2HQHA

Crystal structure of p150glued and clip-170
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title CLIP170 autoinhibition mimics intermolecular interactions with p150Glued or EB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein, protein binding
total genus 14
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hqhA00
1WHKA 2M02A 2E3IA 2CP6A 3E2UA 2MPXC 1WHJA 2Z0WA 2HKNA 2QK0A 1WHMA 2COWA 1WHHA 3TQ7P 2HQHA 2CP0A 1IXDA 3RDVA 2HL5C 2E3HA 2CP3A 2HKQB 2E4HA 2CP5A 1TOVA 2CP7A 1WHGA 2COZA 1WHLA 4B6MA 2COYA 2CP2A 1LPLA 1TXQA 2HL3A
chains in the Genus database with same CATH superfamily
4X9DA 4Z02A 4LXCA 5FU7B 5GAN7 2D9TA 1T0JA 4J7IA 2BE7D 4J9IA 1BI2A 2WSEE 1OPKA 2D8HA 3DLLA 3CMAT 2HBWA 4LN2A 3E9FA 3OS0A 2RF0A 1VQPQ 2K5FA 4RTUA 4ATOA 1H92A 1RL2A 1X01A 1UGPB 2KAFA 3L2QA 4JJBA 1FMKA 1IGUA 3Q1JA 2E41A 2RO0A 5HK3A 4LDUA 4AT1B 2RQRA 5GAMg 1YJWA 3CCRA 4RCCA 1K9MR 1X69A 5GANf 4C8QE 2O4XA 2IVWA 3OBYA 4HCKA 2ECZA 4V2SA 1ZA2B 4IIMA 2FZKB 2KI7A 3HL8A 3DB4A 2SEMA 3JRZA 3CCJQ 2P4TA 3GNFB 1WLPB 1M1KC 2DA9A 1Q86R 2K5IA 1X43A 3HP9A 2DYBA 5HY6A 3LWHA 1A0NB 5LJ3d 1NYFA 4M75G 2QG9B 4KGVB 3RESA 2BZYA 5LJ5j 1WFWA 2A36A 1ABQA 3VJPA 4E7SA 5IH2A 5GANg 2RHZA 1UGQB 4HA8A 2MCNA 3CCSA 5IT9E 3L2RA 1UHCA 3THKA 1U1TA 1NE8A 2KROA 2CP0A 3CCLA 1BK2A 5FLXE 3TCJA 2QDYB 2JM9A 3OA6A 2CP7A 2CUBA 2OTLA 2F69A 4MZMA 2FG0A 1ZQ1A 2IG0A 2K4YA 2KDSA 2KEAA 3P8BB 3VUBA 3TSZA 4LNPA 2VXFA 1OZ3A 4LUDA 1YJ9T 3QYGB 3MEUA 4C5GA 2EYZA 1YJNQ 1N5ZA 5GJWB 1Q95G 2L0AA 1AD5A 2DL7A 3ZBDA 1BIBA 4KULA 2ZPEB 2O4XB 5GAOr 1YIJQ 1M1GA 2O9VA 1MV0B 1Z9ZA 1Q82U 1W4SA 4PNOA 2QDLA 3CD6Q 2HMAA 3J7AF 2K7AA 2EJGA 3QPHA 4FIBA 4J9BA 2FHDA 1VQ6T 5IHIA 3BE3A 2NUTB 2P84A 4WF2A 2JUFA 4XTXA 4XU2A 2GF7A 2K9GA 1XTDA 1H3HA 1VQOQ 2CZ7B 2D1XA 2L89A 1VQ8Q 1H641 1G2BA 3CPWS 2CKKA 4KH1B 1IGQA 2PVOB 4PLIA 4E7LA 1E7OA 1TUDA 1NYGA 1DJ7B 4A63B 2DXBA 2A08A 3CMEA 5C6SA 3VS2A 4R55A 2W10A 4Y91A 1IHWA 1NZ9A 2DETA 1AWXA 2EKHA 1ZUKA 1NBEB 5LJ5f 2M02A 4BE2A 2QQBA 1NPPA 3PE0A 3QDRB 4ZN1A 4EMKA 5FWCA 3EFRA 3CCMA 2AIRB 2DIQA 4D6WA 1GFDA 3H41A 1RAAB 1M27C 1NM7A 3OMCA 3RBBB 4ZGJB 4DOVA 3QZ9B 2DF6A 2YUNA 2CH4A 4GLKA 2DVJA 2F5KA 4A4FA 3JCMg 4EDUA 4D8KA 1QW1A 3MEVA 2R57A 3X28B 1AEYA 4MZTA 2LT1A 3TREA 1MNEA 3KFVA 3OS5A 3EGDA 3ME9A 1NEGA 1NLOC 2HDAA 2L3PA 4DBHA 2E5KA 2QEXA 1U1SA 4OB3B 1JRIA 3OYDA 1PCXA 2LX9A 1UDLA 1QVGP 2RI2A 2XD0A 2EYYA 4JRKA 3VYGA 3EFSA 1W70A 2P0PA 4BI4A 1YITT 1R8OB 4C92C 4AG2C 2FYKA 5FRNA 4OMFB 2ROTA 5FU6B 1LOJA 1T3LA 3N5BB 4PJMA 2DVEA 2MK5A 4BB7A 3CEYA 3X25B 1WHKA 1Y7XA 3LH5A 2LQNA 3OY9A 1WXTA 4PJOD 2RI3A 5FROA 1VQKT 2JTMA 1OOTA 5CO7A 4Z89A 3JCMb 3UPUA 4HVWA 4E7JA 1HD3A 1WX6A 1N27A 1QCOA 2A37A 2KNBB 4FYVB 5IAYA 1KG1A 1T0HA 2VGNA 1YCYA 1Z9QA 4DBFA 2IPOB 3M0UA 4XTWA 4QVDA 3MCAB 4BI3A 2GBQA 2IIMA 1HSQA 1YN8A 1V29B 3EAEA 4FU6A 4IUVA 2FEIA 3SWNA 2AZVA 3CCET 3EGDB 1AWJA 3H6ZA 2C0IA 2GQIA 4DBQA 5DM7R 1BI3A 2CZ0B 2ZPIB 2M16A 2FRWA 4BE0A 1UGSB 3VS0A 1QCNA 2YSQA 4ZTFA 2XKOC 2EAYA 4EMGA 4A53A 3OYGA 5KYUA 4M75A 1YHQA 4LE9A 4PJOE 1K1ZA 3VKIA 3S3MA 1YJ9Q 3OYFA 1WYXA 1FYNA 1M2VB 2RHUA 2EIFA 2ZPHB 3SD4A 1HK9A 1N9SA 2A0FB 3BW1A 4OB0B 3UWNA 1O9SA 3I9QA 1M1KR 2X4XA 1VQPA 1MUZA 1Y07A 2M9UA 1ZSGA 2L3SA 2KRMA 1OU8A 1GFCA 3CBPA 3REAB 4B9WA 5C0MA 1JO8A 2LCCA 3M58A 5GAMh 4PKCC 3G7ZA 1V1CA 2M0YA 2ROLA 3QWYA 4OMPA 4GBQA 4KBMB 1EX4A 5CKHA 5I2MA 1X2KA 2JW4A 1Q81C 1KFZA 5GMKh 1GBRA 3FC3A 4XU1A 2X3XD 5GMKm 3CCJA 2HNIA 4PFPA 2GQVA 3EG3A 4N4GA 2RM4A 4C0GA 3S3NA 2RQWA 4RG8A 1ZX6A 2DRMA 2YT6A 2GTJA 3FEOA 4C8QA 2BE9B 2QA4A 2DK3A 3M4GA 3H0IA 2XICA 1YI2T 3GPLA 4XQ3A 5GANh 4ELYC 4N0AC 1Y96A 4R0KA 5I21A 1UFFA 4E2FB 1BYMA 4M75B 3TU4K 4ME7A 2LQ8A 4E7HA 3INZA 5A0LA 1KQ2A 4PJOG 2K79A 2JS2A 4E7IA 1W2BP 4R56A 3NTIA 2RJFA 3OYJA 1RABB 4PJLA 4RTXA 1S72T 1D0XA 2CP5A 3MKDA 1ZUYA 2RJCA 1X27A 5GAMj 1Q81U 3I5SA 4OGCA 4M7AF 1XOVA 1G8XA 3CC7T 4XK8E 4M78C 1BI1A 3KXTA 1KQSP 1YJNA 2J6FA 5LL6S 4M7AE 1WJSA 5GMKj 2E6NA 2GFUA 1YITQ 3A1PA 5ECAA 1BBZA 3CCQT 1OPLA 2CP6A 1KIKA 5GMKl 2BZXA 1FX7A 1KK7A 3J80E 1WQ7A 4JS5A 3CD6A 2HQEA 3UA7A 5J39A 5CCAA 