1UE9A

Solution structure of the fourth sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
GSSGSSGEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Intersectin 2
publication title Solution structure of the fourth SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
total genus 8
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ue9A00
2F2VA 2W0ZA 2C0OA 4RTWA 2FG0A 2EYXA 1PNJA 2YT6A 4AFZC 4RTUA 2KE9A 3VS3A 1Z9QA 2MOXA 3C0CA 4GLMA 2HSPA 3H0IA 3A98A 1UHCA 4ORZA 3UATA 1NEGA 1QKXA 3NMZC 2O88A 3REAB 3VS5A 3M0PA 2K6DA 1NLPC 1T3LA 1VA7A 4J9DA 4Y92A 3RNJA 2D8JA 1FMKA 2EGCA 2JMAA 4KRTA 2DRKA 2KT1A 2DM1A 2H8HA 2DL3A 1JXOA 2VKNA 2KT8A 3U23A 2NUZA 2P4RA 2DBKA 1T0HA 2K2MA 3UA7A 2KGTA 1GL5A 2BZYA 1H3HA 2XMFA 4FSSA 1Z9ZA 1M3CA 2KYBA 3JV3A 2JM9A 4RTZA 4D8DA 1ZBJA 2DJQA 4J9CA 3VS1A 3RBBB 1QWEA 1X6GA 2CDTA 4HCKA 2JTEA 2DILA 4F16A 2A28A 1CKBA 2MCNA 4R0KA 2GTJA 5IXFA 3O5ZA 4OMNA 2CUBA 2C0TA 3H0FA 1JXMA 1NYFA 1HSQA 3EG2A 3QWYA 4K11A 3EG1A 3TVTA 1T3SA 4WCIA 3VS4A 2L2PA 2LQNA 2M51A 2RQUA 1UFFA 1VYVA 1G2BA 2LMJA 1WXTA 1ABQA 2GQIA 4LNPA 2HBWA 4GBQA 2YUNA 1H92A 1ZUKA 1WA7A 1AWJA 2GNCA 1OOTA 4HVVA 2J7IA 2KYMA 2X3WD 2DNUA 1SHGA 1SPKA 2DL8A 3REBB 3QWXX 3VS2A 2D0NA 2FPFA 4F17A 2AKKA 4OMLA 2EPDA 2ROLA 1K0SA 3CQTA 2F2XA 2RMOA 1B07A 4OMMA 2FRWA 1UE9A 1HD3A 1K0XA 1M8MA 2EKHA 4EIKA 1X43A 1ZLMA 2GGRA 1W70A 1X2KA 4ZNXA 2ABLA 2DL4A 2DMOA 1KFZA 3EG0A 2K3BA 1X27A 1EFNA 1QLYA 1YP5A 4AG1C 1GCQC 2NWMA 4RTYA 2L3SA 4HVWA 2KXCA 5HCKA 1WLPB 4J9GA 2BZXA 2E5KA 3KFVA 5FW9A 1UJYA 3GBQA 4X1VA 1RLQC 1AOJA 2JW4A 1M30A 2O31A 2DX1A 2DYBA 4JJDA 1WXUA 2J6FA 4AFUC 4A63B 2FPEA 2RQRA 4QT7A 4Z88A 5FWBA 2ROTA 1OPLA 2FPDA 2ESWA 4HVUA 2O9VA 1U3OA 3TSZA 1Y0MA 2VVKA 1WYXA 1NM7A 2FEIA 1PKTA 2J06A 2IIMA 2RQTA 1M27C 2CSIA 3VS6A 4LUEA 5GJWB 1OPKA 1UECA 2JT4A 2ECZA 1KIKA 1AZGB 2I0NA 1WIEA 1ZUYA 2KROA 3I5SA 2CUDA 2ENMA 2YUOA 1UGVA 1W6XA 2EW3A 3UF4A 1NEBA 4CC4B 1MUZA 1K76A 2ED1A 2G6FX 2D1XA 1HJDA 2KRSA 2SEMA 2JS0A 1Y57A 1NYGA 1XOVA 2A08A 1AZEA 2DL5A 1U06A 1SRMA 2HEQA 2J05A 2RF0A 3THKA 4JPBW 2RNAA 2EYZA 1UJ0A 5EC7A 2X3XD 4RUGA 1BK2A 1BB9A 4J9EA 1MV3A 1GCPA 1WXBA 2L0AA 2A37A 3SEMA 2CH4A 4LUDA 1GCQA 1YWPA 1JU5C 3PVLA 4HXJA 1M3AA 2B86A 1VYTA 2CT4A 2LCSA 3ZL7C 1GBRA 2YUQA 1BU1A 4CC7A 3FJ5A 3M0QA 4M4ZA 2YUPA 4JJCA 1PKSA 2EGAA 2DL7A 2LJ1A 1GBQA 2DE0X 1BBZA 2OAWA 2RN8A 2L3QA 1MV0B 1AD5A 1I1JA 2V1QA 3UA6A 1CKAA 1T0JA 1LCKA 4J9BA 1WFWA 1YCSB 2EYWA 2LZ6B 2JM8A 1YN8A 1JEGA 3M0UA 1YNZA 2AK5A 1JQQA 1TG0A 3M0SA 2KXDA 1ZX6A 1G83A 2DBMA 2KBTA 2KRMA 2PTKA 4Z89A 1AVZC 5I11A 2M0YA 1E7OA 2L3PA 3EHQA 4RTXA 4OMQA 2EBPA 2K79A 2J6KA 2A36A 2JMCA 4Z8AA 1PRMC 1X6BA 2VWFA 4IIMA 1I0CA 1SEMA 5IHNA 2AZVA 5IHKA 5IH2A 2FRYA 3M0RA 4OMOA 2BTTA 4DEYA 1E6GA 1K4US 1KSWA 2QDLA 4AFSC 1E6HA 1OEBA 3ULRB 4LE9A 1AWXA 2AZSA 1ZUUA 1X2QA 2DA9A 3IQLA 2V1RA 4JZ3A 3R6NA 1RI9A 2JXBA 2RQWA 2JS2A 2DF6A 2OI3A 2DVJA 1SRLA 1GFCA 2DRMA 4J9IA 1ZSGA 3NHNA 3VRYA 2OJ2A 3VRZA 1PRLC 2LJ0A 1TUDA 1K1ZA 2GTOA 2K9GA 1OV3A 3H0HA 3PE0A 2EVRA 5GJVB 1NLOC 1PHTA 4JZ4A 2O9SA 3I35A 2C0IA 1M3BA 1UTIA 1V1CA 5I22A 4J9FA 1J3TA 2PZ1A 1RUWA 2CT3A 2K7AA 2KR3A 1WX6A 4AG2C 4D8KA 4E6RA 2EQIA 1IO6A 1SHFA 4RTVA 1RLPC 4ESRA 1ABOA 4J9HA 1TUCA 1KJWA 1W1FA 2RQVA 5IHIA 3SHWA 4AFQC 1WDXA 2KRNA 1U5SA 2CH4W 1QCFA 3EGUA 1QKWA 1H8KA 2GBQA 5FWCA 2LJ3A 2PNIA 1FYNA 1AWWA 1CSKA 2FO0A 1UG1A 1JO8A 1I07A 3TSWA 2LQWA 4CC3A 2KEAA 1PWTA 4JJBA 4RTTA 4DEXA 3M0TA 1UDLA 2EGEA 4CC2A 3NGPA 2BZ8A 3VS0A 1A0NB 2EYYA 1GRIA 1VYUA 1UHFA 1QWFA 2F2WA 2LP5A 3EG3A 2YDLA 3H41A 2KNBB 1K9AA 2RPNA 1ARKA 2LNHB 2J6OA 2LX7A 1S1NA 1X69A 1UUEA 2CREA 5ECAA 1SSHA 3NPFA 4LN2A 2O2OA 2HDAA 2AKLA 4IIOA 3I9QA 2YSQA 1AWOA 3VS7A 1YWOA 2W10A 3EHRA 3LH5A 5L23A 2MIOA 2DLPA 2ED0A 2SRCA 3I5RA 2HCKA 5IXBA 1B3QA 1WI7A 2CSQA 1NG2A 1N5ZA 4F14A 4OMPA 3PVQA 1AEYA 1GFDA 2D8HA
chains in the Genus database with same CATH superfamily
1QVGA 2F2VA 2FG0A 1D0ZA 1VOMA 2F69A 2YT6A 2IVWA 3VS3A 1Z9QA 2MOXA 4GLMA 4M77B 5D6WA 1D1CA 5CCAA 4J83A 1UHCA 3TREA 4J8OA 3UATA 1NEGA 2O88A 4M78G 2F5TX 1T3LA 4J9DA 2P0KA 2D8JA 3HFOA 2RM4A 2JMAA 2KT1A 4D6WA 4JRPA 1OU9A 1ZA2B 3WXMB 3CCJQ 5J3BA 2NUZA 2DTOA 2K2MA 2X9HA 1KD1C 1GL5A 3D7SB 2BZYA 2XMFA 3ZEHA 5L8RE 2E70A 4RTZA 4D8DA 1ZBJA 5CKFA 5D7UA 2DJQA 4J9CA 4XU1A 4M7AC 1X6GA 2HKQB 1MNEA 2DILA 4XU3A 1CKBA 1HXDA 1KHIA 5J39A 1PSFA 5IXFA 3DKMA 2VASA 2FHDA 4HCCA 3H6ZA 3PIPA 1N6AA 1NYFA 4ELYC 3LWIA 3CCJT 3EG2A 5KYYB 4II1A 4PKCC 2NUTB 2LNVA 3EGDB 3QZ9B 3H8ZA 4C8QF 3CC7T 3WVDB 4HT8A 1RL2A 4OGCA 4ME7A 4LNPA 2YUNA 1MNDA 2QEXA 1QQJA 3X24B 4LDVA 1Q86U 5DLOA 4XTZA 2DNUA 3VS2A 3CPWA 1D0YA 3QWXX 3M53A 2E41A 1S72A 1AT1B 3UPUA 5FROA 1TH7A 2PQWA 3RIRA 3M58A 3SDZA 3CQTA 1D3BB 2RMOA 2ATCB 3VYGA 2RK1A 1IRXA 4EIKA 2LVMA 1RABB 1X43A 2GGRA 4C8QB 2CP6A 1YI2A 4C92C 4RMOA 3C94A 2XKOC 1VQ5A 1EFNA 1K73C 1G3WA 2PUKB 4B9XA 2FZKB 1YP5A 4AG1C 2NWMA 2E4HA 4EPCA 3OYNA 1OZ3A 1I5LA 3VKIA 3GBQA 4X1VA 1YJWQ 4PJOB 1RLQC 4M75E 2JW4A 2O31A 3JSCA 4JJDA 1WXUA 3OS1A 5FLXE 2FPEA 5KH6A 2E64A 2K3XA 5DLQE 3RDVA 2J06A 2IIMA 3G7ZA 1VQKA 2RHYA 4E7HA 2RQTA 4A54A 2LT1A 4Y28E 4DBFA 2JT4A 3HSBA 3CPFA 1KIKA 1AZGB 1ZUYA 2KROA 1YJWT 1M1KU 1NEBA 4CC4B 3CC4A 3MEAA 5CVIA 1MUZA 1NE8A 1HJDA 4FIBA 2KRSA 2SEMA 4IUVA 2QI2A 5LJ3g 1NYGA 3JB9J 1KD1R 3S3MA 2FB7A 3LW5E 3SWNC 3OYDA 1R0BG 2LX9A 1OU8A 2RF0A 2EYZA 4A4FA 1Q82U 4OGEA 5I2SA 2QQBA 1BB9A 3OSSC 4N4GA 3SEMA 5GAN3 2X4XA 2CH4A 2E1HA 2WSFE 2K57A 5CR2A 2JVVA 1YHQQ 5FRNA 3CXCP 3PVLA 4HT9A 1UGPB 2B86A 2CT4A 4M75F 3ZL7C 1GBRA 4CC7A 2YRCA 2DL7A 1IGUA 4E7KA 3QHSA 1WHHA 2L3QA 1MV0B 3UA6A 3QJ6A 4M7DG 1BYMA 2MMPA 1WFWA 3CD6Q 3G71Q 2I2LA 1OI1A 1YN8A 1JEGA 1YNZA 2AK5A 1JQQA 3JB9G 1YHQT 4JRIA 2KXDA 4MMLA 4X34A 1E7OA 2L3PA 4XTVA 2ZCFB 1JJ2S 4A4HA 4OMQA 4M7AA 2OX7A 2K79A 2M0OA 1VQ8A 3CC7A 4JLIA 3HTRA 4XU0A 2XICA 3JCMe 1F1BB 2K4YA 1BCOA 3CD6T 3G71T 3J7AF 3M59A 1IHVA 2FRYA 2HNIA 1LJOA 4OMOA 3VYHB 1GXIE 4DEYA 4AFSC 5KYXA 1AWXA 3TU4K 2WACA 2DA9A 1K73R 4FW2A 1M4ZA 4JZ3A 1IZ6A 4BE1A 4X9DA 4YTLA 1G8XA 3WVEB 3JCMP 2RJEA 3MHXA 1ZSGA 4ZN1A 4HA8A 1QVGP 2OTJA 1MHNA 2NUPB 1MMDA 2E10A 4EMHA 2OJ2A 3JAME 3PMIA 4ZN3A 2LQ8A 