4C8QB

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
b'SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qB00
2E64A 4M75D 4XTXA 4PJOD 4C8QA 3HFOA 4M77E 3SB2A 4XTUA 3QSUA 2DVEA 3BFMA 1Y96B 4M78B 3V7RA 1BIBA 5LJ5f 3SWNA 4C92F 4XQ3A 4EMKA 1U1SA 4J6YA 3RIRA 5GAMf 3V7SA 2FYKA 3JCMQ 5LJ3d 5LJ3h 2FB7A 1N9RA 2EWNA 5GAMe 3QHSA 4C92B 4A53A 5GMKh 4WF2A 1WNLA 4M7AB 5CAIA 5GANh 4M75F 4PJOF 4NL3A 2DTOA 3QO3A 1X01A 3JCMb 4M77A 4A54A 4NL2A 2VC8A 4X9CA 4JRKA 5LJ5j 5GAN2 4M78F 3JB9I 3FB9A 4M75B 3JCMd 3JCMP 3HSBA 4M7DG 3JCMh 5GAMj 4MMKA 4RCBA 4PJOB 2HNIA 2YHTA 1D3BA 4EMGA 4C8QC 2DTHA 5GAOr 4M7DA 2RA2A 3JCMJ 2DTIA 4M7DC 2VXEA 3EFSA 2RD1A 3V7CA 3SWNC 4C92E 1KQ1A 5GMKe 3JB9H 1M8VA 2EJFA 4EMKC 3RKWA 4C8QD 4M7AE 3BW1A 5GANe 5GAN3 4M7AF 3JB9G 3RKYA 5LJ5d 4N0AA 5GMKl 4M7DD 5GAOp 4N0AC 3L2ZA 1YCYA 4XU1A 5GAMd 1MGQA 3M4GA 3JCMX 3L1AA 4J5YA 3GIBA 4XU3A 4M77G 1LJOA 1I81A 1Y96A 4M75E 4PJOE 3JB9J 2VXFA 2JN0A 1N9SA 5GMKj 1U1TA 4J6WA 4XU0A 5GANg 4PNOA 4F7UF 4C92G 4HA8A 4M77C 1TH7A 1M5Q1 4JLIA 4X9DA 5GANj 3JB9D 4M78E 2DJZA 1KQ2A 4RCCA 4QVDA 1LNXA 4C92A 2DZ9A 3HFNA 3JCMg 4C8QF 4F7UB 2YLBA 3INZA 4M77D 5DY9A 5I21A 2RM4A 4XU2A 5LJ3e 3BDUA 4XTVA 5GANf 5GAN7 1I4K1 3RERA 2DEQA 4OP0A 4M75G 4PJOG 1I5LA 2EJ9A 3QUIA 2EJGA 4C8QB 1B34A 1D3BB 3JCMV 2E10A 3V8KA 4V2SA 4M7DB 2ZGWA 4M75A 5LJ5h 1BIAA 2DKGA 5GMKm 4HT9A 4M75C 4M78G 4PJOA 2DZCA 3RESA 3SWNB 3JCMc 5LJ3g 2EAYA 4EMKB 5GAMh 2E41A 5LJ3j 1H641 4M78A 5GMKi 3JCMe 2E1HA 2QTXA 4M78C 1JRIA 2K57A 3V8LA 4F7UE 4M77F 4Y91A 4JUVA 1LOJA 4XTZA 3EFRA 3FIFA 4M7AG 5LJ3f 5GAN4 1WQ7A 2CGHA 4M78D 2Y90A 3VU3C 4C92C 5GAN5 4C8QE 1HK9A 4M77B 4M7AA 5GAN6 4XTWA 4QVCA 4M7DF 5LJ5e 2I2LA 3PGGA 3RUXA 4M7AC 4M7DE 2E65A 3RKXA 1I8FA 3JCMW 1WQWA 4C92D 1WPYA 3V8JA 4HT8A 1HXDA 5GAOl 4J6XA 5GAOn 3AHUA 4F7UG 5GAOm 5GANd 4M7AD 4MMLA 4DQ2A 2YLCA 3JCMf 4PJOC 5LJ5g 1JBMA 2DXTA 4F7UA 4NOYA 3FJPA 4JRIA 5GAOq 3JB9F 1B34B 4C8QG 4EMHA 5GAMg 5GAN8 3BY7A 2DXUA 2RB6A 4XTYA
chains in the Genus database with same CATH superfamily
4DBRA 1PRLC 4R56A 2D9TA 2CSIA 3CC4Q 5LJ5f 1NPRA 2YSQA 1WGSA 4XQ3A 3RIRA 3VJPA 2COZA 4ZTFA 1X69A 4PFZA 3H0HA 4JJCA 4GLKA 4BD3A 3OYKA 2FPDA 1UHFA 5GANh 5I2SA 2E3HA 3CC7Q 2FPFA 2O88A 4OGEA 4M7DG 3JCMh 4LDWA 1PRMC 2RPNA 1I0CA 2A08A 2V1QA 3HRSA 2DM1A 4Z88A 1R0CB 1TG0A 5D7UA 1K8AR 3HL8A 2ZPEB 2RK2A 1IB8A 3EG9B 1FMKA 1M27C 3CCEA 3GF5A 2FO0A 1YITT 1RI9A 2LQNA 4Q5WA 1KK7A 1N9SA 1YJNT 5GANj 2DJZA 2DIQA 1OOTA 2OI3A 3G71Q 2QQBA 2RQTA 4XTVA 2AKKA 4PJOG 1ZSZB 2BE7D 1NYGA 2YRCA 2E10A 1YNZA 5LJ5h 2DKGA 4M75C 4M78G 2DZCA 2QG9B 5M9OA 4F16A 2VGNA 1JRIA 1U06A 3QIIA 4Z89A 3G6ET 1VQKQ 1Q82U 1LCKA 3TREA 2E4HA 3H41A 5LJ3f 1NLPC 3I9QA 2VGMA 1MMNA 1N8RC 1UB4A 2DRKA 2K3BA 1YJ9T 3FRNA 3V8JA 2QQAA 1HXDA 3BDLA 3OS5A 2X4YA 1E6GA 4DQ2A 3EG0A 4PJOC 2D8HA 5CQXA 2DXTA 1MNEA 2GFUA 4E7KA 2KK4A 2MMPA 3SB2A 4JLGA 4J9DA 2DK3A 1Y96B 3WXMB 2G6FX 3OQ5A 2CZ0B 2YUNA 4QQDA 2V26A 1BB9A 5GMKh 5J26A 1RI0A 4J8OA 3QO3A 1VYTA 2L3SA 5KCOA 1UE9A 2L89A 3JB9I 3OMCA 3L2VA 1WXBA 2MI6A 3CCRT 4MZMA 2L8DA 1PSEA 1BK2A 3MKDA 1IZ6A 3M54A 2DERA 2LCCA 4N0AC 2MIOA 1YCYA 2RMOA 1YI2A 2IPOB 4BUGA 3OYCA 2HAXA 3JB9J 3G4SA 2K4YA 2KNBB 3ZBDA 5GMKj 1NJIU 1KG1A 2J6KA 1HSQA 1TH7A 1M3BA 2HQHA 1WYXA 3S6WA 5HK3A 3IQLA 5HY6A 2YT6A 5HK0A 4ZGDB 2RM4A 1D09B 1IHVA 2ZPIB 3PMIA 4IIOA 3L2UA 1VQ5A 2ZGWA 3GOXA 3ULRB 3OS1A 5CKHA 1EX4A 5LJ3j 2OJ2A 2F5TX 2ED0A 4JDSA 3M59A 1PKSA 5J3BA 3EGDB 1ZX6A 3FIFA 3HP9A 1OX8A 3M0TA 3ZEHA 4M7AA 4RUGA 4C5GA 2KRMA 1G2BA 5A0DA 2J05A 1WIEA 2LX9A 3L42A 2GTOA 1VYUA 3I55A 1VA7A 4FCYA 2EQUA 2LT4A 1SKUB 5A0GA 1Q81R 1WJSA 4F7UA 5HKCA 1SHFA 5I22A 5GAN8 2ZPGB 1VQOT 1UGPB 2QQ9A 3O5ZA 1JEGA 1IO6A 2CP6A 3RNJA 1SSFA 4FW2A 3REBB 1SPKA 4M4ZA 3CPWA 1WHMA 2XU8A 3ASKA 3CCMA 2JNGA 1RAGB 2OAUA 2OTLT 2PVDB 3EG3A 4FL6A 3M0QA 4ME7A 1BI3A 1WNLA 1XQHA 4RTWA 4Y28E 5EC7A 5CAIA 2L0AA 4CC4B 1VQMT 2F5KA 4HVUA 3CCEQ 1V76A 1F1BB 2X35A 3M56A 2DA9A 2JMAA 3TVTA 2RD1A 2JMCA 3EFOB 1MV3A 2EYWA 1Q7YR 4WCIA 2HZYA 5GAMd 1K73U 1RACB 4FIBA 2EQIA 2KXDA 2IG0A 2F69A 2KYBA 2QA4A 5IHIA 2HEQA 1M1KC 2F2WA 4RG2A 4HXJA 1UGVA 3OYBA 2PZ1A 1LPLA 2XG8D 3I35A 2FHDA 2RJDA 2GCXA 1QLYA 1BIAA 4LDUA 3CC2T 3CCLA 2RHXA 2O01E 4KGZB 4AFUC 3TU4K 1TTHB 4LDXA 4PFPA 4OMOA 1C6VX 3EFRA 3OSVA 1RABB 2NLUA 3CPFA 4LDYA 1AVZC 1YJWA 1WZOA 1TXQA 1KD1R 1JO8A 2EVRA 1D0ZA 5GAOn 3NTIA 4C0ZA 2RHUA 2JJ9A 1QCOA 1YHQA 3CMAT 2K5LA 3VS1A 2NUZA 4PLLA 2K2MA 2FL7A 3MEVA 1DJ7B 1M3CA 2KRSA 3M0UA 3NTKA 1PC0A 2RHIA 4MDWA 4LD6A 3HKSA 4JRQA 4OF1A 4KRTA 3O8VA 1SRLA 3PTAA 1G3SA 2DYIA 4P5NA 3HHTB 2RF0A 5L8RE 2VC8A 2X4WA 3M53A 1YI2Q 1X6GA 4PJOB 5CKFA 2R5AA 4Z8AA 3G4SQ 1EFNA 4RTTA 2LMJA 4L6V5 1T3LA 2L3QA 4ELZC 4C92E 2EJFA 2X4JA 4EMKC 2JTEA 4M7AE 4RG8A 1M90U 1VQLA 1MGQA 3T9NA 3L1AA 2RK1A 2F1LA 3TQ7P 2QEXT 1SF9A 4GLMA 1VQ5Q 4XU0A 5ECAA 1K73C 1M5Q1 1KQ2A 2M0YA 1AWWA 1N27A 1YP5A 4AFQC 3BDUA 1ZBJA 1C0MA 2DILA 1B3QA 4QQGA 2LX7A 2VYTA 5CKEA 1Z9QA 2EQMA 1SSHA 2EAYA 4X1VA 3OA6A 2E41A 3LYIA 2SEMA 3I55Q 2EQKA 1OPKA 3PIOA 4LXCA 3EHRA 3CBOA 3ER0A 2V8KA 1BI0A 3EHQA 3X28B 1B07A 2QQRA 2HBWA 1Y57A 3G7ZA 5GAN6 4E2FB 3OYNA 3CCJT 3JCMW 2RI5A 4DEYA 3FEOA 2KAFA 4HT8A 5GANd 4BDYA 3CCMQ 4JPBW 3OY9A 4RTVA 3VKIA 1JJ2A 2EFIA 4DBQA 2W0ZA 3HFOA 2DEUA 2ATCB 1QKXA 1VQ4A 1OEBA 2BZYA 2P4TA 1ZUUA 3ZFJA 1VQPT 4BB7A 3CXCA 2NUPA 2DL4A 4LD9K 3L2WA 1K0XA 2YRVA 4N4IA 4RTYA 1CKBA 3NTHA 3WVDB 3PVQA 2EGEA 1IRXA 3G1JA 4A4HA 1JJ2P 3JCMb 4TVRA 4A4FA 2WSFE 1WI7A 4JRKA 1GRIA 5GAMj 4C5HA 2HNIA 1E7OA 2RN8A 1K9MU 3JSCA 2DTIA 3H9NA 2QA4Q 2D6FA 1K0SA 2COWA 1KQ1A 4LE9A 2XDBA 2P0QA 5LJ5d 2JTFA 1I1JA 1GBRA 1LJOA 5FW9A 4M75E 3FJ5A 3QXEB 3PNWC 4J6WA 3TCJA 2KSSA 1M90C 4KH0B 3D7SB 4C92G 1VUBA 1T0JA 6AT1B 3CCLQ 1G3YA 1LNXA 3EAEA 1SEMA 4HVVA 2JT4A 2J06A 3RERA 1U8RA 1GCPA 3TSZA 1YJWQ 4JJNK 4Z02A 4ORZA 1YITA 1K1ZA 1YJNA 1UJ0A 1VQNT 1MMAA 2DE0X 2DXBA 4BI3A 3OB9A 1OZ3A 1PD1A 1YHQQ 1M30A 2FZCB 3CCVT 2KVQG 2CREA 1IGUA 4C92C 1I07A 4C8QE 1X2QA 1Y07A 4PKCC 4ZN3A 3CD6T 4M7DF 4M7AC 5KYWA 2KT8A 1RAHB 1OPLA 3CC7T 3AHUA 1S72T 3JCMf 1TSFA 1FXXA 1P92A 2LJ1A 4HKEA 4KBMB 4DA4A 1B34B 3G6EA 1YIJT 1GL5A 3BY7A 1N8RR 2RB6A 4XTYA 4PJOD 2DD4A 4DOWA 1X2KA 4IUUA 2C0OA 3P8DA 1YJ9A 1BIBA 4KUDK 3EGUA 1QQJA 1U1SA 1OZ2A 5LJ3d 2CS7A 5KE3A 2ROLA 2K2VA 1ZHIA 2FVUA 3J7AF 4FYVB 3P8HA 4PJOF 1AZGB 1X27A 3JRZA 2JXBA 5FLXE 5J39A 1VQLQ 4M78F 2V1RA 3HSBA 4ZGJB 2P84A 1D3BA 1UJYA 2PVOB 2FPEA 4RKUE 5GAOr 4J9IA 1AWOA 3JB9H 5KCHA 1YBYA 2EYZA 1K9MC 1O75A 3S3NA 3CCUT 2K7AA 5GAOp 2MYSA 1IGQA 3HRUA 4XU3A 2A3LA 2KMTA 4IUTA 2JN0A 1I5OB 3CCRA 1ABOA 4X9DA 4J9CA 1JJ2S 3VS0A 1PG5B 3N5BB 1U5SA 2MCNA 3RR6A 4KGVB 1I4K1 5GAN7 2DX1A 2DNUA 2QAZA 4M75G 2KBTA 1FYNA 3V8KA 2HSEB 4A4GA 3JV3A 