1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
4AG5A 3L8YA 4M9SA 4JBYA 2GETA 3I72A 1ZBJA 3AKEA 1WIEA 1OLOA 2HDNB 3CRRA 2FEMA 1XTSA 3LRPA 4RD4A 1OB5A 2EVWX 4GPTA 4KI0A 4FWIB 2G1KA 4HATA 3WHLA 1IY2A 2FFHA 5C4MA 3P32A 3Q8XB 2XX3A 3B5JA 2E87A 2W2TA 4P3YA 4M1SA 3GD7A 2NO7A 4BRUA 4C0KA 1G6HA 1Q20A 4IVQA 5JI2E 4Q1DA 5HE9A 1KO1A 2C96A 1A4RA 2Q3MA 3EPLA 1V5WA 1BS1A 3I92A 5HCIA 1XDBA 1CLUA 2ZE8A 3EG0A 1G20E 3ETLA 4TN1A 3VS6A 4JS0A 1XPOA 4ESVA 1B07A 4XIGS 4BECA 4CT5A 2X1VA 1KMQA 1GTVA 3RS0A 3VTKA 3B6EA 2V55B 4QXAA 3T35A 2SEMA 1DBSA 4XVUA 5FH9A 2ORIA 4LHXA 3HYRA 1HD3A 1R5NA 3TSWA 5FUYA 3P4XA 4Q02A 3LO5A 1KAGA 1OW3B 2VHTA 4JVMA 4DCVA 3QBTA 3MAAC 4BZPA 4QBFA 4QKQA 5JMTA 1U90A 1N5IA 1UFQA 3BD9A 2KBTA 1M7GA 1G7RA 3RWOA 2ERXA 3I32A 1EFHA 2NZ8A 2C95A 2JDIA 4IVRA 2V1UA 4P4SB 1E2QA 4PTLA 4JJKA 1PUJA 1Q3TA 3TLXA 1OXVA 2SRCA 2VQSA 1KY3A 1P9WA 2ZUBA 3A58B 421PA 2PT7A 2E5KA 1OF1A 5IXBA 1VCOA 4XSGA 1IBRA 3U6KA 1E2KA 4F14A 2HLDA 4KLNA 4B3GA 3FE2A 1T3LA 3M0RA 1YKSA 1LNZA 1KZ7B 3PJRA 3HYTA 1A7JA 3QKRB 3IQXA 1X2QA 5CM9C 1EFRD 4GBMA 4PC2A 4J9EA 3MRSA 1J8MF 5HPYB 4KRTA 3VAAA 2JJ8A 2D06A 2V7QA 3EWSA 2REOA 2QTFA 5EXXA 3U3RA 4JJBA 4CC7A 4B44A 3UK6A 4KFSA 4BFWA 3MCAA 1ZU4A 1G64A 1KMHB 3RRNA 3AVTA 3M1IA 1KNQA 1M3CA 1OE0A 4OI4A 2BEJA 3R8FA 3BBPA 4TLBA 4M22A 2FZ4A 5JJKA 3WYGA 3VKHA 2WWFA 4DDWA 2WBLC 2YUOA 5TARA 4ZDJA 1TQ2A 1T4GA 2ZE6A 4TTQA 5EP1A 3GEEA 4D8KA 1J99A 1Q1QA 2JIZA 1QCFA 3EA5A 1UHFA 2CLCX 3CM0A 1ZM9A 3V00A 1SVSA 2NO9A 4AC9A 3QSYA 3IEVA 1TQDA 4YDSA 2UZ3A 4TMXA 2GCNA 1CKEA 1KYIA 1RKBA 1XEWY 2HCJB 2RGBA 3LVRE 3IQWA 4DIDA 1TF5A 2CDNA 3A4LA 1QHXA 2L3PA 1XTIA 1TUCA 1X8JA 2MMCA 3IDQA 4DLZA 1OIVA 2XOKD 1X27A 1YJ5A 4B3DA 3T06B 4HLUC 4A92A 1HE1C 4Q9IA 3TRFA 1AK2A 4IFEA 3VQTA 3X1XA 4M1OA 4HCKA 5L3RA 2F3TA 4DLTA 2ANBA 4C0BA 3Q72A 2ZI6A 3FWYA 2DYBA 4R2IA 2EGEA 4TQUS 1TMKA 2Q3HA 4G5QA 4ESRA 4J9FA 5AJYA 4EPRA 3NEYA 4G5OA 4LV5B 3C15C 2VHQA 1A2BA 3AVWA 1XJ0A 2PMDA 2QMOA 3W9YA 3ZIAA 3GCGA 2DL7A 4ZV4A 3BFXA 4QOSA 2ZVPX 2VP9A 221PA 5LDDC 1IY0A 3K0SA 1DEKA 1RLQC 5DO9A 4B2PA 4LJ6A 2FE4A 3NKVA 2WAYA 1G8PA 2IXFA 3A37A 3BH0A 4II7A 3T34A 2O5VA 4JZ3A 1ZW6A 2XZOA 5FPTA 4F4CA 5CJ2A 5FI0B 4NYJR 1I0CA 2KEAA 2VPPA 4MYUA 2OBMA 5KNDA 4B6EA 3TNFA 3MWKA 1SPKA 3M0UA 2RKOA 4A6PA 4A9AA 1J90A 2BMJA 4IIOA 1TPZA 2OE2A 5GADl 1E0JA 2PCLA 4E22A 1TQ4A 3S1AB 5AWFC 1E32A 3Q85A 3PEWA 3BERA 4R71A 3KQNA 2IF2A 3VRYA 2BKUA 5FOXA 2QMHA 4E03A 2ATVA 4N1AA 3I61A 3U44B 4B75A 2CUBA 2JT4A 3P4YA 3KQLA 2KI5A 4F38A 4J9DA 2GCPA 2ZI5A 5L3SB 3ADCA 1U94A 1XD2B 2C99A 1ZBDA 1DARA 2N1BA 3PUVA 4HVVA 3AVUA 3CKLA 1U5SA 2MMGA 2ZRBA 1CU1A 4Q4HB 1AS3A 1UJ0A 5CDFA 3TUZC 3BB4A 4Q47A 4RD1A 2HBWA 2KRSA 3A1WA 4QJ5A 4DSOA 3AEZA 2Z5FA 1I2MA 2FN4A 5GVRA 1ABQA 4PX9A 5C4GB 4JKIA 1OH7A 4P4TA 3GJXC 4DWJA 4EPXA 5BXQC 4HB4A 2DBMA 3AB3A 4HAVA 5IDVA 2ZXUA 3GLFB 4V0KA 5CIWA 2V8OA 4S2EA 2WWYA 3BJIC 4ZDIA 3GBQA 1OIXA 1QHHA 1SKYE 4LHYA 4EJSA 3AGPA 1Z06A 1WX6A 1P60A 1F2UB 2MSDB 2DNUA 4WCIA 1GKYA 3W5JA 2J41A 1A82A 1G16A 3BRWD 2ROLA 1Z47A 2QEQA 3RRYA 1LY1A 2ZI3A 1G5PA 1G3MA 1W4AA 4FMDF 2HXSA 4R0KA 4LJ9A 3VR5A 3U44A 3KQKA 1XD8A 3FKSA 3SYNA 2RGNA 4HAXA 2W0ZA 1Q57A 1XEFA 1AWOA 2ZSAA 3DKVA 2JLRA 3LA6A 3FB4A 4C7OA 2O8BB 3QIAA 1QVRA 4D82A 4Q4HA 4RVCA 3KUDA 2XTMA 4D4KA 1Y63A 1VG1A 2HYIC 1G2BA 4HB3A 1BYIA 3QXJA 3ZVMA 3GLHA 5BN4A 3EXAA 5ECAA 3TJZA 2O8FB 2P67A 3AKCA 2W2VA 1QWFA 3LBNA 4O2LA 4B32A 4KHZA 3REFA 2OCBA 1V1CA 1Z9ZA 5H8WA 1Z07A 1W46A 1GL9B 5J5CA 4AURA 1XJCA 1FW6A 1AZSC 3UG7A 3IQLA 2R2AA 2NPIA 3SHFA 2FSHA 2IXGA 4ZNXA 4RZ3A 4NU0A 5K8UA 2A5DA 3RVBA 1Z0AA 1KSHA 4MKGA 4BLPA 2DVJA 5JRZA 1NN5A 2ZTSA 4JLBA 2ZQ5A 4I1OA 1Z28A 3HWSA 3ICQB 4DLRA 2QBYB 3FJ5A 1GL5A 2F9LA 2DCUA 721PA 5JRJA 3IEUA 2QGNA 3PFIA 1M27C 1WXBA 3M0EA 5FOWA 3B7GA 5KDLA 4F4IA 4OI0A 1WA5A 1Z0FA 1DADA 1Q1ZA 3I5YA 2V9PA 3U5ZB 2JIZD 2NQ2C 2PT5A 2VLIA 4M9QA 4W5WA 1IM2A 1L4UA 4YQFA 4DDVA 3GMTA 2A28A 2B6HA 2QE7A 1DS6A 3LH5A 1Z0IA 2GWHA 3LQQA 1JR3A 4TL6A 3UA7A 2FDCA 1UEJA 2K9GA 3B78A 2FWRA 4RJLA 1CS4C 1E6CA 2QAGB 2QTVB 3K8YA 4EFLA 2Q0HA 4KVGA 1BMFA 2HEIA 5H70A 2BOVA 1G19A 2GTJA 3QKSB 4PC3A 1M74A 4DDUA 1GRQA 3Q9LA 4PC1A 3BH7A 1WDXA 3QKTA 1YCSB 4JJCA 4GMDA 4AG2C 1NRJB 1JXMA 2BVNA 4US2R 3MUFA 1NG2A 1QKWA 2AX4A 3VS3A 2ZI4A 3FGNA 2VP4A 1I4DD 2IC5A 4Q4JB 4NYIR 1E1RA 1AQUA 2EFCB 1AOJA 1COWA 1H8EA 2ZE7A 3FVQA 5L3VA 2A5FA 4Z88A 1CULC 1X2KA 4NCIA 2BBWA 1KY2A 1ZJ6A 4V0LA 3H41A 4DCTA 1OFHA 2Z6VA 3D6TB 3LD9A 4TL7A 1AEYA 1OH5A 5CDFE 3QJYA 3TE6A 3SQWA 1AVZC 1NJFA 3EG1A 2W6JD 2CSQA 2ZS9A 5J47A 4LJ4A 3K0FA 1XEWX 2WPDA 4JMPA 2BMEA 3RHFA 1Z08A 1BMFD 2AKLA 4G0NA 1FNNA 2NG1A 1KDOA 4OMNA 3CX6A 3NBZC 2ESWA 4KITB 4FWTA 4ERNA 1EFRA 2LKDA 4GI7A 1N6OA 1US8A 1DAEA 1M34E 4H9GA 4D2IA 4Q18A 5CB8A 5AJXA 2QNRA 3F3YA 1HV8A 1BB9A 1X6BA 3H0FA 1JNYA 1XMSA 2WJHA 2KRNA 2ZJOA 3GJ8A 3PUXA 3TUJC 2ZR7A 2WVJA 5FWCA 4D25A 2IYZA 3X1YA 2WWHA 2RAPA 3QE0A 3K0CA 1P7CA 3EIHA 4DUGD 2QP4A 1W4RA 2KGTA 1T3HA 3Q5EA 1CIPA 3BFKA 4Y0AA 3SQXA 4XWOA 1L8QA 2RGGA 4TYWA 4B6FA 2CLDX 2IS1A 1GVNB 