1UE9A

Solution structure of the fourth sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
b'GSSGSSGEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin 2
publication title Solution structure of the fourth SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 8
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ue9A00
3M0UA 1AZGB 2CT3A 2ECZA 2EPDA 4DEXA 1W1FA 1NLPC 2KNBB 2HEQA 2H8HA 2CH4A 2DL4A 2O88A 2AKKA 2KXDA 1ARKA 2P4RA 4RTUA 1PRMC 4X1VA 2EKHA 1SHGA 1ZSGA 1KFZA 1T0HA 4Y92A 4AFQC 2ROLA 2DRKA 3LH5A 1G83A 3GBQA 4HVVA 4AFZC 2LZ6B 2DMOA 3PVQA 2YDLA 1AZEA 1RI9A 2CUBA 2K79A 2LNHB 4D8KA 3EHRA 1QWFA 2K3BA 4LUEA 4JJBA 5ECAA 1ABQA 1WDXA 1M27C 2C0TA 4RUGA 4M4ZA 2SEMA 3H0HA 1NYFA 4GLMA 1KJWA 2EYXA 1ZBJA 3VS0A 1LCKA 1WXUA 1WFWA 2RPNA 4JPBW 2DJQA 2EYZA 4AFUC 5I11A 2FG0A 2DX1A 1T3LA 2J6KA 4QT7A 2CREA 3NHNA 2GBQA 2DL3A 4K11A 1QKXA 4HVUA 1E6GA 2A28A 2OAWA 4DEYA 1X2QA 3ULRB 2AZVA 2RQVA 1YN8A 5IHKA 2J06A 2MIOA 1U06A 2ABLA 4LUDA 2M51A 2DL5A 4J9EA 2GGRA 1MUZA 4Z89A 1HSQA 2HDAA 1N5ZA 2GQIA 2IIMA 2MCNA 1H92A 1UHFA 2ROTA 1AEYA 2A37A 3EGUA 2QDLA 1VYUA 3M0TA 2KROA 3PVLA 2GTOA 1UHCA 2KT1A 2CSIA 4J9FA 5FWCA 2LJ3A 2KRMA 1Z9ZA 1YNZA 1M8MA 1X2KA 2AKLA 3NGPA 3RBBB 2LMJA 2EGAA 1I07A 1WI7A 1GCQC 2ESWA 5IHIA 1OEBA 1ZUUA 3I9QA 1BB9A 2EBPA 3EG0A 4A63B 1JQQA 2DRMA 1UE9A 1E6HA 1M3BA 2DBKA 1BU1A 1FMKA 1HD3A 1GBRA 1WX6A 1PWTA 3PE0A 4ZNXA 1VYVA 5IHNA 2B86A 2I0NA 3FJ5A 4J9HA 2ENMA 2VKNA 4JZ4A 2D8JA 1PNJA 1JXOA 2DLPA 1T3SA 2DVJA 3SEMA 1K76A 4OMOA 3VS4A 1KSWA 4CC7A 2VVKA 2KYMA 1NLOC 2A08A 2JW4A 2XMFA 2O9VA 1AD5A 5L23A 2JTEA 2DF6A 4OMMA 1YWPA 3REAB 4FSSA 1S1NA 1CKBA 2KYBA 1H3HA 3H0FA 2LQNA 1MV3A 2CSQA 1SRLA 5HCKA 3EHQA 2VWFA 5FWBA 1WA7A 2FEIA 2K7AA 3VS1A 1EFNA 4Z8AA 4RTZA 2RQTA 2L0AA 4D8DA 1SRMA 2BZXA 2O31A 3RNJA 2EYYA 2JM9A 1B3QA 4F17A 5EC7A 2J05A 1X43A 4IIOA 2RF0A 2C0IA 1AWOA 1AWWA 2V1QA 3NMZC 3TVTA 2DILA 1IO6A 2PNIA 2JM8A 3A98A 4F16A 2KXCA 2LCSA 5GJWB 4WCIA 2AZSA 2HCKA 1PKSA 2PTKA 1ZLMA 2F2XA 2O9SA 2JMCA 3UATA 2JS2A 1Y57A 1X6BA 2OJ2A 1VA7A 5IXFA 1X6GA 1KIKA 2MOXA 1Y0MA 1MV0B 3EG1A 1HJDA 1OPLA 2KRNA 1YCSB 5I22A 2J6OA 2O2OA 2D1XA 2C0OA 1VYTA 1NEBA 1K9AA 1NEGA 3VS6A 4CC3A 2DL7A 1GBQA 1H8KA 4JJCA 2K2MA 3UF4A 4KRTA 2J7IA 4HXJA 1GFDA 1GFCA 1ZX6A 1WXBA 2YUNA 2NUZA 2SRCA 2EVRA 2W0ZA 1GL5A 2LJ0A 1PRLC 2BZYA 1U3OA 2F2VA 2KT8A 1CKAA 2DBMA 1GCPA 1JU5C 2GTJA 1ZUYA 1J3TA 1GRIA 1FYNA 4EIKA 3REBB 3H41A 1I1JA 2M0YA 4JZ3A 3VS7A 3VRZA 1JEGA 1K0SA 4HCKA 2YUPA 2F2WA 3EG2A 2LQWA 1BBZA 4J9IA 1X27A 2X3XD 1G2BA 4ORZA 3ZL7C 1UECA 4E6RA 2YUQA 2YT6A 3H0IA 4RTXA 2LJ1A 2KGTA 4RTTA 2FPDA 1PHTA 1UTIA 3THKA 1A0NB 3KFVA 1T0JA 2E5KA 4CC4B 1I0CA 2EGCA 3UA7A 2HBWA 2FPFA 5IXBA 3IQLA 2KBTA 2DYBA 4Z88A 2JXBA 1U5SA 2JS0A 2RQRA 3O5ZA 5IH2A 2BTTA 4LN2A 3EG3A 4J9DA 2KRSA 1ABOA 4OMQA 2FRYA 1B07A 3CQTA 1RLQC 3I5SA 4OMNA 1OV3A 3NPFA 2EQIA 4CC2A 2RMOA 2RQUA 1YP5A 2ED1A 1JXMA 3JV3A 1YWOA 1NG2A 1SEMA 1QKWA 2KR3A 1AOJA 4RTYA 3VS3A 1TG0A 1AVZC 1M3CA 1W6XA 2CDTA 4IIMA 1PKTA 2ED0A 1TUDA 4HVWA 2KEAA 2D8HA 2CT4A 2NWMA 2FO0A 3U23A 1WLPB 3QWXX 4ESRA 2YUOA 2CH4W 2L3PA 4J9GA 1OPKA 2AK5A 3I5RA 2D0NA 2FPEA 1K0XA 3VS2A 4RTVA 4RTWA 2RN8A 2DE0X 4AG1C 2JMAA 2KE9A 2EW3A 3VS5A 2L2PA 5FW9A 1UJ0A 1JO8A 2EGEA 3M0RA 3TSWA 3VRYA 1AWXA 4LNPA 1X69A 2L3SA 2BZ8A 2DM1A 1WYXA 2OI3A 1ZUKA 2DA9A 2JT4A 1NYGA 3SHWA 1CSKA 1UGVA 1K1ZA 3TSZA 5GJVB 1RUWA 2K9GA 1W70A 3C0CA 4GBQA 4F14A 1OOTA 1E7OA 3I35A 1K4US 2LP5A 1QCFA 2EYWA 1GCQA 1UUEA 1UG1A 1SSHA 2FRWA 2K6DA 2YSQA 4AFSC 2CUDA 1SPKA 1AWJA 2DNUA 1UJYA 4J9BA 1SHFA 3M0PA 1M3AA 2LX7A 4OMPA 1QWEA 4R0KA 4AG2C 4J9CA 4LE9A 3M0QA 2A36A 2X3WD 3UA6A 1QLYA 2V1RA 2W10A 1RLPC 3R6NA 1M30A 2GNCA 3QWYA 1V1CA 2L3QA 2RNAA 2PZ1A 2G6FX 1XOVA 2RQWA 1WXTA 3M0SA 1TUCA 4OMLA 2J6FA 2DL8A 1Z9QA 1BK2A 4JJDA 2HSPA 1UDLA 1WIEA 1NM7A 1UFFA
chains in the Genus database with same CATH superfamily
3M0UA 2CT3A 3EH2A 2OTLT 1Y96A 4DEXA 1NLPC 2KNBB 3HFNA 2HEQA 2CH4A 1VQ5T 2MMPA 3SB2A 4M77D 2AKKA 4FM4B 2HKQB 1VQ9T 1ARKA 1JJ2A 3H9NA 3MJXA 3QKJA 1C0MA 4N0AC 1ZSGA 2HBPA 4AFQC 3LH5A 2NUTB 1UB4A 1OZ2A 3PVQA 1BCMA 4XTWA 1VQOT 2YDLA 1XNIA 4OVAA 3QYHB 1Q7YR 2XDBA 3VJPA 3LLRA 2LNHB 2QI2A 5HKCA 3QSUA 3QXEB 3RUXA 1RAHB 3C94A 4X9CA 4GLMA 5D6XA 4N4GA 3GNGA 3CBPA 4C0FA 2CP0A 2GBQA 3Q1JA 2DL3A 4HVUA 3N5BB 2RHXA 4JRIA 2OAWA 4DEYA 3VYHB 1VQPT 5IHKA 2J06A 2F5KA 4LUDA 3QBYA 2RI3A 3OYJA 3VYGA 1OYXA 1Y7XA 1YFNA 4Z89A 2GQIA 2IIMA 2LX9A 1PD1A 2AIRB 4UC4A 1M90U 1PC0A 2X4JA 2ROTA 1VQMQ 1AEYA 4C92C 2CZ1B 1N6AA 2YLBA 1DJ7B 1UHCA 4J9FA 2LJ3A 3OYYA 2HL3A 5GAN6 2HNIA 2QGGA 1N8RU 4A4EA 2IVWA 5GAMf 2LMJA 1I07A 2ESWA 4C5GA 5CKFA 1ZUUA 3I9QA 3SWNC 1BB9A 1OI1A 2DRMA 2KK4A 3CBOA 3L2QA 4MDXA 4HCZA 4PJMA 3RDVA 4MZMA 2HKNA 1VQ9Q 2DBKA 3EGXB 1M8VA 4XK8E 4EMKA 1HD3A 2NUPA 1PWTA 5IHNA 2B86A 4M7DE 3OW2A 2EFIA 5GANg 3EGDB 2VKNA 4JZ4A 2QQ9A 1KG1A 1PNJA 5IT9E 2DLPA 3SEMA 4R56A 4OMOA 3VS4A 4A4FA 2EWNA 3E9FA 4X34A 1VQKA 3CEYA 1VQOQ 3CCSA 4M78D 3G6ET 2RJDA 4M7AE 3CPWP 4J6XA 1VQ4A 2O9VA 1NJIC 5L23A 2JTEA 4YTLA 1N9SA 3OBWA 3QHSA 3REAB 1MNEA 4ZGEB 2JNGA 1HXDA 4EDUA 1KC8U 1CKBA 1D3BB 2K2VA 2ZCFB 3I55A 5LJ5j 4C8QE 3PFSA 1ZHIA 1MV3A 2WSCE 1SRLA 5HCKA 1IHVA 4Z8AA 1PG5B 2L0AA 2QAZA 3CC7A 3RNJA 2KSSA 4A54A 4OB2B 1BI2A 2K4YA 2RF0A 1AWOA 1VQPQ 1NJIR 2V1QA 3NMZC 2PNIA 4WTOB 3S3NA 1PKSA 3PGGA 2JMCA 3EG9A 2JS2A 3EAEA 3VKIA 1VA7A 1KIKA 4E47A 2EQMA 4IUVA 3MPUB 1MV0B 2FHDA 2KRNA 4JUVA 1UGQB 3P8DA 3JSCA 4JRQA 3HL8A 3I56T 2H3JA 1K9AA 4CC3A 2DL7A 1H8KA 4JJCA 1WGSA 2RHYA 4PJOG 4R55A 2JOYA 7AT1B 5CK9A 1QVFP 2J7IA 2DD5A 1D0XA 2YUNA 5I2SA 2QEXQ 3C95A 2E70A 1LPLA 2EQKA 2BZYA 5CCAA 5J39A 1CKAA 2GTJA 3JCMP 1KHCA 1YI2T 4KT0E 4OB1B 2RM4A 1I1JA 3VS7A 3VRZA 1K0SA 4M77F 1BCOA 4IURA 3G6EQ 3DKMA 2AT1B 5IN1A 1G2BA 4ORZA 1M1KC 1HYOA 1SG5A 4M7DD 5GAMe 1Q7YU 3JCMc 4KGXB 3H0IA 2EQJA 4RTXA 3L1AA 1PHTA 3HPWA 2XD0A 3KFVA 1YJWA 4M7AD 3UA7A 2FPFA 1XJWB 3CD6T 3KBGA 2KBTA 2DYBA 2RQRA 3PMIA 5IH2A 2BTTA 2LTOA 1N9RA 4Y91A 4IUPA 4PJOA 1VQNA 2DEQA 2KRSA 5KE3A 3OA6A 3FEOA 2EYQA 4E7HA 2EQIA 4C8QD 1M1KR 1VQ6T 4CC2A 2RQUA 1YP5A 4ZN1A 5GAN2 4DBQA 2K3YA 2RI5A 3LWIA 2MYSA 1NG2A 1D1CA 2KR3A 