2HQHA

Crystal structure of p150glued and clip-170
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CLIP170 autoinhibition mimics intermolecular interactions with p150Glued or EB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein, protein binding
molecule keywords Dynactin-1
total genus 14
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hqhA00
2MPXC 1TOVA 2HKQB 4B6MA 2E3IA 1WHKA 2E4HA 2HL5C 2COWA 1WHMA 1LPLA 1WHLA 1WHHA 2CP0A 2E3HA 2M02A 1IXDA 2COZA 1TXQA 2HL3A 2QK0A 2CP7A 3TQ7P 2CP6A 2CP5A 2CP2A 2HKNA 2HQHA 3RDVA 1WHGA 2COYA 3E2UA 2Z0WA 1WHJA 2CP3A
chains in the Genus database with same CATH superfamily
2XK0A 1M9SA 1VQLT 3BY7A 1IZ6A 4ZGDB 2GTJA 4RTYA 2O9SA 3EG9A 2LQKA 2L89A 3M0UA 1M30A 3FLGA 2FHDA 2AHJB 2EFIA 2RHXA 1PRMC 1VYUA 2PQWA 2QDYB 1GXIE 3J7AF 4JJCA 2CT3A 1Z9ZA 1R8OB 4ZGEB 1RAAB 1RUWA 4MDXA 1LOJA 5GANg 1VQ8T 4FCYA 4JRQA 1MMGA 2QXFA 3C0CA 2E10A 2ECZA 1QLYA 3QYHB 2EQIA 4KRTA 1VQNA 1GFDA 5FWCA 2YUQA 1M1KU 3CC4A 3L2VA 4RKUE 5KCOA 3BDUA 3CEYA 4M78A 1LVKA 4A4GA 1K0SA 1QW1A 3TU4K 1D1BA 1PCXA 1X01A 3GLXA 4OMQA 4BE2A 3OBYA 3OW2S 1EFNA 1TUCA 3VS1A 2BZXA 3CCMT 5J39A 1UB4A 1TSFA 2FPDA 4OGEA 3EHRA 3CCVA 1NLOC 4Z89A 5GAMj 3PNWC 1QVGP 3QSUA 1XQHA 2QQ9A 2DL8A 3LH5A 2JXBA 2C0IA 3V8LA 1YIJT 2F69A 3HFNA 1CSKA 1M3CA 3F70A 5FRNA 2RN8A 4Q5WA 4J9GA 1OI1A 2XU8A 2XDPA 3UT1A 2JMCA 3NHNA 1YJNT 3TCJA 3JB9D 1RADB 4F14A 3AT1B 2LCSA 1D3BA 1UHCA 2KE9A 2YUNA 1Q82R 4PLLA 1QKXA 4KGXB 1HJDA 2JNGA 4M7DE 1OPLA 3EFOB 5GAMe 1VQ4A 4RG2A 3PTAA 3INZA 3NTHA 4HVVA 2V8KA 2HSPA 1AWOA 1AZEA 1WPYA 4EMHA 4M75A 4RTZA 2YSQA 4JUVA 1RI0A 2HAXA 3E19A 3JCMV 3M9QA 1G3TA 3OMCA 1ABQA 1QVGA 2ENMA 1YFNA 1KC8C 2DL3A 4V2SA 1WHJA 3LYIA 1Q7YR 4M7DF 1OV3A 3HPWA 1M2VB 1AZGB 3QO3A 2WSCE 4ELZC 3URGA 2OAUA 1GRIA 2RHIA 2AZVA 1VA7A 3X25B 2YT6A 1NJIC 3M56A 2EQMA 2JT4A 5A0GA 1VQKQ 3OYYA 2M51A 2HBWA 2FZKB 2ED0A 1WNLA 4R55A 3PGGA 2CDTA 2AKKA 1OZ2A 5GAN2 3OB9A 2K9GA 2FO0A 3M4GA 2BKDN 3OY9A 1TUGB 3CCVT 3SD4A 2FZGB 4BE0A 1MMDA 2RM4A 2X4WA 1YIJQ 2LTOA 2QGGA 4M78C 1RAHB 2GF7A 2KYBA 3M53A 1QP2A 4C92E 3QUIA 2DYIA 2J06A 4QW2A 1VQMQ 2NUPA 2AK5A 3PT9A 4J6WA 4C8QC 3O8VA 1KQSS 1U3OA 2ZCFB 4N4IA 1VQ5A 3V7RA 5KYXB 1M1GA 4E7ZA 2DXCA 3UPUA 3RERA 2PVDB 1TU0B 1VUBA 3I55A 4OP0A 1U5SA 1WHGA 2R5MA 3DB4A 2RQWA 1QCOA 1Q7YC 2K3BA 2E1HA 3A98A 1WQWA 4XU3A 4M77E 4F7UF 2KQWA 1UDLA 2R58A 2LP5A 2NYSA 3OS1A 5IXBA 1A0NB 2EGAA 2FB7A 4J9CA 1NYGA 3NTKA 1ZX6A 2X35A 1KIKA 1D1AA 1QCNA 1VQKT 4MDWA 3GPLA 1TS9A 3ME9A 4C8QA 4ZN1A 3M0RA 3ZL7C 2QQBA 2GCXA 3CCSA 1TXQA 5KE2A 1RABB 1W70A 2LMJA 1MMNA 2XICA 4J9IA 3KBGA 2DERA 4KBMB 4LDYA 4M75F 4IUQA 4LDUA 2XIDA 3S3MA 3ZEHA 1K76A 1VQ6T 4EMKA 3QDFA 2JM8A 2DE0X 1M5Q1 1D3BB 5KYYB 2M02A 1MUZA 4ATOA 1WJRA 2A36A 1P92A 3VRZA 2V1QA 4BI4A 4DEXA 1JXOA 4D8DA 1PWTA 4RG8A 1M2VA 3EAEA 3VV0A 2YUPA 5GAOq 2VV5A 2I0NA 3QPHA 1QVFS 1YWPA 1YITA 1I5OB 1ABOA 2B86A 1UHFA 3CBOA 3OYAA 1BI2A 3SFMA 4FIBA 2JUFA 4RTTA 4OB2B 4M7AC 4GBQA 5CQXA 4M78F 3M0TA 4FYWB 3JCMJ 2HQEA 2DBMA 1GFCA 2CUBA 4B9XA 4D8KA 1WI7A 3H0HA 5KYNA 4QT7A 3L2UA 3G4SA 1M90U 1ZUYA 3JCMW 2LCCA 4PJLA 2L3PA 3I55T 4PFPA 1ZBJA 2DF6A 2HKQB 1VIEA 4CI0C 2LZ6B 2BUDA 2PUOB 3REBB 3JV3A 4OF1A 4EMKB 1VQ7Q 2KT8A 2DETA 2KNBB 4RCBA 5A0DA 4QQDA 4F04B 2NUPB 4A54A 2K79A 2M1HA 2BE7D 3CXCP 3OYMA 2EYZA 4M75C 1KJWA 2JS0A 2FVUA 1UGQB 1V29B 1B34A 3JSCA 2E5KA 2CS7A 5KYWB 1KQ2A 1Q81U 5LJ3d 2CP6A 1K8AC 3ULRB 1YIJA 2RQRA 3M0SA 3ZBDA 1SKUB 8AT1B 3OW2P 4M7DC 1FMWA 2DTHA 1G3SA 3CCET 3LW5E 4QQGA 1UTIA 2RK1A 3FDRA 4Z8AA 2FPEA 2X51A 1SSFA 2RJDA 4JJDA 4CC4B 4IUPA 1IRXA 4JS4A 4EMGA 2DMOA 3QDRB 3E2UA 4RTVA 1W6XA 1YJ9A 2OI3A 2RQVA 2B8AA 4M7AE 2KI7A 3GBQA 3OYIA 1BKBA 3FIFA 3HFOA 1WQ7A 1NPPA 2EYXA 4OB1B 5GAMd 1KQ1A 2JW4A 2LX7A 2ZPIB 3SWNC 5LJ5g 2DPPB 4C92D 2VUBA 3PIOA 2IIMA 4KGVB 3JCMP 4M75G 3NTIA 4JS5A 4M75B 1ZA2B 3EFOA 2P4RA 2RQTA 2R5AA 1CKAA 1VQ7T 1JO8A 3CC2T 3HL8A 3G71Q 1G5VA 3LX7A 1YJWQ 4M78D 4XU1A 1PM3A 2KR3A 2QA4A 5GAOp 1HK9A 5LJ5j 2LVMA 1X6GA 1Q95G 1ZSGA 2L2PA 3VU3C 9ATCB 4C92A 2F2VA 2RF0A 3OYNA 1BIAA 4F7UB 2OTLQ 1KQSA 2DEQA 2EVRA 1IHWA 1VQNT 4JLIA 2OTJA 