1W1FA

Sh3 domain of human lyn tyrosine kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE LYN
publication title Structural Characterization of Lyn-SH3 Domain in Complex with a Herpesviral Protein Reveals an Extended Recognition Motif that Enhances Binding Affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3-domain
total genus 8
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w1fA00
1M3AA 1NEBA 2M0YA 2KROA 1I1JA 5IHNA 2D8JA 5ECAA 2DM1A 2L2PA 4HXJA 4EIKA 2AKKA 1PHTA 1PKSA 1ZUKA 2JM9A 3LH5A 3I5RA 1UECA 2HDAA 2C0OA 3TVTA 1SHFA 1UHFA 1SHGA 4LNPA 2HCKA 1M3CA 2YUQA 2JS0A 2EYXA 4JJDA 1PRLC 4ESRA 1BBZA 4JJBA 1X2QA 2EQIA 1W1FA 2ECZA 1E6GA 2VWFA 4Y92A 5IHIA 1UG1A 2CH4A 1G83A 1XOVA 2DLPA 2JTEA 2KNBB 5IH2A 2DJQA 1UJ0A 4Z89A 3SHWA 1M8MA 3FJ5A 3EG1A 5GJWB 2LX7A 2DILA 3PE0A 2AKLA 4J9GA 2EKHA 4CC4B 1AWOA 1ZBJA 2KRMA 2CT3A 2F2WA 1AWXA 1TG0A 3NGPA 3EG0A 4LE9A 5FWBA 1X27A 2K79A 2L0AA 2OI3A 4J9CA 5FWCA 3NHNA 2CDTA 2ESWA 1S1NA 1T0JA 3VRYA 4AFUC 4K11A 2EGAA 1WDXA 1UE9A 4A63B 2DNUA 2IIMA 1UUEA 2KXDA 4J9DA 1SRMA 1MUZA 2RN8A 1JEGA 4GLMA 2D8HA 3M0UA 1AD5A 1YN8A 1SRLA 2AK5A 2EYYA 3VS3A 2KE9A 2GTJA 2VVKA 1RI9A 1ZSGA 1LCKA 1WI7A 2E5KA 2GBQA 2DL7A 2LJ3A 1VYTA 3M0QA 2FRWA 3M0TA 1SEMA 1UHCA 1K9AA 4R0KA 2D0NA 1AZEA 4RTZA 5EC7A 1H3HA 2J6OA 2GQIA 1RLPC 3VS1A 1WFWA 2V1RA 1OV3A 3TSZA 1QLYA 3ZL7C 2P4RA 1B3QA 2LNHB 2PZ1A 1YNZA 2NWMA 3JV3A 1H92A 4AFSC 1CSKA 4OMQA 4ORZA 2GTOA 2FPFA 1X6BA 4RUGA 3PVQA 2DA9A 1QCFA 1KFZA 3GBQA 1U3OA 3VS5A 2JMAA 2DX1A 1ABOA 1YWPA 5IXFA 4J9EA 3REAB 2LZ6B 2W10A 2DVJA 2K3BA 3NPFA 2L3SA 1J3TA 2PNIA 3UA7A 1QWFA 1GCQC 1WIEA 2KT1A 1OOTA 5I11A 1ABQA 4LUEA 4M4ZA 1WXBA 2BZYA 4F14A 2O9SA 2K2MA 3I9QA 2FEIA 1PNJA 3IQLA 3UF4A 1YWOA 2RQVA 2KRNA 2SRCA 4AFZC 2YT6A 1K0XA 2W0ZA 2L3PA 1I07A 1Y0MA 5GJVB 1PKTA 2LCSA 3EHRA 1Z9ZA 2CSIA 1X43A 2PTKA 2BZ8A 2RQUA 2YUOA 2B86A 1NYFA 4JPBW 1K4US 1CKAA 2DF6A 2LQNA 2J06A 3H41A 3EGUA 4IIOA 3A98A 2CSQA 3RNJA 3VS7A 4FSSA 2RMOA 2JM8A 2AZVA 1T0HA 4HCKA 2A08A 4OMMA 4ZNXA 3M0PA 4Z88A 1K1ZA 4DEXA 2EPDA 3THKA 2M51A 2K9GA 3O5ZA 5L23A 1ZX6A 2FPEA 1JU5C 2FPDA 2J6KA 1AZGB 4OMOA 4WCIA 5IXBA 1UFFA 2G6FX 4CC2A 2O88A 2RNAA 4J9FA 2DRKA 3I5SA 1EFNA 3TSWA 2FO0A 1I0CA 1TUCA 1OEBA 3VS4A 3QWYA 1WLPB 2KRSA 1Z9QA 1WA7A 2MCNA 2JW4A 4AG2C 4HVWA 4F17A 2H8HA 1GBRA 1WXUA 4HVVA 4QT7A 1SPKA 1CKBA 4RTVA 2LJ1A 1V1CA 2BZXA 2KT8A 2CUBA 2CH4W 1TUDA 2DYBA 2ROLA 3U23A 1AVZC 1OPLA 4F16A 1A0NB 1FMKA 2F2VA 1K0SA 3H0FA 1E7OA 3EHQA 2FG0A 1WXTA 4AG1C 2OJ2A 2DE0X 1UGVA 2MOXA 1KJWA 2O9VA 1JXMA 1AWWA 2RPNA 4RTTA 2L3QA 1GCQA 1X2KA 3REBB 3I35A 2DBMA 1BK2A 4JJCA 4KRTA 3RBBB 1WX6A 4RTXA 2I0NA 2A36A 2DL8A 1E6HA 2ENMA 1YCSB 3CQTA 1JQQA 2CUDA 5FW9A 2FRYA 1GBQA 1JXOA 2AZSA 1YP5A 1QKXA 2VKNA 1MV3A 1BU1A 2DL5A 1QKWA 2KBTA 2KYMA 2LJ0A 3QWXX 1T3SA 2D1XA 2HBWA 2RF0A 2YUNA 3UATA 2V1QA 2EYWA 2A28A 2CREA 1UTIA 1X6GA 1AWJA 2EW3A 2NUZA 4GBQA 4D8DA 2QDLA 4X1VA 5HCKA 4J9IA 2DL4A 1MV0B 3H0HA 1NLPC 1M3BA 2LMJA 3VS6A 1ZUUA 1OPKA 1ZLMA 2X3XD 5IHKA 5I22A 1UJYA 2ED0A 4RTUA 1W6XA 1GCPA 2YUPA 1NYGA 1U5SA 4J9BA 3R6NA 4D8KA 1IO6A 3C0CA 1BB9A 2X3WD 1GL5A 2O2OA 4HVUA 1AOJA 2XMFA 2RQRA 2GGRA 3NMZC 1T3LA 3SEMA 2O31A 2DL3A 2MIOA 1SSHA 2HSPA 4JZ4A 1JO8A 1M30A 1M27C 1W70A 2BTTA 2GNCA 1G2BA 2ROTA 4CC3A 2RQTA 2LQWA 2DMOA 2ED1A 2KGTA 1ARKA 1HSQA 1PRMC 2JMCA 3H0IA 1ZUYA 2DBKA 1WYXA 2HEQA 2KYBA 1U06A 3EG2A 2C0TA 1FYNA 3M0SA 2JT4A 4CC7A 2EYZA 1RUWA 1VYUA 4LN2A 2YDLA 2KXCA 4RTYA 2F2XA 2LP5A 3M0RA 4RTWA 1KIKA 1K76A 1NLOC 3KFVA 1NM7A 2CT4A 2J6FA 1H8KA 4AFQC 4OMNA 1NG2A 2J7IA 1N5ZA 4OMPA 4J9HA 1AEYA 2DRMA 3VS2A 1PWTA 2A37A 2KEAA 2OAWA 2EBPA 1GFDA 1HJDA 1B07A 2ABLA 2RQWA 2J05A 1X69A 1GFCA 4E6RA 4DEYA 1VA7A 1QWEA 2YSQA 3EG3A 3PVLA 4LUDA 3VRZA 2K6DA 1GRIA 2JXBA 2EVRA 3ULRB 1UDLA 1Y57A 2K7AA 1NEGA 2C0IA 3UA6A 1VYVA 2EGEA 4Z8AA 2JS2A 1KSWA 4IIMA 1HD3A 2EGCA 3VS0A 4OMLA 4JZ3A 2SEMA 2KR3A 1RLQC
chains in the Genus database with same CATH superfamily
2LT4A 1V29B 4A54A 2KROA 2EQKA 3L42A 2GF7A 2E1HA 2QQSA 1VQKT 3VJPA 2AKKA 1PKSA 1ZUKA 1OULA 3I5RA 2CZ0B 1G8XA 3TVTA 3QZ5B 1M2VA 2QQRA 1BIBA 2RO0A 4JLGA 1M3CA 1XJWB 2JS0A 2EYXA 2JNGA 1PRLC 3A8HB 4CRIA 4M77E 2PUOB 2CH4A 1G83A 1TUGB 1M2OA 1C0MA 5IH2A 4BACA 1UJ0A 5GMKj 5FRMA 3SHWA 3L2VA 2OAUA 2MWOA 4CC4B 4M77A 2KRMA 4PKCC 2CT3A 3G4SQ 2F2WA 1AWXA 3JAME 4LE9A 4QW2A 2Y90A 2HZYA 1MNEA 2E5QA 4LDXA 4HKEA 1X27A 5KE2A 2K79A 1PSFA 5CKFA 3GIBA 1PCXA 4FW1A 1WQ7A 1GXIE 1T0JA 2QK0A 3A8LB 4L59A 2EGAA 4HT9A 4PJOC 4A63B 3CC4Q 3CCJQ 2K5LA 2CS7A 4L6V5 3CCLQ 4M7DE 2DKGA 4FU6A 1YN8A 2X35A 1SRLA 2EYYA 2DZ9A 3VS3A 2JTFA 5HK3A 2WACA 3CD6Q 2LJ3A 5GAMh 2FZKB 4ANJA 3RKYA 4RCCA 4M7DA 5EC7A 1H3HA 3VV0A 1RLPC 3VS1A 1JJ2S 4II1A 1OV3A 4XU2A 2CZ7B 2FZCB 2DYIA 4EMKB 3G71A 1WJSA 1KK7A 3OBWA 1WHKA 4E7LA 1YNZA 3PIPA 2BE9B 2XD0A 1XNIA 2FPFA 4RUGA 2RJCA 3I56T 3PVQA 2DA9A 3QJYA 4MZPA 1R0BG 3JB9I 5C6SA 4XQ3A 3RMQA 1VQMA 3VUBA 3X28B 4ZTFA 1ABOA 1OZ3A 5LJ3g 2LZ6B 2DVJA 3NPFA 4N0AC 2DPPB 1QWFA 4FT2A 2E41A 1AT1B 3QO3A 3JB9J 5GANg 2R57A 5J26A 2GCXA 4QQGA 1VQ6T 3UF4A 2SRCA 3FRNA 2ZGWA 2F69A 4M78B 4PJMA 3CXCS 1D09B 3JCMc 1MMGA 2CGHA 2BIVA 3ASKA 5FU6C 5IN1A 4FCYA 1Z9ZA 4EMKA 2KI7A 3PTAA 2PTKA 2VASA 2B86A 4AMCA 1N27A 3QSUA 4JPBW 5HY6A 2DF6A 2LQNA 2RHUA 3MJXA 2E3HA 3A98A 5CKHA 3VS7A 4FSSA 2RMOA 5LJ3j 4X9CA 3FLGA 1OX9A 4ZNXA 1FMWA 4Z88A 1K1ZA 1Q86R 3SFMA 3CC2T 2ZZDA 3THKA 5GANj 2M51A 4M78G 3I55T 3RERA 3O5ZA 5L23A 1NPRA 5KYWA 5KYNA 1JU5C 2J6KA 1VQ8Q 3LW5E 1Y96A 3GOXA 2RHIA 2RI2A 1S72Q 2CZ1B 2QYZA 3TSWA 2FO0A 1I0CA 4OGEA 3P8HA 4OB3B 3O8VA 3CPWS 5KYUB 1Q7YU 4C8QB 3G71Q 2COYA 2K4YA 3G1JA 1TU0B 5CO7A 4PJOF 4M77D 4QT7A 3M4YA 3LWHA 4XAXB 1IZ6A 3MCAB 1VQ9T 3CMAQ 3JCMf 2CH4W 1K73C 4A53A 2WSEE 4OP0A 4M75B 1M1KU 3U23A 1M1KC 3QYGB 3QDRB 1FMKA 1VQMQ 3FEOA 5HK0A 2JVVA 1E7OA 4MZTA 1B34A 3OMCA 1VQ9A 3EFOB 3L2ZA 2MOXA 2O9VA 2RPNA 4C8QG 5CCAA 3PNWC 2L3QA 1GCQA 5LJ3f 3RESA 1X2KA 3EG9A 2M16A 3REBB 1VIEA 2E64A 3I35A 4JJCA 1WX6A 3OS5A 3URGA 5GANf 2CUDA 2FRYA 1GBQA 1JXOA 2AZSA 4M7DD 5FU7B 1QKXA 5KYUA 2DJZA 4M75G 2DL5A 2I2LA 1YJ9A 2HSEB 2DIGA 2LJ0A 3CBPA 3V7RA 4E7IA 1YHQA 2RF0A 2P0KA 4B6MA 3UATA 2V1QA 3J80E 