1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
3P1JA 1MRSA 3KTAA 2OFOA 2IS4A 4IOKA 3LRPA 1AWXA 3OHMA 4BEJA 3IDQA 1YZGA 2W0ZA 1P2TA 2OEPA 3EIQA 1QG2A 3I8SA 4AFZC 2EW1A 4PO9A 1ARKA 4JJZA 1E2EA 4RSGA 2QSZA 3CPEA 4RVCA 1UE9A 4GPTA 4E22A 1QCFA 3WP0A 5IHIA 2AK5A 2RMOA 4NDZA 2DR3A 2R6GA 5DISB 5E7MA 5I11A 4A2PA 1M3BA 4C0KA 2DILA 1Z47A 4PO8A 5FBRB 1A2KC 3NWJA 5FTJA 1RLPC 1JO8A 4OMOA 2NO9A 4W5HA 5KSZA 3UXMA 1BOFA 4JL6A 3FGNA 3CH5A 3K09C 3KDSE 5EJEA 1ANKA 3EHRA 5EP2A 2WWHA 1K8RA 1OLOA 1P2SA 4OQMA 4BFTA 2DL7A 3G0HA 2IA5A 3IBGA 4JVMA 1YJ5A 3WYGA 1U0HC 3NVAA 5F3WB 1PLKA 3HP1A 1P3JA 5JCPA 3T1VA 1UF9A 3A58B 1II8A 2JTEA 4DB2A 2CSIA 1X8JA 4C7OB 1ZRHA 2D2EA 4E07A 2BZ8A 5LBIA 3VR2A 1E1QA 2EVWX 4CW7A 5FOXA 1WFWA 1XMIA 4LBZA 1OF1A 3RVBA 3SQWA 3O47A 4V02A 1N5IA 3PFIA 4O0MA 3ONWA 2G0TA 3LXXA 2DWQA 2XNDD 3QKUA 1IN8A 1Q3HA 2OT3B 2C03A 2DRMA 4RCYA 4QT7A 2D62A 1WA5A 3QPUA 4LHZA 4CYMA 4RTVA 2J6OA 2R62A 2J41A 2F2XA 4BFXA 3REAB 3JVUA 5JWOA 4F14A 2RGAA 2XAUA 1E2HA 2KRSA 4DLXA 5C1BA 4Q4JB 2LZ6B 2J0UA 2IK8A 2P5SA 1P9WA 2LP5A 3THXB 3WNDA 5DIFA 3TE6A 3EW9A 1N0VC 1G8YA 5J4VA 4GBQA 2GQIA 2Z83A 3BFXA 5DYGA 2VVKA 1F2TA 1SRMA 3Q9LA 4JBWA 4LRWA 3CR7A 4D25A 1OXVA 2PLRA 4G5GA 1ODFA 2EWWA 1OB5A 3L82B 2A28A 4P4SA 5LB4A 1J7KA 3FFAA 1MABA 4TYQA 1KTVA 4Q9HA 4NCNA 2XMFA 2AKKA 2ERYA 4V0KA 3TUIC 3QBTA 3KQLA 4PR0A 2LQWA 1Q1ZA 1N5ZA 1QLYA 4Z1MA 3THYB 3FMIA 3ZGXA 4UNSA 5IK2A 3I5SA 2A36A 4JJCA 2X77A 1E79A 4EIKA 1S2MA 1GP2A 2R6AA 3KKOA 3ASYA 2G77B 2JLVA 1H8ED 5EZ6B 1OEBA 3HYRA 3ZIAA 1JECA 5KNCA 2A7QA 1AGRA 1ZM4A 2GNCA 4L16A 1FPMA 3SBEA 1YP5A 4A15A 3PCRB 2XZPA 2PZEA 2QSYA 2WWGA 3IQXA 4R7ZA 4GSYA 1NN3A 2C2HA 3PV0A 4HZUB 5CLQA 1VYUA 2QENA 1PUIA 2ZRCA 3CW2A 3TR5A 3VR1A 3ZVMA 2FEMA 1T4GA 4HVVA 1DAFA 1UJ2A 4KSBA 4KODA 2GEUA 4J9FA 1X6BA 