2F1LA 4M77B 1BI0A 3MEAA 3HKSA 5KCHA 2DPPB 3M5AA 5A0LA 3CCRT 1PKTA 2ED0A 4HVWA 4EMHA 2EAYA 2A7YA 2D8HA 2CT4A 2FO0A 2P0QA 3OMGA 1UEBA 3I56Q 4M75G 2L3PA 5IAYA 3PIPA 1K73U 2E4HA 2M02A 4IUQA 3VS2A 4II1A 2QASA 5GMKi 2V26A 5KYWA 2JMAA 4HCBA 3VS5A 1KQSP 3QDRB 5LJ3h 2L2PA 3CMAA 3FC3A 3OYBA 1K9MC 2YRDA 3VRYA 3RKYA 1X69A 3UWNA 3JB9D 4FW1A 2OI3A 1ZUKA 1BIBA 2DA9A 2JT4A 2FZGB 2PVGB 3TSZA 2K9GA 3C0CA 4KGVB 3HFOA 4F14A 1E7OA 2FVUA 3LGLA 2EYWA 3MEWA 1GCQA 4HKEA 1UG1A 1M2OA 2R58A 5EG2A 3CMEQ 3VUZA 3FLGA 2F5TX 4E7IA 1UJYA 1M4ZA 5GAOn 1RAGB 3SFMA 3M0PA 2AHJB 1QWEA 3SWNB 4AG2C 4M78F 5FLXE 3M0QA 2ZPHB 1K9MR 3DLMA 3CD6Q 1RLPC 3R6NA 4M75A 3OBYA 1M30A 1ZSZB 3P8HA 3CC4Q 3QWYA 1V1CA 5CO7A 4RG2A 2PZ1A 2EJ9A 1JJ2S 3M0SA 2DFUA 2P84A 1VQ8T 4BI3A 3CCQT 4BDYA 2J6FA 4QW2A 1NM7A 1UFFA 1VQLT 4PJLA 3JCMd 3OYNA 1NJIU 2ECZA 2RJFA 3CCRQ 2K5FA 1VQ7T 4M77E 1XTDA 4BDZA 1QVFA 1YIJT 5CKHA 1WHJA 2P4RA 5GANf 1PRMC 2JVVA 4X1VA 1YITT 1SHGA 1KFZA 1T0HA 4JJNK 2VC8A 4M78B 4FIBA 1MHNA 3TCJA 1ZA2B 1G83A 3GBQA 3HRUA 1O9SA 1WHLA 2LZ6B 2DMOA 2HMAA 3X20B 1Q95G 2BUDA 1TSFA 2GQVA 1VQKT 1PCXA 1QWFA 3GNFB 1VOMA 1W2BP 4XTYA 3C4SA 2C0TA 1QW1A 2P4TA 3CBMA 3VS0A 1WFWA 1IGUA 2YRVA 4KGZB 2FG0A 4QT7A 3DLLA 1E6GA 4E7JA 3CCVT 1NZ9A 3ULRB 2DTHA 2RQVA 1YN8A 2XG8D 3PT9A 2DK3A 2ABLA 3G71Q 2M51A 4KUDK 4J9EA 1W4SA 2E10A 4M7DF 2COZA 3CCMT 2GCXA 2P0PA 4ANJA 2A37A 1VYUA 1VQ8Q 2QQSA 3CCQQ 1S72T 4M7AF 1Z9ZA 2HL5C 1VQLQ 3GLXA 5KYXA 1WJSA 1X2KA 2AKLA 3NGPA 3G4SA 1M1KU 1VQ7Q 3OB9A 4DBRA 1JQQA 4C0GA 1QP3A 3MP1A 1YIJQ 3LX7A 4J6WA 4C0DC 5C0MA 1YJ9T 1BU1A 4FYWB 3JB9I 1M2VB 1KQSA 1WX6A 3PE0A 4B9WA 4ZNXA 5LJ5h 1YITQ 1BYMA 4J9HA 1BKBA 1VUBA 1JXOA 2RK2A 4XAXB 3HP9A 1B7TA 5KYUA 3QUIA 4CC7A 4M78E 2K5LA 2KYMA 1NLOC 5GAOm 2WSEE 4M7DB 3M54A 1QQJA 1AD5A 1YJNT 2PUOB 4OMMA 1X6OA 1YWPA 4BE2A 3INZA 1K8AC 2Y4YA 3BW1A 3OSSC 4FSSA 4XQ3A 2OTJA 4M7AB 1UGPB 2DZ9A 3PNWC 2ATCB 1H3HA 3H0FA 5LJ5d 4FCYA 2HQXA 2LQNA 2YLCA 4OGEA 4AT1B 1TU0B 3EHQA 2VWFA 2DZCA 1BI1A 4KULA 5FWBA 3EFSA 1NE8A 3D7SB 4RMOA 5GANe 4M77C 3OYHA 1ZBXA 2RQTA 1YJWT 3JB9F 3OS5A 4C8QB 2O31A 2EYYA 3ASKA 3C12A 4LD9K 5EC7A 3CCVQ 4IIOA 5KCOA 2C0IA 2ZGWA 3CC2T 1B34B 1WNLA 3V7SA 2DILA 2E3IA 4F16A 3A98A 2KXCA 5GJWB 4WCIA 2HCKA 2O4XA 3EFRA 1K8AR 2O9SA 3CCMQ 1NBEB 5IXFA 2YXYA 2MOXA 5AYFA 3A8OB 2LDMA 5GMKj 3EG1A 1FX7A 1YCSB 5I22A 1S72Q 4OF1A 2D1XA 3M53A 3JCMV 2A3LA 3CCUA 1NEBA 3HTRA 3VS6A 1NEGA 2LQ8A 2X4YA 1H3ZA 1M1GA 2FYKA 1G5VA 2JJ9A 2XDPA 4KRTA 3CCJT 4KH1B 2Y4XA 2BE7D 4HXJA 2QYZA 1TXQA 2NUZA 2DETA 1YJ9Q 4IUUA 1PSEA 2LJ0A 1PRLC 5FU6B 4C0ZA 1U3OA 4E7KA 2F2VA 1RAAB 1JU5C 2COWA 2OTLQ 1MNDA 3CCET 3REBB 1JEGA 1VQ5Q 1W2BA 2YUPA 2F2WA 3EG2A 2LQWA 3OYIA 1BBZA 2XHCA 4J9IA 4M75E 1U1SA 5CKDA 1ZSZC 3JB9J 4FT2A 3TEEA 3MP8A 3ZL7C 1UECA 3JRZA 2QA4A 5DM7R 2YUQA 2YT6A 2JTFA 5DLOA 2KGTA 2K57A 1TOVA 2ZZDA 4PKCC 1UTIA 2DYIA 2XU8A 4N0AA 2HAXA 2E6ZA 2EGCA 4C92G 2HBWA 2EKOA 3M55A 4PJOD 2FZKB 5CQYA 2VXEA 3E2UA 2FL7A 1I4K1 2DIQA 4HCCA 4RKUE 3SD4A 3CC2Q 5LJ3f 2XKOC 1YHQT 3NTHA 1Y96B 9ATCB 4GLKA 2E5QA 4QQGA 1JXMA 2GFUA 3JV3A 4QQ6A 1OULA 1YWOA 1SEMA 4M78C 1AOJA 4RTYA 3VS3A 3OYLA 2LRQA 2CDTA 4IIMA 2FZCB 1TUDA 3CXCS 1WHHA 4F7UG 1PM3A 3U23A 3QWXX 4ESRA 3CPWS 2CH4W 4J9GA 1I5LA 2OX7A 2CYZB 1HK9A 2V8JA 1K0XA 3S3OA 1GXIE 3CCJQ 3G1JA 2M9UA 5AT1B 4AMCA 2DKGA 2K3XA 4QQDA 1YCYA 4RCCA 2DERA 4OP0A 1UGRB 1AWXA 3QZ9B 1QVGS 3OYCA 4C92A 2JZ2A 3CCLT 3CCEQ 1WYXA 2VGNA 3M9QA 4OB0B 1NYGA 2DD4A 3SHWA 1CSKA 1K1ZA 5GJVB 1RUWA 4TVRA 5FRMA 1OOTA 3I35A 1K4US 2ZPBB 6AT1B 1QCFA 5KH6A 1RAIB 3J7AF 2FRWA 4B9XA 2YSQA 3BDLA 1VQMA 5D7UA 2E1HA 1D1BA 3JCMb 3AHUA 1ZQ1A 5GANj 1M3AA 4R0KA 4OMPA 2RH2A 4ZTFA 5A2QE 4J9CA 3SDZA 4JS4A 3KXTA 4C0DB 2A36A 2VB6A 4E7LA 2RJEA 1N27A 4M75D 2V1RA 4F7UA 2OTLA 2VUBA 2E6NA 2GNCA 1OU9A 1PD0A 4KH0B 1VQ5A 1IGQA 2L8DA 2KAFA 3RKWA 2G6FX 2RQWA 3ZEHA 1VQ9A 2LVMA 1YHQQ 1EX4A 2QK0A 3QPHA 4GY5A 3R6OA 4ZTJA 2HSPA 1NPRA 3DB3A 2LT4A 5HK0A 3TREA 1OZ3A 4HA8A 1Q81C 2PVDB 1C6VX 4JRKA 2RD1A 1AZGB 5CAIA 2EPDA 2GFAA 4EMKB 2KY9A 1VQOA 2H8HA 5KYYA 1K8AU 2DL4A 5GMKl 4M7DC 2KXDA 4XU1A 2ZPIB 3MEVA 2L89A 2EKHA 2RJCA 2BE9B 3QJYA 3X25B 4M7AC 4HVVA 1EZZB 5LJ3e 2O01E 3RESA 4FT4A 2ZPFB 2K5IA 1AZEA 4OB3B 2JTMA 4JLIA 1Q81R 4D8KA 2K3BA 4DBHA 4C8QC 3CCLQ 4LUEA 4JJBA 4O5VA 5ECAA 1WDXA 1IHWA 1M27C 1SF9A 1RAFB 3OMCA 4M4ZA 1VQPA 2SEMA 4ELYC 1NYFA 2KQWA 3OYMA 1KJWA 2OTJT 3LWHA 5GAMd 1WXUA 4NL3A 4MMLA 3L2ZA 3X24B 4BD3A 5GAOq 4JPBW 5I11A 4OGCA 1YI2Q 1TUGB 2CP5A 1T3LA 1IRXA 3MCAB 4K11A 1JB0E 2A28A 1X2QA 4F7UF 4EMGA 4L6V5 1G8XA 3META 2E12A 3WXMB 2DL5A 2DEUA 5LJ5f 1MUZA 3M57A 1R8OB 2VASA 2HDAA 1N5ZA 2MCNA 2QGFB 4D6WA 2DTIA 4PLIA 1SSFA 1Y07A 1ZA1B 2QEXA 1JBMA 2C06A 2DVEA 3EGUA 2D0QB 3JCMh 4C5IA 3M0TA 2KROA 3PVLA 2GTOA 1FWZA 2X35A 5FU6C 2KRMA 2DJZA 1M90C 2MWOA 2YHTA 1M8MA 4DA4A 3RBBB 4PJOF 3EFOA 1RABB 5IHIA 4FYXB 3G6EA 1KQ2A 4A63B 3EG0A 4DQ2A 1UE9A 2CZ7B 1M3BA 3QIIA 1Q86C 1VQ6Q 1G3SA 1RI0A 1FMKA 4XTVA 4LDVA 5LJ3g 1VYVA 3LYIA 2PUKB 2ENMA 2D8JA 1RADB 3OSVA 3ZFJA 4A53A 1K76A 1KSWA 2VVKA 2A08A 1P92A 2RI2A 1QP2A 1U8RA 1M90R 5GAN3 3URGA 4LXCA 2NUTA 5M9OA 4L59A 1Q82C 3UT1A 4X9DA 5CIUA 2VGMA 1Q86R 3OYAA 2WSFE 4F04B 1WZOA 1OX8A 5GMKh 4PJOB 2CZ6B 2X9HA 4XU3A 2FEIA 5A0DA 2K7AA 3VS1A 3CCST 4RTZA 1VQ4T 4J8OA 2V8IA 4DBFA 4F17A 2J05A 3I56A 2P0KA 3A8MB 2QTVA 1R77A 2PVOB 1AWWA 5D6WA 3ER0A 3TVTA 1IO6A 5GAMj 2JM8A 8AT1B 3HRTA 3I55T 3QZ5B 2M1HA 2PTKA 4C5HA 5L8RE 1ZLMA 3FRNA 1Q82R 3PMTA 2QG9B 2XICA 3UATA 1Y57A 5CR2A 3V8KA 1H641 1RACB 3J81E 4XU2A 3M4GA 1R0CB 4FSXA 1OPLA 2RHIA 3CC7T 4PJJA 4ZGJB 2C0OA 4M75F 1MMNA 1VYTA 1YI2A 4MZPA 4C92E 5KYWB 1GBQA 2VXFA 1WJRA 1W2BS 2LNVA 3UF4A 2RHZA 1KHIA 3RMSA 3L2RA 1FXXA 4KBMB 1WQWA 5GAOr 1MGQA 4C5EA 2EVRA 3OW2S 2MF2A 2W0ZA 3S6WA 1GL5A 3CMEA 1I5OB 2RB6A 3P8BB 3MEUA 3WVEB 2KT8A 2DBMA 4ME7A 3MKDA 1ZUYA 1MMDA 2LC4A 1J3TA 3EGXA 1FYNA 3H41A 4CI0C 4JZ3A 3UPUA 1M5Q1 4A4KA 3CD6A 4F7UE 1U1TA 3EGDA 3CC4A 4BY6B 3NFCA 2DIGA 1Q81U 4M75B 4BE0A 1OQKA 1VQ6A 3ME9A 1QMCA 4RTTA 2EJFA 4NOYA 2DO3A 3THKA 1T0JA 4CC4B 1VQKQ 3CCSQ 4ELZC 1MMAA 5DLQE 3IQLA 3QDFA 1D3BA 1VQ4Q 3CCRA 4PJOE 1U5SA 4LN2A 4EMKC 4J9DA 2FRYA 1B07A 3CQTA 