1W1FA

Sh3 domain of human lyn tyrosine kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Lyn-SH3 Domain in Complex with a Herpesviral Protein Reveals an Extended Recognition Motif that Enhances Binding Affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3-domain
molecule keywords TYROSINE-PROTEIN KINASE LYN
total genus 8
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w1fA00
3VS7A 2W0ZA 1BU1A 1GBQA 2JW4A 2YT6A 2FPFA 4LUDA 3VS2A 2OJ2A 2SRCA 1YCSB 1UGVA 4OMMA 1JXOA 1UECA 2X3WD 4RTTA 2CDTA 4ESRA 2A37A 4F17A 1BBZA 2SEMA 3I5RA 1VYVA 2RNAA 1ZBJA 3VS1A 4OMLA 2JXBA 2KEAA 1M3AA 2RPNA 1IO6A 1K9AA 1I07A 2ED0A 2CH4W 1AZGB 1AWJA 3THKA 2K2MA 1E7OA 1UTIA 3PE0A 4J9CA 1BB9A 2L3QA 1RI9A 1SSHA 4D8DA 1K1ZA 1RUWA 4DEYA 2GBQA 5IXBA 2EYWA 4FSSA 2KRSA 4HXJA 2DL3A 2KYBA 3ULRB 2CH4A 1Y0MA 2OI3A 5IHKA 1Z9QA 2KBTA 2K3BA 4Z89A 2VWFA 3KFVA 2DBMA 2F2XA 1MV0B 2DYBA 1SPKA 1B07A 1GCQA 4RTUA 2K6DA 2YUQA 2KGTA 2AZVA 1ZX6A 1UJ0A 1OV3A 2RQTA 1UHCA 1U3OA 4LN2A 5HCKA 3EG2A 2CSQA 3I5SA 2JT4A 2F2WA 2NWMA 4A63B 1SHGA 1AWOA 1K4US 2JMAA 3ZL7C 2LP5A 4CC3A 2FEIA 4QT7A 4WCIA 2RF0A 1YWOA 1B3QA 2EGCA 2DX1A 3IQLA 4J9BA 2A28A 2M0YA 3SEMA 1KIKA 4RTYA 2DL4A 2IIMA 1HJDA 1K76A 2D0NA 1X2QA 4JPBW 1AWWA 2QDLA 1N5ZA 1CSKA 2L0AA 1BK2A 2K7AA 4JJBA 3VS6A 2YUNA 5GJWB 1K0SA 2O2OA 1X27A 3JV3A 2DF6A 2CUBA 2KRNA 1T3SA 3PVLA 1PRMC 1I1JA 1M30A 2RQUA 1WXBA 4F14A 2MIOA 2M51A 3VS4A 4Z8AA 2KRMA 1XOVA 3H0IA 3QWXX 2GTOA 2F2VA 5FWCA 4CC4B 1FYNA 2HEQA 1U06A 2DL8A 2ESWA 3A98A 4KRTA 1QWFA 2J05A 3UA7A 2AK5A 2FO0A 2EGAA 4RTWA 2PTKA 1WXUA 4J9EA 2V1QA 1NLOC 2CT4A 1NYFA 1MV3A 1VYUA 3M0RA 2LZ6B 2YUPA 2HBWA 1GL5A 2KT1A 3EG3A 1JU5C 5IHNA 4RTVA 2DMOA 1HD3A 5EC7A 1ZLMA 2EGEA 1Z9ZA 4CC2A 4RUGA 2L3PA 2DM1A 1OPKA 1QWEA 4J9HA 1JXMA 4DEXA 2XMFA 3I35A 1UE9A 2FG0A 3M0QA 4HVWA 1V1CA 2EW3A 2JMCA 1WYXA 4JZ4A 2HSPA 1G2BA 4J9FA 3H0HA 3M0SA 1GFDA 1G83A 1PNJA 1ZSGA 1GRIA 1GFCA 4IIMA 1YP5A 3SHWA 2LJ3A 2H8HA 2CREA 2DJQA 2DILA 4ZNXA 3REAB 3NMZC 1WA7A 5IH2A 4RTXA 1KJWA 2GQIA 2BZYA 1X43A 2EYXA 2LQNA 2FPEA 2O88A 2EPDA 2YDLA 2JS0A 1X6GA 3RNJA 2ED1A 1CKBA 2GTJA 2JM8A 1E6HA 1WXTA 2KYMA 1UJYA 2O31A 4RTZA 2VVKA 2LJ0A 2W10A 1JEGA 3TSZA 1SEMA 2LMJA 1RLQC 3LH5A 2KROA 1X2KA 2RQWA 3TSWA 1OPLA 2FRYA 1E6GA 1QKWA 2BTTA 1ABOA 2DNUA 1JQQA 1NYGA 2LCSA 1CKAA 4LUEA 3REBB 3M0PA 1TG0A 1VYTA 2MCNA 4HVVA 3TVTA 2BZ8A 1PKSA 2HDAA 4LNPA 2B86A 2JS2A 2KR3A 3NGPA 4J9DA 1Y57A 1HSQA 1GCQC 1UFFA 1I0CA 4JJDA 2PZ1A 3M0TA 4HCKA 2ECZA 4OMPA 1SRLA 3NPFA 1TUCA 4GBQA 2FPDA 2DRMA 1UG1A 1MUZA 1J3TA 2O9SA 1W1FA 2I0NA 5GJVB 1W6XA 2RQRA 1PHTA 2J6FA 2ENMA 4OMOA 1T0JA 1YWPA 1QLYA 1RLPC 2AKLA 1K0XA 4EIKA 3EG1A 4F16A 1AVZC 2EBPA 1NEBA 1M3CA 2KT8A 3I9QA 2KNBB 3VRZA 2D8JA 2LJ1A 1AZEA 2YUOA 1UDLA 2D1XA 4ORZA 2DA9A 4CC7A 2DRKA 2EYYA 4IIOA 1SHFA 2KXCA 1AEYA 2RQVA 1ARKA 1PWTA 2GGRA 2J6OA 3GBQA 3UA6A 5IXFA 1UUEA 2EKHA 2K79A 2ROTA 1KFZA 2BZXA 4AFSC 3VS3A 2MOXA 1WI7A 4J9GA 1ZUKA 5L23A 3H41A 1WX6A 2J06A 2AKKA 2CUDA 4GLMA 1OEBA 1FMKA 1T0HA 2JM9A 1WLPB 2J6KA 3NHNA 1NEGA 4E6RA 3O5ZA 1X6BA 1W70A 4AG2C 2C0OA 1M3BA 2ROLA 2O9VA 2E5KA 1KSWA 5ECAA 1EFNA 1X69A 1TUDA 1AD5A 2ABLA 1GCPA 1H3HA 4OMQA 2YSQA 3UF4A 3H0FA 3U23A 5I22A 2P4RA 1VA7A 2KE9A 3UATA 1NM7A 3EG0A 4HVUA 4D8KA 2OAWA 4K11A 2DL7A 2X3XD 3R6NA 5I11A 1GBRA 2EVRA 1M27C 4JZ3A 2K9GA 1H8KA 1PRLC 2DE0X 2NUZA 1WFWA 2C0IA 2CSIA 2LQWA 2LX7A 1ZUUA 3RBBB 3CQTA 3VS5A 3QWYA 2VKNA 1AWXA 3M0UA 4AG1C 4LE9A 2L2PA 2JTEA 2V1RA 4AFZC 1A0NB 2RMOA 5FW9A 1YNZA 2DVJA 2AZSA 2PNIA 1WIEA 2CT3A 1M8MA 1NG2A 3PVQA 1S1NA 1T3LA 1WDXA 4JJCA 3C0CA 1U5SA 2FRWA 1ZUYA 4M4ZA 1QKXA 3EHQA 4OMNA 1AOJA 2RN8A 1QCFA 3FJ5A 1SRMA 1OOTA 1UHFA 1YN8A 2A08A 1PKTA 2D8HA 1ABQA 4AFUC 2DL5A 2DBKA 2C0TA 2HCKA 5FWBA 3VS0A 3EHRA 1LCKA 1JO8A 4R0KA 4AFQC 2KXDA 3VRYA 2L3SA 2DLPA 2EQIA 1H92A 4Y92A 2G6FX 5IHIA 2J7IA 2EYZA 2A36A 3EGUA 2LNHB 4X1VA 2GNCA 4Z88A 1NLPC 4J9IA
chains in the Genus database with same CATH superfamily
4EMKA 2W0ZA 4EPCA 2RD1A 3JCMe 4LUDA 3JRZA 4C92C 4OMMA 2RO0A 2XIDA 2COZA 2X3WD 1PSEA 1M1KU 4A4HA 2A7YA 2X51A 5KCHA 1B34B 4KUIA 1ZBJA 3JB9J 1VQOQ 1TWBA 1C0MA 2JXBA 2L3RA 1IO6A 1QCNA 1PM3A 2ZPEB 1Q81C 2AHJB 4HCBA 3EG9A 1AWJA 3BDLA 1UB4A 4C0ZA 2QAZA 4DEYA 1AT1B 1YI2A 4BACA 5GMKl 4V2SA 1V76A 1VQ4A 4OGEA 5CAIA 1Y0MA 1MMDA 1KD1C 2EFIA 4E7SA 1Z9QA 3JB9I 4A53A 2KBTA 2K3BA 3JCMV 5GAOp 4Z89A 2VWFA 1YI2Q 4M7DB 1GXIE 2E4HA 4DOVA 2RK1A 1Y71A 1B07A 4MMKA 2K6DA 2XK0A 2DD5A 2ZGWA 2KGTA 1SG5A 3CCET 4M78A 4C0DB 3G71Q 1Q86U 2HL5C 2CZ0B 4FCYA 1OULA 3F70A 4ANJA 5D7UA 1D09B 3OS2A 4M77C 1Q82U 2DTHA 3X28B 3VYHB 1K8AC 2JT4A 4R56A 1IZ6A 5GAN8 5KYYB 1M9SA 3CEYA 2VB6A 1YHQT 5CR2A 3PFSA 2KAFA 3GNFB 2M0YA 2WSCE 3DKMA 4PJLA 2IVWA 2MYSA 3FEOA 5I2SA 4O6JA 4MMLA 2DL4A 4IUVA 3CPWP 2GCXA 3H9NA 1AWWA 1CSKA 3L2VA 1BK2A 2K7AA 4D6WA 3L2ZA 1ZQ1A 3PTAA 2K5LA 3JB9G 4HT9A 3QJ6A 4IKFA 3EFRA 3NTHA 2KRNA 3CMEQ 1T3SA 4XK8E 1PRMC 4F7UE 1C1AA 3OYLA 2EQUA 4DBFA 3SFMA 3JCMJ 3QYHB 5KCOA 1HXDA 4MZMA 3QYGB 1B34A 1QVGA 2E10A 4XU3A 4PJMA 2QQRA 1RAAB 1RAFB 3N5BB 2RI5A 4KRTA 1QWFA 1KQSA 2RHXA 3UA7A 2AK5A 5FROA 4E7KA 3OQ5A 3MP8A 2XKOC 1YITT 2GQVA 2CP7A 2DTIA 1VQ5A 1NYFA 3LLRA 3CCST 1TU0B 4M77E 1KD1R 4LD6A 3A8HB 2QK0A 2F5KA 5GAOm 3RDVA 2RA2A 3EG3A 3UT1A 1HD3A 5EC7A 1N8RU 1EX4A 2M1HA 1YI2T 2VGMA 4RG2A 3RERA 5C6SA 2C06A 3JB9D 3CC2T 1VQKQ 1V1CA 1D0XA 4BDYA 1NBEB 2JMCA 5CKFA 3DB4A 1VQ4Q 2HSPA 3ZEHA 3M0SA 1GFDA 1G83A 3CCUQ 2FHDA 1PNJA 2L5QA 1GFCA 4JUVA 4IIMA 1YP5A 3G71T 2DK3A 2ATCB 3BFMA 3T9NA 1QP3A 3S3MA 3WXMB 5HKCA 3EH1A 3OS5A 2GQIA 3OW2P 3OYKA 2FB7A 2FPEA 2ED1A 3JAME 2JM8A 1YJNQ 1WJSA 1UJYA 1IHVA 2HL3A 3L2UA 4RTZA 2VVKA 4B9XA 1QMCA 2LX9A 4OP0A 5GAMd 3G6ET 4C0FA 1NZ9A 1X2KA 2QASA 4E7IA 5GAN2 2QXFA 3I55Q 1JQQA 5LJ5j 3LGLA 3M0PA 4Z02A 2IPOB 2H3JA 4WF2A 4XTYA 4C5IA 5KYNA 1VQ6T 1UFFA 3M0TA 4DBHA 4HCKA 2ECZA 3G4ST 2QA4T 4OMPA 1Q86R 3EFOA 5FRNA 1D0ZA 1MNDA 2HKNA 1J3TA 1MUZA 3EG9B 3UPUA 2I0NA 4XTWA 2M0OA 3M54A 1X6OA 2J6FA 4M77F 3OYYA 3Q1JA 1MMGA 2WACA 3A8LB 3MP1A 2GFUA 5LJ5f 3JB9F 1K0XA 1U1TA 1Y96A 4F16A 1RAGB 3HRTA 1W2BP 2EQMA 1HK9A 4C92B 2CP0A 2D8JA 2LJ1A 3JCMd 2OAUA 2X4WA 2DA9A 1WQWA 1SHFA 4FM4B 4XU0A 