1TU0B 1PKSA 3RDVA 4E47A 5GANj 3EGUA 2DILA 1RAHB 2EQMA 3CBMA 2DD5A 1VQKQ 4II1A 2RQVA 4QQDA 3CCUT 3PT9A 1FMWA 1RUWA 2G6FX 1W6XA 1I1JA 2EYWA 1VQOA 3FJ5A 1JU5C 5CKDA 1VQ8A 1KD1R 1Y96B 3JB9H 3NGPA 1ZHIA 4QVZA 3A98A 3QDFA 1SPKA 4FSSA 2YRCA 4XTVA 3I35A 2LJ3A 2COWA 3L42A 5FU7C 4M75F 3OYAA 2VC8A 1FMVA 1PD1A 4KGZB 4A4KA 5FRMA 2AZSA 1PSEA 2XDBA 3EHRA 3R6OA 4PFZA 3M56A 4EIKA 3CCEQ 1OULA 4GLMA 4IUQA 1BCMA 1VQLA 4F7UE 3G4ST 3OB9A 2HAXA 1JEGA 1D1BA 1UHFA 4NS5A 4F04B 1VQ5A 2DXTA 2DO3A 2HL5C 3H0FA 2KYMA 3QWXX 3F70A 3JCMh 1VYUA 4NL3A 3OYIA 1YHQQ 3PFSA 2LNVA 3BFMA 2NUZA 1VQNT 5GAMf 4M7AG 4XAXB 3E9GA 1LVKA 4M78D 1EFNA 4E7ZA 2PU9B 3A8OB 2CS7A 2FZCB 5DLOA 3CMAA 1I0CA 2EQIA 1HJDA 2OX7A 3RKYA 4KT0E 2K3YA 5GAOm 2DL4A 1RAFB 2H3JA 3MEAA 4M7DF 1VQ4T 3HSBA 2K6DA 1K9AA 3H9NA 1B34A 1SEMA 4J9EA 3UATA 5L23A 4C8QF 1TTHB 4FYXB 4DBRA 4M7DE 3SDZA 3FIFA 2M51A 3L2VA 4A4EA 4ZN3A 1R77A 1RAEB 1YFNA 4FM4B 1JJ2P 4QQGA 3C12A 1C1AA 1LPLA 4L5GA 2XDPA 2X3WD 2LT4A 4ZGDB 3L2WA 4NOYA 5L8RE 1PD0A 2QTXA 1GRIA 3E19A 1IB8A 1WDXA 2O31A 2EQJA 2G3RA 3X24B 2M0OA 1TUGB 2QA4Q 5KYXA 3JB9D 1MHNA 2COZA 4RTZA 3ZEHA 2PVDB 4M77D 4M78E 4DOWA 1V76A 1M30A 4BY6B 1VQ7T 2AT1B 1Q82C 3M5AA 5AT1B 2CT4A 1VQ7A 3OW2P 2FPFA 2RHXA 2FO0A 2C0OA 1N6AA 1O75A 1ZBXA 2B86A 4C0DC 5IHKA 3MO8A 1M5Q1 4N4HA 5GAOl 2R5AA 4HT8A 3JCMW 3FDRA 1D0ZA 1S72Q 4NL2A 1MV3A 5KYWA 3MHXA 3WVDB 2XG8D 1YWPA 2DMOA 4AFZC 2LRQA 1Q81R 3CC7Q 1D0YA 2X9HA 1Q7YU 2KE9A 4HCCA 1YJ9A 2J6KA 4WCIA 3M4YA 2KR3A 3URGA 1M90U 4M7DG 4A4HA 4EPCA 2QQSA 4M4ZA 5EG2A 5KCOA 1CKAA 2MIOA 4J9FA 3KBGA 4C0DB 3VYHB 1UUEA 4PJOA 3CCQQ 1OQKA 4C8QG 1D3BA 4M77E 3JV3A 3SB2A 3QJYA 2PUOB 2ENMA 2DL5A 3QXEB 3GF5A 2JT4A 4L59A 1VQ6A 2V8IA 3PMTA 1WIEA 3JCMc 3PIPA 5KYXB 3CCUQ 4JZ3A 2HD0A 3RKWA 2DXUA 2J6OA 2F2WA 3M55A 4LD9K 2DX1A 2SRCA 3I55T 2AK5A 2ZPBB 1H8KA 1NJIU 1AT1B 1TUCA 4FSXA 4CC7A 2P0QA 2ED0A 3ULRB 4LDVA 2EPDA 2KBTA 4CRIA 3JCMf 2K3XA 2J06A 3NTHA 1SRMA 3LW5E 3RKXA 1BU1A 3CC2T 1ZSZA 5CIUA 3QUIA 3O8VA 5CKEA 3PGGA 4K11A 1KSWA 2RQTA 1QKWA 1VQLQ 2LVMA 4RTTA 1VQ5Q 3UDCA 2Y90A 1IREB 2DEQA 3M53A 2MI6A 2DNUA 1B3QA 4AFUC 2E65A 3M0PA 3S3OA 1W2BA 5FU6C 2GFAA 4C5EA 2LP5A 2JMCA 2CREA 1QVFP 1X6BA 4EMHA 3LX7A 4PLLA 1TSFA 3MPUB 4XTUA 1VQNQ 2LJ0A 4JJDA 1QWEA 1FWZA 1RI9A 3PVQA 1QCFA 4PJOB 1SHGA 4IIOA 1PRMC 1XJWB 2RB6A 9ATCB 1D3BB 2MF2A 4Y92A 3G6ET 3QZ5B 3UT1A 3CMAQ 5I11A 1ARKA 2CH4W 2JM8A 1KQSA 3RNJA 3VS7A 4J6YA 3T9NA 2ESWA 2RMOA 4AG1C 4M77G 4B9XA 1LNXA 1RAGB 5CKBA 3TVTA 6AT1B 2DEUA 3HFOA 3FRNA 1WHHA 1YBYA 1MMDA 1AVZC 1M3CA 3OYYA 1YITA 4J9GA 1XNIA 3V8LA 1RLQC 3QHSA 2EYXA 3E1SA 1KQ1A 3O5ZA 2CT3A 1GBQA 1TXQA 2I2LA 4DEXA 1AOJA 1LJOA 4M7AA 4J7FA 4Y28E 1VQKA 2QXFA 5IXFA 1RI0A 4EMKB 3CXCP 2YRDA 2L2PA 1OZ2A 2DBMA 2KK4A 1VQMT 1GCQA 1K73U 4BI8B 2E3IA 3M0QA 5GAOq 1K0SA 3C95A 2KQWA 2X35A 3EG1A 3HRSA 4LDWA 2AKLA 5LJ5e 1VQ7Q 4DA4A 3VRZA 2EKOA 3MP8A 4J83A 1R0BG 4J9DA 3DLMA 4IUUA 4BUGA 5IN1A 1N8RU 3CCEA 1BB9A 2CGHA 1OI1A 1X2QA 3L2ZA 2BKDN 3CCVT 1F1BB 2JS0A 2LQKA 5GAN8 3CCVA 4PJOF 3S6WA 1EIFA 1J3TA 3CC4T 1ABOA 3VS6A 4PFOA 3A8MB 3U23A 2KXDA 2B8AA 1IXDA 3OBWA 2DAQA 3H8ZA 3JCMP 2LX7A 2CZ6B 2FRYA 3JSCA 4FW2A 4JLGA 3C94A 2KYBA 2PZ1A 4B6MA 2NLUA 4F7UA 3BDLA 1OV3A 3FLGA 5HKCA 3PIOA 2HZYA 2O88A 2JVVA 3I5RA 3OYBA 3MP6A 3HHTB 2OTJT 4XTZA 1N9RA 4KUIA 4J9HA 3SWNC 2J05A 4M7AB 5KH6A 1WZOA 3MJXA 4C92D 4OMNA 2CP3A 1OU9A 4OMQA 2HSEB 1Q82R 1D1AA 2VGMA 2F2VA 1WJRA 4RTVA 3E2UA 2M1HA 2DFUA 1VQ6Q 2EJ9A 1JJ2A 4JJNK 3OQ5A 4M75C 2D6FA 4BDYA 3NMZC 2GTOA 2DPPB 5CQXA 2E4HA 2QYZA 2PTKA 3D7SB 3I55Q 2D8JA 3VU3C 1BI0A 1MMGA 3SWNB 1M1FA 4M7DA 5FWBA 2QQ9A 2NWMA 2PQWA 3EHQA 2DLPA 3A8LB 2ED1A 2EQUA 5CVIA 5LJ3f 1KC8C 1I4K1 1QVPA 4CC3A 4FCYA 2XK0A 2BTTA 3OW2A 1YI2A 4LUEA 1Y71A 2LTOA 1Q86U 2CP2A 4IKFA 3ZFJA 1JB0E 1ZBJA 5KYUB 3X20B 3WVEB 1WXUA 5LJ5d 3G71T 3HPWA 4C0ZA 8ATCB 5KYNA 4C92E 4BACA 3RR6A 1X6OA 4ZNXA 3CBOA 2DIGA 4M78A 3ER0A 1JBMA 4UC4A 2ZGWA 1M9SA 4RCBA 1VIEA 5LJ3g 2O9SA 1S72A 1E6GA 5IHNA 2DKGA 2XI9A 3MP1A 2YLCA 2WACA 2E10A 3M59A 3G6EQ 2F5TX 5D6XA 4JRIA 1SG5A 3V8JA 3CC7A 1SKUB 2EGAA 3QYHB 1YWOA 3HRUA 2EGEA 3HRTA 