4TLDA 4BUJA 2QP9X 3KJGA 4JKIA 5SZIA 4FSSA 1CLUA 3MFYA 1KZGB 3IILA 5HCIA 4LHVA 4O25A 4BWYA 4BZQA 1S1NA 2HCKA 2L0AA 5F9FA 2GBQA 1FX0A 5KSOA 3PXGA 5EXPA 3LWNA 3BH6A 3L2OB 5K8UA 2G0NA 4KYUA 3T1OA 3GLFA 1MT0A 2IYYA 3BK7A 2XJ4A 3KXKA 2O0HA 5FL7D 1E2NA 5GJVB 5JWRA 5F2EA 1XTJA 2FWRA 4E6RA 3T5DA 4G5QA 2KYMA 3GEIA 1HTWA 3EX7C 2ZRHA 2WSMA 2JEOA 1QWFA 3B60A 2H16A 3W5IA 1TL7C 1XD2B 4LY6A 4PAQA 2RHMA 1JI0A 4PPQA 5JS7A 2ONJA 4M2LA 2ZVPX 4GLMA 2V4ZA 2FPMA 2PZ1A 2YOHA 4OI0A 3NDBB 3F8TA 4K11A 1DAHA 4UNPA 5AJWA 5C4GB 1J8YF 2DX1A 3VR4A 2CJWA 5EZ5A 4PHFA 2O8BB 1UKVY 4PHHA 2ZUDA 3AV0B 4OMQA 1OPXA 2V6JA 3NC1C 1SVLA 2RGGA 1XD8A 1GUAA 4TMTA 4Q47A 4CRWB 2IYZA 3VHLB 1X1RA 3WNBA 5KTYA 4B3FX 5L3QA 2GXSA 2I0NA 4NKRA 4RTZA 1UKZA 2VKNA 5L23A 5FOVA 1KK0A 3RYTC 4IDHA 2Q9BA 2XEXA 1E0AA 3BFVA 1KMHB 2ZS8A 1T3LA 3KJIA 2RGCA 4B47A 2BZYA 1JR3E 1KI4A 2CEAA 5F98A 2VYFA 3M0PA 2QMUA 5G41A 5GJVC 2HLDD 1BIFA 3CH4B 3B1YA 3HR7A 2WBLC 3H41A 2ZUCA 1VG1A 3DM9B 2XTMA 3P26A 4Q9LA 621PA 4FWTA 3LLMA 2GNOA 5HE9A 4KLNA 1GTVA 2PZGA 1G2BA 3HR8A 3ZLJA 4AYTA 4PC2A 1PHTA 2OSBA 3CNLA 1BO6A 2F1JA 2K79A 4OHXA 1P7CA 3KUDA 2NO7A 1F60A 1HSQA 1YZNA 1E2MA 2QN6A 4PO1A 4XD7D 2JS0A 1JALA 4M4ZA 3UATA 3JVVA 2AHOA 2GESA 1DBSA 1SQ5A 4EJSA 3GJ8A 1CR2A 2H57A 2F1RA 3LAWA 1ZNZA 2DFTA 1W0KA 2QAJA 3TW4A 3EASA 4JZ4A 4Z54A 1PRLC 2K6DA 4F91B 1OXTA 3I1FA 1AIPA 3C16C 3VS4A 1UBCA 5DI3A 1OV4A 3M0EA 1RW4A 4QGGA 1TU4A 3SHWA 1N6HA 4HB3A 1TPZA 1X6GA 2AL7A 1E6GA 4M1YA 2GZHA 4Z88A 2IC5A 1SVIA 2GBLC 4N0EA 1NYFA 3QBVA 2ORIA 1NJGA 3P4YA 3QF7A 4IJMA 5GJCA 3RS5A 4UJ5A 1YHNA 2ZJAA 2ZM5A 3RS3A 1SVSA 2IHYA 2Y8EA 1N5JA 1NKSA 4R2IA 1OFIA 2CCKA 1XD9A 1SVOA 2IYQA 3NG1A 4DDUA 1ZINA 2V3CC 3FFBA 5F9HA 2MSCB 1G8HA 3D8BA 4DSOA 1EESA 1OYWA 4D4JA 1HEIA 4NPHA 2C9YA 3UWOA 2YHSA 2OAWA 4LDJA 4Y0VA 2LJ3A 