5CK9A 2RQVA 1MGQA 3MCAB 1PWTA 4PJNA 2QQ9A 2GGRA 3SWNC 2O01E 1KHCA 3FDRA 2DAQA 2O4XB 1UUEA 3O8VA 2ROTA 4KT0E 1KFZA 3M5AA 4AFSC 1TS9A 1WI7A 4N4GA 4LDVA 5GMKe 3H41A 5AT1B 3V8LA 2FZCB 2BIVA 4XAXB 2CUDA 2KY9A 2OTLA 1OEBA 1NPPA 1T0HA 2JM9A 2KK4A 2PUKB 3MP6A 1OX9A 1W70A 4M75F 4AG2C 3G4SA 2QA4A 5ECAA 2DZ9A 3OYGA 1TUDA 4PJOB 3QKJA 5D6XA 3CCJQ 3GLXA 4ATOA 1VUBA 2DZCA 1VA7A 3UATA 1D3BA 1YJWQ 2LTOA 4B6MA 4PJOG 1VQ7Q 4B9WA 4M7AG 2E3HA 1I8FA 3X24B 3JCMW 3R6NA 3JCMf 1WHMA 1VQMA 1N9RA 1DJ7B 3VU3C 4BY6C 2K9GA 3M55A 4M78B 1PRLC 4L5GA 4FYVB 2NUZA 1WJQA 2C0IA 2CSIA 2LQWA 3VS5A 4C8QA 3RKXA 1VQPA 3CCMQ 3C4SA 2R57A 1VQLA 1Q7YC 1G3TA 4M7AC 1YNZA 1WIEA 3M53A 3CCEQ 1G8XA 2CGHA 3I55A 4PJOF 1U5SA 3HTRA 4P5NA 3OW2A 3EHQA 1QCFA 4HA8A 4EDUA 3FJ5A 1FWZA 2DIGA 1K8AU 4LDXA 5CO7A 1UHFA 1S72A 2HQHA 1JJ2A 3CCVA 1KK7A 1M8VA 2HCKA 4XU1A 1LNXA 3OYIA 3EHRA 2PVDB 3QHSA 1JO8A 4C92A 3VRYA 2VV5A 2L3SA 1H92A 4Y92A 5IHIA 4QVDA 1OYXA 4JRQA 2JTFA 2HAXA 4PJJA 1ZSZC 4BUGA 2LNHB 4DBQA 4ZN3A 3FC3A 1BU1A 4QQGA 2YT6A 3G6EQ 3JCMP 3VS2A 3OYEA 1WHGA 3LYIA 3CCLT 4M78G 2CDTA 4M78F 2EWNA 2LVMA 4BY6B 2A37A 4XQ3A 2SEMA 5AYFA 3I5RA 3EFOB 4KBMB 3VS1A 4OMLA 2LT4A 1YIJQ 1VQ5T 1NJIR 1Q86C 1K9AA 1VQLQ 1W2BA 4M7AD 5D6YA 3I55T 1UTIA 4J9CA 1P92A 1BB9A 2L3QA 4BI3A 1RI9A 2ZAEA 3P8BB 4D8DA 1RUWA 2AIRB 2HSEB 4A4KA 5LJ5d 4PLIA 1WQ7A 2KRSA 4F04B 4BE2A 2CH4A 2R5AA 4M75A 4M75B 2RHIA 3OSVA 4J83A 2OI3A 4M77A 1BI2A 3VV0A 4MZPA 3CCVQ 1VQNT 3LW5E 1GCQA 4FL6A 4J7IA 2RI2A 5A0DA 3I56T 2NUPB 5CCAA 1N8RC 3PIPA 3EG2A 3I5SA 4BE1A 1WGSA 3C12A 2F2WA 4NL3A 2XG8D 1K4US 3QJYA 2KSSA 2JMAA 5FU6C 2COWA 4LDWA 3MEAA 4WCIA 1YWOA 1B3QA 1EZZB 2EGCA 1VQNA 2NUTB 1VQPQ 3HP9A 3OW2S 2LCCA 3EH2A 4M78E 3QBYA 4JRIA 3MJXA 4RTYA 2IIMA 2D0NA 5KYWA 2QDLA 1C6VX 4EMKB 3SD4A 3TU4K 3VS6A 2YUNA 4NL2A 3PGGA 1VQOT 4Y91A 1K0SA 5GMKh 1M2VA 1X27A 2CYZB 1M30A 3MKDA 2D6FA 3CMAA 2A0FB 3CC7A 3VS4A 4Z8AA 1UGPB 3QWXX 4QVCA 3A8GB 2F2VA 1FYNA 4M7DD 1N27A 3J7AF 2DL8A 3A98A 1JJ2P 1VQ8A 4N0AC 4M77B 2EGAA 2DEUA 1NLOC 5GMKj 3M57A 3M0RA 3L2QA 2LZ6B 3J80E 2DD4A 3CCRA 2HBWA 2KT1A 3OYAA 5LJ3h 1VQNQ 3JCMb 3TCJA 5IHNA 4RTVA 2RHZA 1VQ6A 4O5VA 2CP6A 1ZLMA 2QEXT 1OU9A 2EGEA 1N9SA 4R55A 3PNWC 3BW1A 2E1HA 1QWEA 4J9HA 4ZTFA 4DEXA 4L59A 2FG0A 3M0QA 3HFNA 4HVWA 2EW3A 4M7AE 3H8ZA 4XTVA 3H0HA 1LJOA 2XD0A 2BE7D 1ZSGA 3TREA 1GRIA 2P84A 3FB9A 3R6OA 3EGXB 1ZA2B 2FZKB 2NYSA 2DILA 5GANh 2MMPA 4YTLA 1NJIU 3NMZC 1WA7A 1JBMA 4QVZA 1ZA1B 1LVKA 1KJWA 2EYXA 2EPDA 1XTDA 3RNJA 1TSFA 1CKBA 1UGSB 3JCMX 3CMAQ 1W4SA 2F1LA 2JZ2A 3EGDB 4M7DC 4LXCA 2LMJA 3QG1A 5CQXA 3TSWA 2RQWA 1E6GA 2EYQA 2BTTA 4M7DF 2DNUA 5LJ3e 3X25B 1K73R 3REBB 1VYTA 1YJ9Q 3CCRT 2B86A 2KR3A 3I56A 3FIFA 1WZOA 3CXCS 1RI0A 1I0CA 1M2VB 4JJDA 3M9QA 1SRLA 2FPDA 2V8IA 3LH0A 3L1AA 2O9SA 4FSXA 1U1SA 4DQ2A 2LCLA 1VQ9Q 2CKKA 2P0KA 1WPYA 2DETA 7AT1B 2ENMA 4OMOA 4M78D 2WSFE 3OBYA 1YHQQ 1Y7XA 2AKLA 3CD6A 3SWNA 4EIKA 2ZPGB 3HL8A 5CKEA 4ELYC 3CCSQ 3E2UA 2KT8A 3HPWA 1TXQA 1WHJA 2MWOA 5D6WA 2RB6A 4CC7A 2DRKA 2EYYA 2RHYA 1YIJT 2KXCA 1AEYA 2LNVA 3UA6A 2K3XA 5IXFA 3P8HA 2K79A 1KC8R 1KQSS 1YJNA 5L23A 1WX6A 4FU6A 2J06A 1WHHA 2R58A 2CZ7B 4GLMA 1YJ9A 2JVVA 3NHNA 3M59A 1NEGA 3HRSA 4ZTJA 1QCOA 4E6RA 3O5ZA 1X6BA 1R77A 2YXYA 2C0OA 3FJPA 5GAOq 1M3BA 2O9VA 5HK0A 1AD5A 4PJOA 1H3HA 2XDPA 3UF4A 2MF2A 3U23A 1BYMA 4DA4A 4VUBA 3S6WA 2RJEA 2WSEE 5GAN3 8ATCB 5KH6A 4HCZA 3QUIA 5GANg 4K11A 2DL7A 1GBRA 1OZ3A 2EVRA 3RMQA 5CQYA 2K5IA 4PL6A 3CCLQ 1M5Q1 3MEVA 5M9OA 1XJWB 5C0MA 1QVFS 1K73C 1OQKA 3JSCA 1H8KA 2JJ9A 2LX7A 3RBBB 1ZUUA 3CC4Q 4J6YA 1UGQB 1XNIA 1AWXA 4AG1C 4C5HA 1FMVA 5IT9E 2RMOA 2X4YA 3CC2Q 2DVJA 1QVGP 2CT3A 1S1NA 1T3LA 1WDXA 1NE8A 4JJCA 3GIBA 4M4ZA 1QKXA 2YRVA 1AOJA 4UC4A 4A4GA 1SRMA 2X35A 2DVEA 2K3YA 1YN8A 2A08A 1G3SA 1PKTA 2D8HA 2YRCA 3MPUB 4IUQA 3RKYA 3TQ7P 4JJNK 2DL5A 1N8RR 5LJ5h 4E7JA 3VS0A 4II1A 3HRUA 3CC4T 3PT9A 1LCKA 2KXDA 4N4HA 1VQ9A 1QP2A 2J7IA 5LJ3f 2CZ6B 2K4YA 2EYZA 3KBGA 1R0CB 2KVQG 1M90U 4PJOD 4F7UA 4F7UB 3QDRB 2DEQA 5HK3A 3CD6Q 1NLPC 4J7FA 3OS1A 3ME9A 1KG1A 3VS7A 1N6AA 2JW4A 1D3BB 1KD1U 4C8QB 4KH0B 3E9FA 2OJ2A 2SRCA 4E7LA 1YCSB 1UGVA 3HSBA 4MDWA 4ESRA 3DB3A 2PVGB 3RR6A 1BBZA 4F17A 5KYYA 3G4SQ 2QA4Q 4JRPA 2RNAA 3RUXA 3AHUA 4PK4A 2QI2A 4FW2A 3CBPA 2KEAA 1M3AA 1G3WA 4OMFB 3RKWA 4BDZA 2RPNA 2VASA 3S3OA 2CH4W 5KE2A 1ZBXA 3THKA 2K2MA 3PE0A 1PG5B 3GPLA 1SSHA 1KC8U 2VGNA 2GBQA 2EYWA 2OTLQ 4A4EA 2XI9A 4HXJA 2KYBA 4PFOA 3ULRB 2KQWA 2OTJA 2PUOB 4EMHA 3CMEA 3CC7Q 1WHKA 5IHKA 2ZPHB 1SKUB 2RH2A 3KFVA 2F2XA 1MV0B 2DYBA 3M56A 4RTUA 1Q7YR 2P0QA 3OYMA 2DXBA 1NPRA 3OMCA 2O4XA 1YJWA 5A2QE 1UJ0A 4NS5A 1WJRA 1VQMQ 4LN2A 5GMKm 1FXXA 2ZPIB 1VQ4T 2NWMA 4A63B 4C92G 1MHNA 3BE3A 4M7DE 2L89A 2LT1A 4Q5WA 4PFPA 1TTHB 4OB0B 1PSFA 1QVFA 2FEIA 4C8QE 4QT7A 2RF0A 3C95A 3META 2DX1A 2EKOA 4J9BA 3PIOA 3OSSC 5GAN5 1V29B 1VQ6Q 4FYXB 1RACB 3V7RA 5GAMh 2KI7A 1HJDA 3UDCA 1X2QA 1N5ZA 2L0AA 4JJBA 3LWIA 3CCQT 5GAMj 1MMAA 3LWHA 1I81A 5GJWB 2O2OA 1NJIC 1JJ2S 1SF9A 1VQPT 4C5GA 4XTUA 4PJOE 2VUBA 3PVLA 1KC8C 4LDYA 5CKBA 3CCSA 3CPWA 3OY9A 2M51A 2KRMA 1XOVA 3H0IA 3M4YA 4QQDA 4OB1B 2GTOA 2LRQA 4XU2A 4BI4A 4CC4B 4M77G 5GANd 2VYTA 2QEXA 4DOWA 1U06A 2VXEA 2ESWA 3MHXA 4QKUA 3HKSA 5J39A 1S72T 2J05A 2K57A 1PC0A 2GF7A 3CPFA 3ZBDA 3CCQQ 2FO0A 3OS0A 4LD9K 3CCVT 2QG9B 2PTKA 2G3RA 4J9EA 2V1QA 4AT1B 5DLOA 2XDDA 2GFAA 3RMSA 2MWPA 2VXFA 2RK2A 1GL5A 2XHCA 4OB3B 2OTLT 1TUGB 3KUFA 2ZPFB 4C8QC 5GAN4 2XDBA 4KGXB 1Z9ZA 3OYDA 1Q7YU 2L3PA 2RM4A 2DM1A 4IUPA 1OPKA 1JXMA 1UE9A 3CCMA 2ZPBB 2HNIA 1VQLT 2DO3A 2A3LA 2DJZA 3L2RA 1K8AR 4M77D 1F1BB 1Y07A 1BCOA 5GAN6 5GMKi 1HYOA 5GAOl 5LJ3g 2DXUA 1IGQA 3QDFA 2XU8A 4RG8A 2CREA 3GNGA 1ZSZB 4ZNXA 2LQ8A 1D1CA 3PMTA 1RABB 4RTXA 2X4JA 2CP5A 1X43A 3ASKA 5KYXA 1X6GA 2HBPA 2M16A 1JRIA 3JCMQ 1E6HA 1WXTA 2KYMA 3BDUA 1BI0A 2DYIA 9ATCB 1OI1A 2FL7A 2LJ0A 3TSZA 1SEMA 3A1PA 1TH7A 1RLQC 5A0GA 1VQ8Q 2FRYA 1ABOA 3DLLA 1NYGA 2E65A 1CKAA 5L8RE 2HD0A 1TG0A 4JLGA 2MCNA 4HVVA 3TVTA 1FMWA 1U8RA 2BZ8A 2X4XA 2DXTA 4NOYA 4JS5A 2PU9B 4J9DA 1TOVA 1Y57A 3V8KA 3GOXA 1HSQA 3RIRA 2QGGA 2PZ1A 3A5ZB 3NPFA 4M78C 2MK5A 4GBQA 2DRMA 1UG1A 2HKQB 4OF1A 3SDZA 5GAMe 1W1FA 4C92E 5GJVB 3CC2A 1IB8A 