2ZS8A 1ELOA 2EWWA 3BS4A 3IBYA 1K76A 1SKQA 2IYTA 1E2LA 1RLPC 5SZHB 2V1RA 1ESNA 2RH5A 1WDTA 3AP1A 2AFHE 4IRUB 3QWYA 4LSGA 2J0UB 3CNLA 4YXWD 1U98A 2R6GA 1T0JB 1G9XA 2AWNA 5FI1B 1E79D 2AKKA 4TWZA 1JQJC 2J7PA 1W36D 1UEIA 1OH6A 2V1XA 1NN1A 1RJ9A 3L0PA 1DELA 3P27A 3THOA 1Z2AA 2CXXA 5AUQA 3WMFA 1VIYA 5CYOA 5SZKB 1FP7A 3CRVA 2G83A 2DR3A 3GJ6A 1VECA 5G53C 2IYSA 3LW8A 3PQCA 2QBYA 2ORWA 2UVQA 1U0LA 3IIMA 4GNKA 2P65A 1H8HA 2L3QA 3EC2A 3TVDA 1ZNXA 1ZUNB 3EZ7A 4RCYA 4DLWA 1N5LA 1GBQA 2PLFA 3K09C 5M04A 1S1NA 5DE3A 1D2EA 4TZ6A 2WIBA 1P75A 4OK5A 2V6IA 4AG6A 3JZMA 4URWR 3CF6R 2PJRA 2QU8A 5EQTA 2HJGA 4DKXA 1FOEB 4MA4A 4TLDA 1NBMD 3CONA 1SHGA 4U02A 1Q21A 2D3WA 5UKDA 3LBIA 4OMQA 4LGMA 3WHKA 4JLKA 5KDOA 4M4ZA 3FTQA 4Y92A 2ZRDA 1NEGA 3QXSA 1U8AA 3ZZ0A 5CB6A 4UJ3A 3VHXA 1IO6A 2W0MA 4HZUB 3IPYA 3R7WA 2WKQA 1AZEA 5J4KA 1TUIA 1OT3A 4YMTA 1YZTA 5EC7A 3LXXA 3RSOA 3ZVLA 3RBBB 1BYUA 1DVRA 4EFMA 3CPJB 1RFLA 1RJ9B 2PBRA 4N0DA 1GG2A 4RZUA 5DI3B 5BWMA 1R8SA 1OKKD 4CEHA 2YUPA 1S9DA 4OJKA 4D0NA 1XBTA 4OJQA 2QSYA 4HDQB 2WWGA 2MIOA 2OT3B 3WYAA 3NEJA 2DYKA 2JJ1D 2OHFA 3KTAA 1W5TA 3OFND 4LJ7A 1EFNA 1AQYA 4F91B 3OZXA 1BK2A 1JEGA 2H5EA 4CZ2A 2YJTD 1DAHA 2X19A 5AUOB 1W70A 2ZSFA 3K0FB 2OCAA 2R62A 3VNVA 1UKEA 1R8QA 4NE2A 3DKPA 1YRAA 1ZUKA 2CJWA 5KU1A 2EYWA 3ECCA 4HVWA 1FMLA 3NXSA 3PUWA 5EE9A 1RI9A 1YWPA 3AF2A 1P73A 4O3MA 4O0MA 4G5GA 5B64A 4IXMA 4GP7A 2ZJ2A 1CR1A 1M6NA 4MRPA 2GEVA 1ZMXA 2P6NA 4NPHA 2GJ9A 5E3HA 1C1YA 4YMVA 4DEYA 1XPUA 1LS1A 2REBA 4KLZA 1ZLMA 1ZNWA 1BIFA 2O0HA 5P21A 2F9MA 1LF0A 3BIFA 1F2TA 1X3SA 1UJYA 2D8JA 3O8CA 1UDWA 4P4SA 1NVXQ 3N70A 4LHZA 5HE8A 1S0UA 1RYFA 4XWKA 4LPKA 3CF2A 1X8KA 2G1JA 2ODWA 3A1UA 5G41A 4GMXA 1KO7A 3ADKA 2EYXA 2EGCA 2GCOB 2XAUA 4DIEA 4CEHB 2ODNA 1GCPA 3KB1A 2ZEJA 5H1YA 1UJ2A 5JEDA 1FMJA 3U7GA 1OOTA 1FMKA 5L8VA 3EG3A 4PSKA 2O8CA 3CW2A 2HF9A 2A5GA 3AQ4A 2LNHB 2YOFA 1P3JA 1W0KA 2QE7D 2VP5A 4XVRA 2NO0A 2GHIA 1OXUA 2KE9A 4DXAA 4Z8AA 1UBGA 2GDJA 2RMKA 3AKYA 3LVQE 3B1WA 1I1JA 3U61B 1EFCA 1GZSA 4YONB 4H1VA 1IJFA 3U3JA 2EFHB 1K9AA 2GXUA 3K0CC 1VKJA 4EUNA 1PVOA 2XTZA 4RTXA 1XTJA 2LZ6B 2PLRA 1G7SA 3E5HA 5KPJA 4X1VA 5GJBA 2F1IA 1OXXK 1MO5A 3VS7A 1U81A 1UGVA 3X1WA 1Z0DA 4V0ME 5FTNA 1TEXA 1DO0A 5A5GA 2QDLA 2VEDA 4M0LA 4LJAA 4PZLA 2J87A 4ILEA 4URUR 1TU3A 2YSQA 4Q4AB 2D74A 3R8CA 4GDFA 1E2MA 1Z29A 4GSYA 5J4YA 3E1SA 4G1UC 2D8HA 2J7IA 2FFQA 1OKKA 2FG5A 1NVWQ 1CBUA 1L4YA 1MABA 4LHWA 3T61A 3FMOB 2LCSA 2DHRA 2ZM5A 1VCMA 4L8GA 1T0HA 2ZETA 2ZYTX 3KKOA 1G17A 2HUPA 1KIKA 3LW7A 4E09A 5DIFA 5DYGA 3SJZA 2G88A 2QT1A 3T1OA 2OBNA 1LVGA 1MV5A 5G3ZA 1IXZA 3NH6A 2EU8A 2P6RA 2AK5A 3IILA 2ZE5A 3HR8A 2XJ9A 1OH8A 3OF5A 1U2RA 1AKYA 2V1QA 4QG7A 4WVFA 1G4AE 1ZUIA 3HPQA 4QRHA 4TT3A 2K6DA 2CSIA 1HURA 2KWIA 2QRZA 1E1RD 4X8LA 5E7JA 4PQRA 2A9KA 2C9CA 2ZRIA 3VR4A 2YUQA 5FWBA 3ZJYA 4AD8A 3HPRA 2GBLC 2K7AA 1ZM7A 1KI4A 3I5SA 2QPTA 4ACAA 3PE0A 4JLPA 4RSGA 3GFOA 4TLAA 1UBFA 3PUYA 1UE9A 4JJZA 1IJEA 1S96A 2WWWA 3FMIA 5FPHA 2VSXA 3LX5A 2IL1A 2ZAOA 3ZL7C 2EW1A 2O0JA 2A30A 2VP2A 1N25A 3H4MA 4D4JA 1KNXA 2J7KA 1MABB 2ZSEA 3FHTA 2JGNA 3D8BA 4B74A 3WNDA 2KRMA 4TLEA 2RB4A 3NC1C 4R98A 4JSTA 2HCKA 1LW7A 4RTYA 3FPAA 1PHTA 4JL6A 1H3HA 1R2QA 3L2OB 2QP9X 4MGKR 1F48A 4BFVA 5KSOA 1KFZA 4LBWA 4Q1CA 3TSZA 2FPFA 1FFHA 2OESA 2FRWA 3JZAA 4Q7KA 1IN7A 1UBCA 3H84A 1OYYA 3E70C 3NMZC 2RGDA 4IOMA 3QVUA 4PZYA 4RTZA 1DAGA 1D2MA 2GTOA 3C8UA 2LJ1A 2DFTA 3AGQA 1D5CA 1L2TA 1E4VA 3AF1A 1OSNA 3KJIA 2WSSD 2M51A 2A37A 2P2LA 2RGAA 4WAUA 4Z1MA 1Z0KA 1UAAA 5CYPA 1UTIA 2WJIA 1GAJA 2WKRA 3OEHD 4M9ZA 3PIRA 2R8RA 4ZI3A 3GJ4A 3GLHE 1J8YF 3K70D 3REAB 1NBME 2F3RA 3OIYA 4JL8A 1F60A 3VR6A 2YC2C 1JO8A 4B73A 2RQTA 2IYRA 2NTYC 3UPUA 1E1QD 3EZ9A 3QPWA 1U99A 1SSHA 2O52A 2NPFA 4A2QA 2A7QA 1G7CA 1W6XA 1NVVR 5L23A 1FYNA 2DMOA 1ZM3A 1MKYA 3LLUA 3PCRB 2FZLA 1ZNYA 3ZQ6A 1QWEA 1GRNA 4PXAA 4HUTA 1SXJB 1XU4A 4MGZR 4IEIA 2GJ8A 5KSYA 3EW9A 2H7VA 4XVQA 1WE2A 1W36C 4ZO4A 2RNAA 3WMEA 4AY2A 2D62A 2BWJA 3SFVA 2HCBA 4Q4LA 3S1AA 4CIDA 3NGPA 3A6PC 1O3YA 3EARA 4L16A 3RDPA 2O8FA 1U9IA 4OL0A 4X8OA 3KKMA 5E7MA 4DSNA 2KXDA 1WLPB 4Q5IA 2CEAA 1ZC3A 1F5NA 2JJ2A 1UG1A 3HDTA 3EHQA 1JJ7A 1XD2A 5JZVA 4C2TA 1JALA 3VS0A 3U6BA 1YR7A 4J9IA 3QOFA 2XNSA 2EGAA 3DL0A 1JR3E 2EWVA 2O8EA 4OQXA 1KDRA 1XXHE 4CGZA 2KYBA 5AK0A 1HA3A 1CXZA 2D2EA 3A1TA 4FINA 4MYCA 4TL9A 4ASUA 1WBBA 3SBDA 3M4YA 1AGPA 5EUQB 3EX7C 4IDQA 5L3QA 2NWMA 1N2CE 2NOAA 1TUEA 1Z22A 2GZHA 3W34A 1SEMA 2XMFA 1GFDA 2MCNA 1ZYUA 2WKPA 1UADA 4TMKA 4Q9HA 1Q12A 4JYCA 1NYGA 2G6BA 2HT6A 1MUZA 3GQBA 3VS5A 1P9NA 4BASA 1AD5A 2PCJA 3B82A 2CLSA 4NYJQ 1Q3HA 4A6XA 5FTMA 3GLFA 2IYLD 4FMDB 1XD9A 3U2QA 2VRWA 1C9KA 1ODFA 3O47A 3WP1B 4IDHA 1N6NA 1G291 4NCJA 1E9DA 3CB4A 1XWIA 3CNOA 2MOXA 4FMBB 2J0QA 5FL3A 3CUEF 4CEJB 3WBKA 4IHQA 2QGZA 2IHBA 1X6VA 3B1ZA 1NNEA 3CZQA 2R44A 2DILA 4HDOB 1MV0B 2JATA 4KO8A 2L0XA 1T3SA 4J9GA 1U0JA 4BFYA 5CJPA 3U4QB 4OHYA 4DLVA 3TKLA 2XOKA 2DWQA 1S1CA 1NF3A 3UF4A 3VHLB 5JJLA 2IIMA 1P72A 2H8KA 1Z6GA 3B1VA 1NVUQ 1VHLA 3VS1A 1OFIA 4Q00A 4ON9A 1U8ZA 5JFGA 2O8EB 1D9ZA 