1W1FA

Sh3 domain of human lyn tyrosine kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
b'QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN KINASE LYN
molecule tags Sh3-domain
source organism Homo sapiens
publication title Structural Characterization of Lyn-SH3 Domain in Complex with a Herpesviral Protein Reveals an Extended Recognition Motif that Enhances Binding Affinity.
pubmed doi rcsb
total genus 8
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w1fA00
3EG2A 2AZSA 2O31A 1AWJA 2DYBA 2LP5A 3UA7A 1CSKA 1Z9ZA 2DNUA 4HXJA 2DL4A 1MUZA 3IQLA 4D8KA 4DEXA 4M4ZA 2KRNA 2PTKA 5FWBA 2HCKA 5IHIA 1AD5A 1WFWA 2JW4A 1H3HA 1WXTA 1WDXA 2EGEA 1OPLA 2CDTA 1QCFA 2E5KA 1CKBA 2SEMA 2HBWA 2KEAA 1BBZA 2JM8A 1UHFA 2BTTA 3EG0A 2J6KA 3JV3A 2C0IA 1TUCA 1Z9QA 4K11A 5FW9A 1WLPB 3I5SA 1UG1A 2LX7A 4CC2A 2BZXA 1GRIA 4JZ3A 4D8DA 4JJBA 1B07A 1BB9A 2EGAA 4LUEA 5L23A 2K9GA 2VWFA 3SEMA 4RTVA 2KNBB 2LZ6B 1ABQA 1AOJA 1T3SA 2CREA 2FPFA 1QLYA 2K2MA 4OMMA 2DL8A 4J9HA 2L0AA 2LNHB 1PWTA 2DBKA 2EYXA 3SHWA 2ED1A 2YUNA 1T3LA 2LJ3A 2X3XD 4Z88A 1NYFA 2J6FA 2LCSA 2BZ8A 2YDLA 2JM9A 2FRWA 4WCIA 3VS0A 3PVLA 1UE9A 2CSQA 1HSQA 1ARKA 2O88A 1GFCA 2KT1A 4AFUC 2AKKA 2DX1A 2FPEA 1UJ0A 3M0QA 1SSHA 1PRLC 2DBMA 2G6FX 1G83A 2OI3A 2GTOA 2L3SA 5EC7A 5ECAA 3H41A 2W0ZA 2F2VA 1X6GA 1X2QA 2H8HA 3UA6A 3NMZC 1UDLA 2RMOA 2AKLA 3O5ZA 3KFVA 5I22A 3UATA 3TSWA 1TUDA 1QWEA 4RUGA 1M3AA 2X3WD 1NM7A 3VS3A 1YWPA 2CT4A 3REAB 4J9IA 4HCKA 2JT4A 1CKAA 2DL7A 4E6RA 4J9CA 2M0YA 4R0KA 2DRMA 1K0SA 1LCKA 1AZGB 2OJ2A 1KSWA 4JPBW 2CH4W 2EPDA 4F14A 2LQWA 1GBRA 2DVJA 1RUWA 3EHRA 2EKHA 4RTWA 1YN8A 1YP5A 1TG0A 3H0FA 4AG2C 2NWMA 1SEMA 3FJ5A 5IXFA 1NEGA 2L3PA 4OMNA 4DEYA 2J06A 1FMKA 2ED0A 4Z8AA 1OV3A 3I35A 1RLQC 2V1QA 1A0NB 4FSSA 4ZNXA 2FPDA 2F2WA 5IHNA 3M0UA 1AVZC 5I11A 2O9SA 2ENMA 1E7OA 5GJWB 2KYBA 3VS5A 2B86A 1X2KA 2EYZA 2DL5A 3VRZA 1MV0B 4J9GA 1NLOC 2RQTA 1HJDA 2KROA 2BZYA 1NG2A 4Z89A 2YUQA 4LN2A 4AFSC 4RTYA 1M3CA 1ZUYA 4RTXA 1E6GA 1RLPC 1AZEA 2EVRA 4J9DA 2KRMA 4RTZA 1PNJA 1BK2A 2C0TA 2M51A 3QWXX 1HD3A 1U3OA 1H8KA 1ZBJA 4HVVA 2A08A 1VYTA 1WYXA 1GBQA 1YNZA 4F16A 1UTIA 4IIMA 4JZ4A 2MIOA 3VRYA 1I07A 2DE0X 1ZLMA 2A28A 2KRSA 2XMFA 1ZUUA 2HSPA 2DL3A 1VYUA 4QT7A 1WXBA 1ZX6A 1VA7A 4Y92A 2EYWA 2L2PA 2YSQA 1G2BA 1IO6A 2ECZA 1EFNA 1M27C 3TSZA 2DJQA 3M0PA 1UECA 1JEGA 1M30A 3EHQA 4RTUA 1NYGA 2GNCA 1GCQC 1T0HA 4J9EA 1GCPA 1W6XA 1WX6A 2OAWA 3VS7A 2V1RA 2KT8A 1PKTA 4OMLA 4ESRA 1U06A 1UJYA 2AZVA 1AEYA 2CSIA 2P4RA 2LQNA 3ZL7C 1WI7A 1QKWA 3GBQA 2VVKA 3I5RA 2LMJA 2HEQA 2W10A 5IH2A 4J9BA 2AK5A 2RQVA 5HCKA 2CUDA 2RQRA 4KRTA 1W1FA 4HVUA 3VS4A 2EQIA 1SPKA 1BU1A 1SHFA 3PE0A 4JJDA 4GLMA 1W70A 1ABOA 3EGUA 1MV3A 1VYVA 3M0TA 4AG1C 1T0JA 4LUDA 1JU5C 1AWWA 1K0XA 2MCNA 2DLPA 1X6BA 2D1XA 3R6NA 3NGPA 4JJCA 2EW3A 2D8HA 4OMOA 2K6DA 4GBQA 2GTJA 1X43A 3LH5A 4OMPA 1KJWA 1PRMC 1V1CA 1JXMA 1UHCA 2D0NA 2LJ0A 1UGVA 5IXBA 1WIEA 1E6HA 2J05A 2ESWA 1M3BA 3RNJA 3THKA 3VS2A 3EG1A 1I1JA 1OEBA 1B3QA 2HDAA 4EIKA 4CC3A 2GGRA 2PNIA 1K4US 2F2XA 2NUZA 1QKXA 2DA9A 3C0CA 1PHTA 3EG3A 3M0SA 1AWOA 1XOVA 2J6OA 1J3TA 1GL5A 2CUBA 4CC4B 3ULRB 1WA7A 2RQWA 4OMQA 2EYYA 3CQTA 2JMAA 1QWFA 1OOTA 1UFFA 2O2OA 1K1ZA 1Y57A 2J7IA 1AWXA 2FO0A 2KBTA 2FEIA 1JQQA 2K79A 3VS6A 3RBBB 2FRYA 3U23A 1YWOA 4AFQC 4F17A 1GCQA 3VS1A 1JO8A 1M8MA 2RF0A 2VKNA 2I0NA 2K7AA 4AFZC 3NPFA 4RTTA 1YCSB 2DM1A 1PKSA 2ABLA 1H92A 2O9VA 2DF6A 2PZ1A 1OPKA 2RNAA 5FWCA 3REBB 1KFZA 1FYNA 1N5ZA 1ZSGA 2ROLA 2YT6A 2YUPA 4LE9A 1SRMA 5IHKA 1ZUKA 1SRLA 2EBPA 2CT3A 1RI9A 2D8JA 1X27A 2JS0A 5GJVB 2A37A 2RQUA 2RN8A 2KXDA 3I9QA 4CC7A 1NLPC 2ROTA 2DRKA 2LJ1A 2KXCA 2GQIA 1WXUA 2YUOA 4ORZA 4A63B 1SHGA 2KYMA 2GBQA 2JXBA 2KGTA 2A36A 1KIKA 4X1VA 1NEBA 2KE9A 1JXOA 1GFDA 3QWYA 2KR3A 3NHNA 1UUEA 1K9AA 2JS2A 2MOXA 2SRCA 3M0RA 3H0HA 2EGCA 3PVQA 2FG0A 1U5SA 1I0CA 3A98A 2C0OA 2DMOA 4HVWA 2IIMA 1X69A 3UF4A 1S1NA 2DILA 4LNPA 3H0IA 1Y0MA 2QDLA 2K3BA 2RPNA 2L3QA 1K76A 4IIOA 4J9FA 2CH4A 2JMCA 2JTEA 3TVTA
chains in the Genus database with same CATH superfamily
3EG2A 1S72T 2AZSA 4EDUA 4ELYC 1VQKQ 3UA7A 1CSKA 4M7DC 1VQNQ 2DL4A 3CCMQ 3CCMA 5HY6A 3JB9F 4M4ZA 3URGA 2JN0A 3CCQQ 4HA8A 2CZ7B 5FWBA 5IT9E 1Y96B 1RADB 1DJ7B 1BIAA 3LLRA 4DBFA 2E6NA 3VKIA 2KEAA 1BBZA 5D6YA 1JJ2P 1VUBA 2JM8A 3OW2P 3M4YA 3J81E 2BTTA 1NE8A 3ME9A 1TUCA 3TEEA 2GFUA 3CEYA 3CBMA 1WLPB 2V8JA 3I5SA 2LX7A 4VUBA 4M7DG 2BZXA 1HXDA 1RAGB 4Z02A 2OTJA 1PD1A 5KCHA 4D8DA 1U8RA 1NPRA 4PJOD 3WVDB 2K9GA 2VWFA 4RTVA 2LZ6B 1YI2T 2RM4A 3UPUA 3HRTA 1ABQA 2EWNA 1AOJA 2FPFA 1QLYA 1SKUB 3SB2A 2VC8A 3CCQT 2ZPGB 2DL8A 1PWTA 3DLLA 2YUNA 2LJ3A 4Z88A 1NYFA 2E4HA 1VQ4T 2LCSA 4LD9K 3KUFA 2FVUA 2CSQA 1X75C 1ARKA 3OS5A 2KT1A 4AFUC 1KD1R 2AKKA 2FPEA 1U1TA 2NUTB 3M0QA 3HP9A 4PLLA 2DFUA 5EC7A 1FMWA 4E47A 4OGCA 2F2VA 2WSEE 3JCMg 3CCUT 2H8HA 1K9MR 3HRSA 1S72Q 3MEWA 1JBMA 2DYIA 4RUGA 1YJNT 2X3WD 4IUQA 4OB0B 2VUBA 4KGZB 3RKWA 1LJOA 3NTHA 4C5EA 4PJJA 4DBHA 1KHCA 2DL7A 2HBPA 4E6RA 1VQOQ 4BY6C 3S6WA 2CH4W 4M78A 4MZMA 4F14A 2LQWA 2ZPFB 1RUWA 1VQLT 1YN8A 3X26B 3H0FA 5LJ3h 4D6WA 1NEGA 4OMNA 3OYYA 1M9SA 1M1KC 2ED0A 4FL6A 3G71A 4M7DF 2XDBA 5FROA 1D1BA 1RAAB 2FPDA 4J6YA 2HAXA 2QEXT 3OYMA 1UB4A 5GANd 4XU1A 1AVZC 3PNWC 1ZHIA 1WJSA 4L5GA 2ENMA 1E7OA 4OB1B 5GAMf 1YJWT 4FM4B 2JUFA 2DL5A 1N8RR 1NLOC 1VQ6A 2KROA 5FLXE 4Z89A 4AFSC 4RTYA 2R57A 4IUTA 1TSFA 1ZUYA 4RTXA 1QP3A 1E6GA 4C92G 3JCMQ 2LVMA 4XU2A 1PNJA 2ZPEB 1H8KA 1VQ6Q 1WYXA 2Y4XA 1GBQA 4LDUA 2FHDA 4IIMA 2D6FA 3CD6Q 1MGQA 2MIOA 5IAYA 2DE0X 3JCMe 2F5TX 2QGGA 5FU7C 1LNXA 1VYUA 3S3NA 3HKSA 4Y92A 2EYWA 2EQMA 3OYNA 2P4TA 4E7JA 4HKEA 1M27C 2QXFA 4BI8B 1UECA 2P0QA 1OZ3A 3SWNB 1JEGA 1M30A 3EHQA 4RTUA 2GNCA 1GCQC 5GAMh 2QA4A 2DXTA 1VQ4Q 2KT8A 2IPOB 1R0BG 2JTFA 1PKTA 1XQHA 3SWNA 1U1SA 1V76A 1U06A 1UJYA 2EJGA 1VQOT 2HQHA 4M7AB 3ZL7C 5KYUA 1K9MU 1WI7A 3GBQA 1BIBA 3CMEA 2KVQG 1NJIR 2HQEA 1ZSZB 1M1FA 2RHIA 2AK5A 4JUVA 2RJFA 3EGXB 3PMTA 3QDRB 2XI9A 4HVUA 4QQGA 4QVDA 1W70A 3JCMP 1Y96A 3M0TA 1K0XA 2D1XA 1KC8C 3R6NA 4OMOA 2K6DA 1VIEA 1YI2A 3EG9A 3V8LA 2M16A 1PRMC 1V1CA 4B6MA 5FU6C 1MNEA 4C5IA 3JCMh 5IXBA 1E6HA 2J05A 2KQWA 1I8FA 2X35A 3RUXA 5KYWB 3VS2A 2E5QA 2X4JA 