2HQHA

Crystal structure of p150glued and clip-170
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title CLIP170 autoinhibition mimics intermolecular interactions with p150Glued or EB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein, protein binding
total genus 14
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hqhA00
1WHGA 2E3HA 2HL5C 2CP5A 1WHMA 1TOVA 2CP3A 2E4HA 2E3IA 2CP6A 1TXQA 2HQHA 2HKQB 3E2UA 2HL3A 1WHJA 2HKNA 2COZA 2COWA 3TQ7P 2COYA 2MPXC 2QK0A 1WHLA 2CP0A 1WHHA 1IXDA 4B6MA 2Z0WA 1LPLA 2CP2A 3RDVA 2M02A 1WHKA 2CP7A
chains in the Genus database with same CATH superfamily
2RQRA 3KXTA 3OW2A 2OTJA 4JJCA 2RK1A 2FL7A 2YLBA 3CQTA 2DEUA 2DETA 4LD6A 1M90R 4OB3B 4JJDA 2QA4T 4OMOA 4MDWA 1VQ9A 1WZOA 1LNXA 1E6GA 2X9HA 2H3EB 5C6SA 5GAN7 5AYFA 5A2QE 1K73R 5KH6A 1M1GA 2GCXA 4RTWA 4C8QG 2P0PA 2PZ1A 3REBB 2D8JA 4B9XA 4CI0C 3ULRB 2FZCB 1JU5C 4OMPA 2D6FA 2HBWA 1WPYA 2KE9A 3E9FA 1LJOA 4C92E 1MGQA 3CBOA 1VQMT 4KUIA 2QEXQ 3CCVT 1ABOA 2EGEA 3MCAB 2GF7A 2Y90A 4OMMA 5CQYA 1M1KU 2DK3A 4RG2A 5KYWB 3HFOA 4Z89A 1LOJA 4J9IA 2JJ9A 2AIRB 2H8HA 1N9RA 2DD5A 2KDSA 1YI2A 1VQ6Q 4A4HA 3CMAQ 2QDLA 2A3LA 3VV0A 2P4TA 3AT1B 3MJXA 4BY6C 1YHQT 3JRZA 2Y4YA 4PFOA 2R5MA 1GFDA 5LL6S 2O9SA 2B86A 1D0ZA 4PNOA 2COZA 2M0YA 3NHNA 2DTIA 1OZ2A 1YBYA 2A28A 4C8QB 2GQIA 2JZ2A 3RIRA 2RHUA 4FSXA 3C0CA 1RUWA 5FU6B 5LJ3j 4KGXB 5LJ5f 4KUDK 1OZ3A 1WHGA 1UECA 4FYYB 1AOJA 3A8GB 4RUGA 2AHJB 1X75C 2FPDA 4AMCA 2EJ9A 4AT1B 5CKFA 1QVGP 1SHGA 1VA7A 4OMQA 3BW1A 1N9SA 2D1XA 3CCQT 3OS0A 4GBQA 1M8MA 2YRVA 3G6EA 1Y71A 2EJGA 3PNWC 5LJ5h 1RAEB 4PFPA 2HSEB 2ZGWA 2KI7A 3I55A 3GP8A 3PT9A 3FJPA 2CDTA 1NM7A 3OYEA 2FZGB 4DQ2A 2JW4A 1PCXA 2X35A 3EGUA 2LQWA 3RKYA 4AG1C 2HKNA 3L2WA 4J9DA 1FWZA 2E10A 4ZN3A 4Z88A 3CCMQ 1WDXA 2JM9A 2QQBA 1FMWA 3C12A 1CKBA 3C95A 4KGZB 3CCJQ 2QA4A 1WHKA 3NPFA 4MMKA 1HXDA 1M1FA 2K2MA 3VUBA 4F17A 2CP6A 3EGXA 3VYHB 3VS5A 2O4XA 2GBQA 2YUOA 3QSUA 2DXCA 3M0RA 2QI2A 3CCLQ 3SD4A 1I5OB 1TU0B 4ZGJB 3CCST 1Q82R 2OX7A 4BACA 4FCYA 4J6WA 4PJLA 1V76A 4M77F 2HZYA 3CCEA 4RG8A 1M30A 1ZUYA 1I81A 5GJWB 3SDZA 3JCMc 5KCHA 1MV3A 1VQMA 4JJBA 3SEMA 1ZSZB 3CCVA 5I2MA 1M9SA 2YSQA 2YRDA 1TTHB 2EQKA 2RF0A 3PVQA 5A0DA 1GCQC 1WXBA 3HTRA 5EG2A 1O75A 4BE0A 2M02A 1YFNA 2D0QB 2DILA 1WLPB 3M54A 4DA4A 4LDXA 2CUBA 4PL6A 2KYMA 2DO3A 4LN2A 1W2BA 1XTDA 2K3YA 2MK5A 1ZUKA 2JTFA 2VC8A 4ZGDB 5GANg 1YHQA 2DL3A 2FRWA 2DAQA 2E65A 3V7SA 3CC7A 1K4US 2YRCA 3HP9A 3MPUB 1Q81C 1GBRA 2W10A 2F2XA 2IPOB 2L3QA 1R0CB 5FLXE 1I4K1 2F2VA 4XAXB 1KQSP 4JPBW 2CP5A 5AT1B 4OMNA 1IGQA 1VQKT 5D7UA 2RJFA 3CCQA 3OS5A 4PJOA 1U3OA 4XQ3A 2QGGA 2EQMA 1K8AC 4N4IA 2K5LA 4Q5WA 3FEOA 3JB9H 3NTIA 1K9MR 4N4GA 4TVRA 1VQ7T 2HL5C 1UE9A 2KRMA 5GAN5 4E7JA 3OMCA 3P8DA 4F7UA 2DX1A 3DLMA 2DL7A 1D1BA 1M2VA 4BI8B 3H0HA 4M7AG 1NYGA 3PIPA 2VWFA 3IQLA 1YIJA 4C8QF 3TSZA 2JM8A 4OMLA 2NUZA 2DZ9A 4A4FA 2K5FA 1JQQA 2YHTA 4HCKA 3CC2Q 2XI9A 3CCSA 2CP0A 1WYXA 1TUCA 2BZXA 4ZTJA 3NTKA 3FRNA 2C0TA 2EQIA 1N8RC 2B8AA 3PFSA 1VQNT 1NPPA 3EGXB 5LJ3f 2O4XB 2ZPEB 4RCBA 3GIBA 2JS0A 4O5VA 4QQGA 4OGCA 1P92A 2X3WD 1VQLT 2ECZA 1M90U 2RB6A 4BY6B 3LW5E 1NEGA 1UDLA 1SRMA 5LJ3h 3ZBDA 2QQSA 2BE9B 3G71Q 3RMQA 2HDAA 4E6RA 3CD6T 1TOVA 5HCKA 2EIFA 3CCRT 2QQAA 1KC8U 2ZPHB 1YJNQ 1EIFA 2LQ8A 8ATCB 2MMPA 1JRIA 4PJOG 1B7TA 1QWEA 2K79A 1PWTA 5KYYA 2VV5A 2SEMA 4IIOA 2RO0A 3CC4T 3D7SB 3U23A 3L2VA 2AZVA 4EDUA 3MEVA 4RTYA 2EAYA 1NJIC 3OYMA 1NE8A 1VQKA 2KQWA 1UJ0A 1BI2A 1YJ9Q 4F7UG 1VQOQ 1OQKA 2CGHA 4OVAA 4IUPA 3QHSA 1Q81R 4UC4A 3M0QA 3OYKA 5GAN4 3URGA 3L2QA 1UUEA 3KFVA 3JCMP 3H0IA 3H8ZA 5C0MA 5FU6C 1VQ7A 4C8QD 3LLRA 1ACMB 3OYAA 1UGVA 1Z9QA 5KE2A 4PJOB 1K8AR 1FX7A 2D0NA 1VOMA 4Z02A 1U5SA 4DBQA 1C1AA 1IB8A 4PLIA 4V2SA 3QIIA 4OP0A 2RI2A 4ZN1A 2AKKA 2ZCFB 3UA7A 2OI3A 2HNIA 1N6AA 1GL5A 1TSFA 1XJWB 2RJDA 4M78G 5GMKi 2LJ0A 1RADB 1K73C 2LP5A 4F7UB 1TWBA 2EKHA 2DNUA 1AD5A 4XK8E 1ABQA 2D8HA 4AFUC 2VUBA 2GTOA 1JXOA 2PVGB 1KHCA 1M2VB 2DL5A 1SG5A 1NZ9A 4E7KA 4K11A 2VYTA 5J3BA 4BUGA 2L3RA 3N5BB 1VQNA 1PRMC 3RUXA 4PK4A 2HL3A 2XD0A 1U06A 1VQ8Q 4FSSA 5KYWA 2O9VA 2R58A 1YITT 3F70A 5GAOp 