2Q9AA 1QG4A 2KNBB 2GBLA 2PJZA 3DZ8A 2OUKA 5CK5A 4DZZA 4IOJA 1E7OA 2CUDA 2VHUA 4PAQA 2CCKA 2IF0A 4Z8YA 2GBQA 3K0AB 2DL3A 1PRLC 2CK3A 2QAGC 1IN4A 1UKZA 2RGNC 1RRFA 4B3BA 3NBYC 3CF0A 4OK6A 4Z54A 1XNJA 2R65A 5AJZA 2ZRHA 3QKRA 2M0YA 1NY6A 2QT0A 3G82C 1W1WA 3E2IA 1YU9A 4NYMR 1N6KA 3H0HA 3T5DA 1X6GA 2WZQA 1E9RA 3GLGB 1FNMA 1XCPA 1XB2A 1ZX6A 5D3MB 4C0LA 1XOVA 4TMTA 4ESHA 1UPTA 2BBOA 2WJJA 2QPOA 4LJ8A 4O2RA 2ECZA 2QM8A 3QPUA 4I81A 4XWAA 2LX7A 2B8TA 4ORZA 1S1MA 2DFKB 2O9SA 2F1RA 2PZEA 4L15A 4LJ5A 4PO1A 3WNCA 1CJKC 1XTRA 1HJDA 1QZXA 1OV3A 1ZVQA 2GILA 3TAUA 2ZIAA 5TMPA 1LTQA 5EP3A 4OMPA 1AZGB 5DH9A 1JJVA 1NLPC 1XRJA 5JSZA 3FYHA 2Z4RA 3QF7A 4BGDA 4CRWB 4EPVA 3AVPA 4ITRC 2QN6A 2W6ID 1E4YA 2WPDD 4GLMA 2G77B 2OJ2A 5EJEA 5IHIA 4EFNA 4P31A 3M0PA 4BZXA 4M9XA 5ELXA 5KO2A 3UMFA 1GFCA 2GA8A 5J4HA 4A2WA 1GDDA 2ZRNA 1W49A 2CL6X 3OE7A 2YKGA 2JM8A 4ZI2A 1A2KC 3R20A 2DLPA 4HLCA 2IW3A 4CVNA 1QHSA 2ONKA 4DCUA 1TU4A 4PPFA 2L0AA 5FPYA 2RQWA 1E2IA 1KKMA 2OZEA 2ODEA 2G9NA 3GPLA 2BTTA 1RUWA 1G8YA 1EG7A 1F3OA 5TDHA 1X8LA 5JI3E 3RC8A 1QKXA 2FFBA 1GRIA 1GRRA 1MH1A 2IYQA 4UXIA 2ZJBA 4X8MA 5FBVB 1EX6A 1IY1A 5E95A 3RABA 1AWJA 4DT1A 4HVUA 2J05A 3THYA 4V0OA 4MKIA 4HSEA 5EXTA 3RS5A 1VIAA 1W2GA 4Q21A 1VG8A 3GFTA 2IK8A 1NIJA 1OYWA 3DDCA 3SYLA 1ABOA 1OHHD 1V43A 2AKYA 5HTKA 4KU4A 5H68A 3L0SA 2GJSA 4LI0A 4CEJA 1N6RA 3IBGA 2J5XA 1TTTA 1NN0A 4Z51A 2BDTA 4C0SA 2CH4W 3SU8A 2ZR0A 1ZCBA 4A0FA 4EKDA 3U4QA 1M8PA 3K1JA 5EP4A 5KSZA 1PLLA 3KQUA 2WTUA 2YWHA 4JL5A 4V03A 4TL8A 3D7MA 1G7TA 1SXJC 4YDHB 1P62B 1J7KA 3PITA 5JHHB 2DY1A 2VYFA 3BWDD 1VG9B 3I3SR 3OEED 4PC6A 4Q1EA 2DRMA 3GLFE 1KO5A 4EIWA 1OB2A 3AM1A 1DG1G 2QY9A 3GLIE 4DEXA 2B7CA 5EXSA 1HT1E 2C2HA 4HLUA 2ZRKA 1F6BA 3L0OA 4BFUA 5AUNB 1N5KA 2GEUA 1E2DA 1KZGB 4TSFD 3SYKA 1EWQA 3TR0A 1GILA 3QQ5A 3M6AA 4FCVA 1IXSB 1NIPA 3QKUA 3NBFA 1MOZA 1Z8FA 2YC4C 4LRWA 2LKCA 4LY6A 5DN6D 1WQ1R 4M1KA 4KFUA 4G5SA 1Y57A 4NCHA 4U5XA 3TUIC 2BC9A 2KXCA 3PVQA 2GJKA 1YNZA 5GVSA 1N5JA 2W6JA 5DGXA 1DAFA 1R0WA 2OSBA 1OJLA 2F1JA 2BBTA 2GF9A 2H1LA 2PH1A 4JBWA 4QJ4A 3SOPA 3GLGA 2R6DA 2ABLA 2EYQA 3KXIA 5J40A 3EPKA 1U06A 1HT2E 3U7FB 1JR6A 3SJBA 4LUCA 1UDLA 3UATA 1P5ZB 2LMJA 4F7WA 2HT1A 1GCQC 2LJ0A 3H2YA 1XXHA 4Q1FA 5FTLA 2RGXA 3B1XA 1W4BA 1LS6A 5C1BA 3QXXA 4JZ4A 2DA9A 2ECKA 5GJCA 3KKNA 1S3SA 4XOIA 2GVZC 3WY9A 4BWYA 3H86A 5IHKA 2H17A 4FD2A 3I73A 4PO9A 4KCGA 1UFFA 3FMPB 1GKIA 3RSLA 4TYPA 5EP2A 5F98A 4P33A 1EX7A 3DPUA 4XSHA 2D7DA 1JU5C 1AWXA 1Q0UA 4BEJA 2EYUA 3I8SA 2KJQA 2LJ3A 3U23A 1M7HA 1SXJD 1GM5A 4JIMA 4TSFA 2A5JA 1E99A 2IWHA 4K81B 3QXHA 3ZLJA 3RWMB 3AUXA 4I99A 3C16C 3ASZA 1ZUUA 1KOFA 4Q48A 4I1SA 4X8HA 1NMXA 521PA 1JAHA 4RUGA 1SVLA 3LNCA 1XJQA 2CT4A 1OHHA 2BCJQ 1K4US 5HZHA 4V0MA 3IUYA 2ZYUX 3VR2A 1G18A 2DRKA 5KDDA 1K8RA 3F8TA 1FP6A 2WJGA 3QENA 1ANKA 4Q9KA 2XZLA 3KFXA 1PLKA 3D31A 4AKHA 2DE0X 3LX8A 2DFLA 4AI6A 4PPNA 2JLSA 1KK3A 2PX3A 3KXKA 4BLTA 5DNYB 4A36A 2FU5C 3ZVRA 1P4SA 1G41A 1AS0A 2C98A 4JT4A 1XZPA 1H92A 3THYB 1J70A 4B48A 2C0OA 4YC7A 3Q7QA 5B58C 1TX4B 2AL7A 4XH9B 1X43A 2QSZA 1E0AA 3N2EA 1BU1A 4K11A 2C9OA 2V6JA 3GFPA 3L0IB 3I8XA 3QI2A 3KUCA 5KUTA 3RYTC 1P61B 1OIWA 5JS8A 3TW8B 4OHXA 1KSJA 4CEIB 4B2LA 4M53A 3PG5A 3QEOA 1HE8B 2OFXA 2ZRCA 2FRYA 5IXFA 3TK1A 3BB1A 4EPTA 4FXPA 1KI6A 4QM7A 2B86A 2X77A 4RTVA 1WI7A 1S2MA 6Q21A 4BE7B 4MRNA 2BM1A 1E79A 4H1UA 2SHKA 4GT1A 1TF7A 2AHOA 3ZD6A 2RPNA 4PC7A 2O8BA 3VMFA 3NG1A 4ARZB 2IEZA 2GF0A 3VU9B 4DLSA 2XNDA 4LN2A 2B8WA 4QBHA 3R9WA 1E9EA 2ZU6A 2XGJA 4F17A 3R9IA 4XD7A 1JB1A 3GJ3A 4A63B 4D0GA 3GJ7A 4DRZA 3AUYA 3A8TA 2FPEA 1R6BX 5GJWB 2ZUCA 2ZJAA 3CBQA 3DMDA 2ZU0C 2J46A 4MUAA 5E7IA 3SE0A 1WA7A 1SXJE 2F43A 2FA9A 4OQFA 4BFXA 4DUGA 1SVOA 2XTNA 1E96A 4KFTA 2DWPA 3WYFA 3SEMA 1II8B 4NCNA 1CP2A 3C5HA 1PKTA 4ABYA 1ZSGA 5JECA 1JPJA 3BH6A 5FUVA 5HKKD 1N3BA 4FCWA 1PLJA 3FOZA 3CH4B 1YZKA 4U7DA 4JLDA 5JEEA 4HYYA 4YXWA 1NEBA 2BCGY 1XXHB 4NL4H 4GBQA 1WXQA 5DI9A 2P0EA 4CW7A 1KI6B 2I1QA 3UA6A 5GJVC 3B1YA 3QF4A 1YN8A 3BOSA 2E1RA 1DO2A 1W44A 2PMKA 2CNWD 1GWNA 1KAOA 3HU3A 4WW0A 4A1FA 2EKHA 2DB3A 1E6GA 3AF0A 1W4CA 1G8GA 2F2WA 4LX0A 1KGDA 3T1QA 5KYKA 2LWIA 4R7ZA 2IYVA 3ZH9B 2ZRPA 2JLXA 1TL7C 4A82A 5IRCD 4B47A 3NHAA 2IBMA 2X8AA 1VCNA 1QF9A 3O5ZA 4PO8A 2ZAMA 5DHAA 2F55A 2EYYA 2J06A 5BYKA 1YE8A 3WBJA 5JBQA 1ZC4A 1WXUA 4PHFA 5EZ6B 4RY2A 1T0JA 4IDNA 3NTUA 4PAMA 2VP6A 4TT3D 4HDCA 4O25A 4DCSA 3EZFA 4IIMA 1YQTA 2W0SA 1QBKC 2GAAA 3MG9A 4IOKA 2J59A 1ZD9A 3BORA 2ZRGA 2OV2A 1OXTA 2KBFA 4A0HA 2JDID 1UF9A 3KL4A 2C9YA 2W2XA 5KTYA 4GRAA 1W36B 5DISB 4LC1A 3SI7A 3X1ZA 3B85A 4FMCF 5HZKA 2VWFA 3NH9A 4PSVA 2ZJYA 1M2OB 3R9XA 3W3ZB 2V54A 2C77A 1SVMA 2XZPA 2OXRA 1M3BA 3ZDQA 2QAJA 2P5TB 3LV8A 4FW9A 2WM9B 1SHKA 3AP2A 4WA7A 3NHNA 5EXPA 4BFTA 3GJ5A 2D2FA 5EE0A 4EPYA 1BO6A 1I4LD 3C4JA 4GOJA 4L4UA 5EZ5A 4C0AC 3DM9B 2L2PA 4HUQB 2IWRA 4Q1AA 821PA 1ZAKA 1NI3A 2B21A 3ONWA 3Q5DA 2IUTA 2GVDC 2HEQA 1XEXA 2TMKA 4I1VA 2V4ZA 1A1VA 1E2GA 1FTSA 4NP6A 5IK2A 4B34A 4GZMA 4LYAA 2LP5A 2OLKA 4MUBA 3LAWA 3A4MA 4HLDA 1NG9A 1XCMA 2OM2A 3SJCA 2IS6A 