1H92A 1E69A 4IVRA 1BK2A 1EX7A 1QHSA 2P3SA 2ZYTX 3KQNA 2EKHA 2JJ2A 2UZIR 5JRZA 5A5GA 2J06A 4HVUA 1LNZA 1KHTA 2X8AA 3I4LA 1VG8A 1X86B 3ND9A 4GOJA 4TT3D 5TB5A 3LXRA 2GJ9A 2O52A 5JZVA 2FRWA 2AR7A 3CF0A 1JXMA 3R8CA 5J5CA 3TGPA 5FTLA 2OO7A 2VP5A 1A4RA 5CB6A 2HT6A 3P20A 2IXEA 1G20E 5JBQA 1E2DA 3D6TB 4R0KA 4NCKA 4S2EA 5SZJA 1COWD 1X69A 3HPRA 4HAZA 2NO6A 4KSCA 4FW9A 3T34A 1KOFA 1ZD1A 2J7PA 1NKTA 2ZI9A 3QXHA 4BZXA 4NYIQ 4GZLA 1ZYUA 1NEBA 4MRPA 2FRYA 1KDRA 2BC9A 2PCJA 3E5HA 4NCIA 1T0JA 2FN4A 3D7MA 3N70A 2Q21A 1RVDA 2WKQA 4XVRA 5E3HA 2J7KA 1JBKA 1GAJA 4GL2A 1IN7A 1SRLA 1CP2A 2OAP1 2QROA 2ZE6A 5GJBA 1NY6A 1RJ9B 2BM1A 2O5VA 2O2OA 1EFUA 4LBYA 2D7DA 4MRNA 3B1XA 1MOZA 1R0WA 3HJNA 2N46A 5IXFA 4AFQC 2V6IA 2FPKA 4B73A 4P33A 2AXPA 4QBHA 3WBJA 1J8MF 1TNDA 2QA5A 2PBRA 4NYIR 1AEYA 4L5BA 2FFHA 2FU5C 3PUZA 5FPSA 3VMFA 4Q4AA 4BGDA 4Q21A 1AS2A 2J6FA 2HYIC 2SEMA 2WICA 1Z0DA 3PR1A 2REXB 1B3QA 4L9SA 4V0OA 1N6NA 3RS7A 3EPKA 1U8YA 2QAGC 5C18A 1WF3A 2V8OA 1NG2A 1AZSC 1G3RA 2F43A 2ZEJA 4KFRA 3ZS8A 1AWJA 5FI1B 4Z8AA 2TMKA 2OXRA 4JIMA 2K2MA 2W2XA 1LCKA 1TG0A 2XXAB 2QBYA 1ETUA 3UANA 3N2IA 4OHYA 1P62B 4D4KA 4B3GA 1E2GA 3CIOA 3I5YA 4QGHA 3JZAA 2XOKD 4WVFA 1VYVA 1WBDA 1XNJA 3FMOB 1FL9A 2CNWD 4BFUA 3Q5EA 2DCUA 1E1RD 1T0HB 3OAAD 3H0KA 1IO6A 1U0JA 1WCV1 1LY1A 1R10A 3MWLA 3AUYA 2JLZA 2VEDA 4M1KA 3U44B 1WYXA 1TMKA 3E2IA 3P4XA 1N6IA 4NTZA 1M34E 5DSZA 2L3QA 2R2AA 2R65A 1GKYA 2GK6A 2ZSAA 1BB9A 2ZAOA 4MA4A 3VRYA 2XNSA 3SU8A 2CSQA 2FZ4A 3AVOA 4QBGB 4RTTA 4EFLA 3CF6R 1OSNA 1ESMA 1VECA 1R7RA 2QDLA 2CUDA 1Q1EA 1UDWA 2P6UA 4OQNA 4TZ0A 4XH9B 1ESNA 1UFFA 1IN6A 1P6XA 1R5NA 1SZPA 1KIKA 2OCBA 4CT5A 3Q3JB 1CXZA 1OIXA 4MYHA 3FPAA 3E1SA 1NMYA 3C4JA 2R6DA 4A2WA 1QF9A 4WXPA 3GJXC 2A78A 4M9XA 3ICEA 2ATXA 2C98A 1LW7A 4LPKA 3FB4A 2KT1A 2DFLA 1AN0A 