1WHGA 1G3WA 2A3LA 2JTEA 4OMOA 5CQYA 3WXMB 1B7TA 1KC8U 3A5ZB 4ELZC 1QKXA 2L3QA 5CR2A 1U8RA 3CCQA 5A2QE 2V1QA 2LZ6B 4X1VA 4LDXA 2QAZA 4M7DB 2QTVA 2HEQA 4PL6A 2LCSA 4KH0B 2D0QB 3PTAA 2QGFB 5M9OA 4D8DA 3M9QA 4HVVA 2E64A 4C8QB 1YIJT 1PWTA 1VYVA 4HKEA 2KMTA 2LDMA 3CCUA 4M77A 3GLXA 5GAN3 1WQWA 2JOYA 2KVQG 1AWWA 1VQMQ 2X4WA 1KHCA 2DZCA 1PC0A 2FPDA 4F7UF 2VYTA 1RLPC 2RD1A 1X75C 2I0NA 1GCPA 2XHCA 4PK4A 2FB7A 2V1RA 1UECA 3OYMA 1WHJA 1UEBA 1UJ0A 3HTRA 2K2VA 2KXCA 3TQ7P 2K57A 3G4SA 3CCVQ 2QQRA 2DZ9A 1CKBA 1ZUUA 3CC4Q 4C5HA 3OYEA 3L2UA 1VQ9T 3M0TA 3P8DA 1QVFA 2CZ1B 2HL3A 2J7IA 3OYKA 2D0NA 5IXBA 2CSIA 2DL8A 3AT1B 1VQNA 5DLQE 2RN8A 4XU3A 3I56T 2OTJQ 1QVGA 2DTIA 2KT1A 3OYLA 3NHNA 1I07A 1PM3A 1WHLA 4Q5WA 1QLYA 1JXOA 2HQXA 2A7YA 1VQ4A 2OI3A 2HKNA 1VIFA 2XMFA 4M77B 4BY6C 1UE9A 3X26B 4E6RA 1RADB 1M8VA 3LGFA 2RQUA 2HCKA 2GNCA 2CSQA 1W1FA 1X6GA 2COYA 4ESRA 4N4IA 5A0GA 4DQ2A 1TS9A 2DBKA 3V7RA 1R0CB 4MDWA 1YJWT 3CCRT 3LWIA 1Q7YC 3CXCA 4M78F 1NEBA 1JJ2S 5GAOp 4E7KA 2HBPA 4QKUA 4AFSC 3RIRA 5KE2A 1M90C 3HKSA 3GNGA 4JLIA 2P0KA 2EFIA 2OAUA 1M3BA 3SHWA 4F7UG 3REBB 3UA6A 1YI2Q 1M2OA 2JN0A 4KRTA 3JCMV 1EZZB 3EG0A 2YDLA 2LC4A 3DKMA 1G3YA 1B07A 2NUTA 1AZGB 2QQAA 3G71Q 3EG2A 4PJNA 2E3HA 2PVGB 3GIBA 1E6HA 5J26A 1TOVA 4JDSA 3OW2S 4HCBA 4RG2A 4OF1A 2R58A 1QMCA 1VOMA 2RHIA 3CCST 5KE3A 1NJIC 3CCLT 1YP5A 2CUDA 3QO3A 2YLBA 1B34B 1UJYA 3QSUA 1D09B 3LGLA 5GMKi 2W0ZA 5GAMe 4FW1A 3DB3A 2OTLT 1UGRB 3M0SA 2VASA 3PVLA 4QW2A 2YUQA 3JB9F 1C0MA 2PNIA 4M77F 1IZ6A 3J81E 3FJPA 1AZEA 4TVRA 1Y0MA 2QK0A 5GMKe 1TWBA 2QGGA 4C5IA 1LCKA 1KC8R 4MMLA 1M1KU 4OP0A 1ZA1B 3V7CA 2JXBA 2RHYA 1NG2A 3JCMX 4BE1A 4HVUA 3OYCA 2YUOA 3FB9A 5GANe 2EWNA 2FVUA 2DD4A 5I2SA 4Z8AA 4QVCA 2DTOA 3ASKA 3JB9I 4M78G 1G83A 4J6WA 3CPWP 3I55A 1PKTA 3RUXA 1K8AC 2AKKA 2X4JA 2R5MA 4PJOC 1UG1A 2YRVA 3CC2A 4AMCA 2EGCA 1K76A 2DE0X 3CMET 2DM1A 3M54A 2JTFA 1NPRA 4L6V5 2JMAA 5KYWB 3G4SQ 4JJCA 2RK2A 1XQHA 4HXJA 2V8KA 2RK1A 3P8HA 3CQTA 4RTWA 2BUDA 2VV5A 1GL5A 5HK0A 1VQ9Q 4JS4A 5GAOn 4CC2A 5KYYA 3CCMT 1U3OA 4P5NA 1G3SA 5LJ3h 2EW3A 1M8MA 5FW9A 4HT9A 3LH0A 5D7UA 2ZPGB 4JUVA 1K73C 2X51A 3H0HA 4C92A 1ZSZC 7AT1B 3I56Q 3G6EA 2BIVA 4DEYA 3JB9G 1QVFS 1K8AU 1HYOA 4RMOA 1KD1C 4EMKC 3CPFA 1M4ZA 5LJ5g 5GAMd 2MYSA 1OX8A 1VQ4Q 4FYYB 2QEXT 1T3SA 1SF9A 1WJQA 2L5QA 2RJDA 2K3BA 1N8RC 2P4RA 3SFMA 1I8FA 3EG9A 5A0DA 1I5OB 1QVGS 4XTYA 5D6YA 1UGVA 1QWFA 2EVRA 4J9CA 1WI7A 3IQLA 2DTHA 2AHJB 2H3EB 1ZSZB 2QASA 2K2MA 4QT7A 1PSFA 1M2VA 5I22A 3CCRQ 1YJWQ 3JB9J 1P92A 5AYFA 3C0CA 1NLPC 2WSFE 2FL7A 5GANd 4MDXA 3NPFA 4X9CA 4ANJA 4OGEA 2OJ2A 1SSHA 2DERA 5CK9A 2DJZA 1VQMA 2C0TA 1I81A 3JCMe 4FL6A 1WHMA 5LJ3j 5GAN4 3META 3CXCS 1KD1U 2F2XA 5D6WA 1KJWA 5KYYB 1VYTA 3VRYA 1U5SA 2E1HA 4PJJA 2RI5A 1C6VX 4CC4B 1WGSA 8AT1B 3VS4A 3PNWC 4M7AC 1TH7A 5GJVB 2E70A 2HSPA 2EJFA 4C92B 1OEBA 2NUPA 1WNLA 2ZAEA 3PMIA 4IUPA 1RACB 3JCMQ 3VV0A 3CCSQ 3EH1A 4J5YA 3CC4A 3SEMA 2LMJA 4XU0A 1K9MC 3CCLQ 4KUDK 4WTOB 1GXIE 1GCQC 2CYZB 3EG9B 1MNDA 3TSWA 2OTLQ 1HXDA 2Z0WA 1Q7YR 2VKNA 3GOXA 2MAMA 3QJ6A 2OTJA 4C0FA 1Q86C 5J3BA 1YHQT 1G3TA 2EQKA 1M90R 2ZCFB 2E6ZA 4OMMA 5HCKA 3OS1A 4O6JA 2A28A 4JZ4A 2GGRA 2MWPA 4ZTJA 2WSCE 1U06A 1MMAA 1OYXA 1ZLMA 2FZGB 1MGQA 1VQPT 3VUZA 5EC7A 1JXMA 1QP3A 4FYWB 1JQQA 2X4YA 2Y4XA 1YCSB 1I5LA 3A8GB 3JAME 2PUKB 2EYQA 3GP8A 1K9MU 4N0AA 2DXCA 1BCOA 3G1JA 2XU8A 1NJIR 2VXEA 2GCXA 5KCHA 3NFCA 4O5VA 1M3AA 4FT2A 3OSSC 2NUPB 4IUTA 3CC2Q 3EFOA 4F14A 1SHFA 1TG0A 1PHTA 2JNGA 2VWFA 1UTIA 4C92F 2LQWA 1QQJA 3RMQA 3R6NA 3RERA 3CCJT 2E5QA 3CMEQ 2EBPA 4VUBA 3JCMd 3MEWA 4M7AD 1UB4A 2DYIA 3QKJA 1D1CA 4F7UB 4A54A 1OX9A 2KRNA 2V8JA 2RA2A 2QA4T 3G71A 2LJ1A 4AFQC 2FPEA 4JRPA 1H3ZA 1KHIA 1K4US 2KRSA 1BKBA 1S1NA 3CCMQ 1VA7A 5CKFA 4M7DC 3JCMJ 3OS2A 5DY9A 4BDZA 3VS5A 3GBQA 4YTLA 3V7SA 4RKUE 3A8HB 3EGXA 4C8QC 1K0XA 1W2BS 2Y4YA 1SSFA 2ABLA 4MZPA 2MMPA 4A4GA 3TEEA 2CDTA 4OB2B 5GAN5 1K8AR 1CSKA 2OAWA 2LNHB 2ZPFB 2V26A 3OSVA 2ZZDA 1G5VA 1RAIB 2QEXQ 2VUBA 2MWOA 1ACMB 1WXBA 4GY5A 1KQSS 2JJ9A 1BIAA 2O01E 2YHTA 3M57A 1YJNT 3LYIA 2RH2A 4X34A 3C4SA 3OMGA 5GAN2 1WA7A 4M75D 2E12A 4ZGEB 4HCZA 