1K1ZA

Solution structure of n-terminal sh3 domain mutant(p33g) of murine vav
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
RAQDKKRNELGLPKMEVFQEYYGIPPPPGAFGGFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords vav
publication title Solution structure of N-terminal SH3 domain of Vav and the recognition site for Grb2 C-terminal SH3 domain
pubmed doi rcsb
source organism Mus musculus
total genus 6
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k1zA00
4JZ3A 1B07A 4Z8AA 3EG0A 1VA7A 4HVWA 2X3XD 2ECZA 4OMOA 2AZSA 2MCNA 2EBPA 2DL5A 3H0FA 1NM7A 4OMMA 2KT8A 1M3AA 1YWPA 2J6OA 1UTIA 1MV0B 1ZUUA 2EGCA 2K7AA 1OEBA 2JM9A 1T0JA 1K76A 2L3SA 2O9SA 3EHQA 2DL7A 2DL4A 2FPDA 2PZ1A 1T3SA 1PNJA 1KFZA 1S1NA 1AOJA 4JPBW 3O5ZA 4J9EA 3TVTA 2VVKA 2LQWA 2A08A 1H92A 5IHKA 3VS6A 3M0QA 1AD5A 1PWTA 2OI3A 1NLPC 4JJDA 1SRMA 2KBTA 3H0HA 2KYMA 2SEMA 4HXJA 2A28A 1AZGB 2HBWA 4RTVA 2J6FA 4IIOA 2O9VA 3I5SA 1PKSA 2FPEA 2D0NA 5IXFA 2J05A 4AFUC 2PNIA 3RNJA 1T0HA 2K6DA 2MIOA 4RTZA 3UA7A 1HJDA 3REAB 4HVUA 2DLPA 2JMAA 2OAWA 2JM8A 2LNHB 4M4ZA 2D8HA 2KXDA 4Z88A 2SRCA 4Y92A 2CUBA 2ESWA 4OMPA 1WFWA 2CDTA 4OMQA 1ABQA 3TSZA 1JU5C 1OPKA 2DRMA 4ESRA 4AFQC 2CT3A 5HCKA 1FMKA 4J9CA 3REBB 3ULRB 3I9QA 3VS1A 4D8KA 1ZSGA 2O2OA 4RUGA 3VS2A 3ZL7C 1GCQA 1X43A 1ZUKA 4OMNA 2FEIA 1X6GA 1BB9A 2FO0A 1VYVA 2CSIA 3QWYA 1Y0MA 4CC3A 1BU1A 2EQIA 1SSHA 1QLYA 3VS3A 1WDXA 1ZUYA 2YT6A 1RUWA 2DM1A 1E6GA 2DBMA 2H8HA 4J9FA 2DE0X 1U06A 3I35A 2LJ3A 4AG1C 2LJ0A 1GRIA 4A63B 4OMLA 2ABLA 3PVLA 2LZ6B 4CC7A 3LH5A 1XOVA 4Z89A 2GNCA 5IH2A 1H8KA 1WI7A 2DVJA 3PVQA 2EW3A 1Y57A 2IIMA 2HCKA 3EHRA 4AG2C 3VRYA 1LCKA 2JS0A 3H0IA 2D8JA 3THKA 5GJWB 1HD3A 3M0SA 2ENMA 3H41A 1N5ZA 2C0TA 2JT4A 4J9GA 3FJ5A 2KXCA 1AWOA 2DRKA 4D8DA 2KYBA 4HCKA 3EG3A 2JMCA 2KROA 1KSWA 4DEYA 1K4US 2YUNA 1WYXA 2AZVA 1CKBA 1I07A 2K79A 1OOTA 4X1VA 2DX1A 1MV3A 2BZ8A 4J9BA 1WXTA 5IXBA 4RTUA 3PE0A 2DYBA 1NLOC 1W6XA 4ZNXA 2EYYA 3VRZA 2CH4A 2BTTA 1I1JA 2X3WD 1RLQC 4LN2A 2DA9A 2L2PA 2RPNA 2L0AA 3M0UA 2CUDA 1JXMA 2KNBB 2CSQA 1GFDA 2JW4A 4F16A 3QWXX 1YWOA 4J9HA 1JQQA 1G83A 2CH4W 2RQUA 2EVRA 2KRMA 2L3QA 2M51A 3R6NA 1GBRA 1SEMA 1YP5A 1I0CA 2A36A 1AWJA 2BZYA 3VS5A 4LE9A 1CSKA 4J9DA 2F2XA 1WXBA 2J7IA 1KIKA 2KRNA 2PTKA 4CC4B 2V1RA 3IQLA 1ABOA 4IIMA 1X2KA 2RMOA 3SHWA 1WIEA 4ORZA 2CT4A 4AFSC 3UF4A 1SHFA 1GBQA 3NPFA 2P4RA 2K3BA 2RNAA 2V1QA 2F2VA 2JS2A 1X27A 2DNUA 1UFFA 1WA7A 1MUZA 1VYUA 1UGVA 4QT7A 1PKTA 2I0NA 2LX7A 3EGUA 1UJYA 4LUDA 2K9GA 2CREA 1E6HA 2JTEA 1RLPC 2EPDA 1M3CA 1SHGA 1PHTA 1YN8A 1Z9QA 1AVZC 2GBQA 2O88A 2LCSA 2NUZA 4AFZC 2QDLA 1GCPA 1W70A 2AK5A 2VKNA 4R0KA 5ECAA 2AKLA 4K11A 2J06A 1JO8A 1PRMC 1SRLA 1BBZA 1TG0A 2KE9A 1ZLMA 4JJBA 1U5SA 1M8MA 2OJ2A 2J6KA 2RN8A 1TUCA 4CC2A 2EYZA 2HDAA 4KRTA 2DL8A 2D1XA 2ROLA 5FW9A 1UECA 3EG2A 1G2BA 2GTJA 3TSWA 2BZXA 1WXUA 2EGAA 1K0XA 1VYTA 2FRWA 1TUDA 2GTOA 1UHFA 2DJQA 3RBBB 2YDLA 1WLPB 3NGPA 5IHIA 4FSSA 4J9IA 1HSQA 1M30A 2KT1A 1EFNA 1YCSB 1GCQC 1NYFA 2MOXA 4DEXA 3EG1A 1CKAA 3U23A 1UUEA 4GLMA 1FYNA 2VWFA 2LJ1A 2KEAA 2LQNA 2NWMA 1T3LA 2EGEA 2YUQA 2EYWA 1AWWA 1SPKA 1UG1A 1X2QA 2ROTA 3GBQA 2EKHA 3M0RA 5L23A 2HSPA 2LMJA 1X69A 2KGTA 4RTYA 2DF6A 1M3BA 1A0NB 1M27C 1B3QA 1K1ZA 2RQRA 4RTXA 2KRSA 4LNPA 1AZEA 5I11A 2G6FX 2RQWA 5FWCA 1QKWA 1UDLA 4JJCA 4F17A 4JZ4A 3VS0A 4EIKA 1NEGA 2W10A 1H3HA 3C0CA 3I5RA 2M0YA 1IO6A 2L3PA 3CQTA 1GFCA 1ARKA 1QKXA 2RQVA 1QCFA 1OV3A 2DILA 2DMOA 2JXBA 3NMZC 2LP5A 4LUEA 3UATA 1UE9A 2ED0A 2YSQA 1V1CA 2YUOA 1QWFA 2KR3A 4F14A 4HVVA 2EYXA 4RTWA 4WCIA 1AWXA 3M0PA 5FWBA 2AKKA 1ZBJA 1ZX6A 2B86A 3M0TA 1NEBA 3JV3A 2GGRA 1WX6A 1YNZA 1K9AA 2C0OA 3UA6A 2DL3A 1J3TA 1PRLC 2W0ZA 5GJVB 1JEGA 3SEMA 2FRYA 1KJWA 1OPLA 2F2WA 1UHCA 2DBKA 1NG2A 3A98A 2A37A 2HEQA 1BK2A 2XMFA 1RI9A 2FG0A 2O31A 3VS7A 1E7OA 3NHNA 1U3OA 2RQTA 1W1FA 1NYGA 4GBQA 5IHNA 3VS4A 4E6RA 2YUPA 2K2MA 1JXOA 1X6BA 2E5KA 1K0SA 3KFVA 1UJ0A 2C0IA 4RTTA 2RF0A 1GL5A 5EC7A 2FPFA 1QWEA 5I22A 2GQIA 2ED1A 1Z9ZA 1AEYA
chains in the Genus database with same CATH superfamily
3EGXB 3D7SB 3PMTA 1FWZA 3TU4K 4M7DB 2H3EB 1NJIR 3EG0A 1KQ2A 5KYNA 3JB9H 2EQUA 4J6YA 4C92D 2MCNA 3BW1A 5GANf 1IHWA 4QVDA 3OS2A 4PNOA 3CC7Q 1VQPQ 1MV0B 1ZUUA 1LJOA 1QP3A 2FZCB 1OEBA 3DB4A 1K76A 3CC7T 3I56A 1M8VA 2MWOA 2DXUA 3EHQA 2DL4A 1C1AA 1KFZA 4JPBW 3O5ZA 3OYKA 5FRNA 4J9EA 2PVGB 1PWTA 1W4SA 2OI3A 4N0AA 1WHLA 1SRMA 5GAOl 3EGXA 2IVWA 3EFSA 4M7DA 2DXCA 3MKDA 2A28A 1AZGB 1LPLA 5GAN7 4IIOA 1PKSA 2FPEA 3QZ9B 1QP2A 1OX8A 2D0NA 1I4K1 3NFCA 2XI9A 3RDVA 2K6DA 3UA7A 1HJDA 2V26A 2DLPA 2OAWA 2RM4A 2D8HA 2YWWA 4Y92A 1KQSA 1WFWA 1WNLA 4M7AA 4A4HA 1OZ2A 3A1PA 4ESRA 2RJFA 4ME7A 2CT3A 1YFNA 1UGSB 4MZTA 5GAN6 5KCOA 5GANe 1XJWB 1D1BA 1X43A 3CMAT 4WTOB 3FJPA 4JS5A 1BIAA 1VYVA 2CSIA 4JJNK 4N4HA 2EQIA 2YHTA 4ZGDB 4JRPA 1QLYA 2O4XB 1WDXA 4XTZA 5FU7C 2DE0X 1Q81C 3M5AA 3OYFA 2RH2A 4AG1C 3FIFA 1Y07A 1K8AC 3KXTA 1YI2Q 3OMGA 2EQJA 2LZ6B 1VUBA 3PTAA 3BDLA 1IREB 2GNCA 3V8LA 1OU9A 3CCRT 2DVJA 1I81A 1YI2T 4AG2C 4MMKA 1VQ9A 3RMQA 2D8JA 4CRIA 2EQKA 2FHDA 1WZOA 3X20B 2QDYB 4M7DD 3MEVA 4LDVA 3BE3A 1C6VX 5GANh 2QGGA 1N5ZA 4M78B 2ZCFB 2ZZDA 4J9GA 2KXCA 4A4EA 2DRKA 1KSWA 2KSSA 2R5AA 3E9FA 4AMCA 3PIOA 2CP7A 2K79A 2DO3A 2QQSA 2DX1A 1W2BA 1K9MC 5IXBA 3PE0A 2DYBA 3PMIA 1WJSA 4XTUA 4B6MA 3VRZA 2GFUA 2CH4A 1VQ4Q 1JBMA 2X3WD 4ANJA 4RKUE 1VQ4T 3M0UA 4BI4A 2RHZA 4M78A 2DIQA 4HT8A 1NE8A 4J9HA 1JQQA 4X34A 5GAMd 2EVRA 3R6NA 5M9OA 4PJOB 2BZYA 1AWJA 9ATCB 5FU6B 4J9DA 1KD1C 1MNDA 1VQ8A 3G7ZA 2MPXC 3HSBA 2JTMA 1Y71A 3CC2A 2G3RA 2QQ9A 2ZGWA 3PT9A 1RAEB 4XTVA 3SHWA 2YRCA 1PG5B 2KVQG 4IKFA 1TUGB 1VIFA 4FW2A 4FU6A 2VYTA 4BY6C 3QBYA 1KQSP 4OF1A 1QVFA 1X27A 2DNUA 4MDXA 1RACB 1WA7A 1R77A 2XDPA 2NLUA 4KH0B 3NTIA 1VYUA 5D6WA 2L5QA 4PJOA 1PKTA 5CQYA 1M2OA 2K9GA 1YBYA 2GCXA 2JTEA 1VQ5Q 1NPRA 3A8HB 1PHTA 1YN8A 1RAIB 1K73U 2O88A 4FM4B 2QI2A 1R0CB 1ZA2B 3SDZA 1W70A 4OB1B 4BACA 4BB7A 3GF5A 2AKLA 2J06A 3CCMA 1PRMC 5GAMe 1BBZA 2LDMA 1TG0A 4FCYA 5KYUB 5A0DA 1LNXA 1FMVA 2HQHA 4CC2A 2X35A 2CZ1B 1AT1B 1PSFA 3WXMB 1UECA 1K73R 5LJ5d 2BZXA 4FYWB 1QQJA 2EGAA 2CGHA 5LJ5f 1TUDA 5KH6A 1UHFA 3I55Q 2DJQA 3RBBB 2E10A 3MEWA 3CD6A 1MNEA 2E64A 3OYEA 