1W1FA

Sh3 domain of human lyn tyrosine kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3-domain
molecule keywords TYROSINE-PROTEIN KINASE LYN
publication title Structural Characterization of Lyn-SH3 Domain in Complex with a Herpesviral Protein Reveals an Extended Recognition Motif that Enhances Binding Affinity.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w1fA00
5I22A 1T3SA 1MV0B 2D0NA 1ZBJA 2DRKA 4JPBW 1UDLA 5I11A 2DL7A 1K4US 2KT8A 1I07A 1JQQA 3VRYA 2A08A 4RTZA 2W0ZA 2RF0A 1K0XA 2JT4A 1CSKA 1JO8A 2H8HA 1U06A 3TSZA 2K2MA 1QWEA 3NHNA 5IXBA 1K1ZA 2OJ2A 4F17A 2JM9A 2J7IA 2DILA 1NEGA 2ESWA 2VVKA 1PRMC 1MV3A 2JMAA 1SRLA 3M0SA 1NM7A 2K9GA 2FO0A 2YUQA 3U23A 2RMOA 2L3QA 3TVTA 4RTVA 4RTTA 1KSWA 1YP5A 1AZEA 1ZX6A 1KIKA 3M0QA 1QKXA 1OEBA 1GCPA 1B07A 1E6HA 2MIOA 2A28A 2DNUA 1SPKA 2F2VA 2P4RA 3QWXX 1SRMA 2F2WA 4DEYA 3I5RA 1M30A 2L0AA 1M3AA 4CC2A 3CQTA 4GLMA 5IH2A 2HBWA 2C0TA 2KGTA 1OPKA 1OPLA 2JS2A 2J6OA 3REBB 2KR3A 2E5KA 3UA7A 3M0TA 2EYWA 2GGRA 2YUPA 1W70A 2RN8A 2KE9A 2HEQA 1G83A 4JZ4A 1TG0A 1WX6A 4ZNXA 4QT7A 1AEYA 2FG0A 1VYTA 2VWFA 2O31A 3SHWA 1ZUKA 2GQIA 4CC7A 2CDTA 3THKA 1WIEA 1WYXA 1WI7A 2QDLA 1TUCA 2CUBA 1K0SA 3M0UA 4LNPA 4CC4B 1YCSB 2M51A 2EQIA 4OMPA 1ZLMA 2XMFA 1T3LA 1GL5A 2BTTA 2D8JA 1ABQA 1NYFA 1ZUYA 4AFUC 3EHRA 2DVJA 1NG2A 2LCSA 1UE9A 1U5SA 1VYUA 2O9SA 2OI3A 1PNJA 3RNJA 5IHNA 2X3XD 1Z9ZA 1LCKA 3QWYA 3C0CA 4J9CA 2GTOA 5GJVB 2J06A 2BZXA 4D8KA 2HDAA 3H0FA 2YUNA 2CUDA 4HVUA 2HSPA 1T0JA 2O88A 4RTYA 2AKKA 4FSSA 2CSQA 1B3QA 2DX1A 2KBTA 2V1QA 1X69A 1UJYA 1AZGB 1FMKA 2JTEA 2ENMA 2JMCA 1E7OA 1GBQA 2EKHA 2MOXA 4HCKA 2VKNA 3JV3A 1WXBA 2LQWA 1RI9A 3TSWA 2DBKA 3I5SA 1GBRA 3VS1A 2EGCA 2RQRA 4OMNA 1SHGA 1G2BA 4J9FA 1GFDA 1E6GA 4RTWA 1KFZA 2K79A 2W10A 4OMOA 1X6BA 3H0HA 4J9BA 1PRLC 1AOJA 2RPNA 2ROLA 5IHIA 2DL4A 3VS5A 2C0OA 4AFZC 2FRYA 2K3BA 3UA6A 2GNCA 2KXCA 4AFSC 2DL5A 1GCQC 3EG0A 2B86A 2M0YA 5HCKA 1JEGA 2KROA 2A37A 1GFCA 2G6FX 3VS7A 1UECA 2EYXA 4EIKA 2EYZA 2NWMA 2PNIA 3EGUA 3UATA 1X6GA 4IIMA 2KYBA 5IXFA 1QCFA 1SEMA 2YUOA 1IO6A 4ESRA 4JJDA 2FPEA 2X3WD 1TUDA 1A0NB 2D1XA 5ECAA 1AWJA 2J6KA 2SEMA 5GJWB 1V1CA 3VS0A 4JZ3A 2JXBA 1AD5A 2D8HA 3O5ZA 1M3CA 3PVLA 2FRWA 1PHTA 2KRMA 2DE0X 4HVWA 3R6NA 2DYBA 1HJDA 2CT3A 2BZYA 2DL8A 2ED0A 2AZSA 4J9DA 1BBZA 2DM1A 4OMLA 2GTJA 1JU5C 1JXMA 4GBQA 2RQVA 1UGVA 3I9QA 3ULRB 2RQTA 4X1VA 1SHFA 1NEBA 1PKSA 2FEIA 1BU1A 1UFFA 4RTXA 2V1RA 3EHQA 2BZ8A 2L3PA 1K9AA 2L2PA 4F16A 1X2QA 2EW3A 1GCQA 2I0NA 4LN2A 1H3HA 3EG2A 4JJCA 2KEAA 4AG1C 1MUZA 2KT1A 2LQNA 2DBMA 2RQUA 3VS2A 3FJ5A 1YWOA 3SEMA 2KNBB 2LJ0A 1EFNA 1QKWA 1GRIA 2KYMA 3I35A 2LMJA 1X2KA 4Z89A 1I1JA 5IHKA 4K11A 1W1FA 1VA7A 2KRNA 1M3BA 3GBQA 3REAB 2RQWA 3LH5A 1WA7A 2YDLA 1ZSGA 3NGPA 2LJ3A 1BK2A 2JM8A 2YSQA 1CKBA 2GBQA 2DRMA 2O9VA 2CREA 1WXTA 2JS0A 1M8MA 2EGEA 1UUEA 5FW9A 2K7AA 2JW4A 4JJBA 2LNHB 2EYYA 2EVRA 1YN8A 4J9GA 5FWBA 3VRZA 1Y0MA 2AKLA 2A36A 1RLPC 3PE0A 4HXJA 3NPFA 2NUZA 1T0HA 1AWXA 3EG3A 1W6XA 1FYNA 2DJQA 3VS4A 1OOTA 2SRCA 2CH4A 1WFWA 5EC7A 1N5ZA 4J9HA 2LZ6B 2ABLA 4OMQA 2CT4A 4J9EA 3KFVA 1VYVA 3EG1A 4AFQC 1UHCA 1UJ0A 2DA9A 4LE9A 2MCNA 1Z9QA 1X43A 4D8DA 2FPFA 1HD3A 1H8KA 4RUGA 1ARKA 4CC3A 4A63B 2HCKA 3ZL7C 1YWPA 3M0PA 1KJWA 4LUEA 3UF4A 1RUWA 2PZ1A 4R0KA 4Z8AA 2J05A 3IQLA 1K76A 1NYGA 4LUDA 5FWCA 1AVZC 2DF6A 1HSQA 4HVVA 3PVQA 1ZUUA 4J9IA 2KRSA 2CSIA 3VS3A 1NLOC 1M27C 1WLPB 4M4ZA 2IIMA 1QLYA 2C0IA 2AK5A 3RBBB 2OAWA 2FPDA 2AZVA 1PWTA 2LP5A 2EPDA 4ORZA 4Z88A 1U3OA 2DMOA 2ROTA 2EBPA 1CKAA 2EGAA 1S1NA 2L3SA 1UTIA 1X27A 1H92A 1RLQC 4RTUA 1Y57A 3M0RA 4IIOA 2F2XA 4Y92A 1J3TA 1BB9A 3A98A 2K6DA 4OMMA 1UHFA 4WCIA 4E6RA 2ECZA 2ED1A 3VS6A 2KXDA 1WXUA 2LJ1A 3H0IA 1UG1A 1WDXA 1ABOA 1SSHA 2RNAA 4F14A 2DL3A 5L23A 3H41A 2DLPA 2O2OA 4DEXA 1I0CA 1JXOA 1OV3A 1AWWA 1YNZA 1QWFA 3NMZC 1AWOA 1PKTA 2LX7A 2J6FA 1NLPC 2CH4W 1XOVA 4KRTA 4AG2C 2YT6A 2PTKA
chains in the Genus database with same CATH superfamily
1VQPA 3OYNA 5I22A 1SG5A 1T3SA 5LJ3e 1HK9A 1MGQA 2DRKA 2K4YA 3LW5E 2QTXA 5C6SA 3DLLA 2W0ZA 4NL2A 1RAAB 3RKWA 1K0XA 2H8HA 4BE0A 3HFNA 4QQGA 3HRTA 1VQKA 1KC8C 1VQ4Q 4F17A 1R8OB 2WSFE 2DILA 3CCST 3EH2A 1XJWB 1MV3A 4C92F 1SRLA 4BD3A 2C06A 2XU8A 3SWNB 2FO0A 4BUGA 3U23A 1K73C 3TVTA 2LT1A 4C92D 1KSWA 1YP5A 1AZEA 1ZX6A 2MK5A 1QKXA 1YHQQ 3HRUA 1B07A 1E6HA 2LVMA 2DTOA 3L1AA 2E1HA 2P4RA 3QWXX 4NL3A 2VGNA 2L0AA 1M3AA 5GANf 3PIPA 1FMVA 2QA4Q 2C0TA 3LH0A 2E5KA 2GGRA 4QVDA 5FU6C 2K3XA 4PJMA 2EIFA 4IUTA 1RAIB 3EGDA 1QW1A 1KD1U 1NJIR 1KG1A 2WACA 2YXYA 1D1AA 3RUXA 3WVDB 2CDTA 1WYXA 2QQAA 1OU9A 1BCMA 5CKEA 3I56A 4AMCA 3M0UA 3PMTA 4BI4A 1YCSB 2EQIA 1VQOA 5KH6A 2D8JA 4JLGA 1ABQA 1NYFA 1VQLQ 3QDFA 2QXFA 2D9TA 2DVJA 1NG2A 1U5SA 2OI3A 3JB9D 2CP5A 5GAOr 3JCMe 4QVZA 2YLCA 3I56T 2J06A 2BZXA 4D8KA 1YITQ 2HDAA 2QEXA 4M7DD 2YUNA 3V8KA 2CUDA 3X20B 4FSSA 2CSQA 2E41A 2QGFB 4C0ZA 3CXCP 4DOVA 4QQ6A 4GLKA 3VS1A 1QVGS 4JRQA 3V7RA 2RQRA 3M56A 1GFDA 1E6GA 2KMTA 3CC7T 1KFZA 3MKDA 1C0MA 1X6BA 3FC3A 3E1SA 5C0MA 1TUGB 3VS5A 4BB7A 2R57A 2D0QB 5FRNA 1OULA 2VUBA 3UA6A 2DPPB 4KGZB 2GNCA 2KXCA 4AFSC 2DL5A 5HCKA 1OQKA 3OYGA 1JJ2P 5KCOA 3M57A 1GFCA 5LL6S 4EPCA 2EYZA 1MNEA 2PNIA 1M5Q1 4DBHA 3UATA 5GANd 1K9MC 2K57A 3VYHB 1D0XA 2QQ9A 1IO6A 4M78F 2FZGB 4JJDA 3SFMA 2IG0A 4M7DA 1BIBA 3C12A 2FPEA 1TUDA 1NBEB 4M77A 5DM7R 3JB9J 4M78D 4O6JA 1AWJA 1VQPQ 1OZ3A 3VS0A 4JZ3A 4AT1B 2BIVA 3MCAB 3GPLA 2MWPA 5D6YA 3EFRA 2D8HA 1YIJA 1UGQB 3OY9A 1M2OA 2DVEA 4C5IA 4C8QA 4ZGDB 1NPPA 3R6NA 4ZN3A 2DYBA 5CKDA 1VQKQ 4FYWB 2V8JA 3EFOB 2BE7D 6AT1B 2RHIA 2AZSA 4J9DA 2Y90A 1HXDA 1KQ1A 4BE2A 4LDYA 1JXMA 2RQVA 1N9RA 1JBMA 1FX7A 1OI1A 1NEBA 2O01E 1RADB 2FEIA 3CCMT 1BU1A 3LLRA 2O4XB 4RTXA 2NUPA 2V1RA 1M1GA 4ANJA 1K9AA 2HZYA 1K8AR 1GCQA 4FU6A 2I0NA 1H3HA 4M75A 1MUZA 2KT1A 1QVGA 5KYYB 2DBMA 2RQUA 2RHZA 4F04B 2LCLA 4M7AA 3EG9B 3JRZA 1VQ7T 2COYA 2DAQA 1WQWA 2KRNA 1WZOA 4P5NA 4C5HA 3C94A 2YDLA 4PLLA 4C5GA 2LQ8A 1OZ2A 1CKBA 2KSSA 2O9VA 2CREA 4F7UB 4ZTFA 5M9OA 5GMKj 5GAN6 1VQOQ 2JS0A 5FW9A 8AT1B 3I55T 4XTUA 7AT1B 2EYYA 4J5YA 5FWBA 1Y0MA 2FVUA 4MZMA 4HXJA 3NTHA 3BW1A 1TWBA 3CCUA 4ME7A 2QEXQ 1WHMA 2CH4A 4F7UG 3BFMA 5KE3A 1QP2A 2LZ6B 2ABLA 