3F70A

Crystal structure of l3mbtl2-h4k20me1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
438
structure length
392
Chain Sequence
b'QDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDAVLRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPPRTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDDDFWCHMWSPLIHPVGWSRRVGHRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDDWFCYHASSHAIFPATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like 2 protein
publication title Methylation-state-specific recognition of histones by the MBT repeat protein L3MBTL2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 88
structure length 392
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3f70A04
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3f70A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3f70A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3f70A01
3MP6A 5J26A 3C4SA 5IN1A 2D9TA 5KE2A 2R57A 4E7JA 2LTOA 2XK0A 4BDYA 1WGSA 3OMCA 2XDPA 4L59A 3LH0A 5D6WA 4Z02A 3OYIA 3H6ZA 3MEUA 3OYGA 2RJEA 3OYEA 4C5HA 3OYFA 3MEVA 2DIQA 2M1HA 2RO0A 5C6SA 2WACA 4PLLA 3OYHA 3P8DA 3BDLA 3OB9A 2EQMA 4E7KA 2HQEA 3OYDA 5FROA 3NTKA 4ZTJA 3LGLA 4RG2A 5M9OA 3QIIA 2CKKA 3QJ6A 3OYAA 3FDRA 1WJQA 3OA6A 3L42A 1OZ3A 2GFUA 2BIVA 2YRVA 1WJRA 4A4FA 2LRQA 2GF7A 4BE1A 3P8HA 1WJSA 2X35A 5IAYA 4A4EA 5J39A 3OYLA 3L2RA 2B8AA 4BACA 3S3MA 2L89A 3Q1JA 2K3XA 3OYKA 2K3YA 4N4HA 2FHDA 4ZTFA 1KHCA 3OY9A 2P0KA 2EQJA 3EAEA 3FEOA 3S3NA 1XNIA 2G3RA 3PNWC 2E6NA 4PL6A 1OYXA 3E9FA 3OS0A 2QQRA 4BD3A 2EKOA 2IG0A 2PQWA 2RJFA 3META 2RI2A 1MHNA 3DLMA 3OS1A 2E5QA 2QQSA 3PMTA 3UWNA 4QW2A 2X4WA 4QQ6A 3OYMA 3OYNA 4UC4A 3ME9A 5C0MA 4QQDA 4QQGA 4CRIA 3M9QA 3QKJA 3UT1A 5KH6A 2RHZA 2RHUA 4X34A 4IUUA 3MP1A 4HCZA 2R5AA 2LCCA 3DB3A 2F5KA 1RI0A 4OVAA 2GFAA 3CEYA 1N27A 4PLIA 2DAQA 2DIGA 4Q5WA 5KE3A 1H3ZA 5KCHA 4IKFA 4II1A 1OI1A 5D6XA 3SD4A 3OMGA 4QVZA 2EQUA 3PMIA 4IUTA 3MO8A 2EQKA 3FLGA 3OS2A 2X4XA 3FC3A 5FRMA 2MWPA 2O4XB 2VYTA 3OYJA 3MEWA 4FL6A 1G5VA 4C5IA 2R5MA 4IUQA 2JTFA 4NS5A 2L8DA 4IUVA 4E7IA 2O4XA 3OQ5A 2M16A 2MWOA 2M0OA 2HQXA 3ASKA 2EFIA 3S6WA 4A4HA 4B9WA 3F70A 4C5EA 3MEAA 2LDMA 4EDUA 4LD6A 3LGFA 3ZEHA 3H8ZA 2RHXA 3OYBA 3L2VA 3MP8A 3GOXA 4E7LA 2RJCA 2RHIA 3O8VA 3OYCA 2LVMA 3L2UA 3NTIA 4E7HA 4IURA 4IUPA 2NLUA 3KUFA 4FU6A 3L2QA 2RI3A 2RJDA 3L2WA 3NTHA 4N4IA 4B9XA 3LX7A 3QBYA 4N4GA 4GY5A 2BKDN 4BE0A 4BDZA 3PFSA 5FRNA 4C5GA 1OZ2A 2RI5A 3LYIA 2RHYA 5KCOA 4BE2A 1SSFA 3DB4A 3LLRA 2X4YA 4A4GA 2JZ2A 3S3OA 3E9GA 5CIUA 2L3RA 2R58A 2BUDA 5D6YA
chains in the Genus database with same CATH superfamily
3CMAQ 1NBEB 2H8HA 1VIFA 1UTIA 5GAOn 1WHMA 2LJ1A 3A5ZB 4Z02A 5IHIA 1WZOA 2LQNA 1M8VA 2YHTA 2EQMA 1G3SA 1YIJQ 1VA7A 3QJ6A 2QI2A 2MOXA 1W2BP 1WJRA 2V1RA 3P8BB 1NM7A 2KQWA 3S3MA 4XTZA 2V8JA 1JJ2A 2V26A 3OSSC 2FHDA 1VQOQ 2CYZB 1VQMA 2DZ9A 4XAXB 1RAHB 3SEMA 1Y96B 2PQWA 2RJFA 2RI2A 3DLMA 1U3OA 1O75A 1IB8A 2ZPBB 2QQ9A 2R5AA 1FWZA 5HK3A 1JB0E 1IREB 4M75A 3OMGA 1U06A 4QVZA 4D8DA 4IUTA 1KD1R 2DETA 4M7AG 2GTJA 2DL4A 1M2OA 2EPDA 1AT1B 4DBHA 2J7IA 4NS5A 1YBYA 1BCOA 1M3AA 1I5LA 4WCIA 1ABQA 4RTZA 3OYBA 3CMET 2DF6A 2DMOA 2RJCA 4IIOA 4HCKA 1VQ8T 1K73U 1MV0B 1X2QA 1MMAA 1CKAA 5LJ3j 2NUPB 2D0QB 5CKDA 4P5NA 2EYYA 2LNHB 1LCKA 4BE2A 3NMZC 5DM7R 3EFRA 2GGRA 5J26A 3C4SA 2O2OA 3EGXB 4J8OA 2SRCA 1K0XA 4OMNA 5IXFA 1WGSA 2CP7A 2J06A 3M58A 1JJ2S 3HHTB 3OYGA 2ZPGB 3VUZA 2D8HA 1BCMA 2WACA 4FYYB 3OB9A 4JLIA 5DY9A 2QEXA 1BB9A 1BIBA 3T9NA 2X35A 3CCJQ 1WX6A 3L2RA 2DTOA 2JJ9A 1YJNA 2YDLA 3EH2A 2A28A 4F16A 4M75E 4LE9A 1KHCA 2P0KA 1HJDA 3OS0A 3META 4C8QG 3OW2A 2AKLA 5KYWA 2LC4A 2HQHA 2VVKA 2DZCA 4IUUA 4C5EA 1VQ7T 3JAME 1YJWA 5HKCA 4PLIA 4LDXA 3HPWA 4M4ZA 4AMCA 3CCMA 5KCHA 5GANe 3SD4A 3CMEQ 1FYNA 1R0BG 3UA6A 2EQIA 1VQ8Q 2JS0A 3O5ZA 1QVPA 2KI7A 2HL3A 8ATCB 1Q86R 3M0TA 4JJBA 3JCMh 2HSEB 2V1QA 5GAMd 1WLPB 1JO8A 1D1CA 1VUBA 2QDYB 3SDZA 3SHWA 4RTVA 1OEBA 5AYFA 3UF4A 3MP8A 3QSUA 5CK9A 1SEMA 4A54A 5CKBA 3MJXA 3L2QA 3CD6A 3VS1A 3VS7A 3OSVA 2VB6A 4J6XA 4M78A 2D9TA 1VQLA 1V76A 3CCET 3V7RA 4V2SA 5GMKj 5D6WA 4OP0A 4EMGA 4C0DC 3MEVA 4R0KA 5LJ5d 2J6OA 4DBFA 4EMKB 4RG2A 3QIIA 3OA6A 1OV3A 1ZX6A 2GFUA 4R55A 4PKCC 5ECAA 2LRQA 3P8HA 2ED0A 3REAB 5LJ3h 1HD3A 1PG5B 1Y07A 1VQ7Q 5FW9A 1GCQC 4ZTFA 1VQ9A 1BYMA 2XD0A 1W70A 1BI2A 2E6NA 4PL6A 1WXTA 1TG0A 4M77A 4JRIA 2ED1A 2XICA 2KDSA 2QA4T 3M9QA 5HY6A 4BI3A 2YSQA 4X1VA 1NEGA 3TCJA 2SEMA 1Q81R 2F5KA 3CQTA 3HP9A 4JJCA 1M5Q1 1WA7A 3PGGA 3OW2P 3GNGA 4J5YA 1X2KA 2YRDA 2LMJA 4PFOA 1Q81C 4M7DA 2KVQG 2JUFA 1NYGA 4XTWA 4AFQC 1TUCA 1WXUA 2K9GA 5FU7C 2AZVA 1OU9A 4A4HA 1J3TA 4PK4A 2HCKA 4M78E 2QASA 1WHJA 2KYBA 3JB9H 5FWBA 3INZA 1YN8A 2M51A 3NTHA 3CCEQ 2QXFA 3PT9A 2BKDN 3RERA 2DTHA 2YT6A 2A36A 4BB7A 5KCOA 3EG9A 1K76A 8AT1B 3QUIA 4HXJA 1OPLA 1YJ9A 1U8RA 1HK9A 2D0NA 4F04B 4OMLA 1Y0MA 2LQ8A 5GAMj 3I56Q 2FO0A 1YCSB 3JCMP 3OYFA 1C6VX 4MDXA 1YWOA 4HT8A 4PJOC 4C0DB 4M77E 2KNBB 1KC8U 1BI1A 3QYGB 2K5FA 2ROLA 2QA4Q 3C12A 2JOYA 1ZSGA 1PSFA 2L3QA 1XNIA 3CXCA 5FWCA 2EAYA 4XU1A 4M7DE 5A2QE 2KMTA 2DL8A 1M2VA 1VQMT 2DX1A 5GMKh 4J7IA 2HBWA 5LJ5j 2DPPB 3OYLA 1N27A 2PU9B 2JM9A 1UFFA 4C92E 1H8KA 2HMAA 3VS5A 2CDTA 1KQSA 1XOVA 1WNLA 4QT7A 2KT1A 3MEWA 3G1JA 5I2MA 3I55A 3RBBB 2O4XA 4HVWA 3VS2A 4Y92A 2YUPA 3H0HA 1B34B 2X3WD 2RQRA 1WHHA 4RCCA 1JQQA 4HA8A 4JZ3A 4OMFB 1M30A 1UHCA 5FU7B 3ZBDA 4MMLA 1YCYA 2EJ9A 2RHYA 2JXBA 2XDDA 3GBQA 2JZ2A 3L2ZA 1WDXA 2W10A 2P4RA 4DQ2A 2ESWA 5IN1A 1X01A 2DJZA 2CREA 2CSIA 4OGEA 3QWXX 1PKSA 4DBRA 4Z8AA 1SPKA 4R56A 3UDCA 4M78F 3TQ7P 2LCLA 3JB9G 1I5OB 3CBPA 3E1SA 2QGGA 1U1TA 1KFZA 1NJIR 3CXCS 3THKA 1K73R 3H0IA 4FT4A 1VQPQ 4M78D 3QPHA 5M9OA 2OTJT 1N9SA 1GBQA 1M3CA 2D6FA 1M1GA 1TS9A 2K5LA 1D3BA 4KH0B 3CPWA 1V29B 2WSEE 4C0GA 3M54A 2QEXT 4PJOB 3TREA 4GLKA 1WYXA 1Z9ZA 5GAN5 1PRMC 1ZLMA 1KQSS 3FEOA 5A0GA 9ATCB 3G71A 1LVKA 1YJNT 1SRMA 1PD0A 1QMCA 2F1LA 4E47A 1WPYA 2F2XA 3CPFA 1HYOA 3CC7A 1ZSZC 2IIMA 3JRZA 5GAMh 3HFNA 5KE3A 1OOTA 2NYSA 5A0DA 1QWEA 3BDUA 5D6XA 4IKFA 2EYWA 4F7UG 2C0OA 4XU0A 3KBGA 4MZMA 1PWTA 3JCMe 3CC2A 2A3LA 2RN8A 4C5IA 3CCMT 4ZGEB 4M77D 4XU3A 3CCQQ 4DOVA 1QCFA 1MMGA 1UG1A 1UJYA 2O9VA 1PKTA 1KHIA 3M53A 4M7DF 1YWPA 4JRKA 1QP2A 1IO6A 5CKEA 2G6FX 2GCXA 1C1AA 1UGSB 4QVCA 4M7DD 2EVRA 4JS4A 1D0XA 4C92F 4DEYA 3CD6T 1WQ7A 4J9DA 5LJ5h 1NZ9A 2ABLA 1G83A 4CC3A 3CCLA 3QZ9B 4E7JA 2OTJQ 4X9CA 4BI8B 4C92D 1N6AA 2LT1A 3LH0A 3OYIA 2LNVA 4LXCA 1U1SA 2FVUA 2FYKA 1W4SA 2COWA 2CT4A 4RG8A 1W2BS 1SKUB 2CP2A 3I5SA 1VQ5Q 2FL7A 3RKYA 4ZTJA 2CZ7B 5LJ3e 3NHNA 2JMCA 1NLPC 5L23A 3J80E 2XDBA 2YWWA 2QG9B 4MZPA 3A8HB 3QJYA 4PFPA 4ZN1A 1N8RU 1W1FA 2CZ1B 3I5RA 5GANf 1Q95G 2LQWA 2QQBA 5LJ5g 1SRLA 5EG2A 1VQ9T 4UC4A 1BK2A 3CPWP 4KRTA 3CCMQ 4C8QC 