1KC8R

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kc8R00
1KD1R 1QVFP 1QVGP 3CPWP 1YHQQ 1VQPQ 1VQ8Q 1VQMQ 1Q86R 3CCVQ 3CCQQ 3G6EQ 1S72Q 3CC7Q 1Q81R 1YIJQ 1KC8R 1VQ5Q 3CCMQ 3CCEQ 1NJIR 1VQNQ 1YJWQ 3CC4Q 1YJ9Q 1N8RR 1VQKQ 1VQ6Q 3CD6Q 3G71Q 1VQ7Q 2QA4Q 3CCUQ 3CMEQ 2QEXQ 1YJNQ 3CXCP 1Q7YR 3CCJQ 1K9MR 1Q82R 1M1KR 1K73R 1VQ4Q 3CC2Q 1JJ2P 3OW2P 2OTLQ 1M90R 3CMAQ 3I55Q 3CCSQ 1YI2Q 1K8AR 3CCLQ 1VQ9Q 3G4SQ 1VQOQ 1W2BP 3CCRQ 3I56Q 1VQLQ 2OTJQ 1KQSP 1YITQ
chains in the Genus database with same CATH superfamily
3M5AA 3CD6A 2CKKA 2F1LA 4DEXA 4OF1A 4QQDA 3V7SA 5AT1B 3QKJA 2ED0A 2HBWA 1HSQA 3TEEA 3CXCA 4PJJA 2CP3A 5CKDA 3RNJA 4JLIA 3HSBA 3SHWA 1X2KA 2FEIA 2ZZDA 4IUUA 1VQOQ 1YIJA 2HMAA 4F7UF 1Y7XA 4AG2C 3CCVT 1RAAB 4PJOB 1R77A 2EYXA 2YT6A 3CMET 4JZ4A 4M77G 2ED1A 4LDYA 3TREA 4ESRA 1HJDA 4J9GA 1R0BG 5LL6S 3TVTA 1M1KU 3NGPA 3EG9B 3OA6A 1ZBXA 4M7AG 1GBRA 2RQVA 3EGXB 3HHTB 2K2MA 4AFZC 1OPLA 2FZKB 3LX7A 3J7AF 2QQ9A 2CP2A 2DM1A 3S6WA 2KRNA 2OTLT 3EAEA 4HA8A 1JJ2P 4ZTJA 4C8QA 2EYWA 2VWFA 2E70A 1RAGB 3QDRB 2RNAA 3PIOA 1Y57A 2RB6A 5LJ3d 3KFVA 1X69A 4X34A 4Z88A 4EDUA 1Y96A 4HT9A 3WVDB 3EH2A 1ZSZC 1WPYA 4OGEA 3SWNA 2COYA 4Z89A 1UB4A 1K73U 2EKOA 4KUIA 2QTVA 5GAOm 4XTYA 2RHUA 5EG2A 3OBWA 1M27C 2YWWA 2EPDA 3RIRA 1VQNT 2EAYA 5LJ5j 3M59A 1S72Q 2DRMA 3MP1A 2GQIA 2XDBA 1AWWA 1LNXA 2LJ3A 2GQVA 4RKUE 3JB9G 1I07A 1JQQA 5IT9E 1VQMA 3I56T 4L5GA 2P0QA 1OV3A 2HKQB 3MEVA 1QVFP 3OYCA 2EJ9A 4M75C 3CCQQ 4EMKB 2VVKA 3EG3A 2BZYA 2O31A 2EYQA 4DBRA 4C92B 3CCST 1YCSB 1K9MR 3FLGA 3GIBA 4LUDA 2K2VA 2MWOA 1N9SA 1OYXA 1ZHIA 1JXMA 2C0TA 2DXBA 3M56A 1B3QA 4CC3A 4HVUA 1AVZC 2DL7A 1AHJB 4JJDA 2IVWA 2K5LA 5IHNA 2BE7D 2XK0A 5CCAA 1N5ZA 1K8AC 3V7RA 5GAN3 4M75E 5GANe 3QZ5B 2GBQA 2MIOA 3CXCS 3REBB 1VQ5A 3CEYA 3HRUA 3VS2A 1I5OB 3A5ZB 4GY5A 2FO0A 5I11A 2PUOB 1EX4A 5LJ3g 3A8GB 1VIFA 4FT2A 1QWEA 7AT1B 1JO8A 2DL3A 2XICA 4OB2B 2M0YA 5GANj 1WXUA 1K0SA 3TSWA 2QXFA 2DAQA 3SB2A 1KQSP 1WQWA 3G71A 1ZX6A 4HVVA 4E7ZA 2H8HA 4WTOB 2QA4T 2ZGWA 5HK0A 2JS0A 1VQ4T 2LJ0A 3CMEQ 4F16A 2NWMA 2KYMA 4MMKA 5GAN6 3LWHA 4M75G 1NLPC 2VV5A 3ER0A 1N9RA 2XDDA 3A8HB 1ACMB 3MEWA 2DEQA 1QP2A 1FWZA 5HY6A 4XU2A 5FWCA 3HL8A 3CCMT 2JS2A 2DERA 4JLGA 2ROLA 2DETA 3JCMV 3CCLT 1Q82R 2ZCFB 2KT1A 3RERA 2OTLQ 1SEMA 1PCXA 3C4SA 2OJ2A 2BIVA 1IGUA 3U23A 2QASA 4XTVA 3TCJA 2XKOC 1VQ7A 3UWNA 1WA7A 2LTOA 2Y4YA 3PGGA 1JXOA 5HK3A 5GJVB 4PJNA 2DNUA 1M4ZA 2HDAA 1O9SA 1V76A 1TSFA 2HSPA 3QSUA 2DJZA 3G4ST 1G2BA 1ZBJA 1UUEA 4RG2A 1MV0B 3E19A 4FT4A 2RK2A 5GMKj 2NUTA 2VASA 4KH0B 3ZEHA 1YJNA 3X24B 1WJQA 4LE9A 4PJOD 1YJ9T 1M1FA 4PJLA 2R5AA 1VQNQ 2CDTA 1KC8R 1M90C 5KYUB 2O9VA 4PJOF 3I55T 4BACA 2YUPA 1V1CA 1Q7YU 3BE3A 4J6WA 2O88A 2J06A 2MI6A 1HD3A 4PFOA 3I35A 1W2BP 1H92A 2EWNA 5KE3A 1PKSA 3PFSA 3JCMf 2PVDB 3VS0A 1BI3A 5FROA 2FZCB 4QVZA 2K57A 3CCSQ 2VXEA 1ZSZA 2YRDA 1WHKA 1ZUYA 3JV3A 4E7IA 3BDUA 4J9BA 1UE9A 2YUNA 3VU3C 1AT1B 4E7JA 1BIBA 4C5HA 4AMCA 1AD5A 3H6ZA 2PVGB 3ASKA 2OTJT 2LT1A 4M77B 3J80E 5GAMh 1UJ0A 2JMCA 2NLUA 3OS2A 1D0XA 2K79A 1QVGP 5KE2A 3EGDB 4RTWA 1K1ZA 4M7AB 1UDLA 4C8QC 2KROA 4J9EA 1F1BB 1MNDA 3OYBA 4A4HA 1K9MU 2KI7A 2X51A 2E4HA 5LJ5d 1U8RA 2LX7A 2CUBA 1DJ7B 3OS1A 3SWNC 3DB3A 3L2RA 3SD4A 4PK4A 3CCUT 1Q81R 1UGPB 2CT4A 3RMQA 1W2BS 2ZPBB 3L2QA 2QA4Q 2FPFA 4C92D 1G3SA 1VQ9T 2EIFA 1VQ4Q 4D8KA 3MP6A 2QK0A 4NL3A 1WHMA 2FYKA 5KYYB 4C92F 1C1AA 2XDPA 1ABQA 4C8QE 2FPDA 5J39A 1SF9A 2YUQA 2GFUA 1D09B 3E2UA 3CC4T 4IIOA 2G3RA 4FYWB 1SSHA 1EFNA 4Z8AA 3FRNA 2L8DA 4OMPA 2DJQA 2I2LA 3CCMQ 2G6FX 1RLQC 2MOXA 3VS1A 2RHYA 3CCLQ 3CQTA 1QWFA 2L0AA 4KRTA 1OX8A 1YHQT 3CCEA 2IIMA 2DL5A 5J26A 2L5QA 5D6YA 1N6AA 2ESWA 4NOYA 3HPWA 4RMOA 2DFUA 4WCIA 2DTOA 2F5KA 4BY6C 1UECA 1XTDA 4RTZA 2EQUA 3G4SQ 4C8QG 2M51A 2DKGA 2RPNA 1NBEB 4E2FB 2EW3A 2KYBA 3C12A 1M5Q1 3NMZC 4KH1B 1QKWA 2QDLA 5GAMg 4AG1C 1OZ3A 3R6OA 5GANd 3MPUB 1TOVA 5KYXA 5CO7A 3CC2Q 1Q82U 3I55Q 1K8AR 3GPLA 4LD6A 3G6EA 4KBMB 3SFMA 1VQ6A 2X4XA 1M8MA 3CBOA 4ELZC 4F7UE 5KYWA 4MDXA 3CCJA 5LJ5g 2K5FA 1D1CA 1PKTA 1YI2A 1N8RR 1ZSZB 3JSCA 3OMGA 2GCXA 2CH4W 4JJNK 1UGQB 4JJBA 1H3ZA 1M3BA 3JCMe 3META 3OW2A 3MKDA 4UC4A 4O6JA 1Q86C 5GJWB 2A3LA 4FU6A 2O4XB 5GAOn 4Q5WA 1NM7A 2V8IA 