1KC8R

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kc8R00
1VQPQ 2OTJQ 3G4SQ 1Q86R 3CCLQ 3CC2Q 1VQ9Q 3CCSQ 1YHQQ 1YIJQ 1W2BP 1VQ6Q 1VQ4Q 3CCJQ 1YJ9Q 1K73R 2OTLQ 3G71Q 3OW2P 1QVFP 1VQNQ 1M1KR 3CXCP 3CPWP 3CD6Q 1Q81R 1VQLQ 3CCQQ 1QVGP 3I55Q 1KD1R 1VQMQ 1KQSP 3CC7Q 1K8AR 1VQ5Q 1NJIR 3CCUQ 1YJNQ 1N8RR 3G6EQ 3I56Q 3CCMQ 1JJ2P 1VQ8Q 1YITQ 1Q7YR 2QA4Q 1VQ7Q 1S72Q 2QEXQ 3CMEQ 1KC8R 1K9MR 1YI2Q 1VQKQ 1Q82R 3CCEQ 1M90R 3CCVQ 1YJWQ 3CMAQ 3CC4Q 1VQOQ 3CCRQ
chains in the Genus database with same CATH superfamily
2J6OA 2WSFE 3EG1A 1W2BP 4BD3A 1K73C 2D8JA 3LWHA 1I81A 4O5VA 5GAMg 2CP7A 2QG9B 4C8QE 2BTTA 3CCVA 1BCMA 1G3SA 4Y91A 1Q81U 1UEBA 1ZSGA 4J5YA 2CYZB 4MMLA 4HT8A 1H641 5HK3A 3QJ6A 3OYDA 1ZQ1A 3WVEB 4X34A 1PKSA 4XK8E 2V8JA 2KRMA 1JXMA 3PIPA 2DL5A 5DLQE 2QDLA 3JSCA 2DL3A 2JTMA 4ANJA 1Y7XA 2QEXA 3HP9A 1UFFA 3ULRB 4JS4A 3C12A 2FO0A 3SWNB 4QQDA 2YT6A 1NZ9A 3EH1A 1JRIA 4OB2B 3OYHA 5CIUA 1VQNQ 4OB1B 2F5TX 4M75C 2DJQA 2QA4A 4HCBA 4OMPA 4IIOA 2HQXA 1PM3A 5FU6B 2FPEA 3VUZA 1ZBXA 2Y4XA 2IPOB 4MZPA 3CC2A 1QCNA 1Z9QA 5I2SA 5ECAA 4R56A 3KXTA 1Y0MA 1WJSA 1KC8C 5GMKe 2DXBA 4XU0A 1YP5A 4WF2A 4J9FA 5J39A 4OP0A 2JM8A 3JB9D 1GCQC 4R55A 1YHQQ 5GAN6 5GAOn 3I56A 3PIOA 1NPPA 3MHXA 4CC2A 4M77C 3CC7Q 2KXDA 5GMKm 1NPRA 5GAOl 2L3RA 4PL6A 1VQNT 3FIFA 4J7FA 4XTZA 1KQ1A 4C92D 1QWFA 4QKUA 3CPFA 1MUZA 3A8MB 1PWTA 1K0SA 5CQYA 5D6YA 3MEWA 4F17A 1M5Q1 1VQLQ 2O31A 4L59A 1YHQT 3QIIA 1QCOA 2K5FA 2RK2A 2VC8A 4BI8B 2L3PA 4KUDK 2YLCA 2FRYA 3CC7T 3H9NA 4E7ZA 5KE2A 2QQRA 4M77D 1JEGA 2PNIA 5KE3A 4X9CA 3VS7A 4B9XA 2CGHA 3JCMc 1E6HA 3E1SA 2NUZA 4QVCA 3REBB 2E3IA 1VUBA 3D7SB 2LT4A 1VQLT 2JW4A 1NBEB 2OI3A 2ZPIB 4BB7A 1TUGB 5LJ3f 2K7AA 4LDWA 5LJ5f 4M7DC 1GBRA 1TUDA 1KQ2A 3KBGA 1IXDA 1I5OB 3BDLA 1WI7A 2L0AA 4J9GA 2KE9A 2A7YA 2RO0A 2D1XA 2X4XA 3G6EQ 3TVTA 5KH6A 1C0MA 4N0AC 3QWXX 3HTRA 3VUBA 4HCZA 4HVVA 2J6KA 2EQIA 3J7AF 3QSUA 1G2BA 2RJFA 1JJ2S 4M7AG 1ZSZC 2FG0A 3Q1JA 2L8DA 1XOVA 2LNHB 1NYFA 2GFUA 1DJ7B 1JU5C 2RNAA 3CCRA 3O5ZA 2A28A 3GLXA 2MI6A 3M4YA 2DTOA 2JMAA 2X4WA 2LMJA 2EIFA 4BY6B 1K9AA 3GBQA 1YJNA 2RA2A 4EIKA 3A8LB 1AOJA 3UPUA 1T0HA 3WXMB 3TCJA 1PRLC 1RUWA 3U23A 4BUGA 1B07A 5GANf 4LDUA 2P0QA 3RKXA 3JRZA 1U06A 2BIVA 4PFZA 3CD6T 5GAMh 1QVFS 3EAEA 3CMEQ 5D6XA 3M59A 6AT1B 3QYHB 5FWCA 4FT4A 1BIBA 1OU8A 5AT1B 4J6XA 3META 2OTLQ 2HAXA 3OW2A 1RI0A 3VRZA 3MPUB 4KGVB 2ROLA 2EQUA 1XQHA 3QO3A 1MNDA 2KGTA 3T9NA 1WA7A 2ZGWA 1VQNA 1UDLA 2I2LA 2ED0A 3OS1A 4QW2A 2COYA 4M75B 2VKNA 1UTIA 2O01E 4A54A 5I22A 3TREA 3EGXA 5GAOr 3BW1A 4E6RA 1R77A 2OTLT 2CSQA 1M2VB 1YHQA 4L5GA 4IUUA 1M2VA 3FJ5A 2RHUA 1N5ZA 2QQ9A 4F04B 1KC8U 2XK0A 1TG0A 4M7DF 1G3WA 2C0IA 3JCMX 4M77B 3QKJA 4HA8A 1QMCA 1JXOA 3LH0A 2EQMA 2F5KA 1WJQA 4PJJA 4JJNK 3OYJA 1D3BB 2NUTA 4C8QC 4FSSA 4A53A 1Y07A 1M90R 1UB4A 1VQPQ 2HSPA 1WQ7A 4M75E 3O8VA 2QDYB 2KRNA 1IO6A 3L2ZA 3G71Q 4HXJA 3OMGA 3ME9A 2E1HA 2MOXA 4CI0C 3P8HA 1WQWA 3RUXA 1VQ8A 4KGZB 1AHJB 1K9MR 1UE9A 3GF5A 2C0OA 4A4HA 2J7IA 2O4XB 3MEVA 3PVQA 5CKBA 3RR6A 2HMAA 3CEYA 4JRPA 2FHDA 1VQPT 1NG2A 1OV3A 4C8QD 2VYTA 2YRDA 3REAB 1VQOA 5FRNA 2CDTA 4NL3A 3CCUQ 2BZXA 2XMFA 2EKHA 2RQUA 1JJ2P 1ZHIA 3M56A 2PU9B 4DBRA 2A37A 2PVDB 3I5SA 2DD4A 4M7DA 2G6FX 2H3JA 3CCVQ 1WDXA 4A4EA 1KHIA 2PVOB 2NUPB 4ORZA 2HQEA 1AWWA 2KYBA 2HKNA 3G6EA 1IHVA 5HCKA 5AYFA 2DXUA 3GPLA 1WIEA 2F2WA 2GQIA 5KYYA 1VQ9A 3PT9A 3MJXA 4LXCA 4PJOD 2PUOB 3HFNA 2E70A 4XTXA 2QEXQ 3L2WA 2CT4A 2LRQA 5CQXA 3CCUT 1ZSZB 1HYOA 2QK0A 1ZX6A 5IAYA 1PD1A 1ZSZA 1TH7A 3JB9G 5CAIA 1F1BB 3CCVT 1QVFP 1VQ7A 2L5QA 1G83A 1P92A 1I07A 2RI5A 2C06A 1LCKA 2DF6A 2V26A 2OTJA 1O75A 5EC7A 3HRUA 1M27C 4C92G 1OEBA 4M7DE 1SSHA 1C6VX 4FW2A 2V8KA 4F7UG 3CBMA 1OPKA 3CC2Q 3A5ZB 2LJ3A 1I5LA 2LQNA 2CH4A 2COWA 2QEXT 1GFDA 3EG0A 4B9WA 3EGDA 4J9IA 3CMEA 1TS9A 2YDLA 2R5MA 3X26B 1KQSA 2EYYA 1NEBA 4M4ZA 4V2SA 1D09B 2G3RA 4J8OA 4ZN3A 4BE0A 2OTLA 3X20B 2JS0A 3EFRA 2EGCA 2FVUA 4M77G 1VQ5A 2CP2A 2QA4T 3M53A 2DEQA 2FB7A 1PCXA 4IUVA 1WPYA 3RDVA 3CC2T 1CKBA 4M78C 4OGEA 5LJ5d 1BYMA 4Z8AA 1X2KA 3EHQA 1K8AC 4AG2C 3NMZC 2RM4A 1YFNA 3I55A 2XIDA 3I56T 1BK2A 2JZ2A 4JZ3A 5GJWB 3V8JA 2CZ1B 2R57A 4OGCA 1UJYA 1WNLA 3DB4A 2LVMA 3OYEA 2VUBA 2JUFA 2RF0A 