1VQMQ 1K1ZA 2GTOA 3NFCA 3FC3A 5IT9E 2ZGWA 4N4IA 4F7UA 1NLOC 3E9FA 5I21A 2JZ2A 4PNOA 3I35A 4BDYA 3G4SA 2C0IA 2HSEB 1YITQ 1V1CA 2XDDA 1O75A 2PZ1A 2K7AA 3M9QA 1WX6A 3TQ7P 4AG2C 4WTOB 3OQ5A 1IO6A 1VQ6Q 1Q86C 4C92A 4J9HA 4XU2A 3LLRA 1JBMA 5GAMh 1VQMT 5LJ3f 4L59A 1HK9A 1RAHB 1JB0E 2JNGA 3N5BB 5KCOA 4ANJA 3AHUA 1QCFA 3OBYA 2KSSA 3EGUA 3L42A 4IUTA 3X28B 5FWCA 3EG9A 1YFNA 1WJQA 1FYNA 5CAIA 4AMCA 1AWWA 1Y7XA 1QVFA 1YITT 3I55Q 3TSWA 1KQ2A 4CC3A 2RI5A 3M0TA 1UDLA 1VQ6T 1ZSZB 4CC2A 1YJWA 3CCMQ 2O4XA 3BY7A 3CC2Q 1TU0B 3GF5A 1QCNA 1OULA 1VQ4Q 2F2WA 2LP5A 3EG3A 2CZ7B 2AIRB 4RG8A 1H641 3LGLA 1U1TA 2L5QA 2LNHB 3CCRQ 1XNIA 3OW2A 1X69A 2CREA 4ZGEB 1N8RU 4IIOA 3EFSA 2E12A 3I55T 3I9QA 1M90U 3QJYA 4BDZA 4Y91A 4IKFA 2QAZA 3SWNA 3CCMT 5L23A 1QP2A 5IXBA 2ZPFB 1Q7YU 3MPUB 2M02A 1N5ZA 3QXEB 5GAOr 1WHLA 3OYYA 2D8HA 2W0ZA 2C0OA 3CCLQ 1M1KC 3CCRT 5AT1B 5GAN6 4AFZC 2YHTA 2KE9A 2MF2A 2RJFA 2HSPA 4A4EA 2HAXA 2QTXA 2CP2A 3G6EQ 3NMZC 3M0PA 6AT1B 1NLPC 1Q82C 1OX8A 2DXUA 2EQKA 4KRTA 4M77E 2KDSA 5LL6S 2DM1A 4KULA 2GFAA 4PFPA 2YRDA 3CCLT 1T0HA 3UA7A 2GCXA 3L2RA 3G71A 1WQWA 1Z9ZA 4PLIA 1M3CA 1VQOQ 2BUDA 3G6ET 1RAEB 3VS1A 3GIBA 1QWEA 2QA4A 4C0DC 2JTEA 2A28A 2FYKA 2KVQG 2GTJA 1K9MU 3O5ZA 2DXCA 1TXQA 4E2FB 2MWOA 1JXMA 1Q86R 1WJRA 2QG9B 3JB9I 3RR6A 2BIVA 4HCBA 4MZMA 2DEUA 2DERA 1VQOT 1WHMA 4M78D 3GLXA 4L6V5 1WXTA 1M2VB 1ABQA 3GNGA 2Y4XA 4KGVB 2K2VA 5C0MA 2GNCA 4C8QG 5GAN2 1VIEA 2KYMA 2M16A 3JCMX 2X3WD 4QQ6A 1BI2A 4M77F 3VV0A 1SHGA 2DL8A 3REBB 4ATOA 4M7DC 2AKKA 5GAMe 2EPDA 3CXCS 1K8AU 1MGQA 1K0SA 3X25B 1YJNQ 1OQKA 1FMVA 1UE9A 2FRWA 4E7IA 3E1SA 1HD3A 4LD6A 1K0XA 1M8MA 2EKHA 3SFMA 4MZTA 1ZLMA 4PJOG 1TTHB 4OB1B 5KE3A 3QYHB 3RKYA 3BE3A 2L89A 4Z02A 3EG0A 2EJ9A 4A4KA 1VQ9T 2VYTA 4RTYA 4C8QE 2V8IA 5A0LA 2L3SA 1YJNT 1WLPB 2BZXA 2E5KA 5FU7C 5FW9A 3QSUA 2HQHA 1VUBA 3BFMA 1AOJA 1Y96B 1M30A 2ZAEA 2DX1A 3ER0A 4A63B 3OYLA 5FWBA 1M1KR 4E7LA 1YCYA 2VB6A 4HVUA 5HK0A 1U3OA 2E65A 2XI9A 4BD3A 3I55A 2VVKA 2P0PA 1YJ9Q 5GMKm 4PJOE 4FM4B 2YRVA 1FMWA 3EFOB 3EGXB 3OYAA 4M75A 1WIEA 1Q82R 2GFUA 2ENMA 2F1LA 2XG8D 4E7ZA 2HZYA 3R6OA 1W6XA 3CMAQ 1D09B 3VU3C 2IPOB 5CQXA 3OYEA 2PU9B 2COZA 1XOVA 4KGZB 1U06A 1SG5A 4KBMB 1QVGS 4PL6A 5GAMd 3A1PA 3KBGA 5KYWB 1YJ9T 7AT1B 5GAMg 4KT0E 2DO3A 1YIJA 1GCQA 1QCOA 1N8RC 4HXJA 1M3AA 1M90C 3J80E 3CMAT 4J7IA 2LCSA 3CCSQ 3LH0A 3CMEA 3SWNB 4DBHA 2KI7A 3CCLA 5IN1A 5LJ3e 1B34A 2E3HA 4JJCA 3HRSA 2EGAA 4E7JA 1Q7YC 2D0QB 3M5AA 4PLLA 2HBPA 2RN8A 2V1QA 4M75G 5GAOq 1CKAA 3VUBA 4PJOF 4J6WA 1QVFP 1KC8U 1VQLQ 1TG0A 3MEWA 1ZX6A 1OX9A 3J81E 1NJIU 2DBMA 1OYXA 2KBTA 2PTKA 2EFIA 2YLCA 1AVZC 5I11A 3CCST 4ELZC 4OVAA 2DPPB 2YLBA 3FB9A 4KH1B 2EBPA 4EMKB 2JJ9A 1BIAA 3CCVQ 2A36A 2RO0A 2X4YA 4NS5A 2JMCA 1PRMC 2R58A 1XQHA 1I0CA 3MP8A 4JUVA 2AZVA 3OW2P 5IH2A 3M0RA 4QQDA 2K3YA 1E6GA 1VQLT 2QDLA 1LNXA 1E6HA 1OEBA 3ULRB 3AT1B 2E6NA 3JCMb 4C0ZA 2AZSA 1X2QA 2V1RA 2ZPEB 2K5LA 1Q81U 2RQWA 4M7DD 1NPRA 5GAOp 3CCVT 3KXTA 1R8OB 3CPWS 1BCMA 2DRMA 2VGNA 4DBQA 5LJ5h 3A8OB 3VRYA 3JB9D 1D1AA 5KYUA 3QUIA 5FU6B 4PFZA 1KQSA 2V8JA 1TUDA 3EH1A 2K9GA 4CRIA 2NYSA 4M7DA 4FYVB 1PHTA 5LJ3d 4JZ4A 3L2QA 2C06A 1M3BA 3EH2A 1VQ9A 3OY9A 4PJLA 5I22A 4FL6A 1RUWA 1WHGA 4FYXB 1UGSB 1BI0A 4M78B 4ESRA 1ABOA 1BKBA 4BI8B 3MO8A 1OZ2A 1W1FA 1KJWA 4DA4A 2PVGB 5IHIA 4QVCA 5A2QE 1BI3A 2XDPA 2DIQA 2XU8A 4JRQA 1K8AC 1QKWA 2M1HA 3E19A 1YBYA 2DTHA 5GANh 1WHJA 2PNIA 5GAMf 5GAOn 3P8HA 2LQWA 4FYYB 5GMKh 4JJBA 2YWWA 3GPLA 1N8RR 2DZ9A 2DYIA 1M90R 3OYKA 1A0NB 1PC0A 2WSCE 2F5KA 4M7AD 1VYUA 1UHFA 2QGGA 2LCCA 1QWFA 2V26A 4C8QC 4QQGA 4XK8E 1Q7YR 2YDLA 1VQPQ 1K9AA 2RPNA 1KHCA 5CK9A 3OYFA 3MKDA 3CCJA 2ZPHB 2LX7A 1I5OB 1UUEA 3NPFA 2HDAA 2PVDB 2QGFB 1YWOA 2W10A 3LH5A 4J6XA 5HY6A 2RB6A 2DLPA 3X26B 2HCKA 2L3RA 4A4GA 1B3QA 2CSQA 4PJOC 1NG2A 4F14A 2OTLQ 4OMPA 3M54A 1EX4A 2QK0A 2CP7A 3FLGA 3E9GA 2CZ6B 3RKWA 1PNJA 4O6JA 4RTUA 3C0CA 3A98A 5A0DA 2LCLA 1WHKA 1EIFA 2EKOA 4ORZA 3OYMA 3MEUA 4C5HA 2EJFA 3RUXA 2B8AA 3REAB 3VS5A 2DK3A 2KY9A 3A8MB 3CCSA 2K6DA 5KCHA 2RHIA 1VA7A 3NTHA 2FZGB 4LDWA 2OTLT 1FMKA 3I56Q 1W4SA 2XD0A 2DRKA 3GOXA 4C92D 5CKDA 5IAYA 1B7TA 1JXOA 3NTIA 2KT8A 3U23A 2MWPA 1K9MR 2P4RA 2DBKA 3OS2A 4QVZA 1H3HA 1TS9A 4EMGA 2E6ZA 2MPXC 3JV3A 4BY6C 3FEOA 2WSEE 5CKHA 4ZTJA 3CBMA 4F16A 1ZQ1A 4FW1A 1R77A 3I56T 3OYBA 1I81A 4N4HA 4OMNA 2CUBA 2C0TA 3H0FA 2L8DA 1NJIC 3O8VA 1HSQA 3OYIA 3QWYA 3M57A 2XDBA 3TVTA 4WCIA 2L2PA 2LQNA 4DOVA 1UFFA 1VYVA 1G2BA 4UC4A 2DXBA 2DETA 2CP3A 3GP8A 1K8AR 1RAAB 2P0QA 3DLMA 3BDUA 3INZA 3LGFA 2HBWA 4GBQA 1WA7A 1ZA1B 3QG1A 4HVVA 1VQNQ 3KUFA 4JJNK 2MAMA 3ZBDA 1SPKA 4NL3A 2D0NA 4M75C 2FPFA 4F17A 2DEQA 4R55A 1B07A 4OMMA 1Q81C 2DZCA 4M77G 1BIBA 3CC2T 5KYYA 4JLGA 2NUTA 8ATCB 1X2KA 1W2BA 1VQ4T 3EGDA 3LWHA 2ABLA 3PIOA 1VQNT 1KFZA 4M7DB 4C5IA 2PVOB 2K3BA 1X27A 2XK0A 1G5VA 1QLYA 5J26A 1QVFS 3UDCA 2K5IA 1GCQC 3C12A 2QQSA 1M9SA 2KXCA 4J9GA 2HQEA 3PGGA 2YXYA 1YHQA 4X9CA 4C5GA 1ZBXA 3OYGA 4IURA 2DYBA 1IXDA 2QEXQ 2RQRA 4QT7A 4Z88A 5LJ5d 2CP0A 4ZTFA 1NZ9A 1D3BA 1C6VX 2O9VA 5LJ5g 1WYXA 4R56A 3P8BB 1S72Q 3OW2S 4M7AF 4C8QA 3T9NA 2CSIA 3VS6A 2KQWA 1FXXA 1UECA 3M4GA 3CD6A 4PJJA 9ATCB 3I5SA 3UWNA 3VUZA 2EW3A 4KGXB 2ZPBB 2QEXT 2ED1A 1HYOA 2D1XA 2KAFA 2JS0A 4KUIA 5DM7R 5M9OA 1KQSP 1Y57A 2A08A 3QO3A 2J05A 4PJOA 1VQ5Q 1WGSA 2FZCB 3THKA 4JPBW 1S72T 2DKGA 4JS4A 2JUFA 4JS5A 3LYIA 4HCZA 5GANd 1VQ7Q 2X3XD 2VC8A 1BK2A 4RUGA 2PUOB 1GCPA 1WXBA 1ZSZC 2L0AA 4RG2A 4M7AB 5C6SA 4FT4A 4LUDA 1IB8A 2CS7A 4ZGDB 1YWPA 2AHJB 2OTLA 5GANg 2CYZB 1RAFB 3M4YA 3MJXA 1NJIR 1KG1A 1QVPA 4F7UF 2YUPA 1IGQA 2Y90A 3QIIA 4PFOA 1VQ5T 1GBQA 5HKCA 3FDRA 2OAWA 1VQKQ 1AD5A 1I1JA 4J6YA 5KYXB 1T0JA 1LCKA 1YCSB 2JM8A 3BW1A 1VQ7T 3M0UA 4FYWB 4TVRA 2VGMA 1RADB 1VQMA 3CCUQ 3M0SA 3CCQQ 1G83A 1PM3A 3PTAA 1MMGA 3DB3A 4V2SA 1LVKA 1YITA 2DVEA 1C0MA 3OB9A 4C5EA 2A0FB 1N9SA 2FL7A 2LC4A 2VWFA 1VQKT 4F7UB 1Q81R 1VQ6A 1SEMA 1G3TA 1PD1A 4BUGA 2LT4A 5IHKA 2BKDN 2M9UA 4BI3A 1JRIA 3DLLA 5D6YA 4VUBA 3CCUT 1K4US 3CCQT 4FU6A 2K5FA 4BE2A 3QDFA 4C92B 1ZUUA 3JCMJ 3A8HB 1D0XA 2JOYA 1TUGB 1RI9A 2JXBA 4GLKA 4GY5A 4M75D 2JS2A 2RI3A 2DF6A 1SRLA 1GFCA 3V7RA 3OMGA 4J9IA 2GQVA 1EZZB 1M1GA 3EG9B 3CCMA 