1W1FA

Sh3 domain of human lyn tyrosine kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Lyn-SH3 Domain in Complex with a Herpesviral Protein Reveals an Extended Recognition Motif that Enhances Binding Affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3-domain
molecule keywords TYROSINE-PROTEIN KINASE LYN
total genus 8
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w1fA00
1SRMA 1FYNA 1WXUA 1GCQC 1JO8A 3THKA 1SSHA 1H8KA 2EW3A 3UA7A 1FMKA 1KJWA 1SEMA 2L3SA 2CH4W 5L23A 2DL8A 3GBQA 1A0NB 2C0IA 1VYVA 1CSKA 1MV0B 2LX7A 4J9GA 2G6FX 2IIMA 2F2XA 4CC3A 2O88A 2SRCA 1UECA 1KSWA 2DBMA 4ORZA 3NPFA 4JJBA 4KRTA 4HCKA 4D8KA 3REBB 1ABOA 2FO0A 2J6OA 2RNAA 1GRIA 2BTTA 4LE9A 1PNJA 4OMNA 1OV3A 3IQLA 1KFZA 4RTVA 1GCQA 5IXFA 1AZEA 3M0QA 2EQIA 1YNZA 4JJCA 1WLPB 3RNJA 2DA9A 4QT7A 4RTZA 1CKAA 1OPKA 2KT1A 2CT3A 2HSPA 1HSQA 1K76A 1NEGA 2KRNA 3REAB 1NYFA 1VYTA 1MUZA 2CH4A 1HD3A 2ABLA 2AKLA 1UDLA 2HDAA 4HXJA 1HJDA 3VS2A 2K79A 2AZVA 2EYXA 2LP5A 2DVJA 2FPDA 4HVUA 1RLQC 5IHIA 3R6NA 2ED0A 2GNCA 1SHFA 1WFWA 1VA7A 2A08A 2LJ1A 3H0HA 2EGEA 2JMCA 2FRYA 3QWXX 4RTTA 3VS4A 2O2OA 2J6KA 2DF6A 1T3SA 2KBTA 1YWOA 1U06A 2OI3A 2RMOA 1PWTA 1B07A 1UJ0A 2JMAA 2SEMA 4OMPA 2K3BA 3H0IA 1UE9A 2EVRA 3UF4A 1TG0A 3VRZA 2GTOA 1GFDA 1TUCA 1YP5A 1QCFA 1AD5A 3EG3A 4CC4B 5ECAA 2KGTA 2J7IA 3PVLA 4J9IA 3EHRA 2ROTA 3JV3A 2FG0A 2LJ0A 2J6FA 2JM9A 4Z88A 3LH5A 3I35A 1ZUYA 2F2WA 2LZ6B 1H92A 3VS5A 1RLPC 3VS3A 2YT6A 4JPBW 3SHWA 5FW9A 4OMMA 2ESWA 3VS0A 1GL5A 2HCKA 4Z89A 2KYBA 2CT4A 1X6BA 1M3AA 2VWFA 1WI7A 2CSQA 3VS6A 1E7OA 1AWWA 1I07A 2ENMA 2JTEA 2EGAA 2PTKA 2ROLA 2K9GA 5EC7A 2EBPA 4LN2A 1X2KA 1QKXA 1ZBJA 1UJYA 1NM7A 4RTYA 3PVQA 1PRLC 1WA7A 2MOXA 1G2BA 4IIMA 2J06A 2JM8A 2KT8A 2RQTA 1UTIA 2EKHA 1S1NA 4F16A 2RN8A 3FJ5A 2HBWA 1W70A 3M0PA 2CSIA 1VYUA 2GTJA 2D8JA 4F14A 1KIKA 4E6RA 2FPEA 2M51A 4AFZC 3EHQA 1E6GA 4AG2C 2BZYA 3M0UA 2YUNA 5I11A 2LJ3A 1UG1A 1K0XA 4AG1C 2DILA 1J3TA 1X6GA 2BZXA 2CDTA 4A63B 2B86A 2EYZA 1U3OA 1X27A 2DM1A 1OOTA 2DNUA 4DEYA 1XOVA 2JS2A 2CUBA 2ECZA 1T0HA 3H41A 3ULRB 5I22A 2OAWA 1OPLA 4OMQA 1JQQA 4HVWA 1ZLMA 3M0RA 3I9QA 3VS1A 5IHKA 4LUEA 2L3QA 4J9EA 4J9FA 2BZ8A 4AFSC 3I5SA 1SPKA 1LCKA 2DMOA 4CC7A 4CC2A 2HEQA 3VS7A 5IXBA 1GFCA 2GGRA 1AWJA 3TVTA 2I0NA 2DYBA 1QKWA 1WX6A 1NEBA 2KR3A 3UA6A 3EG1A 1K0SA 2A28A 4M4ZA 2KRSA 4JZ4A 1UUEA 1UHCA 1UGVA 2A37A 4JZ3A 3TSZA 4EIKA 2A36A 1K4US 2D0NA 1CKBA 2KE9A 2DRKA 2DL3A 4X1VA 1X69A 1NLOC 1I0CA 2RF0A 1Y0MA 2AZSA 4GLMA 2X3XD 3A98A 2LMJA 1WIEA 4RTUA 5HCKA 1PKTA 1K1ZA 2JXBA 3U23A 1NG2A 1G83A 4GBQA 1BU1A 1RUWA 5IHNA 1U5SA 1WXTA 5GJWB 4J9BA 1NYGA 2KRMA 1JXOA 1ZX6A 1PRMC 1ZUKA 1AWXA 3NMZC 2DX1A 3ZL7C 4K11A 1B3QA 4RTWA 1MV3A 2GBQA 2RPNA 1V1CA 1N5ZA 2M0YA 1YN8A 2DL7A 2XMFA 4WCIA 1ZSGA 4Y92A 2L0AA 2JS0A 1ABQA 2KXDA 1RI9A 2YSQA 4FSSA 2NWMA 1QLYA 4JJDA 3UATA 5FWCA 4D8DA 1TUDA 2FRWA 2GQIA 1M8MA 2V1RA 1X43A 1PHTA 1M3BA 2DLPA 1SHGA 1ZUUA 2VVKA 2KNBB 2NUZA 2EYWA 2LQWA 2KXCA 3H0FA 1QWFA 5FWBA 1PKSA 4IIOA 1EFNA 1AOJA 3I5RA 3M0SA 1YWPA 2CUDA 2KYMA 4ESRA 4OMOA 3O5ZA 2C0TA 4LNPA 3M0TA 2F2VA 3QWYA 2KEAA 2W10A 1E6HA 2LNHB 1YCSB 1GCPA 2AK5A 3CQTA 1QWEA 1H3HA 4HVVA 2DE0X 3PE0A 3KFVA 2EPDA 4Z8AA 4OMLA 4J9DA 2RQRA 4AFQC 3EGUA 1T3LA 2L2PA 4RTXA 1WDXA 1K9AA 2JW4A 2MCNA 3NHNA 2D1XA 3VRYA 5IH2A 2LQNA 2DL5A 1Y57A 3RBBB 1JEGA 1Z9ZA 2QDLA 1AZGB 1X2QA 5GJVB 1IO6A 1GBQA 2EGCA 1SRLA 2O9VA 2EYYA 2J05A 2X3WD 1W1FA 2ED1A 1JU5C 1JXMA 1WXBA 2L3PA 1GBRA 4RUGA 2RQWA 3SEMA 1WYXA 1AWOA 2YUQA 3EG2A 1UFFA 2W0ZA 2FEIA 2K7AA 4DEXA 2O31A 2RQVA 2CREA 4F17A 2O9SA 1BBZA 3EG0A 2VKNA 3TSWA 4AFUC 1T0JA 2DL4A 1AVZC 1ARKA 2LCSA 2PZ1A 1W6XA 1I1JA 2P4RA 2YUOA 2YUPA 2PNIA 2OJ2A 3C0CA 2KROA 2DRMA 2JT4A 1NLPC 1OEBA 1AEYA 2H8HA 2K6DA 1Z9QA 1M27C 4ZNXA 1M30A 2C0OA 2K2MA 1M3CA 4J9CA 2D8HA 4R0KA 2DBKA 2RQUA 2FPFA 2E5KA 2YDLA 4LUDA 1UHFA 3NGPA 2AKKA 2V1QA 1BB9A 2MIOA 4J9HA 1BK2A 2DJQA
chains in the Genus database with same CATH superfamily
1WXUA 2E6NA 2LT1A 1H8KA 5I21A 5CKDA 2L3SA 2DL8A 3GBQA 5AT1B 1A0NB 1KQ2A 1CSKA 2EJFA 4KGXB 3CCJT 2K3YA 4J9GA 1QVGP 4CC3A 3GIBA 4MMKA 2O88A 1S72Q 1KSWA 1VIEA 1OYXA 4QKUA 5FROA 3SB2A 4NL2A 1YI2T 2J6OA 2K5FA 2VGNA 4EMKA 4LE9A 3V8JA 4BI4A 4DA4A 4OB2B 1KFZA 3RIRA 1AZEA 2EQIA 3ER0A 3EH2A 1VQLQ 1ACMB 5CVIA 3G71A 3OQ5A 3RKXA 2QASA 3L2WA 1OZ2A 2HSPA 1HSQA 3FIFA 1QCOA 1NEGA 3RR6A 3CMAA 1YHQT 1NBEB 2CH4A 1HD3A 5GAMe 4C8QD 3MP1A 4AMCA 4M7DG 4HXJA 3A8HB 3M59A 2PUKB 4NL3A 2LP5A 1JJ2A 1KD1C 1X6OA 4PJOE 1ZSZA 1VQ4Q 5KCOA 3MP8A 3SWNA 3G6EQ 4FSXA 3G4SA 3JCMf 2EGEA 1KC8C 1NE8A 4M78D 4RTTA 1RACB 2JZ2A 2J6KA 4P5NA 2DF6A 2A7YA 1U06A 2V8JA 2JMAA 1PWTA 1B07A 4DBFA 2K3BA 1D3BB 1QVPA 4M75C 4NOYA 1TUCA 3S3NA 2EQJA 4OB1B 2RI3A 3M5AA 1KK7A 1FWZA 2KGTA 2DXUA 3PVLA 5CKEA 5KYWA 1Q95G 4L5GA 3M9QA 3I35A 1Q82R 1KQSS 2X35A 2LZ6B 4C5IA 3E2UA 3QYGB 1BYMA 2YT6A 3SHWA 3VUZA 2HCKA 2EKOA 2CZ6B 2ZAEA 1X6BA 4RG8A 1VQ4A 1JB0E 1OZ3A 3CD6A 3CCJA 4M77D 1R77A 1QP2A 1M1KC 2QTVA 2NUTB 2CZ0B 2JJ9A 3MHXA 2EBPA 4LN2A 1QKXA 1UJYA 3OA6A 2M9UA 3CBMA 1RADB 3RMQA 1UEBA 2PVDB 3E9FA 1N8RC 2XK0A 2KT8A 1MGQA 1UTIA 2VUBA 2R5AA 2MK5A 5GAN6 3FJ5A 1W70A 4OMFB 4DBHA 3OS1A 3OYYA 3P8DA 1VYUA 2D8JA 5GMKh 2FPEA 5IAYA 5FU7B 3C4SA 2P84A 4AG2C 2YUNA 1K8AU 4DBRA 1PSEA 1P92A 4WF2A 4E7JA 4BI8B 3HTRA 1K8AC 4C0GA 1C1AA 3JCMW 1K73U 2FB7A 4F7UA 3QJYA 1Q82U 1XOVA 4J7FA 3CCLQ 3CCLA 4M77A 3C12A 1KHIA 5I22A 2OAWA 1OPLA 4OMQA 1Q7YC 1G3TA 3M0RA 4AFSC 3JCMd 3JCMQ 1YJWA 2V26A 1D1CA 4EDUA 4CC7A 3CCLT 1RAGB 2E3IA 1GFCA 4M75B 3VU3C 3P8HA 2DYBA 2OTLQ 1C0MA 3C95A 2KR3A 3S3OA 5GANd 4M78C 1K0SA 4D6WA 2A28A 3HFNA 2KRSA 3M58A 1UGVA 2A37A 1PC0A 4JZ3A 3CMEQ 4EIKA 2HL5C 3OSVA 4QQDA 1RAHB 2MPXC 4RG2A 4XU1A 4X1VA 4ZGDB 4R55A 2L8DA 3VKIA 3LWIA 4HCZA 2CP6A 1G3WA 2X3XD 1U1SA 5FU7C 5GAN3 2LMJA 2XU8A 5IT9E 2CZ1B 3M4GA 1MMNA 2CKKA 5GAOp 1VQMT 1PKTA 1F1BB 2JXBA 1WJQA 5GAOl 3CCMQ 2X9HA 1G83A 3NFCA 5IHNA 4KULA 1U5SA 5GJWB 1HK9A 1V29B 2E12A 4BE1A 2HBPA 1JXOA 1M90R 2FYKA 3CCQT 2MWOA 1WJSA 1IHVA 3NMZC 2DX1A 4OGCA 3I56T 5KYUA 5CQYA 1ZSGA 2L0AA 4PFPA 3JCMe 2EJ9A 2ZZDA 5FWCA 4EMGA 3OYHA 2V1RA 2MF2A 1X43A 2XHCA 1EIFA 2EJGA 1YBYA 2VVKA 4BY6C 5LJ3j 2KNBB 