3MP6A 5CAIA 1OEBA 1B3QA 1V29B 1MMDA 2KSSA 3CCQA 4CC3A 4NL2A 1QKXA 2RK1A 5LJ5f 2X4XA 1AWOA 1XOVA 5EG2A 4CC4B 4N0AA 4OMQA 3V8KA 1K1ZA 3JCMb 5LJ3j 1PG5B 1K8AC 1Y57A 3QZ5B 1FWZA 1OULA 4C0DB 2KBTA 4JRIA 1JQQA 2CP7A 4L6V5 3CCMT 1QQJA 4C0GA 2ZGWA 3EH1A 2OTJQ 3CXCP 3VS1A 3M54A 2HL3A 2HQXA 3Q1JA 4C92B 2ZZDA 3GF5A 1H92A 9ATCB 4PJOC 2DF6A 2RNAA 1OPKA 4ZN3A 2O01E 1BI1A 1N5ZA 1X6OA 2E41A 4BDZA 2MMPA 2I2LA 2PUKB 3M56A 1OQKA 4EMGA 1XNIA 2CT3A 2WSCE 1G3SA 4EPCA 4M78F 2NUTA 3RMQA 1KC8U 1OX8A 4BACA 1X01A 3LWIA 3OYFA 1VQ7A 3LYIA 3CCSQ 2DRKA 4WF2A 3P8DA 3EFRA 1VQPQ 1Q82C 2GQIA 2YLCA 2YXYA 1H641 3QKJA 3BW1A 4ORZA 4A63B 3MEUA 4JS4A 3RKYA 4BE2A 4PFPA 5KYXB 2KGTA 1D1AA 2P0PA 2KE9A 1D3BA 2NUPB 3QWYA 4PK4A 1IGQA 2H3JA 3VV0A 3M58A 3CCJQ 2CZ0B 4PJOF 2SRCA 2OTLA 3OSVA 1N8RU 2CP0A 2EGCA 5LJ5j 1WHGA 2DMOA 3C95A 4J7FA 2CP2A 4QQ6A 1S1NA 4CRIA 1YIJQ 3E2UA 2K3BA 2RPNA 4NOYA 2CP6A 2L3QA 4DBRA 1UEBA 3TVTA 2O31A 2DYBA 1N9SA 1Z9ZA 3G4SA 4XK8E 5GAN3 3J7AF 4D8KA 4DQ2A 1WGSA 2PTKA 2DD5A 1M1GA 4FIBA 2JW4A 3P8HA 4RG2A 3FLGA 2BUDA 4M7DA 1WDXA 3CD6A 5CKEA 3M55A 4FYYB 1QCFA 5C6SA 2SEMA 2E12A 2HBWA 5GAOn 4PJNA 2J6KA 2LRQA 3CC7T 1VQLA 4HT9A 1KC8R 2XU8A 3V7RA 3META 3JCMJ 5GMKh 1K9MC 5AT1B 2VASA 1XTDA 1MMGA 2DK3A 1VQ5Q 1B07A 3OS0A 3A8MB 5I2MA 1M90C 5J3BA 4M7AA 5L23A 3MKDA 2PVGB 2KNBB 1Y7XA 2XD0A 3EGXA 4M75B 4R55A 2K2MA 3UDCA 1I5OB 4J9HA 2EYXA 2ED1A 3A8GB 2KY9A 2QA4Q 2X3XD 4FYWB 2J6FA 4MZTA 2M1HA 1M8VA 2FRWA 4WCIA 3VS0A 1QVGA 4FYVB 1UE9A 3VYHB 5M9OA 4R56A 2H3EB 5KE2A 2EQJA 2QEXQ 1PRLC 1HYOA 3QIIA 2OI3A 4M77G 3OYBA 3ZBDA 1X2QA 4RG8A 1UDLA 2RMOA 3H8ZA 3O5ZA 5I22A 3JB9H 3TSWA 4BE1A 3QYGB 2D9TA 4L59A 5GANh 3JB9I 1M3AA 1YJWA 3CC2A 5L8RE 1IZ6A 4HCKA 1Q7YC 2JT4A 2OTJT 1KG1A 4OB2B 4R0KA 1LCKA 1TXQA 5CVIA 3JCMf 5HKCA 2DVJA 3EHRA 4B9WA 1YP5A 4M77D 2V8IA 2NWMA 2XIDA 3FJ5A 5IXFA 3HTRA 4C8QE 2J06A 5CO7A 4WTOB 4HCCA 3OSSC 2DKGA 2DD4A 3I35A 4J7IA 1QVFS 1A0NB 4PLIA 3N5BB 4XTVA 1WPYA 4FT2A 3CCRA 3CCRQ 3I56T 1IHWA 5GJWB 4M77E 3VS5A 4BI3A 2B86A 1X2KA 2EYZA 3BE3A 4J9GA 2RQTA 1VQ5A 4M7AE 2RH2A 4QVZA 2YUQA 1VQ5T 4BB7A 1S72A 3P8BB 2V26A 3M5AA 4OMFB 1RLPC 1D1CA 2EVRA 3QPHA 2KRMA 4RTZA 5KE3A 5GMKi 2M51A 1U3OA 4C8QF 3A8LB 2IVWA 4V2SA 4M75F 1I07A 3QBYA 2A28A 2HSPA 2DL3A 3H9NA 3CXCA 1VA7A 5DLOA 2QQ9A 1BKBA 1UGRB 1XJWB 4EMKA 2DJQA 2VYTA 4FCYA 2L5QA 2HNIA 2VGMA 3MP8A 2AHJB 3RDVA 5GMKm 1GCPA 1KD1C 2NYSA 2K3YA 3OA6A 4J6WA 3RKXA 2CSIA 3QYHB 4C92C 4EMKC 3L2QA 5LJ5e 2LQNA 2QQAA 1W2BA 4C5HA 2LMJA 2HEQA 4A4FA 3CCSA 2W10A 5IH2A 2RJCA 4J9BA 1VQMQ 3L2VA 5GAN2 1MHNA 1D0XA 1Q86R 5CK9A 4PKCC 1SPKA 4GLMA 1ABOA 3D7SB 3I56Q 1MV3A 1VYVA 3NFCA 1VQ8T 1T0JA 4KGVB 4M78G 3JCMX 2MCNA 2DLPA 4JJCA 2EW3A 2ZCFB 4M75C 1TOVA 2MPXC 7AT1B 1WNLA 1X43A 3LH5A 1WJRA 3T9NA 5CKDA 3LGLA 1KJWA 1M1KU 1JXMA 1UHCA 1AHJB 1WQ7A 2D0NA 3GIBA 1M4ZA 4C5GA 2LJ0A 1UGVA 3QXEB 2MYSA 1WIEA 1YIJA 1Q7YU 3RNJA 1Y07A 3G4SQ 3HHTB 3M4GA 1I1JA 4XTXA 3VYGA 2M0OA 1IB8A 1QMCA 1VQMT 2CP3A 2F2XA 4E7IA 5HK3A 2DA9A 1PHTA 1QVPA 2K5FA 1GL5A 1M90R 5CQYA 1N6AA 2RQWA 4KH1B 4M7AG 3UWNA 2JMAA 4II1A 1OOTA 2O2OA 4M75A 1ZSZA 1VQ7Q 5FRNA 2FEIA 3OYAA 3G7ZA 2K79A 4XTYA 1IXDA 2V8KA 4AFQC 4F17A 2JZ2A 4QKUA 1M8MA 2RF0A 2VKNA 2I0NA 3NPFA 3EFSA 5J26A 5GANj 2O9VA 5FWCA 3RESA 3LGFA 4JLGA 4N4IA 2DIGA 3REBB 4A53A 1ZSGA 4C8QG 2QAZA 3EFOB 3CC4Q 5GAN5 2EJ9A 4E2FB 2E70A 2CKKA 2JTMA 3PTAA 2BE7D 1YHQQ 2FYKA 1RI9A 2D8JA 1X27A 2JS0A 3MP1A 2DZ9A 2E3HA 3OB9A 2R5MA 4M7AD 5DM7R 4XQ3A 2Y90A 2KXDA 4KUDK 4ZTJA 1NLPC 2K57A 2FZCB 3CPWS 5C0MA 1SSFA 4LXCA 4ATOA 1WXUA 2JVVA 1QVGP 3OW2S 4JJNK 3MEVA 4M7AC 2HKQB 2JXBA 3TCJA 2DJZA 1M2VB 3WVEB 1K8AU 1KIKA 2O4XB 1O9SA 4J5YA 1VQ6T 1JXOA 1GFDA 2KR3A 3OS2A 3E9FA 2QDYB 1K9AA 3CMAA 1YITA 1M2VA 3VJPA 2JS2A 4C8QD 4DA4A 3E1SA 3H0HA 4M7DD 4FSXA 1EIFA 2CS7A 3PVQA 4BE0A 3QJYA 1U5SA 1I0CA 2C06A 3A98A 2Y4YA 2QA4T 3GNGA 4C92A 4DOWA 1R8OB 1X69A 3UF4A 4A4KA 4KBMB 1Y0MA 2QDLA 4JRPA 1K76A 2CH4A 1VQ7T 2JMCA 4M77F 3X28B 3CCVA 1AWJA 3CCLQ 2LP5A 4LDXA 4HXJA 4ME7A 3OYJA 2LTOA 4XU3A 4DEXA 2KRNA 3HRUA 3ASKA 3A8HB 2HCKA 5IHIA 2F69A 2E10A 2F5KA 1H3HA 4OP0A 4PJLA 1WXTA 4HCZA 3CC2T 2G3RA 4EMKB 2EGEA 1M90U 1OPLA 1K73R 4FU6A 3CCET 2E5KA 3HPWA 4AT1B 2AT1B 1UHFA 1RAIB 4JS5A 2K5IA 3EG0A 5FW9A 3KXTA 3EH2A 4HT8A 4A4HA 3X24B 3CMEQ 4C92D 2OAUA 1W2BS 4LDVA 4M78E 5DLQE 1B7TA 1RABB 4PJOE 1BI0A 1TS9A 2EGAA 2JJ9A 3SFMA 4QVCA 4LUEA 3F70A 3SEMA 5LJ3g 1NPPA 2LCLA 1BCOA 5KYUB 1YJWQ 1T3SA 4Y28E 2P84A 4OMMA 2CYZB 5GAMd 1OI1A 4C8QB 2DBKA 3SHWA 4X9DA 5J39A 3CCEA 1T3LA 4N4HA 1FXXA 3EGDA 1KQ1A 2YDLA 4N0AC 2JM9A 4PNOA 2QGFB 2MWOA 3QUIA 3V7SA 2DZCA 2O88A 1GFCA 2DX1A 2QYZA 2DBMA 3OBWA 2GTOA 3OYLA 3QJ6A 5ECAA 3H41A 4J8OA 1D0YA 1M5Q1 2L8DA 2AKLA 3G1JA 1PM3A 5KYNA 5A0GA 5GAN8 4PJOA 2YRDA 3SDZA 1TTHB 2D0QB 3CCUQ 1KQSP 3VS3A 1JJ2S 1VIFA 2X9HA 4KGXB 2CT4A 4J9IA 4E7ZA 2RA2A 2DPPB 1CKAA 2EIFA 3MO8A 2K3XA 1NJIC 5DY9A 3S3OA 1KSWA 4JPBW 3HSBA 1GBRA 2RO0A 3CCUA 1H3ZA 1G8XA 2L3PA 5GANg 1EX4A 3FDRA 2QQRA 1Q7YR 1OV3A 2NLUA 2KAFA 2V1QA 4FSSA 1TUGB 4ZNXA 2PQWA 3L2WA 3CCVQ 2F2WA 5IHNA 1QP2A 3M0UA 5I11A 2A0FB 1F1BB 4KULA 1RL2A 4DOVA 5GAOp 4MMLA 1FMVA 2RHUA 3EFOA 4ZGJB 2OTLT 3VRZA 4F7UF 2BZYA 1NG2A 1G5VA 1OX9A 4MZPA 4M7DE 3PMIA 3OYCA 4BI4A 4FW2A 3G6ET 3OBYA 3TQ7P 5CCAA 5KH6A 2VXEA 2YRCA 2RHXA 2DERA 2LQ8A 2XDDA 1VQ9T 2C0TA 1HD3A 3QG1A 2EFIA 4Y91A 1WHHA 1ZBJA 4HVVA 1N27A 1Q82U 2A08A 3CCEQ 3PIOA 4F16A 2QTXA 3KBGA 3QHSA 3TREA 1UTIA 5CKFA 2DXCA 3VRYA 1W4SA 4FT4A 3OYKA 1VQOA 3CCVT 1QCNA 2EQKA 2YSQA 1G2BA 2DTHA 4N4GA 1IGUA 1LVKA 4JRQA 4XTUA 4OF1A 4B9XA 1VQKA 3OY9A 4F7UE 2E64A 1NYGA 1Y71A 4GLKA 1T0HA 1VQKT 4J9EA 5A0LA 1W6XA 1WX6A 2OAWA 5LJ3d 3VS7A 4QQDA 1D3BB 4OMLA 5GAMe 1M1KR 2DO3A 3OYGA 1G3WA 1SF9A 2YWWA 2AZVA 1HK9A 1VOMA 1AEYA 3GOXA 4MDXA 1VQ9Q 2P4RA 4QW2A 1QKWA 2CZ1B 2VVKA 3I5RA 2O4XA 3CPWA 2MWPA 3EAEA 2M9UA 1YIJT 5HCKA 2CUDA 1YJ9T 4KRTA 2DXBA 3VS4A 4BD3A 2EQIA 2DETA 4DBQA 2HSEB 1BU1A 3S3MA 2RHYA 2M02A 3OYIA 3EGUA 4MDWA 4AG1C 4ZGDB 5GANf 1X6BA 4OVAA 2D8HA 4GBQA 5LJ5d 4OMPA 5I2SA 2K5LA 4ZGEB 2YHTA 3JCMc 1PSFA 4MMKA 3GLXA 5CIUA 4PL6A 1IREB 2ESWA 2DEQA 2VGNA 1VQPT 5AYFA 3THKA 3FIFA 3EG1A 5GMKe 2FZGB 1NJIU 2QQSA 2R5AA 3CC4T 1PSEA 