3CC2A 1M2OA 3HP9A 2ZPIB 2LJ0A 2P4TA 1IHWA 3QBYA 1VQ4A 1OV3A 3CBPA 1KQ1A 3PE0A 2EVRA 5LJ5f 2CZ1B 2CKKA 1VQNA 2AT1B 2O4XB 3Q1JA 4XAXB 3CCRA 3ASKA 4MMKA 1UGRB 4JDSA 1VQ8Q 4J9FA 4LDXA 2CT3A 4E6RA 2KR3A 2JTFA 3CC7Q 5KE2A 1LOJA 4RTVA 4XTWA 5I2MA 2RH2A 3MP1A 2A3LA 1C1AA 4LXCA 1M5Q1 1TUCA 3SHWA 1U5SA 3HRTA 2QYZA 4HKEA 4DBRA 2GBQA 2NUPA 2QQ9A 2R5MA 2LJ3A 1WJSA 4M78E 1QP3A 3LX7A 2Y4YA 3RESA 5GAMj 4JRKA 2FO0A 1VQ8T 1PWTA 4RTTA 5GANf 2EQUA 4XTXA 3G6EA 3MEVA 1I4K1 2V8KA 2OTJQ 2EGEA 2BZ8A 3TEEA 3VS0A 3P8DA 1RACB 1GRIA 3X20B 2BE7D 3JCMh 2E3IA 3S3NA 3JCMV 4IUQA 4B6MA 2DJZA 3H41A 2KNBB 2RJCA 3URGA 2EYQA 3M55A 4RCCA 3L2ZA 3G4SQ 5ECAA 3L2VA 4FCYA 2O2OA 4P5NA 2YSQA 2DFUA 2IG0A 4J7FA 1VQOA 3L2WA 2OTJT 2RD1A 4M77C 1RI0A 1O9SA 2MIOA 3E2UA 4PJMA 3L2UA 3RERA 2CZ0B 4PJNA 5GMKi 4OF1A 4RCBA 3G1JA 3OYCA 1ZSZA 5HK3A 5D6XA 2XIDA 3G4ST 4CI0C 4RTWA 2EYXA 4M78F 1W2BP 1XJWB 3H0IA 1VQ7A 2RK2A 2CGHA 1K9MC 2RHZA 1QKXA 2R5AA 2G3RA 2RHUA 2X51A 5GAN8 1SSFA 4Y92A 2LRQA 3RNJA 3OSVA 2EGCA 4MDXA 2H8HA 2DL3A 1FWZA 2A7YA 2JTMA 2VKNA 2MI6A 3HL8A 4E7SA 2KGTA 1M1FA 2JN0A 4FSSA 2KYBA 1PG5B 2JM9A 1TWBA 1YJNA 1WQ7A 2X4WA 1M8VA 3CCUA 3CCQA 4FSXA 3H9NA 3RMSA 4F04B 3RBBB 3OYJA 5CKEA 2CDTA 4HCKA 2DAQA 4MDWA 5LJ3j 2MCNA 5CIUA 4R0KA 1JJ2A 5GAN4 5A0GA 4C0FA 2NLUA 4N0AC 1ZHIA 3A5ZB 4K11A 4BY6B 3EG1A 1T3SA 3VS4A 2M51A 2RQUA 4QW2A 4MZPA 1SKUB 2LMJA 4A53A 1P92A 1DJ7B 4XTUA 1KQSS 1NPPA 2GQIA 1H92A 1ZUKA 1AWJA 4J5YA 3S3OA 1WNLA 4OB2B 1OOTA 3MCAB 3C4SA 2J7IA 2QQRA 1MMNA 4NL2A 2LTOA 4EMKC 1YJ9A 4OMLA 3JB9H 2ROLA 2EAYA 4QVDA 2F2XA 2GF7A 5FRMA 2COWA 2QA4Q 3CMAA 1W70A 2DD4A 4Q5WA 2EJGA 3ZFJA 3OS5A 2QQAA 2QXFA 4ZNXA 3C95A 2DL4A 2DMOA 5GAN7 4LDUA 4M75B 3HRUA 4WF2A 3JCMW 1M2VA 1I8FA 1VQPT 3QKJA 3FJPA 2P84A 3QPHA 2BE9B 2H3EB 5CO7A 2D6FA 4IUUA 3BDLA 4HVWA 5HCKA 1Y07A 4O5VA 3HKSA 4FT2A 3KFVA 1UJYA 1V29B 5FU6C 4M7DE 3ME9A 2QA4T 2QASA 4AFUC 2J6FA 2EWNA 4DOWA 5GAOl 4B9WA 1UB4A 1OPLA 2ROTA 4XTYA 2FPDA 1D1BA 2ESWA 4BI4A 2DXTA 3TSZA 1Y0MA 2HD0A 1NM7A 2FEIA 1PKTA 1KK7A 1PSEA 3MP6A 4AT1B 1M27C 3PFSA 4LUEA 1BI1A 5GJWB 1OPKA 4M77D 4M78C 1V76A 2ECZA 1B34B 3EAEA 2I0NA 4L5GA 2CUDA 2YUOA 1VQLA 2RJDA 2EIFA 4M7AG 1UGVA 3UF4A 1U1SA 3F70A 3QZ5B 1K76A 3QYGB 1XTDA 2G6FX 3A8LB 1AHJB 3CCEQ 4M77A 1AZEA 2DL5A 1SRMA 3JCMQ 2HEQA 5LJ5e 1KC8C 3CCVA 1Y96A 4OB0B 1VIFA 2KMTA 1TOVA 4KH0B 2RNAA 3QDRB 1UJ0A 5EC7A 3HFNA 1Q95G 2LDMA 4BE0A 4J9EA 1MV3A 2A37A 3SB2A 4C0DB 1JU5C 5AYFA 2H3JA 1VYTA 1KD1U 4NOYA 3V8JA 4M7DF 2YUQA 1ACMB 1BU1A 3CCET 3V7SA 3FJ5A 4DQ2A 4M4ZA 2XHCA 3M0QA 3EGXA 3EFOA 4OMFB 1PKSA 2DD5A 4BB7A 2LJ1A 2E5QA 4M7AE 3JCMd 3JB9F 3RKXA 2QTVA 2DE0X 1BBZA 8AT1B 4OP0A 4J9BA 3JCMg 2EYWA 2LZ6B 3L1AA 4F7UG 3HHTB 2VXEA 2EQJA 3NTKA 1SF9A 5KYWA 5GANe 2KRMA 5CQYA 4Z89A 2M0YA 3EHQA 2RI2A 4RTXA 5KYUB 4C92G 3TCJA 5GMKl 5GMKe 4EDUA 2J6KA 2HKNA 4OB3B 2HL5C 1U8RA 4Z8AA 1X6BA 4LD9K 4IIMA 1N27A 1Y71A 1N9RA 3CPWP 5IHNA 1WZOA 5DY9A 2ZZDA 4N0AA 4C0GA 2CP5A 1YIJQ 2BTTA 2LQKA 2Z0WA 3META 1KSWA 4LE9A 3VJPA 2X4JA 4C8QD 3CMEQ 4F7UE 3IQLA 4PK4A 3R6NA 2HL3A 1G3SA 4BACA 1X01A 1G3YA 1QW1A 2OI3A 2DVJA 3M56A 3S6WA 3SD4A 3FIFA 4LDYA 3NHNA 3JRZA 2X35A 5FU7B 4C92E 3VRZA 1PRLC 4EMKA 4KUDK 4XQ3A 1YIJT 4PJOD 3OA6A 3PMTA 1K73U 2MK5A 3H0HA 5EG2A 5GJVB 5LJ5j 5KYNA 2VXFA 3CMET 2O9SA 1YI2Q 4E47A 1W2BS 1VQPA 3CEYA 1UTIA 3GNFB 5LJ3h 1J3TA 3UT1A 3CXCA 3OBWA 4D8KA 2EQIA 3OYHA 1SHFA 1PCXA 1RAGB 1RLPC 3RMQA 2DTIA 1X6OA 2KK4A 2RQVA 4ZGJB 3CBOA 1TSFA 4AFQC 5GAN5 1WDXA 4QKUA 2KRNA 2CH4W 2O01E 1H8KA 5GAOm 1KC8R 2MYSA 1YI2T 3PT9A 2DIGA 1LPLA 1PD0A 1H3ZA 3FRNA 1CSKA 1UG1A 1JO8A 1R0CB 1I07A 2RA2A 1JJ2P 3OS0A 2KEAA 5GANj 4DEXA 3EFRA 2D9TA 2FVUA 5CKBA 3PNWC 3NGPA 1X75C 2EYYA 4RKUE 4C92F 3JCMc 1FX7A 5GMKj 3I56A 3CC4Q 1UGQB 4M78A 4IUPA 1ARKA 2J6OA 3OMCA 2VUBA 3JCMf 1VQ9Q 1S1NA 1SSHA 4LN2A 3V8LA 2R57A 2AKLA 1RAIB 1AWOA 2HMAA 3VS7A 3EHRA 1NBEB 2OAUA 2VV5A 2ED0A 1MMAA 2SRCA 2COYA 3I5RA 3HPWA 1WI7A 1QMCA 1IREB 2HQXA 3DB4A 3CCEA 2EQMA 1WPYA 2ZPGB 3A8GB 2RHXA 3V7CA 3PVQA 3CC4T 2QDYB 1AEYA 1GFDA 1UEBA 3V8KA
chains in the Genus database with same CATH topology
2F2VA 2W0ZA 2C0OA 4RTWA 2FG0A 2EYXA 1PNJA 2YT6A 4AFZC 4RTUA 2KE9A 3VS3A 1Z9QA 2MOXA 3C0CA 4GLMA 2HSPA 3H0IA 3A98A 1UHCA 4ORZA 3UATA 1NEGA 1QKXA 3NMZC 2O88A 3REAB 3VS5A 3M0PA 2K6DA 1NLPC 1T3LA 1VA7A 4J9DA 4Y92A 3RNJA 2D8JA 1FMKA 2EGCA 2JMAA 4KRTA 2DRKA 2KT1A 2DM1A 2H8HA 2DL3A 1JXOA 2VKNA 2KT8A 3U23A 2NUZA 2P4RA 2DBKA 1T0HA 2K2MA 3UA7A 2KGTA 1GL5A 2BZYA 1H3HA 2XMFA 4FSSA 1Z9ZA 1M3CA 2KYBA 3JV3A 2JM9A 4RTZA 4D8DA 1ZBJA 2DJQA 4J9CA 3VS1A 3RBBB 1QWEA 1X6GA 2CDTA 4HCKA 2JTEA 2DILA 4F16A 2A28A 1CKBA 2MCNA 4R0KA 2GTJA 5IXFA 3O5ZA 4OMNA 2CUBA 2C0TA 3H0FA 1JXMA 1NYFA 1HSQA 3EG2A 3QWYA 4K11A 3EG1A 3TVTA 1T3SA 4WCIA 3VS4A 2L2PA 2LQNA 2M51A 2RQUA 1UFFA 1VYVA 1G2BA 2LMJA 1WXTA 1ABQA 2GQIA 4LNPA 2HBWA 4GBQA 2YUNA 1H92A 1ZUKA 1WA7A 1AWJA 2GNCA 1OOTA 4HVVA 2J7IA 2KYMA 2X3WD 2DNUA 1SHGA 1SPKA 2DL8A 3REBB 3QWXX 3VS2A 2D0NA 2FPFA 4F17A 2AKKA 4OMLA 2EPDA 2ROLA 1K0SA 3CQTA 2F2XA 2RMOA 1B07A 4OMMA 2FRWA 1UE9A 1HD3A 1K0XA 1M8MA 2EKHA 4EIKA 1X43A 1ZLMA 2GGRA 1W70A 1X2KA 4ZNXA 2ABLA 2DL4A 2DMOA 1KFZA 3EG0A 2K3BA 1X27A 1EFNA 1QLYA 1YP5A 4AG1C 1GCQC 2NWMA 4RTYA 2L3SA 4HVWA 2KXCA 5HCKA 1WLPB 4J9GA 2BZXA 2E5KA 3KFVA 5FW9A 1UJYA 3GBQA 4X1VA 1RLQC 1AOJA 2JW4A 1M30A 2O31A 2DX1A 2DYBA 4JJDA 1WXUA 2J6FA 4AFUC 4A63B 2FPEA 2RQRA 4QT7A 4Z88A 5FWBA 2ROTA 1OPLA 2FPDA 2ESWA 4HVUA 2O9VA 1U3OA 3TSZA 1Y0MA 2VVKA 1WYXA 1NM7A 2FEIA 1PKTA 2J06A 2IIMA 2RQTA 1M27C 2CSIA 3VS6A 4LUEA 5GJWB 1OPKA 1UECA 2JT4A 2ECZA 1KIKA 1AZGB 2I0NA 1WIEA 1ZUYA 2KROA 3I5SA 2CUDA 2ENMA 2YUOA 1UGVA 1W6XA 2EW3A 3UF4A 1NEBA 4CC4B 1MUZA 1K76A 2ED1A 2G6FX 2D1XA 1HJDA 2KRSA 2SEMA 2JS0A 1Y57A 1NYGA 1XOVA 2A08A 1AZEA 2DL5A 1U06A 1SRMA 2HEQA 2J05A 2RF0A 3THKA 4JPBW 2RNAA 2EYZA 1UJ0A 5EC7A 2X3XD 4RUGA 1BK2A 1BB9A 4J9EA 1MV3A 1GCPA 1WXBA 2L0AA 2A37A 3SEMA 2CH4A 4LUDA 1GCQA 1YWPA 1JU5C 3PVLA 4HXJA 1M3AA 2B86A 1VYTA 2CT4A 2LCSA 3ZL7C 1GBRA 2YUQA 1BU1A 4CC7A 3FJ5A 3M0QA 4M4ZA 2YUPA 4JJCA 1PKSA 2EGAA 2DL7A 2LJ1A 1GBQA 2DE0X 1BBZA 2OAWA 2RN8A 2L3QA 1MV0B 1AD5A 1I1JA 2V1QA 3UA6A 1CKAA 