5LJ3d 4JRKA 5CKEA 1UTIA 4LDWA 4M77E 2DBKA 3V7CA 1TUGB 4XTWA 1QP2A 1IZ6A 4QKUA 2DBMA 3L1AA 4CC7A 3OYFA 1N8RR 4M75G 2E12A 2KXCA 5IHKA 3CD6A 2DIGA 1X69A 3GF5A 1T0JA 2AKLA 1WHJA 1MMAA 1UB4A 4M78B 1BI3A 1ZSZC 2LT1A 1ZUUA 4FIBA 2A37A 2V8KA 2JT4A 3A1PA 3C94A 3V8JA 1QMCA 2YXYA 3CBPA 2DF6A 4NL3A 2A7YA 3CC4A 3VS0A 1MMGA 3M0SA 1WXTA 4GLMA 3QG1A 4PJMA 4PKCC 2E6NA 4RMOA 3RNJA 2FPFA 3PMTA 2DVJA 4J9EA 4CC3A 2CT3A 2KRNA 5FU7B 4LDUA 1Q95G 1E6HA 2DMOA 5KYYB 3CMET 2KNBB 1M2OA 4QVCA 2W0ZA 4VUBA 4B9WA 2ROLA 2YUQA 1ZBJA 2XICA 1QVGA 1GRIA 4M75B 1NJIR 4LXCA 5FROA 1QQJA 4C92A 5GAOq 3G6ET 2NYSA 2F5TX 3A8LB 2PU9B 3MHXA 1VQLQ 1OX8A 2DYIA 1JJ2P 2MYSA 1YJWA 2FZKB 3M4GA 3UPUA 5I11A 1E7OA 1HK9A 1MNDA 2Z0WA 1LPLA 1RAIB 1ZBXA 2GTJA 1I0CA 2DIQA 1M27C 1HD3A 4CRIA 3OS2A 3CCRQ 4C0FA 4FYVB 1KQ1A 3FLGA 1WI7A 4JLIA 2E6ZA 2XDBA 2E3IA 4JRQA 5KYUA 2GNCA 2V8JA 2K57A 2D9TA 2HQXA 2JUFA 4X34A 3CCUQ 2DFUA 2Y4XA 2K3XA 2X3XD 4RTZA 3HFNA 2QGFB 3TEEA 1BI1A 5GAMj 1Q82C 1UGQB 1UHCA 1NG2A 2X4JA 3THKA 2EQJA 1VQPQ 1UJYA 4PJJA 4R55A 4AFQC 2QDYB 5EC7A 2DTHA 4C8QE 1QVGS 3G7ZA 1ZSZA 1X6GA 2CT4A 2ENMA 1QKWA 2EYQA 5J39A 3VS3A 2J6FA 1U1SA 3M57A 1VQ5Q 8AT1B 2PVOB 1YITA 4BD3A 3A8MB 5I2SA 4WF2A 3CCET 1G8XA 2RQUA 1RL2A 4C0ZA 1S72Q 1KQ2A 4OGEA 1K0XA 1OOTA 2MF2A 5HK3A 3HKSA 1TXQA 2FHDA 2P84A 3JCMf 1M4ZA 1G2BA 3OBYA 1Q86U 1IGUA 4L6V5 5CK9A 2V1QA 2A36A 5LJ3e 1AVZC 2RM4A 1M3CA 1QP3A 2IIMA 2OTJQ 3I35A 5DLOA 3RR6A 2FO0A 1WHMA 3JCMh 3OA6A 4J9FA 4M7AC 1AZEA 2VGMA 2ESWA 2GFUA 1SHFA 2DEQA 3JCMV 3UWNA 3M0UA 2HKQB 4FU6A 1FMVA 1BCMA 4C92G 5LJ5g 3ZEHA 2V1RA 3TQ7P 5M9OA 3CC7T 3S6WA 1WA7A 4M7AD 2GQVA 1VQ9Q 3OYCA 4D8DA 2MOXA 1I07A 1X6OA 3CMEA 2CYZB 3RERA 4KT0E 1Y7XA 1KQSA 1XNIA 2OAUA 1KK7A 4HKEA 1K9MC 3S3OA 5GAOm 4E2FB 4MZTA 1G5VA 4LNPA 4KGVB 2A08A 2OTLQ 1RAHB 1SEMA 1O9SA 2HSPA 4XTVA 2P0KA 3DB4A 4KH1B 1M3AA 1G3SA 1W6XA 4JLGA 1OYXA 3NTHA 4Z8AA 2AT1B 1HSQA 3MEUA 2CS7A 3M0TA 4FT4A 5GMKe 3I56A 4C92B 1X01A 4QVZA 1SPKA 1YI2Q 2DXTA 4OB1B 1D3BA 4BI4A 4HXJA 2JXBA 5FWBA 1KJWA 4PJOC 1I5LA 2DE0X 3MP6A 3NMZC 2CZ7B 1KQSS 1YIJT 3OW2P 4PJOD 1M1KC 2FEIA 1J3TA 5KYUB 4J9GA 4ANJA 1VQ4T 5IAYA 2R57A 4BE2A 2EQUA 4RTVA 2NUPA 1K8AU 2L3SA 3RDVA 2XMFA 2FYKA 2G6FX 2VB6A 2XIDA 1BYMA 4M7AA 1NYFA 1HJDA 1R0BG 3G6EQ 4LUDA 3JCMW 4HVWA 4MMLA 1VYUA 4ZGEB 3I55Q 3EG3A 3TU4K 1WQWA 4MDXA 1IXDA 2AK5A 2QAZA 2YLCA 4EMHA 3I5SA 2MIOA 2JOYA 2FG0A 4J6XA 3LWHA 5I21A 3HPWA 3GBQA 2ZPFB 2QA4Q 4M78C 2P0QA 2ED0A 4P5NA 2EKOA 3REAB 2CP7A 5GAMf 1YNZA 3OBWA 5KCOA 1XQHA 1PKTA 4M78D 4QT7A 1TUDA 2LCLA 2G3RA 2JMCA 2LQNA 4KRTA 1QKXA 4DEYA 2JN0A 5LJ5d 1N8RU 4M7DC 1TG0A 1I8FA 1UGPB 4LE9A 5GAN8 2J05A 1WNLA 1Q7YU 5GAMh 4ZNXA 5L23A 1JEGA 4N4HA 5FU7C 2EYZA 3G4ST 4C0GA 1AWJA 4Y28E 1VQMQ 1AZGB 3S3NA 5HKCA 1KSWA 3CCVQ 1BI0A 3E19A 3CPFA 1Y96A 1FMKA 1M8VA 1NLPC 5FRNA 2EYXA 2NWMA 4M75C 1D0XA 4F14A 3NGPA 1QW1A 2BUDA 2E41A 2FRYA 5J26A 4QVDA 4M75D 2PTKA 3HL8A 5GAOr 1LCKA 3H9NA 1YHQQ 3VS6A 2P4RA 4BB7A 1VQ4A 1U8RA 4JZ3A 1VIFA 3CC7Q 1NJIU 2E70A 2X4WA 2L3PA 3HSBA 1D3BB 3SWNA 5HY6A 4R56A 2WSCE 5LJ3g 2MAMA 2KT8A 2K6DA 3VKIA 3EG9A 2DA9A 4LDVA 3J81E 1M1KR 2PNIA 1ZHIA 3CCQQ 3H6ZA 3QWXX 2MCNA 1WIEA 1K76A 2HBPA 3BFMA 3VYGA 1OEBA 4M78A 3WVDB 1AT1B 3LGFA 2NUPB 4QQDA 4B6MA 3QDFA 2QTXA 2M0OA 4J9BA 2C0OA 4M7AB 1VIEA 5IHNA 4M7DA 1NBEB 2ZPIB 3OYNA 4PJOE 4J6YA 1VYTA 3OYBA 2LJ1A 4E7HA 3JSCA 4OF1A 3BE3A 1N5ZA 1RI0A 3I9QA 3M55A 1PD1A 1UEBA 3FJ5A 1MUZA 1OPLA 1Y0MA 1K73U 1M5Q1 1EFNA 4Y91A 4E7SA 1YIJQ 3PGGA 3QYGB 2E5KA 4RKUE 3FDRA 4X1VA 3SB2A 2M1HA 3E9GA 5L8RE 2M9UA 1V1CA 4M75A 4NL2A 3EFOA 3VS7A 1W2BP 2RH2A 3FIFA 4HCCA 4II1A 3LH0A 3CCSQ 4CC4B 3FB9A 3JB9I 5DM7R 2GFAA 1RLPC 1I1JA 1D1AA 1BCOA 1OX9A 3RKWA 3DB3A 4JRPA 4RCCA 2MWOA 1X43A 2ABLA 3NFCA 1PHTA 1PM3A 3H41A 3G4SA 5CCAA 3R6OA 1SF9A 2QXFA 3CXCP 2LRQA 1BKBA 4AG2C 3GLXA 2KMTA 1QLYA 1WJQA 2FPEA 5HK0A 2LX7A 4EMGA 4RTXA 4XTYA 5LJ5e 2NLUA 1IHVA 1JJ2A 1C6VX 5CKDA 1YJWT 1BBZA 1UGSB 2DPPB 1K9AA 1PSFA 2KBTA 2ZPGB 3EH1A 2KXDA 5GAOl 2M16A 1M3BA 4A54A 2ZPBB 3M56A 1WXUA 1Y96B 2DKGA 2QEXT 4DOVA 2JS2A 3M4YA 1G83A 1D0YA 2DM1A 4L59A 4QW2A 1W1FA 1WHLA 