1M30A 1FXXA 2CZ0B 1AZEA 1R8OB 1KK7A 1SHGA 1WIEA 1NPRA 4ORZA 1KC8U 1KHIA 3CBMA 1UEBA 4MMLA 5IAYA 1KIKA 5IXFA 1RAEB 2C0IA 5D6WA 1VQPT 2OTJQ 3GNGA 2NYSA 2KY9A 4L6V5 1KJWA 4F7UG 1JEGA 3VS6A 4M75B 2R57A 1PD1A 4OMMA 4WF2A 2CGHA 4B6MA 1GCQA 2JM9A 2YLBA 1D3BB 2L3QA 4LNPA 1BB9A 3FJPA 2KXCA 4HCKA 4HKEA 2RHXA 3REAB 2DPPB 1TUCA 3HP9A 3QO3A 4EMGA 3M0TA 1YCYA 1VQKA 2DF6A 3UA6A 1S1NA 1KD1U 3FB9A 1ZA2B 1WHHA 1OULA 2D0QB 3KBGA 2QI2A 3CCUQ 1I81A 2P4RA 1OOTA 3CCRA 3H8ZA 2KMTA 3OYEA 2NUPA 1NPPA 5I2SA 1KD1C 2HL3A 3OYKA 1VQ9Q 5D7UA 1BI1A 3M0RA 3MP8A 4R0KA 5CR2A 2RHIA 3CD6T 4RTVA 3EG1A 1M1KC 3CC4Q 2LVMA 2DL4A 2BE9B 2QYZA 2EJGA 2RH2A 4PLIA 1AWJA 1YN8A 3X25B 2K6DA 1OU9A 1FMWA 4M77D 2DRKA 3QYGB 2E6NA 2RJCA 5GAN2 3V7CA 1YHQQ 5LJ3h 1YIJT 3J81E 4M77F 3EHRA 4OMLA 1VYVA 4M7AD 3THKA 1X27A 2MAMA 1M2VB 1NJIU 1IZ6A 1WFWA 3VRYA 1XNIA 3CXCP 4M7AF 3MHXA 4FW2A 5FU6B 1G3YA 1M3CA 4BI8B 4PL6A 4J7FA 4XAXB 3JCMb 1M1GA 4JJCA 1ABOA 1QQJA 2FB7A 2YSQA 5CVIA 2IPOB 3NFCA 3NPFA 1MNEA 1NJIC 4IKFA 4BE0A 2F5TX 1TS9A 4JRKA 4M78A 4D6WA 1WJRA 2JTMA 1K73C 2ENMA 2E5QA 1RABB 1SPKA 4R55A 3TSZA 3H0IA 2JT4A 4PJMA 2R5MA 1OU8A 2JM8A 4IUTA 1NZ9A 3OW2S 3JCMc 4OB1B 4XTUA 3CPWA 3PVLA 2X4JA 1VIEA 2E12A 3MO8A 2WSFE 4E6RA 1B07A 3QUIA 3KUFA 1IREB 1MMGA 1OX9A 1SRLA 1RAIB 1NEBA 2LMJA 2BZ8A 2CS7A 1UFFA 4HCZA 1G3WA 4M7DB 2DTIA 3I5RA 1T3SA 3CC7A 5IN1A 1M2OA 4QVDA 5LJ3f 4F7UA 1YJWA 1LVKA 2JUFA 2A36A 3EGUA 4DBHA 2HZYA 1MMNA 2HSEB 4BDZA 4LDWA 4PKCC 2RQUA 2L2PA 1VQLA 1AWXA 2FHDA 1O75A 3PT9A 4LDUA 3JB9I 2M0OA 2LCCA 1H3HA 5A0GA 2NUZA 4EPCA 1VQMT 1I8FA 2CP6A 3M0UA 3LWIA 1VQPQ 3L2WA 4JDSA 3LLRA 3X28B 2DL8A 3ME9A 1N8RU 4B9XA 2LJ1A 2F2XA 2FG0A 3NTIA 1YITA 1RUWA 1WQ7A 4C0ZA 3EFOA 1CKAA 4A53A 3VS5A 1FX7A 4IUVA 1MMAA 2EFIA 4TVRA 2QEXA 1GL5A 2IG0A 3EH1A 4C0FA 5EC7A 3QHSA 2M16A 2DEUA 4LDVA 4BUGA 2JVVA 2HCKA 2XU8A 1JU5C 2J6OA 1SKUB 3NTKA 2ZPGB 1VQ8A 2O2OA 4KGXB 2CSQA 2FZGB 4RCCA 2BUDA 1BK2A 2VGNA 2FRYA 2DVJA 3PMIA 1VQ5T 3TQ7P 2RQTA 4LUEA 3DB4A 2RQRA 4C8QB 3CD6Q 2EQIA 2RJEA 1WHGA 3RUXA 1ARKA 2RI3A 2ECZA 1X6BA 3V8LA 4II1A 5CQYA 1E6HA 2EGEA 2A28A 1Z9ZA 3OYHA 1PRLC 1CSKA 2JJ9A 3DLMA 2PZ1A 1U1TA 4E7LA 1Y96B 4LD9K 3OBYA 2XI9A 4DBFA 4M75D 3SWNB 4C5GA 2EGCA 3G71T 5HKCA 3A8OB 3QJ6A 1YIJQ 3JCMd 3FC3A 1NLOC 1VQKQ 1I0CA 3NTHA 5FU7C 3QWYA 4M75F 4J6XA 4D8DA 3H9NA 3P8HA 1VUBA 3M55A 1OPKA 1UTIA 1OEBA 2DVEA 3OYYA 1QCNA 3HRTA 2CUDA 2DBMA 3RR6A 3CCRQ 3LH5A 3VS3A 4HXJA 2JN0A 3OYGA 2X3XD 3QBYA 2RK1A 4A63B 2D8JA 2P84A 3PIPA 2AKLA 2JTFA 2RN8A 3ZFJA 1LJOA 1CKBA 3CPWS 3CC2T 2KT8A 4JRIA 5CKEA 3GP8A 4B9WA 4Y92A 2AZVA 2PU9B 2KNBB 2CP7A 2EQJA 1GCQC 4E47A 5I22A 2K5IA 4BI3A 5D6XA 2EVRA 2YLCA 5GMKi 2YUOA 3MCAB 8AT1B 3H0FA 1N27A 1VQ7T 3CMAA 1Q7YC 1X43A 5GAOq 3EFRA 4KUDK 1M9SA 4XQ3A 5DLQE 3O5ZA 2BTTA 4DOWA 3JCMX 4F7UB 1PG5B 3MEAA 2WSCE 5DY9A 3FDRA 2O01E 4J9IA 4AFUC 2MF2A 4XK8E 3L42A 2F2WA 3O8VA 5LJ3e 1YJNT 2L3PA 1B34A 4DQ2A 3OS0A 3OB9A 2A7YA 4GLMA 2KGTA 5A0LA 1VQOA 1WDXA 1Z9QA 3L2UA 1HXDA 5CQXA 3UT1A 1ZA1B 1QCOA 4QKUA 2K3XA 3OYJA 5FRMA 1C6VX 1VQMQ 4JZ3A 5KCOA 5LJ3j 1TTHB 4C5EA 5I2MA 3VKIA 1GCPA 1R0CB 2DZCA 3CPFA 2RA2A 2VGMA 1P92A 4XU3A 2A08A 2CZ1B 4OMNA 5KYNA 3BY7A 1MMDA 2VXFA 3SDZA 1VYUA 2XG8D 5LJ5h 4OMFB 1EIFA 2E5KA 1ZUKA 2RO0A 4Z02A 1K9MC 1JB0E 1YJWQ 1G83A 4R56A 3TU4K 1X75C 1RL2A 2VKNA 2LQ8A 2EJFA 4CI0C 4M7DD 1UGVA 2EKHA 4M78C 1I1JA 2JW4A 2MPXC 3KXTA 4M7DF 1OZ2A 2HQEA 1RAHB 2E1HA 2I0NA 1M8VA 2M1HA 2LX9A 1VQ5Q 3HRSA 2HL5C 1GXIE 1QCFA 3A1PA 4F14A 3BW1A 2HAXA 4PJOA 3UATA 4XU0A 2LQNA 3PMTA 2VUBA 3H41A 3PVQA 3P8DA 5GAMf 3UA7A 3F70A 3OSSC 1S72A 2MWPA 1YITQ 4HVWA 1ZQ1A 3EG9A 4MZTA 2A0FB 2AT1B 2QDYB 3E1SA 3OYNA 3UPUA 1IXDA 3EGXA 1QW1A 3G71Q 5FLXE 2DYIA 4M78E 2K3BA 1EZZB 1T0HA 5GAOl 2W10A 2NUTB 3JB9J 5AYFA 1ZSGA 2K7AA 2KR3A 3CCQA 1PC0A 3RMSA 1W70A 4XTZA 1YNZA 2KVQG 4P5NA 1VQ8Q 2Y90A 1MV3A 2RHZA 2RJDA 3G7ZA 5M9OA 2X9HA 1GFDA 1YWOA 4HCCA 1D0ZA 2E65A 3HFNA 1FYNA 4C5IA 4KGZB 2KSSA 4ZGDB 5A2QE 5GANh 3EG2A 2HQXA 3QDFA 3V8JA 1T0JA 1WX6A 2PNIA 1PHTA 2COZA 3M4YA 2WSEE 4IURA 3CCET 3JRZA 3OSVA 3VUBA 2KE9A 5I21A 2XMFA 1Q82C 4C8QD 2RD1A 1VQ7Q 4M78G 4QVCA 3OYIA 2ZPEB 3VJPA 4C8QF 3AT1B 4GLKA 3VYGA 1G8XA 1UHFA 4F04B 3GOXA 4A54A 