1UE9A

Solution structure of the fourth sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
GSSGSSGEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin 2
publication title Solution structure of the fourth SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 8
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ue9A00
2EW3A 3H0IA 4DEXA 1K9AA 1A0NB 3I5RA 4K11A 2PNIA 4J9IA 1J3TA 2ED1A 2A37A 3R6NA 2FRYA 4D8DA 2DF6A 2ROLA 2O88A 4RTUA 1UJYA 2SEMA 2YDLA 1U3OA 2GBQA 1E6HA 1M3BA 2AZVA 3PVLA 3H0FA 2MCNA 2YUOA 2CT3A 2DBMA 1K1ZA 2DL5A 1YP5A 2ESWA 2HSPA 1QWFA 1UUEA 1Y57A 3EG0A 1ABOA 4LUEA 1GBRA 2X3WD 2RQTA 4DEYA 1H3HA 2KBTA 4LNPA 4CC4B 2NUZA 1X6GA 2D0NA 2RPNA 2LP5A 2DL3A 2KGTA 3EHQA 2RQUA 1WLPB 1Z9QA 1BK2A 2J7IA 1PNJA 1AWXA 1E6GA 1NYFA 2LQNA 1Y0MA 1NEGA 3QWXX 1H92A 3RNJA 1X69A 2VVKA 1VA7A 4JJBA 3IQLA 2LJ0A 1Z9ZA 1ABQA 3VRYA 3UF4A 1S1NA 2GQIA 2LJ3A 3VS2A 1AWJA 1GFDA 5FW9A 2LQWA 1UECA 3RBBB 1AZGB 2EQIA 1TUCA 2P4RA 2AKKA 2GGRA 1UHFA 1I0CA 2K79A 2OJ2A 2JMAA 4AFUC 1T3LA 2HBWA 2DNUA 1MV3A 2W0ZA 1JXMA 1NYGA 4AFQC 2EYXA 4FSSA 4QT7A 2L3PA 1AD5A 4OMOA 1U5SA 3VS1A 2OI3A 1G83A 4A63B 4Z8AA 2O9SA 4AG1C 2CREA 3M0PA 2MOXA 3CQTA 3A98A 1CSKA 4LE9A 1ZBJA 2JS2A 1JXOA 5FWBA 2DMOA 1YNZA 3M0TA 1RLQC 1PRMC 2DX1A 3VS7A 2RN8A 1QCFA 1UG1A 1YCSB 2FO0A 2D1XA 4D8KA 1T3SA 1B07A 3M0UA 1KJWA 1NLPC 2K9GA 2JT4A 3THKA 1M3AA 2LX7A 5GJWB 4J9DA 1K0XA 1ZLMA 2JM8A 1ARKA 2J06A 3I35A 1JEGA 2PZ1A 1BBZA 3TSWA 3M0SA 1H8KA 2KRMA 3EG1A 2K2MA 1JU5C 1W70A 4F16A 3REAB 1NLOC 2I0NA 1AEYA 2LNHB 3EGUA 1UFFA 2B86A 1GL5A 1AWOA 1M8MA 3TSZA 2L0AA 4Y92A 5IHKA 2FPDA 3C0CA 4IIMA 2V1QA 2KYMA 2KRSA 2SRCA 5I22A 2CDTA 1QWEA 5ECAA 1PHTA 1GCQA 3H0HA 2AK5A 1QKXA 2AZSA 3EG2A 4KRTA 3VS5A 2KROA 1M27C 1PKTA 2C0OA 1OV3A 2M51A 1VYUA 2KT8A 1UE9A 2D8HA 1SPKA 4ESRA 3VS3A 2RQWA 2ABLA 2YUQA 2MIOA 1M3CA 1KFZA 4IIOA 4F14A 4J9BA 2FG0A 2KXDA 4HVUA 5L23A 1PKSA 1TG0A 2CH4W 2GTOA 4CC2A 2KEAA 2RF0A 1UTIA 3QWYA 3SEMA 1AZEA 1SRMA 3NGPA 2X3XD 1ZX6A 2CH4A 2YT6A 3FJ5A 3M0QA 4JZ4A 2J6OA 1BB9A 4RTWA 1NEBA 3I9QA 2FEIA 3EG3A 4RTXA 5IH2A 4HCKA 3M0RA 2K3BA 1YWPA 3U23A 1OEBA 3NMZC 1SRLA 1IO6A 1GBQA 1JQQA 2FPEA 2BTTA 2YUPA 4HVVA 1SSHA 2DL7A 2H8HA 2HCKA 1UGVA 3EHRA 1G2BA 2ECZA 4Z89A 1V1CA 4J9CA 1W6XA 2CSQA 1ZUYA 2ROTA 2KT1A 2LCSA 2G6FX 2DA9A 3TVTA 2IIMA 2KR3A 4X1VA 2JW4A 1EFNA 2AKLA 2EGAA 4AG2C 2RNAA 2DBKA 2DJQA 1FMKA 2F2XA 3UATA 1KIKA 4JJDA 1ZUUA 4JJCA 1AVZC 5IXBA 2HEQA 2GNCA 1RI9A 4RTYA 1MUZA 2L3QA 2EVRA 2JXBA 5I11A 2D8JA 3VRZA 1YWOA 1SHGA 2DM1A 3H41A 1LCKA 2RQVA 1WDXA 2DLPA 2CSIA 1VYVA 1OPLA 4AFSC 1ZSGA 2OAWA 1WI7A 4J9HA 4OMQA 2QDLA 4ZNXA 1E7OA 2JS0A 1K4US 2BZXA 1RLPC 4RUGA 4GLMA 2CUBA 4AFZC 2ENMA 3ZL7C 1QKWA 2EPDA 1PWTA 2O31A 3VS6A 5IXFA 4HXJA 1QLYA 3LH5A 3KFVA 2RMOA 1T0JA 1GCQC 3I5SA 4E6RA 2F2VA 2E5KA 5HCKA 2BZ8A 2K7AA 4F17A 4WCIA 5GJVB 2LJ1A 2VWFA 4CC3A 1WXUA 3JV3A 3VS4A 5IHNA 3ULRB 1YN8A 1SEMA 2DL4A 1TUDA 2FRWA 2KE9A 4RTZA 1WA7A 4RTTA 3VS0A 2DE0X 1WX6A 1BU1A 4OMMA 4OMLA 3PE0A 2L3SA 2J05A 3GBQA 4RTVA 2DYBA 1MV0B 2EYYA 1PRLC 1X43A 3SHWA 2CUDA 1X6BA 2EGEA 2C0TA 4J9GA 2ED0A 2L2PA 1N5ZA 1WIEA 2O2OA 4JZ3A 2A28A 2F2WA 2YSQA 1X27A 1RUWA 2EGCA 1WXTA 4CC7A 1WXBA 1HSQA 1UJ0A 2GTJA 2NWMA 4Z88A 4OMNA 5EC7A 2YUNA 2VKNA 4LUDA 2KNBB 4R0KA 4GBQA 1X2KA 2A08A 3PVQA 1T0HA 1OOTA 1OPKA 1X2QA 2FPFA 5IHIA 3REBB 1GFCA 2HDAA 3UA7A 4OMPA 1FYNA 2A36A 2KXCA 2BZYA 1WFWA 2JTEA 1JO8A 4HVWA 4M4ZA 1CKAA 2J6FA 4LN2A 1KSWA 2M0YA 1M30A 1WYXA 1K0SA 1VYTA 2W10A 2V1RA 2DRKA 1HD3A 3UA6A 2J6KA 1HJDA 3NHNA 2DRMA 2PTKA 1UHCA 2DL8A 2CT4A 2O9VA 1B3QA 2K6DA 4ORZA 2EYWA 3NPFA 1SHFA 1GCPA 1W1FA 2EBPA 4JPBW 1I1JA 1ZUKA 2XMFA 1CKBA 2JMCA 1GRIA 2EKHA 1AOJA 1I07A 1K76A 2RQRA 2DVJA 2KYBA 1AWWA 2EYZA 3O5ZA 4J9EA 5FWCA 1NG2A 1UDLA 2LZ6B 2LMJA 1U06A 2DILA 2JM9A 2C0IA 2KRNA 1NM7A 4EIKA 4J9FA 1XOVA
chains in the Genus database with same CATH superfamily
1ZQ1A 3H0IA 4DEXA 1YHQA 4X9DA 1YJ9A 1J3TA 3R6NA 3CBOA 5LJ5e 3CCVA 1ZA2B 2DF6A 2ROLA 5HK3A 4HT8A 4RTUA 4CRIA 3HRTA 4M75G 4E7LA 1VQMQ 1E6HA 1M90U 4AT1B 1OQKA 3H0FA 2CT3A 3EH1A 2KMTA 1M1KU 2YWWA 3RKWA 1BCOA 5C6SA 4QQGA 2ESWA 1Y71A 3EG0A 3OYKA 2V26A 2RQTA 4EMKA 5FROA 4ANJA 2KBTA 4B9WA 3CCQT 3MEAA 4OMFB 2CS7A 4MZMA 2KGTA 1X6OA 2RQUA 1Q7YR 1Z9QA 3MCAB 2EQUA 1PNJA 1AWXA 1NYFA 2KVQG 4JDSA 2DZ9A 2AHJB 3JCMV 3V7RA 2X51A 3RNJA 3LWHA 2VVKA 3IQLA 3E1SA 5IN1A 3UF4A 1GFDA 2O4XA 4C8QE 1KD1U 2LQWA 1VQ9T 2CP6A 1AZGB 1TUCA 1UHFA 2X4YA 5M9OA 1T3LA 3G6ET 3CCMQ 5GAMf 1JXMA 4M77D 3G71A 1VIFA 3URGA 4FSSA 1QP2A 2ATCB 3RESA 3FLGA 1U5SA 1MMGA 3VS1A 5LJ5g 1D09B 1TWBA 1N8RC 2YHTA 1QP3A 1IB8A 1M5Q1 4PJOC 1CSKA 4LE9A 2KI7A 4OVAA 4ZTJA 4L59A 1RLQC 3OYYA 3M59A 4RCCA 4IUVA 1B34A 1BKBA 3A8MB 4M78C 2PVGB 2DXBA 4M75F 1IZ6A 3CCQA 4M78E 3OS0A 3FEOA 3GLXA 2FO0A 1MGQA 3MP8A 7AT1B 2E64A 2HSEB 2O01E 5C0MA 4XQ3A 1T3SA 1PM3A 2JZ2A 2K9GA 4ELYC 2LX7A 2K5LA 4KULA 2COYA 3HPWA 4CI0C 3QZ5B 1D1BA 2P0PA 5GAMe 3G1JA 2L5QA 3I35A 3M4GA 3I56Q 2P4TA 3QJ6A 3CMAQ 1BBZA 4M77B 1VQ9A 1FWZA 1H8KA 5GAN2 1Q7YU 3PIPA 1OI1A 3M53A 1JU5C 2CZ1B 3TQ7P 3EFRA 4FU6A 5DLOA 2G3RA 1VQ8T 2RHIA 3G6EA 4IURA 1VQOT 1EX4A 5LJ5j 1H641 2ZPHB 2E3HA 4C0GA 5IHKA 4A4EA 3C0CA 1BYMA 2DTHA 2LDMA 4IIMA 2FYKA 2QTXA 1VQMT 1UGSB 1QWEA 3CBMA 1K9MC 3RMQA 2ZAEA 1UEBA 2MMPA 5FU7C 3H0HA 2AZSA 3EG2A 2FVUA 4KRTA 3FC3A 1MHNA 3JCMg 1NPRA 4KT0E 5GAOn 1MMAA 1OV3A 2QXFA 1YBYA 5D6WA 3A5ZB 3JB9I 2ABLA 3OYIA 2YUQA 2XD0A 4IIOA 4J9BA 2E1HA 4JRIA 3EGXB 5GAN3 2CP3A 3D7SB 2K5FA 2RF0A 1SRMA 2X3XD 1ZX6A 2L3RA 1VQPT 4XU3A 1NEBA 2XU8A 1G3TA 2COZA 2DD5A 4L6V5 1H3ZA 1Y96B 4RMOA 2FEIA 3EG3A 4C8QA 3S3MA 1YI2T 3QPHA 1VQ8A 2K3BA 3U23A 1OEBA 3NMZC 1SRLA 1IO6A 1GBQA 1VQOA 2RHZA 4IUQA 4M7AD 2QASA 3OSSC 2EJ9A 4HVVA 3BFMA 1SSHA 2Z0WA 2DL7A 2R5AA 1UGVA 3TEEA 1RL2A 2HQXA 1BI3A 1BI0A 4WTOB 3GP8A 1ZUYA 2ROTA 4C0DC 4E7KA 2KT1A 3TVTA 4C8QG 3QXEB 5LJ5d 1EFNA 3VUBA 3JB9G 2E3IA 2HQHA 1KIKA 4JJDA 2MF2A 4JJCA 4DA4A 1Y7XA 2QEXT 2HEQA 2CZ6B 1RI9A 2RHUA 3OSVA 3JCMW 4XTWA 1QW1A 1C0MA 3HRUA 5CKDA 4PLIA 5GAN8 4O6JA 2OTJT 1YWOA 2QG9B 3H41A 4BDZA 1LCKA 2DLPA 2CSIA 2QQRA 1RACB 3QBYA 5DM7R 4J9HA 4OMQA 1E7OA 2I2LA 4PLLA 2JS0A 1RLPC 2LVMA 