3CH5A 2AZSA 4FSSA 4WXRA 2ONJA 2OFWA 4OK3A 4RZXA 2YWGA 4UNSA 3TH5A 1E98A 2JEOA 3QNUA 4JVNA 1SVIA 3KXLA 1ZP6A 4URXR 4LNPA 3RAPR 3THWA 1HQYE 5I22A 2J1LA 3VS2A 4KAXA 2QTHA 4NYMQ 1DPFA 4M2LA 2LCFA 2QUZA 1P2VA 2FV8A 1CJVC 1RPZA 4MDEA 2BJWA 2GXSA 3KTAB 1E94E 3VRZA 2FGJA 1CJUC 3QPVA 3B13B 2DJQA 3OESA 2R6FA 1GITA 1JEDA 1NLYA 1OFTA 3LLMA 4UKDA 4M1YA 4PQYA 4ZDKA 1A0NB 4MDFA 1AJEA 3QUSA 2ZSBA 2Q6TA 4LBZA 4Q9JA 4QGAA 2GNOA 1EGAA 2JLVA 4RZ2A 1E0SA 4IDOA 5LB2A 1NSTA 1EXMA 4HAUA 4OHWA 4GFDA 4W9MC 2EVRA 4B3XA 3ZYCA 4FMCB 1L7VC 2ZPTX 3CRMA 1N6LA 1PRMC 4UNRA 1G3RA 5TXGA 1QHHB 4WOPA 3NPFA 4EJSB 3AVYA 4KJZA 2B92A 4BPBA 1ETUA 2K79A 1VHTA 4ZCIA 2HXYA 4IW3B 1FUKA 2H16A 4MRSA 4NTZA 1U8YA 1SRLA 4C0JA 4WZAE 2H8HA 1MV3A 5IHNA 3LWNA 1LFDB 1D2NA 3AVXA 2CCGA 1D6JA 1GNRA 1VMAA 4AYXA 1E2PA 4YMWA 3UIEA 1SQ5A 4Z89A 2BM0A 1JAIA 4RD3A 1TADA 4NONA 2AN9A 5A0FA 1W47A 3PV0A 2H18A 3L82B 1DTSA 3OEHA 1T5IA 3DOEA 5JS7A 2ZR9A 4B35A 4LYJA 4MRRA 2QENA 3LFUA 4TYQA 5EE5B 4F92B 1W2HA 2FEOA 3CWZA 1YR6A 2JCSA 2RHMA 4Q9LA 1PJRA 3C41J 3EIQA 1ZRHA 1HTWA 2CBZA 3UMSA 3AVVA 3LY5A 1E9BA 2MSCB 2O2OA 5JCPA 2P5SA 2A36A 3CR8A 1XMJA 3BC1A 1UECA 3CR7A 4G5RA 1FX0A 1W7AA 2W00A 2JAQA 4LUDA 2VF8A 3J81k 1WRBA 1FQKA 3U3MA 1KDPA 4LOAA 5CIQA 3UANA 3JVUA 5FPSA 1CTQA 5D3MA 4OBEA 4C9BA 2YOGA 2GXQA 1E9FA 4DLUA 4P4UA 1KI2A 2FO0A 2IYUA 3MWYW 1P6XA 3UG6A 4JKYA 3NVAA 1GOTA 3BXZA 3B60A 4QNMA 3GP8A 4KSBA 2FSIA 1ZD1A 1GSIA 2A78A 4LE9A 5BYJA 3SBEA 1GBRA 1K6MA 1QLYA 1K0SA 4PHGA 3EA0A 5JSZB 3W3AA 4NKRA 2A08A 4HAZA 2ASEA 5FUXA 3VX4A 1E0KA 3HU1A 1NSFA 1QVAA 3KB2A 4TYNA 3K9NA 4PQFA 2Z43A 2O8DA 2I0NA 1QHYA 1PKSA 1VDZA 1TNDA 2CVHA 2DWOA 3SNHA 2IHYA 1WXTA 3VR3A 3ZIAD 4EIKA 2KROA 2JJ1A 4S35A 2PEZA 1WF3A 5AJVB 3I5XA 1MO3A 1IONA 4HB0A 1NKSA 4N0EA 1WCV1 2ZRMA 3RS4A 1JBKA 1B0UA 2EFDB 5FR2A 4NBSA 4OI1A 4AK9A 2WIAA 4B3CA 3CX7A 2X2EA 1GKUB 2BHRA 5EE3A 1K5GA 4ZKEA 3BK7A 3IIJA 1NLOC 3PVLA 3SC3A 2VP0A 2FH5B 1UUEA 5I11A 2AR7A 1OPXA 3W90A 3MSXA 1OXSC 4M1WA 4NDZA 3SJAA 4D4LA 4KBFA 3U7HB 5FOUA 1MR3F 5JCZA 3U60B 2C0TA 3K53A 1YZQA 3T5GA 1K1ZA 2BMDA 2RQRA 3PEVA 5DN6A 1HQCA 2ZJ8A 4XD7D 5FOSA 1AIPA 2RMOA 2Z4SA 3EWAA 3PEUA 1NP6A 1T8UA 1VYUA 2WAXA 1MO4A 3TW4A 5FFMA 1SVKA 3QWXX 2GAOA 2OFOA 1C4OA 2C5LA 2EQBA 4QGFA 4MQBA 2J6OA 2QAGA 4WIAA 1N5ZA 1R4AA 1Q44A 4PANA 4ZCLA 2W58A 1U3OA 5JJIA 2G0TA 4A0RA 3T12A 2I1VB 3QKSA 5F2EA 2PTKA 3PXGA 3TSOA 1D9XA 1P2TA 4FCTA 4JVSB 1BH2A 1XPRA 2CHQA 3ICEA 2D4HA 3UKDA 5A4JA 1XP8A 3L43A 4EDHA 4GZLA 1QHIA 4LK2A 2ZYVX 2FPKA 4Z8XA 2YWEA 1PZNA 4BRWA 5G3YA 1GCQA 3K0EA 3EPHA 4F4JA 2JLZA 4RKEA 5JLJA 3EG2A 3W6NA 5K8IA 3ND9A 3CZPA 4OHVA 4OMMA 4Q03A 3KKPA 2N46A 3VKGA 5L3QB 5DHFA 4GOXA 1RZ3A 2AXPA 4D6PA 1SULA 3JV3A 5IT5A 4RTWA 2KE5A 5BQ5A 3U3KA 5J4LA 4I1UA 4LV8B 4Q66C 2FGKA 2OCPA 2IT1A 4B3FX 4Q7JB 2OBLA 4IJMA 4LPSA 1S8FA 3FKSD 1Y0MA 2CHVA 3MD0A 2CMKA 5C2JB 1X69A 3C7KA 3SFZA 1E6HA 2GEDA 4BFZA 4Q1BA 3TMKA 1FUUA 2UKDA 3LXRA 3KJGA 2JASA 4DLYA 4Z1MD 2ORVA 1EFTA 3SHWA 1KMHA 5TV2A 3AF3A 4KYIB 1SGWA 4JLMA 2O31A 4JPBW 4AFQC 2N42A 1TUDA 1BBZA 4LJYA 1WBDA 2YUNA 5L3SA 3P20A 4TQAA 4RD2A 8OHMA 4HLQB 2X3WD 5F9FA 4IVPA 1W1FA 2AZVA 5B30A 3QG1A 4C30A 4AFUC 1UDXA 2WHXA 3MFYA 2P4RA 4UNQA 2EFGA 1D8TA 1GNQA 1VA7A 2QL6A 3QVVA 4Y0VA 3OIUA 2D0NA 3SZRA 1GFIA 2J0UA 5FBQB 5TY0A 4AYWA 1MRSA 4FIDA 5SZJA 2AK2A 3THXB 2AXNA 2YINC 2IS2A 4RTTA 3RNJA 2Q9BA 4UJ5A 4IFBA 2ERYA 3CRW1 4DCNA 5EE1A 3TAHA 1PWTA 1SHZA 5FTJA 1QDEA 2H57A 2QQ0A 2VTKA 2EPDA 3CIOA 4M1TA 2NUZA 4PPGA 3DM5A 1JPNA 3AP3A 3RS7A 4YLGA 4C2UA 1RRCA 4LC0A 1RIFA 1CR0A 4DSTA 3ULRB 1U0HC 1RC8A 1T91A 2YHSA 2G0NA 1R5OA 3DOFA 1B23P 1ZIPA 3LDAA 3W5IA 1QG2A 2W6IA 2CE7A 2FSFA 4OYHA 4EJSC 4WBSA 4ZDWA 1KO8A 1IN8A 4LWZA 3KFVA 1CJMA 3O8BA 5AJWA 2YYZA 2DPXA 4QHYA 2JLYA 5CLLA 3NC0C 1IHUA 2AD1A 1JEEA 2DBYA 1M30A 1KSGA 4TYYA 3WP0A 2QPAA 4QJ3A 2WJYA 4BZQA 2QROA 1IN6A 3B9QA 3ZVNA 4KODA 3GEIA 4MKHA 3L8ZA 5K8TA 1P9RA 3W8RA 1A5TA 1RE0A 2CJWB 2KB0A 1Z3IX 2WWIA 1OPLA 2KT8A 1X1SA 1CR4A 1R0ZA 3MJRA 4HAYA 2YV5A 4RFVA 4KFRA 2RQVA 5CK4A 2J0SA 4B2IA 4CF7A 1Q22A 3THXA 3THKA 2DL4A 5FR1A 1VTKA 2XB4A 3UMRA 3LQRA 2GTPA 4DB2A 4BUJA 5FOVA 1TF2A 2KBEA 2I4IA 2P6UA 1YHNA 1SXJA 4M21A 4CT4B 1TG0A 1GNPA 3BFVA 4YMUA 1YR9A 4ARZA 3AKDA 1WFWA 4J9HA 1EK0A 1HUQA 3ZS9A 4JT2A 4U00A 1UBEA 5CITA 1AA9A 3KX2A 1S9HA 3G0HA 2WV9A 1GUAA 3FFAA 3SEAA 3DMNA 3REGA 1JXOA 2G3YA 2WOOA 1Z83A 4DLXA 1K5DA 2HSPA 1LB1B 4YMSA 2WMNB 4ACBA 1YZNA 2V7QD 2ZITA 2GXAA 2ZRFA 1S3GA 3DVLA 5FOTA 4AG1C 4LBVA 3I5RA 5BN5A 4URYR 2ZYWX 2YWFA 3AVOA 3NWJA 4MGIR 5LD2C 2BKEA 1T9HA 3HP1A 4OQMA 2EFEB 3AV0B 2IYXA 4M4SA 3VKWA 1I4TD 1ZU5A 1WB9A 1IOZA 1Z9QA 1IQPA 1EFUA 1G4UR 3PENA 4C3ZA 2GJAA 3G5UA 4CC3A 3BB3A 4JLOA 2EW3A 2XJ4A 3F5FA 5IH2A 2QM7A 2XITA 4LHVA 2IXEA 3CRQA 3HU2A 1XZQA 4BLQA 3ZD7A 4RD0A 3HJNA 1KI7A 3NHBA 4QHTA 3CWQA 1NN3A 2IYWA 5ANRB 3I1FA 5HKKA 3KKQA 4DC9A 4JLVA 3KDSE 4Q4JA 1G8FA 2Z0MA 4MGYR 3OAAA 4KSCA 2JLWA 2XXAA 1YZLA 4F16A 1Q1EA 4Q4AA 2F2XA 1E1QA 3B8HA 1KJZA 2CDTA 1KI9A 5JWOA 1QHNA 4UXJA 1BOFA 1SRMA 2NZJA 4BFSA 2XB2A 