1LOJA 2XICA 2XKOC 3VUZA 2KMTA 2X4YA 2R5MA 1KHIA 3C94A 2FHDA 5HCKA 2L89A 5GAMg 1ZSZB 2MF2A 2DAQA 4J6XA 4RCBA 2OTLA 3SWNA 3UDCA 1OPKA 3A8OB 1ZLMA 3L2WA 5I22A 1UJYA 3JCMb 2VC8A 2XDDA 2QAZA 2MWPA 4R55A 1BB9A 1GL5A 2O2OA 1M9SA 4PL6A 2XMFA 1QW1A 2LVMA 1G5VA 5KH6A 1Q81U 1Q81C 5CKBA 5GAN3 4JZ4A 3HFOA 4PFZA 2BTTA 3QUIA 3OS1A 3M58A 1TOVA 1KQ2A 1O75A 2ED1A 3INZA 2CP6A 2KGTA 5GAMj 1HSQA 4KT0E 1PRMC 1JBMA 5LJ5h 3H0IA 1ZUYA 2YRCA 2HEQA 2JT4A 4PNOA 1ZSZA 4CC7A 2EYZA 4N4HA 1ZA1B 4C0DB 3JB9H 2KXCA 4PLIA 3M0RA 2X51A 3KFVA 4ELYC 4Y28E 1VQ4T 2F5TX 3JCMX 3PMTA 2IPOB 4J9HA 1AEYA 2DRMA 2A37A 1GFDA 3EGXA 4N4IA 2LTOA 1B07A 5GAN5 1NJIC 1C6VX 1VQOT 1G3SA 1X69A 1GFCA 2YRDA 4IUUA 2DK3A 2X4XA 4BY6C 3VRZA 2K6DA 1GRIA 2EVRA 3ULRB 2PVDB 1UDLA 1Y57A 1N9RA 1WPYA 1VIFA 1YJ9Q 2DXUA 1NEGA 4C92C 2KAFA 2PUKB 2JS2A 1HD3A 1YHQQ 2QASA 1D0ZA 2EYQA 3CCVQ 3I5SA 1RLQC 1M3AA 2L5QA 1NEBA 1VQNQ 8AT1B 4F7UB 2DD4A 4C0GA 2L2PA 2V8IA 4HXJA 4N4GA 1PHTA 3LH5A 1UECA 2HDAA 2C0OA 3A1PA 1UHFA 1SHGA 3ME9A 4LNPA 5GAMf 1K9MU 1K9MC 3CC7Q 4JJDA 4C5HA 3QXEB 5FROA 3JCMh 1X2QA 4J8OA 4ME7A 2BUDA 1E6GA 4IURA 1IREB 5GAN2 3PT9A 3GP8A 4M7AG 2R5AA 2DVEA 3DKMA 2DJQA 2COZA 3G4ST 1M8MA 3FJ5A 3EG1A 4F7UG 1ZA2B 3HFNA 2LX7A 2AKLA 4J9GA 2EKHA 1WHGA 2M02A 3CCQT 1YI2A 3EG0A 5D7UA 2YXYA 3KUFA 2LT1A 3TCJA 2OX7A 2MMPA 4E2FB 4FM4B 4AT1B 1S1NA 4DBFA 2XIDA 1WDXA 1UE9A 2IIMA 5KYYB 3CCLT 2FVUA 2NLUA 1MUZA 4GLMA 2KQWA 1W4SA 2D8HA 3M0UA 4PFPA 3CCJA 3CC4A 2KE9A 3CD6T 2VVKA 4WTOB 1RI9A 1ZSGA 2HQEA 2QTXA 3CCLA 3EGDA 1LCKA 3RMSA 2DZCA 1M2VB 3M0QA 4ZGDB 3M0TA 1SEMA 1RAAB 2DXCA 4R0KA 2CP0A 3A5ZB 5CVIA 1YFNA 3CD6A 2GQIA 3OSSC 1VQ5A 2V1RA 3S3NA 3TSZA 4PJJA 1H3ZA 3F70A 1Q7YR 2E6ZA 4FL6A 4QVDA 1SF9A 2DXBA 3HHTB 2NWMA 1H92A 4AFSC 1CSKA 4OMQA 1W2BA 3PGGA 1QCFA 1KFZA 4M77B 3HRTA 3GBQA 1U3OA 1PSEA 2O01E 1KC8U 5IXFA 4HCZA 4OGCA 3SD4A 3M54A 2W10A 2K3BA 2L3SA 4XTYA 1J3TA 2PNIA 1PD0A 5KCHA 1KQSS 4MZMA 1R0CB 4FYYB 1VOMA 1RL2A 3M9QA 5CAIA 1WXBA 2HNIA 2O9SA 1PNJA 3CCSQ 4YTLA 4OB2B 1XQHA 5A0DA 2QEXA 3CCEQ 5LJ5g 3E9GA 3MPUB 4E7SA 2YT6A 5CQYA 2VXFA 4C92F 4FIBA 4M77G 5I2SA 2COWA 1Y0MA 1PKTA 3EHRA 2XDBA 2RK1A 3OW2A 3MP1A 4BI3A 2RQUA 4M7DB 1NYFA 1CKAA 3CCMQ 2QTVA 2HBPA 2QQAA 1YI2Q 2J06A 3VYGA 1X01A 2AT1B 2CYZB 2CSQA 4PJOE 4DBRA 3SDZA 1YIJQ 1T0HA 4HCKA 4ZGEB 4Z02A 1BKBA 1I4K1 4OMMA 3M0PA 4KH1B 4XTUA 2H3JA 1WHJA 4KGXB 4NOYA 2LCLA 1VQ8T 2K9GA 4PJOA 4RKUE 5LJ5j 3KBGA 3GLXA 3HTRA 4M7DG 2XI9A 3QYHB 4JS4A 2G6FX 1VQ8A 1IGUA 3L1AA 2HKNA 3X20B 2YLBA 1PC0A 1EFNA 1LJOA 2RHXA 2XDPA 2XHCA 4OVAA 1K8AC 5AYFA 2Y4XA 3VS4A 1WZOA 4PK4A 1VQ5Q 1WLPB 3G71T 1S72A 1Z9QA 1WA7A 4Q5WA 1QVGA 4PFOA 3QKJA 5FU6B 4F17A 3CCRQ 1VQPQ 3NTKA 4BB7A 3TU4K 3OS0A 3CMAT 4J6YA 3OS2A 3JCMg 2LJ1A 1V1CA 3OYDA 2BZXA 1NBEB 2KT8A 2CUBA 1VQMT 4MDXA 3OYCA 1AVZC 2BE7D 2F2VA 3CMAA 3FJPA 2RB6A 3JB9G 3V8LA 2FG0A 5M9OA 1WXTA 1EIFA 1UGVA 4XU3A 4N0AA 1UGQB 2E12A 3V8JA 3MHXA 3S3MA 3P8DA 1N6AA 4IKFA 5KYWB 5CIUA 2DBMA 2RI5A 2QEXQ 4RTXA 1IGQA 2A36A 2DL8A 1Y96B 1RI0A 2EFIA 1HXDA 2P84A 1YP5A 4L5GA 2MK5A 1BU1A 2CP5A 1QKWA 5LJ5f 3A8MB 1D1AA 1T3SA 3ZFJA 2V26A 2YUNA 2X4JA 2EYWA 2A28A 2KY9A 2CREA 1VQKQ 1AWJA 1IHWA 2NUZA 4GBQA 4X1VA 4J9IA 2PVGB 1MV0B 5GAN8 3RDVA 1NLPC 5KE3A 3C95A 4HT8A 1RAHB 1IB8A 3LH0A 4E7HA 3AHUA 4RTUA 1WHLA 4JRPA 2YUPA 3GPLA 1I5LA 1M8VA 5A0GA 1K9MR 4X34A 4JDSA 2CP7A 4D8KA 3C0CA 2X3WD 3OB9A 1B34B 3QIIA 4XTVA 4LDWA 1AOJA 2RQRA 5GAOp 2GGRA 3NMZC 4EMHA 2PU9B 1T3LA 2K3YA 1W2BP 4FYXB 2DL3A 2MIOA 2H3EB 1SSHA 3VKIA 3EG9B 1BI2A 4BD3A 9ATCB 3QHSA 1W70A 1M27C 3DB3A 2GNCA 4ZN1A 2LQWA 2DMOA 4GLKA 1Y71A 2K2VA 1ARKA 2DFUA 2P0QA 3GNGA 1YJWQ 2JMCA 2GFUA 1U06A 3V8KA 3EG2A 1FYNA 4DOVA 2YDLA 1U1TA 4XTZA 4XU1A 3OA6A 2LP5A 2ZPIB 2JTMA 2QG9B 2DEUA 1KIKA 5GMKe 4M78C 4JUVA 2CT4A 2JZ2A 4AFQC 3MEAA 1K73U 2LQKA 2WSCE 1N5ZA 3L2UA 3OW2P 2EQUA 3VS2A 4PJOD 3SWNB 2OAWA 1HJDA 4XTWA 2ABLA 3CBOA 4E6RA 1JJ2A 2YSQA 3EG3A 1QVFP 5GMKi 1FMVA 1YJ9T 4IUVA 3NFCA 4ATOA 2BKDN 5DM7R 1YHQT 5J39A 1VYVA 2EGEA 4Z8AA 3JCMJ 4A4EA 2SEMA 1IRXA 2M0YA 5ECAA 5DY9A 3CPFA 2DM1A 3CCVA 5FRNA 2OTLT 4J7FA 2JM9A 1KC8R 3EH2A 1R8OB 4QKUA 1VQNA 5FLXE 2NUPA 1D0XA 3CC7T 2VB6A 3A8GB 3G7ZA 4BI8B 2E70A 5GAOn 2ZCFB 4DQ2A 4ESRA 1BBZA 2D9TA 4JJBA 1QVGP 1MGQA 2VWFA 2VXEA 2G3RA 3CC7A 5IHIA 1UG1A 4FSXA 1XOVA 2DLPA 3LGLA 2JTEA 4PJNA 5GAOl 1TSFA 3EGXB 2OTJA 2DILA 4M75C 2GFAA 1ZBJA 4BY6B 3NGPA 3H8ZA 4JLIA 5FWBA 3FB9A 3L2QA 4XK8E 4E7KA 2OI3A 2V8JA 4J9CA 2HMAA 4ZGJB 2V8KA 2ESWA 1YJNA 5GAOr 1XTDA 3CC2Q 4EDUA 1TWBA 3NTHA 2DNUA 4IUTA 2KXDA 1FWZA 3OYAA 4MDWA 1X75C 1SRMA 2RN8A 1JEGA 2XU8A 1G3WA 3QJ6A 2WSFE 1RACB 2K5IA 1QMCA 2X9HA 4HA8A 3QDFA 5FU7C 2GTJA 2KSSA 1WI7A 2E5KA 2GBQA 1WGSA 2FRWA 1UHCA 1K9AA 2D0NA 5LJ3e 1AZEA 3UWNA 2VV5A 3DB4A 2NYSA 1QLYA 3ZL7C 2P4RA 4UC4A 1D1BA 3EAEA 4C92E 3CPWA 5GANe 1NJIU 4CI0C 4QVCA 1W2BS 2PZ1A 2QGFB 3M55A 4J6WA 3PIOA 3VYHB 3GF5A 3QBYA 3JCMQ 2DIQA 1QCNA 3E9FA 2GTOA 4C92A 4M78F 3OYEA 2NUTA 2B8AA 1UEBA 3T9NA 3VS5A 2JMAA 1YWPA 5LJ3d 4BDZA 1KQ1A 4J9EA 1U8RA 2ATCB 1PM3A 1VQLA 2EQMA 2RI3A 1WIEA 5GANd 1ABQA 3OYKA 4LUEA 1DJ7B 2BZYA 2K2MA 3CCET 4KUDK 4J5YA 2FEIA 1YWOA 3BW1A 2RQVA 1AHJB 4JRQA 1IHVA 4F04B 3CCSA 3JRZA 2DD5A 1K0XA 3EGDB 3CCEA 2L3PA 1I07A 2KVQG 4A4HA 2LCCA 3X25B 1YITQ 2RA2A 1X43A 4C0DC 3OY9A 2OTJQ 3CCMT 1YI2T 5DLOA 2IVWA 1P92A 4J83A 1K4US 2EAYA 3LX7A 3UPUA 1YIJT 1OYXA 2EJGA 3PFSA 1I81A 4IIOA 2EQJA 4DBQA 2AZVA 1D1CA 3CCMA 2A08A 2R58A 1N8RU 1YJNQ 5CKDA 1N8RC 4FYWB 4DOWA 5KYXA 1BI1A 1MHNA 4DEXA 1YIJA 4C8QF 4M7AE 2QXFA 5GMKl 5HKCA 1JJ2P 1ZX6A 2FPEA 3CC4T 3CCJT 5D6XA 2JUFA 1AZGB 5AT1B 4A4KA 3FDRA 4WF2A 2O88A 3JCMP 3DLLA 1R77A 2RNAA 4M75F 4M7AC 5KCOA 1VQ5T 1Y07A 1NZ9A 4JRKA 1M1GA 1TUCA 1OEBA 3C4SA 2KRSA 1VQPT 3CCRT 2MCNA 2LRQA 4AG2C 2H8HA 2QQ9A 3HSBA 1V76A 5A2QE 1GBRA 1M5Q1 4HVVA 1I5OB 3HKSA 4R56A 1SPKA 1VQPA 3CCRA 1EX4A 1CKBA 4RTVA 3QG1A 2QA4A 4XU0A 3CCUA 2EJ9A 2DYBA 2ROLA 1OPLA 7AT1B 1A0NB 1K0SA 2JJ9A 2HL3A 2LDMA 1K73R 1VQLQ 2VUBA 1EZZB 2DE0X 3Q1JA 3ZEHA 1M1KR 1TXQA 1AWWA 4RTTA 2LC4A 2RM4A 4LD9K 1VQOQ 4KH0B 2QEXT 4PJOB 1BK2A 2E65A 3RBBB 1VQ7A 1E6HA 4C5GA 3OYIA 3CQTA 3H9NA 1JQQA 4PLLA 3E19A 1Q95G 1MV3A 4KUIA 3CMEQ 2KYMA 