3MP6A 3LW5E 5GMKj 1VIEA 2LQ8A 2HBWA 3CCMQ 2DTIA 1D1AA 3SEMA 5A0GA 3VV0A 3CPWS 1ABQA 4OMFB 2DETA 2DD5A 2NLUA 3RNJA 3NFCA 2GNCA 1HD3A 2RHYA 4EMGA 1VQMQ 4C8QB 1K8AR 2CUDA 2VB6A 2RHIA 4RTXA 3PE0A 4KULA 2YRCA 5EG2A 4DA4A 5KYXA 4FM4B 5GANd 3P8BB 3CXCS 1ZUYA 3G71A 1OULA 2XKOC 4D6WA 4K11A 2K2MA 4QT7A 4XU1A 3JV3A 1XTDA 4LUEA 1Y96B 1TWBA 3I5RA 1OQKA 2RN8A 5CKFA 4PJMA 1MGQA 3LH5A 1Q7YR 2DKGA 1VQMT 5LJ3e 2B8AA 1Q82C 5LJ5e 3C94A 2AIRB 1CSKA 1PNJA 3CCUA 2YUNA 3OYGA 1UHFA 3S3MA 3AHUA 2B86A 1BI2A 2L3QA 3EFSA 3QG1A 2ED1A 1ARKA 3BFMA 8AT1B 1O9SA 1RI9A 1YJNQ 5IN1A 2LNVA 3V8LA 1R0BG 3JB9H 3MEUA 5GAN4 2RH2A 4C5HA 4FCYA 1E7OA 1RLPC 5GAMd 4KUIA 1M1KC 1I1JA 1GRIA 2NYSA 2QTVA 2EFIA 3EFOA 3CCRT 4M78F 2JXBA 1J3TA 2H3EB 2LQWA 1G3TA 2RMOA 4BI4A 1T0JA 3TSZA 1UJ0A 2RI2A 1AWJA 2PZ1A 4AFQC 2LC4A 2E3HA 1YJNT 3JB9I 4NOYA 5IXFA 2QQSA 1K73R 2MCNA 4BDZA 1I0CA 3L2UA 3JCMQ 2YUPA 5GANe 5CK9A 1KD1C 3OYNA 2ZPEB 4MDWA 1IZ6A 4II1A 5KYWA 2DX1A 1RAAB 1Y57A 2JNGA 1WXTA 1EX4A 4NL2A 2J6FA 5HY6A 4IIMA 1WGSA 3OSSC 2QYZA 4PLLA 4IKFA 2LJ1A 3M0PA 3THKA 2BZ8A 3L1AA 3JCMe 1VYUA 2GTJA 4CRIA 4C5IA 1LVKA 1ABOA 3HSBA 2ENMA 1BU1A 2RQVA 2ZZDA 3A8HB 4KBMB 4PFPA 1LJOA 2A3LA 4M75D 1U1TA 2EJGA 3VJPA 4M78B 3OSVA 3VS2A 3HHTB 4M78A 2F2VA 3ZFJA 5FU7C 3CPWP 1T3SA 2D8HA 4VUBA 4HVUA 3PTAA 5DY9A 1UG1A 1NJIC 1K8AU 4A4GA 3JAME 1IB8A 1KC8R 3H6ZA 2CZ0B 2CS7A 1VQ8Q 1RADB 1RAHB 1I4K1 2EPDA 4KH0B 1X6GA 2VVKA 2KAFA 3CCMA 3CXCP 4JLIA 4ZGEB 1YWPA 1GBQA 4J7IA 1GL5A 2KQWA 2X9HA 1VQ4A 4PJOG 4AG1C 2R58A 1PD0A 3L2RA 1Q7YU 3CMAQ 5CKEA 1VQOQ 4B6MA 4M78E 1VQMA 4D8KA 2I0NA 1X2QA 2RQWA 4AFZC 3UWNA 1VQ8T 4BE2A 4JRQA 3TQ7P 3GNFB 1RAFB 4ELZC 4AFSC 1BIAA 2MIOA 2K57A 2EQJA 1NJIR 2MF2A 3L2QA 1GCPA 5GAN3 1OPLA 2RQRA 1W6XA 3VU3C 1W1FA 4C5GA 1WHJA 4RTTA 1VQ9Q 1KIKA 3OYIA 1VQOT 2KR3A 3PNWC 1UGSB 1FMWA 4RTWA 2KK4A 1V76A 4E2FB 4M7DD 1YITQ 1VQ7Q 2NWMA 4JJCA 3PVLA 3NTIA 2AKKA 1Q82U 1M30A 4Z02A 4C92F 5FW9A 2EGAA 2OTJQ 2DXTA 3G6ET 4HCKA 1WX6A 5GMKh 3H0FA 2DO3A 4F7UF 2FZGB 5A0LA 1U5SA 2MWOA 4IUQA 3OS0A 2Z0WA 3M0SA 1K73U 2OJ2A 1WFWA 3KFVA 1VQ9T 2Y90A 2RB6A 3JCMW 1BI3A 1SEMA 3OYLA 2E41A 1YWOA 5KYUA 4BACA 2YSQA 4DEXA 1RAGB 1WHMA 2CP6A 4C0DC 2PVGB 5GAN5 3VS3A 4XTYA 2KT8A 4CC4B 3HRTA 1VQ7T 2CREA 8ATCB 1K4US 1AEYA 2OTJT 1H3ZA 1BBZA 1VQ5Q 3G4SA 4RTVA 3URGA 1KHCA 2E6NA 3TEEA 2RQTA 2D0QB 4XQ3A 4MMKA 2EYXA 3FRNA 5CO7A 2J06A 3PMTA 4LDYA 4RKUE 4A63B 2CT3A 2RJDA 3CMET 3EGXB 2FEIA 4Q5WA 2GGRA 2DZCA 4FL6A 2XDDA 2DBKA 3I55Q 1YI2A 2RHXA 2DIGA 4OMMA 2L89A 5FLXE 2JS2A 5L23A 2DXCA 5GAMf 3CCSA 5GAOp 1Y71A 4X1VA 2KBTA 1QQJA 1H92A 4LE9A 2ZPHB 1MV3A 4C92A 1VQ5T 4JJDA 4OVAA 4F7UA 2M0OA 1QKWA 3V7RA 3HFOA 1M8VA 2BKDN 2D6FA 4P5NA 3OS2A 2K4YA 1X69A 2KI7A 3LLRA 5J3BA 2V8IA 2QI2A 2QQBA 1SHGA 2RJCA 5GAN2 5I2MA 2NUTB 2ATCB 5FROA 1B34A 3I55T 1X43A 2LJ0A 3TU4K 1LPLA 5FU7B 4PJLA 2BE9B 3VKIA 2SRCA 1FWZA 5D6WA 3QZ9B 2YHTA 4GLMA 3SFMA 3H0HA 3FJPA 2BUDA 4AMCA 3AT1B 2FL7A 3L42A 5DLOA 1NJIU 4HCCA 3OW2S 2LT1A 1X01A 1U8RA 2E6ZA 2EJ9A 2K79A 4XU3A 1VYTA 3UA6A 1WLPB 2EKOA 4N4GA 1EIFA 3H41A 1M1GA 3QDRB 3VS1A 3CMAA 1TSFA 3G71T 1RABB 4J6YA 2YLBA 1M3AA 4FT2A 3KUFA 5CVIA 1QVPA 4M7DB 2LX7A 4OF1A 3QDFA 3E2UA 2CP5A 4ZTJA 1Q86C 3GP8A 5IT9E 5IH2A 2XU8A 3R6OA 1VA7A 1QP3A 3ASKA 2P4TA 1Q81C 1XNIA 3FEOA 1QKXA 2OAWA 5KYYB 2KSSA 2RI3A 3EG3A 2CH4W 2O9VA 2XHCA 3HRSA 3H0IA 1MHNA 4Y92A 1E6GA 3SHWA 4OMLA 4EMKA 2CSIA 4E7JA 2KYMA 2Y4YA 2P4RA 1M1FA 1RL2A 1VIFA 1SHFA 1YITA 3OMCA 1M3BA 2XICA 4FYVB 1BB9A 5LJ3j 5KCOA 4M7AC 5LJ5j 3FC3A 2LZ6B 1YJ9A 3ZEHA 4CC7A 1D1BA 3OYAA 3JCMJ 2WACA 2KVQG 1G3YA 5I21A 3BE3A 4M75G 4D8DA 3M9QA 4FU6A 1YCSB 3FDRA 1WHHA 3EGDB 3SB2A 2H8HA 2QAZA 2DLPA 3NPFA 3I35A 4JLGA 3M58A 1QCFA 1MMNA 1BI1A 2QGGA 1Q95G 4C0DB 1QVGA 3NHNA 4CC3A 2GBQA 1OX8A 3CQTA 4FYYB 1ZLMA 2LCSA 3S6WA 4HT9A 4RTZA 1NLOC 5HKCA 1NE8A 3ZL7C 5C0MA 5A0DA 2K3BA 1AZGB 2F1LA 1UECA 1WYXA 3QJYA 1AWXA 3CCEA 2EWNA 5LJ3g 2K6DA 5LJ5g 2PQWA 1HJDA 4ELYC 2DBMA 2A0FB 5GANj 2JTFA 2EAYA 1U3OA 3CCJQ 2AT1B 1KK7A 1SRLA 3S3NA 1JB0E 2DL8A 2M9UA 4JDSA 3OYFA 1YCYA 1YJWA 4IUTA 3RBBB 1OYXA 4IURA 1I8FA 1X6BA 2DVEA 4DBQA 3L2VA 2DTHA 3RERA 1AZEA 2E5KA 4PJOF 1JO8A 4M78D 1IREB 2ZPBB 2K3XA 3EG9A 1SPKA 3OY9A 