2MAMA

Solution structure of the interdigitated double tudor domain of rbbp1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
118
structure length
118
Chain Sequence
ADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLKQDNTTQLVQDDQVKGPLRVGAIVETRTSDGSFQEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT-rich interactive domain-containing protein 4A
publication title Retinoblastoma-binding protein 1 has an interdigitated double Tudor domain with DNA-binding activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 16
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mamA00
2MAMA
chains in the Genus database with same CATH superfamily
1N8RC 2KDSA 1X6BA 1FX7A 2YXYA 5GAMf 4GLKA 4CC7A 2X9HA 3M4YA 1YJ9A 4CC2A 1G8XA 3M0RA 5KCOA 1PD0A 3RMQA 4HT9A 1TG0A 2FB7A 2FHDA 1WXTA 3QJ6A 1KJWA 4YTLA 1T3LA 1Y7XA 2VB6A 2LVMA 1VQ6T 2Y4XA 1VQ6Q 1UG1A 2YUPA 1YBYA 4C8QC 3G4SA 2KT1A 2DL3A 1K8AR 1NM7A 4OMMA 3AT1B 4KULA 5DLQE 2C0TA 1B3QA 1D1CA 1KQ1A 4M77E 1VIEA 1JBMA 2KXDA 4A4HA 4QVCA 3CC7T 3CCEA 3CC7Q 1TXQA 1M4ZA 5I11A 4JLIA 3QIIA 1UB4A 1WHHA 4XTWA 3SWNA 1BIAA 4AFZC 2FG0A 1W2BP 2JZ2A 1PG5B 1G3TA 2BE7D 1GFCA 2PVGB 4KUIA 2PQWA 3UT1A 2Y90A 2EJGA 5CKFA 2JTEA 2PUKB 5CKHA 2KR3A 1BCOA 4NL2A 1SHFA 4HCZA 3REBB 1B34A 1VQLT 2JW4A 1VQLQ 4K11A 1YJNT 2AIRB 1YJNQ 3BDUA 1QP3A 4JZ4A 1ZUUA 1X27A 3LWHA 4E7HA 1G3SA 4N4HA 4M7AB 2QK0A 3JB9J 1GBQA 2PZ1A 2L0AA 1WFWA 5FU7C 1UGSB 3G71A 4RTUA 1WA7A 2F5KA 4N4GA 3CPWS 5DM7R 3WVDB 2M51A 3AHUA 1WJQA 2K57A 5GAN3 5GAN6 4OP0A 2CP7A 1IREB 3H0HA 1YCYA 4E7LA 1EIFA 2QA4Q 3JCMb 3NTKA 3KBGA 4EMKB 1TH7A 1UGRB 1ZBJA 4KH0B 3VS6A 3V7SA 5GANj 3OA6A 4FYYB 2DX1A 5HK0A 1D0YA 1AVZC 1QWEA 2DTOA 4II1A 5D6YA 1VQ5A 3CCJA 2DXTA 4ZGEB 2JM9A 2YRCA 1PRMC 1UGVA 2NWMA 2LCCA 4M75F 4PJOC 3QZ5B 1UE9A 2EYQA 1ZSZC 3H8ZA 4XTXA 5FROA 3CCUQ 4IUPA 2RNAA 2F2WA 4N0AA 1JJ2P 4PJLA 1K73C 2YUQA 2GGRA 2QTXA 3CMET 2RPNA 4FSXA 2O01E 3VV0A 1X01A 4M78F 3MJXA 2YT6A 2JM8A 2MK5A 3BW1A 2X4JA 1VQPT 1YI2A 1VQ4T 1QMCA 2FRWA 2JXBA 3CBPA 4E7SA 1K8AU 2DEUA 4F7UB 4ANJA 2RJEA 1NLPC 1K1ZA 4XK8E 1Z9QA 5GAOn 3M59A 2JS0A 4IKFA 4C8QB 4A54A 4BB7A 1NEBA 4OVAA 4JJNK 2DERA 1YP5A 1W6XA 3GF5A 1LVKA 1G3WA 3GPLA 3HSBA 1NYGA 3OW2P 1MGQA 1ZLMA 1K73R 2RHZA 3NMZC 2DXUA 2K2MA 3L2VA 2ZPGB 5KYUB 4Z88A 1KHCA 3M0QA 1RUWA 3UDCA 4O5VA 1M8MA 2O9VA 3X25B 3GNGA 1GCPA 4EIKA 2DLPA 2XICA 3CCRQ 4M7AE 1ZHIA 3OYHA 2YLCA 2C0OA 2AT1B 2X35A 3VS5A 3OYJA 2E4HA 1C1AA 2JTFA 2FL7A 4JJDA 2DBMA 1PSEA 3PFSA 1MNDA 4IUUA 4HT8A 5FU7B 1QCFA 3LGFA 2X4WA 3OYIA 2CGHA 1JQQA 3MEAA 2O88A 2HNIA 4LE9A 1U8RA 3E1SA 5AT1B 1AD5A 1RLQC 2DL5A 2XIDA 1OV3A 2I0NA 4RCCA 4V2SA 5CK9A 5GJWB 3I9QA 2L2PA 1PM3A 3M58A 3CCLA 2JT4A 1WJSA 3TEEA 1G2BA 1WNLA 1OYXA 2HSEB 3VKIA 4Y91A 2KSSA 2QA4A 1TTHB 2A0FB 3CXCA 4E7IA 2WSFE 2QQAA 1MMNA 3EHQA 1VQNQ 2HL5C 3KFVA 3TSZA 1MMDA 4FCYA 2AHJB 4M7AA 1X2QA 1M90R 2LT4A 1CSKA 2RHIA 1ZBXA 3CQTA 2OTLA 4PJOB 5LJ3e 2ABLA 3EFOA 2MPXC 2DRMA 4CI0C 1U5SA 1ZSZB 5GAOp 3M55A 2GTJA 5IT9E 1ACMB 3CCQT 3JB9G 3CCQQ 3HL8A 4LNPA 2D0NA 4C92F 4CC3A 5GMKj 1H3HA 4J9GA 3CCUA 3MO8A 2EAYA 5KYYA 4DBQA 2YDLA 2CKKA 2GBQA 5DY9A 3M5AA 3VRZA 4OGEA 3JCMP 2FRYA 2RHUA 4E7KA 1WDXA 2VC8A 1HJDA 3MCAB 2HEQA 4M7AD 4L5GA 3CCMA 4F04B 1BBZA 1AT1B 3WVEB 1MNEA 2DD4A 1M1GA 4BD3A 2G6FX 4JDSA 4BI3A 2YRDA 1QVFA 3RBBB 4DBFA 4J9DA 3O5ZA 2OX7A 2KYMA 4FM4B 4RTTA 3JAME 1S1NA 1U1TA 3A98A 4OMPA 5J26A 1K73U 1AWWA 1AWJA 2VGNA 5GANg 5LJ5j 2D0QB 2LRQA 2L3SA 3X28B 1VQ8T 3OB9A 1VQ8Q 3THKA 1LOJA 3EG2A 5GMKi 2A37A 2V8IA 2QDLA 4WCIA 1QVGA 2LCSA 3CMAT 2QQSA 3CMAQ 3QDRB 4AG2C 3MKDA 4XTVA 1BKBA 2H3EB 6AT1B 2EGEA 2IPOB 2P4TA 2HSPA 2ZPBB 2DJZA 2LJ1A 4ZN3A 4PNOA 2ESWA 1YJ9T 1YJ9Q 5GANd 3S6WA 3C94A 5IHIA 2HAXA 2RJDA 2DM1A 1RACB 2F2VA 2H3JA 3EG1A 4L59A 4C0DC 2W10A 5GAMj 3V7RA 1KG1A 1M9SA 2KE9A 5FWCA 2DZ9A 4F7UA 4LDYA 1VYTA 2YUNA 2KBTA 2SRCA 4BY6B 1QKWA 2E6ZA 3CCRA 1YN8A 4C8QA 4XU1A 3R6NA 5LJ3f 4Z8AA 3OYLA 2QI2A 5CQXA 1YHQQ 4E7JA 2ZPFB 4MMLA 3G4ST 1WXBA 1UDLA 5CR2A 3OYGA 1GRIA 4HCCA 5KYWB 2HCKA 2K3YA 2XDDA 2MCNA 1YIJA 3CCVA 3CCET 2F2XA 4HVWA 2ED1A 3CCEQ 1N6AA 1PNJA 4C8QD 2ENMA 2EPDA 3I5SA 2BZXA 3MEUA 2XKOC 3OYAA 2MOXA 5FWBA 4HKEA 2KY9A 1NPRA 1BI0A 4M77B 4TVRA 2RA2A 1QWFA 1M90U 2ECZA 4FU6A 5I22A 2DBKA 2JMAA 3M53A 3JCMJ 2MF2A 1RADB 4FT4A 1EZZB 3P8HA 1QP2A 4JRIA 1TSFA 3A5ZB 1H3ZA 2J7IA 5HK3A 1VQNA 2K6DA 2KXCA 4OB3B 2NYSA 1I5LA 3PT9A 2P4RA 3G71T 1KQSA 4M7DF 4J6YA 1K9AA 1H92A 3RERA 1N27A 4ATOA 2LX9A 2VUBA 2G3RA 2E64A 3A8MB 1WLPB 2BZYA 3EG9B 2VXEA 2KNBB 1W2BS 5D6XA 4QQDA 4BACA 1RAFB 5A0GA 3RDVA 3SFMA 2E41A 1B7TA 2DF6A 2EYWA 4NS5A 4C0ZA 2J05A 2QQRA 1SHGA 4M75G 4JS4A 1MMAA 3CC4A 1V29B 5GANh 3TREA 2BTTA 1VQ7Q 3M57A 2L89A 2DYIA 2VGMA 1VQ5T 3V8LA 3CCJT 2LQWA 2QASA 1BI3A 4M78G 2CP6A 1ZUYA 2OJ2A 1Y57A 2E3IA 4PJOA 2DE0X 1IO6A 1ZSZA 1ZA1B 2DTIA 3ULRB 1K8AC 2LNVA 3J7AF 1QW1A 3BFMA 3F70A 2DMOA 4J9EA 3RIRA 5A0LA 5KYNA 5FLXE 2A7YA 2X51A 1N9SA 3L2ZA 1YI2T 5HY6A 4GY5A 1YI2Q 1VQKQ 3EGUA 5IHKA 4R0KA 1TU0B 4PJOD 2JTMA 5GAN2 3BY7A 4FW1A 3OMGA 1OEBA 1HSQA 4GBQA 3FLGA 3JCMX 2DL4A 2O4XB 4UC4A 1Y96A 2ROLA 2EYYA 3LH0A 2YRVA 3CC2Q 2B86A 1YHQA 5LJ5g 4JPBW 2K79A 3A8GB 3VUBA 3QZ9B 4PLIA 2DAQA 3GBQA 2CZ6B 5M9OA 2EGCA 3PVQA 1M27C 2DFUA 1JJ2S 3LWIA 4OB1B 1I8FA 4HVVA 4M4ZA 4AT1B 2COYA 1X6GA 3OS1A 3GNFB 4F17A 4ZN1A 2X3XD 1KFZA 5LJ5d 5CAIA 2E5KA 4C0FA 5GAMg 2RB6A 1VYUA 2JJ9A 5IAYA 3MP6A 5I2MA 2LQNA 5HCKA 2MMPA 5C6SA 4DOWA 2DTHA 1WIEA 5CIUA 4D6WA 1Q81R 2RI2A 3A8OB 2XI9A 3OW2S 5KYWA 2ZCFB 3OMCA 2IVWA 1NG2A 5GAMd 1RAGB 4HXJA 2XDBA 3EFOB 1I0CA 3CBOA 1ABOA 1UJ0A 3VRYA 2K5FA 5IXBA 2DXBA 1WZOA 3QWXX 3EH2A 4VUBA 2FZKB 4ORZA 3LW5E 2LQKA 3V7CA 3CCLT 5KYYB 3CCLQ 4A4EA 1FMVA 1JO8A 1U3OA 4M77A 1WGSA 2V8KA 3GLXA 3JCMe 2QA4T 1FWZA 1UGQB 2LJ0A 2P0QA 2MI6A 2NUPB 3OYMA 1FYNA 4J9FA 8ATCB 1Y0MA 2X3WD 2C06A 4J83A 4C92G 4IUVA 2EYZA 4OB0B 2A28A 2EQMA 1VQ7A 1G3YA 9ATCB 2JUFA 1YWPA 2WACA 1PKTA 5IHNA 5KYXB 3CPWA 3MP1A 2OTLT 2OTLQ 3G1JA 2LDMA 2LJ3A 2GTOA 4M77D 1NLOC 2CP2A 2HKNA 3SD4A 2DJQA 2MWPA 2CS7A 1RI9A 5I21A 2F5TX 2LZ6B 4EPCA 1W70A 5GMKh 4OMLA 3QHSA 1E6HA 3CCUT 2FZCB 3EG9A 2KI7A 1AHJB 3QSUA 4OMNA 1Q95G 2LT1A 3TSWA 3CCMT 3I55Q 3CCMQ 4XU0A 4HA8A 3H0IA 