2KMTA 2K4YA 1K4US 2PNIA 1I81A 5CQXA 2R58A 3M0SA 3V7CA 2J6OA 1Q82R 5LJ5g 1J3TA 2CUBA 1K73U 1VQPA 2LQKA 2RI2A 1WA7A 1OZ2A 1UFFA 1ZA1B 2J7IA 3DB4A 1AWXA 4M78C 3VUZA 4F7UA 3L1AA 4C8QA 2RHZA 5KYYB 2FRYA 1QVFP 1VQNT 2COWA 1VQMA 2RB6A 3I55A 2ZPIB 3CCJA 3MCAB 2K7AA 3ZEHA 1YCSB 3QSUA 1PKSA 3RIRA 5GAOm 2ZAEA 1AT1B 4O6JA 3I56A 2YT6A 1PD0A 2YUPA 4PJOB 1ZSZC 3AHUA 1SRMA 3NTIA 1WHMA 4M75E 1YJNA 3M9QA 4RMOA 1BYMA 4NL3A 3L42A 1N8RC 5CKBA 2IG0A 1YITT 3CMAT 3X20B 1FX7A 2A37A 5I21A 3DLMA 2RD1A 2RN8A 3I9QA 3VU3C 4PJMA 4CC7A 3GPLA 1YI2Q 2YRVA 4A4GA 4OB3B 6AT1B 5KYWA 1VQ8Q 1G3YA 2KYMA 1YBYA 2HZYA 2OX7A 3G6EQ 3BFMA 4X9CA 4RCBA 4LDWA 2A36A 4X1VA 1NEBA 2PVOB 5GAN7 2LDMA 1UUEA 1VQ8A 1NZ9A 2ATCB 5GANe 3C94A 2MOXA 2COZA 3HFNA 2A3LA 4JLIA 2FG0A 2LC4A 1C0MA 2C0OA 3CXCS 4HVWA 1I4K1 3OYDA 3FC3A 3DB3A 3H0IA 2DAQA 1D0ZA 3G71T 2QK0A 3OW2A 3JRZA 1WHJA 5IN1A 2JTEA 4EMHA 2RK2A 3CC4A 2DNUA 4FW1A 2MI6A 1OU8A 1MUZA 3IQLA 3JB9D 4ANJA 4C92F 4JRKA 1B34A 1KD1U 1AD5A 1WFWA 1RAEB 4M7AF 2QEXA 1UGSB 4NS5A 4P5NA 4KT0E 5GAN6 3M57A 1PCXA 2CDTA 3O8VA 1CKBA 3JSCA 4TVRA 3CC2Q 2A7YA 4C0ZA 4C0FA 3JV3A 2C0IA 1Z9QA 4K11A 5GMKl 1UG1A 2MAMA 1SG5A 4CC2A 1G3TA 1GRIA 4XTZA 4JZ3A 2LCCA 4JJBA 2XICA 4IUPA 1BB9A 1NBEB 3A5ZB 5KYXA 3NTKA 3SWNC 4IUVA 4XAXB 2CP5A 2DTIA 2XG8D 1WJQA 3LW5E 3L2UA 2CREA 2EYQA 2L89A 3M59A 3LX7A 4BY6B 3I55T 2EAYA 2L0AA 2LNHB 1UGQB 2FZKB 2GF7A 1MMNA 2RI3A 3BDLA 2BZ8A 1WZOA 3PVLA 1O75A 4E7LA 4IKFA 1HSQA 5LJ3f 4Q5WA 1LOJA 3JB9J 1Q86U 3PFSA 1UJ0A 3GNFB 5D6WA 1SSHA 2G6FX 3LH0A 3C4SA 1G83A 1VQ4A 1IHVA 2L3RA 2L3SA 2X51A 3E19A 1Q81C 5GAOq 2W0ZA 3FB9A 1X6GA 2BIVA 1K8AR 2JNGA 5FRMA 3UA6A 2HL5C 3NMZC 3PGGA 3KFVA 3UATA 1ACMB 2LX9A 1TUDA 1TH7A 1QWEA 1Q81R 1OU9A 3QDFA 2ZPHB 2LT1A 1NM7A 1YWPA 2JOYA 2E6ZA 4M7DB 2HMAA 3REAB 3CCLT 2PVDB 4J9CA 2QI2A 2M0YA 2DRMA 1K0SA 1AZGB 2OJ2A 2EPDA 2WSFE 2EKHA 4RTWA 3MHXA 1TG0A 4AG2C 2GFAA 1SEMA 4PFZA 5GAMg 2GQVA 4DEYA 3RR6A 4E7KA 5A2QE 1FMKA 2E1HA 4Z8AA 1QVGS 1RLQC 3PT9A 1TWBA 4F7UB 3OYHA 2LT4A 1BCMA 4CI0C 3EGDB 2O9SA 2KYBA 3AT1B 4A4EA 5LL6S 1MV0B 2DIQA 2CGHA 1HJDA 3QO3A 3EG9B 1JB0E 1WHLA 1M2OA 4LN2A 4M77A 2OTLQ 1VQNA 1JJ2A 1C1AA 1M3CA 1MNDA 1AZEA 3JCMW 3A8OB 4J9DA 2VB6A 3J80E 1BK2A 3QWXX 2MF2A 2DEUA 1R77A 1VYTA 1ZBXA 1RI0A 1YNZA 1Q81U 4GY5A 4JZ4A 4BUGA 3OS1A 3E9GA 2E65A 3G4ST 1ZLMA 2KRSA 2XMFA 1ZUUA 3JCMV 5HK0A 1RAFB 4PJOG 4QT7A 1WXBA 1ZX6A 5FU7B 3CMAQ 1YITQ 2K2VA 4HCBA 1EZZB 1YHQT 1QVFA 2L2PA 3ER0A 1IO6A 2ECZA 1EFNA 1ZA2B 2XHCA 4O5VA 4RCCA 1BI3A 2E3IA 3JB9G 3TSZA 3M0PA 4M77C 8AT1B 3CCLA 2XKOC 3JAME 2KK4A 3A1PA 2X4YA 1I5LA 5LJ3e 3OMCA 5GAOl 1YJNQ 1BI2A 2BKDN 2V1RA 2P0KA 4C8QC 4ESRA 3G6EA 1KQ2A 3C12A 5CKHA 1N9RA 1W2BP 4IUUA 4BDYA 2RI5A 4C92E 1YFNA 3CBPA 4J6XA 3CBOA 1PC0A 3QZ9B 3OYEA 5GAMj 2RQVA 4JDSA 1YCYA 1MMAA 2RQRA 5CR2A 1KQSA 4YTLA 1W1FA 4E7HA 3MEAA 2AIRB 2HD0A 2QQBA 2DTOA 1SHFA 3PE0A 4JJDA 1YHQA 4KUIA 1YJ9Q 4F04B 4LUDA 1JU5C 5GAN4 1AWWA 1RAHB 1WQWA 4ZN1A 2EKOA 3NGPA 4IURA 4ELZC 1B34B 1TU0B 2GTJA 2XDPA 3G71Q 2RJDA 4E7SA 2VXFA 1YJ9A 2QASA 1K73C 3FRNA 2X4WA 4XU0A 3FJPA 3I55Q 2F1LA 1M3BA 4X34A 3CPFA 2KDSA 1R0CB 2NUPA 4LD6A 2EJFA 1QW1A 5GAOr 3HFOA 3CPWP 3CC7Q 2QTVA 3CC7A 2HDAA 3CCJT 4EIKA 2GGRA 1KQSS 2YLBA 1Q95G 1JRIA 2LNVA 4F7UG 3V8JA 1D09B 2NUZA 3C0CA 3EG3A 3MJXA 2B8AA 3DKMA 3BY7A 3MPUB 3BDUA 3ULRB 3H6ZA 3SD4A 2PUOB 4M78B 2EYYA 2FL7A 3CQTA 2FB7A 4AMCA 1QWFA 1VQ9A 2DXUA 2FO0A 3CMET 4J83A 3CCST 5KCOA 3VS6A 3RBBB 1Q86C 1P92A 3U23A 4KH0B 1YWOA 3L2RA 2DVEA 2WACA 1GCQA 1RACB 3X25B 1JO8A 4OGEA 2EQUA 1C6VX 4AFZC 4RTTA 3FEOA 3TU4K 2DM1A 2ABLA 5LJ5h 4PFOA 3CD6T 4LDYA 2PZ1A 2QG9B 1KFZA 2RJEA 1FYNA 2ROLA 2COYA 3HL8A 1IRXA 4LE9A 5GMKj 1QCOA 3GP8A 3RMSA 3OMGA 5IHKA 1ZUKA 1SRLA 2EBPA 4M75D 2KI7A 2VV5A 4FYXB 5GJVB 4RKUE 2RQUA 3R6OA 2PU9B 2ROTA 2LJ1A 1KK7A 2HKNA 4UC4A 2KXCA 3ZFJA 3LWHA 3WXMB 1VQLQ 5FU6B 2YUOA 3INZA 4ZTFA 1SHGA 2MK5A 5A0DA 3UT1A 2GBQA 3M53A 1LPLA 4M75G 1ZQ1A 3NHNA 1UGPB 3JCMd 5KYYA 1KHIA 3M0RA 2GCXA 1OYXA 4M78D 3CCRT 2Z0WA 3L2ZA 3RERA 2IIMA 5D7UA 3PIPA 3OQ5A 2DILA 4LNPA 1GXIE 4A54A 2CZ6B 4M77B 2ZPBB 5D6XA 1WHKA 3VUBA 8ATCB 4IIOA 2BE9B 4J9FA 2XK0A 4XTWA 4C0DC
chains in the Genus database with same CATH topology
3EG2A 2AZSA 2O31A 1AWJA 2DYBA 2LP5A 3UA7A 1CSKA 1Z9ZA 2DNUA 4HXJA 2DL4A 1MUZA 3IQLA 4D8KA 4DEXA 4M4ZA 2KRNA 2PTKA 5FWBA 2HCKA 5IHIA 1AD5A 1WFWA 2JW4A 1H3HA 1WXTA 1WDXA 2EGEA 1OPLA 2CDTA 1QCFA 2E5KA 1CKBA 2SEMA 2HBWA 2KEAA 1BBZA 2JM8A 1UHFA 2BTTA 3EG0A 2J6KA 3JV3A 2C0IA 1TUCA 1Z9QA 4K11A 5FW9A 1WLPB 3I5SA 1UG1A 2LX7A 4CC2A 2BZXA 1GRIA 4JZ3A 4D8DA 4JJBA 1B07A 1BB9A 2EGAA 4LUEA 5L23A 2K9GA 2VWFA 3SEMA 4RTVA 2KNBB 2LZ6B 1ABQA 1AOJA 1T3SA 2CREA 2FPFA 1QLYA 2K2MA 4OMMA 2DL8A 4J9HA 2L0AA 2LNHB 1PWTA 2DBKA 2EYXA 3SHWA 2ED1A 2YUNA 1T3LA 2LJ3A 2X3XD 4Z88A 1NYFA 2J6FA 2LCSA 2BZ8A 2YDLA 2JM9A 2FRWA 4WCIA 3VS0A 3PVLA 1UE9A 2CSQA 1HSQA 1ARKA 2O88A 1GFCA 2KT1A 4AFUC 2AKKA 2DX1A 2FPEA 1UJ0A 3M0QA 1SSHA 1PRLC 2DBMA 2G6FX 1G83A 2OI3A 2GTOA 2L3SA 5EC7A 5ECAA 3H41A 2W0ZA 2F2VA 1X6GA 1X2QA 2H8HA 3UA6A 3NMZC 1UDLA 2RMOA 2AKLA 3O5ZA 3KFVA 5I22A 3UATA 3TSWA 1TUDA 1QWEA 4RUGA 1M3AA 2X3WD 1NM7A 3VS3A 1YWPA 2CT4A 3REAB 4J9IA 4HCKA 2JT4A 1CKAA 2DL7A 4E6RA 4J9CA 2M0YA 4R0KA 2DRMA 1K0SA 1LCKA 1AZGB 2OJ2A 1KSWA 4JPBW 2CH4W 2EPDA 4F14A 2LQWA 1GBRA 2DVJA 1RUWA 3EHRA 2EKHA 4RTWA 1YN8A 1YP5A 1TG0A 3H0FA 4AG2C 2NWMA 1SEMA 3FJ5A 5IXFA 1NEGA 2L3PA 4OMNA 4DEYA 2J06A 1FMKA 2ED0A 4Z8AA 1OV3A 3I35A 1RLQC 2V1QA 1A0NB 4FSSA 4ZNXA 2FPDA 2F2WA 5IHNA 3M0UA 1AVZC 5I11A 2O9SA 2ENMA 1E7OA 5GJWB 2KYBA 3VS5A 2B86A 1X2KA 2EYZA 2DL5A 3VRZA 1MV0B 4J9GA 1NLOC 2RQTA 1HJDA 2KROA 2BZYA 1NG2A 4Z89A 2YUQA 4LN2A 4AFSC 4RTYA 1M3CA 1ZUYA 4RTXA 1E6GA 1RLPC 1AZEA 2EVRA 4J9DA 2KRMA 4RTZA 1PNJA 1BK2A 2C0TA 2M51A 3QWXX 1HD3A 1U3OA 1H8KA 1ZBJA 4HVVA 2A08A 1VYTA 1WYXA 1GBQA 1YNZA 4F16A 1UTIA 4IIMA 4JZ4A 2MIOA 3VRYA 1I07A 2DE0X 1ZLMA 2A28A 2KRSA 2XMFA 1ZUUA 2HSPA 2DL3A 1VYUA 4QT7A 1WXBA 1ZX6A 1VA7A 4Y92A 2EYWA 2L2PA 2YSQA 1G2BA 1IO6A 2ECZA 1EFNA 1M27C 3TSZA 2DJQA 3M0PA 1UECA 1JEGA 1M30A 3EHQA 4RTUA 1NYGA 2GNCA 1GCQC 1T0HA 4J9EA 1GCPA 1W6XA 1WX6A 2OAWA 3VS7A 2V1RA 2KT8A 1PKTA 4OMLA 4ESRA 