4FT4A 3G6ET 3DKMA 1YITT 2LQWA 1KC8R 2KY9A 5FWBA 1PKSA 1EFNA 1AOJA 2QK0A 2WSCE 2YRDA 2YWWA 1VQPQ 2COWA 2QQ9A 4LNPA 2HD0A 3M0TA 5CQXA 2F2VA 1YCSB 3CQTA 5KH6A 3X28B 1PD0A 1TWBA 2HQXA 3J81E 1M90C 3GPLA 3EG9A 1Q81R 3I55Q 5GAN7 1XTDA 2KAFA 2RQRA 1K9AA 1XNIA 2JW4A 2D6FA 4HA8A 5GAOn 1M1KR 1U8RA 4QVZA 5IH2A 4HCCA 3JCMX 1Y57A 4BACA 5GJVB 1QCNA 1VQKQ 1VQ8Q 3G4SQ 3JB9F 2ED1A 2MAMA 2L3PA 3M54A 5J3BA 4FU6A 3SEMA 5KYXB 2EIFA 3HHTB 3I56A 1EZZB 3SFMA 3WVEB 1UFFA 4C8QE 2RHYA 2W0ZA 2FEIA 3JCMc 3GF5A 2RQVA 2BE7D 3CC4Q 4F17A 2QQSA 3EG0A 5CAIA 2R5MA 4PLIA 4LDYA 1AVZC 1LPLA 1QVFS 4F7UG 2PZ1A 1H641 4F04B 4QVCA 1IHWA 2PU9B 2JT4A 4BD3A 2CYZB 1OEBA 2RO0A 4BB7A 1HYOA 1BI2A 2NLUA 1BI1A 4PL6A 2D8HA 5I2MA 2DBKA 3OBYA 4C92A 1Q7YR 3QSUA 3CEYA 1UHFA 2K57A 3KUFA 4PFZA 4C0FA 2MIOA 1YJWT 1KC8U 4IURA 5GANf 3TU4K 4JJNK 2P0PA 1YJ9Q 4Q5WA 3THKA 3I56Q 4DOVA 1FMKA 1WGSA 2GCXA 2JNGA 2LCCA 2RH2A 3EFOB 2GQVA 1MV0B 2L89A 2LX7A 2FZGB 2SRCA 4Y91A 1B7TA 4PJLA 1YJ9T 2QEXQ 4HCKA 2LNVA 4C92D 2RNAA 1N9RA 1NJIU 2BTTA 3V7RA 9ATCB 4RTVA 1ZSZB 1GCQA 3URGA 2EQKA 2DXTA 1YNZA 3A5ZB 4JJCA 4XTZA 4BDYA 1WLPB 3CCST 1BIAA 3RNJA 2KT1A 2RJEA 2D9TA 4M7AF 3CC2Q 2KRNA 3HSBA 1NYFA 2DJZA 1MUZA 2HDAA 1UDLA 3CC7T 4LD9K 2FVUA 1HJDA 3VS2A 2AZVA 4X9CA 2DVJA 1I8FA 1RLQC 2NUPA 2BKDN 3R6NA 2GNCA 1LOJA 2BE9B 5D6WA 2RJDA 3H0HA 3M57A 1I4K1 4M7AB 5A0DA 3UT1A 1Y96A 4PJOB 4A4HA 2EQMA 2FRYA 5CIUA 1D0YA 2O2OA 2F69A 2DETA 3CPFA 4II1A 1T3SA 3O8VA 1YWOA 3QUIA 3V7CA 1QQJA 2CGHA 3GP8A 3PNWC 1UJ0A 2VV5A 1UE9A 3UF4A 2OTJQ 1VQ7T 1GFDA 3LGLA 1QCFA 1VQ5A 3EG3A 4C8QB 5GAN8 4PFOA 1OX9A 5GMKj 3EHRA 3LX7A 3JCMg 2LJ0A 2JM9A 1ZUYA 1JRIA 1WHGA 1VQ4T 5I2SA 3VS5A 4E47A 4JPBW 1YJWQ 3OYEA 2RD1A 2QA4A 1D3BA 3N5BB 3VS0A 2ZPIB 3OBWA 1GL5A 2KYBA 2K2VA 2ZPBB 5CO7A 3DLLA 1WPYA 3L42A 1M3AA 5GAMj 1I81A 2JUFA 2DERA 2VWFA 3VUBA 3CCEQ 3CC7A 1E7OA 2RM4A 2VXEA 3VYHB 1I07A 2JTEA 1K9MC 3M55A 1VQ6Q 2OTLT 5FRMA 3MPUB 2K9GA 4OB0B 3E19A 3SD4A 2EFIA 1W2BP 5CR2A 3OYBA 1IZ6A 4ZTFA 2K5LA 1YCYA 1KQSP 1ZHIA 1ZSZC 1U1TA 3CXCS 2J06A 2RQTA 1VQ9A 2OTLA 2EKHA 1D1BA 2HQHA 1VQNT 4FL6A 1YJNQ 2CSIA 2VB6A 3P8BB 3DB4A 4E6RA 4E2FB 1NJIR 3FB9A 1OU8A 4KBMB 2MI6A 3M0UA 5I11A 4BUGA 1N9SA 1UG1A 5GANh 3QG1A 4QQ6A 1BCMA 5LJ5f 4AG1C 2DILA 3TREA 3CCVA 1KQ1A 4A63B 3CC4A 2B86A 4KH0B 2RB6A 1U3OA 1OOTA 4WTOB 3E1SA 2GFUA 4M7AC 2ECZA 1T0HA 1PCXA 3H41A 3ULRB 3CCVT 1VQ5Q 1JQQA 2KI7A 5GAOq 1ZLMA 2I2LA 2IPOB 3I9QA 3CCQQ 5KYNA 5J39A 4J9EA 2ZPHB 2DPPB 4M7DA 3LH0A 3EFRA 1N27A 2DMOA 4CC2A 1MMAA 5IXBA 1QVGA 4XU0A 1K9MU 4PJOD 1I5OB 1R0CB 4F7UE 1VQMQ 1QKWA 1WX6A 1YFNA 5KE2A 3EG1A 1RL2A 5GMKi 2PQWA 4OP0A 1SKUB 1UHCA 1YITA 3OYLA 3TSZA 1YITQ 3E9GA 4HT8A 1YI2A 1VQ7Q 1IREB 2D0NA 1CKBA 2LQKA 2KE9A 5C0MA 1XJWB 3A8LB 3L2RA 3V7SA 1X69A 4ZN1A 3RUXA 1NLOC 4FYXB 1YJNT 2G3RA 2AZSA 4XTXA 4GLMA 2DD4A 2DEQA 2R57A 2OTJA 3A98A 3PT9A 3CCQA 4RTUA 5HCKA 3CCRQ 1YJNA 2QQRA 3OMGA 3OYJA 2BIVA 4M7AE 1WXTA 3CCET 1TH7A 2KRMA 3RERA 5D6XA 4ELZC 1ZX6A 2EYQA 3LLRA 3S6WA 1R8OB 2VYTA 2JOYA 4M7DD 1ZQ1A 1B3QA 2ZPGB 2RPNA 3RDVA 4IUVA 1YN8A 2DZCA 2CZ7B 4Y92A 4ATOA 2JS0A 1ABQA 5M9OA 1VQKA 2KXDA 1RI9A 3UATA 1QLYA 1LJOA 1TUDA 2HL3A 2Y4XA 4HKEA 2FRWA 5A2QE 1M8MA 8ATCB 1PHTA 1VQNQ 2P0QA 4E7KA 4E7LA 1SHGA 1ZUUA 1YIJA 1Q81C 3G7ZA 2NUZA 3I55A 1KG1A 1G3SA 2V8KA 4IIOA 4PKCC 2DXCA 4J83A 3CCUA 5GAN5 2KYMA 5HK0A 2COYA 1QVGS 2HQEA 5CK9A 3QWYA 5GMKm 4JRKA 2RJCA 2W10A 2ZCFB 4M75G 1GCPA 2HSEB 2DE0X 4MZPA 4C92C 4OMLA 3CPWA 1IGUA 5LJ3g 2CP0A 1VQLT 5J26A 2QYZA 3NHNA 3JCMV 3MP6A 3FC3A 4XAXB 2DIGA 4FW2A 3CCSA 2X4XA 2F5KA 1AZGB 1X2QA 2DO3A 5CKBA 1M9SA 1SRLA 1M2OA 2J05A 2X3WD 3OW2A 1WXBA 3HL8A 3OY9A 1MMDA 4EMHA 1AWOA 1RI0A 2DYIA 2JTMA 3EGXA 5A0GA 5GAOm 4KGVB 4N4GA 5L8RE 2O9SA 2ZPEB 4C92F 1JJ2P 3V8KA 1SF9A 4AFUC 3G71T 5KYYA 1WQ7A 2DTIA 4M7DE 1ARKA 1FX7A 1BCOA 4ZGJB 1W6XA 1I1JA 1D0XA 3GNGA 3OYCA 1QVFA 4J6YA 3C0CA 4C0ZA 2KROA 1G5VA 2DRMA 3MEVA 2YLCA 4ME7A 2QGFB 2F5TX 2HNIA 4ZNXA 1M30A 2K2MA 4C92B 4J9CA 1RAAB 2MMPA 4R0KA 3QZ5B 4J7IA 3ZBDA 4EMKB 4QQGA 4CI0C 2LVMA 3NGPA 4FIBA 1LNXA 2M0OA 4XQ3A 1VQ8A 4J9HA 1EX4A 1C6VX 2DJQA 1SRMA 4TVRA 2AT1B 2K4YA 1GCQC 1JO8A 1SSHA 1YJ9A 3UA7A 1KJWA 1SEMA 1JJ2S 2JTFA 4RCBA 1VYVA 1GXIE 2H3EB 3G1JA 3CCVQ 1VQ5T 2G6FX 3L2QA 1I5LA 2IIMA 2F2XA 2M1HA 1NJIC 1UECA 4ORZA 1Q86R 3NPFA 5LJ5h 4KRTA 1ABOA 2FO0A 1D0ZA 1PNJA 6AT1B 1OV3A 3CC7Q 5KYYB 5HY6A 3M0QA 3PTAA 4XK8E 5LJ5d 1CKAA 1K8AR 1K76A 3JB9J 4EPCA 1H3ZA 2LRQA 3X25B 2ABLA 2AKLA 1Y07A 2B8AA 1KD1U 5AYFA 1SG5A 2K79A 3LYIA 2EWNA 2EYXA 3TQ7P 5IHIA 3CD6Q 3JRZA 4Z02A 4A4KA 4ANJA 1OQKA 3M53A 2QG9B 1WFWA 3X26B 1VA7A 3JCMb 2NYSA 3GLXA 4M77B 5KCHA 1N8RR 2A08A 2LJ1A 3CCRA 4NS5A 4O5VA 3OS0A 2JMCA 3OB9A 4E7SA 4E7HA 3QWXX 3CXCP 4LXCA 3X24B 1TS9A 2RK1A 3EFSA 2HKNA 1VQPT 4B6MA 2RMOA 1TUGB 5LJ3e 2M02A 2SEMA 4OMPA 1S72A 3H0IA 3HPWA 2EVRA 3QKJA 3VRZA 1Q86U 3CC2T 1AD5A 3I55T 4DBQA 2X4JA 2XDBA 5ECAA 3A8GB 4J9IA 2ROTA 3UDCA 3V8LA 2FG0A 4Z88A 4X9DA 2F1LA 3LGFA 5DLOA 3QHSA 4M78F 1H92A 3CBOA 1VQ6A 2KVQG 2RI2A 2YHTA 5IN1A 2YRCA 2H3JA 3PIPA 2KK4A 2ZGWA 5GAOr 2CT4A 2LCLA 3OYKA 3MEUA 3UWNA 3LWHA 5GANj 2O4XA 1WI7A 1M1KU 5GANe 4M78B 4BE2A 4KGZB 5EC7A 1ZBJA 1NM7A 3PVQA 1PRLC 3T9NA 4PK4A 2IVWA 1V76A 1G2BA 4RKUE 2WSFE 4IIMA 2JM8A 5FLXE 2QDYB 3INZA 4PLLA 2HBWA 3M0PA 3M56A 2GTJA 4OGEA 4F14A 1Q86C 1W2BS 1M8VA 2Y90A 4AFZC 4IUTA 3EHQA 2VXFA 1E6GA 2E10A 2BZYA 1AHJB 5LJ3d 2CS7A 1K0XA 1J3TA 1X6GA 2ZPFB 5A0LA 4PJJA 4X34A 2DD5A 1X27A 5KE3A 1VUBA 4DEYA 1IRXA 3OYMA 3OYDA 4PJNA 2RHUA 1VQPA 3H6ZA 4J8OA 1WQWA 2CP3A 3VS1A 5IHKA 4JUVA 2KQWA 2O01E 4J9FA 2BZ8A 3CMEA 3I5SA 1SPKA 1LCKA 2E1HA 3VS7A 5LJ5g 1D09B 3QXEB 3CPWP 3TVTA 4M7DF 4IKFA 2P4TA 4XTUA 1NEBA 1VIFA 3UA6A 5GAMd 4C8QA 1VOMA 2IG0A 5CKHA 5GAN2 3DB3A 8AT1B 4M4ZA 4JZ4A 1SSFA 4B9XA 2QXFA 1VQLA 1PSFA 3RESA 1PG5B 2QA4T 3JCMh 3L1AA 3QDFA 4BE0A 2A36A 3BY7A 2RJFA 3NTIA 4MZTA 2XI9A 4M7DB 1MHNA 2DL3A 1IGQA 5LJ5j 2E5QA 2QTXA 1M1FA 3CCMT 2A3LA 1ZA1B 1TSFA 1RAIB 4ELYC 3EGDA 3CCJQ 2KMTA 2XDDA 3QYHB 1WIEA 4J6XA 1TU0B 1K1ZA 3U23A 3F70A 1NG2A 3CXCA 1WNLA 1BU1A 1RUWA 4AT1B 1Q7YU 1NYGA 4J6WA 1FMVA 4A4FA 3OW2S 1M1GA 4ZN3A 2K5IA 4HT9A 1AWXA 1WJRA 4DOWA 2Y4YA 3ZL7C 4E7ZA 