1T0JA 1LCKA 4J9BA 1WFWA 1YCSB 2EYWA 2LZ6B 2JM8A 1YN8A 1JEGA 3M0UA 1YNZA 2AK5A 1JQQA 1TG0A 3M0SA 2KXDA 1ZX6A 1G83A 2DBMA 2KBTA 2KRMA 2PTKA 4Z89A 1AVZC 5I11A 2M0YA 1E7OA 2L3PA 3EHQA 4RTXA 4OMQA 2EBPA 2K79A 2J6KA 2A36A 2JMCA 4Z8AA 1PRMC 1X6BA 2VWFA 4IIMA 1I0CA 1SEMA 5IHNA 2AZVA 5IHKA 5IH2A 2FRYA 3M0RA 4OMOA 2BTTA 4DEYA 1E6GA 1K4US 1KSWA 2QDLA 4AFSC 1E6HA 1OEBA 3ULRB 4LE9A 1AWXA 2AZSA 1ZUUA 1X2QA 2DA9A 3IQLA 2V1RA 4JZ3A 3R6NA 1RI9A 2JXBA 2RQWA 2JS2A 2DF6A 2OI3A 2DVJA 1SRLA 1GFCA 2DRMA 4J9IA 1ZSGA 3NHNA 3VRYA 2OJ2A 3VRZA 1PRLC 2LJ0A 1TUDA 1K1ZA 2GTOA 2K9GA 1OV3A 3H0HA 3PE0A 2EVRA 5GJVB 1NLOC 1PHTA 4JZ4A 2O9SA 3I35A 2C0IA 1M3BA 1UTIA 1V1CA 5I22A 4J9FA 1J3TA 2PZ1A 1RUWA 2CT3A 2K7AA 2KR3A 1WX6A 4AG2C 4D8KA 4E6RA 2EQIA 1IO6A 1SHFA 4RTVA 1RLPC 4ESRA 1ABOA 4J9HA 1TUCA 1KJWA 1W1FA 2RQVA 5IHIA 3SHWA 4AFQC 1WDXA 2KRNA 1U5SA 2CH4W 1QCFA 3EGUA 1QKWA 1H8KA 2GBQA 5FWCA 2LJ3A 2PNIA 1FYNA 1AWWA 1CSKA 2FO0A 1UG1A 1JO8A 1I07A 3TSWA 2LQWA 4CC3A 2KEAA 1PWTA 4JJBA 4RTTA 4DEXA 3M0TA 1UDLA 2EGEA 4CC2A 3NGPA 2BZ8A 3VS0A 1A0NB 2EYYA 1GRIA 1VYUA 1UHFA 1QWFA 2F2WA 2LP5A 3EG3A 2YDLA 3H41A 2KNBB 1K9AA 2RPNA 1ARKA 2LNHB 2J6OA 2LX7A 1S1NA 1X69A 1UUEA 2CREA 5ECAA 1SSHA 3NPFA 4LN2A 2O2OA 2HDAA 2AKLA 4IIOA 3I9QA 2YSQA 1AWOA 3VS7A 1YWOA 2W10A 3EHRA 3LH5A 5L23A 2MIOA 2DLPA 2ED0A 2SRCA 3I5RA 2HCKA 5IXBA 1B3QA 1WI7A 2CSQA 1NG2A 1N5ZA 4F14A 4OMPA 3PVQA 1AEYA 1GFDA 2D8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2V A;  2W0Z A;  2C0O A;  4RTW A;  2FG0 A;  2EYX A;  1PNJ A;  2YT6 A;  4AFZ C;  4RTU A;  2KE9 A;  3VS3 A;  1Z9Q A;  2MOX A;  3C0C A;  4GLM A;  2HSP A;  3H0I A;  3A98 A;  1UHC A;  4ORZ A;  3UAT A;  1NEG A;  1QKX A;  3NMZ C;  2O88 A;  3REA B;  3VS5 A;  3M0P A;  2K6D A;  1NLP C;  1T3L A;  1VA7 A;  4J9D A;  4Y92 A;  3RNJ A;  2D8J A;  1FMK A;  2EGC A;  2JMA A;  4KRT A;  2DRK A;  2KT1 A;  2DM1 A;  2H8H A;  2DL3 A;  1JXO A;  2VKN A;  2KT8 A;  3U23 A;  2NUZ A;  2P4R A;  2DBK A;  1T0H A;  2K2M A;  3UA7 A;  2KGT A;  1GL5 A;  2BZY A;  1H3H A;  2XMF A;  4FSS A;  1Z9Z A;  1M3C A;  2KYB A;  3JV3 A;  2JM9 A;  4RTZ A;  4D8D A;  1ZBJ A;  2DJQ A;  4J9C A;  3VS1 A;  3RBB B;  1QWE A;  1X6G A;  2CDT A;  4HCK A;  2JTE A;  2DIL A;  4F16 A;  2A28 A;  1CKB A;  2MCN A;  4R0K A;  2GTJ A;  5IXF A;  3O5Z A;  4OMN A;  2CUB A;  2C0T A;  3H0F A;  1JXM A;  1NYF A;  1HSQ A;  3EG2 A;  3QWY A;  4K11 A;  3EG1 A;  3TVT A;  1T3S A;  4WCI A;  3VS4 A;  2L2P A;  2LQN A;  2M51 A;  2RQU A;  1UFF A;  1VYV A;  1G2B A;  2LMJ A;  1WXT A;  1ABQ A;  2GQI A;  4LNP A;  2HBW A;  4GBQ A;  2YUN A;  1H92 A;  1ZUK A;  1WA7 A;  1AWJ A;  2GNC A;  1OOT A;  4HVV A;  2J7I A;  2KYM A;  2X3W D;  2DNU A;  1SHG A;  1SPK A;  2DL8 A;  3REB B;  3QWX X;  3VS2 A;  2D0N A;  2FPF A;  4F17 A;  2AKK A;  4OML A;  2EPD A;  2ROL A;  1K0S A;  3CQT A;  2F2X A;  2RMO A;  1B07 A;  4OMM A;  2FRW A;  1UE9 A;  1HD3 A;  1K0X A;  1M8M A;  2EKH A;  4EIK A;  1X43 A;  1ZLM A;  2GGR A;  1W70 A;  1X2K A;  4ZNX A;  2ABL A;  2DL4 A;  2DMO A;  1KFZ A;  3EG0 A;  2K3B A;  1X27 A;  1EFN A;  1QLY A;  1YP5 A;  4AG1 C;  1GCQ C;  2NWM A;  4RTY A;  2L3S A;  4HVW A;  2KXC A;  5HCK A;  1WLP B;  4J9G A;  2BZX A;  2E5K A;  3KFV A;  5FW9 A;  1UJY A;  3GBQ A;  4X1V A;  1RLQ C;  1AOJ A;  2JW4 A;  1M30 A;  2O31 A;  2DX1 A;  2DYB A;  4JJD A;  1WXU A;  2J6F A;  4AFU C;  4A63 B;  2FPE A;  2RQR A;  4QT7 A;  4Z88 A;  5FWB A;  2ROT A;  1OPL A;  2FPD A;  2ESW A;  4HVU A;  2O9V A;  1U3O A;  3TSZ A;  1Y0M A;  2VVK A;  1WYX A;  1NM7 A;  2FEI A;  1PKT A;  2J06 A;  2IIM A;  2RQT A;  1M27 C;  2CSI A;  3VS6 A;  4LUE A;  5GJW B;  1OPK A;  1UEC A;  2JT4 A;  2ECZ A;  1KIK A;  1AZG B;  2I0N A;  1WIE A;  1ZUY A;  2KRO A;  3I5S A;  2CUD A;  2ENM A;  2YUO A;  1UGV A;  1W6X A;  2EW3 A;  3UF4 A;  1NEB A;  4CC4 B;  1MUZ A;  1K76 A;  2ED1 A;  2G6F X;  2D1X A;  1HJD A;  2KRS A;  2SEM A;  2JS0 A;  1Y57 A;  1NYG A;  1XOV A;  2A08 A;  1AZE A;  2DL5 A;  1U06 A;  1SRM A;  2HEQ A;  2J05 A;  2RF0 A;  3THK A;  4JPB W;  2RNA A;  2EYZ A;  1UJ0 A;  5EC7 A;  2X3X D;  4RUG A;  1BK2 A;  1BB9 A;  4J9E A;  1MV3 A;  1GCP A;  1WXB A;  2L0A A;  2A37 A;  3SEM A;  2CH4 A;  4LUD A;  1GCQ A;  1YWP A;  1JU5 C;  3PVL A;  4HXJ A;  1M3A A;  2B86 A;  1VYT A;  2CT4 A;  2LCS A;  3ZL7 C;  1GBR A;  2YUQ A;  1BU1 A;  4CC7 A;  3FJ5 A;  3M0Q A;  4M4Z A;  2YUP A;  4JJC A;  1PKS A;  2EGA A;  2DL7 A;  2LJ1 A;  1GBQ A;  2DE0 X;  1BBZ A;  2OAW A;  2RN8 A;  2L3Q A;  1MV0 B;  1AD5 A;  1I1J A;  2V1Q A;  3UA6 A;  1CKA A;  1T0J A;  1LCK A;  4J9B A;  1WFW A;  1YCS B;  2EYW A;  2LZ6 B;  2JM8 A;  1YN8 A;  1JEG A;  3M0U A;  1YNZ A;  2AK5 A;  1JQQ A;  1TG0 A;  3M0S A;  2KXD A;  1ZX6 A;  1G83 A;  2DBM A;  2KBT A;  2KRM A;  2PTK A;  4Z89 A;  1AVZ C;  5I11 A;  2M0Y A;  1E7O A;  2L3P A;  3EHQ A;  4RTX A;  4OMQ A;  2EBP A;  2K79 A;  2J6K A;  2A36 A;  2JMC A;  4Z8A A;  1PRM C;  1X6B A;  2VWF A;  4IIM A;  1I0C A;  1SEM A;  5IHN A;  2AZV A;  5IHK A;  5IH2 A;  2FRY A;  3M0R A;  4OMO A;  2BTT A;  4DEY A;  1E6G A;  1K4U S;  1KSW A;  2QDL A;  4AFS C;  1E6H A;  1OEB A;  3ULR B;  4LE9 A;  1AWX A;  2AZS A;  1ZUU A;  1X2Q A;  2DA9 A;  3IQL A;  2V1R A;  4JZ3 A;  3R6N A;  1RI9 A;  2JXB A;  2RQW A;  2JS2 A;  2DF6 A;  2OI3 A;  2DVJ A;  1SRL A;  1GFC A;  2DRM A;  4J9I A;  1ZSG A;  3NHN A;  3VRY A;  2OJ2 A;  3VRZ A;  1PRL C;  2LJ0 A;  1TUD A;  1K1Z A;  2GTO A;  2K9G A;  1OV3 A;  3H0H A;  3PE0 A;  2EVR A;  5GJV B;  1NLO C;  1PHT A;  4JZ4 A;  2O9S A;  3I35 A;  2C0I A;  1M3B A;  1UTI A;  1V1C A;  5I22 A;  4J9F A;  1J3T A;  2PZ1 A;  1RUW A;  2CT3 A;  2K7A A;  2KR3 A;  1WX6 A;  4AG2 C;  4D8K A;  4E6R A;  2EQI A;  1IO6 A;  1SHF A;  4RTV A;  1RLP C;  4ESR A;  1ABO A;  4J9H A;  1TUC A;  1KJW A;  1W1F A;  2RQV A;  5IHI A;  3SHW A;  4AFQ C;  1WDX A;  2KRN A;  1U5S A;  2CH4 W;  1QCF A;  3EGU A;  1QKW A;  1H8K A;  2GBQ A;  5FWC A;  2LJ3 A;  2PNI A;  1FYN A;  1AWW A;  1CSK A;  2FO0 A;  1UG1 A;  1JO8 A;  1I07 A;  3TSW A;  2LQW A;  4CC3 A;  2KEA A;  1PWT A;  4JJB A;  4RTT A;  4DEX A;  3M0T A;  1UDL A;  2EGE A;  4CC2 A;  3NGP A;  2BZ8 A;  3VS0 A;  1A0N B;  2EYY A;  1GRI A;  1VYU A;  1UHF A;  1QWF A;  2F2W A;  2LP5 A;  3EG3 A;  2YDL A;  3H41 A;  2KNB B;  1K9A A;  2RPN A;  1ARK A;  2LNH B;  2J6O A;  2LX7 A;  1S1N A;  1X69 A;  1UUE A;  2CRE A;  5ECA A;  1SSH A;  3NPF A;  4LN2 A;  2O2O A;  2HDA A;  2AKL A;  4IIO A;  3I9Q A;  2YSQ A;  1AWO A;  3VS7 A;  1YWO A;  2W10 A;  3EHR A;  3LH5 A;  5L23 A;  2MIO A;  2DLP A;  2ED0 A;  2SRC A;  3I5R A;  2HCK A;  5IXB A;  1B3Q A;  1WI7 A;  2CSQ A;  1NG2 A;  1N5Z A;  4F14 A;  4OMP A;  3PVQ A;  1AEY A;  1GFD A;  2D8H A; 