1YITT 4JPBW 2RHUA 3V7CA 3PIOA 1W6XA 2DIGA 2LX9A 1H3ZA 2VC8A 1JEGA 3MO8A 5CKHA 2E4HA 1ZSZB 6AT1B 3M0UA 1NEBA 4ELYC 4E7IA 2RK2A 3QXEB 4OB1B 4EMHA 2OTLA 3HSBA 3ZEHA 3L2VA 3CD6Q 1HXDA 1WQWA 2ZZDA 2K79A 4M7AB 1U5SA 5AT1B 2IPOB 2CP5A 2CZ0B 3HTRA 1RACB 2OX7A 3V7SA 2P84A 3FC3A 5GMKm 5GAN6 2P4TA 4EMKA 2R57A 3PIPA 1PM3A 2CP0A 3CBOA 3GIBA 1JBMA 2W0ZA 2YXYA 3CCSQ 1YJ9T 2VUBA 3KFVA 3C95A 3EGDA 2RJEA 4E2FB 1QVFA 3VKIA 4NL2A 2AKKA 2VXFA 3JCMJ 1WHGA 1YITQ 2KYMA 2QTXA 3Q1JA 3RNJA 2DA9A 2JN0A 4M75C 3S3NA 1X27A 2PUOB 1FXXA 1UGPB 4JRPA 1UEBA 3KXTA 1QLYA 5GMKe 2X3XD 5C0MA 1RI9A 4QQGA 4CRIA 1K8AU 3CC4A 3A8GB 2NUTB 3BW1A 5KH6A 1OPKA 1K1ZA 4RTYA 2DK3A 1PHTA 2E41A 5GJVB 1V1CA 4BI4A 1SHFA 2GBQA 1H92A 4C8QB 1SHGA 1Y71A 3A98A 1SG5A 3JB9J 5KYUB 4IUQA 3BE3A 3IQLA 4CC4B 5FLXE 1KC8C 3LW5E 4ELZC 2I2LA 3MEAA 2K2VA 4J9EA 3I55T 5D7UA 1GBRA 2KRMA 3A8OB 3O8VA 1I8FA 1I1JA 1OX9A 2F69A 3HRTA 4HKEA 4ZGJB 1AOJA 2MCNA 1YJ9Q 3QBYA 4OB3B 5FRNA 1B07A 2KT8A 2RNAA 3E19A 1B3QA 2HSPA 2BE7D 2R58A 3GF5A 4PJMA 3HL8A 4Y28E 2HZYA 2O88A 2LX7A 3EFOB 2CH4W 2LTOA 2XK0A 3VS3A 4AFUC 3TEEA 3GPLA 2CH4A 2P0PA 4XTUA 3X25B 2KXDA 3I9QA 4QKUA 1IGQA 2QGFB 2L2PA 2RO0A 2A7YA 5C6SA 1VQOA 2VGMA 2K3BA 2FRWA 4J9FA 3UPUA 4N0AC 1VOMA 2E6ZA 4DOWA 1LNXA 4A4FA 2RA2A 5IAYA 2DL3A 2L3PA 2KE9A 3AT1B 2VKNA 1VQKA 1ZHIA 2EKHA 1O9SA 2D8JA 2ZPFB 1QVFP 3M55A 3SWNA 3PNWC 2NWMA 2QAZA 4OGCA 4D8KA 4BD3A 2OAWA 3OBWA 1VQNA 1H641 3PMTA 3TVTA 5GAMe 3ME9A 4JLGA 3OW2S 2KROA 4M75B 4IIMA 3UT1A 3G71T 1FMKA 1B34A 1AWWA 1M8MA 2KR3A 4WF2A 1OI1A 3A8LB 4M75G 1EFNA 4AFZC 1EZZB 2WSCE 1D1AA 2EWNA 3I55Q 1X75C 3OS2A 4E7SA 1KSWA 2O31A 1PC0A 3FB9A 1UJ0A 4B9WA 2YUNA 3VS6A 3CC2T 4C0ZA 4EDUA 5CCAA 1LPLA 2PZ1A 4FU6A 2E3HA 4JZ4A 1MMNA 2RK1A 3LX7A 1OX8A 1QW1A 4N4GA 5A0LA 3MKDA 4GY5A 5LJ5e 1PNJA 2RI5A 5KYYA 4GLMA 3S3OA 2VGNA 2YLCA 1NG2A 3P8DA 3N5BB 4RTWA 2J6KA 5HK0A 1KD1U 2RPNA 1NLOC 3G4ST 2K5IA 2VV5A 2KAFA 2BZXA 5CQYA 4C92A 3BFMA 5GAOp 2ZPIB 3CCJA 1ZA1B 4PJOA 4RKUE 2DXTA 1AWOA 2HL5C 3EG0A 2DYIA 3NTKA 4OMPA 4PNOA 5I11A 3EGUA 4M77C 4ANJA 2JNGA 2K4YA 2PVOB 4BACA 4J6YA 3TSZA 3G71Q 1VQ4A 3C94A 2RH2A 3JCMV 2HKNA 4KT0E 2EQJA 2WSFE 2G3RA 1ACMB 1OYXA 3FJ5A 1KIKA 2FPFA 3OYMA 2QQSA 4QW2A 2X4WA 2AZSA 2CP6A 5CO7A 3JCMf 2JM8A 4LNPA 1M4ZA 2E12A 3REBB 1MGQA 5IT9E 1Q7YU 3JCMb 4VUBA 3CC2Q 2DEQA 4DEXA 3PMIA 2EQKA 1YI2A 1M1KU 1WIEA 4KGZB 3DLLA 4OB0B 2QQAA 3M56A 2E10A 3OQ5A 1Q82U 3NFCA 2HQXA 1T3LA 1X6BA 4KUDK 3LWIA 1SF9A 4DA4A 4LD6A 3H8ZA 2JTMA 4E6RA 3RMSA 4E7LA 2RHIA 2E5KA 3PVQA 4XK8E 3TU4K 3KUFA 3GP8A 2OTLT 1XJWB 2DRMA 5KYNA 3G4SQ 1N8RC 3L2WA 2E64A 2QYZA 2VASA 4YTLA 2JTEA 2MPXC 4BE0A 3CCRA 4C5GA 4PJOE 1SSFA 3BY7A 1X69A 4M78G 1VYTA 2DILA 2DRKA 2E65A 1S1NA 1Q86U 3U23A 5LJ3f 3VS0A 1K9MU 3X20B 3ZFJA 1WFWA 3E2UA 3RKXA 5IHKA 3OYEA 1TWBA 1GL5A 4OB2B 2L3SA 4ESRA 5KYXB 4PLLA 5GAOm 1MNDA 4J6WA 1BI3A 3QHSA 4OMMA 2O01E 4HVUA 2GF7A 5J3BA 3HKSA 5GAN8 3OYKA 2DD5A 1C0MA 3EFSA 4XTXA 4RTUA 4M77B 4Z89A 2YUOA 3QO3A 2IG0A 2MYSA 2JW4A 3UWNA 3OYNA 4M77G 2C0TA 4QVDA 1UB4A 1Y96A 3D7SB 2P0QA 1VQ6A 3J7AF 1ZBXA 4LD9K 1UE9A 4HCZA 1FMVA 3CEYA 1ARKA 2LZ6B 1VQMQ 1NPPA 1RAFB 3CC4T 2L5QA 4M7AA 2RQVA 3RESA 4J9CA 2X4XA 5GMKl 2NUZA 2OTLQ 2EJGA 4M7DG 2LP5A 4AFSC 1I0CA 2X4JA 3CCEA 2XMFA 3FJPA 4FW2A 2MWOA 3ASKA 3S6WA 1CKBA 2AT1B 2MI6A 5L8RE 1LJOA 2KBTA 4A63B 1TUDA 1IZ6A 4F7UB 4EIKA 5GAN4 2LVMA 3L2UA 3NTIA 3OYYA 2NLUA 4RTTA 4FM4B 4C92G 4J83A 5IHNA 1P92A 4LDWA 2XI9A 1AZEA 1YJWT 2FRYA 2PVGB 2RQWA 1RAAB 3I56A 4DBQA 2NUPA 3LYIA 1AZGB 1R0CB 1K8AC 1D1BA 1RAEB 3E9GA 1XQHA 3WVDB 4RTXA 3CCUA 4HCCA 1YHQA 3GNFB 3R6OA 3EGXA 4FT2A 2VWFA 3X28B 3H6ZA 2HAXA 1GFCA 2M1HA 3C0CA 3URGA 2F2VA 5FROA 4CC2A 4ZN3A 3LGLA 4NL3A 1QQJA 3LH5A 2PTKA 4PJOF 2DM1A 3HRUA 5J39A 1A0NB 1OU8A 4PJJA 3M57A 2EYQA 2DVEA 4HT9A 3MHXA 2K3XA 3NPFA 3CPWS 2HBPA 3PVLA 4JRQA 2L0AA 1VQLT 2MK5A 3OY9A 4PJOD 1T3SA 4M7AE 3E9FA 4FYXB 4C8QA 2QQRA 2QEXQ 1VQKT 2A0FB 3UATA 2E5QA 1OQKA 5KYUA 1AEYA 5HCKA 1YJNQ 3QKJA 4TVRA 3L1AA 4J9GA 1LOJA 4X34A 4OF1A 3HFOA 1VQNT 4Q5WA 2DAQA 1I81A 1IXDA 1UHFA 1XTDA 4BUGA 1T0HA 1UGRB 3ZL7C 1KQ1A 2A08A 5FRMA 2O4XB 4O6JA 2KSSA 1RADB 2L8DA 5GMKi 2XKOC 1YJWQ 1BKBA 2DJQA 1ZBJA 2FB7A 2DLPA 1E6GA 1TH7A 4HVVA 2KEAA 3EFOA 2DBKA 4IUPA 5LL6S 1RLPC 4MDWA 4KH1B 3CCVA 4BDZA 5EC7A 1QVGP 2ECZA 1UECA 2X4YA 1MUZA 2RQUA 2K6DA 1KQ2A 2MAMA 5KE2A 1VQPA 2DERA 3A8MB 2COZA 1VIEA 1SSHA 7AT1B 3M0PA 4ZGDB 3JCMQ 3H9NA 1X6OA 2RMOA 4RUGA 5FU6C 4AT1B 2HD0A 2CUDA 3OYHA 1K9AA 2RB6A 1VQLQ 3G7ZA 1PD1A 2CSQA 3CCJT 1D3BB 4C8QE 2D1XA 1VQKQ 3L42A 2VXEA 2AIRB 1WI7A 5GAMf 5DLQE 1K4US 1F1BB 3ER0A 1VQNQ 3NGPA 3G6EA 2E3IA 2I0NA 3OBYA 1H3HA 4NOYA 4D6WA 2DEUA 2BZ8A 5GAN3 1VQ4T 1MHNA 1KD1C 1E7OA 2DYBA 1GRIA 4AG1C 3CCQA 2X9HA 1NJIU 3MPUB 4ME7A 1VQ9Q 5CAIA 2K57A 4Y91A 2EQUA 2M9UA 3EG3A 3FLGA 2DNUA 4KGVB 2VYTA 2KXCA 2CP3A 2JTFA 2LQKA 2M0OA 1YI2T 5LJ5f 3FRNA 3M59A 3SB2A 1CSKA 4M7AF 1M1FA 1TU0B 4JJDA 2YLBA 1M90U 2RD1A 4OMOA 4XQ3A 2EGEA 4EMKC 2GQIA 2ROTA 5GANd 4M7AD 2OTJA 3A1PA 1JXMA 5GAN2 1KC8R 4B9XA 2HDAA 1Q7YR 2C06A 2HEQA 1OZ2A 1D0YA 2AHJB 5IH2A 2Y4YA 5D6YA 1VQ5A 3GLXA 4KBMB 1Q7YC 1M1KR 3JCMc 3CCRT 4RMOA 4PFZA 3QWYA 1S72A 4BDYA 1Q82R 2LJ3A 3CMAA 2ZPHB 3EH1A 1M1KC 4N0AA 4PJLA 2EGAA 4FSSA 1Q82C 2DE0X 1BU1A 4A53A 4BY6C 1JJ2P 2CKKA 2DL7A 1QVFS 1VQ4Q 3EHQA 2BIVA 2H3JA 1RL2A 4JDSA 4WTOB 4E7ZA 1YIJA 5FU6B 4J7FA 2JS2A 2ZPEB 2L89A 2XG8D 4K11A 1RUWA 2K3YA 1PRLC 1RABB 2RF0A 1ZQ1A 2FZCB 1RAGB 4FCYA 2JT4A 1K9MR 2EKOA 3RDVA 1KK7A 2Y90A 3QYHB 1R77A 1UUEA 2DFUA 2X51A 2EYZA 1Q86C 2LCCA 1K9MC 1RI0A 2GFAA 1YI2Q 1GCQA 2DTIA 4C8QF 4F14A 3VRZA 4ZNXA 3ULRB 4J9HA 1VQ6T 1QKWA 3PTAA 2DVJA 1BI0A 3JCMW 2H3EB 2MWPA 4C8QD 1GFDA 1RAIB 3M0SA 2EFIA 5I21A 2OI3A 3F70A 2MMPA 1NPRA 2EIFA 3QG1A 2KRNA 3RR6A 3VUBA 2CUBA 2CZ6B 5I22A 5GAOl 1X43A 3V8JA 4E7HA 3CCRQ 3CC7T 3LWHA 3CCSA 1QP3A 2F5TX 1QCNA 4FW1A 2FPEA 3JCMg 2GQVA 4PJNA 3DB4A 5KYXA 1YP5A 2RQTA 3MP6A 2EYXA 4GBQA 4XTVA 3I56T 1I4K1 1X6GA 4M78C 3EGDB 1RLQC 4L6V5 4F17A 2F2WA 2CT3A 1DJ7B 3OMCA 2XDPA 4L59A 1AWXA 3VYHB 3MEUA 4LUEA 2QDLA 4C5HA 2A37A 3CCUT 4CI0C 1YITA 2KK4A 2DIQA 2KY9A 1YHQT 1GXIE 3EG1A 3PE0A 1M3BA 1MMDA 3BDLA 2ATCB 1Y57A 2K2MA 2LJ0A 3SWNC 5GANj 4LUDA 3OYAA 2B86A 2FG0A 4ORZA 4L5GA 3WXMB 2DXUA 2Z0WA 3VU3C 4JUVA 2LCSA 4BY6B 1Y7XA 3AHUA 3TSWA 3CCLT 1VQ6Q 5GAN7 3V8LA 5GAOr 4M75F 4LDUA 3OS1A 1G2BA 1D09B 5GAOq 3QZ5B 2ZGWA 4MZTA 2RHZA 2C0IA 1E6HA 5LJ3g 3DB3A 4OVAA 4M75D 1PSEA 4F7UA 5CQXA 3CBMA 2FPDA 1ABOA 1TTHB 1G5VA 3VJPA 1IRXA 3CMEA 5KYWB 1QKXA 3CC7Q 2M16A 4M7DC 3SFMA 1VQ8A 1ZUYA 1N5ZA 1T0JA 3LGFA 3EHRA 1PCXA 2ENMA 2IVWA 2MF2A 3RKWA 1G3YA 2EW3A 2E1HA 4IURA 4O5VA 4HCBA 2DKGA 4N4IA 4C92C 2COYA 4J9IA 1WHKA 5CR2A 1BBZA 3CCUQ 1YHQQ 1JU5C 5CIUA 2L3RA 2BUDA 2ZCFB 3CCVT 1N8RR 2M02A 