4RTWA 3OYIA 2GBQA 1NPRA 5FRNA 2D0QB 2EQUA 1Y71A 1V1CA 1YIJT 2DL7A 2XMFA 3QIIA 3JB9I 4IUPA 2NWMA 4PJOC 1W2BA 2MYSA 3RKYA 2DK3A 2AIRB 3CCUT 4CRIA 3D7SB 2BUDA 4Y28E 1YIJQ 2A0FB 2YRVA 4B9WA 1QWFA 3PMIA 4XU3A 3TEEA 4KH1B 3HRTA 4R56A 1WHMA 3I5RA 3M0SA 3HRUA 3HKSA 2CUDA 5KYUB 3CCUQ 1VQ6T 2C0TA 2DVEA 2XKOC 2XICA 2KEAA 2KDSA 4M7DC 2XG8D 3R6OA 1QWEA 3X20B 1H3HA 1BI0A 4QVDA 3OMCA 2LQ8A 3KFVA 4J9DA 3EGUA 1T3LA 4PJOF 4RTXA 2DXBA 1VQMA 2MCNA 4FYYB 3MCAB 2YXYA 2LQNA 2DL5A 1JEGA 2QDLA 2XIDA 1B34B 3VYGA 1JXMA 3EGXB 2YUQA 3FRNA 4C8QC 5CCAA 2OTJT 1VQ9T 4M78G 3M4YA 2K7AA 1VQKT 2O31A 4FCYA 2DFUA 1QVFP 5LJ3f 4MZMA 2CREA 4IUQA 2DKGA 2VKNA 2K3XA 1T0JA 2DL4A 2DZ9A 5GAMg 2LCSA 2RHIA 1TOVA 1NPPA 2OX7A 2PNIA 1G8XA 3ME9A 3KBGA 4BI3A 3JAME 2RI5A 2C06A 2VASA 4OVAA 3BE3A 4A4EA 4JRIA 1YI2Q 1VQ7A 4MDXA 1FMWA 3CC2A 1M3CA 1PM3A 1M90U 1QMCA 2VC8A 2RQUA 4BDZA 2FPFA 4PJOG 1VQOA 2AKKA 1BB9A 4FM4B 3MEAA 1WHKA 1FYNA 4MDWA 4BY6B 2FHDA 2DTHA 3L2ZA 2EW3A 1IXDA 3ZEHA 4GLKA 2CH4W 4C5GA 4OF1A 5L23A 2C0IA 5LL6S 5CKFA 1LVKA 3QDRB 5GMKe 3CPWS 3FDRA 4F7UB 4MMLA 2DBMA 4GY5A 3EH1A 4JJBA 2P0KA 4D8KA 3REBB 2FL7A 1GRIA 4OMNA 3C94A 3IQLA 2GFAA 5IXFA 1RABB 3G71Q 1OU9A 2DA9A 3NTKA 4QT7A 4RTZA 3JSCA 1OPKA 2CT3A 1VQNA 3REAB 1VYTA 4RCCA 4C8QG 1QP3A 2QGGA 2FPDA 3BDLA 4HVUA 1TXQA 3OSSC 1BKBA 2ED0A 1SHFA 3CMAT 3MO8A 5DM7R 2NUTA 2M16A 2ATCB 1BIBA 4XTWA 5HK3A 2X51A 2L3RA 3VS4A 4M7AG 2KSSA 1VQ8T 3SWNC 3SDZA 4J5YA 2KBTA 4DQ2A 2OI3A 2XD0A 1N8RU 4FT2A 2CP2A 1TG0A 2LTOA 2GTOA 3AHUA 4E7IA 2E4HA 1YHQQ 2NUPB 1YP5A 4QW2A 2CP7A 4CC4B 4A53A 2J7IA 3JV3A 3UPUA 2J6FA 2RHXA 4L59A 1M2VB 1VQOT 3LH5A 1WHLA 1Y96B 2F2WA 4PJOA 3JCMP 1RLPC 2QAZA 3VS3A 5FW9A 1Q82C 2JVVA 2LC4A 4OMMA 2ESWA 5EG2A 2E3HA 2WACA 2CP5A 4Z89A 2O4XB 4FYVB 3LW5E 2CSQA 1X01A 3EGDB 4M7AA 3VS6A 2COZA 2GF7A 3OYAA 1AWWA 4PNOA 2ENMA 1JBMA 2EGAA 4LDVA 2PTKA 2ROLA 1WZOA 3PFSA 4O6JA 1X2KA 3PIOA 2QI2A 4RTYA 2L5QA 3CMAQ 1WA7A 2MOXA 3S3MA 2PVGB 5HKCA 4V2SA 3QZ9B 3CCSQ 4L6V5 4ZGEB 4LDWA 4C0DC 1S1NA 4F16A 3JB9D 2RN8A 1ZBXA 3VJPA 4VUBA 3SWNB 2QEXT 4M75D 1KIKA 4C0DB 2M51A 2E70A 3META 2LJ3A 4A54A 3CBPA 4JS5A 2AHJB 2QQBA 5GAMh 2HZYA 4N4IA 2R58A 2BZXA 2CDTA 1BI3A 4C92E 3EAEA 1FXXA 2Z0WA 2EYZA 2LT4A 1RAEB 2DM1A 2LDMA 2DNUA 1B34A 2JS2A 2CUBA 1KQSA 1UB4A 1NZ9A 3RMSA 3OW2P 1OULA 3MKDA 2PVOB 3GOXA 3QBYA 4HVWA 2OAUA 1O75A 4KUDK 4LUEA 2L3QA 3QO3A 2RHZA 4M78A 1M2VA 4RMOA 4M75A 4FW1A 2HEQA 3NTHA 3QJ6A 4M7AD 2JN0A 4JS4A 2GGRA 5FU6C 1AWJA 4LDXA 2I0NA 3ZFJA 3FLGA 1VQOQ 3Q1JA 1G3YA 2FZKB 4C5EA 5DLQE 1UGSB 1UUEA 2DAQA 1K4US 4JRPA 2WSEE 4IUUA 5KYXA 2DRKA 4HCBA 1K9MR 3PMTA 1I0CA 2DIQA 1D1AA 2RF0A 4C8QF 1Y0MA 2E65A 2EAYA 1UGRB 4N0AA 1K73C 4F7UF 3JCMJ 1OI1A 3OS2A 2XDPA 1W4SA 4C92G 3L2VA 1YHQA 3WXMB 3CCMA 3EG9B 4GBQA 5GAN4 1IB8A 4XTYA 1X75C 4J9BA 3DLMA 4UC4A 1QW1A 1WHJA 4OB3B 2X4WA 2V8IA 1PRMC 1ZUKA 3KXTA 3L2UA 2QEXA 4XU2A 3G4ST 4K11A 1R0BG 4A4GA 2E64A 3JB9G 2HAXA 1RAFB 3MJXA 1MV3A 1KD1R 1N5ZA 2M0YA 4WCIA 4M77G 1OX8A 7AT1B 4LDUA 2YSQA 4JJDA 4FSSA 2RA2A 4D8DA 2GQIA 4JLGA 1KHCA 4YTLA 3BFMA 5D7UA 1S72T 1M3BA 2DLPA 1N6AA 2DTOA 4LD6A 4C5HA 2MWPA 2QA4Q 2EYWA 4N4HA 3OYNA 2KXCA 3H0FA 1Q81U 1PD1A 1YWPA 3ASKA 5C6SA 4ESRA 4OMOA 3O5ZA 1M4ZA 5DY9A 3FEOA 2HKQB 1E6HA 4KUIA 2LNHB 4EMKC 2AK5A 2LX9A 1M5Q1 2DEUA 4HVVA 3PE0A 1MNDA 3HFOA 3A1PA 2EPDA 4Z8AA 3AT1B 4AFQC 4M77C 1DJ7B 2L2PA 2PUOB 3CD6T 1WDXA 1ZA2B 3FJPA 4ZTJA 2D1XA 3VRYA 1VQ9Q 1UGPB 3RBBB 1Z9ZA 2YLBA 1IO6A 4KT0E 1GBQA 2EGCA 1WHHA 3WVDB 3OYGA 2O9VA 2X4YA 5D6YA 1K73R 2EYYA 1W1FA 1JU5C 5KYWB 3GNFB 3OYFA 1GBRA 4RUGA 2RQWA 5LJ5e 4JRQA 1UGQB 1WYXA 1MMGA 1Y7XA 3EG2A 4DEXA 2HMAA 2FZCB 3RKWA 3EFOA 3CCRT 1BBZA 3HRSA 3HP9A 5LJ3h 3TSWA 4N0AC 3CCEA 4XTVA 4M75E 4M77F 3G6EA 4M78E 5GANg 3JB9H 3PGGA 2E41A 2YUPA 2P4RA 2YUOA 2QQAA 1AT1B 1XQHA 2OJ2A 3J7AF 3CC4T 1NLPC 1MNEA 3VV0A 1AEYA 4M75F 4M77E 2H8HA 2E6ZA 2K6DA 1Z9QA 4PJMA 1M27C 4JLIA 2C0OA 4FYWB 3A8MB 3A8OB 1TTHB 1O9SA 3J80E 2RK2A 3TCJA 2E5KA 2YDLA 3OS5A 3CMET 5FU6B 1HXDA 5GMKl 4LUDA 3BW1A 4JDSA 3MEWA 3BDUA 3H9NA 2V1QA 2VGMA 5GAMf 1BK2A 3QPHA 3H8ZA
chains in the Genus database with same CATH topology
1SRMA 1FYNA 1WXUA 1GCQC 1JO8A 3THKA 1SSHA 1H8KA 2EW3A 3UA7A 1FMKA 1KJWA 1SEMA 2L3SA 2CH4W 5L23A 2DL8A 3GBQA 1A0NB 2C0IA 1VYVA 1CSKA 1MV0B 2LX7A 4J9GA 2G6FX 2IIMA 2F2XA 4CC3A 2O88A 2SRCA 1UECA 1KSWA 2DBMA 4ORZA 3NPFA 4JJBA 4KRTA 4HCKA 4D8KA 3REBB 1ABOA 2FO0A 2J6OA 2RNAA 1GRIA 2BTTA 4LE9A 1PNJA 4OMNA 1OV3A 3IQLA 1KFZA 4RTVA 1GCQA 5IXFA 1AZEA 3M0QA 2EQIA 1YNZA 4JJCA 1WLPB 3RNJA 2DA9A 4QT7A 4RTZA 1CKAA 1OPKA 2KT1A 2CT3A 2HSPA 1HSQA 1K76A 1NEGA 2KRNA 3REAB 1NYFA 1VYTA 1MUZA 2CH4A 1HD3A 2ABLA 2AKLA 1UDLA 2HDAA 4HXJA 1HJDA 3VS2A 2K79A 2AZVA 2EYXA 2LP5A 2DVJA 2FPDA 4HVUA 1RLQC 5IHIA 3R6NA 2ED0A 2GNCA 1SHFA 1WFWA 1VA7A 2A08A 2LJ1A 3H0HA 2EGEA 2JMCA 2FRYA 3QWXX 4RTTA 3VS4A 2O2OA 2J6KA 2DF6A 1T3SA 2KBTA 1YWOA 1U06A 2OI3A 2RMOA 1PWTA 1B07A 1UJ0A 2JMAA 2SEMA 4OMPA 2K3BA 3H0IA 1UE9A 2EVRA 3UF4A 1TG0A 3VRZA 2GTOA 1GFDA 1TUCA 1YP5A 1QCFA 1AD5A 3EG3A 4CC4B 5ECAA 2KGTA 2J7IA 3PVLA 4J9IA 3EHRA 2ROTA 3JV3A 2FG0A 2LJ0A 2J6FA 2JM9A 4Z88A 3LH5A 3I35A 1ZUYA 2F2WA 2LZ6B 1H92A 3VS5A 1RLPC 3VS3A 2YT6A 4JPBW 3SHWA 5FW9A 4OMMA 2ESWA 3VS0A 1GL5A 2HCKA 4Z89A 2KYBA 2CT4A 1X6BA 1M3AA 2VWFA 1WI7A 2CSQA 3VS6A 1E7OA 1AWWA 1I07A 2ENMA 2JTEA 2EGAA 2PTKA 2ROLA 2K9GA 5EC7A 2EBPA 4LN2A 1X2KA 1QKXA 1ZBJA 1UJYA 1NM7A 4RTYA 3PVQA 1PRLC 1WA7A 2MOXA 1G2BA 4IIMA 2J06A 2JM8A 2KT8A 2RQTA 1UTIA 2EKHA 1S1NA 4F16A 2RN8A 3FJ5A 2HBWA 1W70A 3M0PA 2CSIA 1VYUA 2GTJA 2D8JA 4F14A 1KIKA 4E6RA 2FPEA 2M51A 4AFZC 3EHQA 1E6GA 4AG2C 2BZYA 3M0UA 2YUNA 5I11A 2LJ3A 1UG1A 1K0XA 4AG1C 2DILA 1J3TA 1X6GA 2BZXA 2CDTA 4A63B 2B86A 2EYZA 1U3OA 1X27A 2DM1A 1OOTA 2DNUA 4DEYA 1XOVA 2JS2A 2CUBA 2ECZA 1T0HA 3H41A 3ULRB 5I22A 2OAWA 1OPLA 4OMQA 1JQQA 4HVWA 1ZLMA 3M0RA 3I9QA 3VS1A 5IHKA 4LUEA 2L3QA 4J9EA 4J9FA 2BZ8A 4AFSC 3I5SA 1SPKA 1LCKA 2DMOA 4CC7A 4CC2A 2HEQA 3VS7A 5IXBA 1GFCA 2GGRA 1AWJA 3TVTA 2I0NA 2DYBA 1QKWA 1WX6A 1NEBA 2KR3A 3UA6A 3EG1A 1K0SA 2A28A 4M4ZA 2KRSA 4JZ4A 1UUEA 1UHCA 1UGVA 2A37A 4JZ3A 3TSZA 4EIKA 2A36A 1K4US 2D0NA 1CKBA 2KE9A 2DRKA 