1W1FA

Sh3 domain of human lyn tyrosine kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
b'QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE LYN
publication title Structural Characterization of Lyn-SH3 Domain in Complex with a Herpesviral Protein Reveals an Extended Recognition Motif that Enhances Binding Affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3-domain
total genus 8
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w1fA00
2M0YA 2KYMA 4HVVA 2JW4A 4HCKA 1PKSA 2O2OA 3I5RA 1K0XA 1UECA 4RTYA 1GRIA 1WDXA 1SRLA 1CSKA 1X6BA 2KBTA 2W10A 1ABQA 3IQLA 2JMCA 1KSWA 4J9IA 1NLOC 2DL3A 1EFNA 5GJVB 1K1ZA 3VS5A 1ZUYA 1UHFA 2FO0A 4RTWA 1X27A 4CC2A 3UA7A 4LNPA 4IIOA 1CKBA 4FSSA 1YWPA 2D1XA 1SPKA 4RTTA 3VS2A 5IXBA 2A28A 4R0KA 2F2WA 3UATA 2ROLA 2DVJA 4Z89A 2DRKA 1UGVA 4ESRA 1U3OA 2DE0X 2RN8A 2RQUA 1ZLMA 1UE9A 2EGAA 2YUQA 3VS6A 1G83A 1AD5A 3O5ZA 2DL7A 5I11A 2O9VA 2DJQA 1T0HA 3VS7A 4AFQC 2DLPA 3REBB 4X1VA 4F17A 2ED1A 2F2XA 2BZ8A 2W0ZA 1A0NB 1UJ0A 1W70A 2SRCA 1M3CA 1VYVA 1SHGA 4D8KA 2XMFA 1U06A 1YP5A 1K9AA 1M3BA 4KRTA 1HD3A 4J9GA 2EYXA 2B86A 1X43A 5IHNA 4J9HA 1RI9A 1Z9ZA 2FPDA 3EHQA 1VYTA 1BK2A 1WI7A 1GCQC 4D8DA 1Y57A 4J9BA 3I9QA 2DA9A 2M51A 3EG1A 2PTKA 3RNJA 2SEMA 1JO8A 3QWYA 4AG2C 2C0IA 1WIEA 1PHTA 2J06A 1SHFA 2ROTA 1UUEA 2X3XD 4LE9A 5IHKA 1WX6A 2HCKA 2YDLA 2D8JA 2KE9A 2L3QA 2OJ2A 4OMLA 3TVTA 4K11A 1OEBA 2ABLA 2EGCA 3VS1A 5ECAA 3JV3A 2FRWA 2OI3A 4AFUC 2KXDA 5HCKA 2GTOA 2JTEA 2VKNA 1TUDA 1QCFA 2HDAA 4J9FA 2RQVA 4OMNA 2GBQA 2F2VA 1VYUA 1TUCA 2VWFA 2ECZA 2CSIA 4JJCA 4GBQA 3H0IA 2JM9A 2L3SA 2V1QA 1YN8A 2JM8A 2DBKA 2E5KA 1M3AA 3EG3A 1RUWA 1AEYA 1HSQA 2LP5A 2LMJA 2CDTA 1UG1A 3I5SA 4JPBW 2EYYA 1AZEA 2BTTA 1E6GA 2C0TA 1AWWA 1RLQC 1JU5C 1Y0MA 1E6HA 3GBQA 1K4US 3PVLA 2EBPA 2X3WD 4E6RA 4QT7A 2DNUA 3SHWA 1H92A 1PWTA 3M0TA 2EYZA 2AK5A 3PE0A 1PKTA 3LH5A 2FPFA 1IO6A 2NWMA 2J6FA 2CUBA 1FMKA 3H41A 1PNJA 1WXTA 3VRZA 3M0RA 2AZVA 5FWCA 2KEAA 2PZ1A 1AVZC 2FG0A 2DM1A 3NPFA 1QKWA 3I35A 5L23A 4LUDA 2O88A 3A98A 2K79A 2KRSA 2RNAA 1AOJA 4OMMA 4F16A 2EQIA 1OV3A 3TSZA 4AFSC 2KR3A 2GTJA 4HVWA 1S1NA 1AWJA 1W6XA 2K2MA 2LJ1A 2LJ0A 1H8KA 1MV3A 1K0SA 2DBMA 1B3QA 1ZUUA 1KFZA 3NMZC 1T3SA 3R6NA 3ULRB 1X2KA 2VVKA 1KIKA 2A37A 3REAB 1XOVA 1GBRA 2RPNA 5IXFA 1LCKA 3VS0A 2YUNA 2DF6A 1ZUKA 4CC7A 2JXBA 2CT3A 4A63B 1AWXA 1GBQA 4AG1C 2CH4W 1X2QA 2J05A 2YSQA 1OOTA 4EIKA 3C0CA 2L2PA 1RLPC 2NUZA 2LJ3A 2DRMA 2V1RA 3VS3A 3TSWA 1AWOA 2HBWA 2RQRA 2MCNA 1WLPB 4DEXA 4HXJA 2ESWA 1JEGA 1E7OA 2EW3A 2YUOA 3M0QA 1T3LA 4JZ4A 2J6KA 1M30A 2CT4A 4WCIA 4Z8AA 1GCQA 1WFWA 2K7AA 1CKAA 1UHCA 2DL8A 3EGUA 1NEGA 2LCSA 1ZX6A 2C0OA 4M4ZA 3PVQA 4J9EA 2LNHB 2G6FX 1JQQA 4GLMA 4OMPA 2JMAA 5GJWB 1YWOA 1ARKA 1OPKA 4RTZA 3U23A 2MOXA 3EHRA 1N5ZA 1GCPA 2EVRA 2KYBA 4OMQA 3RBBB 4Y92A 1UDLA 2EGEA 2CUDA 2KXCA 1UTIA 4JJBA 2BZYA 4HVUA 1G2BA 1QLYA 2HSPA 2QDLA 2RMOA 1M8MA 4IIMA 1W1FA 2A08A 1I1JA 1MUZA 4AFZC 1X6GA 1I07A 3SEMA 1JXOA 1WYXA 4J9CA 3M0PA 2DL5A 4RTXA 2AZSA 2KT8A 1NYGA 1TG0A 2J6OA 2OAWA 2CH4A 1BB9A 2EYWA 2JS0A 5IHIA 1X69A 3VRYA 1QKXA 2HEQA 3M0UA 2RQWA 4ORZA 1B07A 3ZL7C 2KNBB 1JXMA 3NHNA 1WXUA 2A36A 4RUGA 4DEYA 3EG2A 1I0CA 2O9SA 1QWEA 2IIMA 5I22A 3M0SA 2P4RA 3UF4A 5FW9A 2KT1A 2LZ6B 3UA6A 2L0AA 2RQTA 4ZNXA 4LUEA 3H0HA 1J3TA 1KJWA 2LX7A 2ENMA 3FJ5A 2AKLA 2D0NA 2FRYA 2D8HA 1ZBJA 3KFVA 2GNCA 1U5SA 2DILA 1Z9QA 2YUPA 1GL5A 4RTVA 2GGRA 2KRMA 5IH2A 2CSQA 1M27C 1H3HA 1FYNA 1SEMA 2KROA 5EC7A 4Z88A 4J9DA 1NLPC 2AKKA 2J7IA 2FEIA 2KRNA 4CC3A 4CC4B 1UFFA 1BBZA 1YNZA 3VS4A 2O31A 1PRLC 1MV0B 1QWFA 1GFDA 3CQTA 1SSHA 1VA7A 4OMOA 2RF0A 2K6DA 4JZ3A 1GFCA 1NYFA 1OPLA 1HJDA 2DL4A 3NGPA 2EKHA 2K9GA 2DYBA 2ED0A 4F14A 1ABOA 2DX1A 2FPEA 1V1CA 1NM7A 4JJDA 1UJYA 1PRMC 1NG2A 2JS2A 1YCSB 2PNIA 2L3PA 2K3BA 2JT4A 2DMOA 2LQNA 2H8HA 1WA7A 2MIOA 1T0JA 2CREA 3EG0A 3H0FA 2YT6A 2LQWA 3THKA 4RTUA 1WXBA 2I0NA 2KGTA 2EPDA 2BZXA 1ZSGA 3QWXX 1SRMA 1AZGB 1NEBA 5FWBA 1K76A 2GQIA 4LN2A 1BU1A
chains in the Genus database with same CATH superfamily
1D3BA 1QP2A 2O2OA 3I5RA 1UECA 2X35A 1M1FA 4N0AA 1WDXA 1X6BA 1RADB 2BE7D 4J9IA 4PNOA 1Q7YC 1UGPB 3JCMQ 3OYCA 9ATCB 1XNIA 3META 5I21A 4CC2A 1UB4A 4LNPA 3A1PA 3CCLT 1YHQA 1Q86R 3CD6A 3I56T 1YWPA 1VQMA 1YJWQ 4PFPA 1WHHA 3UT1A 3CMAA 5IXBA 4GLKA 4VUBA 2DVJA 4M78A 4OB1B 1U3OA 2DE0X 2V8KA 2EJFA 1YIJT 1VQ6Q 2XDBA 1VQLT 2RQUA 1UE9A 4C0DB 1Q82R 2LCLA 3O5ZA 3JCMg 3E1SA 3L42A 5CIUA 4JDSA 4C0ZA 4JUVA 5GANe 1PD1A 1M4ZA 3CCQQ 2QEXQ 1A0NB 1W70A 1M3CA 1VYVA 1U06A 1YP5A 2EYXA 2B86A 5FRMA 1X43A 1RI9A 4ELYC 5GAOn 2PQWA 1Z9ZA 4JLGA 4JJNK 4DA4A 1VYTA 1WI7A 4TVRA 4ME7A 4J9BA 2RA2A 2M51A 1LPLA 2EFIA 2XIDA 4MMKA 2QTVA 3WXMB 1NJIR 2E6NA 4C0FA 2SEMA 1D1CA 3QWYA 2OTJA 4V2SA 1UUEA 3LX7A 1WX6A 1YI2A 4RKUE 5LJ3h 4OMLA 3NTIA 4LD6A 1D1AA 5GMKj 4EPCA 4C5IA 3QHSA 2PVOB 4M75F 3PIPA 2FRWA 2X4YA 4FW1A 1KQSP 4AFUC 2KI7A 1V76A 2VKNA 1TUDA 1QCFA 2HDAA 1C0MA 1X01A 4MDWA 2EJGA 3OBWA 1BKBA 1G3YA 5GAN7 1VYUA 3SWNB 2HQHA 4BB7A 2JM9A 2JM8A 1K8AR 2E5KA 3P8BB 2VXFA 3UWNA 1M3AA 3EG3A 2LP5A 2CDTA 3A8LB 5A0DA 3E2UA 3M5AA 5GMKi 1AZEA 1AWWA 1JU5C 3GBQA 2QA4A 1PC0A 2EBPA 3PVLA 4PLLA 1RAHB 4O5VA 5IAYA 1YITT 4QT7A 1BI3A 3SHWA 2QQBA 5EG2A 1U8RA 4XU1A 3MP8A 1IO6A 2J6FA 4KGXB 1FMKA 1KQ2A 3M0RA 2IVWA 1N9RA 2KEAA 3DB3A 2FG0A 2QDYB 2QTXA 2HD0A 5DY9A 3I35A 4QQGA 3A98A 2K79A 1OV3A 4AFSC 2KR3A 3CCRT 1MGQA 4HVWA 1VQ5T 1UEBA 2OAUA 4FYXB 1BI0A 1H8KA 1Q86C 3VYHB 2K5FA 3CMEQ 1T3SA 2GQVA 3R6NA 3OYAA 4PK4A 1H641 4BI8B 4ZGEB 2XDDA 2A37A 3X26B 3GP8A 3INZA 3REAB 1GBRA 3JCMf 4HCZA 2YUNA 1YJNT 4XAXB 2FYKA 2HL3A 4KULA 1SKUB 3MPUB 4M7DC 3PMTA 1Q82C 4AG1C 2CH4W 2J05A 3PFSA 4C92F 3NTHA 3P8DA 2L2PA 3CBPA 2HKQB 2NUZA 2LJ3A 3LYIA 5DLQE 4PJJA 1I5OB 3CC2T 4M77F 3JCMd 5GAOq 3P8HA 1KD1R 2BE9B 3QPHA 3EFSA 4F7UG 2ESWA 4F7UB 1K73R 1YBYA 5LJ5h 3TEEA 3MEWA 2YUOA 4JZ4A 3L2ZA 4Z8AA 4C0DC 5A0LA 3ZFJA 1NJIC 2KAFA 1VQ4T 1UGSB 1D0YA 2HZYA 3L2WA 1W2BA 3PVQA 3CCSQ 1JQQA 1VQ7T 4E47A 2CS7A 5FROA 4RTZA 3QIIA 2E65A 1N5ZA 1P92A 4EMKA 4PJOF 2RHZA 2EGEA 4C5GA 1MNEA 2K57A 1D1BA 3O8VA 2XG8D 1W2BS 2A08A 1RAFB 3OA6A 1I1JA 3G4SQ 8AT1B 4NOYA 4A4EA 1NYGA 3HL8A 3RMSA 1TG0A 3HRSA 3HSBA 2B8AA 