1M1KC 3I5SA 1K9MU 3G71T 2RK2A 1OZ3A 1G3YA 2KDSA 2QK0A 1JJ2A 3TQ7P 4DBHA 1M90R 3J81E 3QJYA 5CO7A 2A3LA 2ZAEA 2LQ8A 2DFUA 2QTXA 3EGXB 3PMIA 4FYXB 3FJ5A 3QWYA 1VQOT 3L1AA 3THKA 1YJNQ 2K6DA 3CQTA 5KYYA 2FZCB 3CXCA 4C8QE 3OYDA 2KY9A 4OMLA 2DZ9A 1K4US 3QZ9B 2M9UA 5I22A 1NEBA 2DO3A 2DIQA 3UA7A 3V7CA 1R0BG 1KK7A 2DD4A 2DRKA 1VYVA 1X27A 3A8LB 5HK0A 2G6FX 4WCIA 5GAOl 1N8RU 4Y92A 4C0FA 2HEQA 2VVKA 3OYGA 1AVZC 3MEUA 3HKSA 1W1FA 5IHNA 3HHTB 2YRVA 2YLCA 5M9OA 2P84A 2XKOC 1I0CA 4DQ2A 2O01E 4XTXA 1PHTA 1WA7A 5GANd 2CUDA 4C92B 3G4ST 5I2MA 3H8ZA 3VS3A 1KHCA 1H641 3NPFA 2GBQA 1FYNA 5LJ3f 3CD6Q 1KHIA 1FMKA 1RAIB 1BK2A 3CCRA 1NG2A 1RAEB 1VQ7A 1K0XA 4AFUC 2I2LA 2YDLA 2GNCA 3P8BB 5CVIA 4DOWA 4C92G 1VQ9A 1JQQA 3A8OB 2NLUA 2RHYA 2E3IA 3RKYA 1X2KA 1LPLA 3EGUA 3UF4A 1N9RA 2LNVA 4M77A 4FT4A 4NL3A 1M4ZA 1M27C 1VQOQ 2ESWA 2DXTA 1FXXA 4DBQA 2F2XA 1K1ZA 4HT8A 1S72A 2ZPEB 4N0AA 2O88A 2OTJT 2OTLA 1OEBA 2COYA 3MEVA 4R56A 2QG9B 4DBRA 4QVDA 4ZNXA 1NPRA 3JCMb 1O9SA 2EGEA 4PJMA 2DTOA 1RLQC 5CK9A 2W10A 3H0FA 2J7IA 3VS6A 4J5YA 3EG0A 2JMAA 1IGUA 5D6WA 5KE3A 1Q82U 2OTLT 4XU0A 5GAMh 1D0YA 4IKFA 2EGCA 4N0AC 2MYSA 1UGPB 2KSSA 2AIRB 1Z9QA 3I55Q 1BB9A 4FL6A 1GBRA 3UA6A 4M7DG 2D6FA 4NL2A 1BIBA 1AT1B 1E6GA 4FW2A 4M4ZA 1I07A 3U23A 1GCPA 3EG1A 5A0LA 3JCMd 1NZ9A 1K9AA 4PJOA 3JRZA 3C95A 4X9CA 3CMAQ 1NJIR 2RQUA 1D09B 3CPFA 3VS2A 3FC3A 2LJ3A 1UGSB 4BACA 3EFRA 3OYHA 1MNDA 4C8QD 2JTMA 1W2BS 3M5AA 4C5EA 3SHWA 4XQ3A 1OYXA 3PMTA 4Z88A 2Y90A 2K4YA 4IUVA 3CBMA 1Q82C 1N5ZA 1WGSA 1PG5B 3H0IA 3CC4T 4PFOA 3MEWA 2QA4T 4A4FA 5GAN7 3CD6A 3OYEA 1Y96B 2CP3A 4J7FA 1VQ9T 1N6AA 2HDAA 2SRCA 5KYWA 3QWXX 1G8XA 1M3AA 2DD5A 2OTJQ 3CCMA 4BB7A 4KH1B 2JTFA 3HRSA 2PU9B 3CMAA 2PVGB 2GQVA 4OMFB 1T3LA 3PE0A 3WXMB 3CCMQ 1LCKA 4AG2C 5EC7A 2EKHA 2DKGA 5GAOr 2QEXA 1QVPA 1TH7A 2FRYA 1TOVA 5GAMf 3X20B 3REAB 1Q7YU 2DIGA 2RJEA 5I11A 4Y91A 3CMEA 3OSSC 1S72T 2ZPFB 3JB9G 4CRIA 4L6V5 2F1LA 5GAN6 1KC8U 1WYXA 4E7SA 1Y7XA 1KD1R 3DKMA 1YI2T 1RAFB 3FB9A 3M0PA 4XTUA 3CMET 1S1NA 1S72Q 2P4TA 2X3WD 3CCSQ 2DL5A 2K3XA 2PTKA 1YHQT 1H3HA 3RKXA 4M77G 1OOTA 4J9HA 1KD1C 1M1FA 3MEAA 2H3JA 1V1CA 2W0ZA 2NUTB 3HTRA 1MV3A 2CP2A 2EQJA 1M3BA 2HKNA 4A63B 2GFUA 2RA2A 4ME7A 4FT2A 3O5ZA 2FL7A 5GMKm 2A28A 1I81A 3RMSA 1VQ9Q 1JBMA 3OBWA 4AG1C 4ANJA 3OS2A 2VKNA 3MJXA 5CKFA 2QTVA 4ZTFA 5CQYA 1VIFA 1AOJA 2LDMA 3OS0A 1UE9A 3E9FA 3JCMg 2KXCA 1U1SA 3QBYA 4L5GA 2RD1A 1H8KA 2DJZA 4E7LA 4B6MA 1WZOA 3EG9B 4XAXB 4M7DD 1PKTA 4OB3B 4PLIA 5LJ5f 5GAOm 3R6NA 3OYBA 1KQSP 4QQ6A 5IXFA 4M75E 5HK3A 5DLQE 1K8AR 3MP1A 3JCMe 4UC4A 2G3RA 1VQNQ 4LXCA 2VXFA 1SRLA 4FU6A 5CKBA 4M78B 2DBKA 3EGDB 1ZBXA 2ABLA 1AD5A 1QP3A 2LRQA 2AKLA 2MF2A 5HCKA 1NE8A 2RI3A 2EPDA 1XNIA 2XI9A 1MMAA 1YJNA 1ACMB 2MWOA 1PNJA 1NM7A 2MI6A 1M1KR 1Y96A 2CZ1B 1JRIA 4LDVA 2H8HA 3E1SA 3I9QA 1N8RC 2EW3A 1OU9A 4XU2A 1PD1A 3V8JA 3EFSA 2ZPBB 2E6ZA 4BI3A 4C8QG 1MGQA 3OYLA 3C94A 1FWZA 2CZ6B 4X34A 1GBQA 4M77C 2D8JA 2F2WA 3KFVA 2K5FA 4E7KA 4BY6C 3JCMQ 1C1AA 2E12A 1VQ8A 1BCOA 1JB0E 5FWBA 4RTWA 4C92C 1OX8A 1MNEA 1X75C 1DJ7B 3I35A 3CCJT 3AHUA 3GIBA 4QVZA 1T0JA 4IIOA 3EGXA 3L2ZA 5IH2A 2KYMA 4EIKA 2AZSA 5D7UA 1B3QA 3KXTA 4M7AG 4C0DB 5GMKh 2ED1A 1LNXA 1WHKA 4LDWA 5J26A 4C8QF 2RPNA 3G4SQ 5GANj 5IHIA 1OQKA 3HP9A 1VQPA 1W2BP 5FRMA 2COZA 1NLPC 2LJ1A 3QG1A 4J9DA 5GMKi 1VQPQ 5IHKA 2QASA 1VQMT 4FSXA 3G7ZA 4E7HA 2CZ0B 4KUDK 1T3SA 2NUTA 1KSWA 1IHVA 4JZ4A 2DVJA 1Q86U 1YJ9Q 2HZYA 2IG0A 1ZUUA 2LQWA 5GAOn 2QA4Q 2LC4A 5GMKe 3P8HA 3LGLA 4BD3A 1ARKA 2DA9A 4PK4A 1QVGS 4PJOD 2DEUA 3SB2A 2DNUA 3D7SB 1M8VA 1VOMA 1ZA1B 4AFSC 2HBPA 3CPWP 2MIOA 1YITT 3A8GB 3NGPA 1X2QA 4A4HA 1SRMA 4M7DB 3M55A 3G1JA 4ZTJA 3HSBA 4KH0B 5C0MA 3HRUA 2EJGA 3JB9J 2XDDA 2Y4XA 3LH0A 4C0GA 2BE9B 2RI5A 4PJOB 3EG2A 5GAN8 3LWHA 4FW1A 4HVUA 2DILA 2HQHA 2KGTA 2E64A 2JZ2A 2WSFE 3PFSA 4C92F 4J6XA 5FU6B 1JXMA 2CT4A 4LD6A 2CH4W 3LLRA 2GTOA 1SEMA 3X26B 4PJOF 1E7OA 4JRIA 2QAZA 1RI9A 7AT1B 2RHUA 3RMQA 2MCNA 2R57A 3V8KA 3NFCA 1H92A 5J3BA 2KVQG 4C0DC 3M59A 5KYUB 3MP6A 3QIIA 1VQ6Q 2WSEE 1PSEA 1MHNA 2FG0A 1YWOA 3VS0A 1CKBA 2DXUA 3JCMh 4JLGA 1AWXA 2J6OA 4C5HA 3VYHB 1UEBA 