1UE9A

Solution structure of the fourth sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
GSSGSSGEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin 2
publication title Solution structure of the fourth SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 8
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ue9A00
1AWJA 1B07A 2YUNA 4LN2A 4J9HA 1GL5A 4CC7A 3VS1A 3LH5A 1YWOA 1X2KA 2FRWA 4F16A 1I1JA 3EHRA 4RTXA 2O31A 1M8MA 5IHIA 4HVVA 1HD3A 2YUOA 1GCQA 2KRSA 5GJVB 1OEBA 4GLMA 1KIKA 2VKNA 2LQWA 1SHFA 1T3SA 3M0SA 4OMLA 3QWXX 1M30A 1RLPC 2AZSA 4ORZA 4HCKA 2ESWA 1TUDA 2KEAA 2DYBA 1SRMA 3NMZC 1WX6A 1ABQA 2W0ZA 3CQTA 2K2MA 1JEGA 4JZ4A 1WLPB 2PTKA 1H8KA 1UECA 2L0AA 1GBRA 3PVLA 2KNBB 2ENMA 3EG0A 1BBZA 1PHTA 1GBQA 1SSHA 1AZEA 1WA7A 1UDLA 3M0PA 1RI9A 2LCSA 1AD5A 2LJ1A 4OMOA 2EBPA 1UUEA 2GTJA 3H0FA 2HCKA 4F14A 4HVWA 2DBKA 2DLPA 3M0UA 2D8JA 1CKBA 2X3WD 1X6GA 1Z9ZA 1PRMC 1VYTA 1PNJA 3REBB 3UATA 2O2OA 2DVJA 1ZUKA 2FO0A 4JJCA 1KJWA 2OAWA 2DRMA 3VS3A 5I22A 2AKKA 1W6XA 3C0CA 4AFUC 2YDLA 1X6BA 5EC7A 2KXDA 2LP5A 2GNCA 1OPLA 3QWYA 3VS6A 1ZSGA 3KFVA 4KRTA 2O9SA 3RBBB 2DJQA 2EYYA 4X1VA 3VS0A 5GJWB 2V1QA 1VYVA 5ECAA 3R6NA 1ARKA 1YWPA 2JT4A 1K0XA 1E6GA 1T3LA 2DE0X 4F17A 3UA6A 2YUQA 1GFCA 1BB9A 1RLQC 5FWBA 1ABOA 2P4RA 4HXJA 1UG1A 3TSZA 3JV3A 1ZUUA 1JXOA 2JM8A 2V1RA 1H92A 4CC4B 1NEGA 1M3BA 1GRIA 2DL5A 2F2VA 1ZX6A 2DL3A 2GTOA 2FG0A 1AOJA 4CC3A 2J7IA 3M0RA 4OMQA 2EYWA 2HEQA 4J9BA 4J9IA 1OV3A 1QWEA 2LJ3A 1AEYA 2E5KA 1UTIA 1W1FA 5L23A 2HBWA 2LJ0A 1QLYA 1NLOC 2KXCA 4R0KA 4J9DA 2L2PA 1Y57A 4D8DA 1XOVA 1AZGB 4D8KA 2DL4A 3EGUA 3TVTA 1X69A 1K9AA 2EGCA 2L3QA 2RF0A 1OPKA 1VYUA 1UHCA 2AZVA 4OMNA 1PKSA 2LNHB 4Z8AA 4JPBW 1MUZA 3VRYA 1TG0A 1QCFA 2A36A 2KBTA 2KT8A 2CUBA 2D8HA 3VRZA 2K6DA 3VS2A 4A63B 2L3SA 1MV3A 4OMPA 4J9FA 2DM1A 2KR3A 3U23A 2G6FX 1AWOA 3ULRB 2JM9A 1NEBA 1ZUYA 1YP5A 4IIOA 4J9EA 1JO8A 1WFWA 2DBMA 4JJBA 1KSWA 4Y92A 1I07A 2C0IA 3VS7A 1VA7A 4J9CA 3ZL7C 1QWFA 1K76A 2MOXA 4M4ZA 2OJ2A 1IO6A 1NYFA 2KRMA 2DNUA 2J6OA 1GCQC 1W70A 1NM7A 2CDTA 2CREA 2BZYA 4Z88A 1FMKA 1S1NA 1UE9A 1U3OA 3O5ZA 1LCKA 4QT7A 2W10A 1AWXA 2H8HA 3FJ5A 4JJDA 3TSWA 3EG3A 1Y0MA 2EYZA 5I11A 1E7OA 3EG2A 3M0TA 3I5RA 3PE0A 2AK5A 2J6KA 1J3TA 1ZBJA 1PRLC 1UJ0A 2J05A 2CH4A 1NG2A 2X3XD 2LX7A 2A08A 2D0NA 2KROA 2ROTA 2JMCA 2CSQA 4AG1C 2OI3A 4WCIA 1WXBA 1X43A 3I9QA 4LNPA 2RQRA 1QKWA 5IHNA 4CC2A 1Z9QA 2GQIA 2M0YA 2BZXA 2EYXA 1NLPC 1T0JA 1HSQA 1GFDA 2GBQA 2RQUA 4LE9A 2RPNA 4OMMA 4ZNXA 2SRCA 3UF4A 1WIEA 2EVRA 2KYBA 2DILA 2J06A 2YT6A 2FPEA 3M0QA 2EPDA 1UJYA 2J6FA 3SEMA 2JW4A 2CSIA 2LZ6B 2JS2A 2DF6A 2QDLA 1G2BA 2A28A 3PVQA 2BTTA 2BZ8A 2IIMA 1K0SA 1WDXA 2F2WA 1CSKA 3IQLA 1WXTA 2I0NA 2CT4A 2GGRA 4RTVA 2DRKA 3UA7A 1YCSB 2HSPA 1JU5C 4LUEA 1B3QA 1UFFA 2EKHA 1BK2A 2C0TA 1EFNA 3VS5A 3VS4A 4ESRA 2DA9A 2L3PA 3I5SA 4RUGA 1WI7A 2JTEA 2RQVA 5FWCA 2KT1A 5IHKA 1M3CA 2A37A 3EG1A 2FRYA 1SRLA 2CUDA 3NPFA 1GCPA 2NWMA 4E6RA 1MV0B 1SEMA 1PWTA 1K1ZA 1YN8A 1G83A 2VWFA 1JQQA 2FPFA 1A0NB 5IXBA 5IXFA 4AFSC 2MIOA 4HVUA 1ZLMA 4GBQA 4LUDA 3REAB 2ROLA 2K7AA 2EGAA 2CH4W 3NGPA 1FYNA 2PNIA 2DL8A 2SEMA 1H3HA 2ABLA 2ECZA 2K79A 1RUWA 3NHNA 1AWWA 5HCKA 1BU1A 2JS0A 1UHFA 1JXMA 4AFZC 2D1XA 3A98A 5FW9A 2DL7A 1KFZA 1TUCA 2EW3A 2MCNA 3H41A 2RN8A 1QKXA 2FPDA 2F2XA 2O9VA 1OOTA 4RTTA 2HDAA 1AVZC 4EIKA 1E6HA 2YUPA 4DEYA 5IH2A 3EHQA 2DMOA 1M27C 2RQWA 2LMJA 1UGVA 3H0IA 2KGTA 4DEXA 2RQTA 1X2QA 1YNZA 2B86A 4JZ3A 2KE9A 1K4US 3H0HA 1WYXA 3GBQA 1NYGA 2JXBA 2EQIA 4K11A 2ED0A 2JMAA 2CT3A 1HJDA 3SHWA 2KRNA 4AG2C 4FSSA 2PZ1A 1V1CA 2EGEA 1SHGA 2RNAA 1WXUA 4RTZA 2KYMA 3RNJA 4RTWA 1PKTA 2NUZA 3I35A 1M3AA 1X27A 2XMFA 2VVKA 2ED1A 4RTUA 2RMOA 1N5ZA 1T0HA 2O88A 1U06A 2K3BA 4AFQC 2YSQA 2AKLA 1CKAA 2K9GA 4Z89A 2DX1A 1U5SA 3THKA 2LQNA 2M51A 2C0OA 4J9GA 1I0CA 4IIMA 4RTYA 2FEIA 1SPKA
chains in the Genus database with same CATH superfamily
4CC7A 3VS1A 1YJ9A 2FRWA 4E7KA 4DBRA 2L8DA 2X51A 2OTLA 2CZ1B 3L2UA 1VQOQ 3CXCP 4M75F 1M8MA 3QBYA 1HD3A 2DTOA 3C4SA 3CCEQ 3CCST 2QEXT 1N9SA 1PC0A 5CQXA 4A4GA 1Q82U 2EJ9A 4BUGA 3I55A 1SHFA 3A8LB 2BE9B 5CR2A 3M0SA 4M75A 2ZZDA 1BI2A 1VQ9T 3CC2A 1M4ZA 3OS2A 2KY9A 3MJXA 2W0ZA 1TU0B 2K2MA 4RKUE 1WLPB 3E9GA 4C8QC 2K3XA 4II1A 1V29B 3L2QA 4KGXB 3HPWA 1BBZA 2CZ6B 1GBQA 3EAEA 3CCUA 3V7SA 3QJYA 1AZEA 1OU9A 2K4YA 2LCSA 1QVGS 3RKYA 1AD5A 1M90U 4OMOA 2LRQA 3QHSA 4F14A 2QQAA 5KYNA 3OYNA 4JS4A 3M0UA 4EMKB 1TUGB 3EGDA 1X6GA 1Z9ZA 2RHIA 3REBB 4FSXA 2FO0A 2DRMA 1MMDA 5KE2A 1QVGA 1KQSP 3C0CA 1RL2A 2GNCA 2CP2A 1ZSGA 3KFVA 1K73C 4KRTA 1TOVA 2O9SA 3RBBB 4C8QE 2DJQA 5FRNA 4X1VA 3PT9A 2E3IA 1N8RR 1GFCA 3E1SA 4PJOC 2ZGWA 4E7IA 4PFPA 2K3YA 1TSFA 2P4RA 2WACA 3V8LA 2E3HA 2A7YA 1UG1A 3TSZA 3OYAA 3L2RA 3JCMb 1JXOA 3CC4A 4HCCA 1BKBA 1OX9A 4XTXA 3ME9A 5L8RE 1H92A 2FZKB 5GAN8 1M3BA 2DL5A 1AOJA 3JRZA 4M77C 2CP7A 2HEQA 1BCMA 2V8JA 1MGQA 4RG2A 1QWEA 1QP3A 3SWNC 1QLYA 2CZ7B 2L2PA 3GF5A 1XOVA 4PJOE 3V7CA 3CMAQ 3QG1A 3I56T 5CIUA 2EGCA 5LJ3e 4M7AA 4PJJA 5IN1A 3JB9D 4JPBW 1TXQA 3BE3A 1UGRB 4C5GA 2O4XB 1XNIA 2KBTA 4C92B 2LDMA 5A0GA 3CPWP 2D8HA 4BD3A 5GAMd 2K6DA 2PUOB 3VS2A 2L3SA 1MV3A 2OTJA 2JM9A 2R5MA 2EYQA 1VIFA 3G71A 1WFWA 5I21A 4EPCA 1YJWQ 2CZ0B 2QTVA 2FZGB 1VQ7T 1PSFA 2LX9A 2LCCA 3ASKA 3PMIA 2QASA 3CCQA 4J7FA 5GAN4 4M4ZA 2OJ2A 2KRMA 1W70A 5GAN5 3OYKA 1MNEA 2RI5A 3L2WA 4MZTA 4Z88A 2DTHA 2C06A 1VQ6Q 4PJOD 3SD4A 1S1NA 2XK0A 1W2BS 4M75C 4EMKA 4BY6C 3OS0A 1VQKT 1Q86U 3OYIA 5I11A 3M0TA 1BCOA 4OP0A 4X9CA 1W2BA 3UWNA 5DM7R 1LPLA 1RAHB 4M77D 4NS5A 3M59A 1VQMT 1Q95G 1R0CB 1NG2A 2X3XD 2YRDA 3RKWA 3MKDA 2A08A 3JCMV 2D0NA 4M78B 3OYCA 2JMCA 4OGCA 1HXDA 3EFOB 3CCRA 1PD0A 7AT1B 1FX7A 2OI3A 1WXBA 4XTUA 1X43A 4M75E 2GF7A 1LJOA 1QKWA 1S72Q 3AHUA 1YJ9T 4C8QG 2OTLT 3CCMA 1NLPC 2JJ9A 1HSQA 1GFDA 2GBQA 2RPNA 1VUBA 2QYZA 4ZNXA 3CCVT 1WHKA 1TH7A 4EDUA 3UF4A 4JRIA 5GAOn 3CC7A 5IT9E 3LX7A 2EPDA 1UJYA 4ZN1A 2XICA 3I55T 4N4HA 2QI2A 2R58A 4QW2A 4MMKA 3CC2Q 2ATCB 2CYZB 4C92F 5AYFA 5GAMj 1G2BA 1K9MU 2D0QB 4ATOA 5J26A 3META 1D1AA 1YI2Q 4E7JA 2DXCA 2F2WA 2O4XA 1CSKA 4ZGDB 4C92A 3FLGA 5D6WA 2I0NA 2GGRA 2X4WA 1YCSB 4LUEA 1JU5C 1I81A 1UFFA 1JJ2S 3CCUT 1KC8C 3VS5A 