4OB2B 2CP6A 1JRIA 2CT4A 4AFQC 1Q81R 2LDMA 3A8LB 1X75C 2I2LA 3SDZA 3SWNA 2OTJQ 2CZ6B 3QO3A 4ELYC 3CCUT 3M55A 4OMFB 4GY5A 5FU7B 9ATCB 1KD1C 1ARKA 3HPWA 2HCKA 1C1AA 3M0PA 1YWPA 2QQRA 2L5QA 3LX7A 4LUEA 1YFNA 2ZZDA 3IQLA 2K5IA 3DLMA 3CCJQ 1VQNA 1YJ9A 3CBPA 3C95A 2VASA 1M90R 3PVQA 4J9IA 2H3JA 2CZ1B 1G3SA 1M4ZA 2PVOB 5GANe 1RAHB 2IIMA 4V2SA 3OQ5A 1LPLA 2ZGWA 3SWNC 4KGVB 2XD0A 1VQNT 2AZVA 1Q86R 1YJNA 4N0AA 2FZKB 2LP5A 4CRIA 1XTDA 4E47A 2DMOA 2HL3A 3MP8A 2DIQA 4IUVA 2CZ7B 1Y57A 4IIOA 3L2WA 5KYNA 4WCIA 4E6RA 1Q82R 2ECZA 5A0GA 1YJNT 4J8OA 1YIJQ 1HYOA 3GNGA 1UG1A 4C92B 1ABOA 1SSHA 4F14A 4HT9A 2DL3A 4EMKA 2DLPA 3OW2S 4O5VA 3LGLA 4FSXA 3FEOA 3OBWA 4Y28E 3G4ST 1IREB 1AWWA 1KC8R 3NMZC 2LX7A 2J6FA 1Q95G 3CC2A 2CH4W 1PG5B 4C92G 4JRIA 1VQ6A 4RTZA 1K73R 4Z02A 4A4EA 1MV0B 3CMAQ 2D0NA 3QYGB 2XKOC 1ZBJA 1KQSS 3EAEA 3A8OB 2KT8A 5KYUB 3VRYA 4LDWA 4C0FA 1QMCA 2LQKA 3OS0A 3X24B 1WHJA 1QWEA 3NHNA 1VQ6T 4FM4B 3S3NA 2RHYA 2HKNA 2OTLA 2XIDA 1I4K1 2JM9A 2J7IA 2ESWA 2VVKA 2JMAA 4C0DC 1G8XA 2KI7A 1V29B 2K9GA 2YUQA 4PJOA 2FB7A 2ZPFB 1M8VA 4A4FA 5L8RE 2L3RA 1WPYA 4HCBA 2M1HA 2MIOA 3QZ5B 5GAN2 2DNUA 4KGXB 3AT1B 1ZQ1A 5KYWA 3GOXA 3TU4K 1PD1A 4FT2A 2CP2A 1M30A 3CCQT 4KULA 4LXCA 1WHGA 4A4HA 4GLMA 2RK1A 2HBWA 1Y7XA 2EQMA 2KGTA 3S3MA 2LTOA 2MMPA 1IGUA 2J6OA 2KR3A 3UA7A 2EYWA 2V26A 2EJGA 4FIBA 2KE9A 5HY6A 2DEQA 1M1KU 2JTFA 3CCUQ 3OBYA 4JZ4A 3G71T 4KBMB 1ZSZA 4KT0E 4KUIA 1O9SA 4LDUA 3G6EA 3MEAA 3BY7A 1NPRA 1R0BG 1Y96B 2GQIA 2P0QA 4XU1A 3UPUA 5HK0A 2H3EB 3PMIA 3JCMP 3TCJA 2BTTA 1ZUYA 2QAZA 2E4HA 1S72A 3G6ET 2JJ9A 2O9SA 1PNJA 5IHNA 2X3XD 2RK2A 2OAUA 3C0CA 3QWYA 1M9SA 4J9CA 3QBYA 4L6V5 5GJVB 1UEBA 2M9UA 2O88A 1YJ9Q 1B3QA 4PFOA 4FYVB 1D09B 2X9HA 2RJEA 2VC8A 3MEWA 2MOXA 2E3IA 1MHNA 3OYYA 3MJXA 5D6XA 2VKNA 3PGGA 1RI9A 3I5SA 3DB4A 4M78B 4MDXA 3ER0A 1G2BA 4FL6A 2NUTA 1MMNA 4OMOA 3DB3A 4J9BA 3CCSA 2RPNA 4OB0B 2YRVA 1KHIA 3PIOA 2RB6A 2M02A 2YLBA 2P84A 1K9MR 4TVRA 3V7SA 4M78G 2JNGA 3UDCA 2RI2A 2P4TA 3EGXB 4IKFA 4J6WA 2VGMA 2M0YA 2ZPHB 3CCVT 2FHDA 1KHCA 5GAMg 1JEGA 1H3ZA 4LDXA 1D3BA 4X9DA 4PLIA 2G6FX 3QJYA 2M16A 4F7UE 5FLXE 1QQJA 3OYAA 1X6GA 3ASKA 1SEMA 3RESA 3DKMA 3PFSA 3CC2Q 1SF9A 2CP0A 1VQ8Q 2J6KA 3M58A 1V1CA 1H641 1WJSA 3PVLA 1PHTA 2KRMA 4XU2A 5LJ3j 3JCMV 2EKOA 4LD9K 2DE0X 1RAFB 2DERA 2WSEE 3JSCA 4BDZA 2OTLQ 1G3WA 2DL8A 3GLXA 2ED0A 4ZGJB 2DM1A 4OMLA 1MMAA 2GTJA 4A53A 2AHJB 2PUOB 3FDRA 3NTKA 4HT8A 3JB9F 5GAMh 2QI2A 1D1BA 1PKSA 5LJ5g 5A0DA 2RM4A 4M7DF 2HQXA 3EHQA 2L3PA 1UGSB 2HNIA 3FIFA 3A5ZB 4M77F 3NTIA 5FU7C 2L2PA 4F16A 1X2QA 3QKJA 4LN2A 2RJFA 3CC7A 4OF1A 2XICA 4M77D 1D1CA 1EZZB 3L2RA 2ATCB 1EFNA 2KYMA 1VQ9A 4C8QF 1X2KA 3E2UA 1M2VB 4E7KA 1VUBA 3MEVA 5IHKA 2LC4A 4J83A 4C8QD 3S3OA 3GBQA 2ZAEA 5KE2A 1SKUB 4ZN1A 2RQWA 3URGA 2KY9A 1ZSGA 3JCMJ 1BK2A 4OGCA 2JM8A 2YSQA 1VQ9T 2DRMA 1I5OB 2QGGA 1BI3A 4C92E 4IUQA 2EGEA 2K7AA 2KK4A 2JW4A 4A54A 3RERA 2LNHB 1IZ6A 4HCCA 1S72Q 1N9SA 3CC4A 2E65A 2FL7A 2PVGB 5GMKh 3NPFA 1T0HA 3OSVA 1AWXA 1TOVA 4M75F 1Q7YR 1KD1R 4MMKA 2DJQA 3VS4A 1QVFP 1OOTA 1ZBXA 3QDRB 5LJ5h 4XTYA 2E6NA 4C92C 1N5ZA 3QIIA 5CQYA 4M75D 1WJQA 4M7AF 3CXCS 2KVQG 3P8HA 2XDDA 3MP1A 5GAN8 3CCET 5KYXB 2VXFA 1VOMA 3CC4T 3OS5A 1N27A 3CCRT 4DBQA 4M7AD 1UHCA 3KUFA 1KQ2A 3X25B 1W2BP 1M1KC 1WHKA 3A8GB 4D8DA 4QKUA 1HD3A 3CCSQ 4OB1B 4A4KA 1H8KA 3OSSC 2X4XA 4CC3A 3VU3C 2R5AA 4XTXA 3OYLA 3UF4A 2E10A 4RKUE 2E70A 5KCHA 3SD4A 5D7UA 1N8RU 2K5LA 1MMGA 1QCOA 2YWWA 1K76A 3CCMA 1IXDA 1JJ2S 3M5AA 4J7IA 4JUVA 1HSQA 4HVVA 5GAMj 1WLPB 2CKKA 4M4ZA 5AT1B 3QPHA 2OAWA 3VV0A 3HRSA 3R6OA 4DBFA 1B34A 1PWTA 1Y96A 1U3OA 2ROTA 4FCYA 1CKAA 5GMKe 1VQ7A 4JJNK 1S1NA 3JCMW 1H92A 3M0RA 3ME9A 2F2XA 4Y92A 3OS1A 1IHVA 2K6DA 1UHFA 1NZ9A 2ED1A 4R55A 2KXDA 1WXUA 1YCYA 3O8VA 1WDXA 1G3YA 1MMDA 3H41A 5GMKl 3I55A 4B9WA 2RI3A 3L2QA 2L8DA 1JXOA 2EJFA 1M1FA 2AT1B 1QWFA 3I56Q 3J80E 1PKTA 3FLGA 3QJ6A 5LJ3f 1M90U 1NLPC 3L2UA 2HKQB 1WQ7A 1BIAA 1LNXA 5LJ5j 5D6WA 3BE3A 3OYHA 2D6FA 5I11A 1UDLA 3CXCA 1Q86U 2YRCA 3GNFB 3RDVA 4M78E 3CC7Q 2RF0A 1CSKA 1JO8A 1U06A 4FYXB 1VQMT 3RMQA 1FXXA 3WVEB 4PK4A 2DXCA 4E7HA 2DZCA 2DYIA 4NS5A 3JCMb 3E9FA 2HBPA 1U8RA 2DD5A 3HKSA 1VQ5A 2EQJA 1NM7A 3JCMQ 3T9NA 2RMOA 2L3QA 4RTVA 4RTTA 4M78C 2LRQA 2HD0A 3M0QA 3A1PA 1GCPA 2F1LA 1WHLA 1JJ2A 2F2VA 1SRMA 2F2WA 1VQ5T 8ATCB 5GAOl 4BI3A 4DEYA 4RG8A 1QVFA 3CQTA 2A3LA 1OPKA 1OPLA 5CQXA 3REBB 3M0TA 2YUPA 1W70A 3AHUA 4WTOB 1XQHA 2HQHA 2HL5C 1G83A 3CMET 3F70A 5DY9A 3EGDB 3CD6A 1WX6A 4QT7A 2FG0A 1VYTA 2L89A 2VWFA 4BY6B 1ZUKA 4CC7A 2QK0A 3THKA 1WIEA 5IT9E 1WI7A 1TUCA 2CUBA 2ZPBB 5GAOq 1K0SA 4PJOF 2RHXA 2GF7A 3CBMA 4LNPA 2M51A 3JCMf 4OMPA 5HKCA 1GL5A 1T3LA 4L5GA 3CD6T 2X4YA 4PJOD 3G4SA 2RJCA 1UE9A 1YI2T 3RIRA 4Y91A 5CO7A 3RNJA 2B8AA 4BDYA 3MO8A 5I2SA 3CPWP 2JUFA 3OS2A 3H0FA 1TSFA 3CCMQ 1T0JA 4J7FA 2DX1A 3FRNA 2V1QA 1UJYA 1AZGB 1VQ4A 2JTEA 2ENMA 1GBQA 1U1SA 3JV3A 2P0KA 2GFAA 4HKEA 1WXBA 2LQWA 3TSWA 3LWHA 2DBKA 1GBRA 5J3BA 4EMGA 2E6ZA 2EGCA 3FJPA 4RTWA 2W10A 1D0YA 2QASA 3H0HA 1PRLC 1QVPA 3GIBA 2ROLA 3ZEHA 1VQ4T 2EYQA 3M4YA 5GAMf 1VIFA 4AFZC 1VQ7Q 3N5BB 2FRYA 5LJ3g 3QXEB 3MP6A 2RH2A 2QYZA 3OYDA 2VV5A 3EG0A 2B86A 2QTVA 5EG2A 2ZPEB 3M54A 2QA4A 1YHQT 2KROA 1BYMA 2IVWA 2A37A 1FWZA 3VS7A 3CCQA 4JS4A 2EYXA 3I55Q 1LOJA 3OYIA 1RI0A 2KYBA 2A7YA 1N8RC 1QCFA 2QA4T 4FT4A 4MZTA 4ESRA 1GXIE 4M7DB 2D1XA 4M77B 3G71A 2SEMA 5GJWB 3JB9G 5CAIA 3LGFA 2JXBA 1AD5A 3M4GA 3O5ZA 1M3CA 2FRWA 3J7AF 4M7DG 4C0GA 1W4SA 3FB9A 4M77G 4C8QB 3EFOA 2BZYA 5LJ5f 3C4SA 1VQLT 5LJ3h 3X26B 3HP9A 3OYMA 2RD1A 3TQ7P 1JU5C 3CBOA 4B9XA 1V76A 4IURA 1UGVA 3I9QA 1YITT 4C8QG 1SHFA 2O4XA 4A4GA 3HFOA 4JRKA 2NUPB 2P0PA 2QQSA 2GCXA 1ZA1B 2EW3A 4IUPA 2RI5A 3JCMg 4JJCA 2KEAA 4M75B 5KYYA 1VQNQ 1M90C 3VS2A 4C5EA 3FJ5A 3PT9A 5FRMA 2K3YA 4M7AB 2LJ0A 3EG9A 4HCZA 5GAMd 3HHTB 1AHJB 4BACA 3KXTA 1QKWA 1GRIA 3I35A 3QG1A 2LMJA 4Z89A 3QHSA 2DFUA 1Q86C 4E7ZA 1W1FA 4M75G 3CCVA 1G3TA 1YJNQ 1IGQA 3Q1JA 3REAB 1NJIU 1WA7A 4E7JA 4M7AG 2LJ3A 2NLUA 3V8LA 2X4WA 1NE8A 4F7UA 2E64A 1WXTA 3J81E 4PL6A 1QP3A 1UUEA 1TXQA 3P8BB 3OYJA 3G4SQ 1OU8A 3VJPA 4J9GA 1M1KR 5GAN3 1U1TA 3X28B 2AKLA 2A36A 1RLPC 3PE0A 1SSFA 1BI1A 1XNIA 3L42A 1W6XA 