1U06A 1UJYA 2AZVA 1AEYA 2CSIA 2P4RA 2LQNA 3ZL7C 1WI7A 1QKWA 3GBQA 2VVKA 3I5RA 2LMJA 2HEQA 2W10A 5IH2A 4J9BA 2AK5A 2RQVA 5HCKA 2CUDA 2RQRA 4KRTA 1W1FA 4HVUA 3VS4A 2EQIA 1SPKA 1BU1A 1SHFA 3PE0A 4JJDA 4GLMA 1W70A 1ABOA 3EGUA 1MV3A 1VYVA 3M0TA 4AG1C 1T0JA 4LUDA 1JU5C 1AWWA 1K0XA 2MCNA 2DLPA 1X6BA 2D1XA 3R6NA 3NGPA 4JJCA 2EW3A 2D8HA 4OMOA 2K6DA 4GBQA 2GTJA 1X43A 3LH5A 4OMPA 1KJWA 1PRMC 1V1CA 1JXMA 1UHCA 2D0NA 2LJ0A 1UGVA 5IXBA 1WIEA 1E6HA 2J05A 2ESWA 1M3BA 3RNJA 3THKA 3VS2A 3EG1A 1I1JA 1OEBA 1B3QA 2HDAA 4EIKA 4CC3A 2GGRA 2PNIA 1K4US 2F2XA 2NUZA 1QKXA 2DA9A 3C0CA 1PHTA 3EG3A 3M0SA 1AWOA 1XOVA 2J6OA 1J3TA 1GL5A 2CUBA 4CC4B 3ULRB 1WA7A 2RQWA 4OMQA 2EYYA 3CQTA 2JMAA 1QWFA 1OOTA 1UFFA 2O2OA 1K1ZA 1Y57A 2J7IA 1AWXA 2FO0A 2KBTA 2FEIA 1JQQA 2K79A 3VS6A 3RBBB 2FRYA 3U23A 1YWOA 4AFQC 4F17A 1GCQA 3VS1A 1JO8A 1M8MA 2RF0A 2VKNA 2I0NA 2K7AA 4AFZC 3NPFA 4RTTA 1YCSB 2DM1A 1PKSA 2ABLA 1H92A 2O9VA 2DF6A 2PZ1A 1OPKA 2RNAA 5FWCA 3REBB 1KFZA 1FYNA 1N5ZA 1ZSGA 2ROLA 2YT6A 2YUPA 4LE9A 1SRMA 5IHKA 1ZUKA 1SRLA 2EBPA 2CT3A 1RI9A 2D8JA 1X27A 2JS0A 5GJVB 2A37A 2RQUA 2RN8A 2KXDA 3I9QA 4CC7A 1NLPC 2ROTA 2DRKA 2LJ1A 2KXCA 2GQIA 1WXUA 2YUOA 4ORZA 4A63B 1SHGA 2KYMA 2GBQA 2JXBA 2KGTA 2A36A 1KIKA 4X1VA 1NEBA 2KE9A 1JXOA 1GFDA 3QWYA 2KR3A 3NHNA 1UUEA 1K9AA 2JS2A 2MOXA 2SRCA 3M0RA 3H0HA 2EGCA 3PVQA 2FG0A 1U5SA 1I0CA 3A98A 2C0OA 2DMOA 4HVWA 2IIMA 1X69A 3UF4A 1S1NA 2DILA 4LNPA 3H0IA 1Y0MA 2QDLA 2K3BA 2RPNA 2L3QA 1K76A 4IIOA 4J9FA 2CH4A 2JMCA 2JTEA 3TVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG2 A;  2AZS A;  2O31 A;  1AWJ A;  2DYB A;  2LP5 A;  3UA7 A;  1CSK A;  1Z9Z A;  2DNU A;  4HXJ A;  2DL4 A;  1MUZ A;  3IQL A;  4D8K A;  4DEX A;  4M4Z A;  2KRN A;  2PTK A;  5FWB A;  2HCK A;  5IHI A;  1AD5 A;  1WFW A;  2JW4 A;  1H3H A;  1WXT A;  1WDX A;  2EGE A;  1OPL A;  2CDT A;  1QCF A;  2E5K A;  1CKB A;  2SEM A;  2HBW A;  2KEA A;  1BBZ A;  2JM8 A;  1UHF A;  2BTT A;  3EG0 A;  2J6K A;  3JV3 A;  2C0I A;  1TUC A;  1Z9Q A;  4K11 A;  5FW9 A;  1WLP B;  3I5S A;  1UG1 A;  2LX7 A;  4CC2 A;  2BZX A;  1GRI A;  4JZ3 A;  4D8D A;  4JJB A;  1B07 A;  1BB9 A;  2EGA A;  4LUE A;  5L23 A;  2K9G A;  2VWF A;  3SEM A;  4RTV A;  2KNB B;  2LZ6 B;  1ABQ A;  1AOJ A;  1T3S A;  2CRE A;  2FPF A;  1QLY A;  2K2M A;  4OMM A;  2DL8 A;  4J9H A;  2L0A A;  2LNH B;  1PWT A;  2DBK A;  2EYX A;  3SHW A;  2ED1 A;  2YUN A;  1T3L A;  2LJ3 A;  2X3X D;  4Z88 A;  1NYF A;  2J6F A;  2LCS A;  2BZ8 A;  2YDL A;  2JM9 A;  2FRW A;  4WCI A;  3VS0 A;  3PVL A;  1UE9 A;  2CSQ A;  1HSQ A;  1ARK A;  2O88 A;  1GFC A;  2KT1 A;  4AFU C;  2AKK A;  2DX1 A;  2FPE A;  1UJ0 A;  3M0Q A;  1SSH A;  1PRL C;  2DBM A;  2G6F X;  1G83 A;  2OI3 A;  2GTO A;  2L3S A;  5EC7 A;  5ECA A;  3H41 A;  2W0Z A;  2F2V A;  1X6G A;  1X2Q A;  2H8H A;  3UA6 A;  3NMZ C;  1UDL A;  2RMO A;  2AKL A;  3O5Z A;  3KFV A;  5I22 A;  3UAT A;  3TSW A;  1TUD A;  1QWE A;  4RUG A;  1M3A A;  2X3W D;  1NM7 A;  3VS3 A;  1YWP A;  2CT4 A;  3REA B;  4J9I A;  4HCK A;  2JT4 A;  1CKA A;  2DL7 A;  4E6R A;  4J9C A;  2M0Y A;  4R0K A;  2DRM A;  1K0S A;  1LCK A;  1AZG B;  2OJ2 A;  1KSW A;  4JPB W;  2CH4 W;  2EPD A;  4F14 A;  2LQW A;  1GBR A;  2DVJ A;  1RUW A;  3EHR A;  2EKH A;  4RTW A;  1YN8 A;  1YP5 A;  1TG0 A;  3H0F A;  4AG2 C;  2NWM A;  1SEM A;  3FJ5 A;  5IXF A;  1NEG A;  2L3P A;  4OMN A;  4DEY A;  2J06 A;  1FMK A;  2ED0 A;  4Z8A A;  1OV3 A;  3I35 A;  1RLQ C;  2V1Q A;  1A0N B;  4FSS A;  4ZNX A;  2FPD A;  2F2W A;  5IHN A;  3M0U A;  1AVZ C;  5I11 A;  2O9S A;  2ENM A;  1E7O A;  5GJW B;  2KYB A;  3VS5 A;  2B86 A;  1X2K A;  2EYZ A;  2DL5 A;  3VRZ A;  1MV0 B;  4J9G A;  1NLO C;  2RQT A;  1HJD A;  2KRO A;  2BZY A;  1NG2 A;  4Z89 A;  2YUQ A;  4LN2 A;  4AFS C;  4RTY A;  1M3C A;  1ZUY A;  4RTX A;  1E6G A;  1RLP C;  1AZE A;  2EVR A;  4J9D A;  2KRM A;  4RTZ A;  1PNJ A;  1BK2 A;  2C0T A;  2M51 A;  3QWX X;  1HD3 A;  1U3O A;  1H8K A;  1ZBJ A;  4HVV A;  2A08 A;  1VYT A;  1WYX A;  1GBQ A;  1YNZ A;  4F16 A;  1UTI A;  4IIM A;  4JZ4 A;  2MIO A;  3VRY A;  1I07 A;  2DE0 X;  1ZLM A;  2A28 A;  2KRS A;  2XMF A;  1ZUU A;  2HSP A;  2DL3 A;  1VYU A;  4QT7 A;  1WXB A;  1ZX6 A;  1VA7 A;  4Y92 A;  2EYW A;  2L2P A;  2YSQ A;  1G2B A;  1IO6 A;  2ECZ A;  1EFN A;  1M27 C;  3TSZ A;  2DJQ A;  3M0P A;  1UEC A;  1JEG A;  1M30 A;  3EHQ A;  4RTU A;  1NYG A;  2GNC A;  1GCQ C;  1T0H A;  4J9E A;  1GCP A;  1W6X A;  1WX6 A;  2OAW A;  3VS7 A;  2V1R A;  2KT8 A;  1PKT A;  4OML A;  4ESR A;  1U06 A;  1UJY A;  2AZV A;  1AEY A;  2CSI A;  2P4R A;  2LQN A;  3ZL7 C;  1WI7 A;  1QKW A;  3GBQ A;  2VVK A;  3I5R A;  2LMJ A;  2HEQ A;  2W10 A;  5IH2 A;  4J9B A;  2AK5 A;  2RQV A;  5HCK A;  2CUD A;  2RQR A;  4KRT A;  1W1F A;  4HVU A;  3VS4 A;  2EQI A;  1SPK A;  1BU1 A;  1SHF A;  3PE0 A;  4JJD A;  4GLM A;  1W70 A;  1ABO A;  3EGU A;  1MV3 A;  1VYV A;  3M0T A;  4AG1 C;  1T0J A;  4LUD A;  1JU5 C;  1AWW A;  1K0X A;  2MCN A;  2DLP A;  1X6B A;  2D1X A;  3R6N A;  3NGP A;  4JJC A;  2EW3 A;  2D8H A;  4OMO A;  2K6D A;  4GBQ A;  2GTJ A;  1X43 A;  3LH5 A;  4OMP A;  1KJW A;  1PRM C;  1V1C A;  1JXM A;  1UHC A;  2D0N A;  2LJ0 A;  1UGV A;  5IXB A;  1WIE A;  1E6H A;  2J05 A;  2ESW A;  1M3B A;  3RNJ A;  3THK A;  3VS2 A;  3EG1 A;  1I1J A;  1OEB A;  1B3Q A;  2HDA A;  4EIK A;  4CC3 A;  2GGR A;  2PNI A;  1K4U S;  2F2X A;  2NUZ A;  1QKX A;  2DA9 A;  3C0C A;  1PHT A;  3EG3 A;  3M0S A;  1AWO A;  1XOV A;  2J6O A;  1J3T A;  1GL5 A;  2CUB A;  4CC4 B;  3ULR B;  1WA7 A;  2RQW A;  4OMQ A;  2EYY A;  3CQT A;  2JMA A;  1QWF A;  1OOT A;  1UFF A;  2O2O A;  1K1Z A;  1Y57 A;  2J7I A;  1AWX A;  2FO0 A;  2KBT A;  2FEI A;  1JQQ A;  2K79 A;  3VS6 A;  3RBB B;  2FRY A;  3U23 A;  1YWO A;  4AFQ C;  4F17 A;  1GCQ A;  3VS1 A;  1JO8 A;  1M8M A;  2RF0 A;  2VKN A;  2I0N A;  2K7A A;  4AFZ C;  3NPF A;  4RTT A;  1YCS B;  2DM1 A;  1PKS A;  2ABL A;  1H92 A;  2O9V A;  2DF6 A;  2PZ1 A;  1OPK A;  2RNA A;  5FWC A;  3REB B;  1KFZ A;  1FYN A;  1N5Z A;  1ZSG A;  2ROL A;  2YT6 A;  2YUP A;  4LE9 A;  1SRM A;  5IHK A;  1ZUK A;  1SRL A;  2EBP A;  2CT3 A;  1RI9 A;  2D8J A;  1X27 A;  2JS0 A;  5GJV B;  2A37 A;  2RQU A;  2RN8 A;  2KXD A;  3I9Q A;  4CC7 A;  1NLP C;  2ROT A;  2DRK A;  2LJ1 A;  2KXC A;  2GQI A;  1WXU A;  2YUO A;  4ORZ A;  4A63 B;  1SHG A;  2KYM A;  2GBQ A;  2JXB A;  2KGT A;  2A36 A;  1KIK A;  4X1V A;  1NEB A;  2KE9 A;  1JXO A;  1GFD A;  3QWY A;  2KR3 A;  3NHN A;  1UUE A;  1K9A A;  2JS2 A;  2MOX A;  2SRC A;  3M0R A;  3H0H A;  2EGC A;  3PVQ A;  2FG0 A;  1U5S A;  1I0C A;  3A98 A;  2C0O A;  2DMO A;  4HVW A;  2IIM A;  1X69 A;  3UF4 A;  1S1N A;  2DIL A;  4LNP A;  3H0I A;  1Y0M A;  2QDL A;  2K3B A;  2RPN A;  2L3Q A;  1K76 A;  4IIO A;  4J9F A;  2CH4 A;  2JMC A;  2JTE A;  3TVT A; 