1M1KC 3C95A 1KQ2A 5EG2A 5GAMh 3EFSA 3GOXA 5FWCA 2KT1A 4RCCA 1M3CA 2A37A 3EG1A 3NPFA 2AHJB 1JJ2A 3HFOA 1GCPA 2PUKB 1C6VX 4XU0A 2RJCA 9ATCB 1K1ZA 5GAMe 2DERA 1YN8A 3CD6A 1JQQA 2EAYA 4OVAA 1VQNA 3OA6A 1A0NB 3MEUA 2H3JA 1IREB 3JCMJ 4DBQA 1WHLA 3MEWA 1U8RA 2ROLA 1UGSB 1G5VA 4X9DA 1FYNA 2PNIA 2SEMA 1BU1A 1UHFA 2E6NA 3CCEA 1H641 4PJNA 3CC4T 4M78F 4P5NA 5LJ3f 2MI6A 2MCNA 3KXTA 3HTRA 2FPDA 1G8XA 3M57A 2HDAA 2PVDB 2YUPA 3TCJA 3HKSA 4OB1B 4IKFA 4JLGA 4OB0B 2DMOA 4M78A 1M27C 3F70A 2RQWA 3OYMA 1RAIB 5GMKl 3EFOA 4HA8A 1K4US 3GBQA 3L1AA 4OF1A 2EQIA 2V8IA 1K8AU 2ZPFB 1NZ9A 2DZCA 3GPLA 1VQ8Q 3S3OA 5CQYA 1DJ7B 3MEAA 2YRVA 5C6SA 1WJQA 3D7SB 1V1CA 2DFUA 1SHGA 4PJLA 4XTWA 4RTZA 2KYMA 4M7DB 1PKTA 2NUZA 1D09B 3I35A 2WSFE 3R6OA 2LQ8A 4M75G 1M2OA 1XQHA 2RMOA 1T0HA 4LXCA 2K3BA 2WSCE 2HQEA 5GANd 1IGUA 3RR6A 3NFCA 5CKFA 2BUDA 2K9GA 1UB4A 1RACB 3RESA 4FW2A 3RIRA 1AWJA 1KQ1A 3CCQT 3LH5A 1Q81C 3WVDB 2GFUA 2DYIA 1BI1A 4RTXA 1VOMA 1WHHA 2O31A 5IHIA 3S3MA 1WGSA 3L2ZA 3VV0A 1RADB 4FYYB 4GLMA 5J39A 1KD1R 4J7IA 2LQWA 4PLLA 1VQ4Q 3QWXX 3DKMA 1M30A 2AZSA 4IUVA 1ZSZB 2ESWA 3QYGB 2DYBA 1SRMA 4MZPA 1ABQA 2IPOB 4C0ZA 5GAMg 4BI8B 3BFMA 5D7UA 1BIAA 3CQTA 1D0XA 2KDSA 1H8KA 2HL3A 1QVPA 1UECA 3BY7A 3PVLA 3EH2A 3J80E 4XU3A 3J7AF 1YCYA 3LH0A 1PHTA 1SSHA 1WA7A 1X6OA 2EBPA 2DBKA 3CCMT 1XTDA 4FYWB 2D8JA 1VQLT 1G3TA 1Y96B 4PJMA 2KI7A 1D1CA 2XU8A 1VYTA 2ZCFB 3S3NA 2E5QA 1QQJA 2O2OA 2DVJA 2VV5A 3A8GB 2OAWA 1YJWA 3CC7T 5I22A 1Q7YR 2M16A 3TREA 2LP5A 2QA4Q 2MF2A 3CBMA 5I2MA 4XTVA 4DOVA 4M7DF 3VS0A 4QKUA 1BI0A 4XTYA 1PG5B 1W4SA 3MO8A 1T3LA 2YUQA 2E70A 2HMAA 3DB3A 5GANj 5FWBA 4N0AA 1ABOA 1VQ6A 1VQPQ 5GAMf 3OW2A 3JV3A 1ZUUA 4M7DA 2YLCA 3QDFA 1NPPA 1GRIA 2MPXC 4C5IA 1ZX6A 5HY6A 2FG0A 2J7IA 2LT4A 2RO0A 3CXCS 2CP5A 2EYWA 2QDYB 4OB2B 2MMPA 4J9IA 1OV3A 2HBPA 5GANh 1AEYA 2FHDA 1K73U 2KXCA 4J9DA 3QIIA 4D8DA 3CXCA 1AZGB 1VQNQ 5FROA 2DL4A 4EMHA 3TVTA 3CD6T 2DJZA 4KT0E 2L3QA 1I4K1 4RMOA 1OPKA 3CCLQ 4M7AB 1S72A 1WQWA 3X28B 2GCXA 2XI9A 1PKSA 2AT1B 2LNHB 5GAOm 2G3RA 2NLUA 4C5EA 4WTOB 1VQOT 5FU6C 4X34A 1G3WA 1KG1A 3L2VA 3OMCA 2KT8A 2CUBA 2I2LA 3RMSA 3VRZA 3X24B 1FXXA 3CCET 2YRCA 2MWOA 1ZSZA 1D0ZA 1V76A 1IGQA 4OMPA 3X25B 2KR3A 3CCSQ 2M0OA 3ULRB 1NEBA 1ZUYA 4IIOA 3GLXA 2PVOB 2RA2A 3PNWC 4JJBA 1VQ9Q 3JCMP 1N27A 3MP1A 4Q5WA 1I07A 2X4YA 2Y90A 4L5GA 3HRSA 1YI2A 1KQSS 1QWFA 2QAZA 1N8RC 1K76A 5CKEA 2MOXA 1IO6A 4FL6A 4KH0B 2X9HA 2VGMA 3A8OB 4OGEA 1KQSA 1LCKA 1Y96A 3SB2A 4DBFA 3NTIA 1NE8A 2FB7A 4JJDA 3TSWA 4KUDK 2EQKA 3EG3A 3E9FA 3LWHA 2EYZA 1OU8A 3EG2A 3I5RA 3PE0A 1WQ7A 3OYGA 2COWA 4NL2A 1ZBJA 1ACMB 1UJ0A 4GLKA 3OS5A 5IAYA 2LX7A 3NTHA 4IUTA 3VU3C 3AT1B 2HQXA 3OSSC 4AG1C 3FJPA 3JCMX 4WCIA 4C92G 2F69A 4LNPA 2XIDA 5IHNA 4FYVB 4CC2A 2GQIA 1QMCA 3H9NA 3EGXB 4BDYA 4FT2A 2RQUA 2FL7A 3HP9A 1ZHIA 1QW1A 1TWBA 1RAEB 4M7AF 2LCLA 3C94A 2K57A 3CPWS 1MMNA 3MP6A 2NYSA 1SG5A 2CSIA 3RDVA 2AIRB 2LZ6B 3M55A 3PIPA 5M9OA 4MDWA 3CCJQ 3CBOA 4M7DC 3PVQA 3CPWA 1IHVA 2BTTA 3JCMW 3CMAT 4C8QD 1VQ8A 2BZ8A 2IIMA 5GANg 1VQ5A 2XKOC 4A53A 1K0SA 1WDXA 3G1JA 3IQLA 1QVFS 3QZ9B 3V7RA 5CKHA 2HSPA 1B3QA 1EZZB 2EKHA 4FCYA 2K5IA 4ESRA 4OB3B 2COYA 1GXIE 4BDZA 2L3PA 4E7HA 3I5SA 4RUGA 2JTEA 4WF2A 1HK9A 4HT9A 1Q82R 1TTHB 2JZ2A 4M78G 1D0YA 4M7DE 4E6RA 2MYSA 1QVFP 1SEMA 1YJWT 1PWTA 1G83A 2VWFA 3ZBDA 3G4SQ 5LJ5d 4DA4A 2D9TA 5IXBA 3JB9J 2EQMA 4BB7A 4GBQA 4LUDA 4QVDA 4E7ZA 3RMQA 3PTAA 1D1BA 2DL8A 1VQ6T 1M1KU 1KC8U 2ABLA 3V8JA 2K79A 1RUWA 1AWWA 2HD0A 3MEVA 5A0DA 1YJNT 2D1XA 5GAN6 2KK4A 2ZPEB 3H41A 2EWNA 2RM4A 1QKXA 1M90R 1VQ4A 4KGVB 2DTIA 3OY9A 1OOTA 4EIKA 3QJ6A 1YIJQ 3H8ZA 2BE7D 1UGVA 1F1BB 4KH1B 4ME7A 2DAQA 1M5Q1 5CAIA 1YNZA 1VQMQ 4JZ3A 3SDZA 4RG8A 5GMKj 3CPFA 2JXBA 1R0BG 2Y4YA 2ED0A 2JMAA 4C0DB 3SHWA 3EGXA 2KRNA 4AG2C 1QCOA 1VIEA 3OYEA 2ZPBB 4FU6A 1S72T 3GIBA 2RNAA 1B34B 4FW1A 1OYXA 1RAFB 5FLXE 2JTMA 4L59A 3VYGA 5GMKh 4J6YA 1M3AA 1RAGB 2FVUA 3JCMQ 2XHCA 2KMTA 3M58A 1KHCA 1FMVA 1N5ZA 1EX4A 4AFQC 2QA4A 3CC2T 4GY5A 2FYKA 1G3YA 4XU2A 1CKAA 3EH1A 3QUIA 2VASA 4Z89A 4N4IA 3T9NA 3HFNA 1U5SA 3THKA 4BACA 2C0OA 2HQHA 4E2FB 4DOWA 5D6YA 2DPPB 2NUTB 1VQPA 3MHXA 1IHWA 1B07A 1YI2T 2YUNA 1OX8A 4J9HA 1ZQ1A 1U1TA 4F16A 2DD4A 5KCHA 2QQBA 3EHRA 2RK1A 4M75D 2CGHA 2M9UA 5LJ5j 2YUOA 3UDCA 2HKNA 2E1HA 2KRSA 2HNIA 1OEBA 2DD5A 2VKNA 4M7AC 1M1FA 2DXBA 1T3SA 2VB6A 4OMLA 4F04B 4QQ6A 1RLPC 1JRIA 4ORZA 3L42A 4C0GA 1FWZA 2KEAA 3NMZC 1WX6A 2M02A 1NPRA 2KSSA 4PFOA 3A5ZB 2DXUA 5LJ5h 1JEGA 3CCLA 1Q81U 5FU7B 3JSCA 2L0AA 4AT1B 1YITQ 2KNBB 4M7DG 1D3BB 2V8KA 3EG0A 5GAOr 3G6EQ 4VUBA 5A2QE 3M0PA 2LJ1A 1UUEA 3H0FA 4M7AE 2HCKA 2DLPA 3QDRB 1RAAB 1QCNA 3CCSA 2QEXA 4F7UB 1CKBA 2X3WD 1PNJA 4KULA 2DIQA 1Q86R 1KJWA 3TU4K 1VQ9A 1M9SA 2AKKA 1W6XA 4PJOB 4AFUC 1X6BA 5EC7A 2KXDA 1OPLA 3QWYA 4EMKC 3OBWA 2PQWA 2MWPA 2EYYA 5GJWB 2V1QA 5ECAA 3R6NA 1ARKA 5KH6A 1WZOA 2XD0A 1E6GA 2DE0X 2XDDA 1VQ5Q 4F17A 5DY9A 2COZA 1RI0A 4ZTFA 1BB9A 5GAOl 1VQ8T 1B34A 4M77B 4JRKA 2V1RA 4R56A 1NEGA 2F2VA 4B9XA 3OYBA 3HRUA 2GTOA 3SWNB 3J81E 3M0RA 4R55A 1KD1C 4OMQA 1TS9A 4J83A 3JCMd 2OTJT 4N4GA 1C1AA 3OYFA 4J9BA 5CVIA 1UTIA 3G71T 1W1FA 5L23A 2HBWA 4M7AD 1IRXA 4KGZB 1NJIC 5HK3A 2NUTA 1MMAA 4BE0A 2RB6A 2RF0A 1YHQQ 1K9MR 2DXTA 1MNDA 1UHCA 4OMNA 5KYYB 4PLIA 4IUUA 3JB9F 4Z8AA 2RHZA 3URGA 1MUZA 2HSEB 2XDPA 2LNVA 3VRYA 1TG0A 2P0QA 2A36A 3FB9A 2MK5A 4XAXB 4J9FA 2DM1A 2F1LA 1VQ4T 3X20B 2CP3A 2OX7A 2CP0A 4C92C 2QGGA 1YP5A 5GAOq 1JO8A 1Q7YC 3CCJA 1KSWA 4Y92A 4XK8E 2EQUA 2C0IA 2DVEA 2WSEE 4J9CA 3ZL7C 1D3BA 4F7UF 5C0MA 3CCRT 1N9RA 3CBPA 2O01E 4BY6B 2YHTA 2J6OA 4Y28E 1NM7A 2CDTA 2BZYA 2QTXA 4PJOF 1PD1A 2RJEA 1UE9A 1U3OA 3O5ZA 1UGPB 1Q81R 4F7UA 2RI3A 2W10A 3JB9H 3GP8A 2H8HA 2QG9B 1SSFA 1Y71A 2LT1A 4PL6A 3KBGA 1E7OA 4C92E 4PJOA 2AK5A 2J6KA 3GNGA 1J3TA 1UEBA 2E65A 1VQLQ 1PRLC 4M77F 2RD1A 2EIFA 2J05A 2CH4A 1KK7A 1U1SA 1YBYA 3G4SA 2K5FA 2RHXA 4M7AG 3ER0A 1N8RU 1EIFA 1SF9A 4IUPA 2ROTA 2V26A 3MCAB 1VQ7A 4M77A 2CS7A 4A4FA 2DIGA 8ATCB 1WHJA 2JVVA 2H3EB 3P8BB 2KQWA 3FDRA 3I9QA 1K8AR 2RQRA 3SWNA 4M78C 2M0YA 2F5TX 2RHUA 4PFZA 2HZYA 2QXFA 2EYXA 1T0JA 3QXEB 2M1HA 4LE9A 1YIJA 2DO3A 3JCMh 1VQKA 2EVRA 2DILA 3NTKA 2J06A 2YT6A 