2RI3A 4PFZA 2MAMA 2YLBA 5DLQE 1BIAA 1T0JA 1YWPA 3LGFA 2E41A 1D1AA 3OYJA 2IG0A 1RLPC 4E47A 3MO8A 3EG1A 2QDYB 1AVZC 2EBPA 1NEBA 1M3CA 1RADB 3ZFJA 3I9QA 3TEEA 1AZEA 4ORZA 1UDLA 2D1XA 2YUOA 2QQBA 4IIOA 1VIFA 2MPXC 3DLMA 2E6ZA 2J6OA 3GBQA 3CXCA 4HKEA 2EKHA 4Y28E 5I21A 4KH1B 1FX7A 3VS3A 1IREB 2MOXA 3HFOA 1M2OA 2AKKA 4CRIA 2YRDA 4AMCA 5LJ3d 1Q82R 1M90C 3P8DA 2D9TA 2J6KA 1Q95G 2CP2A 2HZYA 4CI0C 1KSWA 1EFNA 4OMQA 2YSQA 3QZ5B 2OTJT 4EMGA 1X01A 2KE9A 4PLLA 4BE0A 5GAMf 3G71A 2E70A 3QXEB 4JDSA 4BD3A 2QTXA 4FIBA 3CCUA 4N4IA 5I11A 1KQSP 1YJWT 5DY9A 5FRMA 2LDMA 2V26A 4FYWB 1X75C 1K9MR 1OZ2A 2K2VA 2E3IA 2DE0X 4JS4A 3VUBA 1WFWA 5FU6B 1YIJA 3CQTA 2VKNA 3M0UA 4TVRA 3CCMT 2L2PA 2R5MA 1A0NB 2ZZDA 4ZGDB 3NFCA 5FW9A 2AZSA 2EIFA 4M75G 1M8MA 5EG2A 4E7HA 1VQ9T 2EJGA 2V8KA 3C0CA 2LQKA 2FRWA 3WVEB 1PCXA 1BKBA 2Y4YA 4E2FB 4N0AA 2RN8A 5J26A 1D1BA 1WHLA 6AT1B 2DERA 4ZN1A 1VIEA 2JN0A 1OOTA 2ZCFB 4MDXA 3EGXA 3V7CA 3FRNA 1YITQ 3L2WA 2D0QB 5FWBA 2L8DA 5IN1A 3X20B 2QQAA 4R0KA 1S72Q 2EQIA 2P4TA 3CCRQ 3QO3A 2A36A 3CMAT 4X1VA 1GBQA 2FPFA 1VOMA 1JXOA 1UECA 2HQEA 4RTTA 3D7SB 3OYFA 3E1SA 1VYVA 3E9GA 1MNEA 2Y90A 4PNOA 4LDUA 5KYUA 1JB0E 1I07A 1ZHIA 4EMKC 2ED0A 1AZGB 3CCEA 1E7OA 1UGRB 4C92D 4WTOB 2P0PA 1K1ZA 1I5OB 5IXBA 3CCQA 1H3ZA 5GANe 4FSSA 3CCLA 3VJPA 4J6XA 2DL3A 2RHUA 2QGFB 2FYKA 4IUTA 2Z0WA 1IRXA 5KYUB 3EAEA 1K9MC 1BCMA 3CCJA 3CC4A 2DBMA 1SPKA 4OVAA 2LC4A 2YUQA 2AZVA 1VQMT 1ZX6A 4QQ6A 5KYWB 1OV3A 1R0BG 2RQTA 1UHCA 3WVDB 1U3OA 5FLXE 5HY6A 4FT4A 1YJ9T 5HCKA 2CSQA 2DTOA 1EIFA 1AWOA 3SB2A 1SHGA 3V8JA 4OB2B 4F7UF 3JB9H 1M1GA 4FW1A 3X26B 8AT1B 3OYBA 1RAEB 1G5VA 3ZL7C 2LP5A 4CC3A 1B7TA 5GANj 2VC8A 5GAN7 1LOJA 2YHTA 2XICA 3QZ9B 3IQLA 5LJ5e 2A28A 3SEMA 4C8QD 3CBOA 1KIKA 2M9UA 5CIUA 1YFNA 1H641 1K76A 4JPBW 4ME7A 4RKUE 1W2BS 1M4ZA 4RMOA 4KUDK 1RL2A 4QW2A 1M1KC 5I2MA 4C5EA 4ZGEB 3JV3A 1BIBA 2DF6A 4GLKA 2CUBA 5GANf 1YITA 3QIIA 1YHQA 1I1JA 2RQUA 1WXBA 5CKHA 2QEXQ 3C94A 2MIOA 4F14A 3NTKA 4HT8A 4RCBA 1AHJB 3HHTB 1KHIA 4IUUA 4PJOC 2KDSA 4J6WA 5FWCA 1Y96B 1R8OB 2HEQA 3JCMh 5KE3A 4C8QG 4FT2A 3SWNB 3A8OB 3S3NA 5GAOr 4M7DG 3G6EA 4M75E 2AT1B 4RTWA 3AT1B 1K9MU 1WXUA 1VQKT 3BY7A 2CT4A 4MZTA 1MV3A 1VYUA 3I56Q 2BUDA 3CCUT 2YUPA 1RAHB 1JU5C 4X9DA 2DMOA 2YWWA 3VYGA 4JRKA 4CC2A 4RUGA 1ZSZA 1BI3A 3UWNA 2XMFA 3I35A 3INZA 3KXTA 1Q81R 2E5QA 3CMET 5FU7B 3PMIA 5LJ3j 1WYXA 2PVOB 4JZ4A 1G2BA 4J9FA 1SSFA 1LPLA 2RJCA 1OX8A 4HCCA 1RAIB 1IGUA 3EGDA 4XTXA 3SHWA 2LJ3A 3JCMg 2H8HA 2DJQA 4IURA 4A54A 3REAB 2RJDA 3QSUA 5IH2A 3E19A 3OBWA 5LL6S 2BZYA 2LQNA 4F7UG 2O88A 2YDLA 3NTIA 2JS0A 1QVFP 2GTJA 4DBRA 1M90R 1UEBA 3JCMc 2QYZA 2NUPA 2O31A 4KGZB 2W10A 1JEGA 1KQ1A 3LH5A 3QPHA 2KROA 1OPLA 1QKWA 2Y4XA 4M75C 2M02A 2LCSA 1QVGS 4LUEA 1PKSA 5GAOn 2HDAA 4LNPA 2JS2A 3NGPA 1GCQC 2DXCA 4M7AF 1M1KR 3GP8A 1TUCA 3L42A 2MI6A 2FVUA 1W6XA 5GAMg 2E64A 2RQRA 3OYCA 1PHTA 1VQ7A 2BKDN 1XQHA 4C92F 4FYYB 1O9SA 1QLYA 1I4K1 2I2LA 3MEWA 2HQXA 5DM7R 3H6ZA 4A4FA 1BI1A 3RESA 2DIQA 2PQWA 5KYXB 4C8QF 2QQSA 3OA6A 2KNBB 3VRZA 4C0GA 3GF5A 2JTMA 2K5FA 2V8JA 1M1FA 3OMGA 4KGVB 2DPPB 1VQ7T 1ARKA 2EJ9A 1QVPA 1I5LA 1IXDA 2BZXA 2OX7A 4JLIA 3URGA 2BE9B 4KULA 4J9GA 1ZUKA 3CBMA 1IHWA 4GY5A 3CC7T 3FLGA 1YCYA 3EFSA 3MEUA 1FMKA 1WLPB 1D0YA 4PKCC 3CPWS 3A8MB 2QTVA 2H3EB 2OTJQ 2ROLA 2E5KA 2F5TX 1X69A 1VQ8T 2ABLA 1GCPA 3V7SA 5IAYA 2COYA 4ZGJB 3H0FA 3ER0A 5CVIA 4M7AB 1G3YA 5I22A 2P4RA 2CS7A 1VQKA 5CKDA 1YJNT 1VQ5Q 1NM7A 3EG0A 1QW1A 2DKGA 4HVUA 4D8KA 2OAWA 1Q81U 3CD6T 4OGCA 2X3XD 4BI8B 2NUTA 4X9CA 5J3BA 1M27C 4JZ3A 4J8OA 3J81E 3VKIA 2EJFA 2DFUA 2E12A 1VQOA 1PD0A 4ELZC 3QWYA 1WNLA 3OYNA 3CXCP 4LE9A 2JTEA 2V1RA 4AFZC 4BB7A 2JUFA 3M4GA 2E6NA 2PNIA 3PVQA 1NG2A 2FZGB 4M75D 2EQKA 4C0DC 1ZUYA 2HMAA 2JNGA 1PD1A 4OMNA 2RJFA 1QQJA 3LX7A 4XTZA 1O75A 2YLCA 3G7ZA 5A0LA 2EQJA 2NLUA 1KQ2A 1MMNA 1K73U 1ABQA 4M7AA 4AFUC 2F69A 2CP3A 4J5YA 2DBKA 2C0TA 2B8AA 1ACMB 3CCJT 1YBYA 3OYHA 2KMTA 4E7ZA 4AFQC 5LJ5g 3M58A 2DLPA 1Q82C 2EAYA 4M7DA 2G6FX 3G1JA 1OU8A 4L6V5 3VUZA 2X9HA 2CZ1B 3EGUA 4X34A 4RCCA 2GNCA 2JOYA 4Z88A 5FU7C 3OB9A 4J9IA
chains in the Genus database with same CATH topology
3VS7A 2W0ZA 1BU1A 1GBQA 2JW4A 2YT6A 2FPFA 4LUDA 3VS2A 2OJ2A 2SRCA 1YCSB 1UGVA 4OMMA 1JXOA 1UECA 2X3WD 4RTTA 2CDTA 4ESRA 2A37A 4F17A 1BBZA 2SEMA 3I5RA 1VYVA 2RNAA 1ZBJA 3VS1A 4OMLA 2JXBA 2KEAA 1M3AA 2RPNA 1IO6A 1K9AA 1I07A 2ED0A 2CH4W 1AZGB 1AWJA 3THKA 2K2MA 1E7OA 1UTIA 3PE0A 4J9CA 1BB9A 2L3QA 1RI9A 1SSHA 4D8DA 1K1ZA 1RUWA 4DEYA 2GBQA 5IXBA 2EYWA 4FSSA 2KRSA 4HXJA 2DL3A 2KYBA 3ULRB 2CH4A 1Y0MA 2OI3A 5IHKA 1Z9QA 2KBTA 2K3BA 4Z89A 2VWFA 3KFVA 2DBMA 2F2XA 1MV0B 2DYBA 1SPKA 1B07A 1GCQA 4RTUA 2K6DA 2YUQA 2KGTA 2AZVA 1ZX6A 1UJ0A 1OV3A 2RQTA 1UHCA 1U3OA 4LN2A 5HCKA 3EG2A 2CSQA 3I5SA 2JT4A 2F2WA 2NWMA 4A63B 1SHGA 1AWOA 1K4US 2JMAA 3ZL7C 2LP5A 4CC3A 2FEIA 4QT7A 4WCIA 2RF0A 1YWOA 1B3QA 2EGCA 2DX1A 3IQLA 4J9BA 2A28A 2M0YA 3SEMA 1KIKA 4RTYA 2DL4A 2IIMA 1HJDA 1K76A 2D0NA 1X2QA 4JPBW 1AWWA 2QDLA 1N5ZA 1CSKA 2L0AA 1BK2A 2K7AA 4JJBA 3VS6A 2YUNA 5GJWB 1K0SA 2O2OA 1X27A 3JV3A 2DF6A 2CUBA 2KRNA 1T3SA 3PVLA 1PRMC 1I1JA 1M30A 2RQUA 1WXBA 4F14A 2MIOA 2M51A 3VS4A 4Z8AA 2KRMA 1XOVA 3H0IA 3QWXX 2GTOA 2F2VA 5FWCA 4CC4B 1FYNA 2HEQA 1U06A 2DL8A 2ESWA 3A98A 4KRTA 1QWFA 2J05A 3UA7A 2AK5A 2FO0A 2EGAA 4RTWA 2PTKA 1WXUA 4J9EA 2V1QA 1NLOC 2CT4A 1NYFA 1MV3A 1VYUA 3M0RA 2LZ6B 2YUPA 2HBWA 1GL5A 2KT1A 3EG3A 1JU5C 5IHNA 4RTVA 2DMOA 1HD3A 5EC7A 1ZLMA 2EGEA 1Z9ZA 4CC2A 4RUGA 2L3PA 2DM1A 1OPKA 1QWEA 4J9HA 1JXMA 4DEXA 2XMFA 3I35A 1UE9A 2FG0A 3M0QA 4HVWA 1V1CA 2EW3A 2JMCA 1WYXA 4JZ4A 2HSPA 1G2BA 4J9FA 3H0HA 3M0SA 1GFDA 1G83A 1PNJA 1ZSGA 1GRIA 1GFCA 4IIMA 1YP5A 3SHWA 2LJ3A 2H8HA 2CREA 2DJQA 2DILA 4ZNXA 3REAB 3NMZC 1WA7A 5IH2A 4RTXA 1KJWA 2GQIA 2BZYA 1X43A 2EYXA 2LQNA 2FPEA 2O88A 2EPDA 2YDLA 2JS0A 1X6GA 3RNJA 2ED1A 1CKBA 2GTJA 2JM8A 1E6HA 1WXTA 2KYMA 1UJYA 2O31A 4RTZA 2VVKA 2LJ0A 2W10A 1JEGA 3TSZA 1SEMA 2LMJA 1RLQC 3LH5A 2KROA 1X2KA 2RQWA 3TSWA 1OPLA 2FRYA 1E6GA 1QKWA 2BTTA 1ABOA 2DNUA 1JQQA 1NYGA 2LCSA 1CKAA 4LUEA 3REBB 3M0PA 1TG0A 1VYTA 2MCNA 4HVVA 3TVTA 2BZ8A 1PKSA 2HDAA 4LNPA 2B86A 2JS2A 2KR3A 3NGPA 4J9DA 1Y57A 