#chains in the Genus database with same CATH topology
 3EG2 A;  1S72 T;  2AZS A;  4EDU A;  4ELY C;  1VQK Q;  3UA7 A;  1CSK A;  4M7D C;  1VQN Q;  2DL4 A;  3CCM Q;  3CCM A;  5HY6 A;  3JB9 F;  4M4Z A;  3URG A;  2JN0 A;  3CCQ Q;  4HA8 A;  2CZ7 B;  5FWB A;  5IT9 E;  1Y96 B;  1RAD B;  1DJ7 B;  1BIA A;  3LLR A;  4DBF A;  2E6N A;  3VKI A;  2KEA A;  1BBZ A;  5D6Y A;  1JJ2 P;  1VUB A;  2JM8 A;  3OW2 P;  3M4Y A;  3J81 E;  2BTT A;  1NE8 A;  3ME9 A;  1TUC A;  3TEE A;  2GFU A;  3CEY A;  3CBM A;  1WLP B;  2V8J A;  3I5S A;  2LX7 A;  4VUB A;  4M7D G;  2BZX A;  1HXD A;  1RAG B;  4Z02 A;  2OTJ A;  1PD1 A;  5KCH A;  4D8D A;  1U8R A;  1NPR A;  4PJO D;  3WVD B;  2K9G A;  2VWF A;  4RTV A;  2LZ6 B;  1YI2 T;  2RM4 A;  3UPU A;  3HRT A;  1ABQ A;  2EWN A;  1AOJ A;  2FPF A;  1QLY A;  1SKU B;  3SB2 A;  2VC8 A;  3CCQ T;  2ZPG B;  2DL8 A;  1PWT A;  3DLL A;  2YUN A;  2LJ3 A;  4Z88 A;  1NYF A;  2E4H A;  1VQ4 T;  2LCS A;  4LD9 K;  3KUF A;  2FVU A;  2CSQ A;  1X75 C;  1ARK A;  3OS5 A;  2KT1 A;  4AFU C;  1KD1 R;  2AKK A;  2FPE A;  1U1T A;  2NUT B;  3M0Q A;  3HP9 A;  4PLL A;  2DFU A;  5EC7 A;  1FMW A;  4E47 A;  4OGC A;  2F2V A;  2WSE E;  3JCM g;  3CCU T;  2H8H A;  1K9M R;  3HRS A;  1S72 Q;  3MEW A;  1JBM A;  2DYI A;  4RUG A;  1YJN T;  2X3W D;  4IUQ A;  4OB0 B;  2VUB A;  4KGZ B;  3RKW A;  1LJO A;  3NTH A;  4C5E A;  4PJJ A;  4DBH A;  1KHC A;  2DL7 A;  2HBP A;  4E6R A;  1VQO Q;  4BY6 C;  3S6W A;  2CH4 W;  4M78 A;  4MZM A;  4F14 A;  2LQW A;  2ZPF B;  1RUW A;  1VQL T;  1YN8 A;  3X26 B;  3H0F A;  5LJ3 h;  4D6W A;  1NEG A;  4OMN A;  3OYY A;  1M9S A;  1M1K C;  2ED0 A;  4FL6 A;  3G71 A;  4M7D F;  2XDB A;  5FRO A;  1D1B A;  1RAA B;  2FPD A;  4J6Y A;  2HAX A;  2QEX T;  3OYM A;  1UB4 A;  5GAN d;  4XU1 A;  1AVZ C;  3PNW C;  1ZHI A;  1WJS A;  4L5G A;  2ENM A;  1E7O A;  4OB1 B;  5GAM f;  1YJW T;  4FM4 B;  2JUF A;  2DL5 A;  1N8R R;  1NLO C;  1VQ6 A;  2KRO A;  5FLX E;  4Z89 A;  4AFS C;  4RTY A;  2R57 A;  4IUT A;  1TSF A;  1ZUY A;  4RTX A;  1QP3 A;  1E6G A;  4C92 G;  3JCM Q;  2LVM A;  4XU2 A;  1PNJ A;  2ZPE B;  1H8K A;  1VQ6 Q;  1WYX A;  2Y4X A;  1GBQ A;  4LDU A;  2FHD A;  4IIM A;  2D6F A;  3CD6 Q;  1MGQ A;  2MIO A;  5IAY A;  2DE0 X;  3JCM e;  2F5T X;  2QGG A;  5FU7 C;  1LNX A;  1VYU A;  3S3N A;  3HKS A;  4Y92 A;  2EYW A;  2EQM A;  3OYN A;  2P4T A;  4E7J A;  4HKE A;  1M27 C;  2QXF A;  4BI8 B;  1UEC A;  2P0Q A;  1OZ3 A;  3SWN B;  1JEG A;  1M30 A;  3EHQ A;  4RTU A;  2GNC A;  1GCQ C;  5GAM h;  2QA4 A;  2DXT A;  1VQ4 Q;  2KT8 A;  2IPO B;  1R0B G;  2JTF A;  1PKT A;  1XQH A;  3SWN A;  1U1S A;  1V76 A;  1U06 A;  1UJY A;  2EJG A;  1VQO T;  2HQH A;  4M7A B;  3ZL7 C;  5KYU A;  1K9M U;  1WI7 A;  3GBQ A;  1BIB A;  3CME A;  2KVQ G;  1NJI R;  2HQE A;  1ZSZ B;  1M1F A;  2RHI A;  2AK5 A;  4JUV A;  2RJF A;  3EGX B;  3PMT A;  3QDR B;  2XI9 A;  4HVU A;  4QQG A;  4QVD A;  1W70 A;  3JCM P;  1Y96 A;  3M0T A;  1K0X A;  2D1X A;  1KC8 C;  3R6N A;  4OMO A;  2K6D A;  1VIE A;  1YI2 A;  3EG9 A;  3V8L A;  2M16 A;  1PRM C;  1V1C A;  4B6M A;  5FU6 C;  1MNE A;  4C5I A;  3JCM h;  5IXB A;  1E6H A;  2J05 A;  2KQW A;  1I8F A;  2X35 A;  3RUX A;  5KYW B;  3VS2 A;  2E5Q A;  2X4J A;  3MP6 A;  5CAI A;  1OEB A;  1B3Q A;  1V29 B;  1MMD A;  2KSS A;  3CCQ A;  4CC3 A;  4NL2 A;  1QKX A;  2RK1 A;  5LJ5 f;  2X4X A;  1AWO A;  1XOV A;  5EG2 A;  4CC4 B;  4N0A A;  4OMQ A;  3V8K A;  1K1Z A;  3JCM b;  5LJ3 j;  1PG5 B;  1K8A C;  1Y57 A;  3QZ5 B;  1FWZ A;  1OUL A;  4C0D B;  2KBT A;  4JRI A;  1JQQ A;  2CP7 A;  4L6V 5;  3CCM T;  1QQJ A;  4C0G A;  2ZGW A;  3EH1 A;  2OTJ Q;  3CXC P;  3VS1 A;  3M54 A;  2HL3 A;  2HQX A;  3Q1J A;  4C92 B;  2ZZD A;  3GF5 A;  1H92 A;  9ATC B;  4PJO C;  2DF6 A;  2RNA A;  1OPK A;  4ZN3 A;  2O01 E;  1BI1 A;  1N5Z A;  1X6O A;  2E41 A;  4BDZ A;  2MMP A;  2I2L A;  2PUK B;  3M56 A;  1OQK A;  4EMG A;  1XNI A;  2CT3 A;  2WSC E;  1G3S A;  4EPC A;  4M78 F;  2NUT A;  3RMQ A;  1KC8 U;  1OX8 A;  4BAC A;  1X01 A;  3LWI A;  3OYF A;  1VQ7 A;  3LYI A;  3CCS Q;  2DRK A;  4WF2 A;  3P8D A;  3EFR A;  1VQP Q;  1Q82 C;  2GQI A;  2YLC A;  2YXY A;  1H64 1;  3QKJ A;  3BW1 A;  4ORZ A;  4A63 B;  3MEU A;  4JS4 A;  3RKY A;  4BE2 A;  4PFP A;  5KYX B;  2KGT A;  1D1A A;  2P0P A;  2KE9 A;  1D3B A;  2NUP B;  3QWY A;  4PK4 A;  1IGQ A;  2H3J A;  3VV0 A;  3M58 A;  3CCJ Q;  2CZ0 B;  4PJO F;  2SRC A;  2OTL A;  3OSV A;  1N8R U;  2CP0 A;  2EGC A;  5LJ5 j;  1WHG A;  2DMO A;  3C95 A;  4J7F A;  2CP2 A;  4QQ6 A;  1S1N A;  4CRI A;  1YIJ Q;  3E2U A;  2K3B A;  2RPN A;  4NOY A;  2CP6 A;  2L3Q A;  4DBR A;  1UEB A;  3TVT A;  2O31 A;  2DYB A;  1N9S A;  1Z9Z A;  3G4S A;  4XK8 E;  5GAN 3;  3J7A F;  4D8K A;  4DQ2 A;  1WGS A;  2PTK A;  2DD5 A;  1M1G A;  4FIB A;  2JW4 A;  3P8H A;  4RG2 A;  3FLG A;  2BUD A;  4M7D A;  1WDX A;  3CD6 A;  5CKE A;  3M55 A;  4FYY B;  1QCF A;  5C6S A;  2SEM A;  2E12 A;  2HBW A;  5GAO n;  4PJN A;  2J6K A;  2LRQ A;  3CC7 T;  1VQL A;  4HT9 A;  1KC8 R;  2XU8 A;  3V7R A;  3MET A;  3JCM J;  5GMK h;  1K9M C;  5AT1 B;  2VAS A;  1XTD A;  1MMG A;  2DK3 A;  1VQ5 Q;  1B07 A;  3OS0 A;  3A8M B;  5I2M A;  1M90 C;  5J3B A;  4M7A A;  5L23 A;  3MKD A;  2PVG B;  2KNB B;  1Y7X A;  2XD0 A;  3EGX A;  4M75 B;  4R55 A;  2K2M A;  3UDC A;  1I5O B;  4J9H A;  2EYX A;  2ED1 A;  3A8G B;  2KY9 A;  2QA4 Q;  2X3X D;  4FYW B;  2J6F A;  4MZT A;  2M1H A;  1M8V A;  2FRW A;  4WCI A;  3VS0 A;  1QVG A;  4FYV B;  1UE9 A;  3VYH B;  5M9O A;  4R56 A;  2H3E B;  5KE2 A;  2EQJ A;  2QEX