2HQHA

Crystal structure of p150glued and clip-170
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, protein binding
molecule keywords Dynactin-1
publication title CLIP170 autoinhibition mimics intermolecular interactions with p150Glued or EB1.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hqhA00
1WHHA 2CP7A 2HL5C 2HKQB 4B6MA 2CP5A 3E2UA 3TQ7P 2M02A 2E4HA 1IXDA 2CP2A 1TXQA 1WHKA 1WHLA 2CP3A 2HKNA 2COWA 1WHGA 2CP0A 1LPLA 2COYA 2E3IA 2E3HA 1WHJA 2COZA 2HQHA 3RDVA 1WHMA 2CP6A 2HL3A 1TOVA 2QK0A 2Z0WA 2MPXC
chains in the Genus database with same CATH superfamily
3SWNB 1WHHA 3MP6A 3SHWA 5DLQE 3V7SA 4ZGEB 2GNCA 2FHDA 3PT9A 5CVIA 4OGCA 4BI3A 2LCSA 2ZPEB 2RHIA 5IAYA 2DERA 3VRYA 1YIJT 1VQ7Q 3V7RA 4J7FA 4K11A 4GBQA 1SG5A 1HD3A 2M02A 1T0JA 1S72A 1V76A 2KQWA 1RADB 4M75D 1AWXA 4ELYC 2HCKA 2KRNA 5CKFA 4J5YA 2CZ0B 1BYMA 5CO7A 5I2SA 3PE0A 2C0IA 2X3XD 1I5LA 2HZYA 3JCMf 1KC8C 1H8KA 4N0AC 2IG0A 4X9DA 3HKSA 5C0MA 2HAXA 3HP9A 2Y4XA 3I55A 3OS5A 5DLOA 2ED0A 2FL7A 1X27A 2YHTA 4C0FA 3OBWA 3C94A 1I81A 1WXBA 5KYUA 2IIMA 5HK3A 3JCMW 4HVVA 2J6KA 2GCXA 5LJ5e 5FU6C 1GCQA 3TSWA 5IXFA 5A0GA 1I5OB 2BUDA 4MMLA 1VQLT 5GAMh 3EH1A 1V29B 3HHTB 5FU7B 1UJYA 5FU6B 3M4YA 4C5HA 1IO6A 1Y7XA 1LOJA 2QG9B 4DEXA 1N8RC 2JS0A 3CCMQ 1AT1B 2E65A 1WI7A 5D6YA 5GAN4 4XAXB 3VS5A 3GIBA 2CDTA 4PJLA 1KD1C 4V2SA 3OB9A 1YI2T 1QVGS 2LJ1A 2DXCA 3MKDA 9ATCB 1X69A 3RNJA 3OY9A 2JJ9A 4JLGA 4JS5A 4LD6A 1BIBA 1HXDA 1VOMA 2DL4A 3ZBDA 3ME9A 4M7AG 4OMFB 3JRZA 2DXUA 1RLPC 5J26A 4HA8A 1K0XA 3ZFJA 3R6OA 2KBTA 2AK5A 3G6EA 1QVPA 4Z89A 4AFUC 5HK0A 2EPDA 4GLMA 4C0DC 5GMKl 5I21A 4BI4A 2RD1A 3CCUA 2DM1A 1YHQA 3MPUB 3KBGA 3QKJA 1GFDA 3MCAB 1G3TA 2DE0X 2ATCB 5A0LA 3CC4Q 1WX6A 4C0DB 2PVDB 1KD1R 4XU2A 3AHUA 4RTWA 2JOYA 2EIFA 4XTVA 4BACA 4QKUA 1G2BA 4JLIA 1VA7A 1TUCA 2PZ1A 1YCSB 1PRMC 1QKWA 1UTIA 2JTEA 1I07A 4KRTA 4M77G 3KFVA 1X43A 3PIPA 5KYWB 1RABB 4M75A 1FMVA 1K9MU 1IB8A 5LJ3d 2RQUA 3J81E 3CCQA 1WHKA 2XHCA 4OB1B 2A28A 3QXEB 4KT0E 5GAN6 2FPDA 1YJNT 4HCCA 1WJQA 3D7SB 4BE1A 4E7ZA 2CP7A 2LP5A 4J9GA 4AFSC 4C8QG 1M5Q1 3V8KA 2X4WA 3GNFB 1OPKA 3I56Q 5AT1B 3MEWA 4X1VA 5KYXB 4M7AD 2DZ9A 1SSHA 3PMTA 1HSQA 3QWXX 3SD4A 4J83A 4PJOC 1RAGB 1JXOA 4OMPA 3OYFA 4BB7A 1W1FA 1B7TA 2QGFB 3INZA 3OSVA 1TH7A 1UFFA 2Y90A 4A4FA 1XNIA 1VQMA 3BE3A 4F7UF 3FLGA 4PJOB 1PC0A 3CXCS 1OV3A 5FRNA 4M75E 1RAEB 1K76A 1D09B 3OMGA 3JSCA 3CCVQ 1W4SA 2AIRB 4XTYA 2QQAA 2OTLT 2YRDA 3MP1A 1VQ8Q 2DJZA 1W2BA 2RJCA 5A0DA 1Q82C 1M1KC 2JTMA 2YUPA 3C4SA 2KYBA 4XTWA 1F1BB 3UT1A 3Q1JA 1LCKA 1VQPT 2HBWA 2X51A 1LPLA 2E3IA 3EH2A 3A8HB 2V8IA 2C0OA 2EYZA 2AZSA 4RTZA 1WJRA 1SKUB 1BBZA 5GAMj 4Y92A 1I4K1 2JNGA 3NFCA 4AG1C 3G4SA 2DO3A 1G3YA 5CKEA 2K4YA 1SHGA 2LJ0A 1KQ1A 1M3BA 4MZPA 2ZCFB 2EGEA 1KHCA 4EDUA 2EBPA 3VS0A 2XK0A 2QGGA 2E3HA 1WA7A 2LC4A 2GFUA 1BK2A 4IUUA 4BDYA 3ZL7C 4C8QD 2MOXA 3QYHB 1E7OA 4LDVA 2QQBA 1V1CA 4J9HA 5CR2A 1H3ZA 2K7AA 1TU0B 2VYTA 2K2VA 3QPHA 2GF7A 1IGUA 3T9NA 3CPWP 2GBQA 2J6FA 3X25B 1AEYA 3EFRA 3FRNA 3X26B 2DZCA 1VQNT 1KC8U 5LJ3g 3DLMA 3HFOA 2DX1A 1ABOA 1TXQA 2K5IA 1LVKA 2J7IA 2EKHA 2JT4A 2QDLA 3M0SA 3OYAA 2JMAA 2PTKA 1VQ4Q 2H3JA 4O6JA 4NL2A 2CSIA 5LJ5h 3CC7Q 3CD6Q 3VS3A 2WACA 2DL8A 2QTVA 1C6VX 4LDWA 4KH1B 1NZ9A 3JAME 1G5VA 4PLIA 1EZZB 4JJBA 4F16A 1W2BP 4M7AA 5GAMd 2RN8A 3RMQA 2E12A 3EG3A 2QQRA 2QA4T 3I9QA 3PVLA 2R5AA 5DM7R 2P0KA 5L8RE 1QLYA 3V7CA 4ZTJA 1PKSA 4AMCA 3IQLA 4FCYA 4IUQA 4B6MA 3A1PA 3QUIA 3O5ZA 1S72Q 3JB9F 5IHNA 1WQ7A 4J9IA 2J05A 3OMCA 1EFNA 2CH4W 2RNAA 2FRWA 1YITT 2LJ3A 3CCRT 3OS0A 1JB0E 3EGUA 1X2QA 1G3SA 1QVFA 1BKBA 2L3PA 1VYUA 1M27C 3CCJA 3R6NA 3REBB 2VV5A 3M58A 3I55Q 2CP5A 2D0NA 2K5LA 3O8VA 2YT6A 3FJ5A 3M0RA 1OU8A 2X4XA 3JV3A 4M77A 4NL3A 3CCLT 2FPFA 3REAB 3OYJA 5J3BA 2YLCA 4M7AE 2M51A 5LJ3f 1UDLA 4PJOF 3SEMA 2DXBA 2JW4A 1X6GA 1NJIC 3VUBA 1OI1A 1CSKA 1OZ2A 4PK4A 5GAOr 2VXFA 1ZUKA 1ZSGA 1TUDA 1M2VB 2X4JA 2L89A 3FDRA 2YSQA 3CC2A 3I5RA 4C8QA 2H3EB 5IT9E 2OTJQ 2LRQA 3PNWC 2D6FA 2D8JA 2RM4A 3JCMV 3UATA 1Z9ZA 2V26A 1RI0A 4KUIA 5CKDA 5GANd 2HKNA 2EGAA 1H641 4M77E 2BZYA 5FWBA 3CCEQ 2YUNA 2DEQA 3M53A 2DETA 