1Q95G 3LGLA 2XIDA 4GBQA 2EYYA 4A4GA 3LYIA 3DKMA 5KCHA 1I4K1 1PSFA 1WNLA 3M9QA 2VC8A 1YJNQ 3INZA 4EMKA 4XU1A 1U3OA 2ABLA 2E6ZA 4C0DC 4J9FA 1WLPB 2LT4A 4C92A 2YDLA 3CCVA 2DZ9A 5J3BA 4AFQC 3G6ET 1KC8C 1TG0A 1NE8A 3E9FA 4FYXB 1BU1A 1UG1A 3CMEA 1VQ6T 2DXUA 3EG0A 4J7IA 2KXDA 4C0GA 1PNJA 4X9DA 3CCJT 5CKHA 4J83A 4N4IA 1LOJA 1YI2T 4HT8A 5GMKh 2D6FA 3QYHB 3PE0A 1J3TA 4X1VA 1JJ2A 1LCKA 2DE0X 2K4YA 2HNIA 1VOMA 2J6KA 2LRQA 4Y28E 1TU0B 2EYZA 2YHTA 2E41A 4FW1A 2OTLA 2DA9A 2QQBA 5IHIA 5C0MA 1SG5A 2ZPIB 4MZPA 3ZBDA 3OW2P 1MGQA 2VYTA 2FRWA 4OMOA 1M3AA 3EHQA 3NHNA 5GANg 2JXBA 1RAFB 1BCMA 2YRCA 3L2VA 1AZGB 1LPLA 4CRIA 2RI5A 1TUDA 1NEGA 2P0PA 4N4GA 2QGGA 1IO6A 2DIQA 1M90R 2HD0A 2H3EB 2OX7A 1E7OA 3A8LB 1VQNA 4NL2A 2V1QA 2J6FA 2DLPA 5GAMe 1QVFA 1K4US 5CKBA 2DILA 1VQKT 1HYOA 1Q81U 4AT1B 1WYXA 2V26A 3OYLA 4OGCA 1Q7YR 3QPHA 2OI3A 3I56A 2KDSA 2MMPA 3CCRT 4J9HA 3S3NA 3IQLA 1TXQA 3HKSA 5CAIA 1Q81C 4FL6A 1WI7A 2PUKB 5LJ5e 3M54A 5GAMj 1D0YA 5GMKm 5KYXB 4ATOA 5L23A 2L3SA 5L8RE 2CH4A 4K11A 4OB0B 3CCSA 4EMHA 2KQWA 3JCMW 3VS4A 4E7HA 1G3TA 4FM4B 4CC4B 4JS4A 2DO3A 1SHFA 3MJXA 5IHKA 2X4WA 4IUQA 2V8JA 2LNHB 5KYWB 2JZ2A 4J8OA 5FWBA 2O9SA 3D7SB 3GBQA 4M4ZA 1H641 2B86A 4OMQA 4KGVB 1D1BA 2LNVA 1KQ2A 5DM7R 3CCEQ 2QTXA 3LW5E 4RTUA 2CZ7B 1SRMA 3WVEB 5FU7B 2XHCA 4ZN1A 2H3JA 5KYUA 5ECAA 5IH2A 2LQKA 2MYSA 1KQSA 1B7TA 4ZTFA 3N5BB 1WXBA 2LZ6B 1UGSB 2Y4XA 3GLXA 3JB9D 2PVOB 1KHCA 3AHUA 5FW9A 1GBQA 1GFCA 4KT0E 2QGFB 4YTLA 1BCOA 3S3OA 2GF7A 5HCKA 2DIGA 5DLOA 3JB9F 3GNFB 1RI0A 2RQWA 1AOJA 4FIBA 1K8AU 2ZAEA 4J6YA 1PM3A 3RKYA 1IGQA 2ZPHB 1JJ2S 1QP3A 3M0SA 2QA4A 2LDMA 4PJOC 3BDLA 3G6EQ 1VQ4A 4LDXA 1VQ6Q 3I5SA 4QQ6A 2WACA 5CIUA 2EQKA 3CCJQ 4HCBA 1YI2Q 3RBBB 2EQMA 2OAWA 3CCMA 1IHVA 3RKXA 2PTKA 3CC7T 3CPWP 1YP5A 1IB8A 3I9QA 4N0AA 1N8RC 4M77A 2L3RA 1YJWT 4VUBA 1PWTA 2KBTA 4MZMA 4CC7A 3A8MB 2NUPB 4Y91A 5KH6A 2HKNA 3ZL7C 2KK4A 3CCLA 3EGDA 2SRCA 2QG9B 3MEUA 4M7AA 4QT7A 2QQAA 2GFAA 4PJOE 3G1JA 1ZUUA 1VQLT 3SEMA 1WZOA 1WHJA 5C6SA 3C0CA 2GTJA 6AT1B 2AHJB 2QAZA 2P0KA 1WHLA 4CC2A 1K9AA 1K76A 3CCVQ 1IRXA 3RESA 4JUVA 1QVFS 3LH0A 1U5SA 4AFSC 3G4SA 2PQWA 5FU6C 1WJSA 2HQHA 3X26B 4PNOA 2A37A 1YITT 3M58A 1UHCA 1QMCA 4QQGA 1W2BA 2DMOA 2L89A 3OQ5A 3VUZA 1YJ9A 5KYYA 3E9GA 1UJYA 4JRQA 3CC2A 3C94A 2RI2A 2QEXT 2FL7A 3GF5A 1BI0A 3I55A 2BKDN 2CREA 1YWPA 4DA4A 3JCMh 1TWBA 3DLLA 2DXCA 3M0PA 4PJOG 5GMKe 2GNCA 2DD4A 2F69A 4IUPA 1VQ8T 4M78B 3M53A 1PD0A 2JOYA 1XOVA 4PFPA 4EMKC 1Q86R 5FRNA 2V8KA 4E7KA 4C92C 2AK5A 4E7SA 1W1FA 2E3IA 4M7DC 2K3YA 1M90U 1X01A 1WXTA 1BI2A 4ZN3A 4V2SA 3QXEB 2W0ZA 3PTAA 1U06A 4BDYA 2DK3A 1QVGA 2DX1A 5GAOr 3JCMP 1BBZA 2CYZB 1BYMA 1KQSS 1NYFA 1OQKA 4BI4A 2XD0A 5GAN4 2J05A 2OTJA 3L1AA 4DEYA 1A0NB 1AEYA 4BY6B 4MDWA 4OP0A 2GTOA 2RF0A 1PRMC 3M57A 2LQWA 4ZGEB 4FYYB 1MUZA 3I56Q 2SEMA 2DTHA 4C92E 2K9GA 2V1RA 4PLLA 3OY9A 1TH7A 4M7DE 3JB9H 3QWXX 2DXTA 2FVUA 2YRVA 3QZ9B 3OYAA 2RM4A 2F2VA 5GAN7 2JNGA 1TUGB 2LP5A 3S3MA 2KRMA 4DBQA 4FCYA 4RTTA 1U1SA 2EGAA 4QW2A 1Y07A 4J9DA 3T9NA 1KD1R 1KSWA 3M4GA 3OMCA 1KFZA 3HTRA 1V29B 3CCUA 4J5YA 3ULRB 2AKKA 4O5VA 3UDCA 5A0DA 3RDVA 2O4XA 3QIIA 4RCBA 1VQ9A 2EBPA 4XTXA 3EFOB 5IXBA 3CMAT 1GRIA 2DD5A 1M1KR 2KEAA 2RMOA 1QVPA 5GAMd 1XQHA 3JCMg 2LCLA 4F17A 3CC4A 4C92G 3P8BB 3RKWA 1E6GA 2AIRB 3LGFA 3C95A 3VYHB 1RACB 2KAFA 4X9CA 2ATCB 3CC7Q 4M7DG 3OYFA 1D1AA 4JS5A 2QQRA 4M75A 4RUGA 4BD3A 3V8KA 4ZNXA 1VQOT 1YHQA 1D3BA 4C0DB 4KULA 1VQLQ 2D1XA 3FEOA 4LXCA 4RTYA 4OVAA 1HK9A 4JRPA 1W6XA 9ATCB 3JCMJ 2KRSA 1NJIR 3FJ5A 3A98A 2QQSA 4OB3B 3X20B 1K73R 5GAN8 1UGRB 2D8HA 2D9TA 2GGRA 3WXMB 1T3LA 4FYVB 3M0QA 2BZXA 2E3HA 3OYMA 4BE1A 3PNWC 3H0HA 1H8KA 2JMAA 2MK5A 2CT3A 2DBKA 2QEXQ 1I5LA 2X3WD 1VYTA 1RLPC 4BE2A 2OAUA 2P4TA 1NG2A 1YFNA 4ZGJB 5LJ5f 5GMKl 4L59A 1KQ1A 4BB7A 4ELYC 1KG1A 2E10A 1ZLMA 1BKBA 2C06A 3QG1A 1X6GA 1W4SA 1YBYA 3HFOA 1QVGS 2FPEA 1FMVA 2D0NA 3R6NA 1RADB 3JCMQ 2M02A 2J7IA 3VS7A 1M2VA 1X6OA 1Y71A 2E64A 4A4EA 2Z0WA 2YXYA 2LCSA 2RJFA 1C0MA 3JAME 1S72T 1OI1A 8ATCB 5CK9A 3VRZA 4DOVA 1NYGA 1RI9A 3CBPA 4A4FA 1YJ9Q 3OS5A 4N0AC 1VQPA 1Y0MA 4M77C 4RG8A 3URGA 1PSEA 2CSIA 3OYDA 4NS5A 4J9CA 1B34B 3CCQT 4PFZA 4JPBW 3UF4A 4M7AC 1IHWA 2B8AA 2AZSA 3L2ZA 4XTWA 1Q86U 5GAN5 1AWOA 1FMKA 3QJYA 2DYBA 2X4YA 3EFSA 1SSFA 1G5VA 1XJWB 4ME7A 2M9UA 1K0XA 4IIMA 4A4KA 5CKFA 2JTEA 2HBPA 2VB6A 4M78D 2R58A 4EIKA 4M7DA 2C0OA 4N4HA 2CP5A 2LC4A 4M77E 4M78F 1X2QA 2ROTA 1QLYA 1MHNA 2X35A 3BFMA 5GAOp 3FIFA 5GANf 2HEQA 4FSSA 3Q1JA 3VV0A 1JBMA 2CP0A 1BIAA 4LN2A 2COWA 3CMAQ 1JRIA 2CZ6B 4RTXA 2MCNA 4M7AE 2ZPFB 4ANJA 1VA7A 4FSXA 1QKXA 1WGSA