1RLQC 4EPCA 4NL2A 2ZAEA 4OMNA 1OV3A 1KQ1A 3NPFA 5GAN7 1V76A 1RL2A 3I55Q 2RMOA 2ED1A 2LCCA 1WHKA 3UDCA 5C6SA 1WHGA 4LD6A 4DOWA 1D1AA 2BIVA 4PFOA 1TG0A 5FROA 1AVZC 2HZYA 1D0YA 4XTZA 5KYNA 4V2SA 1QVPA 2CP3A 2E64A 3CC7Q 5GAN4 2KEAA 3M56A 2NWMA 1VQNT 5KE2A 1OPKA 4MZTA 3I5RA 2D0NA 3MP6A 3MO8A 4RTVA 2LT1A 5LJ5g 1K9MU 5J3BA 4VUBA 8ATCB 1K73C 2KE9A 4L5GA 3JCMW 5FW9A 5J26A 1TS9A 1UJ0A 1JO8A 2DAQA 3TSWA 2BKDN 5GANh 4C92D 2L3SA 2QXFA 2JN0A 5CKBA 3JCMJ 3OYKA 3M59A 4M77G 1WQ7A 3FDRA 3J80E 5FU7C 1QCOA 1X75C 4J7FA 3KUFA 3BDUA 3G71A 1F1BB 1W70A 1IXDA 3NTIA 2CZ0B 2DTOA 3VV0A 1SSHA 2KI7A 4JDSA 1Y71A 3L2VA 4A4HA 3CMAT 2CUDA 1AWJA 2DNUA 4J9BA 2QQBA 1VQ8A 1K73R 3CCQA 1SHFA 1IB8A 2LX7A 5GANd 2MI6A 1VQLA 2X3WD 3UA6A 3OYFA 1YJNQ 1QLYA 2W10A 1FMVA 3L2UA 1Q86U 2D9TA 4QVCA 1VQ7A 3H6ZA 2RNAA 3GOXA 3X26B 5HK3A 2V8KA 1YIJA 1XOVA 5KYXB 1WXTA 1TUCA 2HD0A 4BACA 4RCBA 2QEXT 1UGSB 1VIFA 1YITA 5DY9A 2DL8A 1Z9QA 5GAN5 4JJDA 1PSFA 1UDLA 1LOJA 2FB7A 1YJWQ 2EJGA 1TWBA 3OS1A 1W1FA 1Q82U 3CXCP 1KD1C 2O88A 1VQNQ 1AHJB 4M77A 2ZPEB 4MMKA 4IKFA 5HY6A 5KYUB 2COYA 3QJ6A 4RTUA 3WVDB 4J7IA 4BI8B 3V7CA 1D09B 4FL6A 4QVZA 2IPOB 4Y92A 2ROLA 1WJQA 2DRKA 1G3WA 4AFZC 3T9NA 4PJNA 4PJOC 5D6YA 3A1PA 1RI9A 2CUBA 3ZBDA 2K79A 1QVGP 3EHRA 5I2MA 2VV5A 1OX9A 1ABQA 3QG1A 3CCVA 3A8GB 4RUGA 4E7SA 3H0HA 1KD1R 3JCMf 2R5AA 2M0OA 2EYXA 1ZBJA 1LCKA 3CCMA 2LQKA 2Y90A 2H3EB 3V8LA 3HRSA 2RPNA 5GAOp 3CMAQ 5LL6S 2DJQA 2EYZA 2X4WA 3F70A 4AFUC 2EQUA 2DX1A 3E19A 2J6KA 1BIAA 2CREA 3NHNA 1S72A 2O4XB 3A8LB 1QKXA 4M78G 2E65A 2AZVA 3MHXA 2MIOA 1R0BG 1U06A 2PQWA 2LCLA 4BUGA 2X51A 3V7RA 5A0GA 4XTXA 2RHUA 2E41A 1WPYA 2GGRA 3E1SA 1HSQA 3SWNA 1H92A 3OYEA 3M4YA 1UHFA 3OY9A 4PK4A 1YJ9A 1TTHB 4FYVB 2D6FA 2QDLA 1ZSZA 4BB7A 2KT1A 2CSIA 5FWCA 3OYGA 3FIFA 4BI4A 3A5ZB 4LDUA 1YNZA 3TQ7P 3CPFA 5FRNA 3GP8A 2F69A 2EGAA 1WI7A 1GCQC 3GIBA 1OEBA 1QVFS 2EBPA 4MDWA 2EIFA 1YJNA 3FJPA 4LDWA 4FW2A 1E6HA 4BY6C 1AT1B 3NTKA 3X28B 1GBRA 1MMGA 4QVDA 2I0NA 3FJ5A 2DXBA 1KK7A 3CMET 3L2WA 4M75C 3S3MA 2NUPB 1T3SA 2DVJA 4JS5A 3G4ST 3HHTB 4P5NA 3PIOA 3H8ZA 2JW4A 2XMFA 4M78A 3OS2A 2DF6A 4ZGDB 3CC4T 5GAMh 1S1NA 3CC2A 2KYBA 1RAEB 1LNXA 4XU0A 1M9SA 3JB9H 2CSQA 3JCMQ 1WA7A 1BI3A 4FYYB 1EFNA 4C92F 4E2FB 3OS0A 5GAOl 4D8DA 1SRMA 1YBYA 2CP2A 2BZXA 1JRIA 2DXCA 1TH7A 2JM9A 1B3QA 2NYSA 1X43A 2Z0WA 2CKKA 2MK5A 3E9GA 2LCSA 3HSBA 3RR6A 2AZSA 2RK1A 3CCJA 2F2XA 1VIEA 4M7DG 4PL6A 1G3TA 1X6BA 2OJ2A 4RG8A 1X6GA 2CP7A 2IG0A 1Y0MA 2L5QA 3RMQA 1HJDA 3EG9B 3EH1A 3JCMe 2RO0A 1FMWA 3GF5A 2DXUA 2B8AA 5FU7B 2J6OA 2QTXA 2O2OA 4WF2A 4M7AG 2I2LA 3CXCA 3G7ZA 4PFZA 2KDSA 1I81A 3JCMX 3CCEA 3LGFA 3CPWA 3RIRA 2K2MA 3PTAA 2JUFA 5GAMg 1GFDA 4FU6A 1JJ2P 1WHMA 1GFCA 1ZX6A 1WXBA 4C92B 4C8QG 5CKEA 1KQSS 1C1AA 2SRCA 2XIDA 4PLLA 2VYTA 2RA2A 1GCPA 2M16A 3TU4K 3CCUT 3LW5E 2CS7A 5LJ3d 1QVGA 1GRIA 4EIKA 4BE1A 2M0YA 3G4SQ 4HCKA 1LJOA 1M2VA 1N8RC 3GPLA 1X27A 2X3XD 4Y28E 2QQAA 3AT1B 3G71T 1D0ZA 1IZ6A 3OQ5A 1XQHA 2A0FB 4E6RA 4M7DA 4F7UB 1YHQA 1IREB 4Z02A 2XK0A 2LJ1A 2XI9A 2FPDA 4HT8A 1A0NB 5GMKe 2DXTA 2E5KA 1I0CA 2CGHA 1KD1U 3RERA 4M7AA 1QCNA 5IXBA 2KMTA 2CP6A 4Z88A 3JB9G 2JXBA 2E3HA 4A4GA 4OMFB 2JS0A 3O5ZA 2QQRA 3EG3A 1ABOA 4OMQA 3I5SA 1N8RR 2QA4T 2R5MA 2OTJQ 3JCMg 3LH0A 4J6YA 4C8QA 3O8VA 4PNOA 4J83A 5KYYB 1KC8C 4KUIA 1QKWA 4XTUA 2OAUA 1B34A 1OU8A 1M3CA 1W6XA 4ZN3A 4ATOA 3JAME 2HSEB 4N4HA 1WLPB 4HT9A 3A8HB 2YUOA 5I21A 3V8JA 3CCLA 2AK5A 1X01A 2YRCA 2FPEA 1G3YA 4O6JA 4Q5WA 2WACA 2YWWA 3VUBA 2MAMA 4RTWA 1LVKA 2G3RA 2RN8A 2DE0X 3DB4A 4AG1C 2MWPA 3M58A 2QDYB 4LDXA 1NPPA 2EW3A 2PU9B 3OW2P 1KC8R 2EGEA 3M0RA 1EIFA 4LNPA 4DOVA 2HQHA 3CCUQ 1ACMB 2BZ8A 2DM1A 3BE3A 3FB9A 2MPXC 1M1FA 1I8FA 1UGVA 2X4XA 4LDYA 4GBQA 2NLUA 1SKUB 4NS5A 2LP5A 1UUEA 5LJ5e 4J5YA 2K6DA 4IUTA 4AFSC 1SPKA 5LJ3j 2GF7A 2XDDA 4B6MA 4JRPA 1O75A 2ZPGB 3RKXA 4CRIA 4LE9A 3BY7A 3VU3C 5GAN8 3BFMA 5CVIA 4PFPA 1V29B 5GMKm 2L3RA 5CQXA 2KVQG 2L3QA 3QYGB 3L42A 1VQMT 2QA4Q 3OYDA 2HQEA 4C8QF 3EFOB 4QKUA 4OMLA 4E7ZA 2R57A 1BK2A 3QO3A 1Q7YC 1WIEA 4JLGA 4N4IA
chains in the Genus database with same CATH topology
3M0UA 1AZGB 2CT3A 2ECZA 2EPDA 4DEXA 1W1FA 1NLPC 2KNBB 2HEQA 2H8HA 2CH4A 2DL4A 2O88A 2AKKA 2KXDA 1ARKA 2P4RA 4RTUA 1PRMC 4X1VA 2EKHA 1SHGA 1ZSGA 1KFZA 1T0HA 4Y92A 4AFQC 2ROLA 2DRKA 3LH5A 1G83A 3GBQA 4HVVA 4AFZC 2LZ6B 2DMOA 3PVQA 2YDLA 1AZEA 1RI9A 2CUBA 2K79A 2LNHB 4D8KA 3EHRA 1QWFA 2K3BA 4LUEA 4JJBA 5ECAA 1ABQA 1WDXA 1M27C 2C0TA 4RUGA 4M4ZA 2SEMA 3H0HA 1NYFA 4GLMA 1KJWA 2EYXA 1ZBJA 3VS0A 1LCKA 1WXUA 1WFWA 2RPNA 4JPBW 2DJQA 2EYZA 4AFUC 5I11A 2FG0A 2DX1A 1T3LA 2J6KA 4QT7A 2CREA 3NHNA 2GBQA 2DL3A 4K11A 1QKXA 4HVUA 1E6GA 2A28A 2OAWA 4DEYA 1X2QA 3ULRB 2AZVA 2RQVA 1YN8A 5IHKA 2J06A 2MIOA 1U06A 2ABLA 4LUDA 2M51A 2DL5A 4J9EA 2GGRA 1MUZA 4Z89A 1HSQA 2HDAA 1N5ZA 2GQIA 2IIMA 2MCNA 1H92A 1UHFA 2ROTA 1AEYA 2A37A 3EGUA 2QDLA 1VYUA 3M0TA 2KROA 3PVLA 2GTOA 1UHCA 2KT1A 2CSIA 4J9FA 5FWCA 2LJ3A 2KRMA 1Z9ZA 1YNZA 1M8MA 1X2KA 2AKLA 3NGPA 3RBBB 2LMJA 2EGAA 1I07A 1WI7A 1GCQC 2ESWA 5IHIA 1OEBA 1ZUUA 3I9QA 1BB9A 2EBPA 3EG0A 4A63B 1JQQA 2DRMA 1UE9A 1E6HA 1M3BA 2DBKA 1BU1A 1FMKA 1HD3A 1GBRA 1WX6A 1PWTA 3PE0A 4ZNXA 1VYVA 5IHNA 2B86A 2I0NA 3FJ5A 4J9HA 2ENMA 2VKNA 4JZ4A 2D8JA 1PNJA 1JXOA 2DLPA 1T3SA 2DVJA 3SEMA 1K76A 4OMOA 3VS4A 1KSWA 4CC7A 2VVKA 2KYMA 1NLOC 2A08A 2JW4A 2XMFA 2O9VA 1AD5A 5L23A 2JTEA 2DF6A 4OMMA 1YWPA 3REAB 4FSSA 1S1NA 1CKBA 2KYBA 1H3HA 3H0FA 2LQNA 1MV3A 2CSQA 1SRLA 5HCKA 3EHQA 2VWFA 5FWBA 1WA7A 2FEIA 2K7AA 3VS1A 1EFNA 4Z8AA 4RTZA 2RQTA 2L0AA 4D8DA 1SRMA 2BZXA 2O31A 3RNJA 2EYYA 2JM9A 1B3QA 4F17A 5EC7A 2J05A 1X43A 4IIOA 2RF0A 2C0IA 1AWOA 1AWWA 2V1QA 3NMZC 3TVTA 2DILA 1IO6A 2PNIA 2JM8A 3A98A 4F16A 2KXCA 2LCSA 5GJWB 4WCIA 2AZSA 2HCKA 1PKSA 2PTKA 1ZLMA 2F2XA 2O9SA 2JMCA 3UATA 2JS2A 1Y57A 1X6BA 2OJ2A 1VA7A 5IXFA 1X6GA 1KIKA 2MOXA 1Y0MA 1MV0B 3EG1A 1HJDA 1OPLA 2KRNA 1YCSB 5I22A 2J6OA 2O2OA 2D1XA 2C0OA 1VYTA 1NEBA 1K9AA 1NEGA 3VS6A 4CC3A 2DL7A 1GBQA 1H8KA 4JJCA 2K2MA 3UF4A 4KRTA 2J7IA 4HXJA 1GFDA 1GFCA 1ZX6A 1WXBA 2YUNA 2NUZA 2SRCA 2EVRA 2W0ZA 1GL5A 2LJ0A 1PRLC 2BZYA 1U3OA 2F2VA 2KT8A 1CKAA 2DBMA 1GCPA 1JU5C 2GTJA 1ZUYA 1J3TA 1GRIA 