2J6OA 1K8AC 1BB9A 2EYWA 4M75A 1X69A 4C92G 2HEQA 4L5GA 3X28B 2RQWA 2CYZB 1EX4A 4E7KA 4PFZA 3EG2A 4HCCA 1I0CA 3C95A 5GANg 3OYJA 1VQ6T 3OB9A 1OULA 3LW5E 2OTLQ 5I22A 3M0SA 3UF4A 5FW9A 3CCMQ 2F69A 2P4TA 2FHDA 2DIGA 4FU6A 4DBQA 3MKDA 4ZNXA 1TXQA 2QEXT 3CCQT 3H0HA 3GNGA 2LX7A 5KCOA 3EG9B 3EGDB 5DLOA 1WQ7A 5GAMj 5LJ3e 1Z9QA 1XJWB 2CP2A 5AT1B 3HRTA 4DBHA 5IH2A 1VOMA 4KBMB 1TTHB 1M27C 3L2QA 1SEMA 2KROA 1I5LA 4J7IA 3C12A 1BIAA 3I55A 4CC4B 1YNZA 1M2VA 1QWFA 2MWPA 4HT8A 4E7HA 1NYFA 2LC4A 3OSVA 1HJDA 4D6WA 4M78E 2DL4A 1SG5A 3V8JA 2ED0A 1LNXA 1ABOA 2DX1A 2DAQA 3LWHA 1WHJA 1V1CA 3S3NA 4YTLA 3S6WA 2YHTA 4JJDA 1PRMC 1NG2A 4PKCC 2RB6A 3CBMA 1VQPQ 4M7AF 5KYYA 4M78D 2JT4A 2O01E 1JJ2A 2DERA 3VU3C 1KD1C 5AYFA 4C8QF 2MIOA 5GMKl 1Q81U 1X75C 3EG0A 3EGXB 3GLXA 3RDVA 2LQWA 4RTUA 4J6WA 3CEYA 4KGVB 1YJ9Q 1ZSGA 4C92A 5C0MA 1AZGB 1K73U 1OI1A 3GF5A 3QJ6A 3VUBA 3CCLA 3CC7Q 1WHGA 3I56A 2M0YA 3DB4A 4M77A 2DO3A 4HVVA 5J26A 1JJ2S 3N5BB 1MMGA 1ZQ1A 4B6MA 3IQLA 3L1AA 1KC8U 2JMCA 1KSWA 2R5AA 1WHKA 2DL3A 5GJVB 1K1ZA 2L89A 4DQ2A 1YIJA 3VS5A 1VQLA 3VJPA 4DBRA 3E9GA 4FYYB 3JCMX 3UA7A 2HKNA 1I81A 4ZN1A 2DXBA 5KYUB 2XU8A 1VQ9Q 2LDMA 1IHVA 3PIOA 1SPKA 2RM4A 2H3EB 1QP3A 4MMLA 1RL2A 4Z89A 2DRKA 2RHIA 4ESRA 2RN8A 4DOWA 5CQXA 3OS2A 3R6OA 5CKHA 2QQ9A 3G7ZA 3CC4Q 4PJOA 2MMPA 2YUQA 3CMET 3HPWA 3LLRA 3HRUA 1IRXA 5I11A 3GIBA 5FLXE 3VS7A 4A4HA 5LJ5e 4CI0C 4C8QG 4BACA 4LDUA 2L8DA 3UPUA 4D8KA 5J3BA 1K9AA 5GAMf 2JNGA 1HD3A 4KRTA 3ME9A 4OF1A 3MHXA 1WNLA 5KYWA 3EHQA 2D0QB 5GANd 3CMAQ 5GAN4 2RHXA 5CR2A 2JVVA 2HSEB 2EYQA 4ZTFA 5D6YA 3MO8A 1D0ZA 3RNJA 1C1AA 1UGRB 4AG2C 2C0IA 2FZGB 1WZOA 3FIFA 2YRCA 2Y4XA 2J06A 2ROTA 4PL6A 5HK0A 4LE9A 4MZTA 1VQ8T 2DD5A 2KE9A 2L3QA 2OJ2A 3TVTA 4JRKA 1FXXA 1OEBA 2PUOB 2K3XA 1WJSA 2EGCA 3VS1A 1W4SA 3EAEA 3JV3A 2RK1A 3CCST 3G1JA 2GTOA 2CZ1B 4J9FA 1YITA 8ATCB 1TOVA 2RJFA 2DYIA 2GBQA 2F2VA 5I2MA 3OW2A 3RUXA 2CSIA 4JJCA 2RI3A 3CPFA 4WTOB 4KUDK 2DBKA 2OTJQ 3QUIA 1AEYA 3G4ST 4M7DG 4M7DB 4OGEA 4JPBW 2EYYA 3A5ZB 1E6GA 3OSSC 3QZ5B 3CCRA 1K4US 1S72T 2X3WD 1VQ5A 2DNUA 2F1LA 3OW2S 3PE0A 4M7AA 2LT4A 4XK8E 5A2QE 2FPFA 5GAOr 3JB9H 2DZCA 3VUZA 1ZA1B 3C4SA 2NWMA 4LD9K 4C8QA 2DD4A 2COYA 5GAN3 1WXTA 2D9TA 1QCOA 3CCVQ 1YJNA 2AZVA 3QXEB 2PZ1A 2OTLT 1N6AA 1QKWA 3CCMT 5LJ3g 2KRSA 4F16A 1QVGA 2LX9A 3L2UA 1S1NA 1AWJA 2K2MA 2LJ0A 3PGGA 1M90U 4JS5A 2DBMA 3OYYA 3NMZC 3G6ET 3CC2A 3RERA 1ZSZC 5IXFA 1LCKA 2DF6A 1ZUKA 4X34A 2VGNA 3S3MA 2KQWA 2QYZA 1EZZB 2F5TX 1MMDA 3L2VA 1AWXA 3SFMA 1QVGS 4M75E 2E70A 1G3TA 1X2QA 2YSQA 1VQ4A 4QQDA 4J6YA 2NUTA 1OOTA 4EIKA 3OYHA 3EFOA 1X6OA 1V29B 2K3YA 1WHMA 4OP0A 2V1RA 1AWOA 1YFNA 1G3SA 1VQ7A 2EKOA 2RQRA 1WLPB 3KXTA 4M75D 4DEXA 5KYXB 2EW3A 1XTDA 2FZKB 5FU6C 4AT1B 3OYDA 4FT4A 4IURA 2CT4A 4WCIA 1IXDA 2HL5C 1GCQA 1WFWA 2DVEA 2DL8A 3EGUA 4XTZA 1QW1A 3H8ZA 5D7UA 1NEGA 3Q1JA 4A4FA 2ZPFB 2A3LA 1YJ9T 1BI2A 4J9EA 1NPRA 4KUIA 5CKFA 4KT0E 4UC4A 2XK0A 3S3OA 1PG5B 4OMPA 3CC7T 2CP6A 2BIVA 1OPKA 3M58A 1C6VX 3U23A 2MOXA 4CRIA 2EVRA 4PLIA 4OMQA 3RBBB 1UDLA 2CUDA 4JJBA 2BZYA 1W2BP 1K9MU 1JRIA 1VQ6A 4M78C 4F7UF 1W1FA 3AT1B 5KYNA 1MUZA 1RAGB 4AFZC 4XU3A 3ASKA 1JXOA 4J9CA 3M0PA 2ATCB 2XHCA 3OYEA 3OYLA 3CCQA 2QEXA 3VRYA 3F70A 2QXFA 1VQ9T 3TQ7P 1NE8A 4ELZC 4ORZA 1B07A 3ZL7C 4RCCA 4XTXA 1JXMA 3NHNA 3LGFA 5J39A 3PT9A 3URGA 3JB9F 2O9SA 3CC4T 2YXYA 2CP0A 3J7AF 4C92E 5LJ5g 1NZ9A 3RKYA 1UGQB 3SDZA 2KT1A 2LZ6B 3UA6A 2L0AA 2ZGWA 4M77E 2RQTA 2V8JA 2LVMA 3HTRA 1KJWA 4XQ3A 3CCJQ 2D0NA 2ZPHB 4N4GA 2GNCA 3OYFA 2DILA 3OMCA 1BCOA 1Y96B 3NFCA 2CSQA 3RESA 4J9DA 2MYSA 4II1A 2FEIA 2LCCA 4KH0B 4M77D 1R0CB 4C0GA 3CXCA 1LJOA 1BBZA 3BFMA 1PRLC 1Q81R 1MV0B 5DM7R 2RF0A 4JZ3A 4QW2A 3SWNA 2WSCE 5KCHA 4IUVA 1OZ3A 2MPXC 3H6ZA 2QASA 2R58A 2EKHA 4E7LA 2DYBA 5CK9A 4E7IA 3EH2A 4PJOE 3CCEQ 2LTOA 3H9NA 3QG1A 3QJYA 2E1HA 1NM7A 3C94A 3HP9A 1UJYA 4J7FA 3CXCS 1SF9A 1KC8R 2WSEE 4ZTJA 2QG9B 4Q5WA 2PNIA 4QVCA 3JSCA 4QQ6A 2LQNA 2CP5A 5C6SA 2H8HA 6AT1B 1T0JA 4J8OA 1VQKQ 3G71Q 4PJOD 3JB9G 4XTVA 3SB2A 3FRNA 3X25B 4N4IA 4QVDA 1VIFA 5GAOm 1M1GA 2I0NA 4Y91A 2EPDA 4BE1A 2OX7A 3QWXX 3WVEB 1SRMA 1NEBA 4HCBA 2YLBA 2GQIA 1WQWA 3HHTB 4A4KA 1BU1A 3TREA 1JJ2P 2M1HA 2JW4A 1PKSA 1MHNA 1K0XA 1LOJA 1GRIA 4FSXA 3CCUQ 4J83A 5M9OA 1EFNA 2L5QA 3E9FA 1ZUYA 3CMEA 1YJWT 2GFAA 2KDSA 2DXCA 5CQYA 1YCYA 2BKDN 3CCVT 4FCYA 4IIOA 4FSSA 2E3IA 4HT9A 4RTTA 2A28A 5GANj 4R0KA 2F2WA 2JJ9A 1MNDA 1IHWA 2HMAA 4R56A 4JRPA 3I56Q 1TUGB 1MMAA 3BDUA 4ZN3A 2HAXA 4IUUA 2ZPGB 2MWOA 2EGAA 3ZBDA 3FEOA 3QSUA 1HXDA 3QKJA 1AD5A 3OS5A 1M1KU 2HQXA 2O9VA 4OB2B 2DJQA 4F7UA 1B34B 1T0HA 4B9XA 2JUFA 2DLPA 3REBB 2W0ZA 3A8MB 1UJ0A 2SRCA 1WJQA 4O6JA 1VQ8A 1M3BA 4BE0A 2DFUA 1R0BG 4J9GA 5CKDA 2AHJB 1BCMA 2LNVA 4J9HA 4M7AE 3FC3A 1QMCA 1BK2A 4A53A 3JCMe 1Y57A 4C8QE 2DA9A 1KHIA 3CCSA 3EG1A 2PTKA 1TWBA 1JBMA 3L2RA 4EMHA 2I2LA 4DOVA 1R8OB 3OYGA 1ZA2B 1SHFA 1NBEB 2MAMA 2QAZA 2X3XD 4J6XA 4M7AD 2YDLA 4BDYA 4C8QD 4K11A 3V7RA 4JRQA 4PJMA 3M54A 4BDZA 2O4XB 2RK2A 3G4SA 4BI4A 2A0FB 4C5EA 1OX9A 3FJPA 1K73C 1VQNQ 2OI3A 2K5IA 2NUPB 5HCKA 3OYBA 1R77A 2JTEA 5GAMh 3LH0A 3X24B 1S72A 4OMFB 2QQRA 3A8GB 5D6WA 2JN0A 5GMKe 2DXTA 4M75C 2ECZA 2FL7A 2JOYA 4GBQA 4BD3A 1ZSZB 1YN8A 1EIFA 3D7SB 1RUWA 2LMJA 2OTLA 1VQOQ 3I5SA 3CCMA 2BTTA 1RLQC 1Y0MA 1M90R 4R55A 2ZAEA 3OW2P 3EG9A 3EGDA 4JS4A 2CZ0B 1PWTA 2XI9A 2AK5A 4LDWA 3LH5A 3G6EA 4C5HA 5HY6A 1VIEA 1MMNA 2DEUA 1PNJA 1HYOA 2XD0A 1QVFA 4WF2A 3OYNA 5FWCA 1AVZC 2RI2A 5CKEA 2DM1A 5FU6B 3NPFA 1RAEB 4XTWA 1D3BB 4LUDA 5KE2A 1B7TA 5GANf 2EQIA 3M4GA 1W6XA 1BYMA 1MV3A 1B3QA 3CCJT 3FDRA 1ZUUA 4M7DF 4LDVA 3RKWA 3ULRB 3PNWC 2D6FA 1KIKA 1VQ5Q 5IN1A 4LDXA 1QVFS 1OQKA 3VS0A 1YHQQ 3CD6Q 3RMQA 3CPWA 1VQMQ 1QVGP 4JRIA 4BY6C 2JXBA 2DETA 1BI1A 1BIBA 3OMGA 2WSFE 2CZ6B 1M9SA 3EGXA 4M78G 4M78B 4X9CA 3C0CA 2DKGA 1YJ9A 3VS3A 3TSWA 1AHJB 2HBWA 2RJDA 2GF7A 3CCET 2MCNA 3CPWS 1Q95G 2IG0A 3CC7A 4HXJA 2ZPBB 1E7OA 3M0QA 4RG2A 3CC2Q 2X4XA 1K9MR 1Y71A 2Y90A 2AT1B 3A8OB 4M77C 2K7AA 1UHCA 3HFNA 3QO3A 3VYGA 1VQKT 4EDUA 3G71T 2A7YA 2LCSA 2P0PA 2C0OA 4M4ZA 1RI0A 3PTAA 4BUGA 3QZ9B 4GLMA 5KYUA 5HKCA 3M56A 5GJWB 3EH1A 1YWOA 1I8FA 4F04B 3PMIA 1ARKA 5GAOp 2P0KA 1VQ9A 4A4GA 4JLIA 3EHRA 2KYBA 