2VUBA 3M0QA 2J6FA 4A4KA 1ZBXA 5GAOp 3SEMA 2IVWA 1VQMA 5KE3A 1WJRA 2JS2A 5LJ3d 2QDLA 4C92D 4HCBA 3CMEQ 3PMTA 1VQNT 3Q1JA 4JUVA 2A28A 2VXFA 5GANe 5KYYA 3JCMe 2LQKA 5LL6S 4ZN3A 1I8FA 3CEYA 4M78E 3CCLT 2X4JA 2PU9B 5D6XA 1AT1B 2CT4A 4RTVA 2DRKA 1M1GA 2X4XA 3GNFB 1BK2A 2K2VA 2C0TA 4OMFB 1EFNA 1XJWB 3VS4A 3FC3A 2QEXQ 3SFMA 3CCVA 2FZCB 2RQVA 2FRYA 3JB9I 2R5AA 4D6WA 2NWMA 4J6XA 3E2UA 3A8MB 1LOJA 5IXFA 2MIOA 3OQ5A 3WVEB 2EGAA 2ZPGB 2CH4W 3NGPA 2E10A 4O5VA 3FEOA 5GAN7 1H3HA 2ECZA 4PKCC 2E6ZA 2JS0A 1JXMA 4JDSA 3TQ7P 3OYHA 1OQKA 3A98A 4M78D 2EW3A 1IXDA 2QQRA 2YWWA 2RN8A 5FU7C 3H6ZA 2O9VA 2MAMA 4RTTA 1AVZC 1E6HA 5IH2A 2B8AA 3EHQA 3WXMB 3EG9B 2LMJA 2JNGA 2KGTA 4DEXA 2L5QA 4YTLA 4B9WA 4CI0C 3JCMc 1WYXA 1NYGA 4JJNK 2DEUA 1YITA 1HJDA 1QVGP 3G6EA 1OULA 4FSSA 1LNXA 5LJ3j 3DLLA 2X35A 5KYXB 3RNJA 3S6WA 4RTWA 2A0FB 4ZGJB 1M8VA 3ZFJA 5GAN2 1X27A 2P0PA 3FIFA 3M53A 2JOYA 2ED1A 2L3RA 1Q82C 4N0AC 4L6V5 2DEQA 2VXEA 2E12A 3LGLA 2YSQA 3A1PA 5LJ3h 3VUZA 4DBHA 1K73R 4F7UE 3CCJT 3JAME 4J9GA 3JCMg 1I0CA 4IIMA 3I56Q 4RTYA 2FEIA 2IG0A 4LN2A 1LVKA 4HT8A 1GL5A 4ZGEB 1YWOA 1X2KA 2ZAEA 1I1JA 1R8OB 2YXYA 1QVFA 3QYHB 4HVVA 4LDWA 4KUIA 4FYXB 1GCQA 4CRIA 3DLMA 5GJVB 1PM3A 1M90C 1I5OB 1KIKA 4M77E 2YLBA 4HCKA 1TUDA 3RKXA 4ANJA 3QSUA 3UT1A 1X75C 1VQ7Q 3G4ST 1YHQA 2R57A 4JZ4A 1ZSZC 4LDXA 2PTKA 1GBRA 2OAUA 5KYWB 3PGGA 2ENMA 1SKUB 4A4EA 5GANf 3JCMf 4JLIA 1UDLA 1RI9A 4C0FA 2GTJA 4J8OA 4XU1A 4HVWA 4XTZA 1YJNQ 1VQKQ 3EG9A 2HAXA 2K5LA 2BIVA 3O8VA 1PRMC 1YIJT 3OYJA 3UATA 1WJSA 1ZUKA 2RI2A 1QP2A 4JJCA 3QO3A 3VS3A 3HHTB 1C0MA 2YDLA 3V8KA 1BYMA 3M54A 3VS6A 3P8HA 4ZTJA 4QVZA 4ELYC 4M7DD 1VYVA 4AMCA 1YWPA 2JT4A 1K0XA 2A3LA 3UA6A 1W2BP 5KYXA 2RK2A 2LC4A 1RLQC 4LD6A 1JBMA 4HXJA 1N6AA 2DKGA 1YJ9Q 2JM8A 2CKKA 2JUFA 2OTLQ 4CC4B 3N5BB 2VYTA 3OS1A 2DL3A 4PNOA 1I5LA 3JB9G 4CC3A 3CCVQ 1PSEA 5I2SA 1VQLA 1AHJB 3OYLA 2GFAA 3OYYA 2LJ3A 2E5KA 2Z0WA 3I55Q 4LDVA 4XQ3A 2LJ0A 8AT1B 1NLOC 5GMKe 4E7SA 4R0KA 1ZA2B 1Y57A 3OYDA 2PVGB 2E4HA 3X26B 4D8KA 3EGUA 3FRNA 4FM4B 4KBMB 5FU6B 1X69A 1M2VB 1K9AA 1ZA1B 2QGFB 2RJDA 3EFRA 5GAN3 2RHYA 3BDUA 2P84A 2XG8D 1VYUA 2EQJA 2AZVA 3G7ZA 5LJ3g 2EKOA 4NL3A 4JS5A 2ZPHB 4F7UG 3LW5E 1QCFA 1KD1U 3UPUA 4RCBA 5HKCA 3CCUQ 2E41A 2HKQB 4FT4A 2E64A 4PJOG 4A63B 1O9SA 4C8QB 3HSBA 3U23A 2G6FX 3OBYA 3VKIA 1NJIU 1AWOA 3HRTA 4NOYA 1Q86C 4A54A 4QQDA 4FIBA 4J9EA 2JTFA 3CMEA 4IUQA 2DBMA 5HK0A 5AT1B 3E19A 3M5AA 3VS7A 1OZ2A 1R77A 4BI3A 1VA7A 5KYWA 4M77G 1NYFA 2BKDN 4J5YA 2DNUA 4IURA 4A4HA 1JJ2P 1GCQC 1NBEB 1YITT 2CREA 3HL8A 5CCAA 5DLOA 5LJ5e 1FMKA 3G6ET 1IZ6A 5CKBA 4QT7A 1VQOA 3CC4Q 1AWXA 1M1KR 2DK3A 1KC8R 3FJ5A 3A8HB 1Y0MA 2NUPB 4MZMA 4E7LA 4E47A 1Q7YU 2ZPIB 3PFSA 3QZ5B 3ZEHA 1YFNA 1UGQB 1MHNA 1BI3A 2Y4XA 1WHMA 1BIBA 4MMLA 2KROA 2EFIA 1Y7XA 2F5KA 2CSQA 1VQ5T 2QK0A 1KHIA 1K9MC 5KYUB 1Z9QA 3QKJA 1PCXA 2BZXA 3OMGA 5DLQE 4LDYA 3VUBA 1OZ3A 4OMMA 4DQ2A 2SRCA 1WIEA 2KYBA 4Z02A 3INZA 2FPEA 1O75A 2JW4A 2OTJQ 4LD9K 3LWIA 2VC8A 1M2VA 2DF6A 3G71Q 2P0KA 3VJPA 4TVRA 1WHGA 3TEEA 4C8QF 1YHQT 3OSVA 3CCQQ 1WXTA 2RJFA 2XDBA 3UA7A 3M56A 3VYHB 3RERA 3MP8A 4C5HA 2HL5C 4C8QA 2VGNA 3M4YA 3M9QA 2DA9A 2KAFA 4V2SA 1JB0E 1WI7A 3C12A 4LDUA 5FRMA 5IHKA 4BI4A 4BE2A 1SRLA 2CUDA 4JRPA 4J6WA 1H3ZA 2EJGA 3BW1A 5CO7A 5A0LA 1MV0B 3QPHA 2CP6A 4M75B 3OB9A 2LTOA 3I56A 1NJIR 3BDLA 2FPFA 1B7TA 4AFSC 3CMAA 3LLRA 2QQSA 4HVUA 1ZLMA 3REAB 2QQ9A 3CCRQ 5LJ5g 1K8AC 2K7AA 2KVQG 4Y91A 4HKEA 5CK9A 3PIOA 3NHNA 2JN0A 3M4GA 5HCKA 2NUPA 4AFZC 5FW9A 2DL7A 1KFZA 1TUCA 1WPYA 5J3BA 3CCMQ 1RABB 2F2XA 1IB8A 2DETA 1HYOA 4DEYA 2QA4T 3CC7Q 3H0IA 3EGDB 3LGFA 2RQTA 1X2QA 3P8DA 2B86A 2KE9A 5KCOA 3H0HA 3MPUB 4HCZA 4QQGA 4O6JA 5KYUA 1VQPT 6AT1B 1G3SA 4K11A 3OW2S 2D6FA 2CT3A 4B6MA 2RH2A 4EMGA 2EJFA 1MMGA 1OI1A 2PZ1A 2EGEA 3LYIA 1WNLA 2L89A 1WXUA 1YJNA 4UC4A 1Y07A 4C0DC 4PK4A 5LJ5f 2P4TA 2XMFA 2VVKA 4MDXA 4QVCA 1X01A 4RTUA 3OW2P 1P92A 2DZ9A 2O88A 1U06A 2LVMA 2AKLA 5CKDA 3DB4A 2DX1A 3RUXA 5GMKm 2LQNA 3CMET 2M51A 5GMKi 4ELZC 4BE1A 3CD6Q 2GQVA 3KUFA 4JRQA 1FMWA 1SPKA
chains in the Genus database with same CATH topology
1AWJA 1B07A 2YUNA 4LN2A 4J9HA 1GL5A 4CC7A 3VS1A 3LH5A 1YWOA 1X2KA 2FRWA 4F16A 1I1JA 3EHRA 4RTXA 2O31A 1M8MA 5IHIA 4HVVA 1HD3A 2YUOA 1GCQA 2KRSA 5GJVB 1OEBA 4GLMA 1KIKA 2VKNA 2LQWA 1SHFA 1T3SA 3M0SA 4OMLA 3QWXX 1M30A 1RLPC 2AZSA 4ORZA 4HCKA 2ESWA 1TUDA 2KEAA 2DYBA 1SRMA 3NMZC 1WX6A 1ABQA 2W0ZA 3CQTA 2K2MA 1JEGA 4JZ4A 1WLPB 2PTKA 1H8KA 1UECA 2L0AA 1GBRA 3PVLA 2KNBB 2ENMA 3EG0A 1BBZA 1PHTA 1GBQA 1SSHA 1AZEA 1WA7A 1UDLA 3M0PA 1RI9A 2LCSA 1AD5A 2LJ1A 4OMOA 2EBPA 1UUEA 2GTJA 3H0FA 2HCKA 4F14A 4HVWA 2DBKA 2DLPA 3M0UA 2D8JA 1CKBA 2X3WD 1X6GA 1Z9ZA 1PRMC 1VYTA 1PNJA 3REBB 3UATA 2O2OA 2DVJA 1ZUKA 2FO0A 4JJCA 1KJWA 2OAWA 2DRMA 3VS3A 5I22A 2AKKA 1W6XA 3C0CA 4AFUC 2YDLA 1X6BA 5EC7A 2KXDA 2LP5A 2GNCA 1OPLA 3QWYA 3VS6A 1ZSGA 3KFVA 4KRTA 2O9SA 3RBBB 2DJQA 2EYYA 4X1VA 3VS0A 5GJWB 2V1QA 1VYVA 5ECAA 3R6NA 1ARKA 1YWPA 2JT4A 1K0XA 1E6GA 1T3LA 2DE0X 4F17A 3UA6A 2YUQA 1GFCA 1BB9A 1RLQC 5FWBA 1ABOA 2P4RA 4HXJA 1UG1A 3TSZA 3JV3A 1ZUUA 1JXOA 2JM8A 2V1RA 1H92A 4CC4B 1NEGA 1M3BA 1GRIA 2DL5A 2F2VA 1ZX6A 2DL3A 2GTOA 2FG0A 1AOJA 4CC3A 2J7IA 3M0RA 4OMQA 2EYWA 2HEQA 4J9BA 4J9IA 1OV3A 1QWEA 2LJ3A 1AEYA 2E5KA 1UTIA 1W1FA 5L23A 2HBWA 2LJ0A 1QLYA 1NLOC 2KXCA 4R0KA 4J9DA 2L2PA 1Y57A 4D8DA 1XOVA 1AZGB 4D8KA 2DL4A 3EGUA 3TVTA 1X69A 1K9AA 2EGCA 2L3QA 2RF0A 1OPKA 1VYUA 1UHCA 2AZVA 4OMNA 1PKSA 2LNHB 4Z8AA 4JPBW 1MUZA 3VRYA 1TG0A 1QCFA 2A36A 2KBTA 2KT8A 2CUBA 2D8HA 3VRZA 2K6DA 3VS2A 4A63B 2L3SA 1MV3A 4OMPA 4J9FA 2DM1A 2KR3A 3U23A 2G6FX 1AWOA 3ULRB 2JM9A 1NEBA 1ZUYA 1YP5A 4IIOA 4J9EA 1JO8A 1WFWA 2DBMA 4JJBA 1KSWA 4Y92A 1I07A 2C0IA 3VS7A 1VA7A 4J9CA 3ZL7C 1QWFA 1K76A 2MOXA 4M4ZA 2OJ2A 1IO6A 1NYFA 2KRMA 2DNUA 2J6OA 1GCQC 1W70A 1NM7A 2CDTA 2CREA 2BZYA 4Z88A 1FMKA 1S1NA 1UE9A 1U3OA 3O5ZA 1LCKA 4QT7A 2W10A 1AWXA 2H8HA 3FJ5A 4JJDA 3TSWA 3EG3A 1Y0MA 2EYZA 5I11A 1E7OA 3EG2A 3M0TA 3I5RA 3PE0A 2AK5A 2J6KA 1J3TA 1ZBJA 1PRLC 1UJ0A 2J05A 2CH4A 1NG2A 2X3XD 2LX7A 2A08A 2D0NA 2KROA 2ROTA 2JMCA 2CSQA 4AG1C 2OI3A 4WCIA 1WXBA 1X43A 3I9QA 4LNPA 2RQRA 1QKWA 5IHNA 4CC2A 1Z9QA 