1FYNA 4EIKA 3REBB 3H41A 1I1JA 2M0YA 4JZ3A 3VS7A 3VRZA 1JEGA 1K0SA 4HCKA 2YUPA 2F2WA 3EG2A 2LQWA 1BBZA 4J9IA 1X27A 2X3XD 1G2BA 4ORZA 3ZL7C 1UECA 4E6RA 2YUQA 2YT6A 3H0IA 4RTXA 2LJ1A 2KGTA 4RTTA 2FPDA 1PHTA 1UTIA 3THKA 1A0NB 3KFVA 1T0JA 2E5KA 4CC4B 1I0CA 2EGCA 3UA7A 2HBWA 2FPFA 5IXBA 3IQLA 2KBTA 2DYBA 4Z88A 2JXBA 1U5SA 2JS0A 2RQRA 3O5ZA 5IH2A 2BTTA 4LN2A 3EG3A 4J9DA 2KRSA 1ABOA 4OMQA 2FRYA 1B07A 3CQTA 1RLQC 3I5SA 4OMNA 1OV3A 3NPFA 2EQIA 4CC2A 2RMOA 2RQUA 1YP5A 2ED1A 1JXMA 3JV3A 1YWOA 1NG2A 1SEMA 1QKWA 2KR3A 1AOJA 4RTYA 3VS3A 1TG0A 1AVZC 1M3CA 1W6XA 2CDTA 4IIMA 1PKTA 2ED0A 1TUDA 4HVWA 2KEAA 2D8HA 2CT4A 2NWMA 2FO0A 3U23A 1WLPB 3QWXX 4ESRA 2YUOA 2CH4W 2L3PA 4J9GA 1OPKA 2AK5A 3I5RA 2D0NA 2FPEA 1K0XA 3VS2A 4RTVA 4RTWA 2RN8A 2DE0X 4AG1C 2JMAA 2KE9A 2EW3A 3VS5A 2L2PA 5FW9A 1UJ0A 1JO8A 2EGEA 3M0RA 3TSWA 3VRYA 1AWXA 4LNPA 1X69A 2L3SA 2BZ8A 2DM1A 1WYXA 2OI3A 1ZUKA 2DA9A 2JT4A 1NYGA 3SHWA 1CSKA 1UGVA 1K1ZA 3TSZA 5GJVB 1RUWA 2K9GA 1W70A 3C0CA 4GBQA 4F14A 1OOTA 1E7OA 3I35A 1K4US 2LP5A 1QCFA 2EYWA 1GCQA 1UUEA 1UG1A 1SSHA 2FRWA 2K6DA 2YSQA 4AFSC 2CUDA 1SPKA 1AWJA 2DNUA 1UJYA 4J9BA 1SHFA 3M0PA 1M3AA 2LX7A 4OMPA 1QWEA 4R0KA 4AG2C 4J9CA 4LE9A 3M0QA 2A36A 2X3WD 3UA6A 1QLYA 2V1RA 2W10A 1RLPC 3R6NA 1M30A 2GNCA 3QWYA 1V1CA 2L3QA 2RNAA 2PZ1A 2G6FX 1XOVA 2RQWA 1WXTA 3M0SA 1TUCA 4OMLA 2J6FA 2DL8A 1Z9QA 1BK2A 4JJDA 2HSPA 1UDLA 1WIEA 1NM7A 1UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0U A;  1AZG B;  2CT3 A;  2ECZ A;  2EPD A;  4DEX A;  1W1F A;  1NLP C;  2KNB B;  2HEQ A;  2H8H A;  2CH4 A;  2DL4 A;  2O88 A;  2AKK A;  2KXD A;  1ARK A;  2P4R A;  4RTU A;  1PRM C;  4X1V A;  2EKH A;  1SHG A;  1ZSG A;  1KFZ A;  1T0H A;  4Y92 A;  4AFQ C;  2ROL A;  2DRK A;  3LH5 A;  1G83 A;  3GBQ A;  4HVV A;  4AFZ C;  2LZ6 B;  2DMO A;  3PVQ A;  2YDL A;  1AZE A;  1RI9 A;  2CUB A;  2K79 A;  2LNH B;  4D8K A;  3EHR A;  1QWF A;  2K3B A;  4LUE A;  4JJB A;  5ECA A;  1ABQ A;  1WDX A;  1M27 C;  2C0T A;  4RUG A;  4M4Z A;  2SEM A;  3H0H A;  1NYF A;  4GLM A;  1KJW A;  2EYX A;  1ZBJ A;  3VS0 A;  1LCK A;  1WXU A;  1WFW A;  2RPN A;  4JPB W;  2DJQ A;  2EYZ A;  4AFU C;  5I11 A;  2FG0 A;  2DX1 A;  1T3L A;  2J6K A;  4QT7 A;  2CRE A;  3NHN A;  2GBQ A;  2DL3 A;  4K11 A;  1QKX A;  4HVU A;  1E6G A;  2A28 A;  2OAW A;  4DEY A;  1X2Q A;  3ULR B;  2AZV A;  2RQV A;  1YN8 A;  5IHK A;  2J06 A;  2MIO A;  1U06 A;  2ABL A;  4LUD A;  2M51 A;  2DL5 A;  4J9E A;  2GGR A;  1MUZ A;  4Z89 A;  1HSQ A;  2HDA A;  1N5Z A;  2GQI A;  2IIM A;  2MCN A;  1H92 A;  1UHF A;  2ROT A;  1AEY A;  2A37 A;  3EGU A;  2QDL A;  1VYU A;  3M0T A;  2KRO A;  3PVL A;  2GTO A;  1UHC A;  2KT1 A;  2CSI A;  4J9F A;  5FWC A;  2LJ3 A;  2KRM A;  1Z9Z A;  1YNZ A;  1M8M A;  1X2K A;  2AKL A;  3NGP A;  3RBB B;  2LMJ A;  2EGA A;  1I07 A;  1WI7 A;  1GCQ C;  2ESW A;  5IHI A;  1OEB A;  1ZUU A;  3I9Q A;  1BB9 A;  2EBP A;  3EG0 A;  4A63 B;  1JQQ A;  2DRM A;  1UE9 A;  1E6H A;  1M3B A;  2DBK A;  1BU1 A;  1FMK A;  1HD3 A;  1GBR A;  1WX6 A;  1PWT A;  3PE0 A;  4ZNX A;  1VYV A;  5IHN A;  2B86 A;  2I0N A;  3FJ5 A;  4J9H A;  2ENM A;  2VKN A;  4JZ4 A;  2D8J A;  1PNJ A;  1JXO A;  2DLP A;  1T3S A;  2DVJ A;  3SEM A;  1K76 A;  4OMO A;  3VS4 A;  1KSW A;  4CC7 A;  2VVK A;  2KYM A;  1NLO C;  2A08 A;  2JW4 A;  2XMF A;  2O9V A;  1AD5 A;  5L23 A;  2JTE A;  2DF6 A;  4OMM A;  1YWP A;  3REA B;  4FSS A;  1S1N A;  1CKB A;  2KYB A;  1H3H A;  3H0F A;  2LQN A;  1MV3 A;  2CSQ A;  1SRL A;  5HCK A;  3EHQ A;  2VWF A;  5FWB A;  1WA7 A;  2FEI A;  2K7A A;  3VS1 A;  1EFN A;  4Z8A A;  4RTZ A;  2RQT A;  2L0A A;  4D8D A;  1SRM A;  2BZX A;  2O31 A;  3RNJ A;  2EYY A;  2JM9 A;  1B3Q A;  4F17 A;  5EC7 A;  2J05 A;  1X43 A;  4IIO A;  2RF0 A;  2C0I A;  1AWO A;  1AWW A;  2V1Q A;  3NMZ C;  3TVT A;  2DIL A;  1IO6 A;  2PNI A;  2JM8 A;  3A98 A;  4F16 A;  2KXC A;  2LCS A;  5GJW B;  4WCI A;  2AZS A;  2HCK A;  1PKS A;  2PTK A;  1ZLM A;  2F2X A;  2O9S A;  2JMC A;  3UAT A;  2JS2 A;  1Y57 A;  1X6B A;  2OJ2 A;  1VA7 A;  5IXF A;  1X6G A;  1KIK A;  2MOX A;  1Y0M A;  1MV0 B;  3EG1 A;  1HJD A;  1OPL A;  2KRN A;  1YCS B;  5I22 A;  2J6O A;  2O2O A;  2D1X A;  2C0O A;  1VYT A;  1NEB A;  1K9A A;  1NEG A;  3VS6 A;  4CC3 A;  2DL7 A;  1GBQ A;  1H8K A;  4JJC A;  2K2M A;  3UF4 A;  4KRT A;  2J7I A;  4HXJ A;  1GFD A;  1GFC A;  1ZX6 A;  1WXB A;  2YUN A;  2NUZ A;  2SRC A;  2EVR A;  2W0Z A;  1GL5 A;  2LJ0 A;  1PRL C;  2BZY A;  1U3O A;  2F2V A;  2KT8 A;  1CKA A;  2DBM A;  1GCP A;  1JU5 C;  2GTJ A;  1ZUY A;  1J3T A;  1GRI A;  1FYN A;  4EIK A;  3REB B;  3H41 A;  1I1J A;  2M0Y A;  4JZ3 A;  3VS7 A;  3VRZ A;  1JEG A;  1K0S A;  4HCK A;  2YUP A;  2F2W A;  3EG2 A;  2LQW A;  1BBZ A;  4J9I A;  1X27 A;  2X3X D;  1G2B A;  4ORZ A;  3ZL7 C;  1UEC A;  4E6R A;  2YUQ A;  2YT6 A;  3H0I A;  4RTX A;  2LJ1 A;  2KGT A;  4RTT A;  2FPD A;  1PHT A;  1UTI A;  3THK A;  1A0N B;  3KFV A;  1T0J A;  2E5K A;  4CC4 B;  1I0C A;  2EGC A;  3UA7 A;  2HBW A;  2FPF A;  5IXB A;  3IQL A;  2KBT A;  2DYB A;  4Z88 A;  2JXB A;  1U5S A;  2JS0 A;  2RQR A;  3O5Z A;  5IH2 A;  2BTT A;  4LN2 A;  3EG3 A;  4J9D A;  2KRS A;  1ABO A;  4OMQ A;  2FRY A;  1B07 A;  3CQT A;  1RLQ C;  3I5S A;  4OMN A;  1OV3 A;  3NPF A;  2EQI A;  4CC2 A;  2RMO A;  2RQU A;  1YP5 A;  2ED1 A;  1JXM A;  3JV3 A;  1YWO A;  1NG2 A;  1SEM A;  1QKW A;  2KR3 A;  1AOJ A;  4RTY A;  3VS3 A;  1TG0 A;  1AVZ C;  1M3C A;  1W6X A;  2CDT A;  4IIM A;  1PKT A;  2ED0 A;  1TUD A;  4HVW A;  2KEA A;  2D8H A;  2CT4 A;  2NWM A;  2FO0 A;  3U23 A;  1WLP B;  3QWX X;  4ESR A;  2YUO A;  2CH4 W;  2L3P A;  4J9G A;  1OPK A;  2AK5 A;  3I5R A;  2D0N A;  2FPE A;  1K0X A;  3VS2 A;  4RTV A;  4RTW A;  2RN8 A;  2DE0 X;  4AG1 C;  2JMA A;  2KE9 A;  2EW3 A;  3VS5 A;  2L2P A;  5FW9 A;  1UJ0 A;  1JO8 A;  2EGE A;  3M0R A;  3TSW A;  3VRY A;  1AWX A;  4LNP A;  1X69 A;  2L3S A;  2BZ8 A;  2DM1 A;  1WYX A;  2OI3 A;  1ZUK A;  2DA9 A;  2JT4 A;  1NYG A;  3SHW A;  1CSK A;  1UGV A;  1K1Z A;  3TSZ A;  5GJV B;  1RUW A;  2K9G A;  1W70 A;  3C0C A;  4GBQ A;  4F14 A;  1OOT A;  1E7O A;  3I35 A;  1K4U S;  2LP5 A;  1QCF A;  2EYW A;  1GCQ A;  1UUE A;  1UG1 A;  1SSH A;  2FRW A;  2K6D A;  2YSQ A;  4AFS C;  2CUD A;  1SPK A;  1AWJ A;  2DNU A;  1UJY A;  4J9B A;  1SHF A;  3M0P A;  1M3A A;  2LX7 A;  4OMP A;  1QWE A;  4R0K A;  4AG2 C;  4J9C A;  4LE9 A;  3M0Q A;  2A36 A;  2X3W D;  3UA6 A;  1QLY A;  2V1R A;  2W10 A;  1RLP C;  3R6N A;  1M30 A;  2GNC A;  3QWY A;  1V1C A;  2L3Q A;  2RNA A;  2PZ1 A;  2G6F X;  1XOV A;  2RQW A;  1WXT A;  3M0S A;  1TUC A;  4OML A;  2J6F A;  2DL8 A;  1Z9Q A;  1BK2 A;  4JJD A;  2HSP A;  1UDL A;  1WIE A;  1NM7 A;  1UFF A; 