1R8OB 4OP0A 3HL8A 2DMOA 1QWEA 4BD3A 1MV0B 3KUFA 1NBEB 3M0QA 2QDYB 1VQ6T 4E2FB 1KHIA 3CMAT 4J9CA 4JZ3A 1WGSA 2K3YA 1SPKA 2HMAA 1K8AU 3H0HA 4HCZA 2E5QA 1EX4A 1YHQQ 4OMOA 1LJOA 2JS2A 2DKGA 1UE9A 4CI0C 2O88A 1QVFP 2NUZA 4OMMA 4C8QE 1PWTA 1QCFA 4LD9K 1Z9QA 4FW2A 2VGNA 1AHJB 4QQGA 5I22A 3JCMc 1YWPA 2LX7A 5GAMg 1VQOT 3WVEB 1YCYA 1I1JA 5HCKA 1TWBA 2RHUA 3LWHA 5KE3A 1IREB 2AHJB 3CC7A 2L3RA 2ROLA 4AFQC 1RUWA 2DJQA 2K2MA 1TS9A 3CCQQ 3JB9I 4Y91A 1JQQA 2XD0A 2L8DA 4HCKA 1UUEA 4PLLA 4A63B 3P8HA 4M7AC 4J6WA 1D1CA 1UGQB 3M0UA 3PGGA 4R0KA 5LJ5j 2DLPA 3BW1A 1ZA1B 3JCMb 1YIJQ 3NPFA 4M7AB 3P8DA 2R58A 2R5MA 2RHYA 3BFMA 4A4KA 1VYVA 1GBQA 3A8OB 2K9GA 1MUZA 3CXCA 4LXCA 1VQ7T 1U1SA 5L23A 2LQKA 2VXEA 2YDLA 1JO8A 1Q7YU 3EGDA 1XOVA 1VQMQ 2MMPA 1D0ZA 2F69A 2DBKA 4FYVB 3RR6A 2CP2A 1Q86C 3TEEA 1Y0MA 4L6V5 2HEQA 3ER0A 4KGVB 1RAFB 1WXTA 2M1HA 4M77C 4P5NA 2F5KA 2X9HA 4Q5WA 4E7SA 5CQYA 2X3WD 2QTXA 5GAMf 3QHSA 5LL6S 4M77B 3LW5E 2RK2A 5CKHA 1PSFA 4J6XA 1ABQA 2DD4A 2W10A 2LDMA 1M3AA 2YWWA 2RQRA 2LQNA 2KNBB 4J9FA 1KQSS 2FO0A 5KYYA 1VQ5T 4CC7A 1OX8A 5LJ3j 2LMJA 2KR3A 2DF6A 4C8QC 3G4SQ 1XTDA 3GOXA 2OTJA 4VUBA 2I2LA 2D1XA 1VUBA 5LJ5d 5M9OA 3OYGA 3NTHA 3UPUA 4QVZA 1Q86R 4LDYA 2ZPFB 3RIRA 3VS4A 2GFAA 2A37A 5IHKA 2DVEA 2P0PA 3CCEA 3EFOA 3QJ6A 4N4GA 3OS1A 3CMET 2KYMA 2DL7A 4E7HA 2BIVA 1WLPB 2PU9B 4CC2A 4F04B 2VWFA 2EJGA 2LCLA 4HKEA 1MNDA 1X2KA 4J8OA 1I8FA 3L2RA 2EQIA 2RJFA 2CSQA 3SDZA 3LGFA 4ZN1A 1JEGA 1MGQA 4J7IA 2CH4A 2VUBA 2EGCA 2Z0WA 1Q81U 2HQXA 3CCST 2A3LA 1FWZA 2DK3A 2V8JA 1T3SA 5GMKh 2M16A 2LX9A 2X4YA 2A0FB 2F2VA 4F7UG 2JM8A 2DVJA 4KH0B 2J06A 3P8BB 2VKNA 3EHRA 3G71A 1QMCA 2JM9A 1GFCA 5GANh 4E6RA 2DTIA 2ZAEA 1YJ9T 3JCMQ 1ZSZA 4M78G 3H9NA 4QQDA 2XU8A 1KK7A 2OX7A 1BI3A 3BDLA 4FIBA 1JJ2A 5CKBA 3L2WA 4QW2A 2DEUA 1NLPC 1MMGA 4JRQA 1YJWT 4L5GA 4R55A 2ZZDA 2YRVA 3H0IA 4D8KA 1BCMA 1VQ9T 4PFZA 1YIJA 1K73U 3DKMA 1U5SA 4BE2A 4B9XA 1WJSA 2F2XA 4GLKA 3BDUA 4JRPA 2GQVA 1Y96A 3M54A 3OYEA 3DB4A 5FLXE 2EYXA 2C0TA 1K1ZA 1GRIA 1C0MA 3V8JA 2QEXT 4RTXA 3QO3A 3CCJQ 4JZ4A 1AVZC 1N9RA 2QK0A 2V8KA 1AOJA 2JXBA 3EHQA 2SEMA 3VS7A 2JTFA 1X6OA 4OB0B 3X20B 1P92A 1M90C 2KT1A 5GAOm 3I56T 1BI2A 4C5GA 2E1HA 3LX7A 2ENMA 2WSFE 1M9SA 1QW1A 3TVTA 1UB4A 2CUDA 5IHIA 2OTLQ 2XICA 2FPEA 3H0FA 3OYMA 1C1AA 2RQVA 3MO8A 5GAN7 4UC4A 4HT8A 1PRLC 3EG2A 2FEIA 2MWOA 5LJ5g 1GCQC 5KH6A 1SRMA 1VQLA 2MIOA 4M77F 3M59A 5KYUB 2B8AA 2COWA 4JJCA 5I2MA 3CC2Q 3CCVT 1IHWA 3OSSC 3OW2A 3HRTA 2HQHA 2VB6A 2B86A 4R56A 1W6XA 4L59A 1VQ8T 2PVGB 3S3OA 2ZPIB 3H6ZA 2DL5A 3E19A 8ATCB 1UHFA 2LT4A 1M1GA 1UGSB 4M78D 2LVMA 1K8AR 4BDZA 4XTZA 1YI2A 2BKDN 1M90R 2F1LA 5FRMA 3CBPA 4A53A 2DYIA 2ZPGB 2M0OA 5KYYB 2FYKA 2ECZA 4ATOA 1ZHIA 3QBYA 5D6WA 4N4HA 1JJ2P 4Z8AA 3X28B 3VRZA 2BZXA 2DILA 2EAYA 3LH5A 1NYFA 1MNEA 3CMEA 1SF9A 4E47A 1QQJA 2RJDA 1KFZA 2XKOC 5GAN2 3RESA 4DBHA 1GBRA 3HRUA 3OS2A 1X75C 2DIGA 1XJWB 4OB3B 3EFOB 1G8XA 2YXYA 4FT4A 1WPYA 1BIAA 4A4EA 3M4GA 2L5QA 3OBYA 4LE9A 4DBFA 1QWFA 1SEMA 2NLUA 2DNUA 4D6WA 5EG2A 2XI9A 2FZCB 1ZBXA 2NUTA 3JCMe 1CKAA 3QIIA 3CCSA 1MMAA 1S1NA 1BI0A 1B3QA 4TVRA 2KMTA 5LJ5f 3CBMA 3QZ5B 4XTUA 1WYXA 4C5EA 1X6BA 2F2WA 3M57A 3JCMX 4ANJA 2JZ2A 5D6XA 2PVOB 4FW1A 1QCOA 4BUGA 2D0QB 4JDSA 1MMDA 2EQMA 4PJJA 5GMKj 5GAMe 4PJOG 4BY6C 2K79A 2M9UA 2RF0A 5J39A 1YP5A 4C92G 2EKOA 4M75C 2KK4A 4RMOA 1VQKT 3EG9A 1VQ4T 1R77A 4BY6B 1R0BG 1ZQ1A 3OW2P 1Q7YR 3CD6T 2QA4Q 2E10A 2MCNA 2KEAA 1N8RU 2ED1A 4M75B 2KRSA 5GANj 1YJNA 5EC7A 5D7UA 4XTXA 4RTVA 1ACMB 1KD1U 1SHFA 2QASA 1J3TA 1YITQ 3CCRQ 3A8LB 1UJ0A 2OAUA 5IN1A 5GAOl 3MHXA 1AWJA 1BU1A 2V1RA 2QYZA 3QG1A 4F7UA 1S72T 1Y96B 3TCJA 2GQIA 1H92A 3OYDA 2DTOA 5DY9A 3CCLQ 2RH2A 1NLOC 3UWNA 5GAN5 1VYTA 1IZ6A 2YLBA 3UA7A 2RHZA 4RTYA 2CREA 2E70A 2EQUA 3MP8A 4M78A 3PTAA 1KQSA 2OTLA 3QJYA 2O4XA 2E6ZA 3MJXA 4X34A 3VJPA 5FW9A 2ABLA 4YTLA 4M7DG 1QP3A 1ZX6A 2MYSA 2O2OA 2DFUA 3QSUA 2D9TA 3CPWS 4E7JA 1QVGA 4A54A 3C95A 4KGXB 1ZUYA 4OGEA 4WCIA 2RPNA 1VQPA 1CKBA 5CCAA 4Z02A 1O9SA 4PJOD 2PQWA 3LH0A 1OQKA 4C92D 1KSWA 1PHTA 4NOYA 4ORZA 3QZ9B 1IXDA 4ZTFA 1NPRA 1D3BA 4IUVA 1OZ3A 5HY6A 2GTOA 4F7UE 