#chains in the Genus database with same CATH topology
 1QVG A;  2F2V A;  2FG0 A;  1D0Z A;  1VOM A;  2F69 A;  2YT6 A;  2IVW A;  3VS3 A;  1Z9Q A;  2MOX A;  4GLM A;  4M77 B;  5D6W A;  1D1C A;  5CCA A;  4J83 A;  1UHC A;  3TRE A;  4J8O A;  3UAT A;  1NEG A;  2O88 A;  4M78 G;  2F5T X;  1T3L A;  4J9D A;  2P0K A;  2D8J A;  3HFO A;  2RM4 A;  2JMA A;  2KT1 A;  4D6W A;  4JRP A;  1OU9 A;  1ZA2 B;  3WXM B;  3CCJ Q;  5J3B A;  2NUZ A;  2DTO A;  2K2M A;  2X9H A;  1KD1 C;  1GL5 A;  3D7S B;  2BZY A;  2XMF A;  3ZEH A;  5L8R E;  2E70 A;  4RTZ A;  4D8D A;  1ZBJ A;  5CKF A;  5D7U A;  2DJQ A;  4J9C A;  4XU1 A;  4M7A C;  1X6G A;  2HKQ B;  1MNE A;  2DIL A;  4XU3 A;  1CKB A;  1HXD A;  1KHI A;  5J39 A;  1PSF A;  5IXF A;  3DKM A;  2VAS A;  2FHD A;  4HCC A;  3H6Z A;  3PIP A;  1N6A A;  1NYF A;  4ELY C;  3LWI A;  3CCJ T;  3EG2 A;  5KYY B;  4II1 A;  4PKC C;  2NUT B;  2LNV A;  3EGD B;  3QZ9 B;  3H8Z A;  4C8Q F;  3CC7 T;  3WVD B;  4HT8 A;  1RL2 A;  4OGC A;  4ME7 A;  4LNP A;  2YUN A;  1MND A;  2QEX A;  1QQJ A;  3X24 B;  4LDV A;  1Q86 U;  5DLO A;  4XTZ A;  2DNU A;  3VS2 A;  3CPW A;  1D0Y A;  3QWX X;  3M53 A;  2E41 A;  1S72 A;  1AT1 B;  3UPU A;  5FRO A;  1TH7 A;  2PQW A;  3RIR A;  3M58 A;  3SDZ A;  3CQT A;  1D3B B;  2RMO A;  2ATC B;  3VYG A;  2RK1 A;  1IRX A;  4EIK A;  2LVM A;  1RAB B;  1X43 A;  2GGR A;  4C8Q B;  2CP6 A;  1YI2 A;  4C92 C;  4RMO A;  3C94 A;  2XKO C;  1VQ5 A;  1EFN A;  1K73 C;  1G3W A;  2PUK B;  4B9X A;  2FZK B;  1YP5 A;  4AG1 C;  2NWM A;  2E4H A;  4EPC A;  3OYN A;  1OZ3 A;  1I5L A;  3VKI A;  3GBQ A;  4X1V A;  1YJW Q;  4PJO B;  1RLQ C;  4M75 E;  2JW4 A;  2O31 A;  3JSC A;  4JJD A;  1WXU A;  3OS1 A;  5FLX E;  2FPE A;  5KH6 A;  2E64 A;  2K3X A;  5DLQ E;  3RDV A;  2J06 A;  2IIM A;  3G7Z A;  1VQK A;  2RHY A;  4E7H A;  2RQT A;  4A54 A;  2LT1 A;  4Y28 E;  4DBF A;  2JT4 A;  3HSB A;  3CPF A;  1KIK A;  1AZG B;  1ZUY A;  2KRO A;  1YJW T;  1M1K U;  1NEB A;  4CC4 B;  3CC4 A;  3MEA A;  5CVI A;  1MUZ A;  1NE8 A;  1HJD A;  4FIB A;  2KRS A;  2SEM A;  4IUV A;  2QI2 A;  5LJ3 g;  1NYG A;  3JB9 J;  1KD1 R;  3S3M A;  2FB7 A;  3LW5 E;  3SWN C;  3OYD A;  1R0B G;  2LX9 A;  1OU8 A;  2RF0 A;  2EYZ A;  4A4F A;  1Q82 U;  4OGE A;  5I2S A;  2QQB A;  1BB9 A;  3OSS C;  4N4G A;  3SEM A;  5GAN 3;  2X4X A;  2CH4 A;  2E1H A;  2WSF E;  2K57 A;  5CR2 A;  2JVV A;  1YHQ Q;  5FRN A;  3CXC P;  3PVL A;  4HT9 A;  1UGP B;  2B86 A;  2CT4 A;  4M75 F;  3ZL7 C;  1GBR A;  4CC7 A;  2YRC A;  2DL7 A;  1IGU A;  4E7K A;  3QHS A;  1WHH A;  2L3Q A;  1MV0 B;  3UA6 A;  3QJ6 A;  4M7D G;  1BYM A;  2MMP A;  1WFW A;  3CD6 Q;  3G71 Q;  2I2L A;  1OI1 A;  1YN8 A;  1JEG A;  1YNZ A;  2AK5 A;  1JQQ A;  3JB9 G;  1YHQ T;  4JRI A;  2KXD A;  4MML A;  4X34 A;  1E7O A;  2L3P A;  4XTV A;  2ZCF B;  1JJ2 S;  4A4H A;  4OMQ A;  4M7A A;  2OX7 A;  2K79 A;  2M0O A;  1VQ8 A;  3CC7 A;  4JLI A;  3HTR A;  4XU0 A;  2XIC A;  3JCM e;  1F1B B;  2K4Y A;  1BCO A;  3CD6 T;  3G71 T;  3J7A F;  3M59 A;  1IHV A;  2FRY A;  2HNI A;  1LJO A;  4OMO A;  3VYH B;  1GXI E;  4DEY A;  4AFS C;  5KYX A;  1AWX A;  3TU4 K;  2WAC A;  2DA9 A;  1K73 R;  4FW2 A;  1M4Z A;  4JZ3 A;  1IZ6 A;  4BE1 A;  4X9D A;  4YTL A;  1G8X A;  3WVE B;  3JCM P;  2RJE A;  3MHX A;  1ZSG A;  4ZN1 A;  4HA8 A;  1QVG P;  2OTJ A;  1MHN A;  2NUP B;  1MMD A;  2E10 A;  4EMH A;  2OJ2 A;  3JAM E;  3PMI A;  4ZN3 A;  2LQ8 A;  1VQM Q;  1K1Z A;  2GTO A;  3NFC A;  3FC3 A;  5IT9 E;  2ZGW A;  4N4I A;  4F7U A;  1NLO C;  3E9F A;  5I21 A;  2JZ2 A;  4PNO A;  3I35 A;  4BDY A;  3G4S A;  2C0I A;  2HSE B;  1YIT Q;  1V1C A;  2XDD A;  1O75 A;  2PZ1 A;  2K7A A;  3M9Q A;  1WX6 A;  3TQ7 P;  4AG2 C;  4WTO B;  3OQ5 A;  1IO6 A;  1VQ6 Q;  1Q86 C;  4C92 A;  4J9H A;  4XU2 A;  3LLR A;  1JBM A;  5GAM h;  1VQM T;  5LJ3 f;  4L59 A;  1HK9 A;  1RAH B;  1JB0 E;  2JNG A;  3N5B B;  5KCO A;  4ANJ A;  3AHU A;  1QCF A;  3OBY A;  2KSS A;  3EGU A;  3L42 A;  4IUT A;  3X28 B;  5FWC A;  3EG9 A;  1YFN A;  1WJQ A;  1FYN A;  5CAI A;  4AMC A;  1AWW A;  1Y7X A;  1QVF A;  1YIT T;  3I55 Q;  3TSW A;  1KQ2 A;  4CC3 A;  2RI5 A;  3M0T A;  1UDL A;  1VQ6 T;  1ZSZ B;  4CC2 A;  1YJW A;  3CCM Q;  2O4X A;  3BY7 A;  3CC2 Q;  1TU0 B;  3GF5 A;  1QCN A;  1OUL A;  1VQ4 Q;  2F2W A;  2LP5 A;  3EG3 A;  2CZ7 B;  2AIR B;  4RG8 A;  1H64 1;  3LGL A;  1U1T A;  2L5Q A;  2LNH B;  3CCR Q;  1XNI A;  3OW2 A;  1X69 A;  2CRE A;  4ZGE B;  1N8R U;  4IIO A;  3EFS A;  2E12 A;  3I55 T;  3I9Q A;  1M90 U;  3QJY A;  4BDZ A;  4Y91 A;  4IKF A;  2QAZ A;  3SWN A;  3CCM T;  5L23 A;  1QP2 A;  5IXB A;  2ZPF B;  1Q7Y U;  3MPU B;  2M02 A;  1N5Z A;  3QXE B;  5GAO r;  1WHL A;  3OYY A;  2D8H A;  2W0Z A;  2C0O A;  3CCL Q;  1M1K C;  3CCR T;  5AT1 B;  5GAN 6;  4AFZ C;  2YHT A;  2KE9 A;  2MF2 A;  2RJF A;  2HSP A;  4A4E A;  2HAX A;  2QTX A;  2CP2 A;  3G6E Q;  3NMZ C;  3M0P A;  6AT1 B;  1NLP C;  1Q82 C;  1OX8 A;  2DXU A;  2EQK A;  4KRT A;  4M77 E;  2KDS A;  5LL6 S;  2DM1 A;  4KUL A;  2GFA A;  4PFP A;  2YRD A;  3CCL T;  1T0H A;  3UA7 A;  2GCX A;  3L2R A;  3G71 A;  1WQW A;  1Z9Z A;  4PLI A;  1M3C A;  1VQO Q;  2BUD A;  3G6E T;  1RAE B;  3VS1 A;  3GIB A;  1QWE A;  2QA4 A;  4C0D C;  2JTE A;  2A28 A;  2FYK A;  2KVQ G;  2GTJ A;  1K9M U;  3O5Z A;  2DXC A;  1TXQ A;  4E2F B;  2MWO A;  1JXM A;  1Q86 R;  1WJR A;  2QG9 B;  3JB9 I;  3RR6 A;  2BIV A;  4HCB A;  4MZM A;  2DEU A;  2DER A;  1VQO T;  1WHM A;  4M78 D;  3GLX A;  4L6V 5;  1WXT A;  1M2V B;  1ABQ A;  3GNG A;  2Y4X A;  4KGV B;  2K2V A;  5C0M A;  2GNC A;  4C8Q G;  5GAN 2;  1VIE A;  2KYM A;  2M16 A;  