2YWWA 3QWXX 4C5EA 2D1XA 1JB0E 3J81E 1Y7XA 4OF1A 2E6NA 3OQ5A 3TQ7P 1QVPA 1SSFA 3HL8A 2EW3A 5GAN6 5GAMd 3G6EQ 2QDLA 3M59A 2M1HA 2DL4A 2CP3A 1B7TA 2FL7A 4PJOG 1WQWA 1M3BA 2LMJA 4C92D 1VQKA 3VS6A 1ZUUA 1SG5A 3BY7A 1QVFA 5IHKA 2ED0A 3LYIA 1GCPA 1NYGA 2YLCA 1LPLA 3CPWP 1BCMA 1WHHA 2HD0A 1IO6A 4TVRA 5EG2A 1YCYA 1IXDA 1OU8A 4HVUA 4NL3A 4JJNK 2LX9A 2MPXC 3QZ9B 2F5KA 4BDYA 3SEMA 2O31A 2EIFA 5CR2A 4M77C 2KK4A 4X9DA 1S72T 4MMKA 3CCQQ 2K5FA 1M30A 3OYMA 2Z0WA 2ROTA 2RQTA 1K8AU 4KGVB 4EMGA 1YJWT 2CZ6B 1U1SA 1Q81R 3ER0A 3OYHA 2HQXA 3X26B 3MP6A 2P4TA 2YHTA 2C0TA 1BYMA 1RUWA 1YJWA 3C12A 2QA4Q 4IUPA 3CCUQ 2RJFA 2RH2A 4RTYA 2F2XA 4QVZA 4RTWA 3HP9A 1NLOC 1NM7A 2EKOA 1H8KA 2J7IA 4OMPA 1H641 2GQVA 4M7AF 2RD1A 2E3IA 4M7DC 1PD1A 1OQKA 4F7UF 1WJRA 4Y91A 3BDLA 2RQWA 4O5VA 3J7AF 2J05A 4M7AD 1VQ7Q 3PVLA 3EH1A 1JRIA 5GAOm 1NJIR 3RR6A 2K7AA 4E7ZA 1Q82U 1Q82C 4IIMA 4OMLA 6AT1B 4RG8A 2KR3A 2DERA 3N5BB 4XTXA 4F14A 1QQJA 3I56A 1OZ2A 1I1JA 5IHNA 2D8JA 2HAXA 1BCOA 4VUBA 4BE2A 3FC3A 3M57A 2D6FA 4EIKA 4LXCA 3BE3A 4OB1B 1ACMB 3WVDB 4BUGA 1LVKA 1SHFA 4JS5A 3LLRA 3OYNA 1KQSA 2HCKA 2YUQA 2CP2A 3CEYA 4PJLA 4DA4A 4O6JA 3FIFA 2EQIA 1W1FA 2ECZA 3QPHA 1VQ6A 3S6WA 4Y92A 2L3RA 2PQWA 2RHZA 4EMKC 2KNBB 2DEQA 4Z89A 5GJWB 1WHMA 3M53A 3PE0A 1WJQA 1AWOA 1QCOA 2L8DA 2ZAEA 1QP3A 4C5IA 1TG0A 3HPWA 2VGMA 5DLQE 5I21A 2L0AA 2O4XB 4OMFB 5FWCA 1NPPA 3NHNA 2A7YA 2CDTA 3VRYA 4AFUC 4BE1A 4M78E 4K11A 2QI2A 1N8RR 3P8BB 1UUEA 1M1FA 1MMAA 3CC2A 4J9DA 2IG0A 3I55A 3OYJA 4LDVA 1AD5A 2AK5A 2RHYA 4M78A 4NL2A 5C0MA 2DTIA 4A4GA 2F1LA 4M77F 5CKEA 2DL7A 2NUPB 1VYTA 2AHJB 3OYLA 1RAGB 4RTZA 1Q7YC 2J6OA 4MMLA 1OU9A 4V2SA 3SB2A 1WFWA 2RK2A 5LL6S 2VYTA 1KD1U 1F1BB 1B3QA 1KD1C 2LNHB 1NE8A 4P5NA 4IUQA 3M5AA 5GAOq 1M90U 1D0YA 1M90C 1HYOA 1UGPB 5LJ5e 2JOYA 1G3TA 3JV3A 3OSVA 5IT9E 2ZPGB 2O4XA 3RUXA 4ORZA 1BIAA 2RJEA 1X6BA 3CBMA 4ZTJA 1G3YA 1BI3A 2Y4YA 4C0ZA 3CCVT 3I56Q 2M9UA 2DX1A 1VQNT 1UGSB 3JCMV 2LNVA 3REAB 4M7DF 2M0OA 4B9WA 3R6OA 4C8QE 3UA7A 4J7IA 1GCQC 5GMKm 2KT1A 1OOTA 5I11A 4M4ZA 1N9SA 2XG8D 2E4HA 3KXTA 3M56A 3I9QA 3IQLA 3PMIA 5LJ5d 2KRNA 4JRIA 2P0PA 5L8RE 4C8QA 1VQ6Q 4AFZC 3E2UA 5CQXA 4M75E 2HQHA 4C8QC 3OYGA 5J3BA 1YITT 2W0ZA 1RAEB 4HCBA 2OTJT 5GJVB 2PVOB 2LCSA 4A4FA 3TREA 2CSIA 2FYKA 4BI4A 1VUBA 2X4WA 3CXCA 4RG2A 2BZ8A 2RJDA 3MEVA 2YUOA 1YBYA 2EWNA 1YITA 4M75A 2AIRB 3H41A 2FB7A 3EGUA 4LDYA 8ATCB 3RNJA 2DO3A 2JN0A 1YJNT 2JM8A 3JB9F 3SWNC 3EFRA 2K57A 4EPCA 3EFOA 2DTHA 2EPDA 4LDUA 4C92B 4QQDA 1TH7A 2NUTB 5GMKh 3JB9D 3I55Q 2FPDA 1O9SA 3BDUA 4OMOA 3JCMe 2HL5C 4WCIA 5IXBA 1TTHB 3X24B 1UFFA 5A0LA 1RABB 4CC2A 1BI0A 3OYYA 3RKXA 4J9FA 4FYVB 2DRKA 5IAYA 3WXMB 3QWYA 4ELZC 5D6WA 4E47A 4D6WA 2JW4A 3RKWA 4HVWA 4C92G 1PG5B 1K8AR 4FW2A 2MAMA 1KQSP 1WXUA 1ZSZC 2C06A 3JCMd 1D3BB 2YRVA 1TUDA 3OYBA 3S3OA 1VQ9Q 2DETA 1FXXA 4F16A 1KHCA 4HCCA 4QQ6A 2ZPFB 3META 4NS5A 1VQLT 3H0FA 3EHQA 1M4ZA 1LNXA 5D6YA 4AG1C 1VQ4A 2OJ2A 3JSCA 1KJWA 1JXMA 2DTOA 5KYXB 2QGGA 3MP8A 4FT4A 1MNDA 5GAN7 4M78D 4GY5A 1OI1A 4KULA 1FX7A 4C0FA 3CCST 4LD6A 4KRTA 3EFSA 2I0NA 5CK9A 1SKUB 2ENMA 1VQOA 1YCSB 1I8FA 3AT1B 5FW9A 3WVEB 2HKQB 3CMET 1ZBXA 4M7AB 2LQ8A 2VKNA 3OW2S 2KBTA 3D7SB 3BFMA 2HBWA 2QQBA 1Q82R 2XK0A 3G6ET 2QDYB 3CMEA 1D3BA 1UTIA 1X6GA 2OTLQ 4E7JA 4D8DA 1QVFS 3UT1A 2KDSA 3H0HA 1RAIB 3GNFB 2E10A 1Q86U 1RAFB 1Q86C 5I2MA 3G6EA 1QP2A 3MEUA 2X3XD 4BE0A 3OYFA 4KBMB 1W6XA 3ZBDA 1U5SA 4J9BA 3LGFA 3R6NA 2CKKA 2D0QB 2MYSA 3MKDA 4F7UE 3E1SA 5LJ3h 3JCMW 5GAN4 4OB0B 2EJFA 4C8QD 3OMGA 3V7SA 4M7AA 2HSPA 3HRUA 3G4SA 3M4GA 1MMDA 2VGNA 3H6ZA 1JO8A 5GANh 1G2BA 4CC3A 1X6OA 4F7UA 1QVGS 3CCQA 1TS9A 3HRSA 3DLMA 1UB4A 1ZQ1A 2DBKA 1WYXA 2QA4T 2KYBA 3NTIA 3CCUT 4M75D 4B9XA 3M0SA 3L2RA 1ZHIA 2DXTA 3MO8A 4RMOA 1HK9A 1C1AA 1VYUA 4LN2A 1OX8A 1K76A 2FZGB 4ZN3A 2J6FA 4OMNA 2ZPHB 1NG2A 3VU3C 1VQ4Q 3RIRA 1PWTA 4KGZB 2ZPEB 2KEAA 3CXCP 2EBPA 1UGRB 2A0FB 1KG1A 3V7CA 2A3LA 2MI6A 1VQ7T 3OBYA 4DEYA 1VA7A 5GAMe 1QWEA 3MEWA 4LUDA 3LWIA 2JXBA 2ZPBB 1KD1R 2K3XA 4DBHA 1M90R 2C0IA 3UA6A 1RADB 1KSWA 2EGCA 3VS0A 5KYYA 1MMNA 4JZ3A 1WNLA 1KC8C 3TEEA
chains in the Genus database with same CATH topology
1M3AA 1NEBA 2M0YA 2KROA 1I1JA 5IHNA 2D8JA 5ECAA 2DM1A 2L2PA 4HXJA 4EIKA 2AKKA 1PHTA 1PKSA 1ZUKA 2JM9A 3LH5A 3I5RA 1UECA 2HDAA 2C0OA 3TVTA 1SHFA 1UHFA 1SHGA 4LNPA 2HCKA 1M3CA 2YUQA 2JS0A 2EYXA 4JJDA 1PRLC 4ESRA 1BBZA 4JJBA 1X2QA 2EQIA 1W1FA 2ECZA 1E6GA 2VWFA 4Y92A 5IHIA 1UG1A 2CH4A 1G83A 1XOVA 2DLPA 2JTEA 2KNBB 5IH2A 2DJQA 1UJ0A 4Z89A 3SHWA 1M8MA 3FJ5A 3EG1A 5GJWB 2LX7A 2DILA 3PE0A 2AKLA 4J9GA 2EKHA 4CC4B 1AWOA 1ZBJA 2KRMA 2CT3A 2F2WA 1AWXA 1TG0A 3NGPA 3EG0A 4LE9A 5FWBA 1X27A 2K79A 2L0AA 2OI3A 4J9CA 5FWCA 3NHNA 2CDTA 2ESWA 1S1NA 1T0JA 3VRYA 4AFUC 4K11A 2EGAA 1WDXA 1UE9A 4A63B 2DNUA 2IIMA 1UUEA 2KXDA 4J9DA 1SRMA 1MUZA 2RN8A 1JEGA 4GLMA 2D8HA 3M0UA 1AD5A 1YN8A 1SRLA 2AK5A 2EYYA 3VS3A 2KE9A 2GTJA 2VVKA 1RI9A 1ZSGA 1LCKA 1WI7A 2E5KA 2GBQA 2DL7A 2LJ3A 1VYTA 3M0QA 2FRWA 3M0TA 1SEMA 1UHCA 1K9AA 4R0KA 2D0NA 1AZEA 4RTZA 5EC7A 1H3HA 2J6OA 2GQIA 1RLPC 3VS1A 1WFWA 2V1RA 1OV3A 3TSZA 1QLYA 3ZL7C 2P4RA 1B3QA 2LNHB 2PZ1A 1YNZA 2NWMA 3JV3A 1H92A 4AFSC 1CSKA 4OMQA 4ORZA 2GTOA 2FPFA 1X6BA 4RUGA 3PVQA 2DA9A 1QCFA 1KFZA 3GBQA 1U3OA 3VS5A 2JMAA 2DX1A 1ABOA 1YWPA 5IXFA 4J9EA 3REAB 2LZ6B 2W10A 2DVJA 2K3BA 3NPFA 2L3SA 1J3TA 2PNIA 3UA7A 1QWFA 1GCQC 1WIEA 2KT1A 1OOTA 5I11A 1ABQA 4LUEA 4M4ZA 1WXBA 2BZYA 4F14A 2O9SA 2K2MA 3I9QA 2FEIA 1PNJA 3IQLA 3UF4A 1YWOA 2RQVA 2KRNA 2SRCA 4AFZC 2YT6A 1K0XA 2W0ZA 2L3PA 1I07A 1Y0MA 5GJVB 1PKTA 2LCSA 3EHRA 1Z9ZA 2CSIA 1X43A 2PTKA 2BZ8A 2RQUA 2YUOA 2B86A 1NYFA 4JPBW 1K4US 1CKAA 2DF6A 2LQNA 2J06A 3H41A 3EGUA 4IIOA 3A98A 2CSQA 3RNJA 3VS7A 4FSSA 2RMOA 2JM8A 2AZVA 1T0HA 4HCKA 2A08A 4OMMA 4ZNXA 3M0PA 4Z88A 1K1ZA 4DEXA 2EPDA 3THKA 2M51A 2K9GA 3O5ZA 5L23A 1ZX6A 2FPEA 1JU5C 2FPDA 2J6KA 1AZGB 4OMOA 4WCIA 5IXBA 1UFFA 2G6FX 4CC2A 2O88A 2RNAA 4J9FA 2DRKA 3I5SA 1EFNA 3TSWA 2FO0A 1I0CA 1TUCA 1OEBA 3VS4A 3QWYA 1WLPB 2KRSA 1Z9QA 1WA7A 2MCNA 2JW4A 4AG2C 4HVWA 4F17A 2H8HA 1GBRA 1WXUA 4HVVA 4QT7A 1SPKA 1CKBA 4RTVA 2LJ1A 1V1CA 2BZXA 2KT8A 2CUBA 2CH4W 1TUDA 2DYBA 2ROLA 3U23A 1AVZC 1OPLA 