4RG8A 1WZOA 1Y57A 1YN8A 3VKIA 1FXXA 4JRIA 1WFWA 3JCMP 2EYWA 3QYGB 1WHJA 1RAAB 2COZA 2DD5A 2PUKB 5ECAA 1W2BS 3M5AA 4QT7A 4LDXA 3HSBA 2W0ZA 1VQ6Q 3L2ZA 2NUPA 4M78E 1UG1A 2M0YA 4KULA 2CZ7B 4E7LA 1WHLA 2K6DA 2E41A 3RMSA 3ZEHA 1MV3A 1RL2A 2LCCA 3C0CA 5HKCA 3MEVA 2FG0A 2EW3A 4ELZC 4CRIA 2KGTA 3G1JA 2PNIA 5GAN8 1K9MR 4CC3A 2P84A 4XK8E 3G6ET 1G3WA 2KAFA 2FRYA 1VQNA 4OMLA 4EIKA 3CCUT 2HBPA 4PJNA 3VYGA 3RDVA 2ESWA 2CP6A 4HXJA 2J6OA 3G71Q 4M7DD 1W70A 2NUTB 4IUPA 5GAOq 2LZ6B 1QCNA 2RJEA 3CPFA 4IUTA 3OYBA 3A8MB 1T0HA 1D0XA 1PG5B 2KXCA 1Q82U 1U06A 2JN0A 1SRLA 3C12A 1QVGP 1M1KU 2QI2A 2RO0A 4II1A 2EJ9A 3RUXA 3OYYA 1PM3A 2I0NA 2P4TA 2HL3A 1TOVA 2RMOA 2QA4A 1E6HA 2ZPHB 2RQWA 3CCQT 1KJWA 1JXMA 3TREA 4GY5A 4M75F 2BTTA 3EG9B 1H3HA 2X35A 2LNVA 3LYIA 4OF1A 3UF4A 2K5FA 3X24B 2XDPA 2R57A 1YITA 2CP0A 3CCRA 5GAOn 1M3CA 2RI2A 5KYXA 1TSFA 5KYNA 2HNIA 4ZN3A 1D1BA 1BB9A 1HYOA 3GF5A 2MWPA 1N27A 2E64A 3EG0A 3CEYA 4PJOA 3TSZA 3CCLA 4EMKA 3RERA 3RKYA 4C92A 4JJNK 2RB6A 2EQJA 2GGRA 4F7UB 3META 3ULRB 4ESRA 1VQMT 4M78C 4JS4A 5KCHA 3DB3A 5GAN3 3UA6A 1VQLQ 3JCMh 1UGVA 2E6NA 4E7KA 3NMZC 4O5VA 5GANg 3KXTA 3CBOA 1QVFS 4FU6A 1SSFA 2A08A 4M78B 1GL5A 5FU7C 3GBQA 2O4XB 3J7AF 1VQ5Q 2RA2A 3MEUA 1M2OA 1VIFA 2QQ9A 2LTOA 1YI2Q 2O31A 3FJPA 2C06A 3MEAA 4DBRA 4FL6A 2XG8D 4C8QB 3L2VA 2P4RA 3CCMT 2RK1A 1QKXA 1Y71A 4HVUA 3OYKA 2KXDA 1TG0A 3EGXA 4PJOE 1YFNA 1O75A 4FYWB 3G4ST 4JJDA 1D3BB 4C92E 3CMEQ 1M8MA 1NM7A 4LNPA 1KC8R 4KGZB 3OYHA 3OQ5A 2RI5A 1VQ6A 1WNLA 4IIOA 3CMAA 1BCOA 2CP3A 2RQTA 4DA4A 2BE7D 4MZMA 3L1AA 2VGMA 4Z88A 4M7DA 4OVAA 3NGPA 3HTRA 2FB7A 3E9GA 3J80E 3VUZA 3CXCP 2NUPB 4PJMA 4J6YA 1OEBA 4JPBW 1AWWA 2JUFA 4DOVA 1AWOA 1B34A 2DXTA 2LNHB 2ZGWA 3CCSQ 2DL3A 2F5TX 4A4GA 4PNOA 3JB9J 2CYZB 2DYBA 2GTJA 1IGQA 2VASA 1D0YA 2NYSA 4BE0A 3FC3A 1VQOA 3H41A 4J9DA 3L2QA 1N8RR 3PFSA 2CT3A 1OX9A 1WHMA 4QVDA 5GANf 2FVUA 4QQ6A 5FWCA 5LJ3e 1UHCA 3CC4T 4XU1A 3A5ZB 3THKA 3M9QA 1NJIU 2EQKA 3H8ZA 2LQ8A 3LGLA 1YJ9Q 4NS5A 5CAIA 1R0CB 1N9SA 3GPLA 3NHNA 2AKLA 3N5BB 2O01E 4X9CA 1ZA2B 4F14A 2EWNA 1E6GA 3V8LA 1YJWQ 1YJNQ 4M7DE 2CZ1B 2XDDA 1VQ9Q 1NEBA 2KROA 2E4HA 1K0SA 4LDUA 2HQEA 3NTIA 3FEOA 2OI3A 5CIUA 4M7AF 2WSEE 1LNXA 2G6FX 4IIMA 4RCCA 1X01A 1NG2A 2G3RA 2QEXQ 3BY7A 3TU4K 2DRMA 5CQXA 1VQ7A 2MPXC 2D8HA 2HKQB 1K8AC 2OAWA 1YNZA 2HSEB 4ZGJB 1U8RA 1OPLA 1VIEA 4DBQA 5GMKi 1KQ2A 1I0CA 3CPWA 1K9AA 1ZLMA 2Y4YA 3CCJT 3EGDB 4EMKC 4C92C 4FSXA 1RAIB 3EG1A 2KI7A 2QQSA 4JUVA 2H8HA 3S3NA 1U1TA 2IVWA 2KRMA 4EMKB 4XU0A 4C92B 3AT1B 4PFOA 2HDAA 1M2VA 1OULA 2L0AA 2HD0A 2KVQG 1VQPQ 3GP8A 3FIFA 4EPCA 3PIOA 4QVCA 1EIFA 4M78F 2EYQA 1FMKA 1VQ5A 1AD5A 3HPWA 3M56A 2CUBA 4M4ZA 4A4HA 4DOWA 2AKKA 3JB9H 1NPPA 4HCBA 2AZVA 3CC2T 4IKFA 1UECA 4M77D 5KCOA 4LUEA 5IXBA 1Y07A 3EFSA 5IH2A 3CCMA 1RI9A 4PKCC 3QDFA 4C8QF 4RCBA 4Y28E 1MHNA 2HL5C 1UEBA 2O9VA 1T3LA 4DQ2A 1IHVA 4FYYB 1TUGB 1M1FA 2ZPBB 3I5SA 3PVQA 3NTKA 2FZKB 3EGXB 5GAOp 3JB9G 1FYNA 1PSEA 3FB9A 3OYCA 1OU9A 1Q7YC 3G7ZA 2IPOB 4M7DC 2RI3A 3CQTA 2EFIA 3GNGA 1A0NB 4JRKA 1K4US 1VQNQ 3S3MA 1Q82R 1FX7A 2A7YA 5FROA 4M7DB 1YBYA 1M1KR 5KE2A 2ROTA 2AT1B 1Q86U 1ZUUA 2E5KA 1OOTA 1WIEA 4J9EA 4AFZC 1TTHB 1B34B 1Q95G 4XQ3A 2DTHA 2MAMA 4PFPA 3E2UA 2OJ2A 3TQ7P 3CC4A 1XQHA 2YUOA 3PMIA 4MMKA 2L3QA 3OYLA 3SWNA 3ASKA 4RUGA 1YJ9A 4MZTA 1QP2A 4BI8B 2YRCA 1ZSZC 3JCMd 4MDWA 1WHGA 1VQKQ 4EMHA 3OYNA 2CGHA 2EYYA 3CC7T 2MF2A 4AT1B 4FYXB 1PNJA 1YWOA 1YJWA 3VS1A 3M0TA 1M4ZA 1ZSZB 4LN2A 3EAEA 5GJVB 2KDSA 1VQ9A 2K57A 2DAQA 3HRSA 2HSPA 5A2QE 2JMCA 3RKWA 2LQWA 1UGRB 2MK5A 4DEYA 2V1QA 3SFMA 2XIDA 4AG2C 1WQWA 1AZGB 2NWMA 4RTTA 3DLLA 2QEXA 3SB2A 1ARKA 3A98A 2PUOB 6AT1B 3M0PA 3GLXA 3I35A 4KUDK 1JJ2S 3JB9D 4WF2A 3URGA 2KY9A 3RBBB 5CK9A 2XDBA 2VVKA 1FMWA 3I56A 1G83A 3M55A 5C6SA 4F17A 1Q81C 1HK9A 2CS7A 1HJDA 1U3OA 1D1AA 4N0AA 1PCXA 3E9FA 4HVWA 3I55T 2XMFA 5GMKe 4ME7A 4XU3A 1RLQC 4RKUE 2DIQA 3VU3C 2CZ6B 4IURA 4MDXA 2WSCE 3OA6A 4CC4B 2CT4A 4C92F 3CCVA 1PKTA 2K3XA 1DJ7B 1K9MC 5LJ3h 1RAHB 5GANe 1VQ8A 1GXIE 2KE9A 2FZGB 8AT1B 4ZGDB 3VV0A 3U23A 2DA9A 2DRKA 2MI6A 2YUQA 1WXUA 2EVRA 1N6AA 1K73C 1WDXA 4HT9A 3UDCA 