2MAMA

Solution structure of the interdigitated double tudor domain of rbbp1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
118
structure length
118
Chain Sequence
ADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLKQDNTTQLVQDDQVKGPLRVGAIVETRTSDGSFQEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords AT-rich interactive domain-containing protein 4A
publication title Retinoblastoma-binding protein 1 has an interdigitated double Tudor domain with DNA-binding activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1170 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mamA00
2MAMA
chains in the Genus database with same CATH superfamily
4F16A 1BIAA 2RO0A 4IUUA 1RL2A 4J9EA 1X27A 4CI0C 1NJIU 3QWXX 1YBYA 3GLXA 1KG1A 2DF6A 3FJ5A 3IQLA 1VQNQ 1SHFA 4ESRA 1RAAB 4HT9A 1Q7YU 1GRIA 1MNEA 1NE8A 1YP5A 1ZQ1A 2LQNA 2K5LA 2EKOA 5GAN8 2RJCA 1FMWA 5GAOp 3CEYA 3LWIA 1TG0A 3CCLT 2DJZA 4E7ZA 1MMDA 4D8KA 1TH7A 1IRXA 4LDXA 3LWHA 3QJ6A 3BY7A 4HVUA 3PTAA 1VQ5T 2ZPFB 4RTXA 1I0CA 1G3TA 1T3LA 5GAN2 1Q81U 2C0OA 2WSCE 4JRIA 2B86A 5LJ5e 3GBQA 4ZNXA 5GAN7 8AT1B 1WZOA 4C0FA 3CD6Q 1NLPC 3QBYA 4MZTA 2B8AA 3JCMP 3VJPA 5KYYB 2NYSA 3JCMc 2FPEA 1VQ4T 4C8QA 3QUIA 2DK3A 4DEYA 2J06A 4C0DB 4PKCC 5KYXA 2X9HA 5LJ3h 1MUZA 5GMKi 3FIFA 2SEMA 2MAMA 1IREB 2OI3A 2H3EB 2J6FA 2OTJT 1PRLC 2E5QA 1K73U 3CCLA 4BY6C 2CS7A 4J9IA 1SF9A 1C0MA 3O5ZA 3EFRA 1H92A 4HKEA 1VQ5A 4LUDA 2GTJA 3CCRQ 4C5EA 4FU6A 1U1SA 4NOYA 3RDVA 2O31A 4J9GA 4M7DB 2HKQB 2ED0A 3BW1A 2DZCA 3V7CA 2C0IA 4X9CA 1AZEA 3A8LB 5GAOn 4M78F 4HVWA 3LYIA 3PIOA 1VQ4A 1HXDA 1SKUB 2MWOA 4J5YA 1K8AR 3CXCS 2GQIA 3CCVT 3QXEB 3R6NA 2OTJA 1WI7A 4L6V5 2QDYB 4JZ4A 4JS5A 1KSWA 3EG1A 2PNIA 2EAYA 1KJWA 2DL4A 2K6DA 5GMKl 2OAWA 3BE3A 1QP2A 1HYOA 4M7DF 2FEIA 3MCAB 2EPDA 3M56A 4PJOG 2V26A 4B9XA 3OYYA 2FL7A 4WCIA 3I55A 4QW2A 1EFNA 2KEAA 4PLLA 1NLOC 3CBMA 2XIDA 4J6YA 1ZUUA 1TWBA 3QHSA 3G71T 4XTYA 2RHYA 2E70A 3CCVA 2M0YA 4O5VA 3NPFA 2VGNA 4C8QE 4HCKA 2E3IA 4J7FA 2X4YA 2LCCA 1OULA 2KYBA 3JB9J 4D6WA 4FIBA 1KFZA 2FRWA 2FPDA 3RBBB 2CP7A 4IUPA 4M7AB 5KYWB 2EJGA 5GANe 5I21A 2FRYA 1VQ8T 1YJ9T 1RI9A 4C0DC 3ZEHA 5LJ3j 2L2PA 1ZA1B 2I2LA 4MZPA 2WSFE 3CCLQ 2BKDN 4J8OA 1Q82C 5HCKA 3G71A 1KIKA 1S72T 2X3WD 5GJWB 1LOJA 2VB6A 4UC4A 3OA6A 1GCPA 1LCKA 4DQ2A 3QO3A 3CCQA 3JCMX 1PD0A 2CREA 3EG3A 5GAMg 1YI2T 2L3RA 3RIRA 4BI3A 1BU1A 4KGZB 4N4IA 4OMNA 4Q5WA 4M77G 1N8RC 1BI1A 3MHXA 2ZPGB 4M7DC 4M7AF 3CPFA 4HCZA 2MF2A 3G1JA 3CCUT 5IHKA 1P92A 1CKBA 4RTWA 2XD0A 2EQKA 3PVLA 1VQ8A 1YJ9A 3ME9A 4JDSA 3SWNC 1GCQC 2QG9B 2RNAA 1D0YA 3VS7A 3X28B 9ATCB 2J6OA 4QQ6A 2KR3A 5LL6S 4MZMA 3JCMW 2LJ3A 5LJ5f 1S72A 1VYTA 2DIGA 2QA4T 1UG1A 4N4GA 3CCMA 1QP3A 4EPCA 1U3OA 1YI2A 3GF5A 3J80E 3EH2A 3I55Q 3MO8A 2K57A 4GLMA 4RG8A 2D6FA 4AMCA 5LJ3g 3H9NA 2JW4A 2L3PA 3ZBDA 3VUZA 4LUEA 2BTTA 3CCUA 1WGSA 3TREA 2QTXA 1RLQC 1T3SA 2CYZB 3FJPA 4BI8B 1QQJA 2LTOA 1N27A 1OPKA 3CCEQ 4OB0B 2VV5A 2CDTA 1WJRA 1OX9A 1SG5A 4Y92A 1OZ2A 4XTWA 3OYBA 1N8RR 2X51A 4C5GA 4FSXA 2RK2A 4FW2A 2A3LA 3T9NA 1XTDA 1MHNA 2SRCA 1G5VA 2DD4A 1YN8A 4M7AC 3OQ5A 2JTEA 3H41A 3RMQA 1TXQA 3JB9F 1M1GA 1WJQA 1X01A 4F14A 1D09B 3G4SQ 1FWZA 3VS2A 5M9OA 2E1HA 3CCQQ 2VKNA 1O75A 4BE0A 5I22A 2QEXQ 1RLPC 5LJ5g 2YXYA 3AHUA 3P8BB 2NLUA 3EGDB 4A53A 5GAOr 2V8KA 1OI1A 1W2BA 4C92G 2QQ9A 3HP9A 4QT7A 4F17A 4XU3A 3H6ZA 5IH2A 5KYUA 1VQ8Q 2F5KA 2CZ7B 3J81E 3OS5A 3M0TA 2K4YA 3VU3C 1C6VX 4PLIA 5I2SA 3CMAT 2IPOB 2EJFA 2DERA 4XAXB 1D1BA 3A98A 2OTLQ 4LN2A 2Y90A 3TU4K 3I56T 4AFSC 3CPWA 3I9QA 2GGRA 4PK4A 1X43A 4A54A 4J83A 2HQEA 2F5TX 3CCMQ 3JB9H 3FB9A 2ABLA 2HSPA 4OMMA 1BI2A 2DNUA 2LCLA 2GQVA 3X26B 2FG0A 5GANf 1VQNT 1Q86U 3PE0A 3SEMA 2Y4YA 3E9FA 5AYFA 1K9MR 2ESWA 4C92B 5D7UA 1EX4A 2DMOA 3PGGA 2GFAA 3CMAA 2KVQG 3CMEQ 3FDRA 1LPLA 2E12A 4XTVA 1YJNQ 1FMVA 4P5NA 3I56A 2EBPA 2DEQA 3OMCA 4M7DA 4Y91A 3ZFJA 2QGFB 4JRPA 5GMKm 2DTHA 4FSSA 2M0OA 3REBB 1JQQA 1AD5A 3SWNA 4M75G 1GCQA 3SD4A 3L42A 2IVWA 4JRQA 2ZPEB 1EZZB 2HBPA 4ZGDB 4XU0A 3KFVA 2R5AA 4R56A 1JXMA 2PZ1A 3G6ET 1QKXA 1U1TA 3THKA 1JXOA 1Y71A 4IURA 1KQSS 5CKFA 4AFZC 2ZZDA 3JCMh 1SRLA 1TUGB 4IIOA 3I5RA 3MKDA 2EGAA 4KUDK 1AWOA 3M0PA 1UHCA 3JCMb 4CC7A 2DXCA 4CC2A 5FU6B 3UWNA 4HXJA 3CCRT 1ZBXA 3RESA 4Z89A 2LQ8A 2HNIA 5GAMe 1G3WA 4XU2A 4WF2A 5FRNA 1KQ1A 2AK5A 1BIBA 2FZKB 3NHNA 2Y4XA 4M75B 3OYDA 2DXBA 3FLGA 2V1RA 5KH6A 3OYCA 2E64A 3G6EA 1SPKA 3E19A 1UJYA 3DKMA 2LJ1A 2YDLA 2Z0WA 3RR6A 2ECZA 3QPHA 2HAXA 2BZYA 3CC7A 3X20B 1DJ7B 2RJEA 5HK3A 4M7AA 1PKTA 5J39A 3EHQA 1NEBA 4C0ZA 1YITQ 3CCRA 5KE3A 2P0KA 4LD6A 2YUNA 1JU5C 4DBFA 1QVGA 1A0NB 4OB2B 4C0GA 3A8MB 2DVEA 1OPLA 2J05A 4JRKA 4M78D 4CRIA 5LJ3e 3QZ5B 1QLYA 4C92C 3CMAQ 4M7DE 2PUKB 1JBMA 3QYHB 2LMJA 1KD1R 1QMCA 2O88A 1VQ7Q 1D3BB 4A4GA 4JS4A 4B6MA 2YUOA 1H3HA 3VYHB 4XTUA 1FMKA 1W2BP 1VYVA 3A8OB 3QIIA 3TCJA 1ZLMA 4RCBA 4DEXA 3L2WA 4OGCA 5EC7A 2LNHB 3HL8A 4M7DD 1FYNA 4PJMA 2G6FX 2DD5A 4LDYA 2DEUA 4KT0E 3CC2T 5KYUB 2RK1A 5GAN5 3CPWP 4BDYA 2EJ9A 2FPFA 3LW5E 1IO6A 2K7AA 1C1AA 1IGQA 1K8AC 1M90C 1M2OA 2DFUA 3L1AA 1K1ZA 3QSUA 3H0HA 2ZPHB 1QCFA 2K9GA 3M0RA 2JM9A 4OMPA 1XQHA 5FWCA 1Y57A 3C12A 2CH4A 4M4ZA 2X4XA 2L8DA 5FU6C 2ZCFB 2KAFA 4KH0B 2GNCA 4QQGA 4J9CA 4M77A 2DBKA 3RKWA 1BI3A 1UGQB 2FB7A 1S1NA 2EQMA 4RTZA 1M27C 2M9UA 1I4K1 2MPXC 3G6EQ 4CC4B 5I2MA 1UUEA 3REAB 3NFCA 4M75C 4N4HA 5GAN6 3CC2A 2LP5A 1WHHA 4M7AE 3OW2A 2KI7A 5GAOl 1SRMA 3CC7Q 2J6KA 3TSWA 2CP3A 2RHXA 2E5KA 3JRZA 6AT1B 1ACMB 3META 2CZ1B 1Q7YR 1RACB 3RERA 2RD1A 2YLBA 5CKHA 4YTLA 3V8JA 3I55T 1R0BG 3PNWC 4C5IA 5A0GA 4HCBA 3VS5A 1H3ZA 4KH1B 1R8OB 1D1CA 2AHJB 3SWNB 2E4HA 4M7AD 2RI3A 3OSVA 2YSQA 2HMAA 1ZBJA 1M90R 4DOVA 3G7ZA 4OP0A 1M8VA 5D6YA 2RM4A 4E2FB 1OZ3A 3EGDA 2EFIA 4L59A 1T0JA 3CCET 5IAYA 2PVGB 1ABQA 1WQWA 2K3YA 2HL5C 4ZN1A 2ZPIB 1OEBA 2XG8D 2HQHA 5GAMf 2RHIA 5IT9E 4E7HA 5GAN4 1RAIB 5IHNA 2HCKA 1IHVA 2RHUA 1HJDA 1ZUYA 4CC3A 2JM8A 1WXUA 1K73R 5C0MA 5EG2A 3TVTA 1AWXA 3OYEA 3SDZA 1GXIE 3JAME 4KBMB 4R0KA 1MMGA 1T0HA 2M16A 3G4ST 1KHIA 3R6OA 3CCQT 1RAHB 2ROLA 2QEXT 1PCXA 1E7OA 2O4XB 1BCOA 1G83A 3CCEA 1NZ9A 2CGHA 3EG0A 2KRMA 4F7UG 5GAN3 1QVGP 1BCMA 2LQKA 4C92A 3CBPA 3OYNA 2EWNA 1LNXA 5J26A 4K11A 2OAUA 1Y96A 1SSFA 2EIFA 1WXBA 