4RTYA 3EFOB 2BZ8A 2C06A 3VS1A 1YIJA 4QQ6A 3L1AA 1PNJA 1IRXA 2O2OA 2L8DA 3CD6T 3LLRA 3CPWA 1YNZA 3VS3A 2NYSA 4MMKA 4ORZA 3EH2A 3UF4A 2YWWA 2HQHA 1Y57A 3HFNA 4Z88A 3ZL7C 1K73R 2H8HA 2HKQB 4FT4A 2YXYA 1SRLA 4J6XA 2VVKA 1VQOT 1QP2A 4C92G 4OB1B 4M78B 2QI2A 1VQ8T 4LD6A 5LJ3e 3NTKA 2KT8A 3OYHA 3QG1A 4OMLA 3RMSA 1PRLC 2DL3A 4OVAA 1MMNA 1IO6A 2DRKA 4F16A 4RUGA 3BY7A 2F1LA 2KSSA 3V8KA 2XIDA 4CI0C 3EGXB 4F17A 3AHUA 2K5LA 2RPNA 1N8RR 1AHJB 2VB6A 1FXXA 4J8OA 5GAN6 3M0RA 3OYNA 4BD3A 4M77C 2RNAA 4LDYA 4M7DD 2RJEA 3QIIA 1VQ9A 4KGXB 2LCLA 1VQLT 4M75E 2MPXC 1WPYA 2ATCB 2YUPA 4C8QD 1AWOA 1VQ5T 2JZ2A 3KUFA 2DJQA 1VUBA 2MOXA 4JPBW 2L3RA 5CAIA 4JRQA 2KY9A 3QBYA 1IHVA 3I56A 4IURA 1PG5B 2KGTA 3BDUA 5LJ5h 2XDDA
chains in the Genus database with same CATH topology
1WHKA 2M02A 2E3IA 2CP6A 3E2UA 2MPXC 1WHJA 2Z0WA 2HKNA 2QK0A 1WHMA 2COWA 1WHHA 3TQ7P 2HQHA 2CP0A 1IXDA 3RDVA 2HL5C 2E3HA 2CP3A 2HKQB 2E4HA 2CP5A 1TOVA 2CP7A 1WHGA 2COZA 1WHLA 4B6MA 2COYA 2CP2A 1LPLA 1TXQA 2HL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHK A;  2M02 A;  2E3I A;  2CP6 A;  3E2U A;  2MPX C;  1WHJ A;  2Z0W A;  2HKN A;  2QK0 A;  1WHM A;  2COW A;  1WHH A;  3TQ7 P;  2HQH A;  2CP0 A;  1IXD A;  3RDV A;  2HL5 C;  2E3H A;  2CP3 A;  2HKQ B;  2E4H A;  2CP5 A;  1TOV A;  2CP7 A;  1WHG A;  2COZ A;  1WHL A;  4B6M A;  2COY A;  2CP2 A;  1LPL A;  1TXQ A;  2HL3 A; 
#chains in the Genus database with same CATH topology
 4X9D A;  4Z02 A;  4LXC A;  5FU7 B;  5GAN 7;  2D9T A;  1T0J A;  4J7I A;  2BE7 D;  4J9I A;  1BI2 A;  2WSE E;  1OPK A;  2D8H A;  3DLL A;  3CMA T;  2HBW A;  4LN2 A;  3E9F A;  3OS0 A;  2RF0 A;  1VQP Q;  2K5F A;  4RTU A;  4ATO A;  1H92 A;  1RL2 A;  1X01 A;  1UGP B;  2KAF A;  3L2Q A;  4JJB A;  1FMK A;  1IGU A;  3Q1J A;  2E41 A;  2RO0 A;  5HK3 A;  4LDU A;  4AT1 B;  2RQR A;  5GAM g;  1YJW A;  3CCR A;  4RCC A;  1K9M R;  1X69 A;  5GAN f;  4C8Q E;  2O4X A;  2IVW A;  3OBY A;  4HCK A;  2ECZ A;  4V2S A;  1ZA2 B;  4IIM A;  2FZK B;  2KI7 A;  3HL8 A;  3DB4 A;  2SEM A;  3JRZ A;  3CCJ Q;  2P4T A;  3GNF B;  1WLP B;  1M1K C;  2DA9 A;  1Q86 R;  2K5I A;  1X43 A;  3HP9 A;  2DYB A;  5HY6 A;  3LWH A;  1A0N B;  5LJ3 d;  1NYF A;  4M75 G;  2QG9 B;  4KGV B;  3RES A;  2BZY A;  5LJ5 j;  1WFW A;  2A36 A;  1ABQ A;  3VJP A;  4E7S A;  5IH2 A;  5GAN g;  2RHZ A;  1UGQ B;  4HA8 A;  2MCN A;  3CCS A;  5IT9 E;  3L2R A;  1UHC A;  3THK A;  1U1T A;  1NE8 A;  2KRO A;  2CP0 A;  3CCL A;  1BK2 A;  5FLX E;  3TCJ A;  2QDY B;  2JM9 A;  3OA6 A;  2CP7 A;  2CUB A;  2OTL A;  2F69 A;  4MZM A;  2FG0 A;  1ZQ1 A;  2IG0 A;  2K4Y A;  2KDS A;  2KEA A;  3P8B B;  3VUB A;  3TSZ A;  4LNP A;  2VXF A;  1OZ3 A;  4LUD A;  1YJ9 T;  3QYG B;  3MEU A;  4C5G A;  2EYZ A;  1YJN Q;  1N5Z A;  5GJW B;  1Q95 G;  2L0A A;  1AD5 A;  2DL7 A;  3ZBD A;  1BIB A;  4KUL A;  2ZPE B;  2O4X B;  5GAO r;  1YIJ Q;  1M1G A;  2O9V A;  1MV0 B;  1Z9Z A;  1Q82 U;  1W4S A;  4PNO A;  2QDL A;  3CD6 Q;  2HMA A;  3J7A F;  2K7A A;  2EJG A;  3QPH A;  4FIB A;  4J9B A;  2FHD A;  1VQ6 T;  5IHI A;  3BE3 A;  2NUT B;  2P84 A;  4WF2 A;  2JUF A;  4XTX A;  4XU2 A;  2GF7 A;  2K9G A;  1XTD A;  1H3H A;  1VQO Q;  2CZ7 B;  2D1X A;  2L89 A;  1VQ8 Q;  1H64 1;  1G2B A;  3CPW S;  2CKK A;  4KH1 B;  1IGQ A;  2PVO B;  4PLI A;  4E7L A;  1E7O A;  1TUD A;  1NYG A;  1DJ7 B;  4A63 B;  2DXB A;  2A08 A;  3CME A;  5C6S A;  3VS2 A;  4R55 A;  2W10 A;  4Y91 A;  1IHW A;  1NZ9 A;  2DET A;  1AWX A;  2EKH A;  1ZUK A;  1NBE B;  5LJ5 f;  2M02 A;  4BE2 A;  2QQB A;  1NPP A;  3PE0 A;  3QDR B;  4ZN1 A;  4EMK A;  5FWC A;  3EFR A;  3CCM A;  2AIR B;  2DIQ A;  4D6W A;  1GFD A;  3H41 A;  1RAA B;  1M27 C;  1NM7 A;  3OMC A;  3RBB B;  4ZGJ B;  4DOV A;  3QZ9 B;  2DF6 A;  2YUN A;  2CH4 A;  4GLK A;  2DVJ A;  2F5K A;  4A4F A;  3JCM g;  4EDU A;  4D8K A;  1QW1 A;  3MEV A;  2R57 A;  3X28 B;  1AEY A;  4MZT A;  2LT1 A;  3TRE A;  1MNE A;  3KFV A;  3OS5 A;  3EGD A;  3ME9 A;  1NEG A;  1NLO C;  2HDA A;  2L3P A;  4DBH A;  2E5K A;  2QEX A;  1U1S A;  4OB3 B;  1JRI A;  3OYD A;  1PCX A;  2LX9 A;  1UDL A;  1QVG P;  2RI2 A;  2XD0 