2A3RA 3GLHB 3TBKA 3CNNA 5DSZA 3A36A 3P26A 2ZI7A 2X3XD 4Q01A 1YZUA 1NMZA 1ZM4A 4QL3A 4CC4B 1KTVA 1XCGB 4KV9A 1COWD 3H0IA 1RRGA 1IAQA 1XFAA 2B7BA 2REXB 2Z83A 2ZJ5A 3A4NA 4ZIRB 1Z5ZA 3C0CA 1BKDR 2HLDD 1H8KA 1N0VC 3Q3JB 1TQ6A 5G40A 2VVKA 1G5RA 4NH0A 4A4DA 3RRZA 2KSQA 4B43A 2BZ8A 2YNMA 1LCKA 1KK1A 5AUPB 4DDTA 1ZNZA 5KNBA 2YVUA 3CLVA 4RCZA 4F93B 3K70C 1KI3A 4RTUA 2ZANA 2F43B 1M3AA 1DAMA 2F6RA 1ARKA 2ATXA 3GJ0A 2J3EA 3PUZA 1CR2A 1II8A 1G83A 4HUQA 1ZUYA 3DEFA 2FMXA 3IHWA 4LDJA 4CYMA 1GIAA 4E5UA 1XEXB 4MYTA 2AKAB 4QGGA 3RLFA 1F2UA 2I3BA 4QFMA 1T0HB 3QBVA 1NL3A 5LBIA 2OILA 2FNAA 2VSOA 2YT6A 621PA 4M1MA 4E6RA 2PNIA 2FX3A 1ESMA 1H8HD 1XMIA 2ZI9A 3LBHA 3PVSA 2D1XA 3RANA 2JLQA 4MH0R 4RFSB 4V02A 3M0TA 3VX3A 2J0VA 1JQLB 4W7SA 2C8VA 3QEJA 1NG1A 3K9LA 2ROTA 3D3QA 3GLGE 4C7OB 4OMOA 2GRJA 2QI9C 3UWKA 2F7SA 4L5BA 1TAGA 2BMFA 1RW4A 4P32A 1TEVA 3AF4A 1KK2A 4JBXA 1OV4A 1ZUHA 2GQIA 3SN6A 2ZVQX 4M8NE 2C04A 4HI0E 2CVFA 3OHMA 4R9UC 2DL5A 1SVWA 1CKBA 3ZQJA 4A15A 4URVR 4LYFA 2OCYC 3CPHA 2RGEA 5D3QA 1CEEA 4OQLA 1YP5A 1XTQA 3X1DA 3I35A 3TVTA 3U3OA 3EG5A 3OAAD 5IK2D 3K9HA 4XTRA 4QBIA 3CPEA 3TR5A 4QT7A 1KKLA 4IKEA 3K09A 1I07A 1KDTA 4JZKA 4OHZA 1X86B 5KPDA 3IIKA 1KJWA 1US8B 2NMVA 1KHTA 2JTEA 5F3WB 3ADBA 3EPJA 2GGRA 2RQUA 3BAFA 2JMAA 4DT1B 2BIFA 3BE4A 3IHLA 1G3QA 4G01B 4HZUA 3UXMA 4KVAA 3IO3A 2Q21A 1Z6XA 4RFSA 2IEYA 5IF9A 3W8NA 3FKQA 3MGCA 1GP2A 4C4PA 4CDGA 2OAWA 1W0JD 1AWWA 2DX1A 2ZROA 3ND8A 4PZZA 5FL7A 2HV8A 2YZ2A 4PFSA 1Z63A 2XXAB 2W10A 2BJVA 5E4FA 3I62A 2ZRJA 1CSKA 1G21E 3VU9A 5SZIA 2ZS7A 4L9WA 4NYIQ 3RC3A 4DVGA 2ED0A 3C14C 1LV7A 2OLJA 3EHRA 1ZIOA 2CK3D 2A5YB 2NO1A 2FFAA 2R9VA 4KYUA 2QMUA 5FTKA 2OI3A 1O87A 1Z6YA 2GK7A 3CO5A 4QNRA 2AFIE 4D80A 1EESA 1E2FA 4ZCMA 3KQHA 4ASUD 4UXHA 5KOYA 5JWHA 4ZIRA 2KYMA 4Q19A 5KNCA 4GL2A 1XMVA 3WNBA 4JJDA 2FPDA 4B33A 1PUIA 4EAQA 3MWJA 5FBLB 4K46A 1P2SA 4LBYA 2JLUA 4V0NA 1CRQA 2GKSA 2K3BA 1R7RA 4MRVA 2BBSA 4NZYA 4US1R 5FBWB 2JA1A 1PNJA 3PR1A 3T1TA 4J9CA 2CT3A 1AS2A 3SS8A 2WSSA 1AZTA 3NBXX 3QF4B 5FUWA 1KJYA 1AGRA 2QMEA 1G3IA 4AKGA 4BLRA 2CHGA 4J0QA 2W83A 4NHOA 3V9PA 3NDBB 2JJ2D 1JECA 1OFUX 4JLJA 2QRNA 2VBCA 3EC1A 2AD5A 1NLFA 2ZRAA 1KSWA 4CEIA 1E2NA 3N5CA 2NIPA 4DJTA 2G6FX 1DE0A 1W48A 4RD6A 2OAQ1 1SHFA 4KBGA 5GJWC 5J4VA 1G6OA 1RYHA 4EPWA 2J6FA 1E69A 2O8CB 3MMPA 2A2ZA 4P0TA 2GZAA 5LB4A 1R0XA 3GLIA 4CC2A 1Z6AA 2E9SA 3IPXA 1N0WA 3K70B 4Q7LA 2WWXA 1UHCA 1GL7A 2GNCA 2EQIA 2HDAA 2V3CC 1N6PA 1Z6TA 4DB4A 2YOHA 4Q7MB 4QM6A 1FQJA 2DFNA 4XTCS 4QC2A 3REBB 2ZREA 3V4RA 1II0A 2J9RA 2OEPA 3FDIA 1HH4A 1IXRC 2ANCA 3X2SA 3FHOA 3O8RA 4URZR 4B76A 4EQ6B 1N6HA 3GEHA 1G3UA 4HAWA 3K0AA 1HYQA 3FFBA 2J6KA 1UKYA 1Z2CA 1E3MA 2VO1A 1FX0B 1LF5A 3CQTA 1DAKA 4IEEA 5KHOC 2FOLA 1IN5A 3ZS8A 2FEIA 3PEYA 4MITA 4DBLC 3U7EB 1CJTC 2IUUA 2C78A 4GOKA 3OIWA 3T1VA 5C46F 4HB2A 2WSMA 3EGUA 4JLAA 4C0HA 1KI8A 2JS2A 2D7CA 4LCBA 2L3SA 1KI1A 2UZIR 4K8OA 2PL3A 3GLIB 4R2HA 3EIEA 3O8DA 4PHTA 3H0KA 2K2MA 4JLNA 4AFSC 4D4MA 4PAOA 2CH4A 2CREA 2IA5A 3A1VA 1OPKA 5JHGB 2DL8A 2EYZA 3MLEA 4PHHA 4TZ0A 2VIIA 4AYTA 3ASYA 1DOAA 3AVQA 2C03A 4TTPA 3WMGA 1VCIA 2FSGA 5LD2B 1WP9A 2PZGA 4A8JC 4OKSA 4EQ6A 1J3TA 3TQFA 1Y3AA 1RVDA 2CL0X 3MWLA 4AFZC 5IHPA 3R6NA 5F9HA 2ZUDA 4NMMA 2BZYA 3WXMA 3R7WB 2RGCA 3SDZA 1SZPA 5DYIA 4L9SA 1CKAA 3NIBA 4QGHA 1W5SA 4TMVA 4KXFB 1HEIA 3EASA 3TQCA 3WRXC 3P1JA 3M0QA 1MRNA 3B9PA 3FHCB 2ENMA 1I2DA 1M1YE 1ZD8A 4LV6A 5DLQC 3Q7PA 2LQNA 3RNLA 4BEBA 5BW8A 4BQSA 2PX0A 1YZGA 3NDPA 5B57C 4HXJA 2Q3FA 3UWOA 2F1HA 2HJVA 4UNNA 2YDLA 2ED1A 2CL7X 2AWOA 5HCNA 4A8JA 2BZXA 1VYVA 4FI3C 1K0XA 2JS0A 3M0SA 4D8DA 2DM1A 1Z0JA 1NYFA 2QORA 3TIFA 2WJVA 2QG6A 2JM9A 3IGFA 1M7BA 1PV4A 1EWRA 2IUSA 2RF0A 1SKYB 1VPLA 1XTKA 4E07A 5CLQA 4WXPA 2O0KA 1FL9A 3KJHA 2FG0A 1XX6A 2ZSDA 4N3NA 1UKVY 1ONBA 2MSEB 1VYTA 2BV3A 2WICA 2HYDA 4AIIA 2VA8A 1UM8A 2VHCA 3KJEA 3HR7A 1NM7A 2OG2A 3ZZTA 2RCNA 4BLSA 2PEYA 2OAP1 3ZGXA 1II9A 4J9BA 1E9SA 1NMYA 3OIVA 1B3QA 2XEXA 4C0QC 4B71A 3ADDA 1R0YA 4GP6A 3QG5A 2NO6A 3QXCA 2DBKA 4IXNA 3THWB 1KK0A 2RHDA 4I4LA 1J2JA 4MKFA 1FTNA 3EAQA 5BN3A 4TQ9A 4OQNA 2O9VA 1Q1BA 1WMSA 2GZDA 2KR3A 2ZRLA 1QRAA 1P2UA 1YVDA 4W5HA 1H65A 2VSFA 1H8ED 3AH8A 4QBGB 1YWOA 2FF7A 1NLZA 2PZFA 2WMOB 2QZ4A 4AWXA 1KIMA 2CE2X 1AN0A 2BEKA 3KZ1E 5K8LA 2RN8A 1S4QA 4TMZA 5FBRB 3RS3A 2R6AA 1MO6A 2X2FA 4XJXA 3VFDA 4WZBE 1AM4D 4DHEA 5HR5A 3RS2A 5JWRA 1R5BA 3VS4A 5EUMA 2Q9CA 1ZM2A 5LPNA 1G1MA 4TMWA 3EZ2A 1MT0A 2GK6A 2J7PD 1JI0A 4D26A 3FMFA 1DAIA 3T15A 3N2IA 1YRBA 5CM8B 2XSZA 2FPLA 4IDPA 2OO7A 4BLOA 4MYHA 4POAA 1RRPA 1OEBA 1N6IA 1XF9A 1U9IC 1X1RA 1R10A 2GESA 3IKJA 4PSAA 2Y8EA 1KO4A 2FPMA 2QA5A 3DO6A 1M8MA 1E9CA 2J45A 1E2EA 2JXBA 4A0GA 4ZPXA 2VF7A 3B2EA 2CCJA 5GJVB 3IO5A 4UQOA 5TVKA 2HF8A 5TB5A 4ZKDA 2DF6A 1E9AA 1W0JA 5FL7D 5FW9A 3I4LA 1JR3D 2XNDD 4JSYA 5DI3A 3VNUA 3A98A 4US0R 3OEEA 1DG3A 3SR0A 3A1SA 2AK3A 1NKTA 1FZQA 3W6OA 3C5CA 3I9QA 5AR1A 1HSQA 1WYXA 2FJUA 2KT1A 1FPMA 4RKFA 4D0LB 1E2JA 3K9GA 4WZ6A 1NY5A 1ZCAA 1ZINA 4LYHA 2JW4A 2VHJA 3QY0A 2ZJZA 2P3SA 2O88A 4NCKA 5B2ZA 4G3XA 4LUEA 4UNPA 4AKIA 1T6NA 5C18A 3JVVA 3WRYC 1HY3A 1JQQA 2PZ1A 4OI2A 1CRPA 3H1TA 2VL7A 3DHWC 4JVLA 4DSUA 4PR0A 1E2HA 3CX8A 3TGPA 2F2VA 1NJGA 1YR8A 2EBPA 2VH5R 2VKNA 3F0TA 4IOLA 4QHSA 2JMCA 1W0KD 2LQWA 2XSZD 3DZDA 1VG0B 2ODBA 1NBMA 2NGRA 1T5LA 1AKEA 1T8TA 4TLCA 4TTRA 3RRMA 4A8JB 2IS4A 4FN5A 4LZZA 1CF4A 3OFNA 1N0UA 4W5JA 4OMLA 4JYBA 1NVVQ 1KSFX 3OE7D 4HEJA 1F2TB 2R6CA 5KSPA 1GL6A 2OXCA 3BGWA 4HZIA 1QHGA 2QQEA 2IX3A 2O8DB 2C0IA 1G5TA 3VR1A 121PA 3EZ6A 5FPKA 5HCKA 2CNWA 4AKEA 2GCOA 3W6PA 4PPQA 3ZZUA 4D81A 2H92A 2K5UA 2IYYA 3V4FA 1G8HA 2WOJA 4A2PA 3MJHA 2QP3A