2X4WA 5LJ3f 3M0SA 1TU0B 5CVIA 4MMKA 1VQ9Q 1NEGA 4PJOB 2A28A 3CC2Q 1VQLT 2YUPA 4C8QD 2OTLT 4DBRA 2P84A 3UDCA 3JB9D 2YUQA 4JLIA 1TUCA 4GBQA 3G4SA 3CBOA 4FYVB 3KBGA 3CCMT 2QEXA 2JMAA 4MDXA 1R77A 3NTKA 5LJ5d 4XQ3A 1HSQA 4L5GA 1X2KA 4A4FA 1Y07A 2W0ZA 3C0CA 2DL3A 2LX9A 4F7UB 1NYFA 1Q82U 4ZTJA 3SB2A 4ZN3A 1YNZA 4PJOF 1RAEB 2K2VA 3HTRA 3P8DA 4OF1A 1EIFA 4AFQC 3CMET 3EH1A 2A0FB 1VQLA 4JZ3A 2CKKA 3M59A 1YJNT 2OTLA 4PFZA 1TTHB 1N8RU 4KGXB 1UTIA 2KT8A 3LX7A 5IXBA 1JEGA 2CT4A 2VC8A 4M75A 3S3NA 1BB9A 3V8LA 4ME7A 5KE2A 2EGCA 4F7UF 3OYFA 2HBWA 3KXTA 4M77B 3OW2P 4LDWA 1TS9A 2X35A 1FXXA 3QDRB 1U5SA 1UJ0A 2QQRA 5FRMA 4C92E 7AT1B 5GANh 3CMEA 4E47A 2AKKA 2AZVA 5CKDA 3HKSA 1YJNA 4X34A 3FEOA 1IGUA 4J9DA 3NTHA 2WSEE 2YWWA 2JT4A 1U8RA 4OMOA 5CKBA 5GMKe 3VRYA 1SHGA 3QG1A 4JLGA 4BD3A 4OMLA 1WPYA 5HK0A 2IG0A 1D3BA 1UGSB 1RUWA 4M77F 1WDXA 1K9MC 2R58A 1CKAA 4PJOC 1QVFA 2RHZA 3QWYA 2DPPB 4JUVA 3AT1B 1QWEA 1GFCA 1MV0B 2VVKA 2JTMA 3HRUA 4RKUE 2RQWA 2HKNA 2RI5A 4OMFB 1K0XA 2ENMA 1HK9A 2VWFA 3A8HB 1M1KC 2XDPA 1WNLA 1GBRA 3JV3A 1YITT 1XNIA 2M02A 1K9MU 3HRSA 2YLCA 1D1AA 2W10A 3VS1A 4IKFA 5GANd 2EW3A 2QAZA 2FHDA 1IZ6A 2JZ2A 3BDLA 1VQKA 5L23A 5C6SA 2JN0A 3A8GB 1XJWB 1VQLQ 3S3OA 2K79A 1B3QA 1VQ7T 5FU7B 2LRQA 1TSFA 3V7SA 1QW1A 3M57A 4QQDA 2KY9A 3VYGA 1VYUA 5GAOm 3HFNA 4XTZA 4A63B 4M75E 2DAQA 2PU9B 2EVRA 1WHMA 3PIPA 2MYSA 1WHGA 3M9QA 3L2UA 2L89A 1BBZA 2C0TA 2CZ6B 4ELZC 4A4KA 2CUBA 2CT3A 1YHQQ 2OX7A 3OYKA 1YITA 1N9SA 2YRVA 2JJ9A 1ZSZB 3LLRA 4IUTA 2XDDA 5D6XA 2DILA 2KDSA 2FZCB 3UF4A 1K4US 1WYXA 1N6AA 1Y96B 4M77C 2V8IA 4O6JA 2JVVA 2LJ0A 4NL3A 1VQ7A 1M1KR 1VIFA 3QDFA 2JNGA 2K5IA 4R55A 2AIRB 5FWBA 5GANj 2EKHA 4KULA 4LXCA 4FW1A 1TUDA 1NG2A 1YWOA 5GJVB 5IN1A 1IB8A 1VIEA 3OS1A 1I81A 2O2OA 4OVAA 3EAEA 4PL6A 2CSQA 4J9BA 2KMTA 3V7RA 2DJQA 2BIVA 2RJDA 2CP2A 2PQWA 1I5OB 1RI0A 3PT9A 4C92F 2COYA 4FL6A 4X1VA 4J6WA 1WHJA 2KE9A 2NUPB 1Z9QA 3V8KA 1PC0A 4FYWB 1R0CB 3CC7T 3KUFA 1KD1C 1OU9A 1UECA 1UGVA 2PTKA 5KYNA 3OBWA 3PMIA 4II1A 3OS2A 4HA8A 3UATA 3QJYA 1SSHA 4KGVB 5L8RE 1RABB 1GBQA 2JS0A 1B34A 1LJOA 4NL2A 3CCSQ 1W2BS 1ABOA 1VQKQ 3C4SA 3WVDB 2XI9A 1GFDA 2HEQA 3E1SA 5ECAA 1M3BA 2VXFA 2DO3A 2G3RA 3PVQA 3LH0A 2DL7A 2QTVA 2O4XA 1QCOA 1UDLA 2CP5A 4HT8A 4EIKA 1WLPB 2JOYA 3SHWA 2EQIA 5FLXE 3OYIA 4NS5A 2FZGB 5FU7C 1IHWA 3ZL7C 3EHRA 2RPNA 2I0NA 3I35A 3MPUB 3CC4Q 3CPWS 2BZ8A 5DLQE 3OMGA 3MP1A 2NUZA 3L2VA 1SEMA 1B07A 2V8JA 4XTXA 4PJOA 1W4SA 1CSKA 3OSSC 1KQ2A 8ATCB 1WHKA 2A7YA 2IIMA 2LX7A 1PKSA 2GF7A 3OBYA 1ZSZC 1Z9ZA 4M75F 1QVFP 2KK4A 1X6BA 1PM3A 3L2ZA 2QQSA 3RMSA 1V1CA 2EYZA 1NJIC 3JCMQ 4BB7A 3M5AA 3M0QA 3ULRB 4ORZA 2FVUA 4AT1B 1M2VA 1V29B 2MWPA 4AFUC 3CXCA 5CQXA 2HL3A 2KGTA 5J3BA 2RH2A 3UA7A 2MIOA 3O8VA 2LZ6B 3C94A 1UE9A 4F7UA 1E6GA 2CZ0B 4V2SA 1Q7YC 4A4HA 4Y28E 4ATOA 3HSBA 1AT1B 3GNFB 4RTUA 4RTYA 4EMKC 1VQPQ 2EQJA 1AZGB 3E9GA 3UA6A 2K2MA 1VQ9T 2AZSA 4JJCA 1YIJT 1VQMQ 1PSEA 4M78G 3JCMf 2F1LA 5GAMh 1UHFA 1Q81C 3NTIA 2FYKA 4MDWA 3M4GA 4XK8E 1PG5B 4E7LA 3L2RA 1X2QA 1ZX6A 2J7IA 1YJWA 1VQOQ 1M8MA 2P4TA 4J9HA 1H8KA 2QK0A 1ZHIA 4QVDA 2DLPA 2VXEA 2YHTA 1KC8R 1X6OA 1OQKA 3JB9I 2MCNA 4LDUA 4M7DG 1WHLA 5CAIA 1WJSA 1UEBA 2KROA 1K8AU 1M90U 1VQ6Q 5FW9A 2XHCA 2LC4A 1D0XA 1W6XA 1NJIR 3DLLA 1K73C 1VQ9A 1YIJA 2X3XD 4OGEA 3CCJQ 1UGRB 2E3HA 2AT1B 1PRMC 4M78B 2DM1A 4PJOE 2BZXA 2BE7D 3OYJA 2P0PA 2KXCA 1RAFB 1WXTA 4FT2A 1BK2A 2M51A 4JJNK 4J9FA 2DX1A 3EFOA 2A37A 5GAMd 4QVZA 2L0AA 1X75C 2KT1A 3OB9A 1QVPA 4RMOA 4BUGA 3MEAA 2E10A 1OYXA 4ELYC 1Q81R 1QVGS 1JJ2A 2ROTA 2EQUA 2ZGWA 2QDLA 2YRDA 3JCMg 5A2QE 4PJOD 3UT1A 4F7UE 4X9DA 4DOWA 5HY6A 4KUIA 4E6RA 2EYYA 1ARKA 3A1PA 2RMOA 1BI0A 2QYZA 3MEUA 2HQXA 4BACA 1GL5A 2E65A 3S6WA 2R5MA 2LQWA 3F70A 4XU1A 2COZA 2MOXA 5LJ5h 4KRTA 1B34B 5GAOq 1K0SA 4M7AG 1NPPA 5LJ3d 3URGA 1NBEB 3DB4A 3VS3A 2E6ZA 4A4EA 2XICA 3BFMA 2JUFA 3EGXA 3P8HA 4JJBA 5GAMj 4J7IA 4PJLA 2NWMA 1YJWQ 3OY9A 1G3SA 4M77E 2A08A 4IUVA 1M3AA 2YT6A 2KRNA 2NUTB 4ZGEB 3EFSA 3EG2A 2RJFA 1ZSZA 2XU8A 4N0AC 3JSCA 5KCOA 1ZUKA 4E7KA 1G3YA 2E41A 2FO0A 2H8HA 4PNOA 3WXMB 4DA4A 1JB0E 2V1QA 2CSIA 2L5QA 3M55A 1YIJQ 4Z02A 2RQVA 2LVMA 1Q95G 3U23A 3EG9A 2RA2A 1WFWA 2DTOA 4M77D 1ZA2B 3CXCP 2O01E 2DE0X 1M5Q1 5DY9A 5CCAA 3OS0A 5DLOA 3VS0A 2H3JA 1QKWA 3OW2S 2KXDA 1AWJA 3C95A 4M78C 3MEVA 1W70A 4EMKA 2QGGA 1UFFA 1FX7A 1M2VB 2GTOA 4D8DA 1F1BB 4J6XA 1YHQT 3MP6A 4ZTFA 4JPBW 1NPRA 2QQBA 2X4JA 2HZYA 1VQ5Q 1TOVA 3TEEA 2NUPA 3INZA 4OMQA 1OU8A 1H641 2BE9B 2F2XA 4TVRA 1BKBA 2PUOB 5FROA 2XMFA 4Z8AA 3DLMA 3VKIA 2WACA 5CKEA 4PJNA 4C8QG 1JJ2S 1VQ4Q 3JB9G 4LDVA 3FC3A 2CP0A 2JMCA 5I11A 2YRCA 2D1XA 2RQRA 4VUBA 1O9SA 2OJ2A 2DXTA 2GCXA 2OTJQ 3UPUA 4AG1C 2O9VA 1YCSB 2COWA 4FYXB 1N5ZA 2LT1A 3L2QA 1YHQA 1YFNA 4EMHA 1X6GA 2DTIA 3M0UA 1ZSGA 3HPWA 1PNJA 2KBTA 1M30A 4RG2A 2P4RA 3OYLA 2EYWA 5LJ5j 3GOXA 1M1FA 2DRMA 1I07A 1E6HA 2XK0A 2EYXA 3RNJA 2K3XA 2ZPBB 2QQAA 4EMGA 3I5SA 3JCMV 2KQWA 1QCNA 2MI6A 3HFOA 2QASA 3DB3A 1G8XA 3QZ9B 3ER0A 4C8QB 5CK9A 1Q82R 3N5BB 3VS6A 2QXFA 5KYXB 3CCVQ 2HD0A 5CR2A 2KSSA 1M9SA 1JJ2P 3CCST 2VUBA 1VQKT 4BI4A 1VA7A 1WQ7A 3EFOB 2ED1A 1Y0MA 4Z88A 1NM7A 3MEWA 4C92D 3ASKA 1MMAA 3GNGA 3MJXA 2RF0A 2QA4A 2D0QB 4QVCA 2CP6A 2R57A 3A5ZB 2O9SA 1M4ZA 2DZ9A 2F2WA 5IXFA 4F04B 1KQSA 3LH5A 1K76A 4C8QF 3CC4T 2XDBA 3GIBA 4OB1B 1PD1A 1WX6A 1VOMA 3TSZA 3G71Q 1K9AA 1X69A 2RN8A 2VASA 4DBQA 3CQTA 2RB6A 2DIQA 4E7SA 3CCSA 4DBHA 4RTTA 2M1HA 4FYYB 5CIUA 3FRNA 2L3QA 3HHTB 1WIEA 1MV3A 3H8ZA 4HVVA 2MK5A 4IIMA 2DL8A 3H0IA 4N0AA 1M1KU 2JS2A 3JCMe 3OYGA 3QYGB 1JRIA 2D9TA 5AT1B 2GBQA 2PVDB 3HRTA 1U06A 2F69A 3EGXB 1YJ9Q 1OOTA 4HCCA 3OYAA 3S3MA 1YCYA 4PFOA 1Q86C 2DRKA 3D7SB 2PVOB 2C06A 4LE9A 1JO8A 3CC4A 1AWWA 1XOVA 2HDAA 3VUBA 2RQUA 3VS4A 1OV3A 2KYMA 4LNPA 1UB4A 1S72Q 2LT4A 1AVZC 2L3SA 1VQPT 4PJJA 3GPLA 5KYYA 2QI2A 4E7IA 5HKCA 4QKUA 2DYBA 1VQMT 1HD3A 3NGPA 4ZGJB 4GLKA 1YI2Q 2JXBA 4M78A 4M75D 2DYIA 1RAGB 4B9WA 5GMKh 1PSFA 3RKYA 3LGFA 4JJDA 3EG9B 4EDUA 2JTFA 1MGQA 2DL5A 3CCUQ 1AOJA 3EGUA 1VQOT 4RCCA 2DETA 2DKGA 1V76A 3PFSA 1AHJB 2RQTA 4C8QC 3QKJA 3Q1JA 2LNVA 1Y7XA 2MMPA 4EMKB 2DA9A 3VRZA 3TQ7P 3BDUA 1D0ZA 4BDZA 2DXUA 2CH4W 3PMTA 2A36A 1VQ6T 2QA4Q 1VQPA 2P0QA 3OYMA 3J7AF 3LGLA 1VQMA 1KK7A 3RKXA 3CD6T 4BE2A 3CCJT 4ANJA 5IHIA 5CO7A 2ATCB 1W1FA 1VQNA 2ZAEA 3X24B 2DVJA 1Q86R 1RADB 3M53A 1QVFS 2DBMA 4FCYA 3M4YA 4GY5A 3MP8A 2XKOC 1VQOA 4WTOB 2KNBB 1J3TA 1OX8A 3WVEB 2D8HA 2E6NA 4RTVA 4MMLA 1PHTA 2EYQA 4E7JA 2D8JA 1KD1U 1AEYA 2LDMA 4RUGA 1YWPA 4FM4B 1VQ6A 1QWFA 1I5LA 5CQYA 1VUBA 5GANg 2D0NA 2NUTA 3CD6A 2KRSA 2HSEB 3CCJA 3M54A 4IUQA 5DM7R 4BE1A 2BUDA 1WA7A 3NMZC 2CUDA 2K5FA 2LCSA 1N9RA 1IXDA 4M78E 4BY6B 1BYMA 2F2VA 5A0DA 3VV0A 5A0LA 1KC8C 1B7TA 2GFUA 2AKLA 4LD9K 1PWTA 1G2BA 2K3BA 5D6WA 1M3CA 3JCMJ 5KYWA 4FT4A 2VGMA 3SFMA 1I1JA 4AG2C 1MMNA 1KQSP 5GMKj 1LVKA 2VYTA 1YJWT 3JCMd 3OYHA 4PFPA 4C5HA 4OB3B 3GP8A 2RI2A 3RUXA 3M58A 1KC8U 1MNDA 2EGEA 3E2UA 3H0FA 1KHCA 1NYGA 1I8FA 1UGPB 3X25B 3I56Q 5KCHA