A;  2EYY A;  4JRK A;  3VYG A;  3EFS A;  1W70 A;  2P0P A;  4BI4 A;  1YIT T;  1R8O B;  4C92 C;  4AG2 C;  2FYK A;  5FRN A;  4OMF B;  2ROT A;  5FU6 B;  1LOJ A;  1T3L A;  3N5B B;  4PJM A;  2DVE A;  2MK5 A;  4BB7 A;  3CEY A;  3X25 B;  1WHK A;  1Y7X A;  3LH5 A;  2LQN A;  3OY9 A;  1WXT A;  4PJO D;  2RI3 A;  5FRO A;  1VQK T;  2JTM A;  1OOT A;  5CO7 A;  4Z89 A;  3JCM b;  3UPU A;  4HVW A;  4E7J A;  1HD3 A;  1WX6 A;  1N27 A;  1QCO A;  2A37 A;  2KNB B;  4FYV B;  5IAY A;  1KG1 A;  1T0H A;  2VGN A;  1YCY A;  1Z9Q A;  4DBF A;  2IPO B;  3M0U A;  4XTW A;  4QVD A;  3MCA B;  4BI3 A;  2GBQ A;  2IIM A;  1HSQ A;  1YN8 A;  1V29 B;  3EAE A;  4FU6 A;  4IUV A;  2FEI A;  3SWN A;  2AZV A;  3CCE T;  3EGD B;  1AWJ A;  3H6Z A;  2C0I A;  2GQI A;  4DBQ A;  5DM7 R;  1BI3 A;  2CZ0 B;  2ZPI B;  2M16 A;  2FRW A;  4BE0 A;  1UGS B;  3VS0 A;  1QCN A;  2YSQ A;  4ZTF A;  2XKO C;  2EAY A;  4EMG A;  4A53 A;  3OYG A;  5KYU A;  4M75 A;  1YHQ A;  4LE9 A;  4PJO E;  1K1Z A;  3VKI A;  3S3M A;  1YJ9 Q;  3OYF A;  1WYX A;  1FYN A;  1M2V B;  2RHU A;  2EIF A;  2ZPH B;  3SD4 A;  1HK9 A;  1N9S A;  2A0F B;  3BW1 A;  4OB0 B;  3UWN A;  1O9S A;  3I9Q A;  1M1K R;  2X4X A;  1VQP A;  1MUZ A;  1Y07 A;  2M9U A;  1ZSG A;  2L3S A;  2KRM A;  1OU8 A;  1GFC A;  3CBP A;  3REA B;  4B9W A;  5C0M A;  1JO8 A;  2LCC A;  3M58 A;  5GAM h;  4PKC C;  3G7Z A;  1V1C A;  2M0Y A;  2ROL A;  3QWY A;  4OMP A;  4GBQ A;  4KBM B;  1EX4 A;  5CKH A;  5I2M A;  1X2K A;  2JW4 A;  1Q81 C;  1KFZ A;  5GMK h;  1GBR A;  3FC3 A;  4XU1 A;  2X3X D;  5GMK m;  3CCJ A;  2HNI A;  4PFP A;  2GQV A;  3EG3 A;  4N4G A;  2RM4 A;  4C0G A;  3S3N A;  2RQW A;  4RG8 A;  1ZX6 A;  2DRM A;  2YT6 A;  2GTJ A;  3FEO A;  4C8Q A;  2BE9 B;  2QA4 A;  2DK3 A;  3M4G A;  3H0I A;  2XIC A;  1YI2 T;  3GPL A;  4XQ3 A;  5GAN h;  4ELY C;  4N0A C;  1Y96 A;  4R0K A;  5I21 A;  1UFF A;  4E2F B;  1BYM A;  4M75 B;  3TU4 K;  4ME7 A;  2LQ8 A;  4E7H A;  3INZ A;  5A0L A;  1KQ2 A;  4PJO G;  2K79 A;  2JS2 A;  4E7I A;  1W2B P;  4R56 A;  3NTI A;  2RJF A;  3OYJ A;  1RAB B;  4PJL A;  4RTX A;  1S72 T;  1D0X A;  2CP5 A;  3MKD A;  1ZUY A;  2RJC A;  1X27 A;  5GAM j;  1Q81 U;  3I5S A;  4OGC A;  4M7A F;  1XOV A;  1G8X A;  3CC7 T;  4XK8 E;  4M78 C;  1BI1 A;  3KXT A;  1KQS P;  1YJN A;  2J6F A;  5LL6 S;  4M7A E;  1WJS A;  5GMK j;  2E6N A;  2GFU A;  1YIT Q;  3A1P A;  5ECA A;  1BBZ A;  3CCQ T;  1OPL A;  2CP6 A;  1KIK A;  5GMK l;  2BZX A;  1FX7 A;  1KK7 A;  3J80 E;  1WQ7 A;  4JS5 A;  3CD6 A;  2HQE A;  3UA7 A;  5J39 A;  5CCA A;  1TU0 B;  1PKS A;  3RDV A;  4E47 A;  5GAN j;  3EGU A;  2DIL A;  1RAH B;  2EQM A;  3CBM A;  2DD5 A;  1VQK Q;  4II1 A;  2RQV A;  4QQD A;  3CCU T;  3PT9 A;  1FMW A;  1RUW A;  2G6F X;  1W6X A;  1I1J A;  2EYW A;  1VQO A;  3FJ5 A;  1JU5 C;  5CKD A;  1VQ8 A;  1KD1 R;  1Y96 B;  3JB9 H;  3NGP A;  1ZHI A;  4QVZ A;  3A98 A;  3QDF A;  1SPK A;  4FSS A;  2YRC A;  4XTV A;  3I35 A;  2LJ3 A;  2COW A;  3L42 A;  5FU7 C;  4M75 F;  3OYA A;  2VC8 A;  1FMV A;  1PD1 A;  4KGZ B;  4A4K A;  5FRM A;  2AZS A;  1PSE A;  2XDB A;  3EHR A;  3R6O A;  4PFZ A;  3M56 A;  4EIK A;  3CCE Q;  1OUL A;  4GLM A;  4IUQ A;  1BCM A;  1VQL A;  4F7U E;  3G4S T;  3OB9 A;  2HAX A;  1JEG A;  1D1B A;  1UHF A;  4NS5 A;  4F04 B;  1VQ5 A;  2DXT A;  2DO3 A;  2HL5 C;  3H0F A;  2KYM A;  3QWX X;  3F70 A;  3JCM h;  1VYU A;  4NL3 A;  3OYI A;  1YHQ Q;  3PFS A;  2LNV A;  3BFM A;  2NUZ A;  1VQN T;  5GAM f;  4M7A G;  4XAX B;  3E9G A;  1LVK A;  4M78 D;  1EFN A;  4E7Z A;  2PU9 B;  3A8O B;  2CS7 A;  2FZC B;  5DLO A;  3CMA A;  1I0C A;  2EQI A;  1HJD A;  2OX7 A;  3RKY A;  4KT0 E;  2K3Y A;  5GAO m;  2DL4 A;  1RAF B;  2H3J A;  3MEA A;  4M7D F;  1VQ4 T;  3HSB A;  2K6D A;  1K9A A;  3H9N A;  1B34 A;  1SEM A;  4J9E A;  3UAT A;  5L23 A;  4C8Q F;  1TTH B;  4FYX B;  4DBR A;  4M7D E;  3SDZ A;  3FIF A;  2M51 A;  3L2V A;  4A4E A;  4ZN3 A;  1R77 A;  1RAE B;  1YFN A;  4FM4 B;  1JJ2 P;  4QQG A;  3C12 A;  1C1A A;  1LPL A;  4L5G A;  2XDP A;  2X3W D;  2LT4 A;  4ZGD B;  3L2W A;  4NOY A;  5L8R E;  1PD0 A;  2QTX A;  1GRI A;  3E19 