4FW2A 3TU4K 1VQKA 1RAAB 1KK7A 2HMAA 1TOVA 2KRSA 3ZFJA 3SB2A 1WHGA 2F1LA 2RQVA 4DBHA 5LJ5h 2DETA 1YJWQ 4IURA 1H641 2K5LA 3M54A 2D6FA 2CSIA 3CC2A 4A4KA 2L3QA 3PMTA 2CP0A 1TUGB 4CC4B 1WI7A 2COZA 1ZQ1A 3OSVA 1K4US 5J3BA 2KK4A 4QQGA 2DL8A 4X1VA 3RKYA 1I5OB 2RK1A 1JXMA 5AYFA 3JCMf 4J8OA 5GAMh 1OOTA 2CP3A 1Q81U 3NHNA 3CBMA 2JS2A 4X34A 2VKNA 2EFIA 1MMGA 3CCRT 3EFSA 2O4XA 1D0XA 5KE3A 2E10A 4M75C 4E2FB 2MYSA 3RNJA 1VYVA 3V8KA 1R0CB 3VUZA 4BDYA 3JB9H 5LJ3j 4MZMA 4ELZC 3DB4A 1OULA 1Q7YC 1E6GA 1YIJT 1M90C 3CCSA 1AWOA 1YIJQ 3MHXA 3LYIA 3CCVT 4M78C 1M1FA 4F14A 3CCVQ 2FEIA 4IUTA 1NJIC 1DJ7B 5HKCA 2DVEA 5DLOA 1BU1A 3L1AA 2JOYA 2BZ8A 1TS9A 1Q86R 1AZEA 3HRSA 5GMKl 2P84A 3HRUA 3NPFA 3PE0A 3CXCS 4RMOA 3BDLA 1AWXA 3OYYA 3FEOA 1MV0B 4OMOA 4KBMB 4M7DG 4J7IA 2JVVA 8AT1B 4J6WA 4KGXB 2RM4A 2V1QA 2DKGA 3L2UA 1YWOA 4OF1A 1VQNT 3VS1A 2R5MA 1Q7YR 2L5QA 4LD6A 1I1JA 3P8DA 1NJIR 2NLUA 2DRKA 3OS2A 3OQ5A 2JNGA 2KMTA 2QYZA 4RTZA 2EGAA 3HTRA 2RQUA 3G6EQ 3JCMc 3SEMA 1F1BB 1OX8A 2MIOA 2IG0A 2WSCE 3J80E 1JRIA 1XQHA 1D1BA 2YSQA 1GCQA 4ZTJA 3FDRA 1HD3A 1QVFS 3QG1A 2BIVA 3ME9A 3I55A 3CC4T 2NUPA 3CC4Q 1WXUA 3VS3A 3E9FA 3T9NA 5I2SA 1IXDA 1I07A 1KIKA 4HCBA 2HQXA 4FSSA 3OBWA 2KAFA 1RAIB 4J6XA 2ROTA 4B9WA 1NPPA 5KYXA 1PHTA 3EH1A 1TWBA 1NYFA 4FL6A 1Y96B 1FMWA 1YJWA 3VYGA 3OYNA 2K2VA 4A4FA 3UA6A 3NGPA 1X75C 3G7ZA 4ESRA 4AFUC 1M1KC 4J9HA 3C12A 2XK0A 5FW9A 1JXOA 3MPUB 2D1XA 2DK3A 4ME7A 1P92A 1KC8R 3FIFA 2VYTA 2C0IA 2Y4YA 1ABQA 3FJ5A 2D9TA 4PJNA 2J6FA 2O9SA 2ZPHB 1UEBA 2D8JA 1BB9A 2DVJA 3CXCP 1C6VX 4DOVA 4M75B 3I5RA 4ELYC 1CKBA 1VQOQ 4A63B 4FYVB 3EG3A 2EJFA 4CRIA 1YHQT 2DA9A 4A4GA 4M7AF 1AOJA 3PGGA 1BIBA 5GAOl 1Q86U 4C92C 1SF9A 1M1KR 4JUVA 1PCXA 5EC7A 1C0MA 2RF0A 2O2OA 3GOXA 1WPYA 1PC0A 2DYBA 1OI1A 2HKQB 1IGUA 2E65A 2DZCA 2CT3A 1JEGA 1K0XA 2EVRA 3MEWA 4HVUA 3FB9A 2DEQA 1Q82R 4KRTA 2KGTA 2B8AA 1KSWA 1ZX6A 1MUZA 3EGDB 2QGGA 4OB2B 1Q7YU 3VS7A 3LLRA 2CREA 1QVFP 3X24B 3WXMB 2YHTA 3PIOA 1NJIU 4MMKA 2KRNA 4D8KA 4KH1B 4JJCA 1OZ2A 1PRLC 2V8JA 2K4YA 2DPPB 3VS2A 1OX9A 5FU6C 4ZTFA 3JB9D 1K9MR 1K0SA 2DD5A 2QGFB 4JRKA 2ZGWA 4IIOA 1G5VA 3X26B 1T3SA 1QVGP 2AK5A 2V1RA 3UPUA 2QG9B 4ZGJB 2LMJA 3QO3A 5LJ3g 1M3AA 4PLLA 3CD6Q 3OY9A 1SPKA 4XTZA 2DL7A 3G6EA 1VQ9A 2CUDA 2FYKA 2HQEA 1KD1R 3C95A 2CP5A 3HKSA 4PFOA 2VASA 3M0UA 2XD0A 1FMKA 1Z9ZA 4RTVA 5J39A 4FIBA 2BKDN 4F7UF 2EWNA 3LX7A 3MP8A 4Y28E 5LJ3d 1AEYA 3NTIA 4C8QF 1VQ7T 4B9XA 3HFOA 2RHXA 4B6MA 3PTAA 2RK2A 1YNZA 7AT1B 1G83A 2RN8A 1KC8U 4KUDK 4X9CA 1XJWB 3VS4A 2QEXA 3UA7A 1D3BB 4LDWA 2RQWA 4J9CA 2ED0A 1WQWA 3LH5A 1W2BA 2EYXA 2CUBA 4DEYA 5GAOq 3QJYA 3FJPA 4EMKC 4N4IA 3KXTA 3JCMW 2K7AA 1HK9A 3H41A 4C0DB 1IHWA 4M75E 3ZBDA 1H8KA 2HL3A 2A3LA 2FPEA 3UATA 5KCHA 2GQVA 3IQLA 1VQKT 4MDXA 4MDWA 5GMKm 3NTHA 2K3XA 1YFNA 3QUIA 1M1KU 1R77A 5GAN8 1S72Q 4M78E 2SEMA 2LP5A 3EGXB 3SDZA 4RCBA 3A1PA 2EQJA 4PK4A 2ATCB 4C92B 1PD1A 1VQOA 4M7DC 4M77G 3CC2T 1SKUB 3ZL7C 1B07A 2CZ1B 1QLYA 1RABB 3QPHA 1Q82U 1Q81C 1UTIA 3L2RA 4QKUA 1KQSP 4FYXB 2HBWA 5CKDA 3OBYA 5D7UA 2QAZA 3OYKA 4EMHA 3U23A 4JS5A 4WF2A 1M5Q1 3UF4A 2DILA 4E47A 3EFRA 1WJRA 1UHFA 1WHKA 3OS5A 3D7SB 1K9MU 2X4XA 4LDVA 3I56A 2CZ0B 4DA4A 2J6OA 2MAMA 2WSEE 2LNHB 4LN2A 1X2KA 2VXFA 5D6WA 1N8RR 1GBRA 4RTYA 1W4SA 4C5EA 4M75A 5FU6B 1R0BG 3QDFA 4P5NA 4RG8A 2L3PA 3TCJA 2P0KA 1X6OA 2A08A 3RKXA 1M30A 4KT0E 2CZ7B 2DXCA 2K3BA 1JJ2A 3VJPA 3JCMQ 2EW3A 1E7OA 4DEXA 2GNCA 2M16A 3DKMA 4PJOF 1KD1U 4LXCA 2LQ8A 3HP9A 5LJ3h 2R57A 1IGQA 2GQIA 2HD0A 4M78A 4JJBA 4QT7A 1VQMA 2M0YA 2AKKA 3CCST 4EMGA 2PTKA 3CCSQ 5GJVB 2OTJA 3S3MA 2GFAA 3C0CA 3MEVA 4JZ3A 1OQKA 4M75D 2EQKA 3E19A 1UHCA 3CD6A 1X43A 1HXDA 2KYBA 2ZAEA 4NL3A 4AMCA 4BI4A 4C5GA 2I2LA 1HYOA 2EJ9A 1LNXA 3EGDA 4LD9K 3M56A 2YUOA 4D8DA 4JLGA 4M78D 1CKAA 3DLLA 1RLPC 5L23A 4PKCC 3E9GA 3OW2A 2KT8A 3RR6A 3E2UA 1EX4A 2RJCA 3EAEA 2FPDA 3QBYA 3VS0A 5A0DA 3FRNA 2XU8A 2E6NA 3H0FA 4QVZA 4QVDA 3O8VA 2COWA 2KROA 4NOYA 3OSSC 1RAEB 1K76A 5GAOm 1W1FA 4J5YA 3QYGB 1NE8A 4Y92A 1IHVA 1U06A 4XU3A 3H6ZA 4C5IA 4KGZB 4DQ2A 2QXFA 1YITA 2EQUA 1OU8A 4PFZA 1WYXA 3P8BB 1J3TA 1NZ9A 4AFQC 5C0MA 1R8OB 3I55T 4C92E 2RD1A 4MZTA 2XDPA 1SSHA 1MHNA 3CEYA 2E5QA 2IIMA 5ECAA 1KQ2A 5IH2A 4M7DB 1QCOA 1S72A 4J9IA 2HZYA 1RL2A 2AKLA 3CMEQ 1YJWT 1AZGB 1D3BA 3SHWA 2EKOA 1JU5C 2K5IA 2YLBA 1NBEB 2NUZA 4F16A 1VQPQ 2OAUA 1VQ4Q 3ER0A 2BE9B 2M0OA 2D8HA 4BE0A 2JN0A 4LDUA 1N8RU 1O9SA 2EIFA 2QDYB 4L6V5 5GANe 2NUTB 2P0PA 5GAN5 3V8JA 3N5BB 2O31A 3OYEA 4M7AG 4FYWB 2CH4W 4M77F 1VQ6A 3A8HB 1T0JA 2DIQA 2GCXA 1Q86C 1FXXA 3OYDA 1VUBA 1WHMA 2EBPA 4OMQA 4JRQA 1WX6A 1PWTA 1WQ7A 3HFNA 4XTYA 3EGXA 1QCNA 5CKBA 4C92A 1TUDA 3CC7A 3KUFA 3CPWP 3OYFA 1PKSA 1M2VB 3TVTA 1OPLA 2OAWA 4PL6A 3JCMV 1UUEA 3R6OA 3L42A 1NEGA 2DO3A 3OS0A 1I81A 2A36A 2XMFA 4C5HA 2E70A 4BUGA 1GFDA 3PVLA 3SWNC 3REAB 1BI1A 2RJFA 1N9RA 2VVKA 3QKJA 4AG1C 4IIMA 1EFNA 5KH6A 4E7ZA 1LPLA 1BI2A 4BY6C 4C92D 5LL6S 3NFCA 1VQLA 3HPWA 1YJNA 4LDXA 3QYHB 1UJYA 3M4GA 1SSFA 1LJOA 3L2QA 1I4K1 1M3BA 2PNIA 4LUDA 3JCMg 1M8VA 1T0HA 1D1AA 3PIPA 2E12A 4BE2A 5KE2A 2RHYA 3LGLA 4RTWA 2QQBA 2RI3A 2VV5A 1QVPA 4J9BA 4OMFB 4R56A 2HQHA 3EHRA 4F7UG 5GANf 1IZ6A 2CDTA 4M77C 4R55A 5CCAA 3JCMd 3G6ET 2W0ZA 4C8QG 1VQ9T 1VQ9Q 4XU2A 3PMIA 3PNWC 2LTOA 2M9UA 4WTOB 3DB3A 3JSCA 5EG2A 3UWNA 1QQJA 2MWOA 2CT4A 1KC8C 4DBRA 4M7DE 2GF7A 1YCSB 2PVDB 4LUEA 1GXIE 5FRNA 4OGCA 3Q1JA 2PVOB 3M0SA 5A2QE 3J81E 4C0GA 1M2OA 2QQ9A 3H9NA 1X69A 4F7UE 2RQTA 1D09B 2QEXT 2QEXQ 1QVGS 3X20B 3GP8A 2R58A 1PSFA 3CMEA 5GAN7 1ZSGA 4N0AC 2LX7A 4C8QE 3TQ7P 4JRPA 1BK2A 4EMKA 4PJMA 3FC3A 1VQPA 1VQ4A 2EKHA 3A8LB 4FT2A 5IN1A 1XOVA 4Q5WA 3JRZA 4BE1A 4PJJA 1UFFA 1O75A 1OZ3A 2FZGB 2K9GA 2X4YA 1BCMA 2PU9B 1VA7A 1Q82C 4ZNXA 4Z89A 1N5ZA 4QQ6A 4Z02A 1A0NB 4XQ3A 4M7DA 2QTVA 4RUGA 1VQOT 4IUQA 5GMKe 2YWWA 3ASKA 2AZVA 2RH2A 2GFUA 2J6KA 4PFPA 1RAHB 1K9MC 2FO0A 4AFSC 1SEMA 1Y71A 3M9QA 3OYBA 3M0TA 5CO7A 3URGA 3SWNB 3M0PA 2OI3A 4M78B 3C4SA 2F69A 2HBPA 1OPKA 4M7DD 2NUTA 3RESA 4XAXB 3I35A 3HHTB 3QXEB 1XNIA 4RG2A 5L8RE 1B34B 1ARKA 5GAOr 3I56T 5LJ5e 3I56Q 3G4SQ 4PJOG 3VU3C 2CSQA 2V26A 3JCMh 3S3OA 1KD1C 4GLMA 4MZPA 2KQWA 3S3NA 2Z0WA 3BE3A 1UGPB 4QW2A 2BUDA 3JV3A 3RUXA 1VIFA 2J06A 2E3HA 5KYUA 1KHIA 2PUOB 3EG0A 1OU9A 1M2VA 4E6RA 2VWFA 2ZZDA 1SRMA 1ZA2B 2ZPIB 1RI0A 2EQIA 4RKUE 1VQMT 2FPFA 1VQMQ 1KQSS 5GAMe 3RMSA 2OTJT 2OTJQ 2CH4A 4XTUA 1M3CA 3CD6T 3META 4PJOE 1XTDA 4KGVB 2JMCA 2ZPEB 2RO0A 5CQYA 1V76A 2HDAA 3GIBA 4J7FA 4EDUA 1TUCA 4HCKA 2FVUA 3HRTA 2KRMA 4A53A 2M1HA 1WHJA 1Y07A 2KVQG 1QKXA 1V1CA 3L2WA 3G71Q 4M7AC 2L8DA 1IB8A 5FRMA 1GL5A 3CCQA 4X9DA 1IRXA 2R5AA 4ZGDB 3RKWA 2CYZB 2E1HA 3CPFA 2LCLA 2H8HA 5CVIA 1JB0E 2DIGA 1GCQC 1VOMA 3QWYA 1MV3A 4RTXA 5CKEA 5IXFA 2XHCA 4BDZA 1SRLA 1D0ZA 5LJ5f 2KEAA 3ZEHA 2M02A 2XG8D 1U1SA 3JB9F 1YITT 1YITQ 3INZA 1WHLA 2DNUA 1VQ5Q 2LC4A 3CCJQ 1UECA 3VYHB 5GAN4 2L3RA 1VQ8A 3JB9I 1SG5A 2RQRA 1BYMA 2RI5A 3DLMA 4O6JA 3CMAA 4BI8B 2RMOA 2AZSA 3OYCA 1LCKA 1S72T 1ZUKA