2ZPGB 3OYKA 5AT1B 1VYTA 2L3RA 4J6YA 3EH1A 4HA8A 2DL4A 4E7IA 5GAN4 4JZ3A 2K3YA 5LL6S 4PFZA 1ZSZB 4M78G 1YITQ 4KUIA 1VQPT 3G6ET 2P0KA 1OULA 4HCBA 5EG2A 4II1A 3T9NA 2EQUA 3MO8A 2NUZA 2GQIA 2HNIA 4GLKA 4MZPA 5DM7R 4EPCA 4BDZA 2K57A 1VQ5T 3EHQA 5CR2A 1QVFA 4RUGA 3OYCA 2MPXC 1K9MC 2X4JA 1K73R 3TEEA 4OMOA 2RH2A 2EQKA 4E2FB 1EX4A 4NOYA 2HL3A 3FJPA 1PRLC 1N9SA 5C6SA 1WFWA 3A1PA 3OMGA 1GCQA 1ZSZA 1YCSB 2RNAA 2HMAA 3VYGA 5GANf 4XTVA 3SDZA 3CC7A 5HY6A 5IAYA 2D1XA 3C4SA 1VQ4T 2KT1A 3N5BB 3VUZA 4C8QB 5FLXE 2EJFA 1WLPB 4BI8B 2MAMA 3UWNA 2RJFA 3CCQA 1I1JA 1RL2A 3WVDB 3CCRQ 2DYBA 4KULA 2QQSA 3CC7T 1OPKA 1RAGB 3JCMf 4OMMA 2X4YA 4JRPA 5GJVB 2J05A 1F1BB 2QEXQ 2CSIA 5GMKj 5CKEA 2QQAA 2RMOA 1YNZA 2ZGWA 4PJOE 4C5IA 2MWPA 3PVQA 4M77F 4F7UE 1VQMA 3SWNA 3S3NA 1VQ6A 3I56T 1NJIU 4XTZA 3TVTA 1BU1A 3BFMA 5CKHA 4CC7A 4D6WA 2A08A 1WXTA 4JJBA 4DEYA 3CCEA 2O9VA 2LT4A 1BYMA 2HL5C 2OX7A 2CP0A 3VKIA 2O2OA 5D6XA 2EKOA 4A4KA 2V26A 4M7AA 2CSQA 4RCCA 2CH4A 2HQXA 4J9FA 2BZ8A 2L8DA 2XMFA 3M0QA 2BZYA 4OMNA 2LJ0A 1Y07A 1K73C 1YJWT 2DLPA 2V1RA 4LE9A 4KT0E 1Y57A 3A8MB 2XG8D 3Q1JA 2VASA 3SEMA 2RO0A 2EBPA 1B34B 2M0OA 1XOVA 4BDYA 2WACA 4M7AF 5GANh 2IVWA 2K2VA 5HKCA 2VGNA 3I5RA 4AFZC 3A8HB 2F5TX 2D0NA 4FYYB 1ZSZC 1XTDA 1SF9A 3RUXA 1UFFA 1NYFA 3OA6A 2KMTA 2X3XD 1YN8A 5GMKl 1TG0A 4OB0B 3CC2Q 1R77A 2O4XB 3CPWS 2VC8A 3I56Q 3G71A 1E6HA 1I8FA 4HCKA 3L2RA 1K73U 2JJ9A 1Y71A 1VQKA 5KH6A 2COWA 2JTEA 4K11A 1XJWB 1KC8R 1GL5A 4J7IA 3L2QA 3CD6T 1EZZB 1QQJA 1KD1U 2O4XA 3BE3A 2DAQA 1IGQA 1VQOA 4ZGJB 5AYFA 1WXBA 3FRNA 2LT1A 4R0KA 3QZ5B 3DB3A 3X28B 1Q86C 1JEGA 2YHTA 3RKWA 1W2BA 4F7UG 3ER0A 3BDLA 2QQRA 1X69A 1HD3A 3MCAB 4EDUA 4MMLA 3ZFJA 1IXDA 5L23A 4M77B 2EJ9A 3KUFA 4JPBW 2KRSA 1VQ8Q 2CP7A 2RJCA 1O75A 3LWIA 1D1CA 5KYUA 2VGMA 2ROLA 4Z02A 2K7AA 2IPOB 2RB6A 2EIFA 1UJ0A 3RIRA 2YLBA 3WVEB 1W4SA 4MZTA 3SWNB 1C0MA 4F16A 4NS5A 2C06A 4XTWA 4P5NA 3UATA 3EGDA 3RESA 4J8OA 3DLMA 2C0OA 2LCLA 4PJNA 2O31A 2Z0WA 4KGZB 4ESRA 1U06A 3JAME 1WJQA 4WTOB 1AWJA 3RR6A 3CC4Q 4M7AD 1QCFA 1SHGA 2DK3A 1M2OA 1Y0MA 2E41A 4F17A 4A4EA 3S3OA 2K5LA 4X9DA 2DJQA 4X1VA 1M8MA 4GY5A 4J9EA 2L3SA 3PIPA 4LDXA 5LJ5e 1D0XA 2JM9A 2QI2A 3CMAT 1I5LA 2ZPHB 5KCHA 4LUEA 3X24B 1PC0A 3VS4A 5A2QE 2CREA 3CCLT 3S6WA 2FYKA 3H6ZA 2EYWA 1AEYA 2E70A 3I56A 1WIEA 1OU8A 1TUDA 3DLLA 1AHJB 3CCQQ 2MOXA 4JRKA 4N4HA 4HVWA 3OSVA 1RACB 2QEXT 2J6KA 2JS2A 2A7YA 3BW1A 2OAWA 4AMCA 5GAN5 2FEIA 4LUDA 3L42A 1R0CB 1YJWA 2ATCB 1X43A 2J6FA 1QMCA 1C6VX 1ZUKA 1VQ4Q 4OVAA 2X9HA 1BBZA 3VS7A 2PUKB 4Y28E 4O6JA 1D0ZA 4IUUA 1SSHA 2DX1A 3TREA 4LNPA 1BI1A 1K8AU 4PJOC 1UG1A 2P0PA 3QYGB 1LJOA 4ELYC 1UGRB 1VQLA 4TVRA 3CCRT 1YHQQ 1NEGA 5FW9A 2JN0A 5GAMg 4XTYA 4RTUA 3L2WA 5FU7C 1H3ZA 1Q86R 1WXUA 1NBEB 4C5GA 2VB6A 1WX6A 1WHMA 1WHLA 2DVEA 4AFQC 3UDCA 3CCUQ 2JOYA 1YI2Q 1QVFP 1T0HA 2DZCA 2DRMA 2EWNA 3CCJQ 1PSFA 1QWEA 5I2SA 2PVOB 2HCKA 3RDVA 1JJ2P 3JB9F 1SHFA 3CCST 2L5QA 5IN1A 2EYYA 4BE1A 1TWBA 2KK4A 4HKEA 2JVVA 4QKUA 3TSZA 1B07A 1VQ5Q 3CCUT 2K2MA 3MKDA 5D6YA 1U1TA 1JJ2S 4DA4A 5LJ3g 4RMOA 4CC3A 5CAIA 4PNOA 3CCLA 4IURA 1G2BA 2ZZDA 2PNIA 2QYZA 1YI2A 4HCZA 3NMZC 3CCUA 2M16A 5KYXA 3MP8A 1WHHA 2HD0A 5CKDA 5LJ3e 4LD9K 1ZQ1A 3G6EQ 2CYZB 5L8RE 2DTIA 3G6EA 2YRDA 5GJWB 4M75D 1YHQA 3MHXA 4M7DA 3A5ZB 1UGVA 2BTTA 1FX7A 3JB9I 2V8IA 3QKJA 3OYJA 1HYOA 2KRNA 4ZN3A 8ATCB 2GGRA 1N27A 2VXEA 4C0ZA 4PJOG 1BI0A 3J80E 5IT9E 4IIMA 4E7JA 3VJPA 5LJ3h 1UUEA 2BIVA 3CBPA 5FU7B 2XHCA 3IQLA 3CCQT 3JCMX 3CC2A 3CPWA 2A37A 2D9TA 2E6NA 1GCQC 4FM4B 1YBYA 2PZ1A 2KROA 2HSEB 1G83A 4M78E 3OS5A 2FRWA 4XK8E 4BUGA 2RHZA 2CKKA 4FYVB 2YWWA 1AWWA 3V7SA 1BI3A 1G3WA 2QDLA 1IREB 4O5VA 3OW2A 1X6BA 1IB8A 2VWFA 2LX9A 4RTXA 3JCMc 3E9GA 1FMVA 4FSSA 3M58A 2NWMA 1QKWA 1SPKA 1YCYA 2K5IA 4HT9A 5ECAA 5LJ5h 3FEOA 3LGFA 1UJYA 1M90C 4ORZA 2C0TA 2LQNA 1I4K1 1V76A 2KRMA 2XDBA 1PD0A 1QWFA 1WDXA 5GANe 4QVCA 2E4HA 5FU6C 3META 3GNGA 3CMEQ 1YJ9T 2E5QA 2OJ2A 2KBTA 4N4GA 3R6OA 1B7TA 1HXDA 1OX9A 3GF5A 3EH2A 3CCEQ 2YXYA 2VYTA 3HRTA 4WF2A 3GOXA 3VRYA 2CP5A 5DLOA 4M77D 1J3TA 2YUOA 2V8JA 2ROTA 2A0FB 3RNJA 4E6RA 2RI2A 4J9BA 6AT1B 3CCVQ 2AT1B 2X4XA 