1VQ4Q 3OW2P 1NEGA 1R8OB 1K0XA 1G5VA 3QHSA 2DVJA 1D0YA 3M4GA 4GY5A 4FSXA 1TU0B 1FYNA 1QLYA 3RKYA 2LP5A 4M7DG 3NTHA 5KYXB 3M57A 3JCMP 1QVGS 2RPNA 4LUDA 1N8RC 3M0TA 1KQSS 2JMCA 3CCMT 2R5AA 4ZGDB 5GANg 1ZA1B 3E9FA 5GJVB 5GAMj 2FRWA 1QW1A 4QVDA 1RAIB 3OB9A 1VQKA 1VQ4T 2DJZA 4M7AF 3VYHB 1W4SA 3OYCA 4E7HA 4X9DA 2QXFA 1AVZC 3A8OB 5FRMA 4N4IA 3JCMg 3VS4A 1A0NB 4PKCC 2DERA 2QGFB 1S72A 2KY9A 4E47A 2FYKA 5GAN7 4JS5A 3VS0A 1VQ6A 2DZ9A 4ME7A 4PJOA 1MNEA 2DE0X 1IRXA 1PRMC 1ZA2B 2LCCA 3IQLA 5IHIA 1TXQA 3F70A 1Q86U 2GFAA 2M51A 3EFOB 2JOYA 2SEMA 3MKDA 3OQ5A 4BY6C 3QZ5B 1SRMA 3DLLA 3CC4A 1WXBA 3LYIA 3CCLA 3UT1A 2ESWA 3ER0A 4RCCA 2VWFA 3UF4A 2RJEA 2MYSA 4KH1B 4LNPA 4JUVA 2DL7A 4QVZA 2X35A 1Q82R 3A8GB 3G4SQ 1BKBA 3SDZA 2E12A 3H8ZA 2DILA 2OAUA 3BDUA 3OYKA 4GBQA 2EBPA 3QBYA 4M7AB 5A2QE 4XTUA 4ESRA 4Y28E 4M7AA 1OOTA 5I11A 2E10A 2EJFA 4XU2A 5KYWB 3PGGA 3PMIA 3FLGA 4PJOE 4QQ6A 3SWNA 2M1HA 1YI2Q 1FX7A 1M1KR 2DNUA 2YUQA 4BDYA 1KFZA 4C92C 3M0QA 3CCSQ 2D9TA 2L3SA 2HZYA 2KMTA 2K2VA 3R6NA 1X27A 3EG2A 4FIBA 3G4ST 1KG1A 2HD0A 1SKUB 2ZCFB 2DM1A 4F14A 1YIJA 3EGUA 4PJNA 2YXYA 4RTUA 4E7KA 2ZPFB 3FB9A 4DBHA 2GTOA 2X3XD 4RUGA 2COZA 2M16A 5M9OA 1YI2T 4M7AE 3V7SA 2K5LA 3GOXA 1M2OA 1WXUA 3JCMb 3OA6A 3CCST 1KD1R 2YUOA 4C8QG 4JRKA 2BE7D 1ZUUA 2P0PA 3GNGA 4C5EA 5GAMe 3A98A 3NTKA 1OX9A 2P84A 1JJ2A 2CP3A 3CCJA 4DOVA 1M4ZA 2KXCA 4OMOA 5LJ3h 2XD0A 5LJ5h 2D0NA 2OX7A 1V29B 4EMHA 2DIQA 1QVGP 1KQSP 3VRYA 2LDMA 2VXFA 1WHGA 4AT1B 3MEAA 3CCQA 2E5QA 4PFOA 3UA7A 2CKKA 4RCBA 4A4KA 1QVFA 1IGQA 1UGQB 2GQVA 1MV0B 3X24B 4E7LA 1IHWA 1ZUKA 2E64A 1YN8A 2CP0A 3LX7A 4E7IA 3J81E 1OZ3A 3WVDB 4JRIA 1N8RU 2X3WD 2ECZA 2AZVA 4EMKC 5GAOq 3CMAT 2E65A 4Z88A 3RMSA 5C6SA 5CKDA 2JJ9A 1EZZB 3JB9F 1TOVA 2HDAA 5KYNA 2L2PA 2JT4A 3NGPA 5GANh 3G1JA 4FYWB 2VGMA 5CR2A 2YRVA 2X51A 2KNBB 2FPDA 2J05A 2JTEA 4RTYA 3A1PA 2O9SA 2HCKA 1SF9A 4EDUA 1XJWB 1JQQA 2KEAA 1FXXA 3MP8A 1YJ9Q 2X4JA 3RKWA 4TVRA 4M75F 3HPWA 2MPXC 1YNZA 3CD6Q 4OB3B 4A4FA 4LDVA 5KYUB 4ZNXA 3M0UA 3JCMh 2AK5A 2P0KA 2DYIA 2F2XA 1BI0A 1OI1A 4MZMA 1X6OA 5GAN8 1YITT 1M1KU 1UGPB 2F69A 1N9SA 1TTHB 4DQ2A 4RG8A 4L6V5 4M77F 1K76A 1H3HA 1RACB 2IIMA 2PTKA 5IXBA 1YJ9T 2FZKB 1UUEA 1X75C 2AHJB 2DL4A 2V1QA 3CCEQ 2IG0A 2DFUA 2RK1A 4J9EA 4M78G 4LDXA 4JJBA 3VS6A 1OZ2A 4EPCA 1LOJA 4HVWA 1BCOA 3DKMA 3JCMf 1ZBJA 3JCMV 4OB0B 3OYMA 2O88A 3DB3A 1KD1U 1VYVA 4J9BA 4OMQA 5GAOm 2GF7A 4C92B 2DMOA 1B3QA 2KRSA 2XDPA 4F7UB 1YJWQ 1M90C 4PK4A 3V7CA 2HL5C 2YWWA 2ZPGB 4M75A 4DEYA 1VOMA 2HSEB 5KCHA 3CCET 4DOWA 2AKLA 4RG2A 2DEUA 3V8KA 3HKSA 3INZA 4KRTA 2O2OA 2DAQA 1LNXA 1N6AA 4C0ZA 4WTOB 3OBWA 3UDCA 1V1CA 1B34B 1SG5A 2DK3A 2MWPA 4KT0E 1GCQA 1MMAA 1KJWA 1K9MC 2ZAEA 3DLMA 3CC7A 4PLIA 1N9RA 4BE1A 1AWOA 4M77A 1YJWT 1W2BA 2VV5A 1Z9ZA 2DA9A 1EFNA 3MCAB 2EYWA 2EYQA 1PG5B 3J80E 9ATCB 4C92E 1D3BA 1VQKQ 4F7UE 1RAEB 5L8RE 3CBOA 1VQLA 2KDSA 3ZBDA 1OU9A 5D7UA 4J9CA 2ABLA 1M3CA 2M0YA 1GFCA 1UGVA 3VYGA 1D1CA 3OBYA 4E7SA 2XDBA 1K1ZA 5IHNA 4J6WA 3OYBA 1S72Q 2LCLA 3RIRA 1C1AA 2E4HA 4QQGA 1NYGA 3C4SA 3UATA 1FMVA 2FZCB 4M77E 4YTLA 2LX9A 2O4XA 1VQ6Q 4PJOC 2PUKB 2QQAA 1VQKT 1SSFA 2VASA 3X25B 4LD9K 3RMQA 3RESA 2K3YA 3S3OA 1T3LA 2HKQB 1HK9A 3EHRA 4WCIA 2EYZA 5IHKA 2IVWA 3M54A 2DRKA 3OS5A 1JBMA 1RLQC 1NLPC 1PSFA 2FPFA 4JZ4A 3M55A 4EMKB 1UGRB 1WZOA 1HXDA 4N4HA 3CC4Q 3SD4A 2DPPB 2HQHA 3CCLQ 1U1SA 4NS5A 1S72T 2NUPA 4XTWA 1AD5A 3E9GA 1TUCA 1VQ6T 4N0AA 3MO8A 1W2BS 5HK0A 1WJRA 2KT1A 2CZ6B 4LD6A 2QTXA 2EQKA 2EGEA 2KROA 1HSQA 1B7TA 3CD6A 1Q86R 3SWNC 5FWBA 1NM7A 3JB9J 2MMPA 3CC4T 1QP2A 1AT1B 4XAXB 3CCLT 1Q81R 4F16A 3CPWA 2CZ7B 4KGXB 1KSWA 1QWEA 2A36A 4R0KA 1M9SA 4PNOA 4IUPA 4RMOA 3M5AA 1PKTA 2AZSA 2QA4Q 1WHKA 3QUIA 5FU6C 4FYXB 2C0TA 1N27A 5LL6S 2ROTA 1YIJQ 3LGFA 4M7AD 2RD1A 3QPHA 7AT1B 1GXIE 2WSEE 3TSWA 4ZTFA 3CXCA 1H8KA 3OYYA 3LGLA 3I56Q 3P8DA 2HL3A 1MMDA 4C8QF 3HL8A 4MZTA 2VXEA 3MP1A 5CCAA 5LJ3d 2QASA 3BY7A 1YIJT 3QYGB 3M0RA 2W10A 3GIBA 2EW3A 2LQKA 1M90U 4ATOA 3EG9B 2JN0A 2HEQA 1PC0A 2V1RA 5GMKl 5J26A 3CCQQ 5GMKi 4ZN1A 3I9QA 4C0FA 1FMKA 3CCJT 1N8RR 4LN2A 4JPBW 4UC4A 2DRMA 1PSEA 1Q7YC 2XI9A 1D0XA 4DBFA 4J9DA 1K9MU 2RHZA 3EH2A 4FW1A 4Z89A 3VS5A 3G7ZA 2HNIA 2A08A 2LTOA 1G8XA 3CBPA 3E19A 3QXEB 4GLKA 5DM7R 3QWYA 1IGUA 4C8QA 1VQPA 1R0CB 4J83A 5CKHA 1MMGA 3LWIA 3CCQT 1CKAA 2EVRA 2X4YA 2GCXA 4J9HA 2K5IA 1WHLA 2JVVA 2HBPA 3C95A 4BI3A 4ZGJB 1ACMB 1S1NA 2W0ZA 2DYBA 3PFSA 1UHCA 3C0CA 2CUBA 2K9GA 4OMNA 2WSCE 1Y96A 4AFUC 4XTVA 4MDXA 1M8MA 2JM9A 1D0ZA 3X28B 4O6JA 2M02A 2MAMA 1W70A 4PJOB 2VGNA 3N5BB 3JCMd 2BZYA 2XG8D 1PHTA 1YBYA 4HKEA 4C0GA 3CCRQ 2MK5A