chains in the Genus database with same CATH topology
1NE8A 1N8RC 4E7JA 2ZPFB 2KDSA 4MMLA 1FX7A 4RMOA 3CXCS 5GAMf 3G4ST 3BDLA 4XU3A 3OYYA 3FEOA 4GLKA 5LJ3f 3H6ZA 4C5IA 5CR2A 4KBMB 3OYGA 4DQ2A 4M7DG 3M4YA 4J7IA 2JVVA 1YJ9A 2QXFA 4HCCA 1YITA 2EQUA 5KCOA 4J6WA 2K3YA 2XDDA 3P8BB 3RMQA 2RM4A 4HT9A 1YIJA 2FB7A 3CCVA 1NZ9A 2DKGA 3CCET 3L2UA 4OF1A 1VQNT 5C0MA 1R8OB 3I55T 2FHDA 4C92E 2RD1A 1N6AA 4MZTA 2XDPA 3QJ6A 4C8QD 1MHNA 2R5MA 3CEYA 2E5QA 2L5QA 3MEUA 4LD6A 2XKOC 3OYAA 1KQ2A 4YTLA 3P8DA 4HKEA 2NLUA 3OS2A 3JCMP 3OQ5A 2KY9A 1Y7XA 2LVMA 4M7DB 1NPRA 2JNGA 2KMTA 1S72A 1VQ6T 2Y4XA 1BI0A 4M77B 4TVRA 2RA2A 1YBYA 4C8QC 3JCMc 1RL2A 1M90U 3G4SA 1YJWT 1D3BA 4FU6A 2IG0A 2WSCE 2EKOA 4KULA 3J80E 1JRIA 3M53A 2YLBA 2K5IA 5DLQE 1XQHA 3JCMJ 2MF2A 2OAUA 3ER0A 4FT4A 2M0OA 1KQ1A 4M77E 4ZTJA 1VIEA 4BE0A 1JBMA 3FDRA 3P8HA 1QVFS 1QP2A 4A4HA 4JRIA 3QG1A 3A5ZB 4QVCA 1H3ZA 3CC7T 2JN0A 4LDUA 5HK3A 2BIVA 3CCEA 1VQNA 3ME9A 1N8RU 1M4ZA 3I55A 4JLIA 3CC4T 1O9SA 2EIFA 2QDYB 3QIIA 3E9FA 4L6V5 3T9NA 5I2SA 1UB4A 3WXMB 5GANe 4OB3B 2P0PA 5GAN5 4XTWA 4HCBA 2HQXA 1I5LA 3SWNA 1BIAA 3OBWA 3N5BB 3V8JA 3PT9A 2KAFA 3OYEA 3G71T 1KQSA 2JZ2A 4J6YA 4J6XA 3GIBA 4M7AG 1G3TA 4B9WA 4M7DF 4M77F 1NPPA 1VQ6A 3A8HB 1N27A 3RERA 4ATOA 2PVGB 2DIQA 2LX9A 2VUBA 2G3RA 2E64A 1FXXA 2GCXA 1VUBA 4KUIA 3OYDA 2PQWA 3A8MB 4FL6A 1Y96B 2Y90A 3UT1A 2EJGA 5CKFA 3VYGA 3OYNA 1YJWA 2K2VA 4A4FA 2PUKB 5CKHA 4JRQA 2VXEA 4NL2A 4HCZA 1W2BS 1WQ7A 4QQDA 5D6XA 1B34A 3HFNA 4XTYA 4BACA 1VQLT 1X75C 3G7ZA 5A0GA 1YJNT 1M1KC 3BDUA 3SFMA 2E41A 3C12A 1QP3A 2XK0A 5CKBA 4C92A 2DK3A 4NS5A 3LWHA 4ME7A 4C0ZA 2QQRA 3CC7A 4M75G 4E7HA 1G3SA 1P92A 4N4HA 3KUFA 4JS4A 3CC4A 3FIFA 4M7AB 3OYFA 1V29B 5GANh 2VYTA 4PL6A 3JCMV 3TREA 3R6OA 3JB9J 4C92G 3L42A 3M57A 2DO3A 3OS0A 1I81A 2L89A 4C5HA 2E70A 1UGSB 2VGMA 2Y4YA 5FU7C 4BUGA 3G71A 3V8LA 1VQ5T 3CCJT 3SWNC 2F5KA 3X24B 1BI3A 4N4GA 3CPWS 2D9TA 5DM7R 4M78G 1BI1A 3WVDB 2RJFA 1N9RA 2ZPHB 3AHUA 4PJOA 1UEBA 1WJQA 2K57A 3QKJA 5KH6A 1BI2A 4BY6C 5GAN3 4C92D 5GAN6 4OP0A 4DOVA 4M75B 2DTIA 3NFCA 5LL6S 1VQLA 1KG1A 4ELYC 1IREB 3HPWA 1YJNA 1YCYA 4E7LA 1K8AC 2LNVA 4LDXA 1EIFA 3J7AF 3QYHB 3JCMb 1QW1A 2EJFA 3NTKA 3BFMA 4CRIA 3F70A 3M4GA 3KBGA 1SSFA 1YHQT 4EMKB 1TH7A 1UGRB 4A4GA 1LJOA 4M7AF 3L2QA 1I4K1 3PGGA 1BIBA 3RIRA 5GAOl 1Q86U 4C92C 5A0LA 3V7SA 5GANj 3OA6A 4JUVA 5FLXE 2A7YA 3JCMg 1M8VA 5HK0A 1N9SA 3GOXA 2DTOA 3L2ZA 4II1A 1WPYA 5D6YA 5HY6A 4GY5A 3PIPA 1YI2T 1OI1A 2E12A 4PJOD 1VQ5A 2E65A 2DZCA 2DXTA 2JTMA 5GAN2 3CCJA 4BE2A 3BY7A 5KE2A 4ZGEB 3OMGA 1S72T 2RHYA 3LGLA 2QQBA 2RI3A 3FLGA 3MEWA 2VV5A 3JCMX 3FB9A 1QVPA 2DEQA 2LCCA 4M75F 4OMFB 4R56A 4PJOC 2O4XB 3QZ5B 4F7UG 4UC4A 1Y96A 5GANf 2B8AA 1IZ6A 1Q86C 2EYQA 3H8ZA 4XTXA 5FROA 3LH0A 4M77C 2YRVA 4IUPA 4R55A 4N0AA 5CCAA 3JCMd 1K73C 1YHQA 4OB2B 5LJ5g 3G6ET 1Q7YU 4C8QG 1VQ9T 2QTXA 3LLRA 3A8GB 4XU2A 3PMIA 3PNWC 2LTOA 3VUBA 3QZ9B 2O01E 2YHTA 4FSXA 4PLIA 1X01A 4MMKA 4M78F 2DAQA 2M9UA 3PIOA 1NJIU 3DB3A 2CZ6B 3JSCA 5EG2A 3UWNA 1OZ2A 2MWOA 3BW1A 2V8JA 5M9OA 2K4YA 2X4JA 2DPPB 1VQPT 1YI2A 1VQ4T 1KC8C 5FU6C 4M7DE 2GF7A 3JB9D 4ZTFA 1JJ2S 3LWIA 3CBPA 4OB1B 1I8FA 2DD5A 1K8AU 2PVDB 4F7UB 4JRKA 2ZGWA 1GXIE 1G5VA 2RJEA 4OGCA 3X26B 5FRNA 3Q1JA 4XK8E 2PVOB 5GAOn 3UPUA 3M59A 3OS1A 3VV0A 3GNFB 4ZN1A 4ZGJB 5A2QE 3J81E 4IKFA 4C0GA 3QO3A 4C8QB 4A54A 5LJ3g 5LJ5d 2QQ9A 4PLLA 4BB7A 5CAIA 3OY9A 4OVAA 4XTZA 4C0FA 4JJNK 4F7UE 5GAMg 2QEXT 1QVGS 2RB6A 3X20B 5IAYA 3MP6A 5I2MA 3G6EA 2R58A 3GF5A 3GP8A 1PSFA 2FYKA 1VQ9A 2HQEA 1G3WA 5GAN7 4N0AC 3GPLA 3CMEA 3C95A 3HSBA 4C8QE 3HKSA 1MGQA 4JRPA 4EMKA 2MMPA 3FC3A 5C6SA 1VQPA 2XD0A 2RHZA 5J39A 4DOWA 2DTHA 1VQ4A 2DXUA 4FIBA 5CIUA 4D6WA 3L2VA 2ZPGB 2BKDN 3A8LB 4FT2A 5IN1A 4F7UF 2RI2A 1XOVA 4Q5WA 3JRZA 4BE1A 3A8OB 2EWNA 2XI9A 1KHCA 3LX7A 3MP8A 4Y28E 5LJ3d 3OW2S 2ZCFB 3OMCA 2IVWA 1O75A 1OZ3A 3HRUA 3NTIA 3UDCA 4O5VA 4C8QF 5GAMd 1VQ7T 4B9XA 3HFOA 2X4YA 2RHXA 3X25B 2XDBA 3GNGA 3PTAA 2RK2A 3CBOA 2K5FA 2DXBA 2PU9B 1KC8U 4KUDK 4X9CA 3CMET 1Q82C 2QEXA 4VUBA 2XICA 1D3BB 4M7AE 1ZHIA 4LDWA 3OYHA 3LW5E 4QQ6A 2YLCA 2LQKA 4Z02A 3V7CA 4XQ3A 2X35A 3CCLT 1W2BA 1WQWA 3OYJA 4A4EA 4M7DA 2JTFA 2FL7A 4M77A 5GAOq 1WGSA 2V8KA 3QJYA 3GLXA 4IUQA 1PSEA 5GMKe 1VQOT 3ASKA 3FJPA 3JCMe 2QA4T 1FWZA 4EMKC 2RH2A 2GFUA 3PFSA 1UGQB 2P0QA 4IUUA 2MI6A 4N4IA 3KXTA 4HT8A 3OYMA 3JCMW 1HK9A 5FU7B 1K9MC 2C06A 3LGFA 1Y71A 3M9QA 4IUVA 2X4WA 4J83A 4C0DB 2CGHA 5CO7A 3MEAA 3SWNB 3URGA 3OYIA 4M75E 3ZBDA 4OB0B 1VQ7A 2EQMA 2HNIA 1G3YA 2A3LA 3E1SA 4M78B 1U8RA 3C4SA 2JUFA 5KCHA 2GQVA 2WACA 1VQKT 4MDXA 2F69A 2XIDA 2HBPA 4MDWA 5GMKm 3NTHA 2K3XA 3MP1A 3QUIA 3CPWA 2OTLT 4RCCA 1M1KU 4V2SA 4M7DD 5CK9A 5GAN8 2LDMA 4M77D 3RESA 4XAXB 3M58A 3HHTB 3QXEB 1XNIA 4M78E 4RG2A 3SD4A 5L8RE 1B34B 2MWPA 3CCLA 5GAOr 2CS7A 3I56T 5LJ5e 5I21A 2F5TX 1WJSA 4PJOG 3TEEA 3SDZA 4EPCA 4RCBA 5GMKh 3VU3C 2EQJA 1WNLA 3QHSA 1OYXA 3JCMh 4C92B 3S3OA 4MZPA 3VKIA 4Y91A 3CCUT 1VQOA 1KD1C 2KQWA 2KSSA 4M77G 2QA4A 3S3NA 4M7DC 3CC2T 2CZ1B 3CXCA 3QPHA 1Q82U 1AHJB 3QSUA 4E7IA 1Q81C 1UGPB 3L2RA 2WSFE 4QW2A 2BUDA 2LT1A 2QQAA 3RUXA 1VIFA 3CCMT 5CKDA 3OBYA 1KHIA 4XU0A 2PUOB 4HA8A 3OYKA 4EMHA 3TU4K 1VQKA 4JS5A 2AHJB 4WF2A 4M7AA 1M5Q1 2LT4A 2OTLA 2RHIA 1ZBXA 2ZZDA 3ZFJA 4E47A 3EFRA 4PJOB 5LJ3e 1WJRA 3SB2A 2ZPIB 1RI0A 4CI0C 4RKUE 3OS5A 1VQMT 5GAOp 1KQSS 5GAMe 3RMSA 3M55A 2OTJT 1K9MU 2X4XA 5LJ5h 5IT9E 4LDVA 3I56A 4XTUA 3CCQT 3JB9G 3HL8A 4IURA 4C92F 2CZ0B 4DA4A 1H641 2K5LA 