1HSQA 1GCQC 1UFFA 1I0CA 4JJDA 2PZ1A 3M0TA 4HCKA 2ECZA 4OMPA 1SRLA 3NPFA 1TUCA 4GBQA 2FPDA 2DRMA 1UG1A 1MUZA 1J3TA 2O9SA 1W1FA 2I0NA 5GJVB 1W6XA 2RQRA 1PHTA 2J6FA 2ENMA 4OMOA 1T0JA 1YWPA 1QLYA 1RLPC 2AKLA 1K0XA 4EIKA 3EG1A 4F16A 1AVZC 2EBPA 1NEBA 1M3CA 2KT8A 3I9QA 2KNBB 3VRZA 2D8JA 2LJ1A 1AZEA 2YUOA 1UDLA 2D1XA 4ORZA 2DA9A 4CC7A 2DRKA 2EYYA 4IIOA 1SHFA 2KXCA 1AEYA 2RQVA 1ARKA 1PWTA 2GGRA 2J6OA 3GBQA 3UA6A 5IXFA 1UUEA 2EKHA 2K79A 2ROTA 1KFZA 2BZXA 4AFSC 3VS3A 2MOXA 1WI7A 4J9GA 1ZUKA 5L23A 3H41A 1WX6A 2J06A 2AKKA 2CUDA 4GLMA 1OEBA 1FMKA 1T0HA 2JM9A 1WLPB 2J6KA 3NHNA 1NEGA 4E6RA 3O5ZA 1X6BA 1W70A 4AG2C 2C0OA 1M3BA 2ROLA 2O9VA 2E5KA 1KSWA 5ECAA 1EFNA 1X69A 1TUDA 1AD5A 2ABLA 1GCPA 1H3HA 4OMQA 2YSQA 3UF4A 3H0FA 3U23A 5I22A 2P4RA 1VA7A 2KE9A 3UATA 1NM7A 3EG0A 4HVUA 4D8KA 2OAWA 4K11A 2DL7A 2X3XD 3R6NA 5I11A 1GBRA 2EVRA 1M27C 4JZ3A 2K9GA 1H8KA 1PRLC 2DE0X 2NUZA 1WFWA 2C0IA 2CSIA 2LQWA 2LX7A 1ZUUA 3RBBB 3CQTA 3VS5A 3QWYA 2VKNA 1AWXA 3M0UA 4AG1C 4LE9A 2L2PA 2JTEA 2V1RA 4AFZC 1A0NB 2RMOA 5FW9A 1YNZA 2DVJA 2AZSA 2PNIA 1WIEA 2CT3A 1M8MA 1NG2A 3PVQA 1S1NA 1T3LA 1WDXA 4JJCA 3C0CA 1U5SA 2FRWA 1ZUYA 4M4ZA 1QKXA 3EHQA 4OMNA 1AOJA 2RN8A 1QCFA 3FJ5A 1SRMA 1OOTA 1UHFA 1YN8A 2A08A 1PKTA 2D8HA 1ABQA 4AFUC 2DL5A 2DBKA 2C0TA 2HCKA 5FWBA 3VS0A 3EHRA 1LCKA 1JO8A 4R0KA 4AFQC 2KXDA 3VRYA 2L3SA 2DLPA 2EQIA 1H92A 4Y92A 2G6FX 5IHIA 2J7IA 2EYZA 2A36A 3EGUA 2LNHB 4X1VA 2GNCA 4Z88A 1NLPC 4J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS7 A;  2W0Z A;  1BU1 A;  1GBQ A;  2JW4 A;  2YT6 A;  2FPF A;  4LUD A;  3VS2 A;  2OJ2 A;  2SRC A;  1YCS B;  1UGV A;  4OMM A;  1JXO A;  1UEC A;  2X3W D;  4RTT A;  2CDT A;  4ESR A;  2A37 A;  4F17 A;  1BBZ A;  2SEM A;  3I5R A;  1VYV A;  2RNA A;  1ZBJ A;  3VS1 A;  4OML A;  2JXB A;  2KEA A;  1M3A A;  2RPN A;  1IO6 A;  1K9A A;  1I07 A;  2ED0 A;  2CH4 W;  1AZG B;  1AWJ A;  3THK A;  2K2M A;  1E7O A;  1UTI A;  3PE0 A;  4J9C A;  1BB9 A;  2L3Q A;  1RI9 A;  1SSH A;  4D8D A;  1K1Z A;  1RUW A;  4DEY A;  2GBQ A;  5IXB A;  2EYW A;  4FSS A;  2KRS A;  4HXJ A;  2DL3 A;  2KYB A;  3ULR B;  2CH4 A;  1Y0M A;  2OI3 A;  5IHK A;  1Z9Q A;  2KBT A;  2K3B A;  4Z89 A;  2VWF A;  3KFV A;  2DBM A;  2F2X A;  1MV0 B;  2DYB A;  1SPK A;  1B07 A;  1GCQ A;  4RTU A;  2K6D A;  2YUQ A;  2KGT A;  2AZV A;  1ZX6 A;  1UJ0 A;  1OV3 A;  2RQT A;  1UHC A;  1U3O A;  4LN2 A;  5HCK A;  3EG2 A;  2CSQ A;  3I5S A;  2JT4 A;  2F2W A;  2NWM A;  4A63 B;  1SHG A;  1AWO A;  1K4U S;  2JMA A;  3ZL7 C;  2LP5 A;  4CC3 A;  2FEI A;  4QT7 A;  4WCI A;  2RF0 A;  1YWO A;  1B3Q A;  2EGC A;  2DX1 A;  3IQL A;  4J9B A;  2A28 A;  2M0Y A;  3SEM A;  1KIK A;  4RTY A;  2DL4 A;  2IIM A;  1HJD A;  1K76 A;  2D0N A;  1X2Q A;  4JPB W;  1AWW A;  2QDL A;  1N5Z A;  1CSK A;  2L0A A;  1BK2 A;  2K7A A;  4JJB A;  3VS6 A;  2YUN A;  5GJW B;  1K0S A;  2O2O A;  1X27 A;  3JV3 A;  2DF6 A;  2CUB A;  2KRN A;  1T3S A;  3PVL A;  1PRM C;  1I1J A;  1M30 A;  2RQU A;  1WXB A;  4F14 A;  2MIO A;  2M51 A;  3VS4 A;  4Z8A A;  2KRM A;  1XOV A;  3H0I A;  3QWX X;  2GTO A;  2F2V A;  5FWC A;  4CC4 B;  1FYN A;  2HEQ A;  1U06 A;  2DL8 A;  2ESW A;  3A98 A;  4KRT A;  1QWF A;  2J05 A;  3UA7 A;  2AK5 A;  2FO0 A;  2EGA A;  4RTW A;  2PTK A;  1WXU A;  4J9E A;  2V1Q A;  1NLO C;  2CT4 A;  1NYF A;  1MV3 A;  1VYU A;  3M0R A;  2LZ6 B;  2YUP A;  2HBW A;  1GL5 A;  2KT1 A;  3EG3 A;  1JU5 C;  5IHN A;  4RTV A;  2DMO A;  1HD3 A;  5EC7 A;  1ZLM A;  2EGE A;  1Z9Z A;  4CC2 A;  4RUG A;  2L3P A;  2DM1 A;  1OPK A;  1QWE A;  4J9H A;  1JXM A;  4DEX A;  2XMF A;  3I35 A;  1UE9 A;  2FG0 A;  3M0Q A;  4HVW A;  1V1C A;  2EW3 A;  2JMC A;  1WYX A;  4JZ4 A;  2HSP A;  1G2B A;  4J9F A;  3H0H A;  3M0S A;  1GFD A;  1G83 A;  1PNJ A;  1ZSG A;  1GRI A;  1GFC A;  4IIM A;  1YP5 A;  3SHW A;  2LJ3 A;  2H8H A;  2CRE A;  2DJQ A;  2DIL A;  4ZNX A;  3REA B;  3NMZ C;  1WA7 A;  5IH2 A;  4RTX A;  1KJW A;  2GQI A;  2BZY A;  1X43 A;  2EYX A;  2LQN A;  2FPE A;  2O88 A;  2EPD A;  2YDL A;  2JS0 A;  1X6G A;  3RNJ A;  2ED1 A;  1CKB A;  2GTJ A;  2JM8 A;  1E6H A;  1WXT A;  2KYM A;  1UJY A;  2O31 A;  4RTZ A;  2VVK A;  2LJ0 A;  2W10 A;  1JEG A;  3TSZ A;  1SEM A;  2LMJ A;  1RLQ C;  3LH5 A;  2KRO A;  1X2K A;  2RQW A;  3TSW A;  1OPL A;  2FRY A;  1E6G A;  1QKW A;  2BTT A;  1ABO A;  2DNU A;  1JQQ A;  1NYG A;  2LCS A;  1CKA A;  4LUE A;  3REB B;  3M0P A;  1TG0 A;  1VYT A;  2MCN A;  4HVV A;  3TVT A;  2BZ8 A;  1PKS A;  2HDA A;  4LNP A;  2B86 A;  2JS2 A;  2KR3 A;  3NGP A;  4J9D A;  1Y57 A;  1HSQ A;  1GCQ C;  1UFF A;  1I0C A;  4JJD A;  2PZ1 A;  3M0T A;  4HCK A;  2ECZ A;  4OMP A;  1SRL A;  3NPF A;  1TUC A;  4GBQ A;  2FPD A;  2DRM A;  1UG1 A;  1MUZ A;  1J3T A;  2O9S A;  1W1F A;  2I0N A;  5GJV B;  1W6X A;  2RQR A;  1PHT A;  2J6F A;  2ENM A;  4OMO A;  1T0J A;  1YWP A;  1QLY A;  1RLP C;  2AKL A;  1K0X A;  4EIK A;  3EG1 A;  4F16 A;  1AVZ C;  2EBP A;  1NEB A;  1M3C A;  2KT8 A;  3I9Q A;  2KNB B;  3VRZ A;  2D8J A;  2LJ1 A;  1AZE A;  2YUO A;  1UDL A;  2D1X A;  4ORZ A;  2DA9 A;  4CC7 A;  2DRK A;  2EYY A;  4IIO A;  1SHF A;  2KXC A;  1AEY A;  2RQV A;  1ARK A;  1PWT A;  2GGR A;  2J6O A;  3GBQ A;  3UA6 A;  5IXF A;  1UUE A;  2EKH A;  2K79 A;  2ROT A;  1KFZ A;  2BZX A;  4AFS C;  3VS3 A;  2MOX A;  1WI7 A;  4J9G A;  1ZUK A;  5L23 A;  3H41 A;  1WX6 A;  2J06 A;  2AKK A;  2CUD A;  4GLM A;  1OEB A;  1FMK A;  1T0H A;  2JM9 A;  1WLP B;  2J6K A;  3NHN A;  1NEG A;  4E6R A;  3O5Z A;  1X6B A;  1W70 A;  4AG2 C;  2C0O A;  1M3B A;  2ROL A;  2O9V A;  2E5K A;  1KSW A;  5ECA A;  1EFN A;  1X69 A;  1TUD A;  1AD5 A;  2ABL A;  1GCP A;  1H3H A;  4OMQ A;  2YSQ A;  3UF4 A;  3H0F A;  3U23 A;  5I22 A;  2P4R A;  1VA7 A;  2KE9 A;  3UAT A;  1NM7 A;  3EG0 A;  4HVU A;  4D8K A;  2OAW A;  4K11 A;  2DL7 A;  2X3X D;  3R6N A;  5I11 A;  1GBR A;  2EVR A;  1M27 C;  4JZ3 A;  2K9G A;  1H8K A;  1PRL C;  2DE0 X;  2NUZ A;  1WFW A;  2C0I A;  2CSI A;  2LQW A;  2LX7 A;  1ZUU A;  3RBB B;  3CQT A;  3VS5 A;  3QWY A;  2VKN A;  1AWX A;  3M0U A;  4AG1 C;  4LE9 A;  2L2P A;  2JTE A;  2V1R A;  4AFZ C;  1A0N B;  2RMO A;  5FW9 A;  1YNZ A;  2DVJ A;  2AZS A;  2PNI A;  1WIE A;  2CT3 A;  1M8M A;  1NG2 A;  3PVQ A;  1S1N A;  1T3L A;  1WDX A;  4JJC A;  3C0C A;  1U5S A;  2FRW A;  1ZUY A;  4M4Z A;  1QKX A;  3EHQ A;  4OMN A;  1AOJ A;  2RN8 A;  1QCF A;  3FJ5 A;  1SRM A;  1OOT A;  1UHF A;  1YN8 A;  2A08 A;  1PKT A;  2D8H A;  1ABQ A;  4AFU C;  2DL5 A;  2DBK A;  2C0T A;  2HCK A;  5FWB A;  3VS0 A;  3EHR A;  1LCK A;  1JO8 A;  4R0K A;  4AFQ C;  2KXD A;  3VRY A;  2L3S A;  2DLP A;  2EQI A;  1H92 A;  4Y92 A;  2G6F X;  5IHI A;  2J7I A;  2EYZ A;  2A36 A;  3EGU A;  2LNH B;  4X1V A;  2GNC A;  4Z88 A;  1NLP C;  4J9I A; 