4F16A 1A0NB 1FMKA 2F2VA 1K0SA 3H0FA 1E7OA 3EHQA 2FG0A 1WXTA 4AG1C 2OJ2A 2DE0X 1UGVA 2MOXA 1KJWA 2O9VA 1JXMA 1AWWA 2RPNA 4RTTA 2L3QA 1GCQA 1X2KA 3REBB 3I35A 2DBMA 1BK2A 4JJCA 4KRTA 3RBBB 1WX6A 4RTXA 2I0NA 2A36A 2DL8A 1E6HA 2ENMA 1YCSB 3CQTA 1JQQA 2CUDA 5FW9A 2FRYA 1GBQA 1JXOA 2AZSA 1YP5A 1QKXA 2VKNA 1MV3A 1BU1A 2DL5A 1QKWA 2KBTA 2KYMA 2LJ0A 3QWXX 1T3SA 2D1XA 2HBWA 2RF0A 2YUNA 3UATA 2V1QA 2EYWA 2A28A 2CREA 1UTIA 1X6GA 1AWJA 2EW3A 2NUZA 4GBQA 4D8DA 2QDLA 4X1VA 5HCKA 4J9IA 2DL4A 1MV0B 3H0HA 1NLPC 1M3BA 2LMJA 3VS6A 1ZUUA 1OPKA 1ZLMA 2X3XD 5IHKA 5I22A 1UJYA 2ED0A 4RTUA 1W6XA 1GCPA 2YUPA 1NYGA 1U5SA 4J9BA 3R6NA 4D8KA 1IO6A 3C0CA 1BB9A 2X3WD 1GL5A 2O2OA 4HVUA 1AOJA 2XMFA 2RQRA 2GGRA 3NMZC 1T3LA 3SEMA 2O31A 2DL3A 2MIOA 1SSHA 2HSPA 4JZ4A 1JO8A 1M30A 1M27C 1W70A 2BTTA 2GNCA 1G2BA 2ROTA 4CC3A 2RQTA 2LQWA 2DMOA 2ED1A 2KGTA 1ARKA 1HSQA 1PRMC 2JMCA 3H0IA 1ZUYA 2DBKA 1WYXA 2HEQA 2KYBA 1U06A 3EG2A 2C0TA 1FYNA 3M0SA 2JT4A 4CC7A 2EYZA 1RUWA 1VYUA 4LN2A 2YDLA 2KXCA 4RTYA 2F2XA 2LP5A 3M0RA 4RTWA 1KIKA 1K76A 1NLOC 3KFVA 1NM7A 2CT4A 2J6FA 1H8KA 4AFQC 4OMNA 1NG2A 2J7IA 1N5ZA 4OMPA 4J9HA 1AEYA 2DRMA 3VS2A 1PWTA 2A37A 2KEAA 2OAWA 2EBPA 1GFDA 1HJDA 1B07A 2ABLA 2RQWA 2J05A 1X69A 1GFCA 4E6RA 4DEYA 1VA7A 1QWEA 2YSQA 3EG3A 3PVLA 4LUDA 3VRZA 2K6DA 1GRIA 2JXBA 2EVRA 3ULRB 1UDLA 1Y57A 2K7AA 1NEGA 2C0IA 3UA6A 1VYVA 2EGEA 4Z8AA 2JS2A 1KSWA 4IIMA 1HD3A 2EGCA 3VS0A 4OMLA 4JZ3A 2SEMA 2KR3A 1RLQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M3A A;  1NEB A;  2M0Y A;  2KRO A;  1I1J A;  5IHN A;  2D8J A;  5ECA A;  2DM1 A;  2L2P A;  4HXJ A;  4EIK A;  2AKK A;  1PHT A;  1PKS A;  1ZUK A;  2JM9 A;  3LH5 A;  3I5R A;  1UEC A;  2HDA A;  2C0O A;  3TVT A;  1SHF A;  1UHF A;  1SHG A;  4LNP A;  2HCK A;  1M3C A;  2YUQ A;  2JS0 A;  2EYX A;  4JJD A;  1PRL C;  4ESR A;  1BBZ A;  4JJB A;  1X2Q A;  2EQI A;  1W1F A;  2ECZ A;  1E6G A;  2VWF A;  4Y92 A;  5IHI A;  1UG1 A;  2CH4 A;  1G83 A;  1XOV A;  2DLP A;  2JTE A;  2KNB B;  5IH2 A;  2DJQ A;  1UJ0 A;  4Z89 A;  3SHW A;  1M8M A;  3FJ5 A;  3EG1 A;  5GJW B;  2LX7 A;  2DIL A;  3PE0 A;  2AKL A;  4J9G A;  2EKH A;  4CC4 B;  1AWO A;  1ZBJ A;  2KRM A;  2CT3 A;  2F2W A;  1AWX A;  1TG0 A;  3NGP A;  3EG0 A;  4LE9 A;  5FWB A;  1X27 A;  2K79 A;  2L0A A;  2OI3 A;  4J9C A;  5FWC A;  3NHN A;  2CDT A;  2ESW A;  1S1N A;  1T0J A;  3VRY A;  4AFU C;  4K11 A;  2EGA A;  1WDX A;  1UE9 A;  4A63 B;  2DNU A;  2IIM A;  1UUE A;  2KXD A;  4J9D A;  1SRM A;  1MUZ A;  2RN8 A;  1JEG A;  4GLM A;  2D8H A;  3M0U A;  1AD5 A;  1YN8 A;  1SRL A;  2AK5 A;  2EYY A;  3VS3 A;  2KE9 A;  2GTJ A;  2VVK A;  1RI9 A;  1ZSG A;  1LCK A;  1WI7 A;  2E5K A;  2GBQ A;  2DL7 A;  2LJ3 A;  1VYT A;  3M0Q A;  2FRW A;  3M0T A;  1SEM A;  1UHC A;  1K9A A;  4R0K A;  2D0N A;  1AZE A;  4RTZ A;  5EC7 A;  1H3H A;  2J6O A;  2GQI A;  1RLP C;  3VS1 A;  1WFW A;  2V1R A;  1OV3 A;  3TSZ A;  1QLY A;  3ZL7 C;  2P4R A;  1B3Q A;  2LNH B;  2PZ1 A;  1YNZ A;  2NWM A;  3JV3 A;  1H92 A;  4AFS C;  1CSK A;  4OMQ A;  4ORZ A;  2GTO A;  2FPF A;  1X6B A;  4RUG A;  3PVQ A;  2DA9 A;  1QCF A;  1KFZ A;  3GBQ A;  1U3O A;  3VS5 A;  2JMA A;  2DX1 A;  1ABO A;  1YWP A;  5IXF A;  4J9E A;  3REA B;  2LZ6 B;  2W10 A;  2DVJ A;  2K3B A;  3NPF A;  2L3S A;  1J3T A;  2PNI A;  3UA7 A;  1QWF A;  1GCQ C;  1WIE A;  2KT1 A;  1OOT A;  5I11 A;  1ABQ A;  4LUE A;  4M4Z A;  1WXB A;  2BZY A;  4F14 A;  2O9S A;  2K2M A;  3I9Q A;  2FEI A;  1PNJ A;  3IQL A;  3UF4 A;  1YWO A;  2RQV A;  2KRN A;  2SRC A;  4AFZ C;  2YT6 A;  1K0X A;  2W0Z A;  2L3P A;  1I07 A;  1Y0M A;  5GJV B;  1PKT A;  2LCS A;  3EHR A;  1Z9Z A;  2CSI A;  1X43 A;  2PTK A;  2BZ8 A;  2RQU A;  2YUO A;  2B86 A;  1NYF A;  4JPB W;  1K4U S;  1CKA A;  2DF6 A;  2LQN A;  2J06 A;  3H41 A;  3EGU A;  4IIO A;  3A98 A;  2CSQ A;  3RNJ A;  3VS7 A;  4FSS A;  2RMO A;  2JM8 A;  2AZV A;  1T0H A;  4HCK A;  2A08 A;  4OMM A;  4ZNX A;  3M0P A;  4Z88 A;  1K1Z A;  4DEX A;  2EPD A;  3THK A;  2M51 A;  2K9G A;  3O5Z A;  5L23 A;  1ZX6 A;  2FPE A;  1JU5 C;  2FPD A;  2J6K A;  1AZG B;  4OMO A;  4WCI A;  5IXB A;  1UFF A;  2G6F X;  4CC2 A;  2O88 A;  2RNA A;  4J9F A;  2DRK A;  3I5S A;  1EFN A;  3TSW A;  2FO0 A;  1I0C A;  1TUC A;  1OEB A;  3VS4 A;  3QWY A;  1WLP B;  2KRS A;  1Z9Q A;  1WA7 A;  2MCN A;  2JW4 A;  4AG2 C;  4HVW A;  4F17 A;  2H8H A;  1GBR A;  1WXU A;  4HVV A;  4QT7 A;  1SPK A;  1CKB A;  4RTV A;  2LJ1 A;  1V1C A;  2BZX A;  2KT8 A;  2CUB A;  2CH4 W;  1TUD A;  2DYB A;  2ROL A;  3U23 A;  1AVZ C;  1OPL A;  4F16 A;  1A0N B;  1FMK A;  2F2V A;  1K0S A;  3H0F A;  1E7O A;  3EHQ A;  2FG0 A;  1WXT A;  4AG1 C;  2OJ2 A;  2DE0 X;  1UGV A;  2MOX A;  1KJW A;  2O9V A;  1JXM A;  1AWW A;  2RPN A;  4RTT A;  2L3Q A;  1GCQ A;  1X2K A;  3REB B;  3I35 A;  2DBM A;  1BK2 A;  4JJC A;  4KRT A;  3RBB B;  1WX6 A;  4RTX A;  2I0N A;  2A36 A;  2DL8 A;  1E6H A;  2ENM A;  1YCS B;  3CQT A;  1JQQ A;  2CUD A;  5FW9 A;  2FRY A;  1GBQ A;  1JXO A;  2AZS A;  1YP5 A;  1QKX A;  2VKN A;  1MV3 A;  1BU1 A;  2DL5 A;  1QKW A;  2KBT A;  2KYM A;  2LJ0 A;  3QWX X;  1T3S A;  2D1X A;  2HBW A;  2RF0 A;  2YUN A;  3UAT A;  2V1Q A;  2EYW A;  2A28 A;  2CRE A;  1UTI A;  1X6G A;  1AWJ A;  2EW3 A;  2NUZ A;  4GBQ A;  4D8D A;  2QDL A;  4X1V A;  5HCK A;  4J9I A;  2DL4 A;  1MV0 B;  3H0H A;  1NLP C;  1M3B A;  2LMJ A;  3VS6 A;  1ZUU A;  1OPK A;  1ZLM A;  2X3X D;  5IHK A;  5I22 A;  1UJY A;  2ED0 A;  4RTU A;  1W6X A;  1GCP A;  2YUP A;  1NYG A;  1U5S A;  4J9B A;  3R6N A;  4D8K A;  1IO6 A;  3C0C A;  1BB9 A;  2X3W D;  1GL5 A;  2O2O A;  4HVU A;  1AOJ A;  2XMF A;  2RQR A;  2GGR A;  3NMZ C;  1T3L A;  3SEM A;  2O31 A;  2DL3 A;  2MIO A;  1SSH A;  2HSP A;  4JZ4 A;  1JO8 A;  1M30 A;  1M27 C;  1W70 A;  2BTT A;  2GNC A;  1G2B A;  2ROT A;  4CC3 A;  2RQT A;  2LQW A;  2DMO A;  2ED1 A;  2KGT A;  1ARK A;  1HSQ A;  1PRM C;  2JMC A;  3H0I A;  1ZUY A;  2DBK A;  1WYX A;  2HEQ A;  2KYB A;  1U06 A;  3EG2 A;  2C0T A;  1FYN A;  3M0S A;  2JT4 A;  4CC7 A;  2EYZ A;  1RUW A;  1VYU A;  4LN2 A;  2YDL A;  2KXC A;  4RTY A;  2F2X A;  2LP5 A;  3M0R A;  4RTW A;  1KIK A;  1K76 A;  1NLO C;  3KFV A;  1NM7 A;  2CT4 A;  2J6F A;  1H8K A;  4AFQ C;  4OMN A;  1NG2 A;  2J7I A;  1N5Z A;  4OMP A;  4J9H A;  1AEY A;  2DRM A;  3VS2 A;  1PWT A;  2A37 A;  2KEA A;  2OAW A;  2EBP A;  1GFD A;  1HJD A;  1B07 A;  2ABL A;  2RQW A;  2J05 A;  1X69 A;  1GFC A;  4E6R A;  4DEY A;  1VA7 A;  1QWE A;  2YSQ A;  3EG3 A;  3PVL A;  4LUD A;  3VRZ A;  2K6D A;  1GRI A;  2JXB A;  2EVR A;  3ULR B;  1UDL A;  1Y57 A;  2K7A A;  1NEG A;  2C0I A;  3UA6 A;  1VYV A;  2EGE A;  4Z8A A;  2JS2 A;  1KSW A;  4IIM A;  1HD3 A;  2EGC A;  3VS0 A;  4OML A;  4JZ3 A;  2SEM A;  2KR3 A;  1RLQ C; 