3JCM X;  2X3W D;  4QQ6 A;  1BI2 A;  4M77 F;  3VV0 A;  1SHG A;  2DL8 A;  3REB B;  4ATO A;  4M7D C;  2AKK A;  5GAM e;  2EPD A;  3CXC S;  1K8A U;  1MGQ A;  1K0S A;  3X25 B;  1YJN Q;  1OQK A;  1FMV A;  1UE9 A;  2FRW A;  4E7I A;  3E1S A;  1HD3 A;  4LD6 A;  1K0X A;  1M8M A;  2EKH A;  3SFM A;  4MZT A;  1ZLM A;  4PJO G;  1TTH B;  4OB1 B;  5KE3 A;  3QYH B;  3RKY A;  3BE3 A;  2L89 A;  4Z02 A;  3EG0 A;  2EJ9 A;  4A4K A;  1VQ9 T;  2VYT A;  4RTY A;  4C8Q E;  2V8I A;  5A0L A;  2L3S A;  1YJN T;  1WLP B;  2BZX A;  2E5K A;  5FU7 C;  5FW9 A;  3QSU A;  2HQH A;  1VUB A;  3BFM A;  1AOJ A;  1Y96 B;  1M30 A;  2ZAE A;  2DX1 A;  3ER0 A;  4A63 B;  3OYL A;  5FWB A;  1M1K R;  4E7L A;  1YCY A;  2VB6 A;  4HVU A;  5HK0 A;  1U3O A;  2E65 A;  2XI9 A;  4BD3 A;  3I55 A;  2VVK A;  2P0P A;  1YJ9 Q;  5GMK m;  4PJO E;  4FM4 B;  2YRV A;  1FMW A;  3EFO B;  3EGX B;  3OYA A;  4M75 A;  1WIE A;  1Q82 R;  2GFU A;  2ENM A;  2F1L A;  2XG8 D;  4E7Z A;  2HZY A;  3R6O A;  1W6X A;  3CMA Q;  1D09 B;  3VU3 C;  2IPO B;  5CQX A;  3OYE A;  2PU9 B;  2COZ A;  1XOV A;  4KGZ B;  1U06 A;  1SG5 A;  4KBM B;  1QVG S;  4PL6 A;  5GAM d;  3A1P A;  3KBG A;  5KYW B;  1YJ9 T;  7AT1 B;  5GAM g;  4KT0 E;  2DO3 A;  1YIJ A;  1GCQ A;  1QCO A;  1N8R C;  4HXJ A;  1M3A A;  1M90 C;  3J80 E;  3CMA T;  4J7I A;  2LCS A;  3CCS Q;  3LH0 A;  3CME A;  3SWN B;  4DBH A;  2KI7 A;  3CCL A;  5IN1 A;  5LJ3 e;  1B34 A;  2E3H A;  4JJC A;  3HRS A;  2EGA A;  4E7J A;  1Q7Y C;  2D0Q B;  3M5A A;  4PLL A;  2HBP A;  2RN8 A;  2V1Q A;  4M75 G;  5GAO q;  1CKA A;  3VUB A;  4PJO F;  4J6W A;  1QVF P;  1KC8 U;  1VQL Q;  1TG0 A;  3MEW A;  1ZX6 A;  1OX9 A;  3J81 E;  1NJI U;  2DBM A;  1OYX A;  2KBT A;  2PTK A;  2EFI A;  2YLC A;  1AVZ C;  5I11 A;  3CCS T;  4ELZ C;  4OVA A;  2DPP B;  2YLB A;  3FB9 A;  4KH1 B;  2EBP A;  4EMK B;  2JJ9 A;  1BIA A;  3CCV Q;  2A36 A;  2RO0 A;  2X4Y A;  4NS5 A;  2JMC A;  1PRM C;  2R58 A;  1XQH A;  1I0C A;  3MP8 A;  4JUV A;  2AZV A;  3OW2 P;  5IH2 A;  3M0R A;  4QQD A;  2K3Y A;  1E6G A;  1VQL T;  2QDL A;  1LNX A;  1E6H A;  1OEB A;  3ULR B;  3AT1 B;  2E6N A;  3JCM b;  4C0Z A;  2AZS A;  1X2Q A;  2V1R A;  2ZPE B;  2K5L A;  1Q81 U;  2RQW A;  4M7D D;  1NPR A;  5GAO p;  3CCV T;  3KXT A;  1R8O B;  3CPW S;  1BCM A;  2DRM A;  2VGN A;  4DBQ A;  5LJ5 h;  3A8O B;  3VRY A;  3JB9 D;  1D1A A;  5KYU A;  3QUI A;  5FU6 B;  4PFZ A;  1KQS A;  2V8J A;  1TUD A;  3EH1 A;  2K9G A;  4CRI A;  2NYS A;  4M7D A;  4FYV B;  1PHT A;  5LJ3 d;  4JZ4 A;  3L2Q A;  2C06 A;  1M3B A;  3EH2 A;  1VQ9 A;  3OY9 A;  4PJL A;  5I22 A;  4FL6 A;  1RUW A;  1WHG A;  4FYX B;  1UGS B;  1BI0 A;  4M78 B;  4ESR A;  1ABO A;  1BKB A;  4BI8 B;  3MO8 A;  1OZ2 A;  1W1F A;  1KJW A;  4DA4 A;  2PVG B;  5IHI A;  4QVC A;  5A2Q E;  1BI3 A;  2XDP A;  2DIQ A;  2XU8 A;  4JRQ A;  1K8A C;  1QKW A;  2M1H A;  3E19 A;  1YBY A;  2DTH A;  5GAN h;  1WHJ A;  2PNI A;  5GAM f;  5GAO n;  3P8H A;  2LQW A;  4FYY B;  5GMK h;  4JJB A;  2YWW A;  3GPL A;  1N8R R;  2DZ9 A;  2DYI A;  1M90 R;  3OYK A;  1A0N B;  1PC0 A;  2WSC E;  2F5K A;  4M7A D;  1VYU A;  1UHF A;  2QGG A;  2LCC A;  1QWF A;  2V26 A;  4C8Q C;  4QQG A;  4XK8 E;  1Q7Y R;  2YDL A;  1VQP Q;  1K9A A;  2RPN A;  1KHC A;  5CK9 A;  3OYF A;  3MKD A;  3CCJ A;  2ZPH B;  2LX7 A;  1I5O B;  1UUE A;  3NPF A;  2HDA A;  2PVD B;  2QGF B;  1YWO A;  2W10 A;  3LH5 A;  4J6X A;  5HY6 A;  2RB6 A;  2DLP A;  3X26 B;  2HCK A;  2L3R A;  4A4G A;  1B3Q A;  2CSQ A;  4PJO C;  1NG2 A;  4F14 A;  2OTL Q;  4OMP A;  3M54 A;  1EX4 A;  2QK0 A;  2CP7 A;  3FLG A;  3E9G A;  2CZ6 B;  3RKW A;  1PNJ A;  4O6J A;  4RTU A;  3C0C A;  3A98 A;  5A0D A;  2LCL A;  1WHK A;  1EIF A;  2EKO A;  4ORZ A;  3OYM A;  3MEU A;  4C5H A;  2EJF A;  3RUX A;  2B8A A;  3REA B;  3VS5 A;  2DK3 A;  2KY9 A;  3A8M B;  3CCS A;  2K6D A;  5KCH A;  2RHI A;  1VA7 A;  3NTH A;  2FZG B;  4LDW A;  2OTL T;  1FMK A;  3I56 Q;  1W4S A;  2XD0 A;  2DRK A;  3GOX A;  4C92 D;  5CKD A;  5IAY A;  1B7T A;  1JXO A;  3NTI A;  2KT8 A;  3U23 A;  2MWP A;  1K9M R;  2P4R A;  2DBK A;  3OS2 A;  4QVZ A;  1H3H A;  1TS9 A;  4EMG A;  2E6Z A;  2MPX C;  3JV3 A;  4BY6 C;  3FEO A;  2WSE E;  5CKH A;  4ZTJ A;  3CBM A;  4F16 A;  1ZQ1 A;  4FW1 A;  1R77 A;  3I56 T;  3OYB A;  1I81 A;  4N4H A;  4OMN A;  2CUB A;  2C0T A;  3H0F A;  2L8D A;  1NJI C;  3O8V A;  1HSQ A;  3OYI A;  3QWY A;  3M57 A;  2XDB A;  3TVT A;  4WCI A;  2L2P A;  2LQN A;  4DOV A;  1UFF A;  1VYV A;  1G2B A;  4UC4 A;  2DXB A;  2DET A;  2CP3 A;  3GP8 A;  1K8A R;  1RAA B;  2P0Q A;  3DLM A;  3BDU A;  3INZ A;  3LGF A;  2HBW A;  4GBQ A;  1WA7 A;  1ZA1 B;  3QG1 A;  4HVV A;  1VQN Q;  3KUF A;  4JJN K;  2MAM A;  3ZBD A;  1SPK A;  4NL3 A;  2D0N A;  4M75 C;  2FPF A;  4F17 A;  2DEQ A;  4R55 A;  1B07 A;  4OMM A;  1Q81 C;  2DZC A;  4M77 G;  1BIB A;  3CC2 T;  5KYY A;  4JLG A;  2NUT A;  8ATC B;  1X2K A;  1W2B A;  1VQ4 T;  3EGD A;  3LWH A;  2ABL A;  3PIO A;  1VQN T;  1KFZ A;  4M7D B;  4C5I A;  2PVO B;  2K3B A;  1X27 A;  2XK0 A;  1G5V A;  1QLY A;  5J26 A;  1QVF S;  3UDC A;  2K5I A;  1GCQ C;  3C12 A;  2QQS A;  1M9S A;  2KXC A;  4J9G A;  2HQE A;  3PGG A;  2YXY A;  1YHQ A;  4X9C A;  4C5G A;  1ZBX A;  3OYG A;  4IUR A;  2DYB A;  1IXD A;  2QEX Q;  2RQR A;  4QT7 A;  4Z88 A;  5LJ5 d;  2CP0 A;  4ZTF A;  1NZ9 A;  1D3B A;  1C6V X;  2O9V A;  5LJ5 g;  1WYX A;  4R56 A;  3P8B B;  1S72 Q;  3OW2 S;  4M7A F;  4C8Q A;  3T9N A;  2CSI A;  3VS6 A;  2KQW A;  1FXX A;  1UEC A;  3M4G A;  3CD6 A;  4PJJ A;  9ATC B;  3I5S A;  3UWN A;  3VUZ A;  2EW3 A;  4KGX B;  2ZPB B;  2QEX T;  2ED1 A;  1HYO A;  2D1X A;  2KAF A;  2JS0 A;  4KUI A;  5DM7 R;  5M9O A;  1KQS P;  1Y57 A;  2A08 A;  3QO3 A;  2J05 A;  4PJO A;  1VQ5 Q;  1WGS A;  2FZC B;  3THK A;  4JPB W;  1S72 T;  2DKG A;  4JS4 A;  2JUF A;  4JS5 A;  3LYI A;  4HCZ A;  5GAN d;  1VQ7 Q;  2X3X D;  2VC8 A;  1BK2 A;  4RUG A;  2PUO B;  1GCP A;  1WXB A;  1ZSZ C;  2L0A A;  4RG2 A;  4M7A B;  5C6S A;  4FT4 A;  4LUD A;  1IB8 A;  2CS7 A;  4ZGD B;  1YWP A;  2AHJ B;  2OTL A;  5GAN g;  2CYZ B;  1RAF B;  3M4Y A;  3MJX A;  1NJI R;  1KG1 A;  1QVP A;  4F7U F;  2YUP A;  1IGQ A;  