1YI2Q 1IREB 4PFOA 1UTIA 3JCMP 3CCUT 4HVUA 1G2BA 1QLYA 2VB6A 2HSPA 2VC8A 1KHCA 1N8RU 3CC4A 1X6GA 4FYVB 1I07A 1WYXA 2Z0WA 2DL5A 1WHLA 1IZ6A 4HA8A 2AZSA 4PJOC 1NPPA 2OAWA 2CH4A 2JS0A 2RH2A 1FMVA 2G3RA 2VV5A 1QKXA 3EFRA 4B9WA 1ACMB 3QDRB 4EMGA 1Q7YU 2COZA 5CO7A 1QQJA 3JCMV 5I2SA 1WGSA 2KNBB 1PM3A 1WXUA 4RUGA 4ZGDB 1M90C 1U1SA 4XTUA 5LJ3j 2RHYA 4QKUA 3BE3A 2MI6A 4P5NA 2P4RA 1PD0A 3TCJA 1GXIE 1M2OA 3M53A 2QA4Q 2E41A 2ENMA 1DJ7B 3FJ5A 3SD4A 3VKIA 2AKLA 2FRYA 2V26A 1ZBJA 3KFVA 2DXUA 2ZPEB 2YUPA 1GL5A 2ZPIB 3M4YA 2KRMA 2P0QA 4N4HA 1H3HA 1FYNA 2EWNA 2AKKA 2J7IA 2PVGB 2RO0A 2AIRB 3BDLA 2QQAA 2KRNA 3MJXA 3VS4A 2E12A 2EQUA 5GAMe 3CQTA 1VA7A 4OMOA 2K6DA 2NYSA 4KH1B 4L59A 3NGPA 3JCMb 2PVDB 3OS0A 2M02A 2KMTA 4F14A 1VQPT 2FPEA 3V7SA 2DPPB 2KK4A 3CXCP 4M7DA 4OVAA 1U1TA 5GAN6 1TSFA 4N0AC 2EJ9A 3DLLA 4F7UE 1OX8A 2JS2A 1VQNT 3JCMh 3QDFA 2JZ2A 2DMOA 3WVDB 1PCXA 3HKSA 3CBOA 2DTOA 2KSSA 2VGMA 1TS9A 2GCXA 2CREA 3H0FA 2YT6A 4FIBA 3V8KA 3THKA 3V8LA 1KG1A 1YJWA 4FYWB 2C06A 2EAYA 2BZXA 2HQEA 4XTYA 1K9MC 4E7ZA 3E19A 4M7AC 2CP7A 5CKBA 5GAN8 5FWBA 1K76A 3CCVA 5GAN5 2YRDA 4C8QC 2KYMA 3DLMA 2M9UA 1VQOT 5GAOl 4HCKA 3MEVA 4RTYA 2QI2A 5FU7C 1SRLA 1CSKA 1XQHA 1QVPA 2KBTA 1ABQA 2W10A 3MP6A 2DTHA 1NLOC 4MDXA 3GPLA 1M1KR 2RD1A 1UHFA 2FO0A 4RTWA 2MK5A 4X9DA 1X27A 2DIQA 1HK9A 1TU0B 5GMKh 3JB9D 2X9HA 3BY7A 1CKBA 1RACB 2D1XA 2R57A 3VS2A 2YRVA 2VYTA 3UATA 4NL2A 2ROLA 5LJ5j 2RJEA 1UGVA 4EMKB 4ATOA 3OY9A 2M16A 4OGCA 1ZLMA 3VS6A 1RAIB 5LJ3f 1N27A 1G83A 2XDPA 2CKKA 2DL7A 3V7CA 3M57A 3RIRA 4C92D 1OZ2A 4AFQC 5KYXA 1ZBXA 1YHQT 3CD6T 1IB8A 1VQMT 4X1VA 4F17A 2ED1A 2F2XA 2BZ8A 3CMAT 2RJCA 4M75G 1SHGA 4M75B 1Q86U 2XMFA 2EIFA 2X4WA 5IHNA 3OYIA 1OYXA 5LJ3d 2FPDA 4D8DA 1GCQC 4XU2A 3I9QA 5GAN2 2XKOC 2YWWA 3RR6A 3QYHB 1QCNA 1Q82U 1G5VA 1JO8A 3KBGA 1WIEA 1PHTA 3VV0A 1KQSA 2P84A 5IHKA 2E10A 4FL6A 4DBFA 4LXCA 4RG8A 2CP3A 2HCKA 2QGFB 2D8JA 2DEQA 2BUDA 2RI5A 2F5KA 5HK3A 2M0OA 4NL3A 2LQKA 2ABLA 4GY5A 1F1BB 2RHUA 2QK0A 5ECAA 2IPOB 1VQ8Q 1O75A 3I55Q 2KXDA 2QGGA 2E5QA 1M8VA 1KQSS 3JRZA 2OTJT 1WJRA 1G8XA 1M2VB 1NJIU 2RQVA 4OMNA 1TUCA 1YI2T 3FLGA 2VWFA 2NLUA 2X51A 1WPYA 3OBYA 3ZEHA 4RCBA 3H0IA 2VUBA 2L3SA 2V1QA 1TH7A 1HSQA 3A8HB 5D6XA 2QQSA 5L8RE 4BY6B 1UG1A 4IUTA 3JCMc 2JTFA 2KVQG 2C0TA 1H3ZA 1E6HA 3MP1A 1OU9A 5KYYB 4E6RA 1IGUA 2DK3A 1H92A 1OU8A 4MZPA 1D09B 2R5MA 3M0TA 3CCJA 2EYZA 1PKTA 1Y96A 4OB0B 4HKEA 4ANJA 1KK7A 3JCMJ 3BW1A 2CUBA 4IUPA 1S72Q 3H41A 4FW2A 3JCMW 4C92B 3VRZA 3T9NA 3CCLQ 2WACA 1FWZA 1K8AU 3AHUA 1M1KC 4E2FB 5FRNA 4PJNA 5L23A 3J81E 2JTMA 2O88A 4M77G 4M77B 2RNAA 1AOJA 4OMMA 2X4JA 3TSZA 4IKFA 2GTJA 1ZHIA 2QA4T 2YLCA 5LJ5f 2LJ1A 1K0SA 1O9SA 1YIJQ 4KGZB 2COWA 1VQLQ 1KFZA 1QVFP 3SWNC 4MZMA 1X2KA 2ZZDA 2VVKA 5GAMg 4FM4B 1XOVA 2RPNA 3OQ5A 5CVIA 3CCEA 4CC7A 3G6EQ 2CT3A 4A63B 4AMCA 1GBQA 2E64A 5LJ5d 2XICA 3QYGB 4E7SA 3DKMA 4QVZA 3M55A 2Y4YA 1VQKA 5KE3A 3G71A 1RLPC 1Y07A 2DRMA 3JAME 4PJOG 4PJOB 5LL6S 2DJZA 3CPWP 1FX7A 1PSFA 5GANh 1Q81C 4EMKC 1JEGA 1T3LA 2K5LA 2V8IA 4A54A 2PUKB 2J6KA 1M30A 1N8RR 3CCUA 1CKAA 4J5YA 3FB9A 2E6ZA 4Z02A 5KYWB 1ZX6A 3TU4K 2LNHB 2LT1A 2G6FX 3QBYA 1KC8C 3OYMA 2JMAA 1Q7YR 1RABB 2ZCFB 4M78F 1KD1U 3NTKA 3UDCA 1GCPA 3OS1A 4Y92A 2KXCA 2LQ8A 1PSEA 3M59A 2E3HA 2QDLA 1G3WA 2RMOA 1M8MA 4IIMA 1VUBA 2VASA 5KH6A 1AT1B 4LDYA 3SEMA 1B34A 4M7DE 4RTXA 1D0XA 3OYKA 1M5Q1 2KT8A 5IHIA 1YITQ 2HBPA 2EQJA 1RAAB 3M0UA 2MF2A 1FMWA 2A36A 4DEYA 3J80E 4M7DD 2L3RA 1QWEA 3MEAA 2IIMA 4ZGJB 1IGQA 5IT9E 2FZCB 3CCRQ 3GOXA 2LRQA 4LUEA 1J3TA 2D8HA 2CGHA 1KQ1A 4L6V5 4BE2A 1U5SA 4M7AG 4M7AB 4RTVA 2GGRA 1LVKA 1VQPA 4NS5A 2O4XA 5EC7A 4Z88A 4C8QB 1NLPC 2H3JA 1YJNQ 3ER0A 2E4HA 2NUPA 4CC3A 1VQNA 5FU7B 1UFFA 2O31A 4Y28E 1GFDA 4E7JA 1SSHA 4PJLA 3GNFB 3LWIA 1GFCA 2FVUA 2K4YA 1OPLA 2DTIA 4OB3B 3JB9I 4C92C 2DZ9A 1ZSZA 2K9GA 2GFUA 3KUFA 5CCAA 5GAMd 3HFOA 3RKXA 4RMOA 3MEUA 5A0GA 1Y7XA 2EQMA 5GMKm 5CAIA 1VQOA 1YCSB 1SSFA 3I55T 7AT1B 3M9QA 2K3BA 2L3PA 3MCAB 4BI3A 2CZ7B 2VXEA 1VQ4Q 1WA7A 4XU0A 4FT2A 2FB7A 2NUTB 3X20B 1WXBA 2PU9B 3EFOB 3LGLA 2KGTA 1I4K1 2HNIA 1VQ7Q 1N8RC 1JB0E 1N9SA 4IUQA 2EQKA 4LN2A 3JB9J 2K2VA 2KY9A
chains in the Genus database with same CATH topology
2M0YA 2KYMA 4HVVA 2JW4A 4HCKA 1PKSA 2O2OA 3I5RA 1K0XA 1UECA 4RTYA 1GRIA 1WDXA 1SRLA 1CSKA 1X6BA 2KBTA 2W10A 1ABQA 3IQLA 2JMCA 1KSWA 4J9IA 1NLOC 2DL3A 1EFNA 5GJVB 1K1ZA 3VS5A 1ZUYA 1UHFA 2FO0A 4RTWA 1X27A 4CC2A 3UA7A 4LNPA 4IIOA 1CKBA 4FSSA 1YWPA 2D1XA 1SPKA 4RTTA 3VS2A 5IXBA 2A28A 4R0KA 2F2WA 3UATA 2ROLA 2DVJA 4Z89A 2DRKA 1UGVA 4ESRA 1U3OA 2DE0X 2RN8A 2RQUA 1ZLMA 1UE9A 2EGAA 2YUQA 3VS6A 1G83A 1AD5A 3O5ZA 2DL7A 5I11A 2O9VA 2DJQA 1T0HA 3VS7A 4AFQC 2DLPA 3REBB 4X1VA 4F17A 2ED1A 2F2XA 2BZ8A 2W0ZA 1A0NB 1UJ0A 1W70A 2SRCA 1M3CA 1VYVA 1SHGA 4D8KA 2XMFA 1U06A 1YP5A 1K9AA 1M3BA 4KRTA 1HD3A 4J9GA 2EYXA 2B86A 1X43A 5IHNA 4J9HA 1RI9A 1Z9ZA 2FPDA 3EHQA 1VYTA 1BK2A 1WI7A 1GCQC 4D8DA 1Y57A 4J9BA 3I9QA 2DA9A 2M51A 3EG1A 2PTKA 3RNJA 2SEMA 1JO8A 3QWYA 4AG2C 2C0IA 1WIEA 1PHTA 2J06A 1SHFA 2ROTA 1UUEA 2X3XD 4LE9A 5IHKA 1WX6A 2HCKA 2YDLA 2D8JA 2KE9A 2L3QA 2OJ2A 4OMLA 3TVTA 4K11A 1OEBA 2ABLA 2EGCA 3VS1A 5ECAA 3JV3A 2FRWA 2OI3A 4AFUC 2KXDA 5HCKA 2GTOA 2JTEA 2VKNA 1TUDA 1QCFA 2HDAA 4J9FA 2RQVA 4OMNA 2GBQA 2F2VA 1VYUA 1TUCA 2VWFA 2ECZA 2CSIA 4JJCA 4GBQA 3H0IA 2JM9A 2L3SA 2V1QA 1YN8A 2JM8A 2DBKA 2E5KA 1M3AA 3EG3A 1RUWA 1AEYA 1HSQA 2LP5A 2LMJA 2CDTA 1UG1A 3I5SA 4JPBW 2EYYA 1AZEA 2BTTA 1E6GA 2C0TA 1AWWA 1RLQC 1JU5C 1Y0MA 1E6HA 3GBQA 1K4US 3PVLA 2EBPA 2X3WD 4E6RA 4QT7A 2DNUA 3SHWA 1H92A 1PWTA 3M0TA 2EYZA 2AK5A 3PE0A 1PKTA 3LH5A 2FPFA 1IO6A 2NWMA 2J6FA 2CUBA 1FMKA 3H41A 1PNJA 1WXTA 3VRZA 3M0RA 2AZVA 5FWCA 2KEAA 2PZ1A 1AVZC 2FG0A 2DM1A 3NPFA 1QKWA 3I35A 5L23A 4LUDA 2O88A 3A98A 2K79A 2KRSA 2RNAA 1AOJA 4OMMA 4F16A 2EQIA 1OV3A 3TSZA 4AFSC 2KR3A 2GTJA 4HVWA 1S1NA 1AWJA 1W6XA 2K2MA 2LJ1A 2LJ0A 1H8KA 1MV3A 1K0SA 2DBMA 1B3QA 1ZUUA 1KFZA 3NMZC 1T3SA 3R6NA 3ULRB 1X2KA 2VVKA 1KIKA 2A37A 3REAB 1XOVA 1GBRA 2RPNA 5IXFA 1LCKA 3VS0A 2YUNA 2DF6A 1ZUKA 4CC7A 2JXBA 2CT3A 4A63B 1AWXA 1GBQA 4AG1C 2CH4W 1X2QA 2J05A 2YSQA 1OOTA 4EIKA 3C0CA 2L2PA 1RLPC 2NUZA 2LJ3A 2DRMA 2V1RA 3VS3A 3TSWA 