2DL3A 4X1VA 1X69A 1NLOC 1I0CA 2RF0A 1Y0MA 2AZSA 4GLMA 2X3XD 3A98A 2LMJA 1WIEA 4RTUA 5HCKA 1PKTA 1K1ZA 2JXBA 3U23A 1NG2A 1G83A 4GBQA 1BU1A 1RUWA 5IHNA 1U5SA 1WXTA 5GJWB 4J9BA 1NYGA 2KRMA 1JXOA 1ZX6A 1PRMC 1ZUKA 1AWXA 3NMZC 2DX1A 3ZL7C 4K11A 1B3QA 4RTWA 1MV3A 2GBQA 2RPNA 1V1CA 1N5ZA 2M0YA 1YN8A 2DL7A 2XMFA 4WCIA 1ZSGA 4Y92A 2L0AA 2JS0A 1ABQA 2KXDA 1RI9A 2YSQA 4FSSA 2NWMA 1QLYA 4JJDA 3UATA 5FWCA 4D8DA 1TUDA 2FRWA 2GQIA 1M8MA 2V1RA 1X43A 1PHTA 1M3BA 2DLPA 1SHGA 1ZUUA 2VVKA 2KNBB 2NUZA 2EYWA 2LQWA 2KXCA 3H0FA 1QWFA 5FWBA 1PKSA 4IIOA 1EFNA 1AOJA 3I5RA 3M0SA 1YWPA 2CUDA 2KYMA 4ESRA 4OMOA 3O5ZA 2C0TA 4LNPA 3M0TA 2F2VA 3QWYA 2KEAA 2W10A 1E6HA 2LNHB 1YCSB 1GCPA 2AK5A 3CQTA 1QWEA 1H3HA 4HVVA 2DE0X 3PE0A 3KFVA 2EPDA 4Z8AA 4OMLA 4J9DA 2RQRA 4AFQC 3EGUA 1T3LA 2L2PA 4RTXA 1WDXA 1K9AA 2JW4A 2MCNA 3NHNA 2D1XA 3VRYA 5IH2A 2LQNA 2DL5A 1Y57A 3RBBB 1JEGA 1Z9ZA 2QDLA 1AZGB 1X2QA 5GJVB 1IO6A 1GBQA 2EGCA 1SRLA 2O9VA 2EYYA 2J05A 2X3WD 1W1FA 2ED1A 1JU5C 1JXMA 1WXBA 2L3PA 1GBRA 4RUGA 2RQWA 3SEMA 1WYXA 1AWOA 2YUQA 3EG2A 1UFFA 2W0ZA 2FEIA 2K7AA 4DEXA 2O31A 2RQVA 2CREA 4F17A 2O9SA 1BBZA 3EG0A 2VKNA 3TSWA 4AFUC 1T0JA 2DL4A 1AVZC 1ARKA 2LCSA 2PZ1A 1W6XA 1I1JA 2P4RA 2YUOA 2YUPA 2PNIA 2OJ2A 3C0CA 2KROA 2DRMA 2JT4A 1NLPC 1OEBA 1AEYA 2H8HA 2K6DA 1Z9QA 1M27C 4ZNXA 1M30A 2C0OA 2K2MA 1M3CA 4J9CA 2D8HA 4R0KA 2DBKA 2RQUA 2FPFA 2E5KA 2YDLA 4LUDA 1UHFA 3NGPA 2AKKA 2V1QA 1BB9A 2MIOA 4J9HA 1BK2A 2DJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRM A;  1FYN A;  1WXU A;  1GCQ C;  1JO8 A;  3THK A;  1SSH A;  1H8K A;  2EW3 A;  3UA7 A;  1FMK A;  1KJW A;  1SEM A;  2L3S A;  2CH4 W;  5L23 A;  2DL8 A;  3GBQ A;  1A0N B;  2C0I A;  1VYV A;  1CSK A;  1MV0 B;  2LX7 A;  4J9G A;  2G6F X;  2IIM A;  2F2X A;  4CC3 A;  2O88 A;  2SRC A;  1UEC A;  1KSW A;  2DBM A;  4ORZ A;  3NPF A;  4JJB A;  4KRT A;  4HCK A;  4D8K A;  3REB B;  1ABO A;  2FO0 A;  2J6O A;  2RNA A;  1GRI A;  2BTT A;  4LE9 A;  1PNJ A;  4OMN A;  1OV3 A;  3IQL A;  1KFZ A;  4RTV A;  1GCQ A;  5IXF A;  1AZE A;  3M0Q A;  2EQI A;  1YNZ A;  4JJC A;  1WLP B;  3RNJ A;  2DA9 A;  4QT7 A;  4RTZ A;  1CKA A;  1OPK A;  2KT1 A;  2CT3 A;  2HSP A;  1HSQ A;  1K76 A;  1NEG A;  2KRN A;  3REA B;  1NYF A;  1VYT A;  1MUZ A;  2CH4 A;  1HD3 A;  2ABL A;  2AKL A;  1UDL A;  2HDA A;  4HXJ A;  1HJD A;  3VS2 A;  2K79 A;  2AZV A;  2EYX A;  2LP5 A;  2DVJ A;  2FPD A;  4HVU A;  1RLQ C;  5IHI A;  3R6N A;  2ED0 A;  2GNC A;  1SHF A;  1WFW A;  1VA7 A;  2A08 A;  2LJ1 A;  3H0H A;  2EGE A;  2JMC A;  2FRY A;  3QWX X;  4RTT A;  3VS4 A;  2O2O A;  2J6K A;  2DF6 A;  1T3S A;  2KBT A;  1YWO A;  1U06 A;  2OI3 A;  2RMO A;  1PWT A;  1B07 A;  1UJ0 A;  2JMA A;  2SEM A;  4OMP A;  2K3B A;  3H0I A;  1UE9 A;  2EVR A;  3UF4 A;  1TG0 A;  3VRZ A;  2GTO A;  1GFD A;  1TUC A;  1YP5 A;  1QCF A;  1AD5 A;  3EG3 A;  4CC4 B;  5ECA A;  2KGT A;  2J7I A;  3PVL A;  4J9I A;  3EHR A;  2ROT A;  3JV3 A;  2FG0 A;  2LJ0 A;  2J6F A;  2JM9 A;  4Z88 A;  3LH5 A;  3I35 A;  1ZUY A;  2F2W A;  2LZ6 B;  1H92 A;  3VS5 A;  1RLP C;  3VS3 A;  2YT6 A;  4JPB W;  3SHW A;  5FW9 A;  4OMM A;  2ESW A;  3VS0 A;  1GL5 A;  2HCK A;  4Z89 A;  2KYB A;  2CT4 A;  1X6B A;  1M3A A;  2VWF A;  1WI7 A;  2CSQ A;  3VS6 A;  1E7O A;  1AWW A;  1I07 A;  2ENM A;  2JTE A;  2EGA A;  2PTK A;  2ROL A;  2K9G A;  5EC7 A;  2EBP A;  4LN2 A;  1X2K A;  1QKX A;  1ZBJ A;  1UJY A;  1NM7 A;  4RTY A;  3PVQ A;  1PRL C;  1WA7 A;  2MOX A;  1G2B A;  4IIM A;  2J06 A;  2JM8 A;  2KT8 A;  2RQT A;  1UTI A;  2EKH A;  1S1N A;  4F16 A;  2RN8 A;  3FJ5 A;  2HBW A;  1W70 A;  3M0P A;  2CSI A;  1VYU A;  2GTJ A;  2D8J A;  4F14 A;  1KIK A;  4E6R A;  2FPE A;  2M51 A;  4AFZ C;  3EHQ A;  1E6G A;  4AG2 C;  2BZY A;  3M0U A;  2YUN A;  5I11 A;  2LJ3 A;  1UG1 A;  1K0X A;  4AG1 C;  2DIL A;  1J3T A;  1X6G A;  2BZX A;  2CDT A;  4A63 B;  2B86 A;  2EYZ A;  1U3O A;  1X27 A;  2DM1 A;  1OOT A;  2DNU A;  4DEY A;  1XOV A;  2JS2 A;  2CUB A;  2ECZ A;  1T0H A;  3H41 A;  3ULR B;  5I22 A;  2OAW A;  1OPL A;  4OMQ A;  1JQQ A;  4HVW A;  1ZLM A;  3M0R A;  3I9Q A;  3VS1 A;  5IHK A;  4LUE A;  2L3Q A;  4J9E A;  4J9F A;  2BZ8 A;  4AFS C;  3I5S A;  1SPK A;  1LCK A;  2DMO A;  4CC7 A;  4CC2 A;  2HEQ A;  3VS7 A;  5IXB A;  1GFC A;  2GGR A;  1AWJ A;  3TVT A;  2I0N A;  2DYB A;  1QKW A;  1WX6 A;  1NEB A;  2KR3 A;  3UA6 A;  3EG1 A;  1K0S A;  2A28 A;  4M4Z A;  2KRS A;  4JZ4 A;  1UUE A;  1UHC A;  1UGV A;  2A37 A;  4JZ3 A;  3TSZ A;  4EIK A;  2A36 A;  1K4U S;  2D0N A;  1CKB A;  2KE9 A;  2DRK A;  2DL3 A;  4X1V A;  1X69 A;  1NLO C;  1I0C A;  2RF0 A;  1Y0M A;  2AZS A;  4GLM A;  2X3X D;  3A98 A;  2LMJ A;  1WIE A;  4RTU A;  5HCK A;  1PKT A;  1K1Z A;  2JXB A;  3U23 A;  1NG2 A;  1G83 A;  4GBQ A;  1BU1 A;  1RUW A;  5IHN A;  1U5S A;  1WXT A;  5GJW B;  4J9B A;  1NYG A;  2KRM A;  1JXO A;  1ZX6 A;  1PRM C;  1ZUK A;  1AWX A;  3NMZ C;  2DX1 A;  3ZL7 C;  4K11 A;  1B3Q A;  4RTW A;  1MV3 A;  2GBQ A;  2RPN A;  1V1C A;  1N5Z A;  2M0Y A;  1YN8 A;  2DL7 A;  2XMF A;  4WCI A;  1ZSG A;  4Y92 A;  2L0A A;  2JS0 A;  1ABQ A;  2KXD A;  1RI9 A;  2YSQ A;  4FSS A;  2NWM A;  1QLY A;  4JJD A;  3UAT A;  5FWC A;  4D8D A;  1TUD A;  2FRW A;  2GQI A;  1M8M A;  2V1R A;  1X43 A;  1PHT A;  1M3B A;  2DLP A;  1SHG A;  1ZUU A;  2VVK A;  2KNB B;  2NUZ A;  2EYW A;  2LQW A;  2KXC A;  3H0F A;  1QWF A;  5FWB A;  1PKS A;  4IIO A;  1EFN A;  1AOJ A;  3I5R A;  3M0S A;  1YWP A;  2CUD A;  2KYM A;  4ESR A;  4OMO A;  3O5Z A;  2C0T A;  4LNP A;  3M0T A;  2F2V A;  3QWY A;  2KEA A;  2W10 A;  1E6H A;  2LNH B;  1YCS B;  1GCP A;  2AK5 A;  3CQT A;  1QWE A;  1H3H A;  4HVV A;  2DE0 X;  3PE0 A;  3KFV A;  2EPD A;  4Z8A A;  4OML A;  4J9D A;  2RQR A;  4AFQ C;  3EGU A;  1T3L A;  2L2P A;  4RTX A;  1WDX A;  1K9A A;  2JW4 A;  2MCN A;  3NHN A;  2D1X A;  3VRY A;  5IH2 A;  2LQN A;  2DL5 A;  1Y57 A;  3RBB B;  1JEG A;  1Z9Z A;  2QDL A;  1AZG B;  1X2Q A;  5GJV B;  1IO6 A;  1GBQ A;  2EGC A;  1SRL A;  2O9V A;  2EYY A;  2J05 A;  2X3W D;  1W1F A;  2ED1 A;  1JU5 C;  1JXM A;  1WXB A;  2L3P A;  1GBR A;  4RUG A;  2RQW A;  3SEM A;  1WYX A;  1AWO A;  2YUQ A;  3EG2 A;  1UFF A;  2W0Z A;  2FEI A;  2K7A A;  4DEX A;  2O31 A;  2RQV A;  2CRE A;  4F17 A;  2O9S A;  1BBZ A;  3EG0 A;  2VKN A;  3TSW A;  4AFU C;  1T0J A;  2DL4 A;  1AVZ C;  1ARK A;  2LCS A;  2PZ1 A;  1W6X A;  1I1J A;  2P4R A;  2YUO A;  2YUP A;  2PNI A;  2OJ2 A;  3C0C A;  2KRO A;  2DRM A;  2JT4 A;  1NLP C;  1OEB A;  1AEY A;  2H8H A;  2K6D A;  1Z9Q A;  1M27 C;  4ZNX A;  1M30 A;  2C0O A;  2K2M A;  1M3C A;  4J9C A;  2D8H A;  4R0K A;  2DBK A;  2RQU A;  2FPF A;  2E5K A;  2YDL A;  4LUD A;  1UHF A;  3NGP A;  2AKK A;  2V1Q A;  1BB9 A;  2MIO A;  4J9H A;  1BK2 A;  2DJQ A; 