chains in the Genus database with same CATH topology
1KD1R 1QVFP 1QVGP 3CPWP 1YHQQ 1VQPQ 1VQ8Q 1VQMQ 1Q86R 3CCVQ 3CCQQ 3G6EQ 1S72Q 3CC7Q 1Q81R 1YIJQ 1KC8R 1VQ5Q 3CCMQ 3CCEQ 1NJIR 1VQNQ 1YJWQ 3CC4Q 1YJ9Q 1N8RR 1VQKQ 1VQ6Q 3CD6Q 3G71Q 1VQ7Q 2QA4Q 3CCUQ 3CMEQ 2QEXQ 1YJNQ 3CXCP 1Q7YR 3CCJQ 1K9MR 1Q82R 1M1KR 1K73R 1VQ4Q 3CC2Q 1JJ2P 3OW2P 2OTLQ 1M90R 3CMAQ 3I55Q 3CCSQ 1YI2Q 1K8AR 3CCLQ 1VQ9Q 3G4SQ 1VQOQ 1W2BP 3CCRQ 3I56Q 1VQLQ 2OTJQ 1KQSP 1YITQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 R;  1QVF P;  1QVG P;  3CPW P;  1YHQ Q;  1VQP Q;  1VQ8 Q;  1VQM Q;  1Q86 R;  3CCV Q;  3CCQ Q;  3G6E Q;  1S72 Q;  3CC7 Q;  1Q81 R;  1YIJ Q;  1KC8 R;  1VQ5 Q;  3CCM Q;  3CCE Q;  1NJI R;  1VQN Q;  1YJW Q;  3CC4 Q;  1YJ9 Q;  1N8R R;  1VQK Q;  1VQ6 Q;  3CD6 Q;  3G71 Q;  1VQ7 Q;  2QA4 Q;  3CCU Q;  3CME Q;  2QEX Q;  1YJN Q;  3CXC P;  1Q7Y R;  3CCJ Q;  1K9M R;  1Q82 R;  1M1K R;  1K73 R;  1VQ4 Q;  3CC2 Q;  1JJ2 P;  3OW2 P;  2OTL Q;  1M90 R;  3CMA Q;  3I55 Q;  3CCS Q;  1YI2 Q;  1K8A R;  3CCL Q;  1VQ9 Q;  3G4S Q;  1VQO Q;  1W2B P;  3CCR Q;  3I56 Q;  1VQL Q;  2OTJ Q;  1KQS P;  1YIT Q; 
#chains in the Genus database with same CATH topology
 3M5A A;  3CD6 A;  2CKK A;  2F1L A;  4DEX A;  4OF1 A;  4QQD A;  3V7S A;  5AT1 B;  3QKJ A;  2ED0 A;  2HBW A;  1HSQ A;  3TEE A;  3CXC A;  4PJJ A;  2CP3 A;  5CKD A;  3RNJ A;  4JLI A;  3HSB A;  3SHW A;  1X2K A;  2FEI A;  2ZZD A;  4IUU A;  1VQO Q;  1YIJ A;  2HMA A;  4F7U F;  1Y7X A;  4AG2 C;  3CCV T;  1RAA B;  4PJO B;  1R77 A;  2EYX A;  2YT6 A;  3CME T;  4JZ4 A;  4M77 G;  2ED1 A;  4LDY A;  3TRE A;  4ESR A;  1HJD A;  4J9G A;  1R0B G;  5LL6 S;  3TVT A;  1M1K U;  3NGP A;  3EG9 B;  3OA6 A;  1ZBX A;  4M7A G;  1GBR A;  2RQV A;  3EGX B;  3HHT B;  2K2M A;  4AFZ C;  1OPL A;  2FZK B;  3LX7 A;  3J7A F;  2QQ9 A;  2CP2 A;  2DM1 A;  3S6W A;  2KRN A;  2OTL T;  3EAE A;  4HA8 A;  1JJ2 P;  4ZTJ A;  4C8Q A;  2EYW A;  2VWF A;  2E70 A;  1RAG B;  3QDR B;  2RNA A;  3PIO A;  1Y57 A;  2RB6 A;  5LJ3 d;  3KFV A;  1X69 A;  4X34 A;  4Z88 A;  4EDU A;  1Y96 A;  4HT9 A;  3WVD B;  3EH2 A;  1ZSZ C;  1WPY A;  4OGE A;  3SWN A;  2COY A;  4Z89 A;  1UB4 A;  1K73 U;  2EKO A;  4KUI A;  2QTV A;  5GAO m;  4XTY A;  2RHU A;  5EG2 A;  3OBW A;  1M27 C;  2YWW A;  2EPD A;  3RIR A;  1VQN T;  2EAY A;  5LJ5 j;  3M59 A;  1S72 Q;  2DRM A;  3MP1 A;  2GQI A;  2XDB A;  1AWW A;  1LNX A;  2LJ3 A;  2GQV A;  4RKU E;  3JB9 G;  1I07 A;  1JQQ A;  5IT9 E;  1VQM A;  3I56 T;  4L5G A;  2P0Q A;  1OV3 A;  2HKQ B;  3MEV A;  1QVF P;  3OYC A;  2EJ9 A;  4M75 C;  3CCQ Q;  4EMK B;  2VVK A;  3EG3 A;  2BZY A;  2O31 A;  2EYQ A;  4DBR A;  4C92 B;  3CCS T;  1YCS B;  1K9M R;  3FLG A;  3GIB A;  4LUD A;  2K2V A;  2MWO A;  1N9S A;  1OYX A;  1ZHI A;  1JXM A;  2C0T A;  2DXB A;  3M56 A;  1B3Q A;  4CC3 A;  4HVU A;  1AVZ C;  2DL7 A;  1AHJ B;  4JJD A;  2IVW A;  2K5L A;  5IHN A;  2BE7 D;  2XK0 A;  5CCA A;  1N5Z A;  1K8A C;  3V7R A;  5GAN 3;  4M75 E;  5GAN e;  3QZ5 B;  2GBQ A;  2MIO A;  3CXC S;  3REB B;  1VQ5 A;  3CEY A;  3HRU A;  3VS2 A;  1I5O B;  3A5Z B;  4GY5 A;  2FO0 A;  5I11 A;  2PUO B;  1EX4 A;  5LJ3 g;  3A8G B;  1VIF A;  4FT2 A;  1QWE A;  7AT1 B;  1JO8 A;  2DL3 A;  2XIC A;  4OB2 B;  2M0Y A;  5GAN j;  1WXU A;  1K0S A;  3TSW A;  2QXF A;  2DAQ A;  3SB2 A;  1KQS P;  1WQW A;  3G71 A;  1ZX6 A;  4HVV A;  4E7Z A;  2H8H A;  4WTO B;  2QA4 T;  2ZGW A;  5HK0 A;  2JS0 A;  1VQ4 T;  2LJ0 A;  3CME Q;  4F16 A;  2NWM A;  2KYM A;  4MMK A;  5GAN 6;  3LWH A;  4M75 G;  1NLP C;  2VV5 A;  3ER0 A;  1N9R A;  2XDD A;  3A8H B;  1ACM B;  3MEW A;  2DEQ A;  1QP2 A;  1FWZ A;  5HY6 A;  4XU2 A;  5FWC A;  3HL8 A;  3CCM T;  2JS2 A;  2DER A;  4JLG A;  2ROL A;  2DET A;  3JCM V;  3CCL T;  1Q82 R;  2ZCF B;  2KT1 A;  3RER A;  2OTL Q;  1SEM