5FU7C 2KT1A 3CXCS 4XK8E 4PK4A 4EMKB 1WDXA 1WHLA 2VB6A 2E1HA 1QVFP 5IXFA 4PL6A 2MAMA 2YWWA 1ZUKA 3MCAB 2LQKA 4PJLA 2CGHA 3UA7A 4QVCA 3X20B 2DIGA 1K8AU 1VQ4Q 1I8FA 2JTMA 1PHTA 1QCFA 2YLCA 1PSFA 1K9AA 1UGRB 3TSWA 3EG2A 1VQ6T 5GAOq 4DBHA 4C8QG 1T0HA 2Y4XA 3CCQT 1ZSZA 2V8JA 4M77E 4C0DC 2CKKA 2X3WD 1MMGA 2YXYA 4PJNA 2DJQA 4J9FA 1UTIA 2XHCA 2LZ6B 1N9RA 2VVKA 4OVAA 2SRCA 2HD0A 1CSKA 1GXIE 4CC2A 4HCBA 2DL8A 1VQOA 1KC8R 1UECA 5LJ5j 3M0PA 3FB9A 2LQ8A 1GFDA 2A37A 3TEEA 1Q86C 4C8QC 2DTHA 3OYFA 4D6WA 4JS4A 2QGGA 2OTLA 4CRIA 3A5ZB 1KFZA 3I5RA 4PLIA 1NEBA 3L2ZA 2K79A 1VQMA 1W1FA 3M5AA 2VWFA 1X6BA 1YN8A 3RBBB 1Y96A 4A63B 2MF2A 1YITQ 4AG1C 3OYMA 4QVDA 1YJNQ 3EGXB 4ELYC 1QMCA 2LC4A 2O9VA 2OTJT 4KGXB 4N4HA 1OI1A 2EJGA 3C0CA 3QPHA 2P0PA 3CQTA 2K3XA 3QDFA 1M1KR 3Q1JA 4HCCA 2ZPBB 1K4US 2Y4YA 2RI2A 3CCST 4J9GA 3UA6A 3OBYA 5GAN4 3G6EQ 2GFAA 3MP8A 4J9BA 4FSXA 2GBQA 1OYXA 2I2LA 2E65A 1XTDA 1YJ9Q 2E70A 4J6XA 3CC2A 4X34A 3M4YA 5CVIA 1IREB 3FC3A 2G3RA 1K8AC 2DO3A 1KQSP 5FRNA 1UFFA 2LCSA 1RLQC 1JXMA 2GTJA 5DM7R 2PTKA 4OMFB 4ANJA 1Q82C 2FB7A 1M2VB 1NYFA 3QHSA 4C92B 4A53A 3M9QA 3CMAA 3EGDA 4CC7A 1X75C 2D0NA 4M7AB 2CSQA 4WTOB 2BKDN 2CH4W 3REAB 2DFUA 1GCQA 4QQ6A 3JCMP 3EH2A 3FDRA 1ZQ1A 2D1XA 4GBQA 1VIFA 2WSCE 3CCRQ 3VS3A 1TUCA 2ED1A 2QK0A 2M51A 3SWNC 4KH1B 3A8LB 1XJWB 1R8OB 3RKWA 3I56T 4EIKA 2FEIA 2CDTA 4FYXB 2MK5A 1JB0E 1VYVA 1Q81U 1AZEA 1RAAB 1OQKA 2BZ8A 2ECZA 1U1TA 5I2MA 4BACA 4M77C 3JB9D 2AK5A 2EGAA 4FU6A 3QZ9B 3J80E 2KGTA 5KYNA 3META 3QG1A 2EKHA 2LJ0A 4JZ3A 1UGQB 2E3IA 2JS0A 1WLPB 5IHKA 2QEXA 2C06A 1KJWA 1D1AA 1PKTA 2J7IA 2K57A 4OB2B 4D8DA 4D8KA 2WACA 1BU1A 1NJIC 3GP8A 3H6ZA 3PGGA 3OYDA 2DPPB 4VUBA 1EZZB 1Q7YU 3BE3A 2NWMA 2XDPA 5KYYA 4Y92A 1JBMA 2LQWA 2O2OA 2COYA 5GAMg 5FU7B 4R55A 4FSSA 1VQOQ 3R6OA 3A8MB 3QKJA 2RHZA 1VQ9T 3CCJA 1VQ8T 2FYKA 4E7JA 4BI4A 2EWNA 2E6NA 2BE9B 2EBPA 2E5KA 2OTLQ 1YWOA 3OYGA 2KE9A 1D1BA 3M57A 1D0XA 2J6OA 1AD5A 2B86A 1VIEA 4FYWB 3E9GA 3LGFA 4LNPA 4M75B 5KH6A 1VQMQ 2ZPFB 5CIUA 8AT1B 4M7DA 2RJCA 2X4XA 4O6JA 4C0DB 3FLGA 5GAN3 3JB9G 1KD1U 5GMKl 2L2PA 1NPPA 3L2QA 2ZAEA 3C94A 1R0BG 4AT1B 2O4XB 2JM9A 2PUOB 1W2BP 5GJWB 1QVGP 3HTRA 3MHXA 1Q81C 1OV3A 5DLQE 4AMCA 1YCSB 2CUBA 2YLBA 2LNVA 4BI8B 4C8QB 4PJOA 2F2VA 4HT9A 2IIMA 1W6XA 5D6XA 4M78A 2QTXA 2L3RA 3CC2Q 2K5IA 4F7UE 3OMGA 3VU3C 3NHNA 3X26B 3VYGA 1ACMB 3L2RA 5FWBA 1OX9A 2HDAA 2Z0WA 4C92D 1NZ9A 4M7AD 2DL3A 4LUDA 1QP3A 2R58A 2P0KA 3PVLA 1VQNA 5I11A 4C5EA 1Q7YC 4JRIA 7AT1B 2AIRB 3CMAQ 2AT1B 4MZPA 3CCVA 1MHNA 2M16A 2QQSA 4BY6C 2CZ7B 3CD6A 3E9FA 2DVEA 3BFMA 4N4GA 1VQ7T 2HCKA 4C92F 2DL7A 3UF4A 2XMFA 4NS5A 2HQXA 1UUEA 1S72A 1FX7A 4HCKA 5KYXB 3A98A 2VKNA 1B7TA 1YIJA 4E7HA 2BUDA 5IXBA 1BKBA 2EQJA 3UWNA 5IAYA 1PM3A 1AWXA 5A2QE 5GAN2 1NLOC 2QI2A 1S1NA 2MOXA 3JCMd 1ZA2B 4OB1B 3NFCA 1UG1A 1Z9ZA 2X3XD 4AG2C 3UPUA 2NYSA 1K76A 1OU9A 4IUQA 2CP2A 2C0TA 2YUOA 2HQEA 2LP5A 1QP2A 2NUTA 1IXDA 5GANe 2KQWA 3DB3A 2LDMA 5KYUA 3SD4A 5IT9E 4IUVA 4E47A 2YRDA 5HCKA 1KD1C 5GANg 1ZLMA 1G8XA 4HA8A 5FROA 2QEXQ 1PWTA 2DZ9A 2K6DA 3JCMg 4J9HA 5DY9A 1GBQA 2EIFA 3CCUA 2A28A 4A4KA 2O31A 5IN1A 3URGA 2EJ9A 3QUIA 2DLPA 2P4RA 2RJEA 2QASA 3MPUB 3CEYA 3SWNB 4CC3A 3M55A 3CMET 3LX7A 3V8LA 4M7AG 3H0IA 1WQ7A 4F17A 2FRYA 2PUKB 4M77B 2X51A 2XI9A 2XK0A 5LJ5e 4M7DE 4XAXB 4KUIA 4IIMA 4F7UG 2YUPA 3CCJQ 2DAQA 3OS0A 5LJ5g 5CKBA 2AHJB 2KDSA 4M75D 3RMQA 1WHKA 3CC4T 2XD0A 4XTUA 2EYXA 1QWEA 3OS2A 3SEMA 2JVVA 2HMAA 2K9GA 5CQYA 1Y0MA 3QWXX 4WF2A 1VQ6A 1M1FA 3C95A 4M75F 5KYWB 5D6YA 3CCQA 2DTOA 2PNIA 1ZBXA 2ZPHB 4RMOA 4A4EA 1GCQC 4E7LA 1FMWA 2LCLA 3S3MA 2QYZA 4ESRA 5GMKe 4C8QD 3BW1A 3RKYA 4E7IA 5L23A 3OYEA 3M4GA 3DLMA 2VXFA 4FT4A 1N8RU 3M58A 3VUZA 3G71T 3MO8A 3PIPA 2ESWA 4C8QF 1VQ4T 3INZA 1G3WA 5LJ3e 2DEQA 4OP0A 4BE1A 2RHYA 4RTXA 1D3BB 2RO0A 2HL3A 5GMKm 3JCMc 5LJ3g 2RQWA 4KT0E 1RUWA 1VQKT 1LVKA 1QVFA 1RAFB 3GBQA 3F70A 4Y91A 3C12A 4XTZA 1VQNQ 3AT1B 1ZSGA 1WXTA 2OTJA 2M02A 2QTVA 1HK9A 1JQQA 8ATCB 3CCVQ 3RUXA 1PCXA 3CD6Q 1NE8A 3QWYA 2ROTA 3J81E 1CKAA 2EW3A 3A8HB 1IHWA 2KI7A 3FJPA 2JS2A 3CCSA 1S72Q 2CZ1B 5FRMA 2E6ZA 1WXUA 2KYMA 2RNAA 1YIJQ 3MP6A 3QSUA 3X24B 2C0IA 2LT1A 3EG9A 5CCAA 2XIDA 4EMKA 2DYBA 2KRNA 3V7SA 2OX7A 2EGCA 4J9EA 4OB0B 2XICA 4C0GA 1D0YA 2L3PA 4II1A 4NL3A 5KE2A 2DVJA 2DL5A 4QVZA 1UEBA 1Q82R 1QKWA 1NM7A 4FW1A 2F2XA 4M7DC 4LDVA 3V7CA 3WVEB 4BY6B 2KR3A 2QXFA 3NMZC 4PJJA 4R0KA 1M4ZA 3CCUQ 3KBGA 3NGPA 2CP0A 1R77A 3LW5E 4JLIA 2HKQB 2QGFB 2CZ6B 4RCCA 4EPCA 3HFNA 5GJVB 3UDCA 4M77D 5I21A 3I56A 4XU2A 3P8BB 1W70A 3H0FA 1I5LA 3JCMV 1ABQA 2FZKB 2RJFA 3M0RA 4HCZA 1KC8U 3OYLA 1AOJA 4M78C 3NPFA 4JJBA 5FU6C 1KHIA 4M77F 3A8OB 3UT1A 3EG1A 2X9HA 2EYYA 2B8AA 1H8KA 3PFSA 4O5VA 3RKXA 4E7ZA 4DEXA 5GAOm 2AZSA 1WA7A 1J3TA 2CT4A 3EGXA 1GFCA 1ZUYA 3SDZA 2DXUA 1NJIR 1KQSA 5CK9A 1VQ6Q 3LWIA 2IVWA 3CCQQ 4BE0A 4F04B 2HSPA 3V7RA 3VRZA 4C0FA 2I0NA 2K5FA 4L59A 1WJRA 2ABLA 2GQVA 4AFZC 3MP1A 5LJ3h 4GY5A 1TS9A 4YTLA 2QDLA 1ZA1B 1M1KU 2FG0A 3CCET 2OAWA 1HJDA 1M9SA 4RCBA 4RTZA 2YHTA 3KUFA 4EMGA 4J7IA 1VQ9A 3VS6A 1VQ8A 2R57A 1QVFS 1M8MA 2FZGB 2GF7A 2VXEA 3EFSA 1WHJA 1M8VA 3X25B 2DMOA 1RAIB 2GQIA 3VUBA 2RI3A 1OULA 1G5VA 4J5YA 4M77G 1N6AA 1RLPC 2QDYB 1UHCA 1FWZA 5CKDA 1QVPA 1PNJA 2DBKA 3A1PA 1M2VA 1RADB 4FM4B 4C92A 2H3JA 2W10A 2M9UA 4F7UB 5CO7A 1X43A 1ARKA 2KEAA 2OTJQ 4JZ4A 3VRYA 3MEAA 3OW2A 2CP3A 3THKA 2K3YA 4DOVA 5LL6S 2H8HA 5GMKi 3S3OA 1M3AA 4LN2A 4JUVA 1KC8C 1BYMA 2CP7A 3VYHB 3CCSQ 2PVGB 2DETA 2AKLA 3H8ZA 2DF6A 3QBYA 2LJ3A 4FYYB 3CBMA 4ZN1A 3OW2P 1K73R 3JB9F 3ZL7C 3C4SA 3MEUA 3EFOA 1UDLA 2DD5A 3CPWP 4KULA 1NBEB 4J6YA 2LVMA 1RL2A 2L5QA 4B9WA 1AEYA 4F14A 5GAMe 5CR2A 1A0NB 1YI2T 1X01A 4OMQA 4QT7A 3LGLA 3E2UA 3G4ST 2DRMA 4MMKA 4IUPA 4RTUA 5KYYB 1VQ7A 1Y7XA 3JCMJ 2R5MA 1H3HA 1NEGA 4MDXA 4ZGEB 4OGCA 3QJYA 1TUDA 3I56Q 1VQ5T 2V8IA 2ZZDA 3VS4A 2EYQA 1WHGA 4PNOA 4ZNXA 3VS5A 1W2BA 1NG2A 5C0MA 1QVGA 1V1CA 1FMVA 1KQSS 2YUQA 1VQPA 4BDZA 1KHCA 3RDVA 1V29B 2MWOA 3UATA 3SFMA 1AHJB 1PD0A 1G83A 2CT3A 1AT1B 3VV0A 4M7DB 4M75A 1TOVA 3I55T 3SHWA 1WJQA 3EH1A 1M1GA 3OYHA 1H3ZA 1U3OA 5DLOA 5D6WA 3KXTA 3JAME 1N5ZA 4E7SA 2Y90A 2J6FA 2JW4A 2DBMA 2BTTA 2O9SA 3OYIA 2O4XA 1EIFA 1WQWA 1BCMA 3CCMT 2E5QA 1M90R 3GNGA 3CMEA 4MMLA 2M0OA 2RQUA 1Q95G 1H92A 1YFNA 1BCOA 3LH0A 3QYGB 3LLRA 2FRWA 2CYZB 2H3EB 2XKOC 2VUBA 4C8QA 3PE0A 9ATCB 4M78B 4UC4A 4JJDA 5FU6B 5GAMf 3E19A 3JCMQ 2EPDA 4K11A 2E12A 2RQRA 3HRTA 1VQ9Q 3OYAA 1VQ8Q 1C1AA 4QKUA 1SG5A 3A8GB 4PJMA 3HPWA 1BBZA 2GNCA 3MJXA 3CC4A 1YWPA 3OW2S 4NL2A 4X9CA 4HVWA 2MWPA 1TWBA 1SRMA 1ZSZC 2HBPA 3GLXA 5IH2A 1MMDA 3OYJA 2QA4T 3GNFB 1E6HA 2JOYA 3OYYA 4M7AF 4OMNA 3CPWS 2HL5C 3CC7A 1T3SA 4N0AA 4J83A 1M2OA 3GIBA 3DKMA 1TU0B 3LWHA 4F7UF 3CCLT 2JM8A 2GGRA 5AT1B 3E1SA 