chains in the Genus database with same CATH topology
1VQPQ 2OTJQ 3G4SQ 1Q86R 3CCLQ 3CC2Q 1VQ9Q 3CCSQ 1YHQQ 1YIJQ 1W2BP 1VQ6Q 1VQ4Q 3CCJQ 1YJ9Q 1K73R 2OTLQ 3G71Q 3OW2P 1QVFP 1VQNQ 1M1KR 3CXCP 3CPWP 3CD6Q 1Q81R 1VQLQ 3CCQQ 1QVGP 3I55Q 1KD1R 1VQMQ 1KQSP 3CC7Q 1K8AR 1VQ5Q 1NJIR 3CCUQ 1YJNQ 1N8RR 3G6EQ 3I56Q 3CCMQ 1JJ2P 1VQ8Q 1YITQ 1Q7YR 2QA4Q 1VQ7Q 1S72Q 2QEXQ 3CMEQ 1KC8R 1K9MR 1YI2Q 1VQKQ 1Q82R 3CCEQ 1M90R 3CCVQ 1YJWQ 3CMAQ 3CC4Q 1VQOQ 3CCRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP Q;  2OTJ Q;  3G4S Q;  1Q86 R;  3CCL Q;  3CC2 Q;  1VQ9 Q;  3CCS Q;  1YHQ Q;  1YIJ Q;  1W2B P;  1VQ6 Q;  1VQ4 Q;  3CCJ Q;  1YJ9 Q;  1K73 R;  2OTL Q;  3G71 Q;  3OW2 P;  1QVF P;  1VQN Q;  1M1K R;  3CXC P;  3CPW P;  3CD6 Q;  1Q81 R;  1VQL Q;  3CCQ Q;  1QVG P;  3I55 Q;  1KD1 R;  1VQM Q;  1KQS P;  3CC7 Q;  1K8A R;  1VQ5 Q;  1NJI R;  3CCU Q;  1YJN Q;  1N8R R;  3G6E Q;  3I56 Q;  3CCM Q;  1JJ2 P;  1VQ8 Q;  1YIT Q;  1Q7Y R;  2QA4 Q;  1VQ7 Q;  1S72 Q;  2QEX Q;  3CME Q;  1KC8 R;  1K9M R;  1YI2 Q;  1VQK Q;  1Q82 R;  3CCE Q;  1M90 R;  3CCV Q;  1YJW Q;  3CMA Q;  3CC4 Q;  1VQO Q;  3CCR Q; 
#chains in the Genus database with same CATH topology
 2J6O A;  2WSF E;  3EG1 A;  1W2B P;  4BD3 A;  1K73 C;  2D8J A;  3LWH A;  1I81 A;  4O5V A;  5GAM g;  2CP7 A;  2QG9 B;  4C8Q E;  2BTT A;  3CCV A;  1BCM A;  1G3S A;  4Y91 A;  1Q81 U;  1UEB A;  1ZSG A;  4J5Y A;  2CYZ B;  4MML A;  4HT8 A;  1H64 1;  5HK3 A;  3QJ6 A;  3OYD A;  1ZQ1 A;  3WVE B;  4X34 A;  1PKS A;  4XK8 E;  2V8J A;  2KRM A;  1JXM A;  3PIP A;  2DL5 A;  5DLQ E;  2QDL A;  3JSC A;  2DL3 A;  2JTM A;  4ANJ A;  1Y7X A;  2QEX A;  3HP9 A;  1UFF A;  3ULR B;  4JS4 A;  3C12 A;  2FO0 A;  3SWN B;  4QQD A;  2YT6 A;  1NZ9 A;  3EH1 A;  1JRI A;  4OB2 B;  3OYH A;  5CIU A;  1VQN Q;  4OB1 B;  2F5T X;  4M75 C;  2DJQ A;  2QA4 A;  4HCB A;  4OMP A;  4IIO A;  2HQX A;  1PM3 A;  5FU6 B;  2FPE A;  3VUZ A;  1ZBX A;  2Y4X A;  2IPO B;  4MZP A;  3CC2 A;  1QCN A;  1Z9Q A;  5I2S A;  5ECA A;  4R56 A;  3KXT A;  1Y0M A;  1WJS A;  1KC8 C;  5GMK e;  2DXB A;  4XU0 A;  1YP5 A;  4WF2 A;  4J9F A;  5J39 A;  4OP0 A;  2JM8 A;  3JB9 D;  1GCQ C;  4R55 A;  1YHQ Q;  5GAN 6;  5GAO n;  3I56 A;  3PIO A;  1NPP A;  3MHX A;  4CC2 A;  4M77 C;  3CC7 Q;  2KXD A;  5GMK m;  1NPR A;  5GAO l;  2L3R A;  4PL6 A;  1VQN T;  3FIF A;  4J7F A;  4XTZ A;  1KQ1 A;  4C92 D;  1QWF A;  4QKU A;  3CPF A;  1MUZ A;  3A8M B;  1PWT A;  1K0S A;  5CQY A;  5D6Y A;  3MEW A;  4F17 A;  1M5Q 1;  1VQL Q;  2O31 A;  4L59 A;  1YHQ T;  3QII A;  1QCO A;  2K5F A;  2RK2 A;  2VC8 A;  4BI8 B;  2L3P A;  4KUD K;  2YLC A;  2FRY A;  3CC7 T;  3H9N A;  4E7Z A;  5KE2 A;  2QQR A;  4M77 D;  1JEG A;  2PNI A;  5KE3 A;  4X9C A;  3VS7 A;  4B9X A;  2CGH A;  3JCM c;  1E6H A;  3E1S A;  2NUZ A;  4QVC A;  3REB B;  2E3I A;  1VUB A;  3D7S B;  2LT4 A;  1VQL T;  2JW4 A;  1NBE B;  2OI3 A;  2ZPI B;  4BB7 A;  1TUG B;  5LJ3 f;  2K7A A;  4LDW A;  5LJ5 f;  4M7D C;  1GBR A;  1TUD A;  1KQ2 A;  3KBG A;  1IXD A;  1I5O B;  3BDL A;  1WI7 A;  2L0A A;  4J9G A;  2KE9 A;  2A7Y A;  2RO0 A;  2D1X A;  2X4X A;  3G6E Q;  3TVT A;  5KH6 A;  1C0M A;  4N0A C;  3QWX X;  3HTR A;  3VUB A;  4HCZ A;  4HVV A;  2J6K A;  2EQI A;  3J7A F;  3QSU A;  1G2B A;  2RJF A;  1JJ2 S;  4M7A G;  1ZSZ C;  2FG0 A;  3Q1J A;  2L8D A;  1XOV A;  2LNH B;  1NYF A;  2GFU A;  1DJ7 B;  1JU5 C;  2RNA A;  3CCR A;  3O5Z A;  2A28 A;  3GLX A;  2MI6 A;  3M4Y A;  2DTO A;  2JMA A;  2X4W A;  2LMJ A;  2EIF A;  4BY6 B;  1K9A A;  3GBQ A;  1YJN A;  2RA2 A;  4EIK A;  3A8L B;  1AOJ A;  3UPU A;  1T0H A;  3WXM B;  3TCJ A;  1PRL C;  1RUW A;  3U23 A;  4BUG A;  1B07 A;  5GAN f;  4LDU A;  2P0Q A;  3RKX A;  3JRZ A;  1U06 A;  2BIV A;  4PFZ A;  3CD6 T;  5GAM h;  1QVF S;  3EAE A;  3CME Q;  5D6X A;  3M59 