1VQPA 3ZL7C 2IVWA 1TS9A 2XDPA 2QYZA 3VS6A 5LJ5h 3LH5A 4M7AB 2RMOA 1YI2A 5FLXE 3I5SA 4JS4A 3JCMX 2BZ8A 2K7AA 2M1HA 4IUTA 4M78G 9ATCB 4KUDK 1VQ4T 2DTIA 3CC4T 3VS4A 5IHNA 2DVEA 4LDYA 1GXIE 3LYIA 2DL4A 1WA7A 4C0ZA 4FW1A 4UC4A 5KYNA 4J5YA 1Q81C 1G3SA 2DYBA 1M4ZA 2F5KA 1WJSA 4OGEA 3CCJQ 1X43A 5GAOl 1X6BA 2EGEA 4XK8E 2ED0A 1N5ZA 4F7UE 3BDLA 2QEXA 1YJNT 2A28A 1YHQQ 3PFSA 1RUWA 1YJ9Q 3M58A 4JLGA 5IT9E 4QKUA 4EPCA 5GANg 2V8KA 1UJ0A 3JCMd 3JB9D 4C8QF 2OTJA 4XAXB 2EJGA 5KYUB 1YIJT 2HBPA 4LUDA 4MDXA 4GBQA 3C94A 4M77E 1T0HA 2XHCA 1OOTA 1X2QA 3X25B 5IHIA 2E4HA 2V8JA 3M5AA 4IUUA 4OMPA 2KXCA 4BI4A 2JTEA 3GNGA 4NS5A 2J6FA 3X26B 2XDBA 3L2VA 3LGLA 1RI0A 1M30A 4FSXA 2LQKA 1MNDA 4PJOD 3KXTA 2DRKA 2NUTB 1U8RA 1QVFP 4E2FB 4DBHA 3LWIA 1VQ4A 1D0ZA 3CC4A 3NHNA 1QVGP 4X9CA 4BE1A 1UHCA 2DL8A 3CXCS 3CXCA 5GAOp 2QDYB 3L2ZA 3OA6A 4N0AC 1GCPA 2P84A 4E7IA 2K3XA 4MZPA 4JPBW 1I1JA 4M78F 2XMFA 4NOYA 4J7IA 2EKHA 2LT4A 2RQRA 3OBYA 3O5ZA 3G71Q 2ZGWA 2IG0A 2JOYA 1YJNA 2LZ6B 2JJ9A 2JVVA 5GANj 3BY7A 5GAMh 1VQKT 1SG5A 4J7FA 5KE3A 4QQ6A 1Q82R 1QCOA 1X01A 3C95A 2MI6A 2EW3A 1YIJA 1K9AA 1G3WA 5EG2A 2A37A 1BCMA 1WHGA 3ER0A 2SEMA 1R0CB 4TVRA 4PJOB 2GBQA 5GMKi 1M3BA 1OYXA 2YUOA 3CCQQ 8ATCB 2D9TA 2AT1B 3QHSA 1LJOA 3M9QA 2X4XA 1ABOA 4HCZA 1QVPA 2X3WD 2EQJA 4CC4B 4BACA 2MPXC 2LP5A 3QUIA 2DL3A 3EHQA 1XTDA 4FYXB 2J7IA 1H92A 1VQ9Q 1VQNT 2QI2A 2VASA 1VA7A 4JJBA 1OX9A 2YXYA 1S1NA 3G6EQ 2GQIA 2LJ3A 3RUXA 2DJZA 1PSEA 1UECA 5GMKm 2P4RA 3VUZA 3CCUT 1VQKA 1I0CA 2K79A 1PG5B 2JMAA 2HBWA 1MV3A 2W0ZA 1IGQA 2KQWA 5CQXA 1NYGA 4DQ2A 2EYXA 1RAIB 1AD5A 4OMOA 8AT1B 2A0FB 4M7AC 2GFAA 4BD3A 4BY6B 4Z8AA 4M7AE 2O9SA 4M77A 4AG1C 2CREA 1WPYA 5GANd 3DLMA 5A2QE 4IUPA 3X28B 2JS2A 1Q82U 1BI1A 4F7UG 1M1FA 1YNZA 3LX7A 3M0TA 3EAEA 1XNIA 2DX1A 4PFOA 3BW1A 3VS7A 2LRQA 3FB9A 1QQJA 4M77G 1QCFA 3FJPA 1BI2A 4ZGJB 3I55T 4D8KA 4M75A 1B07A 3M0UA 1KJWA 2JT4A 1M3AA 4BI8B 4JRPA 1VQNA 5GJWB 4J9DA 2RK2A 4E7HA 2NUPA 1ZLMA 4YTLA 2J06A 1VQ8Q 4BI3A 2EWNA 1VQOQ 1M8VA 3RDVA 3HSBA 3TSWA 1WQWA 4FCYA 3EGXA 3CCUA 2DTOA 3CPWP 1W70A 3PT9A 1X75C 1AEYA 4PJMA 1W2BP 2GQVA 3QIIA 5CKEA 1UFFA 2B86A 1ZSZB 1GL5A 2WSCE 1OU8A 4KH0B 1M8MA 2L0AA 4PJNA 1I4K1 3JCMc 2V1QA 2X9HA 3GOXA 2KRSA 1Q81R 3SWNC 3RKXA 3LW5E 1JRIA 4C0DB 3VS5A 4HT9A 1PKTA 1RAHB 2JTFA 4LDUA 3OW2S 2RJFA 4PKCC 3V8LA 3OW2A 3E9GA 4ESRA 2RQWA 4QVZA 3X20B 2MIOA 1KFZA 2CP2A 2L89A 5KCOA 3I55A 2KXDA 4HVUA 1KQSP 1PKSA 1VQPQ 4CC2A 5LJ3f 3OBWA 1YI2Q 2E65A 2YRCA 4WF2A 3QWYA 3SEMA 3G4ST 2LT1A 2CH4A 2RJDA 2KSSA 2YT6A 3FJ5A 3M0QA 4M77F 2J6OA 2XICA 4M7DC 3I9QA 4N4HA 4M7DE 4E7JA 3M0RA 1G8XA 5I2SA 4PJOE 2BTTA 3CPFA 3RIRA 3HHTB 2QGGA 2R5MA 2HCKA 1RABB 1G2BA 5CQYA 3KBGA 3CEYA 4M7AA 4Z89A 3VJPA 3SDZA 2QEXQ 3V8KA 3F70A 4E7ZA 3QZ9B 2LCSA 3FDRA 1TXQA 2EGAA 3P8DA 2D6FA 2JUFA 2OTJQ 3UATA 4F7UB 5LJ3e 1AHJB 4A54A 3NTIA 2RK1A 1Q81U 2L8DA 2L3QA 1R77A 2EVRA 3J81E 5HK0A 4BE0A 4HA8A 3MEUA 1NPPA 4M7AG 1SHGA 1JJ2S 5KYYB 2RQVA 1JJ2A 1VYVA 4AFSC 1FMWA 1AT1B 1OZ2A 3G4SA 1K4US 2VV5A 4DOVA 2XI9A 2CUBA 1JBMA 3L2RA 1VQ4Q 2GFUA 2ENMA 4LD9K 3PNWC 3GPLA 4BY6C 3CC4Q 2EPDA 3HRSA 5CK9A 5KYUA 1IXDA 4JLIA 1GCQC 2EJFA 1D0YA 4MZTA 4F17A 4WCIA 2LJ1A 3L2UA 5GAOq 1WXUA 2LTOA 2YLCA 1TUDA 2FRWA 1OZ3A 4RKUE 4RTTA 2DE0X 3MPUB 2LNVA 4ZN1A 2NUTA 1YJNQ 1HXDA 4RTVA 3SHWA 2M02A 3ZEHA 2CUDA 3A8HB 3QYHB 2LCCA 4ME7A 4J9GA 2O2OA 1YIJQ 3QKJA 4JZ3A 5GAMg 1X27A 4JS5A 1PCXA 5AYFA 2E6NA 4CC7A 2QGFB 3LH0A 4PFZA 1N6AA 4Z88A 2NWMA 1SKUB 4OMNA 5GAN4 3AHUA 3ME9A 2YUNA 4R0KA 3L1AA 1X2KA 3PVQA 2HDAA 4KBMB 2DAQA 3CC7T 1ZSZC 2A36A 2BZYA 4C92C 1ZHIA 4JJNK 4M4ZA 1CKAA 2PUOB 3EGDA 4M7AF 4LN2A 2CYZB 4C92E 2M0YA 2JN0A 2MWPA 1K0SA 3P8BB 4XTZA 3OYCA 2M16A 3UA6A 4C0FA 2DRMA 4Z02A 4FYWB 2CT4A 2DO3A 2VUBA 4PJOA 2O9VA 4DOWA 2CKKA 3VKIA 2EYWA 2IPOB 2XG8D 1SHFA 1W1FA 1C1AA 2DERA 1QCNA 4QVDA 1ZUKA 2PVDB 2RD1A 1VQKQ 2DXCA 4M78A 2DVJA 2RH2A 4ELZC 5GAMj 5J39A 1KD1C 1UDLA 1TSFA 2B8AA 2MWOA 4PJOG 2JM9A 1NM7A 4EIKA 3MJXA 3P8HA 4O5VA 2LC4A 1A0NB 3I5RA 4K11A 1VQ7T 2K5IA 2PNIA 1D3BB 2DD4A 2ED1A 2FRYA 2RJEA 4D8DA 1XJWB 3FIFA 2HD0A 3CC7A 2O88A 1I8FA 1UJYA 1R8OB 2YDLA 2M9UA 2PVOB 1LPLA 1I5LA 2AZVA 3PVLA 4QQDA 2XIDA 2MCNA 3WVDB 2DBMA 1K1ZA 2ZCFB 1YP5A 1B34B 2HSPA 1QWFA 1UUEA 1Y57A 4PJJA 1DJ7B 4Q5WA 4DEYA 1H3HA 2HMAA 1VQNQ 4LNPA 5A0DA 4LXCA 2NUZA 1X6GA 2D0NA 4KH1B 3S3NA 2WSFE 1EZZB 1N9RA 2EKOA 1BK2A 2HNIA 3C12A 1Y0MA 1NEGA 1LVKA 3QWXX 4JRQA 1X69A 3CCUQ 2LJ0A 5KYWB 1Z9ZA 3MKDA 1ABQA 3VV0A 2ZZDA 3E19A 2OAUA 4RG8A 1KQ1A 3JB9F 1AWJA 5FW9A 1K8AC 4OB2B 1N8RR 2X4WA 3CD6T 2FB7A 3RBBB 3EG9B 2EQIA 2AKKA 1WHMA 5GMKe 3UDCA 2BKDN 2OJ2A 2XKOC 2HL5C 4M7DD 4AFQC 1VQ6T 5A0LA 2DXTA 5CVIA 2L3PA 5KYXA 1VQ7A 3PMIA 1G83A 4A63B 3RMSA 5GAMd 5CO7A 5CKHA 4PJOF 2MOXA 1UB4A 2PQWA 3SWNB 3A98A 3INZA 4JUVA 2HZYA 5FWBA 1WNLA 1KHCA 3OYAA 3I55Q 1KG1A 1PRMC 2ZPFB 2Y90A 4KGZB 2FL7A 4C5EA 2EFIA 1YCSB 1OX8A 5LJ3h 4II1A 2EAYA 4OB1B 4PL6A 1U1TA 1K0XA 1PD1A 4C92G 2JM8A 3OS2A 1Y07A 3O8VA 3L2QA 2QA4Q 1TUGB 3CD6A 2QQ9A 2PZ1A 4HCCA 5GAOm 4M7DB 2COWA 3EG1A 2K2MA 4B6MA 1K9MR 3CBPA 3JB9J 2I0NA 4C5HA 4QW2A 3EGUA 3UWNA 1VQ6A 2CP7A 1Q86C 3M57A 4Y92A 2FPDA 2A7YA 1N8RU 1C6VX 4DBQA 4EMKC 2KYMA 2MYSA 2CDTA 1PHTA 2VXEA 1WZOA 2DEQA 4DBRA 1SSFA 4OGCA 1HYOA 2K57A 2VGMA 2DETA 3QYGB 2OTLT 5IAYA 4EMHA 4NL3A 1UE9A 1SPKA 2D0QB 2PU9B 1V76A 3G4SQ 1KQ2A 5L23A 3A1PA 4E47A 1TG0A 2CH4W 2GTOA 3CC2T 1HK9A 4RG2A 4F7UA 2ZPBB 3OY9A 2H3EB 4XTVA 2CP5A 2ZPIB 3OYEA 1BB9A 3M54A 1PC0A 5HKCA 5KYYA 4MDWA 4J6WA 4C92D 4KGXB 5FRNA 1G5VA 1YJWT 5CKBA 2H3JA 4MMLA 4ZGEB 2YUPA 2DIQA 2MK5A 3EHRA 2NLUA 5CIUA 5CKFA 2HAXA 3L2WA 4R56A 2ECZA 1V1CA 4FYYB 1K9MU 3MP1A 2C06A 3CXCP 2G6FX 2DA9A 3JAME 2IIMA 1VQ5T 3OYGA 3PTAA 4EDUA 2KR3A 4X1VA 2JW4A 2DBKA 2F2XA 3SD4A 2OTLA 4XU1A 1AVZC 3JSCA 2P0QA 2CZ0B 4N0AA 2GNCA 4RTYA 5AT1B 1R0BG 5I11A 3CMET 3QO3A 2D8JA 2YRDA 3DKMA 4LDVA 2DM1A 3TREA 3PIOA 1YITT 3CC2A 1WDXA 1M2VB 2OAWA 3CCST 1WI7A 2QDLA 5KH6A 2QA4T 2BZXA 4RUGA 4GLMA 4C92B 1ZA1B 3UT1A 2VGNA 1PWTA 3X24B 2O31A 4A4HA 2LQ8A 2QAZA 5CCAA 1Y96A 4FIBA 3CCET 1LNXA 4E6RA 2F2VA 3CCLT 4FT4A 5HCKA 4BE2A 4OB0B 1YJWA 1V29B 4CC3A 6AT1B 1S72T 4ZTFA 3DB3A 3ULRB 1YN8A 