2GQIA 2M0YA 2BZXA 2EYXA 1NLPC 1T0JA 1HSQA 1GFDA 2GBQA 2RQUA 4LE9A 2RPNA 4OMMA 4ZNXA 2SRCA 3UF4A 1WIEA 2EVRA 2KYBA 2DILA 2J06A 2YT6A 2FPEA 3M0QA 2EPDA 1UJYA 2J6FA 3SEMA 2JW4A 2CSIA 2LZ6B 2JS2A 2DF6A 2QDLA 1G2BA 2A28A 3PVQA 2BTTA 2BZ8A 2IIMA 1K0SA 1WDXA 2F2WA 1CSKA 3IQLA 1WXTA 2I0NA 2CT4A 2GGRA 4RTVA 2DRKA 3UA7A 1YCSB 2HSPA 1JU5C 4LUEA 1B3QA 1UFFA 2EKHA 1BK2A 2C0TA 1EFNA 3VS5A 3VS4A 4ESRA 2DA9A 2L3PA 3I5SA 4RUGA 1WI7A 2JTEA 2RQVA 5FWCA 2KT1A 5IHKA 1M3CA 2A37A 3EG1A 2FRYA 1SRLA 2CUDA 3NPFA 1GCPA 2NWMA 4E6RA 1MV0B 1SEMA 1PWTA 1K1ZA 1YN8A 1G83A 2VWFA 1JQQA 2FPFA 1A0NB 5IXBA 5IXFA 4AFSC 2MIOA 4HVUA 1ZLMA 4GBQA 4LUDA 3REAB 2ROLA 2K7AA 2EGAA 2CH4W 3NGPA 1FYNA 2PNIA 2DL8A 2SEMA 1H3HA 2ABLA 2ECZA 2K79A 1RUWA 3NHNA 1AWWA 5HCKA 1BU1A 2JS0A 1UHFA 1JXMA 4AFZC 2D1XA 3A98A 5FW9A 2DL7A 1KFZA 1TUCA 2EW3A 2MCNA 3H41A 2RN8A 1QKXA 2FPDA 2F2XA 2O9VA 1OOTA 4RTTA 2HDAA 1AVZC 4EIKA 1E6HA 2YUPA 4DEYA 5IH2A 3EHQA 2DMOA 1M27C 2RQWA 2LMJA 1UGVA 3H0IA 2KGTA 4DEXA 2RQTA 1X2QA 1YNZA 2B86A 4JZ3A 2KE9A 1K4US 3H0HA 1WYXA 3GBQA 1NYGA 2JXBA 2EQIA 4K11A 2ED0A 2JMAA 2CT3A 1HJDA 3SHWA 2KRNA 4AG2C 4FSSA 2PZ1A 1V1CA 2EGEA 1SHGA 2RNAA 1WXUA 4RTZA 2KYMA 3RNJA 4RTWA 1PKTA 2NUZA 3I35A 1M3AA 1X27A 2XMFA 2VVKA 2ED1A 4RTUA 2RMOA 1N5ZA 1T0HA 2O88A 1U06A 2K3BA 4AFQC 2YSQA 2AKLA 1CKAA 2K9GA 4Z89A 2DX1A 1U5SA 3THKA 2LQNA 2M51A 2C0OA 4J9GA 1I0CA 4IIMA 4RTYA 2FEIA 1SPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWJ A;  1B07 A;  2YUN A;  4LN2 A;  4J9H A;  1GL5 A;  4CC7 A;  3VS1 A;  3LH5 A;  1YWO A;  1X2K A;  2FRW A;  4F16 A;  1I1J A;  3EHR A;  4RTX A;  2O31 A;  1M8M A;  5IHI A;  4HVV A;  1HD3 A;  2YUO A;  1GCQ A;  2KRS A;  5GJV B;  1OEB A;  4GLM A;  1KIK A;  2VKN A;  2LQW A;  1SHF A;  1T3S A;  3M0S A;  4OML A;  3QWX X;  1M30 A;  1RLP C;  2AZS A;  4ORZ A;  4HCK A;  2ESW A;  1TUD A;  2KEA A;  2DYB A;  1SRM A;  3NMZ C;  1WX6 A;  1ABQ A;  2W0Z A;  3CQT A;  2K2M A;  1JEG A;  4JZ4 A;  1WLP B;  2PTK A;  1H8K A;  1UEC A;  2L0A A;  1GBR A;  3PVL A;  2KNB B;  2ENM A;  3EG0 A;  1BBZ A;  1PHT A;  1GBQ A;  1SSH A;  1AZE A;  1WA7 A;  1UDL A;  3M0P A;  1RI9 A;  2LCS A;  1AD5 A;  2LJ1 A;  4OMO A;  2EBP A;  1UUE A;  2GTJ A;  3H0F A;  2HCK A;  4F14 A;  4HVW A;  2DBK A;  2DLP A;  3M0U A;  2D8J A;  1CKB A;  2X3W D;  1X6G A;  1Z9Z A;  1PRM C;  1VYT A;  1PNJ A;  3REB B;  3UAT A;  2O2O A;  2DVJ A;  1ZUK A;  2FO0 A;  4JJC A;  1KJW A;  2OAW A;  2DRM A;  3VS3 A;  5I22 A;  2AKK A;  1W6X A;  3C0C A;  4AFU C;  2YDL A;  1X6B A;  5EC7 A;  2KXD A;  2LP5 A;  2GNC A;  1OPL A;  3QWY A;  3VS6 A;  1ZSG A;  3KFV A;  4KRT A;  2O9S A;  3RBB B;  2DJQ A;  2EYY A;  4X1V A;  3VS0 A;  5GJW B;  2V1Q A;  1VYV A;  5ECA A;  3R6N A;  1ARK A;  1YWP A;  2JT4 A;  1K0X A;  1E6G A;  1T3L A;  2DE0 X;  4F17 A;  3UA6 A;  2YUQ A;  1GFC A;  1BB9 A;  1RLQ C;  5FWB A;  1ABO A;  2P4R A;  4HXJ A;  1UG1 A;  3TSZ A;  3JV3 A;  1ZUU A;  1JXO A;  2JM8 A;  2V1R A;  1H92 A;  4CC4 B;  1NEG A;  1M3B A;  1GRI A;  2DL5 A;  2F2V A;  1ZX6 A;  2DL3 A;  2GTO A;  2FG0 A;  1AOJ A;  4CC3 A;  2J7I A;  3M0R A;  4OMQ A;  2EYW A;  2HEQ A;  4J9B A;  4J9I A;  1OV3 A;  1QWE A;  2LJ3 A;  1AEY A;  2E5K A;  1UTI A;  1W1F A;  5L23 A;  2HBW A;  2LJ0 A;  1QLY A;  1NLO C;  2KXC A;  4R0K A;  4J9D A;  2L2P A;  1Y57 A;  4D8D A;  1XOV A;  1AZG B;  4D8K A;  2DL4 A;  3EGU A;  3TVT A;  1X69 A;  1K9A A;  2EGC A;  2L3Q A;  2RF0 A;  1OPK A;  1VYU A;  1UHC A;  2AZV A;  4OMN A;  1PKS A;  2LNH B;  4Z8A A;  4JPB W;  1MUZ A;  3VRY A;  1TG0 A;  1QCF A;  2A36 A;  2KBT A;  2KT8 A;  2CUB A;  2D8H A;  3VRZ A;  2K6D A;  3VS2 A;  4A63 B;  2L3S A;  1MV3 A;  4OMP A;  4J9F A;  2DM1 A;  2KR3 A;  3U23 A;  2G6F X;  1AWO A;  3ULR B;  2JM9 A;  1NEB A;  1ZUY A;  1YP5 A;  4IIO A;  4J9E A;  1JO8 A;  1WFW A;  2DBM A;  4JJB A;  1KSW A;  4Y92 A;  1I07 A;  2C0I A;  3VS7 A;  1VA7 A;  4J9C A;  3ZL7 C;  1QWF A;  1K76 A;  2MOX A;  4M4Z A;  2OJ2 A;  1IO6 A;  1NYF A;  2KRM A;  2DNU A;  2J6O A;  1GCQ C;  1W70 A;  1NM7 A;  2CDT A;  2CRE A;  2BZY A;  4Z88 A;  1FMK A;  1S1N A;  1UE9 A;  1U3O A;  3O5Z A;  1LCK A;  4QT7 A;  2W10 A;  1AWX A;  2H8H A;  3FJ5 A;  4JJD A;  3TSW A;  3EG3 A;  1Y0M A;  2EYZ A;  5I11 A;  1E7O A;  3EG2 A;  3M0T A;  3I5R A;  3PE0 A;  2AK5 A;  2J6K A;  1J3T A;  1ZBJ A;  1PRL C;  1UJ0 A;  2J05 A;  2CH4 A;  1NG2 A;  2X3X D;  2LX7 A;  2A08 A;  2D0N A;  2KRO A;  2ROT A;  2JMC A;  2CSQ A;  4AG1 C;  2OI3 A;  4WCI A;  1WXB A;  1X43 A;  3I9Q A;  4LNP A;  2RQR A;  1QKW A;  5IHN A;  4CC2 A;  1Z9Q A;  2GQI A;  2M0Y A;  2BZX A;  2EYX A;  1NLP C;  1T0J A;  1HSQ A;  1GFD A;  2GBQ A;  2RQU A;  4LE9 A;  2RPN A;  4OMM A;  4ZNX A;  2SRC A;  3UF4 A;  1WIE A;  2EVR A;  2KYB A;  2DIL A;  2J06 A;  2YT6 A;  2FPE A;  3M0Q A;  2EPD A;  1UJY A;  2J6F A;  3SEM A;  2JW4 A;  2CSI A;  2LZ6 B;  2JS2 A;  2DF6 A;  2QDL A;  1G2B A;  2A28 A;  3PVQ A;  2BTT A;  2BZ8 A;  2IIM A;  1K0S A;  1WDX A;  2F2W A;  1CSK A;  3IQL A;  1WXT A;  2I0N A;  2CT4 A;  2GGR A;  4RTV A;  2DRK A;  3UA7 A;  1YCS B;  2HSP A;  1JU5 C;  4LUE A;  1B3Q A;  1UFF A;  2EKH A;  1BK2 A;  2C0T A;  1EFN A;  3VS5 A;  3VS4 A;  4ESR A;  2DA9 A;  2L3P A;  3I5S A;  4RUG A;  1WI7 A;  2JTE A;  2RQV A;  5FWC A;  2KT1 A;  5IHK A;  1M3C A;  2A37 A;  3EG1 A;  2FRY A;  1SRL A;  2CUD A;  3NPF A;  1GCP A;  2NWM A;  4E6R A;  1MV0 B;  1SEM A;  1PWT A;  1K1Z A;  1YN8 A;  1G83 A;  2VWF A;  1JQQ A;  2FPF A;  1A0N B;  5IXB A;  5IXF A;  4AFS C;  2MIO A;  4HVU A;  1ZLM A;  4GBQ A;  4LUD A;  3REA B;  2ROL A;  2K7A A;  2EGA A;  2CH4 W;  3NGP A;  1FYN A;  2PNI A;  2DL8 A;  2SEM A;  1H3H A;  2ABL A;  2ECZ A;  2K79 A;  1RUW A;  3NHN A;  1AWW A;  5HCK A;  1BU1 A;  2JS0 A;  1UHF A;  1JXM A;  4AFZ C;  2D1X A;  3A98 A;  5FW9 A;  2DL7 A;  1KFZ A;  1TUC A;  2EW3 A;  2MCN A;  3H41 A;  2RN8 A;  1QKX A;  2FPD A;  2F2X A;  2O9V A;  1OOT A;  4RTT A;  2HDA A;  1AVZ C;  4EIK A;  1E6H A;  2YUP A;  4DEY A;  5IH2 A;  3EHQ A;  2DMO A;  1M27 C;  2RQW A;  2LMJ A;  1UGV A;  3H0I A;  2KGT A;  4DEX A;  2RQT A;  1X2Q A;  1YNZ A;  2B86 A;  4JZ3 A;  2KE9 A;  1K4U S;  3H0H A;  1WYX A;  3GBQ A;  1NYG A;  2JXB A;  2EQI A;  4K11 A;  2ED0 A;  2JMA A;  2CT3 A;  1HJD A;  3SHW A;  2KRN A;  4AG2 C;  4FSS A;  2PZ1 A;  1V1C A;  2EGE A;  1SHG A;  2RNA A;  1WXU A;  4RTZ A;  2KYM A;  3RNJ A;  4RTW A;  1PKT A;  2NUZ A;  3I35 A;  1M3A A;  1X27 A;  2XMF A;  2VVK A;  2ED1 A;  4RTU A;  2RMO A;  1N5Z A;  1T0H A;  2O88 A;  1U06 A;  2K3B A;  4AFQ C;  2YSQ A;  2AKL A;  1CKA A;  2K9G A;  4Z89 A;  2DX1 A;  1U5S A;  3THK A;  2LQN A;  2M51 A;  2C0O A;  4J9G A;  1I0C A;  4IIM A;  4RTY A;  2FEI A;  1SPK A; 