#chains in the Genus database with same CATH topology
 2LT4 A;  1V29 B;  4A54 A;  2KRO A;  2EQK A;  3L42 A;  2GF7 A;  2E1H A;  2QQS A;  1VQK T;  3VJP A;  2AKK A;  1PKS A;  1ZUK A;  1OUL A;  3I5R A;  2CZ0 B;  1G8X A;  3TVT A;  3QZ5 B;  1M2V A;  2QQR A;  1BIB A;  2RO0 A;  4JLG A;  1M3C A;  1XJW B;  2JS0 A;  2EYX A;  2JNG A;  1PRL C;  3A8H B;  4CRI A;  4M77 E;  2PUO B;  2CH4 A;  1G83 A;  1TUG B;  1M2O A;  1C0M A;  5IH2 A;  4BAC A;  1UJ0 A;  5GMK j;  5FRM A;  3SHW A;  3L2V A;  2OAU A;  2MWO A;  4CC4 B;  4M77 A;  2KRM A;  4PKC C;  2CT3 A;  3G4S Q;  2F2W A;  1AWX A;  3JAM E;  4LE9 A;  4QW2 A;  2Y90 A;  2HZY A;  1MNE A;  2E5Q A;  4LDX A;  4HKE A;  1X27 A;  5KE2 A;  2K79 A;  1PSF A;  5CKF A;  3GIB A;  1PCX A;  4FW1 A;  1WQ7 A;  1GXI E;  1T0J A;  2QK0 A;  3A8L B;  4L59 A;  2EGA A;  4HT9 A;  4PJO C;  4A63 B;  3CC4 Q;  3CCJ Q;  2K5L A;  2CS7 A;  4L6V 5;  3CCL Q;  4M7D E;  2DKG A;  4FU6 A;  1YN8 A;  2X35 A;  1SRL A;  2EYY A;  2DZ9 A;  3VS3 A;  2JTF A;  5HK3 A;  2WAC A;  3CD6 Q;  2LJ3 A;  5GAM h;  2FZK B;  4ANJ A;  3RKY A;  4RCC A;  4M7D A;  5EC7 A;  1H3H A;  3VV0 A;  1RLP C;  3VS1 A;  1JJ2 S;  4II1 A;  1OV3 A;  4XU2 A;  2CZ7 B;  2FZC B;  2DYI A;  4EMK B;  3G71 A;  1WJS A;  1KK7 A;  3OBW A;  1WHK A;  4E7L A;  1YNZ A;  3PIP A;  2BE9 B;  2XD0 A;  1XNI A;  2FPF A;  4RUG A;  2RJC A;  3I56 T;  3PVQ A;  2DA9 A;  3QJY A;  4MZP A;  1R0B G;  3JB9 I;  5C6S A;  4XQ3 A;  3RMQ A;  1VQM A;  3VUB A;  3X28 B;  4ZTF A;  1ABO A;  1OZ3 A;  5LJ3 g;  2LZ6 B;  2DVJ A;  3NPF A;  4N0A C;  2DPP B;  1QWF A;  4FT2 A;  2E41 A;  1AT1 B;  3QO3 A;  3JB9 J;  5GAN g;  2R57 A;  5J26 A;  2GCX A;  4QQG A;  1VQ6 T;  3UF4 A;  2SRC A;  3FRN A;  2ZGW A;  2F69 A;  4M78 B;  4PJM A;  3CXC S;  1D09 B;  3JCM c;  1MMG A;  2CGH A;  2BIV A;  3ASK A;  5FU6 C;  5IN1 A;  4FCY A;  1Z9Z A;  4EMK A;  2KI7 A;  3PTA A;  2PTK A;  2VAS A;  2B86 A;  4AMC A;  1N27 A;  3QSU A;  4JPB W;  5HY6 A;  2DF6 A;  2LQN A;  2RHU A;  3MJX A;  2E3H A;  3A98 A;  5CKH A;  3VS7 A;  4FSS A;  2RMO A;  5LJ3 j;  4X9C A;  3FLG A;  1OX9 A;  4ZNX A;  1FMW A;  4Z88 A;  1K1Z A;  1Q86 R;  3SFM A;  3CC2 T;  2ZZD A;  3THK A;  5GAN j;  2M51 A;  4M78 G;  3I55 T;  3RER A;  3O5Z A;  5L23 A;  1NPR A;  5KYW A;  5KYN A;  1JU5 C;  2J6K A;  1VQ8 Q;  3LW5 E;  1Y96 A;  3GOX A;  2RHI A;  2RI2 A;  1S72 Q;  2CZ1 B;  2QYZ A;  3TSW A;  2FO0 A;  1I0C A;  4OGE A;  3P8H A;  4OB3 B;  3O8V A;  3CPW S;  5KYU B;  1Q7Y U;  4C8Q B;  3G71 Q;  2COY A;  2K4Y A;  3G1J A;  1TU0 B;  5CO7 A;  4PJO F;  4M77 D;  4QT7 A;  3M4Y A;  3LWH A;  4XAX B;  1IZ6 A;  3MCA B;  1VQ9 T;  3CMA Q;  3JCM f;  2CH4 W;  1K73 C;  4A53 A;  2WSE E;  4OP0 A;  4M75 B;  1M1K U;  3U23 A;  1M1K C;  3QYG B;  3QDR B;  1FMK A;  1VQM Q;  3FEO A;  5HK0 A;  2JVV A;  1E7O A;  4MZT A;  1B34 A;  3OMC A;  1VQ9 A;  3EFO B;  3L2Z A;  2MOX A;  2O9V A;  2RPN A;  4C8Q G;  5CCA A;  3PNW C;  2L3Q A;  1GCQ A;  5LJ3 f;  3RES A;  1X2K A;  3EG9 A;  2M16 A;  3REB B;  1VIE A;  2E64 A;  3I35 A;  4JJC A;  1WX6 A;  3OS5 A;  3URG A;  5GAN f;  2CUD A;  2FRY A;  1GBQ A;  1JXO A;  2AZS A;  4M7D D;  5FU7 B;  1QKX A;  5KYU A;  2DJZ A;  4M75 G;  2DL5 A;  2I2L A;  1YJ9 A;  2HSE B;  2DIG A;  2LJ0 A;  3CBP A;  3V7R A;  4E7I A;  1YHQ A;  2RF0 A;  2P0K A;  4B6M A;  3UAT A;  2V1Q A;  3J80 E;  1LOJ A;  2XIC A;  2XKO C;  3VUZ A;  2KMT A;  2X4Y A;  2R5M A;  1KHI A;  3C94 A;  2FHD A;  5HCK A;  2L89 A;  5GAM g;  1ZSZ B;  2MF2 A;  2DAQ A;  4J6X A;  4RCB A;  2OTL A;  3SWN A;  3UDC A;  1OPK A;  3A8O B;  1ZLM A;  3L2W A;  5I22 A;  1UJY A;  3JCM b;  2VC8 A;  2XDD A;  2QAZ A;  2MWP A;  4R55 A;  1BB9 A;  1GL5 A;  2O2O A;  1M9S A;  4PL6 A;  2XMF A;  1QW1 A;  2LVM A;  1G5V A;  5KH6 A;  1Q81 U;  1Q81 C;  5CKB A;  5GAN 3;  4JZ4 A;  3HFO A;  4PFZ A;  2BTT A;  3QUI A;  3OS1 A;  3M58 A;  1TOV A;  1KQ2 A;  1O75 A;  2ED1 A;  3INZ A;  2CP6 A;  2KGT A;  5GAM j;  1HSQ A;  4KT0 E;  1PRM C;  1JBM A;  5LJ5 h;  3H0I A;  1ZUY A;  2YRC A;  2HEQ A;  2JT4 A;  4PNO A;  1ZSZ A;  4CC7 A;  2EYZ A;  4N4H A;  1ZA1 B;  4C0D B;  3JB9 H;  2KXC A;  4PLI A;  3M0R A;  2X51 A;  3KFV A;  4ELY C;  4Y28 E;  1VQ4 T;  2F5T X;  3JCM X;  3PMT A;  2IPO B;  4J9H A;  1AEY A;  2DRM A;  2A37 A;  1GFD A;  3EGX A;  4N4I A;  2LTO A;  1B07 A;  5GAN 5;  1NJI C;  1C6V X;  1VQO T;  1G3S A;  1X69 A;  1GFC A;  2YRD A;  4IUU A;  2DK3 A;  2X4X A;  4BY6 C;  3VRZ A;  2K6D A;  1GRI A;  2EVR A;  3ULR B;  2PVD B;  1UDL A;  1Y57 A;  1N9R A;  1WPY A;  1VIF A;  1YJ9 Q;  2DXU A;  1NEG A;  4C92 C;  2KAF A;  2PUK B;  2JS2 A;  1HD3 A;  1YHQ Q;  2QAS A;  1D0Z A;  2EYQ A;  3CCV Q;  3I5S A;  1RLQ C;  1M3A A;  2L5Q A;  1NEB A;  1VQN Q;  8AT1 B;  4F7U B;  2DD4 A;  4C0G A;  2L2P A;  2V8I A;  4HXJ A;  4N4G A;  1PHT A;  3LH5 A;  1UEC A;  2HDA A;  2C0O A;  3A1P A;  1UHF A;  1SHG A;  3ME9 A;  4LNP A;  5GAM f;  1K9M U;  1K9M C;  3CC7 Q;  4JJD A;  4C5H A;  3QXE B;  5FRO A;  3JCM h;  1X2Q A;  4J8O A;  4ME7 A;  2BUD A;  1E6G A;  4IUR A;  1IRE B;  5GAN 2;  3PT9 A;  3GP8 A;  4M7A G;  2R5A A;  2DVE A;  3DKM A;  2DJQ A;  2COZ A;  3G4S T;  1M8M A;  3FJ5 A;  3EG1 A;  4F7U G;  1ZA2 B;  3HFN A;  2LX7 A;  2AKL A;  4J9G A;  2EKH A;  1WHG A;  2M02 A;  3CCQ T;  1YI2 A;  3EG0 A;  5D7U A;  2YXY A;  3KUF A;  2LT1 A;  3TCJ A;  2OX7 A;  2MMP A;  4E2F B;  4FM4 B;  4AT1 B;  1S1N A;  4DBF A;  2XID A;  1WDX A;  1UE9 A;  2IIM A;  5KYY B;  3CCL T;  2FVU A;  2NLU A;  1MUZ A;  4GLM A;  2KQW A;  1W4S A;  2D8H A;  3M0U A;  4PFP A;  3CCJ A;  3CC4 A;  2KE9 A;  3CD6 T;  