1WHKA 4FSSA 3FRNA 5A0LA 3GP8A 1OU8A 2QQAA 2KT1A 2XDBA 4E7ZA 4C5GA 1W2BP 3U23A 3CBPA 4C0DB 1VQ6Q 5KYUA 4GLMA 2E5QA 2VWFA 5GMKl 2KEAA 2CZ6B 3VKIA 4C92E 4PFOA 5GAMh 2E65A 3QXEB 2EWNA 2YUQA 2EYWA 1AWWA 4E7HA 2K5IA 5L23A 2HSPA 3H9NA 4E7KA 2DJZA 1M27C 4KBMB 4F04B 4JRQA 2G6FX 2RQWA 5J26A 3Q1JA 1JJ2P 1VQMT 1UDLA 3VS0A 1OULA 1H3HA 4EMKB 4C5IA 1IB8A 3VUZA 5LJ5e 2L3PA 1GFCA 4J83A 1W2BS 4DOVA 3NTHA 2A7YA 2RHYA 3HRTA 4ZGJB 2DMOA 1V76A 3NMZC 1P92A 1RL2A 2OTLA 3S3OA 1IXDA 1QVFP 3CPFA 2ED0A 3GNFB 2XDDA 5GANg 3ZBDA 3JSCA 4JRKA 4HVVA 5FWBA 5KYYB 2AIRB 2AKKA 3CEYA 1ZBJA 3M0TA 2HBPA 4R55A 3LGLA 5D6XA 3UDCA 2C0OA 5LJ3f 2M02A 3CCJQ 3CCLT 5GJVB 2EJ9A 2OTJA 4EMKA 1VQOA 4C8QB 1KJWA 1JJ2S 2F2WA 3CCJT 4XU3A 1NG2A 3FDRA 2DIGA 3A98A 3MCAB 3OYGA 2COWA 1G3TA 2FB7A 1BK2A 2XMFA 2FG0A 1TH7A 2VXEA 5LJ5h 1YJNQ 3NHNA 2CP2A 3META 4E47A 1MMAA 4B9XA 4ZTJA 4GBQA 2XHCA 1UGRB 2VGNA 1YJNT 2LT1A 3INZA 1K0SA 3JCMW 5KYYA 1FXXA 2C0IA 1QVFS 4E7LA 2WACA 4VUBA 3SWNC 3HFOA 3E1SA 2ED1A 1AEYA 3VV0A 2ZPHB 2XIDA 4JZ3A 1B07A 4BUGA 3G4SA 1YJWA 2COYA 2X3XD 3CCVA 4OGEA 4C8QA 2FZGB 2AZSA 3H0FA 3T9NA 2KT8A 1M3AA 1YWPA 4GLKA 1BYMA 3JCMX 1Q86C 4BE1A 1T0JA 3MEUA 2RI3A 2VC8A 4L6V5 5LJ3e 2DL7A 3OMCA 1G5VA 2PZ1A 4XU2A 3LWIA 1D0XA 4A53A 5I21A 3L42A 1LOJA 1YHQA 2DETA 3R6OA 2LQWA 2MF2A 1H92A 1AD5A 1NLPC 4JJDA 1D1CA 3X24B 1YIJQ 3L2WA 3OA6A 5CAIA 4FT2A 1ACMB 2RD1A 2HBWA 4RTVA 4LD9K 2J6FA 3EGDB 3MHXA 1YIJT 3I5SA 1VQ7A 3HRUA 2CZ7B 4BE0A 2J05A 2DZCA 3RNJA 1T0HA 5DY9A 2QAZA 1QMCA 5GANj 1F1BB 1TXQA 4HVUA 2JM8A 2LNHB 4OP0A 2A0FB 3E19A 2ESWA 4OMPA 2PUOB 2PUKB 3CC4T 2CDTA 1ABQA 1OPKA 4AFQC 5HCKA 2OAUA 3ULRB 3I9QA 4N4IA 4D8KA 4XK8E 3NTKA 4RUGA 4NL3A 2DAQA 3DLMA 3G6EA 5LL6S 1M9SA 1PD1A 4OMNA 2HNIA 2FEIA 1X6GA 1BB9A 2FO0A 2E1HA 3EGDA 1SSHA 2P0KA 3VS3A 2CZ0B 2PVDB 4ZGEB 4C8QD 2DBMA 2EFIA 1U06A 1YITQ 1NPPA 3I35A 4BI8B 2C06A 5A0GA 3LLRA 2D6FA 2FL7A 1YITT 1KHCA 3E9GA 7AT1B 3L2QA 3HFNA 1XQHA 5C6SA 2HL5C 2ZPEB 3VU3C 2RK1A 2HCKA 1BI1A 3H0IA 3SB2A 5GJWB 3OYBA 1HD3A 3H6ZA 1N6AA 1GXIE 2LNVA 4M75D 4M77B 4RG8A 4C92C 4RMOA 2PQWA 1O75A 5GAOr 4PL6A 4D8DA 4FW1A 3EG3A 2JMCA 1MMNA 2D0QB 4M75F 4Z02A 5DLOA 1OOTA 3TCJA 2E6NA 2A3LA 1VQLT 1MV3A 2BZ8A 1WXTA 4C92F 4E7JA 1V29B 1WJQA 1I5LA 1VQPA 4M7AB 3OBYA 1I1JA 5CIUA 1IGQA 4GY5A 3OS1A 2QTVA 3HP9A 1M2VB 4FL6A 4A4KA 1N8RC 3AHUA 3TREA 2DA9A 2L2PA 2M0OA 2P0PA 1JXMA 2KNBB 2Y4YA 2HAXA 4M77A 1K8AU 3V7CA 3I56T 2FZKB 3MEAA 1SKUB 2KRMA 2A36A 1I0CA 1CSKA 3G1JA 2CP6A 3SD4A 2E6ZA 3OYYA 2PTKA 2WSEE 4C92G 1NJIC 5GMKe 1ZA1B 1ABOA 3UPUA 3QSUA 2LX9A 1WIEA 2CT4A 1K8AR 1M2VA 3NPFA 3RKXA 5LJ5g 3CMAQ 2NUTB 2MK5A 2F1LA 3JCMd 1M1KC 4ELZC 3LWHA 4J5YA 5D7UA 1HK9A 1K9MU 3TQ7P 1WQWA 4NL2A 2RO0A 3M4YA 1QVGA 1QVPA 4E2FB 3EGUA 3RIRA 4LD6A 2CREA 3GOXA 4B9WA 4BI3A 1C0MA 2EPDA 4KULA 2JJ9A 1RAGB 1SHGA 1AVZC 3C94A 3CCRQ 2NUZA 3UWNA 4AFZC 1OQKA 4HCCA 3J7AF 3JCMb 3H8ZA 2VKNA 4R0KA 5GMKh 1K9MR 3CXCP 2NUTA 5IT9E 2HQEA 4N0AC 1Q82U 1WJRA 1KD1U 2HQXA 3M9QA 4X9CA 1BI0A 4M7DC 2OJ2A 4NS5A 2RN8A 5J39A 1M90C 2HDAA 5FW9A 4IUQA 5GAN5 1JRIA 1PCXA 2X4JA 2QG9B 4O6JA 1VQ9T 3LW5E 4M7DF 1M1FA 2FRWA 2QQRA 2QASA 5CR2A 1Q82R 2HKNA 2ZPFB 3NGPA 2QA4A 1KD1R 3JCMe 2EKOA 3EH1A 4JS4A 1QW1A 2JN0A 4M7AD 4QW2A 1BIBA 4PJJA 4DBQA 5CKEA 1NYFA 3CCUA 2RHUA 4QQ6A 1UUEA 3J80E 1FYNA 2XK0A 2P0QA 3CXCS 2LJ1A 4KGVB 3JB9J 2LCLA 1T3LA 2EGEA 5LJ3g 3FLGA 3MO8A 1SPKA 2ROTA 3GBQA 3M0RA 4BD3A 4M7DG 3BY7A 5GAMf 2ZPGB 1UGPB 2HMAA 2X51A 2ZPIB 2L8DA 5LJ5j 1OZ3A 1AZEA 3C95A 5FWCA 2AHJB 1QKWA 4XU1A 3M58A 4F17A 3JCMh 4EIKA 3CC2Q 4ZN3A 2JOYA 1VQ8T 2K4YA 3C0CA 3EFRA 3CC2T 4QQGA 1QKXA 3PNWC 1I8FA 1QCFA 3QJ6A 4IUUA 5GAOq 1OV3A 5GAOp 3S3NA 2JZ2A 1R0BG 3JB9D 4OB2B 2EJGA 4JUVA 2L3RA 3MJXA 1UE9A 3N5BB 2XICA 2YLBA 4HCZA 4RTWA 1TTHB 1AWXA 3M0PA 4FYVB 1QVGP 1WHJA 3OYDA 4RG2A 4KGXB 1XTDA 2GGRA 1VQ5A 3UA6A 2DL3A 1PRLC 1EX4A 3SEMA 2FRYA 2QYZA 4M78C 1UHCA 2DBKA 2PU9B 4C8QE 2CP5A 4JLGA 3FEOA 4M78D 3S3MA 1KQSS 4FYYB 1RI9A 1U1SA 3VS7A 3CCMQ 1U3OA 2RQTA 1KC8C 4E6RA 3CCMT 3HKSA 2K2MA 1X6BA 4M78F 3OW2A 5I2SA 4RTTA 2AT1B 3QHSA 2QEXA 4J7IA 3VUBA 1QVGS 4KGZB 4Z8AA 3V8KA 2JVVA 2DYIA 5I2MA 3S6WA 3I55A 4HVWA 3JCMJ 1RAHB 4M75E 3CD6Q 5LJ3j 4OMOA 5HY6A 4JRIA 1NM7A 3QZ5B 1BCMA 1QCOA 2J6OA 4HT9A 3CD6T 5KE3A 2EGCA 2JM9A 3OBWA 5FU6C 1VQ6A 2IG0A 2KDSA 2O9SA 2DEQA 4PJOD 2Y90A 2GF7A 1BI3A 4M78G 1T3SA 2X4YA 2K3YA 1KK7A 1WGSA 4HCBA 3QIIA 2VVKA 3V7RA 5IHKA 4PJOF 4QQDA 3JCMV 1K73C 1VQMQ 1TS9A 3EAEA 2KBTA 3H0HA 2SEMA 3OYHA 3QDFA 3ZEHA 2VV5A 1Q7YC 2PNIA 3OSSC 4V2SA 4FSXA 2MIOA 4RTZA 5A2QE 2QTXA 1S72A 4A4GA 1SG5A 4Z88A 2SRCA 3RESA 5CQXA 3P8BB 3PFSA 3OQ5A 3TSZA 1JU5C 4KH1B 4J9CA 4OB0B 3VS2A 3ZL7C 3CCQQ 1GCQA 3PGGA 1ZUKA 1Q86U 3CCQT 2OTLT 3CCLQ 1MMDA 5IAYA 1Y0MA 1BU1A 3GPLA 1ZUYA 2DM1A 1B34B 3A5ZB 4HKEA 4WF2A 4IUPA 4F7UB 2H3JA 2LJ3A 2LJ0A 5GAN8 1GRIA 3M55A 2MI6A 1M1GA 2DKGA 2ABLA 2LQ8A 4OMLA 2NUPB 4DOWA 8AT1B 3L2UA 2V8JA 3JCMP 3G71A 3C12A 4Z89A 1Q86R 2P84A 2OTJT 3PVQA 2EW3A 3JCMc 1VQOT 2IIMA 4Y91A 3EHRA 4PKCC 2KK4A 1LCKA 3DLLA 3VJPA 2JTFA 1X01A 3P8HA 4LDXA 4C0DC 3FC3A 4QKUA 3GNGA 4QVCA 4O5VA 3V8JA 1AWOA 1ZBXA 4HCKA 5D6YA 2YRDA 4M7DE 2EAYA 1B34A 4PJNA 1JB0E 4F7UA 1CKBA 1I07A 2M9UA 2NUPA 1YJWQ 5CKDA 3CPWA 4J9BA 3G4ST 4RTUA 2LC4A 1YJWT 2K5FA 1NLOC 3J81E 3OS0A 4MZPA 2EYYA 3QG1A 4N4GA 3CCVT 1MGQA 2BTTA 5CCAA 1N27A 4M7AE 5HK0A 4LN2A 2RPNA 2VXFA 2L0AA 1PC0A 1ZSZC 2CSQA 1GFDA 2JW4A 4F16A 5GMKj 1YHQQ 4EMKC 1R8OB 1TSFA 1YWOA 1VQNA 3QDRB 2LTOA 1G83A 2L3QA 1SEMA 2KY9A 2XU8A 3VS5A 1YHQT 4LE9A 3CBOA 2I2LA 4EMHA 3CCEA 2E3HA 2J7IA 1KIKA 2KRNA 3M56A 2R5MA 3CC4Q 4CC4B 1VQ7Q 2V1RA 4NOYA 3IQLA 2FYKA 1VQKA 4P5NA 1X2KA 2RMOA 1IHVA 3HRSA 1FMWA 3CCSA 4ORZA 4XTXA 1VQ7T 4PLLA 4EMGA 3UF4A 1HYOA 1GBQA 1G3SA 4IUTA 2K5LA 5CVIA 1N9SA 4J8OA 2ZAEA 1IRXA 2K3BA 2RNAA 2F2VA 2XD0A 1RABB 4LDWA 4C8QC 4ZTFA 1MUZA 1YCYA 1TOVA 4QT7A 2I0NA 2LX7A 2VGMA 1MMGA 4R56A 1N8RU 3X26B 3G6ET 1RLPC 2WSCE 3ZFJA 1M3CA 1KQ1A 2EJFA 1Z9QA 2GBQA 2X4XA 4C8QF 3JB9I 2AK5A 3CMEA 5ECAA 5GAMg 1YJ9A 3A8LB 2JNGA 1PD0A 2VASA 3OSVA 4M75C 2KE9A 1B7TA 4JJBA 1M8MA 1Y96B 1N8RR 1TUCA 1IGUA 5FU7B 4MDWA 2EYZA 4IURA 2DL8A 2ROLA 2RK2A 4PJLA 5FLXE 5GAN2 3L2VA 2DD4A 1UGQB 1G2BA 