A;  1PCX A;  3C4S A;  2OJ2 A;  2BIV A;  1IGU A;  3U23 A;  2QAS A;  4XTV A;  3TCJ A;  2XKO C;  1VQ7 A;  3UWN A;  1WA7 A;  2LTO A;  2Y4Y A;  3PGG A;  1JXO A;  5HK3 A;  5GJV B;  4PJN A;  2DNU A;  1M4Z A;  2HDA A;  1O9S A;  1V76 A;  1TSF A;  2HSP A;  3QSU A;  2DJZ A;  3G4S T;  1G2B A;  1ZBJ A;  1UUE A;  4RG2 A;  1MV0 B;  3E19 A;  4FT4 A;  2RK2 A;  5GMK j;  2NUT A;  2VAS A;  4KH0 B;  3ZEH A;  1YJN A;  3X24 B;  1WJQ A;  4LE9 A;  4PJO D;  1YJ9 T;  1M1F A;  4PJL A;  2R5A A;  1VQN Q;  2CDT A;  1KC8 R;  1M90 C;  5KYU B;  2O9V A;  4PJO F;  3I55 T;  4BAC A;  2YUP A;  1V1C A;  1Q7Y U;  3BE3 A;  4J6W A;  2O88 A;  2J06 A;  2MI6 A;  1HD3 A;  4PFO A;  3I35 A;  1W2B P;  1H92 A;  2EWN A;  5KE3 A;  1PKS A;  3PFS A;  3JCM f;  2PVD B;  3VS0 A;  1BI3 A;  5FRO A;  2FZC B;  4QVZ A;  2K57 A;  3CCS Q;  2VXE A;  1ZSZ A;  2YRD A;  1WHK A;  1ZUY A;  3JV3 A;  4E7I A;  3BDU A;  4J9B A;  1UE9 A;  2YUN A;  3VU3 C;  1AT1 B;  4E7J A;  1BIB A;  4C5H A;  4AMC A;  1AD5 A;  3H6Z A;  2PVG B;  3ASK A;  2OTJ T;  2LT1 A;  4M77 B;  3J80 E;  5GAM h;  1UJ0 A;  2JMC A;  2NLU A;  3OS2 A;  1D0X A;  2K79 A;  1QVG P;  5KE2 A;  3EGD B;  4RTW A;  1K1Z A;  4M7A B;  1UDL A;  4C8Q C;  2KRO A;  4J9E A;  1F1B B;  1MND A;  3OYB A;  4A4H A;  1K9M U;  2KI7 A;  2X51 A;  2E4H A;  5LJ5 d;  1U8R A;  2LX7 A;  2CUB A;  1DJ7 B;  3OS1 A;  3SWN C;  3DB3 A;  3L2R A;  3SD4 A;  4PK4 A;  3CCU T;  1Q81 R;  1UGP B;  2CT4 A;  3RMQ A;  1W2B S;  2ZPB B;  3L2Q A;  2QA4 Q;  2FPF A;  4C92 D;  1G3S A;  1VQ9 T;  2EIF A;  1VQ4 Q;  4D8K A;  3MP6 A;  2QK0 A;  4NL3 A;  1WHM A;  2FYK A;  5KYY B;  4C92 F;  1C1A A;  2XDP A;  1ABQ A;  4C8Q E;  2FPD A;  5J39 A;  1SF9 A;  2YUQ A;  2GFU A;  1D09 B;  3E2U A;  3CC4 T;  4IIO A;  2G3R A;  4FYW B;  1SSH A;  1EFN A;  4Z8A A;  3FRN A;  2L8D A;  4OMP A;  2DJQ A;  2I2L A;  3CCM Q;  2G6F X;  1RLQ C;  2MOX A;  3VS1 A;  2RHY A;  3CCL Q;  3CQT A;  1QWF A;  2L0A A;  4KRT A;  1OX8 A;  1YHQ T;  3CCE A;  2IIM A;  2DL5 A;  5J26 A;  2L5Q A;  5D6Y A;  1N6A A;  2ESW A;  4NOY A;  3HPW A;  4RMO A;  2DFU A;  4WCI A;  2DTO A;  2F5K A;  4BY6 C;  1UEC A;  1XTD A;  4RTZ A;  2EQU A;  3G4S Q;  4C8Q G;  2M51 A;  2DKG A;  2RPN A;  1NBE B;  4E2F B;  2EW3 A;  2KYB A;  3C12 A;  1M5Q 1;  3NMZ C;  4KH1 B;  1QKW A;  2QDL A;  5GAM g;  4AG1 C;  1OZ3 A;  3R6O A;  5GAN d;  3MPU B;  1TOV A;  5KYX A;  5CO7 A;  3CC2 Q;  1Q82 U;  3I55 Q;  1K8A R;  3GPL A;  4LD6 A;  3G6E A;  4KBM B;  3SFM A;  1VQ6 A;  2X4X A;  1M8M A;  3CBO A;  4ELZ C;  4F7U E;  5KYW A;  4MDX A;  3CCJ A;  5LJ5 g;  2K5F A;  1D1C A;  1PKT A;  1YI2 A;  1N8R R;  1ZSZ B;  3JSC A;  3OMG A;  2GCX A;  2CH4 W;  4JJN K;  1UGQ B;  4JJB A;  1H3Z A;  1M3B A;  3JCM e;  3MET A;  3OW2 A;  3MKD A;  4UC4 A;  4O6J A;  1Q86 C;  5GJW B;  2A3L A;  4FU6 A;  2O4X B;  5GAO n;  4Q5W A;  1NM7 A;  2V8I A;  1M30 A;  1FXX A;  2CZ0 B;  1AZE A;  1R8O B;  1KK7 A;  1SHG A;  1WIE A;  1NPR A;  4ORZ A;  1KC8 U;  1KHI A;  3CBM A;  1UEB A;  4MML A;  5IAY A;  1KIK A;  5IXF A;  1RAE B;  2C0I A;  5D6W A;  1VQP T;  2OTJ Q;  3GNG A;  2NYS A;  2KY9 A;  4L6V 5;  1KJW A;  4F7U G;  1JEG A;  3VS6 A;  4M75 B;  2R57 A;  1PD1 A;  4OMM A;  4WF2 A;  2CGH A;  4B6M A;  1GCQ A;  2JM9 A;  2YLB A;  1D3B B;  2L3Q A;  4LNP A;  1BB9 A;  3FJP A;  2KXC A;  4HCK A;  4HKE A;  2RHX A;  3REA B;  2DPP B;  1TUC A;  3HP9 A;  3QO3 A;  4EMG A;  3M0T A;  1YCY A;  1VQK A;  2DF6 A;  3UA6 A;  1S1N A;  1KD1 U;  3FB9 A;  1ZA2 B;  1WHH A;  1OUL A;  2D0Q B;  3KBG A;  2QI2 A;  3CCU Q;  1I81 A;  2P4R A;  1OOT A;  3CCR A;  3H8Z A;  2KMT A;  3OYE A;  2NUP A;  1NPP A;  5I2S A;  1KD1 C;  2HL3 A;  3OYK A;  1VQ9 Q;  5D7U A;  1BI1 A;  3M0R A;  3MP8 A;  4R0K A;  5CR2 A;  2RHI A;  3CD6 T;  4RTV A;  3EG1 A;  1M1K C;  3CC4 Q;  2LVM A;  2DL4 A;  2BE9 B;  2QYZ A;  2EJG A;  2RH2 A;  4PLI A;  1AWJ A;  1YN8 A;  3X25 B;  2K6D A;  1OU9 A;  1FMW A;  4M77 D;  2DRK A;  3QYG B;  2E6N A;  2RJC A;  5GAN 2;  3V7C A;  1YHQ Q;  5LJ3 h;  1YIJ T;  3J81 E;  4M77 F;  3EHR A;  4OML A;  1VYV A;  4M7A D;  3THK A;  1X27 A;  2MAM A;  1M2V B;  1NJI U;  1IZ6 A;  1WFW A;  3VRY A;  1XNI A;  3CXC P;  4M7A F;  3MHX A;  4FW2 