4OMLA 5KYXA 4OB3B 2VASA 4AFSC 1YJWT 1G3TA 3CBPA 2LRQA 1XOVA 1HYOA 2KXCA 4B6MA 2CP5A 5GAMh 2NUTB 1H641 2NUPB 3JCMe 5KYUB 1YHQT 3G71A 2AZVA 4ATOA 2CUDA 1O9SA 5AYFA 1K9MR 3LH5A 3M0SA 3PMTA 5GAN5 2JUFA 2ENMA 1QWFA 4LUEA 4B9XA 4FT2A 1WFWA 4QW2A 5IHNA 5GAOl 1RAEB 1MUZA 4MZTA 5EG2A 1VQKA 3OBWA 2HKNA 1VOMA 4EMHA 2JZ2A 4J7FA 2E64A 4XTXA 1KIKA 3DB4A 1W4SA 4EDUA 3QJ6A 3SWNA 3MEWA 3CXCP 1W2BS 1OU8A 1QVGS 1VQ7Q 1UGSB 2D0QB 4JRPA 3KFVA 4ZTJA 2M1HA 1X6OA 3GPLA 1JXOA 1VQLT 4M77A 4A54A 2MPXC 1WX6A 4BE2A 1QW1A 2D8JA 2RA2A 3U23A 2BIVA 1XNIA 3VS7A 3ME9A 4DBFA 2A36A 1VQPQ 4M7DD 4E6RA 3I5SA 4XU1A 2LNHB 3JCMX 4PFOA 1HD3A 4CI0C 3PT9A 1JU5C 1TUGB 1I81A 1KSWA 3RMSA 4PJOE 4L5GA 2LTOA 5FWCA 1D1CA 1WHHA 1SHGA 4M78E 2RH2A 2PQWA 1BI2A 1BI1A 5GANf 3VS2A 1AWJA 4IKFA 1QCNA 2CH4A 4OMMA 2KROA 1B34A 3OSSC 4V2SA 4C5IA 2KY9A 3QZ5B 3RESA 5C6SA 1Q86R 2DXCA 2A0FB 3CMEQ 2VV5A 3R6NA 1LOJA 2RQVA 3QYHB 4M78D 4JS5A 4OMPA 2A7YA 1Y71A 2YDLA 4XTWA 1MV0B 3QDRB 5A0LA 1WPYA 2XDDA 1MNDA 2EKOA 2WSEE 2PU9B 1Q86U 2BZXA 4NOYA 3DLLA 2ZCFB 4IURA
chains in the Genus database with same CATH topology
3LWIA 2IVWA 3R6OA 3A8MB 3HFOA 4BE0A 3QKJA 2D9TA 4R56A 1VQ4A 5LJ5f 1NPRA 2P4TA 2RHZA 3V7RA 1WGSA 4C0FA 2K5FA 4XQ3A 3ZFJA 3CCJA 3RIRA 3VJPA 4BB7A 4L59A 4ZTFA 3CXCA 1VQ9T 1WJRA 2FYKA 2GQVA 1VQ8T 4LD9K 3L2WA 3MP1A 4BI4A 4E7JA 5LJ3h 2YRVA 2EWNA 2E6NA 4N4IA 4GLKA 4GY5A 4BD3A 3OYKA 3NTHA 4YTLA 3WVDB 5GANh 5I2SA 1M1KU 3OYGA 4A4HA 3CCET 3M57A 3JCMb 4TVRA 4A4FA 2WSFE 4JRKA 1VIEA 3E9GA 3LGFA 4M75B 4OGEA 5KH6A 4M7DG 3JCMh 4C5HA 1M9SA 4RCBA 5GAMj 2HNIA 2ZPFB 2YHTA 4LDWA 3KUFA 5CIUA 4J7IA 4EMGA 1K9MU 1VQ9A 3JSCA 1KQSA 1VQ8A 4M7DA 2R57A 2RJCA 1QVFS 2DTIA 2X4XA 3HRSA 2GF7A 2VXEA 3EFSA 2D6FA 1M8VA 1KQ1A 4O6JA 4C0DB 3FLGA 2XDBA 3X25B 5GAN3 3VUBA 3JB9G 2P0QA 5LJ5d 2RI3A 5GMKl 1KD1U 3HL8A 2ZPEB 2RK2A 1NPPA 3L2QA 3CCEA 2JTFA 3C94A 1G5VA 3GF5A 4J5YA 4M77G 1LJOA 4M75E 1YITT 1N6AA 2O4XB 4Q5WA 1N9SA 2QDYB 3PNWC 3QXEB 4J6WA 2KSSA 2PUOB 3TCJA 1M90C 4C92G 1YJNT 1FWZA 1VUBA 5CKDA 5GANj 1QVPA 3MHXA 1Q81C 2DJZA 2DIQA 5DLQE 1G3YA 1LNXA 4FM4B 4C92A 2H3JA 2M9UA 3EAEA 4F7UB 2YLBA 5CO7A 2LNVA 2QQBA 4BI8B 4XTVA 3RERA 1U8RA 4PJOG 4C8QB 2E10A 4JJNK 3MEAA 4Z02A 5LJ5h 2DKGA 3OW2A 4HT9A 4PJOA 4M75C 4M78G 1YITA 2DZCA 5M9OA 2K3YA 4DOVA 5D6XA 5LL6S 1YJNA 4M78A 5GMKi 3S3OA 2QTXA 2L3RA 2VGNA 1JRIA 2K5IA 3QIIA 1VQNT 2DXBA 4BI3A 3OB9A 4F7UE 1OZ3A 3G6ET 4JUVA 1KC8C 1Q82U 1BYMA 3TREA 3OMGA 3VYHB 5LJ3f 3VU3C 2PVGB 3X26B 3VYGA 3CCVT 2KVQG 2VGMA 4C92C 4C8QE 1N8RC 1UB4A 1Y07A 3L2RA 4PKCC 4ZN3A 3CD6T 3H8ZA 1YJ9T 4M7DF 4M7AC 3FRNA 3QBYA 3CBMA 4C92D 3V8JA 4ZN1A 2QQAA 1HXDA 3BDLA 3OS5A 3CC7T 3AHUA 1NZ9A 4M7AD 2X4YA 4DQ2A 1QP3A 2R58A 3JCMf 1S72T 4PJOC 2P0KA 5CQXA 2DXTA 1VQNA 1FXXA 1P92A 4C5EA 4JRIA 4HKEA 4KBMB 4DA4A 1B34B 3G6EA 3C4SA 1YIJT 3BY7A 2RB6A 4XTYA 2GFUA 4PJOD 2DD4A 3MEUA 4DOWA 4MZPA 4E7KA 2KK4A 3CCVA 1MHNA 2M16A 2MMPA 2QQSA 4IUUA 4BY6C 3SB2A 4JLGA 2DD5A 3P8DA 2CZ7B 3CD6A 2DK3A 2DVEA 3BFMA 1Y96B 3E9FA 4KULA 1BIBA 4N4GA 3WXMB 1YJ9A 1VQ7T 4C92F 1VQPT 4KUDK 3OQ5A 1U1SA 4J6YA 2CZ0B 2LVMA 1RL2A 2L5QA 1OZ2A 4NS5A 2CS7A 5LJ3d 4B9WA 5KE3A 2K2VA 1ZHIA 2HQXA 4QQDA 5GAMe 1S72A 1FX7A 2FVUA 5CR2A 5GMKh 5J26A 1RI0A 3J7AF 1YIJA 4J8OA 2BUDA 3P8HA 4PJOF 4E7HA 1BKBA 3JRZA 2EQJA 3QO3A 3UWNA 1X01A 5IAYA 1YI2T 5KCOA 5A2QE 5FLXE 5J39A 2L89A 5GAN2 3LGLA 2QI2A 3OMCA 4M78F 3JB9I 3L2VA 3G4ST 3JCMd 3HSBA 4ZGJB 2MI6A 3CCRT 4MMKA 4IUPA 2L8DA 4MZMA 4OB1B 1VQ7A 1D3BA 2PVOB 3NFCA 4RKUE 1PSEA 1Y7XA 5GAOr 3UPUA 3JCMJ 2R5MA 4MDXA 4IUQA 1IZ6A 2HQEA 4ZGEB 4OGCA 5KCHA 1YBYA 1QP2A 3M54A 3JB9H 1K9MC 1O75A 5GANe 2KQWA 3S3NA 3CCUT 2LCCA 2LDMA 3DB3A 3QJYA 3SD4A 5IT9E 5GAOp 4N0AC 1YCYA 4IUVA 4E47A 3HRUA 1YI2A 1VQ5T 2V8IA 2ZZDA 4XU3A 2A3LA 2KMTA 4IUTA 2EYQA 4BUGA 3OYCA 2HAXA 3JB9J 1KD1C 2JN0A 3G4SA 2K4YA 5GMKj 3ZBDA 5GANg 1NJIU 1KG1A 4PNOA 3CCRA 4HA8A 5FROA 1TH7A 4X9DA 1W2BA 5C0MA 3S6WA 1QVGA 1JJ2S 5HK3A 2DZ9A 1KQSS 3N5BB 3JCMg 5HY6A 1VQPA 4BDZA 1KHCA 5DY9A 4ZGDB 2RM4A 5HK0A 1V29B 2MWOA 2EIFA 1I4K1 3SFMA 5GAN7 3CCUA 4M75G 1AHJB 4A4KA 5IN1A 3URGA 2EJ9A 3QUIA 2ZPIB 3PMIA 3V8KA 3L2UA 1VQ5A 4A4GA 2RJEA 3VV0A 4M7DB 2ZGWA 5FU7C 4M75A 3GOXA 3I55T 3CEYA 4XK8E 3OS1A 3CXCS 3SWNB 4EMKB 5CKHA 3M55A 3CMET 1WJQA 1M1GA 5LJ3j 3JB9F 2E1HA 3OYHA 3LX7A 2F5TX 4PL6A 1H3ZA 4JDSA 2MAMA 3M59A 5DLOA 3MCAB 5J3BA 5D6WA 3V8LA 3KXTA 2LQKA 3JAME 3FIFA 4M7AG 1WQ7A 2CGHA 3HP9A 2Y90A 3ZEHA 4M77B 2PUKB 4M7AA 4QVCA 2XI9A 2XK0A 4C5GA 5LJ5e 3X20B 3OYIA 4M7DE 4XAXB 2O4XA 2DIGA 5A0DA 1K8AU 1EIFA 1I8FA 1WQWA 2JTMA 2LX9A 3L42A 3I55A 3CCMT 2E5QA 4KUIA 3GNGA 4F7UG 3CMEA 2EQUA 2DAQA 2LT4A 4MMLA 2YLCA 5A0GA 1PSFA 3OS0A 1UGRB 2M0OA 5LJ5g 1WJSA 4F7UA 3LH0A 5HKCA 1VQ6T 5GAOq 3QYGB 4C8QG 2Y4XA 5CKBA 2ZPGB 5GAN8 2AHJB 2QQ9A 1UGPB 3LLRA 3CCQT 1VQOT 2KDSA 4M75D 3RMQA 3CC4T 2CYZB 2V8JA 2XKOC 2VUBA 4M77E 4C8QA 4C0DC 2CKKA 1SSFA 2XD0A 4XTUA 4M78B 4UC4A 3CPWA 5FU6B 2XHCA 3OS2A 5GAMf 2XU8A 2JVVA 3ASKA 3CCMA 3E19A 3JCMQ 2JNGA 2OAUA 2E12A 3HRTA 3OYAA 2OTLT 1N9RA 2PVDB 5CQYA 4FL6A 4OVAA 4ME7A 1BI3A 2HD0A 4WF2A 1VQ6A 1WNLA 1GXIE 1XQHA 3A8GB 4Y28E 1M1FA 3C95A 5CAIA 4HCBA 4M75F 3HPWA 1VQOA 5D6YA 3CCQA 2DTOA 1VQMT 3CC4A 3OW2S 2F5KA 1ZBXA 2ZPHB 4NL2A 4X9CA 5LJ5j 4A4EA 4RMOA 2X35A 4E7LA 3FB9A 2LQ8A 2MWPA 2LCLA 3TEEA 3M56A 1Q86C 4C8QC 2HBPA 3GLXA 2DTHA 2QA4T 3OYJA 3OYFA 3S3MA 4D6WA 2RD1A 5GMKe 3GNFB 4JS4A 2OTLA 2JOYA 3OYYA 4C8QD 4M7AF 3BW1A 3A5ZB 4CRIA 3CPWS 3CC7A 3RKYA 4N0AA 4E7IA 4PLIA 3L2ZA 4J83A 5GAMd 3OYEA 3M4GA 1K73U 3GIBA 4FIBA 1VQMA 3M5AA 1Y96A 3DLMA 3DKMA 2VXFA 4FT4A 2MF2A 2IG0A 2F69A 3LWHA 4F7UF 1N8RU 3CCLT 3E1SA 3M58A 3VUZA 2QA4A 3G71T 3OYMA 1M1KC 4QVDA 3MO8A 3PIPA 4ELYC 4C8QF 4RG2A 1VQ4T 3INZA 1G3WA 4OB3B 3OYBA 2LC4A 5LJ3e 2OTJT 2DEQA 2XG8D 4OP0A 1YJWT 4BE1A 4N4HA 1G3TA 2RHYA 1OI1A 2EJGA 1D3BB 3QPHA 2FHDA 3CBPA 2RO0A 2RJDA 2GCXA 2LRQA 2P0PA 1BIAA 1XOVA 2K3XA 4LDUA 5GMKm 3JCMc 5LJ3g 5GAMh 3CC2T 3CCLA 3Q1JA 2RHXA 1H641 4KT0E 2O01E 4HCCA 3JCMe 1VQKT 2ZPBB 1YHQT 3G71A 1QVFA 3TU4K 4LDXA 2Y4YA 2RI2A 3CCST 3F70A 4Y91A 3C12A 4XTZA 4ATOA 1O9SA 3EFRA 3OSVA 5AYFA 3OBYA 5GAN4 2NLUA 2GFAA 3CPFA 4LDYA 2OTJA 3MP8A 3PMTA 5GAN5 1YJWA 1HK9A 4FSXA 1OYXA 2I2LA 3RUXA 2JUFA 2E65A 1XTDA 4B9XA 4FT2A 1NE8A 2E70A 4QW2A 5GAOl 4J6XA 5GAOn 3J81E 4X34A 3CC2A 3M4YA 3A8HB 3NTIA 5CVIA 4MZTA 4C0ZA 1IREB 2RHUA 5EG2A 3FC3A 1VQKA 2G3RA 1YHQA 1K8AC 3CMAT 2DO3A 2K5LA 3OBWA 3FJPA 3CCSA 4PLLA 4EMHA 2CZ1B 2JZ2A 5FRNA 5FRMA 4J7FA 2E6ZA 2E64A 2FL7A 4XTXA 5DM7R 3MEVA 1DJ7B 3DB4A 1W4SA 3MP6A 3QSUA 3X24B 4EDUA 4OMFB 3QJ6A 2LT1A 3NTKA 3SWNA 5CCAA 3MEWA 2XIDA 1W2BS 2RHIA 4EMKA 1QVGS 4MDWA 4LD6A 3V7SA 3HKSA 4JRQA 1Q82C 4OF1A 1UGSB 2D0QB 2FB7A 3O8VA 4JRPA 4ZTJA 