2GTJA 3TSWA 4M78E 4AT1B 1WXUA 2V8KA 1X75C 1H641 1VQLQ 4FIBA 1M1KU 2RHIA 4C8QG 1WLPB 4A54A 1EZZB 4XTYA 5IHIA 2IPOB 2BUDA 2DTHA 4C0FA 2E41A 3WVDB 1VIEA 1HSQA 1M30A 3CC7A 2K3XA 4PFPA 1HXDA 5GANd 4DEXA 1CKAA 3HPWA 3LH0A 3CPWP 1Q81U 5KCHA 4J7FA 3I56Q 3OYMA 1Y96A 2FVUA 1I5OB 1D0ZA 3EH2A 1M1KR 1VQPT 2ZPBB 1UG1A 2EKHA 4E7IA 4M75G 2KGTA 4RTYA 3X25B 4PJOE 2VB6A 2XKOC 1A0NB 1RAFB 3QO3A 1M90U 1Q81R 4RTXA 4LNPA 5I11A 3OY9A 4D6WA 3EG9B 4JZ4A 3GIBA 3E2UA 2W10A 3L2ZA 2F5TX 4PFZA 3I5RA 2RI2A 3CQTA 2LVMA 1ARKA 5AT1B 3CPWS 3JCMf 4EPCA 4FT4A 2DFUA 4C0ZA 3CMAA 3URGA 4Q5WA 2JXBA 3M57A 1RI0A 4KT0E 1RAAB 4LUEA 1RADB 4LXCA 1M90R 2YSQA 2YUOA 2KR3A 3A8MB 4C0GA 4F14A 5GAMj 1D3BB 3PIPA 1UB4A 1M5Q1 5CK9A 4BY6B 3L2RA 3HL8A 2DEUA 1WX6A 1YNZA 3EG9A 1K9AA 1WHHA 3JRZA 3LGFA 2W0ZA 3CCRA 5GAN4 4M77C 1YI2A 4XU0A 3MPUB 4OMFB 4DBRA 2JUFA 3ASKA 3O8VA 5KE2A 3LYIA 4M77D 3X28B 2HEQA 3M54A 2X9HA 4PK4A 2RHXA 1VQ9Q 4UC4A 1W1FA 1NYGA 1EIFA 2DZ9A 3KBGA 2YUPA 4M77F 1UJ0A 1D3BA 1GL5A 5EC7A 2FPFA 5I22A 2GQIA 4M7AC 1U8RA 2EQMA 1Z9ZA 2O4XA 1VA7A 2EIFA 2LT4A 5CKHA 2QA4Q 4KUDK 2ECZA 2R57A 3ER0A 1NZ9A 2EBPA 2DL5A 3OYJA 4OMMA 3WVEB 4J6XA 3EFOB 4M7AF 1UTIA 3RMSA 2QA4T 1VQ4A 2QGFB 5FRMA 2K7AA 3ME9A 3CCUQ 2HZYA 5AYFA 4BE2A 2L3SA 4M77G 4OVAA 3CCUT 2FPDA 4DQ2A 2DERA 1PNJA 3OYCA 2DTIA 1S1NA 1AOJA 2CP3A 3TVTA 2A08A 2DK3A 3VS6A 3M0QA 2K2VA 2MMPA 1G3YA 2LQKA 2M1HA 4XQ3A 2KYMA 1TU0B 4HXJA 1VQ8Q 1KC8U 2O9VA 2RB6A 3JAME 5IXFA 1Q82C 1KG1A 4AFUC 4M7AG 2E70A 3EFOA 1H3ZA 1JJ2A 4FYXB 3REAB 5HK3A 2JMAA 4M4ZA 2KXDA 2CS7A 2CUBA 1X6OA 2RJDA 3RUXA 4OMQA 4Y28E 2DRMA 3VYGA 1FMKA 3REBB 4LDUA 3VS1A 1ZSGA 2O2OA 1KC8R 3JB9F 4ZN1A 3F70A 5KYWB 1Y7XA 4CC3A 2HKQB 3QJYA 3QWYA 4C5EA 2E3IA 3AT1B 2YT6A 1RUWA 1E6GA 2H8HA 4J9FA 2E4HA 4A63B 4HA8A 3LX7A 2MWPA 3PVLA 3MP8A 4F7UE 1VQ5T 3JCMQ 4CC7A 3LH5A 1XOVA 1XNIA 2MAMA 5IH2A 1H8KA 1WI7A 3FB9A 3OB9A 1Y57A 5C0MA 1Q7YU 1G8XA 5DM7R 3SFMA 3A8OB 3JB9G 5FROA 2E12A 3VRYA 2BE7D 2JS0A 5GMKm 3THKA 5KYWA 4DBHA 3M0SA 5J3BA 2ENMA 3H41A 2KI7A 2F5KA 2C0TA 2JT4A 3L1AA 3OYNA 3FJ5A 2LCCA 2KYBA 2QEXQ 1NBEB 2KROA 4DEYA 1K4US 2YUNA 1WYXA 2AZVA 2QEXT 3VYHB 1Q7YR 4X1VA 4PJOC 4XTWA 3I55T 4ELYC 4OGCA 1IZ6A 2F69A 1W6XA 4ZNXA 1U1TA 3SWNB 4MZMA 2HL3A 3V7SA 1RLQC 4E7SA 1Q95G 4TVRA 3M53A 2CUDA 2VUBA 2BKDN 1VQ6T 2DVEA 1BCOA 2DXBA 3QWXX 3KUFA 2CH4W 2RQUA 2COZA 2M51A 2KQWA 1GBRA 3MP6A 4BDZA 3RR6A 3P8DA 1YP5A 1VQMA 3QUIA 2F2XA 5L8RE 4JLIA 1WXBA 1DJ7B 4L5GA 5DLQE 3OS5A 3OYAA 4J6WA 3QYHB 4IIMA 4RCCA 4AFSC 3SWNA 4PLIA 1SHFA 1ZSZB 1S72Q 2RA2A 4L59A 4PJOG 2NYSA 1S72T 2OTLQ 2P4RA 2V1QA 2JS2A 1UFFA 4X9DA 1TWBA 2P4TA 2PVOB 3CCQA 1OX9A 1UGVA 2B8AA 3OYLA 1UJYA 4LUDA 4RCBA 1UEBA 3CCLA 3C4SA 3M4GA 1E6HA 1AHJB 5CO7A 1QCNA 1M4ZA 1WQ7A 1OI1A 4QVZA 3CCJA 2OTJQ 2LCSA 5LJ3d 1VQOQ 2D9TA 1ZSZA 2QDLA 1GCPA 3CBMA 2YXYA 5CKFA 2BIVA 4K11A 1JO8A 1ZQ1A 1SRLA 1YJNA 4MMLA 3G71Q 1ZLMA 1U5SA 1WHGA 2OX7A 3DB3A 2J6KA 2YRVA 4KRTA 3G71T 3RKYA 2D1XA 3OW2P 2DD5A 1PM3A 2KMTA 4LDYA 4M77E 3EG2A 4XAXB 4II1A 3QKJA 2L89A 3RERA 1K0XA 2YLCA 1VYTA 2CP0A 4EDUA 2GTOA 3JCMg 3G4SQ 2ATCB 2YDLA 3BFMA 3HHTB 3M59A 1D1AA 3CCVQ 2QXFA 4J9IA 4M75B 3HTRA 1EFNA 1YCSB 1GCQC 2MOXA 1KHIA 3EG1A 3GLXA 4IUVA 2R58A 2GFAA 4C92B 1N9RA 2CYZB 4PJMA 1PSEA 2LQNA 4C5HA 2QQBA 2NWMA 4JDSA 2CKKA 2RJCA 4BDYA 6AT1B 3QYGB 1X2QA 3TEEA 2LMJA 3BDUA 1X69A 1SF9A 1YIJA 3OW2S 5GAN3 2DF6A 2O01E 2DPPB 1M3BA 2KAFA 1VQNQ 8ATCB 2Y4XA 1B3QA 2QK0A 4A4FA 1K1ZA 2RQRA 2KRSA 1VQNT 4M75A 3CCEQ 1WPYA 5GAOn 1BI2A 4JJCA 3RKWA 3CC4A 2EYQA 1NEGA 3CCET 1D09B 4C92A 1VQKQ 3CCSQ 1FX7A 2RJEA 2M0YA 1IO6A 2DXTA 3UT1A 1BKBA 1VQKT 3CCST 1WHMA 2RQVA 3DKMA 2DILA 2RI5A 1MHNA 2LP5A 1VOMA 4CI0C 5HKCA 3G6EQ 3UATA 5KYXB 2MYSA 2XG8D 1V1CA 4YTLA 1LVKA 1QWFA 2X4WA 1D0YA 3A8GB 2EYXA 4WCIA 5LJ3h 5GMKi 3MP1A 1ZX6A 1OYXA 2B86A 1NEBA 2V8IA 3JV3A 4F7UF 2Z0WA 1YITA 5IN1A 1J3TA 4DBFA 2WSFE 1JEGA 4ATOA 2BE9B 1OPLA 4OB3B 3OYIA 1NJIU 3CXCA 3CMEQ 2A37A 2LRQA 1YJ9Q 2HSEB 2O31A 5EG2A 1E7OA 5KYXA 2K57A 3CMET 1G3WA 1YJ9T 4KUIA 5IHNA 3VS4A 2M16A 4DA4A 1JXOA 2DTOA 2E5KA 2HD0A 3KFVA 1O9SA 2RF0A 2GQVA 1QWEA 1ZHIA 1SSFA 3QPHA 5CKBA 4F7UG 5GAOm 1VQLA
chains in the Genus database with same CATH topology
4JZ3A 1B07A 4Z8AA 3EG0A 1VA7A 4HVWA 2X3XD 2ECZA 4OMOA 2AZSA 2MCNA 2EBPA 2DL5A 3H0FA 1NM7A 4OMMA 2KT8A 1M3AA 1YWPA 2J6OA 1UTIA 1MV0B 1ZUUA 2EGCA 2K7AA 1OEBA 2JM9A 1T0JA 1K76A 2L3SA 2O9SA 3EHQA 2DL7A 2DL4A 2FPDA 2PZ1A 1T3SA 1PNJA 1KFZA 1S1NA 1AOJA 4JPBW 3O5ZA 4J9EA 3TVTA 2VVKA 2LQWA 2A08A 1H92A 5IHKA 3VS6A 3M0QA 1AD5A 1PWTA 2OI3A 1NLPC 4JJDA 1SRMA 2KBTA 3H0HA 2KYMA 2SEMA 4HXJA 2A28A 1AZGB 2HBWA 4RTVA 2J6FA 4IIOA 2O9VA 3I5SA 1PKSA 2FPEA 2D0NA 5IXFA 2J05A 4AFUC 2PNIA 3RNJA 1T0HA 2K6DA 2MIOA 4RTZA 3UA7A 1HJDA 3REAB 4HVUA 2DLPA 2JMAA 2OAWA 2JM8A 2LNHB 4M4ZA 2D8HA 2KXDA 4Z88A 2SRCA 4Y92A 2CUBA 2ESWA 4OMPA 1WFWA 2CDTA 4OMQA 1ABQA 3TSZA 1JU5C 1OPKA 2DRMA 4ESRA 4AFQC 2CT3A 5HCKA 1FMKA 4J9CA 3REBB 3ULRB 3I9QA 3VS1A 4D8KA 1ZSGA 2O2OA 4RUGA 3VS2A 3ZL7C 1GCQA 1X43A 1ZUKA 4OMNA 2FEIA 1X6GA 1BB9A 2FO0A 1VYVA 2CSIA 3QWYA 1Y0MA 4CC3A 1BU1A 2EQIA 1SSHA 1QLYA 3VS3A 1WDXA 1ZUYA 2YT6A 1RUWA 2DM1A 1E6GA 2DBMA 2H8HA 4J9FA 2DE0X 1U06A 3I35A 2LJ3A 4AG1C 2LJ0A 1GRIA 4A63B 4OMLA 2ABLA 3PVLA 2LZ6B 4CC7A 3LH5A 1XOVA 4Z89A 2GNCA 5IH2A 1H8KA 1WI7A 2DVJA 3PVQA 2EW3A 1Y57A 2IIMA 2HCKA 3EHRA 4AG2C 3VRYA 1LCKA 2JS0A 3H0IA 2D8JA 3THKA 5GJWB 1HD3A 3M0SA 2ENMA 3H41A 1N5ZA 2C0TA 2JT4A 4J9GA 3FJ5A 2KXCA 1AWOA 2DRKA 4D8DA 2KYBA 4HCKA 3EG3A 2JMCA 2KROA 1KSWA 4DEYA 1K4US 2YUNA 1WYXA 2AZVA 1CKBA 1I07A 2K79A 1OOTA 4X1VA 2DX1A 1MV3A 2BZ8A 4J9BA 1WXTA 5IXBA 4RTUA 3PE0A 2DYBA 1NLOC 1W6XA 4ZNXA 2EYYA 3VRZA 2CH4A 2BTTA 1I1JA 2X3WD 1RLQC 4LN2A 2DA9A 2L2PA 2RPNA 2L0AA 3M0UA 2CUDA 1JXMA 2KNBB 2CSQA 1GFDA 2JW4A 4F16A 3QWXX 1YWOA 4J9HA 1JQQA 1G83A 2CH4W 2RQUA 2EVRA 2KRMA 2L3QA 2M51A 3R6NA 1GBRA 1SEMA 1YP5A 1I0CA 2A36A 1AWJA 2BZYA 3VS5A 4LE9A 1CSKA 4J9DA 2F2XA 1WXBA 2J7IA 1KIKA 2KRNA 2PTKA 4CC4B 2V1RA 3IQLA 1ABOA 4IIMA 1X2KA 2RMOA 3SHWA 1WIEA 4ORZA 2CT4A 4AFSC 3UF4A 1SHFA 1GBQA 3NPFA 2P4RA 2K3BA 2RNAA 2V1QA 2F2VA 2JS2A 1X27A 2DNUA 1UFFA 1WA7A 1MUZA 1VYUA 1UGVA 4QT7A 1PKTA 2I0NA 