4C7OA 5EE5B 4P3YA 4LPSA 1Z0JA 3QVUA 2YZ2A 4TL7A 3VFDA 2NZJA 5FW9A 4RKFA 4XIGS 4BFVA 4CZ2A 2BVNA 1W0JA 4W9MC 4DLYA 1Q1QA 1P9RA 2A08A 4TMWA 2BKUA 2JLSA 1R0ZA 4EKDA 1O87A 1M7HA 2HXYA 4OJQA 1JEEA 3AKDA 1MKYA 5DYIA 2V7QA 4JLKA 2CH4W 1OE0A 4BZPA 2CL7X 1E32A 1VIYA 2ZU0C 1NNEA 2EGAA 4GP6A 1ZC4A 1II9A 2W0MA 2B92A 4Q02A 3MUFA 4RZXA 1KI7A 1MH1A 4JSTA 5E95A 4YMUA 1QHYA 2A37A 1S9HA 3I72A 3ZDQA 2QEQA 4UNNA 1FP6A 2ROLA 2OAQ1 4Q4JA 1AZEA 1OH8A 3H0IA 2IEYA 4KVGA 5JJIA 2P65A 1N6RA 1FTNA 4WA7A 3THXA 3RS2A 1X8KA 2JT4A 3VTKA 2WMNB 2BV3A 3X1WA 1ZU5A 1VG0B 3VHXA 4QHYA 4KXFB 5AUPB 4LYFA 4RY2A 4HSEA 2IYXA 4US0R 1OIVA 1Q44A 2FSHA 2CMKA 1NBME 1NBMD 1FMJA 2HF9A 2OLKA 3PEUA 5BN5A 4DKXA 3LY5A 4RTUA 1FTSA 3TJZA 3M4YA 3PE0A 3BGWA 2GWHA 3GD7A 4TN1A 1F48A 3NBFA 1KSFX 3IO5A 4J9HA 2RGXA 1LTQA 5DH9A 3GP8A 4OJKA 4MYUA 2W6JD 2VLIA 5EP4A 2JCSA 1E94E 4J0QA 4URVR 3A4LA 3KFVA 4DUGA 1GIAA 2DL4A 4A4DA 1ZM7A 1HY3A 4CC4B 3TMKA 1AJEA 3Q8XB 3WMGA 2JJ1A 3DZDA 3AVUA 1QKXA 2IEZA 1KO4A 5GADl 3WMFA 1MV5A 3A1SA 4HZUA 4IDNA 2G1KA 3T15A 5LB2A 4DLWA 4DSUA 4TYNA 1DARA 3LBIA 2A5YB 4WW0A 1TEXA 3VKWA 2IS1A 1GDDA 2JLUA 1N0WA 3ZVRA 2WSSD 3K0FB 1G7RA 1S0UA 1JPJA 2O9SA 3DOFA 3QIAA 4GMDA 1YN8A 3SI7A 1U9IC 4JBXA 4MKFA 2BCGY 3K0AB 1QHIA 4FN5A 3IGFA 4JL8A 3QKSB 1XJCA 4DHEA 2ZE7A 1TTTA 1Z6XA 2HF8A 1W44A 1T8UA 4FD2A 4NBSA 3PVLA 3OF5A 3EZ6A 2ENMA 2GDJA 2QGNA 3X1XA 3I73A 4QGAA 4LV8B 2RQWA 1GRNA 3BS4A 4U7DA 4IHQA 1XD2A 1ZJ6A 1SXJC 2RQUA 2JA1A 1ZD9A 2ZUBA 3A1VA 3U2QA 2GEVA 3VR6A 5FWCA 3TH5A 3DOEA 3KJEA 1DEKA 2G6FX 1E2FA 3B5JA 3M0QA 1QVAA 5JJLA 3WHLA 1W49A 4F4CA 2A5FA 2CCGA 2DYKA 3QEJA 1G5PA 3T5GA 4OKSA 2O8BA 3SE0A 3TNFA 2KB0A 1TAGA 2KXDA 2ZJYA 4AKIA 4EPTA 4MRSA 3GLIB 4U02A 1W1FA 2NZ8A 1W48A 3L43A 4DLUA 2JIZD 4TQAA 5TV2A 3QSYA 4IDQA 4H1VA 3BBPA 2JLXA 3B1ZA 