chains in the Genus database with same CATH superfamily
5CBPB 3L8YA 1CDZA 2GETA 3II6X 1ZBJA 3NRBA 1RABB 2AMVA 1XJWB 4IKPA 4LOJA 2DVMA 1VE7A 1PR1A 4R1SA 3WDKA 4KXQA 3Q7TA 2Z0WA 1H23A 1KQSP 2FEMA 2XQJA 2UYCA 3MTIA 3GT7A 5KOJB 2M6RA 4YRPA 4FWIB 4MQMA 1EDEA 5D85A 4GKJB 1Y7IA 1PJAA 2CXQA 4E2YA 1M8KA 2R4QA 4YMGA 5CFOA 3TZBA 1PUXA 4P3YA 4D8WA 3HB0A 3B2NA 3GD7A 2XY4A 2YRFA 2QL7A 3CUVA 1ECCA 4IVQA 4Q1DA 1W59A 2ATIA 1QIJA 4NJOA 3AMVA 3UW3A 1A4RA 2D4AA 2Q3MA 4FL6A 1V5WA 1WCIA 1PT9A 2Z1NA 3I92A 3OLYA 1XDBA 5DM1A 5HCIA 3EG0A 1G20E 4TN1A 1XE3A 3V8KA 2BFCA 2Z8YA 3ISTA 4U8GA 4G5XA 4NK5A 3TNYA 4BECA 3NHPA 1QVPA 3AQIA 3KAKA 4JX9A 1L7MA 4J4BA 1KMQA 3CPWS 2OYCA 4BVJA 3AFGA 2V55B 4H2DA 3W5DA 3C6ZA 1JFLA 1XTPA 5E3JA 2COKA 4XR9A 1K5PA 3TSWA 3R0JA 3TEJA 1FBNA 1CJCA 2V96A 3BGSA 4JUVA 1KAGA 2ID7A 1SZCA 4QVZA 2QLJA 3L6CA 2O3UA 1C7JA 4Y2RA 3UUEA 3HXLA 4OA5A 3EBPA 5I7AA 2A57A 2ZXFA 4BZPA 4EECA 5BRAA 3UCXA 1UFQA 3BD9A 2KBTA 1ZGBA 1G7RA 1QH1B 3RWOA 2ERXA 4TT8A 4P4LA 2C95A 1PD1A 3G89A 2M02A 3A3OA 3A0RB 5JAMA 1X1BA 3JR3A 3L1KA 4IIHA 1FMWA 4QUHA 4R6WA 3ZWCA 1Z5GA 3BDAA 3DTVD 2FYKA 1OXVA 1JTEA 2WG2A 4RV5A 2VQSA 4Q3CA 1KY3A 421PA 2ZUBA 4UM9D 3H1FA 1W5EA 1GTZA 3MWEA 3Q2OA 3TLAA 3G6ET 1KAEA 5C0OE 4DANA 5JPDA 3G7SA 3O8QA 3D02A 4XW2A 1DUIA 1B3BA 3FOBA 3PJRA 2QZPA 3Q4GA 1QIHA 3L7IA 1X2QA 2HMVA 1XLWA 4GBED 4J9EA 2IZ0A 2NXJA 2DFUA 3L2QA 1J8MF 3NFRA 4WXEA 3FWHA 1A2OA 1K7CA 3ISJA 3A1NA 4ZYXA 2DXCA 3W9UA 3ROEA 1TD1A 3QMWA 4MWEA 2VXYA 1FCJA 4B44A 4LIPD 3MCAA 1KMHB 1XZBA 1C0KA 3RRNA 3EHDA 1J0CA 1TMGE 3JCMh 1M3CA 1RAAA 1KQGA 1SQSA 4Q82A 2JIMA 3BBPA 4MPTA 4PG7A 3FDJA 1YQGA 3P4UA 2VS1A 2QG4A 5F9MA 1QVFA 2NU8B 3D7NA 3WYGA 3DT8A 2YUOA 2Q4TA 5EP1A 2JCVA 1UOEA 5F7ZA 5I9MA 4BX2A 1MX5A 1J99A 1Q1QA 4YLEA 4M77E 1CNFA 3JD1A 1UHFA 2NVUB 3IKLA 2RGRA 3NU1A 1O77A 1OI4A 1SVSA 1BCMA 3B2QA 4TZTA 4UTXA 3M6XA 4IDBA 4D4HA 3ZEHA 1D8AA 1ZA2B 1P7YA 2RGBA 5BV1A 5A2QA 4CKZA 3HYCA 4G6ZA 5I9SA 1BW9B 3S81A 2CN1A 3LQYA 3CCSQ 3PI6A 3A4LA 5K9ZA 4DLZA 1ZBQA 1UDRA 4HQRA 4DR7B 1QGZA 3R0VA 1YJ5A 3O8LA 4B3DA 3T06B 4EH1A 4F4HA 1HE1C 4FGUA 1NPPA 5AFSA 1PD0A 1B6RA 3X1XA 3SIRA 4M1OA 4CF5A 4I9FA 4HCKA 1G4HA 3O7MA 3RYFA 4TV9A 4W9RA 1SG6A 5KNCD 4FX2A 3FWYA 3OPNA 2OGWA 4TQUS 2EGEA 1H4TA 2ISCA 2YUIA 1EWYA 2J6IA 4OUKX 2ZUTA 5CKFA 3RT7A 1XQHA 2POCA 4HNUA 4J9FA 5U9CA 1RLTA 3PT9A 5CA0A 1A2BA 1ZIYA 4PZ9A 4NOLA 4BX8A 5E2BA 1IY0A 3DMTA 2WWYA 3VI3B 1U6KA 2P91A 1JG7A 3S3TA 1G8PA 3DMGA 3H5VA 4YNBA 2ACEA 2B3DA 3QOXA 2BF4A 4ETIA 1GNLA 4KIGA 2HSEA 3ZLVA 5B3JC 4C1BA 1XG5A 4AJEA 2XYGA 1AVTA 4WK4B 5CJ2A 2CEKA 4NYJR 3EY4A 2I66A 2VPPA 1DZ3A 4FBGA 3LY9A 1AG9A 4G1EB 3LJKA 4JK3A 1XTVA 3EXFA 1NUQA 3MWKA 3MP6A 4B3TB 3C1UA 3E81A 5JSUA 2QZZA 5K0LA 4RANA 3TQIA 2W42A 4BBPA 3IXMA 2PCLA 4BD3A 5KYYB 3OA0A 3ZGVA 4D98A 2WB2A 1Q0HA 1PGJA 3BERA 3COYA 4Z4IA 4B6MA 2IF2A 2EQAA 2ET6A 4E03A 2ATVA 1FVXA 2CUBA 3P4YA 4H60A 4HPJB 2KI5A 2AN3A 5KVVA 2UYGA 3UWSA 2HFJA 3O2QB 1ZBDA 4RMGA 4OJTA 1NQVA 3JAWA 2IGBA 5PNTA 1RYBA 1U5SA 3IESA 4U4AA 1TK9A 1U2QA 3ZGNA 1CU1A 2PZ8A 2QTCA 5D5QA 1OU9A 2R7AA 4WRRA 1TPYA 4RD1A 4GD3Q 5C7IO 2HBWA 2KRSA 2Q62A 3A1WA 3PXAA 4Z1OA 3B52X 1BKSB 2FN4A 2JGKA 2P6PA 5JXHA 1L4KA 3HDQA 4HKEA 3EVTA 3AFOA 4E2XA 2IEBA 4HC4A 4JKIA 2GB4A 3PSAA 4KQ9A 4UMEA 2HNBA 1XRPA 1PT6A 1JE0A 4HB4A 1HDEA 5IDVA 1IBLB 3AV3A 1FSGA 4G1VA 2EZTA 3ZBUA 2PVCA 3DFKA 5FCDA 5H9WA 4D9GA 4HXFB 5ABPA 1QP7A 2XHZA 5K6RA 1T3TA 3HN2A 4HRVA 4G0YA 4Y9UA 1KEUA 4FOPA 4JT9A 4O6VA 4PCAA 5IJXA 2DNUA 3M58A 1ST2A 1H2EA 2AMFA 3L2UA 4G67A 5TPWA 1UMDB 3TLKA 3VNSA 3E7WA 4O5OA 4D97A 1E1CB 1I7LA 1PQ4A 2QEQA 2WFZA 3T7RA 2ZB3A 3SZOA 4MVWA 1BDHA 4DVJA 3QO3A 2P8JA 4I3FA 1UM9A 4L0MA 2HXSA 5EEHA 4R0KA 3WLFA 5KCZA 5DX8A 3C3XA 3LUPA 2M6SA 3EXIB 3HXPA 3CKMA 2RD1A 1XV5A 4WFIA 1AWOA 2ZSAA 3DKVA 3SYMA 1I1QB 4YX9A 4D92A 1QCDA 4EUEA 4A16A 4IINA 4M0KA 5LL6P 2Q50A 1YIJQ 2KQUA 3M1YA 1UEBA 2XTMA 3SIWA 5GIOE 1N8RU 3MMSA 2AHJB 4X1OA 1SA0B 4EG5A 2WTNA 5BSMA 3V34A 3HLKA 1Q83A 5ECAA 3TFOA 3CCLQ 2W2VA 2Q9UA 2UYOA 1SUCA 2VF2A 3F5MA 5IKEA 3JQBC 4B32A 2LVBA 3G2PA 4NBUA 2OCBA 2E64A 2Q1YA 4P5EA 5HBRA 1ORHA 1OQKA 3EJWA 4L50A 2H2HA 4IXTA 1YFJA 1GL9B 2JL1A 4M77C 2VG8A 4AG3A 3K1TA 3UG7A 3F73A 3O1IC 3CCEQ 4RNDB 3VHRA 3MS2A 3SHFA 3KEQA 2XGSA 2IXGA 4ZNXA 4RZ3A 5IKMA 1QF6A 2PA0A 5BMOA 1Z0AA 3OFSA 4AMUA 3CVUA 2XICA 1J2YA 2R8EA 4C92A 3RBVA 3TFQA 3O4FA 3OLWA 3KT8A 3FSEA 2PUGA 2RA2A 4EX7A 2DCUA 5JNWA 1S2LA 2OGSA 1BQ4A 2IPNA 1WXBA 