A;  6AT1 B;  3QYH B;  5FWC A;  4FT4 A;  1BIB A;  1OU8 A;  5AT1 B;  4J6X A;  3MET A;  2OTL Q;  2HAX A;  3OW2 A;  1RI0 A;  3VRZ A;  3MPU B;  4KGV B;  2ROL A;  2EQU A;  1XQH A;  3QO3 A;  1MND A;  2KGT A;  3T9N A;  1WA7 A;  2ZGW A;  1VQN A;  1UDL A;  2I2L A;  2ED0 A;  3OS1 A;  4QW2 A;  2COY A;  4M75 B;  2VKN A;  1UTI A;  2O01 E;  4A54 A;  5I22 A;  3TRE A;  3EGX A;  5GAO r;  3BW1 A;  4E6R A;  1R77 A;  2OTL T;  2CSQ A;  1M2V B;  1YHQ A;  4L5G A;  4IUU A;  1M2V A;  3FJ5 A;  2RHU A;  1N5Z A;  2QQ9 A;  4F04 B;  1KC8 U;  2XK0 A;  1TG0 A;  4M7D F;  1G3W A;  2C0I A;  3JCM X;  4M77 B;  3QKJ A;  4HA8 A;  1QMC A;  1JXO A;  3LH0 A;  2EQM A;  2F5K A;  1WJQ A;  4PJJ A;  4JJN K;  3OYJ A;  1D3B B;  2NUT A;  4C8Q C;  4FSS A;  4A53 A;  1Y07 A;  1M90 R;  1UB4 A;  1VQP Q;  2HSP A;  1WQ7 A;  4M75 E;  3O8V A;  2QDY B;  2KRN A;  1IO6 A;  3L2Z A;  3G71 Q;  4HXJ A;  3OMG A;  3ME9 A;  2E1H A;  2MOX A;  4CI0 C;  3P8H A;  1WQW A;  3RUX A;  1VQ8 A;  4KGZ B;  1AHJ B;  1K9M R;  1UE9 A;  3GF5 A;  2C0O A;  4A4H A;  2J7I A;  2O4X B;  3MEV A;  3PVQ A;  5CKB A;  3RR6 A;  2HMA A;  3CEY A;  4JRP A;  2FHD A;  1VQP T;  1NG2 A;  1OV3 A;  4C8Q D;  2VYT A;  2YRD A;  3REA B;  1VQO A;  5FRN A;  2CDT A;  4NL3 A;  3CCU Q;  2BZX A;  2XMF A;  2EKH A;  2RQU A;  1JJ2 P;  1ZHI A;  3M56 A;  2PU9 B;  4DBR A;  2A37 A;  2PVD B;  3I5S A;  2DD4 A;  4M7D A;  2G6F X;  2H3J A;  3CCV Q;  1WDX A;  4A4E A;  1KHI A;  2PVO B;  2NUP B;  4ORZ A;  2HQE A;  1AWW A;  2KYB A;  2HKN A;  3G6E A;  1IHV A;  5HCK A;  5AYF A;  2DXU A;  3GPL A;  1WIE A;  2F2W A;  2GQI A;  5KYY A;  1VQ9 A;  3PT9 A;  3MJX A;  4LXC A;  4PJO D;  2PUO B;  3HFN A;  2E70 A;  4XTX A;  2QEX Q;  3L2W A;  2CT4 A;  2LRQ A;  5CQX A;  3CCU T;  1ZSZ B;  1HYO A;  2QK0 A;  1ZX6 A;  5IAY A;  1PD1 A;  1ZSZ A;  1TH7 A;  3JB9 G;  5CAI A;  1F1B B;  3CCV T;  1QVF P;  1VQ7 A;  2L5Q A;  1G83 A;  1P92 A;  1I07 A;  2RI5 A;  2C06 A;  1LCK A;  2DF6 A;  2V26 A;  2OTJ A;  1O75 A;  5EC7 A;  3HRU A;  1M27 C;  4C92 G;  1OEB A;  4M7D E;  1SSH A;  1C6V X;  4FW2 A;  2V8K A;  4F7U G;  3CBM A;  1OPK A;  3CC2 Q;  3A5Z B;  2LJ3 A;  1I5L A;  2LQN A;  2CH4 A;  2COW A;  2QEX T;  1GFD A;  3EG0 A;  4B9W A;  3EGD A;  4J9I A;  3CME A;  1TS9 A;  2YDL A;  2R5M A;  3X26 B;  1KQS A;  2EYY A;  1NEB A;  4M4Z A;  4V2S A;  1D09 B;  2G3R A;  4J8O A;  4ZN3 A;  4BE0 A;  2OTL A;  3X20 B;  2JS0 A;  3EFR A;  2EGC A;  2FVU A;  4M77 G;  1VQ5 A;  2CP2 A;  2QA4 T;  3M53 A;  2DEQ A;  2FB7 A;  1PCX A;  4IUV A;  1WPY A;  3RDV A;  3CC2 T;  1CKB A;  4M78 C;  4OGE A;  5LJ5 d;  1BYM A;  4Z8A A;  1X2K A;  3EHQ A;  1K8A C;  4AG2 C;  3NMZ C;  2RM4 A;  1YFN A;  3I55 A;  2XID A;  3I56 T;  1BK2 A;  2JZ2 A;  4JZ3 A;  5GJW B;  3V8J A;  2CZ1 B;  2R57 A;  4OGC A;  1UJY A;  1WNL A;  3DB4 A;  2LVM A;  3OYE A;  2VUB A;  2JUF A;  2RF0 A;  3MP6 A;  3LW5 E;  5GMK j;  1VIE A;  2LQ8 A;  2HBW A;  3CCM Q;  2DTI A;  1D1A A;  3SEM A;  5A0G A;  3VV0 A;  3CPW S;  1ABQ A;  4OMF B;  2DET A;  2DD5 A;  2NLU A;  3RNJ A;  3NFC A;  2GNC A;  1HD3 A;  2RHY A;  4EMG A;  1VQM Q;  4C8Q B;  1K8A R;  2CUD A;  2VB6 A;  2RHI A;  4RTX A;  3PE0 A;  4KUL A;  2YRC A;  5EG2 A;  4DA4 A;  5KYX A;  4FM4 B;  5GAN d;  3P8B B;  3CXC S;  1ZUY A;  3G71 A;  1OUL A;  2XKO C;  4D6W A;  4K11 A;  2K2M A;  4QT7 A;  4XU1 A;  3JV3 A;  1XTD A;  4LUE A;  1Y96 B;  1TWB A;  3I5R A;  1OQK A;  2RN8 A;  5CKF A;  4PJM A;  1MGQ A;  3LH5 A;  1Q7Y R;  2DKG A;  1VQM T;  5LJ3 e;  2B8A A;  1Q82 C;  5LJ5 e;  3C94 A;  2AIR B;  1CSK A;  1PNJ A;  3CCU A;  2YUN A;  3OYG A;  1UHF A;  3S3M A;  3AHU A;  2B86 A;  1BI2 A;  2L3Q A;  3EFS A;  3QG1 A;  2ED1 A;  1ARK A;  3BFM A;  8AT1 B;  1O9S A;  1RI9 A;  1YJN Q;  5IN1 A;  2LNV A;  3V8L A;  1R0B G;  3JB9 H;  3MEU A;  5GAN 4;  2RH2 A;  4C5H A;  4FCY A;  1E7O A;  1RLP C;  5GAM d;  4KUI A;  1M1K C;  1I1J A;  1GRI A;  2NYS A;  2QTV A;  2EFI A;  3EFO A;  3CCR T;  4M78 F;  2JXB A;  1J3T A;  2H3E B;  2LQW A;  1G3T A;  2RMO A;  4BI4 A;  1T0J A;  3TSZ A;  1UJ0 A;  2RI2 A;  1AWJ A;  2PZ1 A;  4AFQ C;  2LC4 A;  2E3H A;  1YJN T;  3JB9 I;  4NOY A;  5IXF A;  2QQS A;  1K73 R;  2MCN A;  4BDZ A;  1I0C