1AWOA 2HBWA 2RQRA 2MCNA 1WLPB 4DEXA 4HXJA 2ESWA 1JEGA 1E7OA 2EW3A 2YUOA 3M0QA 1T3LA 4JZ4A 2J6KA 1M30A 2CT4A 4WCIA 4Z8AA 1GCQA 1WFWA 2K7AA 1CKAA 1UHCA 2DL8A 3EGUA 1NEGA 2LCSA 1ZX6A 2C0OA 4M4ZA 3PVQA 4J9EA 2LNHB 2G6FX 1JQQA 4GLMA 4OMPA 2JMAA 5GJWB 1YWOA 1ARKA 1OPKA 4RTZA 3U23A 2MOXA 3EHRA 1N5ZA 1GCPA 2EVRA 2KYBA 4OMQA 3RBBB 4Y92A 1UDLA 2EGEA 2CUDA 2KXCA 1UTIA 4JJBA 2BZYA 4HVUA 1G2BA 1QLYA 2HSPA 2QDLA 2RMOA 1M8MA 4IIMA 1W1FA 2A08A 1I1JA 1MUZA 4AFZC 1X6GA 1I07A 3SEMA 1JXOA 1WYXA 4J9CA 3M0PA 2DL5A 4RTXA 2AZSA 2KT8A 1NYGA 1TG0A 2J6OA 2OAWA 2CH4A 1BB9A 2EYWA 2JS0A 5IHIA 1X69A 3VRYA 1QKXA 2HEQA 3M0UA 2RQWA 4ORZA 1B07A 3ZL7C 2KNBB 1JXMA 3NHNA 1WXUA 2A36A 4RUGA 4DEYA 3EG2A 1I0CA 2O9SA 1QWEA 2IIMA 5I22A 3M0SA 2P4RA 3UF4A 5FW9A 2KT1A 2LZ6B 3UA6A 2L0AA 2RQTA 4ZNXA 4LUEA 3H0HA 1J3TA 1KJWA 2LX7A 2ENMA 3FJ5A 2AKLA 2D0NA 2FRYA 2D8HA 1ZBJA 3KFVA 2GNCA 1U5SA 2DILA 1Z9QA 2YUPA 1GL5A 4RTVA 2GGRA 2KRMA 5IH2A 2CSQA 1M27C 1H3HA 1FYNA 1SEMA 2KROA 5EC7A 4Z88A 4J9DA 1NLPC 2AKKA 2J7IA 2FEIA 2KRNA 4CC3A 4CC4B 1UFFA 1BBZA 1YNZA 3VS4A 2O31A 1PRLC 1MV0B 1QWFA 1GFDA 3CQTA 1SSHA 1VA7A 4OMOA 2RF0A 2K6DA 4JZ3A 1GFCA 1NYFA 1OPLA 1HJDA 2DL4A 3NGPA 2EKHA 2K9GA 2DYBA 2ED0A 4F14A 1ABOA 2DX1A 2FPEA 1V1CA 1NM7A 4JJDA 1UJYA 1PRMC 1NG2A 2JS2A 1YCSB 2PNIA 2L3PA 2K3BA 2JT4A 2DMOA 2LQNA 2H8HA 1WA7A 2MIOA 1T0JA 2CREA 3EG0A 3H0FA 2YT6A 2LQWA 3THKA 4RTUA 1WXBA 2I0NA 2KGTA 2EPDA 2BZXA 1ZSGA 3QWXX 1SRMA 1AZGB 1NEBA 5FWBA 1K76A 2GQIA 4LN2A 1BU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0Y A;  2KYM A;  4HVV A;  2JW4 A;  4HCK A;  1PKS A;  2O2O A;  3I5R A;  1K0X A;  1UEC A;  4RTY A;  1GRI A;  1WDX A;  1SRL A;  1CSK A;  1X6B A;  2KBT A;  2W10 A;  1ABQ A;  3IQL A;  2JMC A;  1KSW A;  4J9I A;  1NLO C;  2DL3 A;  1EFN A;  5GJV B;  1K1Z A;  3VS5 A;  1ZUY A;  1UHF A;  2FO0 A;  4RTW A;  1X27 A;  4CC2 A;  3UA7 A;  4LNP A;  4IIO A;  1CKB A;  4FSS A;  1YWP A;  2D1X A;  1SPK A;  4RTT A;  3VS2 A;  5IXB A;  2A28 A;  4R0K A;  2F2W A;  3UAT A;  2ROL A;  2DVJ A;  4Z89 A;  2DRK A;  1UGV A;  4ESR A;  1U3O A;  2DE0 X;  2RN8 A;  2RQU A;  1ZLM A;  1UE9 A;  2EGA A;  2YUQ A;  3VS6 A;  1G83 A;  1AD5 A;  3O5Z A;  2DL7 A;  5I11 A;  2O9V A;  2DJQ A;  1T0H A;  3VS7 A;  4AFQ C;  2DLP A;  3REB B;  4X1V A;  4F17 A;  2ED1 A;  2F2X A;  2BZ8 A;  2W0Z A;  1A0N B;  1UJ0 A;  1W70 A;  2SRC A;  1M3C A;  1VYV A;  1SHG A;  4D8K A;  2XMF A;  1U06 A;  1YP5 A;  1K9A A;  1M3B A;  4KRT A;  1HD3 A;  4J9G A;  2EYX A;  2B86 A;  1X43 A;  5IHN A;  4J9H A;  1RI9 A;  1Z9Z A;  2FPD A;  3EHQ A;  1VYT A;  1BK2 A;  1WI7 A;  1GCQ C;  4D8D A;  1Y57 A;  4J9B A;  3I9Q A;  2DA9 A;  2M51 A;  3EG1 A;  2PTK A;  3RNJ A;  2SEM A;  1JO8 A;  3QWY A;  4AG2 C;  2C0I A;  1WIE A;  1PHT A;  2J06 A;  1SHF A;  2ROT A;  1UUE A;  2X3X D;  4LE9 A;  5IHK A;  1WX6 A;  2HCK A;  2YDL A;  2D8J A;  2KE9 A;  2L3Q A;  2OJ2 A;  4OML A;  3TVT A;  4K11 A;  1OEB A;  2ABL A;  2EGC A;  3VS1 A;  5ECA A;  3JV3 A;  2FRW A;  2OI3 A;  4AFU C;  2KXD A;  5HCK A;  2GTO A;  2JTE A;  2VKN A;  1TUD A;  1QCF A;  2HDA A;  4J9F A;  2RQV A;  4OMN A;  2GBQ A;  2F2V A;  1VYU A;  1TUC A;  2VWF A;  2ECZ A;  2CSI A;  4JJC A;  4GBQ A;  3H0I A;  2JM9 A;  2L3S A;  2V1Q A;  1YN8 A;  2JM8 A;  2DBK A;  2E5K A;  1M3A A;  3EG3 A;  1RUW A;  1AEY A;  1HSQ A;  2LP5 A;  2LMJ A;  2CDT A;  1UG1 A;  3I5S A;  4JPB W;  2EYY A;  1AZE A;  2BTT A;  1E6G A;  2C0T A;  1AWW A;  1RLQ C;  1JU5 C;  1Y0M A;  1E6H A;  3GBQ A;  1K4U S;  3PVL A;  2EBP A;  2X3W D;  4E6R A;  4QT7 A;  2DNU A;  3SHW A;  1H92 A;  1PWT A;  3M0T A;  2EYZ A;  2AK5 A;  3PE0 A;  1PKT A;  3LH5 A;  2FPF A;  1IO6 A;  2NWM A;  2J6F A;  2CUB A;  1FMK A;  3H41 A;  1PNJ A;  1WXT A;  3VRZ A;  3M0R A;  2AZV A;  5FWC A;  2KEA A;  2PZ1 A;  1AVZ C;  2FG0 A;  2DM1 A;  3NPF A;  1QKW A;  3I35 A;  5L23 A;  4LUD A;  2O88 A;  3A98 A;  2K79 A;  2KRS A;  2RNA A;  1AOJ A;  4OMM A;  4F16 A;  2EQI A;  1OV3 A;  3TSZ A;  4AFS C;  2KR3 A;  2GTJ A;  4HVW A;  1S1N A;  1AWJ A;  1W6X A;  2K2M A;  2LJ1 A;  2LJ0 A;  1H8K A;  1MV3 A;  1K0S A;  2DBM A;  1B3Q A;  1ZUU A;  1KFZ A;  3NMZ C;  1T3S A;  3R6N A;  3ULR B;  1X2K A;  2VVK A;  1KIK A;  2A37 A;  3REA B;  1XOV A;  1GBR A;  2RPN A;  5IXF A;  1LCK A;  3VS0 A;  2YUN A;  2DF6 A;  1ZUK A;  4CC7 A;  2JXB A;  2CT3 A;  4A63 B;  1AWX A;  1GBQ A;  4AG1 C;  2CH4 W;  1X2Q A;  2J05 A;  2YSQ A;  1OOT A;  4EIK A;  3C0C A;  2L2P A;  1RLP C;  2NUZ A;  2LJ3 A;  2DRM A;  2V1R A;  3VS3 A;  3TSW A;  1AWO A;  2HBW A;  2RQR A;  2MCN A;  1WLP B;  4DEX A;  4HXJ A;  2ESW A;  1JEG A;  1E7O A;  2EW3 A;  2YUO A;  3M0Q A;  1T3L A;  4JZ4 A;  2J6K A;  1M30 A;  2CT4 A;  4WCI A;  4Z8A A;  1GCQ A;  1WFW A;  2K7A A;  1CKA A;  1UHC A;  2DL8 A;  3EGU A;  1NEG A;  2LCS A;  1ZX6 A;  2C0O A;  4M4Z A;  3PVQ A;  4J9E A;  2LNH B;  2G6F X;  1JQQ A;  4GLM A;  4OMP A;  2JMA A;  5GJW B;  1YWO A;  1ARK A;  1OPK A;  4RTZ A;  3U23 A;  2MOX A;  3EHR A;  1N5Z A;  1GCP A;  2EVR A;  2KYB A;  4OMQ A;  3RBB B;  4Y92 A;  1UDL A;  2EGE A;  2CUD A;  2KXC A;  1UTI A;  4JJB A;  2BZY A;  4HVU A;  1G2B A;  1QLY A;  2HSP A;  2QDL A;  2RMO A;  1M8M A;  4IIM A;  1W1F A;  2A08 A;  1I1J A;  1MUZ A;  4AFZ C;  1X6G A;  1I07 A;  3SEM A;  1JXO A;  1WYX A;  4J9C A;  3M0P A;  2DL5 A;  4RTX A;  2AZS A;  2KT8 A;  1NYG A;  1TG0 A;  2J6O A;  2OAW A;  2CH4 A;  1BB9 A;  2EYW A;  2JS0 A;  5IHI A;  1X69 A;  3VRY A;  1QKX A;  2HEQ A;  3M0U A;  2RQW A;  4ORZ A;  1B07 A;  3ZL7 C;  2KNB B;  1JXM A;  3NHN A;  1WXU A;  2A36 A;  4RUG A;  4DEY A;  3EG2 A;  1I0C A;  2O9S A;  1QWE A;  2IIM A;  5I22 A;  3M0S A;  2P4R A;  3UF4 A;  5FW9 A;  2KT1 A;  2LZ6 B;  3UA6 A;  2L0A A;  2RQT A;  4ZNX A;  4LUE A;  3H0H A;  1J3T A;  1KJW A;  2LX7 A;  2ENM A;  3FJ5 A;  2AKL A;  2D0N A;  2FRY A;  2D8H A;  1ZBJ A;  3KFV A;  2GNC A;  1U5S A;  2DIL A;  1Z9Q A;  2YUP A;  1GL5 A;  4RTV A;  2GGR A;  2KRM A;  5IH2 A;  2CSQ A;  1M27 C;  1H3H A;  1FYN A;  1SEM A;  2KRO A;  5EC7 A;  4Z88 A;  4J9D A;  1NLP C;  2AKK A;  2J7I A;  2FEI A;  2KRN A;  4CC3 A;  4CC4 B;  1UFF A;  1BBZ A;  1YNZ A;  3VS4 A;  2O31 A;  1PRL C;  1MV0 B;  1QWF A;  1GFD A;  3CQT A;  1SSH A;  1VA7 A;  4OMO A;  2RF0 A;  2K6D A;  4JZ3 A;  1GFC A;  1NYF A;  1OPL A;  1HJD A;  2DL4 A;  3NGP A;  2EKH A;  2K9G A;  2DYB A;  2ED0 A;  4F14 A;  1ABO A;  2DX1 A;  2FPE A;  1V1C A;  1NM7 A;  4JJD A;  1UJY A;  1PRM C;  1NG2 A;  2JS2 A;  1YCS B;  2PNI A;  2L3P A;  2K3B A;  2JT4 A;  2DMO A;  2LQN A;  2H8H A;  1WA7 A;  2MIO A;  1T0J A;  2CRE A;  3EG0 A;  3H0F A;  2YT6 A;  2LQW A;  3THK A;  4RTU A;  1WXB A;  2I0N A;  2KGT A;  2EPD A;  2BZX A;  1ZSG A;  3QWX X;  1SRM A;  1AZG B;  1NEB A;  5FWB A;  1K76 A;  2GQI A;  4LN2 A;  1BU1 A; 