1FYNA 5CVIA 1WFWA 5A0LA 1C6VX 2M0OA 4XTWA 3LWIA 4JLIA 1VQPT 4D6WA 3L2VA 4J9EA 3JCMh 2DK3A 3H6ZA 2XDBA 1EIFA 4XQ3A 2OX7A 1VQ6Q 2DA9A 4LE9A 1BKBA 1ZA2B 2QG9B 3EFSA 1VQKT 5LJ5d 5AYFA 3ZL7C 1ACMB 2A0FB 1RUWA 4LDVA 4R0KA 4Z8AA 1D0ZA 4QVCA 2GFUA 1IRXA 3QSUA 3WXMB 1NYGA 4LUDA 5FWCA 1AVZC 3SB2A 2E12A 1DJ7B 1Y07A 2CSIA 2ZPIB 2XG8D 4DQ2A 1NLOC 3CCQQ 1QLYA 1TTHB 1QVGP 2AK5A 1Q7YU 4DOWA 5DLOA 3RBBB 3ZBDA 5GMKm 2EPDA 4ORZA 2RA2A 2EAYA 4N4GA 2EGAA 4YTLA 2L3SA 4KH0B 1RLQC 3G71Q 1J3TA 1F1BB 4OMMA 1PM3A 2HSEB 3VS6A 3OA6A 2LJ1A 2CS7A 4R56A 4C92A 4XTZA 2E3HA 4PFPA 2MWOA 5L23A 2O2OA 4EMKB 1VQOT 3G6EQ 2XK0A 1BI2A 4DEXA 5GAN5 1I0CA 3JCMX 1OV3A 2BE9B 4C0DB 4JS5A 2DETA 1AWOA 1WHHA 4BY6C 4PJNA 2OTJA 4FW2A 2QQBA 2Y4YA 3PNWC 4KRTA 5GMKi 2QEXT 2YHTA 2GQVA 2PTKA 4ELZC 2X35A 3CCEA 2BKDN 4JPBW 3CCRA 1TH7A 2DL7A 2Z0WA 1K4US 4UC4A 5KYUA 1I07A 1JQQA 4OGEA 2A08A 4X9CA 1PD0A 1UB4A 1K8AU 2OTJT 2JT4A 3RMSA 3TSZA 2K2MA 1G5VA 5GAMe 5IXBA 1K1ZA 3CCJA 4XAXB 5GAOm 2OJ2A 1RAEB 2RHUA 1PC0A 3MEUA 1NEGA 1RABB 1PRMC 3M0SA 3VUZA 2DEUA 2DXBA 1P92A 3S6WA 4PJOB 5J26A 3E9GA 3OYBA 3META 5GAN7 3CCVQ 5CKHA 2PU9B 2R5MA 1WNLA 3P8DA 1KIKA 3CCJT 4RG2A 4Q5WA 4QW2A 1OEBA 2X4JA 2A28A 1YJWA 1SPKA 4MMLA 3D7SB 5KYWB 4ATOA 2X51A 3I5RA 4PJOG 2EFIA 1R77A 2LNVA 4CC2A 2DZ9A 3G7ZA 3V7CA 5IH2A 3PTAA 2JS2A 5CK9A 2HQEA 2RN8A 1YJWT 1QVFS 2HEQA 3RKYA 2ZPGB 4M7DE 1TU0B 1R0CB 4M77E 1UGPB 1TG0A 5GANg 2XDPA 2LT4A 4ZNXA 1AEYA 5IN1A 1QCNA 1ZSZB 2O31A 3SHWA 3UWNA 2QDLA 1FMWA 3E19A 1YIJT 3MHXA 1W2BS 2JOYA 2VYTA 1Q81U 2MPXC 4CC4B 3TEEA 2Y4XA 4M7DC 1ZLMA 2XMFA 2NYSA 5LJ5e 5GAN4 2EWNA 4C8QE 3V8JA 4M77C 4AFUC 3EHRA 2LCSA 3CEYA 4J6YA 3CMAA 1VYUA 1Z9ZA 4KH1B 1LCKA 4FW1A 2GTOA 1NJIC 1EX4A 4XK8E 4OB3B 2E5QA 2CZ0B 2CYZB 4HVUA 1ZHIA 2HSPA 4RTYA 2AKKA 4ZTJA 4C8QC 2KBTA 1X69A 2XI9A 1FMKA 2JMCA 1E7OA 2EKHA 2FZCB 4HCKA 3CMAT 4PKCC 4E7LA 4E7IA 4M78A 4XU0A 1WJRA 3HTRA 4OMNA 1SHGA 4RMOA 4J9FA 1VQMA 2K79A 4M75E 1RACB 2NUTB 1RAGB 3JB9I 1N6AA 4EDUA 1AOJA 5IHIA 2DL4A 4M7AE 2C0OA 1N8RR 5CIUA 2K2VA 5GANh 2K3BA 3EGXA 2MF2A 1GCQC 3L2ZA 2FYKA 4M75C 3OB9A 5FU6B 5CKBA 2DKGA 3JAME 1Q82U 1VQ9Q 4M7AC 4E2FB 1D3BB 1UECA 4EIKA 2NWMA 3QUIA 3EGUA 4JRPA 1Y71A 5HK3A 4IIMA 5IXFA 2YUOA 2DO3A 2V8KA 5IAYA 3CMEA 2X3WD 2EQKA 1KC8U 1A0NB 5FROA 5ECAA 4L59A 1WGSA 3OYEA 2YRDA 4LD6A 5GAOp 4XTVA 3CCEQ 1IHWA 3CC4Q 2JTMA 1K73U 2MAMA 3CCRQ 1Q7YC 2CP7A 3BDLA 1OX8A 3QYHB 2RJDA 1UGRB 4HVWA 3CCLA 3RKXA 3OYCA 1W2BA 2HMAA 3INZA 1HJDA 3MPUB 2CT3A 2F5KA 1YI2A 2DTIA 4J6XA 4N4HA 5A2QE 2COWA 3TREA 1I5LA 3OW2P 4E7SA 4IUUA 4EMHA 1BBZA 2JZ2A 4DA4A 1JB0E 4GBQA 2EQUA 4KUDK 2DTHA 4OP0A 3ULRB 3CCLT 2RQTA 4X1VA 4CI0C 3KBGA 1AT1B 1UFFA 1YJ9T 2PVDB 1RL2A 2VB6A 1YJWQ 2BZ8A 1KQSP 2DXUA 4RCCA 5LJ3d 3EG2A 4II1A 4AG1C 2KAFA 2LQNA 2XHCA 1YWOA 4MZPA 2R58A 3SEMA 2KNBB 4XU3A 2RO0A 3M53A 2IPOB 1M2VA 1LJOA 1VIEA 3JB9H 4B6MA 1I1JA 2WSCE 4K11A 1VA7A 5GANj 1M3BA 5DLQE 1PSFA 1K8AC 2PQWA 1BI0A 1YHQA 3LH5A 1BCOA 5CCAA 3VYGA 3NGPA 4N0AC 2COZA 4PNOA 5GAOn 2ZCFB 2GBQA 1YBYA 4BE1A 3H8ZA 2JN0A 2DJZA 1VQ8A 1I8FA 1M8MA 5J39A 2K5FA 3VKIA 4JJBA 3JCMc 2EVRA 1YN8A 4HA8A 3VRZA 3CPWS 2QDYB 2V8IA 3A8MB 2NUZA 1KK7A 3EG3A 3HSBA 1LVKA 2SRCA 3CC2T 1OYXA 3GF5A 5EC7A 1VQ8T 4QQDA 2DXTA 4J9HA 1X01A 1I81A 4OMQA 4EMKC 5KYXA 2DD4A 3KFVA 1VYVA 3EG1A 3HL8A 2LCCA 2PUKB 3RR6A 3VUBA 1UJ0A 3OYKA 3H9NA 1VQMQ 4MDWA 2MCNA 1Z9QA 1X43A 2FPFA 1VQLA 4VUBA 2OTLT 1B7TA 2CGHA 4RUGA 3OYFA 4PJJA 4A63B 4F7UF 1MNDA 1KJWA 1O75A 2VXEA 2PZ1A 3M59A 5I2MA 2J05A 5CKFA 1K9MU 1YITA 4PJOE 3JCMd 4FYYB 1Q81C 3A8HB 2DF6A 2AIRB 2F5TX 4WF2A 1ZUUA 2KRSA 3VS3A 1VQ5Q 2MYSA 2KQWA 5CR2A 3NFCA 1M27C 4RCBA 3BDUA 1PCXA 2MI6A 2C0IA 2KDSA 4PJOC 2FPDA 1PSEA 4ZGEB 1X6OA 1B34B 2EJ9A 3G1JA 4Z88A 3UT1A 2EBPA 3CMEQ 2LX9A 3OMCA 1UTIA 1X27A 3LYIA 1TS9A 4RTUA 3GP8A 1BB9A 3A98A 3CPFA 4NOYA 3EH1A 3ZFJA 3OW2A 4JDSA 4BI8B 2JVVA 3H0IA 2F69A 1IB8A 1OX9A 5I21A 3CCLQ 3CD6Q 2RNAA 1YI2Q 2G3RA 4N4IA 3QZ9B 4DBRA 2HAXA 1S72T 1YNZA 3OMGA 1ZSZC 4PFZA 3CPWA 1KQSA 2CP3A 2BUDA 2DIGA 1XOVA 4X34A 1Q82C 3M9QA 4PJLA 4AG2C 4OVAA 2YT6A
chains in the Genus database with same CATH topology
5I22A 1T3SA 1MV0B 2D0NA 1ZBJA 2DRKA 4JPBW 1UDLA 5I11A 2DL7A 1K4US 2KT8A 1I07A 1JQQA 3VRYA 2A08A 4RTZA 2W0ZA 2RF0A 1K0XA 2JT4A 1CSKA 1JO8A 2H8HA 1U06A 3TSZA 2K2MA 1QWEA 3NHNA 5IXBA 1K1ZA 2OJ2A 4F17A 2JM9A 2J7IA 2DILA 1NEGA 2ESWA 2VVKA 1PRMC 1MV3A 2JMAA 1SRLA 3M0SA 1NM7A 2K9GA 2FO0A 2YUQA 3U23A 2RMOA 2L3QA 3TVTA 4RTVA 4RTTA 1KSWA 1YP5A 1AZEA 1ZX6A 1KIKA 3M0QA 1QKXA 1OEBA 1GCPA 1B07A 1E6HA 2MIOA 2A28A 2DNUA 1SPKA 2F2VA 2P4RA 3QWXX 1SRMA 2F2WA 4DEYA 3I5RA 1M30A 2L0AA 1M3AA 4CC2A 3CQTA 4GLMA 5IH2A 2HBWA 2C0TA 2KGTA 1OPKA 1OPLA 2JS2A 2J6OA 3REBB 2KR3A 2E5KA 3UA7A 3M0TA 2EYWA 2GGRA 2YUPA 1W70A 2RN8A 2KE9A 2HEQA 1G83A 4JZ4A 1TG0A 1WX6A 4ZNXA 4QT7A 1AEYA 2FG0A 1VYTA 2VWFA 2O31A 3SHWA 1ZUKA 2GQIA 4CC7A 2CDTA 3THKA 1WIEA 1WYXA 1WI7A 2QDLA 1TUCA 2CUBA 1K0SA 3M0UA 4LNPA 4CC4B 1YCSB 2M51A 2EQIA 4OMPA 1ZLMA 2XMFA 1T3LA 1GL5A 2BTTA 2D8JA 1ABQA 1NYFA 1ZUYA 4AFUC 3EHRA 2DVJA 1NG2A 2LCSA 1UE9A 1U5SA 1VYUA 2O9SA 2OI3A 1PNJA 3RNJA 5IHNA 2X3XD 1Z9ZA 1LCKA 3QWYA 3C0CA 4J9CA 2GTOA 5GJVB 2J06A 2BZXA 4D8KA 2HDAA 3H0FA 2YUNA 2CUDA 4HVUA 2HSPA 1T0JA 2O88A 4RTYA 2AKKA 4FSSA 2CSQA 1B3QA 2DX1A 2KBTA 2V1QA 1X69A 1UJYA 1AZGB 1FMKA 2JTEA 2ENMA 2JMCA 1E7OA 1GBQA 2EKHA 2MOXA 4HCKA 2VKNA 3JV3A 1WXBA 2LQWA 1RI9A 3TSWA 2DBKA 3I5SA 1GBRA 3VS1A 2EGCA 2RQRA 4OMNA 1SHGA 1G2BA 4J9FA 1GFDA 1E6GA 4RTWA 1KFZA 2K79A 2W10A 4OMOA 1X6BA 3H0HA 4J9BA 1PRLC 1AOJA 2RPNA 2ROLA 5IHIA 2DL4A 3VS5A 2C0OA 4AFZC 2FRYA 2K3BA 3UA6A 2GNCA 2KXCA 4AFSC 2DL5A 1GCQC 3EG0A 2B86A 2M0YA 5HCKA 1JEGA 2KROA 2A37A 1GFCA 2G6FX 3VS7A 1UECA 2EYXA 4EIKA 2EYZA 2NWMA 2PNIA 3EGUA 3UATA 1X6GA 4IIMA 2KYBA 5IXFA 1QCFA 1SEMA 2YUOA 1IO6A 4ESRA 4JJDA 2FPEA 2X3WD 1TUDA 1A0NB 2D1XA 5ECAA 1AWJA 2J6KA 2SEMA 5GJWB 1V1CA 3VS0A 4JZ3A 2JXBA 1AD5A 2D8HA 3O5ZA 1M3CA 3PVLA 2FRWA 1PHTA 2KRMA 2DE0X 4HVWA 3R6NA 2DYBA 1HJDA 2CT3A 2BZYA 2DL8A 2ED0A 2AZSA 4J9DA 1BBZA 2DM1A 4OMLA 2GTJA 1JU5C 1JXMA 4GBQA 2RQVA 1UGVA 3I9QA 3ULRB 2RQTA 4X1VA 1SHFA 1NEBA 1PKSA 2FEIA 1BU1A 1UFFA 4RTXA 