2AK5A 1ZUKA 2K7AA 2YUQA 2JMAA 2XIDA 4OMQA 3R6NA 1VQPT 3EG2A 2FZKB 4LDYA 4JS5A 3RUXA 2DL5A 4M78B 2FZGB 3X26B 2HQEA 3M5AA 3CCLQ 4J9BA 1JXOA 1UGQB 3UA7A 3FDRA 3JV3A 2KGTA 2YRVA 1Z9QA 1G3TA 2HKQB 1WJSA 3V8KA 4A4EA 1MV3A 2B8AA 3M0RA 3SWNB 1AWJA 2MIOA 4N4HA 3JSCA 4F7UE 1KJWA 2FEIA 1JRIA 5DLOA 4RCBA 2BE9B 1VQ7A 4QQ6A 3G6ET 1B7TA 2M0YA 1UDLA 2V8IA 1N9RA 2GNCA 4II1A 3J81E 3CCQT 2XU8A 5GANh 5I2SA 1TXQA 4IUVA 1ZSZA 2RM4A 2CGHA 3M4GA 4LN2A 1HSQA 4FIBA 4FYWB 3M0QA 4KGXB 2LDMA 3I35A 3JCMX 3RMQA 1AVZC 3H41A 3CCVQ 1M27C 2DO3A 1I07A 2DBMA 2RI3A 4JJNK 2DXCA 4M7DB 2YRCA 2CS7A 5KYYB 1EX4A 4XU2A 1TOVA 1YFNA 2QK0A 3JCMd 1ZUUA 2GTOA 3PFSA 1WHLA 3VRYA 3VS4A 1TUGB 3LLRA 3OS5A 5CVIA 4A4GA 1WXBA 2LT4A 3QDRB 5IXBA 1GCPA 1NJIC 1QVGA 4C92B 2J05A 1K73C 3QDFA 1VQ5T 1W2BA 2PNIA 1K8AR 1QCOA 5GANg 2Y4XA 1M90R 3EG9B 4PJOG 1S72T 2BTTA 4KULA 1Q81U 3CMAT 4E7KA 1YNZA 3OYDA 2E70A 3JB9F 1WJQA 1M90C 1OZ3A 2ZAEA 4BE1A 1FX7A 2OAUA 2DXBA 4FYVB 4MMKA 3G6EQ 3CXCP 2PUKB 3JB9I 4M77F 1EIFA 2DD4A 3JB9D 1G3WA 4C0FA 1ZA2B 2J6FA 1VYVA 3EAEA 5CKFA 2QA4A 1YIJT 4CC7A 2O9SA 3X24B 1QWFA 3H0FA 3MCAB 4M7AC 1MNEA 4ATOA 1NYFA 2EBPA 4Z88A 1G8XA 4QQDA 1IHVA 5LJ3d 2PVDB 1KQSP 2V8KA 3MP1A 3HRSA 1VQOT 1K0SA 3FIFA 2NUTA 1AD5A 1IHWA 2OJ2A 3OYJA 3M4YA 2HNIA 4FL6A 1KG1A 1M2VB 3G4SA 2R5MA 4FSXA 3CC4Q 1OULA 2JVVA 1D0ZA 4F7UF 2EJFA 4A4KA 4EPCA 4AG2C 5GAMg 4KUIA 2RHXA 4XTYA 1QVGS 3GOXA 1M9SA 5GJWB 3DKMA 3OYCA 1R8OB 3WVEB 1NE8A 1TSFA 1VYUA 3VV0A 2RJDA 2KRSA 1FMWA 4B6MA 1IGUA 2BZYA 3VYGA 4LDVA 3RIRA 1UGVA 1BIAA 2EGCA 1AHJB 4X9DA 3CCST 1S72Q 2XHCA 2QTVA
chains in the Genus database with same CATH topology
4KBMB 1Q7YC 5IN1A 1X01A 2DJZA 3JCMc 3CCRT 4RMOA 1VIFA 3G4ST 4OGEA 2K5IA 2VV5A 5GAOn 2KAFA 4R56A 5CQYA 1S72A 3UDCA 4BDYA 4C92A 3A5ZB 3BFMA 4Z02A 2ZPHB 4M78F 3CMAA 5GAOp 3OYIA 2ZPIB 2LCLA 3JB9G 3CCJA 3E1SA 3CBPA 1M1KC 1U1TA 4PJOA 1M8VA 4N0AA 2YHTA 4RKUE 3CXCS 2DXTA 1Q82C 2EQMA 4FT4A 1G3SA 4A53A 4M78D 3NTKA 3QPHA 4BY6C 5M9OA 2OTJT 1N9SA 2CKKA 3QJ6A 2QI2A 4PNOA 1QVFS 4M77C 2D6FA 2BIVA 2H3JA 1M1GA 2K5LA 1RL2A 1D3BA 1WJRA 2K4YA 2JNGA 4JDSA 1YIJA 5FU6B 2PVOB 3P8BB 4J7FA 2KQWA 4BACA 4XTZA 2ZPEB 2L89A 3CPWA 4J6YA 2XG8D 3S3MA 2V8JA 1V29B 1VQ4A 1JJ2A 2WSEE 3C94A 3M54A 4C0GA 2QEXT 3TREA 2K3YA 4GLKA 4PJOB 5GAN5 3OSSC 2FHDA 2RH2A 3JCMV 2CYZB 4KT0E 2EQJA 3FEOA 2WSFE 5A0GA 1KQSS 1VQMA 2G3RA 1ZQ1A 2DZ9A 4XAXB 3G71A 1YJNT 1OYXA 1Y96B 2EKOA 2PQWA 2RJFA 2RI2A 3DLMA 4E47A 3OYMA 2QQSA 4QW2A 2X4WA 5CO7A 1WPYA 2Y90A 3QYHB 3CPFA 3JCMf 3CC7A 1M4ZA 2E12A 1MGQA 1O75A 3JRZA 2ZPBB 5IT9E 2QQ9A 5GAMh 3HFNA 1Q7YU 2R5AA 2LCCA 1Q86C 1K9MC 1RI0A 1FWZA 2GFAA 1JB0E 5KE3A 5HK3A 1IREB 2DTIA 4M75A 4C8QF 4VUBA 3JCMb 2DEQA 5A0DA 3BDUA 5D6XA 4IKFA 3OMGA 1VQ6T 4QVZA 4F7UG 3PTAA 3PMIA 1BI0A 4IUTA 4XU0A 3KBGA 3JCMW 2EQKA 4MZMA 1YI2A 4M7AG 3JCMe 2MWPA 1M1KU 3CC2A 2A3LA 3DLLA 4C5IA 4OB0B 4C8QD 3CCMT 4ZGEB 4NS5A 2QQAA 3M56A 2E10A 1YBYA 4M77D 4XU3A 1I5LA 3OQ5A 1Q82U 3NFCA 4DOVA 2HQXA 2EFIA 5I21A 4KUDK 3F70A 3LWIA 4DA4A 2MMPA 3OYBA 1NPRA 2EIFA 1KHIA 3H8ZA 2JTMA 3M53A 3QG1A 4LD6A 3VUBA 3RMSA 3CMET 4E7LA 2RJCA 4M7DF 2RHIA 2CZ6B 4JRKA 5GAOl 1QP2A 3V8JA 4XK8E 3TU4K 1K73U 4E7HA 1VQ8T 3KUFA 3GP8A 2OTLT 1N8RC 5CKEA 2GCXA 3L2WA 2E64A 5LJ3j 3CC7T 1UGSB 2D0QB 5CKDA 4YTLA 3LWHA 1QP3A 2F5TX 4P5NA 4QVCA 3CCSA 4M7DD 4BE0A 4JS4A 3CCRA 4C5GA 3JCMg 2GQVA 4BE2A 4PJOE 1SSFA 3BY7A 3DB4A 4C92F 5DM7R 3CD6T 1WQ7A 5LJ5h 4M78G 3EFRA 1NZ9A 3MP6A 5J26A 3C4SA 4XTVA 3I56T 3QZ9B 3CCLA 1I4K1 4M78C 4J8OA 2E65A 4E7JA 4L6V5 4X9CA 4BI8B 1Q86U 5LJ3f 4C92D 1K9MU 1DJ7B 1WGSA 1N6AA 2LT1A 2XDPA 3LH0A 3OMCA 4L59A 3X20B 2LNVA 3RKXA 3VYHB 3M58A 3MEUA 3HHTB 1U1SA 3OYGA 2ZPGB 2FVUA 2FYKA 1W4SA 3VUZA 4C5HA 3OYEA 4RG8A 3CCUT 1W2BS 4CI0C 4OB2B 2KK4A 2DIQA 2KY9A 1YHQT 1YITA 1GXIE 2WACA 4PLLA 5GAOm 3BDLA 3OB9A 3SWNC 4JLIA 5GANj 2FL7A 3RKYA 4ZTJA 4J6WA 1BI3A 2CZ7B 3QHSA 5LJ3e 3OYAA 5DY9A 2QEXA 2O01E 4L5GA 3WXMB 1BIBA 2DXUA 2GF7A 3T9NA 3J80E 2X35A 5J3BA 3HKSA 3L2RA 2DTOA 3VU3C 1YJNA 2XDBA 4JUVA 5GAN8 1VQ5A 3OYKA 4M75E 4MZPA 2DD5A 4BY6B 1Y7XA 3A8HB 3QJYA 3AHUA 1KHCA 3EFSA 2P0KA 4XTXA 4ZN1A 3CCLT 1N8RU 4M77B 2CZ1B 5GANf 5GAN7 3V8LA 3OS0A 5GAOr 3QO3A 2QQBA 4M75F 2IG0A 3META 4LDUA 4C8QG 3OS1A 5LJ5g 3UWNA 3OYNA 3OW2A 5GAOq 5EG2A 3QZ5B 1VQ9T 4M77G 2LC4A 4UC4A 4QVDA 1UB4A 1Y96A 3J7AF 2P0QA 1VQ6A 2ZGWA 4C8QC 4MZTA 1YITT 1ZBXA 4LD9K 2RHZA 2RHUA 5LJ3g 2DZCA 4IUUA 4HCZA 3V7CA 3DB3A 4C5EA 4OVAA 4PLIA 5HKCA 3JAME 4M75D 3CEYA 3PIOA 1YJWA 2LX9A 2DIGA 3HPWA 4LDXA 3CCMA 1PSEA 4F7UA 5GANe 1NPPA 3SD4A 5KCHA 5CQXA 2VC8A 1H3ZA 3CC4T 2L5QA 3CBMA 4M7AA 3MO8A 5CKHA 3RESA 2X4XA 5GMKl 1G5VA 2EJGA 1QVPA 3VJPA 4M7DG 3CMEA 2X4JA 4ELYC 3CCEA 3FJPA 4E7IA 2RK2A 3JCMh 2M16A 2MWOA 3ASKA 3SFMA 3ZFJA 3S6WA 5GAMd 1VQ8A 3QXEB 4M7DC 2MI6A 5L8RE 4OB1B 4EMHA 1VUBA 2OTLA 1LJOA 2QDYB 3SDZA 3HSBA 3LGFA 3ZEHA 3L2VA 1IZ6A 5AYFA 1HXDA 1WQWA 2MF2A 2IVWA 3MP8A 3RKWA 1G3YA 4F7UB 5CK9A 3QSUA 2E1HA 2ZZDA 4A54A 5GAN4 4M7AB 2LVMA 5CKBA 3NTIA 3OYYA 4IURA 4O5VA 2NLUA 3L2UA 4HCBA 4FM4B 4C92G 3L2QA 4J83A 2DKGA 3CD6A 4N4IA 2CZ0B 1P92A 4LDWA 2XI9A 3OSVA 3V7SA 4C92C 4X9DA 1YJWT 2PVGB 3I56A 3LYIA 5CR2A 4J6XA 4M78A 1K8AC 3E9GA 5CIUA 2L3RA 1XQHA 3WVDB 2BUDA 3FC3A 2ZCFB 5GMKm 3CCVT 5GAN6 2P4TA 2D9TA 4EMKA 2R57A 1VQLA 3PIPA 3CCUA 4HCCA 3CBOA 1YHQA 3GNFB 3R6OA 3CCET 1JBMA 3GIBA 3V7RA 4V2SA 1YJ9T 2VUBA 4FT2A 5D6WA 4OP0A 5GMKj 4EMGA 3C95A 3X28B 3H6ZA 4C0DC 2XIDA 2RJEA 1VQPT 4LDYA 4JS5A 3RUXA 2HAXA 3MEVA 2M1HA 4M78B 5LJ5d 3URGA 3X26B 2HQEA 3M5AA 5FROA 4ZN3A 3LGLA 4EMKB 4NL3A 1QVFA 1KD1U 4RG2A 1UGQB 3VKIA 3QIIA 3FDRA 4NL2A 2VXFA 3OA6A 3JCMJ 2GFUA 2YRVA 4R55A 4PKCC 4PJOF 2LRQA 1G3TA 3HRUA 3P8HA 1WJSA 3V8KA 4A4EA 5J39A 2B8AA 5LJ3h 3M57A 2QTXA 3Q1JA 2EYQA 2DVEA 3SWNB 3MHXA 2K3XA 3CPWS 4HT9A 1Y07A 2HBPA 2JN0A 4N4HA 4JRQA 4ZTFA 3JSCA 4F7UE 4M75C 1VQ9A 1VQLT 3S3NA 3OY9A 1BYMA 2XD0A 1JRIA 4PJOD 2PUOB 4M7AE 1BI2A 2E6NA 4PL6A 5DLOA 1FXXA 1UGPB 3E9FA 4RCBA 2QQRA 4C8QA 1UEBA 4JRPA 1VQ7A 1VQKT 3KXTA 4M77A 5GMKe 2E5QA 4JRIA 4QQ6A 5C0MA 3G6ET 2XICA 4QQGA 2KDSA 4CRIA 2QA4T 1K8AU 3M9QA 3A8GB 3QKJA 4TVRA 5HY6A 3BW1A 3L1AA 4BI3A 5KH6A 3CC4A 1LOJA 4X34A 3TCJA 4OF1A 2F5KA 2V8IA 3HFOA 1N9RA 4Q5WA 1VQNT 2DAQA 1I81A 2DK3A 3HP9A 2E41A 1XTDA 1M5Q1 4II1A 4BUGA 4BI4A 3J81E 4DQ2A 3PGGA 1UGRB 3CCQT 4C8QB 1KQ1A 3GNGA 2XU8A 2O4XB 4J5YA 5FRMA 4M7DA 1Y71A 5GANh 4O6JA 1Q81C 2KVQG 5I2SA 3JB9J 2JUFA 2KSSA 4IUQA 4XTWA 2L8DA 4IUVA 2RM4A 2CGHA 5FLXE 5GMKi 3M4GA 2XKOC 1KC8C 3LW5E 5FU7C 1BKBA 4FIBA 4A4HA 4ELZC 2FB7A 2I2LA 4M78E 3MEAA 2LDMA 1VQ7T 2K2VA 3JCMX 3RMQA 1TH7A 3I55T 3JB9H 3A8OB 3O8VA 1I8FA 2DO3A 3HRTA 2F69A 4IUPA 4HKEA 5LL6S 4JJNK 2RI3A 3INZA 2DXCA 4ZGJB 4M7DB 4MDWA 2CS7A 3NTHA 2QXFA 3PT9A 3QBYA 4OB3B 4XU2A 