2LX7A 3EGUA 1UJYA 4LUDA 2K9GA 2CREA 1E6HA 2JTEA 1RLPC 2EPDA 1M3CA 1SHGA 1PHTA 1YN8A 1Z9QA 1AVZC 2GBQA 2O88A 2LCSA 2NUZA 4AFZC 2QDLA 1GCPA 1W70A 2AK5A 2VKNA 4R0KA 5ECAA 2AKLA 4K11A 2J06A 1JO8A 1PRMC 1SRLA 1BBZA 1TG0A 2KE9A 1ZLMA 4JJBA 1U5SA 1M8MA 2OJ2A 2J6KA 2RN8A 1TUCA 4CC2A 2EYZA 2HDAA 4KRTA 2DL8A 2D1XA 2ROLA 5FW9A 1UECA 3EG2A 1G2BA 2GTJA 3TSWA 2BZXA 1WXUA 2EGAA 1K0XA 1VYTA 2FRWA 1TUDA 2GTOA 1UHFA 2DJQA 3RBBB 2YDLA 1WLPB 3NGPA 5IHIA 4FSSA 4J9IA 1HSQA 1M30A 2KT1A 1EFNA 1YCSB 1GCQC 1NYFA 2MOXA 4DEXA 3EG1A 1CKAA 3U23A 1UUEA 4GLMA 1FYNA 2VWFA 2LJ1A 2KEAA 2LQNA 2NWMA 1T3LA 2EGEA 2YUQA 2EYWA 1AWWA 1SPKA 1UG1A 1X2QA 2ROTA 3GBQA 2EKHA 3M0RA 5L23A 2HSPA 2LMJA 1X69A 2KGTA 4RTYA 2DF6A 1M3BA 1A0NB 1M27C 1B3QA 1K1ZA 2RQRA 4RTXA 2KRSA 4LNPA 1AZEA 5I11A 2G6FX 2RQWA 5FWCA 1QKWA 1UDLA 4JJCA 4F17A 4JZ4A 3VS0A 4EIKA 1NEGA 2W10A 1H3HA 3C0CA 3I5RA 2M0YA 1IO6A 2L3PA 3CQTA 1GFCA 1ARKA 1QKXA 2RQVA 1QCFA 1OV3A 2DILA 2DMOA 2JXBA 3NMZC 2LP5A 4LUEA 3UATA 1UE9A 2ED0A 2YSQA 1V1CA 2YUOA 1QWFA 2KR3A 4F14A 4HVVA 2EYXA 4RTWA 4WCIA 1AWXA 3M0PA 5FWBA 2AKKA 1ZBJA 1ZX6A 2B86A 3M0TA 1NEBA 3JV3A 2GGRA 1WX6A 1YNZA 1K9AA 2C0OA 3UA6A 2DL3A 1J3TA 1PRLC 2W0ZA 5GJVB 1JEGA 3SEMA 2FRYA 1KJWA 1OPLA 2F2WA 1UHCA 2DBKA 1NG2A 3A98A 2A37A 2HEQA 1BK2A 2XMFA 1RI9A 2FG0A 2O31A 3VS7A 1E7OA 3NHNA 1U3OA 2RQTA 1W1FA 1NYGA 4GBQA 5IHNA 3VS4A 4E6RA 2YUPA 2K2MA 1JXOA 1X6BA 2E5KA 1K0SA 3KFVA 1UJ0A 2C0IA 4RTTA 2RF0A 1GL5A 5EC7A 2FPFA 1QWEA 5I22A 2GQIA 2ED1A 1Z9ZA 1AEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ3 A;  1B07 A;  4Z8A A;  3EG0 A;  1VA7 A;  4HVW A;  2X3X D;  2ECZ A;  4OMO A;  2AZS A;  2MCN A;  2EBP A;  2DL5 A;  3H0F A;  1NM7 A;  4OMM A;  2KT8 A;  1M3A A;  1YWP A;  2J6O A;  1UTI A;  1MV0 B;  1ZUU A;  2EGC A;  2K7A A;  1OEB A;  2JM9 A;  1T0J A;  1K76 A;  2L3S A;  2O9S A;  3EHQ A;  2DL7 A;  2DL4 A;  2FPD A;  2PZ1 A;  1T3S A;  1PNJ A;  1KFZ A;  1S1N A;  1AOJ A;  4JPB W;  3O5Z A;  4J9E A;  3TVT A;  2VVK A;  2LQW A;  2A08 A;  1H92 A;  5IHK A;  3VS6 A;  3M0Q A;  1AD5 A;  1PWT A;  2OI3 A;  1NLP C;  4JJD A;  1SRM A;  2KBT A;  3H0H A;  2KYM A;  2SEM A;  4HXJ A;  2A28 A;  1AZG B;  2HBW A;  4RTV A;  2J6F A;  4IIO A;  2O9V A;  3I5S A;  1PKS A;  2FPE A;  2D0N A;  5IXF A;  2J05 A;  4AFU C;  2PNI A;  3RNJ A;  1T0H A;  2K6D A;  2MIO A;  4RTZ A;  3UA7 A;  1HJD A;  3REA B;  4HVU A;  2DLP A;  2JMA A;  2OAW A;  2JM8 A;  2LNH B;  4M4Z A;  2D8H A;  2KXD A;  4Z88 A;  2SRC A;  4Y92 A;  2CUB A;  2ESW A;  4OMP A;  1WFW A;  2CDT A;  4OMQ A;  1ABQ A;  3TSZ A;  1JU5 C;  1OPK A;  2DRM A;  4ESR A;  4AFQ C;  2CT3 A;  5HCK A;  1FMK A;  4J9C A;  3REB B;  3ULR B;  3I9Q A;  3VS1 A;  4D8K A;  1ZSG A;  2O2O A;  4RUG A;  3VS2 A;  3ZL7 C;  1GCQ A;  1X43 A;  1ZUK A;  4OMN A;  2FEI A;  1X6G A;  1BB9 A;  2FO0 A;  1VYV A;  2CSI A;  3QWY A;  1Y0M A;  4CC3 A;  1BU1 A;  2EQI A;  1SSH A;  1QLY A;  3VS3 A;  1WDX A;  1ZUY A;  2YT6 A;  1RUW A;  2DM1 A;  1E6G A;  2DBM A;  2H8H A;  4J9F A;  2DE0 X;  1U06 A;  3I35 A;  2LJ3 A;  4AG1 C;  2LJ0 A;  1GRI A;  4A63 B;  4OML A;  2ABL A;  3PVL A;  2LZ6 B;  4CC7 A;  3LH5 A;  1XOV A;  4Z89 A;  2GNC A;  5IH2 A;  1H8K A;  1WI7 A;  2DVJ A;  3PVQ A;  2EW3 A;  1Y57 A;  2IIM A;  2HCK A;  3EHR A;  4AG2 C;  3VRY A;  1LCK A;  2JS0 A;  3H0I A;  2D8J A;  3THK A;  5GJW B;  1HD3 A;  3M0S A;  2ENM A;  3H41 A;  1N5Z A;  2C0T A;  2JT4 A;  4J9G A;  3FJ5 A;  2KXC A;  1AWO A;  2DRK A;  4D8D A;  2KYB A;  4HCK A;  3EG3 A;  2JMC A;  2KRO A;  1KSW A;  4DEY A;  1K4U S;  2YUN A;  1WYX A;  2AZV A;  1CKB A;  1I07 A;  2K79 A;  1OOT A;  4X1V A;  2DX1 A;  1MV3 A;  2BZ8 A;  4J9B A;  1WXT A;  5IXB A;  4RTU A;  3PE0 A;  2DYB A;  1NLO C;  1W6X A;  4ZNX A;  2EYY A;  3VRZ A;  2CH4 A;  2BTT A;  1I1J A;  2X3W D;  1RLQ C;  4LN2 A;  2DA9 A;  2L2P A;  2RPN A;  2L0A A;  3M0U A;  2CUD A;  1JXM A;  2KNB B;  2CSQ A;  1GFD A;  2JW4 A;  4F16 A;  3QWX X;  1YWO A;  4J9H A;  1JQQ A;  1G83 A;  2CH4 W;  2RQU A;  2EVR A;  2KRM A;  2L3Q A;  2M51 A;  3R6N A;  1GBR A;  1SEM A;  1YP5 A;  1I0C A;  2A36 A;  1AWJ A;  2BZY A;  3VS5 A;  4LE9 A;  1CSK A;  4J9D A;  2F2X A;  1WXB A;  2J7I A;  1KIK A;  2KRN A;  2PTK A;  4CC4 B;  2V1R A;  3IQL A;  1ABO A;  4IIM A;  1X2K A;  2RMO A;  3SHW A;  1WIE A;  4ORZ A;  2CT4 A;  4AFS C;  3UF4 A;  1SHF A;  1GBQ A;  3NPF A;  2P4R A;  2K3B A;  2RNA A;  2V1Q A;  2F2V A;  2JS2 A;  1X27 A;  2DNU A;  1UFF A;  1WA7 A;  1MUZ A;  1VYU A;  1UGV A;  4QT7 A;  1PKT A;  2I0N A;  2LX7 A;  3EGU A;  1UJY A;  4LUD A;  2K9G A;  2CRE A;  1E6H A;  2JTE A;  1RLP C;  2EPD A;  1M3C A;  1SHG A;  1PHT A;  1YN8 A;  1Z9Q A;  1AVZ C;  2GBQ A;  2O88 A;  2LCS A;  2NUZ A;  4AFZ C;  2QDL A;  1GCP A;  1W70 A;  2AK5 A;  2VKN A;  4R0K A;  5ECA A;  2AKL A;  4K11 A;  2J06 A;  1JO8 A;  1PRM C;  1SRL A;  1BBZ A;  1TG0 A;  2KE9 A;  1ZLM A;  4JJB A;  1U5S A;  1M8M A;  2OJ2 A;  2J6K A;  2RN8 A;  1TUC A;  4CC2 A;  2EYZ A;  2HDA A;  4KRT A;  2DL8 A;  2D1X A;  2ROL A;  5FW9 A;  1UEC A;  3EG2 A;  1G2B A;  2GTJ A;  3TSW A;  2BZX A;  1WXU A;  2EGA A;  1K0X A;  1VYT A;  2FRW A;  1TUD A;  2GTO A;  1UHF A;  2DJQ A;  3RBB B;  2YDL A;  1WLP B;  3NGP A;  5IHI A;  4FSS A;  4J9I A;  1HSQ A;  1M30 A;  2KT1 A;  1EFN A;  1YCS B;  1GCQ C;  1NYF A;  2MOX A;  4DEX A;  3EG1 A;  1CKA A;  3U23 A;  1UUE A;  4GLM A;  1FYN A;  2VWF A;  2LJ1 A;  2KEA A;  2LQN A;  2NWM A;  1T3L A;  2EGE A;  2YUQ A;  2EYW A;  1AWW A;  1SPK A;  1UG1 A;  1X2Q A;  2ROT A;  3GBQ A;  2EKH A;  3M0R A;  5L23 A;  2HSP A;  2LMJ A;  1X69 A;  2KGT A;  4RTY A;  2DF6 A;  1M3B A;  1A0N B;  1M27 C;  1B3Q A;  1K1Z A;  2RQR A;  4RTX A;  2KRS A;  4LNP A;  1AZE A;  5I11 A;  2G6F X;  2RQW A;  5FWC A;  1QKW A;  1UDL A;  4JJC A;  4F17 A;  4JZ4 A;  3VS0 A;  4EIK A;  1NEG A;  2W10 A;  1H3H A;  3C0C A;  3I5R A;  2M0Y A;  1IO6 A;  2L3P A;  3CQT A;  1GFC A;  1ARK A;  1QKX A;  2RQV A;  1QCF A;  1OV3 A;  2DIL A;  2DMO A;  2JXB A;  3NMZ C;  2LP5 A;  4LUE A;  3UAT A;  1UE9 A;  2ED0 A;  2YSQ A;  1V1C A;  2YUO A;  1QWF A;  2KR3 A;  4F14 A;  4HVV A;  2EYX A;  4RTW A;  4WCI A;  1AWX A;  3M0P A;  5FWB A;  2AKK A;  1ZBJ A;  1ZX6 A;  2B86 A;  3M0T A;  1NEB A;  3JV3 A;  2GGR A;  1WX6 A;  1YNZ A;  1K9A A;  2C0O A;  3UA6 A;  2DL3 A;  1J3T A;  1PRL C;  2W0Z A;  5GJV B;  1JEG A;  3SEM A;  2FRY A;  1KJW A;  1OPL A;  2F2W A;  1UHC A;  2DBK A;  1NG2 A;  3A98 A;  2A37 A;  2HEQ A;  1BK2 A;  2XMF A;  1RI9 A;  2FG0 A;  2O31 A;  3VS7 A;  1E7O A;  3NHN A;  1U3O A;  2RQT A;  1W1F A;  1NYG A;  4GBQ A;  5IHN A;  3VS4 A;  4E6R A;  2YUP A;  2K2M A;  1JXO A;  1X6B A;  2E5K A;  1K0S A;  3KFV A;  1UJ0 A;  2C0I A;  4RTT A;  2RF0 A;  1GL5 A;  5EC7 A;  2FPF A;  1QWE A;  5I22 A;  2GQI A;  2ED1 A;  1Z9Z A;  1AEY A; 