A;  3L2U A;  3JCM Q;  2YUP A;  5GAN e;  5CK9 A;  1KD1 C;  3OYN A;  2ZPE B;  4MDW A;  1IZ6 A;  4II1 A;  5KYW A;  2DX1 A;  1RAA B;  1Y57 A;  2JNG A;  1WXT A;  1EX4 A;  4NL2 A;  2J6F A;  5HY6 A;  4IIM A;  1WGS A;  3OSS C;  2QYZ A;  4PLL A;  4IKF A;  2LJ1 A;  3M0P A;  3THK A;  2BZ8 A;  3L1A A;  3JCM e;  1VYU A;  2GTJ A;  4CRI A;  4C5I A;  1LVK A;  1ABO A;  3HSB A;  2ENM A;  1BU1 A;  2RQV A;  2ZZD A;  3A8H B;  4KBM B;  4PFP A;  1LJO A;  2A3L A;  4M75 D;  1U1T A;  2EJG A;  3VJP A;  4M78 B;  3OSV A;  3VS2 A;  3HHT B;  4M78 A;  2F2V A;  3ZFJ A;  5FU7 C;  3CPW P;  1T3S A;  2D8H A;  4VUB A;  4HVU A;  3PTA A;  5DY9 A;  1UG1 A;  1NJI C;  1K8A U;  4A4G A;  3JAM E;  1IB8 A;  1KC8 R;  3H6Z A;  2CZ0 B;  2CS7 A;  1VQ8 Q;  1RAD B;  1RAH B;  1I4K 1;  2EPD A;  4KH0 B;  1X6G A;  2VVK A;  2KAF A;  3CCM A;  3CXC P;  4JLI A;  4ZGE B;  1YWP A;  1GBQ A;  4J7I A;  1GL5 A;  2KQW A;  2X9H A;  1VQ4 A;  4PJO G;  4AG1 C;  2R58 A;  1PD0 A;  3L2R A;  1Q7Y U;  3CMA Q;  5CKE A;  1VQO Q;  4B6M A;  4M78 E;  1VQM A;  4D8K A;  2I0N A;  1X2Q A;  2RQW A;  4AFZ C;  3UWN A;  1VQ8 T;  4BE2 A;  4JRQ A;  3TQ7 P;  3GNF B;  1RAF B;  4ELZ C;  4AFS C;  1BIA A;  2MIO A;  2K57 A;  2EQJ A;  1NJI R;  2MF2 A;  3L2Q A;  1GCP A;  5GAN 3;  1OPL A;  2RQR A;  1W6X A;  3VU3 C;  1W1F A;  4C5G A;  1WHJ A;  4RTT A;  1VQ9 Q;  1KIK A;  3OYI A;  1VQO T;  2KR3 A;  3PNW C;  1UGS B;  1FMW A;  4RTW A;  2KK4 A;  1V76 A;  4E2F B;  4M7D D;  1YIT Q;  1VQ7 Q;  2NWM A;  4JJC A;  3PVL A;  3NTI A;  2AKK A;  1Q82 U;  1M30 A;  4Z02 A;  4C92 F;  5FW9 A;  2EGA A;  2OTJ Q;  2DXT A;  3G6E T;  4HCK A;  1WX6 A;  5GMK h;  3H0F A;  2DO3 A;  4F7U F;  2FZG B;  5A0L A;  1U5S A;  2MWO A;  4IUQ A;  3OS0 A;  2Z0W A;  3M0S A;  1K73 U;  2OJ2 A;  1WFW A;  3KFV A;  1VQ9 T;  2Y90 A;  2RB6 A;  3JCM W;  1BI3 A;  1SEM A;  3OYL A;  2E41 A;  1YWO A;  5KYU A;  4BAC A;  2YSQ A;  4DEX A;  1RAG B;  1WHM A;  2CP6 A;  4C0D C;  2PVG B;  5GAN 5;  3VS3 A;  4XTY A;  2KT8 A;  4CC4 B;  3HRT A;  1VQ7 T;  2CRE A;  8ATC B;  1K4U S;  1AEY A;  2OTJ T;  1H3Z A;  1BBZ A;  1VQ5 Q;  3G4S A;  4RTV A;  3URG A;  1KHC A;  2E6N A;  3TEE A;  2RQT A;  2D0Q B;  4XQ3 A;  4MMK A;  2EYX A;  3FRN A;  5CO7 A;  2J06 A;  3PMT A;  4LDY A;  4RKU E;  4A63 B;  2CT3 A;  2RJD A;  3CME T;  3EGX B;  2FEI A;  4Q5W A;  2GGR A;  2DZC A;  4FL6 A;  2XDD A;  2DBK A;  3I55 Q;  1YI2 A;  2RHX A;  2DIG A;  4OMM A;  2L89 A;  5FLX E;  2JS2 A;  5L23 A;  2DXC A;  5GAM f;  3CCS A;  5GAO p;  1Y71 A;  4X1V A;  2KBT A;  1QQJ A;  1H92 A;  4LE9 A;  2ZPH B;  1MV3 A;  4C92 A;  1VQ5 T;  4JJD A;  4OVA A;  4F7U A;  2M0O A;  1QKW A;  3V7R A;  3HFO A;  1M8V A;  2BKD N;  2D6F A;  4P5N A;  3OS2 A;  2K4Y A;  1X69 A;  2KI7 A;  3LLR A;  5J3B A;  2V8I A;  2QI2 A;  2QQB A;  1SHG A;  2RJC A;  5GAN 2;  5I2M A;  2NUT B;  2ATC B;  5FRO A;  1B34 A;  3I55 T;  1X43 A;  2LJ0 A;  3TU4 K;  1LPL A;  5FU7 B;  4PJL A;  2BE9 B;  3VKI A;  2SRC A;  1FWZ A;  5D6W A;  3QZ9 B;  2YHT A;  4GLM A;  3SFM A;  3H0H A;  3FJP A;  2BUD A;  4AMC A;  3AT1 B;  2FL7 A;  3L42 A;  5DLO A;  1NJI U;  4HCC A;  3OW2 S;  2LT1 A;  1X01 A;  1U8R A;  2E6Z A;  2EJ9 A;  2K79 A;  4XU3 A;  1VYT A;  3UA6 A;  1WLP B;  2EKO A;  4N4G A;  1EIF A;  3H41 A;  1M1G A;  3QDR B;  3VS1 A;  3CMA A;  1TSF A;  3G71 T;  1RAB B;  4J6Y A;  2YLB A;  1M3A A;  4FT2 A;  3KUF A;  5CVI A;  1QVP A;  4M7D B;  2LX7 A;  4OF1 A;  3QDF A;  3E2U A;  2CP5 A;  4ZTJ A;  1Q86 C;  3GP8 A;  5IT9 E;  5IH2 A;  2XU8 A;  3R6O A;  1VA7 A;  1QP3 A;  3ASK A;  2P4T A;  1Q81 C;  1XNI A;  3FEO A;  1QKX A;  2OAW A;  5KYY B;  2KSS A;  2RI3 A;  3EG3 A;  2CH4 W;  2O9V A;  2XHC A;  3HRS A;  3H0I A;  1MHN A;  4Y92 A;  1E6G A;  3SHW A;  4OML A;  4EMK A;  2CSI A;  4E7J A;  2KYM A;  2Y4Y A;  2P4R A;  1M1F A;  1RL2 A;  1VIF A;  1SHF A;  1YIT A;  3OMC A;  1M3B A;  2XIC A;  4FYV B;  1BB9 A;  5LJ3 j;  5KCO A;  4M7A C;  5LJ5 j;  3FC3 A;  2LZ6 B;  1YJ9 A;  3ZEH A;  4CC7 A;  1D1B A;  3OYA A;  3JCM J;  2WAC A;  2KVQ G;  1G3Y A;  5I21 A;  3BE3 A;  4M75 G;  4D8D A;  3M9Q A;  4FU6 A;  1YCS B;  3FDR A;  1WHH A;  3EGD B;  3SB2 A;  2H8H A;  2QAZ A;  2DLP A;  3NPF A;  3I35 