#chains in the Genus database with same CATH topology
 4CC7 A;  3VS1 A;  1YJ9 A;  2FRW A;  4E7K A;  4DBR A;  2L8D A;  2X51 A;  2OTL A;  2CZ1 B;  3L2U A;  1VQO Q;  3CXC P;  4M75 F;  1M8M A;  3QBY A;  1HD3 A;  2DTO A;  3C4S A;  3CCE Q;  3CCS T;  2QEX T;  1N9S A;  1PC0 A;  5CQX A;  4A4G A;  1Q82 U;  2EJ9 A;  4BUG A;  3I55 A;  1SHF A;  3A8L B;  2BE9 B;  5CR2 A;  3M0S A;  4M75 A;  2ZZD A;  1BI2 A;  1VQ9 T;  3CC2 A;  1M4Z A;  3OS2 A;  2KY9 A;  3MJX A;  2W0Z A;  1TU0 B;  2K2M A;  4RKU E;  1WLP B;  3E9G A;  4C8Q C;  2K3X A;  4II1 A;  1V29 B;  3L2Q A;  4KGX B;  3HPW A;  1BBZ A;  2CZ6 B;  1GBQ A;  3EAE A;  3CCU A;  3V7S A;  3QJY A;  1AZE A;  1OU9 A;  2K4Y A;  2LCS A;  1QVG S;  3RKY A;  1AD5 A;  1M90 U;  4OMO A;  2LRQ A;  3QHS A;  4F14 A;  2QQA A;  5KYN A;  3OYN A;  4JS4 A;  3M0U A;  4EMK B;  1TUG B;  3EGD A;  1X6G A;  1Z9Z A;  2RHI A;  3REB B;  4FSX A;  2FO0 A;  2DRM A;  1MMD A;  5KE2 A;  1QVG A;  1KQS P;  3C0C A;  1RL2 A;  2GNC A;  2CP2 A;  1ZSG A;  3KFV A;  1K73 C;  4KRT A;  1TOV A;  2O9S A;  3RBB B;  4C8Q E;  2DJQ A;  5FRN A;  4X1V A;  3PT9 A;  2E3I A;  1N8R R;  1GFC A;  3E1S A;  4PJO C;  2ZGW A;  4E7I A;  4PFP A;  2K3Y A;  1TSF A;  2P4R A;  2WAC A;  3V8L A;  2E3H A;  2A7Y A;  1UG1 A;  3TSZ A;  3OYA A;  3L2R A;  3JCM b;  1JXO A;  3CC4 A;  4HCC A;  1BKB A;  1OX9 A;  4XTX A;  3ME9 A;  5L8R E;  1H92 A;  2FZK B;  5GAN 8;  1M3B A;  2DL5 A;  1AOJ A;  3JRZ A;  4M77 C;  2CP7 A;  2HEQ A;  1BCM A;  2V8J A;  1MGQ A;  4RG2 A;  1QWE A;  1QP3 A;  3SWN C;  1QLY A;  2CZ7 B;  2L2P A;  3GF5 A;  1XOV A;  4PJO E;  3V7C A;  3CMA Q;  3QG1 A;  3I56 T;  5CIU A;  2EGC A;  5LJ3 e;  4M7A A;  4PJJ A;  5IN1 A;  3JB9 D;  4JPB W;  1TXQ A;  3BE3 A;  1UGR B;  4C5G A;  2O4X B;  1XNI A;  2KBT A;  4C92 B;  2LDM A;  5A0G A;  3CPW P;  2D8H A;  4BD3 A;  5GAM d;  2K6D A;  2PUO B;  3VS2 A;  2L3S A;  1MV3 A;  2OTJ A;  2JM9 A;  2R5M A;  2EYQ A;  1VIF A;  3G71 A;  1WFW A;  5I21 A;  4EPC A;  1YJW Q;  2CZ0 B;  2QTV A;  2FZG B;  1VQ7 T;  1PSF A;  2LX9 A;  2LCC A;  3ASK A;  3PMI A;  2QAS A;  3CCQ A;  4J7F A;  5GAN 4;  4M4Z A;  2OJ2 A;  2KRM A;  1W70 A;  5GAN 5;  3OYK A;  1MNE A;  2RI5 A;  3L2W A;  4MZT A;  4Z88 A;  2DTH A;  2C06 A;  1VQ6 Q;  4PJO D;  3SD4 A;  1S1N A;  2XK0 A;  1W2B S;  4M75 C;  4EMK A;  4BY6 C;  3OS0 A;  1VQK T;  1Q86 U;  3OYI A;  5I11 A;  3M0T A;  1BCO A;  4OP0 A;  4X9C A;  1W2B A;  3UWN A;  5DM7 R;  1LPL A;  1RAH B;  4M77 D;  4NS5 A;  3M59 A;  1VQM T;  1Q95 G;  1R0C B;  1NG2 A;  2X3X D;  2YRD A;  3RKW A;  3MKD A;  2A08 A;  3JCM V;  2D0N A;  4M78 B;  3OYC A;  2JMC A;  4OGC A;  1HXD A;  3EFO B;  3CCR A;  1PD0 A;  7AT1 B;  1FX7 A;  2OI3 A;  1WXB A;  4XTU A;  1X43 A;  4M75 E;  2GF7 A;  1LJO A;  1QKW A;  1S72 Q;  3AHU A;  1YJ9 T;  4C8Q G;  2OTL T;  3CCM A;  1NLP C;  2JJ9 A;  1HSQ A;  1GFD A;  2GBQ A;  2RPN A;  1VUB A;  2QYZ A;  4ZNX A;  3CCV T;  1WHK A;  1TH7 A;  4EDU A;  3UF4 A;  4JRI A;  5GAO n;  3CC7 A;  5IT9 E;  3LX7 A;  2EPD A;  1UJY A;  4ZN1 A;  2XIC A;  3I55 T;  4N4H A;  2QI2 A;  2R58 A;  4QW2 A;  4MMK A;  3CC2 Q;  2ATC B;  2CYZ B;  4C92 F;  5AYF A;  5GAM j;  1G2B A;  1K9M U;  2D0Q B;  4ATO A;  5J26 A;  3MET A;  1D1A A;  1YI2 Q;  4E7J A;  2DXC A;  2F2W A;  2O4X A;  1CSK A;  4ZGD B;  4C92 A;  3FLG A;  5D6W A;  2I0N A;  2GGR A;  2X4W A;  1YCS B;  4LUE A;  1JU5 C;  1I81 A;  1UFF A;  1JJ2 S;  3CCU T;  1KC8 C;  3VS5 A;  1M1K C;  3C95 A;  1KQ2 A;  5EG2 A;  5GAM h;  3EFS A;  3GOX A;  5FWC A;  2KT1 A;  4RCC A;  1M3C A;  2A37 A;  3EG1 A;  3NPF A;  2AHJ B;  1JJ2 A;  3HFO A;  1GCP A;  2PUK B;  1C6V X;  4XU0 A;  2RJC A;  9ATC B;  1K1Z A;  5GAM e;  2DER A;  1YN8 A;  3CD6 A;  1JQQ A;  2EAY A;  4OVA A;  1VQN A;  3OA6 A;  1A0N B;  3MEU A;  2H3J A;  1IRE B;  3JCM J;  4DBQ A;  1WHL A;  3MEW A;  1U8R A;  2ROL A;  1UGS B;  1G5V A;  4X9D A;  1FYN A;  2PNI A;  2SEM A;  1BU1 A;  1UHF A;  2E6N A;  3CCE A;  1H64 1;  4PJN A;  3CC4 T;  4M78 F;  4P5N A;  5LJ3 f;  2MI6 A;  2MCN A;  3KXT A;  3HTR A;  2FPD A;  1G8X A;  3M57 A;  2HDA A;  2PVD B;  2YUP A;  3TCJ A;  3HKS A;  4OB1 B;  4IKF A;  4JLG A;  4OB0 B;  2DMO A;  4M78 A;  1M27 C;  3F70 A;  2RQW A;  3OYM A;  1RAI B;  5GMK l;  3EFO A;  4HA8 A;  1K4U S;  3GBQ A;  3L1A A;  4OF1 A;  2EQI A;  2V8I A;  1K8A U;  2ZPF B;  1NZ9 A;  2DZC A;  3GPL A;  1VQ8 Q;  3S3O A;  5CQY A;  1DJ7 B;  3MEA A;  2YRV A;  5C6S A;  1WJQ A;  3D7S B;  1V1C A;  2DFU A;  1SHG A;  4PJL A;  4XTW A;  4RTZ A;  2KYM A;  4M7D B;  1PKT A;  2NUZ A;  1D09 B;  3I35 A;  2WSF E;  3R6O A;  2LQ8 A;  4M75 G;  1M2O A;  1XQH A;  2RMO A;  1T0H A;  4LXC A;  2K3B A;  2WSC E;  2HQE A;  5GAN d;  1IGU A;  3RR6 A;  3NFC A;  5CKF A;  2BUD A;  2K9G A;  1UB4 A;  1RAC B;  3RES A;  4FW2 A;  3RIR A;  1AWJ A;  1KQ1 A;  3CCQ T;  3LH5 A;  1Q81 C;  3WVD B;  2GFU A;  2DYI A;  1BI1 A;  4RTX A;  1VOM A;  1WHH A;  2O31 A;  5IHI A;  3S3M A;  1WGS A;  3L2Z A;  3VV0 A;  1RAD B;  4FYY B;  4GLM A;  5J39 A;  1KD1 R;  4J7I A;  2LQW A;  4PLL A;  1VQ4 Q;  3QWX X;  3DKM A;  1M30 A;  2AZS A;  4IUV A;  1ZSZ B;  2ESW A;  3QYG B;  2DYB A;  1SRM A;  4MZP A;  1ABQ A;  2IPO B;  4C0Z A;  5GAM g;  4BI8 B;  3BFM A;  5D7U A;  1BIA A;  3CQT A;  1D0X A;  2KDS A;  1H8K A;  2HL3 A;  1QVP A;  1UEC A;  3BY7 A;  3PVL A;  3EH2 A;  3J80 E;  4XU3 A;  3J7A F;  1YCY A;  3LH0 A;  1PHT A;  1SSH A;  1WA7 A;  1X6O A;  2EBP A;  2DBK A;  3CCM T;  1XTD A;  4FYW B;  2D8J A;  1VQL T;  1G3T A;  1Y96 B;  4PJM A;  2KI7 A;  1D1C A;  2XU8 A;  1VYT A;  2ZCF B;  3S3N A;  2E5Q A;  1QQJ A;  2O2O A;  2DVJ A;  