chains in the Genus database with same CATH topology
1BIAA 3QDRB 2RO0A 1B34B 4IUUA 1RL2A 4CI0C 5GAOq 4M7AG 1NPPA 1NJIU 5LJ3d 3URGA 2QQRA 5FRMA 3DB4A 4P5NA 3I56A 2E6ZA 4A4EA 4C92E 2DEQA 2XICA 3BFMA 1YBYA 2JUFA 3GLXA 3OMCA 3P8HA 4Y91A 3ZFJA 4E47A 4J7IA 5GAMj 3CMEA 1KG1A 5CKDA 4JRPA 3HKSA 1YJNA 5GMKm 3OY9A 4X34A 3FEOA 2DTHA 2M0OA 1G3SA 4M77E 4IUVA 3SWNA 4M75G 4ZGEB 3NTHA 2WSEE 3EFSA 1Q7YU 3SD4A 4HT9A 1ZQ1A 1NE8A 2IVWA 3L42A 4JRQA 2RJFA 2K5LA 2XU8A 2EKOA 2ZPEB 5GAN8 4N0AC 1U8RA 2HBPA 2RJCA 5CKBA 5GMKe 4ZGDB 3JSCA 4XU0A 5GAOp 2R5AA 3CEYA 5KCOA 4R56A 5DLQE 3QG1A 4JLGA 4BD3A 3LWIA 3G6ET 4E7KA 1G3YA 2E41A 2DJZA 3CCLT 1WPYA 1U1TA 4PNOA 3WXMB 5HK0A 2IG0A 4DA4A 1D3BA 1UGSB 1Y71A 4IURA 1TH7A 4M77F 1KQSS 1JB0E 5CKFA 4LDXA 3LWHA 3QJ6A 1K9MC 3BY7A 2L5QA 3PTAA 1VQ5T 2R58A 2ZPFB 2ZZDA 3M55A 4Z02A 3JCMh 1G3TA 5GAN2 1Q81U 4PJOC 2LVMA 1QVFA 2WSCE 2RHZA 4JRIA 4KUDK 2RA2A 2DPPB 4JUVA 5LJ5e 3JCMb 5GAN7 2DTOA 4M77D 2DXCA 2O01E 1M5Q1 5DY9A 5FU6B 2JTMA 3HRUA 4RKUE 3UWNA 3QBYA 4MZTA 4C0FA 3CCRT 2B8AA 3JCMP 3VJPA 5DLOA 2RI5A 3OS0A 1ZBXA 3JCMc 4OMFB 3RESA 2H3JA 1HK9A 1VQ4T 4C8QA 3A8HB 1M1KC 3QUIA 2DK3A 2LQ8A 3OW2S 2HNIA 5GAMe 3C95A 4M78C 4C0DB 1G3WA 3MEVA 2XDPA 1WNLA 4PKCC 1YITT 4XU2A 4EMKA 1XNIA 4WF2A 5LJ3h 1FX7A 3FIFA 5GMKi 5FRNA 1K9MU 2MAMA 3HRSA 1IREB 2YLCA 1KQ1A 4J6XA 1YHQT 1BIBA 3MP6A 2OTJT 2Y4XA 4M75B 3OYDA 4ZTFA 2DXBA 3FLGA 4IKFA 1NPRA 5GANd 2QQBA 5KH6A 3OYCA 2E64A 2FHDA 2X4JA 1IZ6A 3TEEA 2E5QA 3G6EA 2JZ2A 3BDLA 1VQKA 1K73U 3INZA 3CCLA 3E19A 3DKMA 5C6SA 2JN0A 3A8GB 1H641 3S3OA 4BY6C 2CS7A 4TVRA 1BKBA 1VQ7T 2PUOB 3EFRA 5FU7B 2LRQA 4HKEA 5FROA 3V7SA 1VQ5A 1QW1A 3M57A 4QQDA 2KY9A 3VYGA 3DLMA 3QPHA 4C5EA 2HAXA 3VKIA 4FU6A 3HFNA 5GAOm 1U1SA 2WACA 3X20B 4NOYA 4XTZA 4M75E 5CKEA 1DJ7B 4C8QG 3CC7A 1JJ2S 2DAQA 2PU9B 3PIPA 4M7DB 2RJEA 5HK3A 4M7AA 3BW1A 5J39A 2DZCA 3M9QA 3V7CA 3L2UA 3JB9G 2L89A 4C0ZA 4LDVA 3FC3A 4X9CA 3CCRA 3A8LB 5GAOn 4M78F 3LYIA 4VUBA 1O9SA 3PIOA 1VQ4A 2CZ6B 5KE3A 4ELZC 2P0KA 4LD6A 4A4KA 2DXTA 1HXDA 1QVGA 2GCXA 4OB2B 3UPUA 3OYKA 4C0GA 3A8MB 1YITA 1N9SA 2MWOA 4J5YA 2YRVA 2DVEA 3LLRA 4IUTA 4JRKA 4M78D 4CRIA 5LJ3e 3QZ5B 3CXCS 3CCVT 2XDDA 3QXEB 2LT1A 5D6XA 4C92C 3L2QA 1YHQA 4M7DE 2KDSA 2PUKB 4EMHA 2OTJA 1JBMA 3QYHB 4L6V5 1N6AA 2DTIA 3HPWA 1Y96B 2QDYB 4RG2A 3OYLA 1D3BB 4JS5A 4A4GA 3GOXA 5LJ5j 2EAYA 1M1FA 4M77C 4JS4A 2V8IA 4O6JA 3VYHB 2XK0A 4XTUA 2JVVA 4NL3A 5GMKl 1VQ7A 2K3XA 2ZPBB 2QQAA 5LJ5h 1VIFA 4EMGA 2JNGA 2K5IA 4R55A 5GANj 1KQ2A 3JCMV 3A8OB 3QIIA 1QP2A 3TCJA 4KULA 4M7DF 4RCBA 2KQWA 3MCAB 3L2WA 3M56A 4OGCA 4PJOG 2MI6A 3HFOA 4B9XA 3OYYA 3DB3A 1VIEA 5IN1A 3OS1A 2FL7A 3QZ9B 1I81A 3ER0A 4OVAA 4QW2A 3I55A 3EAEA 3HL8A 4C8QB 4PL6A 5CK9A 3N5BB 2KMTA 3V7RA 4M7DD 4PLLA 2QXFA 2BIVA 2RJDA 2PQWA 3CBMA 2XIDA 2HD0A 4J6YA 5CR2A 1RI0A 3QHSA 2DD5A 3G71T 2KSSA 4LDYA 3PT9A 4XTYA 4C92F 2RHYA 4KT0E 4FL6A 1M9SA 3FDRA 3CCST 2E70A 3CC2T 2VUBA 2RK1A 3CCVA 5GAN5 1VQKT 4BI4A 4J6WA 4BDYA 2EJ9A 4O5VA 3LW5E 1WQ7A 2VGNA 4C8QE 1K8AC 1M90C 3L1AA 3QSUA 3MEWA 4J7FA 4C92D 3V8KA 2X4YA 3ASKA 2ZPHB 2LCCA 3GNGA 2QA4A 3JB9J 2D0QB 4D6WA 4QVCA 4FIBA 3CC7T 1XQHA 3KUFA 1KD1C 2R57A 3C12A 3OBWA 3PMIA 3A5ZB 1M4ZA 2DZ9A 2X4XA 2L8DA 4II1A 2ZCFB 5FU6C 2KAFA 4QQGA 4IUPA 3OS2A 4M7AB 4HA8A 1KQSA 2EJGA 5GANe 5I21A 3QJYA 4M77A 4C8QF 3RKWA 3CC4T 2XDBA 1VQ8T 1BI3A 1UGQB 2FB7A 2EQMA 1YJ9T 3GIBA 4OB1B 5L8RE 4C0DC 3ZEHA 5LJ3j 2M9UA 2I2LA 1B34A 1I4K1 1LJOA 4NL2A 1W2BS 4MZPA 2WSFE 3C4SA 3WVDB 2BKDN 2XI9A 4J8OA 1Q82C 5I2MA 3E1SA 3NFCA 2RB6A 4M75C 4N4HA 2DIQA 3G71A 2VXFA 2G3RA 2DO3A 5GAN6 3LH0A 1S72T 3CCSA 3CC2A 4M7AE 1LOJA 3OW2A 2M1HA 5CIUA 3FRNA 2O4XA 4UC4A 3HHTB 3OA6A 5GAOl 4DQ2A 3CCQA 3QO3A 4HT8A 3H8ZA 3JCMX 2JOYA 2RHXA 5FLXE 3OYIA 4M7AF 4NS5A 3JRZA 2L3RA 3RIRA 4N0AA 3META 5FU7C 4BI3A 5GAMg 1YI2T 1M1KU 2CZ1B 3JCMe 3OYGA 3RERA 2RD1A 4N4IA 3QYGB 1JRIA 4Q5WA 2D9TA 4M77G 1N8RC 1BI1A 2PVDB 3CPWS 3HRTA 2F69A 3MHXA 2YLBA 2ZPGB 3MP1A 3OMGA 5CKHA 3CPFA 4HCZA 2MF2A 4YTLA 3V8JA 3I55T 4HCCA 3OYAA 3CCUT 3S3MA 1YCYA 1P92A 3PNWC 1Q86C 4C5IA 5A0GA 4HCBA 1H3ZA 2V8JA 2PVOB 1R8OB 4XTXA 2C06A 2EQKA 2XD0A 4PJOA 3CC4A 1W4SA 2AHJB 3OSSC 1YJ9A 3ME9A 1XOVA 4JDSA 3SWNB 3SWNC 3VUBA 1VQ8A 2A7YA 4M7AD 2GF7A 2RI3A 3OSVA 3OBYA 3X28B 1UB4A 2LT4A 4QQ6A 4DOVA 3G7ZA 4M75F 4OP0A 5LL6S 1M8VA 5D6YA 2KK4A 2RM4A 4MZMA 3JCMW 1VQPT 1OZ3A 3GPLA 2QI2A 3L2ZA 2QQSA 4E7IA 5HKCA 3RMSA 5LJ5f 1VQMT 2EFIA 4L59A 4ZGJB 4GLKA 1S72A 3CCET 5IAYA 4M78A 2PVGB 1NJIC 3JCMQ 4M75D 4BB7A 1WQWA 4M7DA 2DIGA 2QA4T 4B9WA 3M5AA 2K3YA 4N4GA 4ZN1A 2FVUA 1PSFA 2ZPIB 1QP3A 1V29B 5GMKh 3CCMA 2XG8D 2MWPA 4EPCA 3RKYA 3CXCA 3LGFA 5GAMf 2RHIA 3GF5A 1YI2A 5CQXA 3J80E 4EDUA 5IT9E 2JTFA 5J3BA 1MGQA 3MO8A 4E7HA 2RH2A 2K57A 5GAN4 4RG8A 3O8VA 1VQOT 4RCCA 2D6FA 3C94A 2DKGA 5LJ3g 3PFSA 4F7UA 2CZ0B 4V2SA 1Q7YC 2RHUA 3ZBDA 4A4HA 3VUZA 1AHJB 4Y28E 4ATOA 3CCUA 1WGSA 3TREA 3QKJA 4C8QC 3HSBA 2QTXA 3Q1JA 2LNVA 1Y7XA 5C0MA 5EG2A 3GNFB 2CYZB 2MMPA 4EMKB 4EMKC 2EQJA 3OYEA 3E9GA 3FJPA 3SDZA 1VQ9T 3BDUA 4BI8B 1YIJT 1GXIE 2LTOA 3JAME 1N27A 4BDZA 1PSEA 4KBMB 2DXUA 4M78G 4OB0B 2VV5A 3PMTA 3L2VA 1VQ6T 1WJRA 2M16A 3JCMf 3G4ST 5GAMh 1KHIA 1VQPA 2P0QA 3R6OA 3OYMA 3CCQT 3J7AF 3LGLA 1Q81C 3NTIA 2QEXT 2O4XB 3RKXA 1VQMA 1OZ2A 3CD6T 2FYKA 4BE2A 4XTWA 3CCJT 3OYBA 4MDWA 3M4GA 3CCEA 4M7DC 1NZ9A 4XK8E 4C5GA 5CO7A 4FSXA 4E7LA 3L2RA 2CGHA 1YJWA 1VQNA 2RK2A 3X24B 4F7UG 5GAN3 3M53A 2P4TA 2LQKA 2A3LA 4C92A 3CBPA 3OYNA 