDZ A;  2K3X A;  1WQ7 A;  4B9X A;  3KBG A;  2XK0 A;  4F7U E;  1Q82 C;  2E1H A;  1VQM A;  2WSE E;  3ZFJ A;  1U8R A;  1JJ2 S;  4BI3 A;  3HFN A;  4B9W A;  3TU4 K;  3A8G B;  1Q81 U;  4N4H A;  3OYM A;  2E6N A;  4O6J A;  1Y71 A;  2FYK A;  2R58 A;  3PMI A;  1NJI U;  5EG2 A;  2OTJ T;  2EAY A;  1WQW A;  3DLM A;  3RUX A;  5GMK h;  3OMC A;  1QW1 A;  2HQE A;  2P0P A;  4KBM B;  4BI8 B;  1YJW T;  2XG8 D;  4DQ2 A;  2XHC A;  5GAO l;  2XDB A;  1M1F A;  1OZ2 A;  3A8M B;  3DB4 A;  3OQ5 A;  2DTI A;  4J8O A;  4PNO A;  4BD3 A;  4C92 E;  2Y4Y A;  4J6Y A;  2LT4 A;  5DM7 R;  4E7L A;  2LCL A;  5IN1 A;  3A5Z B;  2LTO A;  3QG1 A;  4Z02 A;  3CCJ A;  1NJI C;  4RKU E;  1VQL A;  2ZPB B;  1W2B A;  5KE3 A;  4ZGE B;  4NL2 A;  2RHZ A;  4EMK C;  1KC8 C;  2EFI A;  3E19 A;  3OS5 A;  4HCZ A;  3G6E A;  5IT9 E;  4M7A F;  2HBP A;  3PIO A;  3OYI A;  4J5Y A;  4QW2 A;  3FC3 A;  4PJO C;  2JOY A;  1KQS A;  1VQ6 T;  2RHX A;  4M75 A;  2DIQ A;  4BB7 A;  4ZTF A;  2EJ9 A;  3CCR A;  2HD0 A;  3OYY A;  1KQ2 A;  4EMK B;  2EQK A;  4ELZ C;  2EIF A;  2M16 A;  5HK0 A;  4IKF A;  3GOX A;  1HK9 A;  4E7K A;  3CPW A;  1VQ4 A;  2RI2 A;  4TVR A;  5CQY A;  3CBM A;  4L59 A;  3G6E T;  2YRV A;  1Y7X A;  1KHC A;  3CMA A;  1M1K C;  5D6Y A;  2D0Q B;  3VYH B;  3L2Q A;  1Q86 C;  3KUF A;  4M78 E;  2M0O A;  3UWN A;  1I8F A;  3RMQ A;  1QP2 A;  1LJO A;  4D6W A;  4R55 A;  4M7A D;  1N9S A;  4FU6 A;  3ME9 A;  4KT0 E;  2QA4 A;  2F5K A;  2O01 E;  4FT2 A;  5CKD A;  2X4Y A;  2E10 A;  3X25 B;  4XU3 A;  3L2Z A;  3VYG A;  4E7J A;  5GMK l;  1YJW A;  2L5Q A;  1YCY A;  4XK8 E;  3JAM E;  4ME7 A;  3FLG A;  3DLL A;  4Y28 E;  2V8J A;  3OW2 S;  4IUU A;  3INZ A;  4OB3 B;  1VQL T;  4JRP A;  2CZ6 B;  4M77 A;  4M7A C;  4C92 D;  2F69 A;  5LJ3 j;  3X20 B;  4LD6 A;  3NTK A;  2XIC A;  3RER A;  5J3B A;  4E7H A;  3QKJ A;  3J7A F;  2XU8 A;  1WNL A;  5C0M A;  2ZPI B;  3G7Z A;  1Q7Y U;  4BUG A;  4BE2 A;  3JB9 F;  5HK3 A;  4MZP A;  3RKW A;  1BI1 A;  3LWH A;  2PVG B;  2E70 A;  3BDL A;  4LD9 K;  2IG0 A;  3JCM e;  3RKY A;  5A0D A;  1XQH A;  4J7I A;  2M9U A;  5J26 A;  4XU0 A;  3C94 A;  2JZ2 A;  4LDU A;  2F5T X;  3CC4 A;  5GAM e;  3M4G A;  5GAO p;  3S3M A;  3CCR T;  3V7S A;  4PKC C;  5KCH A;  3JB9 J;  4MML A;  