5GMKj 3M54A 2D6FA 3CD6T 2MAMA 2WSEE 3META 3CCUA 4PJOE 1XTDA 3MO8A 2EAYA 2VXFA 5D6WA 3CC2A 2ZPEB 4A4KA 2RO0A 5CQYA 1W4SA 2CKKA 3PMTA 4C5EA 5DY9A 3M5AA 3OYBA 4M75A 4OGEA 2RHUA 4J7FA 4P5NA 4RG8A 5FU6B 2VC8A 4EDUA 4E7KA 3TCJA 3MCAB 2P0KA 1X6OA 3RKXA 4M7AD 1ZQ1A 3OSVA 4L5GA 4KT0E 2FVUA 3HRTA 2CZ7B 2DXCA 5J3BA 4A53A 3CCMA 2M1HA 1JJ2A 3WVEB 3VJPA 2KK4A 1Y07A 2DD4A 1M1GA 3QYGB 4BD3A 3JCMQ 4JDSA 4BI3A 1QVFA 2M16A 4QQGA 2KVQG 3DKMA 4PJOF 3RKYA 2LQ8A 3HP9A 2RK1A 5LJ3h 1KD1U 2R57A 5AYFA 4FM4B 2HD0A 4M78A 3JCMf 3L2WA 3JAME 1U1TA 5J26A 4J8OA 5GAMh 4M7AC 1VQMA 2L8DA 1K73U 3CCST 4EMGA 5FRMA 2VGNA 2OTJA 5GANg 5LJ5j 2D0QB 3S3MA 1Q81U 2LRQA 2GFAA 3MEVA 3X28B 3CCQA 4X9DA 1VQ8T 3OB9A 2R5AA 1LOJA 3CBMA 4M75D 3RKWA 2CYZB 2EQKA 3E19A 4ZGDB 5GMKi 1HXDA 3CD6A 2V8IA 4X34A 1QVGA 2E1HA 3CPFA 3CMAT 2LCLA 2EFIA 2QQSA 3QDRB 3CCRT 5CVIA 4NL3A 3EFSA 1JB0E 2O4XA 4BI4A 4C5GA 4XTVA 1BKBA 2I2LA 2DIGA 2EJ9A 5KE3A 1LNXA 2E10A 2P4TA 4M75C 4LD9K 3M56A 5CKEA 2ZPBB 4JLGA 4M78D 2DJZA 2XHCA 3V8KA 4BDZA 4ZN3A 4PNOA 3DLLA 5LJ5f 3ZEHA 3VUZA 2XG8D 4PKCC 4BDYA 1U1SA 1YJ9T 3JB9F 3JB9H 5GANd 5LJ3j 3S6WA 1YITT 3C94A 3E9GA 3OW2A 4MZMA 4ELZC 3DB4A 2RJDA 2HAXA 3INZA 4C0DC 2H3JA 4L59A 2LC4A 5GAMj 1Q7YC 2RJCA 1YIJT 3EAEA 3V7RA 3QBYA 3CCSA 5A0DA 1M90C 3FRNA 3LYIA 1M9SA 3MHXA 4M78C 1M1FA 3CCVT 3VYHB 4IUTA 5GAN4 1NJIC 2XU8A 2L3RA 1VQ8A 2E6NA 4QVZA 1DJ7B 4QVDA 2DZ9A 4F7UA 3JB9I 4LDYA 5HKCA 2DVEA 1BYMA 5DLOA 2RI5A 3DLMA 3O8VA 3L1AA 4O6JA 2JOYA 4NOYA 3CMAA 4BI8B 3OSSC 4BY6B 2E6ZA 3CCRA 4C8QA 4XU1A 5GAOm 3OYCA 3HRSA 4J5YA 5GMKl 3OYLA 2QI2A 5CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAM A; 
#chains in the Genus database with same CATH topology
 1N8R C;  2KDS A;  1X6B A;  1FX7 A;  2YXY A;  5GAM f;  4GLK A;  4CC7 A;  2X9H A;  3M4Y A;  1YJ9 A;  4CC2 A;  1G8X A;  3M0R A;  5KCO A;  1PD0 A;  3RMQ A;  4HT9 A;  1TG0 A;  2FB7 A;  2FHD A;  1WXT A;  3QJ6 A;  1KJW A;  4YTL A;  1T3L A;  1Y7X A;  2VB6 A;  2LVM A;  1VQ6 T;  2Y4X A;  1VQ6 Q;  1UG1 A;  2YUP A;  1YBY A;  4C8Q C;  3G4S A;  2KT1 A;  2DL3 A;  1K8A R;  1NM7 A;  4OMM A;  3AT1 B;  4KUL A;  5DLQ E;  2C0T A;  1B3Q A;  1D1C A;  1KQ1 A;  4M77 E;  1VIE A;  1JBM A;  2KXD A;  4A4H A;  4QVC A;  3CC7 T;  3CCE A;  3CC7 Q;  1TXQ A;  1M4Z A;  5I11 A;  4JLI A;  3QII A;  1UB4 A;  1WHH A;  4XTW A;  3SWN A;  1BIA A;  4AFZ C;  2FG0 A;  1W2B P;  2JZ2 A;  1PG5 B;  1G3T A;  2BE7 D;  1GFC A;  2PVG B;  4KUI A;  2PQW A;  3UT1 A;  2Y90 A;  2EJG A;  5CKF A;  2JTE A;  2PUK B;  5CKH A;  2KR3 A;  1BCO A;  4NL2 A;  1SHF A;  4HCZ A;  3REB B;  1B34 A;  1VQL T;  2JW4 A;  1VQL Q;  4K11 A;  1YJN T;  2AIR B;  1YJN Q;  3BDU A;  1QP3 A;  4JZ4 A;  1ZUU A;  1X27 A;  3LWH A;  4E7H A;  1G3S A;  4N4H A;  4M7A B;  2QK0 A;  3JB9 J;  1GBQ A;  2PZ1 A;  2L0A A;  1WFW A;  5FU7 C;  1UGS B;  3G71 A;  4RTU A;  1WA7 A;  2F5K A;  4N4G A;  3CPW S;  5DM7 R;  3WVD B;  2M51 A;  3AHU A;  1WJQ A;  2K57 A;  5GAN 3;  5GAN 6;  4OP0 A;  2CP7 A;  1IRE B;  3H0H A;  1YCY A;  4E7L A;  1EIF A;  2QA4 Q;  3JCM b;  3NTK A;  3KBG A;  4EMK B;  1TH7 A;  1UGR B;  1ZBJ A;  4KH0 B;  3VS6 A;  3V7S A;  5GAN j;  3OA6 A;  4FYY B;  2DX1 A;  5HK0 A;  1D0Y A;  1AVZ C;  1QWE A;  2DTO A;  4II1 A;  5D6Y A;  1VQ5 A;  3CCJ A;  2DXT A;  4ZGE B;  2JM9 A;  2YRC A;  1PRM C;  1UGV A;  2NWM A;  2LCC A;  4M75 F;  4PJO C;  3QZ5 B;  1UE9 A;  2EYQ A;  1ZSZ C;  3H8Z A;  4XTX A;  5FRO A;  3CCU Q;  4IUP A;  2RNA A;  2F2W A;  4N0A A;  1JJ2 P;  4PJL A;  1K73 C;  2YUQ A;  2GGR A;  2QTX A;  3CME T;  2RPN A;  4FSX A;  2O01 E;  3VV0 A;  1X01 A;  4M78 F;  3MJX A;  2YT6 A;  2JM8 A;  2MK5 A;  3BW1 A;  2X4J A;  1VQP T;  1YI2 A;  1VQ4 T;  1QMC A;  2FRW A;  2JXB A;  3CBP A;  4E7S A;  1K8A U;  2DEU A;  4F7U B;  4ANJ A;  2RJE A;  1NLP C;  1K1Z A;  4XK8 E;  1Z9Q A;  5GAO n;  3M59 A;  2JS0 A;  4IKF A;  4C8Q B;  4A54 A;  4BB7 A;  1NEB A;  4OVA A;  4JJN K;  2DER A;  1YP5 A;  1W6X A;  3GF5 A;  1LVK A;  1G3W A;  3GPL A;  3HSB A;  1NYG A;  3OW2 P;  1MGQ A;  1ZLM A;  1K73 R;  2RHZ A;  3NMZ C;  2DXU A;  2K2M A;  3L2V A;  2ZPG B;  5KYU B;  4Z88 A;  1KHC A;  3M0Q A;  1RUW A;  3UDC A;  4O5V A;  1M8M A;  2O9V A;  3X25 B;  3GNG A;  1GCP A;  4EIK A;  2DLP A;  2XIC A;  3CCR Q;  4M7A E;  1ZHI A;  3OYH A;  2YLC A;  2C0O A;  2AT1 B;  2X35 A;  3VS5 A;  3OYJ A;  2E4H A;  1C1A A;  2JTF A;  2FL7 A;  4JJD A;  2DBM A;  1PSE A;  3PFS A;  1MND A;  4IUU A;  4HT8 A;  5FU7 B;  1QCF A;  3LGF A;  2X4W A;  3OYI A;  2CGH A;  1JQQ A;  3MEA A;  2O88 A;  2HNI A;  4LE9 A;  1U8R A;  3E1S A;  5AT1 B;  1AD5 A;  1RLQ C;  2DL5 A;  2XID A;  1OV3 A;  2I0N A;  4RCC A;  4V2S A;  5CK9 A;  5GJW B;  3I9Q A;  2L2P A;  1PM3 A;  3M58 A;  3CCL A;  2JT4 A;  1WJS A;  3TEE A;  1G2B A;  1WNL A;  1OYX A;  2HSE B;  3VKI A;  4Y91 A;  2KSS A;  2QA4 A;  1TTH B;  2A0F B;  3CXC A;  4E7I A;  2WSF E;  2QQA A;  1MMN A;  3EHQ A;  1VQN Q;  2HL5 C;  3KFV A;  3TSZ A;  1MMD A;  4FCY A;  2AHJ B;  4M7A A;  1X2Q A;  1M90 R;  2LT4 A;  1CSK A;  2RHI A;  1ZBX A;  3CQT A;  2OTL A;  4PJO B;  5LJ3 e;  2ABL A;  3EFO A;  2MPX C;  2DRM A;  4CI0 C;  1U5S A;  1ZSZ B;  5GAO p;  3M55 A;  2GTJ A;  5IT9 E;  1ACM B;  3CCQ T;  3JB9 G;  3CCQ Q;  3HL8 A;  4LNP A;  2D0N A;  4C92 F;  4CC3 A;  5GMK j;  1H3H A;  4J9G A;  3CCU A;  3MO8 A;  2EAY A;  5KYY A;  4DBQ A;  2YDL A;  2CKK A;  2GBQ A;  5DY9 A;  3M5A A;  3VRZ A;  4OGE A;  3JCM P;  2FRY A;  2RHU A;  4E7K A;  1WDX A;  2VC8 A;  1HJD A;  3MCA B;  2HEQ A;  4M7A D;  4L5G A;  3CCM A;  4F04 B;  1BBZ A;  1AT1 B;  3WVE B;  1MNE A;  2DD4 A;  1M1G A;  4BD3 A;  2G6F X;  4JDS A;  4BI3 A;  2YRD A;  1QVF A;  3RBB B;  4DBF A;  4J9D A;  3O5Z A;  2OX7 A;  2KYM A;  4FM4 B;  4RTT A;  3JAM E;  1S1N A;  1U1T A;  3A98 A;  4OMP A;  5J26 A;  1K73 U;  1AWW A;  1AWJ A;  2VGN A;  5GAN g;  5LJ5 j;  2D0Q B;  2LRQ A;  2L3S A;  3X28 B;  1VQ8 T;  3OB9 A;  1VQ8 Q;  3THK A;  1LOJ A;  3EG2 A;  5GMK i;  2A37 A;  2V8I A;  2QDL A;  4WCI A;  1QVG A;  2LCS A;  3CMA T;  2QQS A;  3CMA Q;  3QDR B;  4AG2 C;  3MKD A;  4XTV A;  1BKB A;  2H3E B;  6AT1 B;  2EGE A;  2IPO B;  2P4T A;  2HSP A;  2ZPB B;  2DJZ A;  2LJ1 A;  4ZN3 A;  4PNO A;  2ESW