2QK0A 1OU9A 2FZCB 3WVEB 4RTZA 2KE9A 1KK7A 4J83A 3VS0A 1UGQB 3EFOB 4OMLA 3PE0A 3GBQA 3OQ5A 4DBFA 1VUBA 2V8IA 1VQLT 1FMVA 1MV0B 1VQ5A 2EYYA 1K8AR 4F7UF 4XTYA 2C0TA 3JCMf 1WIEA 1U1SA 3JRZA 2F2WA 2EGCA 1WHJA 5DLQE 1WXBA 3CMEA 2ZPEB 1TOVA 3CC7Q 3S3OA 2DK3A 1K73C 2GTJA 4C8QC 3OB9A 5EC7A 1YITA 3OS5A 2FZKB 2VKNA 2KNBB 2A08A 1OULA 5GMKh 3JCMJ 2CP0A 2FPFA 4NL2A 3REBB 3CCSA 4BB7A 4PJLA 3RR6A 3LLRA 1FYNA 5CR2A 3HFNA 2QA4A 3OMGA 1M2OA 1WFWA 1LOJA 3JB9H 1JO8A 1EIFA 1KSWA 3RERA 1WYXA 1D1CA 1VYTA 3CCEA 4FT2A 1D3BA 3CCLA 2RB6A 2VXFA 2W10A 4BDYA 3HL8A 3GF5A 2BE7D 2J6KA 1HJDA 1S72A 3M4YA 4C5GA 2PTKA 3NTKA 3V8JA 2K6DA 2KAFA 4ORZA 3JCMe 5L8RE 1NJIC 1IGUA 1G3YA 5GAOr 3C4SA 1CKBA 4M75D 1GRIA 2CZ7B 5J26A 1VQLA 4XU2A 2OX7A 2KYBA 2QQSA 4HCBA 3OYLA 1VQ7Q 2LMJA 1U06A 3M55A 2FHDA 2C0IA 2E6ZA 1Q86R 5D7UA 1XOVA 5KYWA 1F1BB 3CCRT 1YCYA 1K8AU 3ZFJA 2WACA 3TCJA 4J9IA 1TH7A 3EG9A 1W4SA 4A4KA 1IREB 2GCXA 1KC8C 4HKEA 1U3OA 3QDRB 1BIAA 4N4IA 1Q82C 3PMTA 2VYTA 1O9SA 3OYMA 4E7SA 2DL5A 1NE8A 3RKYA 2WSEE 1I5OB 4LUEA 1GBRA 3A8GB 1M1GA 3SWNA 3BE3A 2EIFA 3E9FA 2RPNA 4R55A 5LJ3g 4M75B 2MAMA 3OMCA 3OW2P 1WLPB 4V2SA 3PGGA 2ZPGB 1PSFA 3CD6Q 4OB3B 1IRXA 1E6GA 2LQNA 5D6XA 2NUPB 3JCMQ 1MNEA 4B9XA 3L42A 3M56A 4C5IA 3T9NA 3META 2F69A 4Y28E 3VRYA 2E41A 3OYBA 1FXXA 3VS2A 1VQ6Q 4FL6A 2KY9A 4FW2A 2GGRA 1TTHB 4N4GA 1MMNA 2K3YA 4X34A 3OYDA 4AFUC 1WHLA 2DNUA 2BIVA 2XK0A 4QT7A 5KE2A 3OYJA 3CCRA 5GANf 1M90C 2QTVA 2OI3A 2Y4XA 1M1KC 1RADB 1WJRA 4M7DA 1IHWA 1B7TA 4EMKB 3CCMT 3M0PA 3CQTA 4IKFA 3R6OA 1QVFS 4A4FA 1ZBJA 4EMGA 1QVFA 1Q86U 1JXOA 2DMOA 1QVGS 3HP9A 2HKNA 3OS1A 1QVGA 3KUFA 3HFOA 2DYIA 4QVCA 1VQMA 4AMCA 1BIBA 5LJ3j 2RN8A 1RAEB 1WGSA 4M7DG 1UG1A 1VOMA 2E12A 2D1XA 2O4XB 3EH2A 1NZ9A 5GAN6 1D0XA 1NLPC 3THKA 2DFUA 1ZBXA 2F5TX 3VYHB 1ARKA 1JJ2P 2DZCA 3H9NA 1JB0E 5GANe 1JEGA 2VB6A 3M0SA 3VU3C 2F1LA 2EQMA 2KRMA 3ASKA 2EQKA 5FRMA 4F16A 2X4JA 3REAB 1NLOC 3UPUA 2LNHB 3Q1JA 3I56T 4BUGA 1AWOA 2EYQA 3DLLA 3CMAT 1WHKA 2VC8A 3H8ZA 3OYFA 5HY6A 3TSZA 1PD0A 2SRCA 3ZBDA 3CCMA 5I22A 1P92A 4J6YA 2OTLQ 4J8OA 5ECAA 1GCQA 3EFSA 1NBEB 2GF7A 2AK5A 1QKXA 2KROA 1M27C 3QSUA 3HKSA 2C0OA 3MHXA 2M51A 1VYUA 2KT8A 3QDFA 5FU6B 3CC2Q 2D8HA 3VS3A 1K73R 5LL6S 1M3CA 4RCBA 4D6WA 4F14A 2FG0A 3SB2A 2K4YA 4GLKA 3TU4K 4LD6A 2KEAA 1Q7YC 2FZGB 2P0KA 5I21A 2E10A 1FX7A 1IHVA 1UTIA 3CCVQ 4C8QD 1AZEA 3NGPA 5LJ3d 5GAN5 4JZ4A 1YJWQ 4M7DF 2DIGA 4M77C 4RTWA 2DXUA 2E5QA 1M2VA 4RTXA 5IH2A 2HL3A 1UGRB 3NTHA 3G7ZA 4HCKA 1N9SA 1YWPA 5D6YA 3VYGA 3I56A 1JQQA 2FPEA 3CMAA 3FRNA 1ZSZA 4C92A 3A8OB 1VQ5Q 1NJIR 2H8HA 1XQHA 3QG1A 4ZGDB 3NFCA 2KK4A 3V7SA 4J9CA 3S6WA 1W6XA 2CSQA 1ACMB 1KHIA 1MMDA 4M75C 3V7CA 2AKLA 4AG2C 3CMEQ 3JCMh 4M75E 3SFMA 2RNAA 4L5GA 2DJQA 1FMKA 3DB4A 3MEVA 5GMKl 2AIRB 4LDWA 1YITQ 1ZUUA 1RAAB 4M78D 4PFPA 5IXBA 4OP0A 1UGPB 3EFOA 3CCSQ 1MUZA 1QMCA 2JXBA 3VRZA 4C8QB 2NYSA 3BDUA 1OPLA 2HKQB 1ZSGA 1KC8R 4ZNXA 3CCEQ 3CCLQ 3JCMb 3CPWS 3H6ZA 1K73U 3EGDB 3CPWA 4AFZC 1RAGB 1W2BS 1QKWA 1S72Q 1W2BA 3GIBA 5IXFA 4HXJA 1QLYA 4PK4A 3KFVA 4GY5A 3OYHA 1T0JA 4JRKA 2Y4YA 2E5KA 2JNGA 5GJVB 3E2UA 4LDXA 2VWFA 3JV3A 1YFNA 1O75A 1VQLQ 3MO8A 4J6XA 1SEMA 2X35A 2RI5A 1WX6A 1BU1A 4OMMA 2RHYA 2L3SA 4Y91A 2J05A 4KUIA 4A4GA 2K2VA 4M78B 2RM4A 1PRLC 2YLBA 1N27A 3AT1B 1NJIU 2L2PA 4ATOA 5CAIA 1KQSS 2YSQA 4OF1A 4XU0A 1KQSA 1WXTA 3CCJT 2BE9B 1HSQA 3HTRA 2HQEA 1M90R 5GMKj 5A0GA 2R57A 2RI3A 4FM4B 4XTUA 1M1KR 2DKGA 5J3BA 5I2MA 1YHQT 1YJ9T 1OPKA 3CCVT 5DY9A 1GFCA 2PUKB 3UA7A 4C92F 1RAFB 3A8LB 4HVWA 3J7AF 4P5NA 4XTXA 1WHHA 2M0OA 2R58A 3WXMB 1WJQA 2KDSA 5LJ5f 2V1RA 2JTMA 1HD3A 5GAN7 3MEWA 2RO0A 3LGFA 5KCHA 1KC8U 1WQ7A 2DEUA 2QQBA 2E70A 1I81A 1Q95G 4ZN3A 4KGVB 5FU7B 1B3QA 3GNFB 1D1AA 1KD1R 1M9SA 2YRVA 3NPFA 2RHXA 5FU6C 2BUDA 4FYVB 2CGHA 2XDDA 1SF9A 2EBPA 2A3LA 4VUBA 4A53A 2RA2A 2DPPB 4PNOA 2JMCA 2RJCA 4MMKA 2LX9A 3QJYA 1AOJA 1I07A 1K76A 1AWWA 2EYZA 4J9EA 3CCRQ 2RI2A 5FWCA 1NG2A 1TU0B 2DILA 3J80E 2LCLA 4F04B 3OYNA 3CCJA 2KRNA 1VIEA 3MP6A 5GANh 3N5BB 3JCMP 5KYXB 4J9FA 2QQAA 3G71T
chains in the Genus database with same CATH topology
2EW3A 3H0IA 4DEXA 1K9AA 1A0NB 3I5RA 4K11A 2PNIA 4J9IA 1J3TA 2ED1A 2A37A 3R6NA 2FRYA 4D8DA 2DF6A 2ROLA 2O88A 4RTUA 1UJYA 2SEMA 2YDLA 1U3OA 2GBQA 1E6HA 1M3BA 2AZVA 3PVLA 3H0FA 2MCNA 2YUOA 2CT3A 2DBMA 1K1ZA 2DL5A 1YP5A 2ESWA 2HSPA 1QWFA 1UUEA 1Y57A 3EG0A 1ABOA 4LUEA 1GBRA 2X3WD 2RQTA 4DEYA 1H3HA 2KBTA 4LNPA 4CC4B 2NUZA 1X6GA 2D0NA 2RPNA 2LP5A 2DL3A 2KGTA 3EHQA 2RQUA 1WLPB 1Z9QA 1BK2A 2J7IA 1PNJA 1AWXA 1E6GA 1NYFA 2LQNA 1Y0MA 1NEGA 3QWXX 1H92A 3RNJA 1X69A 2VVKA 1VA7A 4JJBA 3IQLA 2LJ0A 1Z9ZA 1ABQA 3VRYA 3UF4A 1S1NA 2GQIA 2LJ3A 3VS2A 1AWJA 1GFDA 5FW9A 2LQWA 1UECA 3RBBB 1AZGB 2EQIA 1TUCA 2P4RA 2AKKA 2GGRA 1UHFA 1I0CA 2K79A 2OJ2A 2JMAA 4AFUC 1T3LA 2HBWA 2DNUA 1MV3A 2W0ZA 1JXMA 1NYGA 4AFQC 2EYXA 4FSSA 4QT7A 2L3PA 1AD5A 4OMOA 1U5SA 3VS1A 2OI3A 1G83A 4A63B 4Z8AA 2O9SA 4AG1C 2CREA 3M0PA 2MOXA 3CQTA 3A98A 1CSKA 4LE9A 1ZBJA 2JS2A 1JXOA 5FWBA 2DMOA 1YNZA 3M0TA 1RLQC 1PRMC 2DX1A 3VS7A 2RN8A 1QCFA 1UG1A 1YCSB 2FO0A 2D1XA 4D8KA 1T3SA 1B07A 3M0UA 1KJWA 1NLPC 2K9GA 2JT4A 3THKA 1M3AA 2LX7A 5GJWB 4J9DA 1K0XA 1ZLMA 2JM8A 1ARKA 2J06A 3I35A 1JEGA 2PZ1A 1BBZA 3TSWA 3M0SA 1H8KA 2KRMA 3EG1A 2K2MA 1JU5C 1W70A 4F16A 3REAB 1NLOC 2I0NA 1AEYA 2LNHB 3EGUA 1UFFA 2B86A 1GL5A 1AWOA 1M8MA 3TSZA 2L0AA 4Y92A 5IHKA 2FPDA 3C0CA 4IIMA 2V1QA 2KYMA 2KRSA 2SRCA 5I22A 2CDTA 1QWEA 5ECAA 1PHTA 1GCQA 3H0HA 2AK5A 1QKXA 2AZSA 3EG2A 4KRTA 3VS5A 2KROA 1M27C 1PKTA 2C0OA 1OV3A 2M51A 1VYUA 2KT8A 1UE9A 2D8HA 1SPKA 4ESRA 3VS3A 2RQWA 2ABLA 2YUQA 2MIOA 1M3CA 1KFZA 4IIOA 4F14A 4J9BA 2FG0A 2KXDA 4HVUA 5L23A 1PKSA 1TG0A 2CH4W 2GTOA 4CC2A 2KEAA 2RF0A 1UTIA 3QWYA 3SEMA 1AZEA 1SRMA 3NGPA 2X3XD 1ZX6A 2CH4A 2YT6A 3FJ5A 3M0QA 4JZ4A 2J6OA 1BB9A 4RTWA 1NEBA 3I9QA 2FEIA 3EG3A 4RTXA 5IH2A 4HCKA 3M0RA 2K3BA 1YWPA 3U23A 1OEBA 3NMZC 1SRLA 1IO6A 1GBQA 1JQQA 2FPEA 2BTTA 2YUPA 4HVVA 1SSHA 2DL7A 2H8HA 2HCKA 1UGVA 3EHRA 1G2BA 2ECZA 4Z89A 1V1CA 4J9CA 1W6XA 2CSQA 1ZUYA 2ROTA 2KT1A 2LCSA 2G6FX 2DA9A 3TVTA 2IIMA 2KR3A 4X1VA 2JW4A 1EFNA 2AKLA 2EGAA 4AG2C 2RNAA 2DBKA 2DJQA 1FMKA 2F2XA 3UATA 