1X6O A;  2QQB A;  1KQ1 A;  3FEO A;  4RG8 A;  2BUD A;  2E41 A;  3RKX A;  4EDU A;  4QVC A;  2LCC A;  2HAX A;  1N9R A;  2ZPE B;  5CQX A;  3JCM h;  3I56 A;  4M77 G;  2JNG A;  3M55 A;  3CCU A;  2RJE A;  4M77 F;  2DXU A;  3HKS A;  2GQV A;  2QQA A;  1LNX A;  5GAN h;  3OS1 A;  3A8H B;  5GAN 8;  5DY9 A;  3J81 E;  1QVP A;  4PJO E;  3F70 A;  1RL2 A;  5CR2 A;  1MGQ A;  4C5G A;  5FRN A;  4N0A A;  5GAN 3;  4JJN K;  1YJ9 T;  3M9Q A;  1KC8 U;  3HRS A;  5GAM d;  3I55 A;  3CCL A;  1TH7 A;  4BE0 A;  1Y07 A;  1VIF A;  2YLC A;  4FL6 A;  3JCM b;  3SFM A;  2QA4 T;  1BKB A;  2OAU A;  3QBY A;  5GAM j;  3AHU A;  2X4J A;  2K2V A;  3CCU T;  3JCM d;  3HPW A;  1YJN A;  2EJG A;  2VGM A;  2YHT A;  2L8D A;  4M75 D;  3MO8 A;  4C5E A;  4PJO F;  5HKC A;  2H3J A;  5LJ3 d;  4F7U F;  2LT1 A;  4UC4 A;  3A8O B;  4NOY A;  3QZ9 B;  1Y96 A;  3OSV A;  3X24 B;  5KH6 A;  4E7I A;  1G3Y A;  1EIF A;  3OA6 A;  5GAN 7;  4GLK A;  2E6Z A;  1WJS A;  2PUK B;  3R6O A;  2KQW A;  4ATO A;  5GMK m;  1ZQ1 A;  4HA8 A;  3EFR A;  2CZ7 B;  3LWI A;  3JB9 H;  3QUI A;  3FDR A;  1B34 A;  2JTF A;  2R57 A;  2EQU A;  2LDM A;  5DLO A;  2VXF A;  2MI6 A;  3I56 T;  1KQS S;  1JJ2 A;  4BY6 B;  3LGL A;  3P8H A;  4C92 B;  4OB1 B;  2RA2 A;  1GXI E;  3L42 A;  3L2R A;  3MP6 A;  1IZ6 A;  2I2L A;  4M78 C;  1WPY A;  4A4G A;  4R56 A;  2JTM A;  4C0G A;  3G71 A;  4BE1 A;  1NZ9 A;  1Q7Y C;  3JCM c;  4MMK A;  3JCM W;  1QVF S;  5D6X A;  4M78 F;  5CKH A;  3OW2 A;  3L2W A;  2M1H A;  2LVM A;  4XTW A;  1YBY A;  4C92 A;  2EQM A;  3QYH B;  2MF2 A;  4C8Q D;  3OS0 A;  3CCM T;  3JRZ A;  3JCM f;  4ZTJ A;  1B34 B;  2RHU A;  2PVO B;  3C12 A;  2O4X A;  4MDW A;  4CRI A;  3OYC A;  5FRM A;  2FVU A;  2FB7 A;  2EQJ A;  2DAQ A;  3RES A;  5KCO A;  4M7D G;  3CC7 T;  3GNG A;  1YJN T;  2E12 A;  3BY7 A;  2OTJ A;  4Y91 A;  3MEW A;  3OYF A;  1BI0 A;  4M75 E;  4C8Q G;  1G3S A;  4ZGJ B;  4L6V 5;  1YI2 A;  3LH0 A;  4X34 A;  1VQK A;  1OI1 A;  3CXC A;  2HQX A;  4FIB A;  3M59 A;  2OTL T;  3OYA A;  5FU7 C;  3JCM X;  4OGE A;  3SWN A;  1NPR A;  4C0D C;  3CXC S;  3OYB A;  3CC2 T;  4M78 A;  1X01 A;  2A3L A;  2DXB A;  3A8L B;  4CI0 C;  2D6F A;  4WF2 A;  2QQ9 A;  1VUB A;  3QII A;  2QDY B;  3C4S A;  4IUT A;  3ZBD A;  1IRE B;  