A;  1YJ9 T;  1YJ9 Q;  5GAN d;  3S6W A;  3C94 A;  5IHI A;  2HAX A;  2RJD A;  2DM1 A;  1RAC B;  2F2V A;  2H3J A;  3EG1 A;  4L59 A;  4C0D C;  2W10 A;  5GAM j;  3V7R A;  1KG1 A;  1M9S A;  2KE9 A;  5FWC A;  2DZ9 A;  4F7U A;  4LDY A;  1VYT A;  2YUN A;  2KBT A;  2SRC A;  4BY6 B;  1QKW A;  2E6Z A;  3CCR A;  1YN8 A;  4C8Q A;  4XU1 A;  3R6N A;  5LJ3 f;  4Z8A A;  3OYL A;  2QI2 A;  5CQX A;  1YHQ Q;  4E7J A;  2ZPF B;  4MML A;  3G4S T;  1WXB A;  1UDL A;  5CR2 A;  3OYG A;  1GRI A;  4HCC A;  5KYW B;  2HCK A;  2K3Y A;  2XDD A;  2MCN A;  1YIJ A;  3CCV A;  3CCE T;  2F2X A;  4HVW A;  2ED1 A;  3CCE Q;  1N6A A;  1PNJ A;  4C8Q D;  2ENM A;  2EPD A;  3I5S A;  2BZX A;  3MEU A;  2XKO C;  3OYA A;  2MOX A;  5FWB A;  4HKE A;  2KY9 A;  1NPR A;  1BI0 A;  4M77 B;  4TVR A;  2RA2 A;  1QWF A;  1M90 U;  2ECZ A;  4FU6 A;  5I22 A;  2DBK A;  2JMA A;  3M53 A;  3JCM J;  2MF2 A;  1RAD B;  4FT4 A;  1EZZ B;  3P8H A;  1QP2 A;  4JRI A;  1TSF A;  3A5Z B;  1H3Z A;  2J7I A;  5HK3 A;  1VQN A;  2K6D A;  2KXC A;  4OB3 B;  2NYS A;  1I5L A;  3PT9 A;  2P4R A;  3G71 T;  1KQS A;  4M7D F;  4J6Y A;  1K9A A;  1H92 A;  3RER A;  1N27 A;  4ATO A;  2LX9 A;  2VUB A;  2G3R A;  2E64 A;  3A8M B;  1WLP B;  2BZY A;  3EG9 B;  2VXE A;  2KNB B;  1W2B S;  5D6X A;  4QQD A;  4BAC A;  1RAF B;  5A0G A;  3RDV A;  3SFM A;  2E41 A;  1B7T A;  2DF6 A;  2EYW A;  4NS5 A;  4C0Z A;  2J05 A;  2QQR A;  1SHG A;  4M75 G;  4JS4 A;  1MMA A;  3CC4 A;  1V29 B;  5GAN h;  3TRE A;  2BTT A;  1VQ7 Q;  3M57 A;  2L89 A;  2DYI A;  2VGM A;  1VQ5 T;  3V8L A;  3CCJ T;  2LQW A;  2QAS A;  1BI3 A;  4M78 G;  2CP6 A;  1ZUY A;  2OJ2 A;  1Y57 A;  2E3I A;  4PJO A;  2DE0 X;  1IO6 A;  1ZSZ A;  1ZA1 B;  2DTI A;  3ULR B;  1K8A C;  2LNV A;  3J7A F;  1QW1 A;  3BFM A;  3F70 A;  2DMO A;  4J9E A;  3RIR A;  5A0L A;  5KYN A;  5FLX E;  2A7Y A;  2X51 A;  1N9S A;  3L2Z A;  1YI2 T;  5HY6 A;  4GY5 A;  1YI2 Q;  1VQK Q;  3EGU A;  5IHK A;  4R0K A;  1TU0 B;  4PJO D;  2JTM A;  5GAN 2;  3BY7 A;  4FW1 A;  3OMG A;  1OEB A;  1HSQ A;  4GBQ A;  3FLG A;  3JCM X;  2DL4 A;  2O4X B;  4UC4 A;  1Y96 A;  2ROL A;  2EYY A;  3LH0 A;  2YRV A;  3CC2 Q;  2B86 A;  1YHQ A;  5LJ5 g;  4JPB W;  2K79 A;  3A8G B;  3VUB A;  3QZ9 B;  4PLI A;  2DAQ A;  3GBQ A;  2CZ6 B;  5M9O A;  2EGC A;  3PVQ A;  1M27 C;  2DFU A;  1JJ2 S;  3LWI A;  4OB1 B;  1I8F A;  4HVV A;  4M4Z A;  4AT1 B;  2COY A;  1X6G A;  3OS1 A;  3GNF B;  4F17 A;  4ZN1 A;  2X3X D;  1KFZ A;  5LJ5 d;  5CAI A;  2E5K A;  4C0F A;  5GAM g;  2RB6 A;  1VYU A;  2JJ9 A;  5IAY A;  3MP6 A;  5I2M A;  2LQN A;  5HCK A;  2MMP A;  5C6S A;  4DOW A;  2DTH A;  1WIE A;  5CIU A;  4D6W A;  1Q81 R;  2RI2 A;  3A8O B;  2XI9 A;  3OW2 S;  5KYW A;  2ZCF B;  3OMC A;  2IVW A;  1NG2 A;  5GAM d;  1RAG B;  4HXJ A;  2XDB A;  3EFO B;  1I0C A;  3CBO A;  1ABO A;  1UJ0 A;  3VRY A;  2K5F A;  5IXB A;  2DXB A;  1WZO A;  3QWX X;  3EH2 A;  4VUB A;  2FZK B;  4ORZ A;  3LW5 E;  2LQK A;  3V7C A;  3CCL T;  5KYY B;  3CCL Q;  4A4E A;  1FMV A;  1JO8 A;  1U3O A;  4M77 A;  1WGS A;  2V8K A;  3GLX A;  3JCM e;  2QA4 T;  1FWZ A;  1UGQ B;  2LJ0 A;  2P0Q A;  2MI6 A;  2NUP B;  3OYM A;  1FYN A;  4J9F A;  8ATC B;  1Y0M A;  2X3W D;  2C06 A;  4J83 A;  4C92 G;  4IUV A;  2EYZ A;  4OB0 B;  2A28 A;  2EQM A;  1VQ7 A;  1G3Y A;  9ATC B;  2JUF A;  1YWP A;  2WAC A;  1PKT A;  5IHN A;  5KYX B;  3CPW A;  3MP1 A;  2OTL T;  2OTL Q;  3G1J A;  2LDM A;  2LJ3 A;  2GTO A;  4M77 D;  1NLO C;  2CP2 A;  2HKN A;  3SD4 A;  2DJQ A;  2MWP A;  2CS7 A;  1RI9 A;  5I21 A;  2F5T X;  2LZ6 B;  4EPC A;  1W70 A;  5GMK h;  4OML A;  3QHS A;  1E6H A;  3CCU T;  2FZC B;  3EG9 A;  2KI7 A;  1AHJ B;  3QSU A;  4OMN A;  1Q95 G;  2LT1 A;  3TSW A;  3CCM T;  3I55 Q;  3CCM Q;  4XU0 A;  4HA8 A;  3H0I A;  4FW2 A;  3TU4 K;  1VQK A;  1RAA B;  1KK7 A;  2HMA A;  1TOV A;  2KRS A;  3ZFJ A;  3SB2 A;  1WHG A;  2F1L A;  2RQV A;  4DBH A;  5LJ5 h;  2DET A;  1YJW Q;  4IUR A;  1H64 1;  2K5L A;  3M54 A;  2D6F A;  2CSI A;  3CC2 A;  4A4K A;  2L3Q A;  3PMT A;  2CP0 A;  1TUG B;  4CC4 B;  1WI7 A;  2COZ A;  1ZQ1 A;  3OSV A;  1K4U S;  5J3B A;  2KK4 A;  4QQG A;  2DL8 A;  4X1V A;  3RKY A;  1I5O B;  2RK1 A;  1JXM A;  5AYF A;  3JCM f;  4J8O A;  5GAM h;  1OOT A;  2CP3 A;  1Q81 U;  3NHN A;  3CBM A;  2JS2 A;  4X34 A;  2VKN A;  2EFI A;  1MMG A;  3CCR T;  3EFS A;  2O4X A;  1D0X A;  5KE3 A;  2E10 A;  4M75 C;  4E2F B;  2MYS A;  3RNJ A;  1VYV A;  3V8K A;  1R0C B;  3VUZ A;  4BDY A;  3JB9 H;  5LJ3 j;  4MZM A;  4ELZ C;  3DB4 A;  1OUL A;  1Q7Y C;  1E6G A;  1YIJ T;  1M90 C;  3CCS A;  1AWO A;  1YIJ Q;  3MHX A;  3LYI A;  3CCV T;  4M78 C;  1M1F A;  4F14 A;  3CCV Q;  2FEI A;  4IUT A;  1NJI C;  1DJ7 B;  5HKC A;  2DVE A;  5DLO A;  1BU1 A;  3L1A A;  2JOY A;  2BZ8 A;  1TS9 A;  1Q86 R;  1AZE A;  3HRS A;  5GMK l;  2P84 A;  3HRU A;  3NPF A;  3PE0 A;  3CXC S;  4RMO A;  3BDL A;  1AWX A;  3OYY A;  3FEO A;  1MV0 B;  4OMO A;  4KBM B;  4M7D G;  4J7I A;  2JVV A;  8AT1 B;  4J6W A;  4KGX B;  2RM4 A;  2V1Q A;  2DKG A;  3L2U A;  1YWO A;  4OF1 A;  1VQN T;  3VS1 A;  2R5M A;  1Q7Y R;  2L5Q A;  4LD6 A;  1I1J A;  3P8D A;  1NJI R;  2NLU A;  2DRK A;  3OS2 A;  3OQ5 A;  2JNG A;  2KMT A;  2QYZ A;  4RTZ A;  2EGA A;  3HTR A;  2RQU A;  3G6E Q;  3JCM c;  3SEM A;  1F1B B;  1OX8 A;  2MIO A;  2IG0 A;  2WSC E;  3J80 E;  1JRI A;  1XQH A;  1D1B A;  2YSQ A;  1GCQ A;  4ZTJ A;  3FDR A;  1HD3 A;  1QVF S;  3QG1 A;  2BIV A;  3ME9 A;  3I55 A;  3CC4 T;  2NUP A;  3CC4 Q;  1WXU A;  3VS3 A;  3E9F A;  3T9N A;  5I2S A;  1IXD A;  1I07 A;  1KIK A;  4HCB A;  2HQX A;  4FSS A;  3OBW A;  2KAF A;  1RAI B;  4J6X A;  2ROT A;  4B9W A;  1NPP A;  5KYX A;  1PHT A;  3EH1 A;  1TWB A;  1NYF A;  4FL6 A;  1Y96 B;  1FMW A;  1YJW A;  3VYG A;  3OYN A;  2K2V A;  4A4F A;  3UA6 A;  3NGP A;  1X75 C;  3G7Z A;  4ESR A;  4AFU C;  1M1K C;  4J9H A;  3C12 A;  2XK0 A;  5FW9 A;  1JXO A;  3MPU B;  2D1X A;  2DK3 A;  4ME7 A;  1P92 A;  1KC8 R;  3FIF A;  2VYT A;  2C0I A;  2Y4Y A;  1ABQ A;  3FJ5 A;  2D9T A;  4PJN A;  2J6F A;  2O9S A;  2ZPH B;  1UEB A;  2D8J A;  1BB9 A;  2DVJ A;  3CXC P;  1C6V X;  4DOV A;  4M75 B;  3I5R A;  4ELY C;  1CKB A;  1VQO Q;  4A63 B;  4FYV B;  3EG3 