3CCVA 2BKDN 3JCMd 2DTHA 3RERA 4BDZA 3PFSA 5FRNA 4BB7A 5KCOA 3LLRA 3OS5A 5CVIA 2X4YA 3E19A 4A4GA 3CCST 3QUIA 1YJ9A 1U8RA 2LT4A 2R58A 3GF5A 3QDRB 1KQ2A 1NJIC 2MAMA 3HL8A 4Y28E 5KE2A 1VQPA 1QVGA 4C92B 1HK9A 1K73C 3A8MB 1VIEA 1JJ2S 2LTOA 2XK0A 3TEEA 3GPLA 2LQ8A 5GAMj 1VQ5T 2P0PA 3JCMP 1W2BA 4XTUA 3X25B 4ZGDB 3JCMQ 5GANg 3OYFA 2Y4XA 1X6OA 2RO0A 4MDXA 2A7YA 5C6SA 5FU6C 4PJOG 2HD0A 1S72T 3OYHA 1VQOA 1Q81U 4KULA 2RB6A 2VGMA 3CMAT 4E7KA 4HT8A 3G7ZA 3OYDA 2E70A 3UPUA 4PJOC 3CCJT 1D3BB 4C8QE 3JB9F 4N0AC 4C0DB 4M77E 2E6ZA 4DOWA 1WJQA 1KC8U 1M90C 3L42A 1OZ3A 2VXEA 1LNXA 1BI1A 3QYGB 4A4FA 4BE1A 1FX7A 2K5FA 2DXBA 2OAUA 2RA2A 4MMKA 5GAMf 5IAYA 2PUKB 3C12A 3JB9I 2JOYA 4M77F 5DLQE 1VQKA 1EIFA 1ZHIA 2DD4A 3ER0A 3JB9D 1O9SA 1G3WA 1PSFA 4C0FA 3G6EA 3EAEA 2ZPFB 5CKFA 2QA4A 3M55A 1XNIA 3SWNA 3OBYA 3PNWC 1YIJT 4NOYA 3CXCA 3X24B 2EAYA 3MCAB 4XU1A 4OGCA 4M7AC 4D6WA 4BD3A 5GAN3 1VQ4T 4ATOA 3OBWA 4M7DE 1VQNA 1MHNA 5A2QE 1H641 2KMTA 3PMTA 5GAMe 1KD1C 3ME9A 4QQDA 4JLGA 3OW2S 1VQMT 5LJ3d 4M75B 3UT1A 2PVDB 3G71T 3CCQA 2V8KA 5GMKh 4J7IA 5LJ5j 3MP1A 2DPPB 3OYLA 1NJIU 3HRSA 1VQOT 4ME7A 1B34A 5CAIA 1N27A 2K57A 3FIFA 2PU9B 4WF2A 4Y91A 1OI1A 3A8LB 4M75G 2EQUA 2WSCE 4C92E 2EWNA 2M9UA 1X75C 1KQSA 3FLGA 1XOVA 1WNLA 3OS2A 3OYJA 2VYTA 3M4YA 2HNIA 3MEWA 4FL6A 1KG1A 3G4SA 2R5MA 5I2MA 2JTFA 4FSXA 2LQKA 2JVVA 3I55A 2O4XA 3FB9A 4F7UF 2EJFA 2M0OA 4A4KA 5HK0A 4EPCA 1YI2T 5LJ5f 3FRNA 3M59A 3SB2A 4B9WA 5GAMg 4M7AF 1M1FA 3CC2T 1B34B 4C0ZA 4EDUA 4KUIA 5CCAA 2RHXA 4RCCA 2YLBA 4XTYA 2RD1A 4XQ3A 3GOXA 1QVGS 1M90U 1M9SA 3DKMA 4EMKC 3OYCA 4HA8A 1R8OB 3WVEB 1NE8A 4FU6A 4OMFB 5GANd 5FU7B 2RJDA 3VV0A 3ZBDA 4MMLA 4M7AD 2RK1A 2OTJA 5GAN2 4B9XA 3LX7A 4N4GA 1QW1A 1YCYA 5A0LA 4GY5A 5LJ5e 2C06A 2EJ9A 1OZ2A 2RI5A 3VYGA 2RHYA 4LDVA 2XDDA 3RIRA 2AHJB 1BIAA 2JZ2A 3L2ZA 3S3OA 2VGNA 2Y4YA 1AHJB 2YLCA 3N5BB 3P8DA 5D6YA 2XHCA 3GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP6 A;  5J26 A;  3C4S A;  5IN1 A;  2D9T A;  5KE2 A;  2R57 A;  4E7J A;  2LTO A;  2XK0 A;  4BDY A;  1WGS A;  3OMC A;  2XDP A;  4L59 A;  3LH0 A;  5D6W A;  4Z02 A;  3OYI A;  3H6Z A;  3MEU A;  3OYG A;  2RJE A;  3OYE A;  4C5H A;  3OYF A;  3MEV A;  2DIQ A;  2M1H A;  2RO0 A;  5C6S A;  2WAC A;  4PLL A;  3OYH A;  3P8D A;  3BDL A;  3OB9 A;  2EQM A;  4E7K A;  2HQE A;  3OYD A;  5FRO A;  3NTK A;  4ZTJ A;  3LGL A;  4RG2 A;  5M9O A;  3QII A;  2CKK A;  3QJ6 A;  3OYA A;  3FDR A;  1WJQ A;  3OA6 A;  3L42 A;  1OZ3 A;  2GFU A;  2BIV A;  2YRV A;  1WJR A;  4A4F A;  2LRQ A;  2GF7 A;  4BE1 A;  3P8H A;  1WJS A;  2X35 A;  5IAY A;  4A4E A;  5J39 A;  3OYL A;  3L2R A;  2B8A A;  4BAC A;  3S3M A;  2L89 A;  3Q1J A;  2K3X A;  3OYK A;  2K3Y A;  4N4H A;  2FHD A;  4ZTF A;  1KHC A;  3OY9 A;  2P0K A;  2EQJ A;  3EAE A;  3FEO A;  3S3N A;  1XNI A;  2G3R A;  3PNW C;  2E6N A;  4PL6 A;  1OYX A;  3E9F A;  3OS0 A;  2QQR A;  4BD3 A;  2EKO A;  2IG0 A;  2PQW A;  2RJF A;  3MET A;  2RI2 A;  1MHN A;  3DLM A;  3OS1 A;  2E5Q A;  2QQS A;  3PMT A;  3UWN A;  4QW2 A;  2X4W A;  4QQ6 A;  3OYM A;  3OYN A;  4UC4 A;  3ME9 A;  5C0M A;  4QQD A;  4QQG A;  4CRI A;  3M9Q A;  3QKJ A;  3UT1 A;  5KH6 A;  2RHZ A;  2RHU A;  4X34 A;  4IUU A;  3MP1 A;  4HCZ A;  2R5A A;  2LCC A;  3DB3 A;  2F5K A;  1RI0 A;  4OVA A;  2GFA A;  3CEY A;  1N27 A;  4PLI A;  2DAQ A;  2DIG A;  4Q5W A;  5KE3 A;  1H3Z A;  5KCH A;  4IKF A;  4II1 A;  1OI1 A;  5D6X A;  3SD4 A;  3OMG A;  4QVZ A;  2EQU A;  3PMI A;  4IUT A;  3MO8 A;  2EQK A;  3FLG A;  3OS2 A;  2X4X A;  3FC3 A;  5FRM A;  2MWP A;  2O4X B;  2VYT A;  3OYJ A;  3MEW A;  4FL6 A;  1G5V A;  4C5I A;  2R5M A;  4IUQ A;  2JTF A;  4NS5 A;  2L8D A;  4IUV A;  4E7I A;  2O4X A;  3OQ5 A;  2M16 A;  2MWO A;  2M0O A;  2HQX A;  3ASK A;  2EFI A;  3S6W A;  4A4H A;  4B9W A;  3F70 A;  4C5E A;  3MEA A;  2LDM A;  4EDU A;  4LD6 A;  3LGF A;  3ZEH A;  3H8Z A;  2RHX A;  3OYB A;  3L2V A;  3MP8 A;  3GOX A;  4E7L A;  2RJC A;  2RHI A;  3O8V A;  3OYC A;  2LVM A;  3L2U A;  3NTI A;  4E7H A;  4IUR A;  4IUP A;  2NLU A;  3KUF A;  4FU6 A;  3L2Q A;  2RI3 A;  2RJD A;  3L2W A;  3NTH A;  4N4I A;  4B9X A;  3LX7 A;  3QBY A;  4N4G A;  4GY5 A;  2BKD N;  4BE0 A;  4BDZ A;  3PFS A;  5FRN A;  4C5G A;  1OZ2 A;  2RI5 A;  3LYI A;  2RHY A;  5KCO A;  4BE2 A;  1SSF A;  3DB4 A;  3LLR A;  2X4Y A;  4A4G A;  2JZ2 A;  3S3O A;  3E9G A;  5CIU A;  2L3R A;  2R58 A;  2BUD A;  5D6Y A; 
#chains in the Genus database with same CATH topology
 3CMA Q;  1NBE B;  2H8H A;  1VIF A;  1UTI A;  5GAO n;  1WHM A;  2LJ1 A;  3A5Z B;  4Z02 A;  5IHI A;  1WZO A;  2LQN A;  1M8V A;  2YHT A;  2EQM A;  1G3S A;  1YIJ Q;  1VA7 A;  3QJ6 A;  2QI2 A;  2MOX A;  1W2B P;  1WJR A;  2V1R A;  3P8B B;  1NM7 A;  2KQW A;  3S3M A;  4XTZ A;  2V8J A;  1JJ2 A;  2V26 A;  3OSS C;  2FHD A;  1VQO Q;  2CYZ B;  1VQM A;  2DZ9 A;  4XAX B;  1RAH B;  3SEM A;  1Y96 B;  2PQW A;  2RJF A;  2RI2 A;  3DLM A;  1U3O A;  1O75 A;  1IB8 A;  2ZPB B;  2QQ9 A;  2R5A A;  1FWZ A;  5HK3 A;  1JB0 E;  1IRE B;  4M75 A;  3OMG A;  1U06 A;  4QVZ A;  4D8D A;  4IUT A;  1KD1 R;  2DET A;  4M7A G;  2GTJ A;  2DL4 A;  1M2O A;  2EPD A;  1AT1 B;  4DBH A;  2J7I A;  4NS5 A;  1YBY A;  1BCO A;  1M3A A;  1I5L A;  4WCI A;  1ABQ A;  4RTZ A;  3OYB A;  3CME T;  2DF6 A;  2DMO A;  2RJC A;  4IIO A;  4HCK A;  1VQ8 T;  1K73 U;  1MV0 B;  1X2Q A;  1MMA A;  1CKA A;  5LJ3 j;  2NUP B;  2D0Q B;  5CKD A;  4P5N A;  2EYY A;  2LNH B;  1LCK A;  4BE2 A;  3NMZ C;  5DM7 R;  3EFR A;  2GGR A;  5J26 A;  3C4S A;  2O2O A;  3EGX B;  4J8O A;  2SRC A;  1K0X A;  4OMN A;  5IXF A;  1WGS A;  2CP7 A;  2J06 A;  3M58 A;  1JJ2 S;  3HHT B;  3OYG A;  2ZPG B;  3VUZ A;  2D8H A;  1BCM A;  2WAC A;  4FYY B;  3OB9 A;  4JLI A;  5DY9 A;  2QEX A;  1BB9 A;  1BIB A;  3T9N A;  2X35 A;  3CCJ Q;  1WX6 A;  3L2R A;  2DTO A;  2JJ9 A;  1YJN A;  2YDL A;  3EH2 A;  2A28 A;  4F16 A;  4M75 E;  4LE9 A;  1KHC A;  2P0K A;  1HJD A;  3OS0 A;  3MET A;  4C8Q G;  3OW2 A;  2AKL A;  5KYW A;  2LC4 A;  2HQH A;  2VVK A;  2DZC A;  4IUU A;  4C5E A;  1VQ7 T;  3JAM E;  1YJW A;  5HKC A;  4PLI A;  4LDX A;  3HPW A;  4M4Z A;  4AMC A;  3CCM A;  5KCH A;  5GAN e;  3SD4 A;  3CME Q;  1FYN A;  1R0B G;  3UA6 A;  2EQI A;  1VQ8 Q;  2JS0 A;  3O5Z A;  1QVP A;  2KI7 A;  2HL3 A;  8ATC B;  1Q86 R;  3M0T A;  4JJB A;  3JCM h;  2HSE B;  2V1Q A;  5GAM d;  1WLP B;  1JO8 A;  1D1C A;  1VUB A;  2QDY B;  3SDZ A;  3SHW A;  4RTV A;  1OEB A;  5AYF A;  3UF4 A;  3MP8 A;  3QSU A;  5CK9 A;  1SEM A;  4A54 A;  5CKB A;  3MJX A;  3L2Q A;  3CD6 A;  3VS1 A;  3VS7 A;  3OSV A;  2VB6 A;  4J6X A;  4M78 A;  2D9T A;  1VQL A;  1V76 A;  3CCE T;  3V7R A;  4V2S A;  5GMK j;  5D6W A;  4OP0 A;  4EMG A;  4C0D C;  3MEV A;  4R0K A;  5LJ5 d;  2J6O A;  4DBF A;  4EMK