2VVK A;  4WTO B;  1RI9 A;  1ZSG A;  2HQE A;  2QTX A;  3CCL A;  3EGD A;  1LCK A;  3RMS A;  2DZC A;  1M2V B;  3M0Q A;  4ZGD B;  3M0T A;  1SEM A;  1RAA B;  2DXC A;  4R0K A;  2CP0 A;  3A5Z B;  5CVI A;  1YFN A;  3CD6 A;  2GQI A;  3OSS C;  1VQ5 A;  2V1R A;  3S3N A;  3TSZ A;  4PJJ A;  1H3Z A;  3F70 A;  1Q7Y R;  2E6Z A;  4FL6 A;  4QVD A;  1SF9 A;  2DXB A;  3HHT B;  2NWM A;  1H92 A;  4AFS C;  1CSK A;  4OMQ A;  1W2B A;  3PGG A;  1QCF A;  1KFZ A;  4M77 B;  3HRT A;  3GBQ A;  1U3O A;  1PSE A;  2O01 E;  1KC8 U;  5IXF A;  4HCZ A;  4OGC A;  3SD4 A;  3M54 A;  2W10 A;  2K3B A;  2L3S A;  4XTY A;  1J3T A;  2PNI A;  1PD0 A;  5KCH A;  1KQS S;  4MZM A;  1R0C B;  4FYY B;  1VOM A;  1RL2 A;  3M9Q A;  5CAI A;  1WXB A;  2HNI A;  2O9S A;  1PNJ A;  3CCS Q;  4YTL A;  4OB2 B;  1XQH A;  5A0D A;  2QEX A;  3CCE Q;  5LJ5 g;  3E9G A;  3MPU B;  4E7S A;  2YT6 A;  5CQY A;  2VXF A;  4C92 F;  4FIB A;  4M77 G;  5I2S A;  2COW A;  1Y0M A;  1PKT A;  3EHR A;  2XDB A;  2RK1 A;  3OW2 A;  3MP1 A;  4BI3 A;  2RQU A;  4M7D B;  1NYF A;  1CKA A;  3CCM Q;  2QTV A;  2HBP A;  2QQA A;  1YI2 Q;  2J06 A;  3VYG A;  1X01 A;  2AT1 B;  2CYZ B;  2CSQ A;  4PJO E;  4DBR A;  3SDZ A;  1YIJ Q;  1T0H A;  4HCK A;  4ZGE B;  4Z02 A;  1BKB A;  1I4K 1;  4OMM A;  3M0P A;  4KH1 B;  4XTU A;  2H3J A;  1WHJ A;  4KGX B;  4NOY A;  2LCL A;  1VQ8 T;  2K9G A;  4PJO A;  4RKU E;  5LJ5 j;  3KBG A;  3GLX A;  3HTR A;  4M7D G;  2XI9 A;  3QYH B;  4JS4 A;  2G6F X;  1VQ8 A;  1IGU A;  3L1A A;  2HKN A;  3X20 B;  2YLB A;  1PC0 A;  1EFN A;  1LJO A;  2RHX A;  2XDP A;  2XHC A;  4OVA A;  1K8A C;  5AYF A;  2Y4X A;  3VS4 A;  1WZO A;  4PK4 A;  1VQ5 Q;  1WLP B;  3G71 T;  1S72 A;  1Z9Q A;  1WA7 A;  4Q5W A;  1QVG A;  4PFO A;  3QKJ A;  5FU6 B;  4F17 A;  3CCR Q;  1VQP Q;  3NTK A;  4BB7 A;  3TU4 K;  3OS0 A;  3CMA T;  4J6Y A;  3OS2 A;  3JCM g;  2LJ1 A;  1V1C A;  3OYD A;  2BZX A;  1NBE B;  2KT8 A;  2CUB A;  1VQM T;  4MDX A;  3OYC A;  1AVZ C;  2BE7 D;  2F2V A;  3CMA A;  3FJP A;  2RB6 A;  3JB9 G;  3V8L A;  2FG0 A;  5M9O A;  1WXT A;  1EIF A;  1UGV A;  4XU3 A;  4N0A A;  1UGQ B;  2E12 A;  3V8J A;  3MHX A;  3S3M A;  3P8D A;  1N6A A;  4IKF A;  5KYW B;  5CIU A;  2DBM A;  2RI5 A;  2QEX Q;  4RTX A;  1IGQ A;  2A36 A;  2DL8 A;  1Y96 B;  1RI0 A;  2EFI A;  1HXD A;  2P84 A;  1YP5 A;  4L5G A;  2MK5 A;  1BU1 A;  2CP5 A;  1QKW A;  5LJ5 f;  3A8M B;  1D1A A;  1T3S A;  3ZFJ A;  2V26 A;  2YUN A;  2X4J A;  2EYW A;  2A28 A;  2KY9 A;  2CRE A;  1VQK Q;  1AWJ A;  1IHW A;  2NUZ A;  4GBQ A;  4X1V A;  4J9I A;  2PVG B;  1MV0 B;  5GAN 8;  3RDV A;  1NLP C;  5KE3 A;  3C95 A;  4HT8 A;  1RAH B;  1IB8 A;  3LH0 A;  4E7H A;  3AHU A;  4RTU A;  1WHL A;  4JRP A;  2YUP A;  3GPL A;  1I5L A;  1M8V A;  5A0G A;  1K9M R;  4X34 A;  4JDS A;  2CP7 A;  4D8K A;  3C0C A;  2X3W D;  3OB9 A;  1B34 B;  3QII A;  4XTV A;  4LDW A;  1AOJ A;  2RQR A;  5GAO p;  2GGR A;  3NMZ C;  4EMH A;  2PU9 B;  1T3L A;  2K3Y A;  1W2B P;  4FYX B;  2DL3 A;  2MIO A;  2H3E B;  1SSH A;  3VKI A;  3EG9 B;  1BI2 A;  4BD3 A;  9ATC B;  3QHS A;  1W70 A;  1M27 C;  3DB3 A;  2GNC A;  4ZN1 A;  2LQW A;  2DMO A;  4GLK A;  1Y71 A;  2K2V A;  1ARK A;  2DFU A;  2P0Q A;  3GNG A;  1YJW Q;  2JMC A;  2GFU A;  1U06 A;  3V8K A;  3EG2 A;  1FYN A;  4DOV A;  2YDL A;  1U1T A;  4XTZ A;  4XU1 A;  3OA6 A;  2LP5 A;  2ZPI B;  2JTM A;  2QG9 B;  2DEU A;  1KIK A;  5GMK e;  4M78 C;  4JUV A;  2CT4 A;  2JZ2 A;  4AFQ C;  3MEA A;  1K73 U;  2LQK A;  2WSC E;  1N5Z A;  3L2U A;  3OW2 P;  2EQU A;  3VS2 A;  4PJO D;  3SWN B;  2OAW A;  1HJD A;  4XTW A;  2ABL A;  3CBO A;  4E6R A;  1JJ2 A;  2YSQ A;  3EG3 A;  1QVF P;  5GMK i;  1FMV A;  1YJ9 T;  4IUV A;  3NFC A;  4ATO A;  2BKD N;  5DM7 R;  1YHQ T;  5J39 A;  1VYV A;  2EGE A;  4Z8A A;  3JCM J;  4A4E A;  2SEM A;  1IRX A;  2M0Y A;  5ECA A;  5DY9 A;  3CPF A;  2DM1 A;  3CCV A;  5FRN A;  2OTL T;  4J7F A;  2JM9 A;  1KC8 R;  3EH2 A;  1R8O B;  4QKU A;  1VQN A;  5FLX E;  2NUP A;  1D0X A;  3CC7 T;  2VB6 A;  3A8G B;  3G7Z A;  4BI8 B;  2E70 A;  5GAO n;  2ZCF B;  4DQ2 A;  4ESR A;  1BBZ A;  2D9T A;  4JJB A;  1QVG P;  1MGQ A;  2VWF A;  2VXE A;  2G3R A;  3CC7 A;  5IHI A;  1UG1 A;  4FSX A;  1XOV A;  2DLP A;  3LGL A;  2JTE A;  4PJN A;  5GAO l;  1TSF A;  3EGX B;  2OTJ A;  2DIL A;  4M75 C;  2GFA A;  1ZBJ A;  4BY6 B;  3NGP A;  3H8Z A;  4JLI A;  5FWB A;  3FB9 A;  3L2Q A;  4XK8 E;  4E7K A;  2OI3 A;  2V8J A;  4J9C A;  2HMA A;  4ZGJ B;  2V8K A;  2ESW A;  1YJN A;  5GAO r;  1XTD A;  3CC2 Q;  4EDU A;  1TWB A;  3NTH A;  2DNU A;  4IUT A;  2KXD A;  1FWZ A;  3OYA A;  4MDW A;  1X75 C;  1SRM A;  2RN8 A;  1JEG A;  2XU8 A;  1G3W A;  3QJ6 A;  2WSF E;  1RAC B;  2K5I A;  1QMC A;  2X9H A;  4HA8 A;  3QDF A;  5FU7 C;  2GTJ A;  2KSS A;  1WI7 A;  2E5K A;  2GBQ A;  1WGS A;  2FRW A;  1UHC A;  1K9A A;  2D0N A;  5LJ3 e;  1AZE A;  3UWN A;  2VV5 A;  3DB4 A;  2NYS A;  1QLY A;  3ZL7 C;  2P4R A;  4UC4 A;  1D1B A;  3EAE A;  4C92 E;  3CPW A;  5GAN e;  1NJI U;  4CI0 C;  4QVC A;  1W2B S;  2PZ1 A;  2QGF B;  3M55 A;  4J6W A;  3PIO A;  3VYH B;  3GF5 A;  3QBY A;  3JCM Q;  2DIQ A;  1QCN A;  3E9F A;  2GTO A;  4C92 A;  4M78 F;  3OYE A;  2NUT A;  2B8A A;  1UEB A;  3T9N A;  3VS5 A;  2JMA A;  1YWP A;  5LJ3 d;  4BDZ A;  1KQ1 A;  4J9E A;  1U8R A;  2ATC B;  1PM3 A;  1VQL A;  2EQM A;  2RI3 A;  1WIE A;  5GAN d;  1ABQ A;  3OYK A;  4LUE A;  1DJ7 B;  2BZY A;  2K2M A;  3CCE T;  4KUD K;  4J5Y A;  2FEI A;  1YWO A;  3BW1 A;  2RQV A;  1AHJ B;  4JRQ A;  1IHV A;  4F04 B;  3CCS A;  3JRZ A;  2DD5 A;  1K0X A;  3EGD B;  3CCE A;  2L3P A;  1I07 A;  2KVQ G;  4A4H A;  2LCC A;  3X25 B;  1YIT Q;  2RA2 A;  1X43 A;  4C0D C;  3OY9 A;  2OTJ Q;  3CCM T;  1YI2 T;  5DLO A;  2IVW A;  1P92 A;  4J83 A;  1K4U S;  2EAY A;  3LX7 A;  3UPU A;  1YIJ T;  1OYX A;  2EJG A;  3PFS A;  1I81 A;  4IIO A;  2EQJ A;  4DBQ A;  2AZV A;  1D1C A;  3CCM A;  2A08 A;  2R58 A;  1N8R U;  1YJN Q;  5CKD A;  1N8R C;  4FYW B;  4DOW A;  5KYX A;  1BI1 A;  1MHN A;  4DEX A;  1YIJ A;  4C8Q F;  4M7A E;  2QXF A;  5GMK l;  5HKC A;  1JJ2 P;  1ZX6 A;  2FPE A;  3CC4 T;  3CCJ T;  5D6X A;  2JUF A;  1AZG B;  5AT1 B;  4A4K A;  3FDR