3QHSA 4C92B 2M1HA 4OB0B 4A53A 2XICA 3M9QA 1G3SA 4C0GA 1X6OA 3PTAA 3CMAA 1X75C 4M7AB 3GPLA 4P5NA 4II1A 4NL3A 3HHTB 5KE2A 1VQLT 2BKDN 5L8RE 4M77A 4A54A 2VC8A 2X4WA 4QQ6A 3M53A 4QVZA 4BE2A 1UEBA 1QW1A 4PJOB 3JCMP 5CKFA 3FDRA 1ZQ1A 2R5AA 1VIFA 2WSCE 4L6V5 2RA2A 4M7DC 2BIVA 4LDVA 1XNIA 4ELZC 3ME9A 3V7CA 4C92E 3SWNC 3WVEB 3A8LB 2EJFA 2X4JA 1R8OB 3RKWA 4BY6B 4EMKC 3I56T 4M7AE 4RG8A 4M7DD 2QXFA 1M90U 1JB0E 4XU1A 1VQLA 1M4ZA 1MGQA 3T9NA 3JCMX 3L1AA 4CI0C 1Q81U 2RK1A 3PT9A 3KBGA 1I81A 3RMSA 4PJOE 4L5GA 2LTOA 2QEXT 1U1TA 4XU0A 5I2MA 4BACA 3LW5E 4M77C 1K73C 1M5Q1 4JLIA 3JB9D 4M78E 2RH2A 1KQ2A 2CZ6B 4RCCA 2PQWA 1N27A 4EPCA 1BI2A 3HFNA 3QZ9B 4FU6A 3UDCA 1BI1A 4M77D 5I21A 3J80E 3I56A 4XU2A 3BDUA 3P8BB 5GANf 1Q7YC 3META 4IKFA 3QG1A 1I5LA 4QQGA 1B34A 3OSSC 3JCMV 4V2SA 1UGQB 2VYTA 5CKEA 4C5IA 2RJFA 2KY9A 3QZ5B 3RESA 2QEXA 2EQMA 5C6SA 2EAYA 4HCZA 3OA6A 1KC8U 2E41A 3LYIA 3OYLA 2DXCA 2C06A 2EQKA 4M78C 5FU6C 1KHIA 3PIOA 2K57A 3CBOA 2VV5A 3A8OB 3ER0A 2V8KA 1BI0A 4M77F 1LOJA 4OB2B 3UT1A 3X28B 3QYHB 2WACA 2QQRA 4M78D 4JS5A 3G7ZA 2A7YA 1NJIC 1Y71A 3GP8A 3H6ZA 4XTWA 2B8AA 5GAN6 3PGGA 3PFSA 3QDRB 3OYDA 2DPPB 4O5VA 3OYNA 3RKXA 3CCJT 4VUBA 2RI5A 5A0LA 3JCMW 1Q7YU 3FEOA 1WPYA 2KAFA 4HT8A 2XDDA 5GAOm 5GANd 4BDYA 2EKOA 2WSEE 2XDPA 1JBMA 2PU9B 3OY9A 1Q86U 3VKIA 4NOYA 1JJ2A 2EFIA 3DLLA 5GAMg 3SDZA 5FU7B 2DXUA 4R55A 2ZCFB 4IURA 5CK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  4M75 D;  4XTX A;  4PJO D;  4C8Q A;  3HFO A;  4M77 E;  3SB2 A;  4XTU A;  3QSU A;  2DVE A;  3BFM A;  1Y96 B;  4M78 B;  3V7R A;  1BIB A;  5LJ5 f;  3SWN A;  4C92 F;  4XQ3 A;  4EMK A;  1U1S A;  4J6Y A;  3RIR A;  5GAM f;  3V7S A;  2FYK A;  3JCM Q;  5LJ3 d;  5LJ3 h;  2FB7 A;  1N9R A;  2EWN A;  5GAM e;  3QHS A;  4C92 B;  4A53 A;  5GMK h;  4WF2 A;  1WNL A;  4M7A B;  5CAI A;  5GAN h;  4M75 F;  4PJO F;  4NL3 A;  2DTO A;  3QO3 A;  1X01 A;  3JCM b;  4M77 A;  4A54 A;  4NL2 A;  2VC8 A;  4X9C A;  4JRK A;  5LJ5 j;  5GAN 2;  4M78 F;  3JB9 I;  3FB9 A;  4M75 B;  3JCM d;  3JCM P;  3HSB A;  4M7D G;  3JCM h;  5GAM j;  4MMK A;  4RCB A;  4PJO B;  2HNI A;  2YHT A;  1D3B A;  4EMG A;  4C8Q C;  2DTH A;  5GAO r;  4M7D A;  2RA2 A;  3JCM J;  2DTI A;  4M7D C;  2VXE A;  3EFS A;  2RD1 A;  3V7C A;  3SWN C;  4C92 E;  1KQ1 A;  5GMK e;  3JB9 H;  1M8V A;  2EJF A;  4EMK C;  3RKW A;  4C8Q D;  4M7A E;  3BW1 A;  5GAN e;  5GAN 3;  4M7A F;  3JB9 G;  3RKY A;  5LJ5 d;  4N0A A;  5GMK l;  4M7D D;  5GAO p;  4N0A C;  3L2Z A;  1YCY A;  4XU1 A;  5GAM d;  1MGQ A;  3M4G A;  3JCM X;  3L1A A;  4J5Y A;  3GIB A;  4XU3 A;  4M77 G;  1LJO A;  1I81 A;  1Y96 A;  4M75 E;  4PJO E;  3JB9 J;  2VXF A;  2JN0 A;  1N9S A;  5GMK j;  1U1T A;  4J6W A;  4XU0 A;  5GAN g;  4PNO A;  4F7U F;  4C92 G;  4HA8 A;  4M77 C;  1TH7 A;  1M5Q 1;  4JLI A;  4X9D A;  5GAN j;  3JB9 D;  4M78 E;  2DJZ A;  1KQ2 A;  4RCC A;  4QVD A;  1LNX A;  4C92 A;  2DZ9 A;  3HFN A;  3JCM g;  4C8Q F;  4F7U B;  2YLB A;  3INZ A;  4M77 D;  5DY9 A;  5I21 A;  2RM4 A;  4XU2 A;  5LJ3 e;  3BDU A;  4XTV A;  5GAN f;  5GAN 7;  1I4K 1;  3RER A;  2DEQ A;  4OP0 A;  4M75 G;  4PJO G;  1I5L A;  2EJ9 A;  3QUI A;  2EJG A;  4C8Q B;  1B34 A;  1D3B B;  3JCM V;  2E10 A;  3V8K A;  4V2S A;  4M7D B;  2ZGW A;  4M75 A;  5LJ5 h;  1BIA A;  2DKG A;  5GMK m;  4HT9 A;  4M75 C;  4M78 G;  4PJO A;  2DZC A;  3RES A;  3SWN B;  3JCM c;  5LJ3 g;  2EAY A;  4EMK B;  5GAM h;  2E41 A;  5LJ3 j;  1H64 1;  4M78 A;  5GMK i;  3JCM e;  2E1H A;  2QTX A;  4M78 C;  1JRI A;  2K57 A;  3V8L A;  4F7U E;  4M77 F;  4Y91 A;  4JUV A;  1LOJ A;  4XTZ A;  3EFR A;  3FIF A;  4M7A G;  5LJ3 f;  5GAN 4;  1WQ7 A;  2CGH A;  4M78 D;  2Y90 A;  3VU3 C;  4C92 C;  5GAN 5;  4C8Q E;  1HK9 A;  4M77 B;  4M7A A;  5GAN 6;  4XTW A;  4QVC A;  4M7D F;  5LJ5 e;  2I2L A;  3PGG A;  3RUX A;  4M7A C;  4M7D E;  2E65 A;  3RKX A;  1I8F A;  3JCM W;  1WQW A;  4C92 D;  1WPY A;  3V8J A;  4HT8 A;  1HXD A;  5GAO l;  4J6X A;  5GAO n;  3AHU A;  4F7U G;  5GAO m;  5GAN d;  4M7A D;  4MML A;  4DQ2 A;  2YLC A;  3JCM f;  4PJO C;  5LJ5 g;  1JBM A;  2DXT A;  4F7U A;  4NOY A;  3FJP A;  4JRI A;  5GAO q;  3JB9 F;  1B34 B;  4C8Q G;  4EMH A;  5GAM g;  5GAN 8;  3BY7 A;  2DXU A;  2RB6 A;  4XTY A; 
#chains in the Genus database with same CATH topology
 4DBR A;  1PRL C;  4R56 A;  2D9T A;  2CSI A;  3CC4 Q;  5LJ5 f;  1NPR A;  2YSQ A;  1WGS A;  4XQ3 A;  3RIR A;  3VJP A;  2COZ A;  4ZTF A;  1X69 A;  4PFZ A;  3H0H A;  4JJC A;  4GLK A;  4BD3 A;  3OYK A;  2FPD A;  1UHF A;  5GAN h;  5I2S A;  2E3H A;  3CC7 Q;  2FPF A;  2O88 A;  4OGE A;  4M7D G;  3JCM h;  4LDW A;  1PRM C;  2RPN A;  1I0C A;  2A08 A;  2V1Q A;  3HRS A;  2DM1 A;  4Z88 A;  1R0C B;  1TG0 A;  5D7U A;  1K8A R;  3HL8 A;  2ZPE B;  2RK2 A;  1IB8 A;  3EG9 B;  1FMK A;  1M27 C;  3CCE A;  3GF5 A;  2FO0 A;  1YIT T;  1RI9 A;  2LQN A;  4Q5W A;  1KK7 A;  1N9S A;  1YJN T;  5GAN j;  2DJZ A;  2DIQ A;  1OOT A;  2OI3 A;  3G71 Q;  2QQB A;  2RQT A;  4XTV A;  2AKK A;  4PJO G;  1ZSZ B;  2BE7 D;  1NYG A;  2YRC A;  2E10 A;  1YNZ A;  5LJ5 h;  2DKG A;  4M75 C;  4M78 G;  2DZC A;  2QG9 B;  5M9O A;  4F16 A;  2VGN A;  1JRI A;  1U06 A;  3QII A;  4Z89 A;  3G6E T;  1VQK Q;  1Q82 U;  1LCK A;  3TRE A;  2E4H A;  3H41 A;  5LJ3 f;  1NLP C;  3I9Q A;  2VGM A;  1MMN A;  1N8R C;  1UB4 A;  2DRK A;  2K3B A;  1YJ9 T;  3FRN A;  3V8J A;  2QQA A;  1HXD A;  3BDL A;  3OS5 A;  2X4Y A;  1E6G A;  4DQ2 A;  3EG0 A;  4PJO C;  2D8H A;  5CQX A;  2DXT A;  1MNE A;  2GFU A;  4E7K A;  2KK4 A;  2MMP A;  3SB2 A;  4JLG A;  4J9D A;  2DK3 A;  1Y96 B;  3WXM B;  2G6F X;  3OQ5 A;  2CZ0 B;  2YUN A;  4QQD A;  2V26 A;  1BB9 A;  5GMK h;  5J26 A;  1RI0 A;  4J8O A;  3QO3 A;  1VYT A;  2L3S A;  5KCO A;  1UE9 A;  2L89 A;  3JB9 I;  3OMC A;  3L2V A;  1WXB A;  2MI6 A;  3CCR T;  4MZM A;  2L8D A;  1PSE A;  1BK2 A;  3MKD A;  1IZ6 A;  3M54 A;  2DER A;  2LCC A;  4N0A C;  2MIO A;  1YCY A;  2RMO A;  1YI2 A;  2IPO B;  4BUG A;  3OYC A;  2HAX A;  3JB9 J;  3G4S A;  2K4Y A;  2KNB B;  3ZBD A;  5GMK j;  1NJI U;  1KG1 A;  2J6K A;  1HSQ A;  1TH7 A;  1M3B A;  2HQH A;  1WYX A;  3S6W A;  5HK3 A;  3IQL A;  5HY6 A;  2YT6 A;  5HK0 A;  4ZGD B;  2RM4 A;  1D09 B;  1IHV A;  2ZPI B;  3PMI A;  4IIO A;  3L2U A;  1VQ5 A;  2ZGW A;  3GOX A;  3ULR B;  3OS1 A;  5CKH A;  1EX4 A;  5LJ3 j;  2OJ2 A;  2F5T X;  2ED0 A;  4JDS A;  3M59 A;  1PKS A;  5J3B A;  3EGD B;  1ZX6 A;  3FIF A;  3HP9 A;  1OX8 A;  3M0T A;  3ZEH A;  4M7A A;  4RUG A;  4C5G A;  2KRM A;  1G2B A;  5A0D A;  2J05 A;  1WIE A;  2LX9 A;  3L42 A;  2GTO A;  1VYU A;  3I55 A;  1VA7 A;  4FCY A;  2EQU A;  2LT4 A;  1SKU B;  5A0G A;  1Q81 R;  1WJS A;  4F7U A;  5HKC A;  1SHF A;  5I22 A;  5GAN 8;  2ZPG