2V1RA 3EHQA 2BZ8A 2L3PA 1K9AA 2L2PA 4F16A 1X2QA 2EW3A 1GCQA 2I0NA 4LN2A 1H3HA 3EG2A 4JJCA 2KEAA 4AG1C 1MUZA 2KT1A 2LQNA 2DBMA 2RQUA 3VS2A 3FJ5A 1YWOA 3SEMA 2KNBB 2LJ0A 1EFNA 1QKWA 1GRIA 2KYMA 3I35A 2LMJA 1X2KA 4Z89A 1I1JA 5IHKA 4K11A 1W1FA 1VA7A 2KRNA 1M3BA 3GBQA 3REAB 2RQWA 3LH5A 1WA7A 2YDLA 1ZSGA 3NGPA 2LJ3A 1BK2A 2JM8A 2YSQA 1CKBA 2GBQA 2DRMA 2O9VA 2CREA 1WXTA 2JS0A 1M8MA 2EGEA 1UUEA 5FW9A 2K7AA 2JW4A 4JJBA 2LNHB 2EYYA 2EVRA 1YN8A 4J9GA 5FWBA 3VRZA 1Y0MA 2AKLA 2A36A 1RLPC 3PE0A 4HXJA 3NPFA 2NUZA 1T0HA 1AWXA 3EG3A 1W6XA 1FYNA 2DJQA 3VS4A 1OOTA 2SRCA 2CH4A 1WFWA 5EC7A 1N5ZA 4J9HA 2LZ6B 2ABLA 4OMQA 2CT4A 4J9EA 3KFVA 1VYVA 3EG1A 4AFQC 1UHCA 1UJ0A 2DA9A 4LE9A 2MCNA 1Z9QA 1X43A 4D8DA 2FPFA 1HD3A 1H8KA 4RUGA 1ARKA 4CC3A 4A63B 2HCKA 3ZL7C 1YWPA 3M0PA 1KJWA 4LUEA 3UF4A 1RUWA 2PZ1A 4R0KA 4Z8AA 2J05A 3IQLA 1K76A 1NYGA 4LUDA 5FWCA 1AVZC 2DF6A 1HSQA 4HVVA 3PVQA 1ZUUA 4J9IA 2KRSA 2CSIA 3VS3A 1NLOC 1M27C 1WLPB 4M4ZA 2IIMA 1QLYA 2C0IA 2AK5A 3RBBB 2OAWA 2FPDA 2AZVA 1PWTA 2LP5A 2EPDA 4ORZA 4Z88A 1U3OA 2DMOA 2ROTA 2EBPA 1CKAA 2EGAA 1S1NA 2L3SA 1UTIA 1X27A 1H92A 1RLQC 4RTUA 1Y57A 3M0RA 4IIOA 2F2XA 4Y92A 1J3TA 1BB9A 3A98A 2K6DA 4OMMA 1UHFA 4WCIA 4E6RA 2ECZA 2ED1A 3VS6A 2KXDA 1WXUA 2LJ1A 3H0IA 1UG1A 1WDXA 1ABOA 1SSHA 2RNAA 4F14A 2DL3A 5L23A 3H41A 2DLPA 2O2OA 4DEXA 1I0CA 1JXOA 1OV3A 1AWWA 1YNZA 1QWFA 3NMZC 1AWOA 1PKTA 2LX7A 2J6FA 1NLPC 2CH4W 1XOVA 4KRTA 4AG2C 2YT6A 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I22 A;  1T3S A;  1MV0 B;  2D0N A;  1ZBJ A;  2DRK A;  4JPB W;  1UDL A;  5I11 A;  2DL7 A;  1K4U S;  2KT8 A;  1I07 A;  1JQQ A;  3VRY A;  2A08 A;  4RTZ A;  2W0Z A;  2RF0 A;  1K0X A;  2JT4 A;  1CSK A;  1JO8 A;  2H8H A;  1U06 A;  3TSZ A;  2K2M A;  1QWE A;  3NHN A;  5IXB A;  1K1Z A;  2OJ2 A;  4F17 A;  2JM9 A;  2J7I A;  2DIL A;  1NEG A;  2ESW A;  2VVK A;  1PRM C;  1MV3 A;  2JMA A;  1SRL A;  3M0S A;  1NM7 A;  2K9G A;  2FO0 A;  2YUQ A;  3U23 A;  2RMO A;  2L3Q A;  3TVT A;  4RTV A;  4RTT A;  1KSW A;  1YP5 A;  1AZE A;  1ZX6 A;  1KIK A;  3M0Q A;  1QKX A;  1OEB A;  1GCP A;  1B07 A;  1E6H A;  2MIO A;  2A28 A;  2DNU A;  1SPK A;  2F2V A;  2P4R A;  3QWX X;  1SRM A;  2F2W A;  4DEY A;  3I5R A;  1M30 A;  2L0A A;  1M3A A;  4CC2 A;  3CQT A;  4GLM A;  5IH2 A;  2HBW A;  2C0T A;  2KGT A;  1OPK A;  1OPL A;  2JS2 A;  2J6O A;  3REB B;  2KR3 A;  2E5K A;  3UA7 A;  3M0T A;  2EYW A;  2GGR A;  2YUP A;  1W70 A;  2RN8 A;  2KE9 A;  2HEQ A;  1G83 A;  4JZ4 A;  1TG0 A;  1WX6 A;  4ZNX A;  4QT7 A;  1AEY A;  2FG0 A;  1VYT A;  2VWF A;  2O31 A;  3SHW A;  1ZUK A;  2GQI A;  4CC7 A;  2CDT A;  3THK A;  1WIE A;  1WYX A;  1WI7 A;  2QDL A;  1TUC A;  2CUB A;  1K0S A;  3M0U A;  4LNP A;  4CC4 B;  1YCS B;  2M51 A;  2EQI A;  4OMP A;  1ZLM A;  2XMF A;  1T3L A;  1GL5 A;  2BTT A;  2D8J A;  1ABQ A;  1NYF A;  1ZUY A;  4AFU C;  3EHR A;  2DVJ A;  1NG2 A;  2LCS A;  1UE9 A;  1U5S A;  1VYU A;  2O9S A;  2OI3 A;  1PNJ A;  3RNJ A;  5IHN A;  2X3X D;  1Z9Z A;  1LCK A;  3QWY A;  3C0C A;  4J9C A;  2GTO A;  5GJV B;  2J06 A;  2BZX A;  4D8K A;  2HDA A;  3H0F A;  2YUN A;  2CUD A;  4HVU A;  2HSP A;  1T0J A;  2O88 A;  4RTY A;  2AKK A;  4FSS A;  2CSQ A;  1B3Q A;  2DX1 A;  2KBT A;  2V1Q A;  1X69 A;  1UJY A;  1AZG B;  1FMK A;  2JTE A;  2ENM A;  2JMC A;  1E7O A;  1GBQ A;  2EKH A;  2MOX A;  4HCK A;  2VKN A;  3JV3 A;  1WXB A;  2LQW A;  1RI9 A;  3TSW A;  2DBK A;  3I5S A;  1GBR A;  3VS1 A;  2EGC A;  2RQR A;  4OMN A;  1SHG A;  1G2B A;  4J9F A;  1GFD A;  1E6G A;  4RTW A;  1KFZ A;  2K79 A;  2W10 A;  4OMO A;  1X6B A;  3H0H A;  4J9B A;  1PRL C;  1AOJ A;  2RPN A;  2ROL A;  5IHI A;  2DL4 A;  3VS5 A;  2C0O A;  4AFZ C;  2FRY A;  2K3B A;  3UA6 A;  2GNC A;  2KXC A;  4AFS C;  2DL5 A;  1GCQ C;  3EG0 A;  2B86 A;  2M0Y A;  5HCK A;  1JEG A;  2KRO A;  2A37 A;  1GFC A;  2G6F X;  3VS7 A;  1UEC A;  2EYX A;  4EIK A;  2EYZ A;  2NWM A;  2PNI A;  3EGU A;  3UAT A;  1X6G A;  4IIM A;  2KYB A;  5IXF A;  1QCF A;  1SEM A;  2YUO A;  1IO6 A;  4ESR A;  4JJD A;  2FPE A;  2X3W D;  1TUD A;  1A0N B;  2D1X A;  5ECA A;  1AWJ A;  2J6K A;  2SEM A;  5GJW B;  1V1C A;  3VS0 A;  4JZ3 A;  2JXB A;  1AD5 A;  2D8H A;  3O5Z A;  1M3C A;  3PVL A;  2FRW A;  1PHT A;  2KRM A;  2DE0 X;  4HVW A;  3R6N A;  2DYB A;  1HJD A;  2CT3 A;  2BZY A;  2DL8 A;  2ED0 A;  2AZS A;  4J9D A;  1BBZ A;  2DM1 A;  4OML A;  2GTJ A;  1JU5 C;  1JXM A;  4GBQ A;  2RQV A;  1UGV A;  3I9Q A;  3ULR B;  2RQT A;  4X1V A;  1SHF A;  1NEB A;  1PKS A;  2FEI A;  1BU1 A;  1UFF A;  4RTX A;  2V1R A;  3EHQ A;  2BZ8 A;  2L3P A;  1K9A A;  2L2P A;  4F16 A;  1X2Q A;  2EW3 A;  1GCQ A;  2I0N A;  4LN2 A;  1H3H A;  3EG2 A;  4JJC A;  2KEA A;  4AG1 C;  1MUZ A;  2KT1 A;  2LQN A;  2DBM A;  2RQU A;  3VS2 A;  3FJ5 A;  1YWO A;  3SEM A;  2KNB B;  2LJ0 A;  1EFN A;  1QKW A;  1GRI A;  2KYM A;  3I35 A;  2LMJ A;  1X2K A;  4Z89 A;  1I1J A;  5IHK A;  4K11 A;  1W1F A;  1VA7 A;  2KRN A;  1M3B A;  3GBQ A;  3REA B;  2RQW A;  3LH5 A;  1WA7 A;  2YDL A;  1ZSG A;  3NGP A;  2LJ3 A;  1BK2 A;  2JM8 A;  2YSQ A;  1CKB A;  2GBQ A;  2DRM A;  2O9V A;  2CRE A;  1WXT A;  2JS0 A;  1M8M A;  2EGE A;  1UUE A;  5FW9 A;  2K7A A;  2JW4 A;  4JJB A;  2LNH B;  2EYY A;  2EVR A;  1YN8 A;  4J9G A;  5FWB A;  3VRZ A;  1Y0M A;  2AKL A;  2A36 A;  1RLP C;  3PE0 A;  4HXJ A;  3NPF A;  2NUZ A;  1T0H A;  1AWX A;  3EG3 A;  1W6X A;  1FYN A;  2DJQ A;  3VS4 A;  1OOT A;  2SRC A;  2CH4 A;  1WFW A;  5EC7 A;  1N5Z A;  4J9H A;  2LZ6 B;  2ABL A;  4OMQ A;  2CT4 A;  4J9E A;  3KFV A;  1VYV A;  3EG1 A;  4AFQ C;  1UHC A;  1UJ0 A;  2DA9 A;  4LE9 A;  2MCN A;  1Z9Q A;  1X43 A;  4D8D A;  2FPF A;  1HD3 A;  1H8K A;  4RUG A;  1ARK A;  4CC3 A;  4A63 B;  2HCK A;  3ZL7 C;  1YWP A;  3M0P A;  1KJW A;  4LUE A;  3UF4 A;  1RUW A;  2PZ1 A;  4R0K A;  4Z8A A;  2J05 A;  3IQL A;  1K76 A;  1NYG A;  4LUD A;  5FWC A;  1AVZ C;  2DF6 A;  1HSQ A;  4HVV A;  3PVQ A;  1ZUU A;  4J9I A;  2KRS A;  2CSI A;  3VS3 A;  1NLO C;  1M27 C;  1WLP B;  4M4Z A;  2IIM A;  1QLY A;  2C0I A;  2AK5 A;  3RBB B;  2OAW A;  2FPD A;  2AZV A;  1PWT A;  2LP5 A;  2EPD A;  4ORZ A;  4Z88 A;  1U3O A;  2DMO A;  2ROT A;  2EBP A;  1CKA A;  2EGA A;  1S1N A;  2L3S A;  1UTI A;  1X27 A;  1H92 A;  1RLQ C;  4RTU A;  1Y57 A;  3M0R A;  4IIO A;  2F2X A;  4Y92 A;  1J3T A;  1BB9 A;  3A98 A;  2K6D A;  4OMM A;  1UHF A;  4WCI A;  4E6R A;  2ECZ A;  2ED1 A;  3VS6 A;  2KXD A;  1WXU A;  2LJ1 A;  3H0I A;  1UG1 A;  1WDX A;  1ABO A;  1SSH A;  2RNA A;  4F14 A;  2DL3 A;  5L23 A;  3H41 A;  2DLP A;  2O2O A;  4DEX A;  1I0C A;  1JXO A;  1OV3 A;  1AWW A;  1YNZ A;  1QWF A;  3NMZ C;  1AWO A;  1PKT A;  2LX7 A;  2J6F A;  1NLP C;  2CH4 W;  1XOV A;  4KRT A;  4AG2 C;  2YT6 A;  2PTK A; 