2EWNA 1QVFS 1ZHIA 1LNXA 4QVDA 5J26A 3T9NA 2VXEA 1XTDA 1MHNA 1G5VA 2YHTA 2OAUA 3M4YA 1Y96A 1SSFA 2DD4A 1X6OA 2EIFA 4GY5A 3MP8A 4M7AC 2XKOC 3OQ5A 1VQOA 2X4WA 5LJ3f 3JB9I 3RMQA 5CVIA 5GANh 4MMKA 3JB9F 1M1GA 4LDUA 4PJOB 1WJQA 1X01A 4M7DG 3WVEB 5CAIA 1WJSA 1UEBA 1K8AU 1M90U 2E6NA 1VQLT 2XHCA 2LC4A 4MMLA 4C8QD 2OTLT 1FWZA 3DLLA 5M9OA 2E1HA 4BE0A 1K73C 1O75A 2EYQA 1VQ9A 3UDCA 4E7JA 1YIJA 5LJ5g 3JB9D 4OGEA 4JLIA 3AHUA 1KD1U 3P8BB 2NLUA 2LDMA 1UGRB 4A53A 4FM4B 1VQ6A 5GAOr 1I5LA 3G4SA 3CBOA 5CQYA 2V8KA 4M78B 3KBGA 1VUBA 5GANg 2QEXA 1OI1A 3CCMT 1W2BA 4C92G 2QQ9A 3CD6A 4PJOE 3HP9A 3CCJA 4MDXA 3NTKA 5CCAA 5LJ5d 3OYJA 4XQ3A 2P0PA 4XU3A 3H6ZA 3M54A 4L5GA 4A4FA 4FT2A 4IUQA 5DM7R 4JJNK 2BUDA 4BE1A 1Y07A 2F5KA 2CZ7B 3J81E 3OS5A 2K5FA 2LX9A 2K4YA 4F7UB 3VU3C 1Q82U 4PLIA 4QVZA 5GAMd 3SB2A 5I2SA 4ZTJA 1N9RA 3CMAT 1X75C 3OB9A 2EJFA 4M78E 4ZN3A 1QVPA 4BY6B 4XAXB 4RMOA 1BYMA 4BUGA 3MEAA 4PJOF 5A0DA 2Y90A 2K2VA 2E10A 3P8DA 4OF1A 3VV0A 5A0LA 1EIFA 1KC8C 3TU4K 2GFUA 1OYXA 3I56T 4ELYC 1JJ2A 1QVGS 2EQUA 4LD9K 3CMET 2ZGWA 3CPWA 1VQLA 2CKKA 3M59A 5D6WA 3JCMg 4A54A 5A2QE 1YJNT 3JCMJ 2OTLA 4PJOD 4J83A 2HQEA 3UT1A 2F5TX 3JB9H 3FB9A 4F7UE 4FT4A 4X9DA 2VGMA 4DOWA 3SFMA 1N8RU 5HY6A 1BI2A 5GMKj 2LCLA 4KUIA 2GQVA 2VYTA 3X26B 1YJWT 5GANf 3LX7A 1VQNT 3JCMd 1Q86U 3OYHA 4C5HA 1BI0A 2Y4YA 4OB3B 3MEUA 3GP8A 2HQXA 3E9FA 5AYFA 4BACA 2VC8A 2RI2A 4M75A 2E65A 3S3NA 3RUXA 3S6WA 2R5MA 3M58A 4C92B 3F70A 4XU1A 1KC8U 3V8LA 4ME7A 5KE2A 4F7UF 3OYFA 1KHCA 3KXTA 3PGGA 2GFAA 1I8FA 1UGPB 4M77B 3X25B 3CMAA 4LDWA 5KCHA 2KVQG 2E12A 4XTVA 2X35A 1FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAM A; 
#chains in the Genus database with same CATH topology
 4F16 A;  1BIA A;  2RO0 A;  4IUU A;  1RL2 A;  4J9E A;  1X27 A;  4CI0 C;  1NJI U;  3QWX X;  1YBY A;  3GLX A;  1KG1 A;  2DF6 A;  3FJ5 A;  3IQL A;  1VQN Q;  1SHF A;  4ESR A;  1RAA B;  4HT9 A;  1Q7Y U;  1GRI A;  1MNE A;  1NE8 A;  1YP5 A;  1ZQ1 A;  2LQN A;  2K5L A;  2EKO A;  5GAN 8;  2RJC A;  1FMW A;  5GAO p;  3CEY A;  3LWI A;  1TG0 A;  3CCL T;  2DJZ A;  4E7Z A;  1MMD A;  4D8K A;  1TH7 A;  1IRX A;  4LDX A;  3LWH A;  3QJ6 A;  3BY7 A;  4HVU A;  3PTA A;  1VQ5 T;  2ZPF B;  4RTX A;  1I0C A;  1G3T A;  1T3L A;  5GAN 2;  1Q81 U;  2C0O A;  2WSC E;  4JRI A;  2B86 A;  5LJ5 e;  3GBQ A;  4ZNX A;  5GAN 7;  8AT1 B;  1WZO A;  4C0F A;  3CD6 Q;  1NLP C;  3QBY A;  4MZT A;  2B8A A;  3JCM P;  3VJP A;  5KYY B;  2NYS A;  3JCM c;  2FPE A;  1VQ4 T;  4C8Q A;  3QUI A;  2DK3 A;  4DEY A;  2J06 A;  4C0D B;  4PKC C;  5KYX A;  2X9H A;  5LJ3 h;  1MUZ A;  5GMK i;  3FIF A;  2SEM A;  2MAM A;  1IRE B;  2OI3 A;  2H3E B;  2J6F A;  2OTJ T;  1PRL C;  2E5Q A;  1K73 U;  3CCL A;  4BY6 C;  2CS7 A;  4J9I A;  1SF9 A;  1C0M A;  3O5Z A;  3EFR A;  1H92 A;  4HKE A;  1VQ5 A;  4LUD A;  2GTJ A;  3CCR Q;  4C5E A;  4FU6 A;  1U1S A;  4NOY A;  3RDV A;  2O31 A;  4J9G A;  4M7D B;  2HKQ B;  2ED0 A;  3BW1 A;  2DZC A;  3V7C A;  2C0I A;  4X9C A;  1AZE A;  3A8L B;  5GAO n;  4M78 F;  4HVW A;  3LYI A;  3PIO A;  1VQ4 A;  1HXD A;  1SKU B;  2MWO A;  4J5Y A;  1K8A R;  3CXC S;  2GQI A;  3CCV T;  3QXE B;  3R6N A;  2OTJ A;  1WI7 A;  4L6V 5;  2QDY B;  4JZ4 A;  4JS5 A;  1KSW A;  3EG1 A;  2PNI A;  2EAY A;  1KJW A;  2DL4 A;  2K6D A;  5GMK l;  2OAW A;  3BE3 A;  1QP2 A;  1HYO A;  4M7D F;  2FEI A;  3MCA B;  2EPD A;  3M56 A;  4PJO G;  2V26 A;  4B9X A;  3OYY A;  2FL7 A;  4WCI A;  3I55 A;  4QW2 A;  1EFN A;  2KEA A;  4PLL A;  1NLO C;  3CBM A;  2XID A;  4J6Y A;  1ZUU A;  1TWB A;  3QHS A;  3G71 T;  4XTY A;  2RHY A;  2E70 A;  3CCV A;  2M0Y A;  4O5V A;  3NPF A;  2VGN A;  4C8Q E;  4HCK A;  2E3I A;  4J7F A;  2X4Y A;  2LCC A;  1OUL A;  2KYB A;  3JB9 J;  4D6W A;  4FIB A;  1KFZ A;  2FRW A;  2FPD A;  3RBB B;  2CP7 A;  4IUP A;  4M7A B;  5KYW B;  2EJG A;  5GAN e;  5I21 A;  2FRY A;  1VQ8 T;  1YJ9 T;  1RI9 A;  4C0D C;  3ZEH A;  5LJ3 j;  2L2P A;  1ZA1 B;  2I2L A;  4MZP A;  2WSF E;  3CCL Q;  2BKD N;  4J8O A;  1Q82 C;  5HCK A;  3G71 A;  1KIK A;  1S72 T;  2X3W D;  5GJW B;  1LOJ A;  2VB6 A;  4UC4 A;  3OA6 A;  1GCP A;  1LCK A;  4DQ2 A;  3QO3 A;  3CCQ A;  3JCM X;  1PD0 A;  2CRE A;  3EG3 A;  5GAM g;  1YI2 T;  2L3R A;  3RIR A;  4BI3 A;  1BU1 A;  4KGZ B;  4N4I A;  4OMN A;  4Q5W A;  4M77 G;  1N8R C;  1BI1 A;  3MHX A;  2ZPG B;  4M7D C;  4M7A F;  3CPF A;  4HCZ A;  2MF2 A;  3G1J A;  3CCU T;  5IHK A;  1P92 A;  1CKB A;  4RTW A;  2XD0 A;  2EQK A;  3PVL A;  1VQ8 A;  1YJ9 A;  3ME9 A;  4JDS A;  3SWN C;  1GCQ C;  2QG9 B;  2RNA A;  1D0Y A;  3VS7 A;  3X28 B;  9ATC B;  2J6O A;  4QQ6 A;  2KR3 A;  5LL6 S;  4MZM A;  3JCM W;  2LJ3 A;  5LJ5 f;  1S72 A;  1VYT A;  2DIG A;  2QA4 T;  1UG1 A;  4N4G A;  3CCM A;  1QP3 A;  4EPC A;  1U3O A;  1YI2 A;  3GF5 A;  3J80 E;  3EH2 A;  3I55 Q;  3MO8 A;  2K57 A;  4GLM A;  4RG8 A;  2D6F A;  4AMC A;  5LJ3 g;  3H9N A;  2JW4 A;  2L3P A;  3ZBD A;  3VUZ A;  4LUE A;  2BTT A;  3CCU A;  1WGS A;  3TRE A;  2QTX A;  1RLQ C;  1T3S A;  2CYZ B;  3FJP A;  4BI8 B;  1QQJ A;  2LTO A;  1N27 A;  1OPK A;  3CCE Q;  4OB0 B;  2VV5 A;  2CDT A;  1WJR A;  1OX9 A;  1SG5 A;  4Y92 A;  1OZ2 A;  4XTW A;  3OYB A;  1N8R R;  2X51 A;  4C5G A;  4FSX A;  2RK2 A;  4FW2 A;  2A3L A;  3T9N A;  1XTD A;  1MHN A;  2SRC A;  1G5V A;  2DD4 A;  1YN8 A;  4M7A C;  3OQ5 A;  2JTE A;  3H41 A;  3RMQ A;  1TXQ A;  3JB9 F;  1M1G A;  1WJQ A;  1X01 A;  4F14 A;  1D09 B;  3G4S Q;  1FWZ A;  3VS2 A;  5M9O A;  2E1H A;  3CCQ Q;  2VKN A;  1O75 A;  4BE0 A;  5I22 A;  2QEX Q;  1RLP C;  5LJ5 g;  2YXY A;  3AHU A;  3P8B B;  2NLU A;  3EGD B;  4A53 A;  5GAO r;  2V8K A;  1OI1 A;  1W2B A;  4C92 G;  2QQ9 A;  3HP9 A;  4QT7 A;  4F17 A;  4XU3 A;  3H6Z A;  5IH2 A;  5KYU A;  1VQ8 Q;  2F5K A;  2CZ7 B;  3J81 E;  3OS5 A;  3M0T A;  2K4Y A;  3VU3 C;  1C6V X;  4PLI A;  5I2S A;  3CMA T;  2IPO B;  2EJF A;  2DER A;  4XAX B;  1D1B A;  3A98 A;  2OTL Q;  4LN2 A;  2Y90 A;  3TU4 K;  3I56 T;  4AFS C;  3CPW A;  3I9Q A;  2GGR A;  4PK4 A;  1X43 A;  4A54 A;  4J83 A;  2HQE A;  2F5T X;  3CCM Q;  3JB9 H;  3FB9 A;  2ABL A;  2HSP A;  4OMM A;  1BI2 A;  2DNU A;  2LCL A;  2GQV A;  3X26 B;  2FG0 A;  5GAN f;  1VQN T;  1Q86 U;  3PE0 A;  3SEM A;  