1QVVA 2W2OA 4YCBA 3C8HA 1P2FA 5FOWA 3HSBA 1TTHA 1WA5A 3GGSA 3QV1A 2SECE 5ALSA 4R9RA 5F21A 4QOIA 5B4UA 2G36A 2PT5A 4NDNE 1PG0A 1ZK3A 2HQOA 1VRVA 3SOZA 4YQFA 3H05A 2WF5A 1XUOA 1LBTA 1JLRA 3A3NA 2A28A 2QE7A 3GVPA 3FPSA 4RK7A 3LH5A 3ES9A 1K8QA 4TL6A 1JR3A 3LUDA 1J24A 2V0CA 1LCIA 2HQBA 2YZMA 3ZR4B 2NYSA 2FWRA 1J39A 1Q2UA 2QTVB 1GPWB 1MX1A 2H5IA 4RM2A 5C5EA 3CSDA 4UE2A 4X6UA 1B1CA 1TAHA 2BOVA 3AFIA 3O4HA 4J76A 3MRXA 1Q86C 1M74A 3BJZA 4PZ0A 5EWMB 2J33A 2WLTA 3RB8A 1MXHA 3Q9LA 2OV1A 3SGLA 4CM4A 3WQSB 4CLHA 4FYYB 4YQZA 4CIWA 4TSKA 1JXMA 3MUFA 3T9BA 1QKWA 3ITDA 2C8KA 2R6ZA 5AM2A 1UCFA 3VS3A 2EKDA 2ZI4A 3FGNA 2HPAA 2VP4A 2COZA 3ORRA 4NYIR 5HZMA 1MCZA 1POWA 1IHYA 2EFCB 5GAMd 1N8NA 2PGLA 2ZE7A 3DBLB 3U4HA 2BI8A 4CTMA 4XTVA 2Z2KA 1R0RE 3NXKA 2XVZA 1I51A 1XAHA 4FYXB 4HX2A 1OFHA 2Z6VA 3V2IA 2WSEE 1AUOA 1EP2B 4LISA 2X40A 1SC4A 1AEYA 3O8OA 4FFNA 5CDFE 1ZMBA 4FDLA 4JN6B 2ZS9A 4MS1A 5K99A 3K0FA 1FF9A 1WHSB 2WPDA 2DTOA 4LQ4A 5F33A 1RYYA 3RFFA 3RHFA 2QIPA 3TOZA 4D9NA 4ZTZB 3UUWA 1J9EA 3DCNA 2AKLA 2L69A 4WCFC 1FNNA 5FFNA 3ZTYA 3ELDA 1INLA 5AW0A 4JJFA 2ESWA 5D5HA 5I9TA 3HCBA 4EJ6A 3BILA 3CRNA 4WINA 3T3PB 1R4MA 4FD3A 4P3XA 1EVJA 3B48A 3K8ZA 1KAQA 4KR6A 4JASB 1US8A 3Q8KA 1F38A 3G0DA 3LG2A 4NY1A 1I81A 3CFYA 3OEWA 2YTZA 5L4NA 3WAJA 3AEKA 1BB9A 1X6BA 2EFIA 3FJ1A 3GJ8A 4XCQA 4LMBA 2P77A 1Q0QA 2ZR7A 5C3UA 2WVJA 5FWCA 2GK3A 4H3KB 2VATA 4C21A 4HL6A 3QE0A 4M7AD 3SD4A 1SOMA 3EIUA 5KYGA 1L6RA 1W4RA 1U8XX 1O4WA 1ENOA 1L8QA 2CDAA 5E9AA 1QP3A 2ZQYA 2RGGA 3HJRA 4L6AA 5DMXA 4TYWA 5LIRA 3AESB 2CZ7B 1ELOA 1VP9A 3VH2A 2II6A 1K76A 1SKQA 1AB5A 2IYTA 2O57A 1E2LA 3UWNA 4P0PB 2V1RA 2RHRA 1ESNA 4CKBB 3FB9A 3L79A 3S0JA 3BWCA 4O5AA 1RAIB 4IRUB 3QWYA 2RHUA 5DNWA 1D0XA 1U98A 1K27A 4I5DA 5CXSA 1T0JB 2E6KA 4OGKA 1I14A 4Z9XA 5LLDA 4J7FA 2XUPA 2OTJT 3OS5A 4ZODA 3JU3A 4DMUB 5IFLA 2R0QC 4FX5A 1GGEA 4UHHA 3LT5A 3DZGA 5K0NA 2IPMA 2VJOA 2A0YA 1W36D 1QZZA 1JAYA 4X45A 1QJ4A 1UEIA 1C41A 3O4JA 1M1GA 3G0CA 1RJ9A 4WI1A 4MPDA 2H4FA 2V7GA 3THOA 1N2BA 2H7XA 2CXXA 4MW2A 5AUQA 4EVQA 5JVDB 3NOQA 1Y8RB 3WMFA 1T2AA 1VIYA 3ANYB 5CYOA 5SZKB 1TQHA 2Q6OA 2DR3A 1SBCA 3ESCA 4X7MA 1XQVA 1O75A 1YBHA 1X7HA 2VQ6A 3NW9A 4QG3A 4PJOB 3LW8A 5IS2A 3PQCA 1HM5A 2G7ZA 3U09A 3ACBA 3JZIA 4XEUA 4GU5A 2A7XA 3EC2A 4RU1A 1U80A 3LUKA 2HDOA 4UCFA 1ZUNB 1EBUA 1Q7BA 1GBQA 3FJPA 2PKQP 3H9CA 3K09C 2OFFA 4FYVB 2IHVA 1W2WB 3IB3A 2WIBA 4GYWA 2Y2VA 3I23A 1HMYA 4GZ6A 4OK5A 4UNIA 2IZZA 3CF6R 2PJRA 2QU8A 1A5ZA 1ZVMA 5BW5A 5JDIA 2I54A 3FOCA 4DKXA 5E38A 1NBMD 4HDSA 1RACB 5TF4A 5THKA 4LGMA 3IVGA 3V4OA 3VV0A 4BVBA 1R6TA 5KDOA 4EW1A 2YVLA 2ZRDA 3FTQA 1NEGA 1LJ8A 3M5PA 2QL5A 3QXSA 4YK7A 5CNJA 3V7CA 4EUHA 1NW8A 1HWYA 3AG6A 4CL8A 4UE3S 3C4SA 1IO6A 1FDOA 3VHXA 1F4PA 2L5QA 1ADFA 2WKQA 4DBRA 1O03A 4R51A 1OT3A 3CMCO 5TX7A 5J4KA 5FA8A 1SXQA 1VLMA 1SSFA 3ISVA 1WO8A 1Q50A 1VIFA 4YJ2F 2FUG6 4DLLA 4DS3A 2G08A 5DI3B 4N0DA 5AXDA 3T4UA 5MGNA 2YUPA 3PK0A 2IEIA 2JBAB 3P5BA 2GS9A 1C4WA 1Q84A 2OGUA 2YXBA 3V8MA 3JASB 1RQLA 3UAWA 4TV8F 4RXMA 3E9YA 2AZDA 4YN3A 4LJ7A 3V4ZA 3CD6T 3OFND 1KDZA 1EFNA 1AQYA 2LDBA 2XDQA 3FWKA 3OZXA 4ZCPA 2HHJA 3WWYA 1FP1D 1DAHA 3OX3A 4R6XA 5DSXA 4MS1B 2ZSFA 3K0FB 5ECYA 2O5CA 3OD1A 4V0RA 1R8QA 2GASA 4F1KA 5HJ5A 5KE2A 5DCYA 2VEOA 4K86A 1YRAA 3VDMA 5KU1A 1CK4A 3R23A 1DQRA 1NRXA 4HVWA 1YCHA 2CHUA 2MSWA 2V6MA 3NXSA 3PUWA 1DOHA 3IVAA 1I4K1 4NS5A 2HMWA 3CEJA 1HDXA 2PGJA 3ETHA 4G5GA 2WF7A 4IXMA 1KS9A 4GP7A 1TUGB 2CLEB 4KQGA 3RVQA 4MEAA 5DXFA 3R8XA 4MRPA 1QANA 2V8BA 2XDYA 3GJSA 3ZU3A 2GJ9A 4FOLA 5E3HA 5GQSA 2REBA 2F3UA 4AF6A 2B2XA 3D5EA 3W8DA 1Y4ZA 4NMLA 1BIFA 3DG9A 3N2GB 2I76A 2Q3DA 2ORED 5P21A 1JJBA 4C0FA 2FQWA 4YJ3A 1DUSA 2GFIA 2NACA 1UJYA 3F47A 1UDWA 1WKCA 4YI3A 3N70A 2GBIA 4BE1A 1IGUA 2JGJA 2Q45A 3ANTA 2VYCA 3LF2A 4HLNA 4Y1FA 4ZVQA 4XWKA 2G1PA 4LPKA 1X8KA 1ZKDA 3GARA 2KK4A 3PNVA 2VH1A 4J94A 3A1UA 4RGBA 4KE6A 5GAMj 2AYYA 4GMXA 4PJMA 1KO7A 1Z4MA 3ADKA 2EGCA 3AESA 4DIEA 3IA7A 1GCPA 1RI2A 2RJEA 3KB1A 5H1YA 3ZJ5A 1B7TA 2QA4Q 5DM2A 5L7YA 4UM5A 1CEQA 4FFBB 3AR4A 3IAM6 5A0TA 5C34B 2O8CA 3CW2A 4AURA 4JI7B 1CE8A 1XNIA 3DEZA 1WQ3A 2VK1A 1RYEA 3M81A 5FJJA 4F6RB 4DUZB 1LSSA 1TVCA 3LVQE 2PGNA 2DLCX 3MEUA 1CUEA 4QVGA 5DWDA 4ND3A 5L6LB 3HXMA 4OQ4A 3U61B 8AT1B 3IRVA 5HZGA 1EFCA 3UBMA 2QLLA 1IJFA 3U3JA 2C2MA 2GXUA 2HD4A 2RHOA 3K0CC 4D56A 1JSZA 3I64A 1IB8A 4RTXA 1JSLA 2LZ6B 2NXEA 2PLRA 2B99A 2XTZA 3IUQA 5KPJA 5IVHA 4L85A 1H93A 2XCIA 3OQHA 4CWAA 1OXXK 1BVRA 1MO5A 3VS7A 4YP5A 1KPGA 1ICIA 1XCBA 2HU7A 4GR9A 5B6IA 5J58A 3GCXA 5M34A 3Q3HA 4V0ME 5FTNA 7YASA 1BQEA 3COVA 3ILVA 4M7AA 5A5GA 3T7AA 2VEDA 4UPVA 4LJAA 2J87A 4DMLA 2X5XA 3LPCA 1JEJA 1KD1U 2VKQA 3R8CA 4BP1A 4GDFA 4NG4A 3TFWA 2VDVE 2D8HA 1Z13A 3CQ9A 4E1VA 1A9SA 1Y3HA 1DTEA 1J25A 1NVWQ 5J2TB 3T61A 4HVAA 4LHWA 1DV2A 3NYQA 4IKFA 2JIPA 2PKXA 2BE7D 2LCSA 3OUZA 4OHBA 2XA2A 5FUBA 3SDSA 3HJHA 3JVIA 2X23A 4HR7A 4I5FA 4QDUA 3SC6A 5KQSA 2IY9A 2VTVA 4L28A 1ACMA 3M5DA 4PVCA 1GTL1 2G88A 4TV9B 1ZI9A 4V1CI 1MAVA 1LNXA 1LVGA 3KR1A 4ER0A 3R7NA 2JZNA 5FTWA 3S2YA 3NH6A 4I66A 