#chains in the Genus database with same CATH topology
 4EMK A;  2W0Z A;  4EPC A;  2RD1 A;  3JCM e;  4LUD A;  3JRZ A;  4C92 C;  4OMM A;  2RO0 A;  2XID A;  2COZ A;  2X3W D;  1PSE A;  1M1K U;  4A4H A;  2A7Y A;  2X51 A;  5KCH A;  1B34 B;  4KUI A;  1ZBJ A;  3JB9 J;  1VQO Q;  1TWB A;  1C0M A;  2JXB A;  2L3R A;  1IO6 A;  1QCN A;  1PM3 A;  2ZPE B;  1Q81 C;  2AHJ B;  4HCB A;  3EG9 A;  1AWJ A;  3BDL A;  1UB4 A;  4C0Z A;  2QAZ A;  4DEY A;  1AT1 B;  1YI2 A;  4BAC A;  5GMK l;  4V2S A;  1V76 A;  1VQ4 A;  4OGE A;  5CAI A;  1Y0M A;  1MMD A;  1KD1 C;  2EFI A;  4E7S A;  1Z9Q A;  3JB9 I;  4A53 A;  2KBT A;  2K3B A;  3JCM V;  5GAO p;  4Z89 A;  2VWF A;  1YI2 Q;  4M7D B;  1GXI E;  2E4H A;  4DOV A;  2RK1 A;  1Y71 A;  1B07 A;  4MMK A;  2K6D A;  2XK0 A;  2DD5 A;  2ZGW A;  2KGT A;  1SG5 A;  3CCE T;  4M78 A;  4C0D B;  3G71 Q;  1Q86 U;  2HL5 C;  2CZ0 B;  4FCY A;  1OUL A;  3F70 A;  4ANJ A;  5D7U A;  1D09 B;  3OS2 A;  4M77 C;  1Q82 U;  2DTH A;  3X28 B;  3VYH B;  1K8A C;  2JT4 A;  4R56 A;  1IZ6 A;  5GAN 8;  5KYY B;  1M9S A;  3CEY A;  2VB6 A;  1YHQ T;  5CR2 A;  3PFS A;  2KAF A;  3GNF B;  2M0Y A;  2WSC E;  3DKM A;  4PJL A;  2IVW A;  2MYS A;  3FEO A;  5I2S A;  4O6J A;  4MML A;  2DL4 A;  4IUV A;  3CPW P;  2GCX A;  3H9N A;  1AWW A;  1CSK A;  3L2V A;  1BK2 A;  2K7A A;  4D6W A;  3L2Z A;  1ZQ1 A;  3PTA A;  2K5L A;  3JB9 G;  4HT9 A;  3QJ6 A;  4IKF A;  3EFR A;  3NTH A;  2KRN A;  3CME Q;  1T3S A;  4XK8 E;  1PRM C;  4F7U E;  1C1A A;  3OYL A;  2EQU A;  4DBF A;  3SFM A;  3JCM J;  3QYH B;  5KCO A;  1HXD A;  4MZM A;  3QYG B;  1B34 A;  1QVG A;  2E10 A;  4XU3 A;  4PJM A;  2QQR A;  1RAA B;  1RAF B;  3N5B B;  2RI5 A;  4KRT A;  1QWF A;  1KQS A;  2RHX A;  3UA7 A;  2AK5 A;  5FRO A;  4E7K A;  3OQ5 A;  3MP8 A;  2XKO C;  1YIT T;  2GQV A;  2CP7 A;  2DTI A;  1VQ5 A;  1NYF A;  3LLR A;  3CCS T;  1TU0 B;  4M77 E;  1KD1 R;  4LD6 A;  3A8H B;  2QK0 A;  2F5K A;  5GAO m;  3RDV A;  2RA2 A;  3EG3 A;  3UT1 A;  1HD3 A;  5EC7 A;  1N8R U;  1EX4 A;  2M1H A;  1YI2 T;  2VGM A;  4RG2 A;  3RER A;  5C6S A;  2C06 A;  3JB9 D;  3CC2 T;  1VQK Q;  1V1C A;  1D0X A;  4BDY A;  1NBE B;  2JMC A;  5CKF A;  3DB4 A;  1VQ4 Q;  2HSP A;  3ZEH A;  3M0S A;  1GFD A;  1G83 A;  3CCU Q;  2FHD A;  1PNJ A;  2L5Q A;  1GFC A;  4JUV A;  4IIM A;  1YP5 A;  3G71 T;  2DK3 A;  2ATC B;  3BFM A;  3T9N A;  1QP3 A;  3S3M A;  3WXM B;  5HKC A;  3EH1 A;  3OS5 A;  2GQI A;  3OW2 P;  3OYK A;  2FB7 A;  2FPE A;  2ED1 A;  3JAM E;  2JM8 A;  1YJN Q;  1WJS A;  1UJY A;  1IHV A;  2HL3 A;  3L2U A;  4RTZ A;  2VVK A;  4B9X A;  1QMC A;  2LX9 A;  4OP0 A;  5GAM d;  3G6E T;  4C0F A;  1NZ9 A;  1X2K A;  2QAS A;  4E7I A;  5GAN 2;  2QXF A;  3I55 Q;  1JQQ A;  5LJ5 j;  3LGL A;  3M0P A;  4Z02 A;  2IPO B;  2H3J A;  4WF2 A;  4XTY A;  4C5I A;  5KYN A;  1VQ6 T;  1UFF A;  3M0T A;  4DBH A;  4HCK A;  2ECZ A;  3G4S T;  2QA4 T;  4OMP A;  1Q86 R;  3EFO A;  5FRN A;  1D0Z A;  1MND A;  2HKN A;  1J3T A;  1MUZ A;  3EG9 B;  3UPU A;  2I0N A;  4XTW A;  2M0O A;  3M54 A;  1X6O A;  2J6F A;  4M77 F;  3OYY A;  3Q1J A;  1MMG A;  2WAC A;  3A8L B;  3MP1 A;  2GFU A;  5LJ5 f;  3JB9 F;  1K0X A;  1U1T A;  1Y96 A;  4F16 A;  1RAG B;  3HRT A;  1W2B P;  2EQM A;  1HK9 A;  4C92 B;  2CP0 A;  2D8J A;  2LJ1 A;  3JCM d;  2OAU A;  2X4W A;  2DA9 A;  1WQW A;  1SHF A;  4FM4 B;  4XU0 A;  5CK9 A;  2RQV A;  1MGQ A;  3MCA B;  1PWT A;  4PJN A;  2QQ9 A;  2GGR A;  3SWN C;  2O01 E;  1KHC A;  3FDR A;  2DAQ A;  2O4X B;  1UUE A;  3O8V A;  2ROT A;  4KT0 E;  1KFZ A;  3M5A A;  4AFS C;  1TS9 A;  1WI7 A;  4N4G A;  4LDV A;  5GMK e;  3H41 A;  5AT1 B;  3V8L A;  2FZC B;  2BIV A;  4XAX B;  2CUD A;  2KY9 A;  2OTL A;  1OEB A;  1NPP A;  1T0H A;  2JM9 A;  2KK4 A;  2PUK B;  3MP6 A;  1OX9 A;  1W70 A;  4M75 F;  4AG2 C;  3G4S A;  2QA4 A;  5ECA A;  2DZ9 A;  3OYG A;  1TUD A;  4PJO B;  3QKJ A;  5D6X A;  3CCJ Q;  3GLX A;  4ATO A;  1VUB A;  2DZC A;  1VA7 A;  3UAT A;  1D3B A;  1YJW Q;  2LTO A;  4B6M A;  4PJO G;  1VQ7 Q;  4B9W A;  4M7A G;  2E3H A;  1I8F A;  3X24 B;  3JCM W;  3R6N A;  3JCM f;  1WHM A;  1VQM A;  1N9R A;  1DJ7 B;  3VU3 C;  4BY6 C;  2K9G A;  3M55 A;  4M78 B;  1PRL C;  4L5G A;  4FYV B;  2NUZ A;  1WJQ A;  2C0I A;  2CSI A;  2LQW A;  3VS5 A;  4C8Q A;  3RKX A;  1VQP A;  3CCM Q;  3C4S A;  2R57 A;  1VQL A;  1Q7Y C;  1G3T A;  4M7A C;  1YNZ A;  1WIE A;  3M53 A;  3CCE Q;  1G8X A;  2CGH A;  3I55 A;  4PJO F;  1U5S A;  3HTR A;  4P5N A;  3OW2 A;  3EHQ A;  1QCF A;  4HA8 A;  4EDU A;  3FJ5 A;  1FWZ A;  2DIG A;  1K8A U;  4LDX A;  5CO7 A;  1UHF A;  1S72 A;  2HQH A;  1JJ2 A;  3CCV A;  1KK7 A;  1M8V A;  2HCK A;  4XU1 A;  1LNX A;  3OYI A;  3EHR A;  2PVD B;  3QHS A;  1JO8 A;  4C92 A;  3VRY A;  2VV5 A;  2L3S A;  1H92 A;  4Y92 A;  5IHI A;  4QVD A;  1OYX A;  4JRQ A;  2JTF A;  2HAX A;  4PJJ A;  1ZSZ C;  4BUG A;  2LNH B;  4DBQ A;  4ZN3 A;  3FC3 A;  1BU1 A;  4QQG A;  2YT6 A;  3G6E Q;  3JCM P;  3VS2 A;  3OYE A;  1WHG A;  3LYI A;  3CCL T;  4M78 G;  2CDT A;  4M78 F;  2EWN A;  2LVM A;  4BY6 B;  2A37 A;  4XQ3 A;  2SEM A;  5AYF A;  3I5R A;  3EFO B;  4KBM B;  3VS1 A;  4OML A;  2LT4 A;  1YIJ Q;  1VQ5 T;  1NJI R;  1Q86 C;  1K9A A;  1VQL Q;  1W2B A;  4M7A D;  5D6Y A;  3I55 T;  1UTI A;  4J9C A;  1P92 A;  1BB9 A;  2L3Q A;  4BI3 A;  1RI9 A;  2ZAE A;  3P8B B;  4D8D A;  1RUW A;  2AIR B;  2HSE B;  4A4K A;  5LJ5 d;  4PLI A;  1WQ7 A;  2KRS A;  4F04 B;  4BE2 A;  2CH4 A;  2R5A A;  4M75 A;  4M75 B;  2RHI A;  3OSV A;  4J83 A;  2OI3 A;  4M77 A;  1BI2 A;  3VV0 A;  4MZP A;  3CCV Q;  1VQN T;  3LW5 E;  1GCQ A;  4FL6 