2OTJT 1Q81R 7AT1B 2CKKA 4N4IA 1AZEA 3S6WA 2BE9B 1JU5C 3CMAQ 3L42A 3VS6A 3OYIA 3VS2A 3OW2S 3WXMB 2QAZA 2L2PA 2P0QA 4C0GA 2DPPB 3E1SA 4B9WA 3CCET 2VC8A 3RKXA 4M75G 1M8VA 4EMGA 1KG1A 2RHXA 1NE8A 2KT8A 2DBMA 1NEGA 4FSSA 4OB2B 1MMNA 1ZBJA 1NJIR 4KBMB 1PD0A 4E7IA 4PL6A 3L2UA 4C0ZA 5GJWB 3G6EQ 1JBMA 4ZNXA 4FT2A 4RG2A 1KIKA 4OMQA 2JVVA 3CCUQ 1RACB 3JCMg 1NYGA 1UGPB 4C5IA 1YHQT 3JCMJ 1VQOQ 1M90U 1JRIA 2QXFA 4OMNA 4RTUA 4D8DA 3F70A 4M7DF 1PD1A 3QWYA 3LLRA 5AYFA 2BZ8A 3VYHB 1K73R 2O9SA 1GCPA 1IRXA 2L3SA 3QDRB 5GMKm 1N5ZA 1KQSP 1B07A 2KSSA 3HFNA 5KYWA 5I11A 1BI1A 4LUDA 3LWIA 4WTOB 2EJFA 3SWNC 3WVDB 1M30A 2LT1A 2COYA 1VQKA 4FM4B 2SRCA 1VQ4A 2K3BA 3G71T 2A36A 3A8GB 4J9BA 3CD6A 1OYXA
chains in the Genus database with same CATH topology
1WHHA 2CP7A 2HL5C 2HKQB 4B6MA 2CP5A 3E2UA 3TQ7P 2M02A 2E4HA 1IXDA 2CP2A 1TXQA 1WHKA 1WHLA 2CP3A 2HKNA 2COWA 1WHGA 2CP0A 1LPLA 2COYA 2E3IA 2E3HA 1WHJA 2COZA 2HQHA 3RDVA 1WHMA 2CP6A 2HL3A 1TOVA 2QK0A 2Z0WA 2MPXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHH A;  2CP7 A;  2HL5 C;  2HKQ B;  4B6M A;  2CP5 A;  3E2U A;  3TQ7 P;  2M02 A;  2E4H A;  1IXD A;  2CP2 A;  1TXQ A;  1WHK A;  1WHL A;  2CP3 A;  2HKN A;  2COW A;  1WHG A;  2CP0 A;  1LPL A;  2COY A;  2E3I A;  2E3H A;  1WHJ A;  2COZ A;  2HQH A;  3RDV A;  1WHM A;  2CP6 A;  2HL3 A;  1TOV A;  2QK0 A;  2Z0W A;  2MPX C; 
#chains in the Genus database with same CATH topology
 3SWN B;  1WHH A;  3MP6 A;  3SHW A;  5DLQ E;  3V7S A;  4ZGE B;  2GNC A;  2FHD A;  3PT9 A;  5CVI A;  4OGC A;  4BI3 A;  2LCS A;  2ZPE B;  2RHI A;  5IAY A;  2DER A;  3VRY A;  1YIJ T;  1VQ7 Q;  3V7R A;  4J7F A;  4K11 A;  4GBQ A;  1SG5 A;  1HD3 A;  2M02 A;  1T0J A;  1S72 A;  1V76 A;  2KQW A;  1RAD B;  4M75 D;  1AWX A;  4ELY C;  2HCK A;  2KRN A;  5CKF A;  4J5Y A;  2CZ0 B;  1BYM A;  5CO7 A;  5I2S A;  3PE0 A;  2C0I A;  2X3X D;  1I5L A;  2HZY A;  3JCM f;  1KC8 C;  1H8K A;  4N0A C;  2IG0 A;  4X9D A;  3HKS A;  5C0M A;  2HAX A;  3HP9 A;  2Y4X A;  3I55 A;  3OS5 A;  5DLO A;  2ED0 A;  2FL7 A;  1X27 A;  2YHT A;  4C0F A;  3OBW A;  3C94 A;  1I81 A;  1WXB A;  5KYU A;  2IIM A;  5HK3 A;  3JCM W;  4HVV A;  2J6K A;  2GCX A;  5LJ5 e;  5FU6 C;  1GCQ A;  3TSW A;  5IXF A;  5A0G A;  1I5O B;  2BUD A;  4MML A;  1VQL T;  5GAM h;  3EH1 A;  1V29 B;  3HHT B;  5FU7 B;  1UJY A;  5FU6 B;  3M4Y A;  4C5H A;  1IO6 A;  1Y7X A;  1LOJ A;  2QG9 B;  4DEX A;  1N8R C;  2JS0 A;  3CCM Q;  1AT1 B;  2E65 A;  1WI7 A;  5D6Y A;  5GAN 4;  4XAX B;  3VS5 A;  3GIB A;  2CDT A;  4PJL A;  1KD1 C;  4V2S A;  3OB9 A;  1YI2 T;  1QVG S;  2LJ1 A;  2DXC A;  3MKD A;  9ATC B;  1X69 A;  3RNJ A;  3OY9 A;  2JJ9 A;  4JLG A;  4JS5 A;  4LD6 A;  1BIB A;  1HXD A;  1VOM A;  2DL4 A;  3ZBD A;  3ME9 A;  4M7A G;  4OMF B;  3JRZ A;  2DXU A;  1RLP C;  5J26 A;  4HA8 A;  1K0X A;  3ZFJ A;  3R6O A;  2KBT A;  2AK5 A;  3G6E A;  1QVP A;  4Z89 A;  4AFU C;  5HK0 A;  2EPD A;  4GLM A;  4C0D C;  5GMK l;  5I21 A;  4BI4 A;  2RD1 A;  3CCU A;  2DM1 A;  1YHQ A;  3MPU B;  3KBG A;  3QKJ A;  1GFD A;  3MCA B;  1G3T A;  2DE0 X;  2ATC B;  5A0L A;  3CC4 Q;  1WX6 A;  4C0D B;  2PVD B;  1KD1 R;  4XU2 A;  3AHU A;  4RTW A;  2JOY A;  2EIF A;  4XTV A;  4BAC A;  4QKU A;  1G2B A;  4JLI A;  1VA7 A;  1TUC A;  2PZ1 A;  1YCS B;  1PRM C;  1QKW A;  1UTI A;  2JTE A;  1I07 A;  4KRT A;  4M77 G;  3KFV A;  1X43 A;  3PIP A;  5KYW B;  1RAB B;  4M75 A;  1FMV A;  1K9M U;  1IB8 A;  5LJ3 d;  2RQU A;  3J81 E;  3CCQ A;  1WHK A;  2XHC A;  4OB1 B;  2A28 A;  3QXE B;  4KT0 E;  5GAN 6;  2FPD A;  1YJN T;  4HCC A;  1WJQ A;  3D7S B;  4BE1 A;  4E7Z A;  2CP7 A;  2LP5 A;  4J9G A;  4AFS C;  4C8Q G;  1M5Q 1;  3V8K A;  2X4W A;  3GNF B;  1OPK A;  3I56 Q;  5AT1 B;  3MEW A;  4X1V A;  5KYX B;  4M7A D;  2DZ9 A;  1SSH A;  3PMT A;  1HSQ A;  3QWX X;  3SD4 A;  4J83 A;  4PJO C;  1RAG B;  1JXO A;  4OMP A;  3OYF A;  4BB7 A;  1W1F A;  1B7T A;  2QGF B;  3INZ A;  3OSV A;  1TH7 A;  1UFF A;  2Y90 A;  4A4F A;  1XNI A;  1VQM A;  3BE3 A;  4F7U F;  3FLG A;  4PJO B;  1PC0 A;  3CXC S;  1OV3 A;  5FRN A;  4M75 E;  1RAE B;  1K76 A;  1D09 B;  