Q;  1PRL C;  1HYO A;  3QII A;  2OI3 A;  4M77 G;  3OYB A;  3ZBD A;  1X2Q A;  4RG8 A;  1UDL A;  2RMO A;  3H8Z A;  3O5Z A;  5I22 A;  3JB9 H;  3TSW A;  4BE1 A;  3QYG B;  2D9T A;  4L59 A;  5GAN h;  3JB9 I;  1M3A A;  1YJW A;  3CC2 A;  5L8R E;  1IZ6 A;  4HCK A;  1Q7Y C;  2JT4 A;  2OTJ T;  1KG1 A;  4OB2 B;  4R0K A;  1LCK A;  1TXQ A;  5CVI A;  3JCM f;  5HKC A;  2DVJ A;  3EHR A;  4B9W A;  1YP5 A;  4M77 D;  2V8I A;  2NWM A;  2XID A;  3FJ5 A;  5IXF A;  3HTR A;  4C8Q E;  2J06 A;  5CO7 A;  4WTO B;  4HCC A;  3OSS C;  2DKG A;  2DD4 A;  3I35 A;  4J7I A;  1QVF S;  1A0N B;  4PLI A;  3N5B B;  4XTV A;  1WPY A;  4FT2 A;  3CCR A;  3CCR Q;  3I56 T;  1IHW A;  5GJW B;  4M77 E;  3VS5 A;  4BI3 A;  2B86 A;  1X2K A;  2EYZ A;  3BE3 A;  4J9G A;  2RQT A;  1VQ5 A;  4M7A E;  2RH2 A;  4QVZ A;  2YUQ A;  1VQ5 T;  4BB7 A;  1S72 A;  3P8B B;  2V26 A;  3M5A A;  4OMF B;  1RLP C;  1D1C A;  2EVR A;  3QPH A;  2KRM A;  4RTZ A;  5KE3 A;  5GMK i;  2M51 A;  1U3O A;  4C8Q F;  3A8L B;  2IVW A;  4V2S A;  4M75 F;  1I07 A;  3QBY A;  2A28 A;  2HSP A;  2DL3 A;  3H9N A;  3CXC A;  1VA7 A;  5DLO A;  2QQ9 A;  1BKB A;  1UGR B;  1XJW B;  4EMK A;  2DJQ A;  2VYT A;  4FCY A;  2L5Q A;  2HNI A;  2VGM A;  3MP8 A;  2AHJ B;  3RDV A;  5GMK m;  1GCP A;  1KD1 C;  2NYS A;  2K3Y A;  3OA6 A;  4J6W A;  3RKX A;  2CSI A;  3QYH B;  4C92 C;  4EMK C;  3L2Q A;  5LJ5 e;  2LQN A;  2QQA A;  1W2B A;  4C5H A;  2LMJ A;  2HEQ A;  4A4F A;  3CCS A;  2W10 A;  5IH2 A;  2RJC A;  4J9B A;  1VQM Q;  3L2V A;  5GAN 2;  1MHN A;  1D0X A;  1Q86 R;  5CK9 A;  4PKC C;  1SPK A;  4GLM A;  1ABO A;  3D7S B;  3I56 Q;  1MV3 A;  1VYV A;  3NFC A;  1VQ8 T;  1T0J A;  4KGV B;  4M78 G;  3JCM X;  2MCN A;  2DLP A;  4JJC A;  2EW3 A;  2ZCF B;  4M75 C;  1TOV A;  2MPX C;  7AT1 B;  1WNL A;  1X43 A;  3LH5 A;  1WJR A;  3T9N A;  5CKD A;  3LGL A;  1KJW A;  1M1K U;  1JXM A;  1UHC A;  1AHJ B;  1WQ7 A;  2D0N A;  3GIB A;  1M4Z A;  4C5G A;  2LJ0 A;  1UGV A;  3QXE B;  2MYS A;  1WIE A;  1YIJ A;  1Q7Y U;  3RNJ A;  1Y07 A;  3G4S Q;  3HHT B;  3M4G A;  1I1J A;  4XTX A;  3VYG A;  2M0O A;  1IB8 A;  1QMC A;  1VQM T;  2CP3 A;  2F2X A;  4E7I A;  5HK3 A;  2DA9 A;  1PHT A;  1QVP A;  2K5F A;  1GL5 A;  1M90 R;  5CQY A;  1N6A A;  2RQW A;  4KH1 B;  4M7A G;  3UWN A;  2JMA A;  4II1 A;  1OOT A;  2O2O A;  4M75 A;  1ZSZ A;  1VQ7 Q;  5FRN A;  2FEI A;  3OYA A;  3G7Z A;  2K79 A;  4XTY A;  1IXD A;  2V8K A;  4AFQ C;  4F17 A;  2JZ2 A;  4QKU A;  1M8M A;  2RF0 A;  2VKN A;  2I0N A;  3NPF A;  3EFS A;  5J26 A;  5GAN j;  2O9V A;  5FWC A;  3RES A;  3LGF A;  4JLG A;  4N4I A;  2DIG A;  3REB B;  4A53 A;  1ZSG A;  4C8Q G;  2QAZ A;  3EFO B;  3CC4 Q;  5GAN 5;  2EJ9 A;  4E2F B;  2E70 A;  2CKK A;  2JTM A;  3PTA A;  2BE7 D;  1YHQ Q;  2FYK A;  1RI9 A;  2D8J A;  1X27 A;  2JS0 A;  3MP1 A;  2DZ9 A;  2E3H A;  3OB9 A;  2R5M A;  4M7A D;  5DM7 R;  4XQ3 A;  2Y90 A;  2KXD A;  4KUD K;  4ZTJ A;  1NLP C;  2K57 A;  2FZC B;  3CPW S;  5C0M A;  1SSF A;  4LXC A;  4ATO A;  1WXU A;  2JVV A;  1QVG P;  3OW2 S;  4JJN K;  3MEV A;  4M7A C;  2HKQ B;  2JXB A;  3TCJ A;  2DJZ A;  1M2V B;  3WVE B;  1K8A U;  1KIK A;  2O4X B;  1O9S A;  4J5Y A;  1VQ6 T;  1JXO A;  1GFD A;  2KR3 A;  3OS2 A;  3E9F A;  2QDY B;  1K9A A;  3CMA A;  1YIT A;  1M2V A;  3VJP A;  2JS2 A;  4C8Q D;  4DA4 A;  3E1S A;  3H0H A;  4M7D D;  4FSX A;  1EIF A;  2CS7 A;  3PVQ A;  4BE0 A;  3QJY A;  1U5S A;  1I0C A;  2C06 A;  3A98 A;  2Y4Y A;  2QA4 T;  3GNG A;  4C92 A;  4DOW A;  1R8O B;  1X69 A;  3UF4 A;  4A4K A;  4KBM B;  1Y0M A;  2QDL A;  4JRP A;  1K76 A;  2CH4 A;  1VQ7 T;  2JMC A;  4M77 F;  3X28 B;  3CCV A;  1AWJ A;  3CCL Q;  2LP5 A;  4LDX A;  4HXJ A;  4ME7 A;  3OYJ A;  2LTO A;  4XU3 A;  4DEX A;  2KRN A;  3HRU A;  3ASK A;  3A8H B;  2HCK A;  5IHI A;  2F69 A;  2E10 A;  2F5K A;  1H3H A;  4OP0 A;  4PJL A;  1WXT A;  4HCZ A;  3CC2 T;  2G3R A;  4EMK B;  2EGE A;  1M90 U;  1OPL A;  1K73 R;  4FU6 A;  3CCE T;  2E5K A;  3HPW A;  4AT1 B;  2AT1 B;  1UHF A;  1RAI B;  4JS5 A;  2K5I A;  3EG0 A;  5FW9 A;  3KXT A;  3EH2 A;  4HT8 A;  4A4H A;  3X24 B;  3CME Q;  4C92 D;  2OAU A;  1W2B S;  4LDV A;  4M78 E;  5DLQ E;  1B7T A;  1RAB B;  4PJO E;  1BI0 A;  1TS9 A;  2EGA A;  2JJ9 A;  3SFM A;  4QVC A;  4LUE A;  3F70 A;  3SEM A;  5LJ3 g;  1NPP A;  2LCL A;  1BCO A;  5KYU B;  1YJW Q;  1T3S A;  4Y28 E;  2P84 A;  4OMM A;  2CYZ B;  5GAM d;  1OI1 A;  4C8Q B;  2DBK A;  3SHW A;  4X9D A;  5J39 A;  3CCE A;  1T3L A;  4N4H A;  1FXX A;  3EGD A;  1KQ1 A;  2YDL A;  4N0A C;  2JM9 A;  4PNO A;  2QGF B;  2MWO A;  3QUI A;  3V7S A;  2DZC A;  2O88 A;  1GFC A;  2DX1 A;  2QYZ A;  2DBM A;  3OBW A;  2GTO A;  3OYL A;  3QJ6 A;  5ECA A;  3H41 A;  4J8O A;  1D0Y A;  1M5Q 1;  2L8D A;  2AKL A;  3G1J A;  1PM3 A;  5KYN A;  5A0G A;  5GAN 8;  4PJO A;  2YRD A;  3SDZ A;  1TTH B;  2D0Q B;  3CCU Q;  1KQS P;  3VS3 A;  1JJ2 S;  1VIF A;  2X9H A;  4KGX B;  2CT4 A;  4J9I A;  4E7Z A;  2RA2 A;  2DPP B;  1CKA A;  2EIF A;  3MO8 A;  2K3X A;  1NJI C;  5DY9 A;  3S3O A;  1KSW A;  4JPB W;  3HSB A;  1GBR A;  2RO0 A;  3CCU A;  1H3Z A;  1G8X A;  2L3P A;  5GAN g;  1EX4 A;  3FDR A;  2QQR A;  1Q7Y R;  1OV3 A;  2NLU A;  2KAF A;  2V1Q A;  4FSS A;  1TUG B;  4ZNX A;  2PQW A;  3L2W A;  3CCV Q;  2F2W A;  5IHN A;  1QP2 A;  3M0U A;  5I11 A;  2A0F B;  1F1B B;  4KUL A;  1RL2 A;  4DOV A;  5GAO p;  4MML A;  1FMV A;  2RHU A;  3EFO A;  4ZGJ B;  2OTL T;  3VRZ A;  4F7U F;  2BZY A;  1NG2 A;  1G5V A;  1OX9 A;  4MZP A;  4M7D E;  3PMI A;  3OYC A;  4BI4 A;  4FW2 A;  3G6E T;  3OBY A;  3TQ7 P;  5CCA A;  5KH6 A;  2VXE A;  2YRC A;  2RHX A;  2DER A;  2LQ8 A;  2XDD A;  1VQ9 T;  2C0T A;  1HD3 A;  3QG1 A;  2EFI A;  4Y91 A;  1WHH A;  1ZBJ A;  4HVV A;  1N27 A;  1Q82 U;  2A08 A;  3CCE Q;  3PIO A;  4F16 A;  2QTX A;  3KBG A;  3QHS A;  3TRE A;  1UTI A;  5CKF A;  2DXC A;  3VRY A;  1W4S A;  4FT4 A;  3OYK A;  1VQO A;  3CCV T;  1QCN A;  2EQK A;  2YSQ A;  1G2B A;  2DTH A;  4N4G A;  1IGU A;  1LVK A;  4JRQ A;  4XTU A;  4OF1 A;  4B9X A;  1VQK A;  3OY9 A;  4F7U E;  2E64 A;  1NYG A;  1Y71 A;  4GLK A;  1T0H A;  1VQK T;  4J9E A;  5A0L A;  1W6X A;  1WX6 A;  2OAW A;  5LJ3 d;  3VS7 A;  4QQD