#chains in the Genus database with same CATH topology
 3M0U A;  2CT3 A;  3EH2 A;  2OTL T;  1Y96 A;  4DEX A;  1NLP C;  2KNB B;  3HFN A;  2HEQ A;  2CH4 A;  1VQ5 T;  2MMP A;  3SB2 A;  4M77 D;  2AKK A;  4FM4 B;  2HKQ B;  1VQ9 T;  1ARK A;  1JJ2 A;  3H9N A;  3MJX A;  3QKJ A;  1C0M A;  4N0A C;  1ZSG A;  2HBP A;  4AFQ C;  3LH5 A;  2NUT B;  1UB4 A;  1OZ2 A;  3PVQ A;  1BCM A;  4XTW A;  1VQO T;  2YDL A;  1XNI A;  4OVA A;  3QYH B;  1Q7Y R;  2XDB A;  3VJP A;  3LLR A;  2LNH B;  2QI2 A;  5HKC A;  3QSU A;  3QXE B;  3RUX A;  1RAH B;  3C94 A;  4X9C A;  4GLM A;  5D6X A;  4N4G A;  3GNG A;  3CBP A;  4C0F A;  2CP0 A;  2GBQ A;  3Q1J A;  2DL3 A;  4HVU A;  3N5B B;  2RHX A;  4JRI A;  2OAW A;  4DEY A;  3VYH B;  1VQP T;  5IHK A;  2J06 A;  2F5K A;  4LUD A;  3QBY A;  2RI3 A;  3OYJ A;  3VYG A;  1OYX A;  1Y7X A;  1YFN A;  4Z89 A;  2GQI A;  2IIM A;  2LX9 A;  1PD1 A;  2AIR B;  4UC4 A;  1M90 U;  1PC0 A;  2X4J A;  2ROT A;  1VQM Q;  1AEY A;  4C92 C;  2CZ1 B;  1N6A A;  2YLB A;  1DJ7 B;  1UHC A;  4J9F A;  2LJ3 A;  3OYY A;  2HL3 A;  5GAN 6;  2HNI A;  2QGG A;  1N8R U;  4A4E A;  2IVW A;  5GAM f;  2LMJ A;  1I07 A;  2ESW A;  4C5G A;  5CKF A;  1ZUU A;  3I9Q A;  3SWN C;  1BB9 A;  1OI1 A;  2DRM A;  2KK4 A;  3CBO A;  3L2Q A;  4MDX A;  4HCZ A;  4PJM A;  3RDV A;  4MZM A;  2HKN A;  1VQ9 Q;  2DBK A;  3EGX B;  1M8V A;  4XK8 E;  4EMK A;  1HD3 A;  2NUP A;  1PWT A;  5IHN A;  2B86 A;  4M7D E;  3OW2 A;  2EFI A;  5GAN g;  3EGD B;  2VKN A;  4JZ4 A;  2QQ9 A;  1KG1 A;  1PNJ A;  5IT9 E;  2DLP A;  3SEM A;  4R56 A;  4OMO A;  3VS4 A;  4A4F A;  2EWN A;  3E9F A;  4X34 A;  1VQK A;  3CEY A;  1VQO Q;  3CCS A;  4M78 D;  3G6E T;  2RJD A;  4M7A E;  3CPW P;  4J6X A;  1VQ4 A;  2O9V A;  1NJI C;  5L23 A;  2JTE A;  4YTL A;  1N9S A;  3OBW A;  3QHS A;  3REA B;  1MNE A;  4ZGE B;  2JNG A;  1HXD A;  4EDU A;  1KC8 U;  1CKB A;  1D3B B;  2K2V A;  2ZCF B;  3I55 A;  5LJ5 j;  4C8Q E;  3PFS A;  1ZHI A;  1MV3 A;  2WSC E;  1SRL A;  5HCK A;  1IHV A;  4Z8A A;  1PG5 B;  2L0A A;  2QAZ A;  3CC7 A;  3RNJ A;  2KSS A;  4A54 A;  4OB2 B;  1BI2 A;  2K4Y A;  2RF0 A;  1AWO A;  1VQP Q;  1NJI R;  2V1Q A;  3NMZ C;  2PNI A;  4WTO B;  3S3N A;  1PKS A;  3PGG A;  2JMC A;  3EG9 A;  2JS2 A;  3EAE A;  3VKI A;  1VA7 A;  1KIK A;  4E47 A;  2EQM A;  4IUV A;  3MPU B;  1MV0 B;  2FHD A;  2KRN A;  4JUV A;  1UGQ B;  3P8D A;  3JSC A;  4JRQ A;  3HL8 A;  3I56 T;  2H3J A;  1K9A A;  4CC3 A;  2DL7 A;  1H8K A;  4JJC A;  1WGS A;  2RHY A;  4PJO G;  4R55 A;  2JOY A;  7AT1 B;  5CK9 A;  1QVF P;  2J7I A;  2DD5 A;  1D0X A;  2YUN A;  5I2S A;  2QEX Q;  3C95 A;  2E70 A;  1LPL A;  2EQK A;  2BZY A;  5CCA A;  5J39 A;  1CKA A;  2GTJ A;  3JCM P;  1KHC A;  1YI2 T;  4KT0 E;  4OB1 B;  2RM4 A;  1I1J A;  3VS7 A;  3VRZ A;  1K0S A;  4M77 F;  1BCO A;  4IUR A;  3G6E Q;  3DKM A;  2AT1 B;  5IN1 A;  1G2B A;  4ORZ A;  1M1K C;  1HYO A;  1SG5 A;  4M7D D;  5GAM e;  1Q7Y U;  3JCM c;  4KGX B;  3H0I A;  2EQJ A;  4RTX A;  3L1A A;  1PHT A;  3HPW A;  2XD0 A;  3KFV A;  1YJW A;  4M7A D;  3UA7 A;  2FPF A;  1XJW B;  3CD6 T;  3KBG A;  2KBT A;  2DYB A;  2RQR A;  3PMI A;  5IH2 A;  2BTT A;  2LTO A;  1N9R A;  4Y91 A;  4IUP A;  4PJO A;  1VQN A;  2DEQ A;  2KRS A;  5KE3 A;  3OA6 A;  3FEO A;  2EYQ A;  4E7H A;  2EQI A;  4C8Q D;  1M1K R;  1VQ6 T;  4CC2 A;  2RQU A;  1YP5 A;  4ZN1 A;  5GAN 2;  4DBQ A;  2K3Y A;  2RI5 A;  3LWI A;  2MYS A;  1NG2 A;  1D1C A;  2KR3 A;  2F1L A;  4M77 B;  1BI0 A;  3MEA A;  3HKS A;  5KCH A;  2DPP B;  3M5A A;  5A0L A;  3CCR T;  1PKT A;  2ED0 A;  4HVW A;  4EMH A;  2EAY A;  2A7Y A;  2D8H A;  2CT4 A;  2FO0 A;  2P0Q A;  3OMG A;  1UEB A;  3I56 Q;  4M75 G;  2L3P A;  5IAY A;  3PIP A;  1K73 U;  2E4H A;  2M02 A;  4IUQ A;  3VS2 A;  4II1 A;  2QAS A;  5GMK i;  2V26 A;  5KYW A;  2JMA A;  4HCB A;  3VS5 A;  1KQS P;  3QDR B;  5LJ3 h;  2L2P A;  3CMA A;  3FC3 A;  3OYB A;  1K9M C;  2YRD A;  3VRY A;  3RKY A;  1X69 A;  3UWN A;  3JB9 D;  4FW1 A;  2OI3 A;  1ZUK A;  1BIB A;  2DA9 A;  2JT4 A;  2FZG B;  2PVG B;  3TSZ A;  2K9G A;  3C0C A;  4KGV B;  3HFO A;  4F14 A;  1E7O A;  2FVU A;  3LGL A;  2EYW A;  3MEW A;  1GCQ A;  4HKE A;  1UG1 A;  1M2O A;  2R58 A;  5EG2 A;  3CME Q;  3VUZ A;  3FLG A;  2F5T X;  4E7I A;  1UJY A;  1M4Z A;  5GAO n;  1RAG B;  3SFM A;  3M0P A;  2AHJ B;  1QWE A;  3SWN B;  4AG2 C;  4M78 F;  5FLX E;  3M0Q A;  2ZPH B;  1K9M R;  3DLM A;  3CD6 Q;  1RLP C;  3R6N A;  4M75 A;  3OBY A;  1M30 A;  1ZSZ B;  3P8H A;  3CC4 Q;  3QWY A;  1V1C A;  5CO7 A;  4RG2 A;  2PZ1 A;  2EJ9 A;  1JJ2 S;  3M0S A;  2DFU A;  2P84 A;  1VQ8 T;  4BI3 A;  3CCQ T;  4BDY A;  2J6F A;  4QW2 A;  1NM7 A;  1UFF A;  1VQL T;  4PJL A;  3JCM d;  3OYN A;  1NJI U;  2ECZ A;  2RJF A;  3CCR Q;  2K5F A;  1VQ7 T;  4M77 E;  1XTD A;  4BDZ A;  1QVF A;  1YIJ T;  5CKH A;  1WHJ A;  2P4R A;  5GAN f;  1PRM C;  2JVV A;  4X1V A;  1YIT T;  1SHG A;  1KFZ A;  1T0H A;  4JJN K;  2VC8 A;  4M78 B;  4FIB A;  1MHN A;  3TCJ A;  1ZA2 B;  1G83 A;  3GBQ A;  3HRU A;  1O9S A;  1WHL A;  2LZ6 B;  2DMO A;  2HMA A;  3X20 B;  1Q95 G;  2BUD A;  1TSF A;  2GQV A;  1VQK T;  1PCX A;  1QWF A;  3GNF B;  1VOM A;  1W2B P;  4XTY A;  3C4S A;  2C0T A;  1QW1 A;  2P4T A;  3CBM A;  3VS0 A;  1WFW A;  1IGU A;  2YRV A;  4KGZ B;  2FG0 A;  4QT7 A;  3DLL A;  1E6G A;  4E7J A;  3CCV T;  1NZ9 A;  3ULR B;  2DTH A;  2RQV A;  1YN8 A;  2XG8 D;  3PT9 A;  2DK3 A;  2ABL A;  3G71 Q;  2M51 A;  4KUD K;  4J9E A;  1W4S A;  2E10 A;  4M7D F;  2COZ A;  3CCM T;  2GCX A;  2P0P A;  4ANJ A;  2A37 A;  1VYU A;  1VQ8 Q;  2QQS A;  3CCQ Q;  1S72 T;  4M7A F;  1Z9Z A;  2HL5 C;  