2Y90 A;  3QII A;  4PFO A;  1VQ5 T;  1GBQ A;  5HKC A;  3FDR A;  2OAW A;  1VQK Q;  1AD5 A;  1I1J A;  4J6Y A;  5KYX B;  1T0J A;  1LCK A;  1YCS B;  2JM8 A;  3BW1 A;  1VQ7 T;  3M0U A;  4FYW B;  4TVR A;  2VGM A;  1RAD B;  1VQM A;  3CCU Q;  3M0S A;  3CCQ Q;  1G83 A;  1PM3 A;  3PTA A;  1MMG A;  3DB3 A;  4V2S A;  1LVK A;  1YIT A;  2DVE A;  1C0M A;  3OB9 A;  4C5E A;  2A0F B;  1N9S A;  2FL7 A;  2LC4 A;  2VWF A;  1VQK T;  4F7U B;  1Q81 R;  1VQ6 A;  1SEM A;  1G3T A;  1PD1 A;  4BUG A;  2LT4 A;  5IHK A;  2BKD N;  2M9U A;  4BI3 A;  1JRI A;  3DLL A;  5D6Y A;  4VUB A;  3CCU T;  1K4U S;  3CCQ T;  4FU6 A;  2K5F A;  4BE2 A;  3QDF A;  4C92 B;  1ZUU A;  3JCM J;  3A8H B;  1D0X A;  2JOY A;  1TUG B;  1RI9 A;  2JXB A;  4GLK A;  4GY5 A;  4M75 D;  2JS2 A;  2RI3 A;  2DF6 A;  1SRL A;  1GFC A;  3V7R A;  3OMG A;  4J9I A;  2GQV A;  1EZZ B;  1M1G A;  3EG9 B;  3CCM A;  3CC2 A;  1M2O A;  3HP9 A;  2ZPI B;  2LJ0 A;  2P4T A;  1IHW A;  3QBY A;  1VQ4 A;  1OV3 A;  3CBP A;  1KQ1 A;  3PE0 A;  2EVR A;  5LJ5 f;  2CZ1 B;  2CKK A;  1VQN A;  2AT1 B;  2O4X B;  3Q1J A;  4XAX B;  3CCR A;  3ASK A;  4MMK A;  1UGR B;  4JDS A;  1VQ8 Q;  4J9F A;  4LDX A;  2CT3 A;  4E6R A;  2KR3 A;  2JTF A;  3CC7 Q;  5KE2 A;  1LOJ A;  4RTV A;  4XTW A;  5I2M A;  2RH2 A;  3MP1 A;  2A3L A;  1C1A A;  4LXC A;  1M5Q 1;  1TUC A;  3SHW A;  1U5S A;  3HRT A;  2QYZ A;  4HKE A;  4DBR A;  2GBQ A;  2NUP A;  2QQ9 A;  2R5M A;  2LJ3 A;  1WJS A;  4M78 E;  1QP3 A;  3LX7 A;  2Y4Y A;  3RES A;  5GAM j;  4JRK A;  2FO0 A;  1VQ8 T;  1PWT A;  4RTT A;  5GAN f;  2EQU A;  4XTX A;  3G6E A;  3MEV A;  1I4K 1;  2V8K A;  2OTJ Q;  2EGE A;  2BZ8 A;  3TEE A;  3VS0 A;  3P8D A;  1RAC B;  1GRI A;  3X20 B;  2BE7 D;  3JCM h;  2E3I A;  3S3N A;  3JCM V;  4IUQ A;  4B6M A;  2DJZ A;  3H41 A;  2KNB B;  2RJC A;  3URG A;  2EYQ A;  3M55 A;  4RCC A;  3L2Z A;  3G4S Q;  5ECA A;  3L2V A;  4FCY A;  2O2O A;  4P5N A;  2YSQ A;  2DFU A;  2IG0 A;  4J7F A;  1VQO A;  3L2W A;  2OTJ T;  2RD1 A;  4M77 C;  1RI0 A;  1O9S A;  2MIO A;  3E2U A;  4PJM A;  3L2U A;  3RER A;  2CZ0 B;  4PJN A;  5GMK i;  4OF1 A;  4RCB A;  3G1J A;  3OYC A;  1ZSZ A;  5HK3 A;  5D6X A;  2XID A;  3G4S T;  4CI0 C;  4RTW A;  2EYX A;  4M78 F;  1W2B P;  1XJW B;  3H0I A;  1VQ7 A;  2RK2 A;  2CGH A;  1K9M C;  2RHZ A;  1QKX A;  2R5A A;  2G3R A;  2RHU A;  2X51 A;  5GAN 8;  1SSF A;  4Y92 A;  2LRQ A;  3RNJ A;  3OSV A;  2EGC A;  4MDX A;  2H8H A;  2DL3 A;  1FWZ A;  2A7Y A;  2JTM A;  2VKN A;  2MI6 A;  3HL8 A;  4E7S A;  2KGT A;  1M1F A;  2JN0 A;  4FSS A;  2KYB A;  1PG5 B;  2JM9 A;  1TWB A;  1YJN A;  1WQ7 A;  2X4W A;  1M8V A;  3CCU A;  3CCQ A;  4FSX A;  3H9N A;  3RMS A;  4F04 B;  3RBB B;  3OYJ A;  5CKE A;  2CDT A;  4HCK A;  2DAQ A;  4MDW A;  5LJ3 j;  2MCN A;  5CIU A;  4R0K A;  1JJ2 A;  5GAN 4;  5A0G A;  4C0F A;  2NLU A;  4N0A C;  1ZHI A;  3A5Z B;  4K11 A;  4BY6 B;  3EG1 A;  1T3S A;  3VS4 A;  2M51 A;  2RQU A;  4QW2 A;  4MZP A;  1SKU B;  2LMJ A;  4A53 A;  1P92 A;  1DJ7 B;  4XTU A;  1KQS S;  1NPP A;  2GQI A;  1H92 A;  1ZUK A;  1AWJ A;  4J5Y A;  3S3O A;  1WNL A;  4OB2 B;  1OOT A;  3MCA B;  3C4S A;  2J7I A;  2QQR A;  1MMN A;  4NL2 A;  2LTO A;  4EMK C;  1YJ9 A;  4OML A;  3JB9 H;  2ROL A;  2EAY A;  4QVD A;  2F2X A;  2GF7 A;  5FRM A;  2COW A;  2QA4 Q;  3CMA A;  1W70 A;  2DD4 A;  4Q5W A;  2EJG A;  3ZFJ A;  3OS5 A;  2QQA A;  2QXF A;  4ZNX A;  3C95 A;  2DL4 A;  2DMO A;  5GAN 7;  4LDU A;  4M75 B;  3HRU A;  4WF2 A;  3JCM W;  1M2V A;  1I8F A;  1VQP T;  3QKJ A;  3FJP A;  2P84 A;  3QPH A;  2BE9 B;  2H3E B;  5CO7 A;  2D6F A;  4IUU A;  3BDL A;  4HVW A;  5HCK A;  1Y07 A;  4O5V A;  3HKS A;  4FT2 A;  3KFV A;  1UJY A;  1V29 B;  5FU6 C;  4M7D E;  3ME9 A;  2QA4 T;  2QAS A;  4AFU C;  2J6F A;  2EWN A;  4DOW A;  5GAO l;  4B9W A;  1UB4 A;  1OPL A;  2ROT A;  4XTY A;  2FPD A;  1D1B A;  2ESW A;  4BI4 A;  2DXT A;  3TSZ A;  1Y0M A;  2HD0 A;  1NM7 A;  2FEI A;  1PKT A;  1KK7 A;  1PSE A;  3MP6 A;  4AT1 B;  1M27 C;  3PFS A;  4LUE A;  1BI1 A;  5GJW B;  1OPK A;  4M77 D;  4M78 C;  1V76 A;  2ECZ A;  1B34 B;  3EAE A;  2I0N A;  4L5G A;  2CUD A;  2YUO A;  1VQL A;  2RJD A;  2EIF A;  4M7A G;  1UGV A;  3UF4 A;  1U1S A;  3F70 A;  3QZ5 B;  1K76 A;  3QYG B;  1XTD A;  2G6F X;  3A8L B;  1AHJ B;  3CCE Q;  4M77 A;  1AZE A;  2DL5 A;  1SRM A;  3JCM Q;  2HEQ A;  5LJ5 e;  1KC8 C;  3CCV A;  1Y96 A;  4OB0 B;  1VIF A;  2KMT A;  1TOV A;  4KH0 B;  2RNA A;  3QDR B;  1UJ0 A;  5EC7 A;  3HFN A;  1Q95 G;  2LDM A;  4BE0 A;  4J9E A;  1MV3 A;  2A37 A;  3SB2 A;  4C0D B;  1JU5 C;  5AYF A;  2H3J A;  1VYT A;  1KD1 U;  4NOY A;  3V8J A;  4M7D F;  2YUQ A;  1ACM B;  1BU1 A;  3CCE T;  3V7S A;  3FJ5 A;  4DQ2 A;  4M4Z A;  2XHC A;  3M0Q A;  3EGX A;  3EFO A;  4OMF B;  1PKS A;  2DD5 A;  4BB7 A;  2LJ1 A;  2E5Q A;  4M7A E;  3JCM d;  3JB9 F;  3RKX A;  2QTV A;  2DE0 X;  1BBZ A;  8AT1 B;  4OP0 A;  4J9B A;  3JCM g;  2EYW A;  2LZ6 B;  3L1A A;  4F7U G;  3HHT B;  2VXE A;  2EQJ A;  3NTK A;  1SF9 A;  5KYW A;  5GAN e;  2KRM A;  5CQY A;  4Z89 A;  2M0Y A;  3EHQ A;  2RI2 A;  4RTX A;  5KYU B;  4C92 G;  3TCJ A;  5GMK l;  5GMK e;  4EDU A;  2J6K A;  2HKN A;  4OB3 B;  2HL5 C;  1U8R A;  4Z8A A;  1X6B A;  4LD9 K;  4IIM A;  1N27 A;  1Y71 A;  1N9R A;  3CPW P;  5IHN A;  1WZO A;  5DY9 A;  2ZZD A;  4N0A A;  4C0G A;  2CP5 A;  1YIJ Q;  2BTT A;  2LQK A;  2Z0W A;  3MET A;  1KSW A;  4LE9 A;  3VJP A;  2X4J A;  4C8Q D;  3CME Q;  4F7U E;  3IQL A;  4PK4 A;  3R6N A;  2HL3 A;  1G3S A;  4BAC A;  1X01 A;  1G3Y A;  1QW1 A;  2OI3 A;  2DVJ A;  3M56 A;  3S6W A;  3SD4 A;  3FIF A;  4LDY A;  3NHN A;  3JRZ A;  2X35 A;  5FU7 B;  4C92 E;  3VRZ A;  1PRL C;  4EMK A;  4KUD K;  4XQ3 A;  1YIJ T;  4PJO D;  3OA6 A;  3PMT A;  1K73 U;  2MK5 A;  3H0H A;  5EG2 A;  5GJV B;  5LJ5 j;  5KYN A;  2VXF A;  3CME T;  2O9S A;  1YI2 Q;  4E47 A;  1W2B S;  1VQP A;  3CEY A;  1UTI A;  3GNF B;  5LJ3 h;  1J3T A;  3UT1 A;  3CXC A;  3OBW A;  4D8K A;  2EQI A;  3OYH A;  1SHF A;  1PCX A;  1RAG B;  1RLP C;  3RMQ A;  2DTI A;  1X6O A;  2KK4 A;  2RQV A;  4ZGJ B;  3CBO A;  1TSF A;  4AFQ C;  5GAN 5;  1WDX A;  4QKU A;  2KRN A;  2CH4 W;  2O01 E;  1H8K A;  5GAO m;  1KC8 R;  2MYS A;  1YI2 T;  3PT9 A;  2DIG A;  1LPL A;  1PD0 A;  1H3Z A;  3FRN A;  1CSK A;  1UG1 A;  1JO8 A;  1R0C B;  1I07 A;  2RA2 A;  1JJ2 P;  3OS0 A;  2KEA A;  5GAN j;  4DEX A;  3EFR A;  2D9T A;  2FVU A;  5CKB A;  3PNW C;  3NGP A;  1X75 C;  2EYY A;  4RKU E;  4C92 F;  3JCM c;  1FX7 A;  5GMK j;  3I56 A;  3CC4 Q;  1UGQ B;  4M78 A;  4IUP A;  1ARK A;  2J6O A;  3OMC A;  2VUB A;  3JCM f;  1VQ9 Q;  1S1N A;  1SSH A;  4LN2 A;  3V8L A;  2R57 A;  2AKL A;  1RAI B;  1AWO A;  2HMA A;  3VS7 A;  3EHR A;  1NBE B;  2OAU A;  2VV5 A;  2ED0 A;  1MMA A;  2SRC A;  2COY A;  3I5R A;  3HPW A;  1WI7 A;  1QMC A;  1IRE B;  2HQX A;  3DB4 A;  3CCE A;  2EQM A;  1WPY A;  2ZPG B;  3A8G B;  2RHX A;  3V7C A;  3PVQ A;  3CC4 T;  2QDY B;  1AEY A;  1GFD A;  1UEB A;  3V8K A; 