#chains in the Genus database with same CATH topology
 1VQP A;  3OYN A;  5I22 A;  1SG5 A;  1T3S A;  5LJ3 e;  1HK9 A;  1MGQ A;  2DRK A;  2K4Y A;  3LW5 E;  2QTX A;  5C6S A;  3DLL A;  2W0Z A;  4NL2 A;  1RAA B;  3RKW A;  1K0X A;  2H8H A;  4BE0 A;  3HFN A;  4QQG A;  3HRT A;  1VQK A;  1KC8 C;  1VQ4 Q;  4F17 A;  1R8O B;  2WSF E;  2DIL A;  3CCS T;  3EH2 A;  1XJW B;  1MV3 A;  4C92 F;  1SRL A;  4BD3 A;  2C06 A;  2XU8 A;  3SWN B;  2FO0 A;  4BUG A;  3U23 A;  1K73 C;  3TVT A;  2LT1 A;  4C92 D;  1KSW A;  1YP5 A;  1AZE A;  1ZX6 A;  2MK5 A;  1QKX A;  1YHQ Q;  3HRU A;  1B07 A;  1E6H A;  2LVM A;  2DTO A;  3L1A A;  2E1H A;  2P4R A;  3QWX X;  4NL3 A;  2VGN A;  2L0A A;  1M3A A;  5GAN f;  3PIP A;  1FMV A;  2QA4 Q;  2C0T A;  3LH0 A;  2E5K A;  2GGR A;  4QVD A;  5FU6 C;  2K3X A;  4PJM A;  2EIF A;  4IUT A;  1RAI B;  3EGD A;  1QW1 A;  1KD1 U;  1NJI R;  1KG1 A;  2WAC A;  2YXY A;  1D1A A;  3RUX A;  3WVD B;  2CDT A;  1WYX A;  2QQA A;  1OU9 A;  1BCM A;  5CKE A;  3I56 A;  4AMC A;  3M0U A;  3PMT A;  4BI4 A;  1YCS B;  2EQI A;  1VQO A;  5KH6 A;  2D8J A;  4JLG A;  1ABQ A;  1NYF A;  1VQL Q;  3QDF A;  2QXF A;  2D9T A;  2DVJ A;  1NG2 A;  1U5S A;  2OI3 A;  3JB9 D;  2CP5 A;  5GAO r;  3JCM e;  4QVZ A;  2YLC A;  3I56 T;  2J06 A;  2BZX A;  4D8K A;  1YIT Q;  2HDA A;  2QEX A;  4M7D D;  2YUN A;  3V8K A;  2CUD A;  3X20 B;  4FSS A;  2CSQ A;  2E41 A;  2QGF B;  4C0Z A;  3CXC P;  4DOV A;  4QQ6 A;  4GLK A;  3VS1 A;  1QVG S;  4JRQ A;  3V7R A;  2RQR A;  3M56 A;  1GFD A;  1E6G A;  2KMT A;  3CC7 T;  1KFZ A;  3MKD A;  1C0M A;  1X6B A;  3FC3 A;  3E1S A;  5C0M A;  1TUG B;  3VS5 A;  4BB7 A;  2R57 A;  2D0Q B;  5FRN A;  1OUL A;  2VUB A;  3UA6 A;  2DPP B;  4KGZ B;  2GNC A;  2KXC A;  4AFS C;  2DL5 A;  5HCK A;  1OQK A;  3OYG A;  1JJ2 P;  5KCO A;  3M57 A;  1GFC A;  5LL6 S;  4EPC A;  2EYZ A;  1MNE A;  2PNI A;  1M5Q 1;  4DBH A;  3UAT A;  5GAN d;  1K9M C;  2K57 A;  3VYH B;  1D0X A;  2QQ9 A;  1IO6 A;  4M78 F;  2FZG B;  4JJD A;  3SFM A;  2IG0 A;  4M7D A;  1BIB A;  3C12 A;  2FPE A;  1TUD A;  1NBE B;  4M77 A;  5DM7 R;  3JB9 J;  4M78 D;  4O6J A;  1AWJ A;  1VQP Q;  1OZ3 A;  3VS0 A;  4JZ3 A;  4AT1 B;  2BIV A;  3MCA B;  3GPL A;  2MWP A;  5D6Y A;  3EFR A;  2D8H A;  1YIJ A;  1UGQ B;  3OY9 A;  1M2O A;  2DVE A;  4C5I A;  4C8Q A;  4ZGD B;  1NPP A;  3R6N A;  4ZN3 A;  2DYB A;  5CKD A;  1VQK Q;  4FYW B;  2V8J A;  3EFO B;  2BE7 D;  6AT1 B;  2RHI A;  2AZS A;  4J9D A;  2Y90 A;  1HXD A;  1KQ1 A;  4BE2 A;  4LDY A;  1JXM A;  2RQV A;  1N9R A;  1JBM A;  1FX7 A;  1OI1 A;  1NEB A;  2O01 E;  1RAD B;  2FEI A;  3CCM T;  1BU1 A;  3LLR A;  2O4X B;  4RTX A;  2NUP A;  2V1R A;  1M1G A;  4ANJ A;  1K9A A;  2HZY A;  1K8A R;  1GCQ A;  4FU6 A;  2I0N A;  1H3H A;  4M75 A;  1MUZ A;  2KT1 A;  1QVG A;  5KYY B;  2DBM A;  2RQU A;  2RHZ A;  4F04 B;  2LCL A;  4M7A A;  3EG9 B;  3JRZ A;  1VQ7 T;  2COY A;  2DAQ A;  1WQW A;  2KRN A;  1WZO A;  4P5N A;  4C5H A;  3C94 A;  2YDL A;  4PLL A;  4C5G A;  2LQ8 A;  1OZ2 A;  1CKB A;  2KSS A;  2O9V A;  2CRE A;  4F7U B;  4ZTF A;  5M9O A;  5GMK j;  5GAN 6;  1VQO Q;  2JS0 A;  5FW9 A;  8AT1 B;  3I55 T;  4XTU A;  7AT1 B;  2EYY A;  4J5Y A;  5FWB A;  1Y0M A;  2FVU A;  4MZM A;  4HXJ A;  3NTH A;  3BW1 A;  1TWB A;  3CCU A;  4ME7 A;  2QEX Q;  1WHM A;  2CH4 A;  4F7U G;  3BFM A;  5KE3 A;  1QP2 A;  2LZ6 B;  2ABL A;  4OB2 B;  2CP6 A;  1JRI A;  2CT4 A;  4AFQ C;  1Q81 R;  2LDM A;  3A8L B;  1X75 C;  2I2L A;  3SDZ A;  3SWN A;  2OTJ Q;  2CZ6 B;  3QO3 A;  4ELY C;  3CCU T;  3M55 A;  4OMF B;  4GY5 A;  5FU7 B;  9ATC B;  1KD1 C;  1ARK A;  3HPW A;  2HCK A;  1C1A A;  3M0P A;  1YWP A;  2QQR A;  2L5Q A;  3LX7 A;  4LUE A;  1YFN A;  2ZZD A;  3IQL A;  2K5I A;  3DLM A;  3CCJ Q;  1VQN A;  1YJ9 A;  3CBP A;  3C95 A;  2VAS A;  1M90 R;  3PVQ A;  4J9I A;  2H3J A;  2CZ1 B;  1G3S A;  1M4Z A;  2PVO B;  5GAN e;  1RAH B;  2IIM A;  4V2S A;  3OQ5 A;  1LPL A;  2ZGW A;  3SWN C;  4KGV B;  2XD0 A;  1VQN T;  2AZV A;  1Q86 R;  1YJN A;  4N0A A;  2FZK B;  2LP5 A;  4CRI A;  1XTD A;  4E47 A;  2DMO A;  2HL3 A;  3MP8 A;  2DIQ A;  4IUV A;  2CZ7 B;  1Y57 A;  4IIO A;  3L2W A;  5KYN A;  4WCI A;  4E6R A;  1Q82 R;  2ECZ A;  5A0G A;  1YJN T;  4J8O A;  1YIJ Q;  1HYO A;  3GNG A;  1UG1 A;  4C92 B;  1ABO A;  1SSH A;  4F14 A;  4HT9 A;  2DL3 A;  4EMK A;  2DLP A;  3OW2 S;  4O5V A;  3LGL A;  4FSX A;  3FEO A;  3OBW A;  4Y28 E;  3G4S T;  1IRE B;  1AWW A;  1KC8 R;  3NMZ C;  2LX7 A;  2J6F A;  1Q95 G;  3CC2 A;  2CH4 W;  1PG5 B;  4C92 G;  4JRI A;  1VQ6 A;  4RTZ A;  1K73 R;  4Z02 A;  4A4E A;  1MV0 B;  3CMA Q;  2D0N A;  3QYG B;  2XKO C;  1ZBJ A;  1KQS S;  3EAE A;  3A8O B;  2KT8 A;  5KYU B;  3VRY A;  4LDW A;  4C0F A;  1QMC A;  2LQK A;  3OS0 A;  3X24 B;  1WHJ A;  1QWE A;  3NHN A;  1VQ6 T;  4FM4 B;  3S3N A;  2RHY A;  2HKN A;  2OTL A;  2XID A;  1I4K 1;  2JM9 A;  2J7I A;  2ESW A;  2VVK A;  2JMA A;  4C0D C;  1G8X A;  2KI7 A;  1V29 B;  2K9G A;  2YUQ A;  4PJO A;  2FB7 A;  2ZPF B;  1M8V A;  4A4F A;  5L8R E;  2L3R A;  1WPY A;  4HCB A;  2M1H A;  2MIO A;  3QZ5 B;  5GAN 2;  2DNU A;  4KGX B;  3AT1 B;  1ZQ1 A;  5KYW A;  3GOX A;  3TU4 K;  1PD1 A;  4FT2 A;  2CP2 A;  1M30 A;  3CCQ T;  4KUL A;  4LXC A;  1WHG A;  4A4H A;  4GLM A;  2RK1 A;  2HBW A;  1Y7X A;  2EQM A;  2KGT A;  3S3M A;  2LTO A;  2MMP A;  1IGU A;  2J6O A;  2KR3 A;  3UA7 A;  2EYW A;  2V26 A;  2EJG A;  4FIB A;  2KE9 A;  5HY6 A;  2DEQ A;  1M1K U;  2JTF A;  3CCU Q;  3OBY A;  4JZ4 A;  3G71 T;  4KBM B;  1ZSZ A;  4KT0 E;  4KUI A;  1O9S A;  4LDU A;  3G6E A;  3MEA A;  3BY7 A;  1NPR