3OMG A;  3JSC A;  3CCV Q;  1W4S A;  2AIR B;  4XTY A;  2QQA A;  2OTL T;  2YRD A;  3MP1 A;  1VQ8 Q;  2DJZ A;  1W2B A;  2RJC A;  5A0D A;  1Q82 C;  1M1K C;  2JTM A;  2YUP A;  3C4S A;  2KYB A;  4XTW A;  1F1B B;  3UT1 A;  3Q1J A;  1LCK A;  1VQP T;  2HBW A;  2X51 A;  1LPL A;  2E3I A;  3EH2 A;  3A8H B;  2V8I A;  2C0O A;  2EYZ A;  2AZS A;  4RTZ A;  1WJR A;  1SKU B;  1BBZ A;  5GAM j;  4Y92 A;  1I4K 1;  2JNG A;  3NFC A;  4AG1 C;  3G4S A;  2DO3 A;  1G3Y A;  5CKE A;  2K4Y A;  1SHG A;  2LJ0 A;  1KQ1 A;  1M3B A;  4MZP A;  2ZCF B;  2EGE A;  1KHC A;  4EDU A;  2EBP A;  3VS0 A;  2XK0 A;  2QGG A;  2E3H A;  1WA7 A;  2LC4 A;  2GFU A;  1BK2 A;  4IUU A;  4BDY A;  3ZL7 C;  4C8Q D;  2MOX A;  3QYH B;  1E7O A;  4LDV A;  2QQB A;  1V1C A;  4J9H A;  5CR2 A;  1H3Z A;  2K7A A;  1TU0 B;  2VYT A;  2K2V A;  3QPH A;  2GF7 A;  1IGU A;  3T9N A;  3CPW P;  2GBQ A;  2J6F A;  3X25 B;  1AEY A;  3EFR A;  3FRN A;  3X26 B;  2DZC A;  1VQN T;  1KC8 U;  5LJ3 g;  3DLM A;  3HFO A;  2DX1 A;  1ABO A;  1TXQ A;  2K5I A;  1LVK A;  2J7I A;  2EKH A;  2JT4 A;  2QDL A;  3M0S A;  3OYA A;  2JMA A;  2PTK A;  1VQ4 Q;  2H3J A;  4O6J A;  4NL2 A;  2CSI A;  5LJ5 h;  3CC7 Q;  3CD6 Q;  3VS3 A;  2WAC A;  2DL8 A;  2QTV A;  1C6V X;  4LDW A;  4KH1 B;  1NZ9 A;  3JAM E;  1G5V A;  4PLI A;  1EZZ B;  4JJB A;  4F16 A;  1W2B P;  4M7A A;  5GAM d;  2RN8 A;  3RMQ A;  2E12 A;  3EG3 A;  2QQR A;  2QA4 T;  3I9Q A;  3PVL A;  2R5A A;  5DM7 R;  2P0K A;  5L8R E;  1QLY A;  3V7C A;  4ZTJ A;  1PKS A;  4AMC A;  3IQL A;  4FCY A;  4IUQ A;  4B6M A;  3A1P A;  3QUI A;  3O5Z A;  1S72 Q;  3JB9 F;  5IHN A;  1WQ7 A;  4J9I A;  2J05 A;  3OMC A;  1EFN A;  2CH4 W;  2RNA A;  2FRW A;  1YIT T;  2LJ3 A;  3CCR T;  3OS0 A;  1JB0 E;  3EGU A;  1X2Q A;  1G3S A;  1QVF A;  1BKB A;  2L3P A;  1VYU A;  1M27 C;  3CCJ A;  3R6N A;  3REB B;  2VV5 A;  3M58 A;  3I55 Q;  2CP5 A;  2D0N A;  2K5L A;  3O8V A;  2YT6 A;  3FJ5 A;  3M0R A;  1OU8 A;  2X4X A;  3JV3 A;  4M77 A;  4NL3 A;  3CCL T;  2FPF A;  3REA B;  3OYJ A;  5J3B A;  2YLC A;  4M7A E;  2M51 A;  5LJ3 f;  1UDL A;  4PJO F;  3SEM A;  2DXB A;  2JW4 A;  1X6G A;  1NJI C;  3VUB A;  1OI1 A;  1CSK A;  1OZ2 A;  4PK4 A;  5GAO r;  2VXF A;  1ZUK A;  1ZSG A;  1TUD A;  1M2V B;  2X4J A;  2L89 A;  3FDR A;  2YSQ A;  3CC2 A;  3I5R A;  4C8Q A;  2H3E B;  5IT9 E;  2OTJ Q;  2LRQ A;  3PNW C;  2D6F A;  2D8J A;  2RM4 A;  3JCM V;  3UAT A;  1Z9Z A;  2V26 A;  1RI0 A;  4KUI A;  5CKD A;  5GAN d;  2HKN A;  2EGA A;  1H64 1;  4M77 E;  2BZY A;  5FWB A;  3CCE Q;  2YUN A;  2DEQ A;  3M53 A;  2DET A;  1R8O B;  4OP0 A;  3HL8 A;  2DMO A;  1QWE A;  4BD3 A;  1MV0 B;  3KUF A;  1NBE B;  3M0Q A;  2QDY B;  1VQ6 T;  4E2F B;  1KHI A;  3CMA T;  4J9C A;  4JZ3 A;  1WGS A;  2K3Y A;  1SPK A;  2HMA A;  1K8A U;  3H0H A;  4HCZ A;  2E5Q A;  1EX4 A;  1YHQ Q;  4OMO A;  1LJO A;  2JS2 A;  2DKG A;  1UE9 A;  4CI0 C;  2O88 A;  1QVF P;  2NUZ A;  4OMM A;  4C8Q E;  1PWT A;  1QCF A;  4LD9 K;  1Z9Q A;  4FW2 A;  2VGN A;  1AHJ B;  4QQG A;  5I22 A;  3JCM c;  1YWP A;  2LX7 A;  5GAM g;  1VQO T;  3WVE B;  1YCY A;  1I1J A;  5HCK A;  1TWB A;  2RHU A;  3LWH A;  5KE3 A;  1IRE B;  2AHJ B;  3CC7 A;  2L3R A;  2ROL A;  4AFQ C;  1RUW A;  2DJQ A;  2K2M A;  1TS9 A;  3CCQ Q;  3JB9 I;  4Y91 A;  1JQQ A;  2XD0 A;  2L8D A;  4HCK A;  1UUE A;  4PLL A;  4A63 B;  3P8H A;  4M7A C;  4J6W A;  1D1C A;  1UGQ B;  3M0U A;  3PGG A;  4R0K A;  5LJ5 j;  2DLP A;  3BW1 A;  1ZA1 B;  3JCM b;  1YIJ Q;  3NPF A;  4M7A B;  3P8D A;  2R58 A;  2R5M A;  2RHY A;  3BFM A;  4A4K A;  1VYV A;  1GBQ A;  3A8O B;  2K9G A;  1MUZ A;  3CXC A;  4LXC A;  1VQ7 T;  1U1S A;  5L23 A;  2LQK A;  2VXE A;  2YDL A;  1JO8 A;  1Q7Y U;  3EGD A;  1XOV A;  1VQM Q;  2MMP A;  1D0Z A;  2F69 A;  2DBK A;  4FYV B;  3RR6 A;  2CP2 A;  1Q86 C;  3TEE A;  1Y0M A;  4L6V 5;  2HEQ A;  3ER0 A;  4KGV B;  1RAF B;  1WXT A;  2M1H A;  4M77 C;  4P5N A;  2F5K A;  2X9H A;  4Q5W A;  4E7S A;  5CQY A;  2X3W D;  2QTX A;  5GAM f;  3QHS A;  5LL6 S;  4M77 B;  3LW5 E;  2RK2 A;  5CKH A;  1PSF A;  4J6X A;  1ABQ A;  2DD4 A;  2W10 A;  2LDM A;  1M3A A;  