A;  4J7I A;  2RI2 A;  5A0D A;  3I56 T;  2NUP B;  5CCA A;  1N8R C;  3PIP A;  3EG2 A;  3I5S A;  4BE1 A;  1WGS A;  3C12 A;  2F2W A;  4NL3 A;  2XG8 D;  1K4U S;  3QJY A;  2KSS A;  2JMA A;  5FU6 C;  2COW A;  4LDW A;  3MEA A;  4WCI A;  1YWO A;  1B3Q A;  1EZZ B;  2EGC A;  1VQN A;  2NUT B;  1VQP Q;  3HP9 A;  3OW2 S;  2LCC A;  3EH2 A;  4M78 E;  3QBY A;  4JRI A;  3MJX A;  4RTY A;  2IIM A;  2D0N A;  5KYW A;  2QDL A;  1C6V X;  4EMK B;  3SD4 A;  3TU4 K;  3VS6 A;  2YUN A;  4NL2 A;  3PGG A;  1VQO T;  4Y91 A;  1K0S A;  5GMK h;  1M2V A;  1X27 A;  2CYZ B;  1M30 A;  3MKD A;  2D6F A;  3CMA A;  2A0F B;  3CC7 A;  3VS4 A;  4Z8A A;  1UGP B;  3QWX X;  4QVC A;  3A8G B;  2F2V A;  1FYN A;  4M7D D;  1N27 A;  3J7A F;  2DL8 A;  3A98 A;  1JJ2 P;  1VQ8 A;  4N0A C;  4M77 B;  2EGA A;  2DEU A;  1NLO C;  5GMK j;  3M57 A;  3M0R A;  3L2Q A;  2LZ6 B;  3J80 E;  2DD4 A;  3CCR A;  2HBW A;  2KT1 A;  3OYA A;  5LJ3 h;  1VQN Q;  3JCM b;  3TCJ A;  5IHN A;  4RTV A;  2RHZ A;  1VQ6 A;  4O5V A;  2CP6 A;  1ZLM A;  2QEX T;  1OU9 A;  2EGE A;  1N9S A;  4R55 A;  3PNW C;  3BW1 A;  2E1H A;  1QWE A;  4J9H A;  4ZTF A;  4DEX A;  4L59 A;  2FG0 A;  3M0Q A;  3HFN A;  4HVW A;  2EW3 A;  4M7A E;  3H8Z A;  4XTV A;  3H0H A;  1LJO A;  2XD0 A;  2BE7 D;  1ZSG A;  3TRE A;  1GRI A;  2P84 A;  3FB9 A;  3R6O A;  3EGX B;  1ZA2 B;  2FZK B;  2NYS A;  2DIL A;  5GAN h;  2MMP A;  4YTL A;  1NJI U;  3NMZ C;  1WA7 A;  1JBM A;  4QVZ A;  1ZA1 B;  1LVK A;  1KJW A;  2EYX A;  2EPD A;  1XTD A;  3RNJ A;  1TSF A;  1CKB A;  1UGS B;  3JCM X;  3CMA Q;  1W4S A;  2F1L A;  2JZ2 A;  3EGD B;  4M7D C;  4LXC A;  2LMJ A;  3QG1 A;  5CQX A;  3TSW A;  2RQW A;  1E6G A;  2EYQ A;  2BTT A;  4M7D F;  2DNU A;  5LJ3 e;  3X25 B;  1K73 R;  3REB B;  1VYT A;  1YJ9 Q;  3CCR T;  2B86 A;  2KR3 A;  3I56 A;  3FIF A;  1WZO A;  3CXC S;  1RI0 A;  1I0C A;  1M2V B;  4JJD A;  3M9Q A;  1SRL A;  2FPD A;  2V8I A;  3LH0 A;  3L1A A;  2O9S A;  4FSX A;  1U1S A;  4DQ2 A;  2LCL A;  1VQ9 Q;  2CKK A;  2P0K A;  1WPY A;  2DET A;  7AT1 B;  2ENM A;  4OMO A;  4M78 D;  2WSF E;  3OBY A;  1YHQ Q;  1Y7X A;  2AKL A;  3CD6 A;  3SWN A;  4EIK A;  2ZPG B;  3HL8 A;  5CKE A;  4ELY C;  3CCS Q;  3E2U A;  2KT8 A;  3HPW A;  1TXQ A;  1WHJ A;  2MWO A;  5D6W A;  2RB6 A;  4CC7 A;  2DRK A;  2EYY A;  2RHY A;  1YIJ T;  2KXC A;  1AEY A;  2LNV A;  3UA6 A;  2K3X A;  5IXF A;  3P8H A;  2K79 A;  1KC8 R;  1KQS S;  1YJN A;  5L23 A;  1WX6 A;  4FU6 A;  2J06 A;  1WHH A;  2R58 A;  2CZ7 B;  4GLM A;  1YJ9 A;  2JVV A;  3NHN A;  3M59 A;  1NEG A;  3HRS A;  4ZTJ A;  1QCO A;  4E6R A;  3O5Z A;  1X6B A;  1R77 A;  2YXY A;  2C0O A;  3FJP A;  5GAO q;  1M3B A;  2O9V A;  5HK0 A;  1AD5 A;  4PJO A;  1H3H A;  2XDP A;  3UF4 A;  2MF2 A;  3U23 A;  1BYM A;  4DA4 A;  4VUB A;  3S6W A;  2RJE A;  2WSE E;  5GAN 3;  8ATC B;  5KH6 A;  4HCZ A;  3QUI A;  5GAN g;  4K11 A;  2DL7 A;  1GBR A;  1OZ3 A;  2EVR A;  3RMQ A;  5CQY A;  2K5I A;  4PL6 A;  3CCL Q;  1M5Q 1;  3MEV A;  5M9O A;  1XJW B;  5C0M A;  1QVF S;  1K73 C;  1OQK A;  3JSC A;  1H8K A;  2JJ9 A;  2LX7 A;  3RBB B;  1ZUU A;  3CC4 Q;  4J6Y A;  1UGQ B;  1XNI A;  1AWX A;  4AG1 C;  4C5H A;  1FMV A;  5IT9 E;  2RMO A;  2X4Y A;  3CC2 Q;  2DVJ A;  1QVG P;  2CT3 A;  1S1N A;  1T3L A;  1WDX A;  1NE8 A;  4JJC A;  3GIB A;  4M4Z A;  1QKX A;  2YRV A;  1AOJ A;  4UC4 A;  4A4G A;  1SRM A;  2X35 A;  2DVE A;  2K3Y A;  1YN8 A;  2A08 A;  1G3S A;  1PKT A;  2D8H A;  2YRC A;  3MPU B;  4IUQ A;  3RKY A;  3TQ7 P;  4JJN K;  2DL5 A;  1N8R R;  5LJ5 h;  4E7J A;  3VS0 A;  4II1 A;  3HRU A;  3CC4 T;  3PT9 A;  1LCK A;  2KXD A;  4N4H A;  1VQ9 A;  1QP2 A;  2J7I A;  5LJ3 f;  2CZ6 B;  2K4Y A;  2EYZ A;  3KBG A;  1R0C B;  2KVQ G;  1M90 U;  4PJO D;  4F7U A;  4F7U B;  3QDR B;  2DEQ A;  5HK3 A;  3CD6 Q;  1NLP C;  4J7F A;  3OS1 A;  3ME9 A;  1KG1 A;  3VS7 A;  1N6A A;  2JW4 A;  1D3B B;  1KD1 U;  4C8Q B;  4KH0 B;  3E9F A;  2OJ2 A;  2SRC A;  4E7L A;  1YCS B;  1UGV A;  3HSB A;  4MDW A;  4ESR A;  3DB3 A;  2PVG B;  3RR6 A;  1BBZ A;  4F17 A;  5KYY A;  3G4S Q;  2QA4 Q;  4JRP A;  2RNA A;  3RUX A;  3AHU A;  4PK4 A;  2QI2 A;  4FW2 A;  3CBP A;  2KEA A;  1M3A A;  1G3W A;  4OMF B;  3RKW A;  4BDZ A;  2RPN A;  2VAS A;  3S3O A;  2CH4 W;  5KE2 A;  1ZBX A;  3THK A;  2K2M A;  3PE0 A;  1PG5 B;  3GPL A;  1SSH A;  1KC8 U;  2VGN A;  2GBQ A;  2EYW A;  2OTL Q;  4A4E A;  2XI9 A;  4HXJ A;  2KYB A;  4PFO A;  3ULR B;  2KQW A;  2OTJ A;  2PUO B;  4EMH A;  3CME A;  3CC7 Q;  1WHK A;  5IHK A;  2ZPH B;  1SKU B;  2RH2 A;  3KFV A;  2F2X A;  1MV0 B;  2DYB A;  3M56 A;  4RTU A;  1Q7Y R;  2P0Q A;  3OYM A;  2DXB A;  1NPR A;  3OMC A;  2O4X A;  1YJW A;  5A2Q E;  1UJ0 A;  4NS5 A;  1WJR A;  1VQM Q;  4LN2 A;  5GMK m;  1FXX A;  2ZPI B;  1VQ4 T;  2NWM A;  4A63 B;  4C92 G;  1MHN A;  3BE3 A;  4M7D E;  2L89 A;  2LT1 A;  4Q5W A;  4PFP A;  1TTH B;  4OB0 B;  1PSF A;  1QVF A;  2FEI A;  4C8Q E;  4QT7 A;  2RF0 A;  3C95 A;  3MET A;  2DX1 A;  2EKO A;  4J9B A;  3PIO A;  3OSS C;  5GAN 5;  1V29 B;  1VQ6 Q;  4FYX B;  1RAC B;  3V7R A;  5GAM h;  2KI7 A;  1HJD A;  3UDC A;  1X2Q A;  1N5Z A;  2L0A A;  4JJB A;  3LWI A;  3CCQ T;  5GAM j;  1MMA A;  3LWH A;  1I81 A;  5GJW B;  2O2O A;  1NJI C;  1JJ2 S;  1SF9 A;  1VQP T;  4C5G A;  4XTU A;  4PJO E;  2VUB A;  3PVL A;  1KC8 C;  4LDY A;  5CKB A;  3CCS A;  3CPW A;  3OY9 A;  2M51 A;  2KRM A;  1XOV A;  3H0I A;  3M4Y A;  4QQD A;  4OB1 B;  2GTO A;  2LRQ A;  4XU2 A;  4BI4 A;  4CC4 B;  4M77 G;  5GAN d;  2VYT A;  2QEX A;  4DOW A;  1U06 A;  2VXE A;  2ESW A;  3MHX A;  4QKU A;  3HKS A;  5J39 A;  1S72 T;  2J05 A;  2K57 A;  1PC0 A;  2GF7 A;  3CPF A;  3ZBD A;  3CCQ Q;  2FO0 A;  3OS0 A;  4LD9 K;  3CCV T;  2QG9 B;  2PTK A;  2G3R A;  4J9E A;  2V1Q A;  4AT1 B;  5DLO A;  2XDD A;  2GFA A;  3RMS A;  2MWP A;  2VXF A;  2RK2 A;  1GL5 A;  2XHC A;  4OB3 B;  2OTL T;  1TUG B;  3KUF A;  2ZPF B;  4C8Q C;  5GAN 4;  2XDB A;  4KGX B;  1Z9Z A;  3OYD A;  1Q7Y U;  2L3P A;  2RM4 A;  2DM1 A;  4IUP A;  1OPK A;  1JXM A;  1UE9 A;  3CCM A;  2ZPB B;  2HNI A;  1VQL T;  2DO3 A;  2A3L A;  2DJZ A;  3L2R A;  1K8A R;  4M77 D;  1F1B B;  1Y07 A;  1BCO A;  5GAN 6;  5GMK