A;  2EJF A;  4CRI A;  1YHQ T;  2DA9 A;  4A4G A;  4M7A F;  1AOJ A;  3PGG A;  1BIB A;  5GAO l;  1Q86 U;  4C92 C;  1SF9 A;  1M1K R;  4JUV A;  1PCX A;  5EC7 A;  1C0M A;  2RF0 A;  2O2O A;  3GOX A;  1WPY A;  1PC0 A;  2DYB A;  1OI1 A;  2HKQ B;  1IGU A;  2E65 A;  2DZC A;  2CT3 A;  1JEG A;  1K0X A;  2EVR A;  3MEW A;  4HVU A;  3FB9 A;  2DEQ A;  1Q82 R;  4KRT A;  2KGT A;  2B8A A;  1KSW A;  1ZX6 A;  1MUZ A;  3EGD B;  2QGG A;  4OB2 B;  1Q7Y U;  3VS7 A;  3LLR A;  2CRE A;  1QVF P;  3X24 B;  3WXM B;  2YHT A;  3PIO A;  1NJI U;  4MMK A;  2KRN A;  4D8K A;  4KH1 B;  4JJC A;  1OZ2 A;  1PRL C;  2V8J A;  2K4Y A;  2DPP B;  3VS2 A;  1OX9 A;  5FU6 C;  4ZTF A;  3JB9 D;  1K9M R;  1K0S A;  2DD5 A;  2QGF B;  4JRK A;  2ZGW A;  4IIO A;  1G5V A;  3X26 B;  1T3S A;  1QVG P;  2AK5 A;  2V1R A;  3UPU A;  2QG9 B;  4ZGJ B;  2LMJ A;  3QO3 A;  5LJ3 g;  1M3A A;  4PLL A;  3CD6 Q;  3OY9 A;  1SPK A;  4XTZ A;  2DL7 A;  3G6E A;  1VQ9 A;  2CUD A;  2FYK A;  2HQE A;  1KD1 R;  3C95 A;  2CP5 A;  3HKS A;  4PFO A;  2VAS A;  3M0U A;  2XD0 A;  1FMK A;  1Z9Z A;  4RTV A;  5J39 A;  4FIB A;  2BKD N;  4F7U F;  2EWN A;  3LX7 A;  3MP8 A;  4Y28 E;  5LJ3 d;  1AEY A;  3NTI A;  4C8Q F;  1VQ7 T;  4B9X A;  3HFO A;  2RHX A;  4B6M A;  3PTA A;  2RK2 A;  1YNZ A;  7AT1 B;  1G83 A;  2RN8 A;  1KC8 U;  4KUD K;  4X9C A;  1XJW B;  3VS4 A;  2QEX A;  3UA7 A;  1D3B B;  4LDW A;  2RQW A;  4J9C A;  2ED0 A;  1WQW A;  3LH5 A;  1W2B A;  2EYX A;  2CUB A;  4DEY A;  5GAO q;  3QJY A;  3FJP A;  4EMK C;  4N4I A;  3KXT A;  3JCM W;  2K7A A;  1HK9 A;  3H41 A;  4C0D B;  1IHW A;  4M75 E;  3ZBD A;  1H8K A;  2HL3 A;  2A3L A;  2FPE A;  3UAT A;  5KCH A;  2GQV A;  3IQL A;  1VQK T;  4MDX A;  4MDW A;  5GMK m;  3NTH A;  2K3X A;  1YFN A;  3QUI A;  1M1K U;  1R77 A;  5GAN 8;  1S72 Q;  4M78 E;  2SEM A;  2LP5 A;  3EGX B;  3SDZ A;  4RCB A;  3A1P A;  2EQJ A;  4PK4 A;  2ATC B;  4C92 B;  1PD1 A;  1VQO A;  4M7D C;  4M77 G;  3CC2 T;  1SKU B;  3ZL7 C;  1B07 A;  2CZ1 B;  1QLY A;  1RAB B;  3QPH A;  1Q82 U;  1Q81 C;  1UTI A;  3L2R A;  4QKU A;  1KQS P;  4FYX B;  2HBW A;  5CKD A;  3OBY A;  5D7U A;  2QAZ A;  3OYK A;  4EMH A;  3U23 A;  4JS5 A;  4WF2 A;  1M5Q 1;  3UF4 A;  2DIL A;  4E47 A;  3EFR A;  1WJR A;  1UHF A;  1WHK A;  3OS5 A;  3D7S B;  1K9M U;  2X4X A;  4LDV A;  3I56 A;  2CZ0 B;  4DA4 A;  2J6O A;  2MAM A;  2WSE E;  2LNH B;  4LN2 A;  1X2K A;  2VXF A;  5D6W A;  1N8R R;  1GBR A;  4RTY A;  1W4S A;  4C5E A;  4M75 A;  5FU6 B;  1R0B G;  3QDF A;  4P5N A;  4RG8 A;  2L3P A;  3TCJ A;  2P0K A;  1X6O A;  2A08 A;  3RKX A;  1M30 A;  4KT0 E;  2CZ7 B;  2DXC A;  2K3B A;  1JJ2 A;  3VJP A;  3JCM Q;  2EW3 A;  1E7O A;  4DEX A;  2GNC A;  2M16 A;  3DKM A;  4PJO F;  1KD1 U;  4LXC A;  2LQ8 A;  3HP9 A;  5LJ3 h;  2R57 A;  1IGQ A;  2GQI A;  2HD0 A;  4M78 A;  4JJB A;  4QT7 A;  1VQM A;  2M0Y A;  2AKK A;  3CCS T;  4EMG A;  2PTK A;  3CCS Q;  5GJV B;  2OTJ A;  3S3M A;  2GFA A;  3C0C A;  3MEV A;  4JZ3 A;  1OQK A;  4M75 D;  2EQK A;  3E19 A;  1UHC A;  3CD6 A;  1X43 A;  1HXD A;  2KYB A;  2ZAE A;  4NL3 A;  4AMC A;  4BI4 A;  4C5G A;  2I2L A;  1HYO A;  2EJ9 A;  1LNX A;  3EGD A;  4LD9 K;  3M56 A;  2YUO A;  4D8D A;  4JLG A;  4M78 D;  1CKA A;  3DLL A;  1RLP C;  5L23 A;  4PKC C;  3E9G A;  3OW2 A;  2KT8 A;  3RR6 A;  3E2U A;  1EX4 A;  2RJC A;  3EAE A;  2FPD A;  3QBY A;  3VS0 A;  5A0D A;  3FRN A;  2XU8 A;  2E6N A;  3H0F A;  4QVZ A;  4QVD A;  3O8V A;  2COW A;  2KRO A;  4NOY A;  3OSS C;  1RAE B;  1K76 A;  5GAO m;  1W1F A;  4J5Y A;  3QYG B;  1NE8 A;  4Y92 A;  1IHV A;  1U06 A;  4XU3 A;  3H6Z A;  4C5I A;  4KGZ B;  4DQ2 A;  2QXF A;  1YIT A;  2EQU A;  1OU8 A;  4PFZ A;  1WYX A;  3P8B B;  1J3T A;  1NZ9 A;  4AFQ C;  5C0M A;  1R8O B;  3I55 T;  4C92 E;  2RD1 A;  4MZT A;  2XDP A;  1SSH A;  1MHN A;  3CEY A;  2E5Q A;  2IIM A;  5ECA A;  1KQ2 A;  5IH2 A;  4M7D B;  1QCO A;  1S72 A;  4J9I A;  2HZY A;  1RL2 A;  2AKL A;  3CME Q;  1YJW T;  1AZG B;  1D3B A;  3SHW A;  2EKO A;  1JU5 C;  2K5I A;  2YLB A;  1NBE B;  2NUZ A;  4F16 A;  1VQP Q;  2OAU A;  1VQ4 Q;  3ER0 A;  2BE9 B;  2M0O A;  2D8H A;  4BE0 A;  2JN0 A;  4LDU A;  1N8R U;  1O9S A;  2EIF A;  2QDY B;  4L6V 5;  5GAN e;  2NUT B;  2P0P A;  5GAN 5;  3V8J A;  3N5B B;  2O31 A;  3OYE A;  4M7A G;  4FYW B;  2CH4 W;  4M77 F;  1VQ6 A;  3A8H B;  1T0J A;  2DIQ A;  2GCX A;  1Q86 C;  1FXX A;  3OYD A;  1VUB A;  1WHM A;  2EBP A;  4OMQ A;  4JRQ A;  1WX6 A;  1PWT A;  1WQ7 A;  3HFN A;  4XTY A;  3EGX A;  1QCN A;  5CKB A;  4C92 A;  1TUD A;  3CC7 A;  3KUF A;  3CPW P;  3OYF A;  1PKS A;  1M2V B;  3TVT A;  1OPL A;  2OAW A;  4PL6 A;  3JCM V;  1UUE A;  3R6O A;  3L42 A;  1NEG A;  2DO3 A;  3OS0 A;  1I81 A;  2A36 A;  2XMF A;  4C5H A;  2E70 A;  4BUG A;  1GFD A;  3PVL A;  3SWN C;  3REA B;  1BI1 A;  2RJF A;  1N9R A;  2VVK A;  3QKJ A;  4AG1 C;  4IIM A;  1EFN A;  5KH6 A;  4E7Z A;  1LPL A;  1BI2 A;  4BY6 C;  4C92 D;  5LL6 S;  3NFC A;  1VQL A;  3HPW A;  1YJN A;  4LDX A;  3QYH B;  1UJY A;  3M4G A;  1SSF A;  1LJO A;  3L2Q A;  1I4K 1;  1M3B A;  2PNI A;  4LUD A;  3JCM g;  1M8V A;  1T0H A;  1D1A A;  3PIP A;  2E12 A;  4BE2 A;  5KE2 A;  2RHY A;  3LGL A;  4RTW A;  2QQB A;  2RI3 A;  2VV5 A;  1QVP A;  4J9B A;  4OMF B;  4R56 A;  2HQH A;  3EHR A;  4F7U G;  5GAN f;  1IZ6 A;  2CDT A;  4M77 C;  4R55 A;  5CCA A;  3JCM d;  3G6E T;  2W0Z A;  4C8Q G;  1VQ9 T;  1VQ9 Q;  4XU2 A;  3PMI A;  3PNW C;  2LTO A;  2M9U A;  4WTO B;  3DB3 A;  3JSC A;  5EG2 A;  3UWN A;  1QQJ A;  2MWO A;  2CT4 A;  1KC8 C;  4DBR A;  4M7D E;  2GF7 A;  1YCS B;  2PVD B;  4LUE A;  1GXI E;  5FRN A;  4OGC A;  3Q1J A;  2PVO B;  3M0S A;  5A2Q E;  3J81 E;  4C0G A;  1M2O A;  2QQ9 A;  3H9N A;  1X69 A;  4F7U E;  2RQT A;  1D09 B;  2QEX T;  2QEX Q;  1QVG S;  3X20 B;  3GP8 A;  2R58 A;  1PSF A;  3CME A;  5GAN 7;  1ZSG A;  4N0A C;  2LX7 A;  4C8Q E;  3TQ7 P;  4JRP A;  1BK2 A;  4EMK A;  4PJM A;  3FC3 A;  1VQP A;  1VQ4 A;  2EKH A;  3A8L B;  4FT2 A;  5IN1 A;  1XOV A;  4Q5W A;  3JRZ A;  4BE1 A;  4PJJ A;  1UFF A;  1O75 A;  1OZ3 A;  2FZG B;  2K9G A;  2X4Y A;  1BCM A;  2PU9 B;  1VA7 A;  1Q82 C;  4ZNX A;  4Z89 A;  1N5Z A;  4QQ6 A;  4Z02 A;  1A0N B;  4XQ3 A;  4M7D A;  2QTV