2YWW A;  2RQR A;  2LQN A;  2KNB B;  4J9F A;  1KQS S;  2FO0 A;  5KYY A;  1VQ5 T;  4CC7 A;  1OX8 A;  5LJ3 j;  2LMJ A;  2KR3 A;  2DF6 A;  4C8Q C;  3G4S Q;  1XTD A;  3GOX A;  2OTJ A;  4VUB A;  2I2L A;  2D1X A;  1VUB A;  5LJ5 d;  5M9O A;  3OYG A;  3NTH A;  3UPU A;  4QVZ A;  1Q86 R;  4LDY A;  2ZPF B;  3RIR A;  3VS4 A;  2GFA A;  2A37 A;  5IHK A;  2DVE A;  2P0P A;  3CCE A;  3EFO A;  3QJ6 A;  4N4G A;  3OS1 A;  3CME T;  2KYM A;  2DL7 A;  4E7H A;  2BIV A;  1WLP B;  2PU9 B;  4CC2 A;  4F04 B;  2VWF A;  2EJG A;  2LCL A;  4HKE A;  1MND A;  1X2K A;  4J8O A;  1I8F A;  3L2R A;  2EQI A;  2RJF A;  2CSQ A;  3SDZ A;  3LGF A;  4ZN1 A;  1JEG A;  1MGQ A;  4J7I A;  2CH4 A;  2VUB A;  2EGC A;  2Z0W A;  1Q81 U;  2HQX A;  3CCS T;  2A3L A;  1FWZ A;  2DK3 A;  2V8J A;  1T3S A;  5GMK h;  2M16 A;  2LX9 A;  2X4Y A;  2A0F B;  2F2V A;  4F7U G;  2JM8 A;  2DVJ A;  4KH0 B;  2J06 A;  3P8B B;  2VKN A;  3EHR A;  3G71 A;  1QMC A;  2JM9 A;  1GFC A;  5GAN h;  4E6R A;  2DTI A;  2ZAE A;  1YJ9 T;  3JCM Q;  1ZSZ A;  4M78 G;  3H9N A;  4QQD A;  2XU8 A;  1KK7 A;  2OX7 A;  1BI3 A;  3BDL A;  4FIB A;  1JJ2 A;  5CKB A;  3L2W A;  4QW2 A;  2DEU A;  1NLP C;  1MMG A;  4JRQ A;  1YJW T;  4L5G A;  4R55 A;  2ZZD A;  2YRV A;  3H0I A;  4D8K A;  1BCM A;  1VQ9 T;  4PFZ A;  1YIJ A;  1K73 U;  3DKM A;  1U5S A;  4BE2 A;  4B9X A;  1WJS A;  2F2X A;  4GLK A;  3BDU A;  4JRP A;  2GQV A;  1Y96 A;  3M54 A;  3OYE A;  3DB4 A;  5FLX E;  2EYX A;  2C0T A;  1K1Z A;  1GRI A;  1C0M A;  3V8J A;  2QEX T;  4RTX A;  3QO3 A;  3CCJ Q;  4JZ4 A;  1AVZ C;  1N9R A;  2QK0 A;  2V8K A;  1AOJ A;  2JXB A;  3EHQ A;  2SEM A;  3VS7 A;  2JTF A;  1X6O A;  4OB0 B;  3X20 B;  1P92 A;  1M90 C;  2KT1 A;  5GAO m;  3I56 T;  1BI2 A;  4C5G A;  2E1H A;  3LX7 A;  2ENM A;  2WSF E;  1M9S A;  1QW1 A;  3TVT A;  1UB4 A;  2CUD A;  5IHI A;  2OTL Q;  2XIC A;  2FPE A;  3H0F A;  3OYM A;  1C1A A;  2RQV A;  3MO8 A;  5GAN 7;  4UC4 A;  4HT8 A;  1PRL C;  3EG2 A;  2FEI A;  2MWO A;  5LJ5 g;  1GCQ C;  5KH6 A;  1SRM A;  1VQL A;  2MIO A;  4M77 F;  3M59 A;  5KYU B;  2B8A A;  2COW A;  4JJC A;  5I2M A;  3CC2 Q;  3CCV T;  1IHW A;  3OSS C;  3OW2 A;  3HRT A;  2HQH A;  2VB6 A;  2B86 A;  4R56 A;  1W6X A;  4L59 A;  1VQ8 T;  2PVG B;  3S3O A;  2ZPI B;  3H6Z A;  2DL5 A;  3E19 A;  8ATC B;  1UHF A;  2LT4 A;  1M1G A;  1UGS B;  4M78 D;  2LVM A;  1K8A R;  4BDZ A;  4XTZ A;  1YI2 A;  2BKD N;  1M90 R;  2F1L A;  5FRM A;  3CBP A;  4A53 A;  2DYI A;  2ZPG B;  2M0O A;  5KYY B;  2FYK A;  2ECZ A;  4ATO A;  1ZHI A;  3QBY A;  5D6W A;  4N4H A;  1JJ2 P;  4Z8A A;  3X28 B;  3VRZ A;  2BZX A;  2DIL A;  2EAY A;  3LH5 A;  1NYF A;  1MNE A;  3CME A;  1SF9 A;  4E47 A;  1QQJ A;  2RJD A;  1KFZ A;  2XKO C;  5GAN 2;  3RES A;  4DBH A;  1GBR A;  3HRU A;  3OS2 A;  1X75 C;  2DIG A;  1XJW B;  4OB3 B;  3EFO B;  1G8X A;  2YXY A;  4FT4 A;  1WPY A;  1BIA A;  4A4E A;  3M4G A;  2L5Q A;  3OBY A;  4LE9 A;  4DBF A;  1QWF A;  1SEM A;  2NLU A;  2DNU A;  4D6W A;  5EG2 A;  2XI9 A;  2FZC B;  1ZBX A;  2NUT A;  3JCM e;  1CKA A;  3QII A;  3CCS A;  1MMA A;  1S1N A;  1BI0 A;  1B3Q A;  4TVR A;  2KMT A;  5LJ5 f;  3CBM A;  3QZ5 B;  4XTU A;  1WYX A;  4C5E A;  1X6B A;  2F2W A;  3M57 A;  3JCM X;  4ANJ A;  2JZ2 A;  5D6X A;  2PVO B;  4FW1 A;  1QCO A;  4BUG A;  2D0Q B;  4JDS A;  1MMD A;  2EQM A;  4PJJ A;  5GMK j;  5GAM e;  4PJO G;  4BY6 C;  2K79 A;  2M9U A;  2RF0 A;  5J39 A;  1YP5 A;  4C92 G;  2EKO A;  4M75 C;  2KK4 A;  4RMO A;  1VQK T;  3EG9 A;  1VQ4 T;  1R77 A;  4BY6 B;  1R0B G;  1ZQ1 A;  3OW2 P;  1Q7Y R;  3CD6 T;  2QA4 Q;  2E10 A;  2MCN A;  2KEA A;  1N8R U;  2ED1 A;  4M75 B;  2KRS A;  5GAN j;  1YJN A;  5EC7 A;  5D7U A;  4XTX A;  4RTV A;  1ACM B;  1KD1 U;  1SHF A;  2QAS A;  1J3T A;  1YIT Q;  3CCR Q;  3A8L B;  1UJ0 A;  2OAU A;  5IN1 A;  5GAO l;  3MHX A;  1AWJ A;  1BU1 A;  2V1R A;  2QYZ A;  3QG1 A;  4F7U A;  1S72 T;  1Y96 B;  3TCJ A;  2GQI A;  1H92 A;  3OYD A;  2DTO A;  5DY9 A;  3CCL Q;  2RH2 A;  1NLO C;  3UWN A;  5GAN 5;  1VYT A;  1IZ6 A;  2YLB A;  3UA7 A;  2RHZ A;  4RTY A;  2CRE A;  2E70 A;  2EQU A;  3MP8 A;  