B;  4RG2 A;  3QII A;  3OA6 A;  1OV3 A;  1ZX6 A;  2GFU A;  4R55 A;  4PKC C;  5ECA A;  2LRQ A;  3P8H A;  2ED0 A;  3REA B;  5LJ3 h;  1HD3 A;  1PG5 B;  1Y07 A;  1VQ7 Q;  5FW9 A;  1GCQ C;  4ZTF A;  1VQ9 A;  1BYM A;  2XD0 A;  1W70 A;  1BI2 A;  2E6N A;  4PL6 A;  1WXT A;  1TG0 A;  4M77 A;  4JRI A;  2ED1 A;  2XIC A;  2KDS A;  2QA4 T;  3M9Q A;  5HY6 A;  4BI3 A;  2YSQ A;  4X1V A;  1NEG A;  3TCJ A;  2SEM A;  1Q81 R;  2F5K A;  3CQT A;  3HP9 A;  4JJC A;  1M5Q 1;  1WA7 A;  3PGG A;  3OW2 P;  3GNG A;  4J5Y A;  1X2K A;  2YRD A;  2LMJ A;  4PFO A;  1Q81 C;  4M7D A;  2KVQ G;  2JUF A;  1NYG A;  4XTW A;  4AFQ C;  1TUC A;  1WXU A;  2K9G A;  5FU7 C;  2AZV A;  1OU9 A;  4A4H A;  1J3T A;  4PK4 A;  2HCK A;  4M78 E;  2QAS A;  1WHJ A;  2KYB A;  3JB9 H;  5FWB A;  3INZ A;  1YN8 A;  2M51 A;  3NTH A;  3CCE Q;  2QXF A;  3PT9 A;  2BKD N;  3RER A;  2DTH A;  2YT6 A;  2A36 A;  4BB7 A;  5KCO A;  3EG9 A;  1K76 A;  8AT1 B;  3QUI A;  4HXJ A;  1OPL A;  1YJ9 A;  1U8R A;  1HK9 A;  2D0N A;  4F04 B;  4OML A;  1Y0M A;  2LQ8 A;  5GAM j;  3I56 Q;  2FO0 A;  1YCS B;  3JCM P;  3OYF A;  1C6V X;  4MDX A;  1YWO A;  4HT8 A;  4PJO C;  4C0D B;  4M77 E;  2KNB B;  1KC8 U;  1BI1 A;  3QYG B;  2K5F A;  2ROL A;  2QA4 Q;  3C12 A;  2JOY A;  1ZSG A;  1PSF A;  2L3Q A;  1XNI A;  3CXC A;  5FWC A;  2EAY A;  4XU1 A;  4M7D E;  5A2Q E;  2KMT A;  2DL8 A;  1M2V A;  1VQM T;  2DX1 A;  5GMK h;  4J7I A;  2HBW A;  5LJ5 j;  2DPP B;  3OYL A;  1N27 A;  2PU9 B;  2JM9 A;  1UFF A;  4C92 E;  1H8K A;  2HMA A;  3VS5 A;  2CDT A;  1KQS A;  1XOV A;  1WNL A;  4QT7 A;  2KT1 A;  3MEW A;  3G1J A;  5I2M A;  3I55 A;  3RBB B;  2O4X A;  4HVW A;  3VS2 A;  4Y92 A;  2YUP A;  3H0H A;  1B34 B;  2X3W D;  2RQR A;  1WHH A;  4RCC A;  1JQQ A;  4HA8 A;  4JZ3 A;  4OMF B;  1M30 A;  1UHC A;  5FU7 B;  3ZBD A;  4MML A;  1YCY A;  2EJ9 A;  2RHY A;  2JXB A;  2XDD A;  3GBQ A;  2JZ2 A;  3L2Z A;  1WDX A;  2W10 A;  2P4R A;  4DQ2 A;  2ESW A;  5IN1 A;  1X01 A;  2DJZ A;  2CRE A;  2CSI A;  4OGE A;  3QWX X;  1PKS A;  4DBR A;  4Z8A A;  1SPK A;  4R56 A;  3UDC A;  4M78 F;  3TQ7 P;  2LCL A;  3JB9 G;  1I5O B;  3CBP A;  3E1S A;  2QGG A;  1U1T A;  1KFZ A;  1NJI R;  3CXC S;  3THK A;  1K73 R;  3H0I A;  4FT4 A;  1VQP Q;  4M78 D;  3QPH A;  5M9O A;  2OTJ T;  1N9S A;  1GBQ A;  1M3C A;  2D6F A;  1M1G A;  1TS9 A;  2K5L A;  1D3B A;  4KH0 B;  3CPW A;  1V29 B;  2WSE E;  4C0G A;  3M54 A;  2QEX T;  4PJO B;  3TRE A;  4GLK A;  1WYX A;  1Z9Z A;  5GAN 5;  1PRM C;  1ZLM A;  1KQS S;  3FEO A;  5A0G A;  9ATC B;  3G71 A;  1LVK A;  1YJN T;  1SRM A;  1PD0 A;  1QMC A;  2F1L A;  4E47 A;  1WPY A;  2F2X A;  3CPF A;  1HYO A;  3CC7 A;  1ZSZ C;  2IIM A;  3JRZ A;  5GAM h;  3HFN A;  5KE3 A;  1OOT A;  2NYS A;  5A0D A;  1QWE A;  3BDU A;  5D6X A;  4IKF A;  2EYW A;  4F7U G;  2C0O A;  4XU0 A;  3KBG A;  4MZM A;  1PWT A;  3JCM e;  3CC2 A;  2A3L A;  2RN8 A;  4C5I A;  3CCM T;  4ZGE B;  4M77 D;  4XU3 A;  3CCQ Q;  4DOV A;  1QCF A;  1MMG A;  1UG1 A;  1UJY A;  2O9V A;  1PKT A;  1KHI A;  3M53 A;  4M7D F;  1YWP A;  4JRK A;  1QP2 A;  1IO6 A;  5CKE A;  2G6F X;  2GCX A;  1C1A A;  1UGS B;  4QVC A;  4M7D D;  2EVR A;  4JS4 A;  1D0X A;  4C92 F;  4DEY A;  3CD6 T;  1WQ7 A;  4J9D A;  5LJ5 h;  1NZ9 A;  2ABL A;  1G83 A;  4CC3 A;  3CCL A;  3QZ9 B;  4E7J A;  2OTJ Q;  4X9C A;  4BI8 B;  4C92 D;  1N6A A;  2LT1 A;  3LH0 A;  3OYI A;  2LNV A;  4LXC A;  1U1S A;  2FVU A;  2FYK A;  1W4S A;  2COW A;  2CT4 A;  4RG8 A;  1W2B S;  1SKU B;  2CP2 A;  3I5S A;  1VQ5 Q;  2FL7 A;  3RKY A;  4ZTJ A;  2CZ7 B;  5LJ3 e;  3NHN A;  2JMC A;  1NLP C;  5L23 A;  3J80 E;  2XDB A;  2YWW A;  2QG9 B;  4MZP A;  3A8H B;  3QJY A;  4PFP A;  4ZN1 A;  1N8R U;  1W1F A;  2CZ1 B;  3I5R A;  5GAN f;  1Q95 G;  2LQW A;  2QQB A;  5LJ5 g;  1SRL A;  5EG2 A;  1VQ9 T;  4UC4 A;  1BK2 A;  3CPW P;  4KRT A;  3CCM Q;  4C8Q C;  1YIT T;  4JPB W;  2RHU A;  3V7C A;  3PIO A;  1W6X A;  2DIG A;  2LX9 A;  1H3Z A;  2VC8 A;  1JEG A;  3MO8 A;  5CKH A;  2E4H A;  1ZSZ B;  6AT1 B;  3M0U A;  1NEB A;  4ELY C;  4E7I A;  2RK2 A;  3QXE B;  4OB1 B;  4EMH A;  2OTL A;  3HSB A;  3ZEH A;  3L2V A;  3CD6 Q;  1HXD A;  1WQW A;  2ZZD A;  2K79 A;  4M7A B;  1U5S A;  5AT1 B;  2IPO B;  2CP5 A;  2CZ0 B;  3HTR A;  1RAC B;  2OX7 A;  3V7S A;  2P84 A;  3FC3 A;  5GMK m;  5GAN 6;  2P4T A;  4EMK A;  2R57 A;  3PIP A;  1PM3 A;  2CP0 A;  3CBO A;  3GIB A;  1JBM A;  2W0Z A;  2YXY A;  3CCS Q;  1YJ9 T;  2VUB A;  3KFV A;  3C95 A;  3EGD A;  2RJE A;  4E2F B;  1QVF A;  3VKI A;  4NL2 A;  2AKK A;  2VXF A;  3JCM J;  1WHG A;  1YIT Q;  2KYM A;  2QTX A;  3Q1J A;  3RNJ A;  2DA9 A;  2JN0 A;  4M75 C;  3S3N A;  1X27 A;  2PUO B;  1FXX A;  1UGP B;  4JRP A;  1UEB A;  3KXT A;  1QLY A;  5GMK e;  2X3X D;  5C0M A;  1RI9 A;  4QQG A;  4CRI A;  1K8A U;  3CC4 A;  3A8G B;  2NUT B;  3BW1 A;  5KH6 A;  1OPK A;  1K1Z A;  4RTY A;  2DK3 A;  1PHT A;  2E41 A;  5GJV B;  1V1C A;  4BI4 A;  1SHF A;  2GBQ A;  1H92 A;  4C8Q B;  1SHG A;  1Y71 A;  3A98 A;  1SG5 A;  3JB9 J;  5KYU B;  4IUQ A;  3BE3 A;  3IQL A;  4CC4 B;  5FLX E;  1KC8 C;  3LW5 E;  4ELZ C;  2I2L A;  3MEA A;  2K2V A;  4J9E A;  3I55 T;  5D7U A;  1GBR A;  2KRM A;  3A8O B;  3O8V A;  1I8F A;  1I1J A;  1OX9 A;  2F69 A;  3HRT A;  4HKE A;  4ZGJ B;  1AOJ A;  2MCN A;  1YJ9 Q;  3QBY A;  4OB3 B;  5FRN A;  1B07 A;  2KT8 A;  2RNA A;  3E19 A;  1B3Q A;  2HSP A;  2BE7 D;  2R58 A;  3GF5 A;  4PJM A;  3HL8 A;  4Y28 E;  2HZY A;  2O88 A;  2LX7 A;  3EFO B;  2CH4 W;  2LTO A;  2XK0 A;  3VS3 A;  4AFU C;  3TEE A;  3GPL A;  2CH4 A;  2P0P A;  4XTU A;  3X25 B;  2KXD A;  3I9Q A;  4QKU A;  1IGQ A;  2QGF B;  2L2P A;  2RO0 A;  2A7Y A;  5C6S A;  1VQO A;  2VGM A;  2K3B A;  2FRW A;  4J9F A;  3UPU A;  4N0A C;  1VOM A;  2E6Z A;  4DOW A;  1LNX A;  4A4F A;  2RA2 A;  5IAY A;  2DL3 A;  2L3P A;  2KE9 A;  3AT1 B;  2VKN A;  1VQK A;  1ZHI A;  2EKH A;  1O9S A;  2D8J A;  2ZPF B;  1QVF P;  3M55 A;  3SWN A;  3PNW C;  2NWM A;  2QAZ A;  4OGC A;  4D8K A;  4BD3 A;  2OAW A;  3OBW A;  1VQN A;  1H64 1;  3PMT A;  3TVT A;  5GAM e;  3ME9 A;  4JLG A;  3OW2 S;  2KRO A;  4M75 B;  4IIM A;  3UT1 A;  3G71 T;  1FMK A;  1B34 A;  1AWW A;  1M8M A;  2KR3 A;  4WF2 A;  1OI1 A;  3A8L B;  4M75 G;  1EFN A;  4AFZ C;  1EZZ B;  2WSC E;  1D1A A;  2EWN A;  3I55 Q;  1X75 C;  3OS2 A;  4E7S A;  1KSW A;  2O31 A;  1PC0 A;  3FB9 A;  1UJ0 A;  4B9W A;  2YUN A;  3VS6 A;  3CC2 T;  4C0Z A;  4EDU A;  5CCA A;  1LPL A;  2PZ1 A;  4FU6 A;  2E3H A;  4JZ4 A;  1MMN A;  2RK1 A;  3LX7 A;  1OX8 A;  1QW1 A;  4N4G A;  5A0L A;  3MKD A;  4GY5 A;  5LJ5 e;  1PNJ A;  2RI5 A;  5KYY A;  4GLM A;  3S3O A;  2VGN A;  2YLC A;  1NG2 A;  3P8D A;  3N5B B;  4RTW A;  2J6K A;  5HK0 A;  1KD1 U;  2RPN A;  1NLO C;  3G4S T;  2K5I A;  