#chains in the Genus database with same CATH topology
 3EGX B;  3D7S B;  3PMT A;  1FWZ A;  3TU4 K;  4M7D B;  2H3E B;  1NJI R;  3EG0 A;  1KQ2 A;  5KYN A;  3JB9 H;  2EQU A;  4J6Y A;  4C92 D;  2MCN A;  3BW1 A;  5GAN f;  1IHW A;  4QVD A;  3OS2 A;  4PNO A;  3CC7 Q;  1VQP Q;  1MV0 B;  1ZUU A;  1LJO A;  1QP3 A;  2FZC B;  1OEB A;  3DB4 A;  1K76 A;  3CC7 T;  3I56 A;  1M8V A;  2MWO A;  2DXU A;  3EHQ A;  2DL4 A;  1C1A A;  1KFZ A;  4JPB W;  3O5Z A;  3OYK A;  5FRN A;  4J9E A;  2PVG B;  1PWT A;  1W4S A;  2OI3 A;  4N0A A;  1WHL A;  1SRM A;  5GAO l;  3EGX A;  2IVW A;  3EFS A;  4M7D A;  2DXC A;  3MKD A;  2A28 A;  1AZG B;  1LPL A;  5GAN 7;  4IIO A;  1PKS A;  2FPE A;  3QZ9 B;  1QP2 A;  1OX8 A;  2D0N A;  1I4K 1;  3NFC A;  2XI9 A;  3RDV A;  2K6D A;  3UA7 A;  1HJD A;  2V26 A;  2DLP A;  2OAW A;  2RM4 A;  2D8H A;  2YWW A;  4Y92 A;  1KQS A;  1WFW A;  1WNL A;  4M7A A;  4A4H A;  1OZ2 A;  3A1P A;  4ESR A;  2RJF A;  4ME7 A;  2CT3 A;  1YFN A;  1UGS B;  4MZT A;  5GAN 6;  5KCO A;  5GAN e;  1XJW B;  1D1B A;  1X43 A;  3CMA T;  4WTO B;  3FJP A;  4JS5 A;  1BIA A;  1VYV A;  2CSI A;  4JJN K;  4N4H A;  2EQI A;  2YHT A;  4ZGD B;  4JRP A;  1QLY A;  2O4X B;  1WDX A;  4XTZ A;  5FU7 C;  2DE0 X;  1Q81 C;  3M5A A;  3OYF A;  2RH2 A;  4AG1 C;  3FIF A;  1Y07 A;  1K8A C;  3KXT A;  1YI2 Q;  3OMG A;  2EQJ A;  2LZ6 B;  1VUB A;  3PTA A;  3BDL A;  1IRE B;  2GNC A;  3V8L A;  1OU9 A;  3CCR T;  2DVJ A;  1I81 A;  1YI2 T;  4AG2 C;  4MMK A;  1VQ9 A;  3RMQ A;  2D8J A;  4CRI A;  2EQK A;  2FHD A;  1WZO A;  3X20 B;  2QDY B;  4M7D D;  3MEV A;  4LDV A;  3BE3 A;  1C6V X;  5GAN h;  2QGG A;  1N5Z A;  4M78 B;  2ZCF B;  2ZZD A;  4J9G A;  2KXC A;  4A4E A;  2DRK A;  1KSW A;  2KSS A;  2R5A A;  3E9F A;  4AMC A;  3PIO A;  2CP7 A;  2K79 A;  2DO3 A;  2QQS A;  2DX1 A;  1W2B A;  1K9M C;  5IXB A;  3PE0 A;  2DYB A;  3PMI A;  1WJS A;  4XTU A;  4B6M A;  3VRZ A;  2GFU A;  2CH4 A;  1VQ4 Q;  1JBM A;  2X3W D;  4ANJ A;  4RKU E;  1VQ4 T;  3M0U A;  4BI4 A;  2RHZ A;  4M78 A;  2DIQ A;  4HT8 A;  1NE8 A;  4J9H A;  1JQQ A;  4X34 A;  5GAM d;  2EVR A;  3R6N A;  5M9O A;  4PJO B;  2BZY A;  1AWJ A;  9ATC B;  5FU6 B;  4J9D A;  1KD1 C;  1MND A;  1VQ8 A;  3G7Z A;  2MPX C;  3HSB A;  2JTM A;  1Y71 A;  3CC2 A;  2G3R A;  2QQ9 A;  2ZGW A;  3PT9 A;  1RAE B;  4XTV A;  3SHW A;  2YRC A;  1PG5 B;  2KVQ G;  4IKF A;  1TUG B;  1VIF A;  4FW2 A;  4FU6 A;  2VYT A;  4BY6 C;  3QBY A;  1KQS P;  4OF1 A;  1QVF A;  1X27 A;  2DNU A;  4MDX A;  1RAC B;  1WA7 A;  1R77 A;  2XDP A;  2NLU A;  4KH0 B;  3NTI A;  1VYU A;  5D6W A;  2L5Q A;  4PJO A;  1PKT A;  5CQY A;  1M2O A;  2K9G A;  1YBY A;  2GCX A;  2JTE A;  1VQ5 Q;  1NPR A;  3A8H B;  1PHT A;  1YN8 A;  1RAI B;  1K73 U;  2O88 A;  4FM4 B;  2QI2 A;  1R0C B;  1ZA2 B;  3SDZ A;  1W70 A;  4OB1 B;  4BAC A;  4BB7 A;  3GF5 A;  2AKL A;  2J06 A;  3CCM A;  1PRM C;  5GAM e;  1BBZ A;  2LDM A;  1TG0 A;  4FCY A;  5KYU B;  5A0D A;  1LNX A;  1FMV A;  2HQH A;  4CC2 A;  2X35 A;  2CZ1 B;  1AT1 B;  1PSF A;  3WXM B;  1UEC A;  1K73 R;  5LJ5 d;  2BZX A;  4FYW B;  1QQJ A;  2EGA A;  2CGH A;  5LJ5 f;  1TUD A;  5KH6 A;  1UHF A;  3I55 Q;  2DJQ A;  3RBB B;  2E10 A;  3MEW A;  3CD6 A;  1MNE A;  2E64 A;  3OYE A;  1WHK A;  4FSS A;  3FRN A;  5A0L A;  3GP8 A;  1OU8 A;  2QQA A;  2KT1 A;  2XDB A;  4E7Z A;  4C5G A;  1W2B P;  3U23 A;  3CBP A;  4C0D B;  1VQ6 Q;  5KYU A;  4GLM A;  2E5Q A;  2VWF A;  5GMK l;  2KEA A;  2CZ6 B;  3VKI A;  4C92 E;  4PFO A;  5GAM h;  2E65 A;  3QXE B;  2EWN A;  2YUQ A;  2EYW A;  1AWW A;  4E7H A;  2K5I A;  5L23 A;  2HSP A;  3H9N A;  4E7K A;  2DJZ A;  1M27 C;  4KBM B;  4F04 B;  4JRQ A;  2G6F X;  2RQW A;  5J26 A;  3Q1J A;  1JJ2 P;  1VQM T;  1UDL A;  3VS0 A;  1OUL A;  1H3H A;  4EMK B;  4C5I A;  1IB8 A;  3VUZ A;  5LJ5 e;  2L3P A;  1GFC A;  4J83 A;  1W2B S;  4DOV A;  3NTH A;  2A7Y A;  2RHY A;  3HRT A;  4ZGJ B;  2DMO A;  1V76 A;  3NMZ C;  1P92 A;  1RL2 A;  2OTL A;  3S3O A;  1IXD A;  1QVF P;  3CPF A;  2ED0 A;  3GNF B;  2XDD A;  5GAN g;  3ZBD A;  3JSC A;  4JRK A;  4HVV A;  5FWB A;  5KYY B;  2AIR B;  2AKK A;  3CEY A;  1ZBJ A;  3M0T A;  2HBP A;  4R55 A;  3LGL A;  5D6X A;  3UDC A;  2C0O A;  5LJ3 f;  2M02 A;  3CCJ Q;  3CCL T;  5GJV B;  2EJ9 A;  2OTJ A;  4EMK A;  1VQO A;  4C8Q B;  1KJW A;  1JJ2 S;  2F2W A;  3CCJ T;  4XU3 A;  1NG2 A;  3FDR A;  2DIG A;  3A98 A;  3MCA B;  3OYG A;  2COW A;  1G3T A;  2FB7 A;  1BK2 A;  2XMF A;  2FG0 A;  1TH7 A;  2VXE A;  5LJ5 h;  1YJN Q;  3NHN A;  2CP2 A;  3MET A;  4E47 A;  1MMA A;  4B9X A;  4ZTJ A;  4GBQ A;  2XHC A;  1UGR B;  2VGN A;  1YJN T;  2LT1 A;  3INZ A;  1K0S A;  3JCM W;  5KYY A;  1FXX A;  2C0I A;  1QVF S;  4E7L A;  2WAC A;  4VUB A;  3SWN C;  3HFO A;  3E1S A;  2ED1 A;  1AEY A;  3VV0 A;  2ZPH B;  2XID A;  4JZ3 A;  1B07 A;  4BUG A;  3G4S A;  1YJW A;  2COY A;  2X3X D;  3CCV A;  4OGE A;  4C8Q A;  2FZG B;  2AZS A;  3H0F A;  3T9N A;  2KT8 A;  1M3A A;  1YWP A;  4GLK A;  1BYM A;  3JCM X;  1Q86 C;  4BE1 A;  1T0J A;  3MEU A;  2RI3 A;  2VC8 A;  4L6V 5;  5LJ3 e;  2DL7 A;  3OMC A;  1G5V A;  2PZ1 A;  4XU2 A;  3LWI A;  1D0X A;  4A53 A;  5I21 A;  3L42 A;  1LOJ A;  1YHQ A;  2DET A;  3R6O A;  2LQW A;  2MF2 A;  1H92 A;  1AD5 A;  1NLP C;  4JJD A;  1D1C A;  3X24 B;  1YIJ Q;  3L2W A;  3OA6 A;  5CAI A;  4FT2 A;  1ACM B;  2RD1 A;  2HBW A;  4RTV A;  4LD9 K;  2J6F A;  3EGD B;  3MHX A;  1YIJ T;  3I5S A;  1VQ7 A;  3HRU A;  2CZ7 B;  4BE0 A;  2J05 A;  2DZC A;  3RNJ A;  1T0H A;  5DY9 A;  2QAZ A;  1QMC A;  5GAN j;  1F1B B;  1TXQ A;  