1VQL Q;  3GLX A;  5KYX A;  1WJS A;  1X2K A;  2AKL A;  3NGP A;  3G4S A;  1M1K U;  1VQ7 Q;  3OB9 A;  4DBR A;  1JQQ A;  4C0G A;  1QP3 A;  3MP1 A;  1YIJ Q;  3LX7 A;  4J6W A;  4C0D C;  5C0M A;  1YJ9 T;  1BU1 A;  4FYW B;  3JB9 I;  1M2V B;  1KQS A;  1WX6 A;  3PE0 A;  4B9W A;  4ZNX A;  5LJ5 h;  1YIT Q;  1BYM A;  4J9H A;  1BKB A;  1VUB A;  1JXO A;  2RK2 A;  4XAX B;  3HP9 A;  1B7T A;  5KYU A;  3QUI A;  4CC7 A;  4M78 E;  2K5L A;  2KYM A;  1NLO C;  5GAO m;  2WSE E;  4M7D B;  3M54 A;  1QQJ A;  1AD5 A;  1YJN T;  2PUO B;  4OMM A;  1X6O A;  1YWP A;  4BE2 A;  3INZ A;  1K8A C;  2Y4Y A;  3BW1 A;  3OSS C;  4FSS A;  4XQ3 A;  2OTJ A;  4M7A B;  1UGP B;  2DZ9 A;  3PNW C;  2ATC B;  1H3H A;  3H0F A;  5LJ5 d;  4FCY A;  2HQX A;  2LQN A;  2YLC A;  4OGE A;  4AT1 B;  1TU0 B;  3EHQ A;  2VWF A;  2DZC A;  1BI1 A;  4KUL A;  5FWB A;  3EFS A;  1NE8 A;  3D7S B;  4RMO A;  5GAN e;  4M77 C;  3OYH A;  1ZBX A;  2RQT A;  1YJW T;  3JB9 F;  3OS5 A;  4C8Q B;  2O31 A;  2EYY A;  3ASK A;  3C12 A;  4LD9 K;  5EC7 A;  3CCV Q;  4IIO A;  5KCO A;  2C0I A;  2ZGW A;  3CC2 T;  1B34 B;  1WNL A;  3V7S A;  2DIL A;  2E3I A;  4F16 A;  3A98 A;  2KXC A;  5GJW B;  4WCI A;  2HCK A;  2O4X A;  3EFR A;  1K8A R;  2O9S A;  3CCM Q;  1NBE B;  5IXF A;  2YXY A;  2MOX A;  5AYF A;  3A8O B;  2LDM A;  5GMK j;  3EG1 A;  1FX7 A;  1YCS B;  5I22 A;  1S72 Q;  4OF1 A;  2D1X A;  3M53 A;  3JCM V;  2A3L A;  3CCU A;  1NEB A;  3HTR A;  3VS6 A;  1NEG A;  2LQ8 A;  2X4Y A;  1H3Z A;  1M1G A;  2FYK A;  1G5V A;  2JJ9 A;  2XDP A;  4KRT A;  3CCJ T;  4KH1 B;  2Y4X A;  2BE7 D;  4HXJ A;  2QYZ A;  1TXQ A;  2NUZ A;  2DET A;  1YJ9 Q;  4IUU A;  1PSE A;  2LJ0 A;  1PRL C;  5FU6 B;  4C0Z A;  1U3O A;  4E7K A;  2F2V A;  1RAA B;  1JU5 C;  2COW A;  2OTL Q;  1MND A;  3CCE T;  3REB B;  1JEG A;  1VQ5 Q;  1W2B A;  2YUP A;  2F2W A;  3EG2 A;  2LQW A;  3OYI A;  1BBZ A;  2XHC A;  4J9I A;  4M75 E;  1U1S A;  5CKD A;  1ZSZ C;  3JB9 J;  4FT2 A;  3TEE A;  3MP8 A;  3ZL7 C;  1UEC A;  3JRZ A;  2QA4 A;  5DM7 R;  2YUQ A;  2YT6 A;  2JTF A;  5DLO A;  2KGT A;  2K57 A;  1TOV A;  2ZZD A;  4PKC C;  1UTI A;  2DYI A;  2XU8 A;  4N0A A;  2HAX A;  2E6Z A;  2EGC A;  4C92 G;  2HBW A;  2EKO A;  3M55 A;  4PJO D;  2FZK B;  5CQY A;  2VXE A;  3E2U A;  2FL7 A;  1I4K 1;  2DIQ A;  4HCC A;  4RKU E;  3SD4 A;  3CC2 Q;  5LJ3 f;  2XKO C;  1YHQ T;  3NTH A;  1Y96 B;  9ATC B;  4GLK A;  2E5Q A;  4QQG A;  1JXM A;  2GFU A;  3JV3 A;  4QQ6 A;  1OUL A;  1YWO A;  1SEM A;  4M78 C;  1AOJ A;  4RTY A;  3VS3 A;  3OYL A;  2LRQ A;  2CDT A;  4IIM A;  2FZC B;  1TUD A;  3CXC S;  1WHH A;  4F7U G;  1PM3 A;  3U23 A;  3QWX X;  4ESR A;  3CPW S;  2CH4 W;  4J9G A;  1I5L A;  2OX7 A;  2CYZ B;  1HK9 A;  2V8J A;  1K0X A;  3S3O A;  1GXI E;  3CCJ Q;  3G1J A;  2M9U A;  5AT1 B;  4AMC A;  2DKG A;  2K3X A;  4QQD A;  1YCY A;  4RCC A;  2DER A;  4OP0 A;  1UGR B;  1AWX A;  3QZ9 B;  1QVG S;  3OYC A;  4C92 A;  2JZ2 A;  3CCL T;  3CCE Q;  1WYX A;  2VGN A;  3M9Q A;  4OB0 B;  1NYG A;  2DD4 A;  3SHW A;  1CSK A;  1K1Z A;  5GJV B;  1RUW A;  4TVR A;  5FRM A;  1OOT A;  3I35 A;  1K4U S;  2ZPB B;  6AT1 B;  1QCF A;  5KH6 A;  1RAI B;  3J7A F;  2FRW A;  4B9X A;  2YSQ A;  3BDL A;  1VQM A;  5D7U A;  2E1H A;  1D1B A;  3JCM b;  3AHU A;  1ZQ1 A;  5GAN j;  1M3A A;  4R0K A;  4OMP A;  2RH2 A;  4ZTF A;  5A2Q E;  4J9C A;  3SDZ A;  4JS4 A;  3KXT A;  4C0D B;  2A36 A;  2VB6 A;  4E7L A;  2RJE A;  1N27 A;  4M75 D;  2V1R A;  4F7U A;  2OTL A;  2VUB A;  2E6N A;  2GNC A;  1OU9 A;  1PD0 A;  4KH0 B;  1VQ5 A;  1IGQ A;  2L8D A;  2KAF A;  3RKW A;  2G6F X;  2RQW A;  3ZEH A;  1VQ9 A;  2LVM A;  1YHQ Q;  1EX4 A;  2QK0 A;  3QPH A;  4GY5 A;  3R6O A;  4ZTJ A;  2HSP A;  1NPR A;  3DB3 A;  2LT4 A;  5HK0 A;  3TRE A;  1OZ3 A;  4HA8 A;  1Q81 C;  2PVD B;  1C6V X;  4JRK A;  2RD1 A;  1AZG B;  5CAI A;  2EPD A;  2GFA A;  4EMK B;  2KY9 A;  1VQO A;  2H8H A;  5KYY A;  1K8A U;  2DL4 A;  5GMK l;  4M7D C;  2KXD A;  4XU1 A;  2ZPI B;  3MEV A;  2L89 A;  2EKH A;  2RJC A;  2BE9 B;  3QJY A;  3X25 B;  4M7A C;  4HVV A;  1EZZ B;  5LJ3 e;  2O01 E;  3RES A;  4FT4 A;  2ZPF B;  2K5I A;  1AZE A;  4OB3 B;  2JTM A;  4JLI A;  1Q81 R;  4D8K A;  2K3B A;  4DBH A;  4C8Q C;  3CCL Q;  4LUE A;  4JJB A;  4O5V A;  5ECA A;  1WDX A;  1IHW A;  1M27 C;  1SF9 A;  1RAF B;  3OMC A;  4M4Z A;  1VQP A;  2SEM A;  4ELY C;  1NYF A;  2KQW A;  3OYM A;  1KJW A;  2OTJ T;  3LWH A;  5GAM d;  1WXU A;  4NL3 A;  4MML A;  3L2Z A;  3X24 B;  4BD3 A;  5GAO q;  4JPB W;  5I11 A;  4OGC A;  1YI2 Q;  1TUG B;  2CP5 A;  1T3L A;  1IRX A;  3MCA B;  4K11 A;  1JB0 E;  2A28 A;  1X2Q A;  4F7U F;  4EMG A;  4L6V 5;  1G8X A;  3MET A;  2E12 A;  3WXM B;  2DL5 A;  2DEU A;  5LJ5 f;  1MUZ A;  3M57 A;  1R8O B;  2VAS A;  2HDA A;  1N5Z A;  2MCN A;  2QGF B;  4D6W A;  2DTI A;  4PLI A;  1SSF A;  1Y07 A;  1ZA1 B;  2QEX A;  1JBM A;  2C06 A;  2DVE A;  3EGU A;  2D0Q B;  3JCM h;  4C5I A;  3M0T A;  2KRO A;  3PVL A;  2GTO A;  1FWZ A;  2X35 A;  5FU6 C;  2KRM A;  2DJZ A;  1M90 C;  2MWO A;  2YHT A;  1M8M A;  4DA4 A;  3RBB B;  4PJO F;  3EFO A;  1RAB B;  5IHI A;  4FYX B;  3G6E A;  1KQ2 A;  4A63 B;  3EG0 A;  4DQ2 A;  1UE9 A;  2CZ7 B;  1M3B A;  3QII A;  1Q86 C;  1VQ6 Q;  1G3S A;  1RI0 A;  1FMK A;  4XTV A;  4LDV A;  5LJ3 g;  1VYV A;  3LYI A;  2PUK B;  2ENM A;  2D8J A;  1RAD B;  3OSV A;  3ZFJ A;  4A53 A;  1K76 A;  1KSW A;  2VVK A;  2A08 A;  1P92 A;  2RI2 A;  1QP2 A;  1U8R A;  1M90 R;  5GAN 3;  3URG A;  4LXC A;  2NUT A;  5M9O A;  4L59 A;  1Q82 C;  3UT1 A;  4X9D A;  5CIU A;  2VGM A;  1Q86 R;  3OYA A;  2WSF E;  4F04 B;  1WZO A;  1OX8 A;  5GMK h;  4PJO B;  2CZ6 B;  2X9H A;  4XU3 A;  2FEI A;  5A0D A;  2K7A A;  3VS1 A;  3CCS T;  4RTZ A;  1VQ4 T;  4J8O A;  2V8I A;  4DBF A;  4F17 A;  2J05 A;  3I56 A;  2P0K A;  3A8M B;  2QTV A;  1R77 A;  2PVO B;  1AWW A;  5D6W A;  3ER0 A;  3TVT A;  1IO6 A;  5GAM j;  2JM8 A;  8AT1 B;  3HRT A;  3I55 T;  3QZ5 B;  2M1H A;  2PTK A;  4C5H A;  5L8R E;  1ZLM A;  3FRN A;  1Q82 R;  3PMT A;  2QG9 B;  2XIC A;  3UAT A;  1Y57 A;  5CR2 A;  3V8K A;  1H64 1;  1RAC B;  3J81 E;  4XU2 A;  3M4G A;  1R0C B;  4FSX A;  1OPL A;  2RHI