A;  5FU6 B;  1G3Y A;  1M3C A;  4BI8 B;  4PL6 A;  4J7F A;  4XAX B;  3JCM b;  1M1G A;  4JJC A;  1ABO A;  1QQJ A;  2FB7 A;  2YSQ A;  5CVI A;  2IPO B;  3NFC A;  3NPF A;  1MNE A;  1NJI C;  4IKF A;  4BE0 A;  2F5T X;  1TS9 A;  4JRK A;  4M78 A;  4D6W A;  1WJR A;  2JTM A;  1K73 C;  2ENM A;  2E5Q A;  1RAB B;  1SPK A;  4R55 A;  3TSZ A;  3H0I A;  2JT4 A;  4PJM A;  2R5M A;  1OU8 A;  2JM8 A;  4IUT A;  1NZ9 A;  3OW2 S;  3JCM c;  4OB1 B;  4XTU A;  3CPW A;  3PVL A;  2X4J A;  1VIE A;  2E12 A;  3MO8 A;  2WSF E;  4E6R A;  1B07 A;  3QUI A;  3KUF A;  1IRE B;  1MMG A;  1OX9 A;  1SRL A;  1RAI B;  1NEB A;  2LMJ A;  2BZ8 A;  2CS7 A;  1UFF A;  4HCZ A;  1G3W A;  4M7D B;  2DTI A;  3I5R A;  1T3S A;  3CC7 A;  5IN1 A;  1M2O A;  4QVD A;  5LJ3 f;  4F7U A;  1YJW A;  1LVK A;  2JUF A;  2A36 A;  3EGU A;  4DBH A;  2HZY A;  1MMN A;  2HSE B;  4BDZ A;  4LDW A;  4PKC C;  2RQU A;  2L2P A;  1VQL A;  1AWX A;  2FHD A;  1O75 A;  3PT9 A;  4LDU A;  3JB9 I;  2M0O A;  2LCC A;  1H3H A;  5A0G A;  2NUZ A;  4EPC A;  1VQM T;  1I8F A;  2CP6 A;  3M0U A;  3LWI A;  1VQP Q;  3L2W A;  4JDS A;  3LLR A;  3X28 B;  2DL8 A;  3ME9 A;  1N8R U;  4B9X A;  2LJ1 A;  2F2X A;  2FG0 A;  3NTI A;  1YIT A;  1RUW A;  1WQ7 A;  4C0Z A;  3EFO A;  1CKA A;  4A53 A;  3VS5 A;  1FX7 A;  4IUV A;  1MMA A;  2EFI A;  4TVR A;  2QEX A;  1GL5 A;  2IG0 A;  3EH1 A;  4C0F A;  5EC7 A;  3QHS A;  2M16 A;  2DEU A;  4LDV A;  4BUG A;  2JVV A;  2HCK A;  2XU8 A;  1JU5 C;  2J6O A;  1SKU B;  3NTK A;  2ZPG B;  1VQ8 A;  2O2O A;  4KGX B;  2CSQ A;  2FZG B;  4RCC A;  2BUD A;  1BK2 A;  2VGN A;  2FRY A;  2DVJ A;  3PMI A;  1VQ5 T;  3TQ7 P;  2RQT A;  4LUE A;  3DB4 A;  2RQR A;  4C8Q B;  3CD6 Q;  2EQI A;  2RJE A;  1WHG A;  3RUX A;  1ARK A;  2RI3 A;  2ECZ A;  1X6B A;  3V8L A;  4II1 A;  5CQY A;  1E6H A;  2EGE A;  2A28 A;  1Z9Z A;  3OYH A;  1PRL C;  1CSK A;  2JJ9 A;  3DLM A;  2PZ1 A;  1U1T A;  4E7L A;  1Y96 B;  4LD9 K;  3OBY A;  2XI9 A;  4DBF A;  4M75 D;  3SWN B;  4C5G A;  2EGC A;  3G71 T;  5HKC A;  3A8O B;  3QJ6 A;  1YIJ Q;  3JCM d;  3FC3 A;  1NLO C;  1VQK Q;  1I0C A;  3NTH A;  5FU7 C;  3QWY A;  4M75 F;  4J6X A;  4D8D A;  3H9N A;  3P8H A;  1VUB A;  3M55 A;  1OPK A;  1UTI A;  1OEB A;  2DVE A;  3OYY A;  1QCN A;  3HRT A;  2CUD A;  2DBM A;  3RR6 A;  3CCR Q;  3LH5 A;  3VS3 A;  4HXJ A;  2JN0 A;  3OYG A;  2X3X D;  3QBY A;  2RK1 A;  4A63 B;  2D8J A;  2P84 A;  3PIP A;  2AKL A;  2JTF A;  2RN8 A;  3ZFJ A;  1LJO A;  1CKB A;  3CPW S;  3CC2 T;  2KT8 A;  4JRI A;  5CKE A;  3GP8 A;  4B9W A;  4Y92 A;  2AZV A;  2PU9 B;  2KNB B;  2CP7 A;  2EQJ A;  1GCQ C;  4E47 A;  5I22 A;  2K5I A;  4BI3 A;  5D6X A;  2EVR A;  2YLC A;  5GMK i;  2YUO A;  3MCA B;  8AT1 B;  3H0F A;  1N27 A;  1VQ7 T;  3CMA A;  1Q7Y C;  1X43 A;  5GAO q;  3EFR A;  4KUD K;  1M9S A;  4XQ3 A;  5DLQ E;  3O5Z A;  2BTT A;  4DOW A;  3JCM X;  4F7U B;  1PG5 B;  3MEA A;  2WSC E;  5DY9 A;  3FDR A;  2O01 E;  4J9I A;  4AFU C;  2MF2 A;  4XK8 E;  3L42 A;  2F2W A;  3O8V A;  5LJ3 e;  1YJN T;  2L3P A;  1B34 A;  4DQ2 A;  3OS0 A;  3OB9 A;  2A7Y A;  4GLM A;  2KGT A;  5A0L A;  1VQO A;  1WDX A;  1Z9Q A;  3L2U A;  1HXD A;  5CQX A;  3UT1 A;  1ZA1 B;  1QCO A;  4QKU A;  2K3X A;  3OYJ A;  5FRM A;  1C6V X;  1VQM Q;  4JZ3 A;  5KCO A;  5LJ3 j;  1TTH B;  4C5E A;  5I2M A;  3VKI A;  1GCP A;  1R0C B;  2DZC A;  3CPF A;  2RA2 A;  2VGM A;  1P92 A;  4XU3 A;  2A08 A;  2CZ1 B;  4OMN A;  5KYN A;  3BY7 A;  1MMD A;  2VXF A;  3SDZ A;  1VYU A;  2XG8 D;  5LJ5 h;  4OMF B;  1EIF A;  2E5K A;  1ZUK A;  2RO0 A;  4Z02 A;  1K9M C;  1JB0 E;  1YJW Q;  1G83 A;  4R56 A;  3TU4 K;  1X75 C;  1RL2 A;  2VKN A;  2LQ8 A;  2EJF A;  4CI0 C;  4M7D D;  1UGV A;  2EKH A;  4M78 C;  1I1J A;  2JW4 A;  2MPX C;  3KXT A;  4M7D F;  1OZ2 A;  2HQE A;  1RAH B;  2E1H A;  2I0N A;  1M8V A;  2M1H A;  2LX9 A;  1VQ5 Q;  3HRS A;  2HL5 C;  1GXI E;  1QCF A;  3A1P A;  4F14 A;  3BW1 A;  2HAX A;  4PJO A;  3UAT A;  4XU0 A;  2LQN A;  3PMT A;  2VUB A;  3H41 A;  3PVQ A;  3P8D A;  5GAM f;  3UA7 A;  3F70 A;  3OSS C;  1S72 A;  2MWP A;  1YIT Q;  4HVW A;  1ZQ1 A;  3EG9 A;  4MZT A;  2A0F B;  2AT1 B;  2QDY B;  3E1S A;  3OYN A;  3UPU A;  1IXD A;  3EGX A;  1QW1 