A;  1R0B G;  1Y96 B;  2GQI A;  2P0Q A;  4XU1 A;  3UPU A;  5HK0 A;  2H3E B;  3PMI A;  3JCM P;  3TCJ A;  2BTT A;  1ZUY A;  2QAZ A;  2E4H A;  1S72 A;  3G6E T;  2JJ9 A;  2O9S A;  1PNJ A;  5IHN A;  2X3X D;  2RK2 A;  2OAU A;  3C0C A;  3QWY A;  1M9S A;  4J9C A;  3QBY A;  4L6V 5;  5GJV B;  1UEB A;  2M9U A;  2O88 A;  1YJ9 Q;  1B3Q A;  4PFO A;  4FYV B;  1D09 B;  2X9H A;  2RJE A;  2VC8 A;  3MEW A;  2MOX A;  2E3I A;  1MHN A;  3OYY A;  3MJX A;  5D6X A;  2VKN A;  3PGG A;  1RI9 A;  3I5S A;  3DB4 A;  4M78 B;  4MDX A;  3ER0 A;  1G2B A;  4FL6 A;  2NUT A;  1MMN A;  4OMO A;  3DB3 A;  4J9B A;  3CCS A;  2RPN A;  4OB0 B;  2YRV A;  1KHI A;  3PIO A;  2RB6 A;  2M02 A;  2YLB A;  2P84 A;  1K9M R;  4TVR A;  3V7S A;  4M78 G;  2JNG A;  3UDC A;  2RI2 A;  2P4T A;  3EGX B;  4IKF A;  4J6W A;  2VGM A;  2M0Y A;  2ZPH B;  3CCV T;  2FHD A;  1KHC A;  5GAM g;  1JEG A;  1H3Z A;  4LDX A;  1D3B A;  4X9D A;  4PLI A;  2G6F X;  3QJY A;  2M16 A;  4F7U E;  5FLX E;  1QQJ A;  3OYA A;  1X6G A;  3ASK A;  1SEM A;  3RES A;  3DKM A;  3PFS A;  3CC2 Q;  1SF9 A;  2CP0 A;  1VQ8 Q;  2J6K A;  3M58 A;  1V1C A;  1H64 1;  1WJS A;  3PVL A;  1PHT A;  2KRM A;  4XU2 A;  5LJ3 j;  3JCM V;  2EKO A;  4LD9 K;  2DE0 X;  1RAF B;  2DER A;  2WSE E;  3JSC A;  4BDZ A;  2OTL Q;  1G3W A;  2DL8 A;  3GLX A;  2ED0 A;  4ZGJ B;  2DM1 A;  4OML A;  1MMA A;  2GTJ A;  4A53 A;  2AHJ B;  2PUO B;  3FDR A;  3NTK A;  4HT8 A;  3JB9 F;  5GAM h;  2QI2 A;  1D1B A;  1PKS A;  5LJ5 g;  5A0D A;  2RM4 A;  4M7D F;  2HQX A;  3EHQ A;  2L3P A;  1UGS B;  2HNI A;  3FIF A;  3A5Z B;  4M77 F;  3NTI A;  5FU7 C;  2L2P A;  4F16 A;  1X2Q A;  3QKJ A;  4LN2 A;  2RJF A;  3CC7 A;  4OF1 A;  2XIC A;  4M77 D;  1D1C A;  1EZZ B;  3L2R A;  2ATC B;  1EFN A;  2KYM A;  1VQ9 A;  4C8Q F;  1X2K A;  3E2U A;  1M2V B;  4E7K A;  1VUB A;  3MEV A;  5IHK A;  2LC4 A;  4J83 A;  4C8Q D;  3S3O A;  3GBQ A;  2ZAE A;  5KE2 A;  1SKU B;  4ZN1 A;  2RQW A;  3URG A;  2KY9 A;  1ZSG A;  3JCM J;  1BK2 A;  4OGC A;  2JM8 A;  2YSQ A;  1VQ9 T;  2DRM A;  1I5O B;  2QGG A;  1BI3 A;  4C92 E;  4IUQ A;  2EGE A;  2K7A A;  2KK4 A;  2JW4 A;  4A54 A;  3RER A;  2LNH B;  1IZ6 A;  4HCC A;  1S72 Q;  1N9S A;  3CC4 A;  2E65 A;  2FL7 A;  2PVG B;  5GMK h;  3NPF A;  1T0H A;  3OSV A;  1AWX A;  1TOV A;  4M75 F;  1Q7Y R;  1KD1 R;  4MMK A;  2DJQ A;  3VS4 A;  1QVF P;  1OOT A;  1ZBX A;  3QDR B;  5LJ5 h;  4XTY A;  2E6N A;  4C92 C;  1N5Z A;  3QII A;  5CQY A;  4M75 D;  1WJQ A;  4M7A F;  3CXC S;  2KVQ G;  3P8H A;  2XDD A;  3MP1 A;  5GAN 8;  3CCE T;  5KYX B;  2VXF A;  1VOM A;  3CC4 T;  3OS5 A;  1N27 A;  3CCR T;  4DBQ A;  4M7A D;  1UHC A;  3KUF A;  1KQ2 A;  3X25 B;  1W2B P;  1M1K C;  1WHK A;  3A8G B;  4D8D A;  4QKU A;  1HD3 A;  3CCS Q;  4OB1 B;  4A4K A;  1H8K A;  3OSS C;  2X4X A;  4CC3 A;  3VU3 C;  2R5A A;  4XTX A;  3OYL A;  3UF4 A;  2E10 A;  4RKU E;  2E70 A;  5KCH A;  3SD4 A;  5D7U A;  1N8R U;  2K5L A;  1MMG A;  1QCO A;  2YWW A;  1K76 A;  3CCM A;  1IXD A;  1JJ2 S;  3M5A A;  4J7I A;  4JUV A;  1HSQ A;  4HVV A;  5GAM j;  1WLP B;  2CKK A;  4M4Z A;  5AT1 B;  3QPH A;  2OAW A;  3VV0 A;  3HRS A;  3R6O A;  4DBF A;  1B34 A;  1PWT A;  1Y96 A;  1U3O A;  2ROT A;  4FCY A;  1CKA A;  5GMK e;  1VQ7 A;  4JJN K;  1S1N A;  3JCM W;  1H92 A;  3M0R A;  3ME9 A;  2F2X A;  4Y92 A;  3OS1 A;  1IHV A;  2K6D A;  1UHF A;  1NZ9 A;  2ED1 A;  4R55 A;  2KXD A;  1WXU A;  1YCY A;  3O8V A;  1WDX A;  1G3Y A;  1MMD A;  3H41 A;  5GMK l;  3I55 A;  4B9W A;  2RI3 A;  3L2Q A;  2L8D A;  1JXO A;  2EJF A;  1M1F A;  2AT1 B;  1QWF A;  3I56 Q;  3J80 E;  1PKT A;  3FLG A;  3QJ6 A;  5LJ3 f;  1M90 U;  1NLP C;  3L2U A;  2HKQ B;  1WQ7 A;  1BIA A;  1LNX A;  5LJ5 j;  5D6W A;  3BE3 A;  3OYH A;  2D6F A;  5I11 A;  1UDL A;  3CXC A;  1Q86 U;  2YRC A;  3GNF B;  3RDV A;  4M78 E;  3CC7 Q;  2RF0 A;  1CSK A;  1JO8 A;  1U06 A;  4FYX B;  1VQM T;  3RMQ A;  1FXX A;  3WVE B;  4PK4 A;  2DXC A;  4E7H A;  2DZC A;  2DYI A;  4NS5 A;  3JCM b;  3E9F A;  2HBP A;  1U8R A;  2DD5 A;  3HKS A;  1VQ5 A;  2EQJ A;  1NM7 A;  3JCM Q;  3T9N A;  2RMO A;  2L3Q A;  4RTV A;  4RTT A;  4M78 C;  2LRQ A;  2HD0 A;  3M0Q A;  3A1P A;  1GCP A;  2F1L A;  1WHL A;  1JJ2 A;  2F2V A;  1SRM A;  2F2W A;  1VQ5 T;  8ATC B;  5GAO l;  4BI3 A;  4DEY A;  4RG8 A;  1QVF A;  3CQT A;  2A3L A;  1OPK A;  1OPL A;  5CQX A;  3REB B;  3M0T A;  2YUP A;  1W70 A;  3AHU A;  4WTO B;  1XQH A;  2HQH A;  2HL5 C;  1G83 A;  3CME T;  3F70 A;  5DY9 A;  3EGD B;  3CD6 A;  1WX6 A;  4QT7 A;  2FG0 A;  1VYT A;  2L89 A;  2VWF A;  4BY6 B;  1ZUK A;  4CC7 A;  2QK0 A;  3THK A;  1WIE A;  5IT9 E;  1WI7 A;  1TUC A;  2CUB A;  2ZPB B;  5GAO q;  1K0S A;  4PJO F;  2RHX A;  2GF7 A;  3CBM A;  4LNP A;  2M51 A;  3JCM f;  4OMP A;  5HKC A;  1GL5 A;  1T3L A;  4L5G A;  3CD6 T;  2X4Y A;  4PJO D;  3G4S A;  2RJC A;  1UE9 A;  1YI2 T;  3RIR A;  4Y91 A;  5CO7 A;  3RNJ A;  2B8A A;  4BDY A;  3MO8 A;  5I2S A;  3CPW P;  2JUF A;  3OS2 A;  3H0F A;  1TSF A;  3CCM Q;  1T0J A;  4J7F A;  2DX1 A;  3FRN A;  2V1Q A;  1UJY A;  1AZG B;  1VQ4 A;  2JTE A;  2ENM A;  1GBQ A;  1U1S A;  3JV3 A;  2P0K A;  2GFA A;  4HKE A;  1WXB A;  2LQW A;  3TSW A;  3LWH A;  2DBK A;  1GBR A;  5J3B A;  4EMG A;  2E6Z A;  2EGC A;  3FJP A;  4RTW A;  2W10 A;  1D0Y A;  2QAS A;  3H0H A;  1PRL C;  1QVP A;  3GIB A;  2ROL A;  3ZEH A;  1VQ4 T;  2EYQ A;  3M4Y A;  5GAM f;  1VIF A;  4AFZ C;  1VQ7 Q;  3N5B B;  2FRY A;  5LJ3 g;  3QXE B;  3MP6 A;  2RH2 A;  2QYZ A;  3OYD A;  2VV5 A;  3EG0 A;  2B86 A;  2QTV A;  5EG2 A;  2ZPE B;  3M54 A;  2QA4 A;  1YHQ T;  2KRO A;  1BYM A;  2IVW A;  2A37 A;  1FWZ A;  3VS7 A;  3CCQ A;  4JS4 A;  2EYX A;  3I55 Q;  1LOJ A;  3OYI A;  1RI0 A;  2KYB A;  2A7Y A;  1N8R C;  1QCF A;  2QA4 T;  4FT4 A;  4MZT A;  4ESR A;  1GXI E;  4M7D B;  2D1X A;  4M77 B;  3G71 A;  2SEM A;  5GJW B;  3JB9 G;  5CAI A;  3LGF A;  2JXB A;  1AD5 A;  3M4G A;  3O5Z A;  1M3C A;  2FRW A;  3J7A F;  4M7D G;  4C0G A;  1W4S A;  3FB9 A;  4M77 G;  4C8Q B;  3EFO A;  2BZY A;  5LJ5 f;  3C4S A;  1VQL T;  5LJ3 h;  3X26 B;  3HP9 A;  3OYM A;  2RD1 A;  3TQ7 P;  1JU5 C;  3CBO A;  4B9X A;  1V76 A;  4IUR A;  1UGV A;  3I9Q