#chains in the Genus database with same CATH topology
 1D3B A;  1QP2 A;  2O2O A;  3I5R A;  1UEC A;  2X35 A;  1M1F A;  4N0A A;  1WDX A;  1X6B A;  1RAD B;  2BE7 D;  4J9I A;  4PNO A;  1Q7Y C;  1UGP B;  3JCM Q;  3OYC A;  9ATC B;  1XNI A;  3MET A;  5I21 A;  4CC2 A;  1UB4 A;  4LNP A;  3A1P A;  3CCL T;  1YHQ A;  1Q86 R;  3CD6 A;  3I56 T;  1YWP A;  1VQM A;  1YJW Q;  4PFP A;  1WHH A;  3UT1 A;  3CMA A;  5IXB A;  4GLK A;  4VUB A;  2DVJ A;  4M78 A;  4OB1 B;  1U3O A;  2DE0 X;  2V8K A;  2EJF A;  1YIJ T;  1VQ6 Q;  2XDB A;  1VQL T;  2RQU A;  1UE9 A;  4C0D B;  1Q82 R;  2LCL A;  3O5Z A;  3JCM g;  3E1S A;  3L42 A;  5CIU A;  4JDS A;  4C0Z A;  4JUV A;  5GAN e;  1PD1 A;  1M4Z A;  3CCQ Q;  2QEX Q;  1A0N B;  1W70 A;  1M3C A;  1VYV A;  1U06 A;  1YP5 A;  2EYX A;  2B86 A;  5FRM A;  1X43 A;  1RI9 A;  4ELY C;  5GAO n;  2PQW A;  1Z9Z A;  4JLG A;  4JJN K;  4DA4 A;  1VYT A;  1WI7 A;  4TVR A;  4ME7 A;  4J9B A;  2RA2 A;  2M51 A;  1LPL A;  2EFI A;  2XID A;  4MMK A;  2QTV A;  3WXM B;  1NJI R;  2E6N A;  4C0F A;  2SEM A;  1D1C A;  3QWY A;  2OTJ A;  4V2S A;  1UUE A;  3LX7 A;  1WX6 A;  1YI2 A;  4RKU E;  5LJ3 h;  4OML A;  3NTI A;  4LD6 A;  1D1A A;  5GMK j;  4EPC A;  4C5I A;  3QHS A;  2PVO B;  4M75 F;  3PIP A;  2FRW A;  2X4Y A;  4FW1 A;  1KQS P;  4AFU C;  2KI7 A;  1V76 A;  2VKN A;  1TUD A;  1QCF A;  2HDA A;  1C0M A;  1X01 A;  4MDW A;  2EJG A;  3OBW A;  1BKB A;  1G3Y A;  5GAN 7;  1VYU A;  3SWN B;  2HQH A;  4BB7 A;  2JM9 A;  2JM8 A;  1K8A R;  2E5K A;  3P8B B;  2VXF A;  3UWN A;  1M3A A;  3EG3 A;  2LP5 A;  2CDT A;  3A8L B;  5A0D A;  3E2U A;  3M5A A;  5GMK i;  1AZE A;  1AWW A;  1JU5 C;  3GBQ A;  2QA4 A;  1PC0 A;  2EBP A;  3PVL A;  4PLL A;  1RAH B;  4O5V A;  5IAY A;  1YIT T;  4QT7 A;  1BI3 A;  3SHW A;  2QQB A;  5EG2 A;  1U8R A;  4XU1 A;  3MP8 A;  1IO6 A;  2J6F A;  4KGX B;  1FMK A;  1KQ2 A;  3M0R A;  2IVW A;  1N9R A;  2KEA A;  3DB3 A;  2FG0 A;  2QDY B;  2QTX A;  2HD0 A;  5DY9 A;  3I35 A;  4QQG A;  3A98 A;  2K79 A;  1OV3 A;  4AFS C;  2KR3 A;  3CCR T;  1MGQ A;  4HVW A;  1VQ5 T;  1UEB A;  2OAU A;  4FYX B;  1BI0 A;  1H8K A;  1Q86 C;  3VYH B;  2K5F A;  3CME Q;  1T3S A;  2GQV A;  3R6N A;  3OYA A;  4PK4 A;  1H64 1;  4BI8 B;  4ZGE B;  2XDD A;  2A37 A;  3X26 B;  3GP8 A;  3INZ A;  3REA B;  1GBR A;  3JCM f;  4HCZ A;  2YUN A;  1YJN T;  4XAX B;  2FYK A;  2HL3 A;  4KUL A;  1SKU B;  3MPU B;  4M7D C;  3PMT A;  1Q82 C;  4AG1 C;  2CH4 W;  2J05 A;  3PFS A;  4C92 F;  3NTH A;  3P8D A;  2L2P A;  3CBP A;  2HKQ B;  2NUZ A;  2LJ3 A;  3LYI A;  5DLQ E;  4PJJ A;  1I5O B;  3CC2 T;  4M77 F;  3JCM d;  5GAO q;  3P8H A;  1KD1 R;  2BE9 B;  3QPH A;  3EFS A;  4F7U G;  2ESW A;  4F7U B;  1K73 R;  1YBY A;  5LJ5 h;  3TEE A;  3MEW A;  2YUO A;  4JZ4 A;  3L2Z A;  4Z8A A;  4C0D C;  5A0L A;  3ZFJ A;  1NJI C;  2KAF A;  1VQ4 T;  1UGS B;  1D0Y A;  2HZY A;  3L2W A;  1W2B A;  3PVQ A;  3CCS Q;  1JQQ A;  1VQ7 T;  4E47 A;  2CS7 A;  5FRO A;  4RTZ A;  3QII A;  2E65 A;  1N5Z A;  1P92 A;  4EMK A;  4PJO F;  2RHZ A;  2EGE A;  4C5G A;  1MNE A;  2K57 A;  1D1B A;  3O8V A;  2XG8 D;  1W2B S;  2A08 A;  1RAF B;  3OA6 A;  1I1J A;  3G4S Q;  8AT1 B;  4NOY A;  4A4E A;  1NYG A;  3HL8 A;  3RMS A;  1TG0 A;  3HRS A;  3HSB A;  2B8A A;  2J6O A;  1K8A C;  1BB9 A;  2EYW A;  4M75 A;  1X69 A;  4C92 G;  2HEQ A;  4L5G A;  3X28 B;  2RQW A;  2CYZ B;  1EX4 A;  4E7K A;  4PFZ A;  3EG2 A;  4HCC A;  1I0C A;  3C95 A;  5GAN g;  3OYJ A;  1VQ6 T;  3OB9 A;  1OUL A;  3LW5 E;  2OTL Q;  5I22 A;  3M0S A;  3UF4 A;  5FW9 A;  3CCM Q;  2F69 A;  2P4T A;  2FHD A;  2DIG A;  4FU6 A;  4DBQ A;  3MKD A;  4ZNX A;  1TXQ A;  2QEX T;  3CCQ T;  3H0H A;  3GNG A;  2LX7 A;  5KCO A;  3EG9 B;  3EGD B;  5DLO A;  1WQ7 A;  5GAM j;  5LJ3 e;  1Z9Q A;  1XJW B;  2CP2 A;  5AT1 B;  3HRT A;  4DBH A;  5IH2 A;  1VOM A;  4KBM B;  1TTH B;  1M27 C;  3L2Q A;  1SEM A;  2KRO A;  1I5L A;  4J7I A;  3C12 A;  1BIA A;  3I55 A;  4CC4 B;  1YNZ A;  1M2V A;  1QWF A;  2MWP A;  4HT8 A;  4E7H A;  1NYF A;  2LC4 A;  3OSV A;  1HJD A;  4D6W A;  4M78 E;  2DL4 A;  1SG5 A;  3V8J A;  2ED0 A;  1LNX A;  1ABO A;  2DX1 A;  2DAQ A;  3LWH A;  1WHJ A;  1V1C A;  3S3N A;  4YTL A;  3S6W A;  2YHT A;  4JJD A;  1PRM C;  1NG2 A;  4PKC C;  2RB6 A;  3CBM A;  1VQP Q;  4M7A F;  5KYY A;  4M78 D;  2JT4 A;  2O01 E;  1JJ2 A;  2DER A;  3VU3 C;  1KD1 C;  5AYF A;  4C8Q F;  2MIO A;  5GMK l;  1Q81 U;  1X75 C;  3EG0 A;  3EGX B;  3GLX A;  3RDV A;  2LQW A;  4RTU A;  4J6W A;  3CEY A;  4KGV B;  1YJ9 Q;  1ZSG A;  4C92 A;  5C0M A;  1AZG B;  1K73 U;  1OI1 A;  3GF5 A;  3QJ6 A;  3VUB A;  3CCL A;  3CC7 Q;  1WHG A;  3I56 A;  2M0Y A;  3DB4 A;  4M77 A;  2DO3 A;  4HVV A;  5J26 A;  1JJ2 S;  3N5B B;  1MMG A;  1ZQ1 A;  4B6M A;  3IQL A;  3L1A A;  1KC8 U;  2JMC A;  1KSW A;  2R5A A;  1WHK A;  2DL3 A;  5GJV B;  1K1Z A;  2L89 A;  4DQ2 A;  1YIJ A;  3VS5 A;  1VQL A;  3VJP A;  4DBR A;  3E9G A;  4FYY B;  3JCM X;  3UA7 A;  2HKN A;  1I81 A;  4ZN1 A;  2DXB A;  5KYU B;  2XU8 A;  1VQ9 Q;  2LDM A;  1IHV A;  3PIO A;  1SPK A;  2RM4 A;  2H3E B;  1QP3 A;  4MML A;  1RL2 A;  4Z89 A;  2DRK A;  2RHI A;  4ESR A;  2RN8 A;  4DOW A;  5CQX A;  3OS2 A;  3R6O A;  5CKH A;  2QQ9 A;  3G7Z A;  3CC4 Q;  4PJO A;  2MMP A;  2YUQ A;  3CME T;  3HPW A;  3LLR A;  3HRU A;  1IRX A;  5I11 A;  3GIB A;  5FLX E;  3VS7 A;  4A4H A;  5LJ5 e;  4CI0 C;  4C8Q G;  4BAC A;  4LDU A;  2L8D A;  3UPU A;  4D8K A;  5J3B A;  1K9A A;  5GAM f;  2JNG A;  1HD3 A;  4KRT A;  3ME9 A;  4OF1 A;  3MHX A;  1WNL A;  5KYW A;  3EHQ A;  2D0Q B;  5GAN