A;  1D3B B;  4OML A;  5GAM e;  1M1K R;  2DO3 A;  3OYG A;  1G3W A;  1SF9 A;  2YWW A;  2AZV A;  1HK9 A;  1VOM A;  1AEY A;  3GOX A;  4MDX A;  1VQ9 Q;  2P4R A;  4QW2 A;  1QKW A;  2CZ1 B;  2VVK A;  3I5R A;  2O4X A;  3CPW A;  2MWP A;  3EAE A;  2M9U A;  1YIJ T;  5HCK A;  2CUD A;  1YJ9 T;  4KRT A;  2DXB A;  3VS4 A;  4BD3 A;  2EQI A;  2DET A;  4DBQ A;  2HSE B;  1BU1 A;  3S3M A;  2RHY A;  2M02 A;  3OYI A;  3EGU A;  4MDW A;  4AG1 C;  4ZGD B;  5GAN f;  1X6B A;  4OVA A;  2D8H A;  4GBQ A;  5LJ5 d;  4OMP A;  5I2S A;  2K5L A;  4ZGE B;  2YHT A;  3JCM c;  1PSF A;  4MMK A;  3GLX A;  5CIU A;  4PL6 A;  1IRE B;  2ESW A;  2DEQ A;  2VGN A;  1VQP T;  5AYF A;  3THK A;  3FIF A;  3EG1 A;  5GMK e;  2FZG B;  1NJI U;  2QQS A;  2R5A A;  3CC4 T;  1PSE A;  2KMT A;  2K4Y A;  1K4U S;  2PNI A;  1I81 A;  5CQX A;  2R58 A;  3M0S A;  3V7C A;  2J6O A;  1Q82 R;  5LJ5 g;  1J3T A;  2CUB A;  1K73 U;  1VQP A;  2LQK A;  2RI2 A;  1WA7 A;  1OZ2 A;  1UFF A;  1ZA1 B;  2J7I A;  3DB4 A;  1AWX A;  4M78 C;  3VUZ A;  4F7U A;  3L1A A;  4C8Q A;  2RHZ A;  5KYY B;  2FRY A;  1QVF P;  1VQN T;  2COW A;  1VQM A;  2RB6 A;  3I55 A;  2ZPI B;  3CCJ A;  3MCA B;  2K7A A;  3ZEH A;  1YCS B;  3QSU A;  1PKS A;  3RIR A;  5GAO m;  2ZAE A;  1AT1 B;  4O6J A;  3I56 A;  2YT6 A;  1PD0 A;  2YUP A;  4PJO B;  1ZSZ C;  3AHU A;  1SRM A;  3NTI A;  1WHM A;  4M75 E;  1YJN A;  3M9Q A;  4RMO A;  1BYM A;  4NL3 A;  3L42 A;  1N8R C;  5CKB A;  2IG0 A;  1YIT T;  3CMA T;  3X20 B;  1FX7 A;  2A37 A;  5I21 A;  3DLM A;  2RD1 A;  2RN8 A;  3I9Q A;  3VU3 C;  4PJM A;  4CC7 A;  3GPL A;  1YI2 Q;  2YRV A;  4A4G A;  4OB3 B;  6AT1 B;  5KYW A;  1VQ8 Q;  1G3Y A;  2KYM A;  1YBY A;  2HZY A;  2OX7 A;  3G6E Q;  3BFM A;  4X9C A;  4RCB A;  4LDW A;  2A36 A;  4X1V A;  1NEB A;  2PVO B;  5GAN 7;  2LDM A;  1UUE A;  1VQ8 A;  1NZ9 A;  2ATC B;  5GAN e;  3C94 A;  2MOX A;  2COZ A;  3HFN A;  2A3L A;  4JLI A;  2FG0 A;  2LC4 A;  1C0M A;  2C0O A;  3CXC S;  4HVW A;  1I4K 1;  3OYD A;  3FC3 A;  3DB3 A;  3H0I A;  2DAQ A;  1D0Z A;  3G71 T;  2QK0 A;  3OW2 A;  3JRZ A;  1WHJ A;  5IN1 A;  2JTE A;  4EMH A;  2RK2 A;  3CC4 A;  2DNU A;  4FW1 A;  2MI6 A;  1OU8 A;  1MUZ A;  3IQL A;  3JB9 D;  4ANJ A;  4C92 F;  4JRK A;  1B34 A;  1KD1 U;  1AD5 A;  1WFW A;  1RAE B;  4M7A F;  2QEX A;  1UGS B;  4NS5 A;  4P5N A;  4KT0 E;  5GAN 6;  3M57 A;  1PCX A;  2CDT A;  3O8V A;  1CKB A;  3JSC A;  4TVR A;  3CC2 Q;  2A7Y A;  4C0Z A;  4C0F A;  3JV3 A;  2C0I A;  1Z9Q A;  4K11 A;  5GMK l;  1UG1 A;  2MAM A;  1SG5 A;  4CC2 A;  1G3T A;  1GRI A;  4XTZ A;  4JZ3 A;  2LCC A;  4JJB A;  2XIC A;  4IUP A;  1BB9 A;  1NBE B;  3A5Z B;  5KYX A;  3NTK A;  3SWN C;  4IUV A;  4XAX B;  2CP5 A;  2DTI A;  2XG8 D;  1WJQ A;  3LW5 E;  3L2U A;  2CRE A;  2EYQ A;  2L89 A;  3M59 A;  3LX7 A;  4BY6 B;  3I55 T;  2EAY A;  2L0A A;  2LNH B;  1UGQ B;  2FZK B;  2GF7 A;  1MMN A;  2RI3 A;  3BDL A;  2BZ8 A;  1WZO A;  3PVL A;  1O75 A;  4E7L A;  4IKF A;  1HSQ A;  5LJ3 f;  4Q5W A;  1LOJ A;  3JB9 J;  1Q86 U;  3PFS A;  1UJ0 A;  3GNF B;  5D6W A;  1SSH A;  2G6F X;  3LH0 A;  3C4S A;  1G83 A;  1VQ4 A;  1IHV A;  2L3R A;  2L3S A;  2X51 A;  3E19 A;  1Q81 C;  5GAO q;  2W0Z A;  3FB9 A;  1X6G A;  2BIV A;  1K8A R;  2JNG A;  5FRM A;  3UA6 A;  2HL5 C;  3NMZ C;  3PGG A;  3KFV A;  3UAT A;  1ACM B;  2LX9 A;  1TUD A;  1TH7 A;  1QWE A;  1Q81 R;  1OU9 A;  3QDF A;  2ZPH B;  2LT1 A;  1NM7 A;  1YWP A;  2JOY A;  2E6Z A;  4M7D B;  2HMA A;  3REA B;  3CCL T;  2PVD B;  4J9C A;  2QI2 A;  2M0Y A;  2DRM A;  1K0S A;  1AZG B;  2OJ2 A;  2EPD A;  2WSF E;  2EKH A;  4RTW A;  3MHX A;  1TG0 A;  4AG2 C;  2GFA A;  1SEM A;  4PFZ A;  5GAM g;  2GQV A;  4DEY A;  3RR6 A;  4E7K A;  5A2Q E;  1FMK A;  2E1H A;  4Z8A A;  1QVG S;  1RLQ C;  3PT9 A;  1TWB A;  4F7U B;  3OYH A;  2LT4 A;  1BCM A;  4CI0 C;  3EGD B;  2O9S A;  2KYB A;  3AT1 B;  4A4E A;  5LL6 S;  1MV0 B;  2DIQ A;  2CGH A;  1HJD A;  3QO3 A;  3EG9 B;  1JB0 E;  1WHL A;  1M2O A;  4LN2 A;  4M77 A;  2OTL Q;  1VQN A;  1JJ2 A;  1C1A A;  1M3C A;  1MND A;  1AZE A;  3JCM W;  3A8O B;  4J9D A;  2VB6 A;  3J80 E;  1BK2 A;  3QWX X;  2MF2 A;  2DEU A;  1R77 A;  1VYT A;  1ZBX A;  1RI0 A;  1YNZ A;  1Q81 U;  4GY5 A;  4JZ4 A;  4BUG A;  3OS1 A;  3E9G A;  2E65 A;  3G4S T;  1ZLM A;  2KRS A;  2XMF A;  1ZUU A;  3JCM V;  5HK0 A;  1RAF B;  4PJO G;  4QT7 A;  1WXB A;  1ZX6 A;  5FU7 B;  3CMA Q;  1YIT Q;  2K2V A;  4HCB A;  1EZZ B;  1YHQ T;  1QVF A;  2L2P A;  3ER0 A;  1IO6 A;  2ECZ A;  1EFN A;  1ZA2 B;  2XHC A;  4O5V A;  4RCC A;  1BI3 A;  2E3I A;  3JB9 G;  3TSZ A;  3M0P A;  4M77 C;  8AT1 B;  3CCL A;  2XKO C;  3JAM E;  2KK4 A;  3A1P A;  2X4Y A;  1I5L A;  5LJ3 e;  3OMC A;  5GAO l;  1YJN Q;  1BI2 A;  2BKD N;  2V1R A;  2P0K A;  4C8Q C;  4ESR A;  3G6E A;  1KQ2 A;  3C12 A;  5CKH A;  1N9R A;  1W2B P;  4IUU A;  4BDY A;  2RI5 A;  4C92 E;  1YFN A;  3CBP A;  4J6X A;  3CBO A;  1PC0 A;  3QZ9 B;  3OYE A;  5GAM j;  2RQV A;  4JDS A;  1YCY A;  1MMA A;  2RQR A;  5CR2 A;  1KQS A;  4YTL A;  1W1F A;  4E7H A;  3MEA A;  2AIR B;  2HD0 A;  2QQB A;  2DTO A;  1SHF A;  3PE0 A;  4JJD A;  1YHQ A;  4KUI A;  1YJ9 Q;  4F04 B;  4LUD A;  1JU5 C;  5GAN 4;  1AWW A;  1RAH B;  1WQW A;  4ZN1 A;  2EKO A;  3NGP A;  4IUR A;  4ELZ C;  1B34 B;  1TU0 B;  2GTJ A;  2XDP A;  3G71 Q;  2RJD A;  4E7S A;  2VXF A;  1YJ9 A;  2QAS A;  1K73 C;  3FRN A;  2X4W A;  4XU0 A;  3FJP A;  3I55 Q;  2F1L A;  1M3B A;  4X34 A;  3CPF A;  2KDS A;  1R0C B;  2NUP A;  4LD6 A;  2EJF A;  1QW1 A;  5GAO r;  3HFO A;  3CPW P;  3CC7 Q;  2QTV A;  3CC7 A;  2HDA A;  3CCJ T;  4EIK A;  2GGR A;  1KQS S;  2YLB A;  1Q95 G;  1JRI A;  2LNV A;  4F7U G;  3V8J A;  1D09 B;  2NUZ A;  3C0C A;  3EG3 A;  3MJX A;  2B8A A;  3DKM A;  3BY7 A;  3MPU B;  3BDU A;  3ULR B;  3H6Z A;  3SD4 A;  2PUO B;  4M78 B;  2EYY A;  2FL7 A;  3CQT A;  2FB7 A;  4AMC A;  1QWF A;  1VQ9 A;  2DXU A;  2FO0 A;  3CME T;  4J83 A;  3CCS T;  5KCO A;  3VS6 A;  3RBB B;  1Q86 C;  1P92 A;  3U23 A;  4KH0 B;  1YWO A;  3L2R A;  2DVE A;  2WAC A;  1GCQ A;  1RAC B;  3X25 B;  1JO8 A;  4OGE A;  2EQU A;  1C6V X;  4AFZ C;  4RTT A;  3FEO A;  3TU4 K;  2DM1 A;  2ABL A;  5LJ5 h;  4PFO A;  3CD6 T;  4LDY A;  2PZ1 A;  2QG9 B;  1KFZ A;  2RJE A;  1FYN A;  2ROL A;  2COY A;  3HL8 A;  1IRX A;  4LE9 A;  5GMK j;  1QCO A;  3GP8 A;  3RMS A;  3OMG A;  5IHK A;  1ZUK A;  1SRL A;  2EBP A;  4M75 D;  2KI7 A;  2VV5 A;  4FYX B;  5GJV B;  4RKU E;  2RQU A;  3R6O A;  2PU9 B;  2ROT A;  2LJ1 A;  1KK7 A;  2HKN A;  4UC4 A;  2KXC A;  3ZFJ A;  3LWH A;  3WXM B;  1VQL Q;  5FU6 B;  2YUO A;  3INZ A;  4ZTF A;  1SHG A;  2MK5 A;  5A0D A;  3UT1 A;  2GBQ A;  3M53 A;  1LPL A;  4M75 G;  1ZQ1 A;  3NHN A;  1UGP B;  3JCM d;  5KYY A;  1KHI A;  3M0R A;  2GCX A;  1OYX A;  4M78 D;  3CCR T;  2Z0W A;  3L2Z A;  3RER A;  2IIM A;  5D7U A;  3PIP A;  3OQ5 A;  2DIL A;  4LNP A;  1GXI E;  4A54 A;  2CZ6 B;  4M77 B;  2ZPB B;  5D6X A;  1WHK A;  3VUB A;  8ATC B;  4IIO A;  2BE9 B;  4J9F A;  2XK0 A;  4XTW A;  4C0D C; 