4C92C 5DLQE 3JCMb 1T3SA 3CMAT 1QVPA 4C92D 1X6BA 1KC8C 4M7DG 1VQKQ 2DZCA 2CP3A 2F1LA 1T0HA 3E2UA 7AT1B 4C5EA 2LNHB 5KYNA 1JJ2S 4LUEA 3SWNB 4HCBA 4ORZA 4YTLA 2WACA 1FYNA 1YWPA 4FT2A 3UF4A 2CZ0B 2XU8A 2KR3A 2EYYA 3EG9B 1VQ7Q 1ZA2B 1JBMA 3VS4A 1VYVA 5FRMA 2YUPA 2DJZA 3M53A 4JS4A 4A4KA 3JCMJ 4BDZA 2DL4A 2L8DA 2COYA 3QUIA 4PLLA 2MPXC 4F16A 3OYLA 1ZQ1A 1GFCA 1MV0B 2ZZDA 4L5GA 4JDSA 1Q82U 1D1CA 4M7DB 1IREB 2XHCA 5CKHA 1WX6A 3META 2CREA 1ZSGA 3LX7A 3EG0A 2QK0A 2PUOB 4KH0B 2XDPA 4IKFA 3DLLA 3CCMT 3L2UA 3EGDB 3CCJT 1VQNQ 2KT1A 3R6NA 1SKUB 4DEXA 2OAWA 3EFOB 2O2OA 3OYIA 2X4YA 3X20B 1NEBA 2L5QA 2O01E 2DRMA 1N27A 3SFMA 4A4GA 1Z9ZA 3HHTB 4M7AF 2BE7D 2VKNA 1VQ5A 3FC3A 3OYDA 3JB9G 4IUUA 4M4ZA 4NOYA 3CD6Q 3UA6A 1PKSA 2LQKA 4KBMB 1RABB 3CPWP 3I56T 3J7AF 1VUBA 3ASKA 2QEXA 1BIBA 3HRSA 4C5GA 5IT9E 2J6KA 3CC4Q 2LX9A 3JV3A 5IXBA 4C5HA 3QDRB 1VQ6A 1KIKA 3L2ZA 3CMAA 1PC0A 1KD1C 2RHYA 2VASA 2KVQG 2F5KA 4LD9K 4XU0A 1YP5A 3OMGA 3RESA 1K9MU 1Y57A 3A98A 5GANj 1WJRA 4KULA 3LH5A 2EYWA 4FYXB 2K4YA 4F04B 3WXMB 4N0AA 3O8VA 4NS5A 2KYBA 3VJPA 3OS1A 3JCMg 1KC8R 5CQXA 1U1TA 2EGCA 1TS9A 1ZA1B 3H0FA 5FW9A 2KRSA 4PJOF 1B34A 2X51A 4QQ6A 3TSWA 2QQ9A 2OTLA 1K0SA 1YJWQ 1W4SA 2PQWA 1QVFP 3X24B 2YWWA 4DBRA 4E7ZA 2CH4W 4IUVA 5FWCA 1YCYA 3OW2S 4GLKA 4F7UF 2DJQA 4EMKA 4FW2A 3OYGA 1D09B 1XOVA 2E64A 2WSEE 2QTVA 5CO7A 1W70A 3PTAA 3QZ9B 3EAEA 2RMOA 3MP1A 3LWIA 3CCMA 3PIOA 5CVIA 3BY7A 3CCJA 3BDUA 3EHQA 2EVRA 2E1HA 2YDLA 3QBYA 3UT1A 2C06A 2KAFA 3SHWA 1UFFA 1YITQ 3JB9J 3CCLA 2DD4A 3QJYA 1Y07A 2LC4A 3CC2T 4FYWB 2V8IA 1BU1A 2LNVA 4O6JA 3M59A 3QPHA 4M78F 2BIVA 2R5AA 3QYHB 4IURA 5IXFA 2K3BA 1RACB 2CH4A 1H3HA 1FXXA 3TCJA 1BIAA 5IHIA 2I0NA 1HYOA 4M7DF 4OMFB 4DOWA 3P8HA 3PMIA 5GMKl 4CC2A 1MMNA 3OB9A 1Q81U 2LDMA 1PG5B 3G71T 2GGRA 1R8OB 3AHUA 2DLPA 2O88A 2MI6A 1Q86C 1OV3A 1AWXA 4RTTA 2LVMA 2KK4A 1YJNT 3QKJA 1RLQC 1GXIE 3CMEQ 4EPCA 3I5RA 1WJSA 4M75F 2JTMA 1WQ7A 2XKOC 3G1JA 1KD1R 2I2LA 2CSIA 3GNGA 2EBPA 4E7LA 2VGNA 1OPKA 5GMKj 1JO8A 3EH2A 4OB0B 5I22A 2KGTA 2HD0A 4HVVA 1OU9A 4HVUA 1K1ZA 1YJ9T 1VQOT 2V26A 4WTOB 2HMAA 3MP8A 2DXUA 3LYIA 4HCZA 3VS2A 3JCMd 1R77A 3SWNC 1NPRA 4BDYA 2DL8A 3OQ5A 2BZYA 2JNGA 3I56Q 1B34B 2LZ6B 1X27A 2WSFE 4D6WA 3E1SA 2HQHA 2MWPA 4IIMA 5GAMg 1RI9A 4LDYA 2RA2A 2DYBA 3T9NA 5KE3A 2K5IA 3M0PA 1WFWA 3INZA 2DXBA 2OJ2A 4X9DA 5KYXA 4EMKB 1GBQA 4MZPA 2SRCA 3A8OB 4OB2B 2JVVA 4JRIA 2LMJA 1WGSA 2RQVA 3JB9F 3M5AA 3VUZA 4J7FA 2LJ3A 4Y92A 2KROA 1H641 3EFRA 2EW3A 3CCEQ 2ATCB 1H3ZA 4M7DD 3CC2A 5GANf 3CXCA 9ATCB 1RAAB 4E47A 3MEAA 4ATOA 2X4XA 1G3YA 5IH2A 2IG0A 5D6WA 5GANh 1VQ8T 4M7AE 2RHXA 4D8KA 3GPLA 1IO6A 2J7IA 4XU2A 4C0DC 4BI3A 5ECAA 1A0NB 3OSSC 4XTZA 1SRLA 4IUTA 3X25B 2ZAEA 3G71A 2RQWA 1EZZB 6AT1B 1W2BS 4ESRA 2AZSA 4M77C 3MO8A 2NUTA 3ZFJA 4AFZC 1YJNA 1C0MA 2XG8D 3JCMX 2K7AA 2EFIA 2L89A 4M77D 4J8OA 2F69A 3CXCS 2LT4A 5CR2A 1YCSB 1Q86R 1X2QA 3EFSA 2EJFA 2RK2A 3QJ6A 3OSVA 1S1NA 1GCQA 2BZ8A 1JXMA 3L2RA 2VVKA 3JCMQ 3KBGA 4ZTFA 1YJ9A 1VQOA 1LVKA 3PE0A 1IRXA 3QXEB 2EGAA 2J6OA 4C92F 3OY9A 2RQTA 2A0FB 3Q1JA 1AEYA 1H8KA 2RPNA 1X2KA 1Q7YC 3UDCA 3EHRA 3JAME 3JB9D 5CAIA 5CIUA 2M51A 3ZL7C 2DRKA 2QASA 1G3TA 3M58A 4R0KA 4ME7A 3EGDA 3PVLA 4JJNK 1KHIA 2DTOA 2CZ1B 3JCMe 2XDDA 4A63B 2HAXA 1PRLC 3CBMA 1VQ4Q 4J9HA 2O31A 2E4HA 2J06A 1AWWA 3OYYA 3DKMA 4F7UE 3V7RA 3M9QA 2DVEA 3GOXA 2L2PA 5GAMd 3RMSA 1JB0E 2YT6A 5IN1A 1UGRB 4HT8A 3CCUT 3P8BB 2CSQA 2JTEA 1QCOA 5GMKm 2RJEA 1ARKA 5GAOn 1BB9A 4FL6A 2IVWA 1VQPT 1OI1A 4A4EA 2HCKA 4M77A 4DBFA 5GANd 5KYXB 3QO3A 2ROTA 4HA8A 2COWA 3ME9A 1VQ8A 3WVEB 2KSSA 1VQ5T 1QCNA 4C8QC 2RI3A 1UG1A 1MHNA 2QG9B 2ED1A 2K2VA 1G3WA 3J80E 1B3QA 2EPDA 1AHJB 3CPWA 1S72T 1H92A 3VRZA 4M78E 1B07A 2BKDN 5D6YA 4ELYC 3RKXA 5GJVB 1QWFA 2BTTA 3A5ZB 5GMKh 1M90C 2E5QA 2RHIA 4M7DE 2LCCA 3A8HB 1VQ6T 3ER0A 1MNEA 2VXEA 1T3LA 4E7IA 2PUKB 2OTJT 4AFSC 3MEWA 1AWOA 3HRTA 4GY5A 2CUDA 1KFZA 1CSKA 4EIKA 2F2WA 5DY9A 2NUTB 5LJ5j 3L42A 2RHZA 3G4SQ 3LGLA 4A53A 2JMAA 4M75E 2CP2A 1VQ9T 3GNFB 3X26B 2RNAA 2H3JA 2RD1A 4XTXA 2KY9A 4FW1A 3TREA 3CPWS 4DBHA 4JZ4A 3V8LA 5D6XA 2QQRA 2RJCA 2CKKA 4WCIA 1IHWA 2OTLT 