2DM1A 3H9NA 2M0YA 2E3HA 2KAFA 2LNHB 3C12A 4A53A 4L59A 1K9MR 1Q81R 3PVLA 2YRCA 2QGFB 1HSQA 2EAYA 4HXJA 2DL7A 2FPFA 4DBFA 2MMPA 4MMKA 4E47A 5LJ3j 2D0QB 4CC2A 1UECA 1ZHIA 2XD0A 4YTLA 2CGHA 3GNFB 4PL6A 3CCJA 3ASKA 4JJNK 2DXBA 3CXCS 4JDSA 4DOVA 3QXEB 5FROA 4EMKC 4VUBA 4J83A 1U8RA 4OGCA 3EG3A 4B9WA 2CZ7B 1KG1A 4F7UA 1KFZA 3VS5A 3TSWA 1Q81C 2H3EB 3CCLQ 1N8RR 2KEAA 3VUBA 1PKSA 2Y4YA 3P8DA 1VQLQ 1TTHB 2L0AA 1YP5A 2L3QA 4HCCA 4LN2A 2KXDA 1RLPC 4AT1B 4OMPA 1SG5A 5CIUA 1ZLMA 3GP8A 2D8HA 2P0QA 3M4YA 3OYFA 4PKCC 5DY9A 4M7AB 1EIFA 5CCAA 3OQ5A 1IO6A 3M54A 4GLMA 5I21A 2F5KA 1WJSA 3MPUB 3M57A 2E65A 1BCMA 3QHSA 5GAN3 4BY6B 3H41A 1JU5C 1MV0B 2SEMA 4IUTA 3RBBB 3QJ6A 4MZMA 3CC7Q 4PJJA 5LJ5d 3JB9H 2GFAA 2MK5A 1X6OA 2EYQA
chains in the Genus database with same CATH topology
2MPXC 1TOVA 2HKQB 4B6MA 2E3IA 1WHKA 2E4HA 2HL5C 2COWA 1WHMA 1LPLA 1WHLA 1WHHA 2CP0A 2E3HA 2M02A 1IXDA 2COZA 1TXQA 2HL3A 2QK0A 2CP7A 3TQ7P 2CP6A 2CP5A 2CP2A 2HKNA 2HQHA 3RDVA 1WHGA 2COYA 3E2UA 2Z0WA 1WHJA 2CP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPX C;  1TOV A;  2HKQ B;  4B6M A;  2E3I A;  1WHK A;  2E4H A;  2HL5 C;  2COW A;  1WHM A;  1LPL A;  1WHL A;  1WHH A;  2CP0 A;  2E3H A;  2M02 A;  1IXD A;  2COZ A;  1TXQ A;  2HL3 A;  2QK0 A;  2CP7 A;  3TQ7 P;  2CP6 A;  2CP5 A;  2CP2 A;  2HKN A;  2HQH A;  3RDV A;  1WHG A;  2COY A;  3E2U A;  2Z0W A;  1WHJ A;  2CP3 A; 
#chains in the Genus database with same CATH topology
 2XK0 A;  1M9S A;  1VQL T;  3BY7 A;  1IZ6 A;  4ZGD B;  2GTJ A;  4RTY A;  2O9S A;  3EG9 A;  2LQK A;  2L89 A;  3M0U A;  1M30 A;  3FLG A;  2FHD A;  2AHJ B;  2EFI A;  2RHX A;  1PRM C;  1VYU A;  2PQW A;  2QDY B;  1GXI E;  3J7A F;  4JJC A;  2CT3 A;  1Z9Z A;  1R8O B;  4ZGE B;  1RAA B;  1RUW A;  4MDX A;  1LOJ A;  5GAN g;  1VQ8 T;  4FCY A;  4JRQ A;  1MMG A;  2QXF A;  3C0C A;  2E10 A;  2ECZ A;  1QLY A;  3QYH B;  2EQI A;  4KRT A;  1VQN A;  1GFD A;  5FWC A;  2YUQ A;  1M1K U;  3CC4 A;  3L2V A;  4RKU E;  5KCO A;  3BDU A;  3CEY A;  4M78 A;  1LVK A;  4A4G A;  1K0S A;  1QW1 A;  3TU4 K;  1D1B A;  1PCX A;  1X01 A;  3GLX A;  4OMQ A;  4BE2 A;  3OBY A;  3OW2 S;  1EFN A;  1TUC A;  3VS1 A;  2BZX A;  3CCM T;  5J39 A;  1UB4 A;  1TSF A;  2FPD A;  4OGE A;  3EHR A;  3CCV A;  1NLO C;  4Z89 A;  5GAM j;  3PNW C;  1QVG P;  3QSU A;  1XQH A;  2QQ9 A;  2DL8 A;  3LH5 A;  2JXB A;  2C0I A;  3V8L A;  1YIJ T;  2F69 A;  3HFN A;  1CSK A;  1M3C A;  3F70 A;  5FRN A;  2RN8 A;  4Q5W A;  4J9G A;  1OI1 A;  2XU8 A;  2XDP A;  3UT1 A;  2JMC A;  3NHN A;  1YJN T;  3TCJ A;  3JB9 D;  1RAD B;  4F14 A;  3AT1 B;  2LCS A;  1D3B A;  1UHC A;  2KE9 A;  2YUN A;  1Q82 R;  4PLL A;  1QKX A;  4KGX B;  1HJD A;  2JNG A;  4M7D E;  1OPL A;  3EFO B;  5GAM e;  1VQ4 A;  4RG2 A;  3PTA A;  3INZ A;  3NTH A;  4HVV A;  2V8K A;  2HSP A;  1AWO A;  1AZE A;  1WPY A;  4EMH A;  4M75 A;  4RTZ A;  2YSQ A;  4JUV A;  1RI0 A;  2HAX A;  3E19 A;  3JCM V;  3M9Q A;  1G3T A;  3OMC A;  1ABQ A;  1QVG A;  2ENM A;  1YFN A;  1KC8 C;  2DL3 A;  4V2S A;  1WHJ A;  3LYI A;  1Q7Y R;  4M7D F;  1OV3 A;  3HPW A;  1M2V B;  1AZG B;  3QO3 A;  2WSC E;  4ELZ C;  3URG A;  2OAU A;  1GRI A;  2RHI A;  2AZV A;  1VA7 A;  3X25 B;  2YT6 A;  1NJI C;  3M56 A;  2EQM A;  2JT4 A;  5A0G A;  1VQK Q;  3OYY A;  2M51 A;  2HBW A;  2FZK B;  2ED0 A;  1WNL A;  4R55 A;  3PGG A;  2CDT A;  2AKK A;  1OZ2 A;  5GAN 2;  3OB9 A;  2K9G A;  2FO0 A;  3M4G A;  2BKD N;  3OY9 A;  1TUG B;  3CCV T;  3SD4 A;  2FZG B;  4BE0 A;  1MMD A;  2RM4 A;  2X4W A;  1YIJ Q;  2LTO A;  2QGG A;  4M78 C;  1RAH B;  2GF7 A;  2KYB A;  3M53 A;  1QP2 A;  4C92 E;  3QUI A;  2DYI A;  2J06 A;  4QW2 A;  1VQM Q;  2NUP A;  2AK5 A;  3PT9 A;  4J6W A;  4C8Q C;  3O8V A;  1KQS S;  1U3O A;  2ZCF B;  4N4I A;  1VQ5 A;  3V7R A;  5KYX B;  1M1G A;  4E7Z A;  2DXC A;  3UPU A;  3RER A;  2PVD B;  1TU0 B;  1VUB A;  3I55 A;  4OP0 A;  1U5S A;  1WHG A;  2R5M A;  3DB4 A;  2RQW A;  1QCO A;  1Q7Y C;  2K3B A;  2E1H A;  3A98 A;  1WQW A;  4XU3 A;  4M77 E;  4F7U F;  2KQW A;  1UDL A;  2R58 A;  2LP5 A;  2NYS A;  3OS1 A;  5IXB A;  1A0N B;  2EGA A;  