A;  3G71 Q;  5FLX E;  2DYI A;  4M78 E;  2K3B A;  1EZZ B;  1T0H A;  5GAO l;  2W10 A;  2NUT B;  3JB9 J;  5AYF A;  1ZSG A;  2K7A A;  2KR3 A;  3CCQ A;  1PC0 A;  3RMS A;  1W70 A;  4XTZ A;  1YNZ A;  2KVQ G;  4P5N A;  1VQ8 Q;  2Y90 A;  1MV3 A;  2RHZ A;  2RJD A;  3G7Z A;  5M9O A;  2X9H A;  1GFD A;  1YWO A;  4HCC A;  1D0Z A;  2E65 A;  3HFN A;  1FYN A;  4C5I A;  4KGZ B;  2KSS A;  4ZGD B;  5A2Q E;  5GAN h;  3EG2 A;  2HQX A;  3QDF A;  3V8J A;  1T0J A;  1WX6 A;  2PNI A;  1PHT A;  2COZ A;  3M4Y A;  2WSE E;  4IUR A;  3CCE T;  3JRZ A;  3OSV A;  3VUB A;  2KE9 A;  5I21 A;  2XMF A;  1Q82 C;  4C8Q D;  2RD1 A;  1VQ7 Q;  4M78 G;  4QVC A;  3OYI A;  2ZPE B;  3VJP A;  4C8Q F;  3AT1 B;  4GLK A;  3VYG A;  1G8X A;  1UHF A;  4F04 B;  3GOX A;  4A54 A;  1Q95 G;  3LGL A;  2XID A;  4GBQ A;  2EYY A;  4A4G A;  3LYI A;  3DKM A;  5KCH A;  1I4K 1;  1PSF A;  1WNL A;  3M9Q A;  2VC8 A;  1YJN Q;  3INZ A;  4EMK A;  4XU1 A;  1U3O A;  2ABL A;  2E6Z A;  4C0D C;  4J9F A;  1WLP B;  2LT4 A;  4C92 A;  2YDL A;  3CCV A;  2DZ9 A;  5J3B A;  4AFQ C;  3G6E T;  1KC8 C;  1TG0 A;  1NE8 A;  3E9F A;  4FYX B;  1BU1 A;  1UG1 A;  3CME A;  1VQ6 T;  2DXU A;  3EG0 A;  4J7I A;  2KXD A;  4C0G A;  1PNJ A;  4X9D A;  3CCJ T;  5CKH A;  4J83 A;  4N4I A;  1LOJ A;  1YI2 T;  4HT8 A;  5GMK h;  2D6F A;  3QYH B;  3PE0 A;  1J3T A;  4X1V A;  1JJ2 A;  1LCK A;  2DE0 X;  2K4Y A;  2HNI A;  1VOM A;  2J6K A;  2LRQ A;  4Y28 E;  1TU0 B;  2EYZ A;  2YHT A;  2E41 A;  4FW1 A;  2OTL A;  2DA9 A;  2QQB A;  5IHI A;  5C0M A;  1SG5 A;  2ZPI B;  4MZP A;  3ZBD A;  3OW2 P;  1MGQ A;  2VYT A;  2FRW A;  4OMO A;  1M3A A;  3EHQ A;  3NHN A;  5GAN g;  2JXB A;  1RAF B;  1BCM A;  2YRC A;  3L2V A;  1AZG B;  1LPL A;  4CRI A;  2RI5 A;  1TUD A;  1NEG A;  2P0P A;  4N4G A;  2QGG A;  1IO6 A;  2DIQ A;  1M90 R;  2HD0 A;  2H3E B;  2OX7 A;  1E7O A;  3A8L B;  1VQN A;  4NL2 A;  2V1Q A;  2J6F A;  2DLP A;  5GAM e;  1QVF A;  1K4U S;  5CKB A;  2DIL A;  1VQK T;  1HYO A;  1Q81 U;  4AT1 B;  1WYX A;  2V26 A;  3OYL A;  4OGC A;  1Q7Y R;  3QPH A;  2OI3 A;  3I56 A;  2KDS A;  2MMP A;  3CCR T;  4J9H A;  3S3N A;  3IQL A;  1TXQ A;  3HKS A;  5CAI A;  1Q81 C;  4FL6 A;  1WI7 A;  2PUK B;  5LJ5 e;  3M54 A;  5GAM j;  1D0Y A;  5GMK m;  5KYX B;  4ATO A;  5L23 A;  2L3S A;  5L8R E;  2CH4 A;  4K11 A;  4OB0 B;  3CCS A;  4EMH A;  2KQW A;  3JCM W;  3VS4 A;  4E7H A;  1G3T A;  4FM4 B;  4CC4 B;  4JS4 A;  2DO3 A;  1SHF A;  3MJX A;  5IHK A;  2X4W A;  4IUQ A;  2V8J A;  2LNH B;  5KYW B;  2JZ2 A;  4J8O A;  5FWB A;  2O9S A;  3D7S B;  3GBQ A;  4M4Z A;  1H64 1;  2B86 A;  4OMQ A;  4KGV B;  1D1B A;  2LNV A;  1KQ2 A;  5DM7 R;  3CCE Q;  2QTX A;  3LW5 E;  4RTU A;  2CZ7 B;  1SRM A;  3WVE B;  5FU7 B;  2XHC A;  4ZN1 A;  2H3J A;  5KYU A;  5ECA A;  5IH2 A;  2LQK A;  2MYS A;  1KQS A;  1B7T A;  4ZTF A;  3N5B B;  1WXB A;  2LZ6 B;  1UGS B;  2Y4X A;  3GLX A;  3JB9 D;  2PVO B;  1KHC A;  3AHU A;  5FW9 A;  1GBQ A;  1GFC A;  4KT0 E;  2QGF B;  4YTL A;  1BCO A;  3S3O A;  2GF7 A;  5HCK A;  2DIG A;  5DLO A;  3JB9 F;  3GNF B;  1RI0 A;  2RQW A;  1AOJ A;  4FIB A;  1K8A U;  2ZAE A;  4J6Y A;  1PM3 A;  3RKY A;  1IGQ A;  2ZPH B;  1JJ2 S;  1QP3 A;  3M0S A;  2QA4 A;  2LDM A;  4PJO C;  3BDL A;  3G6E Q;  1VQ4 A;  4LDX A;  1VQ6 Q;  3I5S A;  4QQ6 A;  2WAC A;  5CIU A;  2EQK A;  3CCJ Q;  4HCB A;  1YI2 Q;  3RBB B;  2EQM A;  2OAW A;  3CCM A;  1IHV A;  3RKX A;  2PTK A;  3CC7 T;  3CPW P;  1YP5 A;  1IB8 A;  3I9Q A;  4N0A A;  1N8R C;  4M77 A;  2L3R A;  1YJW T;  4VUB A;  1PWT A;  2KBT A;  4MZM A;  4CC7 A;  3A8M B;  2NUP B;  4Y91 A;  5KH6 A;  2HKN A;  3ZL7 C;  2KK4 A;  3CCL A;  3EGD A;  2SRC A;  2QG9 B;  3MEU A;  4M7A A;  4QT7 A;  2QQA A;  2GFA A;  4PJO E;  3G1J A;  1ZUU A;  1VQL T;  3SEM A;  1WZO A;  1WHJ A;  5C6S A;  3C0C A;  2GTJ A;  6AT1 B;  2AHJ B;  2QAZ A;  2P0K A;  1WHL A;  4CC2 A;  1K9A A;  1K76 A;  3CCV Q;  1IRX A;  3RES A;  4JUV A;  1QVF S;  3LH0 A;  1U5S A;  4AFS C;  3G4S A;  2PQW A;  5FU6 C;  1WJS A;  2HQH A;  3X26 B;  4PNO A;  2A37 A;  1YIT T;  3M58 A;  1UHC A;  1QMC A;  4QQG A;  1W2B A;  2DMO A;  2L89 A;  3OQ5 A;  3VUZ A;  1YJ9 A;  5KYY A;  3E9G A;  1UJY A;  4JRQ A;  3CC2 