A;  1IB8 A;  1WDX A;  2O31 A;  2EQJ A;  2G3R A;  3X24 B;  2M0O A;  1TUG B;  2QA4 Q;  5KYX A;  3JB9 D;  1MHN A;  2COZ A;  4RTZ A;  3ZEH A;  2PVD B;  4M77 D;  4M78 E;  4DOW A;  1V76 A;  1M30 A;  4BY6 B;  1VQ7 T;  2AT1 B;  1Q82 C;  3M5A A;  5AT1 B;  2CT4 A;  1VQ7 A;  3OW2 P;  2FPF A;  2RHX A;  2FO0 A;  2C0O A;  1N6A A;  1O75 A;  1ZBX A;  2B86 A;  4C0D C;  5IHK A;  3MO8 A;  1M5Q 1;  4N4H A;  5GAO l;  2R5A A;  4HT8 A;  3JCM W;  3FDR A;  1D0Z A;  1S72 Q;  4NL2 A;  1MV3 A;  5KYW A;  3MHX A;  3WVD B;  2XG8 D;  1YWP A;  2DMO A;  4AFZ C;  2LRQ A;  1Q81 R;  3CC7 Q;  1D0Y A;  2X9H A;  1Q7Y U;  2KE9 A;  4HCC A;  1YJ9 A;  2J6K A;  4WCI A;  3M4Y A;  2KR3 A;  3URG A;  1M90 U;  4M7D G;  4A4H A;  4EPC A;  2QQS A;  4M4Z A;  5EG2 A;  5KCO A;  1CKA A;  2MIO A;  4J9F A;  3KBG A;  4C0D B;  3VYH B;  1UUE A;  4PJO A;  3CCQ Q;  1OQK A;  4C8Q G;  1D3B A;  4M77 E;  3JV3 A;  3SB2 A;  3QJY A;  2PUO B;  2ENM A;  2DL5 A;  3QXE B;  3GF5 A;  2JT4 A;  4L59 A;  1VQ6 A;  2V8I A;  3PMT A;  1WIE A;  3JCM c;  3PIP A;  5KYX B;  3CCU Q;  4JZ3 A;  2HD0 A;  3RKW A;  2DXU A;  2J6O A;  2F2W A;  3M55 A;  4LD9 K;  2DX1 A;  2SRC A;  3I55 T;  2AK5 A;  2ZPB B;  1H8K A;  1NJI U;  1AT1 B;  1TUC A;  4FSX A;  4CC7 A;  2P0Q A;  2ED0 A;  3ULR B;  4LDV A;  2EPD A;  2KBT A;  4CRI A;  3JCM f;  2K3X A;  2J06 A;  3NTH A;  1SRM A;  3LW5 E;  3RKX A;  1BU1 A;  3CC2 T;  1ZSZ A;  5CIU A;  3QUI A;  3O8V A;  5CKE A;  3PGG A;  4K11 A;  1KSW A;  2RQT A;  1QKW A;  1VQL Q;  2LVM A;  4RTT A;  1VQ5 Q;  3UDC A;  2Y90 A;  1IRE B;  2DEQ A;  3M53 A;  2MI6 A;  2DNU A;  1B3Q A;  4AFU C;  2E65 A;  3M0P A;  3S3O A;  1W2B A;  5FU6 C;  2GFA A;  4C5E A;  2LP5 A;  2JMC A;  2CRE A;  1QVF P;  1X6B A;  4EMH A;  3LX7 A;  4PLL A;  1TSF A;  3MPU B;  4XTU A;  1VQN Q;  2LJ0 A;  4JJD A;  1QWE A;  1FWZ A;  1RI9 A;  3PVQ A;  1QCF A;  4PJO B;  1SHG A;  4IIO A;  1PRM C;  1XJW B;  2RB6 A;  9ATC B;  1D3B B;  2MF2 A;  4Y92 A;  3G6E T;  3QZ5 B;  3UT1 A;  3CMA Q;  5I11 A;  1ARK A;  2CH4 W;  2JM8 A;  1KQS A;  3RNJ A;  3VS7 A;  4J6Y A;  3T9N A;  2ESW A;  2RMO A;  4AG1 C;  4M77 G;  4B9X A;  1LNX A;  1RAG B;  5CKB A;  3TVT A;  6AT1 B;  2DEU A;  3HFO A;  3FRN A;  1WHH A;  1YBY A;  1MMD A;  1AVZ C;  1M3C A;  3OYY A;  1YIT A;  4J9G A;  1XNI A;  3V8L A;  1RLQ C;  3QHS A;  2EYX A;  3E1S A;  1KQ1 A;  3O5Z A;  2CT3 A;  1GBQ A;  1TXQ A;  2I2L A;  4DEX A;  1AOJ A;  1LJO A;  4M7A A;  4J7F A;  4Y28 E;  1VQK A;  2QXF A;  5IXF A;  1RI0 A;  4EMK B;  3CXC P;  2YRD A;  2L2P A;  1OZ2 A;  2DBM A;  2KK4 A;  1VQM T;  1GCQ A;  1K73 U;  4BI8 B;  2E3I A;  3M0Q A;  5GAO q;  1K0S A;  3C95 A;  2KQW A;  2X35 A;  3EG1 A;  3HRS A;  4LDW A;  2AKL A;  5LJ5 e;  1VQ7 Q;  4DA4 A;  3VRZ A;  2EKO A;  3MP8 A;  4J83 A;  1R0B G;  4J9D A;  3DLM A;  4IUU A;  4BUG A;  5IN1 A;  1N8R U;  3CCE A;  1BB9 A;  2CGH A;  1OI1 A;  1X2Q A;  3L2Z A;  2BKD N;  3CCV T;  1F1B B;  2JS0 A;  2LQK A;  5GAN 8;  3CCV A;  4PJO F;  3S6W A;  1EIF A;  1J3T A;  3CC4 T;  1ABO A;  3VS6 A;  4PFO A;  3A8M B;  3U23 A;  2KXD A;  2B8A A;  1IXD A;  3OBW A;  2DAQ A;  3H8Z A;  3JCM P;  2LX7 A;  2CZ6 B;  2FRY A;  3JSC A;  4FW2 A;  4JLG A;  3C94 A;  2KYB A;  2PZ1 A;  4B6M A;  2NLU A;  4F7U A;  3BDL A;  1OV3 A;  3FLG A;  5HKC A;  3PIO A;  2HZY A;  2O88 A;  2JVV A;  3I5R A;  3OYB A;  3MP6 A;  3HHT B;  2OTJ T;  4XTZ A;  1N9R A;  4KUI A;  4J9H A;  3SWN C;  2J05 A;  4M7A B;  5KH6 A;  1WZO A;  3MJX A;  4C92 D;  4OMN A;  2CP3 A;  1OU9 A;  4OMQ A;  2HSE B;  1Q82 R;  1D1A A;  2VGM A;  2F2V A;  1WJR A;  4RTV A;  3E2U A;  2M1H A;  2DFU A;  1VQ6 Q;  2EJ9 A;  1JJ2 A;  4JJN K;  3OQ5 A;  4M75 C;  2D6F A;  4BDY A;  3NMZ C;  2GTO A;  2DPP B;  5CQX A;  2E4H A;  2QYZ A;  2PTK A;  3D7S B;  3I55 Q;  2D8J A;  3VU3 C;  1BI0 A;  1MMG A;  3SWN B;  1M1F A;  4M7D A;  5FWB A;  2QQ9 A;  2NWM A;  2PQW A;  3EHQ A;  2DLP A;  3A8L B;  2ED1 A;  2EQU A;  5CVI A;  5LJ3 f;  1KC8 C;  1I4K 1;  1QVP A;  4CC3 A;  4FCY A;  2XK0 A;  2BTT A;  3OW2 A;  1YI2 A;  4LUE A;  1Y71 A;  2LTO A;  1Q86 U;  2CP2 A;  4IKF A;  3ZFJ A;  1JB0 E;  