2FB7 A;  4J9C A;  1NYG A;  3NTK A;  1ZX6 A;  2X35 A;  1KIK A;  1D1A A;  1QCN A;  1VQK T;  4MDW A;  3GPL A;  1TS9 A;  3ME9 A;  4C8Q A;  4ZN1 A;  3M0R A;  3ZL7 C;  2QQB A;  2GCX A;  3CCS A;  1TXQ A;  5KE2 A;  1RAB B;  1W70 A;  2LMJ A;  1MMN A;  2XIC A;  4J9I A;  3KBG A;  2DER A;  4KBM B;  4LDY A;  4M75 F;  4IUQ A;  4LDU A;  2XID A;  3S3M A;  3ZEH A;  1K76 A;  1VQ6 T;  4EMK A;  3QDF A;  2JM8 A;  2DE0 X;  1M5Q 1;  1D3B B;  5KYY B;  2M02 A;  1MUZ A;  4ATO A;  1WJR A;  2A36 A;  1P92 A;  3VRZ A;  2V1Q A;  4BI4 A;  4DEX A;  1JXO A;  4D8D A;  1PWT A;  4RG8 A;  1M2V A;  3EAE A;  3VV0 A;  2YUP A;  5GAO q;  2VV5 A;  2I0N A;  3QPH A;  1QVF S;  1YWP A;  1YIT A;  1I5O B;  1ABO A;  2B86 A;  1UHF A;  3CBO A;  3OYA A;  1BI2 A;  3SFM A;  4FIB A;  2JUF A;  4RTT A;  4OB2 B;  4M7A C;  4GBQ A;  5CQX A;  4M78 F;  3M0T A;  4FYW B;  3JCM J;  2HQE A;  2DBM A;  1GFC A;  2CUB A;  4B9X A;  4D8K A;  1WI7 A;  3H0H A;  5KYN A;  4QT7 A;  3L2U A;  3G4S A;  1M90 U;  1ZUY A;  3JCM W;  2LCC A;  4PJL A;  2L3P A;  3I55 T;  4PFP A;  1ZBJ A;  2DF6 A;  2HKQ B;  1VIE A;  4CI0 C;  2LZ6 B;  2BUD A;  2PUO B;  3REB B;  3JV3 A;  4OF1 A;  4EMK B;  1VQ7 Q;  2KT8 A;  2DET A;  2KNB B;  4RCB A;  5A0D A;  4QQD A;  4F04 B;  2NUP B;  4A54 A;  2K79 A;  2M1H A;  2BE7 D;  3CXC P;  3OYM A;  2EYZ A;  4M75 C;  1KJW A;  2JS0 A;  2FVU A;  1UGQ B;  1V29 B;  1B34 A;  3JSC A;  2E5K A;  2CS7 A;  5KYW B;  1KQ2 A;  1Q81 U;  5LJ3 d;  2CP6 A;  1K8A C;  3ULR B;  1YIJ A;  2RQR A;  3M0S A;  3ZBD A;  1SKU B;  8AT1 B;  3OW2 P;  4M7D C;  1FMW A;  2DTH A;  1G3S A;  3CCE T;  3LW5 E;  4QQG A;  1UTI A;  2RK1 A;  3FDR A;  4Z8A A;  2FPE A;  2X51 A;  1SSF A;  2RJD A;  4JJD A;  4CC4 B;  4IUP A;  1IRX A;  4JS4 A;  4EMG A;  2DMO A;  3QDR B;  3E2U A;  4RTV A;  1W6X A;  1YJ9 A;  2OI3 A;  2RQV A;  2B8A A;  4M7A E;  2KI7 A;  3GBQ A;  3OYI A;  1BKB A;  3FIF A;  3HFO A;  1WQ7 A;  1NPP A;  2EYX A;  4OB1 B;  5GAM d;  1KQ1 A;  2JW4 A;  2LX7 A;  2ZPI B;  3SWN C;  5LJ5 g;  2DPP B;  4C92 D;  2VUB A;  3PIO A;  2IIM A;  4KGV B;  3JCM P;  4M75 G;  3NTI A;  4JS5 A;  4M75 B;  1ZA2 B;  3EFO A;  2P4R A;  2RQT A;  2R5A A;  1CKA A;  1VQ7 T;  1JO8 A;  3CC2 T;  3HL8 A;  3G71 Q;  1G5V A;  3LX7 A;  1YJW Q;  4M78 D;  4XU1 A;  1PM3 A;  2KR3 A;  2QA4 A;  5GAO p;  1HK9 A;  5LJ5 j;  2LVM A;  1X6G A;  1Q95 G;  1ZSG A;  2L2P A;  3VU3 C;  9ATC B;  4C92 A;  2F2V A;  2RF0 A;  3OYN A;  1BIA A;  4F7U B;  2OTL Q;  1KQS A;  2DEQ A;  2EVR A;  1IHW A;  1VQN T;  4JLI A;  2OTJ A;  1M1K C;  3I5S A;  1K9M U;  3G71 T;  2RK2 A;  1OZ3 A;  1G3Y A;  2KDS A;  2QK0 A;  1JJ2 A;  3TQ7 P;  4DBH A;  1M90 R;  3J81 E;  3QJY A;  5CO7 A;  2A3L A;  2ZAE A;  2LQ8 A;  2DFU A;  2QTX A;  3EGX B;  3PMI A;  4FYX B;  3FJ5 A;  3QWY A;  1VQO T;  3L1A A;  3THK A;  1YJN Q;  2K6D A;  3CQT A;  5KYY A;  2FZC B;  3CXC A;  4C8Q E;  3OYD A;  2KY9 A;  4OML A;  2DZ9 A;  1K4U S;  3QZ9 B;  2M9U A;  5I22 A;  1NEB A;  2DO3 A;  2DIQ A;  3UA7 A;  3V7C A;  1R0B G;  1KK7 A;  2DD4 A;  2DRK A;  1VYV A;  1X27 A;  3A8L B;  5HK0 A;  2G6F X;  4WCI A;  5GAO l;  1N8R U;  4Y92 A;  4C0F A;  2HEQ A;  2VVK A;  3OYG A;  1AVZ C;  3MEU A;  3HKS A;  1W1F A;  5IHN A;  3HHT B;  2YRV A;  2YLC A;  5M9O A;  2P84 A;  2XKO C;  1I0C A;  4DQ2 A;  2O01 E;  4XTX A;  1PHT A;  1WA7 A;  5GAN d;  2CUD A;  4C92 B;  3G4S T;  5I2M A;  3H8Z A;  3VS3 A;  1KHC A;  1H64 1;  3NPF A;  2GBQ A;  1FYN A;  5LJ3 f;  3CD6 Q;  1KHI A;  1FMK A;  1RAI B;  1BK2 A;  3CCR A;  1NG2 A;  1RAE B;  1VQ7 A;  1K0X A;  4AFU C;  2I2L A;  2YDL A;  2GNC A;  3P8B B;  5CVI A;  4DOW A;  4C92 G;  1VQ9 A;  1JQQ A;  3A8O B;  2NLU A;  2RHY A;  2E3I A;  3RKY A;  1X2K A;  1LPL A;  3EGU A;  3UF4 A;  1N9R A;  2LNV A;  4M77 A;  4FT4 A;  4NL3 A;  1M4Z A;  1M27 C;  1VQO Q;  2ESW A;  2DXT A;  1FXX A;  4DBQ A;  2F2X A;  1K1Z A;  4HT8 A;  1S72 A;  2ZPE B;  4N0A A;  2O88 A;  2OTJ T;  2OTL A;  1OEB A;  2COY A;  3MEV A;  4R56 A;  2QG9 B;  4DBR A;  4QVD A;  4ZNX A;  1NPR A;  3JCM b;  1O9S A;  2EGE A;  4PJM A;  2DTO A;  1RLQ C;  5CK9 A;  2W10 A;  3H0F A;  2J7I