2Y4Y A;  3E9F A;  5AYF A;  1K9M R;  2ESW A;  4C92 B;  5D7U A;  1EX4 A;  2DMO A;  3PGG A;  2GFA A;  3CMA A;  2KVQ G;  3CME Q;  3FDR A;  1LPL A;  2E12 A;  4XTV A;  1YJN Q;  1FMV A;  4P5N A;  3I56 A;  2EBP A;  2DEQ A;  3OMC A;  4M7D A;  4Y91 A;  3ZFJ A;  2QGF B;  4JRP A;  5GMK m;  2DTH A;  4FSS A;  2M0O A;  3REB B;  1JQQ A;  1AD5 A;  3SWN A;  4M75 G;  1GCQ A;  3SD4 A;  3L42 A;  2IVW A;  4JRQ A;  2ZPE B;  1EZZ B;  2HBP A;  4ZGD B;  4XU0 A;  3KFV A;  2R5A A;  4R56 A;  1JXM A;  2PZ1 A;  3G6E T;  1QKX A;  1U1T A;  3THK A;  1JXO A;  1Y71 A;  4IUR A;  1KQS S;  5CKF A;  4AFZ C;  2ZZD A;  3JCM h;  1SRL A;  1TUG B;  4IIO A;  3I5R A;  3MKD A;  2EGA A;  4KUD K;  1AWO A;  3M0P A;  1UHC A;  3JCM b;  4CC7 A;  2DXC A;  4CC2 A;  5FU6 B;  3UWN A;  4HXJ A;  3CCR T;  1ZBX A;  3RES A;  4Z89 A;  2LQ8 A;  2HNI A;  5GAM e;  1G3W A;  4XU2 A;  4WF2 A;  5FRN A;  1KQ1 A;  2AK5 A;  1BIB A;  2FZK B;  3NHN A;  2Y4X A;  4M75 B;  3OYD A;  2DXB A;  3FLG A;  2V1R A;  5KH6 A;  3OYC A;  2E64 A;  3G6E A;  1SPK A;  3E19 A;  1UJY A;  3DKM A;  2LJ1 A;  2YDL A;  2Z0W A;  3RR6 A;  2ECZ A;  3QPH A;  2HAX A;  2BZY A;  3CC7 A;  3X20 B;  1DJ7 B;  2RJE A;  5HK3 A;  4M7A A;  1PKT A;  5J39 A;  3EHQ A;  1NEB A;  4C0Z A;  1YIT Q;  3CCR A;  5KE3 A;  2P0K A;  4LD6 A;  2YUN A;  1JU5 C;  4DBF A;  1QVG A;  1A0N B;  4OB2 B;  4C0G A;  3A8M B;  2DVE A;  1OPL A;  2J05 A;  4JRK A;  4M78 D;  4CRI A;  5LJ3 e;  3QZ5 B;  1QLY A;  4C92 C;  3CMA Q;  4M7D E;  2PUK B;  1JBM A;  3QYH B;  2LMJ A;  1KD1 R;  1QMC A;  2O88 A;  1VQ7 Q;  1D3B B;  4A4G A;  4JS4 A;  4B6M A;  2YUO A;  1H3H A;  3VYH B;  4XTU A;  1FMK A;  1W2B P;  1VYV A;  3A8O B;  3QII A;  3TCJ A;  1ZLM A;  4RCB A;  4DEX A;  3L2W A;  4OGC A;  5EC7 A;  2LNH B;  3HL8 A;  4M7D D;  1FYN A;  4PJM A;  2G6F X;  2DD5 A;  4LDY A;  2DEU A;  4KT0 E;  3CC2 T;  5KYU B;  2RK1 A;  5GAN 5;  3CPW P;  4BDY A;  2EJ9 A;  2FPF A;  3LW5 E;  1IO6 A;  2K7A A;  1C1A A;  1IGQ A;  1K8A C;  1M90 C;  1M2O A;  2DFU A;  3L1A A;  1K1Z A;  3QSU A;  3H0H A;  2ZPH B;  1QCF A;  2K9G A;  3M0R A;  2JM9 A;  4OMP A;  1XQH A;  5FWC A;  1Y57 A;  3C12 A;  2CH4 A;  4M4Z A;  2X4X A;  2L8D A;  5FU6 C;  2ZCF B;  2KAF A;  4KH0 B;  2GNC A;  4QQG A;  4J9C A;  4M77 A;  2DBK A;  3RKW A;  1BI3 A;  1UGQ B;  2FB7 A;  1S1N A;  2EQM A;  4RTZ A;  1M27 C;  2M9U A;  1I4K 1;  2MPX C;  3G6E Q;  4CC4 B;  5I2M A;  1UUE A;  3REA B;  3NFC A;  4M75 C;  4N4H A;  5GAN 6;  3CC2 A;  2LP5 A;  1WHH A;  4M7A E;  3OW2 A;  2KI7 A;  5GAO l;  1SRM A;  3CC7 Q;  2J6K A;  3TSW A;  2CP3 A;  2RHX A;  2E5K A;  3JRZ A;  6AT1 B;  1ACM B;  3MET A;  2CZ1 B;  1Q7Y R;  1RAC B;  3RER A;  2RD1 A;  2YLB A;  5CKH A;  4YTL A;  3V8J A;  3I55 T;  1R0B G;  3PNW C;  4C5I A;  5A0G A;  4HCB A;  3VS5 A;  1H3Z A;  4KH1 B;  1R8O B;  1D1C A;  2AHJ B;  3SWN B;  2E4H A;  4M7A D;  2RI3 A;  3OSV A;  2YSQ A;  2HMA A;  1ZBJ A;  1M90 R;  4DOV A;  3G7Z A;  4OP0 A;  1M8V A;  5D6Y A;  2RM4 A;  4E2F B;  1OZ3 A;  3EGD A;  2EFI A;  4L59 A;  1T0J A;  3CCE T;  5IAY A;  2PVG B;  1ABQ A;  1WQW A;  2K3Y A;  2HL5 C;  4ZN1 A;  2ZPI B;  1OEB A;  2XG8 D;  2HQH A;  5GAM f;  2RHI A;  5IT9 E;  4E7H A;  5GAN 4;  1RAI B;  5IHN A;  2HCK A;  1IHV A;  2RHU A;  1HJD A;  1ZUY A;  4CC3 A;  2JM8 A;  1WXU A;  1K73 R;  5C0M A;  5EG2 A;  3TVT A;  1AWX A;  3OYE A;  3SDZ A;  1GXI E;  3JAM E;  4KBM B;  4R0K A;  1MMG A;  1T0H A;  2M16 A;  3G4S T;  1KHI A;  3R6O A;  3CCQ T;  1RAH B;  2ROL A;  2QEX T;  1PCX A;  1E7O A;  2O4X B;  1BCO A;  1G83 A;  3CCE A;  1NZ9 A;  2CGH A;  3EG0 A;  2KRM A;  4F7U G;  5GAN 3;  1QVG P;  1BCM A;  2LQK A;  4C92 A;  3CBP A;  3OYN A;  2EWN A;  1LNX A;  5J26 A;  4K11 A;  2OAU A;  1Y96 A;  1SSF A;  2EIF A;  1WXB A;  2X4W A;  5LJ3 f;  3M0S A;  1TU0 B;  5CVI A;  4MMK A;  1VQ9 Q;  1NEG A;  4PJO B;  2A28 A;  3CC2 Q;  1VQL T;  2YUP A;  4C8Q D;  2OTL T;  4DBR A;  2P84 A;  3UDC A;  3JB9 D;  2YUQ A;  4JLI A;  1TUC A;  4GBQ A;  3G4S A;  3CBO A;  4FYV B;  3KBG A;  3CCM T;  2QEX A;  2JMA A;  4MDX A;  1R77 A;  3NTK A;  5LJ5 d;  4XQ3 A;  1HSQ A;  4L5G A;  1X2K A;  4A4F A;  1Y07 A;  2W0Z A;  3C0C A;  2DL3 A;  2LX9 A;  4F7U B;  1NYF A;  1Q82 U;  4ZTJ A;  3SB2 A;  4ZN3 A;  1YNZ A;  4PJO F;  1RAE B;  2K2V A;  3HTR A;  3P8D A;  4OF1 A;  1EIF A;  4AFQ C;  3CME T;  3EH1 A;  2A0F B;  1VQL A;  4JZ3 A;  2CKK A;  3M59 A;  1YJN T;  2OTL A;  4PFZ A;  1TTH B;  1N8R U;  4KGX B;  1UTI A;  2KT8 A;  3LX7 A;  5IXB A;  1JEG A;  2CT4 A;  2VC8 A;  4M75 A;  3S3N A;  1BB9 A;  3V8L A;  4ME7 A;  5KE2 A;  2EGC A;  4F7U F;  3OYF A;  2HBW A;  3KXT A;  4M77 B;  3OW2 P;  4LDW A;  1TS9 A;  2X35 A;  1FXX A;  3QDR B;  1U5S A;  1UJ0 A;  2QQR A;  5FRM A;  4C92 E;  7AT1 B;  5GAN h;  3CME A;  4E47 A;  2AKK A;  2AZV A;  5CKD A;  3HKS A;  1YJN A;  4X34 A;  3FEO A;  1IGU A;  4J9D A;  3NTH A;  2WSE E;  2YWW A;  2JT4 A;  1U8R A;  4OMO A;  5CKB A;  5GMK e;  3VRY A;  1SHG A;  3QG1 A;  4JLG A;  4BD3 A;  4OML A;  1WPY A;  5HK0 A;  2IG0 A;  1D3B A;  1UGS B;  1RUW A;  4M77 F;  1WDX A;  1K9M C;  2R58 A;  1CKA A;  4PJO C;  1QVF A;  2RHZ A;  3QWY A;  2DPP B;  4JUV A;  3AT1 B;  1QWE A;  1GFC A;  1MV0 B;  2VVK A;  2JTM A;  3HRU A;  4RKU E;  2RQW A;  2HKN A;  2RI5 A;  4OMF B;  1K0X A;  2ENM A;  1HK9 A;  2VWF A;  3A8H B;  1M1K C;  2XDP A;  1WNL A;  1GBR A;  3JV3 A;  1YIT T;  1XNI A;  2M02 A;  1K9M U;  3HRS A;  2YLC A;  1D1A A;  2W10 A;  3VS1 A;  4IKF A;  5GAN d;  2EW3 A;  2QAZ A;  2FHD A;  1IZ6 A;  2JZ2 A;  3BDL A;  1VQK A;  5L23 A;  5C6S A;  2JN0 A;  3A8G B;  1XJW B;  1VQL Q;  3S3O A;  2K79 A;  1B3Q A;  1VQ7 T;  5FU7 B;  2LRQ A;  1TSF A;  3V7S A;  1QW1 A;  3M57 A;  4QQD A;  2KY9 A;  3VYG A;  1VYU A;  5GAO m;  3HFN A;  4XTZ A;  4A63 B;  4M75 E;  2DAQ A;  2PU9 B;  2EVR A;  1WHM A;  3PIP A;  2MYS A;  1WHG A;  3M9Q A;  3L2U A;  2L89 A;  1BBZ A;  2C0T A;  2CZ6 B;  4ELZ C;  4A4K A;  2CUB A;  2CT3 A;  1YHQ Q;  2OX7 A;  3OYK A;  1YIT A;  1N9S A;  2YRV A;  2JJ9 A;  1ZSZ B;  3LLR A;  4IUT A;  2XDD A;  5D6X A;  2DIL A;  2KDS A;  2FZC B;  3UF4 A;  1K4U S;  1WYX A;  1N6A A;  1Y96 B;  4M77 C;  2V8I A;  4O6J A;  2JVV A;  2LJ0 A;  4NL3 A;  