A;  4RUG A;  1VQO T;  4IUQ A;  5GMK e;  2YWW A;  3ASK A;  2AZV A;  2RH2 A;  2GFU A;  2J6K A;  4PFP A;  1RAH B;  1K9M C;  2FO0 A;  4AFS C;  1SEM A;  1Y71 A;  3M9Q A;  3OYB A;  3M0T A;  5CO7 A;  3URG A;  3SWN B;  3M0P A;  2OI3 A;  4M78 B;  3C4S A;  2F69 A;  2HBP A;  1OPK A;  4M7D D;  2NUT A;  3RES A;  4XAX B;  3I35 A;  3HHT B;  3QXE B;  1XNI A;  4RG2 A;  5L8R E;  1B34 B;  1ARK A;  5GAO r;  3I56 T;  5LJ5 e;  3I56 Q;  3G4S Q;  4PJO G;  3VU3 C;  2CSQ A;  2V26 A;  3JCM h;  3S3O A;  1KD1 C;  4GLM A;  4MZP A;  2KQW A;  3S3N A;  2Z0W A;  3BE3 A;  1UGP B;  4QW2 A;  2BUD A;  3JV3 A;  3RUX A;  1VIF A;  2J06 A;  2E3H A;  5KYU A;  1KHI A;  2PUO B;  3EG0 A;  1OU9 A;  1M2V A;  4E6R A;  2VWF A;  2ZZD A;  1SRM A;  1ZA2 B;  2ZPI B;  1RI0 A;  2EQI A;  4RKU E;  1VQM T;  2FPF A;  1VQM Q;  1KQS S;  5GAM e;  3RMS A;  2OTJ T;  2OTJ Q;  2CH4 A;  4XTU A;  1M3C A;  3CD6 T;  3MET A;  4PJO E;  1XTD A;  4KGV B;  2JMC A;  2ZPE B;  2RO0 A;  5CQY A;  1V76 A;  2HDA A;  3GIB A;  4J7F A;  4EDU A;  1TUC A;  4HCK A;  2FVU A;  3HRT A;  2KRM A;  4A53 A;  2M1H A;  1WHJ A;  1Y07 A;  2KVQ G;  1QKX A;  1V1C A;  3L2W A;  3G71 Q;  4M7A C;  2L8D A;  1IB8 A;  5FRM A;  1GL5 A;  3CCQ A;  4X9D A;  1IRX A;  2R5A A;  4ZGD B;  3RKW A;  2CYZ B;  2E1H A;  3CPF A;  2LCL A;  2H8H A;  5CVI A;  1JB0 E;  2DIG A;  1GCQ C;  1VOM A;  3QWY A;  1MV3 A;  4RTX A;  5CKE A;  5IXF A;  2XHC A;  4BDZ A;  1SRL A;  1D0Z A;  5LJ5 f;  2KEA A;  3ZEH A;  2M02 A;  2XG8 D;  1U1S A;  3JB9 F;  1YIT T;  1YIT Q;  3INZ A;  1WHL A;  2DNU A;  1VQ5 Q;  2LC4 A;  3CCJ Q;  1UEC A;  3VYH B;  5GAN 4;  2L3R A;  1VQ8 A;  3JB9 I;  1SG5 A;  2RQR A;  1BYM A;  2RI5 A;  3DLM A;  4O6J A;  3CMA A;  4BI8 B;  2RMO A;  2AZS A;  3OYC A;  1LCK A;  1S72 T;  1ZUK A; 
#chains in the Genus database with same CATH homology
 1NE8 A;  1N8R C;  4E7J A;  2ZPF B;  2KDS A;  4MML A;  1FX7 A;  4RMO A;  3CXC S;  5GAM f;  3G4S T;  3BDL A;  4XU3 A;  3OYY A;  3FEO A;  4GLK A;  5LJ3 f;  3H6Z A;  4C5I A;  5CR2 A;  4KBM B;  3OYG A;  4DQ2 A;  4M7D G;  3M4Y A;  4J7I A;  2JVV A;  1YJ9 A;  2QXF A;  4HCC A;  1YIT A;  2EQU A;  5KCO A;  4J6W A;  2K3Y A;  2XDD A;  3P8B B;  3RMQ A;  2RM4 A;  4HT9 A;  1YIJ A;  2FB7 A;  3CCV A;  1NZ9 A;  2DKG A;  3CCE T;  3L2U A;  4OF1 A;  1VQN T;  5C0M A;  1R8O B;  3I55 T;  2FHD A;  4C92 E;  2RD1 A;  1N6A A;  4MZT A;  2XDP A;  3QJ6 A;  4C8Q D;  1MHN A;  2R5M A;  3CEY A;  2E5Q A;  2L5Q A;  3MEU A;  4LD6 A;  2XKO C;  3OYA A;  1KQ2 A;  4YTL A;  3P8D A;  4HKE A;  2NLU A;  3OS2 A;  3JCM P;  3OQ5 A;  2KY9 A;  1Y7X A;  2LVM A;  4M7D B;  1NPR A;  2JNG A;  2KMT A;  1S72 A;  1VQ6 T;  2Y4X A;  1BI0 A;  4M77 B;  4TVR A;  2RA2 A;  1YBY A;  4C8Q C;  3JCM c;  1RL2 A;  1M90 U;  3G4S A;  1YJW T;  1D3B A;  4FU6 A;  2IG0 A;  2WSC E;  2EKO A;  4KUL A;  3J80 E;  1JRI A;  3M53 A;  2YLB A;  2K5I A;  5DLQ E;  1XQH A;  3JCM J;  2MF2 A;  2OAU A;  3ER0 A;  4FT4 A;  2M0O A;  1KQ1 A;  4M77 E;  4ZTJ A;  1VIE A;  4BE0 A;  1JBM A;  3FDR A;  3P8H A;  1QVF S;  1QP2 A;  4A4H A;  4JRI A;  3QG1 A;  3A5Z B;  4QVC A;  1H3Z A;  3CC7 T;  2JN0 A;  4LDU A;  5HK3 A;  2BIV A;  3CCE A;  1VQN A;  3ME9 A;  1N8R U;  1M4Z A;  3I55 A;  4JLI A;  3CC4 T;  1O9S A;  2EIF A;  2QDY B;  3QII A;  3E9F A;  4L6V 5;  3T9N A;  5I2S A;  1UB4 A;  3WXM B;  5GAN e;  4OB3 B;  2P0P A;  5GAN 5;  4XTW A;  4HCB A;  2HQX A;  1I5L A;  3SWN A;  1BIA A;  3OBW A;  3N5B B;  3V8J A;  3PT9 A;  2KAF A;  3OYE A;  3G71 T;  1KQS A;  2JZ2 A;  4J6Y A;  4J6X A;  3GIB A;  4M7A G;  1G3T A;  4B9W A;  4M7D F;  4M77 F;  1NPP A;  1VQ6 A;  3A8H B;  1N27 A;  3RER A;  4ATO A;  2PVG B;  2DIQ A;  2LX9 A;  2VUB A;  2G3R A;  2E64 A;  1FXX A;  2GCX A;  1VUB A;  4KUI A;  3OYD A;  2PQW A;  3A8M B;  4FL6 A;  1Y96 B;  2Y90 A;  3UT1 A;  2EJG A;  5CKF A;  3VYG A;  3OYN A;  1YJW A;  2K2V A;  4A4F A;  2PUK B;  5CKH A;  4JRQ A;  2VXE A;  4NL2 A;  4HCZ A;  1W2B S;  1WQ7 A;  4QQD A;  5D6X A;  1B34 A;  3HFN A;  4XTY A;  4BAC A;  1VQL T;  1X75 C;  3G7Z A;  5A0G A;  1YJN T;  1M1K C;  3BDU A;  3SFM A;  2E41 A;  3C12 A;  1QP3 A;  2XK0 A;  5CKB A;  4C92 A;  2DK3 A;  4NS5 A;  3LWH A;  4ME7 A;  4C0Z A;  2QQR A;  3CC7 A;  4M75 G;  4E7H A;  1G3S A;  1P92 A;  4N4H A;  3KUF A;  4JS4 A;  3CC4 A;  3FIF A;  4M7A B;  3OYF A;  1V29 B;  5GAN h;  2VYT A;  4PL6 A;  3JCM V;  3TRE A;  3R6O A;  3JB9 J;  4C92 G;  3L42 A;  3M57 A;  2DO3 A;  3OS0 A;  1I81 A;  2L89 A;  4C5H A;  2E70 A;  1UGS B;  2VGM A;  2Y4Y A;  5FU7 C;  4BUG A;  3G71 A;  3V8L A;  1VQ5 T;  3CCJ T;  3SWN C;  2F5K A;  3X24 B;  1BI3 A;  4N4G A;  3CPW S;  2D9T A;  5DM7 R;  4M78 G;  1BI1 A;  3WVD B;  2RJF A;  1N9R A;  2ZPH B;  3AHU A;  4PJO A;  1UEB A;  1WJQ A;  2K57 A;  3QKJ A;  5KH6 A;  1BI2 A;  4BY6 C;  5GAN 3;  4C92 D;  5GAN 6;  4OP0 A;  4DOV A;  4M75 B;  2DTI A;  3NFC A;  5LL6 S;  1VQL A;  1KG1 A;  4ELY C;  1IRE B;  3HPW A;  1YJN A;  1YCY A;  4E7L A;  1K8A C;  2LNV A;  4LDX A;  1EIF A;  3J7A F;  3QYH B;  3JCM b;  1QW1 A;  2EJF A;  3NTK A;  3BFM A;  4CRI A;  3F70 A;  3M4G A;  3KBG A;  1SSF A;  1YHQ T;  4EMK B;  1TH7 A;  1UGR B;  4A4G A;  1LJO A;  4M7A F;  3L2Q A;  1I4K 1;  3PGG A;  1BIB A;  3RIR A;  5GAO l;  1Q86 U;  4C92 C;  5A0L A;  3V7S A;  5GAN j;  3OA6 A;  4JUV A;  5FLX E;  2A7Y A;  3JCM g;  1M8V A;  5HK0 A;  1N9S A;  3GOX A;  2DTO A;  3L2Z A;  4II1 A;  1WPY A;  5D6Y A;  5HY6 A;  4GY5 A;  3PIP A;  1YI2 T;  1OI1 A;  2E12 A;  4PJO D;  1VQ5 A;  2E65 A;  2DZC A;  2DXT A;  2JTM A;  5GAN 2;  3CCJ A;  4BE2 A;  3BY7 A;  5KE2 A;  4ZGE B;  3OMG A;  1S72 T;  2RHY A;  3LGL A;  2QQB A;  2RI3 A;  3FLG A;  3MEW A;  2VV5 A;  3JCM X;  3FB9 A;  1QVP A;  2DEQ A;  2LCC A;  4M75 F;  4OMF B;  4R56 A;  4PJO C;  2O4X B;  3QZ5 B;  4F7U G;  4UC4 A;  1Y96 A;  5GAN f;  2B8A A;  1IZ6 A;  1Q86 C;  2EYQ A;  3H8Z A;  4XTX A;  5FRO A;  3LH0 A;  4M77 C;  2YRV A;  4IUP A;  4R55 A;  4N0A A;  5CCA A;  3JCM d;  1K73 C;  1YHQ A;  4OB2 B;  5LJ5 g;  3G6E T;  1Q7Y U;  4C8Q G;  1VQ9 T;  2QTX A;  3LLR A;  3A8G B;  4XU2 A;  3PMI A;  3PNW C;  2LTO A;  3VUB A;  3QZ9 B;  2O01 E;  2YHT A;  4FSX A;  4PLI A;  1X01 A;  4MMK A;  4M78 F;  2DAQ A;  2M9U A;  3PIO A;  1NJI U;  3DB3 A;  2CZ6 B;  3JSC A;  5EG2 A;  3UWN A;  1OZ2 A;  2MWO A;  3BW1 A;  2V8J A;  5M9O A;  2K4Y A;  2X4J A;  2DPP B;  1VQP T;  1YI2 A;  1VQ4 T;  1KC8 C;  5FU6 C;  4M7D E;  2GF7 A;  3JB9 D;  4ZTF A;  1JJ2 S;  3LWI A;  3CBP A;  4OB1 B;  1I8F A;  2DD5 A;  1K8A U;  2PVD B;  4F7U B;  4JRK A;  2ZGW A;  1GXI E;  1G5V A;  2RJE A;  4OGC A;  3X26 B;  5FRN A;  3Q1J A;  4XK8 E;  2PVO B;  5GAO n;  3UPU A;  3M59 A;  3OS1 A;  3VV0 A;  3GNF B;  4ZN1 A;  4ZGJ B;  5A2Q E;  3J81 E;  4IKF A;  4C0G A;  3QO3 A;  4C8Q B;  4A54 A;  5LJ3 g;  5LJ5 d;  2QQ9 A;  4PLL A;  4BB7 A;  5CAI A;  3OY9 A;  4OVA A;  4XTZ A;  4C0F A;  4JJN K;  4F7U E;  5GAM g;  2QEX T;  1QVG S;  2RB6 A;  3X20 B;  5IAY A;  3MP6 A;  5I2M A;  3G6E A;  2R58 A;  3GF5 A;  3GP8 A;  1PSF A;  2FYK A;  1VQ9 A;  2HQE A;  1G3W A;  5GAN 7;  4N0A C;  3GPL A;  3CME A;  3C95 A;  3HSB A;  4C8Q E;  3HKS A;  1MGQ A;  4JRP A;  4EMK A;  2MMP A;  3FC3 A;  5C6S A;  1VQP A;  2XD0 A;  2RHZ A;  5J39 A;  4DOW A;  2DTH A;  1VQ4 A;  2DXU A;  4FIB A;  5CIU A;  4D6W A;  3L2V A;  2ZPG B;  2BKD N;  3A8L B;  4FT2 A;  5IN1 A;  4F7U F;  2RI2 A;  1XOV A;  4Q5W A;  3JRZ A;  4BE1 A;  3A8O B;  2EWN A;  2XI9 A;  1KHC A;  3LX7 A;  3MP8 A;  4Y28 E;  5LJ3 d;  3OW2 S;  2ZCF B;  3OMC A;  2IVW A;  1O75 A;  1OZ3 A;  3HRU A;  3NTI A;  3UDC A;  4O5V A;  4C8Q F;  5GAM d;  1VQ7 T;  4B9X A;  3HFO A;  2X4Y A;  2RHX A;  3X25 B;  2XDB A;  3GNG A;  3PTA A;  2RK2 A;  3CBO A;  2K5F A;  2DXB A;  2PU9 B;  1KC8 U;  4KUD K;  4X9C A;  3CME T;  1Q82 C;  2QEX A;  4VUB A;  2XIC A;  1D3B B;  4M7A E;  1ZHI A;  4LDW A;  3OYH A;  3LW5 E;  4QQ6 A;  2YLC A;  2LQK A;  4Z02 A;  3V7C A;  4XQ3 A;  2X35 A;  3CCL T;  1W2B A;  1WQW A;  3OYJ A;  4A4E A;  4M7D A;  2JTF A;  2FL7 A;  4M77 A;  5GAO q;  1WGS A;  2V8K A;  3QJY A;  3GLX A;  4IUQ A;  1PSE A;  5GMK e;  1VQO T;  3ASK A;  3FJP A;  3JCM e;  2QA4 T;  1FWZ A;  4EMK C;  2RH2 A;  2GFU A;  3PFS A;  1UGQ B;  2P0Q A;  4IUU A;  2MI6 A;  4N4I A;  3KXT A;  4HT8 A;  3OYM A;  3JCM W;  1HK9 A;  5FU7 B;  1K9M C;  2C06 A;  3LGF A;  1Y71 A;  3M9Q A;  4IUV A;  2X4W A;  4J83 A;  4C0D B;  2CGH A;  5CO7 A;  3MEA A;  3SWN B;  3URG A;  3OYI A;  4M75 E;  3ZBD A;  4OB0 B;  1VQ7 A;  2EQM A;  2HNI A;  1G3Y A;  2A3L A;  3E1S A;  4M78 B;  1U8R A;  3C4S A;  2JUF A;  5KCH A;  2GQV A;  2WAC A;  1VQK T;  4MDX A;  2F69 A;  2XID A;  2HBP A;  4MDW A;  5GMK m;  3NTH A;  2K3X A;  3MP1 A;  3QUI A;  3CPW A;  2OTL T;  4RCC A;  1M1K U;  4V2S A;  4M7D D;  5CK9 A;  5GAN 8;  2LDM A;  4M77 D;  3RES A;  4XAX B;  3M58 A;  3HHT B;  3QXE B;  1XNI A;  4M78 E;  4RG2 A;  3SD4 A;  5L8R E;  1B34 B;  2MWP A;  3CCL A;  5GAO r;  2CS7 A;  3I56 T;  5LJ5 e;  5I21 A;  2F5T X;  1WJS A;  4PJO G;  3TEE A;  3SDZ A;  4EPC A;  4RCB A;  5GMK h;  3VU3 C;  2EQJ A;  1WNL A;  3QHS A;  1OYX A;  3JCM h;  4C92 B;  3S3O A;  4MZP A;  3VKI A;  4Y91 A;  3CCU T;  1VQO A;  1KD1 C;  2KQW A;  2KSS A;  4M77 G;  2QA4 A;  3S3N A;  4M7D C;  3CC2 T;  2CZ1 B;  3CXC A;  3QPH A;  1Q82 U;  1AHJ B;  3QSU A;  4E7I A;  1Q81 C;  1UGP B;  3L2R A;  2WSF E;  4QW2 A;  2BUD A;  2LT1 A;  2QQA A;  3RUX A;  1VIF A;  3CCM T;  5CKD A;  3OBY A;  1KHI A;  4XU0 A;  2PUO B;  4HA8 A;  3OYK A;  4EMH A;  3TU4 K;  1VQK A;  4JS5 A;  2AHJ B;  4WF2 A;  4M7A A;  1M5Q 1;  2LT4 A;  2OTL A;  2RHI A;  1ZBX A;  2ZZD A;  3ZFJ A;  4E47 A;  3EFR A;  4PJO B;  5LJ3 e;  1WJR A;  3SB2 A;  2ZPI B;  1RI0 A;  4CI0 C;  4RKU E;  3OS5 A;  1VQM T;  5GAO p;  1KQS S;  5GAM e;  3RMS A;  3M55 A;  2OTJ T;  1K9M U;  2X4X A;  5LJ5 h;  5IT9 E;  4LDV A;  3I56 A;  4XTU A;  3CCQ T;  3JB9 G;  3HL8 A;  4IUR A;  4C92 F;  2CZ0 B;  4DA4 A;  1H64 1;  2K5L A;  5GMK j;  3M54 A;  2D6F A;  3CD6 T;  2MAM A;  2WSE E;  3MET A;  3CCU A;  4PJO E;  1XTD A;  3MO8 A;  2EAY A;  2VXF A;  5D6W A;  3CC2 A;  2ZPE B;  4A4K A;  2RO0 A;  5CQY A;  1W4S A;  2CKK A;  3PMT A;  4C5E A;  5DY9 A;  3M5A A;  3OYB A;  4M75 A;  4OGE A;  2RHU A;  4J7F A;  4P5N A;  4RG8 A;  5FU6 B;  2VC8 A;  4EDU A;  4E7K A;  3TCJ A;  3MCA B;  2P0K A;  1X6O A;  3RKX A;  4M7A D;  1ZQ1 A;  3OSV A;  4L5G A;  4KT0 E;  2FVU A;  3HRT A;  2CZ7 B;  2DXC A;  5J3B A;  4A53 A;  3CCM A;  2M1H A;  1JJ2 A;  3WVE B;  3VJP A;  2KK4 A;  1Y07 A;  2DD4 A;  1M1G A;  3QYG B;  4BD3 A;  3JCM Q;  4JDS A;  4BI3 A;  1QVF A;  2M16 A;  4QQG A;  2KVQ G;  3DKM A;  4PJO F;  3RKY A;  2LQ8 A;  3HP9 A;  2RK1 A;  5LJ3 h;  1KD1 U;  2R57 A;  5AYF A;  4FM4 B;  2HD0 A;  4M78 A;  3JCM f;  3L2W A;  3JAM E;  1U1T A;  5J26 A;  4J8O A;  5GAM h;  4M7A C;  1VQM A;  2L8D A;  1K73 U;  3CCS T;  4EMG A;  5FRM A;  2VGN A;  2OTJ A;  5GAN g;  5LJ5 j;  2D0Q B;  3S3M A;  1Q81 U;  2LRQ A;  2GFA A;  3MEV A;  3X28 B;  3CCQ A;  4X9D A;  1VQ8 T;  3OB9 A;  2R5A A;  1LOJ A;  3CBM A;  4M75 D;  3RKW A;  2CYZ B;  2EQK A;  3E19 A;  4ZGD B;  5GMK i;  1HXD A;  3CD6 A;  2V8I A;  4X34 A;  1QVG A;  2E1H A;  3CPF A;  3CMA T;  2LCL A;  2EFI A;  2QQS A;  3QDR B;  3CCR T;  5CVI A;  4NL3 A;  3EFS A;  1JB0 E;  2O4X A;  4BI4 A;  4C5G A;  4XTV A;  1BKB A;  2I2L A;  2DIG A;  2EJ9 A;  5KE3 A;  1LNX A;  2E10 A;  2P4T A;  4M75 C;  4LD9 K;  3M56 A;  5CKE A;  2ZPB B;  4JLG A;  4M78 D;  2DJZ A;  2XHC A;  3V8K A;  4BDZ A;  4ZN3 A;  4PNO A;  3DLL A;  5LJ5 f;  3ZEH A;  3VUZ A;  2XG8 D;  4PKC C;  4BDY A;  1U1S A;  1YJ9 T;  3JB9 F;  3JB9 H;  5GAN d;  5LJ3 j;  3S6W A;  1YIT T;  3C94 A;  3E9G A;  3OW2 A;  4MZM A;  4ELZ C;  3DB4 A;  2RJD A;  2HAX A;  3INZ A;  4C0D C;  2H3J A;  4L59 A;  2LC4 A;  5GAM j;  1Q7Y C;  2RJC A;  1YIJ T;  3EAE A;  3V7R A;  3QBY A;  3CCS A;  5A0D A;  1M90 C;  3FRN A;  3LYI A;  1M9S A;  3MHX A;  4M78 C;  1M1F A;  3CCV T;  3VYH B;  4IUT A;  5GAN 4;  1NJI C;  2XU8 A;  2L3R A;  1VQ8 A;  2E6N A;  4QVZ A;  1DJ7 B;  4QVD A;  2DZ9 A;  4F7U A;  3JB9 I;  4LDY A;  5HKC A;  2DVE A;  1BYM A;  5DLO A;  2RI5 A;  3DLM A;  3O8V A;  3L1A A;  4O6J A;  2JOY A;  4NOY A;  3CMA A;  4BI8 B;  3OSS C;  4BY6 B;  2E6Z A;  3CCR A;  4C8Q A;  4XU1 A;  5GAO m;  3OYC A;  3HRS A;  4J5Y A;  5GMK l;  3OYL A;  2QI2 A;  5CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...