#chains in the Genus database with same CATH homology
 2F2V A;  2W0Z A;  2C0O A;  4RTW A;  2FG0 A;  2EYX A;  1PNJ A;  2YT6 A;  4AFZ C;  4RTU A;  2KE9 A;  3VS3 A;  1Z9Q A;  2MOX A;  3C0C A;  4GLM A;  2HSP A;  3H0I A;  3A98 A;  1UHC A;  4ORZ A;  3UAT A;  1NEG A;  1QKX A;  3NMZ C;  2O88 A;  3REA B;  3VS5 A;  3M0P A;  2K6D A;  1NLP C;  1T3L A;  1VA7 A;  4J9D A;  4Y92 A;  3RNJ A;  2D8J A;  1FMK A;  2EGC A;  2JMA A;  4KRT A;  2DRK A;  2KT1 A;  2DM1 A;  2H8H A;  2DL3 A;  1JXO A;  2VKN A;  2KT8 A;  3U23 A;  2NUZ A;  2P4R A;  2DBK A;  1T0H A;  2K2M A;  3UA7 A;  2KGT A;  1GL5 A;  2BZY A;  1H3H A;  2XMF A;  4FSS A;  1Z9Z A;  1M3C A;  2KYB A;  3JV3 A;  2JM9 A;  4RTZ A;  4D8D A;  1ZBJ A;  2DJQ A;  4J9C A;  3VS1 A;  3RBB B;  1QWE A;  1X6G A;  2CDT A;  4HCK A;  2JTE A;  2DIL A;  4F16 A;  2A28 A;  1CKB A;  2MCN A;  4R0K A;  2GTJ A;  5IXF A;  3O5Z A;  4OMN A;  2CUB A;  2C0T A;  3H0F A;  1JXM A;  1NYF A;  1HSQ A;  3EG2 A;  3QWY A;  4K11 A;  3EG1 A;  3TVT A;  1T3S A;  4WCI A;  3VS4 A;  2L2P A;  2LQN A;  2M51 A;  2RQU A;  1UFF A;  1VYV A;  1G2B A;  2LMJ A;  1WXT A;  1ABQ A;  2GQI A;  4LNP A;  2HBW A;  4GBQ A;  2YUN A;  1H92 A;  1ZUK A;  1WA7 A;  1AWJ A;  2GNC A;  1OOT A;  4HVV A;  2J7I A;  2KYM A;  2X3W D;  2DNU A;  1SHG A;  1SPK A;  2DL8 A;  3REB B;  3QWX X;  3VS2 A;  2D0N A;  2FPF A;  4F17 A;  2AKK A;  4OML A;  2EPD A;  2ROL A;  1K0S A;  3CQT A;  2F2X A;  2RMO A;  1B07 A;  4OMM A;  2FRW A;  1UE9 A;  1HD3 A;  1K0X A;  1M8M A;  2EKH A;  4EIK A;  1X43 A;  1ZLM A;  2GGR A;  1W70 A;  1X2K A;  4ZNX A;  2ABL A;  2DL4 A;  2DMO A;  1KFZ A;  3EG0 A;  2K3B A;  1X27 A;  1EFN A;  1QLY A;  1YP5 A;  4AG1 C;  1GCQ C;  2NWM A;  4RTY A;  2L3S A;  4HVW A;  2KXC A;  5HCK A;  1WLP B;  4J9G A;  2BZX A;  2E5K A;  3KFV A;  5FW9 A;  1UJY A;  3GBQ A;  4X1V A;  1RLQ C;  1AOJ A;  2JW4 A;  1M30 A;  2O31 A;  2DX1 A;  2DYB A;  4JJD A;  1WXU A;  2J6F A;  4AFU C;  4A63 B;  2FPE A;  2RQR A;  4QT7 A;  4Z88 A;  5FWB A;  2ROT A;  1OPL A;  2FPD A;  2ESW A;  4HVU A;  2O9V A;  1U3O A;  3TSZ A;  1Y0M A;  2VVK A;  1WYX A;  1NM7 A;  2FEI A;  1PKT A;  2J06 A;  2IIM A;  2RQT A;  1M27 C;  2CSI A;  3VS6 A;  4LUE A;  5GJW B;  1OPK A;  1UEC A;  2JT4 A;  2ECZ A;  1KIK A;  1AZG B;  2I0N A;  1WIE A;  1ZUY A;  2KRO A;  3I5S A;  2CUD A;  2ENM A;  2YUO A;  1UGV A;  1W6X A;  2EW3 A;  3UF4 A;  1NEB A;  4CC4 B;  1MUZ A;  1K76 A;  2ED1 A;  2G6F X;  2D1X A;  1HJD A;  2KRS A;  2SEM A;  2JS0 A;  1Y57 A;  1NYG A;  1XOV A;  2A08 A;  1AZE A;  2DL5 A;  1U06 A;  1SRM A;  2HEQ A;  2J05 A;  2RF0 A;  3THK A;  4JPB W;  2RNA A;  2EYZ A;  1UJ0 A;  5EC7 A;  2X3X D;  4RUG A;  1BK2 A;  1BB9 A;  4J9E A;  1MV3 A;  1GCP A;  1WXB A;  2L0A A;  2A37 A;  3SEM A;  2CH4 A;  4LUD A;  1GCQ A;  1YWP A;  1JU5 C;  3PVL A;  4HXJ A;  1M3A A;  2B86 A;  1VYT A;  2CT4 A;  2LCS A;  3ZL7 C;  1GBR A;  2YUQ A;  1BU1 A;  4CC7 A;  3FJ5 A;  3M0Q A;  4M4Z A;  2YUP A;  4JJC A;  1PKS A;  2EGA A;  2DL7 A;  2LJ1 A;  1GBQ A;  2DE0 X;  1BBZ A;  2OAW A;  2RN8 A;  2L3Q A;  1MV0 B;  1AD5 A;  1I1J A;  2V1Q A;  3UA6 A;  1CKA A;  1T0J A;  1LCK A;  4J9B A;  1WFW A;  1YCS B;  2EYW A;  2LZ6 B;  2JM8 A;  1YN8 A;  1JEG A;  3M0U A;  1YNZ A;  2AK5 A;  1JQQ A;  1TG0 A;  3M0S A;  2KXD A;  1ZX6 A;  1G83 A;  2DBM A;  2KBT A;  2KRM A;  2PTK A;  4Z89 A;  1AVZ C;  5I11 A;  2M0Y A;  1E7O A;  2L3P A;  3EHQ A;  4RTX A;  4OMQ A;  2EBP A;  2K79 A;  2J6K A;  2A36 A;  2JMC A;  4Z8A A;  1PRM C;  1X6B A;  2VWF A;  4IIM A;  1I0C A;  1SEM A;  5IHN A;  2AZV A;  5IHK A;  5IH2 A;  2FRY A;  3M0R A;  4OMO A;  2BTT A;  4DEY A;  1E6G A;  1K4U S;  1KSW A;  2QDL A;  4AFS C;  1E6H A;  1OEB A;  3ULR B;  4LE9 A;  1AWX A;  2AZS A;  1ZUU A;  1X2Q A;  2DA9 A;  3IQL A;  2V1R A;  4JZ3 A;  3R6N A;  1RI9 A;  2JXB A;  2RQW A;  2JS2 A;  2DF6 A;  2OI3 A;  2DVJ A;  1SRL A;  1GFC A;  2DRM A;  4J9I A;  1ZSG A;  3NHN A;  3VRY A;  2OJ2 A;  3VRZ A;  1PRL C;  2LJ0 A;  1TUD A;  1K1Z A;  2GTO A;  2K9G A;  1OV3 A;  3H0H A;  3PE0 A;  2EVR A;  5GJV B;  1NLO C;  1PHT A;  4JZ4 A;  2O9S A;  3I35 A;  2C0I A;  1M3B A;  1UTI A;  1V1C A;  5I22 A;  4J9F A;  1J3T A;  2PZ1 A;  1RUW A;  2CT3 A;  2K7A A;  2KR3 A;  1WX6 A;  4AG2 C;  4D8K A;  4E6R A;  2EQI A;  1IO6 A;  1SHF A;  4RTV A;  1RLP C;  4ESR A;  1ABO A;  4J9H A;  1TUC A;  1KJW A;  1W1F A;  2RQV A;  5IHI A;  3SHW A;  4AFQ C;  1WDX A;  2KRN A;  1U5S A;  2CH4 W;  1QCF A;  3EGU A;  1QKW A;  1H8K A;  2GBQ A;  5FWC A;  2LJ3 A;  2PNI A;  1FYN A;  1AWW A;  1CSK A;  2FO0 A;  1UG1 A;  1JO8 A;  1I07 A;  3TSW A;  2LQW A;  4CC3 A;  2KEA A;  1PWT A;  4JJB A;  4RTT A;  4DEX A;  3M0T A;  1UDL A;  2EGE A;  4CC2 A;  3NGP A;  2BZ8 A;  3VS0 A;  1A0N B;  2EYY A;  1GRI A;  1VYU A;  1UHF A;  1QWF A;  2F2W A;  2LP5 A;  3EG3 A;  2YDL A;  3H41 A;  2KNB B;  1K9A A;  2RPN A;  1ARK A;  2LNH B;  2J6O A;  2LX7 A;  1S1N A;  1X69 A;  1UUE A;  2CRE A;  5ECA A;  1SSH A;  3NPF A;  4LN2 A;  2O2O A;  2HDA A;  2AKL A;  4IIO A;  3I9Q A;  2YSQ A;  1AWO A;  3VS7 A;  1YWO A;  2W10 A;  3EHR A;  3LH5 A;  5L23 A;  2MIO A;  2DLP A;  2ED0 A;  2SRC A;  3I5R A;  2HCK A;  5IXB A;  1B3Q A;  1WI7 A;  2CSQ A;  1NG2 A;  1N5Z A;  4F14 A;  4OMP A;  3PVQ A;  1AEY A;  1GFD A;  2D8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...