A;  4JLG A;  3M58 A;  1QCF A;  1MMN A;  1BI1 A;  2QGG A;  1Q95 G;  4C0D B;  1QVG A;  3NHN A;  4CC3 A;  2GBQ A;  1OX8 A;  3CQT A;  4FYY B;  1ZLM A;  2LCS A;  3S6W A;  4HT9 A;  4RTZ A;  1NLO C;  5HKC A;  1NE8 A;  3ZL7 C;  5C0M A;  5A0D A;  2K3B A;  1AZG B;  2F1L A;  1UEC A;  1WYX A;  3QJY A;  1AWX A;  3CCE A;  2EWN A;  5LJ3 g;  2K6D A;  5LJ5 g;  2PQW A;  1HJD A;  4ELY C;  2DBM A;  2A0F B;  5GAN j;  2JTF A;  2EAY A;  1U3O A;  3CCJ Q;  2AT1 B;  1KK7 A;  1SRL A;  3S3N A;  1JB0 E;  2DL8 A;  2M9U A;  4JDS A;  3OYF A;  1YCY A;  1YJW A;  4IUT A;  3RBB B;  1OYX A;  4IUR A;  1I8F A;  1X6B A;  2DVE A;  4DBQ A;  3L2V A;  2DTH A;  3RER A;  1AZE A;  2E5K A;  4PJO F;  1JO8 A;  4M78 D;  1IRE B;  2ZPB B;  2K3X A;  3EG9 A;  1SPK A;  3OY9 A;  1VQ4 Q;  3OW2 P;  1NEG A;  1R8O B;  1K0X A;  1G5V A;  3QHS A;  2DVJ A;  1D0Y A;  3M4G A;  4GY5 A;  4FSX A;  1TU0 B;  1FYN A;  1QLY A;  3RKY A;  2LP5 A;  4M7D G;  3NTH A;  5KYX B;  3M57 A;  3JCM P;  1QVG S;  2RPN A;  4LUD A;  1N8R C;  3M0T A;  1KQS S;  2JMC A;  3CCM T;  2R5A A;  4ZGD B;  5GAN g;  1ZA1 B;  3E9F A;  5GJV B;  5GAM j;  2FRW A;  1QW1 A;  4QVD A;  1RAI B;  3OB9 A;  1VQK A;  1VQ4 T;  2DJZ A;  4M7A F;  3VYH B;  1W4S A;  3OYC A;  4E7H A;  4X9D A;  2QXF A;  1AVZ C;  3A8O B;  5FRM A;  4N4I A;  3JCM g;  3VS4 A;  1A0N B;  4PKC C;  2DER A;  2QGF B;  1S72 A;  2KY9 A;  4E47 A;  2FYK A;  5GAN 7;  4JS5 A;  3VS0 A;  1VQ6 A;  2DZ9 A;  4ME7 A;  4PJO A;  1MNE A;  2DE0 X;  1IRX A;  1PRM C;  1ZA2 B;  2LCC A;  3IQL A;  5IHI A;  1TXQ A;  3F70 A;  1Q86 U;  2GFA A;  2M51 A;  3EFO B;  2JOY A;  2SEM A;  3MKD A;  3OQ5 A;  4BY6 C;  3QZ5 B;  1SRM A;  3DLL A;  3CC4 A;  1WXB A;  3LYI A;  3CCL A;  3UT1 A;  2ESW A;  3ER0 A;  4RCC A;  2VWF A;  3UF4 A;  2RJE A;  2MYS A;  4KH1 B;  4LNP A;  4JUV A;  2DL7 A;  4QVZ A;  2X35 A;  1Q82 R;  3A8G B;  3G4S Q;  1BKB A;  3SDZ A;  2E12 A;  3H8Z A;  2DIL A;  2OAU A;  3BDU A;  3OYK A;  4GBQ A;  2EBP A;  3QBY A;  4M7A B;  5A2Q E;  4XTU A;  4ESR A;  4Y28 E;  4M7A A;  1OOT A;  5I11 A;  2E10 A;  2EJF A;  4XU2 A;  5KYW B;  3PGG A;  3PMI A;  3FLG A;  4PJO E;  4QQ6 A;  3SWN A;  2M1H A;  1YI2 Q;  1FX7 A;  1M1K R;  2DNU A;  2YUQ A;  4BDY A;  1KFZ A;  4C92 C;  3M0Q A;  3CCS Q;  2D9T A;  2L3S A;  2HZY A;  2KMT A;  2K2V A;  3R6N A;  1X27 A;  3EG2 A;  4FIB A;  3G4S T;  1KG1 A;  2HD0 A;  1SKU B;  2ZCF B;  2DM1 A;  4F14 A;  1YIJ A;  3EGU A;  4PJN A;  2YXY A;  4RTU A;  4E7K A;  2ZPF B;  3FB9 A;  4DBH A;  2GTO A;  2X3X D;  4RUG A;  2COZ A;  2M16 A;  5M9O A;  1YI2 T;  4M7A E;  3V7S A;  2K5L A;  3GOX A;  1M2O A;  1WXU A;  3JCM b;  3OA6 A;  3CCS T;  1KD1 R;  2YUO A;  4C8Q G;  4JRK A;  2BE7 D;  1ZUU A;  2P0P A;  3GNG A;  4C5E A;  5GAM e;  3A98 A;  3NTK A;  1OX9 A;  2P84 A;  1JJ2 A;  2CP3 A;  3CCJ A;  4DOV A;  1M4Z A;  2KXC A;  4OMO A;  5LJ3 h;  2XD0 A;  5LJ5 h;  2D0N A;  2OX7 A;  1V29 B;  4EMH A;  2DIQ A;  1QVG P;  1KQS P;  3VRY A;  2LDM A;  2VXF A;  1WHG A;  4AT1 B;  3MEA A;  3CCQ A;  2E5Q A;  4PFO A;  3UA7 A;  2CKK A;  4RCB A;  4A4K A;  1QVF A;  1IGQ A;  1UGQ B;  2GQV A;  1MV0 B;  3X24 B;  4E7L A;  1IHW A;  1ZUK A;  2E64 A;  1YN8 A;  2CP0 A;  3LX7 A;  4E7I A;  3J81 E;  1OZ3 A;  3WVD B;  4JRI A;  1N8R U;  2X3W D;  2ECZ A;  2AZV A;  4EMK C;  5GAO q;  3CMA T;  2E65 A;  4Z88 A;  3RMS A;  5C6S A;  5CKD A;  2JJ9 A;  1EZZ B;  3JB9 F;  1TOV A;  2HDA A;  5KYN A;  2L2P A;  2JT4 A;  3NGP A;  5GAN h;  3G1J A;  4FYW B;  2VGM A;  5CR2 A;  2YRV A;  2X51 A;  2KNB B;  2FPD A;  2J05 A;  2JTE A;  4RTY A;  3A1P A;  2O9S A;  2HCK A;  1SF9 A;  4EDU A;  1XJW B;  1JQQ A;  2KEA A;  1FXX A;  3MP8 A;  1YJ9 Q;  2X4J A;  3RKW A;  4TVR A;  4M75 F;  3HPW A;  2MPX C;  1YNZ A;  3CD6 Q;  4OB3 B;  4A4F A;  4LDV A;  5KYU B;  4ZNX A;  3M0U A;  3JCM h;  2AK5 A;  2P0K A;  2DYI A;  2F2X A;  1BI0 A;  1OI1 A;  4MZM A;  1X6O A;  5GAN 8;  1YIT T;  1M1K U;  1UGP B;  2F69 A;  1N9S A;  1TTH B;  4DQ2 A;  4RG8 A;  4L6V 5;  4M77 F;  1K76 A;  1H3H A;  1RAC B;  2IIM A;  2PTK A;  5IXB A;  1YJ9 T;  2FZK B;  1UUE A;  1X75 C;  2AHJ B;  2DL4 A;  2V1Q A;  3CCE Q;  2IG0 A;  2DFU A;  2RK1 A;  4J9E A;  4M78 G;  4LDX A;  4JJB