#chains in the Genus database with same CATH topology
 1WXU A;  2E6N A;  2LT1 A;  1H8K A;  5I21 A;  5CKD A;  2L3S A;  2DL8 A;  3GBQ A;  5AT1 B;  1A0N B;  1KQ2 A;  1CSK A;  2EJF A;  4KGX B;  3CCJ T;  2K3Y A;  4J9G A;  1QVG P;  4CC3 A;  3GIB A;  4MMK A;  2O88 A;  1S72 Q;  1KSW A;  1VIE A;  1OYX A;  4QKU A;  5FRO A;  3SB2 A;  4NL2 A;  1YI2 T;  2J6O A;  2K5F A;  2VGN A;  4EMK A;  4LE9 A;  3V8J A;  4BI4 A;  4DA4 A;  4OB2 B;  1KFZ A;  3RIR A;  1AZE A;  2EQI A;  3ER0 A;  3EH2 A;  1VQL Q;  1ACM B;  5CVI A;  3G71 A;  3OQ5 A;  3RKX A;  2QAS A;  3L2W A;  1OZ2 A;  2HSP A;  1HSQ A;  3FIF A;  1QCO A;  1NEG A;  3RR6 A;  3CMA A;  1YHQ T;  1NBE B;  2CH4 A;  1HD3 A;  5GAM e;  4C8Q D;  3MP1 A;  4AMC A;  4M7D G;  4HXJ A;  3A8H B;  3M59 A;  2PUK B;  4NL3 A;  2LP5 A;  1JJ2 A;  1KD1 C;  1X6O A;  4PJO E;  1ZSZ A;  1VQ4 Q;  5KCO A;  3MP8 A;  3SWN A;  3G6E Q;  4FSX A;  3G4S A;  3JCM f;  2EGE A;  1KC8 C;  1NE8 A;  4M78 D;  4RTT A;  1RAC B;  2JZ2 A;  2J6K A;  4P5N A;  2DF6 A;  2A7Y A;  1U06 A;  2V8J A;  2JMA A;  1PWT A;  1B07 A;  4DBF A;  2K3B A;  1D3B B;  1QVP A;  4M75 C;  4NOY A;  1TUC A;  3S3N A;  2EQJ A;  4OB1 B;  2RI3 A;  3M5A A;  1KK7 A;  1FWZ A;  2KGT A;  2DXU A;  3PVL A;  5CKE A;  5KYW A;  1Q95 G;  4L5G A;  3M9Q A;  3I35 A;  1Q82 R;  1KQS S;  2X35 A;  2LZ6 B;  4C5I A;  3E2U A;  3QYG B;  1BYM A;  2YT6 A;  3SHW A;  3VUZ A;  2HCK A;  2EKO A;  2CZ6 B;  2ZAE A;  1X6B A;  4RG8 A;  1VQ4 A;  1JB0 E;  1OZ3 A;  3CD6 A;  3CCJ A;  4M77 D;  1R77 A;  1QP2 A;  1M1K C;  2QTV A;  2NUT B;  2CZ0 B;  2JJ9 A;  3MHX A;  2EBP A;  4LN2 A;  1QKX A;  1UJY A;  3OA6 A;  2M9U A;  3CBM A;  1RAD B;  3RMQ A;  1UEB A;  2PVD B;  3E9F A;  1N8R C;  2XK0 A;  2KT8 A;  1MGQ A;  1UTI A;  2VUB A;  2R5A A;  2MK5 A;  5GAN 6;  3FJ5 A;  1W70 A;  4OMF B;  4DBH A;  3OS1 A;  3OYY A;  3P8D A;  1VYU A;  2D8J A;  5GMK h;  2FPE A;  5IAY A;  5FU7 B;  3C4S A;  2P84 A;  4AG2 C;  2YUN A;  1K8A U;  4DBR A;  1PSE A;  1P92 A;  4WF2 A;  4E7J A;  4BI8 B;  3HTR A;  1K8A C;  4C0G A;  1C1A A;  3JCM W;  1K73 U;  2FB7 A;  4F7U A;  3QJY A;  1Q82 U;  1XOV A;  4J7F A;  3CCL Q;  3CCL A;  4M77 A;  3C12 A;  1KHI A;  5I22 A;  2OAW A;  1OPL A;  4OMQ A;  1Q7Y C;  1G3T A;  3M0R A;  4AFS C;  3JCM d;  3JCM Q;  1YJW A;  2V26 A;  1D1C A;  4EDU A;  4CC7 A;  3CCL T;  1RAG B;  2E3I A;  1GFC A;  4M75 B;  3VU3 C;  3P8H A;  2DYB A;  2OTL Q;  1C0M A;  3C95 A;  2KR3 A;  3S3O A;  5GAN d;  4M78 C;  1K0S A;  4D6W A;  2A28 A;  3HFN A;  2KRS A;  3M58 A;  1UGV A;  2A37 A;  1PC0 A;  4JZ3 A;  3CME Q;  4EIK A;  2HL5 C;  3OSV A;  4QQD A;  1RAH B;  2MPX C;  4RG2 A;  4XU1 A;  4X1V A;  4ZGD B;  4R55 A;  2L8D A;  3VKI A;  3LWI A;  4HCZ A;  2CP6 A;  1G3W A;  2X3X D;  1U1S A;  5FU7 C;  5GAN 3;  2LMJ A;  2XU8 A;  5IT9 E;  2CZ1 B;  3M4G A;  1MMN A;  2CKK A;  5GAO p;  1VQM T;  1PKT A;  1F1B B;  2JXB A;  1WJQ A;  5GAO l;  3CCM Q;  2X9H A;  1G83 A;  3NFC A;  5IHN A;  4KUL A;  1U5S A;  5GJW B;  1HK9 A;  1V29 B;  2E12 A;  4BE1 A;  2HBP A;  1JXO A;  1M90 R;  2FYK A;  3CCQ T;  2MWO A;  1WJS A;  1IHV A;  3NMZ C;  2DX1 A;  4OGC A;  3I56 T;  5KYU A;  5CQY A;  1ZSG A;  2L0A A;  4PFP A;  3JCM e;  2EJ9 A;  2ZZD A;  5FWC A;  4EMG A;  3OYH A;  2V1R A;  2MF2 A;  1X43 A;  2XHC A;  1EIF A;  2EJG A;  1YBY A;  2VVK A;  4BY6 C;  5LJ3 j;  2KNB B;  4FT4 A;  3G6E T;  3DKM A;  1YIT T;  2LQW A;  1KC8 R;  2KY9 A;  5FWB A;  1PKS A;  1EFN A;  1AOJ A;  2QK0 A;  2WSC E;  2YRD A;  2YWW A;  1VQP Q;  2COW A;  2QQ9 A;  4LNP A;  2HD0 A;  3M0T A;  5CQX A;  2F2V A;  1YCS B;  3CQT A;  5KH6 A;  3X28 B;  1PD0 A;  1TWB A;  2HQX A;  3J81 E;  1M90 C;  3GPL A;  3EG9 A;  1Q81 R;  3I55 Q;  5GAN 7;  1XTD A;  2KAF A;  2RQR A;  1K9A A;  1XNI A;  2JW4 A;  2D6F A;  4HA8 A;  5GAO n;  1M1K R;  1U8R A;  4QVZ A;  5IH2 A;  4HCC A;  3JCM X;  1Y57 A;  4BAC A;  5GJV B;  1QCN A;  1VQK Q;  1VQ8 Q;  3G4S Q;  3JB9 F;  2ED1 A;  2MAM A;  2L3P A;  3M54 A;  5J3B A;  4FU6 A;  3SEM A;  5KYX B;  2EIF A;  3HHT B;  3I56 A;  1EZZ B;  3SFM A;  3WVE B;  1UFF A;  4C8Q E;  2RHY A;  2W0Z A;  2FEI A;  3JCM c;  3GF5 A;  2RQV A;  2BE7 D;  3CC4 Q;  4F17 A;  2QQS A;  3EG0 A;  5CAI A;  2R5M A;  4PLI A;  4LDY A;  1AVZ C;  1LPL A;  1QVF S;  4F7U G;  2PZ1 A;  1H64 1;  4F04 B;  4QVC A;  1IHW A;  2PU9 B;  2JT4 A;  4BD3 A;  2CYZ B;  1OEB A;  2RO0 A;  4BB7 A;  1HYO A;  1BI2 A;  2NLU A;  1BI1 A;  4PL6 A;  2D8H A;  5I2M A;  2DBK A;  3OBY A;  4C92 A;  1Q7Y R;  3QSU A;  3CEY A;  1UHF A;  2K57 A;  3KUF A;  4PFZ A;  4C0F A;  2MIO A;  1YJW T;  1KC8 U;  4IUR A;  5GAN f;  3TU4 K;  4JJN K;  2P0P A;  1YJ9 Q;  4Q5W A;  3THK A;  3I56 Q;  4DOV A;  1FMK A;  1WGS A;  2GCX A;  2JNG A;  2LCC A;  2RH2 A;  3EFO B;  2GQV A;  1MV0 B;  2L89 A;  2LX7 A;  2FZG B;  2SRC A;  4Y91 A;  1B7T A;  4PJL A;  1YJ9 T;  2QEX Q;  4HCK A;  2LNV A;  4C92 D;  2RNA A;  1N9R A;  1NJI U;  2BTT A;  3V7R A;  9ATC B;  4RTV A;  1ZSZ B;  1GCQ A;  3URG A;  2EQK A;  2DXT A;  1YNZ A;  3A5Z B;  4JJC A;  4XTZ A;  4BDY A;  1WLP B;  3CCS T;  1BIA A;  3RNJ A;  2KT1 A;  2RJE A;  2D9T A;  4M7A F;  3CC2 Q;  2KRN A;  3HSB A;  1NYF A;  2DJZ A;  1MUZ A;  2HDA A;  1UDL A;  3CC7 T;  4LD9 K;  2FVU A;  1HJD A;  3VS2 A;  2AZV A;  4X9C A;  2DVJ A;  1I8F A;  1RLQ C;  2NUP A;  2BKD N;  3R6N A;  2GNC A;  1LOJ A;  2BE9 B;  5D6W A;  2RJD A;  3H0H A;  3M57 A;  1I4K 1;  4M7A B;  5A0D A;  3UT1 A;  1Y96 A;  4PJO B;  4A4H A;  2EQM A;  2FRY A;  5CIU A;  1D0Y A;  2O2O A;  2F69 A;  2DET A;  3CPF A;  4II1 A;  1T3S A;  3O8V A;  1YWO A;  3QUI A;  3V7C