B;  1VQO T;  1UGP B;  2QQ9 A;  3O5Z A;  1JEG A;  1IO6 A;  2CP6 A;  3RNJ A;  1SSF A;  4FW2 A;  3REB B;  1SPK A;  4M4Z A;  3CPW A;  1WHM A;  2XU8 A;  3ASK A;  3CCM A;  2JNG A;  1RAG B;  2OAU A;  2OTL T;  2PVD B;  3EG3 A;  4FL6 A;  3M0Q A;  4ME7 A;  1BI3 A;  1WNL A;  1XQH A;  4RTW A;  4Y28 E;  5EC7 A;  5CAI A;  2L0A A;  4CC4 B;  1VQM T;  2F5K A;  4HVU A;  3CCE Q;  1V76 A;  1F1B B;  2X35 A;  3M56 A;  2DA9 A;  2JMA A;  3TVT A;  2RD1 A;  2JMC A;  3EFO B;  1MV3 A;  2EYW A;  1Q7Y R;  4WCI A;  2HZY A;  5GAM d;  1K73 U;  1RAC B;  4FIB A;  2EQI A;  2KXD A;  2IG0 A;  2F69 A;  2KYB A;  2QA4 A;  5IHI A;  2HEQ A;  1M1K C;  2F2W A;  4RG2 A;  4HXJ A;  1UGV A;  3OYB A;  2PZ1 A;  1LPL A;  2XG8 D;  3I35 A;  2FHD A;  2RJD A;  2GCX A;  1QLY A;  1BIA A;  4LDU A;  3CC2 T;  3CCL A;  2RHX A;  2O01 E;  4KGZ B;  4AFU C;  3TU4 K;  1TTH B;  4LDX A;  4PFP A;  4OMO A;  1C6V X;  3EFR A;  3OSV A;  1RAB B;  2NLU A;  3CPF A;  4LDY A;  1AVZ C;  1YJW A;  1WZO A;  1TXQ A;  1KD1 R;  1JO8 A;  2EVR A;  1D0Z A;  5GAO n;  3NTI A;  4C0Z A;  2RHU A;  2JJ9 A;  1QCO A;  1YHQ A;  3CMA T;  2K5L A;  3VS1 A;  2NUZ A;  4PLL A;  2K2M A;  2FL7 A;  3MEV A;  1DJ7 B;  1M3C A;  2KRS A;  3M0U A;  3NTK A;  1PC0 A;  2RHI A;  4MDW A;  4LD6 A;  3HKS A;  4JRQ A;  4OF1 A;  4KRT A;  3O8V A;  1SRL A;  3PTA A;  1G3S A;  2DYI A;  4P5N A;  3HHT B;  2RF0 A;  5L8R E;  2VC8 A;  2X4W A;  3M53 A;  1YI2 Q;  1X6G A;  4PJO B;  5CKF A;  2R5A A;  4Z8A A;  3G4S Q;  1EFN A;  4RTT A;  2LMJ A;  4L6V 5;  1T3L A;  2L3Q A;  4ELZ C;  4C92 E;  2EJF A;  2X4J A;  4EMK C;  2JTE A;  4M7A E;  4RG8 A;  1M90 U;  1VQL A;  1MGQ A;  3T9N A;  3L1A A;  2RK1 A;  2F1L A;  3TQ7 P;  2QEX T;  1SF9 A;  4GLM A;  1VQ5 Q;  4XU0 A;  5ECA A;  1K73 C;  1M5Q 1;  1KQ2 A;  2M0Y A;  1AWW A;  1N27 A;  1YP5 A;  4AFQ C;  3BDU A;  1ZBJ A;  1C0M A;  2DIL A;  1B3Q A;  4QQG A;  2LX7 A;  2VYT A;  5CKE A;  1Z9Q A;  2EQM A;  1SSH A;  2EAY A;  4X1V A;  3OA6 A;  2E41 A;  3LYI A;  2SEM A;  3I55 Q;  2EQK A;  1OPK A;  3PIO A;  4LXC A;  3EHR A;  3CBO A;  3ER0 A;  2V8K A;  1BI0 A;  3EHQ A;  3X28 B;  1B07 A;  2QQR A;  2HBW A;  1Y57 A;  3G7Z A;  5GAN 6;  4E2F B;  3OYN A;  3CCJ T;  3JCM W;  2RI5 A;  4DEY A;  3FEO A;  2KAF A;  4HT8 A;  5GAN d;  4BDY A;  3CCM Q;  4JPB W;  3OY9 A;  4RTV A;  3VKI A;  1JJ2 A;  2EFI A;  4DBQ A;  2W0Z A;  3HFO A;  2DEU A;  2ATC B;  1QKX A;  1VQ4 A;  1OEB A;  2BZY A;  2P4T A;  1ZUU A;  3ZFJ A;  1VQP T;  4BB7 A;  3CXC A;  2NUP A;  2DL4 A;  4LD9 K;  3L2W A;  1K0X A;  2YRV A;  4N4I A;  4RTY A;  1CKB A;  3NTH A;  3WVD B;  3PVQ A;  2EGE A;  1IRX A;  3G1J A;  4A4H A;  1JJ2 P;  3JCM b;  4TVR A;  4A4F A;  2WSF E;  1WI7 A;  4JRK A;  1GRI A;  5GAM j;  4C5H A;  2HNI A;  1E7O A;  2RN8 A;  1K9M U;  3JSC A;  2DTI A;  3H9N A;  2QA4 Q;  2D6F A;  1K0S A;  2COW A;  1KQ1 A;  4LE9 A;  2XDB A;  2P0Q A;  5LJ5 d;  2JTF A;  1I1J A;  1GBR A;  1LJO A;  5FW9 A;  4M75 E;  3FJ5 A;  3QXE B;  3PNW C;  4J6W A;  3TCJ A;  2KSS A;  1M90 C;  4KH0 B;  3D7S B;  4C92 G;  1VUB A;  1T0J A;  6AT1 B;  3CCL Q;  1G3Y A;  1LNX A;  3EAE A;  1SEM A;  4HVV A;  2JT4 A;  2J06 A;  3RER A;  1U8R A;  1GCP A;  3TSZ A;  1YJW Q;  4JJN K;  4Z02 A;  4ORZ A;  1YIT A;  1K1Z A;  1YJN A;  1UJ0 A;  1VQN T;  1MMA A;  2DE0 X;  2DXB A;  4BI3 A;  3OB9 A;  1OZ3 A;  1PD1 A;  1YHQ Q;  1M30 A;  2FZC B;  3CCV T;  2KVQ G;  2CRE A;  1IGU A;  4C92 C;  1I07 A;  4C8Q E;  1X2Q A;  1Y07 A;  4PKC C;  4ZN3 A;  3CD6 T;  4M7D F;  4M7A C;  5KYW A;  2KT8 A;  1RAH B;  1OPL A;  3CC7 T;  3AHU A;  1S72 T;  3JCM f;  1TSF A;  1FXX A;  1P92 A;  2LJ1 A;  4HKE A;  4KBM B;  4DA4 A;  1B34 B;  3G6E A;  1YIJ T;  1GL5 A;  3BY7 A;  1N8R R;  2RB6 A;  4XTY A;  4PJO D;  2DD4 A;  4DOW A;  1X2K A;  4IUU A;  2C0O A;  3P8D A;  1YJ9 A;  1BIB A;  4KUD K;  3EGU A;  1QQJ A;  1U1S A;  1OZ2 A;  5LJ3 d;  2CS7 A;  5KE3 A;  2ROL A;  2K2V A;  1ZHI A;  2FVU A;  3J7A F;  4FYV B;  3P8H A;  4PJO F;  1AZG B;  1X27 A;  3JRZ A;  2JXB A;  5FLX E;  5J39 A;  1VQL Q;  4M78 F;  2V1R A;  3HSB A;  4ZGJ B;  2P84 A;  1D3B A;  1UJY A;  2PVO B;  2FPE A;  4RKU E;  5GAO r;  4J9I A;  1AWO A;  3JB9 H;  5KCH A;  1YBY A;  2EYZ A;  1K9M C;  1O75 A;  3S3N A;  3CCU T;  2K7A A;  5GAO p;  2MYS A;  1IGQ A;  3HRU A;  4XU3 A;  2A3L A;  2KMT A;  4IUT A;  2JN0 A;  1I5O B;  3CCR A;  1ABO A;  4X9D A;  4J9C A;  1JJ2 S;  3VS0 A;  1PG5 B;  3N5B B;  1U5S A;  2MCN A;  3RR6 A;  4KGV B;  1I4K 1;  5GAN 7;  2DX1 A;  2DNU A;  2QAZ A;  4M75 G;  2KBT A;  1FYN A;  3V8K A;  2HSE B;  4A4G A;  3JV3 A;  5FU7 C;  2KT1 A;  3CXC S;  4XK8 E;  4PK4 A;  4EMK B;  1WDX A;  1WHL A;  2VB6 A;  2E1H A;  1QVF P;  5IXF A;  4PL6 A;  2MAM A;  2YWW A;  1ZUK A;  3MCA B;  2LQK A;  4PJL A;  2CGH A;  3UA7 A;  4QVC A;  3X20 B;  2DIG A;  1K8A U;  1VQ4 Q;  1I8F A;  2JTM A;  1PHT A;  1QCF A;  2YLC A;  1PSF A;  1K9A A;  1UGR B;  3TSW A;  3EG2 A;  1VQ6 T;  5GAO q;  4DBH A;  4C8Q G;  1T0H A;  2Y4X A;  3CCQ T;  1ZSZ A;  2V8J A;  4M77 E;  4C0D C;  2CKK A;  2X3W D;  1MMG A;  2YXY A;  4PJN A;  2DJQ A;  4J9F A;  1UTI A;  2XHC A;  2LZ6 B;  1N9R A;  2VVK A;  4OVA A;  2SRC A;  2HD0 A;  1CSK A;  1GXI E;  4CC2 A;  4HCB A;  2DL8 A;  1VQO A;  1KC8 R;  1UEC A;  5LJ5 j;  3M0P A;  3FB9 A;  2LQ8 A;  1GFD A;  2A37 A;  3TEE A;  1Q86 C;  4C8Q C;  2DTH A;  3OYF A;  4D6W A;  4JS4 A;  2QGG A;  2OTL A;  4CRI A;  3A5Z B;  1KFZ A;  3I5R A;  4PLI A;  1NEB A;  3L2Z A;  2K79 A;  1VQM A;  1W1F A;  3M5A A;  2VWF A;  1X6B A;  1YN8 A;  3RBB B;  1Y96 A;  4A63 B;  2MF2 A;  1YIT Q;  4AG1 C;  3OYM A;  4QVD A;  1YJN Q;  3EGX B;  4ELY C;  1QMC A;  2LC4 A;  2O9V A;  2OTJ T;  4KGX B;  4N4H A;  1OI1 A;  2EJG A;  3C0C A;  3QPH A;  2P0P A;  3CQT A;  2K3X A;  3QDF A;  1M1K R;  3Q1J A;  4HCC A;  2ZPB B;  1K4U S;  2Y4Y A;  2RI2 A;  3CCS T;  4J9G A;  3UA6 A;  3OBY A;  5GAN 4;  3G6E Q;  2GFA A;  3MP8 A;  4J9B A;  4FSX A;  2GBQ A;  1OYX A;  2I2L A;  2E65 A;  1XTD A;  1YJ9 Q;  2E70 A;  4J6X A;  3CC2 A;  4X34 A;  3M4Y A;  5CVI A;  1IRE B;  3FC3 A;  2G3R A;  1K8A C;  2DO3 A;  1KQS P;  5FRN A;  1UFF A;  2LCS A;  1RLQ C;  1JXM A;  2GTJ A;  5DM7 R;  2PTK A;  4OMF B;  4ANJ A;  1Q82 C;  2FB7 A;  1M2V B;  1NYF A;  3QHS A;  4C92 B;  4A53 A;  3M9Q A;  3CMA A;  3EGD A;  4CC7 A;  1X75 C;  2D0N A;  4M7A B;  2CSQ A;  4WTO B;  2BKD N;  2CH4 W;  3REA B;  2DFU A;  1GCQ A;  4QQ6 A;  3JCM P;  3EH2 A;  3FDR A;  1ZQ1 A;  2D1X A;  4GBQ A;  1VIF A;  2WSC E;  3CCR Q;  3VS3 A;  1TUC A;  2ED1 A;  2QK0 A;  2M51 A;  3SWN C;  4KH1 B;  3A8L B;  1XJW B;  1R8O B;  3RKW A;  3I56 T;  4EIK A;  2FEI A;  2CDT A;  4FYX B;  2MK5 A;  1JB0 E;  1VYV A;  1Q81 U;  1AZE A;  1RAA B;  1OQK A;  2BZ8 