1KIKA 4JJDA 1ZUUA 4JJCA 1AVZC 5IXBA 2HEQA 2GNCA 1RI9A 4RTYA 1MUZA 2L3QA 2EVRA 2JXBA 5I11A 2D8JA 3VRZA 1YWOA 1SHGA 2DM1A 3H41A 1LCKA 2RQVA 1WDXA 2DLPA 2CSIA 1VYVA 1OPLA 4AFSC 1ZSGA 2OAWA 1WI7A 4J9HA 4OMQA 2QDLA 4ZNXA 1E7OA 2JS0A 1K4US 2BZXA 1RLPC 4RUGA 4GLMA 2CUBA 4AFZC 2ENMA 3ZL7C 1QKWA 2EPDA 1PWTA 2O31A 3VS6A 5IXFA 4HXJA 1QLYA 3LH5A 3KFVA 2RMOA 1T0JA 1GCQC 3I5SA 4E6RA 2F2VA 2E5KA 5HCKA 2BZ8A 2K7AA 4F17A 4WCIA 5GJVB 2LJ1A 2VWFA 4CC3A 1WXUA 3JV3A 3VS4A 5IHNA 3ULRB 1YN8A 1SEMA 2DL4A 1TUDA 2FRWA 2KE9A 4RTZA 1WA7A 4RTTA 3VS0A 2DE0X 1WX6A 1BU1A 4OMMA 4OMLA 3PE0A 2L3SA 2J05A 3GBQA 4RTVA 2DYBA 1MV0B 2EYYA 1PRLC 1X43A 3SHWA 2CUDA 1X6BA 2EGEA 2C0TA 4J9GA 2ED0A 2L2PA 1N5ZA 1WIEA 2O2OA 4JZ3A 2A28A 2F2WA 2YSQA 1X27A 1RUWA 2EGCA 1WXTA 4CC7A 1WXBA 1HSQA 1UJ0A 2GTJA 2NWMA 4Z88A 4OMNA 5EC7A 2YUNA 2VKNA 4LUDA 2KNBB 4R0KA 4GBQA 1X2KA 2A08A 3PVQA 1T0HA 1OOTA 1OPKA 1X2QA 2FPFA 5IHIA 3REBB 1GFCA 2HDAA 3UA7A 4OMPA 1FYNA 2A36A 2KXCA 2BZYA 1WFWA 2JTEA 1JO8A 4HVWA 4M4ZA 1CKAA 2J6FA 4LN2A 1KSWA 2M0YA 1M30A 1WYXA 1K0SA 1VYTA 2W10A 2V1RA 2DRKA 1HD3A 3UA6A 2J6KA 1HJDA 3NHNA 2DRMA 2PTKA 1UHCA 2DL8A 2CT4A 2O9VA 1B3QA 2K6DA 4ORZA 2EYWA 3NPFA 1SHFA 1GCPA 1W1FA 2EBPA 4JPBW 1I1JA 1ZUKA 2XMFA 1CKBA 2JMCA 1GRIA 2EKHA 1AOJA 1I07A 1K76A 2RQRA 2DVJA 2KYBA 1AWWA 2EYZA 3O5ZA 4J9EA 5FWCA 1NG2A 1UDLA 2LZ6B 2LMJA 1U06A 2DILA 2JM9A 2C0IA 2KRNA 1NM7A 4EIKA 4J9FA 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EW3 A;  3H0I A;  4DEX A;  1K9A A;  1A0N B;  3I5R A;  4K11 A;  2PNI A;  4J9I A;  1J3T A;  2ED1 A;  2A37 A;  3R6N A;  2FRY A;  4D8D A;  2DF6 A;  2ROL A;  2O88 A;  4RTU A;  1UJY A;  2SEM A;  2YDL A;  1U3O A;  2GBQ A;  1E6H A;  1M3B A;  2AZV A;  3PVL A;  3H0F A;  2MCN A;  2YUO A;  2CT3 A;  2DBM A;  1K1Z A;  2DL5 A;  1YP5 A;  2ESW A;  2HSP A;  1QWF A;  1UUE A;  1Y57 A;  3EG0 A;  1ABO A;  4LUE A;  1GBR A;  2X3W D;  2RQT A;  4DEY A;  1H3H A;  2KBT A;  4LNP A;  4CC4 B;  2NUZ A;  1X6G A;  2D0N A;  2RPN A;  2LP5 A;  2DL3 A;  2KGT A;  3EHQ A;  2RQU A;  1WLP B;  1Z9Q A;  1BK2 A;  2J7I A;  1PNJ A;  1AWX A;  1E6G A;  1NYF A;  2LQN A;  1Y0M A;  1NEG A;  3QWX X;  1H92 A;  3RNJ A;  1X69 A;  2VVK A;  1VA7 A;  4JJB A;  3IQL A;  2LJ0 A;  1Z9Z A;  1ABQ A;  3VRY A;  3UF4 A;  1S1N A;  2GQI A;  2LJ3 A;  3VS2 A;  1AWJ A;  1GFD A;  5FW9 A;  2LQW A;  1UEC A;  3RBB B;  1AZG B;  2EQI A;  1TUC A;  2P4R A;  2AKK A;  2GGR A;  1UHF A;  1I0C A;  2K79 A;  2OJ2 A;  2JMA A;  4AFU C;  1T3L A;  2HBW A;  2DNU A;  1MV3 A;  2W0Z A;  1JXM A;  1NYG A;  4AFQ C;  2EYX A;  4FSS A;  4QT7 A;  2L3P A;  1AD5 A;  4OMO A;  1U5S A;  3VS1 A;  2OI3 A;  1G83 A;  4A63 B;  4Z8A A;  2O9S A;  4AG1 C;  2CRE A;  3M0P A;  2MOX A;  3CQT A;  3A98 A;  1CSK A;  4LE9 A;  1ZBJ A;  2JS2 A;  1JXO A;  5FWB A;  2DMO A;  1YNZ A;  3M0T A;  1RLQ C;  1PRM C;  2DX1 A;  3VS7 A;  2RN8 A;  1QCF A;  1UG1 A;  1YCS B;  2FO0 A;  2D1X A;  4D8K A;  1T3S A;  1B07 A;  3M0U A;  1KJW A;  1NLP C;  2K9G A;  2JT4 A;  3THK A;  1M3A A;  2LX7 A;  5GJW B;  4J9D A;  1K0X A;  1ZLM A;  2JM8 A;  1ARK A;  2J06 A;  3I35 A;  1JEG A;  2PZ1 A;  1BBZ A;  3TSW A;  3M0S A;  1H8K A;  2KRM A;  3EG1 A;  2K2M A;  1JU5 C;  1W70 A;  4F16 A;  3REA B;  1NLO C;  2I0N A;  1AEY A;  2LNH B;  3EGU A;  1UFF A;  2B86 A;  1GL5 A;  1AWO A;  1M8M A;  3TSZ A;  2L0A A;  4Y92 A;  5IHK A;  2FPD A;  3C0C A;  4IIM A;  2V1Q A;  2KYM A;  2KRS A;  2SRC A;  5I22 A;  2CDT A;  1QWE A;  5ECA A;  1PHT A;  1GCQ A;  3H0H A;  2AK5 A;  1QKX A;  2AZS A;  3EG2 A;  4KRT A;  3VS5 A;  2KRO A;  1M27 C;  1PKT A;  2C0O A;  1OV3 A;  2M51 A;  1VYU A;  2KT8 A;  1UE9 A;  2D8H A;  1SPK A;  4ESR A;  3VS3 A;  2RQW A;  2ABL A;  2YUQ A;  2MIO A;  1M3C A;  1KFZ A;  4IIO A;  4F14 A;  4J9B A;  2FG0 A;  2KXD A;  4HVU A;  5L23 A;  1PKS A;  1TG0 A;  2CH4 W;  2GTO A;  4CC2 A;  2KEA A;  2RF0 A;  1UTI A;  3QWY A;  3SEM A;  1AZE A;  1SRM A;  3NGP A;  2X3X D;  1ZX6 A;  2CH4 A;  2YT6 A;  3FJ5 A;  3M0Q A;  4JZ4 A;  2J6O A;  1BB9 A;  4RTW A;  1NEB A;  3I9Q A;  2FEI A;  3EG3 A;  4RTX A;  5IH2 A;  4HCK A;  3M0R A;  2K3B A;  1YWP A;  3U23 A;  1OEB A;  3NMZ C;  1SRL A;  1IO6 A;  1GBQ A;  1JQQ A;  2FPE A;  2BTT A;  2YUP A;  4HVV A;  1SSH A;  2DL7 A;  2H8H A;  2HCK A;  1UGV A;  3EHR A;  1G2B A;  2ECZ A;  4Z89 A;  1V1C A;  4J9C A;  1W6X A;  2CSQ A;  1ZUY A;  2ROT A;  2KT1 A;  2LCS A;  2G6F X;  2DA9 A;  3TVT A;  2IIM A;  2KR3 A;  4X1V A;  2JW4 A;  1EFN A;  2AKL A;  2EGA A;  4AG2 C;  2RNA A;  2DBK A;  2DJQ A;  1FMK A;  2F2X A;  3UAT A;  1KIK A;  4JJD A;  1ZUU A;  4JJC A;  1AVZ C;  5IXB A;  2HEQ A;  2GNC A;  1RI9 A;  4RTY A;  1MUZ A;  2L3Q A;  2EVR A;  2JXB A;  5I11 A;  2D8J A;  3VRZ A;  1YWO A;  1SHG A;  2DM1 A;  3H41 A;  1LCK A;  2RQV A;  1WDX A;  2DLP A;  2CSI A;  1VYV A;  1OPL A;  4AFS C;  1ZSG A;  2OAW A;  1WI7 A;  4J9H A;  4OMQ A;  2QDL A;  4ZNX A;  1E7O A;  2JS0 A;  1K4U S;  2BZX A;  1RLP C;  4RUG A;  4GLM A;  2CUB A;  4AFZ C;  2ENM A;  3ZL7 C;  1QKW A;  2EPD A;  1PWT A;  2O31 A;  3VS6 A;  5IXF A;  4HXJ A;  1QLY A;  3LH5 A;  3KFV A;  2RMO A;  1T0J A;  1GCQ C;  3I5S A;  4E6R A;  2F2V A;  2E5K A;  5HCK A;  2BZ8 A;  2K7A A;  4F17 A;  4WCI A;  5GJV B;  2LJ1 A;  2VWF A;  4CC3 A;  1WXU A;  3JV3 A;  3VS4 A;  5IHN A;  3ULR B;  1YN8 A;  1SEM A;  2DL4 A;  1TUD A;  2FRW A;  2KE9 A;  4RTZ A;  1WA7 A;  4RTT A;  3VS0 A;  2DE0 X;  1WX6 A;  1BU1 A;  4OMM A;  4OML A;  3PE0 A;  2L3S A;  2J05 A;  3GBQ A;  4RTV A;  2DYB A;  1MV0 B;  2EYY A;  1PRL C;  1X43 A;  3SHW A;  2CUD A;  1X6B A;  2EGE A;  2C0T A;  4J9G A;  2ED0 A;  2L2P A;  1N5Z A;  1WIE A;  2O2O A;  4JZ3 A;  2A28 A;  2F2W A;  2YSQ A;  1X27 A;  1RUW A;  2EGC A;  1WXT A;  4CC7 A;  1WXB A;  1HSQ A;  1UJ0 A;  2GTJ A;  2NWM A;  4Z88 A;  4OMN A;  5EC7 A;  2YUN A;  2VKN A;  4LUD A;  2KNB B;  4R0K A;  4GBQ A;  1X2K A;  2A08 A;  3PVQ A;  1T0H A;  1OOT A;  1OPK A;  1X2Q A;  2FPF A;  5IHI A;  3REB B;  1GFC A;  2HDA A;  3UA7 A;  4OMP A;  1FYN A;  2A36 A;  2KXC A;  2BZY A;  1WFW A;  2JTE A;  1JO8 A;  4HVW A;  4M4Z A;  1CKA A;  2J6F A;  4LN2 A;  1KSW A;  2M0Y A;  1M30 A;  1WYX A;  1K0S A;  1VYT A;  2W10 A;  2V1R A;  2DRK A;  1HD3 A;  3UA6 A;  2J6K A;  1HJD A;  3NHN A;  2DRM A;  2PTK A;  1UHC A;  2DL8 A;  2CT4 A;  2O9V A;  1B3Q A;  2K6D A;  4ORZ A;  2EYW A;  3NPF A;  1SHF A;  1GCP A;  1W1F A;  2EBP A;  4JPB W;  1I1J A;  1ZUK A;  2XMF A;  1CKB A;  2JMC A;  1GRI A;  2EKH A;  1AOJ A;  1I07 A;  1K76 A;  2RQR A;  2DVJ A;  2KYB A;  1AWW A;  2EYZ A;  3O5Z A;  4J9E A;  5FWC A;  1NG2 A;  1UDL A;  2LZ6 B;  2LMJ A;  1U06 A;  2DIL A;  2JM9 A;  2C0I A;  2KRN A;  1NM7 A;  4EIK A;  4J9F A;  1XOV A; 
#chains in the Genus database with same CATH topology
 1ZQ1 A;  3H0I A;  4DEX A;  1YHQ A;  4X9D A;  1YJ9 A;  1J3T A;  3R6N A;  3CBO A;  5LJ5 e;  3CCV A;  1ZA2 B;  2DF6 A;  2ROL A;  5HK3 A;  4HT8 A;  4RTU A;  4CRI A;  3HRT A;  4M75 G;  4E7L A;  1VQM Q;  1E6H A;  1M90 U;  4AT1 B;  1OQK A;  3H0F A;  2CT3 A;  3EH1 A;  2KMT A;  1M1K U;  2YWW A;  3RKW A;  1BCO A;  5C6S A;  4QQG A;  2ESW A;  1Y71 A;  3EG0 A;  3OYK A;  2V26 A;  2RQT A;  4EMK A;  5FRO A;  4ANJ A;  2KBT A;  4B9W A;  3CCQ T;  3MEA A;  4OMF B;  2CS7 A;  4MZM A;  2KGT A;  1X6O A;  2RQU A;  1Q7Y R;  1Z9Q A;  3MCA B;  2EQU A;  1PNJ A;  1AWX A;  1NYF A;  2KVQ G;  4JDS A;  2DZ9 A;  2AHJ B;  3JCM V;  3V7R A;  2X51 A;  3RNJ A;  3LWH A;  2VVK A;  3IQL A;  3E1S A;  5IN1 A;  3UF4 A;  1GFD A;  2O4X A;  4C8Q E;  1KD1 U;  2LQW A;  1VQ9 T;  2CP6 A;  1AZG B;  1TUC A;  1UHF A;  2X4Y A;  5M9O A;  1T3L A;  3G6E T;  3CCM Q;  5GAM f;  1JXM A;  4M77 D;  3G71 A;  1VIF A;  3URG A;  4FSS A;  1QP2 A;  2ATC B;  3RES A;  3FLG A;  1U5S A;  1MMG A;  3VS1 A;  5LJ5 g;  1D09 B;  1TWB A;  1N8R C;  2YHT A;  1QP3 A;  1IB8 A;  1M5Q 1;  4PJO C;  1CSK A;  4LE9 A;  2KI7 A;  4OVA A;  4ZTJ A;  4L59 A;  1RLQ C;  3OYY A;  3M59 A;  4RCC A;  4IUV A;  1B34 A;  1BKB A;  3A8M B;  4M78 C;  2PVG B;  2DXB A;  4M75 F;  1IZ6 A;  3CCQ A;  4M78 E;  3OS0 A;  3FEO A;  3GLX A;  2FO0 A;  1MGQ A;  3MP8 A;  7AT1 B;  2E64 A;  2HSE B;  2O01 E;  5C0M A;  4XQ3 A;  1T3S A;  1PM3 A;  2JZ2 A;  2K9G A;  4ELY C;  2LX7 A;  2K5L A;  4KUL A;  2COY A;  3HPW A;  4CI0 C;  3QZ5 B;  1D1B A;  2P0P A;  5GAM e;  3G1J A;  2L5Q A;  3I35 A;  3M4G A;  3I56 Q;  2P4T A;  3QJ6 A;  3CMA Q;  1BBZ A;  4M77 B;  1VQ9 A;  1FWZ A;  1H8K A;  5GAN 2;  1Q7Y U;  3PIP A;  1OI1 A;  3M53 A;  1JU5 C;  2CZ1 B;  3TQ7 P;  3EFR A;  4FU6 A;  5DLO A;  2G3R A;  1VQ8 T;  2RHI A;  3G6E A;  4IUR A;  1VQO T;  1EX4 A;  5LJ5 j;  1H64 1;  2ZPH B;  2E3H A;  4C0G A;  5IHK A;  4A4E A;  3C0C A;  1BYM A;  2DTH A;  2LDM A;  4IIM A;  2FYK A;  2QTX A;  1VQM T;  1UGS B;  1QWE A;  3CBM A;  1K9M C;  3RMQ A;  2ZAE A;  1UEB A;  2MMP A;  5FU7 C;  3H0H A;  2AZS A;  3EG2 A;  2FVU A;  4KRT A;  3FC3 A;  1MHN A;  3JCM g;  1NPR A;  4KT0 E;  5GAO n;  1MMA A;  1OV3 A;  2QXF A;  1YBY A;  5D6W A;  3A5Z B;  3JB9 I;  2ABL A;  3OYI A;  2YUQ A;  2XD0 A;  4IIO A;  4J9B A;  2E1H A;  4JRI A;  3EGX B;  5GAN 3;  2CP3 A;  3D7S B;  2K5F A;  2RF0 A;  1SRM A;  2X3X D;  1ZX6 A;  2L3R A;  1VQP T;  4XU3 A;  1NEB A;  2XU8 A;  1G3T A;  2COZ A;  2DD5 A;  4L6V 5;  1H3Z A;  1Y96 B;  4RMO A;  2FEI A;  3EG3 A;  4C8Q A;  3S3M A;  1YI2 T;  3QPH A;  1VQ8 A;  2K3B A;  3U23 A;  1OEB A;  3NMZ C;  1SRL A;  1IO6 A;  1GBQ A;  1VQO A;  2RHZ A;  4IUQ A;  4M7A D;  2QAS A;  3OSS C;  2EJ9 A;  4HVV A;  3BFM A;  1SSH A;  2Z0W A;  2DL7 A;  2R5A A;  1UGV A;  3TEE A;  1RL2 A;  2HQX A;  1BI3 A;  1BI0 A;  4WTO B;  3GP8 A;  1ZUY A;  2ROT A;  4C0D C;  4E7K A;  2KT1 A;  3TVT A;  4C8Q G;  3QXE B;  5LJ5 d;  1EFN A;  3VUB A;  3JB9 G;  2E3I A;  2HQH A;  1KIK A;  4JJD A;  2MF2 A;  4JJC A;  4DA4 A;  1Y7X A;  2QEX T;  2HEQ A;  2CZ6 B;  1RI9 A;  2RHU A;  3OSV A;  3JCM W;  4XTW A;  1QW1 A;  1C0M A;  3HRU A;  5CKD A;  4PLI A;  5GAN 8;  4O6J A;  2OTJ T;  1YWO A;  2QG9 B;  3H41 A;  4BDZ A;  1LCK A;  2DLP A;  2CSI A;  2QQR A;  1RAC B;  3QBY A;  5DM7 R;  4J9H A;  4OMQ A;  1E7O A;  2I2L A;  4PLL A;  2JS0 A;  1RLP C;  2LVM A;  1VQP A;  3ZL7 C;  2IVW A;  1TS9 A;  2XDP A;  2QYZ A;  3VS6 A;  5LJ5 h;  3LH5 A;  4M7A B;  2RMO A;  1YI2 A;  5FLX E;  3I5S A;  4JS4 A;  3JCM X;  2BZ8 A;  2K7A A;  2M1H A;  4IUT A;  4M78 G;  9ATC B;  4KUD K;  1VQ4 T;  2DTI A;  3CC4 T;  3VS4 A;  5IHN A;  2DVE A;  4LDY A;  1GXI E;  3LYI A;  2DL4 A;  1WA7 A;  4C0Z A;  4FW1 A;  4UC4 A;  5KYN A;  4J5Y A;  1Q81 C;  1G3S A;  2DYB A;  1M4Z A;  2F5K A;  1WJS A;  4OGE A;  3CCJ Q;  1X43 A;  5GAO l;  1X6B A;  2EGE A;  4XK8 E;  2ED0 A;  1N5Z A;  4F7U E;  3BDL A;  2QEX A;  1YJN T;  2A28 A;  1YHQ Q;  3PFS A;  1RUW A;  1YJ9 Q;  3M58 A;  4JLG A;  5IT9 E;  4QKU A;  4EPC A;  5GAN g;  2V8K A;  1UJ0 A;  3JCM d;  3JB9 D;  4C8Q F;  2OTJ A;  4XAX B;  2EJG A;  5KYU B;  1YIJ T;  2HBP A;  4LUD A;  4MDX A;  4GBQ A;  3C94 A;  4M77 E;  1T0H A;  2XHC A;  1OOT A;  1X2Q A;  3X25 B;  5IHI A;  2E4H A;  2V8J A;  3M5A A;  4IUU A;  4OMP A;  2KXC A;  4BI4 A;  2JTE A;  3GNG A;  4NS5 A;  2J6F A;  3X26 B;  2XDB A;  3L2V A;  3LGL A;  1RI0 A;  1M30 A;  4FSX A;  2LQK A;  1MND A;  4PJO D;  3KXT A;  2DRK A;  2NUT B;  1U8R A;  1QVF P;  4E2F B;  4DBH A;  3LWI A;  1VQ4 A;  1D0Z A;  3CC4 A;  3NHN A;  1QVG P;  4X9C A;  4BE1 A;  1UHC A;  2DL8 A;  3CXC S;  3CXC A;  5GAO p;  2QDY B;  3L2Z A;  3OA6 A;  4N0A C;  1GCP A;  2P84 A;  4E7I A;  2K3X A;  4MZP A;  4JPB W;  1I1J A;  4M78 F;  2XMF A;  4NOY A;  4J7I A;  2EKH A;  2LT4 A;  2RQR A;  3OBY A;  3O5Z A;  3G71 Q;  2ZGW A;  2IG0 A;  2JOY A;  1YJN A;  2LZ6 B;  2JJ9 A;  2JVV A;  5GAN j;  3BY7 A;  5GAM h;  1VQK T;  1SG5 A;  4J7F A;  5KE3 A;  4QQ6 A;  1Q82 R;  1QCO A;  1X01 A;  3C95 A;  2MI6 A;  2EW3 A;  1YIJ A;  1K9A A;  1G3W A;  5EG2 A;  2A37 A;  1BCM A;  1WHG A;  3ER0 A;  2SEM A;  1R0C B;  4TVR A;  4PJO B;  2GBQ A;  5GMK i;  1M3B A;  1OYX A;  2YUO A;  3CCQ Q;  8ATC B;  2D9T A;  2AT1 B;  3QHS A;  1LJO A;  3M9Q A;  2X4X A;  1ABO A;  4HCZ A;  1QVP A;  2X3W D;  2EQJ A;  4CC4 B;  4BAC A;  2MPX C;  2LP5 A;  3QUI A;  2DL3 A;  3EHQ A;  1XTD A;  4FYX B;  2J7I A;  1H92 A;  1VQ9 Q;  1VQN T;  2QI2 A;  2VAS A;  1VA7 A;  4JJB A;  1OX9 A;  2YXY A;  1S1N A;  3G6E Q;  2GQI