A;  3CC7 T;  4PJJ A;  4ZGJ B;  2C0O A;  4M75 F;  1MMN A;  1VYT A;  1YI2 A;  4MZP A;  4C92 E;  5KYW B;  1GBQ A;  2VXF A;  1WJR A;  1W2B S;  2LNV A;  3UF4 A;  2RHZ A;  1KHI A;  3RMS A;  3L2R A;  1FXX A;  4KBM B;  1WQW A;  5GAO r;  1MGQ A;  4C5E A;  2EVR A;  3OW2 S;  2MF2 A;  2W0Z A;  3S6W A;  1GL5 A;  3CME A;  1I5O B;  2RB6 A;  3P8B B;  3MEU A;  3WVE B;  2KT8 A;  2DBM A;  4ME7 A;  3MKD A;  1ZUY A;  1MMD A;  2LC4 A;  1J3T A;  3EGX A;  1FYN A;  3H41 A;  4CI0 C;  4JZ3 A;  3UPU A;  1M5Q 1;  4A4K A;  3CD6 A;  4F7U E;  1U1T A;  3EGD A;  3CC4 A;  4BY6 B;  3NFC A;  2DIG A;  1Q81 U;  4M75 B;  4BE0 A;  1OQK A;  1VQ6 A;  3ME9 A;  1QMC A;  4RTT A;  2EJF A;  4NOY A;  2DO3 A;  3THK A;  1T0J A;  4CC4 B;  1VQK Q;  3CCS Q;  4ELZ C;  1MMA A;  5DLQ E;  3IQL A;  3QDF A;  1D3B A;  1VQ4 Q;  3CCR A;  4PJO E;  1U5S A;  4LN2 A;  4EMK C;  4J9D A;  2FRY A;  1B07 A;  3CQT A;  1RLQ C;  4EPC A;  4NL2 A;  2ZAE A;  4OMN A;  1OV3 A;  1KQ1 A;  3NPF A;  5GAN 7;  1V76 A;  1RL2 A;  3I55 Q;  2RMO A;  2ED1 A;  2LCC A;  1WHK A;  3UDC A;  5C6S A;  1WHG A;  4LD6 A;  4DOW A;  1D1A A;  2BIV A;  4PFO A;  1TG0 A;  5FRO A;  1AVZ C;  2HZY A;  1D0Y A;  4XTZ A;  5KYN A;  4V2S A;  1QVP A;  2CP3 A;  2E64 A;  3CC7 Q;  5GAN 4;  2KEA A;  3M56 A;  2NWM A;  1VQN T;  5KE2 A;  1OPK A;  4MZT A;  3I5R A;  2D0N A;  3MP6 A;  3MO8 A;  4RTV A;  2LT1 A;  5LJ5 g;  1K9M U;  5J3B A;  4VUB A;  8ATC B;  1K73 C;  2KE9 A;  4L5G A;  3JCM W;  5FW9 A;  5J26 A;  1TS9 A;  1UJ0 A;  1JO8 A;  2DAQ A;  3TSW A;  2BKD N;  5GAN h;  4C92 D;  2L3S A;  2QXF A;  2JN0 A;  5CKB A;  3JCM J;  3OYK A;  3M59 A;  4M77 G;  1WQ7 A;  3FDR A;  3J80 E;  5FU7 C;  1QCO A;  1X75 C;  4J7F A;  3KUF A;  3BDU A;  3G71 A;  1F1B B;  1W70 A;  1IXD A;  3NTI A;  2CZ0 B;  2DTO A;  3VV0 A;  1SSH A;  2KI7 A;  4JDS A;  1Y71 A;  3L2V A;  4A4H A;  3CMA T;  2CUD A;  1AWJ A;  2DNU A;  4J9B A;  2QQB A;  1VQ8 A;  1K73 R;  3CCQ A;  1SHF A;  1IB8 A;  2LX7 A;  5GAN d;  2MI6 A;  1VQL A;  2X3W D;  3UA6 A;  3OYF A;  1YJN Q;  1QLY A;  2W10 A;  1FMV A;  3L2U A;  1Q86 U;  2D9T A;  4QVC A;  1VQ7 A;  3H6Z A;  2RNA A;  3GOX A;  3X26 B;  5HK3 A;  2V8K A;  1YIJ A;  1XOV A;  5KYX B;  1WXT A;  1TUC A;  2HD0 A;  4BAC A;  4RCB A;  2QEX T;  1UGS B;  1VIF A;  1YIT A;  5DY9 A;  2DL8 A;  1Z9Q A;  5GAN 5;  4JJD A;  1PSF A;  1UDL A;  1LOJ A;  2FB7 A;  1YJW Q;  2EJG A;  1TWB A;  3OS1 A;  1W1F A;  1Q82 U;  3CXC P;  1KD1 C;  2O88 A;  1VQN Q;  1AHJ B;  4M77 A;  2ZPE B;  4MMK A;  4IKF A;  5HY6 A;  5KYU B;  2COY A;  3QJ6 A;  4RTU A;  3WVD B;  4J7I A;  4BI8 B;  3V7C A;  1D09 B;  4FL6 A;  4QVZ A;  2IPO B;  4Y92 A;  2ROL A;  1WJQ A;  2DRK A;  1G3W A;  4AFZ C;  3T9N A;  4PJN A;  4PJO C;  5D6Y A;  3A1P A;  1RI9 A;  2CUB A;  3ZBD A;  2K79 A;  1QVG P;  3EHR A;  5I2M A;  2VV5 A;  1OX9 A;  1ABQ A;  3QG1 A;  3CCV A;  3A8G B;  4RUG A;  4E7S A;  3H0H A;  1KD1 R;  3JCM f;  2R5A A;  2M0O A;  2EYX A;  1ZBJ A;  1LCK A;  3CCM A;  2LQK A;  2Y90 A;  2H3E B;  3V8L A;  3HRS A;  2RPN A;  5GAO p;  3CMA Q;  5LL6 S;  2DJQ A;  2EYZ A;  2X4W A;  3F70 A;  4AFU C;  2EQU A;  2DX1 A;  3E19 A;  2J6K A;  1BIA A;  2CRE A;  3NHN A;  1S72 A;  2O4X B;  3A8L B;  1QKX A;  4M78 G;  2E65 A;  2AZV A;  3MHX A;  2MIO A;  1R0B G;  1U06 A;  2PQW A;  2LCL A;  4BUG A;  2X51 A;  3V7R A;  5A0G A;  4XTX A;  2RHU A;  2E41 A;  1WPY A;  2GGR A;  3E1S A;  1HSQ A;  3SWN A;  1H92 A;  3OYE A;  3M4Y A;  1UHF A;  3OY9 A;  4PK4 A;  1YJ9 A;  1TTH B;  4FYV B;  2D6F A;  2QDL A;  1ZSZ A;  4BB7 A;  2KT1 A;  2CSI A;  5FWC A;  3OYG A;  3FIF A;  4BI4 A;  3A5Z B;  4LDU A;  1YNZ A;  3TQ7 P;  3CPF A;  5FRN A;  3GP8 A;  2F69 A;  2EGA A;  1WI7 A;  1GCQ C;  3GIB A;  1OEB A;  1QVF S;  2EBP A;  4MDW A;  2EIF A;  1YJN A;  3FJP A;  4LDW A;  4FW2 A;  1E6H A;  4BY6 C;  1AT1 B;  3NTK A;  3X28 B;  1GBR A;  1MMG A;  4QVD A;  2I0N A;  3FJ5 A;  2DXB A;  1KK7 A;  3CME T;  3L2W A;  4M75 C;  3S3M A;  2NUP B;  1T3S A;  2DVJ A;  4JS5 A;  3G4S T;  3HHT B;  4P5N A;  3PIO A;  3H8Z A;  2JW4 A;  2XMF A;  4M78 A;  3OS2 A;  2DF6 A;  4ZGD B;  3CC4 T;  5GAM h;  1S1N A;  3CC2 A;  2KYB A;  1RAE B;  1LNX A;  4XU0 A;  1M9S A;  3JB9 H;  2CSQ A;  3JCM Q;  1WA7 A;  1BI3 A;  4FYY B;  1EFN A;  4C92 F;  4E2F B;  3OS0 A;  5GAO l;  4D8D A;  1SRM A;  1YBY A;  2CP2 A;  2BZX A;  1JRI A;  2DXC A;  1TH7 A;  2JM9 A;  1B3Q A;  2NYS A;  1X43 A;  2Z0W A;  2CKK A;  2MK5 A;  3E9G A;  2LCS A;  3HSB A;  3RR6 A;  2AZS A;  2RK1 A;  3CCJ A;  2F2X A;  1VIE A;  4M7D G;  4PL6 A;  1G3T A;  1X6B A;  2OJ2 A;  4RG8 A;  1X6G A;  2CP7 A;  2IG0 A;  1Y0M A;  2L5Q A;  3RMQ A;  1HJD A;  3EG9 B;  3EH1 A;  3JCM e;  2RO0 A;  1FMW A;  3GF5 A;  2DXU A;  2B8A A;  5FU7 B;  2J6O A;  2QTX A;  2O2O A;  4WF2 A;  4M7A G;  2I2L A;  3CXC A;  3G7Z A;  4PFZ A;  2KDS A;  1I81 A;  3JCM X;  3CCE A;  3LGF A;  3CPW A;  3RIR A;  2K2M A;  3PTA A;  2JUF A;  5GAM g;  1GFD A;  4FU6 A;  1JJ2 P;  1WHM A;  1GFC A;  1ZX6 A;  1WXB A;  4C92 B;  4C8Q G;  5CKE A;  1KQS S;  1C1A A;  2SRC A;  2XID A;  4PLL A;  2VYT A;  2RA2 A;  1GCP A;  2M16 A;  3TU4 K;  3CCU T;  3LW5 E;  2CS7 A;  5LJ3 d;  1QVG A;  1GRI A;  4EIK A;  4BE1 A;  2M0Y A;  3G4S Q;  4HCK A;  1LJO A;  1M2V A;  1N8R C;  3GPL A;  1X27 A;  2X3X D;  4Y28 E;  2QQA A;  3AT1 B;  3G71 T;  1D0Z A;  1IZ6 A;  3OQ5 A;  1XQH A;  2A0F B;  4E6R A;  4M7D A;  4F7U B;  1YHQ A;  1IRE B;  4Z02 A;  2XK0 A;  2LJ1 A;  2XI9 A;  2FPD A;  4HT8 A;  1A0N B;  5GMK e;  2DXT A;  2E5K A;  1I0C A;  2CGH A;  1KD1 U;  3RER A;  4M7A A;  1QCN A;  5IXB A;  2KMT A;  2CP6 A;  4Z88 A;  3JB9 G;  2JXB A;  2E3H A;  4A4G A;  4OMF B;  2JS0 A;  3O5Z A;  2QQR A;  3EG3 A;  1ABO A;  4OMQ A;  3I5S A;  1N8R R;  2QA4 T;  2R5M A;  2OTJ Q;  3JCM g;  3LH0 A;  4J6Y A;  4C8Q A;  3O8V A;  4PNO A;  4J83 A;  5KYY B;  1KC8 C;  4KUI A;  1QKW A;  4XTU A;  2OAU A;  1B34 A;  1OU8 A;  1M3C A;  1W6X A;  4ZN3 A;  4ATO A;  3JAM E;  2HSE B;  4N4H A;  1WLP B;  4HT9 A;  3A8H B;  2YUO A;  5I21 A;  3V8J A;  3CCL A;  2AK5 A;  1X01 A;  2YRC A;  2FPE A;  1G3Y A;  4O6J A;  4Q5W A;  2WAC A;  2YWW A;  3VUB A;  2MAM A;  4RTW A;  1LVK A;  2G3R A;  2RN8 A;  2DE0 X;  3DB4 A;  4AG1 C;  2MWP A;  3M58 A;  2QDY B;  4LDX A;  1NPP A;  2EW3 A;  2PU9 B;  3OW2 P;  1KC8 R;  2EGE A;  3M0R A;  1EIF A;  4LNP A;  4DOV A;  2HQH A;  3CCU Q;  1ACM B;  2BZ8 A;  2DM1 A;  3BE3 A;  3FB9 A;  2MPX C;  1M1F A;  1I8F A;  1UGV A;  2X4X A;  4LDY A;  4GBQ A;  2NLU A;  1SKU B;  4NS5 A;  2LP5 A;  1UUE A;  5LJ5 e;  4J5Y A;  2K6D A;  4IUT A;  4AFS C;  1SPK A;  5LJ3 j;  2GF7 A;  2XDD A;  4B6M A;  4JRP A;  1O75 A;  2ZPG B;  3RKX A;  4CRI A;  4LE9 A;  3BY7 A;  3VU3 C;  5GAN 8;  3BFM A;  5CVI A;  4PFP A;  1V29 B;  5GMK m;  2L3R A;  5CQX A;  2KVQ G;  2L3Q A;  3QYG B;  3L42 A;  1VQM T;  2QA4 Q;  3OYD A;  2HQE A;  4C8Q F;  3EFO B;  4QKU A;  4OML A;  4E7Z A;  2R57 A;  1BK2 A;  3QO3 A;  1Q7Y C;  1WIE A;  4JLG A;  4N4I A; 