A;  3C94 A;  2RI2 A;  2QEX T;  2FL7 A;  3GF5 A;  1BI0 A;  3I55 A;  2BKD N;  2CRE A;  1YWP A;  4DA4 A;  3JCM h;  1TWB A;  3DLL A;  2DXC A;  3M0P A;  4PJO G;  5GMK e;  2GNC A;  2DD4 A;  2F69 A;  4IUP A;  1VQ8 T;  4M78 B;  3M53 A;  1PD0 A;  2JOY A;  1XOV A;  4PFP A;  4EMK C;  1Q86 R;  5FRN A;  2V8K A;  4E7K A;  4C92 C;  2AK5 A;  4E7S A;  1W1F A;  2E3I A;  4M7D C;  2K3Y A;  1M90 U;  1X01 A;  1WXT A;  1BI2 A;  4ZN3 A;  4V2S A;  3QXE B;  2W0Z A;  3PTA A;  1U06 A;  4BDY A;  2DK3 A;  1QVG A;  2DX1 A;  5GAO r;  3JCM P;  1BBZ A;  2CYZ B;  1BYM A;  1KQS S;  1NYF A;  1OQK A;  4BI4 A;  2XD0 A;  5GAN 4;  2J05 A;  2OTJ A;  3L1A A;  4DEY A;  1A0N B;  1AEY A;  4BY6 B;  4MDW A;  4OP0 A;  2GTO A;  2RF0 A;  1PRM C;  3M57 A;  2LQW A;  4ZGE B;  4FYY B;  1MUZ A;  3I56 Q;  2SEM A;  2DTH A;  4C92 E;  2K9G A;  2V1R A;  4PLL A;  3OY9 A;  1TH7 A;  4M7D E;  3JB9 H;  3QWX X;  2DXT A;  2FVU A;  2YRV A;  3QZ9 B;  3OYA A;  2RM4 A;  2F2V A;  5GAN 7;  2JNG A;  1TUG B;  2LP5 A;  3S3M A;  2KRM A;  4DBQ A;  4FCY A;  4RTT A;  1U1S A;  2EGA A;  4QW2 A;  1Y07 A;  4J9D A;  3T9N A;  1KD1 R;  1KSW A;  3M4G A;  3OMC A;  1KFZ A;  3HTR A;  1V29 B;  3CCU A;  4J5Y A;  3ULR B;  2AKK A;  4O5V A;  3UDC A;  5A0D A;  3RDV A;  2O4X A;  3QII A;  4RCB A;  1VQ9 A;  2EBP A;  4XTX A;  3EFO B;  5IXB A;  3CMA T;  1GRI A;  2DD5 A;  1M1K R;  2KEA A;  2RMO A;  1QVP A;  5GAM d;  1XQH A;  3JCM g;  2LCL A;  4F17 A;  3CC4 A;  4C92 G;  3P8B B;  3RKW A;  1E6G A;  2AIR B;  3LGF A;  3C95 A;  3VYH B;  1RAC B;  2KAF A;  4X9C A;  2ATC B;  3CC7 Q;  4M7D G;  3OYF A;  1D1A A;  4JS5 A;  2QQR A;  4M75 A;  4RUG A;  4BD3 A;  3V8K A;  4ZNX A;  1VQO T;  1YHQ A;  1D3B A;  4C0D B;  4KUL A;  1VQL Q;  2D1X A;  3FEO A;  4LXC A;  4RTY A;  4OVA A;  1HK9 A;  4JRP A;  1W6X A;  9ATC B;  3JCM J;  2KRS A;  1NJI R;  3FJ5 A;  3A98 A;  2QQS A;  4OB3 B;  3X20 B;  1K73 R;  5GAN 8;  1UGR B;  2D8H A;  2D9T A;  2GGR A;  3WXM B;  1T3L A;  4FYV B;  3M0Q A;  2BZX A;  2E3H A;  3OYM A;  4BE1 A;  3PNW C;  3H0H A;  1H8K A;  2JMA A;  2MK5 A;  2CT3 A;  2DBK A;  2QEX Q;  1I5L A;  2X3W D;  1VYT A;  1RLP C;  4BE2 A;  2OAU A;  2P4T A;  1NG2 A;  1YFN A;  4ZGJ B;  5LJ5 f;  5GMK l;  4L59 A;  1KQ1 A;  4BB7 A;  4ELY C;  1KG1 A;  2E10 A;  1ZLM A;  1BKB A;  2C06 A;  3QG1 A;  1X6G A;  1W4S A;  1YBY A;  3HFO A;  1QVG S;  2FPE A;  1FMV A;  2D0N A;  3R6N A;  1RAD B;  3JCM Q;  2M02 A;  2J7I A;  3VS7 A;  1M2V A;  1X6O A;  1Y71 A;  2E64 A;  4A4E A;  2Z0W A;  2YXY A;  2LCS A;  2RJF A;  1C0M A;  3JAM E;  1S72 T;  1OI1 A;  8ATC B;  5CK9 A;  3VRZ A;  4DOV A;  1NYG A;  1RI9 A;  3CBP A;  4A4F A;  1YJ9 Q;  3OS5 A;  4N0A C;  1VQP A;  1Y0M A;  4M77 C;  4RG8 A;  3URG A;  1PSE A;  2CSI A;  3OYD A;  4NS5 A;  4J9C A;  1B34 B;  3CCQ T;  4PFZ A;  4JPB W;  3UF4 A;  4M7A C;  1IHW A;  2B8A A;  2AZS A;  3L2Z A;  4XTW A;  1Q86 U;  5GAN 5;  1AWO A;  1FMK A;  3QJY A;  2DYB A;  2X4Y A;  3EFS A;  1SSF A;  1G5V A;  1XJW B;  4ME7 A;  2M9U A;  1K0X A;  4IIM A;  4A4K A;  5CKF A;  2JTE A;  2HBP A;  2VB6 A;  4M78 D;  2R58 A;  4EIK A;  4M7D A;  2C0O A;  4N4H A;  2CP5 A;  2LC4 A;  4M77 E;  4M78 F;  1X2Q A;  2ROT A;  1QLY A;  1MHN A;  2X35 A;  3BFM A;  5GAO p;  3FIF A;  5GAN f;  2HEQ A;  4FSS A;  3Q1J A;  3VV0 A;  1JBM A;  2CP0 A;  1BIA A;  4LN2 A;  2COW A;  3CMA Q;  1JRI A;  2CZ6 B;  4RTX A;  2MCN A;  4M7A E;  2ZPF B;  4ANJ A;  1VA7 A;  4FSX A;  1QKX A;  1WGS A; 
#chains in the Genus database with same CATH homology
 1KD1 R;  1QVF P;  1QVG P;  3CPW P;  1YHQ Q;  1VQP Q;  1VQ8 Q;  1VQM Q;  1Q86 R;  3CCV Q;  3CCQ Q;  3G6E Q;  1S72 Q;  3CC7 Q;  1Q81 R;  1YIJ Q;  1KC8 R;  1VQ5 Q;  3CCM Q;  3CCE Q;  1NJI R;  1VQN Q;  1YJW Q;  3CC4 Q;  1YJ9 Q;  1N8R R;  1VQK Q;  1VQ6 Q;  3CD6 Q;  3G71 Q;  1VQ7 Q;  2QA4 Q;  3CCU Q;  3CME Q;  2QEX Q;  1YJN Q;  3CXC P;  1Q7Y R;  3CCJ Q;  1K9M R;  1Q82 R;  1M1K R;  1K73 R;  1VQ4 Q;  3CC2 Q;  1JJ2 P;  3OW2 P;  2OTL Q;  1M90 R;  3CMA Q;  3I55 Q;  3CCS Q;  1YI2 Q;  1K8A R;  3CCL Q;  1VQ9 Q;  3G4S Q;  1VQO Q;  1W2B P;  3CCR Q;  3I56 Q;  1VQL Q;  2OTJ Q;  1KQS P;  1YIT Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...