2VV5 A;  2KAF A;  2BZX A;  5CQY A;  4C92 A;  3BFM A;  5GAO p;  2ZPI B;  3CCJ A;  1ZA1 B;  4PJO A;  4RKU E;  2DXT A;  1AWO A;  2HL5 C;  3EG0 A;  2DYI A;  3NTK A;  4OMP A;  4PNO A;  5I11 A;  3EGU A;  4M77 C;  4ANJ A;  2JNG A;  2K4Y A;  2PVO B;  4BAC A;  4J6Y A;  3TSZ A;  3G71 Q;  1VQ4 A;  3C94 A;  2RH2 A;  3JCM V;  2HKN A;  4KT0 E;  2EQJ A;  2WSF E;  2G3R A;  1ACM B;  1OYX A;  3FJ5 A;  1KIK A;  2FPF A;  3OYM A;  2QQS A;  4QW2 A;  2X4W A;  2AZS A;  2CP6 A;  5CO7 A;  3JCM f;  2JM8 A;  4LNP A;  1M4Z A;  2E12 A;  3REB B;  1MGQ A;  5IT9 E;  1Q7Y U;  3JCM b;  4VUB A;  3CC2 Q;  2DEQ A;  4DEX A;  3PMI A;  2EQK A;  1YI2 A;  1M1K U;  1WIE A;  4KGZ B;  3DLL A;  4OB0 B;  2QQA A;  3M56 A;  2E10 A;  3OQ5 A;  1Q82 U;  3NFC A;  2HQX A;  1T3L A;  1X6B A;  4KUD K;  3LWI A;  1SF9 A;  4DA4 A;  4LD6 A;  3H8Z A;  2JTM A;  4E6R A;  3RMS A;  4E7L A;  2RHI A;  2E5K A;  3PVQ A;  4XK8 E;  3TU4 K;  3KUF A;  3GP8 A;  2OTL T;  1XJW B;  2DRM A;  5KYN A;  3G4S Q;  1N8R C;  3L2W A;  2E64 A;  2QYZ A;  2VAS A;  4YTL A;  2JTE A;  2MPX C;  4BE0 A;  3CCR A;  4C5G A;  4PJO E;  1SSF A;  3BY7 A;  1X69 A;  4M78 G;  1VYT A;  2DIL A;  2DRK A;  2E65 A;  1S1N A;  1Q86 U;  3U23 A;  5LJ3 f;  3VS0 A;  1K9M U;  3X20 B;  3ZFJ A;  1WFW A;  3E2U A;  3RKX A;  5IHK A;  3OYE A;  1TWB A;  1GL5 A;  4OB2 B;  2L3S A;  4ESR A;  5KYX B;  4PLL A;  5GAO m;  1MND A;  4J6W A;  1BI3 A;  3QHS A;  4OMM A;  2O01 E;  4HVU A;  2GF7 A;  5J3B A;  3HKS A;  5GAN 8;  3OYK A;  2DD5 A;  1C0M A;  3EFS A;  4XTX A;  4RTU A;  4M77 B;  4Z89 A;  2YUO A;  3QO3 A;  2IG0 A;  2MYS A;  2JW4 A;  3UWN A;  3OYN A;  4M77 G;  2C0T A;  4QVD A;  1UB4 A;  1Y96 A;  3D7S B;  2P0Q A;  1VQ6 A;  3J7A F;  1ZBX A;  4LD9 K;  1UE9 A;  4HCZ A;  1FMV A;  3CEY A;  1ARK A;  2LZ6 B;  1VQM Q;  1NPP A;  1RAF B;  3CC4 T;  2L5Q A;  4M7A A;  2RQV A;  3RES A;  4J9C A;  2X4X A;  5GMK l;  2NUZ A;  2OTL Q;  2EJG A;  4M7D G;  2LP5 A;  4AFS C;  1I0C A;  2X4J A;  3CCE A;  2XMF A;  3FJP A;  4FW2 A;  2MWO A;  3ASK A;  3S6W A;  1CKB A;  2AT1 B;  2MI6 A;  5L8R E;  1LJO A;  2KBT A;  4A63 B;  1TUD A;  1IZ6 A;  4F7U B;  4EIK A;  5GAN 4;  2LVM A;  3L2U A;  3NTI A;  3OYY A;  2NLU A;  4RTT A;  4FM4 B;  4C92 G;  4J83 A;  5IHN A;  1P92 A;  4LDW A;  2XI9 A;  1AZE A;  1YJW T;  2FRY A;  2PVG B;  2RQW A;  1RAA B;  3I56 A;  4DBQ A;  2NUP A;  3LYI A;  1AZG B;  1R0C B;  1K8A C;  1D1B A;  1RAE B;  3E9G A;  1XQH A;  3WVD B;  4RTX A;  3CCU A;  4HCC A;  1YHQ A;  3GNF B;  3R6O A;  3EGX A;  4FT2 A;  2VWF A;  3X28 B;  3H6Z A;  2HAX A;  1GFC A;  2M1H A;  3C0C A;  3URG A;  2F2V A;  5FRO A;  4CC2 A;  4ZN3 A;  3LGL A;  4NL3 A;  1QQJ A;  3LH5 A;  2PTK A;  4PJO F;  2DM1 A;  3HRU A;  5J39 A;  1A0N B;  1OU8 A;  4PJJ A;  3M57 A;  2EYQ A;  2DVE A;  4HT9 A;  3MHX A;  2K3X A;  3NPF A;  3CPW S;  2HBP A;  3PVL A;  4JRQ A;  2L0A A;  1VQL T;  2MK5 A;  3OY9 A;  4PJO D;  1T3S A;  4M7A E;  3E9F A;  4FYX B;  4C8Q A;  2QQR A;  2QEX Q;  1VQK T;  2A0F B;  3UAT A;  2E5Q A;  1OQK A;  5KYU A;  1AEY A;  5HCK A;  1YJN Q;  3QKJ A;  4TVR A;  3L1A A;  4J9G A;  1LOJ A;  4X34 A;  4OF1 A;  3HFO A;  1VQN T;  4Q5W A;  2DAQ A;  1I81 A;  1IXD A;  1UHF A;  1XTD A;  4BUG A;  1T0H A;  1UGR B;  3ZL7 C;  1KQ1 A;  2A08 A;  5FRM A;  2O4X B;  4O6J A;  2KSS A;  1RAD B;  2L8D A;  5GMK i;  2XKO C;  1YJW Q;  1BKB A;  2DJQ A;  1ZBJ A;  2FB7 A;  2DLP A;  1E6G A;  1TH7 A;  4HVV A;  2KEA A;  3EFO A;  2DBK A;  4IUP A;  5LL6 S;  1RLP C;  4MDW A;  4KH1 B;  3CCV A;  4BDZ A;  5EC7 A;  1QVG P;  2ECZ A;  1UEC A;  2X4Y A;  1MUZ A;  2RQU A;  2K6D A;  1KQ2 A;  2MAM A;  5KE2 A;  1VQP A;  2DER A;  3A8M B;  2COZ A;  1VIE A;  1SSH A;  7AT1 B;  3M0P A;  4ZGD B;  3JCM Q;  3H9N A;  1X6O A;  2RMO A;  4RUG A;  5FU6 C;  4AT1 B;  2HD0 A;  2CUD A;  3OYH A;  1K9A A;  2RB6 A;  1VQL Q;  3G7Z A;  1PD1 A;  2CSQ A;  3CCJ T;  1D3B B;  4C8Q E;  2D1X A;  1VQK Q;  3L42 A;  2VXE A;  2AIR B;  1WI7 A;  5GAM f;  5DLQ E;  1K4U S;  1F1B B;  3ER0 A;  1VQN Q;  3NGP A;  3G6E A;  2E3I A;  2I0N A;  3OBY A;  1H3H A;  4NOY A;  4D6W A;  2DEU A;  2BZ8 A;  5GAN 3;  1VQ4 T;  1MHN A;  1KD1 C;  1E7O A;  2DYB A;  1GRI A;  4AG1 C;  3CCQ A;  2X9H A;  1NJI U;  3MPU B;  4ME7 A;  1VQ9 Q;  5CAI A;  2K57 A;  4Y91 A;  2EQU A;  2M9U A;  3EG3 A;  3FLG A;  2DNU A;  4KGV B;  2VYT A;  2KXC A;  2CP3 A;  2JTF A;  2LQK A;  2M0O A;  1YI2 T;  5LJ5 f;  3FRN A;  3M59 A;  3SB2 A;  1CSK A;  4M7A F;  1M1F A;  1TU0 B;  4JJD A;  2YLB A;  1M90 U;  2RD1 A;  4OMO A;  4XQ3 A;  2EGE A;  4EMK C;  2GQI A;  2ROT A;  5GAN d;  4M7A D;  2OTJ A;  3A1P A;  1JXM A;  5GAN 2;  1KC8 R;  4B9X A;  2HDA A;  1Q7Y R;  2C06 A;  2HEQ A;  1OZ2 A;  1D0Y A;  2AHJ B;  5IH2 A;  2Y4Y A;  5D6Y A;  1VQ5 A;  3GLX A;  4KBM B;  1Q7Y C;  1M1K R;  3JCM c;  3CCR T;  4RMO A;  4PFZ A;  3QWY A;  1S72 A;  4BDY A;  1Q82 R;  2LJ3 A;  3CMA A;  2ZPH B;  3EH1 A;  1M1K C;  4N0A A;  4PJL A;  2EGA A;  4FSS A;  1Q82 C;  2DE0 X;  1BU1 A;  4A53 A;  4BY6 C;  1JJ2 P;  2CKK A;  2DL7 A;  1QVF S;  1VQ4 Q;  3EHQ A;  2BIV A;  2H3J A;  1RL2 A;  4JDS A;  4WTO B;  4E7Z A;  1YIJ A;  5FU6 B;  4J7F A;  2JS2 A;  2ZPE B;  2L89 A;  2XG8 D;  4K11 A;  1RUW A;  2K3Y A;  1PRL C;  1RAB B;  2RF0 A;  1ZQ1 A;  2FZC B;  1RAG B;  4FCY A;  2JT4 A;  1K9M R;  2EKO A;  3RDV A;  1KK7 A;  2Y90 A;  3QYH B;  1R77 A;  1UUE A;  2DFU A;  2X51 A;  2EYZ A;  1Q86 C;  2LCC A;  1K9M C;  1RI0 A;  2GFA A;  1YI2 Q;  1GCQ A;  2DTI A;  4C8Q F;  4F14 A;  3VRZ A;  4ZNX A;  3ULR B;  4J9H A;  1VQ6 T;  1QKW A;  3PTA A;  2DVJ A;  1BI0 A;  3JCM W;  2H3E B;  2MWP A;  4C8Q D;  1GFD A;  1RAI B;  3M0S A;  2EFI A;  5I21 A;  2OI3 A;  3F70 A;  2MMP A;  1NPR A;  2EIF A;  3QG1 A;  2KRN A;  3RR6 A;  3VUB A;  2CUB A;  2CZ6 B;  5I22 A;  5GAO l;  1X43 A;  3V8J A;  4E7H A;  3CCR Q;  3CC7 T;  3LWH A;  3CCS A;  1QP3 A;  2F5T X;  1QCN A;  4FW1 A;  2FPE A;  3JCM g;  2GQV A;  4PJN A;  3DB4 A;  5KYX A;  1YP5 A;  2RQT A;  3MP6 A;  2EYX A;  4GBQ A;  4XTV A;  3I56 T;  1I4K 1;  1X6G A;  4M78 C;  3EGD B;  1RLQ C;  4L6V 5;  4F17 A;  2F2W A;  2CT3 A;  1DJ7 B;  3OMC A;  2XDP A;  4L59 A;  1AWX A;  3VYH B;  3MEU A;  4LUE A;  2QDL A;  4C5H A;  2A37 A;  3CCU T;  4CI0 C;  1YIT A;  2KK4 A;  2DIQ A;  2KY9 A;  1YHQ T;  1GXI E;  3EG1 A;  3PE0 A;  1M3B A;  1MMD A;  3BDL A;  2ATC B;  1Y57 A;  2K2M A;  2LJ0 A;  3SWN C;  5GAN j;  4LUD A;  3OYA A;  2B86 A;  2FG0 A;  4ORZ A;  4L5G A;  3WXM B;  2DXU A;  2Z0W A;  3VU3 C;  4JUV A;  2LCS A;  4BY6 B;  1Y7X A;  3AHU A;  3TSW A;  3CCL T;  1VQ6 Q;  5GAN 7;  3V8L A;  5GAO r;  4M75 F;  4LDU A;  3OS1 A;  1G2B A;  1D09 B;  5GAO q;  3QZ5 B;  2ZGW A;  4MZT A;  2RHZ A;  2C0I A;  1E6H A;  5LJ3 g;  3DB3 A;  4OVA A;  4M75 