3CRQA 4LWZA 3UMSA 4FI3C 3OIWA 4MKIA 5CM8B 1AQUA 4TTRA 2O8EA 4K46A 1I2DA 1YE8A 1M7GA 3C41J 2ED0A 1EXMA 2BEKA 2JAQA 4BRWA 2LWIA 4C4PA 5HZHA 4MDFA 3C0CA 2Q9CA 4IXMA 2FA9A 4V0LA 5J4HA 4QC2A 2YOGA 2GBLA 4DLSA 2VO1A 3A6PC 4HAWA 3M0UA 1MUZA 1Q1BA 4JLPA 2JS2A 1TEVA 3EZ7A 4TLBA 3UMRA 2BHRA 2ZRMA 1XCPA 2WJJA 3VNUA 4QRHA 4IFEA 3W6PA 3TUJC 4KI0A 3QXXA 1R5BA 3AKCA 1VIAA 4M9SA 4JYBA 4IRUB 3DO6A 1KJWA 1PZNA 4M1MA 1N5KA 1XTSA 2W2VA 1G3QA 4XSHA 5DGXA 1X43A 3VR3A 4OHWA 1NVWQ 4V0MA 3EGUA 3NHNA 4LUDA 5CIQA 1W6XA 3WP1B 3PIRA 4JS0A 3ZVNA 3H86A 3RRNA 5JMTA 1OPLA 2DA9A 2YUOA 2AN9A 2CHQA 3MCAA 1D2MA 3NBYC 2MSDB 4D8KA 2EU8A 3U7GA 4D2IA 2GCNA 2BTTA 1Z9QA 1P75A 4LE9A 4QFMA 4BFWA 1VKJA 2ZJ2A 1UG1A 1G19A 2VP9A 4QJ3A 2GETA 4PPNA 1FP7A 1XEWY 2UKDA 1YZKA 2GHIA 4CEIB 421PA 2QE7D 4QNMA 3H0HA 2PZFA 2AWOA 1M6NA 4GBMA 1R2QA 1IXRC 2YOFA 2JM8A 2CH4A 3VU9B 3BC1A 3VX4A 4BE7B 3SFZA 1E6CA 2LQNA 2NO0A 4D0GA 4LJ7A 3QEOA 2EYYA 1KI3A 1X1SA 2JXBA 2BM0A 1U94A 2VIIA 4HLCA 4M4SA 2X3WD 3EPHA 4QJ4A 2JLQA 1Z07A 2FE4A 4EFMA 1IY1A 3Q5DA 3PITA 3ADBA 4B34A 5IHNA 2JDIA 4NH0A 3FOZA 3N5CA 1A0NB 1G64A 1SULA 1NRJB 2GVZC 2VBCA 2ZI7A 4DIEA 5FPKA 1XDBA 1XTKA 3TVDA 4Z51A 4HDOB 2JMCA 3M0RA 1RIFA 3DM5A 4ON9A 1LF0A 4M8NE 2HYDA 4EDHA 2NTYC 4TMZA 2H1LA 1BH2A 4ZCMA 5KO2A 5CJ2A 1T3HA 4EUNA 2FGKA 3V4RA 4PSKA 1P2UA 4AC9A 4CC7A 1CSKA 4M1SA 3LNCA 3OESA 5KSPA 3QXSA 3LLUA 1NP6A 3QOFA 3T06B 1PKTA 4D6PA 1FW6A 3U61B 2WOJA 3PVQA 3FWYA 3H84A 3NC0C 1UAAA 2D0NA 3OEHA 4ZCLA 3L0OA 3R8FA 1M30A 1JEDA 4OHZA 2UZ3A 2IHBA 2V54A 3PUYA 1T8TA 2BIFA 1NLPC 2V1XA 3DPUA 2BMDA 1HD3A 3AF2A 2WWXA 3BAFA 3EHQA 1T6NA 3SYKA 4YQFA 1UBFA 5AJXA 1KY3A 4JLJA 2C9OA 1SVWA 4C30A 3QY0A 3BJIC 5DHAA 4B76A 1FUKA 1GCQC 4DC9A 2J87A 3L0SA 4Q4HB 3VQTA 1CJVC 5DO9A 5K8LA 3A4MA 4J9GA 2RAPA 1T5LA 3L0IB 3VKGA 4J9IA 