1CKAA 2K9GA 3O5ZA 4PFZA 1QVFA 5CKBA 3EG2A 1KG1A 2LCSA 1VQLA 3TVTA 4J9CA 2E3HA 4N0AC 5GAN3 3QZ5B 1ZLMA 3CCRA 2QYZA 4M77G 1KD1U 2VXFA 2EWNA 3CEYA 2DERA 5GAN6 2YUNA 3KUFA 1Q7YR 1NLOC 2CZ6B 4C5IA 4C8QA 1PSEA 4J5YA 3MKDA 4PJNA 1TH7A 1YI2T 3CCUA 3C4SA 1SSHA 4X9CA 3VRYA 4XU3A 1GCPA 4ELZC 3BDLA 1RAGB 1BK2A 1VQPA 1DJ7B 3RBBB 1OULA 5A0LA 1PD0A 3HRUA 1YWOA 2HQEA 4J83A 3V8KA 3VS1A 4EMKC 5GAMe 4JS5A 3CCLT 1QVFS 1PNJA 4C0DB 2PVDB 2RN8A 4RTUA 2FVUA 4MZMA 2HEQA 1QCFA 4JUVA 5GAN2 1OU8A 1SSFA 1YN8A 1MMDA 2RI5A 5A0GA 4XU1A 3EG1A 2LTOA 1S72A 2C0IA 4M77B 1EX4A 2L0AA 3X28B 1V29B 3QWYA 4BE1A 1UHFA 5GANe 2KEAA 3OYHA 3OYJA 3S3MA 4XTUA 1F1BB 4HT9A 4J7IA 3I55T 4IUQA 1RAFB 3VU3C 1WHHA 2FB7A 2XK0A 3UATA 1ZX6A 4FM4B
chains in the Genus database with same CATH topology
1WHGA 2E3HA 2HL5C 2CP5A 1WHMA 1TOVA 2CP3A 2E4HA 2E3IA 2CP6A 1TXQA 2HQHA 2HKQB 3E2UA 2HL3A 1WHJA 2HKNA 2COZA 2COWA 3TQ7P 2COYA 2MPXC 2QK0A 1WHLA 2CP0A 1WHHA 1IXDA 4B6MA 2Z0WA 1LPLA 2CP2A 3RDVA 2M02A 1WHKA 2CP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHG A;  2E3H A;  2HL5 C;  2CP5 A;  1WHM A;  1TOV A;  2CP3 A;  2E4H A;  2E3I A;  2CP6 A;  1TXQ A;  2HQH A;  2HKQ B;  3E2U A;  2HL3 A;  1WHJ A;  2HKN A;  2COZ A;  2COW A;  3TQ7 P;  2COY A;  2MPX C;  2QK0 A;  1WHL A;  2CP0 A;  1WHH A;  1IXD A;  4B6M A;  2Z0W A;  1LPL A;  2CP2 A;  3RDV A;  2M02 A;  1WHK A;  2CP7 A; 
#chains in the Genus database with same CATH topology
 2RQR A;  3KXT A;  3OW2 A;  2OTJ A;  4JJC A;  2RK1 A;  2FL7 A;  2YLB A;  3CQT A;  2DEU A;  2DET A;  4LD6 A;  1M90 R;  4OB3 B;  4JJD A;  2QA4 T;  4OMO A;  4MDW A;  1VQ9 A;  1WZO A;  1LNX A;  1E6G A;  2X9H A;  2H3E B;  5C6S A;  5GAN 7;  5AYF A;  5A2Q E;  1K73 R;  5KH6 A;  1M1G A;  2GCX A;  4RTW A;  4C8Q G;  2P0P A;  2PZ1 A;  3REB B;  2D8J A;  4B9X A;  4CI0 C;  3ULR B;  2FZC B;  1JU5 C;  4OMP A;  2D6F A;  2HBW A;  1WPY A;  2KE9 A;  3E9F A;  1LJO A;  4C92 E;  1MGQ A;  3CBO A;  1VQM T;  4KUI A;  2QEX Q;  3CCV T;  1ABO A;  2EGE A;  3MCA B;  2GF7 A;  2Y90 A;  4OMM A;  5CQY A;  1M1K U;  2DK3 A;  4RG2 A;  5KYW B;  3HFO A;  4Z89 A;  1LOJ A;  4J9I A;  2JJ9 A;  2AIR B;  2H8H A;  1N9R A;  2DD5 A;  2KDS A;  1YI2 A;  1VQ6 Q;  4A4H A;  3CMA Q;  2QDL A;  2A3L A;  3VV0 A;  2P4T A;  3AT1 B;  3MJX A;  4BY6 C;  1YHQ T;  3JRZ A;  2Y4Y A;  4PFO A;  2R5M A;  1GFD A;  5LL6 S;  2O9S A;  2B86 A;  1D0Z A;  4PNO A;  2COZ A;  2M0Y A;  3NHN A;  2DTI A;  1OZ2 A;  1YBY A;  2A28 A;  4C8Q B;  2GQI A;  2JZ2 A;  3RIR A;  2RHU A;  4FSX A;  3C0C A;  1RUW A;  5FU6 B;  5LJ3 j;  4KGX B;  5LJ5 f;  4KUD K;  1OZ3 A;  1WHG A;  1UEC A;  4FYY B;  1AOJ A;  3A8G B;  4RUG A;  2AHJ B;  1X75 C;  2FPD A;  4AMC A;  2EJ9 A;  4AT1 B;  5CKF A;  1QVG P;  1SHG A;  1VA7 A;  4OMQ A;  3BW1 A;  1N9S A;  2D1X A;  3CCQ T;  3OS0 A;  4GBQ A;  1M8M A;  2YRV A;  3G6E A;  1Y71 A;  2EJG A;  3PNW C;  5LJ5 h;  1RAE B;  4PFP A;  2HSE B;  2ZGW A;  2KI7 A;  3I55 A;  3GP8 A;  3PT9 A;  3FJP A;  2CDT A;  1NM7 A;  3OYE A;  2FZG B;  4DQ2 A;  2JW4 A;  1PCX A;  2X35 A;  3EGU A;  2LQW A;  3RKY A;  4AG1 C;  2HKN A;  3L2W A;  4J9D A;  1FWZ A;  2E10 A;  4ZN3 A;  4Z88 A;  3CCM Q;  1WDX A;  2JM9 A;  2QQB A;  1FMW A;  3C12 A;  1CKB A;  3C95 A;  4KGZ B;  3CCJ Q;  2QA4 A;  1WHK A;  3NPF A;  4MMK A;  1HXD A;  1M1F A;  2K2M A;  3VUB A;  4F17 A;  2CP6 A;  3EGX A;  3VYH B;  3VS5 A;  2O4X A;  2GBQ A;  2YUO A;  3QSU A;  2DXC A;  3M0R A;  2QI2 A;  3CCL Q;  3SD4 A;  1I5O B;  1TU0 B;  4ZGJ B;  3CCS T;  1Q82 R;  2OX7 A;  4BAC A;  4FCY A;  4J6W A;  4PJL A;  1V76 A;  4M77 F;  2HZY A;  3CCE A;  4RG8 A;  1M30 A;  1ZUY A;  1I81 A;  5GJW B;  3SDZ A;  3JCM c;  5KCH A;  1MV3 A;  1VQM A;  4JJB A;  3SEM A;  1ZSZ B;  3CCV A;  5I2M A;  1M9S A;  2YSQ A;  2YRD A;  1TTH B;  2EQK A;  2RF0 A;  3PVQ A;  5A0D A;  1GCQ C;  1WXB A;  3HTR A;  5EG2 A;  1O75 A;  4BE0 A;  2M02 A;  1YFN A;  2D0Q B;  2DIL A;  1WLP B;  3M54 A;  4DA4 A;  4LDX A;  2CUB A;  4PL6 A;  2KYM A;  2DO3 A;  4LN2 A;  1W2B A;  1XTD A;  2K3Y A;  2MK5 A;  1ZUK A;  2JTF A;  2VC8 A;  4ZGD B;  5GAN g;  1YHQ A;  2DL3 