2VV5 A;  3A8G B;  2OAW A;  1YJW A;  3CC7 T;  5I22 A;  1Q7Y R;  2M16 A;  3TRE A;  2LP5 A;  2QA4 Q;  2MF2 A;  3CBM A;  5I2M A;  4XTV A;  4DOV A;  4M7D F;  3VS0 A;  4QKU A;  1BI0 A;  4XTY A;  1PG5 B;  1W4S A;  3MO8 A;  1T3L A;  2YUQ A;  2E70 A;  2HMA A;  3DB3 A;  5GAN j;  5FWB A;  4N0A A;  1ABO A;  1VQ6 A;  1VQP Q;  5GAM f;  3OW2 A;  3JV3 A;  1ZUU A;  4M7D A;  2YLC A;  3QDF A;  1NPP A;  1GRI A;  2MPX C;  4C5I A;  1ZX6 A;  5HY6 A;  2FG0 A;  2J7I A;  2LT4 A;  2RO0 A;  3CXC S;  2CP5 A;  2EYW A;  2QDY B;  4OB2 B;  2MMP A;  4J9I A;  1OV3 A;  2HBP A;  5GAN h;  1AEY A;  2FHD A;  1K73 U;  2KXC A;  4J9D A;  3QII A;  4D8D A;  3CXC A;  1AZG B;  1VQN Q;  5FRO A;  2DL4 A;  4EMH A;  3TVT A;  3CD6 T;  2DJZ A;  4KT0 E;  2L3Q A;  1I4K 1;  4RMO A;  1OPK A;  3CCL Q;  4M7A B;  1S72 A;  1WQW A;  3X28 B;  2GCX A;  2XI9 A;  1PKS A;  2AT1 B;  2LNH B;  5GAO m;  2G3R A;  2NLU A;  4C5E A;  4WTO B;  1VQO T;  5FU6 C;  4X34 A;  1G3W A;  1KG1 A;  3L2V A;  3OMC A;  2KT8 A;  2CUB A;  2I2L A;  3RMS A;  3VRZ A;  3X24 B;  1FXX A;  3CCE T;  2YRC A;  2MWO A;  1ZSZ A;  1D0Z A;  1V76 A;  1IGQ A;  4OMP A;  3X25 B;  2KR3 A;  3CCS Q;  2M0O A;  3ULR B;  1NEB A;  1ZUY A;  4IIO A;  3GLX A;  2PVO B;  2RA2 A;  3PNW C;  4JJB A;  1VQ9 Q;  3JCM P;  1N27 A;  3MP1 A;  4Q5W A;  1I07 A;  2X4Y A;  2Y90 A;  4L5G A;  3HRS A;  1YI2 A;  1KQS S;  1QWF A;  2QAZ A;  1N8R C;  1K76 A;  5CKE A;  2MOX A;  1IO6 A;  4FL6 A;  4KH0 B;  2X9H A;  2VGM A;  3A8O B;  4OGE A;  1KQS A;  1LCK A;  1Y96 A;  3SB2 A;  4DBF A;  3NTI A;  1NE8 A;  2FB7 A;  4JJD A;  3TSW A;  4KUD K;  2EQK A;  3EG3 A;  3E9F A;  3LWH A;  2EYZ A;  1OU8 A;  3EG2 A;  3I5R A;  3PE0 A;  1WQ7 A;  3OYG A;  2COW A;  4NL2 A;  1ZBJ A;  1ACM B;  1UJ0 A;  4GLK A;  3OS5 A;  5IAY A;  2LX7 A;  3NTH A;  4IUT A;  3VU3 C;  3AT1 B;  2HQX A;  3OSS C;  4AG1 C;  3FJP A;  3JCM X;  4WCI A;  4C92 G;  2F69 A;  4LNP A;  2XID A;  5IHN A;  4FYV B;  4CC2 A;  2GQI A;  1QMC A;  3H9N A;  3EGX B;  4BDY A;  4FT2 A;  2RQU A;  2FL7 A;  3HP9 A;  1ZHI A;  1QW1 A;  1TWB A;  1RAE B;  4M7A F;  2LCL A;  3C94 A;  2K57 A;  3CPW S;  1MMN A;  3MP6 A;  2NYS A;  1SG5 A;  2CSI A;  3RDV A;  2AIR B;  2LZ6 B;  3M55 A;  3PIP A;  5M9O A;  4MDW A;  3CCJ Q;  3CBO A;  4M7D C;  3PVQ A;  3CPW A;  1IHV A;  2BTT A;  3JCM W;  3CMA T;  4C8Q D;  1VQ8 A;  2BZ8 A;  2IIM A;  5GAN g;  1VQ5 A;  2XKO C;  4A53 A;  1K0S A;  1WDX A;  3G1J A;  3IQL A;  1QVF S;  3QZ9 B;  3V7R A;  5CKH A;  2HSP A;  1B3Q A;  1EZZ B;  2EKH A;  4FCY A;  2K5I A;  4ESR A;  4OB3 B;  2COY A;  1GXI E;  4BDZ A;  2L3P A;  4E7H A;  3I5S A;  4RUG A;  2JTE A;  4WF2 A;  1HK9 A;  4HT9 A;  1Q82 R;  1TTH B;  2JZ2 A;  4M78 G;  1D0Y A;  4M7D E;  4E6R A;  2MYS A;  1QVF P;  1SEM A;  1YJW T;  1PWT A;  1G83 A;  2VWF A;  3ZBD A;  3G4S Q;  5LJ5 d;  4DA4 A;  2D9T A;  5IXB A;  3JB9 J;  2EQM A;  4BB7 A;  4GBQ A;  4LUD A;  4QVD A;  4E7Z A;  3RMQ A;  3PTA A;  1D1B A;  2DL8 A;  1VQ6 T;  1M1K U;  1KC8 U;  2ABL A;  3V8J A;  2K79 A;  1RUW A;  1AWW A;  2HD0 A;  3MEV A;  5A0D A;  1YJN T;  2D1X A;  5GAN 6;  2KK4 A;  2ZPE B;  3H41 A;  2EWN A;  2RM4 A;  1QKX A;  1M90 R;  1VQ4 A;  4KGV B;  2DTI A;  3OY9 A;  1OOT A;  4EIK A;  3QJ6 A;  1YIJ Q;  3H8Z A;  2BE7 D;  1UGV A;  1F1B B;  4KH1 B;  4ME7 A;  2DAQ A;  1M5Q 1;  5CAI A;  1YNZ A;  1VQM Q;  4JZ3 A;  3SDZ A;  4RG8 A;  5GMK j;  3CPF A;  2JXB A;  1R0B G;  2Y4Y A;  2ED0 A;  2JMA A;  4C0D B;  3SHW A;  3EGX A;  2KRN A;  4AG2 C;  1QCO A;  1VIE A;  3OYE A;  2ZPB B;  4FU6 A;  1S72 T;  3GIB A;  2RNA A;  1B34 B;  4FW1 A;  1OYX A;  1RAF B;  5FLX E;  2JTM A;  4L59 A;  3VYG A;  5GMK h;  4J6Y A;  1M3A A;  1RAG B;  2FVU A;  3JCM Q;  2XHC A;  2KMT A;  3M58 A;  1KHC A;  1FMV A;  1N5Z A;  1EX4 A;  4AFQ C;  2QA4 A;  3CC2 T;  4GY5 A;  2FYK A;  1G3Y A;  4XU2 A;  1CKA A;  3EH1 A;  3QUI A;  2VAS A;  4Z89 A;  4N4I A;  3T9N A;  3HFN A;  1U5S A;  3THK A;  4BAC A;  2C0O A;  2HQH A;  4E2F B;  4DOW A;  5D6Y A;  2DPP B;  2NUT B;  1VQP A;  3MHX A;  1IHW A;  1B07 A;  1YI2 T;  2YUN A;  1OX8 A;  4J9H A;  1ZQ1 A;  1U1T A;  4F16 A;  2DD4 A;  5KCH A;  2QQB A;  3EHR A;  2RK1 A;  4M75 D;  2CGH A;  2M9U A;  5LJ5 j;  2YUO A;  3UDC A;  2HKN A;  2E1H A;  2KRS A;  2HNI A;  1OEB A;  2DD5 A;  2VKN A;  4M7A C;  1M1F A;  2DXB A;  1T3S A;  2VB6 A;  4OML A;  4F04 B;  4QQ6 A;  1RLP C;  1JRI A;  4ORZ A;  3L42 A;  4C0G A;  1FWZ A;  2KEA A;  3NMZ C;  1WX6 A;  2M02 A;  1NPR A;  2KSS A;  4PFO A;  3A5Z B;  2DXU A;  5LJ5 h;  1JEG A;  3CCL A;  1Q81 U;  5FU7 B;  3JSC A;  2L0A A;  4AT1 B;  1YIT Q;  2KNB B;  4M7D G;  1D3B B;  2V8K A;  3EG0 A;  5GAO r;  3G6E Q;  4VUB A;  5A2Q E;  3M0P A;  2LJ1 A;  1UUE A;  3H0F A;  4M7A E;  2HCK A;  2DLP A;  3QDR B;  1RAA B;  1QCN A;  3CCS A;  2QEX A;  4F7U B;  1CKB A;  2X3W D;  1PNJ A;  4KUL A;  2DIQ A;  1Q86 R;  1KJW A;  3TU4 K;  1VQ9 A;  1M9S A;  2AKK A;  1W6X A;  4PJO B;  4AFU C;  1X6B A;  5EC7 A;  2KXD A;  1OPL A;  3QWY A;  4EMK C;  3OBW A;  2PQW A;  2MWP A;  2EYY A;  5GJW B;  2V1Q A;  5ECA A;  3R6N A;  1ARK A;  5KH6 A;  1WZO A;  2XD0 A;  1E6G A;  2DE0 X;  2XDD A;  1VQ5 Q;  4F17 A;  5DY9 A;  2COZ A;  1RI0 A;  4ZTF A;  1BB9 A;  5GAO l;  1VQ8 T;  1B34 A;  4M77 B;  4JRK A;  2V1R A;  4R56 A;  1NEG A;  2F2V A;  4B9X A;  3OYB A;  3HRU A;  2GTO A;  3SWN B;  3J81 E;  3M0R A;  4R55 A;  1KD1 C;  4OMQ A;  1TS9 A;  4J83 A;  3JCM d;  2OTJ T;  4N4G A;  1C1A A;  3OYF A;  4J9B A;  5CVI A;  1UTI A;  3G71 T;  1W1F A;  5L23 A;  2HBW A;  4M7A D;  1IRX A;  4KGZ B;  1NJI C;  5HK3 A;  2NUT A;  1MMA A;  4BE0 A;  2RB6 A;  2RF0 A;  1YHQ Q;  1K9M R;  2DXT A;  1MND A;  1UHC A;  4OMN A;  5KYY B;  4PLI A;  4IUU A;  3JB9 F;  4Z8A A;  2RHZ A;  3URG A;  1MUZ A;  2HSE B;  2XDP A;  2LNV A;  3VRY A;  1TG0 A;  2P0Q A;  2A36 A;  3FB9 A;  2MK5 A;  4XAX B;  4J9F A;  2DM1 A;  2F1L A;  1VQ4 T;  3X20 B;  2CP3 A;  2OX7 A;  2CP0 A;  4C92 C;  2QGG A;  1YP5 A;  5GAO q;  1JO8 A;  1Q7Y C;  3CCJ A;  1KSW A;  4Y92 A;  4XK8 E;  2EQU A;  2C0I A;  2DVE A;  2WSE E;  4J9C A;  3ZL7 C;  1D3B A;  4F7U F;  5C0M A;  3CCR T;  1N9R A;  3CBP A;  2O01 E;  4BY6 