D;  1PSE A;  4F7U A;  5CQX A;  3CBM A;  2FPD A;  1ABO A;  1TTH B;  1G5V A;  3VJP A;  1IRX A;  3CME A;  5KYW B;  1QKX A;  3CC7 Q;  2M16 A;  4M7D C;  3SFM A;  1VQ8 A;  1ZUY A;  1N5Z A;  1T0J A;  3LGF A;  3EHR A;  1PCX A;  2ENM A;  2IVW A;  2MF2 A;  3RKW A;  1G3Y A;  2EW3 A;  2E1H A;  4IUR A;  4O5V A;  4HCB A;  2DKG A;  4N4I A;  4C92 C;  2COY A;  4J9I A;  1WHK A;  5CR2 A;  1BBZ A;  3CCU Q;  1YHQ Q;  1JU5 C;  5CIU A;  2L3R A;  2BUD A;  2ZCF B;  3CCV T;  1N8R R;  2M02 A;  2AK5 A;  1ZUK A;  2K7A A;  2YUQ A;  2JMA A;  2XID A;  4OMQ A;  3R6N A;  1VQP T;  3EG2 A;  2FZK B;  4LDY A;  4JS5 A;  3RUX A;  2DL5 A;  4M78 B;  2FZG B;  3X26 B;  2HQE A;  3M5A A;  3CCL Q;  4J9B A;  1JXO A;  1UGQ B;  3UA7 A;  3FDR A;  3JV3 A;  2KGT A;  2YRV A;  1Z9Q A;  1G3T A;  2HKQ B;  1WJS A;  3V8K A;  4A4E A;  1MV3 A;  2B8A A;  3M0R A;  3SWN B;  1AWJ A;  2MIO A;  4N4H A;  3JSC A;  4F7U E;  1KJW A;  2FEI A;  1JRI A;  5DLO A;  4RCB A;  2BE9 B;  1VQ7 A;  4QQ6 A;  3G6E T;  1B7T A;  2M0Y A;  1UDL A;  2V8I A;  1N9R A;  2GNC A;  4II1 A;  3J81 E;  3CCQ T;  2XU8 A;  5GAN h;  5I2S A;  1TXQ A;  4IUV A;  1ZSZ A;  2RM4 A;  2CGH A;  3M4G A;  4LN2 A;  1HSQ A;  4FIB A;  4FYW B;  3M0Q A;  4KGX B;  2LDM A;  3I35 A;  3JCM X;  3RMQ A;  1AVZ C;  3H41 A;  3CCV Q;  1M27 C;  2DO3 A;  1I07 A;  2DBM A;  2RI3 A;  4JJN K;  2DXC A;  4M7D B;  2YRC A;  2CS7 A;  5KYY B;  1EX4 A;  4XU2 A;  1TOV A;  1YFN A;  2QK0 A;  3JCM d;  1ZUU A;  2GTO A;  3PFS A;  1WHL A;  3VRY A;  3VS4 A;  1TUG B;  3LLR A;  3OS5 A;  5CVI A;  4A4G A;  1WXB A;  2LT4 A;  3QDR B;  5IXB A;  1GCP A;  1NJI C;  1QVG A;  4C92 B;  2J05 A;  1K73 C;  3QDF A;  1VQ5 T;  1W2B A;  2PNI A;  1K8A R;  1QCO A;  5GAN g;  2Y4X A;  1M90 R;  3EG9 B;  4PJO G;  1S72 T;  2BTT A;  4KUL A;  1Q81 U;  3CMA T;  4E7K A;  1YNZ A;  3OYD A;  2E70 A;  3JB9 F;  1WJQ A;  1M90 C;  1OZ3 A;  2ZAE A;  4BE1 A;  1FX7 A;  2OAU A;  2DXB A;  4FYV B;  4MMK A;  3G6E Q;  3CXC P;  2PUK B;  3JB9 I;  4M77 F;  1EIF A;  2DD4 A;  3JB9 D;  1G3W A;  4C0F A;  1ZA2 B;  2J6F A;  1VYV A;  3EAE A;  5CKF A;  2QA4 A;  1YIJ T;  4CC7 A;  2O9S A;  3X24 B;  1QWF A;  3H0F A;  3MCA B;  4M7A C;  1MNE A;  4ATO A;  1NYF A;  2EBP A;  4Z88 A;  1G8X A;  4QQD A;  1IHV A;  5LJ3 d;  2PVD B;  1KQS P;  2V8K A;  3MP1 A;  3HRS A;  1VQO T;  1K0S A;  3FIF A;  2NUT A;  1AD5 A;  1IHW A;  2OJ2 A;  3OYJ A;  3M4Y A;  2HNI A;  4FL6 A;  1KG1 A;  1M2V B;  3G4S A;  2R5M A;  4FSX A;  3CC4 Q;  1OUL A;  2JVV A;  1D0Z A;  4F7U F;  2EJF A;  4A4K A;  4EPC A;  4AG2 C;  5GAM g;  4KUI A;  2RHX A;  4XTY A;  1QVG S;  3GOX A;  1M9S A;  5GJW B;  3DKM A;  3OYC A;  1R8O B;  3WVE B;  1NE8 A;  1TSF A;  1VYU A;  3VV0 A;  2RJD A;  2KRS A;  1FMW A;  4B6M A;  1IGU A;  2BZY A;  3VYG A;  4LDV A;  3RIR A;  1UGV A;  1BIA A;  2EGC A;  1AHJ B;  4X9D A;  3CCS T;  1S72 Q;  2XHC A;  2QTV A; 
#chains in the Genus database with same CATH homology
 4KBM B;  1Q7Y C;  5IN1 A;  1X01 A;  2DJZ A;  3JCM c;  3CCR T;  4RMO A;  1VIF A;  3G4S T;  4OGE A;  2K5I A;  2VV5 A;  5GAO n;  2KAF A;  4R56 A;  5CQY A;  1S72 A;  3UDC A;  4BDY A;  4C92 A;  3A5Z B;  3BFM A;  4Z02 A;  2ZPH B;  4M78 F;  3CMA A;  5GAO p;  3OYI A;  2ZPI B;  2LCL A;  3JB9 G;  3CCJ A;  3E1S A;  3CBP A;  1M1K C;  1U1T A;  4PJO A;  1M8V A;  4N0A A;  2YHT A;  4RKU E;  3CXC S;  2DXT A;  1Q82 C;  2EQM A;  4FT4 A;  1G3S A;  4A53 A;  4M78 D;  3NTK A;  3QPH A;  4BY6 C;  5M9O A;  2OTJ T;  1N9S A;  2CKK A;  3QJ6 A;  2QI2 A;  4PNO A;  1QVF S;  4M77 C;  2D6F A;  2BIV A;  2H3J A;  1M1G A;  2K5L A;  1RL2 A;  1D3B A;  1WJR A;  2K4Y A;  2JNG A;  4JDS A;  1YIJ A;  5FU6 B;  2PVO B;  3P8B B;  4J7F A;  2KQW A;  4BAC A;  4XTZ A;  2ZPE B;  2L89 A;  3CPW A;  4J6Y A;  2XG8 D;  3S3M A;  2V8J A;  1V29 B;  1VQ4 A;  1JJ2 A;  2WSE E;  3C94 A;  3M54 A;  4C0G A;  2QEX T;  3TRE A;  2K3Y A;  4GLK A;  4PJO B;  5GAN 5;  3OSS C;  2FHD A;  2RH2 A;  3JCM V;  2CYZ B;  4KT0 E;  2EQJ A;  3FEO A;  2WSF E;  5A0G A;  1KQS S;  1VQM A;  2G3R A;  1ZQ1 A;  2DZ9 A;  4XAX B;  3G71 A;  1YJN T;  1OYX A;  1Y96 B;  2EKO A;  2PQW A;  2RJF A;  2RI2 A;  3DLM A;  4E47 A;  3OYM A;  2QQS A;  4QW2 A;  2X4W A;  5CO7 A;  1WPY A;  2Y90 A;  3QYH B;  3CPF A;  3JCM f;  3CC7 A;  1M4Z A;  2E12 A;  1MGQ A;  1O75 A;  3JRZ A;  2ZPB B;  5IT9 E;  2QQ9 A;  5GAM h;  3HFN A;  1Q7Y U;  2R5A A;  2LCC A;  1Q86 C;  1K9M C;  1RI0 A;  1FWZ A;  2GFA A;  1JB0 E;  5KE3 A;  5HK3 A;  1IRE B;  2DTI A;  4M75 A;  4C8Q F;  4VUB A;  3JCM b;  2DEQ A;  5A0D A;  3BDU A;  5D6X A;  4IKF A;  3OMG A;  1VQ6 T;  4QVZ A;  4F7U G;  3PTA A;  3PMI A;  1BI0 A;  4IUT A;  4XU0 A;  3KBG A;  3JCM W;  2EQK A;  4MZM A;  1YI2 A;  4M7A G;  3JCM e;  2MWP A;  1M1K U;  3CC2 A;  2A3L A;  3DLL A;  4C5I A;  4OB0 B;  4C8Q D;  3CCM T;  4ZGE B;  4NS5 A;  2QQA A;  3M56 A;  2E10 A;  1YBY A;  4M77 D;  4XU3 A;  1I5L A;  3OQ5 A;  1Q82 U;  3NFC A;  4DOV A;  2HQX A;  2EFI A;  5I21 A;  4KUD K;  3F70 A;  3LWI A;  4DA4 A;  2MMP A;  3OYB A;  1NPR A;  2EIF A;  1KHI A;  3H8Z A;  2JTM A;  3M53 A;  3QG1 A;  4LD6 A;  3VUB A;  3RMS A;  3CME T;  4E7L A;  2RJC A;  4M7D F;  2RHI A;  2CZ6 B;  4JRK A;  5GAO l;  1QP2 A;  3V8J A;  4XK8 E;  3TU4 K;  1K73 U;  4E7H A;  1VQ8 T;  3KUF A;  3GP8 A;  2OTL T;  1N8R C;  5CKE A;  2GCX A;  3L2W A;  2E64 A;  5LJ3 j;  3CC7 T;  1UGS B;  2D0Q B;  5CKD A;  4YTL A;  3LWH A;  1QP3 A;  2F5T X;  4P5N A;  4QVC A;  3CCS A;  4M7D D;  4BE0 A;  4JS4 A;  3CCR A;  4C5G A;  3JCM g;  2GQV A;  4BE2 A;  4PJO E;  1SSF A;  3BY7 A;  3DB4 A;  4C92 F;  5DM7 R;  3CD6 T;  1WQ7 A;  5LJ5 h;  4M78 G;  3EFR A;  1NZ9 A;  3MP6 A;  5J26 A;  3C4S A;  4XTV A;  3I56 T;  3QZ9 B;  3CCL A;  1I4K 1;  4M78 C;  4J8O A;  2E65 A;  4E7J A;  4L6V 5;  4X9C A;  4BI8 B;  1Q86 U;  5LJ3 f;  4C92 D;  1K9M U;  1DJ7 B;  1WGS A;  1N6A A;  2LT1 A;  2XDP A;  3LH0 A;  3OMC A;  4L59 A;  3X20 B;  2LNV A;  3RKX A;  3VYH B;  3M58 A;  3MEU A;  3HHT B;  1U1S A;  3OYG A;  2ZPG B;  2FVU A;  2FYK A;  1W4S A;  3VUZ A;  4C5H A;  3OYE A;  4RG8 A;  3CCU T;  1W2B S;  4CI0 C;  4OB2 B;  2KK4 A;  2DIQ A;  2KY9 A;  1YHQ T;  1YIT A;  1GXI E;  2WAC A;  4PLL A;  5GAO m;  3BDL A;  3OB9 A;  3SWN C;  4JLI A;  5GAN j;  2FL7 A;  3RKY A;  4ZTJ A;  4J6W A;  1BI3 A;  2CZ7 B;  3QHS A;  5LJ3 e;  3OYA A;  5DY9 A;  2QEX A;  2O01 E;  4L5G A;  3WXM B;  1BIB A;  2DXU A;  2GF7 A;  3T9N A;  3J80 E;  2X35 A;  5J3B A;  3HKS A;  3L2R A;  2DTO A;  3VU3 C;  1YJN A;  2XDB A;  4JUV A;  5GAN 8;  1VQ5 A;  3OYK A;  4M75 E;  4MZP A;  2DD5 A;  4BY6 B;  1Y7X A;  3A8H B;  3QJY A;  3AHU A;  1KHC A;  3EFS A;  2P0K A;  4XTX A;  4ZN1 A;  3CCL T;  1N8R U;  4M77 B;  2CZ1 B;  5GAN f;  5GAN 7;  3V8L A;  3OS0 A;  5GAO r;  