1VQ7 A;  1M1K R;  1VIF A;  3QDF A;  2JNG A;  2K5I A;  4R55 A;  2AIR B;  5FWB A;  5GAN j;  2EKH A;  4KUL A;  4LXC A;  4FW1 A;  1TUD A;  1NG2 A;  1YWO A;  5GJV B;  5IN1 A;  1IB8 A;  1VIE A;  3OS1 A;  1I81 A;  2O2O A;  4OVA A;  3EAE A;  4PL6 A;  2CSQ A;  4J9B A;  2KMT A;  3V7R A;  2DJQ A;  2BIV A;  2RJD A;  2CP2 A;  2PQW A;  1I5O B;  1RI0 A;  3PT9 A;  4C92 F;  2COY A;  4FL6 A;  4X1V A;  4J6W A;  1WHJ A;  2KE9 A;  2NUP B;  1Z9Q A;  3V8K A;  1PC0 A;  4FYW B;  1R0C B;  3CC7 T;  3KUF A;  1KD1 C;  1OU9 A;  1UEC A;  1UGV A;  2PTK A;  5KYN A;  3OBW A;  3PMI A;  4II1 A;  3OS2 A;  4HA8 A;  3UAT A;  3QJY A;  1SSH A;  4KGV B;  5L8R E;  1RAB B;  1GBQ A;  2JS0 A;  1B34 A;  1LJO A;  4NL2 A;  3CCS Q;  1W2B S;  1ABO A;  1VQK Q;  3C4S A;  3WVD B;  2XI9 A;  1GFD A;  2HEQ A;  3E1S A;  5ECA A;  1M3B A;  2VXF A;  2DO3 A;  2G3R A;  3PVQ A;  3LH0 A;  2DL7 A;  2QTV A;  2O4X A;  1QCO A;  1UDL A;  2CP5 A;  4HT8 A;  4EIK A;  1WLP B;  2JOY A;  3SHW A;  2EQI A;  5FLX E;  3OYI A;  4NS5 A;  2FZG B;  5FU7 C;  1IHW A;  3ZL7 C;  3EHR A;  2RPN A;  2I0N A;  3I35 A;  3MPU B;  3CC4 Q;  3CPW S;  2BZ8 A;  5DLQ E;  3OMG A;  3MP1 A;  2NUZ A;  3L2V A;  1SEM A;  1B07 A;  2V8J A;  4XTX A;  4PJO A;  1W4S A;  1CSK A;  3OSS C;  1KQ2 A;  8ATC B;  1WHK A;  2A7Y A;  2IIM A;  2LX7 A;  1PKS A;  2GF7 A;  3OBY A;  1ZSZ C;  1Z9Z A;  4M75 F;  1QVF P;  2KK4 A;  1X6B A;  1PM3 A;  3L2Z A;  2QQS A;  3RMS A;  1V1C A;  2EYZ A;  1NJI C;  3JCM Q;  4BB7 A;  3M5A A;  3M0Q A;  3ULR B;  4ORZ A;  2FVU A;  4AT1 B;  1M2V A;  1V29 B;  2MWP A;  4AFU C;  3CXC A;  5CQX A;  2HL3 A;  2KGT A;  5J3B A;  2RH2 A;  3UA7 A;  2MIO A;  3O8V A;  2LZ6 B;  3C94 A;  1UE9 A;  4F7U A;  1E6G A;  2CZ0 B;  4V2S A;  1Q7Y C;  4A4H A;  4Y28 E;  4ATO A;  3HSB A;  1AT1 B;  3GNF B;  4RTU A;  4RTY A;  4EMK C;  1VQP Q;  2EQJ A;  1AZG B;  3E9G A;  3UA6 A;  2K2M A;  1VQ9 T;  2AZS A;  4JJC A;  1YIJ T;  1VQM Q;  1PSE A;  4M78 G;  3JCM f;  2F1L A;  5GAM h;  1UHF A;  1Q81 C;  3NTI A;  2FYK A;  4MDW A;  3M4G A;  4XK8 E;  1PG5 B;  4E7L A;  3L2R A;  1X2Q A;  1ZX6 A;  2J7I A;  1YJW A;  1VQO Q;  1M8M A;  2P4T A;  4J9H A;  1H8K A;  2QK0 A;  1ZHI A;  4QVD A;  2DLP A;  2VXE A;  2YHT A;  1KC8 R;  1X6O A;  1OQK A;  3JB9 I;  2MCN A;  4LDU A;  4M7D G;  1WHL A;  5CAI A;  1WJS A;  1UEB A;  2KRO A;  1K8A U;  1M90 U;  1VQ6 Q;  5FW9 A;  2XHC A;  2LC4 A;  1D0X A;  1W6X A;  1NJI R;  3DLL A;  1K73 C;  1VQ9 A;  1YIJ A;  2X3X D;  4OGE A;  3CCJ Q;  1UGR B;  2E3H A;  2AT1 B;  1PRM C;  4M78 B;  2DM1 A;  4PJO E;  2BZX A;  2BE7 D;  3OYJ A;  2P0P A;  2KXC A;  1RAF B;  1WXT A;  4FT2 A;  1BK2 A;  2M51 A;  4JJN K;  4J9F A;  2DX1 A;  3EFO A;  2A37 A;  5GAM d;  4QVZ A;  2L0A A;  1X75 C;  2KT1 A;  3OB9 A;  1QVP A;  4RMO A;  4BUG A;  3MEA A;  2E10 A;  1OYX A;  4ELY C;  1Q81 R;  1QVG S;  1JJ2 A;  2ROT A;  2EQU A;  2ZGW A;  2QDL A;  2YRD A;  3JCM g;  5A2Q E;  4PJO D;  3UT1 A;  4F7U E;  4X9D A;  4DOW A;  5HY6 A;  4KUI A;  4E6R A;  2EYY A;  1ARK A;  3A1P A;  2RMO A;  1BI0 A;  2QYZ A;  3MEU A;  2HQX A;  4BAC A;  1GL5 A;  2E65 A;  3S6W A;  2R5M A;  2LQW A;  3F70 A;  4XU1 A;  2COZ A;  2MOX A;  5LJ5 h;  4KRT A;  1B34 B;  5GAO q;  1K0S A;  4M7A G;  1NPP A;  5LJ3 d;  3URG A;  1NBE B;  3DB4 A;  3VS3 A;  2E6Z A;  4A4E A;  2XIC A;  3BFM A;  2JUF A;  3EGX A;  3P8H A;  4JJB A;  5GAM j;  4J7I A;  4PJL A;  2NWM A;  1YJW Q;  3OY9 A;  1G3S A;  4M77 E;  2A08 A;  4IUV A;  1M3A A;  2YT6 A;  2KRN A;  2NUT B;  4ZGE B;  3EFS A;  3EG2 A;  2RJF A;  1ZSZ A;  2XU8 A;  4N0A C;  3JSC A;  5KCO A;  1ZUK A;  4E7K A;  1G3Y A;  2E41 A;  2FO0 A;  2H8H A;  4PNO A;  3WXM B;  4DA4 A;  1JB0 E;  2V1Q A;  2CSI A;  2L5Q A;  3M55 A;  1YIJ Q;  4Z02 A;  2RQV A;  2LVM A;  1Q95 G;  3U23 A;  3EG9 A;  2RA2 A;  1WFW A;  2DTO A;  4M77 D;  1ZA2 B;  3CXC P;  2O01 E;  2DE0 X;  1M5Q 1;  5DY9 A;  5CCA A;  3OS0 A;  5DLO A;  3VS0 A;  2H3J A;  1QKW A;  3OW2 S;  2KXD A;  1AWJ A;  3C95 A;  4M78 C;  3MEV A;  1W70 A;  4EMK A;  2QGG A;  1UFF A;  1FX7 A;  1M2V B;  2GTO A;  4D8D A;  1F1B B;  4J6X A;  1YHQ T;  3MP6 A;  4ZTF A;  4JPB W;  1NPR A;  2QQB A;  2X4J A;  2HZY A;  1VQ5 Q;  1TOV A;  3TEE A;  2NUP A;  3INZ A;  4OMQ A;  1OU8 A;  1H64 1;  2BE9 B;  2F2X A;  4TVR A;  1BKB A;  2PUO B;  5FRO A;  2XMF A;  4Z8A A;  3DLM A;  3VKI A;  2WAC A;  5CKE A;  4PJN A;  4C8Q G;  1JJ2 S;  1VQ4 Q;  3JB9 G;  4LDV A;  3FC3 A;  2CP0 A;  2JMC A;  5I11 A;  2YRC A;  2D1X A;  2RQR A;  4VUB A;  1O9S A;  2OJ2 A;  2DXT A;  2GCX A;  2OTJ Q;  3UPU A;  4AG1 C;  2O9V A;  1YCS B;  2COW A;  4FYX B;  1N5Z A;  2LT1 A;  3L2Q A;  1YHQ A;  1YFN A;  4EMH A;  1X6G A;  2DTI A;  3M0U A;  1ZSG A;  3HPW A;  1PNJ A;  2KBT A;  1M30 A;  4RG2 A;  2P4R A;  3OYL A;  2EYW A;  5LJ5 j;  3GOX A;  1M1F A;  2DRM A;  1I07 A;  1E6H A;  2XK0 A;  2EYX A;  3RNJ A;  2K3X A;  2ZPB B;  2QQA A;  4EMG A;  3I5S A;  3JCM V;  2KQW A;  1QCN A;  2MI6 A;  3HFO A;  2QAS A;  3DB3 A;  1G8X A;  3QZ9 B;  3ER0 A;  4C8Q B;  5CK9 A;  1Q82 R;  3N5B B;  3VS6 A;  2QXF A;  5KYX B;  3CCV Q;  2HD0 A;  5CR2 A;  2KSS A;  1M9S A;  1JJ2 P;  3CCS T;  2VUB A;  1VQK T;  4BI4 A;  1VA7 A;  1WQ7 A;  3EFO B;  2ED1 A;  1Y0M A;  4Z88 A;  1NM7 A;  3MEW A;  4C92 D;  3ASK A;  1MMA A;  3GNG A;  3MJX A;  2RF0 A;  2QA4 A;  2D0Q B;  4QVC A;  2CP6 A;  2R57 A;  3A5Z B;  2O9S A;  1M4Z A;  2DZ9 A;  2F2W A;  5IXF A;  4F04 B;  1KQS A;  3LH5 A;  1K76 A;  4C8Q F;  3CC4 T;  2XDB A;  3GIB A;  4OB1 B;  1PD1 A;  1WX6 A;  1VOM A;  3TSZ A;  3G71 Q;  1K9A A;  1X69 A;  2RN8 A;  2VAS A;  4DBQ A;  3CQT A;  2RB6 A;  2DIQ A;  4E7S A;  3CCS A;  4DBH A;  4RTT A;  2M1H A;  4FYY B;  5CIU A;  3FRN A;  2L3Q A;  3HHT B;  1WIE A;  1MV3 A;  3H8Z A;  4HVV A;  2MK5 A;  4IIM A;  2DL8 A;  3H0I A;  4N0A A;  1M1K U;  2JS2 A;  3JCM e;  3OYG A;  3QYG B;  1JRI A;  2D9T A;  5AT1 B;  2GBQ A;  2PVD B;  3HRT A;  1U06 A;  2F69 A;  3EGX B;  1YJ9 Q;  1OOT A;  4HCC A;  3OYA A;  3S3M A;  1YCY A;  4PFO A;  1Q86 C;  2DRK A;  3D7S B;  2PVO B;  2C06 A;  4LE9 A;  1JO8 A;  3CC4 A;  1AWW A;  1XOV A;  2HDA A;  3VUB A;  2RQU A;  3VS4 A;  1OV3 A;  2KYM A;  4LNP A;  1UB4 A;  1S72 Q;  2LT4 A;  