A;  3VS6 A;  4J5Y A;  3EG0 A;  2JMA A;  1IGU A;  5D6W A;  5KE3 A;  1Q82 U;  2OTL T;  4XU0 A;  5GAM h;  1D0Y A;  4IKF A;  2EGC A;  4N0A C;  2MYS A;  1UGP B;  2KSS A;  2AIR B;  1Z9Q A;  3I55 Q;  1BB9 A;  4FL6 A;  1GBR A;  3UA6 A;  4M7D G;  2D6F A;  4NL2 A;  1BIB A;  1AT1 B;  1E6G A;  4FW2 A;  4M4Z A;  1I07 A;  3U23 A;  1GCP A;  3EG1 A;  5A0L A;  3JCM d;  1NZ9 A;  1K9A A;  4PJO A;  3JRZ A;  3C95 A;  4X9C A;  3CMA Q;  1NJI R;  2RQU A;  1D09 B;  3CPF A;  3VS2 A;  3FC3 A;  2LJ3 A;  1UGS B;  4BAC A;  3EFR A;  3OYH A;  1MND A;  4C8Q D;  2JTM A;  1W2B S;  3M5A A;  4C5E A;  3SHW A;  4XQ3 A;  1OYX A;  3PMT A;  4Z88 A;  2Y90 A;  2K4Y A;  4IUV A;  3CBM A;  1Q82 C;  1N5Z A;  1WGS A;  1PG5 B;  3H0I A;  3CC4 T;  4PFO A;  3MEW A;  2QA4 T;  4A4F A;  5GAN 7;  3CD6 A;  3OYE A;  1Y96 B;  2CP3 A;  4J7F A;  1VQ9 T;  1N6A A;  2HDA A;  2SRC A;  5KYW A;  3QWX X;  1G8X A;  1M3A A;  2DD5 A;  2OTJ Q;  3CCM A;  4BB7 A;  4KH1 B;  2JTF A;  3HRS A;  2PU9 B;  3CMA A;  2PVG B;  2GQV A;  4OMF B;  1T3L A;  3PE0 A;  3WXM B;  3CCM Q;  1LCK A;  4AG2 C;  5EC7 A;  2EKH A;  2DKG A;  5GAO r;  2QEX A;  1QVP A;  1TH7 A;  2FRY A;  1TOV A;  5GAM f;  3X20 B;  3REA B;  1Q7Y U;  2DIG A;  2RJE A;  5I11 A;  4Y91 A;  3CME A;  3OSS C;  1S72 T;  2ZPF B;  3JB9 G;  4CRI A;  4L6V 5;  2F1L A;  5GAN 6;  1KC8 U;  1WYX A;  4E7S A;  1Y7X A;  1KD1 R;  3DKM A;  1YI2 T;  1RAF B;  3FB9 A;  3M0P A;  4XTU A;  3CME T;  1S1N A;  1S72 Q;  2P4T A;  2X3W D;  3CCS Q;  2DL5 A;  2K3X A;  2PTK A;  1YHQ T;  1H3H A;  3RKX A;  4M77 G;  1OOT A;  4J9H A;  1KD1 C;  1M1F A;  3MEA A;  2H3J A;  1V1C A;  2W0Z A;  2NUT B;  3HTR A;  1MV3 A;  2CP2 A;  2EQJ A;  1M3B A;  2HKN A;  4A63 B;  2GFU A;  2RA2 A;  4ME7 A;  4FT2 A;  3O5Z A;  2FL7 A;  5GMK m;  2A28 A;  1I81 A;  3RMS A;  1VQ9 Q;  1JBM A;  3OBW A;  4AG1 C;  4ANJ A;  3OS2 A;  2VKN A;  3MJX A;  5CKF A;  2QTV A;  4ZTF A;  5CQY A;  1VIF A;  1AOJ A;  2LDM A;  3OS0 A;  1UE9 A;  3E9F A;  3JCM g;  2KXC A;  1U1S A;  3QBY A;  4L5G A;  2RD1 A;  1H8K A;  2DJZ A;  4E7L A;  4B6M A;  1WZO A;  3EG9 B;  4XAX B;  4M7D D;  1PKT A;  4OB3 B;  4PLI A;  5LJ5 f;  5GAO m;  3R6N A;  3OYB A;  1KQS P;  4QQ6 A;  5IXF A;  4M75 E;  5HK3 A;  5DLQ E;  1K8A R;  3MP1 A;  3JCM e;  4UC4 A;  2G3R A;  1VQN Q;  4LXC A;  2VXF A;  1SRL A;  4FU6 A;  5CKB A;  4M78 B;  2DBK A;  3EGD B;  1ZBX A;  2ABL A;  1AD5 A;  1QP3 A;  2LRQ A;  2AKL A;  2MF2 A;  5HCK A;  1NE8 A;  2RI3 A;  2EPD A;  1XNI A;  2XI9 A;  1MMA A;  1YJN A;  1ACM B;  2MWO A;  1PNJ A;  1NM7 A;  2MI6 A;  1M1K R;  1Y96 A;  2CZ1 B;  1JRI A;  4LDV A;  2H8H A;  3E1S A;  3I9Q A;  1N8R C;  2EW3 A;  1OU9 A;  4XU2 A;  1PD1 A;  3V8J A;  3EFS A;  2ZPB B;  2E6Z A;  4BI3 A;  4C8Q G;  1MGQ A;  3OYL A;  3C94 A;  1FWZ A;  2CZ6 B;  4X34 A;  1GBQ A;  4M77 C;  2D8J A;  2F2W A;  3KFV A;  2K5F A;  4E7K A;  4BY6 C;  3JCM Q;  1C1A A;  2E12 A;  1VQ8 A;  1BCO A;  1JB0 E;  5FWB A;  4RTW A;  4C92 C;  1OX8 A;  1MNE A;  1X75 C;  1DJ7 B;  3I35 A;  3CCJ T;  3AHU A;  3GIB A;  4QVZ A;  1T0J A;  4IIO A;  3EGX A;  3L2Z A;  5IH2 A;  2KYM A;  4EIK A;  2AZS A;  5D7U A;  1B3Q A;  3KXT A;  4M7A G;  4C0D B;  5GMK h;  2ED1 A;  1LNX A;  1WHK A;  4LDW A;  5J26 A;  4C8Q F;  2RPN A;  3G4S Q;  5GAN j;  5IHI A;  1OQK A;  3HP9 A;  1VQP A;  1W2B P;  5FRM A;  2COZ A;  1NLP C;  2LJ1 A;  3QG1 A;  4J9D A;  5GMK i;  1VQP Q;  5IHK A;  2QAS A;  1VQM T;  4FSX A;  3G7Z A;  4E7H A;  2CZ0 B;  4KUD K;  1T3S A;  2NUT A;  1KSW A;  1IHV A;  4JZ4 A;  2DVJ A;  1Q86 U;  1YJ9 Q;  2HZY A;  2IG0 A;  1ZUU A;  2LQW A;  5GAO n;  2QA4 Q;  2LC4 A;  5GMK e;  3P8H A;  3LGL A;  4BD3 A;  1ARK A;  2DA9 A;  4PK4 A;  1QVG S;  4PJO D;  2DEU A;  3SB2 A;  2DNU A;  3D7S B;  1M8V A;  1VOM A;  1ZA1 B;  4AFS C;  2HBP A;  3CPW P;  2MIO A;  1YIT T;  3A8G B;  3NGP A;  1X2Q A;  4A4H A;  1SRM A;  4M7D B;  3M55 A;  3G1J A;  4ZTJ A;  3HSB A;  4KH0 B;  5C0M A;  3HRU A;  2EJG A;  3JB9 J;  2XDD A;  2Y4X A;  3LH0 A;  4C0G A;  2BE9 B;  2RI5 A;  4PJO B;  3EG2 A;  5GAN 8;  3LWH A;  4FW1 A;  4HVU A;  2DIL A;  2HQH A;  2KGT A;  2E64 