A;  1QQJ A;  2CGH A;  3GP8 A;  3PNW C;  1UJ0 A;  2VV5 A;  1UE9 A;  3UF4 A;  2OTJ Q;  1VQ7 T;  1GFD A;  3LGL A;  1QCF A;  1VQ5 A;  3EG3 A;  4C8Q B;  5GAN 8;  4PFO A;  1OX9 A;  5GMK j;  3EHR A;  3LX7 A;  3JCM g;  2LJ0 A;  2JM9 A;  1ZUY A;  1JRI A;  1WHG A;  1VQ4 T;  5I2S A;  3VS5 A;  4E47 A;  4JPB W;  1YJW Q;  3OYE A;  2RD1 A;  2QA4 A;  1D3B A;  3N5B B;  3VS0 A;  2ZPI B;  3OBW A;  1GL5 A;  2KYB A;  2K2V A;  2ZPB B;  5CO7 A;  3DLL A;  1WPY A;  3L42 A;  1M3A A;  5GAM j;  1I81 A;  2JUF A;  2DER A;  2VWF A;  3VUB A;  3CCE Q;  3CC7 A;  1E7O A;  2RM4 A;  2VXE A;  3VYH B;  1I07 A;  2JTE A;  1K9M C;  3M55 A;  1VQ6 Q;  2OTL T;  5FRM A;  3MPU B;  2K9G A;  4OB0 B;  3E19 A;  3SD4 A;  2EFI A;  1W2B P;  5CR2 A;  3OYB A;  1IZ6 A;  4ZTF A;  2K5L A;  1YCY A;  1KQS P;  1ZHI A;  1ZSZ C;  1U1T A;  3CXC S;  2J06 A;  2RQT A;  1VQ9 A;  2OTL A;  2EKH A;  1D1B A;  2HQH A;  1VQN T;  4FL6 A;  1YJN Q;  2CSI A;  2VB6 A;  3P8B B;  3DB4 A;  4E6R A;  4E2F B;  1NJI R;  3FB9 A;  1OU8 A;  4KBM B;  2MI6 A;  3M0U A;  5I11 A;  4BUG A;  1N9S A;  1UG1 A;  5GAN h;  3QG1 A;  4QQ6 A;  1BCM A;  5LJ5 f;  4AG1 C;  2DIL A;  3TRE A;  3CCV A;  1KQ1 A;  4A63 B;  3CC4 A;  2B86 A;  4KH0 B;  2RB6 A;  1U3O A;  1OOT A;  4WTO B;  3E1S A;  2GFU A;  4M7A C;  2ECZ A;  1T0H A;  1PCX A;  3H41 A;  3ULR B;  3CCV T;  1VQ5 Q;  1JQQ A;  2KI7 A;  5GAO q;  1ZLM A;  2I2L A;  2IPO B;  3I9Q A;  3CCQ Q;  5KYN A;  5J39 A;  4J9E A;  2ZPH B;  2DPP B;  4M7D A;  3LH0 A;  3EFR A;  1N27 A;  2DMO A;  4CC2 A;  1MMA A;  5IXB A;  1QVG A;  4XU0 A;  1K9M U;  4PJO D;  1I5O B;  1R0C B;  4F7U E;  1VQM Q;  1QKW A;  1WX6 A;  1YFN A;  5KE2 A;  3EG1 A;  1RL2 A;  5GMK i;  2PQW A;  4OP0 A;  1SKU B;  1UHC A;  1YIT A;  3OYL A;  3TSZ A;  1YIT Q;  3E9G A;  4HT8 A;  1YI2 A;  1VQ7 Q;  1IRE B;  2D0N A;  1CKB A;  2LQK A;  2KE9 A;  5C0M A;  1XJW B;  3A8L B;  3L2R A;  3V7S A;  1X69 A;  4ZN1 A;  3RUX A;  1NLO C;  4FYX B;  1YJN T;  2G3R A;  2AZS A;  4XTX A;  4GLM A;  2DD4 A;  2DEQ A;  2R57 A;  2OTJ A;  3A98 A;  3PT9 A;  3CCQ A;  4RTU A;  5HCK A;  3CCR Q;  1YJN A;  2QQR A;  3OMG A;  3OYJ A;  2BIV A;  4M7A E;  1WXT A;  3CCE T;  1TH7 A;  2KRM A;  3RER A;  5D6X A;  4ELZ C;  1ZX6 A;  2EYQ A;  3LLR A;  3S6W A;  1R8O B;  2VYT A;  2JOY A;  4M7D D;  1ZQ1 A;  1B3Q A;  2ZPG B;  2RPN A;  3RDV A;  4IUV A;  1YN8 A;  2DZC A;  2CZ7 B;  4Y92 A;  4ATO A;  2JS0 A;  1ABQ A;  5M9O A;  1VQK A;  2KXD A;  1RI9 A;  3UAT A;  1QLY A;  1LJO A;  1TUD A;  2HL3 A;  2Y4X A;  4HKE A;  2FRW A;  5A2Q E;  1M8M A;  8ATC B;  1PHT A;  1VQN Q;  2P0Q A;  4E7K A;  4E7L A;  1SHG A;  1ZUU A;  1YIJ A;  1Q81 C;  3G7Z A;  2NUZ A;  3I55 A;  1KG1 A;  1G3S A;  2V8K A;  4IIO A;  4PKC C;  2DXC A;  4J83 A;  3CCU A;  5GAN 5;  2KYM A;  5HK0 A;  2COY A;  1QVG S;  2HQE A;  5CK9 A;  3QWY A;  5GMK m;  4JRK A;  2RJC A;  2W10 A;  2ZCF B;  4M75 G;  1GCP A;  2HSE B;  2DE0 X;  4MZP A;  4C92 C;  4OML A;  3CPW A;  1IGU A;  5LJ3 g;  2CP0 A;  1VQL T;  5J26 A;  2QYZ A;  3NHN A;  3JCM V;  3MP6 A;  3FC3 A;  4XAX B;  2DIG A;  4FW2 A;  3CCS A;  2X4X A;  2F5K A;  1AZG B;  1X2Q A;  2DO3 A;  5CKB A;  1M9S A;  1SRL A;  1M2O A;  2J05 A;  2X3W D;  3OW2 A;  1WXB A;  3HL8 A;  3OY9 A;  1MMD A;  4EMH A;  1AWO A;  1RI0 A;  2DYI A;  2JTM A;  3EGX A;  5A0G A;  5GAO m;  4KGV B;  4N4G A;  5L8R E;  2O9S A;  2ZPE B;  4C92 F;  1JJ2 P;  3V8K A;  1SF9 A;  4AFU C;  3G71 T;  5KYY A;  1WQ7 A;  2DTI A;  4M7D E;  1ARK A;  1FX7 A;  1BCO A;  4ZGJ B;  1W6X A;  1I1J A;  1D0X A;  3GNG A;  3OYC A;  1QVF A;  4J6Y A;  3C0C A;  4C0Z A;  2KRO A;  1G5V A;  2DRM A;  3MEV A;  2YLC A;  4ME7 A;  2QGF B;  2F5T X;  2HNI A;  4ZNX A;  1M30 A;  2K2M A;  4C92 B;  4J9C A;  1RAA B;  2MMP A;  4R0K A;  3QZ5 B;  4J7I A;  3ZBD A;  4EMK B;  4QQG A;  4CI0 C;  2LVM A;  3NGP A;  4FIB A;  1LNX A;  2M0O A;  4XQ3 A;  1VQ8 A;  4J9H A;  1EX4 A;  1C6V X;  2DJQ A;  1SRM A;  4TVR A;  2AT1 B;  2K4Y A;  1GCQ C;  1JO8 A;  1SSH A;  1YJ9 A;  3UA7 A;  1KJW A;  1SEM A;  1JJ2 S;  2JTF A;  4RCB A;  1VYV A;  1GXI E;  2H3E B;  3G1J A;  3CCV Q;  1VQ5 T;  2G6F X;  3L2Q A;  1I5L A;  2IIM A;  2F2X A;  2M1H A;  1NJI C;  1UEC A;  4ORZ A;  1Q86 R;  3NPF A;  5LJ5 h;  4KRT A;  1ABO A;  2FO0 A;  1D0Z A;  1PNJ A;  6AT1 B;  1OV3 A;  3CC7 Q;  5KYY B;  5HY6 A;  3M0Q A;  3PTA A;  4XK8 E;  5LJ5 d;  1CKA A;  1K8A R;  1K76 A;  3JB9 J;  4EPC A;  1H3Z A;  2LRQ A;  3X25 B;  2ABL A;  2AKL A;  1Y07 A;  2B8A A;  1KD1 U;  5AYF A;  1SG5 A;  2K79 A;  3LYI A;  2EWN A;  2EYX A;  3TQ7 P;  5IHI A;  3CD6 Q;  3JRZ A;  4Z02 A;  4A4K A;  4ANJ A;  1OQK A;  3M53 A;  2QG9 B;  1WFW A;  3X26 B;  1VA7 A;  3JCM b;  2NYS A;  3GLX A;  4M77 B;  5KCH A;  1N8R R;  2A08 A;  2LJ1 A;  3CCR A;  4NS5 A;  4O5V A;  3OS0 A;  2JMC A;  3OB9 A;  4E7S A;  4E7H A;  3QWX X;  3CXC P;  4LXC A;  3X24 B;  1TS9 A;  2RK1 A;  3EFS A;  2HKN A;  1VQP T;  4B6M A;  2RMO A;  1TUG B;  5LJ3 e;  2M02 A;  2SEM A;  4OMP A;  1S72 A;  3H0I A;  3HPW A;  2EVR A;  3QKJ A;  3VRZ A;  1Q86 U;  3CC2 T;  1AD5 A;  3I55 T;  4DBQ A;  2X4J A;  2XDB A;  5ECA A;  3A8G B;  4J9I A;  2ROT A;  3UDC A;  3V8L A;  2FG0 A;  4Z88 A;  4X9D A;  2F1L A;  3LGF A;  5DLO A;  3QHS A;  4M78 F;  1H92 A;  3CBO A;  1VQ6 A;  2KVQ G;  2RI2 A;  2YHT A;  5IN1 A;  2YRC A;  2H3J A;  3PIP A;  2KK4 A;  2ZGW A;  5GAO r;  2CT4 A;  2LCL A;  3OYK A;  3MEU A;  3UWN A;  3LWH A;  5GAN j;  2O4X A;  1WI7 A;  1M1K U;  5GAN e;  4M78 B;  4BE2 A;  4KGZ B;  5EC7 A;  1ZBJ A;  1NM7 A;  3PVQ A;  1PRL C;  3T9N A;  4PK4 A;  2IVW A;  1V76 A;  1G2B A;  4RKU E;  2WSF E;  4IIM A;  2JM8 A;  5FLX E;  2QDY B;  3INZ A;  4PLL A;  2HBW A;  3M0P A;  3M56 A;  2GTJ A;  4OGE A;  4F14 A;  1Q86 C;  1W2B S;  1M8V A;  2Y90 A;  4AFZ C;  4IUT A;  3EHQ A;  2VXF A;  1E6G A;  2E10 A;  2BZY A;  1AHJ B;  5LJ3 d;  2CS7 A;  1K0X A;  1J3T A;  1X6G A;  2ZPF B;  5A0L A;  4PJJ A;  4X34 A;  2DD5 A;  1X27 A;  5KE3 A;  1VUB A;  4DEY A;  1IRX A;  3OYM A;  3OYD A;  4PJN A;  2RHU A;  1VQP A;  3H6Z A;  4J8O A;  1WQW A;  2CP3 A;  3VS1 A;  5IHK A;  4JUV A;  2KQW A;  2O01 E;  4J9F A;  2BZ8 A;  3CME A;  3I5S A;  1SPK A;  