A;  2ECZ A;  1U1T A;  5I2M A;  4BAC A;  4M77 C;  3JB9 D;  2AK5 A;  2EGA A;  4FU6 A;  3QZ9 B;  3J80 E;  2KGT A;  5KYN A;  3MET A;  3QG1 A;  2EKH A;  2LJ0 A;  4JZ3 A;  1UGQ B;  2E3I A;  2JS0 A;  1WLP B;  5IHK A;  2QEX A;  2C06 A;  1KJW A;  1D1A A;  1PKT A;  2J7I A;  2K57 A;  4OB2 B;  4D8D A;  4D8K A;  2WAC A;  1BU1 A;  1NJI C;  3GP8 A;  3H6Z A;  3PGG A;  3OYD A;  2DPP B;  4VUB A;  1EZZ B;  1Q7Y U;  3BE3 A;  2NWM A;  2XDP A;  5KYY A;  4Y92 A;  1JBM A;  2LQW A;  2O2O A;  2COY A;  5GAM g;  5FU7 B;  4R55 A;  4FSS A;  1VQO Q;  3R6O A;  3A8M B;  3QKJ A;  2RHZ A;  1VQ9 T;  3CCJ A;  1VQ8 T;  2FYK A;  4E7J A;  4BI4 A;  2EWN A;  2E6N A;  2BE9 B;  2EBP A;  2E5K A;  2OTL Q;  1YWO A;  3OYG A;  2KE9 A;  1D1B A;  3M57 A;  1D0X A;  2J6O A;  1AD5 A;  2B86 A;  1VIE A;  4FYW B;  3E9G A;  3LGF A;  4LNP A;  4M75 B;  5KH6 A;  1VQM Q;  2ZPF B;  5CIU A;  8AT1 B;  4M7D A;  2RJC A;  2X4X A;  4O6J A;  4C0D B;  3FLG A;  5GAN 3;  3JB9 G;  1KD1 U;  5GMK l;  2L2P A;  1NPP A;  3L2Q A;  2ZAE A;  3C94 A;  1R0B G;  4AT1 B;  2O4X B;  2JM9 A;  2PUO B;  1W2B P;  5GJW B;  1QVG P;  3HTR A;  3MHX A;  1Q81 C;  1OV3 A;  5DLQ E;  4AMC A;  1YCS B;  2CUB A;  2YLB A;  2LNV A;  4BI8 B;  4C8Q B;  4PJO A;  2F2V A;  4HT9 A;  2IIM A;  1W6X A;  5D6X A;  4M78 A;  2QTX A;  2L3R A;  3CC2 Q;  2K5I A;  4F7U E;  3OMG A;  3VU3 C;  3NHN A;  3X26 B;  3VYG A;  1ACM B;  3L2R A;  5FWB A;  1OX9 A;  2HDA A;  2Z0W A;  4C92 D;  1NZ9 A;  4M7A D;  2DL3 A;  4LUD A;  1QP3 A;  2R58 A;  2P0K A;  3PVL A;  1VQN A;  5I11 A;  4C5E A;  1Q7Y C;  4JRI A;  7AT1 B;  2AIR B;  3CMA Q;  2AT1 B;  4MZP A;  3CCV A;  1MHN A;  2M16 A;  2QQS A;  4BY6 C;  2CZ7 B;  3CD6 A;  3E9F A;  2DVE A;  3BFM A;  4N4G A;  1VQ7 T;  2HCK A;  4C92 F;  2DL7 A;  3UF4 A;  2XMF A;  4NS5 A;  2HQX A;  1UUE A;  1S72 A;  1FX7 A;  4HCK A;  5KYX B;  3A98 A;  2VKN A;  1B7T A;  1YIJ A;  4E7H A;  2BUD A;  5IXB A;  1BKB A;  2EQJ A;  3UWN A;  5IAY A;  1PM3 A;  1AWX A;  5A2Q E;  5GAN 2;  1NLO C;  2QI2 A;  1S1N A;  2MOX A;  3JCM d;  1ZA2 B;  4OB1 B;  3NFC A;  1UG1 A;  1Z9Z A;  2X3X D;  4AG2 C;  3UPU A;  2NYS A;  1K76 A;  1OU9 A;  4IUQ A;  2CP2 A;  2C0T A;  2YUO A;  2HQE A;  2LP5 A;  1QP2 A;  2NUT A;  1IXD A;  5GAN e;  2KQW A;  3DB3 A;  2LDM A;  5KYU A;  3SD4 A;  5IT9 E;  4IUV A;  4E47 A;  2YRD A;  5HCK A;  1KD1 C;  5GAN g;  1ZLM A;  1G8X A;  4HA8 A;  5FRO A;  2QEX Q;  1PWT A;  2DZ9 A;  2K6D A;  3JCM g;  4J9H A;  5DY9 A;  1GBQ A;  2EIF A;  3CCU A;  2A28 A;  4A4K A;  2O31 A;  5IN1 A;  3URG A;  2EJ9 A;  3QUI A;  2DLP A;  2P4R A;  2RJE A;  2QAS A;  3MPU B;  3CEY A;  3SWN B;  4CC3 A;  3M55 A;  3CME T;  3LX7 A;  3V8L A;  4M7A G;  3H0I A;  1WQ7 A;  4F17 A;  2FRY A;  2PUK B;  4M77 B;  2X51 A;  2XI9 A;  2XK0 A;  5LJ5 e;  4M7D E;  4XAX B;  4KUI A;  4IIM A;  4F7U G;  2YUP A;  3CCJ Q;  2DAQ A;  3OS0 A;  5LJ5 g;  5CKB A;  2AHJ B;  2KDS A;  4M75 D;  3RMQ A;  1WHK A;  3CC4 T;  2XD0 A;  4XTU A;  2EYX A;  1QWE A;  3OS2 A;  3SEM A;  2JVV A;  2HMA A;  2K9G A;  5CQY A;  1Y0M A;  3QWX X;  4WF2 A;  1VQ6 A;  1M1F A;  3C95 A;  4M75 F;  5KYW B;  5D6Y A;  3CCQ A;  2DTO A;  2PNI A;  1ZBX A;  2ZPH B;  4RMO A;  4A4E A;  1GCQ C;  4E7L A;  1FMW A;  2LCL A;  3S3M A;  2QYZ A;  4ESR A;  5GMK e;  4C8Q D;  3BW1 A;  3RKY A;  4E7I A;  5L23 A;  3OYE A;  3M4G A;  3DLM A;  2VXF A;  4FT4 A;  1N8R U;  3M58 A;  3VUZ A;  3G71 T;  3MO8 A;  3PIP A;  2ESW A;  4C8Q F;  1VQ4 T;  3INZ A;  1G3W A;  5LJ3 e;  2DEQ A;  4OP0 A;  4BE1 A;  2RHY A;  4RTX A;  1D3B B;  2RO0 A;  2HL3 A;  5GMK m;  3JCM c;  5LJ3 g;  2RQW A;  4KT0 E;  1RUW A;  1VQK T;  1LVK A;  1QVF A;  1RAF B;  3GBQ A;  3F70 A;  4Y91 A;  3C12 A;  4XTZ A;  1VQN Q;  3AT1 B;  1ZSG A;  1WXT A;  2OTJ A;  2M02 A;  2QTV A;  1HK9 A;  1JQQ A;  8ATC B;  3CCV Q;  3RUX A;  1PCX A;  3CD6 Q;  1NE8 A;  3QWY A;  2ROT A;  3J81 E;  1CKA A;  2EW3 A;  3A8H B;  1IHW A;  2KI7 A;  3FJP A;  2JS2 A;  3CCS A;  1S72 Q;  2CZ1 B;  5FRM A;  2E6Z A;  1WXU A;  2KYM A;  2RNA A;  1YIJ Q;  3MP6 A;  3QSU A;  3X24 B;  2C0I A;  2LT1 A;  3EG9 A;  5CCA A;  2XID A;  4EMK A;  2DYB A;  2KRN A;  3V7S A;  2OX7 A;  2EGC A;  4J9E A;  4OB0 B;  2XIC A;  4C0G A;  1D0Y A;  2L3P A;  4II1 A;  4NL3 A;  5KE2 A;  2DVJ A;  2DL5 A;  4QVZ A;  1UEB A;  1Q82 R;  1QKW A;  1NM7 A;  4FW1 A;  2F2X A;  4M7D C;  4LDV A;  3V7C A;  3WVE B;  4BY6 B;  2KR3 A;  2QXF A;  3NMZ C;  4PJJ A;  4R0K A;  1M4Z A;  3CCU Q;  3KBG A;  3NGP A;  2CP0 A;  1R77 A;  3LW5 E;  4JLI A;  2HKQ B;  2QGF B;  2CZ6 B;  4RCC A;  4EPC A;  3HFN A;  5GJV B;  3UDC A;  4M77 D;  5I21 A;  3I56 A;  4XU2 A;  3P8B B;  1W70 A;  3H0F A;  1I5L A;  3JCM V;  1ABQ A;  2FZK B;  2RJF A;  3M0R A;  4HCZ A;  1KC8 U;  3OYL A;  1AOJ A;  4M78 C;  3NPF A;  4JJB A;  5FU6 C;  1KHI A;  4M77 F;  3A8O B;  3UT1 A;  3EG1 A;  2X9H A;  2EYY A;  2B8A A;  1H8K A;  3PFS A;  4O5V A;  3RKX A;  4E7Z A;  4DEX A;  5GAO m;  2AZS A;  1WA7 A;  1J3T A;  2CT4 A;  3EGX A;  1GFC A;  1ZUY A;  3SDZ A;  2DXU A;  1NJI R;  1KQS A;  5CK9 A;  1VQ6 Q;  3LWI A;  2IVW A;  3CCQ Q;  4BE0 A;  4F04 B;  2HSP A;  3V7R A;  3VRZ A;  4C0F A;  2I0N A;  2K5F A;  4L59 A;  1WJR A;  2ABL A;  2GQV A;  4AFZ C;  3MP1 A;  5LJ3 h;  4GY5 A;  1TS9 A;  4YTL A;  2QDL A;  1ZA1 B;  1M1K U;  2FG0 A;  3CCE T;  2OAW A;  1HJD A;  1M9S A;  4RCB A;  4RTZ A;  2YHT A;  3KUF A;  4EMG A;  4J7I A;  1VQ9 A;  3VS6 A;  1VQ8 A;  2R57 A;  1QVF S;  1M8M A;  2FZG B;  2GF7 A;  2VXE A;  3EFS A;  1WHJ A;  1M8V A;  3X25 B;  2DMO A;  1RAI B;  2GQI A;  3VUB A;  2RI3 A;  1OUL A;  1G5V A;  4J5Y A;  4M77 G;  1N6A A;  1RLP C;  2QDY B;  1UHC A;  1FWZ A;  5CKD A;  1QVP A;  1PNJ A;  2DBK A;  3A1P A;  1M2V A;  1RAD B;  4FM4 B;  4C92 A;  2H3J A;  2W10 A;  2M9U A;  4F7U B;  5CO7 A;  1X43 A;  1ARK A;  2KEA A;  2OTJ Q;  4JZ4 A;  3VRY A;  3MEA A;  3OW2 A;  2CP3 A;  3THK A;  2K3Y A;  4DOV A;  5LL6 S;  2H8H A;  5GMK i;  3S3O A;  1M3A A;  4LN2 A;  4JUV A;  1KC8 C;  1BYM A;  2CP7 A;  3VYH B;  3CCS Q;  2PVG B;  2DET A;  2AKL A;  3H8Z A;  2DF6 A;  3QBY A;  2LJ3 A;  4FYY B;  3CBM A;  4ZN1 A;  3OW2 P;  1K73 R;  3JB9 F;  3ZL7 C;  3C4S A;  3MEU A;  3EFO A;  1UDL A;  2DD5 A;  3CPW P;  4KUL A;  1NBE B;  4J6Y A;  2LVM A;  1RL2 A;  2L5Q A;  4B9W A;  1AEY A;  4F14 A;  5GAM e;  5CR2 A;  1A0N B;  1YI2 T;  1X01 A;  4OMQ A;  4QT7 A;  3LGL A;  3E2U A;  3G4S T;  2DRM A;  4MMK A;  4IUP A;  4RTU A;  5KYY B;  1VQ7 A;  1Y7X A;  3JCM J;  2R5M A;  1H3H A;  1NEG A;  4MDX A;  4ZGE B;  4OGC A;  3QJY A;  1TUD A;  3I56 Q;  1VQ5 T;  2V8I A;  2ZZD A;  3VS4 A;  2EYQ A;  1WHG A;  4PNO A;  4ZNX A;  3VS5 A;  1W2B A;  1NG2 A;  5C0M A;  1QVG A;  1V1C A;  1FMV A;  1KQS S;  2YUQ A;  1VQP A;  4BDZ A;  1KHC A;  3RDV A;  1V29 B;  2MWO A;  3UAT A;  3SFM A;  1AHJ B;  1PD0 A;  1G83 A;  2CT3 A;  1AT1 B;  3VV0 A;  4M7D B;  4M75 A;  1TOV A;  3I55 T;  3SHW A;  1WJQ A;  3EH1 A;  1M1G A;  3OYH A;  1H3Z A;  1U3O A;  5DLO A;  5D6W A;  3KXT A;  3JAM E;  1N5Z A;  4E7S A;  2Y90 A;  2J6F A;  2JW4 A;  2DBM A;  2BTT A;  2O9S A;  3OYI A;  2O4X A;  1EIF A;  1WQW A;  1BCM A;  3CCM T;  2E5Q A;  1M90 R;  3GNG A;  3CME A;  4MML A;  2M0O A;  2RQU A;  1Q95 G;  1H92 A;  1YFN A;  1BCO A;  3LH0 A;  3QYG B;  3LLR A;  2FRW A;  2CYZ B;  2H3E B;  2XKO C;  2VUB A;  4C8Q A;  3PE0 A;  9ATC B;  4M78 B;  4UC4 A;  4JJD A;  5FU6 B;  5GAM f;  3E19 A;  3JCM Q;  2EPD A;  4K11 A;  2E12 A;  2RQR A;  3HRT A;  1VQ9 Q;  3OYA A;  1VQ8 Q;  1C1A A;  4QKU A;  1SG5 A;  3A8G B;  4PJM A;  3HPW A;  1BBZ A;  2GNC A;  3MJX A;  3CC4 A;  1YWP A;  3OW2 S;  4NL2 A;  4X9C A;  4HVW A;  2MWP A;  1TWB A;  1SRM A;  1ZSZ C;  2HBP A;  3GLX A;  5IH2 A;  1MMD A;  3OYJ A;  2QA4 T;  3GNF B;  1E6H A;  2JOY A;  3OYY A;  4M7A F;  4OMN A;  3CPW S;  2HL5 C;  3CC7 A;  1T3S A;  4N0A A;  4J83 A;  1M2O A;  3GIB A;  3DKM A;  1TU0 B;  3LWH A;  4F7U F;  3CCL T;  2JM8 A;  2GGR A;  5AT1 B;  3E1S A;  4OML A;  5KYX A;  4OB3 B;  2VAS A;  4AFS C;  1YJW T;  1G3T A;  3CBP A;  2LRQ A;  1XOV A;  1HYO A;  2KXC A;  4B6M A;  2CP5 A;  5GAM h;  2NUT B;  1H64 1;  2NUP B;  3JCM e;  5KYU B;  1YHQ T;  3G71 A;  2AZV A;  4ATO A;  2CUD A;  1O9S A;  5AYF A;  1K9M R;  3LH5 A;  3M0S A;  3PMT A;  5GAN 5;  2JUF A;  2ENM A;  1QWF A;  4LUE A;  4B9X A;  4FT2 A;  1WFW A;  4QW2 A;  5IHN A;  5GAO l;  1RAE B;  1MUZ A;  4MZT A;  5EG2 A;  1VQK A;  3OBW A;  2HKN A;  1VOM A;  4EMH A;  2JZ2 A;  4J7F A;  2E64 A;  4XTX A;  1KIK A;  3DB4 A;  1W4S A;  4EDU A;  3QJ6 A;  3SWN A;  3MEW A;  3CXC P;  1W2B S;  1OU8 A;  1QVG S;  1VQ7 Q;  1UGS B;  2D0Q B;  4JRP A;  3KFV A;  4ZTJ A;  2M1H A;  1X6O A;  3GPL A;  1JXO A;  1VQL T;  4M77 A;  4A54 A;  2MPX C;  1WX6 A;  4BE2 A;  1QW1 A;  2D8J A;  2RA2 A;  3U23 A;  2BIV A;  1XNI A;  3VS7 A;  3ME9 A;  4DBF A;  2A36 A;  1VQP Q;  4M7D D;  4E6R A;  3I5S A;  4XU1 A;  2LNH B;  3JCM X;  4PFO A;  1HD3 A;  4CI0 C;  3PT9 A;  1JU5 C;  1TUG B;  1I81 A;  1KSW A;  3RMS A;  4PJO E;  4L5G A;  2LTO A;  5FWC A;  1D1C A;  1WHH A;  1SHG A;  4M78 E;  2RH2 A;  2PQW A;  1BI2 A;  1BI1 A;  5GAN f;  3VS2 A;  1AWJ A;  4IKF A;  1QCN A;  2CH4 A;  4OMM A;  2KRO A;  1B34 A;  3OSS C;  4V2S A;  4C5I A;  2KY9 A;  3QZ5 B;  3RES A;  5C6S A;  1Q86 R;  2DXC A;  2A0F B;  3CME Q;  2VV5 A;  3R6N A;  1LOJ A;  2RQV A;  3QYH B;  4M78 D;  4JS5 A;  4OMP A;  2A7Y A;  1Y71 A;  2YDL A;  4XTW A;  1MV0 B;  3QDR B;  5A0L A;  1WPY A;  2XDD A;  1MND A;  2EKO A;  2WSE E;  2PU9 B;  1Q86 U;  2BZX A;  4NOY A;  3DLL A;  2ZCF B;  4IUR A; 
#chains in the Genus database with same CATH homology
 3LWI A;  2IVW A;  3R6O A;  3A8M B;  3HFO A;  4BE0 A;  3QKJ A;  2D9T A;  4R56 A;  1VQ4 A;  5LJ5 f;  1NPR A;  2P4T A;  2RHZ A;  3V7R A;  1WGS A;  4C0F A;  2K5F A;  4XQ3 A;  3ZFJ A;  3CCJ A;  3RIR A;  3VJP A;  4BB7 A;  4L59 A;  4ZTF A;  3CXC A;  1VQ9 T;  1WJR A;  2FYK A;  2GQV A;  1VQ8 T;  4LD9 K;  3L2W A;  3MP1 A;  4BI4 A;  4E7J A;  5LJ3 h;  2YRV A;  2EWN A;  2E6N A;  4N4I A;  4GLK A;  4GY5 A;  4BD3 A;  3OYK A;  3NTH A;  4YTL A;  3WVD B;  5GAN h;  5I2S A;  1M1K U;  3OYG A;  4A4H A;  3CCE T;  3M57 A;  3JCM b;  4TVR A;  4A4F A;  2WSF E;  4JRK A;  1VIE A;  3E9G A;  3LGF A;  4M75 B;  4OGE A;  5KH6 A;  4M7D G;  3JCM h;  4C5H A;  1M9S A;  4RCB A;  5GAM j;  2HNI A;  2ZPF B;  2YHT A;  4LDW A;  3KUF A;  5CIU A;  4J7I A;  4EMG A;  1K9M U;  1VQ9 A;  3JSC A;  1KQS A;  1VQ8 A;  4M7D A;  2R57 A;  2RJC A;  1QVF S;  2DTI A;  2X4X A;  3HRS A;  2GF7 A;  2VXE A;  3EFS A;  2D6F A;  1M8V A;  1KQ1 A;  4O6J A;  4C0D B;  3FLG A;  2XDB A;  3X25 B;  5GAN 3;  3VUB A;  3JB9 G;  2P0Q A;  5LJ5 d;  2RI3 A;  5GMK l;  1KD1 U;  3HL8 A;  2ZPE B;  2RK2 A;  1NPP A;  3L2Q A;  3CCE A;  2JTF A;  3C94 A;  1G5V A;  3GF5 A;  4J5Y A;  4M77 G;  1LJO A;  4M75 E;  1YIT T;  1N6A A;  2O4X B;  4Q5W A;  1N9S A;  2QDY B;  3PNW C;  3QXE B;  4J6W A;  2KSS A;  2PUO B;  3TCJ A;  1M90 C;  4C92 G;  1YJN T;  1FWZ A;  1VUB A;  5CKD A;  5GAN j;  1QVP A;  3MHX A;  1Q81 C;  2DJZ A;  2DIQ A;  5DLQ E;  1G3Y A;  1LNX A;  4FM4 B;  4C92 A;  2H3J A;  2M9U A;  3EAE A;  4F7U B;  2YLB A;  5CO7 A;  2LNV A;  2QQB A;  4BI8 B;  4XTV A;  3RER A;  1U8R A;  4PJO G;  4C8Q B;  2E10 A;  4JJN K;  3MEA A;  4Z02 A;  5LJ5 h;  2DKG A;  3OW2 A;  4HT9 A;  4PJO A;  4M75 C;  4M78 G;  1YIT A;  2DZC A;  5M9O A;  2K3Y A;  4DOV A;  5D6X A;  5LL6 S;  1YJN A;  4M78 A;  5GMK i;  3S3O A;  2QTX A;  2L3R A;  2VGN A;  1JRI A;  2K5I A;  3QII A;  1VQN T;  2DXB A;  4BI3 A;  3OB9 A;  4F7U E;  1OZ3 A;  3G6E T;  4JUV A;  1KC8 C;  1Q82 U;  1BYM A;  3TRE A;  3OMG A;  3VYH B;  5LJ3 f;  3VU3 C;  2PVG B;  3X26 B;  3VYG A;  3CCV T;  2KVQ G;  2VGM A;  4C92 C;  4C8Q E;  1N8R C;  1UB4 A;  1Y07 A;  3L2R A;  4PKC C;  4ZN3 A;  3CD6 T;  3H8Z A;  1YJ9 T;  4M7D F;  4M7A C;  3FRN A;  3QBY A;  3CBM A;  4C92 D;  3V8J A;  4ZN1 A;  2QQA A;  1HXD A;  3BDL A;  3OS5 A;  3CC7 T;  3AHU A;  1NZ9 A;  4M7A D;  2X4Y A;  4DQ2 A;  1QP3 A;  2R58 A;  3JCM f;  1S72 T;  4PJO C;  2P0K A;  5CQX A;  2DXT A;  1VQN A;  1FXX A;  1P92 A;  4C5E A;  4JRI A;  4HKE A;  4KBM B;  4DA4 A;  1B34 B;  3G6E A;  3C4S A;  1YIJ T;  3BY7 A;  2RB6 A;  4XTY A;  2GFU A;  4PJO D;  2DD4 A;  3MEU A;  4DOW A;  4MZP A;  4E7K A;  2KK4 A;  3CCV A;  1MHN A;  2M16 A;  2MMP A;  2QQS A;  4IUU A;  4BY6 C;  3SB2 A;  4JLG A;  2DD5 A;  3P8D A;  2CZ7 B;  3CD6 A;  2DK3 A;  2DVE A;  3BFM A;  1Y96 B;  3E9F A;  4KUL A;  1BIB A;  4N4G A;  3WXM B;  1YJ9 A;  1VQ7 T;  4C92 F;  1VQP T;  4KUD K;  3OQ5 A;  1U1S A;  4J6Y A;  2CZ0 B;  2LVM A;  1RL2 A;  2L5Q A;  1OZ2 A;  4NS5 A;  2CS7 A;  5LJ3 d;  4B9W A;  5KE3 A;  2K2V A;  1ZHI A;  2HQX A;  4QQD A;  5GAM e;  1S72 A;  1FX7 A;  2FVU A;  5CR2 A;  5GMK h;  5J26 A;  1RI0 A;  3J7A F;  1YIJ A;  4J8O A;  2BUD A;  3P8H A;  4PJO F;  4E7H A;  1BKB A;  3JRZ A;  2EQJ A;  3QO3 A;  3UWN A;  1X01 A;  5IAY A;  1YI2 T;  5KCO A;  5A2Q E;  5FLX E;  5J39 A;  2L89 A;  5GAN 2;  3LGL A;  2QI2 A;  3OMC A;  4M78 F;  3JB9 I;  3L2V A;  3G4S T;  3JCM d;  3HSB A;  4ZGJ B;  2MI6 A;  3CCR T;  4MMK A;  4IUP A;  2L8D A;  4MZM A;  4OB1 B;  1VQ7 A;  1D3B A;  2PVO B;  3NFC A;  4RKU E;  1PSE A;  1Y7X A;  5GAO r;  3UPU A;  3JCM J;  2R5M A;  4MDX A;  4IUQ A;  1IZ6 A;  2HQE A;  4ZGE B;  4OGC A;  5KCH A;  1YBY A;  1QP2 A;  3M54 A;  3JB9 H;  1K9M C;  1O75 A;  5GAN e;  2KQW A;  3S3N A;  3CCU T;  2LCC A;  2LDM A;  3DB3 A;  3QJY