A;  2JZ2 A;  2WSF E;  3PFS A;  4C92 F;  4J6X A;  5FU6 B;  1JXM A;  2CT4 A;  4LD6 A;  2CH4 W;  3LLR A;  2GTO A;  1SEM A;  3X26 B;  4PJO F;  1E7O A;  4JRI A;  2QAZ A;  1RI9 A;  7AT1 B;  2RHU A;  3RMQ A;  2MCN A;  2R57 A;  3V8K A;  3NFC A;  1H92 A;  5J3B A;  2KVQ G;  4C0D C;  3M59 A;  5KYU B;  3MP6 A;  3QII A;  1VQ6 Q;  2WSE E;  1PSE A;  1MHN A;  2FG0 A;  1YWO A;  3VS0 A;  1CKB A;  2DXU A;  3JCM h;  4JLG A;  1AWX A;  2J6O A;  4C5H A;  3VYH B;  1UEB A;  2ZPG B;  3OYK A;  5AT1 B;  1VYT A;  2L3R A;  4J6Y A;  3EH1 A;  4HA8 A;  2DL4 A;  4E7I A;  5GAN 4;  4JZ3 A;  2K3Y A;  5LL6 S;  4PFZ A;  1ZSZ B;  4M78 G;  1YIT Q;  4KUI A;  1VQP T;  3G6E T;  2P0K A;  1OUL A;  4HCB A;  5EG2 A;  4II1 A;  3T9N A;  2EQU A;  3MO8 A;  2NUZ A;  2GQI A;  2HNI A;  4GLK A;  4MZP A;  5DM7 R;  4EPC A;  4BDZ A;  2K57 A;  1VQ5 T;  3EHQ A;  5CR2 A;  1QVF A;  4RUG A;  3OYC A;  2MPX C;  1K9M C;  2X4J A;  1K73 R;  3TEE A;  4OMO A;  2RH2 A;  2EQK A;  4E2F B;  1EX4 A;  4NOY A;  2HL3 A;  3FJP A;  1PRL C;  1N9S A;  5C6S A;  1WFW A;  3A1P A;  3OMG A;  1GCQ A;  1ZSZ A;  1YCS B;  2RNA A;  2HMA A;  3VYG A;  5GAN f;  4XTV A;  3SDZ A;  3CC7 A;  5HY6 A;  5IAY A;  2D1X A;  3C4S A;  1VQ4 T;  2KT1 A;  3N5B B;  3VUZ A;  4C8Q B;  5FLX E;  2EJF A;  1WLP B;  4BI8 B;  2MAM A;  3UWN A;  2RJF A;  3CCQ A;  1I1J A;  1RL2 A;  3WVD B;  3CCR Q;  2DYB A;  4KUL A;  2QQS A;  3CC7 T;  1OPK A;  1RAG B;  3JCM f;  4OMM A;  2X4Y A;  4JRP A;  5GJV B;  2J05 A;  1F1B B;  2QEX Q;  2CSI A;  5GMK j;  5CKE A;  2QQA A;  2RMO A;  1YNZ A;  2ZGW A;  4PJO E;  4C5I A;  2MWP A;  3PVQ A;  4M77 F;  4F7U E;  1VQM A;  3SWN A;  3S3N A;  1VQ6 A;  3I56 T;  1NJI U;  4XTZ A;  3TVT A;  1BU1 A;  3BFM A;  5CKH A;  4CC7 A;  4D6W A;  2A08 A;  1WXT A;  4JJB A;  4DEY A;  3CCE A;  2O9V A;  2LT4 A;  1BYM A;  2HL5 C;  2OX7 A;  2CP0 A;  3VKI A;  2O2O A;  5D6X A;  2EKO A;  4A4K A;  2V26 A;  4M7A A;  2CSQ A;  4RCC A;  2CH4 A;  2HQX A;  4J9F A;  2BZ8 A;  2L8D A;  2XMF A;  3M0Q A;  2BZY A;  4OMN A;  2LJ0 A;  1Y07 A;  1K73 C;  1YJW T;  2DLP A;  2V1R A;  4LE9 A;  4KT0 E;  1Y57 A;  3A8M B;  2XG8 D;  3Q1J A;  2VAS A;  3SEM A;  2RO0 A;  2EBP A;  1B34 B;  2M0O A;  1XOV A;  4BDY A;  2WAC A;  4M7A F;  5GAN h;  2IVW A;  2K2V A;  5HKC A;  2VGN A;  3I5R A;  4AFZ C;  3A8H B;  2F5T X;  2D0N A;  4FYY B;  1ZSZ C;  1XTD A;  1SF9 A;  3RUX A;  1UFF A;  1NYF A;  3OA6 A;  2KMT A;  2X3X D;  1YN8 A;  5GMK l;  1TG0 A;  4OB0 B;  3CC2 Q;  1R77 A;  2O4X B;  3CPW S;  2VC8 A;  3I56 Q;  3G71 A;  1E6H A;  1I8F A;  4HCK A;  3L2R A;  1K73 U;  2JJ9 A;  1Y71 A;  1VQK A;  5KH6 A;  2COW A;  2JTE A;  4K11 A;  1XJW B;  1KC8 R;  1GL5 A;  4J7I A;  3L2Q A;  3CD6 T;  1EZZ B;  1QQJ A;  1KD1 U;  2O4X A;  3BE3 A;  2DAQ A;  1IGQ A;  1VQO A;  4ZGJ B;  5AYF A;  1WXB A;  3FRN A;  2LT1 A;  4R0K A;  3QZ5 B;  3DB3 A;  3X28 B;  1Q86 C;  1JEG A;  2YHT A;  3RKW A;  1W2B A;  4F7U G;  3ER0 A;  3BDL A;  2QQR A;  1X69 A;  1HD3 A;  3MCA B;  4EDU A;  4MML A;  3ZFJ A;  1IXD A;  5L23 A;  4M77 B;  2EJ9 A;  3KUF A;  4JPB W;  2KRS A;  1VQ8 Q;  2CP7 A;  2RJC A;  1O75 A;  3LWI A;  1D1C A;  5KYU A;  2VGM A;  2ROL A;  4Z02 A;  2K7A A;  2IPO B;  2RB6 A;  2EIF A;  1UJ0 A;  3RIR A;  2YLB A;  3WVE B;  1W4S A;  4MZT A;  3SWN B;  1C0M A;  4F16 A;  4NS5 A;  2C06 A;  4XTW A;  4P5N A;  3UAT A;  3EGD A;  3RES A;  4J8O A;  3DLM A;  2C0O A;  2LCL A;  4PJN A;  2O31 A;  2Z0W A;  4KGZ B;  4ESR A;  1U06 A;  3JAM E;  1WJQ A;  4WTO B;  1AWJ A;  3RR6 A;  3CC4 Q;  4M7A D;  1QCF A;  1SHG A;  2DK3 A;  1M2O A;  1Y0M A;  2E41 A;  4F17 A;  4A4E A;  3S3O A;  2K5L A;  4X9D A;  2DJQ A;  4X1V A;  1M8M A;  4GY5 A;  4J9E A;  2L3S A;  3PIP A;  4LDX A;  5LJ5 e;  1D0X A;  2JM9 A;  2QI2 A;  3CMA T;  1I5L A;  2ZPH B;  5KCH A;  4LUE A;  3X24 B;  1PC0 A;  3VS4 A;  5A2Q E;  2CRE A;  3CCL T;  3S6W A;  2FYK A;  3H6Z A;  2EYW A;  1AEY A;  2E70 A;  3I56 A;  1WIE A;  1OU8 A;  1TUD A;  3DLL A;  1AHJ B;  3CCQ Q;  2MOX A;  4JRK A;  4N4H A;  4HVW A;  3OSV A;  1RAC B;  2QEX T;  2J6K A;  2JS2 A;  2A7Y A;  3BW1 A;  2OAW A;  4AMC A;  