A;  1YIT T;  4C8Q G;  1SHF A;  2O4X A;  4A4G A;  3HFO A;  4JRK A;  2NUP B;  2P0P A;  2QQS A;  2GCX A;  1ZA1 B;  2EW3 A;  4IUP A;  2RI5 A;  3JCM g;  4JJC A;  2KEA A;  4M75 B;  5KYY A;  1VQN Q;  1M90 C;  3VS2 A;  4C5E A;  3FJ5 A;  3PT9 A;  5FRM A;  2K3Y A;  4M7A B;  2LJ0 A;  3EG9 A;  4HCZ A;  5GAM d;  3HHT B;  1AHJ B;  4BAC A;  3KXT A;  1QKW A;  1GRI A;  3I35 A;  3QG1 A;  2LMJ A;  4Z89 A;  3QHS A;  2DFU A;  1Q86 C;  4E7Z A;  1W1F A;  4M75 G;  3CCV A;  1G3T A;  1YJN Q;  1IGQ A;  3Q1J A;  3REA B;  1NJI U;  1WA7 A;  4E7J A;  4M7A G;  2LJ3 A;  2NLU A;  3V8L A;  2X4W A;  1NE8 A;  4F7U A;  2E64 A;  1WXT A;  3J81 E;  4PL6 A;  1QP3 A;  1UUE A;  1TXQ A;  3P8B B;  3OYJ A;  3G4S Q;  1OU8 A;  3VJP A;  4J9G A;  1M1K R;  5GAN 3;  1U1T A;  3X28 B;  2AKL A;  2A36 A;  1RLP C;  3PE0 A;  1SSF A;  1BI1 A;  1XNI A;  3L42 A;  1W6X A;  1FYN A;  5CVI A;  1WFW A;  5A0L A;  1C6V X;  2M0O A;  4XTW A;  3LWI A;  4JLI A;  1VQP T;  4D6W A;  3L2V A;  4J9E A;  3JCM h;  2DK3 A;  3H6Z A;  2XDB A;  1EIF A;  4XQ3 A;  2OX7 A;  1VQ6 Q;  2DA9 A;  4LE9 A;  1BKB A;  1ZA2 B;  2QG9 B;  3EFS A;  1VQK T;  5LJ5 d;  5AYF A;  3ZL7 C;  1ACM B;  2A0F B;  1RUW A;  4LDV A;  4R0K A;  4Z8A A;  1D0Z A;  4QVC A;  2GFU A;  1IRX A;  3QSU A;  3WXM B;  1NYG A;  4LUD A;  5FWC A;  1AVZ C;  3SB2 A;  2E12 A;  1DJ7 B;  1Y07 A;  2CSI A;  2ZPI B;  2XG8 D;  4DQ2 A;  1NLO C;  3CCQ Q;  1QLY A;  1TTH B;  1QVG P;  2AK5 A;  1Q7Y U;  4DOW A;  5DLO A;  3RBB B;  3ZBD A;  5GMK m;  2EPD A;  4ORZ A;  2RA2 A;  2EAY A;  4N4G A;  2EGA A;  4YTL A;  2L3S A;  4KH0 B;  1RLQ C;  3G71 Q;  1J3T A;  1F1B B;  4OMM A;  1PM3 A;  2HSE B;  3VS6 A;  3OA6 A;  2LJ1 A;  2CS7 A;  4R56 A;  4C92 A;  4XTZ A;  2E3H A;  4PFP A;  2MWO A;  5L23 A;  2O2O A;  4EMK B;  1VQO T;  3G6E Q;  2XK0 A;  1BI2 A;  4DEX A;  5GAN 5;  1I0C A;  3JCM X;  1OV3 A;  2BE9 B;  4C0D B;  4JS5 A;  2DET A;  1AWO A;  1WHH A;  4BY6 C;  4PJN A;  2OTJ A;  4FW2 A;  2QQB A;  2Y4Y A;  3PNW C;  4KRT A;  5GMK i;  2QEX T;  2YHT A;  2GQV A;  2PTK A;  4ELZ C;  2X35 A;  3CCE A;  2BKD N;  4JPB W;  3CCR A;  1TH7 A;  2DL7 A;  2Z0W A;  1K4U S;  4UC4 A;  5KYU A;  1I07 A;  1JQQ A;  4OGE A;  2A08 A;  4X9C A;  1PD0 A;  1UB4 A;  1K8A U;  2OTJ T;  2JT4 A;  3RMS A;  3TSZ A;  2K2M A;  1G5V A;  5GAM e;  5IXB A;  1K1Z A;  3CCJ A;  4XAX B;  5GAO m;  2OJ2 A;  1RAE B;  2RHU A;  1PC0 A;  3MEU A;  1NEG A;  1RAB B;  1PRM C;  3M0S A;  3VUZ A;  2DEU A;  2DXB A;  1P92 A;  3S6W A;  4PJO B;  5J26 A;  3E9G A;  3OYB A;  3MET A;  5GAN 7;  3CCV Q;  5CKH A;  2PU9 B;  2R5M A;  1WNL A;  3P8D A;  1KIK A;  3CCJ T;  4RG2 A;  4Q5W A;  4QW2 A;  1OEB A;  2X4J A;  2A28 A;  1YJW A;  1SPK A;  4MML A;  3D7S B;  5KYW B;  4ATO A;  2X51 A;  3I5R A;  4PJO G;  2EFI A;  1R77 A;  2LNV A;  4CC2 A;  2DZ9 A;  3G7Z A;  3V7C A;  5IH2 A;  3PTA A;  2JS2 A;  5CK9 A;  2HQE A;  2RN8 A;  1YJW T;  1QVF S;  2HEQ A;  3RKY A;  2ZPG B;  4M7D E;  1TU0 B;  1R0C B;  4M77 E;  1UGP B;  1TG0 A;  5GAN g;  2XDP A;  2LT4 A;  4ZNX A;  1AEY A;  5IN1 A;  1QCN A;  1ZSZ B;  2O31 A;  3SHW A;  3UWN A;  2QDL A;  1FMW A;  3E19 A;  1YIJ T;  3MHX A;  1W2B S;  2JOY A;  2VYT A;  1Q81 U;  2MPX C;  4CC4 B;  3TEE A;  2Y4X A;  4M7D C;  1ZLM A;  2XMF A;  2NYS A;  5LJ5 e;  5GAN 4;  2EWN A;  4C8Q E;  3V8J A;  4M77 C;  4AFU C;  3EHR A;  2LCS A;  3CEY A;  4J6Y A;  3CMA A;  1VYU A;  1Z9Z A;  4KH1 B;  1LCK A;  4FW1 A;  2GTO A;  1NJI C;  1EX4 A;  4XK8 E;  4OB3 B;  2E5Q A;  2CZ0 B;  2CYZ B;  4HVU A;  1ZHI A;  2HSP A;  4RTY A;  2AKK A;  4ZTJ A;  4C8Q C;  2KBT A;  1X69 A;  2XI9 A;  1FMK A;  2JMC A;  1E7O A;  2EKH A;  2FZC B;  4HCK A;  3CMA T;  4PKC C;  4E7L A;  4E7I A;  4M78 A;  4XU0 A;  1WJR A;  3HTR A;  4OMN A;  1SHG A;  4RMO A;  4J9F A;  1VQM A;  2K79 A;  4M75 E;  1RAC B;  2NUT B;  1RAG B;  3JB9 I;  1N6A A;  4EDU A;  1AOJ A;  5IHI A;  2DL4 A;  4M7A E;  2C0O A;  1N8R R;  5CIU A;  2K2V A;  5GAN h;  2K3B A;  3EGX A;  2MF2 A;  1GCQ C;  3L2Z A;  2FYK A;  4M75 C;  3OB9 A;  5FU6 B;  5CKB A;  2DKG A;  3JAM E;  1Q82 U;  1VQ9 Q;  4M7A C;  4E2F B;  1D3B B;  1UEC A;  4EIK A;  2NWM A;  3QUI A;  3EGU A;  4JRP A;  1Y71 A;  5HK3 A;  4IIM A;  5IXF A;  2YUO A;  2DO3 A;  2V8K A;  5IAY A;  3CME A;  2X3W D;  2EQK A;  1KC8 U;  1A0N B;  5FRO A;  5ECA A;  4L59 A;  1WGS A;  3OYE A;  2YRD A;  4LD6 A;  5GAO p;  4XTV A;  3CCE Q;  1IHW A;  3CC4 Q;  2JTM A;  1K73 U;  2MAM A;  3CCR Q;  1Q7Y C;  2CP7 A;  3BDL A;  1OX8 A;  3QYH B;  2RJD A;  1UGR B;  4HVW A;  3CCL A;  3RKX A;  3OYC A;  1W2B A;  2HMA A;  3INZ A;  1HJD A;  3MPU B;  2CT3 A;  2F5K A;  1YI2 A;  2DTI A;  4J6X A;  4N4H A;  5A2Q E;  2COW A;  3TRE A;  1I5L A;  3OW2 P;  4E7S A;  4IUU A;  4EMH A;  1BBZ A;  2JZ2 A;  4DA4 A;  1JB0 E;  4GBQ A;  2EQU A;  4KUD K;  2DTH A;  4OP0 A;  3ULR B;  3CCL T;  2RQT A;  4X1V A;  4CI0 C;  3KBG A;  1AT1 B;  1UFF A;  1YJ9 T;  2PVD B;  1RL2 A;  2VB6 A;  1YJW Q;  2BZ8 A;  1KQS P;  2DXU A;  4RCC A;  5LJ3 d;  3EG2 A;  4II1 A;  4AG1 C;  2KAF A;  2LQN A;  2XHC A;  1YWO A;  4MZP A;  2R58 A;  3SEM A;  2KNB B;  4XU3 A;  2RO0 A;  3M53 A;  2IPO B;  1M2V A;  1LJO A;  1VIE A;  3JB9 H;  4B6M A;  1I1J A;  2WSC E;  4K11 A;  1VA7 A;  5GAN j;  1M3B A;  5DLQ E;  1PSF A;  1K8A C;  2PQW A;  1BI0 A;  1YHQ A;  3LH5 A;  1BCO A;  5CCA A;  3VYG A;  3NGP A;  4N0A C;  2COZ A;  4PNO A;  5GAO n;  2ZCF B;  2GBQ A;  1YBY A;  4BE1 A;  3H8Z A;  2JN0 A;  2DJZ A;  1VQ8 A;  1I8F A;  1M8M A;  5J39 A;  2K5F A;  3VKI A;  4JJB A;  3JCM c;  2EVR A;  1YN8 A;  4HA8 A;  3VRZ A;  3CPW S;  2QDY B;  2V8I A;  3A8M B;  2NUZ A;  1KK7 A;  3EG3 A;  3HSB A;  1LVK A;  2SRC A;  3CC2 T;  1OYX A;  3GF5 A;  5EC7 A;  1VQ8 T;  4QQD A;  2DXT A;  4J9H A;  1X01 A;  1I81 A;  4OMQ A;  4EMK C;  5KYX A;  2DD4 A;  3KFV A;  1VYV A;  3EG1 A;  3HL8 A;  2LCC A;  2PUK B;  3RR6 A;  3VUB A;  1UJ0 A;  3OYK A;  3H9N A;  1VQM Q;  4MDW A;  2MCN A;  1Z9Q A;  1X43 A;  2FPF A;  1VQL A;  4VUB A;  2OTL T;  1B7T A;  2CGH A;  4RUG A;  3OYF A;  4PJJ A;  4A63 B;  4F7U F;  1MND A;  1KJW A;  1O75 A;  2VXE A;  2PZ1 A;  3M59 A;  5I2M A;  2J05 A;  5CKF A;  1K9M U;  1YIT A;  4PJO E;  3JCM d;  4FYY B;  1Q81 C;  3A8H B;  2DF6 A;  2AIR B;  2F5T X;  4WF2 A;  1ZUU A;  2KRS A;  3VS3 A;  1VQ5 Q;  2MYS A;  2KQW A;  5CR2 A;  3NFC A;  1M27 C;  4RCB A;  3BDU A;  1PCX A;  2MI6 A;  2C0I A;  2KDS A;  4PJO C;  2FPD A;  1PSE A;  4ZGE B;  1X6O A;  1B34 B;  2EJ9 A;  3G1J A;  4Z88 A;  3UT1 A;  2EBP A;  3CME Q;  2LX9 A;  3OMC A;  1UTI A;  1X27 A;  3LYI A;  1TS9 A;  4RTU A;  3GP8 A;  1BB9 A;  3A98 A;  3CPF A;  4NOY A;  3EH1 A;  3ZFJ A;  3OW2 A;  4JDS A;  4BI8 B;  2JVV A;  3H0I A;  2F69 A;  1IB8 A;  1OX9 A;  5I21 A;  3CCL Q;  3CD6 Q;  2RNA A;  1YI2 Q;  2G3R A;  4N4I A;  3QZ9 B;  4DBR A;  2HAX A;  1S72 T;  1YNZ A;  3OMG A;  1ZSZ C;  4PFZ A;  3CPW A;  1KQS A;  2CP3 A;  2BUD A;  2DIG A;  1XOV A;  4X34 A;  1Q82 C;  3M9Q A;  4PJL A;  4AG2 C;  4OVA A;  2YT6 A; 