A;  3VS6 A;  1OZ2 A;  4EPC A;  1LOJ A;  4HVW A;  1BCO A;  3DKM A;  3JCM f;  1ZBJ A;  3JCM V;  4OB0 B;  3OYM A;  2O88 A;  3DB3 A;  1KD1 U;  1VYV A;  4J9B A;  4OMQ A;  5GAO m;  2GF7 A;  4C92 B;  2DMO A;  1B3Q A;  2KRS A;  2XDP A;  4F7U B;  1YJW Q;  1M90 C;  4PK4 A;  3V7C A;  2HL5 C;  2YWW A;  2ZPG B;  4M75 A;  4DEY A;  1VOM A;  2HSE B;  5KCH A;  3CCE T;  4DOW A;  2AKL A;  4RG2 A;  2DEU A;  3V8K A;  3HKS A;  3INZ A;  4KRT A;  2O2O A;  2DAQ A;  1LNX A;  1N6A A;  4C0Z A;  4WTO B;  3OBW A;  3UDC A;  1V1C A;  1B34 B;  1SG5 A;  2DK3 A;  2MWP A;  4KT0 E;  1GCQ A;  1MMA A;  1KJW A;  1K9M C;  2ZAE A;  3DLM A;  3CC7 A;  4PLI A;  1N9R A;  4BE1 A;  1AWO A;  4M77 A;  1YJW T;  1W2B A;  2VV5 A;  1Z9Z A;  2DA9 A;  1EFN A;  3MCA B;  2EYW A;  2EYQ A;  1PG5 B;  3J80 E;  9ATC B;  4C92 E;  1D3B A;  1VQK Q;  4F7U E;  1RAE B;  5L8R E;  3CBO A;  1VQL A;  2KDS A;  3ZBD A;  1OU9 A;  5D7U A;  4J9C A;  2ABL A;  1M3C A;  2M0Y A;  1GFC A;  1UGV A;  3VYG A;  1D1C A;  3OBY A;  4E7S A;  2XDB A;  1K1Z A;  5IHN A;  4J6W A;  3OYB A;  1S72 Q;  2LCL A;  3RIR A;  1C1A A;  2E4H A;  4QQG A;  1NYG A;  3C4S A;  3UAT A;  1FMV A;  2FZC B;  4M77 E;  4YTL A;  2LX9 A;  2O4X A;  1VQ6 Q;  4PJO C;  2PUK B;  2QQA A;  1VQK T;  1SSF A;  2VAS A;  3X25 B;  4LD9 K;  3RMQ A;  3RES A;  2K3Y A;  3S3O A;  1T3L A;  2HKQ B;  1HK9 A;  3EHR A;  4WCI A;  2EYZ A;  5IHK A;  2IVW A;  3M54 A;  2DRK A;  3OS5 A;  1JBM A;  1RLQ C;  1NLP C;  1PSF A;  2FPF A;  4JZ4 A;  3M55 A;  4EMK B;  1UGR B;  1WZO A;  1HXD A;  4N4H A;  3CC4 Q;  3SD4 A;  2DPP B;  2HQH A;  3CCL Q;  1U1S A;  4NS5 A;  1S72 T;  2NUP A;  4XTW A;  1AD5 A;  3E9G A;  1TUC A;  1VQ6 T;  4N0A A;  3MO8 A;  1W2B S;  5HK0 A;  1WJR A;  2KT1 A;  2CZ6 B;  4LD6 A;  2QTX A;  2EQK A;  2EGE A;  2KRO A;  1HSQ A;  1B7T A;  3CD6 A;  1Q86 R;  3SWN C;  5FWB A;  1NM7 A;  3JB9 J;  2MMP A;  3CC4 T;  1QP2 A;  1AT1 B;  4XAX B;  3CCL T;  1Q81 R;  4F16 A;  3CPW A;  2CZ7 B;  4KGX B;  1KSW A;  1QWE A;  2A36 A;  4R0K A;  1M9S A;  4PNO A;  4IUP A;  4RMO A;  3M5A A;  1PKT A;  2AZS A;  2QA4 Q;  1WHK A;  3QUI A;  5FU6 C;  4FYX B;  2C0T A;  1N27 A;  5LL6 S;  2ROT A;  1YIJ Q;  3LGF A;  4M7A D;  2RD1 A;  3QPH A;  7AT1 B;  1GXI E;  2WSE E;  3TSW A;  4ZTF A;  3CXC A;  1H8K A;  3OYY A;  3LGL A;  3I56 Q;  3P8D A;  2HL3 A;  1MMD A;  4C8Q F;  3HL8 A;  4MZT A;  2VXE A;  3MP1 A;  5CCA A;  5LJ3 d;  2QAS A;  3BY7 A;  1YIJ T;  3QYG B;  3M0R A;  2W10 A;  3GIB A;  2EW3 A;  2LQK A;  1M90 U;  4ATO A;  3EG9 B;  2JN0 A;  2HEQ A;  1PC0 A;  2V1R A;  5GMK l;  5J26 A;  3CCQ Q;  5GMK i;  4ZN1 A;  3I9Q A;  4C0F A;  1FMK A;  3CCJ T;  1N8R R;  4LN2 A;  4JPB W;  4UC4 A;  2DRM A;  1PSE A;  1Q7Y C;  2XI9 A;  1D0X A;  4DBF A;  4J9D A;  1K9M U;  2RHZ A;  3EH2 A;  4FW1 A;  4Z89 A;  3VS5 A;  3G7Z A;  2HNI A;  2A08 A;  2LTO A;  1G8X A;  3CBP A;  3E19 A;  3QXE B;  4GLK A;  5DM7 R;  3QWY A;  1IGU A;  4C8Q A;  1VQP A;  1R0C B;  4J83 A;  5CKH A;  1MMG A;  3LWI A;  3CCQ T;  1CKA A;  2EVR A;  2X4Y A;  2GCX A;  4J9H A;  2K5I A;  1WHL A;  2JVV A;  2HBP A;  3C95 A;  4BI3 A;  4ZGJ B;  1ACM B;  1S1N A;  2W0Z A;  2DYB A;  3PFS A;  1UHC A;  3C0C A;  2CUB A;  2K9G A;  4OMN A;  2WSC E;  1Y96 A;  4AFU C;  4XTV A;  4MDX A;  1M8M A;  2JM9 A;  1D0Z A;  3X28 B;  4O6J A;  2M02 A;  2MAM A;  1W70 A;  4PJO B;  2VGN A;  3N5B B;  3JCM d;  2BZY A;  2XG8 D;  1PHT A;  1YBY A;  4HKE A;  4C0G A;  3CCR Q;  2MK5 A; 
#chains in the Genus database with same CATH homology
 1VQP Q;  2OTJ Q;  3G4S Q;  1Q86 R;  3CCL Q;  3CC2 Q;  1VQ9 Q;  3CCS Q;  1YHQ Q;  1YIJ Q;  1W2B P;  1VQ6 Q;  1VQ4 Q;  3CCJ Q;  1YJ9 Q;  1K73 R;  2OTL Q;  3G71 Q;  3OW2 P;  1QVF P;  1VQN Q;  1M1K R;  3CXC P;  3CPW P;  3CD6 Q;  1Q81 R;  1VQL Q;  3CCQ Q;  1QVG P;  3I55 Q;  1KD1 R;  1VQM Q;  1KQS P;  3CC7 Q;  1K8A R;  1VQ5 Q;  1NJI R;  3CCU Q;  1YJN Q;  1N8R R;  3G6E Q;  3I56 Q;  3CCM Q;  1JJ2 P;  1VQ8 Q;  1YIT Q;  1Q7Y R;  2QA4 Q;  1VQ7 Q;  1S72 Q;  2QEX Q;  3CME Q;  1KC8 R;  1K9M R;  1YI2 Q;  1VQK Q;  1Q82 R;  3CCE Q;  1M90 R;  3CCV Q;  1YJW Q;  3CMA Q;  3CC4 Q;  1VQO Q;  3CCR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...