1KGDA 1L2TA 4ZIRA 1E9RA 1GITA 5JJKA 5KU1A 1MO3A 1RJ9A 1M74A 4Y0AA 2LCFA 1G5RA 4IW3B 3QENA 1SSHA 4KITB 1OKKD 2WKPA 3AVVA 3MJHA 3O8DA 5AWFC 4B6EA 4BLRA 5EXSA 1UJYA 4PZLA 1WIEA 1BMFD 3QJYA 3SR0A 5IRCD 1QHXA 4LJYA 3ADDA 4AG2C 221PA 2AKAB 5CITA 1V5WA 3BE4A 1JAIA 2QI9C 2M51A 5GVSA 1U98A 4YLGA 1OFTA 1E1QD 2EFGA 2O8DB 2ZJOA 5HPYB 4IFBA 1OOTA 3CRW1 4ZDJA 3FKQA 1B07A 1G3UA 1HH4A 2WMOB 2XXAA 2IYUA 1BS1A 3IQWA 1TF5A 1GZSA 1YR9A 4FCWA 3SBDA 4X8HA 2XZLA 1II0A 1BKDR 2CL0X 4B75A 1V43A 4KFSA 2KSQA 3BIFA 5C46F 1CIPA 1J2JA 1T0HA 1VTKA 1ZUIA 2CVHA 3SJCA 3K53A 3U44A 2YWEA 1I4DD 5LD2B 2C77A 1P2VA 1NIPA 1WP9A 1XMJA 1GKIA 4XWOA 4M53A 2AD5A 3K0CC 4MUAA 5HCNA 1IAQA 1AZTA 1G9XA 1QG4A 4I1VA 1HURA 4ZI3A 2F1IA 2OLJA 1OYYA 4RCZA 1J3TA 2J7IA 3IIKA 4LGMA 2KWIA 3BWDD 2XNDA 2ZJ5A 4GI7A 1X2QA 1UM8A 4IVPA 2DVJA 5FPYA 5J4LA 1G7CA 2E9SA 1VCOA 3AF3A 4FMDF 1IJFA 1DO2A 2QU8A 3BB3A 2GTPA 3B78A 3EPLA 2QY9A 4PQRA 5TARA 4F93B 1F6BA 3IBYA 4Q4LA 1E9EA 1VPLA 4KJZA 4EPXA 3R20A 5IK2D 1WX6A 1JAHA 4RFVA 3NDPA 2EYUA 3GLGB 1NIJA 3CBQA 4IOMA 3HPQA 2IS2A 2V1QA 3IKJA 1BU1A 1QHNA 2BOVA 3ZIAD 2SRCA 3PUXA 2DL8A 2LMJA 1P72A 4X8LA 3RLFA 1S3GA 4J9DA 5LD2C 3O5ZA 1O3YA 4UNRA 2GAAA 2YNMA 5D3MB 1NEGA 5J47A 3LA6A 2FZLA 1P73A 2GCOB 4RD1A 5H68A 3SYNA 3ZQ6A 4TSFD 2GZDA 5FBVB 1DTSA 1NSFA 3CONA 1ZX6A 3T12A 1G7TA 1IXSB 2J0SA 1D5CA 3E70C 5JS8A 2YUNA 4AG5A 1WRBA 4HLUA 1ZU4A 4URUR 3RABA 2A5GA 1KJYA 4DJTA 2O9VA 4YXWD 1BBZA 2D1XA 1H8EA 1YKSA 4HUQB 1X8LA 2QUZA 3H4MA 4R2HA 4TQUS 2FPLA 3Q72A 2P4RA 4PHTA 5FUVA 5GJWC 3WYFA 1UKYA 2FOLA 4FMCF 3RC8A 4RD0A 1SXJE 1SXJD 2R6CA 1ZD8A 2GJAA 3EC1A 1VA7A 4KU4A 4ZDIA 4B43A 4V0NA 3D31A 1VMAA 1NJFA 2O31A 3AVTA 3NPFA 1M8MA 4RZ3A 4D4LA 4JMPA 5L3VA 1DAMA 1OH5A 1R8QA 2RPNA 3KZ1E 2CDNA 4LHYA 4C0JA 1NYGA 4URYR 3HDTA 2V1UA 1GOTA 3AVWA 