B;  2YHT A;  2J6O A;  4Y28 E;  1NM7 A;  2CDT A;  2BZY A;  2QTX A;  4PJO F;  1PD1 A;  2RJE A;  1UE9 A;  1U3O A;  3O5Z A;  1UGP B;  1Q81 R;  4F7U A;  2RI3 A;  2W10 A;  3JB9 H;  3GP8 A;  2H8H A;  2QG9 B;  1SSF A;  1Y71 A;  2LT1 A;  4PL6 A;  3KBG A;  1E7O A;  4C92 E;  4PJO A;  2AK5 A;  2J6K A;  3GNG A;  1J3T A;  1UEB A;  2E65 A;  1VQL Q;  1PRL C;  4M77 F;  2RD1 A;  2EIF A;  2J05 A;  2CH4 A;  1KK7 A;  1U1S A;  1YBY A;  3G4S A;  2K5F A;  2RHX A;  4M7A G;  3ER0 A;  1N8R U;  1EIF A;  1SF9 A;  4IUP A;  2ROT A;  2V26 A;  3MCA B;  1VQ7 A;  4M77 A;  2CS7 A;  4A4F A;  2DIG A;  8ATC B;  1WHJ A;  2JVV A;  2H3E B;  3P8B B;  2KQW A;  3FDR A;  3I9Q A;  1K8A R;  2RQR A;  3SWN A;  4M78 C;  2M0Y A;  2F5T X;  2RHU A;  4PFZ A;  2HZY A;  2QXF A;  2EYX A;  1T0J A;  3QXE B;  2M1H A;  4LE9 A;  1YIJ A;  2DO3 A;  3JCM h;  1VQK A;  2EVR A;  2DIL A;  3NTK A;  2J06 A;  2YT6 A;  2VUB A;  3M0Q A;  2J6F A;  4A4K A;  1ZBX A;  5GAO p;  3SEM A;  2IVW A;  1VQM A;  5KE3 A;  1WJR A;  2JS2 A;  5LJ3 d;  2QDL A;  4C92 D;  4HCB A;  3CME Q;  3PMT A;  1VQN T;  3Q1J A;  4JUV A;  2A28 A;  2VXF A;  5GAN e;  5KYY A;  3JCM e;  2LQK A;  5LL6 S;  4ZN3 A;  1I8F A;  3CEY A;  4M78 E;  3CCL T;  2X4J A;  2PU9 B;  5D6X A;  1AT1 B;  2CT4 A;  4RTV A;  2DRK A;  1M1G A;  2X4X A;  3GNF B;  1BK2 A;  2K2V A;  2C0T A;  4OMF B;  1EFN A;  1XJW B;  3VS4 A;  3FC3 A;  2QEX Q;  3SFM A;  3CCV A;  2FZC B;  2RQV A;  2FRY A;  3JB9 I;  2R5A A;  4D6W A;  2NWM A;  4J6X A;  3E2U A;  3A8M B;  1LOJ A;  5IXF A;  2MIO A;  3OQ5 A;  3WVE B;  2EGA A;  2ZPG B;  2CH4 W;  3NGP A;  2E10 A;  4O5V A;  3FEO A;  5GAN 7;  1H3H A;  2ECZ A;  4PKC C;  2E6Z A;  2JS0 A;  1JXM A;  4JDS A;  3TQ7 P;  3OYH A;  1OQK A;  3A98 A;  4M78 D;  2EW3 A;  1IXD A;  2QQR A;  2YWW A;  2RN8 A;  5FU7 C;  3H6Z A;  2O9V A;  2MAM A;  4RTT A;  1AVZ C;  1E6H A;  5IH2 A;  2B8A A;  3EHQ A;  3WXM B;  3EG9 B;  2LMJ A;  2JNG A;  2KGT A;  4DEX A;  2L5Q A;  4YTL A;  4B9W A;  4CI0 C;  3JCM c;  1WYX A;  1NYG A;  4JJN K;  2DEU A;  1YIT A;  1HJD A;  1QVG P;  3G6E A;  1OUL A;  4FSS A;  1LNX A;  5LJ3 j;  3DLL A;  2X35 A;  5KYX B;  3RNJ A;  3S6W A;  4RTW A;  2A0F B;  4ZGJ B;  1M8V A;  3ZFJ A;  5GAN 2;  1X27 A;  2P0P A;  3FIF A;  3M53 A;  2JOY A;  2ED1 A;  2L3R A;  1Q82 C;  4N0A C;  4L6V 5;  2DEQ A;  2VXE A;  2E12 A;  3LGL A;  2YSQ A;  3A1P A;  5LJ3 h;  3VUZ A;  4DBH A;  1K73 R;  4F7U E;  3CCJ T;  3JAM E;  4J9G A;  3JCM g;  1I0C A;  4IIM A;  3I56 Q;  4RTY A;  2FEI A;  2IG0 A;  4LN2 A;  1LVK A;  4HT8 A;  1GL5 A;  4ZGE B;  1YWO A;  1X2K A;  2ZAE A;  1I1J A;  1R8O B;  2YXY A;  1QVF A;  3QYH B;  4HVV A;  4LDW A;  4KUI A;  4FYX B;  1GCQ A;  4CRI A;  3DLM A;  5GJV B;  1PM3 A;  1M90 C;  1I5O B;  1KIK A;  4M77 E;  2YLB A;  4HCK A;  1TUD A;  3RKX A;  4ANJ A;  3QSU A;  3UT1 A;  1X75 C;  1VQ7 Q;  3G4S T;  1YHQ A;  2R57 A;  4JZ4 A;  1ZSZ C;  4LDX A;  2PTK A;  1GBR A;  2OAU A;  5KYW B;  3PGG A;  2ENM A;  1SKU B;  4A4E A;  5GAN f;  3JCM f;  4JLI A;  1UDL A;  1RI9 A;  4C0F A;  2GTJ A;  4J8O A;  4XU1 A;  4HVW A;  4XTZ A;  1YJN Q;  1VQK Q;  3EG9 A;  2HAX A;  2K5L A;  2BIV A;  3O8V A;  1PRM C;  1YIJ T;  3OYJ A;  3UAT A;  1WJS A;  1ZUK A;  2RI2 A;  1QP2 A;  4JJC A;  3QO3 A;  3VS3 A;  3HHT B;  1C0M A;  2YDL A;  3V8K A;  1BYM A;  3M54 A;  3VS6 A;  3P8H A;  4ZTJ A;  4QVZ A;  4ELY C;  4M7D D;  1VYV A;  4AMC A;  1YWP A;  2JT4 A;  1K0X A;  2A3L A;  3UA6 A;  1W2B P;  5KYX A;  2RK2 A;  2LC4 A;  1RLQ C;  4LD6 A;  1JBM A;  4HXJ A;  1N6A A;  2DKG A;  1YJ9 Q;  2JM8 A;  2CKK A;  2JUF A;  2OTL Q;  4CC4 B;  3N5B B;  2VYT A;  3OS1 A;  2DL3 A;  4PNO A;  1I5L A;  3JB9 G;  4CC3 A;  3CCV Q;  1PSE A;  5I2S A;  1VQL A;  1AHJ B;  3OYL A;  2GFA A;  3OYY A;  2LJ3 A;  2E5K A;  2Z0W A;  3I55 Q;  4LDV A;  4XQ3 A;  2LJ0 A;  8AT1 B;  1NLO C;  5GMK e;  4E7S A;  4R0K A;  1ZA2 B;  1Y57 A;  3OYD A;  2PVG B;  2E4H A;  3X26 B;  4D8K A;  3EGU A;  3FRN A;  4FM4 B;  4KBM B;  5FU6 B;  1X69 A;  1M2V B;  1K9A A;  1ZA1 B;  2QGF B;  2RJD A;  3EFR A;  5GAN 3;  2RHY A;  3BDU A;  2P84 A;  2XG8 D;  1VYU A;  2EQJ A;  2AZV A;  3G7Z A;  5LJ3 g;  2EKO A;  4NL3 A;  4JS5 A;  2ZPH B;  4F7U G;  3LW5 E;  1QCF A;  1KD1 U;  3UPU A;  4RCB A;  5HKC A;  3CCU Q;  2E41 A;  2HKQ B;  4FT4 A;  2E64 A;  4PJO G;  4A63 B;  1O9S A;  4C8Q B;  3HSB A;  3U23 A;  2G6F X;  3OBY A;  3VKI A;  1NJI U;  1AWO A;  3HRT A;  4NOY A;  1Q86 C;  4A54 A;  4QQD A;  4FIB A;  4J9E A;  2JTF A;  3CME A;  4IUQ A;  2DBM A;  5HK0 A;  5AT1 B;  3E19 A;  3M5A A;  3VS7 A;  1OZ2 A;  1R77 A;  4BI3 A;  1VA7 A;  5KYW A;  4M77 G;  1NYF A;  2BKD N;  4J5Y A;  2DNU A;  4IUR A;  4A4H A;  1JJ2 P;  1GCQ C;  1NBE B;  1YIT T;  2CRE A;  3HL8 A;  5CCA A;  5DLO A;  5LJ5 e;  1FMK A;  3G6E T;  1IZ6 A;  5CKB A;  4QT7 A;  1VQO A;  3CC4 Q;  1AWX A;  1M1K R;  2DK3 A;  1KC8 R;  3FJ5 A;  3A8H B;  1Y0M A;  2NUP B;  4MZM A;  4E7L A;  4E47 A;  1Q7Y U;  2ZPI B;  3PFS A;  3QZ5 B;  3ZEH A;  1YFN A;  1UGQ B;  1MHN A;  1BI3 A;  2Y4X A;  1WHM A;  1BIB A;  4MML A;  2KRO A;  2EFI A;  1Y7X A;  2F5K A;  2CSQ A;  1VQ5 T;  2QK0 A;  1KHI A;  1K9M C;  5KYU B;  1Z9Q A;  3QKJ A;  1PCX A;  2BZX A;  3OMG A;  5DLQ E;  4LDY A;  3VUB A;  1OZ3 A;  4OMM A;  4DQ2 A;  2SRC A;  1WIE A;  2KYB A;  4Z02 A;  3INZ A;  2FPE A;  1O75 A;  2JW4 A;  2OTJ Q;  4LD9 K;  3LWI A;  2VC8 A;  1M2V A;  2DF6 A;  3G71 Q;  2P0K A;  3VJP A;  4TVR A;  1WHG A;  3TEE A;  4C8Q F;  1YHQ T;  3OSV A;  3CCQ Q;  1WXT A;  2RJF A;  2XDB A;  3UA7 A;  3M56 A;  3VYH B;  3RER A;  3MP8 A;  4C5H A;  2HL5 C;  4C8Q A;  2VGN A;  3M4Y A;  3M9Q A;  2DA9 A;  2KAF A;  4V2S A;  1JB0 E;  1WI7 A;  3C12 A;  4LDU A;  5FRM A;  5IHK A;  4BI4 A;  4BE2 A;  1SRL A;  2CUD A;  4JRP A;  4J6W A;  1H3Z A;  2EJG A;  3BW1 A;  5CO7 A;  5A0L A;  1MV0 B;  3QPH A;  2CP6 A;  4M75 B;  3OB9 A;  2LTO A;  3I56 A;  1NJI R;  3BDL A;  2FPF A;  1B7T A;  4AFS C;  3CMA A;  3LLR A;  2QQS A;  4HVU A;  1ZLM A;  3REA B;  2QQ9 A;  3CCR Q;  5LJ5 g;  1K8A C;  2K7A A;  2KVQ G;  4Y91 A;  4HKE A;  5CK9 A;  3PIO A;  3NHN A;  2JN0 A;  3M4G A;  5HCK A;  2NUP A;  4AFZ C;  5FW9 A;  2DL7 A;  1KFZ A;  1TUC A;  1WPY A;  5J3B A;  3CCM Q;  1RAB B;  2F2X A;  1IB8 A;  2DET A;  1HYO A;  4DEY A;  2QA4 T;  3CC7 Q;  3H0I A;  3EGD B;  3LGF A;  2RQT A;  1X2Q A;  3P8D A;  2B86 A;  2KE9 A;  5KCO A;  3H0H A;  3MPU B;  4HCZ A;  4QQG A;  4O6J A;  5KYU A;  1VQP T;  6AT1 B;  1G3S A;  4K11 A;  3OW2 S;  2D6F A;  2CT3 A;  4B6M A;  2RH2 A;  4EMG A;  2EJF A;  1MMG A;  1OI1 A;  2PZ1 A;  2EGE A;  3LYI A;  1WNL A;  2L89 A;  1WXU A;  1YJN A;  4UC4 A;  1Y07 A;  4C0D C;  4PK4 A;  5LJ5 f;  2P4T A;  2XMF A;  2VVK A;  4MDX A;  4QVC A;  1X01 A;  4RTU A;  3OW2 P;  1P92 A;  2DZ9 A;  2O88 A;  1U06 A;  2LVM A;  2AKL A;  5CKD A;  3DB4 A;  2DX1 A;  3RUX A;  5GMK m;  2LQN A;  3CME T;  2M51 A;  5GMK i;  4ELZ C;  4BE1 A;  3CD6 Q;  2GQV A;  3KUF A;  4JRQ A;  1FMW A;  1SPK A; 