A;  2LJ3 A;  3RUX A;  2DJZ A;  1PSE A;  1UEC A;  5GMK m;  2P4R A;  3VUZ A;  3CCU T;  1VQK A;  1I0C A;  2K79 A;  1PG5 B;  2JMA A;  2HBW A;  1MV3 A;  2W0Z A;  1IGQ A;  2KQW A;  5CQX A;  1NYG A;  4DQ2 A;  2EYX A;  1RAI B;  1AD5 A;  4OMO A;  8AT1 B;  2A0F B;  4M7A C;  2GFA A;  4BD3 A;  4BY6 B;  4Z8A A;  4M7A E;  2O9S A;  4M77 A;  4AG1 C;  2CRE A;  1WPY A;  5GAN d;  3DLM A;  5A2Q E;  4IUP A;  3X28 B;  2JS2 A;  1Q82 U;  1BI1 A;  4F7U G;  1M1F A;  1YNZ A;  3LX7 A;  3M0T A;  3EAE A;  1XNI A;  2DX1 A;  4PFO A;  3BW1 A;  3VS7 A;  2LRQ A;  3FB9 A;  1QQJ A;  4M77 G;  1QCF A;  3FJP A;  1BI2 A;  4ZGJ B;  3I55 T;  4D8K A;  4M75 A;  1B07 A;  3M0U A;  1KJW A;  2JT4 A;  1M3A A;  4BI8 B;  4JRP A;  1VQN A;  5GJW B;  4J9D A;  2RK2 A;  4E7H A;  2NUP A;  1ZLM A;  4YTL A;  2J06 A;  1VQ8 Q;  4BI3 A;  2EWN A;  1VQO Q;  1M8V A;  3RDV A;  3HSB A;  3TSW A;  1WQW A;  4FCY A;  3EGX A;  3CCU A;  2DTO A;  3CPW P;  1W70 A;  3PT9 A;  1X75 C;  1AEY A;  4PJM A;  1W2B P;  2GQV A;  3QII A;  5CKE A;  1UFF A;  2B86 A;  1ZSZ B;  1GL5 A;  2WSC E;  1OU8 A;  4KH0 B;  1M8M A;  2L0A A;  4PJN A;  1I4K 1;  3JCM c;  2V1Q A;  2X9H A;  3GOX A;  2KRS A;  1Q81 R;  3SWN C;  3RKX A;  3LW5 E;  1JRI A;  4C0D B;  3VS5 A;  4HT9 A;  1PKT A;  1RAH B;  2JTF A;  4LDU A;  3OW2 S;  2RJF A;  4PKC C;  3V8L A;  3OW2 A;  3E9G A;  4ESR A;  2RQW A;  4QVZ A;  3X20 B;  2MIO A;  1KFZ A;  2CP2 A;  2L89 A;  5KCO A;  3I55 A;  2KXD A;  4HVU A;  1KQS P;  1PKS A;  1VQP Q;  4CC2 A;  5LJ3 f;  3OBW A;  1YI2 Q;  2E65 A;  2YRC A;  4WF2 A;  3QWY A;  3SEM A;  3G4S T;  2LT1 A;  2CH4 A;  2RJD A;  2KSS A;  2YT6 A;  3FJ5 A;  3M0Q A;  4M77 F;  2J6O A;  2XIC A;  4M7D C;  3I9Q A;  4N4H A;  4M7D E;  4E7J A;  3M0R A;  1G8X A;  5I2S A;  4PJO E;  2BTT A;  3CPF A;  3RIR A;  3HHT B;  2QGG A;  2R5M A;  2HCK A;  1RAB B;  1G2B A;  5CQY A;  3KBG A;  3CEY A;  4M7A A;  4Z89 A;  3VJP A;  3SDZ A;  2QEX Q;  3V8K A;  3F70 A;  4E7Z A;  3QZ9 B;  2LCS A;  3FDR A;  1TXQ A;  2EGA A;  3P8D A;  2D6F A;  2JUF A;  2OTJ Q;  3UAT A;  4F7U B;  5LJ3 e;  1AHJ B;  4A54 A;  3NTI A;  2RK1 A;  1Q81 U;  2L8D A;  2L3Q A;  1R77 A;  2EVR A;  3J81 E;  5HK0 A;  4BE0 A;  4HA8 A;  3MEU A;  1NPP A;  4M7A G;  1SHG A;  1JJ2 S;  5KYY B;  2RQV A;  1JJ2 A;  1VYV A;  4AFS C;  1FMW A;  1AT1 B;  1OZ2 A;  3G4S A;  1K4U S;  2VV5 A;  4DOV A;  2XI9 A;  2CUB A;  1JBM A;  3L2R A;  1VQ4 Q;  2GFU A;  2ENM A;  4LD9 K;  3PNW C;  3GPL A;  4BY6 C;  3CC4 Q;  2EPD A;  3HRS A;  5CK9 A;  5KYU A;  1IXD A;  4JLI A;  1GCQ C;  2EJF A;  1D0Y A;  4MZT A;  4F17 A;  4WCI A;  2LJ1 A;  3L2U A;  5GAO q;  1WXU A;  2LTO A;  2YLC A;  1TUD A;  2FRW A;  1OZ3 A;  4RKU E;  4RTT A;  2DE0 X;  3MPU B;  2LNV A;  4ZN1 A;  2NUT A;  1YJN Q;  1HXD A;  4RTV A;  3SHW A;  2M02 A;  3ZEH A;  2CUD A;  3A8H B;  3QYH B;  2LCC A;  4ME7 A;  4J9G A;  2O2O A;  1YIJ Q;  3QKJ A;  4JZ3 A;  5GAM g;  1X27 A;  4JS5 A;  1PCX A;  5AYF A;  2E6N A;  4CC7 A;  2QGF B;  3LH0 A;  4PFZ A;  1N6A A;  4Z88 A;  2NWM A;  1SKU B;  4OMN A;  5GAN 4;  3AHU A;  3ME9 A;  2YUN A;  4R0K A;  3L1A A;  1X2K A;  3PVQ A;  2HDA A;  4KBM B;  2DAQ A;  3CC7 T;  1ZSZ C;  2A36 A;  2BZY A;  4C92 C;  1ZHI A;  4JJN K;  4M4Z A;  1CKA A;  2PUO B;  3EGD A;  4M7A F;  4LN2 A;  2CYZ B;  4C92 E;  2M0Y A;  2JN0 A;  2MWP A;  1K0S A;  3P8B B;  4XTZ A;  3OYC A;  2M16 A;  3UA6 A;  4C0F A;  2DRM A;  4Z02 A;  4FYW B;  2CT4 A;  2DO3 A;  2VUB A;  4PJO A;  2O9V A;  4DOW A;  2CKK A;  3VKI A;  2EYW A;  2IPO B;  2XG8 D;  1SHF A;  1W1F A;  1C1A A;  2DER A;  1QCN A;  4QVD A;  1ZUK A;  2PVD B;  2RD1 A;  1VQK Q;  2DXC A;  4M78 A;  2DVJ A;  2RH2 A;  4ELZ C;  5GAM j;  5J39 A;  1KD1 C;  1UDL A;  1TSF A;  2B8A A;  2MWO A;  4PJO G;  2JM9 A;  1NM7 A;  4EIK A;  3MJX A;  3P8H A;  4O5V A;  2LC4 A;  1A0N B;  3I5R A;  4K11 A;  1VQ7 T;  2K5I A;  2PNI A;  1D3B B;  2DD4 A;  2ED1 A;  2FRY A;  2RJE A;  4D8D A;  1XJW B;  3FIF A;  2HD0 A;  3CC7 A;  2O88 A;  1I8F A;  1UJY A;  1R8O B;  2YDL A;  2M9U A;  2PVO B;  1LPL A;  1I5L A;  2AZV A;  3PVL A;  4QQD A;  2XID A;  2MCN A;  3WVD B;  2DBM A;  1K1Z A;  2ZCF B;  1YP5 A;  1B34 B;  2HSP A;  1QWF A;  1UUE A;  1Y57 A;  4PJJ A;  1DJ7 B;  4Q5W A;  4DEY A;  1H3H A;  2HMA A;  1VQN Q;  4LNP A;  5A0D A;  4LXC A;  2NUZ A;  1X6G A;  2D0N A;  4KH1 B;  3S3N A;  2WSF E;  1EZZ B;  1N9R A;  2EKO A;  1BK2 A;  2HNI A;  3C12 A;  1Y0M A;  1NEG A;  1LVK A;  3QWX X;  4JRQ A;  1X69 A;  3CCU Q;  2LJ0 A;  5KYW B;  1Z9Z A;  3MKD A;  1ABQ A;  3VV0 A;  2ZZD A;  3E19 A;  2OAU A;  4RG8 A;  1KQ1 A;  3JB9 F;  1AWJ A;  5FW9 A;  1K8A C;  4OB2 B;  1N8R R;  2X4W A;  3CD6 T;  2FB7 A;  3RBB B;  3EG9 B;  2EQI A;  2AKK A;  1WHM A;  5GMK e;  3UDC A;  2BKD N;  2OJ2 A;  2XKO C;  2HL5 C;  4M7D D;  4AFQ C;  1VQ6 T;  5A0L A;  2DXT A;  5CVI A;  2L3P A;  5KYX A;  1VQ7 A;  3PMI A;  1G83 A;  4A63 B;  3RMS A;  5GAM d;  5CO7 A;  5CKH A;  4PJO F;  2MOX A;  1UB4 A;  2PQW A;  3SWN B;  3A98 A;  3INZ A;  4JUV A;  2HZY A;  5FWB A;  1WNL A;  1KHC A;  3OYA A;  3I55 Q;  1KG1 A;  1PRM C;  2ZPF B;  2Y90 A;  4KGZ B;  2FL7 A;  4C5E A;  2EFI A;  1YCS B;  1OX8 A;  5LJ3 h;  4II1 A;  2EAY A;  4OB1 B;  4PL6 A;  1U1T A;  1K0X A;  1PD1 A;  4C92 G;  2JM8 A;  3OS2 A;  1Y07 A;  3O8V A;  3L2Q A;  2QA4 Q;  1TUG B;  3CD6 A;  2QQ9 A;  2PZ1 A;  4HCC A;  5GAO m;  4M7D B;  2COW A;  3EG1 A;  2K2M A;  4B6M A;  1K9M R;  3CBP A;  3JB9 J;  2I0N A;  4C5H A;  4QW2 A;  3EGU A;  3UWN A;  1VQ6 A;  2CP7 A;  1Q86 C;  3M57 A;  4Y92 A;  2FPD A;  2A7Y A;  1N8R U;  1C6V X;  4DBQ A;  4EMK C;  2KYM A;  2MYS A;  2CDT A;  1PHT A;  2VXE A;  1WZO A;  2DEQ A;  4DBR A;  1SSF A;  4OGC A;  1HYO A;  2K57 A;  2VGM A;  2DET A;  3QYG B;  2OTL T;  5IAY A;  4EMH A;  4NL3 A;  1UE9 A;  1SPK A;  2D0Q B;  2PU9 B;  1V76 A;  3G4S Q;  1KQ2 A;  5L23 A;  3A1P A;  4E47 A;  1TG0 A;  2CH4 W;  2GTO A;  3CC2 T;  1HK9 A;  4RG2 A;  4F7U A;  2ZPB B;  3OY9 A;  2H3E B;  4XTV A;  2CP5 A;  2ZPI B;  3OYE A;  1BB9 A;  3M54 A;  1PC0 A;  5HKC A;  5KYY A;  4MDW A;  4J6W A;  4C92 D;  4KGX B;  5FRN A;  1G5V A;  1YJW T;  5CKB A;  2H3J A;  4MML A;  4ZGE B;  