4HVU A;  2JM8 A;  2LNH B;  4OP0 A;  2A0F B;  3E19 A;  2ESW A;  4OMP A;  2PUO B;  2PUK B;  3CC4 T;  2CDT A;  1ABQ A;  1OPK A;  4AFQ C;  5HCK A;  2OAU A;  3ULR B;  3I9Q A;  4N4I A;  4D8K A;  4XK8 E;  3NTK A;  4RUG A;  4NL3 A;  2DAQ A;  3DLM A;  3G6E A;  5LL6 S;  1M9S A;  1PD1 A;  4OMN A;  2HNI A;  2FEI A;  1X6G A;  1BB9 A;  2FO0 A;  2E1H A;  3EGD A;  1SSH A;  2P0K A;  3VS3 A;  2CZ0 B;  2PVD B;  4ZGE B;  4C8Q D;  2DBM A;  2EFI A;  1U06 A;  1YIT Q;  1NPP A;  3I35 A;  4BI8 B;  2C06 A;  5A0G A;  3LLR A;  2D6F A;  2FL7 A;  1YIT T;  1KHC A;  3E9G A;  7AT1 B;  3L2Q A;  3HFN A;  1XQH A;  5C6S A;  2HL5 C;  2ZPE B;  3VU3 C;  2RK1 A;  2HCK A;  1BI1 A;  3H0I A;  3SB2 A;  5GJW B;  3OYB A;  1HD3 A;  3H6Z A;  1N6A A;  1GXI E;  2LNV A;  4M75 D;  4M77 B;  4RG8 A;  4C92 C;  4RMO A;  2PQW A;  1O75 A;  5GAO r;  4PL6 A;  4D8D A;  4FW1 A;  3EG3 A;  2JMC A;  1MMN A;  2D0Q B;  4M75 F;  4Z02 A;  5DLO A;  1OOT A;  3TCJ A;  2E6N A;  2A3L A;  1VQL T;  1MV3 A;  2BZ8 A;  1WXT A;  4C92 F;  4E7J A;  1V29 B;  1WJQ A;  1I5L A;  1VQP A;  4M7A B;  3OBY A;  1I1J A;  5CIU A;  1IGQ A;  4GY5 A;  3OS1 A;  2QTV A;  3HP9 A;  1M2V B;  4FL6 A;  4A4K A;  1N8R C;  3AHU A;  3TRE A;  2DA9 A;  2L2P A;  2M0O A;  2P0P A;  1JXM A;  2KNB B;  2Y4Y A;  2HAX A;  4M77 A;  1K8A U;  3V7C A;  3I56 T;  2FZK B;  3MEA A;  1SKU B;  2KRM A;  2A36 A;  1I0C A;  1CSK A;  3G1J A;  2CP6 A;  3SD4 A;  2E6Z A;  3OYY A;  2PTK A;  2WSE E;  4C92 G;  1NJI C;  5GMK e;  1ZA1 B;  1ABO A;  3UPU A;  3QSU A;  2LX9 A;  1WIE A;  2CT4 A;  1K8A R;  1M2V A;  3NPF A;  3RKX A;  5LJ5 g;  3CMA Q;  2NUT B;  2MK5 A;  2F1L A;  3JCM d;  1M1K C;  4ELZ C;  3LWH A;  4J5Y A;  5D7U A;  1HK9 A;  1K9M U;  3TQ7 P;  1WQW A;  4NL2 A;  2RO0 A;  3M4Y A;  1QVG A;  1QVP A;  4E2F B;  3EGU A;  3RIR A;  4LD6 A;  2CRE A;  3GOX A;  4B9W A;  4BI3 A;  1C0M A;  2EPD A;  4KUL A;  2JJ9 A;  1RAG B;  1SHG A;  1AVZ C;  3C94 A;  3CCR Q;  2NUZ A;  3UWN A;  4AFZ C;  1OQK A;  4HCC A;  3J7A F;  3JCM b;  3H8Z A;  2VKN A;  4R0K A;  5GMK h;  1K9M R;  3CXC P;  2NUT A;  5IT9 E;  2HQE A;  4N0A C;  1Q82 U;  1WJR A;  1KD1 U;  2HQX A;  3M9Q A;  4X9C A;  1BI0 A;  4M7D C;  2OJ2 A;  4NS5 A;  2RN8 A;  5J39 A;  1M90 C;  2HDA A;  5FW9 A;  4IUQ A;  5GAN 5;  1JRI A;  1PCX A;  2X4J A;  2QG9 B;  4O6J A;  1VQ9 T;  3LW5 E;  4M7D F;  1M1F A;  2FRW A;  2QQR A;  2QAS A;  5CR2 A;  1Q82 R;  2HKN A;  2ZPF B;  3NGP A;  2QA4 A;  1KD1 R;  3JCM e;  2EKO A;  3EH1 A;  4JS4 A;  1QW1 A;  2JN0 A;  4M7A D;  4QW2 A;  1BIB A;  4PJJ A;  4DBQ A;  5CKE A;  1NYF A;  3CCU A;  2RHU A;  4QQ6 A;  1UUE A;  3J80 E;  1FYN A;  2XK0 A;  2P0Q A;  3CXC S;  2LJ1 A;  4KGV B;  3JB9 J;  2LCL A;  1T3L A;  2EGE A;  5LJ3 g;  3FLG A;  3MO8 A;  1SPK A;  2ROT A;  3GBQ A;  3M0R A;  4BD3 A;  4M7D G;  3BY7 A;  5GAM f;  2ZPG B;  1UGP B;  2HMA A;  2X51 A;  2ZPI B;  2L8D A;  5LJ5 j;  1OZ3 A;  1AZE A;  3C95 A;  5FWC A;  2AHJ B;  1QKW A;  4XU1 A;  3M58 A;  4F17 A;  3JCM h;  4EIK A;  3CC2 Q;  4ZN3 A;  2JOY A;  1VQ8 T;  2K4Y A;  3C0C A;  3EFR A;  3CC2 T;  4QQG A;  1QKX A;  3PNW C;  1I8F A;  1QCF A;  3QJ6 A;  4IUU A;  5GAO q;  1OV3 A;  5GAO p;  3S3N A;  2JZ2 A;  1R0B G;  3JB9 D;  4OB2 B;  2EJG A;  4JUV A;  2L3R A;  3MJX A;  1UE9 A;  3N5B B;  2XIC A;  2YLB A;  4HCZ A;  4RTW A;  1TTH B;  1AWX A;  3M0P A;  4FYV B;  1QVG P;  1WHJ A;  3OYD A;  4RG2 A;  4KGX B;  1XTD A;  2GGR A;  1VQ5 A;  3UA6 A;  2DL3 A;  1PRL C;  1EX4 A;  3SEM A;  2FRY A;  2QYZ A;  4M78 C;  1UHC A;  2DBK A;  2PU9 B;  4C8Q E;  2CP5 A;  4JLG A;  3FEO A;  4M78 D;  3S3M A;  1KQS S;  4FYY B;  1RI9 A;  1U1S A;  3VS7 A;  3CCM Q;  1U3O A;  2RQT A;  1KC8 C;  4E6R A;  3CCM T;  3HKS A;  2K2M A;  1X6B A;  4M78 F;  3OW2 A;  5I2S A;  4RTT A;  2AT1 B;  3QHS A;  2QEX A;  4J7I A;  3VUB A;  1QVG S;  4KGZ B;  4Z8A A;  3V8K A;  2JVV A;  2DYI A;  5I2M A;  3S6W A;  3I55 A;  4HVW A;  3JCM J;  1RAH B;  4M75 E;  3CD6 Q;  5LJ3 j;  4OMO A;  5HY6 A;  4JRI A;  1NM7 A;  3QZ5 B;  1BCM A;  1QCO A;  2J6O A;  4HT9 A;  3CD6 T;  5KE3 A;  2EGC A;  2JM9 A;  3OBW A;  5FU6 C;  1VQ6 A;  2IG0 A;  2KDS A;  2O9S A;  2DEQ A;  4PJO D;  2Y90 A;  2GF7 A;  1BI3 A;  4M78 G;  1T3S A;  2X4Y A;  2K3Y A;  1KK7 A;  1WGS A;  4HCB A;  3QII A;  2VVK A;  3V7R A;  5IHK A;  4PJO F;  4QQD A;  3JCM V;  1K73 C;  1VQM Q;  1TS9 A;  3EAE A;  2KBT A;  3H0H A;  2SEM A;  3OYH A;  3QDF A;  3ZEH A;  2VV5 A;  1Q7Y C;  2PNI A;  3OSS C;  4V2S A;  4FSX A;  2MIO A;  4RTZ A;  5A2Q E;  2QTX A;  1S72 A;  4A4G A;  1SG5 A;  4Z88 A;  2SRC A;  3RES A;  5CQX A;  3P8B B;  3PFS A;  3OQ5 A;  3TSZ A;  1JU5 C;  4KH1 B;  4J9C A;  4OB0 B;  3VS2 A;  3ZL7 C;  3CCQ Q;  1GCQ A;  3PGG A;  1ZUK A;  1Q86 U;  3CCQ T;  2OTL T;  3CCL Q;  1MMD A;  5IAY A;  1Y0M A;  1BU1 A;  3GPL A;  1ZUY A;  2DM1 A;  1B34 B;  3A5Z B;  4HKE A;  4WF2 A;  4IUP A;  4F7U B;  2H3J A;  2LJ3 A;  2LJ0 A;  5GAN 8;  1GRI A;  3M55 A;  2MI6 A;  1M1G A;  2DKG A;  2ABL A;  2LQ8 A;  4OML A;  2NUP B;  4DOW A;  8AT1 B;  3L2U A;  2V8J A;  3JCM P;  3G71 A;  3C12 A;  4Z89 A;  1Q86 R;  2P84 A;  2OTJ T;  3PVQ A;  2EW3 A;  3JCM c;  1VQO T;  2IIM A;  4Y91 A;  3EHR A;  4PKC C;  2KK4 A;  1LCK A;  3DLL A;  3VJP A;  2JTF A;  1X01 A;  3P8H A;  4LDX A;  4C0D C;  3FC3 A;  4QKU A;  3GNG A;  4QVC A;  4O5V A;  3V8J A;  1AWO A;  1ZBX A;  4HCK A;  5D6Y A;  2YRD A;  4M7D E;  2EAY A;  1B34 A;  4PJN A;  1JB0 E;  4F7U A;  1CKB A;  1I07 A;  2M9U A;  2NUP A;  1YJW Q;  5CKD A;  3CPW A;  4J9B A;  3G4S T;  4RTU A;  2LC4 A;  1YJW T;  2K5F A;  1NLO C;  3J81 E;  3OS0 A;  4MZP A;  2EYY A;  3QG1 A;  4N4G A;  3CCV T;  1MGQ A;  2BTT A;  5CCA A;  1N27 A;  4M7A E;  5HK0 A;  4LN2 A;  2RPN A;  2VXF A;  2L0A A;  1PC0 A;  1ZSZ C;  2CSQ A;  1GFD A;  2JW4 A;  4F16 A;  5GMK j;  1YHQ Q;  4EMK C;  1R8O B;  1TSF A;  1YWO A;  1VQN A;  3QDR B;  2LTO A;  1G83 A;  2L3Q A;  1SEM A;  2KY9 A;  2XU8 A;  3VS5 A;  1YHQ T;  4LE9 A;  3CBO A;  2I2L A;  4EMH A;  3CCE A;  2E3H A;  2J7I A;  1KIK A;  2KRN A;  3M56 A;  2R5M A;  3CC4 Q;  4CC4 B;  1VQ7 Q;  2V1R A;  4NOY A;  3IQL A;  2FYK A;  1VQK A;  4P5N A;  1X2K A;  2RMO A;  1IHV A;  3HRS