A;  3SD4 A;  5IT9 E;  5GAO p;  4N0A C;  1YCY A;  4IUV A;  4E47 A;  3HRU A;  1YI2 A;  1VQ5 T;  2V8I A;  2ZZD A;  4XU3 A;  2A3L A;  2KMT A;  4IUT A;  2EYQ A;  4BUG A;  3OYC A;  2HAX A;  3JB9 J;  1KD1 C;  2JN0 A;  3G4S A;  2K4Y A;  5GMK j;  3ZBD A;  5GAN g;  1NJI U;  1KG1 A;  4PNO A;  3CCR A;  4HA8 A;  5FRO A;  1TH7 A;  4X9D A;  1W2B A;  5C0M A;  3S6W A;  1QVG A;  1JJ2 S;  5HK3 A;  2DZ9 A;  1KQS S;  3N5B B;  3JCM g;  5HY6 A;  1VQP A;  4BDZ A;  1KHC A;  5DY9 A;  4ZGD B;  2RM4 A;  5HK0 A;  1V29 B;  2MWO A;  2EIF A;  1I4K 1;  3SFM A;  5GAN 7;  3CCU A;  4M75 G;  1AHJ B;  4A4K A;  5IN1 A;  3URG A;  2EJ9 A;  3QUI A;  2ZPI B;  3PMI A;  3V8K A;  3L2U A;  1VQ5 A;  4A4G A;  2RJE A;  3VV0 A;  4M7D B;  2ZGW A;  5FU7 C;  4M75 A;  3GOX A;  3I55 T;  3CEY A;  4XK8 E;  3OS1 A;  3CXC S;  3SWN B;  4EMK B;  5CKH A;  3M55 A;  3CME T;  1WJQ A;  1M1G A;  5LJ3 j;  3JB9 F;  2E1H A;  3OYH A;  3LX7 A;  2F5T X;  4PL6 A;  1H3Z A;  4JDS A;  2MAM A;  3M59 A;  5DLO A;  3MCA B;  5J3B A;  5D6W A;  3V8L A;  3KXT A;  2LQK A;  3JAM E;  3FIF A;  4M7A G;  1WQ7 A;  2CGH A;  3HP9 A;  2Y90 A;  3ZEH A;  4M77 B;  2PUK B;  4M7A A;  4QVC A;  2XI9 A;  2XK0 A;  4C5G A;  5LJ5 e;  3X20 B;  3OYI A;  4M7D E;  4XAX B;  2O4X A;  2DIG A;  5A0D A;  1K8A U;  1EIF A;  1I8F A;  1WQW A;  2JTM A;  2LX9 A;  3L42 A;  3I55 A;  3CCM T;  2E5Q A;  4KUI A;  3GNG A;  4F7U G;  3CME A;  2EQU A;  2DAQ A;  2LT4 A;  4MML A;  2YLC A;  5A0G A;  1PSF A;  3OS0 A;  1UGR B;  2M0O A;  5LJ5 g;  1WJS A;  4F7U A;  3LH0 A;  5HKC A;  1VQ6 T;  5GAO q;  3QYG B;  4C8Q G;  2Y4X A;  5CKB A;  2ZPG B;  5GAN 8;  2AHJ B;  2QQ9 A;  1UGP B;  3LLR A;  3CCQ T;  1VQO T;  2KDS A;  4M75 D;  3RMQ A;  3CC4 T;  2CYZ B;  2V8J A;  2XKO C;  2VUB A;  4M77 E;  4C8Q A;  4C0D C;  2CKK A;  1SSF A;  2XD0 A;  4XTU A;  4M78 B;  4UC4 A;  3CPW A;  5FU6 B;  2XHC A;  3OS2 A;  5GAM f;  2XU8 A;  2JVV A;  3ASK A;  3CCM A;  3E19 A;  3JCM Q;  2JNG A;  2OAU A;  2E12 A;  3HRT A;  3OYA A;  2OTL T;  1N9R A;  2PVD B;  5CQY A;  4FL6 A;  4OVA A;  4ME7 A;  1BI3 A;  2HD0 A;  4WF2 A;  1VQ6 A;  1WNL A;  1GXI E;  1XQH A;  3A8G B;  4Y28 E;  1M1F A;  3C95 A;  5CAI A;  4HCB A;  4M75 F;  3HPW A;  1VQO A;  5D6Y A;  3CCQ A;  2DTO A;  1VQM T;  3CC4 A;  3OW2 S;  2F5K A;  1ZBX A;  2ZPH B;  4NL2 A;  4X9C A;  5LJ5 j;  4A4E A;  4RMO A;  2X35 A;  4E7L A;  3FB9 A;  2LQ8 A;  2MWP A;  2LCL A;  3TEE A;  3M56 A;  1Q86 C;  4C8Q C;  2HBP A;  3GLX A;  2DTH A;  2QA4 T;  3OYJ A;  3OYF A;  3S3M A;  4D6W A;  2RD1 A;  5GMK e;  3GNF B;  4JS4 A;  2OTL A;  2JOY A;  3OYY A;  4C8Q D;  4M7A F;  3BW1 A;  3A5Z B;  4CRI A;  3CPW S;  3CC7 A;  3RKY A;  4N0A A;  4E7I A;  4PLI A;  3L2Z A;  4J83 A;  5GAM d;  3OYE A;  3M4G A;  1K73 U;  3GIB A;  4FIB A;  1VQM A;  3M5A A;  1Y96 A;  3DLM A;  3DKM A;  2VXF A;  4FT4 A;  2MF2 A;  2IG0 A;  2F69 A;  3LWH A;  4F7U F;  1N8R U;  3CCL T;  3E1S A;  3M58 A;  3VUZ A;  2QA4 A;  3G71 T;  3OYM A;  1M1K C;  4QVD A;  3MO8 A;  3PIP A;  4ELY C;  4C8Q F;  4RG2 A;  1VQ4 T;  3INZ A;  1G3W A;  4OB3 B;  3OYB A;  2LC4 A;  5LJ3 e;  2OTJ T;  2DEQ A;  2XG8 D;  4OP0 A;  1YJW T;  4BE1 A;  4N4H A;  1G3T A;  2RHY A;  1OI1 A;  2EJG A;  1D3B B;  3QPH A;  2FHD A;  3CBP A;  2RO0 A;  2RJD A;  2GCX A;  2LRQ A;  2P0P A;  1BIA A;  1XOV A;  2K3X A;  4LDU A;  5GMK m;  3JCM c;  5LJ3 g;  5GAM h;  3CC2 T;  3CCL A;  3Q1J A;  2RHX A;  1H64 1;  4KT0 E;  2O01 E;  4HCC A;  3JCM e;  1VQK T;  2ZPB B;  1YHQ T;  3G71 A;  1QVF A;  3TU4 K;  4LDX A;  2Y4Y A;  2RI2 A;  3CCS T;  3F70 A;  4Y91 A;  3C12 A;  4XTZ A;  4ATO A;  1O9S A;  3EFR A;  3OSV A;  5AYF A;  3OBY A;  5GAN 4;  2NLU A;  2GFA A;  3CPF A;  4LDY A;  2OTJ A;  3MP8 A;  3PMT A;  5GAN 5;  1YJW A;  1HK9 A;  4FSX A;  1OYX A;  2I2L A;  3RUX A;  2JUF A;  2E65 A;  1XTD A;  4B9X A;  4FT2 A;  1NE8 A;  2E70 A;  4QW2 A;  5GAO l;  4J6X A;  5GAO n;  3J81 E;  4X34 A;  3CC2 A;  3M4Y A;  3A8H B;  3NTI A;  5CVI A;  4MZT A;  4C0Z A;  1IRE B;  2RHU A;  5EG2 A;  3FC3 A;  1VQK A;  2G3R A;  1YHQ A;  1K8A C;  3CMA T;  2DO3 A;  2K5L A;  3OBW A;  3FJP A;  3CCS A;  4PLL A;  4EMH A;  2CZ1 B;  2JZ2 A;  5FRN A;  5FRM A;  4J7F A;  2E6Z A;  2E64 A;  2FL7 A;  4XTX A;  5DM7 R;  3MEV A;  1DJ7 B;  3DB4 A;  1W4S A;  3MP6 A;  3QSU A;  3X24 B;  4EDU A;  4OMF B;  3QJ6 A;  2LT1 A;  3NTK A;  3SWN A;  5CCA A;  3MEW A;  2XID A;  1W2B S;  2RHI A;  4EMK A;  1QVG S;  4MDW A;  4LD6 A;  3V7S A;  3HKS A;  4JRQ A;  1Q82 C;  4OF1 A;  1UGS B;  2D0Q B;  2FB7 A;  3O8V A;  4JRP A;  4ZTJ A;  3QHS A;  4C92 B;  2M1H A;  4OB0 B;  4A53 A;  2XIC A;  3M9Q A;  1G3S A;  4C0G A;  1X6O A;  3PTA A;  3CMA A;  1X75 C;  4M7A B;  3GPL A;  4P5N A;  4II1 A;  4NL3 A;  3HHT B;  5KE2 A;  1VQL T;  2BKD N;  5L8R E;  4M77 A;  4A54 A;  2VC8 A;  2X4W A;  4QQ6 A;  3M53 A;  4QVZ A;  4BE2 A;  1UEB A;  1QW1 A;  4PJO B;  3JCM P;  5CKF A;  3FDR A;  1ZQ1 A;  2R5A A;  1VIF A;  2WSC E;  4L6V 5;  2RA2 A;  4M7D C;  2BIV A;  4LDV A;  1XNI A;  4ELZ C;  3ME9 A;  3V7C A;  4C92 E;  3SWN C;  3WVE B;  3A8L B;  2EJF A;  2X4J A;  1R8O B;  3RKW A;  4BY6 B;  4EMK C;  3I56 T;  4M7A E;  4RG8 A;  4M7D D;  2QXF A;  1M90 U;  1JB0 E;  4XU1 A;  1VQL A;  1M4Z A;  1MGQ A;  3T9N A;  3JCM X;  3L1A A;  4CI0 C;  1Q81 U;  2RK1 A;  3PT9 A;  3KBG A;  1I81 A;  3RMS A;  4PJO E;  4L5G A;  2LTO A;  2QEX T;  1U1T A;  4XU0 A;  5I2M A;  4BAC A;  3LW5 E;  4M77 C;  1K73 C;  1M5Q 1;  4JLI A;  3JB9 D;  4M78 E;  2RH2 A;  1KQ2 A;  2CZ6 B;  4RCC A;  2PQW A;  1N27 A;  4EPC A;  1BI2 A;  3HFN A;  3QZ9 B;  4FU6 A;  3UDC A;  1BI1 A;  4M77 D;  5I21 A;  3J80 E;  3I56 A;  4XU2 A;  3BDU A;  3P8B B;  5GAN f;  1Q7Y C;  3MET A;  4IKF A;  3QG1 A;  1I5L A;  4QQG A;  1B34 A;  3OSS C;  3JCM V;  4V2S A;  1UGQ B;  2VYT A;  5CKE A;  4C5I A;  2RJF A;  2KY9 A;  3QZ5 B;  3RES A;  2QEX A;  2EQM A;  5C6S A;  2EAY A;  4HCZ A;  3OA6 A;  1KC8 U;  2E41 A;  3LYI A;  3OYL A;  2DXC A;  2C06 A;  2EQK A;  4M78 C;  5FU6 C;  1KHI A;  3PIO A;  2K57 A;  3CBO A;  2VV5 A;  3A8O B;  3ER0 A;  2V8K A;  1BI0 A;  4M77 F;  1LOJ A;  4OB2 B;  3UT1 A;  3X28 B;  3QYH B;  2WAC A;  2QQR A;  4M78 D;  4JS5 A;  3G7Z A;  2A7Y A;  1NJI C;  1Y71 A;  3GP8 A;  3H6Z A;  4XTW A;  2B8A A;  5GAN 6;  3PGG A;  3PFS A;  3QDR B;  3OYD A;  2DPP B;  4O5V A;  3OYN A;  3RKX A;  3CCJ T;  4VUB A;  2RI5 A;  5A0L A;  3JCM W;  1Q7Y U;  3FEO A;  1WPY A;  2KAF A;  4HT8 A;  2XDD A;  5GAO m;  5GAN d;  4BDY A;  2EKO A;  2WSE E;  2XDP A;  1JBM A;  2PU9 B;  3OY9 A;  1Q86 U;  3VKI A;  4NOY A;  1JJ2 A;  2EFI A;  3DLL A;  5GAM g;  3SDZ A;  5FU7 B;  2DXU A;  4R55 A;  2ZCF B;  4IUR A;  5CK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...