1LCK A;  2E1H A;  3VS7 A;  5LJ5 g;  1D09 B;  3QXE B;  3CPW P;  3TVT A;  4M7D F;  4IKF A;  2P4T A;  4XTU A;  1NEB A;  1VIF A;  3UA6 A;  5GAM d;  4C8Q A;  1VOM A;  2IG0 A;  5CKH A;  5GAN 2;  3DB3 A;  8AT1 B;  4M4Z A;  4JZ4 A;  1SSF A;  4B9X A;  2QXF A;  1VQL A;  1PSF A;  3RES A;  1PG5 B;  2QA4 T;  3JCM h;  3L1A A;  3QDF A;  4BE0 A;  2A36 A;  3BY7 A;  2RJF A;  3NTI A;  4MZT A;  2XI9 A;  4M7D B;  1MHN A;  2DL3 A;  1IGQ A;  5LJ5 j;  2E5Q A;  2QTX A;  1M1F A;  3CCM T;  2A3L A;  1ZA1 B;  1TSF A;  1RAI B;  4ELY C;  3EGD A;  3CCJ Q;  2KMT A;  2XDD A;  3QYH B;  1WIE A;  4J6X A;  1TU0 B;  1K1Z A;  3U23 A;  3F70 A;  1NG2 A;  3CXC A;  1WNL A;  1BU1 A;  1RUW A;  4AT1 B;  1Q7Y U;  1NYG A;  4J6W A;  1FMV A;  4A4F A;  3OW2 S;  1M1G A;  4ZN3 A;  2K5I A;  4HT9 A;  1AWX A;  1WJR A;  4DOW A;  2Y4Y A;  3ZL7 C;  4E7Z A;  4RTW A;  3OYI A;  2GBQ A;  1NPR A;  5FRN A;  2D0Q B;  2EQU A;  1Y71 A;  1V1C A;  1YIJ T;  2DL7 A;  2XMF A;  3QII A;  3JB9 I;  4IUP A;  2NWM A;  4PJO C;  1W2B A;  2MYS A;  3RKY A;  2DK3 A;  2AIR B;  3CCU T;  4CRI A;  3D7S B;  2BUD A;  4Y28 E;  1YIJ Q;  2A0F B;  2YRV A;  4B9W A;  1QWF A;  3PMI A;  4XU3 A;  3TEE A;  4KH1 B;  3HRT A;  4R56 A;  1WHM A;  3I5R A;  3M0S A;  3HRU A;  3HKS A;  2CUD A;  5KYU B;  3CCU Q;  1VQ6 T;  2C0T A;  2DVE A;  2XKO C;  2XIC A;  2KEA A;  2KDS A;  4M7D C;  2XG8 D;  3R6O A;  1QWE A;  3X20 B;  1H3H A;  1BI0 A;  4QVD A;  3OMC A;  2LQ8 A;  3KFV A;  4J9D A;  3EGU A;  1T3L A;  4PJO F;  4RTX A;  2DXB A;  1VQM A;  2MCN A;  4FYY B;  3MCA B;  2YXY A;  2LQN A;  2DL5 A;  1JEG A;  2QDL A;  2XID A;  1B34 B;  3VYG A;  1JXM A;  3EGX B;  2YUQ A;  3FRN A;  4C8Q C;  5CCA A;  2OTJ T;  1VQ9 T;  4M78 G;  3M4Y A;  2K7A A;  1VQK T;  2O31 A;  4FCY A;  2DFU A;  1QVF P;  5LJ3 f;  4MZM A;  2CRE A;  4IUQ A;  2DKG A;  2VKN A;  2K3X A;  1T0J A;  2DL4 A;  2DZ9 A;  5GAM g;  2LCS A;  2RHI A;  1TOV A;  1NPP A;  2OX7 A;  2PNI A;  1G8X A;  3ME9 A;  3KBG A;  4BI3 A;  3JAM E;  2RI5 A;  2C06 A;  2VAS A;  4OVA A;  3BE3 A;  4A4E A;  4JRI A;  1YI2 Q;  1VQ7 A;  4MDX A;  1FMW A;  3CC2 A;  1M3C A;  1PM3 A;  1M90 U;  1QMC A;  2VC8 A;  2RQU A;  4BDZ A;  2FPF A;  4PJO G;  1VQO A;  2AKK A;  1BB9 A;  4FM4 B;  3MEA A;  1WHK A;  1FYN A;  4MDW A;  4BY6 B;  2FHD A;  2DTH A;  3L2Z A;  2EW3 A;  1IXD A;  3ZEH A;  4GLK A;  2CH4 W;  4C5G A;  4OF1 A;  5L23 A;  2C0I A;  5LL6 S;  5CKF A;  1LVK A;  3QDR B;  5GMK e;  3CPW S;  3FDR A;  4F7U B;  4MML A;  2DBM A;  4GY5 A;  3EH1 A;  4JJB A;  2P0K A;  4D8K A;  3REB B;  2FL7 A;  1GRI A;  4OMN A;  3C94 A;  3IQL A;  2GFA A;  5IXF A;  1RAB B;  3G71 Q;  1OU9 A;  2DA9 A;  3NTK A;  4QT7 A;  4RTZ A;  3JSC A;  1OPK A;  2CT3 A;  1VQN A;  3REA B;  1VYT A;  4RCC A;  4C8Q G;  1QP3 A;  2QGG A;  2FPD A;  3BDL A;  4HVU A;  1TXQ A;  3OSS C;  1BKB A;  2ED0 A;  1SHF A;  3CMA T;  3MO8 A;  5DM7 R;  2NUT A;  2M16 A;  2ATC B;  1BIB A;  4XTW A;  5HK3 A;  2X51 A;  2L3R A;  3VS4 A;  4M7A G;  2KSS A;  1VQ8 T;  3SWN C;  3SDZ A;  4J5Y A;  2KBT A;  4DQ2 A;  2OI3 A;  2XD0 A;  1N8R U;  4FT2 A;  2CP2 A;  1TG0 A;  2LTO A;  2GTO A;  3AHU A;  4E7I A;  2E4H A;  1YHQ Q;  2NUP B;  1YP5 A;  4QW2 A;  2CP7 A;  4CC4 B;  4A53 A;  2J7I A;  3JV3 A;  3UPU A;  2J6F A;  2RHX A;  4L59 A;  1M2V B;  1VQO T;  3LH5 A;  1WHL A;  1Y96 B;  2F2W A;  4PJO A;  3JCM P;  1RLP C;  2QAZ A;  3VS3 A;  5FW9 A;  1Q82 C;  2JVV A;  2LC4 A;  4OMM A;  2ESW A;  5EG2 A;  2E3H A;  2WAC A;  2CP5 A;  4Z89 A;  2O4X B;  4FYV B;  3LW5 E;  2CSQ A;  1X01 A;  3EGD B;  4M7A A;  3VS6 A;  2COZ A;  2GF7 A;  3OYA A;  1AWW A;  4PNO A;  2ENM A;  1JBM A;  2EGA A;  4LDV A;  2PTK A;  2ROL A;  1WZO A;  3PFS A;  4O6J A;  1X2K A;  3PIO A;  2QI2 A;  4RTY A;  2L5Q A;  3CMA Q;  1WA7 A;  2MOX A;  3S3M A;  2PVG B;  5HKC A;  4V2S A;  3QZ9 B;  3CCS Q;  4L6V 5;  4ZGE B;  4LDW A;  4C0D C;  1S1N A;  4F16 A;  3JB9 D;  2RN8 A;  1ZBX A;  3VJP A;  4VUB A;  3SWN B;  2QEX T;  4M75 D;  1KIK A;  4C0D B;  2M51 A;  2E70 A;  3MET A;  2LJ3 A;  4A54 A;  3CBP A;  4JS5 A;  2AHJ B;  2QQB A;  5GAM h;  2HZY A;  4N4I A;  2R58 A;  2BZX A;  2CDT A;  1BI3 A;  4C92 E;  3EAE A;  1FXX A;  2Z0W A;  2EYZ A;  2LT4 A;  1RAE B;  2DM1 A;  2LDM A;  2DNU A;  1B34 A;  2JS2 A;  2CUB A;  1KQS A;  1UB4 A;  1NZ9 A;  3RMS A;  3OW2 P;  1OUL A;  3MKD A;  2PVO B;  3GOX A;  3QBY A;  4HVW A;  2OAU A;  1O75 A;  4KUD K;  4LUE A;  2L3Q A;  3QO3 A;  2RHZ A;  4M78 A;  1M2V A;  4RMO A;  4M75 A;  4FW1 A;  2HEQ A;  3NTH A;  3QJ6 A;  4M7A D;  2JN0 A;  4JS4 A;  2GGR A;  5FU6 C;  1AWJ A;  4LDX A;  2I0N A;  3ZFJ A;  3FLG A;  1VQO Q;  3Q1J A;  1G3Y A;  2FZK B;  4C5E A;  5DLQ E;  1UGS B;  1UUE A;  2DAQ A;  1K4U S;  4JRP A;  2WSE E;  4IUU A;  5KYX A;  2DRK A;  4HCB A;  1K9M R;  3PMT A;  1I0C A;  2DIQ A;  1D1A A;  2RF0 A;  4C8Q F;  1Y0M A;  2E65 A;  2EAY A;  1UGR B;  4N0A A;  1K73 C;  4F7U F;  3JCM J;  1OI1 A;  3OS2 A;  2XDP A;  1W4S A;  4C92 G;  3L2V A;  1YHQ A;  3WXM B;  3CCM A;  3EG9 B;  4GBQ A;  5GAN 4;  1IB8 A;  4XTY A;  1X75 C;  4J9B A;  3DLM A;  4UC4 A;  1QW1 A;  1WHJ A;  4OB3 B;  2X4W A;  2V8I A;  1PRM C;  1ZUK A;  3KXT A;  3L2U A;  2QEX A;  4XU2 A;  3G4S T;  4K11 A;  1R0B G;  4A4G A;  2E64 A;  3JB9 G;  2HAX A;  1RAF B;  3MJX A;  1MV3 A;  1KD1 R;  1N5Z A;  2M0Y A;  4WCI A;  4M77 G;  1OX8 A;  7AT1 B;  4LDU A;  2YSQ A;  4JJD A;  4FSS A;  2RA2 A;  4D8D A;  2GQI A;  4JLG A;  1KHC A;  4YTL A;  3BFM A;  5D7U A;  1S72 T;  1M3B A;  2DLP A;  1N6A A;  2DTO A;  4LD6 A;  4C5H A;  2MWP A;  2QA4 Q;  2EYW A;  4N4H A;  3OYN A;  2KXC A;  3H0F A;  1Q81 U;  1PD1 A;  1YWP A;  3ASK A;  5C6S A;  4ESR A;  4OMO A;  3O5Z A;  1M4Z A;  5DY9 A;  3FEO A;  2HKQ B;  1E6H A;  4KUI A;  2LNH B;  4EMK C;  2AK5 A;  2LX9 A;  1M5Q 1;  2DEU A;  4HVV A;  3PE0 A;  1MND A;  3HFO A;  3A1P A;  2EPD A;  4Z8A A;  3AT1 B;  4AFQ C;  4M77 C;  1DJ7 B;  2L2P A;  2PUO B;  3CD6 T;  1WDX A;  1ZA2 B;  3FJP A;  4ZTJ A;  2D1X A;  3VRY A;  1VQ9 Q;  1UGP B;  3RBB B;  1Z9Z A;  2YLB A;  1IO6 A;  4KT0 E;  1GBQ A;  2EGC A;  1WHH A;  3WVD B;  3OYG A;  2O9V A;  2X4Y A;  5D6Y A;  1K73 R;  2EYY A;  1W1F A;  1JU5 C;  5KYW B;  3GNF B;  3OYF A;  1GBR A;  4RUG A;  2RQW A;  5LJ5 e;  4JRQ A;  1UGQ B;  1WYX A;  1MMG A;  1Y7X A;  3EG2 A;  4DEX A;  2HMA A;  2FZC B;  3RKW A;  3EFO A;  3CCR T;  1BBZ A;  3HRS A;  3HP9 A;  5LJ3 h;  3TSW A;  4N0A C;  3CCE A;  4XTV A;  4M75 E;  4M77 F;  3G6E A;  4M78 E;  5GAN g;  3JB9 H;  3PGG A;  2E41 A;  2YUP A;  2P4R A;  2YUO A;  2QQA A;  1AT1 B;  1XQH A;  2OJ2 A;  3J7A F;  3CC4 T;  1NLP C;  1MNE A;  3VV0 A;  1AEY A;  4M75 F;  4M77 E;  2H8H A;  2E6Z A;  2K6D A;  1Z9Q A;  4PJM A;  1M27 C;  4JLI A;  2C0O A;  4FYW B;  3A8M B;  3A8O B;  1TTH B;  1O9S A;  3J80 E;  2RK2 A;  3TCJ A;  2E5K A;  2YDL A;  3OS5 A;  3CME T;  5FU6 B;  1HXD A;  5GMK l;  4LUD A;  3BW1 A;  4JDS A;  3MEW A;  3BDU A;  3H9N A;  2V1Q A;  2VGM A;  5GAM f;  1BK2 A;  3QPH A;  3H8Z A; 