A;  1FMW A;  3CCS A;  4ORZ A;  4XTX A;  1VQ7 T;  4PLL A;  4EMG A;  3UF4 A;  1HYO A;  1GBQ A;  1G3S A;  4IUT A;  2K5L A;  5CVI A;  1N9S A;  4J8O A;  2ZAE A;  1IRX A;  2K3B A;  2RNA A;  2F2V A;  2XD0 A;  1RAB B;  4LDW A;  4C8Q C;  4ZTF A;  1MUZ A;  1YCY A;  1TOV A;  4QT7 A;  2I0N A;  2LX7 A;  2VGM A;  1MMG A;  4R56 A;  1N8R U;  3X26 B;  3G6E T;  1RLP C;  2WSC E;  3ZFJ A;  1M3C A;  1KQ1 A;  2EJF A;  1Z9Q A;  2GBQ A;  2X4X A;  4C8Q F;  3JB9 I;  2AK5 A;  3CME A;  5ECA A;  5GAM g;  1YJ9 A;  3A8L B;  2JNG A;  1PD0 A;  2VAS A;  3OSV A;  4M75 C;  2KE9 A;  1B7T A;  4JJB A;  1M8M A;  1Y96 B;  1N8R R;  1TUC A;  1IGU A;  5FU7 B;  4MDW A;  2EYZ A;  4IUR A;  2DL8 A;  2ROL A;  2RK2 A;  4PJL A;  5FLX E;  5GAN 2;  3L2V A;  2DD4 A;  1UGQ B;  1G2B A;  2GTJ A;  3TSW A;  4M78 E;  4AT1 B;  1WXU A;  2V8K A;  1X75 C;  1H64 1;  1VQL Q;  4FIB A;  1M1K U;  2RHI A;  4C8Q G;  1WLP B;  4A54 A;  1EZZ B;  4XTY A;  5IHI A;  2IPO B;  2BUD A;  2DTH A;  4C0F A;  2E41 A;  3WVD B;  1VIE A;  1HSQ A;  1M30 A;  3CC7 A;  2K3X A;  4PFP A;  1HXD A;  5GAN d;  4DEX A;  1CKA A;  3HPW A;  3LH0 A;  3CPW P;  1Q81 U;  5KCH A;  4J7F A;  3I56 Q;  3OYM A;  1Y96 A;  2FVU A;  1I5O B;  1D0Z A;  3EH2 A;  1M1K R;  1VQP T;  2ZPB B;  1UG1 A;  2EKH A;  4E7I A;  4M75 G;  2KGT A;  4RTY A;  3X25 B;  4PJO E;  2VB6 A;  2XKO C;  1A0N B;  1RAF B;  3QO3 A;  1M90 U;  1Q81 R;  4RTX A;  4LNP A;  5I11 A;  3OY9 A;  4D6W A;  3EG9 B;  4JZ4 A;  3GIB A;  3E2U A;  2W10 A;  3L2Z A;  2F5T X;  4PFZ A;  3I5R A;  2RI2 A;  3CQT A;  2LVM A;  1ARK A;  5AT1 B;  3CPW S;  3JCM f;  4EPC A;  4FT4 A;  2DFU A;  4C0Z A;  3CMA A;  3URG A;  4Q5W A;  2JXB A;  3M57 A;  1RI0 A;  4KT0 E;  1RAA B;  4LUE A;  1RAD B;  4LXC A;  1M90 R;  2YSQ A;  2YUO A;  2KR3 A;  3A8M B;  4C0G A;  4F14 A;  5GAM j;  1D3B B;  3PIP A;  1UB4 A;  1M5Q 1;  5CK9 A;  4BY6 B;  3L2R A;  3HL8 A;  2DEU A;  1WX6 A;  1YNZ A;  3EG9 A;  1K9A A;  1WHH A;  3JRZ A;  3LGF A;  2W0Z A;  3CCR A;  5GAN 4;  4M77 C;  1YI2 A;  4XU0 A;  3MPU B;  4OMF B;  4DBR A;  2JUF A;  3ASK A;  3O8V A;  5KE2 A;  3LYI A;  4M77 D;  3X28 B;  2HEQ A;  3M54 A;  2X9H A;  4PK4 A;  2RHX A;  1VQ9 Q;  4UC4 A;  1W1F A;  1NYG A;  1EIF A;  2DZ9 A;  3KBG A;  2YUP A;  4M77 F;  1UJ0 A;  1D3B A;  1GL5 A;  5EC7 A;  2FPF A;  5I22 A;  2GQI A;  4M7A C;  1U8R A;  2EQM A;  1Z9Z A;  2O4X A;  1VA7 A;  2EIF A;  2LT4 A;  5CKH A;  2QA4 Q;  4KUD K;  2ECZ A;  2R57 A;  3ER0 A;  1NZ9 A;  2EBP A;  2DL5 A;  3OYJ A;  4OMM A;  3WVE B;  4J6X A;  3EFO B;  4M7A F;  1UTI A;  3RMS A;  2QA4 T;  1VQ4 A;  2QGF B;  5FRM A;  2K7A A;  3ME9 A;  3CCU Q;  2HZY A;  5AYF A;  4BE2 A;  2L3S A;  4M77 G;  4OVA A;  3CCU T;  2FPD A;  4DQ2 A;  2DER A;  1PNJ A;  3OYC A;  2DTI A;  1S1N A;  1AOJ A;  2CP3 A;  3TVT A;  2A08 A;  2DK3 A;  3VS6 A;  3M0Q A;  2K2V A;  2MMP A;  1G3Y A;  2LQK A;  2M1H A;  4XQ3 A;  2KYM A;  1TU0 B;  4HXJ A;  1VQ8 Q;  1KC8 U;  2O9V A;  2RB6 A;  3JAM E;  5IXF A;  1Q82 C;  1KG1 A;  4AFU C;  4M7A G;  2E70 A;  3EFO A;  1H3Z A;  1JJ2 A;  4FYX B;  3REA B;  5HK3 A;  2JMA A;  4M4Z A;  2KXD A;  2CS7 A;  2CUB A;  1X6O A;  2RJD A;  3RUX A;  4OMQ A;  4Y28 E;  2DRM A;  3VYG A;  1FMK A;  3REB B;  4LDU A;  3VS1 A;  1ZSG A;  2O2O A;  1KC8 R;  3JB9 F;  4ZN1 A;  3F70 A;  5KYW B;  1Y7X A;  4CC3 A;  2HKQ B;  3QJY A;  3QWY A;  4C5E A;  2E3I A;  3AT1 B;  2YT6 A;  1RUW A;  1E6G A;  2H8H A;  4J9F A;  2E4H A;  4A63 B;  4HA8 A;  3LX7 A;  2MWP A;  3PVL A;  3MP8 A;  4F7U E;  1VQ5 T;  3JCM Q;  4CC7 A;  3LH5 A;  1XOV A;  1XNI A;  2MAM A;  5IH2 A;  1H8K A;  1WI7 A;  3FB9 A;  3OB9 A;  1Y57 A;  5C0M A;  1Q7Y U;  1G8X A;  5DM7 R;  3SFM A;  3A8O B;  3JB9 G;  5FRO A;  2E12 A;  3VRY A;  2BE7 D;  2JS0 A;  5GMK m;  3THK A;  5KYW A;  4DBH A;  3M0S A;  5J3B A;  2ENM A;  3H41 A;  2KI7 A;  2F5K A;  2C0T A;  2JT4 A;  3L1A A;  3OYN A;  3FJ5 A;  2LCC A;  2KYB A;  2QEX Q;  1NBE B;  2KRO A;  4DEY A;  1K4U S;  2YUN A;  1WYX A;  2AZV A;  2QEX T;  3VYH B;  1Q7Y R;  4X1V A;  4PJO C;  4XTW A;  3I55 T;  4ELY C;  4OGC A;  1IZ6 A;  2F69 A;  1W6X A;  4ZNX A;  1U1T A;  3SWN B;  4MZM A;  2HL3 A;  3V7S A;  1RLQ C;  4E7S A;  1Q95 G;  4TVR A;  3M53 A;  2CUD A;  2VUB A;  2BKD N;  1VQ6 T;  2DVE A;  1BCO A;  2DXB A;  3QWX X;  3KUF A;  2CH4 W;  2RQU A;  2COZ A;  2M51 A;  2KQW A;  1GBR A;  3MP6 A;  4BDZ A;  3RR6 A;  3P8D A;  1YP5 A;  1VQM A;  3QUI A;  2F2X A;  5L8R E;  4JLI A;  1WXB A;  1DJ7 B;  4L5G A;  5DLQ E;  3OS5 A;  3OYA A;  4J6W A;  3QYH B;  4IIM A;  4RCC A;  4AFS C;  3SWN A;  4PLI A;  1SHF A;  1ZSZ B;  1S72 Q;  2RA2 A;  4L59 A;  4PJO G;  2NYS A;  1S72 T;  2OTL Q;  2P4R A;  2V1Q A;  2JS2 A;  1UFF A;  4X9D A;  1TWB A;  2P4T A;  2PVO B;  3CCQ A;  1OX9 A;  1UGV A;  2B8A A;  3OYL A;  1UJY A;  4LUD A;  4RCB A;  1UEB A;  3CCL A;  3C4S A;  3M4G A;  1E6H A;  1AHJ B;  5CO7 A;  1QCN A;  1M4Z A;  1WQ7 A;  1OI1 A;  4QVZ A;  3CCJ A;  2OTJ Q;  2LCS A;  5LJ3 d;  1VQO Q;  2D9T A;  1ZSZ A;  2QDL A;  1GCP A;  3CBM A;  2YXY A;  5CKF A;  2BIV A;  4K11 A;  1JO8 A;  1ZQ1 A;  1SRL A;  1YJN A;  4MML A;  3G71 Q;  1ZLM A;  1U5S A;  1WHG A;  2OX7 A;  3DB3 A;  2J6K A;  2YRV A;  4KRT A;  3G71 T;  3RKY A;  2D1X A;  3OW2 P;  2DD5 A;  1PM3 A;  2KMT A;  4LDY A;  4M77 E;  3EG2 A;  4XAX B;  4II1 A;  3QKJ A;  2L89 A;  3RER A;  1K0X A;  2YLC A;  1VYT A;  2CP0 A;  4EDU A;  2GTO A;  3JCM g;  3G4S Q;  2ATC B;  2YDL A;  3BFM A;  3HHT B;  3M59 A;  1D1A A;  3CCV Q;  2QXF A;  4J9I A;  4M75 B;  3HTR A;  1EFN A;  1YCS B;  1GCQ C;  2MOX A;  1KHI A;  3EG1 A;  3GLX A;  4IUV A;  2R58 A;  2GFA A;  4C92 B;  1N9R A;  2CYZ B;  4PJM A;  1PSE A;  2LQN A;  4C5H A;  2QQB A;  2NWM A;  4JDS A;  2CKK A;  2RJC A;  4BDY A;  6AT1 B;  3QYG B;  1X2Q A;  3TEE A;  2LMJ A;  3BDU A;  1X69 A;  1SF9 A;  1YIJ A;  3OW2 S;  5GAN 3;  2DF6 A;  2O01 E;  2DPP B;  1M3B A;  2KAF A;  1VQN Q;  8ATC B;  2Y4X A;  1B3Q A;  2QK0 A;  4A4F A;  1K1Z A;  2RQR A;  2KRS A;  1VQN T;  4M75 A;  3CCE Q;  1WPY A;  5GAO n;  1BI2 A;  4JJC A;  3RKW A;  3CC4 A;  2EYQ A;  1NEG A;  3CCE T;  1D09 B;  4C92 A;  1VQK Q;  3CCS Q;  1FX7 A;  2RJE A;  2M0Y A;  1IO6 A;  2DXT A;  3UT1 A;  1BKB A;  1VQK T;  3CCS T;  1WHM A;  2RQV A;  3DKM A;  2DIL A;  2RI5 A;  1MHN A;  2LP5 A;  1VOM A;  4CI0 C;  5HKC A;  3G6E Q;  3UAT A;  5KYX B;  2MYS A;  2XG8 D;  1V1C A;  4YTL A;  1LVK A;  1QWF A;  2X4W A;  1D0Y A;  3A8G B;  2EYX A;  4WCI A;  5LJ3 h;  5GMK i;  3MP1 A;  1ZX6 A;  1OYX A;  2B86 A;  1NEB A;  2V8I A;  3JV3 A;  4F7U F;  2Z0W A;  1YIT A;  5IN1 A;  1J3T A;  4DBF A;  2WSF E;  1JEG A;  4ATO A;  2BE9 B;  1OPL A;  4OB3 B;  3OYI A;  1NJI U;  3CXC A;  3CME Q;  2A37 A;  2LRQ A;  1YJ9 Q;  2HSE B;  2O31 A;  5EG2 A;  1E7O A;  5KYX A;  2K57 A;  3CME T;  1G3W A;  1YJ9 T;  4KUI A;  5IHN A;  3VS4 A;  2M16 A;  4DA4 A;  1JXO A;  2DTO A;  2E5K A;  2HD0 A;  3KFV A;  1O9S A;  2RF0 A;  2GQV A;  1QWE A;  1ZHI A;  1SSF A;  3QPH A;  5CKB A;  4F7U G;  5GAO m;  1VQL A; 