1AVZ C;  2L3S A;  1VQP T;  4PJJ A;  3GPL A;  5KYY A;  2QI2 A;  4E7I A;  5HKC A;  4QKU A;  2DYB A;  1VQM T;  1HD3 A;  3NGP A;  4ZGJ B;  4GLK A;  1YI2 Q;  2JXB A;  4M78 A;  4M75 D;  2DYI A;  1RAG B;  4B9W A;  5GMK h;  1PSF A;  3RKY A;  3LGF A;  4JJD A;  3EG9 B;  4EDU A;  2JTF A;  1MGQ A;  2DL5 A;  3CCU Q;  1AOJ A;  3EGU A;  1VQO T;  4RCC A;  2DET A;  2DKG A;  1V76 A;  3PFS A;  1AHJ B;  2RQT A;  4C8Q C;  3QKJ A;  3Q1J A;  2LNV A;  1Y7X A;  2MMP A;  4EMK B;  2DA9 A;  3VRZ A;  3TQ7 P;  3BDU A;  1D0Z A;  4BDZ A;  2DXU A;  2CH4 W;  3PMT A;  2A36 A;  1VQ6 T;  2QA4 Q;  1VQP A;  2P0Q A;  3OYM A;  3J7A F;  3LGL A;  1VQM A;  1KK7 A;  3RKX A;  3CD6 T;  4BE2 A;  3CCJ T;  4ANJ A;  5IHI A;  5CO7 A;  2ATC B;  1W1F A;  1VQN A;  2ZAE A;  3X24 B;  2DVJ A;  1Q86 R;  1RAD B;  3M53 A;  1QVF S;  2DBM A;  4FCY A;  3M4Y A;  4GY5 A;  3MP8 A;  2XKO C;  1VQO A;  4WTO B;  2KNB B;  1J3T A;  1OX8 A;  3WVE B;  2D8H A;  2E6N A;  4RTV A;  4MML A;  1PHT A;  2EYQ A;  4E7J A;  2D8J A;  1KD1 U;  1AEY A;  2LDM A;  4RUG A;  1YWP A;  4FM4 B;  1VQ6 A;  1QWF A;  1I5L A;  5CQY A;  1VUB A;  5GAN g;  2D0N A;  2NUT A;  3CD6 A;  2KRS A;  2HSE B;  3CCJ A;  3M54 A;  4IUQ A;  5DM7 R;  4BE1 A;  2BUD A;  1WA7 A;  3NMZ C;  2CUD A;  2K5F A;  2LCS A;  1N9R A;  1IXD A;  4M78 E;  4BY6 B;  1BYM A;  2F2V A;  5A0D A;  3VV0 A;  5A0L A;  1KC8 C;  1B7T A;  2GFU A;  2AKL A;  4LD9 K;  1PWT A;  1G2B A;  2K3B A;  5D6W A;  1M3C A;  3JCM J;  5KYW A;  4FT4 A;  2VGM A;  3SFM A;  1I1J A;  4AG2 C;  1MMN A;  1KQS P;  5GMK j;  1LVK A;  2VYT A;  1YJW T;  3JCM d;  3OYH A;  4PFP A;  4C5H A;  4OB3 B;  3GP8 A;  2RI2 A;  3RUX A;  3M58 A;  1KC8 U;  1MND A;  2EGE A;  3E2U A;  3H0F A;  1KHC A;  1NYG A;  1I8F A;  1UGP B;  3X25 B;  3I56 Q;  5KCH A; 
#chains in the Genus database with same CATH homology
 1BIA A;  3QDR B;  2RO0 A;  1B34 B;  4IUU A;  1RL2 A;  4CI0 C;  5GAO q;  4M7A G;  1NPP A;  1NJI U;  5LJ3 d;  3URG A;  2QQR A;  5FRM A;  3DB4 A;  4P5N A;  3I56 A;  2E6Z A;  4A4E A;  4C92 E;  2DEQ A;  2XIC A;  3BFM A;  1YBY A;  2JUF A;  3GLX A;  3OMC A;  3P8H A;  4Y91 A;  3ZFJ A;  4E47 A;  4J7I A;  5GAM j;  3CME A;  1KG1 A;  5CKD A;  4JRP A;  3HKS A;  1YJN A;  5GMK m;  3OY9 A;  4X34 A;  3FEO A;  2DTH A;  2M0O A;  1G3S A;  4M77 E;  4IUV A;  3SWN A;  4M75 G;  4ZGE B;  3NTH A;  2WSE E;  3EFS A;  1Q7Y U;  3SD4 A;  4HT9 A;  1ZQ1 A;  1NE8 A;  2IVW A;  3L42 A;  4JRQ A;  2RJF A;  2K5L A;  2XU8 A;  2EKO A;  2ZPE B;  5GAN 8;  4N0A C;  1U8R A;  2HBP A;  2RJC A;  5CKB A;  5GMK e;  4ZGD B;  3JSC A;  4XU0 A;  5GAO p;  2R5A A;  3CEY A;  5KCO A;  4R56 A;  5DLQ E;  3QG1 A;  4JLG A;  4BD3 A;  3LWI A;  3G6E T;  4E7K A;  1G3Y A;  2E41 A;  2DJZ A;  3CCL T;  1WPY A;  1U1T A;  4PNO A;  3WXM B;  5HK0 A;  2IG0 A;  4DA4 A;  1D3B A;  1UGS B;  1Y71 A;  4IUR A;  1TH7 A;  4M77 F;  1KQS S;  1JB0 E;  5CKF A;  4LDX A;  3LWH A;  3QJ6 A;  1K9M C;  3BY7 A;  2L5Q A;  3PTA A;  1VQ5 T;  2R58 A;  2ZPF B;  2ZZD A;  3M55 A;  4Z02 A;  3JCM h;  1G3T A;  5GAN 2;  1Q81 U;  4PJO C;  2LVM A;  1QVF A;  2WSC E;  2RHZ A;  4JRI A;  4KUD K;  2RA2 A;  2DPP B;  4JUV A;  5LJ5 e;  3JCM b;  5GAN 7;  2DTO A;  4M77 D;  2DXC A;  2O01 E;  1M5Q 1;  5DY9 A;  5FU6 B;  2JTM A;  3HRU A;  4RKU E;  3UWN A;  3QBY A;  4MZT A;  4C0F A;  3CCR T;  2B8A A;  3JCM P;  3VJP A;  5DLO A;  2RI5 A;  3OS0 A;  1ZBX A;  3JCM c;  4OMF B;  3RES A;  2H3J A;  1HK9 A;  1VQ4 T;  4C8Q A;  3A8H B;  1M1K C;  3QUI A;  2DK3 A;  2LQ8 A;  3OW2 S;  2HNI A;  5GAM e;  3C95 A;  4M78 C;  4C0D B;  1G3W A;  3MEV A;  2XDP A;  1WNL A;  4PKC C;  1YIT T;  4XU2 A;  4EMK A;  1XNI A;  4WF2 A;  5LJ3 h;  1FX7 A;  3FIF A;  5GMK i;  5FRN A;  1K9M U;  2MAM A;  3HRS A;  1IRE B;  2YLC A;  1KQ1 A;  4J6X A;  1YHQ T;  1BIB A;  3MP6 A;  2OTJ T;  2Y4X A;  4M75 B;  3OYD A;  4ZTF A;  2DXB A;  3FLG A;  4IKF A;  1NPR A;  5GAN d;  2QQB A;  5KH6 A;  3OYC A;  2E64 A;  2FHD A;  2X4J A;  1IZ6 A;  3TEE A;  2E5Q A;  3G6E A;  2JZ2 A;  3BDL A;  1VQK A;  1K73 U;  3INZ A;  3CCL A;  3E19 A;  3DKM A;  5C6S A;  2JN0 A;  3A8G B;  1H64 1;  3S3O A;  4BY6 C;  2CS7 A;  4TVR A;  1BKB A;  1VQ7 T;  2PUO B;  3EFR A;  5FU7 B;  2LRQ A;  4HKE A;  5FRO A;  3V7S A;  1VQ5 A;  1QW1 A;  3M57 A;  4QQD A;  2KY9 A;  3VYG A;  3DLM A;  3QPH A;  4C5E A;  2HAX A;  3VKI A;  4FU6 A;  3HFN A;  5GAO m;  1U1S A;  2WAC A;  3X20 B;  4NOY A;  4XTZ A;  4M75 E;  5CKE A;  1DJ7 B;  4C8Q G;  3CC7 A;  1JJ2 S;  2DAQ A;  2PU9 B;  3PIP A;  4M7D B;  2RJE A;  5HK3 A;  4M7A A;  3BW1 A;  5J39 A;  2DZC A;  3M9Q A;  3V7C A;  3L2U A;  3JB9 G;  2L89 A;  4C0Z A;  4LDV A;  3FC3 A;  4X9C A;  3CCR A;  3A8L B;  5GAO n;  4M78 F;  3LYI A;  4VUB A;  1O9S A;  3PIO A;  1VQ4 A;  2CZ6 B;  5KE3 A;  4ELZ C;  2P0K A;  4LD6 A;  4A4K A;  2DXT A;  1HXD A;  1QVG A;  2GCX A;  4OB2 B;  3UPU A;  3OYK A;  4C0G A;  3A8M B;  1YIT A;  1N9S A;  2MWO A;  4J5Y A;  2YRV A;  2DVE A;  3LLR A;  4IUT A;  4JRK A;  4M78 D;  4CRI A;  5LJ3 e;  3QZ5 B;  3CXC S;  3CCV T;  2XDD A;  3QXE B;  2LT1 A;  5D6X A;  4C92 C;  3L2Q A;  1YHQ A;  4M7D E;  2KDS A;  2PUK B;  4EMH A;  2OTJ A;  1JBM A;  3QYH B;  4L6V 5;  1N6A A;  2DTI A;  3HPW A;  1Y96 B;  2QDY B;  4RG2 A;  3OYL A;  1D3B B;  4JS5 A;  4A4G A;  3GOX A;  5LJ5 j;  2EAY A;  1M1F A;  4M77 C;  4JS4 A;  2V8I A;  4O6J A;  3VYH B;  2XK0 A;  4XTU A;  2JVV A;  4NL3 A;  5GMK l;  1VQ7 A;  2K3X A;  2ZPB B;  2QQA A;  5LJ5 h;  1VIF A;  4EMG A;  2JNG A;  2K5I A;  4R55 A;  5GAN j;  1KQ2 A;  3JCM V;  3A8O B;  3QII A;  1QP2 A;  3TCJ A;  4KUL A;  4M7D F;  4RCB A;  2KQW A;  3MCA B;  3L2W A;  3M56 A;  4OGC A;  4PJO G;  2MI6 A;  3HFO A;  4B9X A;  3OYY A;  3DB3 A;  1VIE A;  5IN1 A;  3OS1 A;  2FL7 A;  3QZ9 B;  1I81 A;  3ER0 A;  4OVA A;  4QW2 A;  3I55 A;  3EAE A;  3HL8 A;  4C8Q B;  4PL6 A;  5CK9 A;  3N5B B;  2KMT A;  3V7R A;  4M7D D;  4PLL A;  2QXF A;  2BIV A;  2RJD A;  2PQW A;  3CBM A;  2XID A;  2HD0 A;  4J6Y A;  5CR2 A;  1RI0 A;  3QHS A;  2DD5 A;  3G71 T;  2KSS A;  4LDY A;  3PT9 A;  4XTY A;  4C92 F;  2RHY A;  4KT0 E;  4FL6 A;  1M9S A;  3FDR A;  3CCS T;  2E70 A;  3CC2 T;  2VUB A;  2RK1 A;  3CCV A;  5GAN 5;  1VQK T;  4BI4 