A;  2FRW A;  2DAQ A;  2E65 A;  3V7S A;  3CC7 A;  1K4U S;  2YRC A;  3HP9 A;  3MPU B;  1Q81 C;  1GBR A;  2W10 A;  2F2X A;  2IPO B;  2L3Q A;  1R0C B;  5FLX E;  1I4K 1;  2F2V A;  4XAX B;  1KQS P;  4JPB W;  2CP5 A;  5AT1 B;  4OMN A;  1IGQ A;  1VQK T;  5D7U A;  2RJF A;  3CCQ A;  3OS5 A;  4PJO A;  1U3O A;  4XQ3 A;  2QGG A;  2EQM A;  1K8A C;  4N4I A;  2K5L A;  4Q5W A;  3FEO A;  3JB9 H;  3NTI A;  1K9M R;  4N4G A;  4TVR A;  1VQ7 T;  2HL5 C;  1UE9 A;  2KRM A;  5GAN 5;  4E7J A;  3OMC A;  3P8D A;  4F7U A;  2DX1 A;  3DLM A;  2DL7 A;  1D1B A;  1M2V A;  4BI8 B;  3H0H A;  4M7A G;  1NYG A;  3PIP A;  2VWF A;  3IQL A;  1YIJ A;  4C8Q F;  3TSZ A;  2JM8 A;  4OML A;  2NUZ A;  2DZ9 A;  4A4F A;  2K5F A;  1JQQ A;  2YHT A;  4HCK A;  3CC2 Q;  2XI9 A;  3CCS A;  2CP0 A;  1WYX A;  1TUC A;  2BZX A;  4ZTJ A;  3NTK A;  3FRN A;  2C0T A;  2EQI A;  1N8R C;  2B8A A;  3PFS A;  1VQN T;  1NPP A;  3EGX B;  5LJ3 f;  2O4X B;  2ZPE B;  4RCB A;  3GIB A;  2JS0 A;  4O5V A;  4QQG A;  4OGC A;  1P92 A;  2X3W D;  1VQL T;  2ECZ A;  1M90 U;  2RB6 A;  4BY6 B;  3LW5 E;  1NEG A;  1UDL A;  1SRM A;  5LJ3 h;  3ZBD A;  2QQS A;  2BE9 B;  3G71 Q;  3RMQ A;  2HDA A;  4E6R A;  3CD6 T;  1TOV A;  5HCK A;  2EIF A;  3CCR T;  2QQA A;  1KC8 U;  2ZPH B;  1YJN Q;  1EIF A;  2LQ8 A;  8ATC B;  2MMP A;  1JRI A;  4PJO G;  1B7T A;  1QWE A;  2K79 A;  1PWT A;  5KYY A;  2VV5 A;  2SEM A;  4IIO A;  2RO0 A;  3CC4 T;  3D7S B;  3U23 A;  3L2V A;  2AZV A;  4EDU A;  3MEV A;  4RTY A;  2EAY A;  1NJI C;  3OYM A;  1NE8 A;  1VQK A;  2KQW A;  1UJ0 A;  1BI2 A;  1YJ9 Q;  4F7U G;  1VQO Q;  1OQK A;  2CGH A;  4OVA A;  4IUP A;  3QHS A;  1Q81 R;  4UC4 A;  3M0Q A;  3OYK A;  5GAN 4;  3URG A;  3L2Q A;  1UUE A;  3KFV A;  3JCM P;  3H0I A;  3H8Z A;  5C0M A;  5FU6 C;  1VQ7 A;  4C8Q D;  3LLR A;  1ACM B;  3OYA A;  1UGV A;  1Z9Q A;  5KE2 A;  4PJO B;  1K8A R;  1FX7 A;  2D0N A;  1VOM A;  4Z02 A;  1U5S A;  4DBQ A;  1C1A A;  1IB8 A;  4PLI A;  4V2S A;  3QII A;  4OP0 A;  2RI2 A;  4ZN1 A;  2AKK A;  2ZCF B;  3UA7 A;  2OI3 A;  2HNI A;  1N6A A;  1GL5 A;  1TSF A;  1XJW B;  2RJD A;  4M78 G;  5GMK i;  2LJ0 A;  1RAD B;  1K73 C;  2LP5 A;  4F7U B;  1TWB A;  2EKH A;  2DNU A;  1AD5 A;  4XK8 E;  1ABQ A;  2D8H A;  4AFU C;  2VUB A;  2GTO A;  1JXO A;  2PVG B;  1KHC A;  1M2V B;  2DL5 A;  1SG5 A;  1NZ9 A;  4E7K A;  4K11 A;  2VYT A;  5J3B A;  4BUG A;  2L3R A;  3N5B B;  1VQN A;  1PRM C;  3RUX A;  4PK4 A;  2HL3 A;  2XD0 A;  1U06 A;  1VQ8 Q;  4FSS A;  5KYW A;  2O9V A;  2R58 A;  1YIT T;  3F70 A;  5GAO p;  5LJ3 d;  4JRK A;  5CKE A;  1UTI A;  4LDW A;  4M77 E;  2DBK A;  3V7C A;  1TUG B;  4XTW A;  1QP2 A;  1IZ6 A;  4QKU A;  2DBM A;  3L1A A;  4CC7 A;  3OYF A;  1N8R R;  4M75 G;  2E12 A;  2KXC A;  5IHK A;  3CD6 A;  2DIG A;  1X69 A;  3GF5 A;  1T0J A;  2AKL A;  1WHJ A;  1MMA A;  1UB4 A;  4M78 B;  1BI3 A;  1ZSZ C;  2LT1 A;  1ZUU A;  4FIB A;  2A37 A;  2V8K A;  2JT4 A;  3A1P A;  3C94 A;  3V8J A;  1QMC A;  2YXY A;  3CBP A;  2DF6 A;  4NL3 A;  2A7Y A;  3CC4 A;  3VS0 A;  1MMG A;  3M0S A;  1WXT A;  4GLM A;  3QG1 A;  4PJM A;  4PKC C;  2E6N A;  4RMO A;  3RNJ A;  2FPF A;  3PMT A;  2DVJ A;  4J9E A;  4CC3 A;  2CT3 A;  2KRN A;  5FU7 B;  4LDU A;  1Q95 G;  1E6H A;  2DMO A;  5KYY B;  3CME T;  2KNB B;  1M2O A;  4QVC A;  2W0Z A;  4VUB A;  4B9W A;  2ROL A;  2YUQ A;  1ZBJ A;  2XIC A;  1QVG A;  1GRI A;  4M75 B;  1NJI R;  4LXC A;  5FRO A;  1QQJ A;  4C92 A;  5GAO q;  3G6E T;  2NYS A;  2F5T X;  3A8L B;  2PU9 B;  3MHX A;  1VQL Q;  1OX8 A;  2DYI A;  1JJ2 P;  2MYS A;  1YJW A;  2FZK B;  3M4G A;  3UPU A;  5I11 A;  1E7O A;  1HK9 A;  1MND A;  2Z0W A;  1LPL A;  1RAI B;  1ZBX A;  2GTJ A;  1I0C A;  2DIQ A;  1M27 C;  1HD3 A;  4CRI A;  3OS2 A;  3CCR Q;  4C0F A;  4FYV B;  1KQ1 A;  3FLG A;  1WI7 A;  4JLI A;  2E6Z A;  2XDB A;  2E3I A;  4JRQ A;  5KYU A;  2GNC A;  2V8J A;  2K57 A;  2D9T A;  2HQX A;  2JUF A;  4X34 A;  3CCU Q;  2DFU A;  2Y4X A;  2K3X A;  2X3X D;  4RTZ A;  3HFN A;  2QGF B;  3TEE A;  1BI1 A;  5GAM j;  1Q82 C;  1UGQ B;  1UHC A;  1NG2 A;  2X4J A;  3THK A;  2EQJ A;  1VQP Q;  1UJY