#chains in the Genus database with same CATH homology
 3M0U A;  1AZG B;  2CT3 A;  2ECZ A;  2EPD A;  4DEX A;  1W1F A;  1NLP C;  2KNB B;  2HEQ A;  2H8H A;  2CH4 A;  2DL4 A;  2O88 A;  2AKK A;  2KXD A;  1ARK A;  2P4R A;  4RTU A;  1PRM C;  4X1V A;  2EKH A;  1SHG A;  1ZSG A;  1KFZ A;  1T0H A;  4Y92 A;  4AFQ C;  2ROL A;  2DRK A;  3LH5 A;  1G83 A;  3GBQ A;  4HVV A;  4AFZ C;  2LZ6 B;  2DMO A;  3PVQ A;  2YDL A;  1AZE A;  1RI9 A;  2CUB A;  2K79 A;  2LNH B;  4D8K A;  3EHR A;  1QWF A;  2K3B A;  4LUE A;  4JJB A;  5ECA A;  1ABQ A;  1WDX A;  1M27 C;  2C0T A;  4RUG A;  4M4Z A;  2SEM A;  3H0H A;  1NYF A;  4GLM A;  1KJW A;  2EYX A;  1ZBJ A;  3VS0 A;  1LCK A;  1WXU A;  1WFW A;  2RPN A;  4JPB W;  2DJQ A;  2EYZ A;  4AFU C;  5I11 A;  2FG0 A;  2DX1 A;  1T3L A;  2J6K A;  4QT7 A;  2CRE A;  3NHN A;  2GBQ A;  2DL3 A;  4K11 A;  1QKX A;  4HVU A;  1E6G A;  2A28 A;  2OAW A;  4DEY A;  1X2Q A;  3ULR B;  2AZV A;  2RQV A;  1YN8 A;  5IHK A;  2J06 A;  2MIO A;  1U06 A;  2ABL A;  4LUD A;  2M51 A;  2DL5 A;  4J9E A;  2GGR A;  1MUZ A;  4Z89 A;  1HSQ A;  2HDA A;  1N5Z A;  2GQI A;  2IIM A;  2MCN A;  1H92 A;  1UHF A;  2ROT A;  1AEY A;  2A37 A;  3EGU A;  2QDL A;  1VYU A;  3M0T A;  2KRO A;  3PVL A;  2GTO A;  1UHC A;  2KT1 A;  2CSI A;  4J9F A;  5FWC A;  2LJ3 A;  2KRM A;  1Z9Z A;  1YNZ A;  1M8M A;  1X2K A;  2AKL A;  3NGP A;  3RBB B;  2LMJ A;  2EGA A;  1I07 A;  1WI7 A;  1GCQ C;  2ESW A;  5IHI A;  1OEB A;  1ZUU A;  3I9Q A;  1BB9 A;  2EBP A;  3EG0 A;  4A63 B;  1JQQ A;  2DRM A;  1UE9 A;  1E6H A;  1M3B A;  2DBK A;  1BU1 A;  1FMK A;  1HD3 A;  1GBR A;  1WX6 A;  1PWT A;  3PE0 A;  4ZNX A;  1VYV A;  5IHN A;  2B86 A;  2I0N A;  3FJ5 A;  4J9H A;  2ENM A;  2VKN A;  4JZ4 A;  2D8J A;  1PNJ A;  1JXO A;  2DLP A;  1T3S A;  2DVJ A;  3SEM A;  1K76 A;  4OMO A;  3VS4 A;  1KSW A;  4CC7 A;  2VVK A;  2KYM A;  1NLO C;  2A08 A;  2JW4 A;  2XMF A;  2O9V A;  1AD5 A;  5L23 A;  2JTE A;  2DF6 A;  4OMM A;  1YWP A;  3REA B;  4FSS A;  1S1N A;  1CKB A;  2KYB A;  1H3H A;  3H0F A;  2LQN A;  1MV3 A;  2CSQ A;  1SRL A;  5HCK A;  3EHQ A;  2VWF A;  5FWB A;  1WA7 A;  2FEI A;  2K7A A;  3VS1 A;  1EFN A;  4Z8A A;  4RTZ A;  2RQT A;  2L0A A;  4D8D A;  1SRM A;  2BZX A;  2O31 A;  3RNJ A;  2EYY A;  2JM9 A;  1B3Q A;  4F17 A;  5EC7 A;  2J05 A;  1X43 A;  4IIO A;  2RF0 A;  2C0I A;  1AWO A;  1AWW A;  2V1Q A;  3NMZ C;  3TVT A;  2DIL A;  1IO6 A;  2PNI A;  2JM8 A;  3A98 A;  4F16 A;  2KXC A;  2LCS A;  5GJW B;  4WCI A;  2AZS A;  2HCK A;  1PKS A;  2PTK A;  1ZLM A;  2F2X A;  2O9S A;  2JMC A;  3UAT A;  2JS2 A;  1Y57 A;  1X6B A;  2OJ2 A;  1VA7 A;  5IXF A;  1X6G A;  1KIK A;  2MOX A;  1Y0M A;  1MV0 B;  3EG1 A;  1HJD A;  1OPL A;  2KRN A;  1YCS B;  5I22 A;  2J6O A;  2O2O A;  2D1X A;  2C0O A;  1VYT A;  1NEB A;  1K9A A;  1NEG A;  3VS6 A;  4CC3 A;  2DL7 A;  1GBQ A;  1H8K A;  4JJC A;  2K2M A;  3UF4 A;  4KRT A;  2J7I A;  4HXJ A;  1GFD A;  1GFC A;  1ZX6 A;  1WXB A;  2YUN A;  2NUZ A;  2SRC A;  2EVR A;  2W0Z A;  1GL5 A;  2LJ0 A;  1PRL C;  2BZY A;  1U3O A;  2F2V A;  2KT8 A;  1CKA A;  2DBM A;  1GCP A;  1JU5 C;  2GTJ A;  1ZUY A;  1J3T A;  1GRI A;  1FYN A;  4EIK A;  3REB B;  3H41 A;  1I1J A;  2M0Y A;  4JZ3 A;  3VS7 A;  3VRZ A;  1JEG A;  1K0S A;  4HCK A;  2YUP A;  2F2W A;  3EG2 A;  2LQW A;  1BBZ A;  4J9I A;  1X27 A;  2X3X D;  1G2B A;  4ORZ A;  3ZL7 C;  1UEC A;  4E6R A;  2YUQ A;  2YT6 A;  3H0I A;  4RTX A;  2LJ1 A;  2KGT A;  4RTT A;  2FPD A;  1PHT A;  1UTI A;  3THK A;  1A0N B;  3KFV A;  1T0J A;  2E5K A;  4CC4 B;  1I0C A;  2EGC A;  3UA7 A;  2HBW A;  2FPF A;  5IXB A;  3IQL A;  2KBT A;  2DYB A;  4Z88 A;  2JXB A;  1U5S A;  2JS0 A;  2RQR A;  3O5Z A;  5IH2 A;  2BTT A;  4LN2 A;  3EG3 A;  4J9D A;  2KRS A;  1ABO A;  4OMQ A;  2FRY A;  1B07 A;  3CQT A;  1RLQ C;  3I5S A;  4OMN A;  1OV3 A;  3NPF A;  2EQI A;  4CC2 A;  2RMO A;  2RQU A;  1YP5 A;  2ED1 A;  1JXM A;  3JV3 A;  1YWO A;  1NG2 A;  1SEM A;  1QKW A;  2KR3 A;  1AOJ A;  4RTY A;  3VS3 A;  1TG0 A;  1AVZ C;  1M3C A;  1W6X A;  2CDT A;  4IIM A;  1PKT A;  2ED0 A;  1TUD A;  4HVW A;  2KEA A;  2D8H A;  2CT4 A;  2NWM A;  2FO0 A;  3U23 A;  1WLP B;  3QWX X;  4ESR A;  2YUO A;  2CH4 W;  2L3P A;  4J9G A;  1OPK A;  2AK5 A;  3I5R A;  2D0N A;  2FPE A;  1K0X A;  3VS2 A;  4RTV A;  4RTW A;  2RN8 A;  2DE0 X;  4AG1 C;  2JMA A;  2KE9 A;  2EW3 A;  3VS5 A;  2L2P A;  5FW9 A;  1UJ0 A;  1JO8 A;  2EGE A;  3M0R A;  3TSW A;  3VRY A;  1AWX A;  4LNP A;  1X69 A;  2L3S A;  2BZ8 A;  2DM1 A;  1WYX A;  2OI3 A;  1ZUK A;  2DA9 A;  2JT4 A;  1NYG A;  3SHW A;  1CSK A;  1UGV A;  1K1Z A;  3TSZ A;  5GJV B;  1RUW A;  2K9G A;  1W70 A;  3C0C A;  4GBQ A;  4F14 A;  1OOT A;  1E7O A;  3I35 A;  1K4U S;  2LP5 A;  1QCF A;  2EYW A;  1GCQ A;  1UUE A;  1UG1 A;  1SSH A;  2FRW A;  2K6D A;  2YSQ A;  4AFS C;  2CUD A;  1SPK A;  1AWJ A;  2DNU A;  1UJY A;  4J9B A;  1SHF A;  3M0P A;  1M3A A;  2LX7 A;  4OMP A;  1QWE A;  4R0K A;  4AG2 C;  4J9C A;  4LE9 A;  3M0Q A;  2A36 A;  2X3W D;  3UA6 A;  1QLY A;  2V1R A;  2W10 A;  1RLP C;  3R6N A;  1M30 A;  2GNC A;  3QWY A;  1V1C A;  2L3Q A;  2RNA A;  2PZ1 A;  2G6F X;  1XOV A;  2RQW A;  1WXT A;  3M0S A;  1TUC A;  4OML A;  2J6F A;  2DL8 A;  1Z9Q A;  1BK2 A;  4JJD A;  2HSP A;  1UDL A;  1WIE A;  1NM7 A;  1UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...