#chains in the Genus database with same CATH homology
 5I22 A;  1T3S A;  1MV0 B;  2D0N A;  1ZBJ A;  2DRK A;  4JPB W;  1UDL A;  5I11 A;  2DL7 A;  1K4U S;  2KT8 A;  1I07 A;  1JQQ A;  3VRY A;  2A08 A;  4RTZ A;  2W0Z A;  2RF0 A;  1K0X A;  2JT4 A;  1CSK A;  1JO8 A;  2H8H A;  1U06 A;  3TSZ A;  2K2M A;  1QWE A;  3NHN A;  5IXB A;  1K1Z A;  2OJ2 A;  4F17 A;  2JM9 A;  2J7I A;  2DIL A;  1NEG A;  2ESW A;  2VVK A;  1PRM C;  1MV3 A;  2JMA A;  1SRL A;  3M0S A;  1NM7 A;  2K9G A;  2FO0 A;  2YUQ A;  3U23 A;  2RMO A;  2L3Q A;  3TVT A;  4RTV A;  4RTT A;  1KSW A;  1YP5 A;  1AZE A;  1ZX6 A;  1KIK A;  3M0Q A;  1QKX A;  1OEB A;  1GCP A;  1B07 A;  1E6H A;  2MIO A;  2A28 A;  2DNU A;  1SPK A;  2F2V A;  2P4R A;  3QWX X;  1SRM A;  2F2W A;  4DEY A;  3I5R A;  1M30 A;  2L0A A;  1M3A A;  4CC2 A;  3CQT A;  4GLM A;  5IH2 A;  2HBW A;  2C0T A;  2KGT A;  1OPK A;  1OPL A;  2JS2 A;  2J6O A;  3REB B;  2KR3 A;  2E5K A;  3UA7 A;  3M0T A;  2EYW A;  2GGR A;  2YUP A;  1W70 A;  2RN8 A;  2KE9 A;  2HEQ A;  1G83 A;  4JZ4 A;  1TG0 A;  1WX6 A;  4ZNX A;  4QT7 A;  1AEY A;  2FG0 A;  1VYT A;  2VWF A;  2O31 A;  3SHW A;  1ZUK A;  2GQI A;  4CC7 A;  2CDT A;  3THK A;  1WIE A;  1WYX A;  1WI7 A;  2QDL A;  1TUC A;  2CUB A;  1K0S A;  3M0U A;  4LNP A;  4CC4 B;  1YCS B;  2M51 A;  2EQI A;  4OMP A;  1ZLM A;  2XMF A;  1T3L A;  1GL5 A;  2BTT A;  2D8J A;  1ABQ A;  1NYF A;  1ZUY A;  4AFU C;  3EHR A;  2DVJ A;  1NG2 A;  2LCS A;  1UE9 A;  1U5S A;  1VYU A;  2O9S A;  2OI3 A;  1PNJ A;  3RNJ A;  5IHN A;  2X3X D;  1Z9Z A;  1LCK A;  3QWY A;  3C0C A;  4J9C A;  2GTO A;  5GJV B;  2J06 A;  2BZX A;  4D8K A;  2HDA A;  3H0F A;  2YUN A;  2CUD A;  4HVU A;  2HSP A;  1T0J A;  2O88 A;  4RTY A;  2AKK A;  4FSS A;  2CSQ A;  1B3Q A;  2DX1 A;  2KBT A;  2V1Q A;  1X69 A;  1UJY A;  1AZG B;  1FMK A;  2JTE A;  2ENM A;  2JMC A;  1E7O A;  1GBQ A;  2EKH A;  2MOX A;  4HCK A;  2VKN A;  3JV3 A;  1WXB A;  2LQW A;  1RI9 A;  3TSW A;  2DBK A;  3I5S A;  1GBR A;  3VS1 A;  2EGC A;  2RQR A;  4OMN A;  1SHG A;  1G2B A;  4J9F A;  1GFD A;  1E6G A;  4RTW A;  1KFZ A;  2K79 A;  2W10 A;  4OMO A;  1X6B A;  3H0H A;  4J9B A;  1PRL C;  1AOJ A;  2RPN A;  2ROL A;  5IHI A;  2DL4 A;  3VS5 A;  2C0O A;  4AFZ C;  2FRY A;  2K3B A;  3UA6 A;  2GNC A;  2KXC A;  4AFS C;  2DL5 A;  1GCQ C;  3EG0 A;  2B86 A;  2M0Y A;  5HCK A;  1JEG A;  2KRO A;  2A37 A;  1GFC A;  2G6F X;  3VS7 A;  1UEC A;  2EYX A;  4EIK A;  2EYZ A;  2NWM A;  2PNI A;  3EGU A;  3UAT A;  1X6G A;  4IIM A;  2KYB A;  5IXF A;  1QCF A;  1SEM A;  2YUO A;  1IO6 A;  4ESR A;  4JJD A;  2FPE A;  2X3W D;  1TUD A;  1A0N B;  2D1X A;  5ECA A;  1AWJ A;  2J6K A;  2SEM A;  5GJW B;  1V1C A;  3VS0 A;  4JZ3 A;  2JXB A;  1AD5 A;  2D8H A;  3O5Z A;  1M3C A;  3PVL A;  2FRW A;  1PHT A;  2KRM A;  2DE0 X;  4HVW A;  3R6N A;  2DYB A;  1HJD A;  2CT3 A;  2BZY A;  2DL8 A;  2ED0 A;  2AZS A;  4J9D A;  1BBZ A;  2DM1 A;  4OML A;  2GTJ A;  1JU5 C;  1JXM A;  4GBQ A;  2RQV A;  1UGV A;  3I9Q A;  3ULR B;  2RQT A;  4X1V A;  1SHF A;  1NEB A;  1PKS A;  2FEI A;  1BU1 A;  1UFF A;  4RTX A;  2V1R A;  3EHQ A;  2BZ8 A;  2L3P A;  1K9A A;  2L2P A;  4F16 A;  1X2Q A;  2EW3 A;  1GCQ A;  2I0N A;  4LN2 A;  1H3H A;  3EG2 A;  4JJC A;  2KEA A;  4AG1 C;  1MUZ A;  2KT1 A;  2LQN A;  2DBM A;  2RQU A;  3VS2 A;  3FJ5 A;  1YWO A;  3SEM A;  2KNB B;  2LJ0 A;  1EFN A;  1QKW A;  1GRI A;  2KYM A;  3I35 A;  2LMJ A;  1X2K A;  4Z89 A;  1I1J A;  5IHK A;  4K11 A;  1W1F A;  1VA7 A;  2KRN A;  1M3B A;  3GBQ A;  3REA B;  2RQW A;  3LH5 A;  1WA7 A;  2YDL A;  1ZSG A;  3NGP A;  2LJ3 A;  1BK2 A;  2JM8 A;  2YSQ A;  1CKB A;  2GBQ A;  2DRM A;  2O9V A;  2CRE A;  1WXT A;  2JS0 A;  1M8M A;  2EGE A;  1UUE A;  5FW9 A;  2K7A A;  2JW4 A;  4JJB A;  2LNH B;  2EYY A;  2EVR A;  1YN8 A;  4J9G A;  5FWB A;  3VRZ A;  1Y0M A;  2AKL A;  2A36 A;  1RLP C;  3PE0 A;  4HXJ A;  3NPF A;  2NUZ A;  1T0H A;  1AWX A;  3EG3 A;  1W6X A;  1FYN A;  2DJQ A;  3VS4 A;  1OOT A;  2SRC A;  2CH4 A;  1WFW A;  5EC7 A;  1N5Z A;  4J9H A;  2LZ6 B;  2ABL A;  4OMQ A;  2CT4 A;  4J9E A;  3KFV A;  1VYV A;  3EG1 A;  4AFQ C;  1UHC A;  1UJ0 A;  2DA9 A;  4LE9 A;  2MCN A;  1Z9Q A;  1X43 A;  4D8D A;  2FPF A;  1HD3 A;  1H8K A;  4RUG A;  1ARK A;  4CC3 A;  4A63 B;  2HCK A;  3ZL7 C;  1YWP A;  3M0P A;  1KJW A;  4LUE A;  3UF4 A;  1RUW A;  2PZ1 A;  4R0K A;  4Z8A A;  2J05 A;  3IQL A;  1K76 A;  1NYG A;  4LUD A;  5FWC A;  1AVZ C;  2DF6 A;  1HSQ A;  4HVV A;  3PVQ A;  1ZUU A;  4J9I A;  2KRS A;  2CSI A;  3VS3 A;  1NLO C;  1M27 C;  1WLP B;  4M4Z A;  2IIM A;  1QLY A;  2C0I A;  2AK5 A;  3RBB B;  2OAW A;  2FPD A;  2AZV A;  1PWT A;  2LP5 A;  2EPD A;  4ORZ A;  4Z88 A;  1U3O A;  2DMO A;  2ROT A;  2EBP A;  1CKA A;  2EGA A;  1S1N A;  2L3S A;  1UTI A;  1X27 A;  1H92 A;  1RLQ C;  4RTU A;  1Y57 A;  3M0R A;  4IIO A;  2F2X A;  4Y92 A;  1J3T A;  1BB9 A;  3A98 A;  2K6D A;  4OMM A;  1UHF A;  4WCI A;  4E6R A;  2ECZ A;  2ED1 A;  3VS6 A;  2KXD A;  1WXU A;  2LJ1 A;  3H0I A;  1UG1 A;  1WDX A;  1ABO A;  1SSH A;  2RNA A;  4F14 A;  2DL3 A;  5L23 A;  3H41 A;  2DLP A;  2O2O A;  4DEX A;  1I0C A;  1JXO A;  1OV3 A;  1AWW A;  1YNZ A;  1QWF A;  3NMZ C;  1AWO A;  1PKT A;  2LX7 A;  2J6F A;  1NLP C;  2CH4 W;  1XOV A;  4KRT A;  4AG2 C;  2YT6 A;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...