d;  3CMA Q;  5GAN 4;  2RHX A;  5CR2 A;  2JVV A;  2HSE B;  2EYQ A;  4ZTF A;  5D6Y A;  3MO8 A;  1D0Z A;  3RNJ A;  1C1A A;  1UGR B;  4AG2 C;  2C0I A;  2FZG B;  1WZO A;  3FIF A;  2YRC A;  2Y4X A;  2J06 A;  2ROT A;  4PL6 A;  5HK0 A;  4LE9 A;  4MZT A;  1VQ8 T;  2DD5 A;  2KE9 A;  2L3Q A;  2OJ2 A;  3TVT A;  4JRK A;  1FXX A;  1OEB A;  2PUO B;  2K3X A;  1WJS A;  2EGC A;  3VS1 A;  1W4S A;  3EAE A;  3JV3 A;  2RK1 A;  3CCS T;  3G1J A;  2GTO A;  2CZ1 B;  4J9F A;  1YIT A;  8ATC B;  1TOV A;  2RJF A;  2DYI A;  2GBQ A;  2F2V A;  5I2M A;  3OW2 A;  3RUX A;  2CSI A;  4JJC A;  2RI3 A;  3CPF A;  4WTO B;  4KUD K;  2DBK A;  2OTJ Q;  3QUI A;  1AEY A;  3G4S T;  4M7D G;  4M7D B;  4OGE A;  4JPB W;  2EYY A;  3A5Z B;  1E6G A;  3OSS C;  3QZ5 B;  3CCR A;  1K4U S;  1S72 T;  2X3W D;  1VQ5 A;  2DNU A;  2F1L A;  3OW2 S;  3PE0 A;  4M7A A;  2LT4 A;  4XK8 E;  5A2Q E;  2FPF A;  5GAO r;  3JB9 H;  2DZC A;  3VUZ A;  1ZA1 B;  3C4S A;  2NWM A;  4LD9 K;  4C8Q A;  2DD4 A;  2COY A;  5GAN 3;  1WXT A;  2D9T A;  1QCO A;  3CCV Q;  1YJN A;  2AZV A;  3QXE B;  2PZ1 A;  2OTL T;  1N6A A;  1QKW A;  3CCM T;  5LJ3 g;  2KRS A;  4F16 A;  1QVG A;  2LX9 A;  3L2U A;  1S1N A;  1AWJ A;  2K2M A;  2LJ0 A;  3PGG A;  1M90 U;  4JS5 A;  2DBM A;  3OYY A;  3NMZ C;  3G6E T;  3CC2 A;  3RER A;  1ZSZ C;  5IXF A;  1LCK A;  2DF6 A;  1ZUK A;  4X34 A;  2VGN A;  3S3M A;  2KQW A;  2QYZ A;  1EZZ B;  2F5T X;  1MMD A;  3L2V A;  1AWX A;  3SFM A;  1QVG S;  4M75 E;  2E70 A;  1G3T A;  1X2Q A;  2YSQ A;  1VQ4 A;  4QQD A;  4J6Y A;  2NUT A;  1OOT A;  4EIK A;  3OYH A;  3EFO A;  1X6O A;  1V29 B;  2K3Y A;  1WHM A;  4OP0 A;  2V1R A;  1AWO A;  1YFN A;  1G3S A;  1VQ7 A;  2EKO A;  2RQR A;  1WLP B;  3KXT A;  4M75 D;  4DEX A;  5KYX B;  2EW3 A;  1XTD A;  2FZK B;  5FU6 C;  4AT1 B;  3OYD A;  4FT4 A;  4IUR A;  2CT4 A;  4WCI A;  1IXD A;  2HL5 C;  1GCQ A;  1WFW A;  2DVE A;  2DL8 A;  3EGU A;  4XTZ A;  1QW1 A;  3H8Z A;  5D7U A;  1NEG A;  3Q1J A;  4A4F A;  2ZPF B;  2A3L A;  1YJ9 T;  1BI2 A;  4J9E A;  1NPR A;  4KUI A;  5CKF A;  4KT0 E;  4UC4 A;  2XK0 A;  3S3O A;  1PG5 B;  4OMP A;  3CC7 T;  2CP6 A;  2BIV A;  1OPK A;  3M58 A;  1C6V X;  3U23 A;  2MOX A;  4CRI A;  2EVR A;  4PLI A;  4OMQ A;  3RBB B;  1UDL A;  2CUD A;  4JJB A;  2BZY A;  1W2B P;  1K9M U;  1JRI A;  1VQ6 A;  4M78 C;  4F7U F;  1W1F A;  3AT1 B;  5KYN A;  1MUZ A;  1RAG B;  4AFZ C;  4XU3 A;  3ASK A;  1JXO A;  4J9C A;  3M0P A;  2ATC B;  2XHC A;  3OYE A;  3OYL A;  3CCQ A;  2QEX A;  3VRY A;  3F70 A;  2QXF A;  1VQ9 T;  3TQ7 P;  1NE8 A;  4ELZ C;  4ORZ A;  1B07 A;  3ZL7 C;  4RCC A;  4XTX A;  1JXM A;  3NHN A;  3LGF A;  5J39 A;  3PT9 A;  3URG A;  3JB9 F;  2O9S A;  3CC4 T;  2YXY A;  2CP0 A;  3J7A F;  4C92 E;  5LJ5 g;  1NZ9 A;  3RKY A;  1UGQ B;  3SDZ A;  2KT1 A;  2LZ6 B;  3UA6 A;  2L0A A;  2ZGW A;  4M77 E;  2RQT A;  2V8J A;  2LVM A;  3HTR A;  1KJW A;  4XQ3 A;  3CCJ Q;  2D0N A;  2ZPH B;  4N4G A;  2GNC A;  3OYF A;  2DIL A;  3OMC A;  1BCO A;  1Y96 B;  3NFC A;  2CSQ A;  3RES A;  4J9D A;  2MYS A;  4II1 A;  2FEI A;  2LCC A;  4KH0 B;  4M77 D;  1R0C B;  4C0G A;  3CXC A;  1LJO A;  1BBZ A;  3BFM A;  1PRL C;  1Q81 R;  1MV0 B;  5DM7 R;  2RF0 A;  4JZ3 A;  4QW2 A;  3SWN A;  2WSC E;  5KCH A;  4IUV A;  1OZ3 A;  2MPX C;  3H6Z A;  2QAS A;  2R58 A;  2EKH A;  4E7L A;  2DYB A;  5CK9 A;  4E7I A;  3EH2 A;  4PJO E;  3CCE Q;  2LTO A;  3H9N A;  3QG1 A;  3QJY A;  2E1H A;  1NM7 A;  3C94 A;  3HP9 A;  1UJY A;  4J7F A;  3CXC S;  1SF9 A;  1KC8 R;  2WSE E;  4ZTJ A;  2QG9 B;  4Q5W A;  2PNI A;  4QVC A;  3JSC A;  4QQ6 A;  2LQN A;  2CP5 A;  5C6S A;  2H8H A;  6AT1 B;  1T0J A;  4J8O A;  1VQK Q;  3G71 Q;  4PJO D;  3JB9 G;  4XTV A;  3SB2 A;  3FRN A;  3X25 B;  4N4I A;  4QVD A;  1VIF A;  5GAO m;  1M1G A;  2I0N A;  4Y91 A;  2EPD A;  4BE1 A;  2OX7 A;  3QWX X;  3WVE B;  1SRM A;  1NEB A;  4HCB A;  2YLB A;  2GQI A;  1WQW A;  3HHT B;  4A4K A;  1BU1 A;  3TRE A;  1JJ2 P;  2M1H A;  2JW4 A;  1PKS A;  1MHN A;  1K0X A;  1LOJ A;  1GRI A;  4FSX A;  3CCU Q;  4J83 A;  5M9O A;  1EFN A;  2L5Q A;  3E9F A;  1ZUY A;  3CME A;  1YJW T;  2GFA A;  2KDS A;  2DXC A;  5CQY A;  1YCY A;  2BKD N;  3CCV T;  4FCY A;  4IIO A;  4FSS A;  2E3I A;  4HT9 A;  4RTT A;  2A28 A;  5GAN j;  4R0K A;  2F2W A;  2JJ9 A;  1MND A;  1IHW A;  2HMA A;  4R56 A;  4JRP A;  3I56 Q;  1TUG B;  1MMA A;  3BDU A;  4ZN3 A;  2HAX A;  4IUU A;  2ZPG B;  2MWO A;  2EGA A;  3ZBD A;  3FEO A;  3QSU A;  1HXD A;  3QKJ A;  1AD5 A;  3OS5 A;  1M1K U;  2HQX A;  2O9V A;  4OB2 B;  2DJQ A;  4F7U A;  1B34 B;  1T0H A;  4B9X A;  2JUF A;  2DLP A;  3REB B;  2W0Z A;  3A8M B;  1UJ0 A;  2SRC A;  1WJQ A;  4O6J A;  1VQ8 A;  1M3B A;  4BE0 A;  2DFU A;  1R0B G;  4J9G A;  5CKD A;  2AHJ B;  1BCM A;  2LNV A;  4J9H A;  4M7A E;  3FC3 A;  1QMC A;  1BK2 A;  4A53 A;  3JCM e;  1Y57 A;  4C8Q E;  2DA9 A;  1KHI A;  3CCS A;  3EG1 A;  2PTK A;  1TWB A;  1JBM A;  3L2R A;  4EMH A;  2I2L A;  4DOV A;  1R8O B;  3OYG A;  1ZA2 B;  1SHF A;  1NBE B;  2MAM A;  2QAZ A;  2X3X D;  4J6X A;  4M7A D;  2YDL A;  4BDY A;  4C8Q D;  4K11 A;  3V7R A;  4JRQ A;  4PJM A;  3M54 A;  4BDZ A;  2O4X B;  2RK2 A;  3G4S A;  4BI4 A;  2A0F B;  4C5E A;  1OX9 A;  3FJP A;  1K73 C;  1VQN Q;  2OI3 A;  2K5I A;  2NUP B;  5HCK A;  3OYB A;  1R77 A;  2JTE A;  5GAM h;  3LH0 A;  3X24 B;  1S72 A;  4OMF B;  2QQR A;  3A8G B;  5D6W A;  2JN0 A;  5GMK e;  2DXT A;  4M75 C;  2ECZ A;  2FL7 A;  2JOY A;  4GBQ A;  4BD3 A;  1ZSZ B;  1YN8 A;  1EIF A;  3D7S B;  1RUW A;  2LMJ A;  2OTL A;  1VQO Q;  3I5S A;  3CCM A;  2BTT A;  1RLQ C;  1Y0M A;  1M90 R;  4R55 A;  2ZAE A;  3OW2 P;  3EG9 A;  3EGD A;  4JS4 A;  2CZ0 B;  1PWT A;  2XI9 A;  2AK5 A;  4LDW A;  3LH5 A;  3G6E A;  4C5H A;  5HY6 A;  1VIE A;  1MMN A;  2DEU A;  1PNJ A;  1HYO A;  2XD0 A;  1QVF A;  4WF2 A;  3OYN A;  5FWC A;  1AVZ C;  2RI2 A;  5CKE A;  2DM1 A;  5FU6 B;  3NPF A;  1RAE B;  4XTW A;  1D3B B;  4LUD A;  5KE2 A;  1B7T A;  5GAN f;  2EQI A;  3M4G A;  1W6X A;  1BYM A;  1MV3 A;  1B3Q A;  3CCJ T;  3FDR A;  1ZUU A;  4M7D F;  4LDV A;  3RKW A;  3ULR B;  3PNW C;  2D6F A;  1KIK A;  1VQ5 Q;  5IN1 A;  4LDX A;  1QVF S;  1OQK A;  3VS0 A;  