1S4QA 2KNBB 2IYLD 3AGPA 5HKKD 4IIOA 3FJ5A 1U8ZA 2FSGA 4US1R 1DG3A 1RE0A 2CL6X 3NH9A 1HV8A 2PEZA 1N0UA 2MSEB 2JLWA 4LV6A 5IH2A 3QWYA 1IN5A 3EARA 1K0XA 1E0KA 1UDLA 1UEIA 1RRGA 2DMOA 3IPYA 2EW3A 3LQRA 5HR5A 4NU0A 1YZQA 1K5GA 1GWNA 4HZIA 4NL4H 2I1QA 3K70D 1XEXB 4FXPA 1OIWA 4JT2A 5DE3A 3UMFA 4Q1DA 4B3CA 1R0XA 1YZTA 1W4RA 1ZNXA 3IIMA 2BJWA 2GF0A 3MWKA 3OEED 2EYQA 4ZCIA 3K0FA 4PZYA 1ZMXA 3P32A 2WIAA 4A82A 3OFNA 3RAPR 3C5HA 3R9WA 3LD9A 1HT2E 5KOYA 3SEAA 1HQYE 1NMZA 5AJZA 3K0AA 4HYYA 1Z2CA 4XVQA 1FZQA 2BCJQ 3GJ4A 3U6BA 2O8FB 1DAGA 1LB1B 3QKSA 4LN2A 2I4IA 2IYVA 1YVDA 3GLIE 2ZR9A 1XBTA 1W4BA 2KGTA 1G21E 1N3BA 2AX4A 3W34A 3THWB 2F2VA 5JHHB 4Z89A 1XXHB 2FJUA 1NN1A 1U8AA 2OV2A 2KROA 4B3DA 1NVVQ 2P6NA 1XPUA 2DJQA 1XWIA 4HATA 3VS2A 1UHCA 1JR3A 1OT3A 2VP4A 3CRVA 1KI1A 4LJ8A 2C9CA 4WXRA 1M2OB 3AVYA 4ZDKA 2WV9A 2RMKA 1KFZA 2G83A 2PX3A 4PAMA 3H1TA 1XJ0A 4B44A 1GFDA 5L3SB 1E2QA 1Q12A 1G17A 2VHUA 3BORA 2CT4A 2ZU6A 2ZITA 5TDHA 4D81A 721PA 3CNNA 4CEHB 4TYWA 4ORZA 4I4LA 1QHHA 2WIBA 1NVVR 1W70A 2VSXA 2WVJA 3C7KA 3GEEA 4A8JB 4HUTA 4JL5A 5JI2E 2QORA 4XD7A 3U3RA 5JLJA 1E2IA 2O0JA 1GBQA 4DCUA 1MR3F 2FF7A 2ZI6A 4DCNA 1XPRA 2GVDC 4MUBA 3FVQA 2KR3A 4OMLA 1UHFA 2GJKA 4B33A 1XTRA 3QXCA 2IF2A 1IONA 2QP3A 2WWIA 2XSZD 3W6OA 1EFTA 1NVUQ 1N6LA 1DPFA 2REOA 2GJSA 3CPJB 2RHDA 4LNPA 1PUJA 2VP0A 4B6FA 3LO5A 3B9QA 3EG2A 3M1IA 2AWNA 2JMAA 2P2LA 3GJ7A 1F2UB 3SYLA 2CDTA 3FHCB 4GP7A 2QZ4A 4IEEA 1AM4D 1MV3A 1YCSB 2R8RA 1DE0A 1NF3A 3QKTA 2ZSBA 3WRYC 3I9QA 3UK6A 4BLOA 4R98A 2DF6A 1CTQA 1KK2A 3UWKA 2ZIAA 2QAGB 3MRSA 4Q1EA 1KSGA 2WAYA 4BQSA 1A1VA 3QG5A 1ZCAA 3WRXC 2ECZA 2ODBA 4WCIA 5CJPA 4YDHB 2ZRLA 3OE7D 3X2SA 2ZRIA 2RQRA 2KE9A 4LJ4A 4A8JC 2QM7A 2ZSFA 4WZ6A 4FCTA 4CEIA 4DRZA 4TT3A 1L8QA 4MDEA 1KMQA 4RJLA 4ERNA 1Q21A 4Q9KA 4IOLA 2CT3A 