4M78 A;  3PTA A;  1KQS A;  2OTL A;  3QJY A;  2O4X A;  2E6Z A;  3MJX A;  4X34 A;  3VJP A;  5FW9 A;  2ABL A;  4YTL A;  4M7D G;  1QP3 A;  1ZX6 A;  2MYS A;  2O2O A;  2DFU A;  3QSU A;  2D9T A;  3CPW S;  4E7J A;  1QVG A;  4A54 A;  3C95 A;  4KGX B;  1ZUY A;  4OGE A;  4WCI A;  2RPN A;  1VQP A;  1CKB A;  5CCA A;  4Z02 A;  1O9S A;  4PJO D;  2PQW A;  3LH0 A;  1OQK A;  4C92 D;  1KSW A;  1PHT A;  4NOY A;  4ORZ A;  3QZ9 B;  1IXD A;  4ZTF A;  1NPR A;  1D3B A;  4IUV A;  1OZ3 A;  5HY6 A;  2GTO A;  4F7U E;  4RG8 A;  1WZO A;  1Y57 A;  1YN8 A;  3VKI A;  1FXX A;  4JRI A;  1WFW A;  3JCM P;  2EYW A;  3QYG B;  1WHJ A;  1RAA B;  2COZ A;  2DD5 A;  2PUK B;  5ECA A;  1W2B S;  3M5A A;  4QT7 A;  4LDX A;  3HSB A;  2W0Z A;  1VQ6 Q;  3L2Z A;  2NUP A;  4M78 E;  1UG1 A;  2M0Y A;  4KUL A;  2CZ7 B;  4E7L A;  1WHL A;  2K6D A;  2E41 A;  3RMS A;  3ZEH A;  1MV3 A;  1RL2 A;  2LCC A;  3C0C A;  5HKC A;  3MEV A;  2FG0 A;  2EW3 A;  4ELZ C;  4CRI A;  2KGT A;  3G1J A;  2PNI A;  5GAN 8;  1K9M R;  4CC3 A;  2P84 A;  4XK8 E;  3G6E T;  1G3W A;  2KAF A;  2FRY A;  1VQN A;  4OML A;  4EIK A;  3CCU T;  2HBP A;  4PJN A;  3VYG A;  3RDV A;  2ESW A;  2CP6 A;  4HXJ A;  2J6O A;  3G71 Q;  4M7D D;  1W70 A;  2NUT B;  4IUP A;  5GAO q;  2LZ6 B;  1QCN A;  2RJE A;  3CPF A;  4IUT A;  3OYB A;  3A8M B;  1T0H A;  1D0X A;  1PG5 B;  2KXC A;  1Q82 U;  1U06 A;  2JN0 A;  1SRL A;  3C12 A;  1QVG P;  1M1K U;  2QI2 A;  2RO0 A;  4II1 A;  2EJ9 A;  3RUX A;  3OYY A;  1PM3 A;  2I0N A;  2P4T A;  2HL3 A;  1TOV A;  2RMO A;  2QA4 A;  1E6H A;  2ZPH B;  2RQW A;  3CCQ T;  1KJW A;  1JXM A;  3TRE A;  4GY5 A;  4M75 F;  2BTT A;  3EG9 B;  1H3H A;  2X35 A;  2LNV A;  3LYI A;  4OF1 A;  3UF4 A;  2K5F A;  3X24 B;  2XDP A;  2R57 A;  1YIT A;  2CP0 A;  3CCR A;  5GAO n;  1M3C A;  2RI2 A;  5KYX A;  1TSF A;  5KYN A;  2HNI A;  4ZN3 A;  1D1B A;  1BB9 A;  1HYO A;  3GF5 A;  2MWP A;  1N27 A;  2E64 A;  3EG0 A;  3CEY A;  4PJO A;  3TSZ A;  3CCL A;  4EMK A;  3RER A;  3RKY A;  4C92 A;  4JJN K;  2RB6 A;  2EQJ A;  2GGR A;  4F7U B;  3MET A;  3ULR B;  4ESR A;  1VQM T;  4M78 C;  4JS4 A;  5KCH A;  3DB3 A;  5GAN 3;  3UA6 A;  1VQL Q;  3JCM h;  1UGV A;  2E6N A;  4E7K A;  3NMZ C;  4O5V A;  5GAN g;  3KXT A;  3CBO A;  1QVF S;  4FU6 A;  1SSF A;  2A08 A;  4M78 B;  1GL5 A;  5FU7 C;  3GBQ A;  2O4X B;  3J7A F;  1VQ5 Q;  2RA2 A;  3MEU A;  1M2O A;  1VIF A;  2QQ9 A;  2LTO A;  1YI2 Q;  2O31 A;  3FJP A;  2C06 A;  3MEA A;  4DBR A;  4FL6 A;  2XG8 D;  4C8Q B;  3L2V A;  2P4R A;  3CCM T;  2RK1 A;  1QKX A;  1Y71 A;  4HVU A;  3OYK A;  2KXD A;  1TG0 A;  3EGX A;  4PJO E;  1YFN A;  1O75 A;  4FYW B;  3G4S T;  4JJD A;  1D3B B;  4C92 E;  3CME Q;  1M8M A;  1NM7 A;  4LNP A;  1KC8 R;  4KGZ B;  3OYH A;  3OQ5 A;  2RI5 A;  1VQ6 A;  1WNL A;  4IIO A;  3CMA A;  1BCO A;  2CP3 A;  2RQT A;  4DA4 A;  2BE7 D;  4MZM A;  3L1A A;  2VGM A;  4Z88 A;  4M7D A;  4OVA A;  3NGP A;  3HTR A;  2FB7 A;  3E9G A;  3J80 E;  3VUZ A;  3CXC P;  2NUP B;  4PJM A;  4J6Y A;  1OEB A;  4JPB W;  1AWW A;  2JUF A;  4DOV A;  1AWO A;  1B34 A;  2DXT A;  2LNH B;  2ZGW A;  3CCS Q;  2DL3 A;  2F5T X;  4A4G A;  4PNO A;  3JB9 J;  2CYZ B;  2DYB A;  2GTJ A;  1IGQ A;  2VAS A;  1D0Y A;  2NYS A;  4BE0 A;  3FC3 A;  1VQO A;  3H41 A;  4J9D A;  3L2Q A;  1N8R R;  3PFS A;  2CT3 A;  1OX9 A;  1WHM A;  4QVD A;  5GAN f;  2FVU A;  4QQ6 A;  5FWC A;  5LJ3 e;  1UHC A;  3CC4 T;  4XU1 A;  3A5Z B;  3THK A;  3M9Q A;  1NJI U;  2EQK A;  3H8Z A;  2LQ8 A;  3LGL A;  1YJ9 Q;  4NS5 A;  5CAI A;  1R0C B;  1N9S A;  3GPL A;  3NHN A;  2AKL A;  3N5B B;  2O01 E;  4X9C A;  1ZA2 B;  4F14 A;  2EWN A;  1E6G A;  3V8L A;  1YJW Q;  1YJN Q;  4M7D E;  2CZ1 B;  2XDD A;  1VQ9 Q;  1NEB A;  2KRO A;  2E4H A;  1K0S A;  4LDU A;  2HQE A;  3NTI A;  3FEO A;  2OI3 A;  5CIU A;  4M7A F;  2WSE E;  1LNX A;  2G6F X;  4IIM A;  4RCC A;  1X01 A;  1NG2 A;  2G3R A;  2QEX Q;  3BY7 A;  3TU4 K;  2DRM A;  5CQX A;  1VQ7 A;  2MPX C;  2D8H A;  2HKQ B;  1K8A C;  2OAW A;  1YNZ A;  2HSE B;  4ZGJ B;  1U8R A;  1OPL A;  1VIE A;  4DBQ A;  5GMK i;  1KQ2 A;  1I0C A;  3CPW A;  1K9A A;  1ZLM A;  2Y4Y A;  3CCJ T;  3EGD B;  4EMK C;  4C92 C;  4FSX A;  1RAI B;  3EG1 A;  2KI7 A;  2QQS A;  4JUV A;  2H8H A;  3S3N A;  1U1T A;  2IVW A;  2KRM A;  4EMK B;  4XU0 A;  4C92 B;  3AT1 B;  4PFO A;  2HDA A;  1M2V A;  1OUL A;  2L0A A;  2HD0 A;  2KVQ G;  1VQP Q;  3GP8 A;  3FIF A;  4EPC A;  3PIO A;  4QVC A;  1EIF A;  4M78 F;  2EYQ A;  1FMK A;  1VQ5 A;  1AD5 A;  3HPW A;  3M56 A;  2CUB A;  4M4Z A;  4A4H A;  4DOW A;  2AKK A;  3JB9 H;  1NPP A;  4HCB A;  2AZV A;  3CC2 T;  4IKF A;  1UEC A;  4M77 D;  5KCO A;  4LUE A;  5IXB A;  1Y07 A;  3EFS A;  5IH2 A;  3CCM A;  1RI9 A;  4PKC C;  3QDF A;  4C8Q F;  4RCB A;  4Y28 E;  1MHN A;  2HL5 C;  1UEB A;  2O9V A;  1T3L A;  4DQ2 A;  1IHV A;  4FYY B;  1TUG B;  1M1F A;  2ZPB B;  3I5S A;  3PVQ A;  3NTK A;  2FZK B;  3EGX B;  5GAO p;  3JB9 G;  1FYN A;  1PSE A;  3FB9 A;  3OYC A;  1OU9 A;  1Q7Y C;  3G7Z A;  2IPO B;  4M7D C;  2RI3 A;  3CQT A;  2EFI A;  3GNG A;  1A0N B;  4JRK A;  1K4U S;  1VQN Q;  3S3M A;  1Q82 R;  1FX7 A;  2A7Y A;  5FRO A;  4M7D B;  1YBY A;  1M1K R;  5KE2 A;  2ROT A;  2AT1 B;  1Q86 U;  1ZUU A;  2E5K A;  1OOT A;  1WIE A;  4J9E A;  4AFZ C;  1TTH B;  1B34 B;  1Q95 G;  4XQ3 A;  2DTH A;  2MAM A;  4PFP A;  3E2U A;  2OJ2 A;  3TQ7 P;  3CC4 A;  1XQH A;  2YUO A;  3PMI A;  4MMK A;  2L3Q A;  3OYL A;  3SWN A;  3ASK A;  4RUG A;  1YJ9 A;  4MZT A;  1QP2 A;  4BI8 B;  2YRC A;  1ZSZ C;  3JCM d;  4MDW A;  1WHG A;  1VQK Q;  4EMH A;  3OYN A;  2CGH A;  2EYY A;  3CC7 T;  2MF2 A;  4AT1 B;  4FYX B;  1PNJ A;  1YWO A;  1YJW A;  3VS1 A;  3M0T A;  1M4Z A;  1ZSZ B;  4LN2 A;  3EAE A;  5GJV B;  2KDS A;  1VQ9 A;  2K57 A;  2DAQ A;  3HRS A;  2HSP A;  5A2Q E;  2JMC A;  3RKW A;  2LQW A;  1UGR B;  2MK5 A;  4DEY A;  2V1Q A;  3SFM A;  2XID A;  4AG2 C;  1WQW A;  1AZG B;  2NWM A;  4RTT A;  3DLL A;  2QEX A;  3SB2 A;  1ARK A;  3A98 A;  2PUO B;  6AT1 B;  3M0P A;  3GLX A;  3I35 A;  4KUD K;  1JJ2 S;  3JB9 D;  4WF2 A;  3URG A;  2KY9 A;  3RBB B;  5CK9 A;  2XDB A;  2VVK A;  1FMW A;  3I56 A;  1G83 A;  3M55 A;  5C6S A;  4F17 A;  1Q81 C;  1HK9 A;  2CS7 A;  1HJD A;  1U3O A;  1D1A A;  4N0A A;  1PCX A;  3E9F A;  4HVW A;  3I55 T;  2XMF A;  5GMK e;  4ME7 A;  4XU3 A;  1RLQ C;  4RKU E;  2DIQ A;  3VU3 C;  2CZ6 B;  4IUR A;  4MDX A;  2WSC E;  3OA6 A;  4CC4 B;  2CT4 A;  4C92 F;  3CCV A;  1PKT A;  2K3X A;  1DJ7 B;  1K9M C;  5LJ3 h;  1RAH B;  5GAN e;  1VQ8 A;  1GXI E;  2KE9 A;  2FZG B;  8AT1 B;  4ZGD B;  3VV0 A;  3U23 A;  2DA9 A;  2DRK A;  2MI6 A;  2YUQ A;  1WXU A;  2EVR A;  1N6A A;  1K73 C;  1WDX A;  4HT9 A;  3UDC A;  2OTJ T;  1Q81 R;  7AT1 B;  2CKK A;  4N4I A;  1AZE A;  3S6W A;  2BE9 B;  1JU5 C;  3CMA Q;  3L42 A;  3VS6 A;  3OYI A;  3VS2 A;  3OW2 S;  3WXM B;  2QAZ A;  2L2P A;  2P0Q A;  4C0G A;  2DPP B;  3E1S A;  4B9W A;  3CCE T;  2VC8 A;  3RKX A;  4M75 G;  1M8V A;  4EMG A;  1KG1 A;  2RHX A;  1NE8 A;  2KT8 A;  2DBM A;  1NEG A;  4FSS A;  4OB2 B;  1MMN A;  1ZBJ A;  1NJI R;  4KBM B;  1PD0 A;  4E7I A;  4PL6 A;  3L2U A;  4C0Z A;  5GJW B;  3G6E Q;  1JBM A;  4ZNX A;  4FT2 A;  4RG2 A;  1KIK A;  4OMQ A;  2JVV A;  3CCU Q;  1RAC B;  3JCM g;  1NYG A;  1UGP B;  4C5I A;  1YHQ T;  3JCM J;  1VQO Q;  1M90 U;  1JRI A;  2QXF A;  4OMN A;  4RTU A;  4D8D A;  3F70 A;  4M7D F;  1PD1 A;  3QWY A;  3LLR A;  5AYF A;  2BZ8 A;  3VYH B;  1K73 R;  2O9S A;  1GCP A;  1IRX A;  2L3S A;  3QDR B;  5GMK m;  1N5Z A;  1KQS P;  1B07 A;  2KSS A;  3HFN A;  5KYW A;  5I11 A;  1BI1 A;  4LUD A;  3LWI A;  4WTO B;  2EJF A;  3SWN C;  3WVD B;  1M30 A;  2LT1 A;  2COY A;  1VQK A;  4FM4 B;  2SRC A;  1VQ4 A;  2K3B A;  3G71 T;  2A36 A;  3A8G B;  4J9B A;  3CD6 A;  1OYX A; 
#chains in the Genus database with same CATH homology
 1WHH A;  2CP7 A;  2HL5 C;  2HKQ B;  4B6M A;  2CP5 A;  3E2U A;  3TQ7 P;  2M02 A;  2E4H A;  1IXD A;  2CP2 A;  1TXQ A;  1WHK A;  1WHL A;  2CP3 A;  2HKN A;  2COW A;  1WHG A;  2CP0 A;  1LPL A;  2COY A;  2E3I A;  2E3H A;  1WHJ A;  2COZ A;  2HQH A;  3RDV A;  1WHM A;  2CP6 A;  2HL3 A;  1TOV A;  2QK0 A;  2Z0W A;  2MPX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...