1ZBJ A;  5KYU B;  3X20 B;  3WVE B;  1WXU A;  5LJ5 d;  3G71 T;  3HPW A;  4C0Z A;  8ATC B;  5KYN A;  4C92 E;  4BAC A;  3RR6 A;  1X6O A;  4ZNX A;  3CBO A;  2DIG A;  4M78 A;  3ER0 A;  1JBM A;  4UC4 A;  2ZGW A;  1M9S A;  4RCB A;  1VIE A;  5LJ3 g;  2O9S A;  1S72 A;  1E6G A;  5IHN A;  2DKG A;  2XI9 A;  3MP1 A;  2YLC A;  2WAC A;  2E10 A;  3M59 A;  3G6E Q;  2F5T X;  5D6X A;  4JRI A;  1SG5 A;  3V8J A;  3CC7 A;  1SKU B;  2EGA A;  3QYH B;  1YWO A;  3HRU A;  2EGE A;  3HRT A;  1WHG A;  1G3W A;  2A3L A;  2JTE A;  4OMO A;  5CQY A;  3WXM B;  1B7T A;  1KC8 U;  3A5Z B;  4ELZ C;  1QKX A;  2L3Q A;  5CR2 A;  1U8R A;  3CCQ A;  5A2Q E;  2V1Q A;  2LZ6 B;  4X1V A;  4LDX A;  2QAZ A;  4M7D B;  2QTV A;  2HEQ A;  4PL6 A;  2LCS A;  4KH0 B;  2D0Q B;  3PTA A;  2QGF B;  5M9O A;  4D8D A;  3M9Q A;  4HVV A;  2E64 A;  4C8Q B;  1YIJ T;  1PWT A;  1VYV A;  4HKE A;  2KMT A;  2LDM A;  3CCU A;  4M77 A;  3GLX A;  5GAN 3;  1WQW A;  2JOY A;  2KVQ G;  1AWW A;  1VQM Q;  2X4W A;  1KHC A;  2DZC A;  1PC0 A;  2FPD A;  4F7U F;  2VYT A;  1RLP C;  2RD1 A;  1X75 C;  2I0N A;  1GCP A;  2XHC A;  4PK4 A;  2FB7 A;  2V1R A;  1UEC A;  3OYM A;  1WHJ A;  1UEB A;  1UJ0 A;  3HTR A;  2K2V A;  2KXC A;  3TQ7 P;  2K57 A;  3G4S A;  3CCV Q;  2QQR A;  2DZ9 A;  1CKB A;  1ZUU A;  3CC4 Q;  4C5H A;  3OYE A;  3L2U A;  1VQ9 T;  3M0T A;  3P8D A;  1QVF A;  2CZ1 B;  2HL3 A;  2J7I A;  3OYK A;  2D0N A;  5IXB A;  2CSI A;  2DL8 A;  3AT1 B;  1VQN A;  5DLQ E;  2RN8 A;  4XU3 A;  3I56 T;  2OTJ Q;  1QVG A;  2DTI A;  2KT1 A;  3OYL A;  3NHN A;  1I07 A;  1PM3 A;  1WHL A;  4Q5W A;  1QLY A;  1JXO A;  2HQX A;  2A7Y A;  1VQ4 A;  2OI3 A;  2HKN A;  1VIF A;  2XMF A;  4M77 B;  4BY6 C;  1UE9 A;  3X26 B;  4E6R A;  1RAD B;  1M8V A;  3LGF A;  2RQU A;  2HCK A;  2GNC A;  2CSQ A;  1W1F A;  1X6G A;  2COY A;  4ESR A;  4N4I A;  5A0G A;  4DQ2 A;  1TS9 A;  2DBK A;  3V7R A;  1R0C B;  4MDW A;  1YJW T;  3CCR T;  3LWI A;  1Q7Y C;  3CXC A;  4M78 F;  1NEB A;  1JJ2 S;  5GAO p;  4E7K A;  2HBP A;  4QKU A;  4AFS C;  3RIR A;  5KE2 A;  1M90 C;  3HKS A;  3GNG A;  4JLI A;  2P0K A;  2EFI A;  2OAU A;  1M3B A;  3SHW A;  4F7U G;  3REB B;  3UA6 A;  1YI2 Q;  1M2O A;  2JN0 A;  4KRT A;  3JCM V;  1EZZ B;  3EG0 A;  2YDL A;  2LC4 A;  3DKM A;  1G3Y A;  1B07 A;  2NUT A;  1AZG B;  2QQA A;  3G71 Q;  3EG2 A;  4PJN A;  2E3H A;  2PVG B;  3GIB A;  1E6H A;  5J26 A;  1TOV A;  4JDS A;  3OW2 S;  4HCB A;  4RG2 A;  4OF1 A;  2R58 A;  1QMC A;  1VOM A;  2RHI A;  3CCS T;  5KE3 A;  1NJI C;  3CCL T;  1YP5 A;  2CUD A;  3QO3 A;  2YLB A;  1B34 B;  1UJY A;  3QSU A;  1D09 B;  3LGL A;  5GMK i;  2W0Z A;  5GAM e;  4FW1 A;  3DB3 A;  2OTL T;  1UGR B;  3M0S A;  2VAS A;  3PVL A;  4QW2 A;  2YUQ A;  3JB9 F;  1C0M A;  2PNI A;  4M77 F;  1IZ6 A;  3J81 E;  3FJP A;  1AZE A;  4TVR A;  1Y0M A;  2QK0 A;  5GMK e;  1TWB A;  2QGG A;  4C5I A;  1LCK A;  1KC8 R;  4MML A;  1M1K U;  4OP0 A;  1ZA1 B;  3V7C A;  2JXB A;  2RHY A;  1NG2 A;  3JCM X;  4BE1 A;  4HVU A;  3OYC A;  2YUO A;  3FB9 A;  5GAN e;  2EWN A;  2FVU A;  2DD4 A;  5I2S A;  4Z8A A;  4QVC A;  2DTO A;  3ASK A;  3JB9 I;  4M78 G;  1G83 A;  4J6W A;  3CPW P;  3I55 A;  1PKT A;  3RUX A;  1K8A C;  2AKK A;  2X4J A;  2R5M A;  4PJO C;  1UG1 A;  2YRV A;  3CC2 A;  4AMC A;  2EGC A;  1K76 A;  2DE0 X;  3CME T;  2DM1 A;  3M54 A;  2JTF A;  1NPR A;  4L6V 5;  2JMA A;  5KYW B;  3G4S Q;  4JJC A;  2RK2 A;  1XQH A;  4HXJ A;  2V8K A;  2RK1 A;  3P8H A;  3CQT A;  4RTW A;  2BUD A;  2VV5 A;  1GL5 A;  5HK0 A;  1VQ9 Q;  4JS4 A;  5GAO n;  4CC2 A;  5KYY A;  3CCM T;  1U3O A;  4P5N A;  1G3S A;  5LJ3 h;  2EW3 A;  1M8M A;  5FW9 A;  4HT9 A;  3LH0 A;  5D7U A;  2ZPG B;  4JUV A;  1K73 C;  2X51 A;  3H0H A;  4C92 A;  1ZSZ C;  7AT1 B;  3I56 Q;  3G6E A;  2BIV A;  4DEY A;  3JB9 G;  1QVF S;  1K8A U;  1HYO A;  4RMO A;  1KD1 C;  4EMK C;  3CPF A;  1M4Z A;  5LJ5 g;  5GAM d;  2MYS A;  1OX8 A;  1VQ4 Q;  4FYY B;  2QEX T;  1T3S A;  1SF9 A;  1WJQ A;  2L5Q A;  2RJD A;  2K3B A;  1N8R C;  2P4R A;  3SFM A;  1I8F A;  3EG9 A;  5A0D A;  1I5O B;  1QVG S;  4XTY A;  5D6Y A;  1UGV A;  1QWF A;  2EVR