3HSB A;  2GF7 A;  5HY6 A;  4OMF B;  2XKO C;  3FB9 A;  2KSS A;  3M57 A;  2QQR A;  4ZGD B;  4C8Q B;  4BDZ A;  1BIA A;  1VQ9 A;  3BFM A;  5LJ5 j;  5GAN j;  3QPH A;  4JS5 A;  5GAN g;  2P0Q A;  4OGC A;  1VQO T;  3RMS A;  1VQP T;  5GMK j;  1YIJ T;  2CGH A;  3MHX A;  4OVA A;  4N4G A;  3OS2 A;  3SWN B;  3CCM A;  1M9S A;  1K9M U;  1BI3 A;  4EMK A;  5KE2 A;  3G71 T;  3TRE A;  4M78 B;  1N27 A;  2DPP B;  4M75 G;  5CKE A;  3CME A;  3ER0 A;  1VQ9 T;  4IUV A;  3JB9 D;  3FIF A;  5CO7 A;  2RJF A;  3TCJ A;  3GP8 A;  5DLQ E;  3SB2 A;  4N0A C;  3N5B B;  4BAC A;  2RD1 A;  4PJO A;  5CK9 A;  1JB0 E;  3HHT B;  2BIV A;  2EJF A;  4C92 F;  5A2Q E;  5CVI A;  3GNF B;  4C5H A;  1G3W A;  1I81 A;  5LL6 S;  3VU3 C;  5GAN 5;  3T9N A;  4M78 G;  2DZC A;  2VXE A;  3VUZ A;  4F7U B;  4MDX A;  2C06 A;  1V29 B;  2RI3 A;  3OYH A;  2QXF A;  3CC7 A;  3FJP A;  2E5Q A;  3QYG B;  4OP0 A;  5IAY A;  5GAM g;  2DD4 A;  5LJ3 h;  3VJP A;  5CIU A;  3G4S T;  1UB4 A;  2OTL A;  4X9D A;  1K9M C;  4JS4 A;  1YI2 T;  1UEB A;  2K4Y A;  4C0D B;  1M90 U;  4QVD A;  4BI4 A;  3MET A;  2RJC A;  1M5Q 1;  2FHD A;  2EWN A;  4YTL A;  3CC2 A;  3CCE T;  1VQ6 A;  4M7D A;  4FT4 A;  4JRI A;  2MWP A;  4M7D C;  2AHJ B;  2GFA A;  4BDY A;  4C8Q F;  5D6W A;  1WGS A;  2WSC E;  5FRO A;  5LJ3 g;  2CZ1 B;  1M90 C;  4C8Q C;  1HXD A;  1QVF A;  3Q1J A;  3GPL A;  4C8Q A;  2VV5 A;  3VUB A;  2YLB A;  3G4S A;  4F7U A;  3CCV T;  2RHI A;  2JVV A;  1QVG A;  1M8V A;  1VQP A;  1ZBX A;  3LW5 E;  3CEY A;  3CPF A;  3MEV A;  4E47 A;  1YIJ A;  4O5V A;  4XAX B;  4RCB A;  2KAF A;  3HFO A;  3OYD A;  1VQ7 T;  1UGP B;  1M4Z A;  1MHN A;  2LX9 A;  1O9S A;  1O75 A;  2XI9 A;  2DO3 A;  4M75 B;  2VUB A;  4HT8 A;  1VQN A;  4IUP A;  3S3N A;  1R8O B;  1VIE A;  2A7Y A;  4P5N A;  2DEQ A;  2RM4 A;  1BI2 A;  1KD1 C;  1NE8 A;  3UPU A;  1H64 1;  4MZT A;  2LQ8 A;  3CPW S;  4OF1 A;  4VUB A;  3MP1 A;  4GY5 A;  3OB9 A;  4M78 D;  3PNW C;  2JN0 A;  4PLL A;  3QJ6 A;  1JRI A;  4C8Q E;  3H8Z A;  1S72 T;  3SD4 A;  4M75 F;  1NPP A;  3H6Z A;  1YHQ A;  2EYQ A;  1OZ3 A;  3HP9 A;  4M7A G;  4M77 E;  4A4F A;  3OYN A;  3VV0 A;  3OMG A;  4QQD A;  5I2M A;  4A53 A;  1VQO A;  3CCS T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...