A;  4J6W A;  4BDY A;  2EJ9 A;  4O5V A;  3LW5 E;  1WQ7 A;  2VGN A;  4C8Q E;  1K8A C;  1M90 C;  3L1A A;  3QSU A;  3MEW A;  4J7F A;  4C92 D;  3V8K A;  2X4Y A;  3ASK A;  2ZPH B;  2LCC A;  3GNG A;  2QA4 A;  3JB9 J;  2D0Q B;  4D6W A;  4QVC A;  4FIB A;  3CC7 T;  1XQH A;  3KUF A;  1KD1 C;  2R57 A;  3C12 A;  3OBW A;  3PMI A;  3A5Z B;  1M4Z A;  2DZ9 A;  2X4X A;  2L8D A;  4II1 A;  2ZCF B;  5FU6 C;  2KAF A;  4QQG A;  4IUP A;  3OS2 A;  4M7A B;  4HA8 A;  1KQS A;  2EJG A;  5GAN e;  5I21 A;  3QJY A;  4M77 A;  4C8Q F;  3RKW A;  3CC4 T;  2XDB A;  1VQ8 T;  1BI3 A;  1UGQ B;  2FB7 A;  2EQM A;  1YJ9 T;  3GIB A;  4OB1 B;  5L8R E;  4C0D C;  3ZEH A;  5LJ3 j;  2M9U A;  2I2L A;  1B34 A;  1I4K 1;  1LJO A;  4NL2 A;  1W2B S;  4MZP A;  2WSF E;  3C4S A;  3WVD B;  2BKD N;  2XI9 A;  4J8O A;  1Q82 C;  5I2M A;  3E1S A;  3NFC A;  2RB6 A;  4M75 C;  4N4H A;  2DIQ A;  3G71 A;  2VXF A;  2G3R A;  2DO3 A;  5GAN 6;  3LH0 A;  1S72 T;  3CCS A;  3CC2 A;  4M7A E;  1LOJ A;  3OW2 A;  2M1H A;  5CIU A;  3FRN A;  2O4X A;  4UC4 A;  3HHT B;  3OA6 A;  5GAO l;  4DQ2 A;  3CCQ A;  3QO3 A;  4HT8 A;  3H8Z A;  3JCM X;  2JOY A;  2RHX A;  5FLX E;  3OYI A;  4M7A F;  4NS5 A;  3JRZ A;  2L3R A;  3RIR A;  4N0A A;  3MET A;  5FU7 C;  4BI3 A;  5GAM g;  1YI2 T;  1M1K U;  2CZ1 B;  3JCM e;  3OYG A;  3RER A;  2RD1 A;  4N4I A;  3QYG B;  1JRI A;  4Q5W A;  2D9T A;  4M77 G;  1N8R C;  1BI1 A;  2PVD B;  3CPW S;  3HRT A;  2F69 A;  3MHX A;  2YLB A;  2ZPG B;  3MP1 A;  3OMG A;  5CKH A;  3CPF A;  4HCZ A;  2MF2 A;  4YTL A;  3V8J A;  3I55 T;  4HCC A;  3OYA A;  3CCU T;  3S3M A;  1YCY A;  1P92 A;  3PNW C;  1Q86 C;  4C5I A;  5A0G A;  4HCB A;  1H3Z A;  2V8J A;  2PVO B;  1R8O B;  4XTX A;  2C06 A;  2EQK A;  2XD0 A;  4PJO A;  3CC4 A;  1W4S A;  2AHJ B;  3OSS C;  1YJ9 A;  3ME9 A;  1XOV A;  4JDS A;  3SWN B;  3SWN C;  3VUB A;  1VQ8 A;  2A7Y A;  4M7A D;  2GF7 A;  2RI3 A;  3OSV A;  3OBY A;  3X28 B;  1UB4 A;  2LT4 A;  4QQ6 A;  4DOV A;  3G7Z A;  4M75 F;  4OP0 A;  5LL6 S;  1M8V A;  5D6Y A;  2KK4 A;  2RM4 A;  4MZM A;  3JCM W;  1VQP T;  1OZ3 A;  3GPL A;  2QI2 A;  3L2Z A;  2QQS A;  4E7I A;  5HKC A;  3RMS A;  5LJ5 f;  1VQM T;  2EFI A;  4L59 A;  4ZGJ B;  4GLK A;  1S72 A;  3CCE T;  5IAY A;  4M78 A;  2PVG B;  1NJI C;  3JCM Q;  4M75 D;  4BB7 A;  1WQW A;  4M7D A;  2DIG A;  2QA4 T;  4B9W A;  3M5A A;  2K3Y A;  4N4G A;  4ZN1 A;  2FVU A;  1PSF A;  2ZPI B;  1QP3 A;  1V29 B;  5GMK h;  3CCM A;  2XG8 D;  2MWP A;  4EPC A;  3RKY A;  3CXC A;  3LGF A;  5GAM f;  2RHI A;  3GF5 A;  1YI2 A;  5CQX A;  3J80 E;  4EDU A;  5IT9 E;  2JTF A;  5J3B A;  1MGQ A;  3MO8 A;  4E7H A;  2RH2 A;  2K57 A;  5GAN 4;  4RG8 A;  3O8V A;  1VQO T;  4RCC A;  2D6F A;  3C94 A;  2DKG A;  5LJ3 g;  3PFS A;  4F7U A;  2CZ0 B;  4V2S A;  1Q7Y C;  2RHU A;  3ZBD A;  4A4H A;  3VUZ A;  1AHJ B;  4Y28 E;  4ATO A;  3CCU A;  1WGS A;  3TRE A;  3QKJ A;  4C8Q C;  3HSB A;  2QTX A;  3Q1J A;  2LNV A;  1Y7X A;  5C0M A;  5EG2 A;  3GNF B;  2CYZ B;  2MMP A;  4EMK B;  4EMK C;  2EQJ A;  3OYE A;  3E9G A;  3FJP A;  3SDZ A;  1VQ9 T;  3BDU A;  4BI8 B;  1YIJ T;  1GXI E;  2LTO A;  3JAM E;  1N27 A;  4BDZ A;  1PSE A;  4KBM B;  2DXU A;  4M78 G;  4OB0 B;  2VV5 A;  3PMT A;  3L2V A;  1VQ6 T;  1WJR A;  2M16 A;  3JCM f;  3G4S T;  5GAM h;  1KHI A;  1VQP A;  2P0Q A;  3R6O A;  3OYM A;  3CCQ T;  3J7A F;  3LGL A;  1Q81 C;  3NTI A;  2QEX T;  2O4X B;  3RKX A;  1VQM A;  1OZ2 A;  3CD6 T;  2FYK A;  4BE2 A;  4XTW A;  3CCJ T;  3OYB A;  4MDW A;  3M4G A;  3CCE A;  4M7D C;  1NZ9 A;  4XK8 E;  4C5G A;  5CO7 A;  4FSX A;  4E7L A;  3L2R A;  2CGH A;  1YJW A;  1VQN A;  2RK2 A;  3X24 B;  4F7U G;  5GAN 3;  3M53 A;  2P4T A;  2LQK A;  2A3L A;  4C92 A;  3CBP A;  3OYN A;  2EWN A;  1QVF S;  1ZHI A;  1LNX A;  4QVD A;  5J26 A;  3T9N A;  2VXE A;  1XTD A;  1MHN A;  1G5V A;  2YHT A;  2OAU A;  3M4Y A;  1Y96 A;  1SSF A;  2DD4 A;  1X6O A;  2EIF A;  4GY5 A;  3MP8 A;  4M7A C;  2XKO C;  3OQ5 A;  1VQO A;  2X4W A;  5LJ3 f;  3JB9 I;  3RMQ A;  5CVI A;  5GAN h;  4MMK A;  3JB9 F;  1M1G A;  4LDU A;  4PJO B;  1WJQ A;  1X01 A;  4M7D G;  3WVE B;  5CAI A;  1WJS A;  1UEB A;  1K8A U;  1M90 U;  2E6N A;  1VQL T;  2XHC A;  2LC4 A;  4MML A;  4C8Q D;  2OTL T;  1FWZ A;  3DLL A;  5M9O A;  2E1H A;  4BE0 A;  1K73 C;  1O75 A;  2EYQ A;  1VQ9 A;  3UDC A;  4E7J A;  1YIJ A;  5LJ5 g;  3JB9 D;  4OGE A;  4JLI A;  3AHU A;  1KD1 U;  3P8B B;  2NLU A;  2LDM A;  1UGR B;  4A53 A;  4FM4 B;  1VQ6 A;  5GAO r;  1I5L A;  3G4S A;  3CBO A;  5CQY A;  2V8K A;  4M78 B;  3KBG A;  1VUB A;  5GAN g;  2QEX A;  1OI1 A;  3CCM T;  1W2B A;  4C92 G;  2QQ9 A;  3CD6 A;  4PJO E;  3HP9 A;  3CCJ A;  4MDX A;  3NTK A;  5CCA A;  5LJ5 d;  3OYJ A;  4XQ3 A;  2P0P A;  4XU3 A;  3H6Z A;  3M54 A;  4L5G A;  4A4F A;  4FT2 A;  4IUQ A;  5DM7 R;  4JJN K;  2BUD A;  4BE1 A;  1Y07 A;  2F5K A;  2CZ7 B;  3J81 E;  3OS5 A;  2K5F A;  2LX9 A;  2K4Y A;  4F7U B;  3VU3 C;  1Q82 U;  4PLI A;  4QVZ A;  5GAM d;  3SB2 A;  5I2S A;  4ZTJ A;  1N9R A;  3CMA T;  1X75 C;  3OB9 A;  2EJF A;  4M78 E;  4ZN3 A;  1QVP A;  4BY6 B;  4XAX B;  4RMO A;  1BYM A;  4BUG A;  3MEA A;  4PJO F;  5A0D A;  2Y90 A;  2K2V A;  2E10 A;  3P8D A;  4OF1 A;  3VV0 A;  5A0L A;  1EIF A;  1KC8 C;  3TU4 K;  2GFU A;  1OYX A;  3I56 T;  4ELY C;  1JJ2 A;  1QVG S;  2EQU A;  4LD9 K;  3CME T;  2ZGW A;  3CPW A;  1VQL A;  2CKK A;  3M59 A;  5D6W A;  3JCM g;  4A54 A;  5A2Q E;  1YJN T;  3JCM J;  2OTL A;  4PJO D;  4J83 A;  2HQE A;  3UT1 A;  2F5T X;  3JB9 H;  3FB9 A;  4F7U E;  4FT4 A;  4X9D A;  2VGM A;  4DOW A;  3SFM A;  1N8R U;  5HY6 A;  1BI2 A;  5GMK j;  2LCL A;  4KUI A;  2GQV A;  2VYT A;  3X26 B;  1YJW T;  5GAN f;  3LX7 A;  1VQN T;  3JCM d;  1Q86 U;  3OYH A;  4C5H A;  1BI0 A;  2Y4Y A;  4OB3 B;  3MEU A;  3GP8 A;  2HQX A;  3E9F A;  5AYF A;  4BAC A;  2VC8 A;  2RI2 A;  4M75 A;  2E65 A;  3S3N A;  3RUX A;  3S6W A;  2R5M A;  3M58 A;  4C92 B;  3F70 A;  4XU1 A;  1KC8 U;  3V8L A;  4ME7 A;  5KE2 A;  4F7U F;  3OYF A;  1KHC A;  3KXT A;  3PGG A;  2GFA A;  1I8F A;  1UGP B;  4M77 B;  3X25 B;  3CMA A;  4LDW A;  5KCH A;  2KVQ G;  2E12 A;  4XTV A;  2X35 A;  1FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...