#chains in the Genus database with same CATH homology
 1SRM A;  1FYN A;  1WXU A;  1GCQ C;  1JO8 A;  3THK A;  1SSH A;  1H8K A;  2EW3 A;  3UA7 A;  1FMK A;  1KJW A;  1SEM A;  2L3S A;  2CH4 W;  5L23 A;  2DL8 A;  3GBQ A;  1A0N B;  2C0I A;  1VYV A;  1CSK A;  1MV0 B;  2LX7 A;  4J9G A;  2G6F X;  2IIM A;  2F2X A;  4CC3 A;  2O88 A;  2SRC A;  1UEC A;  1KSW A;  2DBM A;  4ORZ A;  3NPF A;  4JJB A;  4KRT A;  4HCK A;  4D8K A;  3REB B;  1ABO A;  2FO0 A;  2J6O A;  2RNA A;  1GRI A;  2BTT A;  4LE9 A;  1PNJ A;  4OMN A;  1OV3 A;  3IQL A;  1KFZ A;  4RTV A;  1GCQ A;  5IXF A;  1AZE A;  3M0Q A;  2EQI A;  1YNZ A;  4JJC A;  1WLP B;  3RNJ A;  2DA9 A;  4QT7 A;  4RTZ A;  1CKA A;  1OPK A;  2KT1 A;  2CT3 A;  2HSP A;  1HSQ A;  1K76 A;  1NEG A;  2KRN A;  3REA B;  1NYF A;  1VYT A;  1MUZ A;  2CH4 A;  1HD3 A;  2ABL A;  2AKL A;  1UDL A;  2HDA A;  4HXJ A;  1HJD A;  3VS2 A;  2K79 A;  2AZV A;  2EYX A;  2LP5 A;  2DVJ A;  2FPD A;  4HVU A;  1RLQ C;  5IHI A;  3R6N A;  2ED0 A;  2GNC A;  1SHF A;  1WFW A;  1VA7 A;  2A08 A;  2LJ1 A;  3H0H A;  2EGE A;  2JMC A;  2FRY A;  3QWX X;  4RTT A;  3VS4 A;  2O2O A;  2J6K A;  2DF6 A;  1T3S A;  2KBT A;  1YWO A;  1U06 A;  2OI3 A;  2RMO A;  1PWT A;  1B07 A;  1UJ0 A;  2JMA A;  2SEM A;  4OMP A;  2K3B A;  3H0I A;  1UE9 A;  2EVR A;  3UF4 A;  1TG0 A;  3VRZ A;  2GTO A;  1GFD A;  1TUC A;  1YP5 A;  1QCF A;  1AD5 A;  3EG3 A;  4CC4 B;  5ECA A;  2KGT A;  2J7I A;  3PVL A;  4J9I A;  3EHR A;  2ROT A;  3JV3 A;  2FG0 A;  2LJ0 A;  2J6F A;  2JM9 A;  4Z88 A;  3LH5 A;  3I35 A;  1ZUY A;  2F2W A;  2LZ6 B;  1H92 A;  3VS5 A;  1RLP C;  3VS3 A;  2YT6 A;  4JPB W;  3SHW A;  5FW9 A;  4OMM A;  2ESW A;  3VS0 A;  1GL5 A;  2HCK A;  4Z89 A;  2KYB A;  2CT4 A;  1X6B A;  1M3A A;  2VWF A;  1WI7 A;  2CSQ A;  3VS6 A;  1E7O A;  1AWW A;  1I07 A;  2ENM A;  2JTE A;  2EGA A;  2PTK A;  2ROL A;  2K9G A;  5EC7 A;  2EBP A;  4LN2 A;  1X2K A;  1QKX A;  1ZBJ A;  1UJY A;  1NM7 A;  4RTY A;  3PVQ A;  1PRL C;  1WA7 A;  2MOX A;  1G2B A;  4IIM A;  2J06 A;  2JM8 A;  2KT8 A;  2RQT A;  1UTI A;  2EKH A;  1S1N A;  4F16 A;  2RN8 A;  3FJ5 A;  2HBW A;  1W70 A;  3M0P A;  2CSI A;  1VYU A;  2GTJ A;  2D8J A;  4F14 A;  1KIK A;  4E6R A;  2FPE A;  2M51 A;  4AFZ C;  3EHQ A;  1E6G A;  4AG2 C;  2BZY A;  3M0U A;  2YUN A;  5I11 A;  2LJ3 A;  1UG1 A;  1K0X A;  4AG1 C;  2DIL A;  1J3T A;  1X6G A;  2BZX A;  2CDT A;  4A63 B;  2B86 A;  2EYZ A;  1U3O A;  1X27 A;  2DM1 A;  1OOT A;  2DNU A;  4DEY A;  1XOV A;  2JS2 A;  2CUB A;  2ECZ A;  1T0H A;  3H41 A;  3ULR B;  5I22 A;  2OAW A;  1OPL A;  4OMQ A;  1JQQ A;  4HVW A;  1ZLM A;  3M0R A;  3I9Q A;  3VS1 A;  5IHK A;  4LUE A;  2L3Q A;  4J9E A;  4J9F A;  2BZ8 A;  4AFS C;  3I5S A;  1SPK A;  1LCK A;  2DMO A;  4CC7 A;  4CC2 A;  2HEQ A;  3VS7 A;  5IXB A;  1GFC A;  2GGR A;  1AWJ A;  3TVT A;  2I0N A;  2DYB A;  1QKW A;  1WX6 A;  1NEB A;  2KR3 A;  3UA6 A;  3EG1 A;  1K0S A;  2A28 A;  4M4Z A;  2KRS A;  4JZ4 A;  1UUE A;  1UHC A;  1UGV A;  2A37 A;  4JZ3 A;  3TSZ A;  4EIK A;  2A36 A;  1K4U S;  2D0N A;  1CKB A;  2KE9 A;  2DRK A;  2DL3 A;  4X1V A;  1X69 A;  1NLO C;  1I0C A;  2RF0 A;  1Y0M A;  2AZS A;  4GLM A;  2X3X D;  3A98 A;  2LMJ A;  1WIE A;  4RTU A;  5HCK A;  1PKT A;  1K1Z A;  2JXB A;  3U23 A;  1NG2 A;  1G83 A;  4GBQ A;  1BU1 A;  1RUW A;  5IHN A;  1U5S A;  1WXT A;  5GJW B;  4J9B A;  1NYG A;  2KRM A;  1JXO A;  1ZX6 A;  1PRM C;  1ZUK A;  1AWX A;  3NMZ C;  2DX1 A;  3ZL7 C;  4K11 A;  1B3Q A;  4RTW A;  1MV3 A;  2GBQ A;  2RPN A;  1V1C A;  1N5Z A;  2M0Y A;  1YN8 A;  2DL7 A;  2XMF A;  4WCI A;  1ZSG A;  4Y92 A;  2L0A A;  2JS0 A;  1ABQ A;  2KXD A;  1RI9 A;  2YSQ A;  4FSS A;  2NWM A;  1QLY A;  4JJD A;  3UAT A;  5FWC A;  4D8D A;  1TUD A;  2FRW A;  2GQI A;  1M8M A;  2V1R A;  1X43 A;  1PHT A;  1M3B A;  2DLP A;  1SHG A;  1ZUU A;  2VVK A;  2KNB B;  2NUZ A;  2EYW A;  2LQW A;  2KXC A;  3H0F A;  1QWF A;  5FWB A;  1PKS A;  4IIO A;  1EFN A;  1AOJ A;  3I5R A;  3M0S A;  1YWP A;  2CUD A;  2KYM A;  4ESR A;  4OMO A;  3O5Z A;  2C0T A;  4LNP A;  3M0T A;  2F2V A;  3QWY A;  2KEA A;  2W10 A;  1E6H A;  2LNH B;  1YCS B;  1GCP A;  2AK5 A;  3CQT A;  1QWE A;  1H3H A;  4HVV A;  2DE0 X;  3PE0 A;  3KFV A;  2EPD A;  4Z8A A;  4OML A;  4J9D A;  2RQR A;  4AFQ C;  3EGU A;  1T3L A;  2L2P A;  4RTX A;  1WDX A;  1K9A A;  2JW4 A;  2MCN A;  3NHN A;  2D1X A;  3VRY A;  5IH2 A;  2LQN A;  2DL5 A;  1Y57 A;  3RBB B;  1JEG A;  1Z9Z A;  2QDL A;  1AZG B;  1X2Q A;  5GJV B;  1IO6 A;  1GBQ A;  2EGC A;  1SRL A;  2O9V A;  2EYY A;  2J05 A;  2X3W D;  1W1F A;  2ED1 A;  1JU5 C;  1JXM A;  1WXB A;  2L3P A;  1GBR A;  4RUG A;  2RQW A;  3SEM A;  1WYX A;  1AWO A;  2YUQ A;  3EG2 A;  1UFF A;  2W0Z A;  2FEI A;  2K7A A;  4DEX A;  2O31 A;  2RQV A;  2CRE A;  4F17 A;  2O9S A;  1BBZ A;  3EG0 A;  2VKN A;  3TSW A;  4AFU C;  1T0J A;  2DL4 A;  1AVZ C;  1ARK A;  2LCS A;  2PZ1 A;  1W6X A;  1I1J A;  2P4R A;  2YUO A;  2YUP A;  2PNI A;  2OJ2 A;  3C0C A;  2KRO A;  2DRM A;  2JT4 A;  1NLP C;  1OEB A;  1AEY A;  2H8H A;  2K6D A;  1Z9Q A;  1M27 C;  4ZNX A;  1M30 A;  2C0O A;  2K2M A;  1M3C A;  4J9C A;  2D8H A;  4R0K A;  2DBK A;  2RQU A;  2FPF A;  2E5K A;  2YDL A;  4LUD A;  1UHF A;  3NGP A;  2AKK A;  2V1Q A;  1BB9 A;  2MIO A;  4J9H A;  1BK2 A;  2DJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...