A;  4PJJ A;  4R55 A;  4AFQ C;  2QDY B;  5EC7 A;  2DTH A;  4C8Q E;  1QVG S;  3G7Z A;  1ZSZ A;  1X6G A;  2CT4 A;  2ENM A;  1QKW A;  2EYQ A;  5J39 A;  3VS3 A;  2J6F A;  1U1S A;  3M57 A;  1VQ5 Q;  8AT1 B;  2PVO B;  1YIT A;  4BD3 A;  3A8M B;  5I2S A;  4WF2 A;  3CCE T;  1G8X A;  2RQU A;  1RL2 A;  4C0Z A;  1S72 Q;  1KQ2 A;  4OGE A;  1K0X A;  1OOT A;  2MF2 A;  5HK3 A;  3HKS A;  1TXQ A;  2FHD A;  2P84 A;  3JCM f;  1M4Z A;  1G2B A;  3OBY A;  1Q86 U;  1IGU A;  4L6V 5;  5CK9 A;  2V1Q A;  2A36 A;  5LJ3 e;  1AVZ C;  2RM4 A;  1M3C A;  1QP3 A;  2IIM A;  2OTJ Q;  3I35 A;  5DLO A;  3RR6 A;  2FO0 A;  1WHM A;  3JCM h;  3OA6 A;  4J9F A;  4M7A C;  1AZE A;  2VGM A;  2ESW A;  2GFU A;  1SHF A;  2DEQ A;  3JCM V;  3UWN A;  3M0U A;  2HKQ B;  4FU6 A;  1FMV A;  1BCM A;  4C92 G;  5LJ5 g;  3ZEH A;  2V1R A;  3TQ7 P;  5M9O A;  3CC7 T;  3S6W A;  1WA7 A;  4M7A D;  2GQV A;  1VQ9 Q;  3OYC A;  4D8D A;  2MOX A;  1I07 A;  1X6O A;  3CME A;  2CYZ B;  3RER A;  4KT0 E;  1Y7X A;  1KQS A;  1XNI A;  2OAU A;  1KK7 A;  4HKE A;  1K9M C;  3S3O A;  5GAO m;  4E2F B;  4MZT A;  1G5V A;  4LNP A;  4KGV B;  2A08 A;  2OTL Q;  1RAH B;  1SEM A;  1O9S A;  2HSP A;  4XTV A;  2P0K A;  3DB4 A;  4KH1 B;  1M3A A;  1G3S A;  1W6X A;  4JLG A;  1OYX A;  3NTH A;  4Z8A A;  2AT1 B;  1HSQ A;  3MEU A;  2CS7 A;  3M0T A;  4FT4 A;  5GMK e;  3I56 A;  4C92 B;  1X01 A;  4QVZ A;  1SPK A;  1YI2 Q;  2DXT A;  4OB1 B;  1D3B A;  4BI4 A;  4HXJ A;  2JXB A;  5FWB A;  1KJW A;  4PJO C;  1I5L A;  2DE0 X;  3MP6 A;  3NMZ C;  2CZ7 B;  1KQS S;  1YIJ T;  3OW2 P;  4PJO D;  1M1K C;  2FEI A;  1J3T A;  5KYU B;  4J9G A;  4ANJ A;  1VQ4 T;  5IAY A;  2R57 A;  4BE2 A;  2EQU A;  4RTV A;  2NUP A;  1K8A U;  2L3S A;  3RDV A;  2XMF A;  2FYK A;  2G6F X;  2VB6 A;  2XID A;  1BYM A;  4M7A A;  1NYF A;  1HJD A;  1R0B G;  3G6E Q;  4LUD A;  3JCM W;  4HVW A;  4MML A;  1VYU A;  4ZGE B;  3I55 Q;  3EG3 A;  3TU4 K;  1WQW A;  4MDX A;  1IXD A;  2AK5 A;  2QAZ A;  2YLC A;  4EMH A;  3I5S A;  2MIO A;  2JOY A;  2FG0 A;  4J6X A;  3LWH A;  5I21 A;  3HPW A;  3GBQ A;  2ZPF B;  2QA4 Q;  4M78 C;  2P0Q A;  2ED0 A;  4P5N A;  2EKO A;  3REA B;  2CP7 A;  5GAM f;  1YNZ A;  3OBW A;  5KCO A;  1XQH A;  1PKT A;  4M78 D;  4QT7 A;  1TUD A;  2LCL A;  2G3R A;  2JMC A;  2LQN A;  4KRT A;  1QKX A;  4DEY A;  2JN0 A;  5LJ5 d;  1N8R U;  4M7D C;  1TG0 A;  1I8F A;  1UGP B;  4LE9 A;  5GAN 8;  2J05 A;  1WNL A;  1Q7Y U;  5GAM h;  4ZNX A;  5L23 A;  1JEG A;  4N4H A;  5FU7 C;  2EYZ A;  3G4S T;  4C0G A;  1AWJ A;  4Y28 E;  1VQM Q;  1AZG B;  3S3N A;  5HKC A;  1KSW A;  3CCV Q;  1BI0 A;  3E19 A;  3CPF A;  1Y96 A;  1FMK A;  1M8V A;  1NLP C;  5FRN A;  2EYX A;  2NWM A;  4M75 C;  1D0X A;  4F14 A;  3NGP A;  1QW1 A;  2BUD A;  2E41 A;  2FRY A;  5J26 A;  4QVD A;  4M75 D;  2PTK A;  3HL8 A;  5GAO r;  1LCK A;  3H9N A;  1YHQ Q;  3VS6 A;  2P4R A;  4BB7 A;  1VQ4 A;  1U8R A;  4JZ3 A;  1VIF A;  3CC7 Q;  1NJI U;  2E70 A;  2X4W A;  2L3P A;  3HSB A;  1D3B B;  3SWN A;  5HY6 A;  4R56 A;  2WSC E;  5LJ3 g;  2MAM A;  2KT8 A;  2K6D A;  3VKI A;  3EG9 A;  2DA9 A;  4LDV A;  3J81 E;  1M1K R;  2PNI A;  1ZHI A;  3CCQ Q;  3H6Z A;  3QWX X;  2MCN A;  1WIE A;  1K76 A;  2HBP A;  3BFM A;  3VYG A;  1OEB A;  4M78 A;  3WVD B;  1AT1 B;  3LGF A;  2NUP B;  4QQD A;  4B6M A;  3QDF A;  2QTX A;  2M0O A;  4J9B A;  2C0O A;  4M7A B;  1VIE A;  5IHN A;  4M7D A;  1NBE B;  2ZPI B;  3OYN A;  4PJO E;  4J6Y A;  1VYT A;  3OYB A;  2LJ1 A;  4E7H A;  3JSC A;  4OF1 A;  3BE3 A;  1N5Z A;  1RI0 A;  3I9Q A;  3M55 A;  1PD1 A;  1UEB A;  3FJ5 A;  1MUZ A;  1OPL A;  1Y0M A;  1K73 U;  1M5Q 1;  1EFN A;  4Y91 A;  4E7S A;  1YIJ Q;  3PGG A;  3QYG B;  2E5K A;  4RKU E;  3FDR A;  4X1V A;  3SB2 A;  2M1H A;  3E9G A;  5L8R E;  2M9U A;  1V1C A;  4M75 A;  4NL2 A;  3EFO A;  3VS7 A;  1W2B P;  2RH2 A;  3FIF A;  4HCC A;  4II1 A;  3LH0 A;  3CCS Q;  4CC4 B;  3FB9 A;  3JB9 I;  5DM7 R;  2GFA A;  1RLP C;  1I1J A;  1D1A A;  1BCO A;  1OX9 A;  3RKW A;  3DB3 A;  4JRP A;  4RCC A;  2MWO A;  1X43 A;  2ABL A;  3NFC A;  1PHT A;  1PM3 A;  3H41 A;  3G4S A;  5CCA A;  3R6O A;  