A;  4J9C A;  1WI7 A;  3IQL A;  2DTH A;  2AHJ B;  2H3E B;  1ZSZ B;  2QAS A;  2K2M A;  4QT7 A;  1PSF A;  1M2V A;  5I22 A;  3CCR Q;  1YJW Q;  3JB9 J;  1P92 A;  5AYF A;  3C0C A;  1NLP C;  2WSF E;  2FL7 A;  5GAN d;  4MDX A;  3NPF A;  4X9C A;  4ANJ A;  4OGE A;  2OJ2 A;  1SSH A;  2DER A;  5CK9 A;  2DJZ A;  1VQM A;  2C0T A;  1I81 A;  3JCM e;  4FL6 A;  1WHM A;  5LJ3 j;  5GAN 4;  3MET A;  3CXC S;  1KD1 U;  2F2X A;  5D6W A;  1KJW A;  5KYY B;  1VYT A;  3VRY A;  1U5S A;  2E1H A;  4PJJ A;  2RI5 A;  1C6V X;  4CC4 B;  1WGS A;  8AT1 B;  3VS4 A;  3PNW C;  4M7A C;  1TH7 A;  5GJV B;  2E70 A;  2HSP A;  2EJF A;  4C92 B;  1OEB A;  2NUP A;  1WNL A;  2ZAE A;  3PMI A;  4IUP A;  1RAC B;  3JCM Q;  3VV0 A;  3CCS Q;  3EH1 A;  4J5Y A;  3CC4 A;  3SEM A;  2LMJ A;  4XU0 A;  1K9M C;  3CCL Q;  4KUD K;  4WTO B;  1GXI E;  1GCQ C;  2CYZ B;  3EG9 B;  1MND A;  3TSW A;  2OTL Q;  1HXD A;  2Z0W A;  1Q7Y R;  2VKN A;  3GOX A;  2MAM A;  3QJ6 A;  2OTJ A;  4C0F A;  1Q86 C;  5J3B A;  1YHQ T;  1G3T A;  2EQK A;  1M90 R;  2ZCF B;  2E6Z A;  4OMM A;  5HCK A;  3OS1 A;  4O6J A;  2A28 A;  4JZ4 A;  2GGR A;  2MWP A;  4ZTJ A;  2WSC E;  1U06 A;  1MMA A;  1OYX A;  1ZLM A;  2FZG B;  1MGQ A;  1VQP T;  3VUZ A;  5EC7 A;  1JXM A;  1QP3 A;  4FYW B;  1JQQ A;  2X4Y A;  2Y4X A;  1YCS B;  1I5L A;  3A8G B;  3JAM E;  2PUK B;  2EYQ A;  3GP8 A;  1K9M U;  4N0A A;  2DXC A;  1BCO A;  3G1J A;  2XU8 A;  1NJI R;  2VXE A;  2GCX A;  5KCH A;  3NFC A;  4O5V A;  1M3A A;  4FT2 A;  3OSS C;  2NUP B;  4IUT A;  3CC2 Q;  3EFO A;  4F14 A;  1SHF A;  1TG0 A;  1PHT A;  2JNG A;  2VWF A;  1UTI A;  4C92 F;  2LQW A;  1QQJ A;  3RMQ A;  3R6N A;  3RER A;  3CCJ T;  2E5Q A;  3CME Q;  2EBP A;  4VUB A;  3JCM d;  3MEW A;  4M7A D;  1UB4 A;  2DYI A;  3QKJ A;  1D1C A;  4F7U B;  4A54 A;  1OX9 A;  2KRN A;  2V8J A;  2RA2 A;  2QA4 T;  3G71 A;  2LJ1 A;  4AFQ C;  2FPE A;  4JRP A;  1H3Z A;  1KHI A;  1K4U S;  2KRS A;  1BKB A;  1S1N A;  3CCM Q;  1VA7 A;  5CKF A;  4M7D C;  3JCM J;  3OS2 A;  5DY9 A;  4BDZ A;  3VS5 A;  3GBQ A;  4YTL A;  3V7S A;  4RKU E;  3A8H B;  3EGX A;  4C8Q C;  1K0X A;  1W2B S;  2Y4Y A;  1SSF A;  2ABL A;  4MZP A;  2MMP A;  4A4G A;  3TEE A;  2CDT A;  4OB2 B;  5GAN 5;  1K8A R;  1CSK A;  2OAW A;  2LNH B;  2ZPF B;  2V26 A;  3OSV A;  2ZZD A;  1G5V A;  1RAI B;  2QEX Q;  2VUB A;  2MWO A;  1ACM B;  1WXB A;  4GY5 A;  1KQS S;  2JJ9 A;  1BIA A;  2O01 E;  2YHT A;  3M57 A;  1YJN T;  3LYI A;  2RH2 A;  4X34 A;  3C4S A;  3OMG A;  5GAN 2;  1WA7 A;  4M75 D;  2E12 A;  4ZGE B;  4HCZ A;  4RTY A;  3EFO B;  2BZ8 A;  2C06 A;  3VS1 A;  1YIJ A;  4QQ6 A;  3L1A A;  1PNJ A;  1IRX A;  2O2O A;  2L8D A;  3CD6 T;  3LLR A;  3CPW A;  1YNZ A;  3VS3 A;  2NYS A;  4MMK A;  4ORZ A;  3EH2 A;  3UF4 A;  2YWW A;  2HQH A;  1Y57 A;  3HFN A;  4Z88 A;  3ZL7 C;  1K73 R;  2H8H A;  2HKQ B;  4FT4 A;  2YXY A;  1SRL A;  4J6X A;  2VVK A;  1VQO T;  1QP2 A;  4C92 G;  4OB1 B;  4M78 B;  2QI2 A;  1VQ8 T;  4LD6 A;  5LJ3 e;  3NTK A;  2KT8 A;  3OYH A;  3QG1 A;  4OML A;  3RMS A;  1PRL C;  2DL3 A;  4OVA A;  1MMN A;  1IO6 A;  2DRK A;  4F16 A;  4RUG A;  3BY7 A;  2F1L A;  2KSS A;  3V8K A;  2XID A;  4CI0 C;  3EGX B;  4F17 A;  3AHU A;  2K5L A;  2RPN A;  1N8R R;  1AHJ B;  2VB6 A;  1FXX A;  4J8O A;  5GAN 6;  3M0R A;  3OYN A;  4BD3 A;  4M77 C;  2RNA A;  4LDY A;  4M7D D;  2RJE A;  3QII A;  1VQ9 A;  4KGX B;  2LCL A;  1VQL T;  4M75 E;  2MPX C;  1WPY A;  2ATC B;  2YUP A;  4C8Q D;  1AWO A;  1VQ5 T;  2JZ2 A;  3KUF A;  2DJQ A;  1VUB A;  2MOX A;  4JPB W;  2L3R A;  5CAI A;  4JRQ A;  2KY9 A;  3QBY A;  1IHV A;  3I56 A;  4IUR A;  1PG5 B;  2KGT A;  3BDU A;  5LJ5 h;  2XDD A; 
#chains in the Genus database with same CATH homology
 1WHK A;  2M02 A;  2E3I A;  2CP6 A;  3E2U A;  2MPX C;  1WHJ A;  2Z0W A;  2HKN A;  2QK0 A;  1WHM A;  2COW A;  1WHH A;  3TQ7 P;  2HQH A;  2CP0 A;  1IXD A;  3RDV A;  2HL5 C;  2E3H A;  2CP3 A;  2HKQ B;  2E4H A;  2CP5 A;  1TOV A;  2CP7 A;  1WHG A;  2COZ A;  1WHL A;  4B6M A;  2COY A;  2CP2 A;  1LPL A;  1TXQ A;  2HL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...