i;  1HYO A;  5GAO l;  5LJ3 g;  2DXU A;  1IGQ A;  3QDF A;  2XU8 A;  4RG8 A;  2CRE A;  3GNG A;  1ZSZ B;  4ZNX A;  2LQ8 A;  1D1C A;  3PMT A;  1RAB B;  4RTX A;  2X4J A;  2CP5 A;  1X43 A;  3ASK A;  5KYX A;  1X6G A;  2HBP A;  2M16 A;  1JRI A;  3JCM Q;  1E6H A;  1WXT A;  2KYM A;  3BDU A;  1BI0 A;  2DYI A;  9ATC B;  1OI1 A;  2FL7 A;  2LJ0 A;  3TSZ A;  1SEM A;  3A1P A;  1TH7 A;  1RLQ C;  5A0G A;  1VQ8 Q;  2FRY A;  1ABO A;  3DLL A;  1NYG A;  2E65 A;  1CKA A;  5L8R E;  2HD0 A;  1TG0 A;  4JLG A;  2MCN A;  4HVV A;  3TVT A;  1FMW A;  1U8R A;  2BZ8 A;  2X4X A;  2DXT A;  4NOY A;  4JS5 A;  2PU9 B;  4J9D A;  1TOV A;  1Y57 A;  3V8K A;  3GOX A;  1HSQ A;  3RIR A;  2QGG A;  2PZ1 A;  3A5Z B;  3NPF A;  4M78 C;  2MK5 A;  4GBQ A;  2DRM A;  1UG1 A;  2HKQ B;  4OF1 A;  3SDZ A;  5GAM e;  1W1F A;  4C92 E;  5GJV B;  3CC2 A;  1IB8 A;  2RI3 A;  4PFZ A;  2MAM A;  2YLB A;  5DLQ E;  1BIA A;  1T0J A;  1YWP A;  3LGF A;  2E41 A;  1D1A A;  3OYJ A;  2IG0 A;  1RLP C;  4E47 A;  3MO8 A;  3EG1 A;  2QDY B;  1AVZ C;  2EBP A;  1NEB A;  1M3C A;  1RAD B;  3ZFJ A;  3I9Q A;  3TEE A;  1AZE A;  4ORZ A;  1UDL A;  2D1X A;  2YUO A;  2QQB A;  4IIO A;  1VIF A;  2MPX C;  3DLM A;  2E6Z A;  2J6O A;  3GBQ A;  3CXC A;  4HKE A;  2EKH A;  4Y28 E;  5I21 A;  4KH1 B;  1FX7 A;  3VS3 A;  1IRE B;  2MOX A;  3HFO A;  1M2O A;  2AKK A;  4CRI A;  2YRD A;  4AMC A;  5LJ3 d;  1Q82 R;  1M90 C;  3P8D A;  2D9T A;  2J6K A;  1Q95 G;  2CP2 A;  2HZY A;  4CI0 C;  1KSW A;  1EFN A;  4OMQ A;  2YSQ A;  3QZ5 B;  2OTJ T;  4EMG A;  1X01 A;  2KE9 A;  4PLL A;  4BE0 A;  5GAM f;  3G71 A;  2E70 A;  3QXE B;  4JDS A;  4BD3 A;  2QTX A;  4FIB A;  3CCU A;  4N4I A;  5I11 A;  1KQS P;  1YJW T;  5DY9 A;  5FRM A;  2LDM A;  2V26 A;  4FYW B;  1X75 C;  1K9M R;  1OZ2 A;  2K2V A;  2E3I A;  2DE0 X;  4JS4 A;  3VUB A;  1WFW A;  5FU6 B;  1YIJ A;  3CQT A;  2VKN A;  3M0U A;  4TVR A;  3CCM T;  2L2P A;  2R5M A;  1A0N B;  2ZZD A;  4ZGD B;  3NFC A;  5FW9 A;  2AZS A;  2EIF A;  4M75 G;  1M8M A;  5EG2 A;  4E7H A;  1VQ9 T;  2EJG A;  2V8K A;  3C0C A;  2LQK A;  2FRW A;  3WVE B;  1PCX A;  1BKB A;  2Y4Y A;  4E2F B;  4N0A A;  2RN8 A;  5J26 A;  1D1B A;  1WHL A;  6AT1 B;  2DER A;  4ZN1 A;  1VIE A;  2JN0 A;  1OOT A;  2ZCF B;  4MDX A;  3EGX A;  3V7C A;  3FRN A;  1YIT Q;  3L2W A;  2D0Q B;  5FWB A;  2L8D A;  5IN1 A;  3X20 B;  2QQA A;  4R0K A;  1S72 Q;  2EQI A;  2P4T A;  3CCR Q;  3QO3 A;  2A36 A;  3CMA T;  4X1V A;  1GBQ A;  2FPF A;  1VOM A;  1JXO A;  1UEC A;  2HQE A;  4RTT A;  3D7S B;  3OYF A;  3E1S A;  1VYV A;  3E9G A;  1MNE A;  2Y90 A;  4PNO A;  4LDU A;  5KYU A;  1JB0 E;  1I07 A;  1ZHI A;  4EMK C;  2ED0 A;  1AZG B;  3CCE A;  1E7O A;  1UGR B;  4C92 D;  4WTO B;  2P0P A;  1K1Z A;  1I5O B;  5IXB A;  3CCQ A;  1H3Z A;  5GAN e;  4FSS A;  3CCL A;  3VJP A;  4J6X A;  2DL3 A;  2RHU A;  2QGF B;  2FYK A;  4IUT A;  2Z0W A;  1IRX A;  5KYU B;  3EAE A;  1K9M C;  1BCM A;  3CCJ A;  3CC4 A;  2DBM A;  1SPK A;  4OVA A;  2LC4 A;  2YUQ A;  2AZV A;  1VQM T;  1ZX6 A;  4QQ6 A;  5KYW B;  1OV3 A;  1R0B G;  2RQT A;  1UHC A;  3WVD B;  1U3O A;  5FLX E;  5HY6 A;  4FT4 A;  1YJ9 T;  5HCK A;  2CSQ A;  2DTO A;  1EIF A;  1AWO A;  3SB2 A;  1SHG A;  3V8J A;  4OB2 B;  4F7U F;  3JB9 H;  1M1G A;  4FW1 A;  3X26 B;  8AT1 B;  3OYB A;  1RAE B;  1G5V A;  3ZL7 C;  2LP5 A;  4CC3 A;  1B7T A;  5GAN j;  2VC8 A;  5GAN 7;  1LOJ A;  2YHT A;  2XIC A;  3QZ9 B;  3IQL A;  5LJ5 e;  2A28 A;  3SEM A;  4C8Q D;  3CBO A;  1KIK A;  2M9U A;  5CIU A;  1YFN A;  1H64 1;  1K76 A;  4JPB W;  4ME7 A;  4RKU E;  1W2B S;  1M4Z A;  4RMO A;  4KUD K;  1RL2 A;  4QW2 A;  1M1K C;  5I2M A;  4C5E A;  4ZGE B;  3JV3 A;  1BIB A;  2DF6 A;  4GLK A;  2CUB A;  5GAN f;  1YIT A;  3QII A;  1YHQ A;  1I1J A;  2RQU A;  1WXB A;  5CKH A;  2QEX Q;  3C94 A;  2MIO A;  4F14 A;  3NTK A;  4HT8 A;  4RCB A;  1AHJ B;  3HHT B;  1KHI A;  4IUU A;  4PJO C;  2KDS A;  4J6W A;  5FWC A;  1Y96 B;  1R8O B;  2HEQ A;  3JCM h;  5KE3 A;  4C8Q G;  4FT2 A;  3SWN B;  3A8O B;  3S3N A;  5GAO r;  4M7D G;  3G6E A;  4M75 E;  2AT1 B;  4RTW A;  3AT1 B;  1K9M U;  1WXU A;  1VQK T;  3BY7 A;  2CT4 A;  4MZT A;  1MV3 A;  1VYU A;  3I56 Q;  2BUD A;  3CCU T;  2YUP A;  1RAH B;  1JU5 C;  4X9D A;  2DMO A;  2YWW A;  3VYG A;  4JRK A;  4CC2 A;  4RUG A;  1ZSZ A;  1BI3 A;  3UWN A;  2XMF A;  3I35 A;  3INZ A;  3KXT A;  1Q81 R;  2E5Q A;  3CME T;  5FU7 B;  3PMI A;  5LJ3 j;  1WYX A;  2PVO B;  4JZ4 A;  1G2B A;  4J9F A;  1SSF A;  1LPL A;  2RJC A;  1OX8 A;  4HCC A;  1RAI B;  1IGU A;  3EGD A;  4XTX A;  3SHW A;  2LJ3 A;  3JCM g;  2H8H A;  2DJQ A;  4IUR A;  4A54 A;  3REA B;  2RJD A;  3QSU A;  5IH2 A;  3E19 A;  3OBW A;  5LL6 S;  2BZY A;  2LQN A;  4F7U G;  2O88 A;  2YDL A;  3NTI A;  2JS0 A;  1QVF P;  2GTJ A;  4DBR A;  1M90 R;  1UEB A;  3JCM c;  2QYZ A;  2NUP A;  2O31 A;  4KGZ B;  2W10 A;  1JEG A;  1KQ1 A;  3LH5 A;  3QPH A;  2KRO A;  1OPL A;  1QKW A;  2Y4X A;  4M75 C;  2M02 A;  2LCS A;  1QVG S;  4LUE A;  1PKS A;  5GAO n;  2HDA A;  4LNP A;  2JS2 A;  3NGP A;  1GCQ C;  2DXC A;  4M7A F;  1M1K R;  3GP8 A;  1TUC A;  3L42 A;  2MI6 A;  2FVU A;  1W6X A;  5GAM g;  2E64 A;  2RQR A;  3OYC A;  1PHT A;  1VQ7 A;  2BKD N;  1XQH A;  4C92 F;  4FYY B;  1O9S A;  1QLY A;  1I4K 1;  2I2L A;  3MEW A;  2HQX A;  5DM7 R;  3H6Z A;  4A4F A;  1BI1 A;  3RES A;  2DIQ A;  2PQW A;  5KYX B;  4C8Q F;  2QQS A;  3OA6 A;  2KNB B;  3VRZ A;  4C0G A;  3GF5 A;  2JTM A;  2K5F A;  2V8J A;  1M1F A;  3OMG A;  4KGV B;  2DPP B;  1VQ7 T;  1ARK A;  2EJ9 A;  1QVP A;  1I5L A;  1IXD A;  2BZX A;  2OX7 A;  4JLI A;  3URG A;  2BE9 B;  4KUL A;  4J9G A;  1ZUK A;  3CBM A;  1IHW A;  4GY5 A;  3CC7 T;  3FLG A;  1YCY A;  3EFS A;  3MEU A;  1FMK A;  1WLP B;  1D0Y A;  4PKC C;  3CPW S;  3A8M B;  2QTV A;  2H3E B;  2OTJ Q;  2ROL A;  2E5K A;  2F5T X;  1X69 A;  1VQ8 T;  2ABL A;  1GCP A;  3V7S A;  5IAY A;  2COY A;  4ZGJ B;  3H0F A;  3ER0 A;  5CVI A;  4M7A B;  1G3Y A;  5I22 A;  2P4R A;  2CS7 A;  1VQK A;  5CKD A;  1YJN T;  1VQ5 Q;  1NM7 A;  3EG0 A;  1QW1 A;  2DKG A;  4HVU A;  4D8K A;  2OAW A;  1Q81 U;  3CD6 T;  4OGC A;  2X3X D;  4BI8 B;  2NUT A;  4X9C A;  5J3B A;  1M27 C;  4JZ3 A;  4J8O A;  3J81 E;  3VKI A;  2EJF A;  2DFU A;  2E12 A;  1VQO A;  1PD0 A;  4ELZ C;  3QWY A;  1WNL A;  3OYN A;  3CXC P;  4LE9 A;  2JTE A;  2V1R A;  4AFZ C;  4BB7 A;  2JUF A;  3M4G A;  2E6N A;  2PNI A;  3PVQ A;  1NG2 A;  2FZG B;  4M75 D;  2EQK A;  4C0D C;  1ZUY A;  2HMA A;  2JNG A;  1PD1 A;  4OMN A;  2RJF A;  1QQJ A;  3LX7 A;  4XTZ A;  1O75 A;  2YLC A;  3G7Z A;  5A0L A;  2EQJ A;  2NLU A;  1KQ2 A;  1MMN A;  1K73 U;  1ABQ A;  4M7A A;  4AFU C;  2F69 A;  2CP3 A;  4J5Y A;  2DBK A;  2C0T A;  2B8A A;  1ACM B;  3CCJ T;  1YBY A;  3OYH A;  2KMT A;  4E7Z A;  4AFQ C;  5LJ5 g;  3M58 A;  2DLP A;  1Q82 C;  2EAY A;  4M7D A;  2G6F X;  3G1J A;  1OU8 A;  4L6V 5;  3VUZ A;  2X9H A;  2CZ1 B;  3EGU A;  4X34 A;  4RCC A;  2GNC A;  2JOY A;  4Z88 A;  5FU7 C;  3OB9 A;  4J9I A; 