1SF9 A;  2QXF A;  3CXC P;  2LRQ A;  1BKB A;  4AG2 C;  3GLX A;  2KMT A;  1QLY A;  1WJQ A;  2FPE A;  5HK0 A;  2LX7 A;  4EMG A;  4RTX A;  4XTY A;  5LJ5 e;  2NLU A;  1IHV A;  1JJ2 A;  1C6V X;  5CKD A;  1YJW T;  1BBZ A;  1UGS B;  2DPP B;  1K9A A;  1PSF A;  2KBT A;  2ZPG B;  3EH1 A;  2KXD A;  5GAO l;  2M16 A;  1M3B A;  4A54 A;  2ZPB B;  3M56 A;  1WXU A;  1Y96 B;  2DKG A;  2QEX T;  4DOV A;  2JS2 A;  3M4Y A;  1G83 A;  1D0Y A;  2DM1 A;  4L59 A;  4QW2 A;  1W1F A;  1WHL A;  4C92 C;  5DLQ E;  3JCM b;  1T3S A;  3CMA T;  1QVP A;  4C92 D;  1X6B A;  1KC8 C;  4M7D G;  1VQK Q;  2DZC A;  2CP3 A;  2F1L A;  1T0H A;  3E2U A;  7AT1 B;  4C5E A;  2LNH B;  5KYN A;  1JJ2 S;  4LUE A;  3SWN B;  4HCB A;  4ORZ A;  4YTL A;  2WAC A;  1FYN A;  1YWP A;  4FT2 A;  3UF4 A;  2CZ0 B;  2XU8 A;  2KR3 A;  2EYY A;  3EG9 B;  1VQ7 Q;  1ZA2 B;  1JBM A;  3VS4 A;  1VYV A;  5FRM A;  2YUP A;  2DJZ A;  3M53 A;  4JS4 A;  4A4K A;  3JCM J;  4BDZ A;  2DL4 A;  2L8D A;  2COY A;  3QUI A;  4PLL A;  2MPX C;  4F16 A;  3OYL A;  1ZQ1 A;  1GFC A;  1MV0 B;  2ZZD A;  4L5G A;  4JDS A;  1Q82 U;  1D1C A;  4M7D B;  1IRE B;  2XHC A;  5CKH A;  1WX6 A;  3MET A;  2CRE A;  1ZSG A;  3LX7 A;  3EG0 A;  2QK0 A;  2PUO B;  4KH0 B;  2XDP A;  4IKF A;  3DLL A;  3CCM T;  3L2U A;  3EGD B;  3CCJ T;  1VQN Q;  2KT1 A;  3R6N A;  1SKU B;  4DEX A;  2OAW A;  3EFO B;  2O2O A;  3OYI A;  2X4Y A;  3X20 B;  1NEB A;  2L5Q A;  2O01 E;  2DRM A;  1N27 A;  3SFM A;  4A4G A;  1Z9Z A;  3HHT B;  4M7A F;  2BE7 D;  2VKN A;  1VQ5 A;  3FC3 A;  3OYD A;  3JB9 G;  4IUU A;  4M4Z A;  4NOY A;  3CD6 Q;  3UA6 A;  1PKS A;  2LQK A;  4KBM B;  1RAB B;  3CPW P;  3I56 T;  3J7A F;  1VUB A;  3ASK A;  2QEX A;  1BIB A;  3HRS A;  4C5G A;  5IT9 E;  2J6K A;  3CC4 Q;  2LX9 A;  3JV3 A;  5IXB A;  4C5H A;  3QDR B;  1VQ6 A;  1KIK A;  3L2Z A;  3CMA A;  1PC0 A;  1KD1 C;  2RHY A;  2VAS A;  2KVQ G;  2F5K A;  4LD9 K;  4XU0 A;  1YP5 A;  3OMG A;  3RES A;  1K9M U;  1Y57 A;  3A98 A;  5GAN j;  1WJR A;  4KUL A;  3LH5 A;  2EYW A;  4FYX B;  2K4Y A;  4F04 B;  3WXM B;  4N0A A;  3O8V A;  4NS5 A;  2KYB A;  3VJP A;  3OS1 A;  3JCM g;  1KC8 R;  5CQX A;  1U1T A;  2EGC A;  1TS9 A;  1ZA1 B;  3H0F A;  5FW9 A;  2KRS A;  4PJO F;  1B34 A;  2X51 A;  4QQ6 A;  3TSW A;  2QQ9 A;  2OTL A;  1K0S A;  1YJW Q;  1W4S A;  2PQW A;  1QVF P;  3X24 B;  2YWW A;  4DBR A;  4E7Z A;  2CH4 W;  4IUV A;  5FWC A;  1YCY A;  3OW2 S;  4GLK A;  4F7U F;  2DJQ A;  4EMK A;  4FW2 A;  3OYG A;  1D09 B;  1XOV A;  2E64 A;  2WSE E;  2QTV A;  5CO7 A;  1W70 A;  3PTA A;  3QZ9 B;  3EAE A;  2RMO A;  3MP1 A;  3LWI A;  3CCM A;  3PIO A;  5CVI A;  3BY7 A;  3CCJ A;  3BDU A;  3EHQ A;  2EVR A;  2E1H A;  2YDL A;  3QBY A;  3UT1 A;  2C06 A;  2KAF A;  3SHW A;  1UFF A;  1YIT Q;  3JB9 J;  3CCL A;  2DD4 A;  3QJY A;  1Y07 A;  2LC4 A;  3CC2 T;  4FYW B;  2V8I A;  1BU1 A;  2LNV A;  4O6J A;  3M59 A;  3QPH A;  4M78 F;  2BIV A;  2R5A A;  3QYH B;  4IUR A;  5IXF A;  2K3B A;  1RAC B;  2CH4 A;  1H3H A;  1FXX A;  3TCJ A;  1BIA A;  5IHI A;  2I0N A;  1HYO A;  4M7D F;  4OMF B;  4DOW A;  3P8H A;  3PMI A;  5GMK l;  4CC2 A;  1MMN A;  3OB9 A;  1Q81 U;  2LDM A;  1PG5 B;  3G71 T;  2GGR A;  1R8O B;  3AHU A;  2DLP A;  2O88 A;  2MI6 A;  1Q86 C;  1OV3 A;  1AWX A;  4RTT A;  2LVM A;  2KK4 A;  1YJN T;  3QKJ A;  1RLQ C;  1GXI E;  3CME Q;  4EPC A;  3I5R A;  1WJS A;  4M75 F;  2JTM A;  1WQ7 A;  2XKO C;  3G1J A;  1KD1 R;  2I2L A;  2CSI A;  3GNG A;  2EBP A;  4E7L A;  2VGN A;  1OPK A;  5GMK j;  1JO8 A;  3EH2 A;  4OB0 B;  5I22 A;  2KGT A;  2HD0 A;  4HVV A;  1OU9 A;  4HVU A;  1K1Z A;  1YJ9 T;  1VQO T;  2V26 A;  4WTO B;  2HMA A;  3MP8 A;  2DXU A;  3LYI A;  4HCZ A;  3VS2 A;  3JCM d;  1R77 A;  3SWN C;  1NPR A;  4BDY A;  2DL8 A;  3OQ5 A;  2BZY A;  2JNG A;  3I56 Q;  1B34 B;  2LZ6 B;  1X27 A;  2WSF E;  4D6W A;  3E1S A;  2HQH A;  2MWP A;  4IIM A;  5GAM g;  1RI9 A;  4LDY A;  2RA2 A;  2DYB A;  3T9N A;  5KE3 A;  2K5I A;  3M0P A;  1WFW A;  3INZ A;  2DXB A;  2OJ2 A;  4X9D A;  5KYX A;  4EMK B;  1GBQ A;  4MZP A;  2SRC A;  3A8O B;  4OB2 B;  2JVV A;  4JRI A;  2LMJ A;  1WGS