2YUP A;  2DIQ A;  2MK5 A;  3EHR A;  2NLU A;  5CIU A;  5CKF A;  2HAX A;  3L2W A;  4R56 A;  2ECZ A;  1V1C A;  4FYY B;  1K9M U;  3MP1 A;  2C06 A;  3CXC P;  2G6F X;  2DA9 A;  3JAM E;  2IIM A;  1VQ5 T;  3OYG A;  3PTA A;  4EDU A;  2KR3 A;  4X1V A;  2JW4 A;  2DBK A;  2F2X A;  3SD4 A;  2OTL A;  4XU1 A;  1AVZ C;  3JSC A;  2P0Q A;  2CZ0 B;  4N0A A;  2GNC A;  4RTY A;  5AT1 B;  1R0B G;  5I11 A;  3CME T;  3QO3 A;  2D8J A;  2YRD A;  3DKM A;  4LDV A;  2DM1 A;  3TRE A;  3PIO A;  1YIT T;  3CC2 A;  1WDX A;  1M2V B;  2OAW A;  3CCS T;  1WI7 A;  2QDL A;  5KH6 A;  2QA4 T;  2BZX A;  4RUG A;  4GLM A;  4C92 B;  1ZA1 B;  3UT1 A;  2VGN A;  1PWT A;  3X24 B;  2O31 A;  4A4H A;  2LQ8 A;  2QAZ A;  5CCA A;  1Y96 A;  4FIB A;  3CCE T;  1LNX A;  4E6R A;  2F2V A;  3CCL T;  4FT4 A;  5HCK A;  4BE2 A;  4OB0 B;  1YJW A;  1V29 B;  4CC3 A;  6AT1 B;  1S72 T;  4ZTF A;  3DB3 A;  3ULR B;  1YN8 A;  2QK0 A;  1OU9 A;  2FZC B;  3WVE B;  4RTZ A;  2KE9 A;  1KK7 A;  4J83 A;  3VS0 A;  1UGQ B;  3EFO B;  4OML A;  3PE0 A;  3GBQ A;  3OQ5 A;  4DBF A;  1VUB A;  2V8I A;  1VQL T;  1FMV A;  1MV0 B;  1VQ5 A;  2EYY A;  1K8A R;  4F7U F;  4XTY A;  2C0T A;  3JCM f;  1WIE A;  1U1S A;  3JRZ A;  2F2W A;  2EGC A;  1WHJ A;  5DLQ E;  1WXB A;  3CME A;  2ZPE B;  1TOV A;  3CC7 Q;  3S3O A;  2DK3 A;  1K73 C;  2GTJ A;  4C8Q C;  3OB9 A;  5EC7 A;  1YIT A;  3OS5 A;  2FZK B;  2VKN A;  2KNB B;  2A08 A;  1OUL A;  5GMK h;  3JCM J;  2CP0 A;  2FPF A;  4NL2 A;  3REB B;  3CCS A;  4BB7 A;  4PJL A;  3RR6 A;  3LLR A;  1FYN A;  5CR2 A;  3HFN A;  2QA4 A;  3OMG A;  1M2O A;  1WFW A;  1LOJ A;  3JB9 H;  1JO8 A;  1EIF A;  1KSW A;  3RER A;  1WYX A;  1D1C A;  1VYT A;  3CCE A;  4FT2 A;  1D3B A;  3CCL A;  2RB6 A;  2VXF A;  2W10 A;  4BDY A;  3HL8 A;  3GF5 A;  2BE7 D;  2J6K A;  1HJD A;  1S72 A;  3M4Y A;  4C5G A;  2PTK A;  3NTK A;  3V8J A;  2K6D A;  2KAF A;  4ORZ A;  3JCM e;  5L8R E;  1NJI C;  1IGU A;  1G3Y A;  5GAO r;  3C4S A;  1CKB A;  4M75 D;  1GRI A;  2CZ7 B;  5J26 A;  1VQL A;  4XU2 A;  2OX7 A;  2KYB A;  2QQS A;  4HCB A;  3OYL A;  1VQ7 Q;  2LMJ A;  1U06 A;  3M55 A;  2FHD A;  2C0I A;  2E6Z A;  1Q86 R;  5D7U A;  1XOV A;  5KYW A;  1F1B B;  3CCR T;  1YCY A;  1K8A U;  3ZFJ A;  2WAC A;  3TCJ A;  4J9I A;  1TH7 A;  3EG9 A;  1W4S A;  4A4K A;  1IRE B;  2GCX A;  1KC8 C;  4HKE A;  1U3O A;  3QDR B;  1BIA A;  4N4I A;  1Q82 C;  3PMT A;  2VYT A;  1O9S A;  3OYM A;  4E7S A;  2DL5 A;  1NE8 A;  3RKY A;  2WSE E;  1I5O B;  4LUE A;  1GBR A;  3A8G B;  1M1G A;  3SWN A;  3BE3 A;  2EIF A;  3E9F A;  2RPN A;  4R55 A;  5LJ3 g;  4M75 B;  2MAM A;  3OMC A;  3OW2 P;  1WLP B;  4V2S A;  3PGG A;  2ZPG B;  1PSF A;  3CD6 Q;  4OB3 B;  1IRX A;  1E6G A;  2LQN A;  5D6X A;  2NUP B;  3JCM Q;  1MNE A;  4B9X A;  3L42 A;  3M56 A;  4C5I A;  3T9N A;  3MET A;  2F69 A;  4Y28 E;  3VRY A;  2E41 A;  3OYB A;  1FXX A;  3VS2 A;  1VQ6 Q;  4FL6 A;  2KY9 A;  4FW2 A;  2GGR A;  1TTH B;  4N4G A;  1MMN A;  2K3Y A;  4X34 A;  3OYD A;  4AFU C;  1WHL A;  2DNU A;  2BIV A;  2XK0 A;  4QT7 A;  5KE2 A;  3OYJ A;  3CCR A;  5GAN f;  1M90 C;  2QTV A;  2OI3 A;  2Y4X A;  1M1K C;  1RAD B;  1WJR A;  4M7D A;  1IHW A;  1B7T A;  4EMK B;  3CCM T;  3M0P A;  3CQT A;  4IKF A;  3R6O A;  1QVF S;  4A4F A;  1ZBJ A;  4EMG A;  1QVF A;  1Q86 U;  1JXO A;  2DMO A;  1QVG S;  3HP9 A;  2HKN A;  3OS1 A;  1QVG A;  3KUF A;  3HFO A;  2DYI A;  4QVC A;  1VQM A;  4AMC A;  1BIB A;  5LJ3 j;  2RN8 A;  1RAE B;  1WGS A;  4M7D G;  1UG1 A;  1VOM A;  2E12 A;  2D1X A;  2O4X B;  3EH2 A;  1NZ9 A;  5GAN 6;  1D0X A;  1NLP C;  3THK A;  2DFU A;  1ZBX A;  2F5T X;  3VYH B;  1ARK A;  1JJ2 P;  2DZC A;  3H9N A;  1JB0 E;  5GAN e;  1JEG A;  2VB6 A;  3M0S A;  3VU3 C;  2F1L A;  2EQM A;  2KRM A;  3ASK A;  2EQK A;  5FRM A;  4F16 A;  2X4J A;  3REA B;  1NLO C;  3UPU A;  2LNH B;  3Q1J A;  3I56 T;  4BUG A;  1AWO A;  2EYQ A;  3DLL A;  3CMA T;  1WHK A;  2VC8 A;  3H8Z A;  3OYF A;  5HY6 A;  3TSZ A;  1PD0 A;  2SRC A;  3ZBD A;  3CCM A;  5I22 A;  1P92 A;  4J6Y A;  2OTL Q;  4J8O A;  5ECA A;  1GCQ A;  3EFS A;  1NBE B;  2GF7 A;  2AK5 A;  1QKX A;  2KRO A;  1M27 C;  3QSU A;  3HKS A;  2C0O A;  3MHX A;  2M51 A;  1VYU A;  2KT8 A;  3QDF A;  5FU6 B;  3CC2 Q;  2D8H A;  3VS3 A;  1K73 R;  5LL6 S;  1M3C A;  4RCB A;  4D6W A;  4F14 A;  2FG0 A;  3SB2 A;  2K4Y A;  4GLK A;  3TU4 K;  4LD6 A;  2KEA A;  1Q7Y C;  2FZG B;  2P0K A;  5I21 A;  2E10 A;  1FX7 A;  1IHV A;  1UTI A;  3CCV Q;  4C8Q D;  1AZE A;  3NGP A;  5LJ3 d;  5GAN 5;  4JZ4 A;  1YJW Q;  4M7D F;  2DIG A;  4M77 C;  4RTW A;  2DXU A;  2E5Q A;  1M2V A;  4RTX A;  5IH2 A;  2HL3 A;  1UGR B;  3NTH A;  3G7Z A;  4HCK A;  1N9S A;  1YWP A;  5D6Y A;  3VYG A;  3I56 A;  1JQQ A;  2FPE A;  3CMA A;  3FRN A;  1ZSZ A;  4C92 A;  3A8O B;  1VQ5 Q;  1NJI R;  2H8H A;  1XQH A;  3QG1 A;  4ZGD B;  3NFC A;  2KK4 A;  3V7S A;  4J9C A;  3S6W A;  1W6X A;  2CSQ A;  1ACM B;  1KHI A;  1MMD A;  4M75 C;  3V7C A;  2AKL A;  4AG2 C;  3CME Q;  3JCM h;  4M75 E;  3SFM A;  2RNA A;  4L5G A;  2DJQ A;  1FMK A;  3DB4 A;  3MEV A;  5GMK l;  2AIR B;  4LDW A;  1YIT Q;  1ZUU A;  1RAA B;  4M78 D;  4PFP A;  5IXB A;  4OP0 A;  1UGP B;  3EFO A;  3CCS Q;  1MUZ A;  1QMC A;  2JXB A;  3VRZ A;  4C8Q B;  2NYS A;  3BDU A;  1OPL A;  2HKQ B;  1ZSG A;  1KC8 R;  4ZNX A;  3CCE Q;  3CCL Q;  3JCM b;  3CPW S;  3H6Z A;  1K73 U;  3EGD B;  3CPW A;  4AFZ C;  1RAG B;  1W2B S;  1QKW A;  1S72 Q;  1W2B A;  3GIB A;  5IXF A;  4HXJ A;  1QLY A;  4PK4 A;  3KFV A;  4GY5 A;  3OYH A;  1T0J A;  4JRK A;  2Y4Y A;  2E5K A;  2JNG A;  5GJV B;  3E2U A;  4LDX A;  2VWF A;  3JV3 A;  1YFN A;  1O75 A;  1VQL Q;  3MO8 A;  4J6X A;  1SEM A;  2X35 A;  2RI5 A;  1WX6 A;  1BU1 A;  4OMM A;  2RHY A;  2L3S A;  4Y91 A;  2J05 A;  4KUI A;  4A4G A;  2K2V A;  4M78 B;  2RM4 A;  1PRL C;  2YLB A;  1N27 A;  3AT1 B;  1NJI U;  2L2P A;  4ATO A;  5CAI A;  1KQS S;  2YSQ A;  4OF1 A;  4XU0 A;  1KQS A;  1WXT A;  3CCJ T;  2BE9 B;  1HSQ A;  3HTR A;  2HQE A;  1M90 R;  5GMK j;  5A0G A;  2R57 A;  2RI3 A;  4FM4 B;  4XTU A;  1M1K R;  2DKG A;  5J3B A;  5I2M A;  1YHQ T;  1YJ9 T;  1OPK A;  3CCV T;  5DY9 A;  1GFC A;  2PUK B;  3UA7 A;  4C92 F;  1RAF B;  3A8L B;  4HVW A;  3J7A F;  4P5N A;  4XTX A;  1WHH A;  2M0O A;  2R58 A;  3WXM B;  1WJQ A;  2KDS A;  5LJ5 f;  2V1R A;  2JTM A;  1HD3 A;  5GAN 7;  3MEW A;  2RO0 A;  3LGF A;  5KCH A;  1KC8 U;  1WQ7 A;  2DEU A;  2QQB A;  2E70 A;  1I81 A;  1Q95 G;  4ZN3 A;  4KGV B;  5FU7 B;  1B3Q A;  3GNF B;  1D1A A;  1KD1 R;  1M9S A;  2YRV A;  3NPF A;  2RHX A;  5FU6 C;  2BUD A;  4FYV B;  2CGH A;  2XDD A;  1SF9 A;  2EBP A;  2A3L A;  4VUB A;  4A53 A;  2RA2 A;  2DPP B;  4PNO A;  2JMC A;  2RJC A;  4MMK A;  2LX9 A;  3QJY A;  1AOJ A;  1I07 A;  1K76 A;  1AWW A;  2EYZ A;  4J9E A;  3CCR Q;  2RI2 A;  5FWC A;  1NG2 A;  1TU0 B;  2DIL A;  3J80 E;  2LCL A;  4F04 B;  3OYN A;  3CCJ A;  2KRN A;  1VIE A;  3MP6 A;  5GAN h;  3N5B B;  3JCM P;  5KYX B;  4J9F A;  2QQA A;  3G71 T; 