A;  4WF2 A;  2O88 A;  3JCM P;  3DLL A;  1R77 A;  2RNA A;  4M75 F;  4M7A C;  5KCO A;  1VQ5 T;  1Y07 A;  1NZ9 A;  4JRK A;  1M1G A;  1TUC A;  1OEB A;  3C4S A;  2KRS A;  1VQP T;  3CCR T;  2MCN A;  2LRQ A;  4AG2 C;  2H8H A;  2QQ9 A;  3HSB A;  1V76 A;  5A2Q E;  1GBR A;  1M5Q 1;  4HVV A;  1I5O B;  3HKS A;  4R56 A;  1SPK A;  1VQP A;  3CCR A;  1EX4 A;  1CKB A;  4RTV A;  3QG1 A;  2QA4 A;  4XU0 A;  3CCU A;  2EJ9 A;  2DYB A;  2ROL A;  1OPL A;  7AT1 B;  1A0N B;  1K0S A;  2JJ9 A;  2HL3 A;  2LDM A;  1K73 R;  1VQL Q;  2VUB A;  1EZZ B;  2DE0 X;  3Q1J A;  3ZEH A;  1M1K R;  1TXQ A;  1AWW A;  4RTT A;  2LC4 A;  2RM4 A;  4LD9 K;  1VQO Q;  4KH0 B;  2QEX T;  4PJO B;  1BK2 A;  2E65 A;  3RBB B;  1VQ7 A;  1E6H A;  4C5G A;  3OYI A;  3CQT A;  3H9N A;  1JQQ A;  4PLL A;  3E19 A;  1Q95 G;  1MV3 A;  4KUI A;  3CME Q;  2KYM A;  2YWW A;  3QWX X;  4C5E A;  2D1X A;  1JB0 E;  3J81 E;  1Y7X A;  4OF1 A;  2E6N A;  3OQ5 A;  3TQ7 P;  1QVP A;  1SSF A;  3HL8 A;  2EW3 A;  5GAN 6;  5GAM d;  3G6E Q;  2QDL A;  3M59 A;  2M1H A;  2DL4 A;  2CP3 A;  1B7T A;  2FL7 A;  4PJO G;  1WQW A;  1M3B A;  2LMJ A;  4C92 D;  1VQK A;  3VS6 A;  1ZUU A;  1SG5 A;  3BY7 A;  1QVF A;  5IHK A;  2ED0 A;  3LYI A;  1GCP A;  1NYG A;  2YLC A;  1LPL A;  3CPW P;  1BCM A;  1WHH A;  2HD0 A;  1IO6 A;  4TVR A;  5EG2 A;  1YCY A;  1IXD A;  1OU8 A;  4HVU A;  4NL3 A;  4JJN K;  2LX9 A;  2MPX C;  3QZ9 B;  2F5K A;  4BDY A;  3SEM A;  2O31 A;  2EIF A;  5CR2 A;  4M77 C;  2KK4 A;  4X9D A;  1S72 T;  4MMK A;  3CCQ Q;  2K5F A;  1M30 A;  3OYM A;  2Z0W A;  2ROT A;  2RQT A;  1K8A U;  4KGV B;  4EMG A;  1YJW T;  2CZ6 B;  1U1S A;  1Q81 R;  3ER0 A;  3OYH A;  2HQX A;  3X26 B;  3MP6 A;  2P4T A;  2YHT A;  2C0T A;  1BYM A;  1RUW A;  1YJW A;  3C12 A;  2QA4 Q;  4IUP A;  3CCU Q;  2RJF A;  2RH2 A;  4RTY A;  2F2X A;  4QVZ A;  4RTW A;  3HP9 A;  1NLO C;  1NM7 A;  2EKO A;  1H8K A;  2J7I A;  4OMP A;  1H64 1;  2GQV A;  4M7A F;  2RD1 A;  2E3I A;  4M7D C;  1PD1 A;  1OQK A;  4F7U F;  1WJR A;  4Y91 A;  3BDL A;  2RQW A;  4O5V A;  3J7A F;  2J05 A;  4M7A D;  1VQ7 Q;  3PVL A;  3EH1 A;  1JRI A;  5GAO m;  1NJI R;  3RR6 A;  2K7A A;  4E7Z A;  1Q82 U;  1Q82 C;  4IIM A;  4OML A;  6AT1 B;  4RG8 A;  2KR3 A;  2DER A;  3N5B B;  4XTX A;  4F14 A;  1QQJ A;  3I56 A;  1OZ2 A;  1I1J A;  5IHN A;  2D8J A;  2HAX A;  1BCO A;  4VUB A;  4BE2 A;  3FC3 A;  3M57 A;  2D6F A;  4EIK A;  4LXC A;  3BE3 A;  4OB1 B;  1ACM B;  3WVD B;  4BUG A;  1LVK A;  1SHF A;  4JS5 A;  3LLR A;  3OYN A;  1KQS A;  2HCK A;  2YUQ A;  2CP2 A;  3CEY A;  4PJL A;  4DA4 A;  4O6J A;  3FIF A;  2EQI A;  1W1F A;  2ECZ A;  3QPH A;  1VQ6 A;  3S6W A;  4Y92 A;  2L3R A;  2PQW A;  2RHZ A;  4EMK C;  2KNB B;  2DEQ A;  4Z89 A;  5GJW B;  1WHM A;  3M53 A;  3PE0 A;  1WJQ A;  1AWO A;  1QCO A;  2L8D A;  2ZAE A;  1QP3 A;  4C5I A;  1TG0 A;  3HPW A;  2VGM A;  5DLQ E;  5I21 A;  2L0A A;  2O4X B;  4OMF B;  5FWC A;  1NPP A;  3NHN A;  2A7Y A;  2CDT A;  3VRY A;  4AFU C;  4BE1 A;  4M78 E;  4K11 A;  2QI2 A;  1N8R R;  3P8B B;  1UUE A;  1M1F A;  1MMA A;  3CC2 A;  4J9D A;  2IG0 A;  3I55 A;  3OYJ A;  4LDV A;  1AD5 A;  2AK5 A;  2RHY A;  4M78 A;  4NL2 A;  5C0M A;  2DTI A;  4A4G A;  2F1L A;  4M77 F;  5CKE A;  2DL7 A;  2NUP B;  1VYT A;  2AHJ B;  3OYL A;  1RAG B;  4RTZ A;  1Q7Y C;  2J6O A;  4MML A;  1OU9 A;  4V2S A;  3SB2 A;  1WFW A;  2RK2 A;  5LL6 S;  2VYT A;  1KD1 U;  1F1B B;  1B3Q A;  1KD1 C;  2LNH B;  1NE8 A;  4P5N A;  4IUQ A;  3M5A A;  5GAO q;  1M90 U;  1D0Y A;  1M90 C;  1HYO A;  1UGP B;  5LJ5 e;  2JOY A;  1G3T A;  3JV3 A;  3OSV A;  5IT9 E;  2ZPG B;  2O4X A;  3RUX A;  4ORZ A;  1BIA A;  2RJE A;  1X6B A;  3CBM A;  4ZTJ A;  1G3Y A;  1BI3 A;  2Y4Y A;  4C0Z A;  3CCV T;  3I56 Q;  2M9U A;  2DX1 A;  1VQN T;  1UGS B;  3JCM V;  2LNV A;  3REA B;  4M7D F;  2M0O A;  4B9W A;  3R6O A;  4C8Q E;  3UA7 A;  4J7I A;  1GCQ C;  5GMK m;  2KT1 A;  1OOT A;  5I11 A;  4M4Z A;  1N9S A;  2XG8 D;  2E4H A;  3KXT A;  3M56 A;  3I9Q A;  3IQL A;  3PMI A;  5LJ5 d;  2KRN A;  4JRI A;  2P0P A;  5L8R E;  4C8Q A;  1VQ6 Q;  4AFZ C;  3E2U A;  5CQX A;  4M75 E;  2HQH A;  4C8Q C;  3OYG A;  5J3B A;  1YIT T;  2W0Z A;  1RAE B;  4HCB A;  2OTJ T;  5GJV B;  2PVO B;  2LCS A;  4A4F A;  3TRE A;  2CSI A;  2FYK A;  4BI4 A;  1VUB A;  2X4W A;  3CXC A;  4RG2 A;  2BZ8 A;  2RJD A;  3MEV A;  2YUO A;  1YBY A;  2EWN A;  1YIT A;  4M75 A;  2AIR B;  3H41 A;  2FB7 A;  3EGU A;  4LDY A;  8ATC B;  3RNJ A;  2DO3 A;  2JN0 A;  1YJN T;  2JM8 A;  3JB9 F;  3SWN C;  3EFR A;  2K57 A;  4EPC A;  3EFO A;  2DTH A;  2EPD A;  4LDU A;  4C92 B;  4QQD A;  1TH7 A;  2NUT B;  5GMK h;  3JB9 D;  3I55 Q;  2FPD A;  1O9S A;  3BDU A;  4OMO A;  3JCM e;  2HL5 C;  4WCI A;  5IXB A;  1TTH B;  3X24 B;  1UFF A;  5A0L A;  1RAB B;  4CC2 A;  1BI0 A;  3OYY A;  3RKX A;  4J9F A;  4FYV B;  2DRK A;  5IAY A;  3WXM B;  3QWY A;  4ELZ C;  5D6W A;  4E47 A;  4D6W A;  2JW4 A;  3RKW A;  4HVW A;  4C92 G;  1PG5 B;  1K8A R;  4FW2 A;  2MAM A;  1KQS P;  1WXU A;  1ZSZ C;  2C06 A;  3JCM d;  1D3B B;  2YRV A;  1TUD A;  3OYB A;  3S3O A;  1VQ9 Q;  2DET A;  1FXX A;  4F16 A;  1KHC A;  4HCC A;  4QQ6 A;  2ZPF B;  3MET A;  4NS5 A;  1VQL T;  3H0F A;  3EHQ A;  1M4Z A;  1LNX A;  5D6Y A;  4AG1 C;  1VQ4 A;  2OJ2 A;  3JSC A;  1KJW A;  1JXM A;  2DTO A;  5KYX B;  2QGG A;  3MP8 A;  4FT4 A;  1MND A;  5GAN 7;  4M78 D;  4GY5 A;  1OI1 A;  4KUL A;  1FX7 A;  4C0F A;  3CCS T;  4LD6 A;  4KRT A;  3EFS A;  2I0N A;  5CK9 A;  1SKU B;  2ENM A;  1VQO A;  1YCS B;  1I8F A;  3AT1 B;  5FW9 A;  3WVE B;  2HKQ B;  3CME T;  1ZBX A;  4M7A B;  2LQ8 A;  2VKN A;  3OW2 S;  2KBT A;  3D7S B;  3BFM A;  2HBW A;  2QQB A;  1Q82 R;  2XK0 A;  3G6E T;  2QDY B;  3CME A;  1D3B A;  1UTI A;  1X6G A;  2OTL Q;  4E7J A;  4D8D A;  1QVF S;  3UT1 A;  2KDS A;  3H0H A;  1RAI B;  3GNF B;  2E10 A;  1Q86 U;  1RAF B;  1Q86 C;  5I2M A;  3G6E A;  1QP2 A;  3MEU A;  2X3X D;  4BE0 A;  3OYF A;  4KBM B;  1W6X A;  3ZBD A;  1U5S A;  4J9B A;  3LGF A;  3R6N A;  2CKK A;  2D0Q B;  2MYS A;  3MKD A;  4F7U E;  3E1S A;  5LJ3 h;  3JCM W;  5GAN 4;  4OB0 B;  2EJF A;  4C8Q D;  3OMG A;  3V7S A;  4M7A A;  2HSP A;  3HRU A;  3G4S A;  3M4G A;  1MMD A;  2VGN A;  3H6Z A;  1JO8 A;  5GAN h;  1G2B A;  4CC3 A;  1X6O A;  4F7U A;  1QVG S;  3CCQ A;  1TS9 A;  3HRS A;  3DLM A;  1UB4 A;  1ZQ1 A;  2DBK A;  1WYX A;  2QA4 T;  2KYB A;  3NTI A;  3CCU T;  4M75 D;  4B9X A;  3M0S A;  3L2R A;  1ZHI A;  2DXT A;  3MO8 A;  4RMO A;  1HK9 A;  1C1A A;  1VYU A;  4LN2 A;  1OX8 A;  1K76 A;  2FZG B;  4ZN3 A;  2J6F A;  4OMN A;  2ZPH B;  1NG2 A;  3VU3 C;  1VQ4 Q;  3RIR A;  1PWT A;  4KGZ B;  2ZPE B;  2KEA A;  3CXC P;  2EBP A;  1UGR B;  2A0F B;  1KG1 A;  3V7C A;  2A3L A;  2MI6 A;  1VQ7 T;  3OBY A;  4DEY A;  1VA7 A;  5GAM e;  1QWE A;  3MEW A;  4LUD A;  3LWI A;  2JXB A;  2ZPB B;  1KD1 R;  2K3X A;  4DBH A;  1M90 R;  2C0I A;  3UA6 A;  1RAD B;  1KSW A;  2EGC A;  3VS0 A;  5KYY A;  1MMN A;  4JZ3 A;  1WNL A;  1KC8 C;  3TEE A; 