3QO3 A;  2QQB A;  4M75 F;  2IG0 A;  3MET A;  4LDU A;  4C8Q G;  3OS1 A;  5LJ5 g;  3UWN A;  3OYN A;  3OW2 A;  5GAO q;  5EG2 A;  3QZ5 B;  1VQ9 T;  4M77 G;  2LC4 A;  4UC4 A;  4QVD A;  1UB4 A;  1Y96 A;  3J7A F;  2P0Q A;  1VQ6 A;  2ZGW A;  4C8Q C;  4MZT A;  1YIT T;  1ZBX A;  4LD9 K;  2RHZ A;  2RHU A;  5LJ3 g;  2DZC A;  4IUU A;  4HCZ A;  3V7C A;  3DB3 A;  4C5E A;  4OVA A;  4PLI A;  5HKC A;  3JAM E;  4M75 D;  3CEY A;  3PIO A;  1YJW A;  2LX9 A;  2DIG A;  3HPW A;  4LDX A;  3CCM A;  1PSE A;  4F7U A;  5GAN e;  1NPP A;  3SD4 A;  5KCH A;  5CQX A;  2VC8 A;  1H3Z A;  3CC4 T;  2L5Q A;  3CBM A;  4M7A A;  3MO8 A;  5CKH A;  3RES A;  2X4X A;  5GMK l;  1G5V A;  2EJG A;  1QVP A;  3VJP A;  4M7D G;  3CME A;  2X4J A;  4ELY C;  3CCE A;  3FJP A;  4E7I A;  2RK2 A;  3JCM h;  2M16 A;  2MWO A;  3ASK A;  3SFM A;  3ZFJ A;  3S6W A;  5GAM d;  1VQ8 A;  3QXE B;  4M7D C;  2MI6 A;  5L8R E;  4OB1 B;  4EMH A;  1VUB A;  2OTL A;  1LJO A;  2QDY B;  3SDZ A;  3HSB A;  3LGF A;  3ZEH A;  3L2V A;  1IZ6 A;  5AYF A;  1HXD A;  1WQW A;  2MF2 A;  2IVW A;  3MP8 A;  3RKW A;  1G3Y A;  4F7U B;  5CK9 A;  3QSU A;  2E1H A;  2ZZD A;  4A54 A;  5GAN 4;  4M7A B;  2LVM A;  5CKB A;  3NTI A;  3OYY A;  4IUR A;  4O5V A;  2NLU A;  3L2U A;  4HCB A;  4FM4 B;  4C92 G;  3L2Q A;  4J83 A;  2DKG A;  3CD6 A;  4N4I A;  2CZ0 B;  1P92 A;  4LDW A;  2XI9 A;  3OSV A;  3V7S A;  4C92 C;  4X9D A;  1YJW T;  2PVG B;  3I56 A;  3LYI A;  5CR2 A;  4J6X A;  4M78 A;  1K8A C;  3E9G A;  5CIU A;  2L3R A;  1XQH A;  3WVD B;  2BUD A;  3FC3 A;  2ZCF B;  5GMK m;  3CCV T;  5GAN 6;  2P4T A;  2D9T A;  4EMK A;  2R57 A;  1VQL A;  3PIP A;  3CCU A;  4HCC A;  3CBO A;  1YHQ A;  3GNF B;  3R6O A;  3CCE T;  1JBM A;  3GIB A;  3V7R A;  4V2S A;  1YJ9 T;  2VUB A;  4FT2 A;  5D6W A;  4OP0 A;  5GMK j;  4EMG A;  3C95 A;  3X28 B;  3H6Z A;  4C0D C;  2XID A;  2RJE A;  1VQP T;  4LDY A;  4JS5 A;  3RUX A;  2HAX A;  3MEV A;  2M1H A;  4M78 B;  5LJ5 d;  3URG A;  3X26 B;  2HQE A;  3M5A A;  5FRO A;  4ZN3 A;  3LGL A;  4EMK B;  4NL3 A;  1QVF A;  1KD1 U;  4RG2 A;  1UGQ B;  3VKI A;  3QII A;  3FDR A;  4NL2 A;  2VXF A;  3OA6 A;  3JCM J;  2GFU A;  2YRV A;  4R55 A;  4PKC C;  4PJO F;  2LRQ A;  1G3T A;  3HRU A;  3P8H A;  1WJS A;  3V8K A;  4A4E A;  5J39 A;  2B8A A;  5LJ3 h;  3M57 A;  2QTX A;  3Q1J A;  2EYQ A;  2DVE A;  3SWN B;  3MHX A;  2K3X A;  3CPW S;  4HT9 A;  1Y07 A;  2HBP A;  2JN0 A;  4N4H A;  4JRQ A;  4ZTF A;  3JSC A;  4F7U E;  4M75 C;  1VQ9 A;  1VQL T;  3S3N A;  3OY9 A;  1BYM A;  2XD0 A;  1JRI A;  4PJO D;  2PUO B;  4M7A E;  1BI2 A;  2E6N A;  4PL6 A;  5DLO A;  1FXX A;  1UGP B;  3E9F A;  4RCB A;  2QQR A;  4C8Q A;  1UEB A;  4JRP A;  1VQ7 A;  1VQK T;  3KXT A;  4M77 A;  5GMK e;  2E5Q A;  4JRI A;  4QQ6 A;  5C0M A;  3G6E T;  2XIC A;  4QQG A;  2KDS A;  4CRI A;  2QA4 T;  1K8A U;  3M9Q A;  3A8G B;  3QKJ A;  4TVR A;  5HY6 A;  3BW1 A;  3L1A A;  4BI3 A;  5KH6 A;  3CC4 A;  1LOJ A;  4X34 A;  3TCJ A;  4OF1 A;  2F5K A;  2V8I A;  3HFO A;  1N9R A;  4Q5W A;  1VQN T;  2DAQ A;  1I81 A;  2DK3 A;  3HP9 A;  2E41 A;  1XTD A;  1M5Q 1;  4II1 A;  4BUG A;  4BI4 A;  3J81 E;  4DQ2 A;  3PGG A;  1UGR B;  3CCQ T;  4C8Q B;  1KQ1 A;  3GNG A;  2XU8 A;  2O4X B;  4J5Y A;  5FRM A;  4M7D A;  1Y71 A;  5GAN h;  4O6J A;  1Q81 C;  2KVQ G;  5I2S A;  3JB9 J;  2JUF A;  2KSS A;  4IUQ A;  4XTW A;  2L8D A;  4IUV A;  2RM4 A;  2CGH A;  5FLX E;  5GMK i;  3M4G A;  2XKO C;  1KC8 C;  3LW5 E;  5FU7 C;  1BKB A;  4FIB A;  4A4H A;  4ELZ C;  2FB7 A;  2I2L A;  4M78 E;  3MEA A;  2LDM A;  1VQ7 T;  2K2V A;  3JCM X;  3RMQ A;  1TH7 A;  3I55 T;  3JB9 H;  3A8O B;  3O8V A;  1I8F A;  2DO3 A;  3HRT A;  2F69 A;  4IUP A;  4HKE A;  5LL6 S;  4JJN K;  2RI3 A;  3INZ A;  2DXC A;  4ZGJ B;  4M7D B;  4MDW A;  2CS7 A;  3NTH A;  2QXF A;  3PT9 A;  3QBY A;  4OB3 B;  4XU2 A;  3CCV A;  2BKD N;  3JCM d;  2DTH A;  3RER A;  4BDZ A;  3PFS A;  5FRN A;  4BB7 A;  5KCO A;  3LLR A;  3OS5 A;  5CVI A;  2X4Y A;  3E19 A;  4A4G A;  3CCS T;  3QUI A;  1YJ9 A;  1U8R A;  2LT4 A;  2R58 A;  3GF5 A;  3QDR B;  1KQ2 A;  1NJI C;  2MAM A;  3HL8 A;  4Y28 E;  5KE2 A;  1VQP A;  1QVG A;  4C92 B;  1HK9 A;  1K73 C;  3A8M B;  1VIE A;  1JJ2 S;  2LTO A;  2XK0 A;  3TEE A;  3GPL A;  2LQ8 A;  5GAM j;  1VQ5 T;  2P0P A;  3JCM P;  1W2B A;  4XTU A;  3X25 B;  4ZGD B;  3JCM Q;  5GAN g;  3OYF A;  2Y4X A;  1X6O A;  2RO0 A;  4MDX A;  2A7Y A;  5C6S A;  5FU6 C;  4PJO G;  2HD0 A;  1S72 T;  3OYH A;  1VQO A;  1Q81 U;  4KUL A;  2RB6 A;  2VGM A;  3CMA T;  4E7K A;  4HT8 A;  3G7Z A;  3OYD A;  2E70 A;  3UPU A;  4PJO C;  3CCJ T;  1D3B B;  4C8Q E;  3JB9 F;  4N0A C;  4C0D B;  4M77 E;  2E6Z A;  4DOW A;  1WJQ A;  1KC8 U;  1M90 C;  3L42 A;  1OZ3 A;  2VXE A;  1LNX A;  1BI1 A;  3QYG B;  4A4F A;  4BE1 A;  1FX7 A;  2K5F A;  2DXB A;  2OAU A;  2RA2 A;  4MMK A;  5GAM f;  5IAY A;  2PUK B;  3C12 A;  3JB9 I;  2JOY A;  4M77 F;  5DLQ E;  1VQK A;  1EIF A;  1ZHI A;  2DD4 A;  3ER0 A;  3JB9 D;  1O9S A;  1G3W A;  1PSF A;  4C0F A;  3G6E A;  3EAE A;  2ZPF B;  5CKF A;  2QA4 A;  3M55 A;  1XNI A;  3SWN A;  3OBY A;  3PNW C;  1YIJ T;  4NOY A;  3CXC A;  3X24 B;  2EAY A;  3MCA B;  4XU1 A;  4OGC A;  4M7A C;  4D6W A;  4BD3 A;  5GAN 3;  1VQ4 T;  4ATO A;  3OBW A;  4M7D E;  1VQN A;  1MHN A;  5A2Q E;  1H64 1;  2KMT A;  3PMT A;  5GAM e;  1KD1 C;  3ME9 A;  4QQD A;  4JLG A;  3OW2 S;  1VQM T;  5LJ3 d;  4M75 B;  3UT1 A;  2PVD B;  3G71 T;  3CCQ A;  2V8K A;  5GMK h;  4J7I A;  5LJ5 j;  3MP1 A;  2DPP B;  3OYL A;  1NJI U;  3HRS A;  1VQO T;  4ME7 A;  1B34 A;  5CAI A;  1N27 A;  2K57 A;  3FIF A;  2PU9 B;  4WF2 A;  4Y91 A;  1OI1 A;  3A8L B;  4M75 G;  2EQU A;  2WSC E;  4C92 E;  2EWN A;  2M9U A;  1X75 C;  1KQS A;  3FLG A;  1XOV A;  1WNL A;  3OS2 A;  3OYJ A;  2VYT A;  3M4Y A;  2HNI A;  3MEW A;  4FL6 A;  1KG1 A;  3G4S A;  2R5M A;  5I2M A;  2JTF A;  4FSX A;  2LQK A;  2JVV A;  3I55 A;  2O4X A;  3FB9 A;  4F7U F;  2EJF A;  2M0O A;  4A4K A;  5HK0 A;  4EPC A;  1YI2 T;  5LJ5 f;  3FRN A;  3M59 A;  3SB2 A;  4B9W A;  5GAM g;  4M7A F;  1M1F A;  3CC2 T;  1B34 B;  4C0Z A;  4EDU A;  4KUI A;  5CCA A;  2RHX A;  4RCC A;  2YLB A;  4XTY A;  2RD1 A;  4XQ3 A;  3GOX A;  1QVG S;  1M90 U;  1M9S A;  3DKM A;  4EMK C;  3OYC A;  4HA8 A;  1R8O B;  3WVE B;  1NE8 A;  4FU6 A;  4OMF B;  5GAN d;  5FU7 B;  2RJD A;  3VV0 A;  3ZBD A;  4MML A;  4M7A D;  2RK1 A;  2OTJ A;  5GAN 2;  4B9X A;  3LX7 A;  4N4G A;  1QW1 A;  1YCY A;  5A0L A;  4GY5 A;  5LJ5 e;  2C06 A;  2EJ9 A;  1OZ2 A;  2RI5 A;  3VYG A;  2RHY A;  4LDV A;  2XDD A;  3RIR A;  2AHJ B;  1BIA A;  2JZ2 A;  3L2Z A;  3S3O A;  2VGN A;  2Y4Y A;  1AHJ B;  2YLC A;  3N5B B;  3P8D A;  5D6Y A;  2XHC A;  3GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...