#chains in the Genus database with same CATH homology
 3EG2 A;  2AZS A;  2O31 A;  1AWJ A;  2DYB A;  2LP5 A;  3UA7 A;  1CSK A;  1Z9Z A;  2DNU A;  4HXJ A;  2DL4 A;  1MUZ A;  3IQL A;  4D8K A;  4DEX A;  4M4Z A;  2KRN A;  2PTK A;  5FWB A;  2HCK A;  5IHI A;  1AD5 A;  1WFW A;  2JW4 A;  1H3H A;  1WXT A;  1WDX A;  2EGE A;  1OPL A;  2CDT A;  1QCF A;  2E5K A;  1CKB A;  2SEM A;  2HBW A;  2KEA A;  1BBZ A;  2JM8 A;  1UHF A;  2BTT A;  3EG0 A;  2J6K A;  3JV3 A;  2C0I A;  1TUC A;  1Z9Q A;  4K11 A;  5FW9 A;  1WLP B;  3I5S A;  1UG1 A;  2LX7 A;  4CC2 A;  2BZX A;  1GRI A;  4JZ3 A;  4D8D A;  4JJB A;  1B07 A;  1BB9 A;  2EGA A;  4LUE A;  5L23 A;  2K9G A;  2VWF A;  3SEM A;  4RTV A;  2KNB B;  2LZ6 B;  1ABQ A;  1AOJ A;  1T3S A;  2CRE A;  2FPF A;  1QLY A;  2K2M A;  4OMM A;  2DL8 A;  4J9H A;  2L0A A;  2LNH B;  1PWT A;  2DBK A;  2EYX A;  3SHW A;  2ED1 A;  2YUN A;  1T3L A;  2LJ3 A;  2X3X D;  4Z88 A;  1NYF A;  2J6F A;  2LCS A;  2BZ8 A;  2YDL A;  2JM9 A;  2FRW A;  4WCI A;  3VS0 A;  3PVL A;  1UE9 A;  2CSQ A;  1HSQ A;  1ARK A;  2O88 A;  1GFC A;  2KT1 A;  4AFU C;  2AKK A;  2DX1 A;  2FPE A;  1UJ0 A;  3M0Q A;  1SSH A;  1PRL C;  2DBM A;  2G6F X;  1G83 A;  2OI3 A;  2GTO A;  2L3S A;  5EC7 A;  5ECA A;  3H41 A;  2W0Z A;  2F2V A;  1X6G A;  1X2Q A;  2H8H A;  3UA6 A;  3NMZ C;  1UDL A;  2RMO A;  2AKL A;  3O5Z A;  3KFV A;  5I22 A;  3UAT A;  3TSW A;  1TUD A;  1QWE A;  4RUG A;  1M3A A;  2X3W D;  1NM7 A;  3VS3 A;  1YWP A;  2CT4 A;  3REA B;  4J9I A;  4HCK A;  2JT4 A;  1CKA A;  2DL7 A;  4E6R A;  4J9C A;  2M0Y A;  4R0K A;  2DRM A;  1K0S A;  1LCK A;  1AZG B;  2OJ2 A;  1KSW A;  4JPB W;  2CH4 W;  2EPD A;  4F14 A;  2LQW A;  1GBR A;  2DVJ A;  1RUW A;  3EHR A;  2EKH A;  4RTW A;  1YN8 A;  1YP5 A;  1TG0 A;  3H0F A;  4AG2 C;  2NWM A;  1SEM A;  3FJ5 A;  5IXF A;  1NEG A;  2L3P A;  4OMN A;  4DEY A;  2J06 A;  1FMK A;  2ED0 A;  4Z8A A;  1OV3 A;  3I35 A;  1RLQ C;  2V1Q A;  1A0N B;  4FSS A;  4ZNX A;  2FPD A;  2F2W A;  5IHN A;  3M0U A;  1AVZ C;  5I11 A;  2O9S A;  2ENM A;  1E7O A;  5GJW B;  2KYB A;  3VS5 A;  2B86 A;  1X2K A;  2EYZ A;  2DL5 A;  3VRZ A;  1MV0 B;  4J9G A;  1NLO C;  2RQT A;  1HJD A;  2KRO A;  2BZY A;  1NG2 A;  4Z89 A;  2YUQ A;  4LN2 A;  4AFS C;  4RTY A;  1M3C A;  1ZUY A;  4RTX A;  1E6G A;  1RLP C;  1AZE A;  2EVR A;  4J9D A;  2KRM A;  4RTZ A;  1PNJ A;  1BK2 A;  2C0T A;  2M51 A;  3QWX X;  1HD3 A;  1U3O A;  1H8K A;  1ZBJ A;  4HVV A;  2A08 A;  1VYT A;  1WYX A;  1GBQ A;  1YNZ A;  4F16 A;  1UTI A;  4IIM A;  4JZ4 A;  2MIO A;  3VRY A;  1I07 A;  2DE0 X;  1ZLM A;  2A28 A;  2KRS A;  2XMF A;  1ZUU A;  2HSP A;  2DL3 A;  1VYU A;  4QT7 A;  1WXB A;  1ZX6 A;  1VA7 A;  4Y92 A;  2EYW A;  2L2P A;  2YSQ A;  1G2B A;  1IO6 A;  2ECZ A;  1EFN A;  1M27 C;  3TSZ A;  2DJQ A;  3M0P A;  1UEC A;  1JEG A;  1M30 A;  3EHQ A;  4RTU A;  1NYG A;  2GNC A;  1GCQ C;  1T0H A;  4J9E A;  1GCP A;  1W6X A;  1WX6 A;  2OAW A;  3VS7 A;  2V1R A;  2KT8 A;  1PKT A;  4OML A;  4ESR A;  1U06 A;  1UJY A;  2AZV A;  1AEY A;  2CSI A;  2P4R A;  2LQN A;  3ZL7 C;  1WI7 A;  1QKW A;  3GBQ A;  2VVK A;  3I5R A;  2LMJ A;  2HEQ A;  2W10 A;  5IH2 A;  4J9B A;  2AK5 A;  2RQV A;  5HCK A;  2CUD A;  2RQR A;  4KRT A;  1W1F A;  4HVU A;  3VS4 A;  2EQI A;  1SPK A;  1BU1 A;  1SHF A;  3PE0 A;  4JJD A;  4GLM A;  1W70 A;  1ABO A;  3EGU A;  1MV3 A;  1VYV A;  3M0T A;  4AG1 C;  1T0J A;  4LUD A;  1JU5 C;  1AWW A;  1K0X A;  2MCN A;  2DLP A;  1X6B A;  2D1X A;  3R6N A;  3NGP A;  4JJC A;  2EW3 A;  2D8H A;  4OMO A;  2K6D A;  4GBQ A;  2GTJ A;  1X43 A;  3LH5 A;  4OMP A;  1KJW A;  1PRM C;  1V1C A;  1JXM A;  1UHC A;  2D0N A;  2LJ0 A;  1UGV A;  5IXB A;  1WIE A;  1E6H A;  2J05 A;  2ESW A;  1M3B A;  3RNJ A;  3THK A;  3VS2 A;  3EG1 A;  1I1J A;  1OEB A;  1B3Q A;  2HDA A;  4EIK A;  4CC3 A;  2GGR A;  2PNI A;  1K4U S;  2F2X A;  2NUZ A;  1QKX A;  2DA9 A;  3C0C A;  1PHT A;  3EG3 A;  3M0S A;  1AWO A;  1XOV A;  2J6O A;  1J3T A;  1GL5 A;  2CUB A;  4CC4 B;  3ULR B;  1WA7 A;  2RQW A;  4OMQ A;  2EYY A;  3CQT A;  2JMA A;  1QWF A;  1OOT A;  1UFF A;  2O2O A;  1K1Z A;  1Y57 A;  2J7I A;  1AWX A;  2FO0 A;  2KBT A;  2FEI A;  1JQQ A;  2K79 A;  3VS6 A;  3RBB B;  2FRY A;  3U23 A;  1YWO A;  4AFQ C;  4F17 A;  1GCQ A;  3VS1 A;  1JO8 A;  1M8M A;  2RF0 A;  2VKN A;  2I0N A;  2K7A A;  4AFZ C;  3NPF A;  4RTT A;  1YCS B;  2DM1 A;  1PKS A;  2ABL A;  1H92 A;  2O9V A;  2DF6 A;  2PZ1 A;  1OPK A;  2RNA A;  5FWC A;  3REB B;  1KFZ A;  1FYN A;  1N5Z A;  1ZSG A;  2ROL A;  2YT6 A;  2YUP A;  4LE9 A;  1SRM A;  5IHK A;  1ZUK A;  1SRL A;  2EBP A;  2CT3 A;  1RI9 A;  2D8J A;  1X27 A;  2JS0 A;  5GJV B;  2A37 A;  2RQU A;  2RN8 A;  2KXD A;  3I9Q A;  4CC7 A;  1NLP C;  2ROT A;  2DRK A;  2LJ1 A;  2KXC A;  2GQI A;  1WXU A;  2YUO A;  4ORZ A;  4A63 B;  1SHG A;  2KYM A;  2GBQ A;  2JXB A;  2KGT A;  2A36 A;  1KIK A;  4X1V A;  1NEB A;  2KE9 A;  1JXO A;  1GFD A;  3QWY A;  2KR3 A;  3NHN A;  1UUE A;  1K9A A;  2JS2 A;  2MOX A;  2SRC A;  3M0R A;  3H0H A;  2EGC A;  3PVQ A;  2FG0 A;  1U5S A;  1I0C A;  3A98 A;  2C0O A;  2DMO A;  4HVW A;  2IIM A;  1X69 A;  3UF4 A;  1S1N A;  2DIL A;  4LNP A;  3H0I A;  1Y0M A;  2QDL A;  2K3B A;  2RPN A;  2L3Q A;  1K76 A;  4IIO A;  4J9F A;  2CH4 A;  2JMC A;  2JTE A;  3TVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...