1YHQ Q;  3CD6 Q;  3RMQ A;  3CPW A;  1VQM Q;  1QVG P;  4JRI A;  4BY6 C;  2JXB A;  2DET A;  1BI1 A;  1BIB A;  3OMG A;  2WSF E;  2CZ6 B;  1M9S A;  3EGX A;  4M78 G;  4M78 B;  4X9C A;  3C0C A;  2DKG A;  1YJ9 A;  3VS3 A;  3TSW A;  1AHJ B;  2HBW A;  2RJD A;  2GF7 A;  3CCE T;  2MCN A;  3CPW S;  1Q95 G;  2IG0 A;  3CC7 A;  4HXJ A;  2ZPB B;  1E7O A;  3M0Q A;  4RG2 A;  3CC2 Q;  2X4X A;  1K9M R;  1Y71 A;  2Y90 A;  2AT1 B;  3A8O B;  4M77 C;  2K7A A;  1UHC A;  3HFN A;  3QO3 A;  3VYG A;  1VQK T;  4EDU A;  3G71 T;  2A7Y A;  2LCS A;  2P0P A;  2C0O A;  4M4Z A;  1RI0 A;  3PTA A;  4BUG A;  3QZ9 B;  4GLM A;  5KYU A;  5HKC A;  3M56 A;  5GJW B;  3EH1 A;  1YWO A;  1I8F A;  4F04 B;  3PMI A;  1ARK A;  5GAO p;  2P0K A;  1VQ9 A;  4A4G A;  4JLI A;  3EHR A;  2KYB A;  1YI2 Q;  1IRE B;  4PFO A;  1UTI A;  3JCM P;  3CCU T;  4HVU A;  1G2B A;  1QLY A;  2VB6 A;  2HSP A;  2VC8 A;  1KHC A;  1N8R U;  3CC4 A;  1X6G A;  4FYV B;  1I07 A;  1WYX A;  2Z0W A;  2DL5 A;  1WHL A;  1IZ6 A;  4HA8 A;  2AZS A;  4PJO C;  1NPP A;  2OAW A;  2CH4 A;  2JS0 A;  2RH2 A;  1FMV A;  2G3R A;  2VV5 A;  1QKX A;  3EFR A;  4B9W A;  1ACM B;  3QDR B;  4EMG A;  1Q7Y U;  2COZ A;  5CO7 A;  1QQJ A;  3JCM V;  5I2S A;  1WGS A;  2KNB B;  1PM3 A;  1WXU A;  4RUG A;  4ZGD B;  1M90 C;  1U1S A;  4XTU A;  5LJ3 j;  2RHY A;  4QKU A;  3BE3 A;  2MI6 A;  4P5N A;  2P4R A;  1PD0 A;  3TCJ A;  1GXI E;  1M2O A;  3M53 A;  2QA4 Q;  2E41 A;  2ENM A;  1DJ7 B;  3FJ5 A;  3SD4 A;  3VKI A;  2AKL A;  2FRY A;  2V26 A;  1ZBJ A;  3KFV A;  2DXU A;  2ZPE B;  2YUP A;  1GL5 A;  2ZPI B;  3M4Y A;  2KRM A;  2P0Q A;  4N4H A;  1H3H A;  1FYN A;  2EWN A;  2AKK A;  2J7I A;  2PVG B;  2RO0 A;  2AIR B;  3BDL A;  2QQA A;  2KRN A;  3MJX A;  3VS4 A;  2E12 A;  2EQU A;  5GAM e;  3CQT A;  1VA7 A;  4OMO A;  2K6D A;  2NYS A;  4KH1 B;  4L59 A;  3NGP A;  3JCM b;  2PVD B;  3OS0 A;  2M02 A;  2KMT A;  4F14 A;  1VQP T;  2FPE A;  3V7S A;  2DPP B;  2KK4 A;  3CXC P;  4M7D A;  4OVA A;  1U1T A;  5GAN 6;  1TSF A;  4N0A C;  2EJ9 A;  3DLL A;  4F7U E;  1OX8 A;  2JS2 A;  1VQN T;  3JCM h;  3QDF A;  2JZ2 A;  2DMO A;  3WVD B;  1PCX A;  3HKS A;  3CBO A;  2DTO A;  2KSS A;  2VGM A;  1TS9 A;  2GCX A;  2CRE A;  3H0F A;  2YT6 A;  4FIB A;  3V8K A;  3THK A;  3V8L A;  1KG1 A;  1YJW A;  4FYW B;  2C06 A;  2EAY A;  2BZX A;  2HQE A;  4XTY A;  1K9M C;  4E7Z A;  3E19 A;  4M7A C;  2CP7 A;  5CKB A;  5GAN 8;  5FWB A;  1K76 A;  3CCV A;  5GAN 5;  2YRD A;  4C8Q C;  2KYM A;  3DLM A;  2M9U A;  1VQO T;  5GAO l;  4HCK A;  3MEV A;  4RTY A;  2QI2 A;  5FU7 C;  1SRL A;  1CSK A;  1XQH A;  1QVP A;  2KBT A;  1ABQ A;  2W10 A;  3MP6 A;  2DTH A;  1NLO C;  4MDX A;  3GPL A;  1M1K R;  2RD1 A;  1UHF A;  2FO0 A;  4RTW A;  2MK5 A;  4X9D A;  1X27 A;  2DIQ A;  1HK9 A;  1TU0 B;  5GMK h;  3JB9 D;  2X9H A;  3BY7 A;  1CKB A;  1RAC B;  2D1X A;  2R57 A;  3VS2 A;  2YRV A;  2VYT A;  3UAT A;  4NL2 A;  2ROL A;  5LJ5 j;  2RJE A;  1UGV A;  4EMK B;  4ATO A;  3OY9 A;  2M16 A;  4OGC A;  1ZLM A;  3VS6 A;  1RAI B;  5LJ3 f;  1N27 A;  1G83 A;  2XDP A;  2CKK A;  2DL7 A;  3V7C A;  3M57 A;  3RIR A;  4C92 D;  1OZ2 A;  4AFQ C;  5KYX A;  1ZBX A;  1YHQ T;  3CD6 T;  1IB8 A;  1VQM T;  4X1V A;  4F17 A;  2ED1 A;  2F2X A;  2BZ8 A;  3CMA T;  2RJC A;  4M75 G;  1SHG A;  4M75 B;  1Q86 U;  2XMF A;  2EIF A;  2X4W A;  5IHN A;  3OYI A;  1OYX A;  5LJ3 d;  2FPD A;  4D8D A;  1GCQ C;  4XU2 A;  3I9Q A;  5GAN 2;  2XKO C;  2YWW A;  3RR6 A;  3QYH B;  1QCN A;  1Q82 U;  1G5V A;  1JO8 A;  3KBG A;  1WIE A;  1PHT A;  3VV0 A;  1KQS A;  2P84 A;  5IHK A;  2E10 A;  4FL6 A;  4DBF A;  4LXC A;  4RG8 A;  2CP3 A;  2HCK A;  2QGF B;  2D8J A;  2DEQ A;  2BUD A;  2RI5 A;  2F5K A;  5HK3 A;  2M0O A;  4NL3 A;  2LQK A;  2ABL A;  4GY5 A;  1F1B B;  2RHU A;  2QK0 A;  5ECA A;  2IPO B;  1VQ8 Q;  1O75 A;  3I55 Q;  2KXD A;  2QGG A;  2E5Q A;  1M8V A;  1KQS S;  3JRZ A;  2OTJ T;  1WJR A;  1G8X A;  1M2V B;  1NJI U;  2RQV A;  4OMN A;  1TUC A;  1YI2 T;  3FLG A;  2VWF A;  2NLU A;  2X51 A;  1WPY A;  3OBY A;  3ZEH A;  4RCB A;  3H0I A;  2VUB A;  2L3S A;  2V1Q A;  1TH7 A;  1HSQ A;  3A8H B;  5D6X A;  2QQS A;  5L8R E;  4BY6 B;  1UG1 A;  4IUT A;  3JCM c;  2JTF A;  2KVQ G;  2C0T A;  1H3Z A;  1E6H A;  3MP1 A;  1OU9 A;  5KYY B;  4E6R A;  1IGU A;  2DK3 A;  1H92 A;  1OU8 A;  4MZP A;  1D09 B;  2R5M A;  3M0T A;  3CCJ A;  2EYZ A;  1PKT A;  1Y96 A;  4OB0 B;  4HKE A;  4ANJ A;  1KK7 A;  3JCM J;  3BW1 A;  2CUB A;  4IUP A;  1S72 Q;  3H41 A;  4FW2 A;  3JCM W;  4C92 B;  3VRZ A;  3T9N A;  3CCL Q;  2WAC A;  1FWZ A;  1K8A U;  3AHU A;  1M1K C;  4E2F B;  5FRN A;  4PJN A;  5L23 A;  3J81 E;  2JTM A;  2O88 A;  4M77 G;  4M77 B;  2RNA A;  1AOJ A;  4OMM A;  2X4J A;  3TSZ A;  4IKF A;  2GTJ A;  1ZHI A;  2QA4 T;  2YLC A;  5LJ5 f;  2LJ1 A;  1K0S A;  1O9S A;  1YIJ Q;  4KGZ B;  2COW A;  1VQL Q;  1KFZ A;  1QVF P;  3SWN C;  4MZM A;  1X2K A;  2ZZD A;  2VVK A;  5GAM g;  4FM4 B;  1XOV A;  2RPN A;  3OQ5 A;  5CVI A;  3CCE A;  4CC7 A;  3G6E Q;  2CT3 A;  4A63 B;  4AMC A;  1GBQ A;  2E64 A;  5LJ5 d;  2XIC A;  3QYG B;  4E7S A;  3DKM A;  4QVZ A;  3M55 A;  2Y4Y A;  1VQK A;  5KE3 A;  3G71 A;  1RLP C;  1Y07 A;  2DRM A;  3JAM E;  4PJO G;  4PJO B;  5LL6 S;  2DJZ A;  3CPW P;  1FX7 A;  1PSF A;  5GAN h;  1Q81 C;  4EMK C;  1JEG A;  1T3L A;  2K5L A;  2V8I A;  4A54 A;  2PUK B;  2J6K A;  1M30 A;  1N8R R;  3CCU A;  1CKA A;  4J5Y A;  3FB9 A;  2E6Z A;  4Z02 A;  5KYW B;  1ZX6 A;  3TU4 K;  2LNH B;  2LT1 A;  2G6F X;  3QBY A;  1KC8 C;  3OYM A;  2JMA A;  1Q7Y R;  1RAB B;  2ZCF B;  4M78 F;  1KD1 U;  3NTK A;  3UDC A;  1GCP A;  3OS1 A;  4Y92 A;  2KXC A;  2LQ8 A;  1PSE A;  3M59 A;  2E3H A;  2QDL A;  1G3W A;  2RMO A;  1M8M A;  4IIM A;  1VUB A;  2VAS A;  5KH6 A;  1AT1 B;  4LDY A;  3SEM A;  1B34 A;  4M7D E;  4RTX A;  1D0X A;  3OYK A;  1M5Q 1;  2KT8 A;  5IHI A;  1YIT Q;  2HBP A;  2EQJ A;  1RAA B;  3M0U A;  2MF2 A;  1FMW A;  2A36 A;  4DEY A;  3J80 E;  4M7D D;  2L3R A;  1QWE A;  3MEA A;  2IIM A;  4ZGJ B;  1IGQ A;  5IT9 E;  2FZC B;  3CCR Q;  3GOX A;  2LRQ A;  4LUE A;  1J3T A;  2D8H A;  2CGH A;  1KQ1 A;  4L6V 5;  4BE2 A;  1U5S A;  4M7A G;  4M7A B;  4RTV A;  2GGR A;  1LVK A;  1VQP A;  4NS5 A;  2O4X A;  5EC7 A;  4Z88 A;  4C8Q B;  1NLP C;  2H3J A;  1YJN Q;  3ER0 A;  2E4H A;  2NUP A;  4CC3 A;  1VQN A;  5FU7 B;  1UFF A;  2O31 A;  4Y28 E;  1GFD A;  4E7J A;  1SSH A;  4PJL A;  3GNF B;  3LWI A;  1GFC A;  2FVU A;  2K4Y A;  1OPL A;  2DTI A;  4OB3 B;  3JB9 I;  4C92 C;  2DZ9 A;  1ZSZ A;  2K9G A;  2GFU A;  3KUF A;  5CCA A;  5GAM d;  3HFO A;  3RKX A;  4RMO A;  3MEU A;  5A0G A;  1Y7X A;  2EQM A;  5GMK m;  5CAI A;  1VQO A;  1YCS B;  1SSF A;  3I55 T;  7AT1 B;  3M9Q A;  2K3B A;  2L3P A;  3MCA B;  4BI3 A;  2CZ7 B;  2VXE A;  1VQ4 Q;  1WA7 A;  4XU0 A;  4FT2 A;  2FB7 A;  2NUT B;  3X20 B;  1WXB A;  2PU9 B;  3EFO B;  3LGL A;  2KGT A;  1I4K 1;  2HNI A;  1VQ7 Q;  1N8R C;  1JB0 E;  1N9S A;  4IUQ A;  2EQK A;  4LN2 A;  3JB9 J;  2K2V A;  2KY9 A; 