#chains in the Genus database with same CATH homology
 1AWJ A;  1B07 A;  2YUN A;  4LN2 A;  4J9H A;  1GL5 A;  4CC7 A;  3VS1 A;  3LH5 A;  1YWO A;  1X2K A;  2FRW A;  4F16 A;  1I1J A;  3EHR A;  4RTX A;  2O31 A;  1M8M A;  5IHI A;  4HVV A;  1HD3 A;  2YUO A;  1GCQ A;  2KRS A;  5GJV B;  1OEB A;  4GLM A;  1KIK A;  2VKN A;  2LQW A;  1SHF A;  1T3S A;  3M0S A;  4OML A;  3QWX X;  1M30 A;  1RLP C;  2AZS A;  4ORZ A;  4HCK A;  2ESW A;  1TUD A;  2KEA A;  2DYB A;  1SRM A;  3NMZ C;  1WX6 A;  1ABQ A;  2W0Z A;  3CQT A;  2K2M A;  1JEG A;  4JZ4 A;  1WLP B;  2PTK A;  1H8K A;  1UEC A;  2L0A A;  1GBR A;  3PVL A;  2KNB B;  2ENM A;  3EG0 A;  1BBZ A;  1PHT A;  1GBQ A;  1SSH A;  1AZE A;  1WA7 A;  1UDL A;  3M0P A;  1RI9 A;  2LCS A;  1AD5 A;  2LJ1 A;  4OMO A;  2EBP A;  1UUE A;  2GTJ A;  3H0F A;  2HCK A;  4F14 A;  4HVW A;  2DBK A;  2DLP A;  3M0U A;  2D8J A;  1CKB A;  2X3W D;  1X6G A;  1Z9Z A;  1PRM C;  1VYT A;  1PNJ A;  3REB B;  3UAT A;  2O2O A;  2DVJ A;  1ZUK A;  2FO0 A;  4JJC A;  1KJW A;  2OAW A;  2DRM A;  3VS3 A;  5I22 A;  2AKK A;  1W6X A;  3C0C A;  4AFU C;  2YDL A;  1X6B A;  5EC7 A;  2KXD A;  2LP5 A;  2GNC A;  1OPL A;  3QWY A;  3VS6 A;  1ZSG A;  3KFV A;  4KRT A;  2O9S A;  3RBB B;  2DJQ A;  2EYY A;  4X1V A;  3VS0 A;  5GJW B;  2V1Q A;  1VYV A;  5ECA A;  3R6N A;  1ARK A;  1YWP A;  2JT4 A;  1K0X A;  1E6G A;  1T3L A;  2DE0 X;  4F17 A;  3UA6 A;  2YUQ A;  1GFC A;  1BB9 A;  1RLQ C;  5FWB A;  1ABO A;  2P4R A;  4HXJ A;  1UG1 A;  3TSZ A;  3JV3 A;  1ZUU A;  1JXO A;  2JM8 A;  2V1R A;  1H92 A;  4CC4 B;  1NEG A;  1M3B A;  1GRI A;  2DL5 A;  2F2V A;  1ZX6 A;  2DL3 A;  2GTO A;  2FG0 A;  1AOJ A;  4CC3 A;  2J7I A;  3M0R A;  4OMQ A;  2EYW A;  2HEQ A;  4J9B A;  4J9I A;  1OV3 A;  1QWE A;  2LJ3 A;  1AEY A;  2E5K A;  1UTI A;  1W1F A;  5L23 A;  2HBW A;  2LJ0 A;  1QLY A;  1NLO C;  2KXC A;  4R0K A;  4J9D A;  2L2P A;  1Y57 A;  4D8D A;  1XOV A;  1AZG B;  4D8K A;  2DL4 A;  3EGU A;  3TVT A;  1X69 A;  1K9A A;  2EGC A;  2L3Q A;  2RF0 A;  1OPK A;  1VYU A;  1UHC A;  2AZV A;  4OMN A;  1PKS A;  2LNH B;  4Z8A A;  4JPB W;  1MUZ A;  3VRY A;  1TG0 A;  1QCF A;  2A36 A;  2KBT A;  2KT8 A;  2CUB A;  2D8H A;  3VRZ A;  2K6D A;  3VS2 A;  4A63 B;  2L3S A;  1MV3 A;  4OMP A;  4J9F A;  2DM1 A;  2KR3 A;  3U23 A;  2G6F X;  1AWO A;  3ULR B;  2JM9 A;  1NEB A;  1ZUY A;  1YP5 A;  4IIO A;  4J9E A;  1JO8 A;  1WFW A;  2DBM A;  4JJB A;  1KSW A;  4Y92 A;  1I07 A;  2C0I A;  3VS7 A;  1VA7 A;  4J9C A;  3ZL7 C;  1QWF A;  1K76 A;  2MOX A;  4M4Z A;  2OJ2 A;  1IO6 A;  1NYF A;  2KRM A;  2DNU A;  2J6O A;  1GCQ C;  1W70 A;  1NM7 A;  2CDT A;  2CRE A;  2BZY A;  4Z88 A;  1FMK A;  1S1N A;  1UE9 A;  1U3O A;  3O5Z A;  1LCK A;  4QT7 A;  2W10 A;  1AWX A;  2H8H A;  3FJ5 A;  4JJD A;  3TSW A;  3EG3 A;  1Y0M A;  2EYZ A;  5I11 A;  1E7O A;  3EG2 A;  3M0T A;  3I5R A;  3PE0 A;  2AK5 A;  2J6K A;  1J3T A;  1ZBJ A;  1PRL C;  1UJ0 A;  2J05 A;  2CH4 A;  1NG2 A;  2X3X D;  2LX7 A;  2A08 A;  2D0N A;  2KRO A;  2ROT A;  2JMC A;  2CSQ A;  4AG1 C;  2OI3 A;  4WCI A;  1WXB A;  1X43 A;  3I9Q A;  4LNP A;  2RQR A;  1QKW A;  5IHN A;  4CC2 A;  1Z9Q A;  2GQI A;  2M0Y A;  2BZX A;  2EYX A;  1NLP C;  1T0J A;  1HSQ A;  1GFD A;  2GBQ A;  2RQU A;  4LE9 A;  2RPN A;  4OMM A;  4ZNX A;  2SRC A;  3UF4 A;  1WIE A;  2EVR A;  2KYB A;  2DIL A;  2J06 A;  2YT6 A;  2FPE A;  3M0Q A;  2EPD A;  1UJY A;  2J6F A;  3SEM A;  2JW4 A;  2CSI A;  2LZ6 B;  2JS2 A;  2DF6 A;  2QDL A;  1G2B A;  2A28 A;  3PVQ A;  2BTT A;  2BZ8 A;  2IIM A;  1K0S A;  1WDX A;  2F2W A;  1CSK A;  3IQL A;  1WXT A;  2I0N A;  2CT4 A;  2GGR A;  4RTV A;  2DRK A;  3UA7 A;  1YCS B;  2HSP A;  1JU5 C;  4LUE A;  1B3Q A;  1UFF A;  2EKH A;  1BK2 A;  2C0T A;  1EFN A;  3VS5 A;  3VS4 A;  4ESR A;  2DA9 A;  2L3P A;  3I5S A;  4RUG A;  1WI7 A;  2JTE A;  2RQV A;  5FWC A;  2KT1 A;  5IHK A;  1M3C A;  2A37 A;  3EG1 A;  2FRY A;  1SRL A;  2CUD A;  3NPF A;  1GCP A;  2NWM A;  4E6R A;  1MV0 B;  1SEM A;  1PWT A;  1K1Z A;  1YN8 A;  1G83 A;  2VWF A;  1JQQ A;  2FPF A;  1A0N B;  5IXB A;  5IXF A;  4AFS C;  2MIO A;  4HVU A;  1ZLM A;  4GBQ A;  4LUD A;  3REA B;  2ROL A;  2K7A A;  2EGA A;  2CH4 W;  3NGP A;  1FYN A;  2PNI A;  2DL8 A;  2SEM A;  1H3H A;  2ABL A;  2ECZ A;  2K79 A;  1RUW A;  3NHN A;  1AWW A;  5HCK A;  1BU1 A;  2JS0 A;  1UHF A;  1JXM A;  4AFZ C;  2D1X A;  3A98 A;  5FW9 A;  2DL7 A;  1KFZ A;  1TUC A;  2EW3 A;  2MCN A;  3H41 A;  2RN8 A;  1QKX A;  2FPD A;  2F2X A;  2O9V A;  1OOT A;  4RTT A;  2HDA A;  1AVZ C;  4EIK A;  1E6H A;  2YUP A;  4DEY A;  5IH2 A;  3EHQ A;  2DMO A;  1M27 C;  2RQW A;  2LMJ A;  1UGV A;  3H0I A;  2KGT A;  4DEX A;  2RQT A;  1X2Q A;  1YNZ A;  2B86 A;  4JZ3 A;  2KE9 A;  1K4U S;  3H0H A;  1WYX A;  3GBQ A;  1NYG A;  2JXB A;  2EQI A;  4K11 A;  2ED0 A;  2JMA A;  2CT3 A;  1HJD A;  3SHW A;  2KRN A;  4AG2 C;  4FSS A;  2PZ1 A;  1V1C A;  2EGE A;  1SHG A;  2RNA A;  1WXU A;  4RTZ A;  2KYM A;  3RNJ A;  4RTW A;  1PKT A;  2NUZ A;  3I35 A;  1M3A A;  1X27 A;  2XMF A;  2VVK A;  2ED1 A;  4RTU A;  2RMO A;  1N5Z A;  1T0H A;  2O88 A;  1U06 A;  2K3B A;  4AFQ C;  2YSQ A;  2AKL A;  1CKA A;  2K9G A;  4Z89 A;  2DX1 A;  1U5S A;  3THK A;  2LQN A;  2M51 A;  2C0O A;  4J9G A;  1I0C A;  4IIM A;  4RTY A;  2FEI A;  1SPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...