A;  2RQV A;  3JB9 F;  3M5A A;  3VUZ A;  4J7F A;  2LJ3 A;  4Y92 A;  2KRO A;  1H64 1;  3EFR A;  2EW3 A;  3CCE Q;  2ATC B;  1H3Z A;  4M7D D;  3CC2 A;  5GAN f;  3CXC A;  9ATC B;  1RAA B;  4E47 A;  3MEA A;  4ATO A;  2X4X A;  1G3Y A;  5IH2 A;  2IG0 A;  5D6W A;  5GAN h;  1VQ8 T;  4M7A E;  2RHX A;  4D8K A;  3GPL A;  1IO6 A;  2J7I A;  4XU2 A;  4C0D C;  4BI3 A;  5ECA A;  1A0N B;  3OSS C;  4XTZ A;  1SRL A;  4IUT A;  3X25 B;  2ZAE A;  3G71 A;  2RQW A;  1EZZ B;  6AT1 B;  1W2B S;  4ESR A;  2AZS A;  4M77 C;  3MO8 A;  2NUT A;  3ZFJ A;  4AFZ C;  1YJN A;  1C0M A;  2XG8 D;  3JCM X;  2K7A A;  2EFI A;  2L89 A;  4M77 D;  4J8O A;  2F69 A;  3CXC S;  2LT4 A;  5CR2 A;  1YCS B;  1Q86 R;  1X2Q A;  3EFS A;  2EJF A;  2RK2 A;  3QJ6 A;  3OSV A;  1S1N A;  1GCQ A;  2BZ8 A;  1JXM A;  3L2R A;  2VVK A;  3JCM Q;  3KBG A;  4ZTF A;  1YJ9 A;  1VQO A;  1LVK A;  3PE0 A;  1IRX A;  3QXE B;  2EGA A;  2J6O A;  4C92 F;  3OY9 A;  2RQT A;  2A0F B;  3Q1J A;  1AEY A;  1H8K A;  2RPN A;  1X2K A;  1Q7Y C;  3UDC A;  3EHR A;  3JAM E;  3JB9 D;  5CAI A;  5CIU A;  2M51 A;  3ZL7 C;  2DRK A;  2QAS A;  1G3T A;  3M58 A;  4R0K A;  4ME7 A;  3EGD A;  3PVL A;  4JJN K;  1KHI A;  2DTO A;  2CZ1 B;  3JCM e;  2XDD A;  4A63 B;  2HAX A;  1PRL C;  3CBM A;  1VQ4 Q;  4J9H A;  2O31 A;  2E4H A;  2J06 A;  1AWW A;  3OYY A;  3DKM A;  4F7U E;  3V7R A;  3M9Q A;  2DVE A;  3GOX A;  2L2P A;  5GAM d;  3RMS A;  1JB0 E;  2YT6 A;  5IN1 A;  1UGR B;  4HT8 A;  3CCU T;  3P8B B;  2CSQ A;  2JTE A;  1QCO A;  5GMK m;  2RJE A;  1ARK A;  5GAO n;  1BB9 A;  4FL6 A;  2IVW A;  1VQP T;  1OI1 A;  4A4E A;  2HCK A;  4M77 A;  4DBF A;  5GAN d;  5KYX B;  3QO3 A;  2ROT A;  4HA8 A;  2COW A;  3ME9 A;  1VQ8 A;  3WVE B;  2KSS A;  1VQ5 T;  1QCN A;  4C8Q C;  2RI3 A;  1UG1 A;  1MHN A;  2QG9 B;  2ED1 A;  2K2V A;  1G3W A;  3J80 E;  1B3Q A;  2EPD A;  1AHJ B;  3CPW A;  1S72 T;  1H92 A;  3VRZ A;  4M78 E;  1B07 A;  2BKD N;  5D6Y A;  4ELY C;  3RKX A;  5GJV B;  1QWF A;  2BTT A;  3A5Z B;  5GMK h;  1M90 C;  2E5Q A;  2RHI A;  4M7D E;  2LCC A;  3A8H B;  1VQ6 T;  3ER0 A;  1MNE A;  2VXE A;  1T3L A;  4E7I A;  2PUK B;  2OTJ T;  4AFS C;  3MEW A;  1AWO A;  3HRT A;  4GY5 A;  2CUD A;  1KFZ A;  1CSK A;  4EIK A;  2F2W A;  5DY9 A;  2NUT B;  5LJ5 j;  3L42 A;  2RHZ A;  3G4S Q;  3LGL A;  4A53 A;  2JMA A;  4M75 E;  2CP2 A;  1VQ9 T;  3GNF B;  3X26 B;  2RNA A;  2H3J A;  2RD1 A;  4XTX A;  2KY9 A;  4FW1 A;  3TRE A;  3CPW S;  4DBH A;  4JZ4 A;  3V8L A;  5D6X A;  2QQR A;  2RJC A;  2CKK A;  4WCI A;  1IHW A;  2OTL T;  1CKA A;  2K9G A;  3O5Z A;  4PFZ A;  1QVF A;  5CKB A;  3EG2 A;  1KG1 A;  2LCS A;  1VQL A;  3TVT A;  4J9C A;  2E3H A;  4N0A C;  5GAN 3;  3QZ5 B;  1ZLM A;  3CCR A;  2QYZ A;  4M77 G;  1KD1 U;  2VXF A;  2EWN A;  3CEY A;  2DER A;  5GAN 6;  2YUN A;  3KUF A;  1Q7Y R;  1NLO C;  2CZ6 B;  4C5I A;  4C8Q A;  1PSE A;  4J5Y A;  3MKD A;  4PJN A;  1TH7 A;  1YI2 T;  3CCU A;  3C4S A;  1SSH A;  4X9C A;  3VRY A;  4XU3 A;  1GCP A;  4ELZ C;  3BDL A;  1RAG B;  1BK2 A;  1VQP A;  1DJ7 B;  3RBB B;  1OUL A;  5A0L A;  1PD0 A;  3HRU A;  1YWO A;  2HQE A;  4J83 A;  3V8K A;  3VS1 A;  4EMK C;  5GAM e;  4JS5 A;  3CCL T;  1QVF S;  1PNJ A;  4C0D B;  2PVD B;  2RN8 A;  4RTU A;  2FVU A;  4MZM A;  2HEQ A;  1QCF A;  4JUV A;  5GAN 2;  1OU8 A;  1SSF A;  1YN8 A;  1MMD A;  2RI5 A;  5A0G A;  4XU1 A;  3EG1 A;  2LTO A;  1S72 A;  2C0I A;  4M77 B;  1EX4 A;  2L0A A;  3X28 B;  1V29 B;  3QWY A;  4BE1 A;  1UHF A;  5GAN e;  2KEA A;  3OYH A;  3OYJ A;  3S3M A;  4XTU A;  1F1B B;  4HT9 A;  4J7I A;  3I55 T;  4IUQ A;  1RAF B;  3VU3 C;  1WHH A;  2FB7 A;  2XK0 A;  3UAT A;  1ZX6 A;  4FM4 B; 
#chains in the Genus database with same CATH homology
 1WHG A;  2E3H A;  2HL5 C;  2CP5 A;  1WHM A;  1TOV A;  2CP3 A;  2E4H A;  2E3I A;  2CP6 A;  1TXQ A;  2HQH A;  2HKQ B;  3E2U A;  2HL3 A;  1WHJ A;  2HKN A;  2COZ A;  2COW A;  3TQ7 P;  2COY A;  2MPX C;  2QK0 A;  1WHL A;  2CP0 A;  1WHH A;  1IXD A;  4B6M A;  2Z0W A;  1LPL A;  2CP2 A;  3RDV A;  2M02 A;  1WHK A;  2CP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...