#chains in the Genus database with same CATH homology
 1M3A A;  1NEB A;  2M0Y A;  2KRO A;  1I1J A;  5IHN A;  2D8J A;  5ECA A;  2DM1 A;  2L2P A;  4HXJ A;  4EIK A;  2AKK A;  1PHT A;  1PKS A;  1ZUK A;  2JM9 A;  3LH5 A;  3I5R A;  1UEC A;  2HDA A;  2C0O A;  3TVT A;  1SHF A;  1UHF A;  1SHG A;  4LNP A;  2HCK A;  1M3C A;  2YUQ A;  2JS0 A;  2EYX A;  4JJD A;  1PRL C;  4ESR A;  1BBZ A;  4JJB A;  1X2Q A;  2EQI A;  1W1F A;  2ECZ A;  1E6G A;  2VWF A;  4Y92 A;  5IHI A;  1UG1 A;  2CH4 A;  1G83 A;  1XOV A;  2DLP A;  2JTE A;  2KNB B;  5IH2 A;  2DJQ A;  1UJ0 A;  4Z89 A;  3SHW A;  1M8M A;  3FJ5 A;  3EG1 A;  5GJW B;  2LX7 A;  2DIL A;  3PE0 A;  2AKL A;  4J9G A;  2EKH A;  4CC4 B;  1AWO A;  1ZBJ A;  2KRM A;  2CT3 A;  2F2W A;  1AWX A;  1TG0 A;  3NGP A;  3EG0 A;  4LE9 A;  5FWB A;  1X27 A;  2K79 A;  2L0A A;  2OI3 A;  4J9C A;  5FWC A;  3NHN A;  2CDT A;  2ESW A;  1S1N A;  1T0J A;  3VRY A;  4AFU C;  4K11 A;  2EGA A;  1WDX A;  1UE9 A;  4A63 B;  2DNU A;  2IIM A;  1UUE A;  2KXD A;  4J9D A;  1SRM A;  1MUZ A;  2RN8 A;  1JEG A;  4GLM A;  2D8H A;  3M0U A;  1AD5 A;  1YN8 A;  1SRL A;  2AK5 A;  2EYY A;  3VS3 A;  2KE9 A;  2GTJ A;  2VVK A;  1RI9 A;  1ZSG A;  1LCK A;  1WI7 A;  2E5K A;  2GBQ A;  2DL7 A;  2LJ3 A;  1VYT A;  3M0Q A;  2FRW A;  3M0T A;  1SEM A;  1UHC A;  1K9A A;  4R0K A;  2D0N A;  1AZE A;  4RTZ A;  5EC7 A;  1H3H A;  2J6O A;  2GQI A;  1RLP C;  3VS1 A;  1WFW A;  2V1R A;  1OV3 A;  3TSZ A;  1QLY A;  3ZL7 C;  2P4R A;  1B3Q A;  2LNH B;  2PZ1 A;  1YNZ A;  2NWM A;  3JV3 A;  1H92 A;  4AFS C;  1CSK A;  4OMQ A;  4ORZ A;  2GTO A;  2FPF A;  1X6B A;  4RUG A;  3PVQ A;  2DA9 A;  1QCF A;  1KFZ A;  3GBQ A;  1U3O A;  3VS5 A;  2JMA A;  2DX1 A;  1ABO A;  1YWP A;  5IXF A;  4J9E A;  3REA B;  2LZ6 B;  2W10 A;  2DVJ A;  2K3B A;  3NPF A;  2L3S A;  1J3T A;  2PNI A;  3UA7 A;  1QWF A;  1GCQ C;  1WIE A;  2KT1 A;  1OOT A;  5I11 A;  1ABQ A;  4LUE A;  4M4Z A;  1WXB A;  2BZY A;  4F14 A;  2O9S A;  2K2M A;  3I9Q A;  2FEI A;  1PNJ A;  3IQL A;  3UF4 A;  1YWO A;  2RQV A;  2KRN A;  2SRC A;  4AFZ C;  2YT6 A;  1K0X A;  2W0Z A;  2L3P A;  1I07 A;  1Y0M A;  5GJV B;  1PKT A;  2LCS A;  3EHR A;  1Z9Z A;  2CSI A;  1X43 A;  2PTK A;  2BZ8 A;  2RQU A;  2YUO A;  2B86 A;  1NYF A;  4JPB W;  1K4U S;  1CKA A;  2DF6 A;  2LQN A;  2J06 A;  3H41 A;  3EGU A;  4IIO A;  3A98 A;  2CSQ A;  3RNJ A;  3VS7 A;  4FSS A;  2RMO A;  2JM8 A;  2AZV A;  1T0H A;  4HCK A;  2A08 A;  4OMM A;  4ZNX A;  3M0P A;  4Z88 A;  1K1Z A;  4DEX A;  2EPD A;  3THK A;  2M51 A;  2K9G A;  3O5Z A;  5L23 A;  1ZX6 A;  2FPE A;  1JU5 C;  2FPD A;  2J6K A;  1AZG B;  4OMO A;  4WCI A;  5IXB A;  1UFF A;  2G6F X;  4CC2 A;  2O88 A;  2RNA A;  4J9F A;  2DRK A;  3I5S A;  1EFN A;  3TSW A;  2FO0 A;  1I0C A;  1TUC A;  1OEB A;  3VS4 A;  3QWY A;  1WLP B;  2KRS A;  1Z9Q A;  1WA7 A;  2MCN A;  2JW4 A;  4AG2 C;  4HVW A;  4F17 A;  2H8H A;  1GBR A;  1WXU A;  4HVV A;  4QT7 A;  1SPK A;  1CKB A;  4RTV A;  2LJ1 A;  1V1C A;  2BZX A;  2KT8 A;  2CUB A;  2CH4 W;  1TUD A;  2DYB A;  2ROL A;  3U23 A;  1AVZ C;  1OPL A;  4F16 A;  1A0N B;  1FMK A;  2F2V A;  1K0S A;  3H0F A;  1E7O A;  3EHQ A;  2FG0 A;  1WXT A;  4AG1 C;  2OJ2 A;  2DE0 X;  1UGV A;  2MOX A;  1KJW A;  2O9V A;  1JXM A;  1AWW A;  2RPN A;  4RTT A;  2L3Q A;  1GCQ A;  1X2K A;  3REB B;  3I35 A;  2DBM A;  1BK2 A;  4JJC A;  4KRT A;  3RBB B;  1WX6 A;  4RTX A;  2I0N A;  2A36 A;  2DL8 A;  1E6H A;  2ENM A;  1YCS B;  3CQT A;  1JQQ A;  2CUD A;  5FW9 A;  2FRY A;  1GBQ A;  1JXO A;  2AZS A;  1YP5 A;  1QKX A;  2VKN A;  1MV3 A;  1BU1 A;  2DL5 A;  1QKW A;  2KBT A;  2KYM A;  2LJ0 A;  3QWX X;  1T3S A;  2D1X A;  2HBW A;  2RF0 A;  2YUN A;  3UAT A;  2V1Q A;  2EYW A;  2A28 A;  2CRE A;  1UTI A;  1X6G A;  1AWJ A;  2EW3 A;  2NUZ A;  4GBQ A;  4D8D A;  2QDL A;  4X1V A;  5HCK A;  4J9I A;  2DL4 A;  1MV0 B;  3H0H A;  1NLP C;  1M3B A;  2LMJ A;  3VS6 A;  1ZUU A;  1OPK A;  1ZLM A;  2X3X D;  5IHK A;  5I22 A;  1UJY A;  2ED0 A;  4RTU A;  1W6X A;  1GCP A;  2YUP A;  1NYG A;  1U5S A;  4J9B A;  3R6N A;  4D8K A;  1IO6 A;  3C0C A;  1BB9 A;  2X3W D;  1GL5 A;  2O2O A;  4HVU A;  1AOJ A;  2XMF A;  2RQR A;  2GGR A;  3NMZ C;  1T3L A;  3SEM A;  2O31 A;  2DL3 A;  2MIO A;  1SSH A;  2HSP A;  4JZ4 A;  1JO8 A;  1M30 A;  1M27 C;  1W70 A;  2BTT A;  2GNC A;  1G2B A;  2ROT A;  4CC3 A;  2RQT A;  2LQW A;  2DMO A;  2ED1 A;  2KGT A;  1ARK A;  1HSQ A;  1PRM C;  2JMC A;  3H0I A;  1ZUY A;  2DBK A;  1WYX A;  2HEQ A;  2KYB A;  1U06 A;  3EG2 A;  2C0T A;  1FYN A;  3M0S A;  2JT4 A;  4CC7 A;  2EYZ A;  1RUW A;  1VYU A;  4LN2 A;  2YDL A;  2KXC A;  4RTY A;  2F2X A;  2LP5 A;  3M0R A;  4RTW A;  1KIK A;  1K76 A;  1NLO C;  3KFV A;  1NM7 A;  2CT4 A;  2J6F A;  1H8K A;  4AFQ C;  4OMN A;  1NG2 A;  2J7I A;  1N5Z A;  4OMP A;  4J9H A;  1AEY A;  2DRM A;  3VS2 A;  1PWT A;  2A37 A;  2KEA A;  2OAW A;  2EBP A;  1GFD A;  1HJD A;  1B07 A;  2ABL A;  2RQW A;  2J05 A;  1X69 A;  1GFC A;  4E6R A;  4DEY A;  1VA7 A;  1QWE A;  2YSQ A;  3EG3 A;  3PVL A;  4LUD A;  3VRZ A;  2K6D A;  1GRI A;  2JXB A;  2EVR A;  3ULR B;  1UDL A;  1Y57 A;  2K7A A;  1NEG A;  2C0I A;  3UA6 A;  1VYV A;  2EGE A;  4Z8A A;  2JS2 A;  1KSW A;  4IIM A;  1HD3 A;  2EGC A;  3VS0 A;  4OML A;  4JZ3 A;  2SEM A;  2KR3 A;  1RLQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...