5GAN 5;  2FEI A;  4LUD A;  3L42 A;  1R0C B;  1YJW A;  2ATC B;  1X43 A;  2J6F A;  1QMC A;  1C6V X;  1ZUK A;  1VQ4 Q;  4OVA A;  2X9H A;  1BBZ A;  3VS7 A;  2PUK B;  4Y28 E;  4O6J A;  1D0Z A;  4IUU A;  1SSH A;  2DX1 A;  3TRE A;  4LNP A;  1BI1 A;  1K8A U;  4PJO C;  1UG1 A;  2P0P A;  3QYG B;  1LJO A;  4ELY C;  1UGR B;  1VQL A;  4TVR A;  3CCR T;  1YHQ Q;  1NEG A;  5FW9 A;  2JN0 A;  5GAM g;  4XTY A;  4RTU A;  3L2W A;  5FU7 C;  1H3Z A;  1Q86 R;  1WXU A;  1NBE B;  4C5G A;  2VB6 A;  1WX6 A;  1WHM A;  1WHL A;  2DVE A;  4AFQ C;  3UDC A;  3CCU Q;  2JOY A;  1YI2 Q;  1QVF P;  1T0H A;  2DZC A;  2DRM A;  2EWN A;  3CCJ Q;  1PSF A;  1QWE A;  5I2S A;  2PVO B;  2HCK A;  3RDV A;  1JJ2 P;  3JB9 F;  1SHF A;  3CCS T;  2L5Q A;  5IN1 A;  2EYY A;  4BE1 A;  1TWB A;  2KK4 A;  4HKE A;  2JVV A;  4QKU A;  3TSZ A;  1B07 A;  1VQ5 Q;  3CCU T;  2K2M A;  3MKD A;  5D6Y A;  1U1T A;  1JJ2 S;  4DA4 A;  5LJ3 g;  4RMO A;  4CC3 A;  5CAI A;  4PNO A;  3CCL A;  4IUR A;  1G2B A;  2ZZD A;  2PNI A;  2QYZ A;  1YI2 A;  4HCZ A;  3NMZ C;  3CCU A;  2M16 A;  5KYX A;  3MP8 A;  1WHH A;  2HD0 A;  5CKD A;  5LJ3 e;  4LD9 K;  1ZQ1 A;  3G6E Q;  2CYZ B;  5L8R E;  2DTI A;  3G6E A;  2YRD A;  5GJW B;  4M75 D;  1YHQ A;  3MHX A;  4M7D A;  3A5Z B;  1UGV A;  2BTT A;  1FX7 A;  3JB9 I;  2V8I A;  3QKJ A;  3OYJ A;  1HYO A;  2KRN A;  4ZN3 A;  8ATC B;  2GGR A;  1N27 A;  2VXE A;  4C0Z A;  4PJO G;  1BI0 A;  3J80 E;  5IT9 E;  4IIM A;  4E7J A;  3VJP A;  5LJ3 h;  1UUE A;  2BIV A;  3CBP A;  5FU7 B;  2XHC A;  3IQL A;  3CCQ T;  3JCM X;  3CC2 A;  3CPW A;  2A37 A;  2D9T A;  2E6N A;  1GCQ C;  4FM4 B;  1YBY A;  2PZ1 A;  2KRO A;  2HSE B;  1G83 A;  4M78 E;  3OS5 A;  2FRW A;  4XK8 E;  4BUG A;  2RHZ A;  2CKK A;  4FYV B;  2YWW A;  1AWW A;  3V7S A;  1BI3 A;  1G3W A;  2QDL A;  1IRE B;  4O5V A;  3OW2 A;  1X6B A;  1IB8 A;  2VWF A;  2LX9 A;  4RTX A;  3JCM c;  3E9G A;  1FMV A;  4FSS A;  3M58 A;  2NWM A;  1QKW A;  1SPK A;  1YCY A;  2K5I A;  4HT9 A;  5ECA A;  5LJ5 h;  3FEO A;  3LGF A;  1UJY A;  1M90 C;  4ORZ A;  2C0T A;  2LQN A;  1I4K 1;  1V76 A;  2KRM A;  2XDB A;  1PD0 A;  1QWF A;  1WDX A;  5GAN e;  4QVC A;  2E4H A;  5FU6 C;  3MET A;  3GNG A;  3CME Q;  1YJ9 T;  2E5Q A;  2OJ2 A;  2KBT A;  4N4G A;  3R6O A;  1B7T A;  1HXD A;  1OX9 A;  3GF5 A;  3EH2 A;  3CCE Q;  2YXY A;  2VYT A;  3HRT A;  4WF2 A;  3GOX A;  3VRY A;  2CP5 A;  5DLO A;  4M77 D;  1J3T A;  2YUO A;  2V8J A;  2ROT A;  2A0F B;  3RNJ A;  4E6R A;  2RI2 A;  4J9B A;  6AT1 B;  3CCV Q;  2AT1 B;  2X4X A;  2DM1 A;  3H9N A;  2M0Y A;  2E3H A;  2KAF A;  2LNH B;  3C12 A;  4A53 A;  4L59 A;  1K9M R;  1Q81 R;  3PVL A;  2YRC A;  2QGF B;  1HSQ A;  2EAY A;  4HXJ A;  2DL7 A;  2FPF A;  4DBF A;  2MMP A;  4MMK A;  4E47 A;  5LJ3 j;  2D0Q B;  4CC2 A;  1UEC A;  1ZHI A;  2XD0 A;  4YTL A;  2CGH A;  3GNF B;  4PL6 A;  3CCJ A;  3ASK A;  4JJN K;  2DXB A;  3CXC S;  4JDS A;  4DOV A;  3QXE B;  5FRO A;  4EMK C;  4VUB A;  4J83 A;  1U8R A;  4OGC A;  3EG3 A;  4B9W A;  2CZ7 B;  1KG1 A;  4F7U A;  1KFZ A;  3VS5 A;  3TSW A;  1Q81 C;  2H3E B;  3CCL Q;  1N8R R;  2KEA A;  3VUB A;  1PKS A;  2Y4Y A;  3P8D A;  1VQL Q;  1TTH B;  2L0A A;  1YP5 A;  2L3Q A;  4HCC A;  4LN2 A;  2KXD A;  1RLP C;  4AT1 B;  4OMP A;  1SG5 A;  5CIU A;  1ZLM A;  3GP8 A;  2D8H A;  2P0Q A;  3M4Y A;  3OYF A;  4PKC C;  5DY9 A;  4M7A B;  1EIF A;  5CCA A;  3OQ5 A;  1IO6 A;  3M54 A;  4GLM A;  5I21 A;  2F5K A;  1WJS A;  3MPU B;  3M57 A;  2E65 A;  1BCM A;  3QHS A;  5GAN 3;  4BY6 B;  3H41 A;  1JU5 C;  1MV0 B;  2SEM A;  4IUT A;  3RBB B;  3QJ6 A;  4MZM A;  3CC7 Q;  4PJJ A;  5LJ5 d;  3JB9 H;  2GFA A;  2MK5 A;  1X6O A;  2EYQ A; 
#chains in the Genus database with same CATH homology
 2MPX C;  1TOV A;  2HKQ B;  4B6M A;  2E3I A;  1WHK A;  2E4H A;  2HL5 C;  2COW A;  1WHM A;  1LPL A;  1WHL A;  1WHH A;  2CP0 A;  2E3H A;  2M02 A;  1IXD A;  2COZ A;  1TXQ A;  2HL3 A;  2QK0 A;  2CP7 A;  3TQ7 P;  2CP6 A;  2CP5 A;  2CP2 A;  2HKN A;  2HQH A;  3RDV A;  1WHG A;  2COY A;  3E2U A;  2Z0W A;  1WHJ A;  2CP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...