#chains in the Genus database with same CATH homology
 2M0Y A;  2KYM A;  4HVV A;  2JW4 A;  4HCK A;  1PKS A;  2O2O A;  3I5R A;  1K0X A;  1UEC A;  4RTY A;  1GRI A;  1WDX A;  1SRL A;  1CSK A;  1X6B A;  2KBT A;  2W10 A;  1ABQ A;  3IQL A;  2JMC A;  1KSW A;  4J9I A;  1NLO C;  2DL3 A;  1EFN A;  5GJV B;  1K1Z A;  3VS5 A;  1ZUY A;  1UHF A;  2FO0 A;  4RTW A;  1X27 A;  4CC2 A;  3UA7 A;  4LNP A;  4IIO A;  1CKB A;  4FSS A;  1YWP A;  2D1X A;  1SPK A;  4RTT A;  3VS2 A;  5IXB A;  2A28 A;  4R0K A;  2F2W A;  3UAT A;  2ROL A;  2DVJ A;  4Z89 A;  2DRK A;  1UGV A;  4ESR A;  1U3O A;  2DE0 X;  2RN8 A;  2RQU A;  1ZLM A;  1UE9 A;  2EGA A;  2YUQ A;  3VS6 A;  1G83 A;  1AD5 A;  3O5Z A;  2DL7 A;  5I11 A;  2O9V A;  2DJQ A;  1T0H A;  3VS7 A;  4AFQ C;  2DLP A;  3REB B;  4X1V A;  4F17 A;  2ED1 A;  2F2X A;  2BZ8 A;  2W0Z A;  1A0N B;  1UJ0 A;  1W70 A;  2SRC A;  1M3C A;  1VYV A;  1SHG A;  4D8K A;  2XMF A;  1U06 A;  1YP5 A;  1K9A A;  1M3B A;  4KRT A;  1HD3 A;  4J9G A;  2EYX A;  2B86 A;  1X43 A;  5IHN A;  4J9H A;  1RI9 A;  1Z9Z A;  2FPD A;  3EHQ A;  1VYT A;  1BK2 A;  1WI7 A;  1GCQ C;  4D8D A;  1Y57 A;  4J9B A;  3I9Q A;  2DA9 A;  2M51 A;  3EG1 A;  2PTK A;  3RNJ A;  2SEM A;  1JO8 A;  3QWY A;  4AG2 C;  2C0I A;  1WIE A;  1PHT A;  2J06 A;  1SHF A;  2ROT A;  1UUE A;  2X3X D;  4LE9 A;  5IHK A;  1WX6 A;  2HCK A;  2YDL A;  2D8J A;  2KE9 A;  2L3Q A;  2OJ2 A;  4OML A;  3TVT A;  4K11 A;  1OEB A;  2ABL A;  2EGC A;  3VS1 A;  5ECA A;  3JV3 A;  2FRW A;  2OI3 A;  4AFU C;  2KXD A;  5HCK A;  2GTO A;  2JTE A;  2VKN A;  1TUD A;  1QCF A;  2HDA A;  4J9F A;  2RQV A;  4OMN A;  2GBQ A;  2F2V A;  1VYU A;  1TUC A;  2VWF A;  2ECZ A;  2CSI A;  4JJC A;  4GBQ A;  3H0I A;  2JM9 A;  2L3S A;  2V1Q A;  1YN8 A;  2JM8 A;  2DBK A;  2E5K A;  1M3A A;  3EG3 A;  1RUW A;  1AEY A;  1HSQ A;  2LP5 A;  2LMJ A;  2CDT A;  1UG1 A;  3I5S A;  4JPB W;  2EYY A;  1AZE A;  2BTT A;  1E6G A;  2C0T A;  1AWW A;  1RLQ C;  1JU5 C;  1Y0M A;  1E6H A;  3GBQ A;  1K4U S;  3PVL A;  2EBP A;  2X3W D;  4E6R A;  4QT7 A;  2DNU A;  3SHW A;  1H92 A;  1PWT A;  3M0T A;  2EYZ A;  2AK5 A;  3PE0 A;  1PKT A;  3LH5 A;  2FPF A;  1IO6 A;  2NWM A;  2J6F A;  2CUB A;  1FMK A;  3H41 A;  1PNJ A;  1WXT A;  3VRZ A;  3M0R A;  2AZV A;  5FWC A;  2KEA A;  2PZ1 A;  1AVZ C;  2FG0 A;  2DM1 A;  3NPF A;  1QKW A;  3I35 A;  5L23 A;  4LUD A;  2O88 A;  3A98 A;  2K79 A;  2KRS A;  2RNA A;  1AOJ A;  4OMM A;  4F16 A;  2EQI A;  1OV3 A;  3TSZ A;  4AFS C;  2KR3 A;  2GTJ A;  4HVW A;  1S1N A;  1AWJ A;  1W6X A;  2K2M A;  2LJ1 A;  2LJ0 A;  1H8K A;  1MV3 A;  1K0S A;  2DBM A;  1B3Q A;  1ZUU A;  1KFZ A;  3NMZ C;  1T3S A;  3R6N A;  3ULR B;  1X2K A;  2VVK A;  1KIK A;  2A37 A;  3REA B;  1XOV A;  1GBR A;  2RPN A;  5IXF A;  1LCK A;  3VS0 A;  2YUN A;  2DF6 A;  1ZUK A;  4CC7 A;  2JXB A;  2CT3 A;  4A63 B;  1AWX A;  1GBQ A;  4AG1 C;  2CH4 W;  1X2Q A;  2J05 A;  2YSQ A;  1OOT A;  4EIK A;  3C0C A;  2L2P A;  1RLP C;  2NUZ A;  2LJ3 A;  2DRM A;  2V1R A;  3VS3 A;  3TSW A;  1AWO A;  2HBW A;  2RQR A;  2MCN A;  1WLP B;  4DEX A;  4HXJ A;  2ESW A;  1JEG A;  1E7O A;  2EW3 A;  2YUO A;  3M0Q A;  1T3L A;  4JZ4 A;  2J6K A;  1M30 A;  2CT4 A;  4WCI A;  4Z8A A;  1GCQ A;  1WFW A;  2K7A A;  1CKA A;  1UHC A;  2DL8 A;  3EGU A;  1NEG A;  2LCS A;  1ZX6 A;  2C0O A;  4M4Z A;  3PVQ A;  4J9E A;  2LNH B;  2G6F X;  1JQQ A;  4GLM A;  4OMP A;  2JMA A;  5GJW B;  1YWO A;  1ARK A;  1OPK A;  4RTZ A;  3U23 A;  2MOX A;  3EHR A;  1N5Z A;  1GCP A;  2EVR A;  2KYB A;  4OMQ A;  3RBB B;  4Y92 A;  1UDL A;  2EGE A;  2CUD A;  2KXC A;  1UTI A;  4JJB A;  2BZY A;  4HVU A;  1G2B A;  1QLY A;  2HSP A;  2QDL A;  2RMO A;  1M8M A;  4IIM A;  1W1F A;  2A08 A;  1I1J A;  1MUZ A;  4AFZ C;  1X6G A;  1I07 A;  3SEM A;  1JXO A;  1WYX A;  4J9C A;  3M0P A;  2DL5 A;  4RTX A;  2AZS A;  2KT8 A;  1NYG A;  1TG0 A;  2J6O A;  2OAW A;  2CH4 A;  1BB9 A;  2EYW A;  2JS0 A;  5IHI A;  1X69 A;  3VRY A;  1QKX A;  2HEQ A;  3M0U A;  2RQW A;  4ORZ A;  1B07 A;  3ZL7 C;  2KNB B;  1JXM A;  3NHN A;  1WXU A;  2A36 A;  4RUG A;  4DEY A;  3EG2 A;  1I0C A;  2O9S A;  1QWE A;  2IIM A;  5I22 A;  3M0S A;  2P4R A;  3UF4 A;  5FW9 A;  2KT1 A;  2LZ6 B;  3UA6 A;  2L0A A;  2RQT A;  4ZNX A;  4LUE A;  3H0H A;  1J3T A;  1KJW A;  2LX7 A;  2ENM A;  3FJ5 A;  2AKL A;  2D0N A;  2FRY A;  2D8H A;  1ZBJ A;  3KFV A;  2GNC A;  1U5S A;  2DIL A;  1Z9Q A;  2YUP A;  1GL5 A;  4RTV A;  2GGR A;  2KRM A;  5IH2 A;  2CSQ A;  1M27 C;  1H3H A;  1FYN A;  1SEM A;  2KRO A;  5EC7 A;  4Z88 A;  4J9D A;  1NLP C;  2AKK A;  2J7I A;  2FEI A;  2KRN A;  4CC3 A;  4CC4 B;  1UFF A;  1BBZ A;  1YNZ A;  3VS4 A;  2O31 A;  1PRL C;  1MV0 B;  1QWF A;  1GFD A;  3CQT A;  1SSH A;  1VA7 A;  4OMO A;  2RF0 A;  2K6D A;  4JZ3 A;  1GFC A;  1NYF A;  1OPL A;  1HJD A;  2DL4 A;  3NGP A;  2EKH A;  2K9G A;  2DYB A;  2ED0 A;  4F14 A;  1ABO A;  2DX1 A;  2FPE A;  1V1C A;  1NM7 A;  4JJD A;  1UJY A;  1PRM C;  1NG2 A;  2JS2 A;  1YCS B;  2PNI A;  2L3P A;  2K3B A;  2JT4 A;  2DMO A;  2LQN A;  2H8H A;  1WA7 A;  2MIO A;  1T0J A;  2CRE A;  3EG0 A;  3H0F A;  2YT6 A;  2LQW A;  3THK A;  4RTU A;  1WXB A;  2I0N A;  2KGT A;  2EPD A;  2BZX A;  1ZSG A;  3QWX X;  1SRM A;  1AZG B;  1NEB A;  5FWB A;  1K76 A;  2GQI A;  4LN2 A;  1BU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...