#chains in the Genus database with same CATH homology
 2EW3 A;  3H0I A;  4DEX A;  1K9A A;  1A0N B;  3I5R A;  4K11 A;  2PNI A;  4J9I A;  1J3T A;  2ED1 A;  2A37 A;  3R6N A;  2FRY A;  4D8D A;  2DF6 A;  2ROL A;  2O88 A;  4RTU A;  1UJY A;  2SEM A;  2YDL A;  1U3O A;  2GBQ A;  1E6H A;  1M3B A;  2AZV A;  3PVL A;  3H0F A;  2MCN A;  2YUO A;  2CT3 A;  2DBM A;  1K1Z A;  2DL5 A;  1YP5 A;  2ESW A;  2HSP A;  1QWF A;  1UUE A;  1Y57 A;  3EG0 A;  1ABO A;  4LUE A;  1GBR A;  2X3W D;  2RQT A;  4DEY A;  1H3H A;  2KBT A;  4LNP A;  4CC4 B;  2NUZ A;  1X6G A;  2D0N A;  2RPN A;  2LP5 A;  2DL3 A;  2KGT A;  3EHQ A;  2RQU A;  1WLP B;  1Z9Q A;  1BK2 A;  2J7I A;  1PNJ A;  1AWX A;  1E6G A;  1NYF A;  2LQN A;  1Y0M A;  1NEG A;  3QWX X;  1H92 A;  3RNJ A;  1X69 A;  2VVK A;  1VA7 A;  4JJB A;  3IQL A;  2LJ0 A;  1Z9Z A;  1ABQ A;  3VRY A;  3UF4 A;  1S1N A;  2GQI A;  2LJ3 A;  3VS2 A;  1AWJ A;  1GFD A;  5FW9 A;  2LQW A;  1UEC A;  3RBB B;  1AZG B;  2EQI A;  1TUC A;  2P4R A;  2AKK A;  2GGR A;  1UHF A;  1I0C A;  2K79 A;  2OJ2 A;  2JMA A;  4AFU C;  1T3L A;  2HBW A;  2DNU A;  1MV3 A;  2W0Z A;  1JXM A;  1NYG A;  4AFQ C;  2EYX A;  4FSS A;  4QT7 A;  2L3P A;  1AD5 A;  4OMO A;  1U5S A;  3VS1 A;  2OI3 A;  1G83 A;  4A63 B;  4Z8A A;  2O9S A;  4AG1 C;  2CRE A;  3M0P A;  2MOX A;  3CQT A;  3A98 A;  1CSK A;  4LE9 A;  1ZBJ A;  2JS2 A;  1JXO A;  5FWB A;  2DMO A;  1YNZ A;  3M0T A;  1RLQ C;  1PRM C;  2DX1 A;  3VS7 A;  2RN8 A;  1QCF A;  1UG1 A;  1YCS B;  2FO0 A;  2D1X A;  4D8K A;  1T3S A;  1B07 A;  3M0U A;  1KJW A;  1NLP C;  2K9G A;  2JT4 A;  3THK A;  1M3A A;  2LX7 A;  5GJW B;  4J9D A;  1K0X A;  1ZLM A;  2JM8 A;  1ARK A;  2J06 A;  3I35 A;  1JEG A;  2PZ1 A;  1BBZ A;  3TSW A;  3M0S A;  1H8K A;  2KRM A;  3EG1 A;  2K2M A;  1JU5 C;  1W70 A;  4F16 A;  3REA B;  1NLO C;  2I0N A;  1AEY A;  2LNH B;  3EGU A;  1UFF A;  2B86 A;  1GL5 A;  1AWO A;  1M8M A;  3TSZ A;  2L0A A;  4Y92 A;  5IHK A;  2FPD A;  3C0C A;  4IIM A;  2V1Q A;  2KYM A;  2KRS A;  2SRC A;  5I22 A;  2CDT A;  1QWE A;  5ECA A;  1PHT A;  1GCQ A;  3H0H A;  2AK5 A;  1QKX A;  2AZS A;  3EG2 A;  4KRT A;  3VS5 A;  2KRO A;  1M27 C;  1PKT A;  2C0O A;  1OV3 A;  2M51 A;  1VYU A;  2KT8 A;  1UE9 A;  2D8H A;  1SPK A;  4ESR A;  3VS3 A;  2RQW A;  2ABL A;  2YUQ A;  2MIO A;  1M3C A;  1KFZ A;  4IIO A;  4F14 A;  4J9B A;  2FG0 A;  2KXD A;  4HVU A;  5L23 A;  1PKS A;  1TG0 A;  2CH4 W;  2GTO A;  4CC2 A;  2KEA A;  2RF0 A;  1UTI A;  3QWY A;  3SEM A;  1AZE A;  1SRM A;  3NGP A;  2X3X D;  1ZX6 A;  2CH4 A;  2YT6 A;  3FJ5 A;  3M0Q A;  4JZ4 A;  2J6O A;  1BB9 A;  4RTW A;  1NEB A;  3I9Q A;  2FEI A;  3EG3 A;  4RTX A;  5IH2 A;  4HCK A;  3M0R A;  2K3B A;  1YWP A;  3U23 A;  1OEB A;  3NMZ C;  1SRL A;  1IO6 A;  1GBQ A;  1JQQ A;  2FPE A;  2BTT A;  2YUP A;  4HVV A;  1SSH A;  2DL7 A;  2H8H A;  2HCK A;  1UGV A;  3EHR A;  1G2B A;  2ECZ A;  4Z89 A;  1V1C A;  4J9C A;  1W6X A;  2CSQ A;  1ZUY A;  2ROT A;  2KT1 A;  2LCS A;  2G6F X;  2DA9 A;  3TVT A;  2IIM A;  2KR3 A;  4X1V A;  2JW4 A;  1EFN A;  2AKL A;  2EGA A;  4AG2 C;  2RNA A;  2DBK A;  2DJQ A;  1FMK A;  2F2X A;  3UAT A;  1KIK A;  4JJD A;  1ZUU A;  4JJC A;  1AVZ C;  5IXB A;  2HEQ A;  2GNC A;  1RI9 A;  4RTY A;  1MUZ A;  2L3Q A;  2EVR A;  2JXB A;  5I11 A;  2D8J A;  3VRZ A;  1YWO A;  1SHG A;  2DM1 A;  3H41 A;  1LCK A;  2RQV A;  1WDX A;  2DLP A;  2CSI A;  1VYV A;  1OPL A;  4AFS C;  1ZSG A;  2OAW A;  1WI7 A;  4J9H A;  4OMQ A;  2QDL A;  4ZNX A;  1E7O A;  2JS0 A;  1K4U S;  2BZX A;  1RLP C;  4RUG A;  4GLM A;  2CUB A;  4AFZ C;  2ENM A;  3ZL7 C;  1QKW A;  2EPD A;  1PWT A;  2O31 A;  3VS6 A;  5IXF A;  4HXJ A;  1QLY A;  3LH5 A;  3KFV A;  2RMO A;  1T0J A;  1GCQ C;  3I5S A;  4E6R A;  2F2V A;  2E5K A;  5HCK A;  2BZ8 A;  2K7A A;  4F17 A;  4WCI A;  5GJV B;  2LJ1 A;  2VWF A;  4CC3 A;  1WXU A;  3JV3 A;  3VS4 A;  5IHN A;  3ULR B;  1YN8 A;  1SEM A;  2DL4 A;  1TUD A;  2FRW A;  2KE9 A;  4RTZ A;  1WA7 A;  4RTT A;  3VS0 A;  2DE0 X;  1WX6 A;  1BU1 A;  4OMM A;  4OML A;  3PE0 A;  2L3S A;  2J05 A;  3GBQ A;  4RTV A;  2DYB A;  1MV0 B;  2EYY A;  1PRL C;  1X43 A;  3SHW A;  2CUD A;  1X6B A;  2EGE A;  2C0T A;  4J9G A;  2ED0 A;  2L2P A;  1N5Z A;  1WIE A;  2O2O A;  4JZ3 A;  2A28 A;  2F2W A;  2YSQ A;  1X27 A;  1RUW A;  2EGC A;  1WXT A;  4CC7 A;  1WXB A;  1HSQ A;  1UJ0 A;  2GTJ A;  2NWM A;  4Z88 A;  4OMN A;  5EC7 A;  2YUN A;  2VKN A;  4LUD A;  2KNB B;  4R0K A;  4GBQ A;  1X2K A;  2A08 A;  3PVQ A;  1T0H A;  1OOT A;  1OPK A;  1X2Q A;  2FPF A;  5IHI A;  3REB B;  1GFC A;  2HDA A;  3UA7 A;  4OMP A;  1FYN A;  2A36 A;  2KXC A;  2BZY A;  1WFW A;  2JTE A;  1JO8 A;  4HVW A;  4M4Z A;  1CKA A;  2J6F A;  4LN2 A;  1KSW A;  2M0Y A;  1M30 A;  1WYX A;  1K0S A;  1VYT A;  2W10 A;  2V1R A;  2DRK A;  1HD3 A;  3UA6 A;  2J6K A;  1HJD A;  3NHN A;  2DRM A;  2PTK A;  1UHC A;  2DL8 A;  2CT4 A;  2O9V A;  1B3Q A;  2K6D A;  4ORZ A;  2EYW A;  3NPF A;  1SHF A;  1GCP A;  1W1F A;  2EBP A;  4JPB W;  1I1J A;  1ZUK A;  2XMF A;  1CKB A;  2JMC A;  1GRI A;  2EKH A;  1AOJ A;  1I07 A;  1K76 A;  2RQR A;  2DVJ A;  2KYB A;  1AWW A;  2EYZ A;  3O5Z A;  4J9E A;  5FWC A;  1NG2 A;  1UDL A;  2LZ6 B;  2LMJ A;  1U06 A;  2DIL A;  2JM9 A;  2C0I A;  2KRN A;  1NM7 A;  4EIK A;  4J9F A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...