#chains in the Genus database with same CATH homology
 4JZ3 A;  1B07 A;  4Z8A A;  3EG0 A;  1VA7 A;  4HVW A;  2X3X D;  2ECZ A;  4OMO A;  2AZS A;  2MCN A;  2EBP A;  2DL5 A;  3H0F A;  1NM7 A;  4OMM A;  2KT8 A;  1M3A A;  1YWP A;  2J6O A;  1UTI A;  1MV0 B;  1ZUU A;  2EGC A;  2K7A A;  1OEB A;  2JM9 A;  1T0J A;  1K76 A;  2L3S A;  2O9S A;  3EHQ A;  2DL7 A;  2DL4 A;  2FPD A;  2PZ1 A;  1T3S A;  1PNJ A;  1KFZ A;  1S1N A;  1AOJ A;  4JPB W;  3O5Z A;  4J9E A;  3TVT A;  2VVK A;  2LQW A;  2A08 A;  1H92 A;  5IHK A;  3VS6 A;  3M0Q A;  1AD5 A;  1PWT A;  2OI3 A;  1NLP C;  4JJD A;  1SRM A;  2KBT A;  3H0H A;  2KYM A;  2SEM A;  4HXJ A;  2A28 A;  1AZG B;  2HBW A;  4RTV A;  2J6F A;  4IIO A;  2O9V A;  3I5S A;  1PKS A;  2FPE A;  2D0N A;  5IXF A;  2J05 A;  4AFU C;  2PNI A;  3RNJ A;  1T0H A;  2K6D A;  2MIO A;  4RTZ A;  3UA7 A;  1HJD A;  3REA B;  4HVU A;  2DLP A;  2JMA A;  2OAW A;  2JM8 A;  2LNH B;  4M4Z A;  2D8H A;  2KXD A;  4Z88 A;  2SRC A;  4Y92 A;  2CUB A;  2ESW A;  4OMP A;  1WFW A;  2CDT A;  4OMQ A;  1ABQ A;  3TSZ A;  1JU5 C;  1OPK A;  2DRM A;  4ESR A;  4AFQ C;  2CT3 A;  5HCK A;  1FMK A;  4J9C A;  3REB B;  3ULR B;  3I9Q A;  3VS1 A;  4D8K A;  1ZSG A;  2O2O A;  4RUG A;  3VS2 A;  3ZL7 C;  1GCQ A;  1X43 A;  1ZUK A;  4OMN A;  2FEI A;  1X6G A;  1BB9 A;  2FO0 A;  1VYV A;  2CSI A;  3QWY A;  1Y0M A;  4CC3 A;  1BU1 A;  2EQI A;  1SSH A;  1QLY A;  3VS3 A;  1WDX A;  1ZUY A;  2YT6 A;  1RUW A;  2DM1 A;  1E6G A;  2DBM A;  2H8H A;  4J9F A;  2DE0 X;  1U06 A;  3I35 A;  2LJ3 A;  4AG1 C;  2LJ0 A;  1GRI A;  4A63 B;  4OML A;  2ABL A;  3PVL A;  2LZ6 B;  4CC7 A;  3LH5 A;  1XOV A;  4Z89 A;  2GNC A;  5IH2 A;  1H8K A;  1WI7 A;  2DVJ A;  3PVQ A;  2EW3 A;  1Y57 A;  2IIM A;  2HCK A;  3EHR A;  4AG2 C;  3VRY A;  1LCK A;  2JS0 A;  3H0I A;  2D8J A;  3THK A;  5GJW B;  1HD3 A;  3M0S A;  2ENM A;  3H41 A;  1N5Z A;  2C0T A;  2JT4 A;  4J9G A;  3FJ5 A;  2KXC A;  1AWO A;  2DRK A;  4D8D A;  2KYB A;  4HCK A;  3EG3 A;  2JMC A;  2KRO A;  1KSW A;  4DEY A;  1K4U S;  2YUN A;  1WYX A;  2AZV A;  1CKB A;  1I07 A;  2K79 A;  1OOT A;  4X1V A;  2DX1 A;  1MV3 A;  2BZ8 A;  4J9B A;  1WXT A;  5IXB A;  4RTU A;  3PE0 A;  2DYB A;  1NLO C;  1W6X A;  4ZNX A;  2EYY A;  3VRZ A;  2CH4 A;  2BTT A;  1I1J A;  2X3W D;  1RLQ C;  4LN2 A;  2DA9 A;  2L2P A;  2RPN A;  2L0A A;  3M0U A;  2CUD A;  1JXM A;  2KNB B;  2CSQ A;  1GFD A;  2JW4 A;  4F16 A;  3QWX X;  1YWO A;  4J9H A;  1JQQ A;  1G83 A;  2CH4 W;  2RQU A;  2EVR A;  2KRM A;  2L3Q A;  2M51 A;  3R6N A;  1GBR A;  1SEM A;  1YP5 A;  1I0C A;  2A36 A;  1AWJ A;  2BZY A;  3VS5 A;  4LE9 A;  1CSK A;  4J9D A;  2F2X A;  1WXB A;  2J7I A;  1KIK A;  2KRN A;  2PTK A;  4CC4 B;  2V1R A;  3IQL A;  1ABO A;  4IIM A;  1X2K A;  2RMO A;  3SHW A;  1WIE A;  4ORZ A;  2CT4 A;  4AFS C;  3UF4 A;  1SHF A;  1GBQ A;  3NPF A;  2P4R A;  2K3B A;  2RNA A;  2V1Q A;  2F2V A;  2JS2 A;  1X27 A;  2DNU A;  1UFF A;  1WA7 A;  1MUZ A;  1VYU A;  1UGV A;  4QT7 A;  1PKT A;  2I0N A;  2LX7 A;  3EGU A;  1UJY A;  4LUD A;  2K9G A;  2CRE A;  1E6H A;  2JTE A;  1RLP C;  2EPD A;  1M3C A;  1SHG A;  1PHT A;  1YN8 A;  1Z9Q A;  1AVZ C;  2GBQ A;  2O88 A;  2LCS A;  2NUZ A;  4AFZ C;  2QDL A;  1GCP A;  1W70 A;  2AK5 A;  2VKN A;  4R0K A;  5ECA A;  2AKL A;  4K11 A;  2J06 A;  1JO8 A;  1PRM C;  1SRL A;  1BBZ A;  1TG0 A;  2KE9 A;  1ZLM A;  4JJB A;  1U5S A;  1M8M A;  2OJ2 A;  2J6K A;  2RN8 A;  1TUC A;  4CC2 A;  2EYZ A;  2HDA A;  4KRT A;  2DL8 A;  2D1X A;  2ROL A;  5FW9 A;  1UEC A;  3EG2 A;  1G2B A;  2GTJ A;  3TSW A;  2BZX A;  1WXU A;  2EGA A;  1K0X A;  1VYT A;  2FRW A;  1TUD A;  2GTO A;  1UHF A;  2DJQ A;  3RBB B;  2YDL A;  1WLP B;  3NGP A;  5IHI A;  4FSS A;  4J9I A;  1HSQ A;  1M30 A;  2KT1 A;  1EFN A;  1YCS B;  1GCQ C;  1NYF A;  2MOX A;  4DEX A;  3EG1 A;  1CKA A;  3U23 A;  1UUE A;  4GLM A;  1FYN A;  2VWF A;  2LJ1 A;  2KEA A;  2LQN A;  2NWM A;  1T3L A;  2EGE A;  2YUQ A;  2EYW A;  1AWW A;  1SPK A;  1UG1 A;  1X2Q A;  2ROT A;  3GBQ A;  2EKH A;  3M0R A;  5L23 A;  2HSP A;  2LMJ A;  1X69 A;  2KGT A;  4RTY A;  2DF6 A;  1M3B A;  1A0N B;  1M27 C;  1B3Q A;  1K1Z A;  2RQR A;  4RTX A;  2KRS A;  4LNP A;  1AZE A;  5I11 A;  2G6F X;  2RQW A;  5FWC A;  1QKW A;  1UDL A;  4JJC A;  4F17 A;  4JZ4 A;  3VS0 A;  4EIK A;  1NEG A;  2W10 A;  1H3H A;  3C0C A;  3I5R A;  2M0Y A;  1IO6 A;  2L3P A;  3CQT A;  1GFC A;  1ARK A;  1QKX A;  2RQV A;  1QCF A;  1OV3 A;  2DIL A;  2DMO A;  2JXB A;  3NMZ C;  2LP5 A;  4LUE A;  3UAT A;  1UE9 A;  2ED0 A;  2YSQ A;  1V1C A;  2YUO A;  1QWF A;  2KR3 A;  4F14 A;  4HVV A;  2EYX A;  4RTW A;  4WCI A;  1AWX A;  3M0P A;  5FWB A;  2AKK A;  1ZBJ A;  1ZX6 A;  2B86 A;  3M0T A;  1NEB A;  3JV3 A;  2GGR A;  1WX6 A;  1YNZ A;  1K9A A;  2C0O A;  3UA6 A;  2DL3 A;  1J3T A;  1PRL C;  2W0Z A;  5GJV B;  1JEG A;  3SEM A;  2FRY A;  1KJW A;  1OPL A;  2F2W A;  1UHC A;  2DBK A;  1NG2 A;  3A98 A;  2A37 A;  2HEQ A;  1BK2 A;  2XMF A;  1RI9 A;  2FG0 A;  2O31 A;  3VS7 A;  1E7O A;  3NHN A;  1U3O A;  2RQT A;  1W1F A;  1NYG A;  4GBQ A;  5IHN A;  3VS4 A;  4E6R A;  2YUP A;  2K2M A;  1JXO A;  1X6B A;  2E5K A;  1K0S A;  3KFV A;  1UJ0 A;  2C0I A;  4RTT A;  2RF0 A;  1GL5 A;  5EC7 A;  2FPF A;  1QWE A;  5I22 A;  2GQI A;  2ED1 A;  1Z9Z A;  1AEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...