2EU8A 3O2SB 2P6RA 2AK5A 1RQ7A 3RVSA 4ZN1A 2G72A 4RJIA 5BV0A 4LGVA 5AJHA 2QW1A 1SB8A 1B73A 2GAFA 4Z9FA 3G6EQ 3ZHSA 1IB0A 2YW9A 3WGZA 5A7HA 5HM6A 1K6IA 1XYVA 4F84A 3K8OE 1CY8A 1NUHA 2ODQA 1W2BS 2QD2A 2CSIA 1HURA 1BU5A 2HK7A 3F2IA 5TSDA 3SZGA 4BJ3A 3CCFA 1E1RD 1W35A 3JYPA 4PQRA 4X8LA 3LPDA 3TD2A 2C9CA 2KLBA 3EZLA 4M0UA 4CL0A 3LYHA 1T26A 4FS3A 4CDNA 4O6JA 4C7XA 3ZJYA 3HPRA 1NBWB 1QB7A 2GBLC 3HGTA 3OCZA 4FDUA 3OURA 4W82A 3ZWPA 3EGVA 1RI0A 3BQ9A 1ZM7A 2G07A 1DBIA 3I5SA 2X0NA 2NUPA 3QZUA 4R9VA 3PE0A 3RT9A 1ZCZA 3AK4A 4JLPA 3U31A 4ZI7F 4F3CA 5KU7A 5DCLA 5MN4A 3ZNPA 1JBEA 2WJWA 1UE9A 4BI3A 2J30A 2Q5CA 2W2KB 3E2PA 3EXFB 4U2KA 4ENWA 3LX5A 3TRHA 4J0CA 3D2CA 2D2IA 4E2WA 1ZQ1A 3CCUA 1TS9A 5K3AA 1U8FO 4DOVA 3CLTC 3FHTA 2JGNA 3D8BA 3NTQA 4B74A 4N40A 4XCVA 2GQVA 2FB7A 5DT9A 1S2NA 2KRMA 4FFMA 4TLEA 3OYJA 3RGWS 2AS0A 4EMGA 1IUOA 3AIIA 1TDJA 4P7GA 1GPMA 2HCKA 3FPAA 3JSAA 2M0OA 1WF6A 3I5AA 1PHTA 3N2KB 1K4KA 3DXZA 4RACA 1KDVA 1C9DB 3UHFA 1WQWA 2HBYA 3L2OB 2DQSA 4NENA 2QQAA 4K9RA 4ZQGA 1F48A 5EFOA 1U8RA 3BGDA 1Y71A 1GPDG 4KIUA 5BWLA 5KSOA 10MHA 4YRGA 4G0QA 3L9WA 4TVOA 1H5UA 1LXCA 3HBAA 4C92D 3JY6A 3ZEIA 1UBCA 4D1YA 5B4TA 4M89A 3NMZC 1KRHA 2RGDA 1EZZA 2O2SA 3INYA 3ME5A 4RTZA 3QVUA 4ERXA 1BHO1 2GPTA 4WCFA 2GTOA 2DFTA 4G97A 4ZRMA 5JYBA 4GE0A 2FN8A 1D5CA 5GAN5 2BZ0A 3GJYA 2GPNA 3OD5A 2K2VA 1ODIA 2RGAA 3BXXA 1CZKA 3B6ZA 2ZBQA 1BU8A 1UAAA 4IIFA 4YRTA 3I6MA 2QGFB 2DGDA 4MVXA 1R3UA 4M9ZA 4JGBA 5J1SB 2VNHA 1Z0ZA 5KCMA 1SUAA 3BMXA 3I39X 2F3RA 2ZT8A 1HDGO 3LNTA 4S0XA 4B73A 8AT1A 4TV8A 3KLBA 1W581 4LC9A 4ZRDA 2RQTA 3QHQA 4KHPB 1QRRA 2WV7A 2WKSA 4J0FA 1P8AA 1W8IA 2DO3A 1A9QA 2B98A 2VAPA 5B55A 3N5BB 4TXHA 4X62B 1FP4A 2IHJA 2A9PA 3G71A 1ZS9A 4A2QA 3ZI0A 3LP8A 1WMDA 3A6JA 2LPMA 3ZQ6A 1ZNYA 2BRUA 3I2GA 1QWEA 4XARA 3CNQS 5KVAA 3QVGA 1SXJB 3NAZA 1NVGA 1XU4A 5HDBB 4MGZR 2WLSA 5KSYA 1SCUA 3LK7A 4UDYX 1BZYA 1THTA 2H7VA 3V7YA 1W36C 3OO0A 4BO5A 1NM5C 2RNAA 3AHCA 4ZO4A 2EHDA 4AY2A 4J0HA 3F96A 5DW3A 4RPGA 3S1AA 4B7AA 1I7SB 1Q17A 1TEZA 3AO0B 5CTAA 1Z36A 2LNVA 1YFZA 4EI8A 2GF2A 2IJGX 4FW1A 2OZKA 2XKBA 4X8OA 1RRMA 3DL4A 4AO6A 2KXDA 1KVQA 1LA2A 5HKBA 4Q3NA 4YIKA 2CEAA 5JZVA 1AHJB 1F5NA 2JJ2A 3SIPA 1SUIA 3IODA 2GPJA 3JXEA 1HOTA 3OIFA 3O95A 4UUQA 5CX4A 1SK8A 4J9IA 1B14A 3QLVC 3NPMA 4IUDS 2EGAA 3T9EA 1O1YA 2EWVA 1TZMA 2GHRA 1L5GB 5JT1A 2O8EA 3ASUA 1IGQA 3WO1A 3IR6A 1FMCA 1CXZA 1HA3A 4O29A 4N7MA 2AG0A 1KXJA 2R11A 3L6DA 4E33A 1Q92A 4MYCA 5CEEA 4M75G 4MVJH 4NNOA 4XQ9A 2DXIA 3E1GA 5DXAA 1I3CA 3BA6A 5EUQB 1N2CE 5L3QA 2QXUA 2WEKA 4BX0A 3GG2A 2PUBA 1KZ6A 1GFDA 5DGDA 2HR1A 2MCNA 4WLNA 3EXEB 1MGQA 2H4ZA 1IDN1 2PRJA 1NYGA 3M3HA 2HT6A 2P90A 3HADA 3NIDB 3GQBA 3VS5A 3WLRA 2KY9A 4EMKA 2ZW9A 3OZSA 2IBTA 2FVYA 5BOVA 1N4AA 2GQ0A 1PX2A 3KQSA 1GG8A 3T4XA 4LDZA 1ZSVA 4PJOD 2ZZNA 3E9QA 3FPHA 3IT0A 1ODFA 3VPXA 2ODAA 3WP1B 4IDHA 5AVOA 5BQPA 5KTMA 4J91A 1PZGA 1E9DA 1Y7PA 2CMFA 1UGPB 4TKUB 3CNOA 2KYRA 2Z1DA 3U81A 4A3SA 3CUEF 4MW1A 4A8TA 1AHHA 4AQ7A 2IVFA 2IHBA 5G0UA 3ILXA 3FN4A 4DV0B 1YTLA 2XMZA 3BPSA 4KO8A 3WDSA 3N2ZB 3RIRA 5EG2A 2LGJA 3ABIA 4OHRA 1BNCA 5AYVA 3S5JA 3U4QB 3ZWNA 1K6EA 3UKJA 1GUDA 2DWQA 1S1CA 2JVIA 2XOKA 2LRQA 1MG5A 4L4SA 5JJCA 4G0PA 2R7NA 1VHLA 4ZAGA 5HVNA 3OYGA 1OFIA 3SG0A 2C06A 3QBDA 4NENB 4C89A 1PWEA 4L6V5 4D4IA 2JI7A 2Q9AA 5KINB 2I3DA 2YVKA 3G9QA 4HFNA 5CK5A 4BQOA 1G5HA 3VOAA 4CNBA 2CUDA 1G2IA 4PAQA 1RXSA 1ZRNA 2IF0A 2O2YA 4LNUB 4Z8YA 4ML3A 4LHEA 2GBQA 1FA9A 2F3PA 3D0QA 2BFDA 4O4LA 1XL0A 4RJKA 4UUNA 3VH4A 3W2IA 4RGYA 1FWZA 3TLGB 2IZ1A 1L4HA 4GG1A 4CMBA 3FLGA 1UJNA 2Z6UA 1P7WA 2G1UA 1LRLA 4ND8A 2DAPA 2QXYA 2QT0A 1L3IA 3C8DA 1M8VA 1J8DA 1KP3A 1W1WA 2E2WA 1P5FA 1T4BA 2ZXEA 1RSZA 1WV0A 1N6KA 1NBAA 3COJA 1O7JA 1N3YA 4B4UA 1R4MB 3QKJA 2VHWA 4XYGA 1JDTA 3VJLA 1EUCA 4MLCA 1X38A 3GA7A 3HWRA 1MA0A 3OYEA 1PL8A 4RQUA 4OJMX 5D3MB 4UBLA 1OBVA 1HEUA 3AERB 4TMTA 4ESHA 2BBOA 3R7LA 4N6NA 3B20A 5DCUA 2V26A 3O9MA 1CNEA 1MEOA 1QGOA 2ST1A 4FSHA 4LJ8A 1XZDA 1ZGZA 4REMA 4XYEA 3QPUA 5A3QA 2EFJA 4LZPA 2B8TA 4LJ5A 2DFKB 5IPFA 2O9SA 2AJ8A 4A5SA 5AT1A 3PHCA 2Y93A 4J0EA 4Z7OB 4HMPA 3BULA 3ECAA 2RFLA 2H4YA 2WAOA 1GZ3A 1YONA 3BSYA 3OZCA 4HNVA 3RAFC 3VR5D 3S27A 1VQLT 1ADYA 2X6RA 1KZYC 5ALQA 4DC0A 2ZBDA 1EQAA 1ZXXA 4C8QF 1VJGA 2YIDA 3GIWA 1M0WA 2OD2A 4DG9A 2BSAA 4BZWA 4FFLA 1EFLA 5ICCA 4ZVUA 4HD8A 5GZ6A 4EFNA 2LNDA 4BOYA 4LDXA 4CDRA 1R6UA 3K2EA 4K9OA 4M9XA 4BBZA 5SYAA 2NSHA 1GFCA 2GA8A 4U6NA 3RYFB 5J4HA 2HGSA 1P1BA 3N2LA 1EJ0A 3TYXA 2CL6X 1YAJA 1NU6A 1U4SA 2JM8A 1RAHB 2VQ3A 3AFHA 1A2KC 3ML1A 3PR2B 3Q0IA 1EB9A 1FDRA 5CA0F 3GLVA 4NI5A 1ESEA 3B6KA 5EKUA 5T6BA 4CKWA 4HA8A 5FRNA 2QNIA 2L0AA 3DCIA 3LWZA 5K4GA 3GPLA 1E92A 2ODEA 4C04A 5IC4A 3CMMA 1RUWA 5TDHA 5FLXE 4L6CA 4R8KA 4NX2A 5DOVA 4BAGA 4NCAA 3RC8A 4HAIA 4KQCA 3SQLA 3KHTA 4UXIA 2KQWA 4DA9A 5GAN4 1W6RA 1IY1A 3LGLA 3D0OA 2IYOA 1E3LA 3ZWYA 5D5PA 4AY4A 1BFDA 2RJDA 1QLHA 2C5AA 4XAQA 4BKMA 4BO9A 2OYRA 4UTVA 2GARA 2WD9A 3VPDA 3M57A 3RS5A 3PZRA 5JLAA 1TRKA 4J2HA 1VG8A 3MA0A 2HUNA 1NIJA 1OYWA 3WGLA 4R3WA 1XMPA 2W8BA 3JRWA