#chains in the Genus database with same CATH homology
 3VS7 A;  2W0Z A;  1BU1 A;  1GBQ A;  2JW4 A;  2YT6 A;  2FPF A;  4LUD A;  3VS2 A;  2OJ2 A;  2SRC A;  1YCS B;  1UGV A;  4OMM A;  1JXO A;  1UEC A;  2X3W D;  4RTT A;  2CDT A;  4ESR A;  2A37 A;  4F17 A;  1BBZ A;  2SEM A;  3I5R A;  1VYV A;  2RNA A;  1ZBJ A;  3VS1 A;  4OML A;  2JXB A;  2KEA A;  1M3A A;  2RPN A;  1IO6 A;  1K9A A;  1I07 A;  2ED0 A;  2CH4 W;  1AZG B;  1AWJ A;  3THK A;  2K2M A;  1E7O A;  1UTI A;  3PE0 A;  4J9C A;  1BB9 A;  2L3Q A;  1RI9 A;  1SSH A;  4D8D A;  1K1Z A;  1RUW A;  4DEY A;  2GBQ A;  5IXB A;  2EYW A;  4FSS A;  2KRS A;  4HXJ A;  2DL3 A;  2KYB A;  3ULR B;  2CH4 A;  1Y0M A;  2OI3 A;  5IHK A;  1Z9Q A;  2KBT A;  2K3B A;  4Z89 A;  2VWF A;  3KFV A;  2DBM A;  2F2X A;  1MV0 B;  2DYB A;  1SPK A;  1B07 A;  1GCQ A;  4RTU A;  2K6D A;  2YUQ A;  2KGT A;  2AZV A;  1ZX6 A;  1UJ0 A;  1OV3 A;  2RQT A;  1UHC A;  1U3O A;  4LN2 A;  5HCK A;  3EG2 A;  2CSQ A;  3I5S A;  2JT4 A;  2F2W A;  2NWM A;  4A63 B;  1SHG A;  1AWO A;  1K4U S;  2JMA A;  3ZL7 C;  2LP5 A;  4CC3 A;  2FEI A;  4QT7 A;  4WCI A;  2RF0 A;  1YWO A;  1B3Q A;  2EGC A;  2DX1 A;  3IQL A;  4J9B A;  2A28 A;  2M0Y A;  3SEM A;  1KIK A;  4RTY A;  2DL4 A;  2IIM A;  1HJD A;  1K76 A;  2D0N A;  1X2Q A;  4JPB W;  1AWW A;  2QDL A;  1N5Z A;  1CSK A;  2L0A A;  1BK2 A;  2K7A A;  4JJB A;  3VS6 A;  2YUN A;  5GJW B;  1K0S A;  2O2O A;  1X27 A;  3JV3 A;  2DF6 A;  2CUB A;  2KRN A;  1T3S A;  3PVL A;  1PRM C;  1I1J A;  1M30 A;  2RQU A;  1WXB A;  4F14 A;  2MIO A;  2M51 A;  3VS4 A;  4Z8A A;  2KRM A;  1XOV A;  3H0I A;  3QWX X;  2GTO A;  2F2V A;  5FWC A;  4CC4 B;  1FYN A;  2HEQ A;  1U06 A;  2DL8 A;  2ESW A;  3A98 A;  4KRT A;  1QWF A;  2J05 A;  3UA7 A;  2AK5 A;  2FO0 A;  2EGA A;  4RTW A;  2PTK A;  1WXU A;  4J9E A;  2V1Q A;  1NLO C;  2CT4 A;  1NYF A;  1MV3 A;  1VYU A;  3M0R A;  2LZ6 B;  2YUP A;  2HBW A;  1GL5 A;  2KT1 A;  3EG3 A;  1JU5 C;  5IHN A;  4RTV A;  2DMO A;  1HD3 A;  5EC7 A;  1ZLM A;  2EGE A;  1Z9Z A;  4CC2 A;  4RUG A;  2L3P A;  2DM1 A;  1OPK A;  1QWE A;  4J9H A;  1JXM A;  4DEX A;  2XMF A;  3I35 A;  1UE9 A;  2FG0 A;  3M0Q A;  4HVW A;  1V1C A;  2EW3 A;  2JMC A;  1WYX A;  4JZ4 A;  2HSP A;  1G2B A;  4J9F A;  3H0H A;  3M0S A;  1GFD A;  1G83 A;  1PNJ A;  1ZSG A;  1GRI A;  1GFC A;  4IIM A;  1YP5 A;  3SHW A;  2LJ3 A;  2H8H A;  2CRE A;  2DJQ A;  2DIL A;  4ZNX A;  3REA B;  3NMZ C;  1WA7 A;  5IH2 A;  4RTX A;  1KJW A;  2GQI A;  2BZY A;  1X43 A;  2EYX A;  2LQN A;  2FPE A;  2O88 A;  2EPD A;  2YDL A;  2JS0 A;  1X6G A;  3RNJ A;  2ED1 A;  1CKB A;  2GTJ A;  2JM8 A;  1E6H A;  1WXT A;  2KYM A;  1UJY A;  2O31 A;  4RTZ A;  2VVK A;  2LJ0 A;  2W10 A;  1JEG A;  3TSZ A;  1SEM A;  2LMJ A;  1RLQ C;  3LH5 A;  2KRO A;  1X2K A;  2RQW A;  3TSW A;  1OPL A;  2FRY A;  1E6G A;  1QKW A;  2BTT A;  1ABO A;  2DNU A;  1JQQ A;  1NYG A;  2LCS A;  1CKA A;  4LUE A;  3REB B;  3M0P A;  1TG0 A;  1VYT A;  2MCN A;  4HVV A;  3TVT A;  2BZ8 A;  1PKS A;  2HDA A;  4LNP A;  2B86 A;  2JS2 A;  2KR3 A;  3NGP A;  4J9D A;  1Y57 A;  1HSQ A;  1GCQ C;  1UFF A;  1I0C A;  4JJD A;  2PZ1 A;  3M0T A;  4HCK A;  2ECZ A;  4OMP A;  1SRL A;  3NPF A;  1TUC A;  4GBQ A;  2FPD A;  2DRM A;  1UG1 A;  1MUZ A;  1J3T A;  2O9S A;  1W1F A;  2I0N A;  5GJV B;  1W6X A;  2RQR A;  1PHT A;  2J6F A;  2ENM A;  4OMO A;  1T0J A;  1YWP A;  1QLY A;  1RLP C;  2AKL A;  1K0X A;  4EIK A;  3EG1 A;  4F16 A;  1AVZ C;  2EBP A;  1NEB A;  1M3C A;  2KT8 A;  3I9Q A;  2KNB B;  3VRZ A;  2D8J A;  2LJ1 A;  1AZE A;  2YUO A;  1UDL A;  2D1X A;  4ORZ A;  2DA9 A;  4CC7 A;  2DRK A;  2EYY A;  4IIO A;  1SHF A;  2KXC A;  1AEY A;  2RQV A;  1ARK A;  1PWT A;  2GGR A;  2J6O A;  3GBQ A;  3UA6 A;  5IXF A;  1UUE A;  2EKH A;  2K79 A;  2ROT A;  1KFZ A;  2BZX A;  4AFS C;  3VS3 A;  2MOX A;  1WI7 A;  4J9G A;  1ZUK A;  5L23 A;  3H41 A;  1WX6 A;  2J06 A;  2AKK A;  2CUD A;  4GLM A;  1OEB A;  1FMK A;  1T0H A;  2JM9 A;  1WLP B;  2J6K A;  3NHN A;  1NEG A;  4E6R A;  3O5Z A;  1X6B A;  1W70 A;  4AG2 C;  2C0O A;  1M3B A;  2ROL A;  2O9V A;  2E5K A;  1KSW A;  5ECA A;  1EFN A;  1X69 A;  1TUD A;  1AD5 A;  2ABL A;  1GCP A;  1H3H A;  4OMQ A;  2YSQ A;  3UF4 A;  3H0F A;  3U23 A;  5I22 A;  2P4R A;  1VA7 A;  2KE9 A;  3UAT A;  1NM7 A;  3EG0 A;  4HVU A;  4D8K A;  2OAW A;  4K11 A;  2DL7 A;  2X3X D;  3R6N A;  5I11 A;  1GBR A;  2EVR A;  1M27 C;  4JZ3 A;  2K9G A;  1H8K A;  1PRL C;  2DE0 X;  2NUZ A;  1WFW A;  2C0I A;  2CSI A;  2LQW A;  2LX7 A;  1ZUU A;  3RBB B;  3CQT A;  3VS5 A;  3QWY A;  2VKN A;  1AWX A;  3M0U A;  4AG1 C;  4LE9 A;  2L2P A;  2JTE A;  2V1R A;  4AFZ C;  1A0N B;  2RMO A;  5FW9 A;  1YNZ A;  2DVJ A;  2AZS A;  2PNI A;  1WIE A;  2CT3 A;  1M8M A;  1NG2 A;  3PVQ A;  1S1N A;  1T3L A;  1WDX A;  4JJC A;  3C0C A;  1U5S A;  2FRW A;  1ZUY A;  4M4Z A;  1QKX A;  3EHQ A;  4OMN A;  1AOJ A;  2RN8 A;  1QCF A;  3FJ5 A;  1SRM A;  1OOT A;  1UHF A;  1YN8 A;  2A08 A;  1PKT A;  2D8H A;  1ABQ A;  4AFU C;  2DL5 A;  2DBK A;  2C0T A;  2HCK A;  5FWB A;  3VS0 A;  3EHR A;  1LCK A;  1JO8 A;  4R0K A;  4AFQ C;  2KXD A;  3VRY A;  2L3S A;  2DLP A;  2EQI A;  1H92 A;  4Y92 A;  2G6F X;  5IHI A;  2J7I A;  2EYZ A;  2A36 A;  3EGU A;  2LNH B;  4X1V A;  2GNC A;  4Z88 A;  1NLP C;  4J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...