2W6ID 4HEJA 4OI4A 3VU9A 1QDEA 1H8HD 2ZSDA 3QPVA 2WJGA 2WOOA 2IS6A 2XTNA 4LUEA 1SPKA 1QKWA 5KPJA 3KQUA 1E4VA 1FNMA 3KTAB 3NEJA 1F5NA 3VS0A 2C8VA 1EK0A 3TLXA 5BXQC 5FTKA 4HAYA 1COWA 2HJGA 3W90A 2QMEA 3LQQA 4BECA 2LJ1A 2OCPA 1S1MA 5FOTA 2NQ2C 2B21A 3WBKA 1ZBDA 1Z0FA 3K09A 2IUTA 4KYIB 4J9BA 1ZC3A 2EQIA 2GAOA 2QGZA 1FUUA 2EFEB 2ORWA 2EVRA 5M04A 1XZQA 2QM8A 2DM1A 3ZZTA 1JXOA 5A4JA 2ED1A 3KB1A 5KDDA 3K9GA 2OFWA 5IHPA 2VHCA 1Z0KA 5TY0A 1Y63A 2VWFA 1IN4A 1D9ZA 2YYZA 3PUVA 4MKHA 5DN6D 3U7FB 3A8TA 3ZD7A 1CJUC 3I61A 4ESRA 1QBKC 3HYTA 4G3XA 4Q7MB 2DE0X 2OHFA 4M22A 2ZXUA 1RC8A 1SHFA 4IKEA 1W36D 1GRQA 3SEMA 1Q0UA 4JZ3A 1Q57A 1W46A 5JHGB 1I0CA 4QBIA 1II8B 4TMXA 2ZPTX 3SJAA 5AR1A 3TK1A 2FG5A 3U5ZB 1XCGB 3BD9A 2FFAA 1RYHA 4Q1FA 4TYPA 1R0YA 1G41A 1R5OA 3KUCA 3ZQJA 2CHVA 2PH1A 1BYUA 3PG5A 4LCBA 4Q4HA 3P27A 3WYAA 4RTYA 3AF1A 3KX2A 2EWVA 3X1DA 1YU9A 3HU3A 5H8WA 1U5SA 5JSZB 1Z6TA 2EFDB 5FOUA 4QNRA 4Q19A 2X1VA 3PEYA 2QMHA 4Q7KA 2GKSA 2LKCA 2ONKA 3EWSA 1CR0A 3EG3A 4QHTA 4YDSA 4X8OA 1ZM9A 2XOKA 1HJDA 4FIDA 4XSGA 2JLYA 4TWZA 3NMZC 1G8GA 2VQSA 4N0DA 2XTZA 1WI7A 3OAAA 3GBQA 1E1RA 1W1WA 3TKLA 2Q3MA 2NWMA 1LF5A 1KJZA 3GFTA 3RHFA 2ZROA 5FH9A 1W2GA 1EG7A 2CE7A 2LX7A 1K9AA 2CCJA 2XJ9A 4PC6A 4LBVA 3DKVA 1SEMA 1EFRD 2L3SA 4HAUA 3OZXA 4GFDA 1S1CA 3FMFA 5HZKA 4DZZA 2IX3A 1OHHA 1X2KA 3B7GA 2AFHE 3LX5A 2ZRGA 1PV4A 2O8DA 3TRFA 1H3HA 1W0JD 1PVOA 4Q9IA 1CJKC 2Z4RA 3KXIA 1OJLA 3MWYW 2ZRFA 3PJRA 1P60A 3PUWA 4Q1BA 1MABB 1Z6AA 3ICQB 1CRPA 2QQEA 3LV8A 4NCHA 3UA7A 2ZAMA 2OI3A 1HUQA 1D2EA 3M0TA 1ZUYA 2F6RA 3LW8A 2DWOA 3M0SA 2ZJ8A 1CR1A 2RGEA 4MKGA 2DWPA 4P32A 3QQ5A 1TF2A 1XRJA 1XTQA 3K9NA 4OBEA 1YRAA 4P31A 5KPDA 2X3XD 5EQTA 4ESHA 1WQ1R 1HE8B 3NTUA 1AK2A 4HAXA 3GLGE 5FWBA 2V9PA 1E2KA 4LHXA 5KDLA 4BLTA 2ZETA 4A36A 3C15C 2BZXA 4KLZA 4CGZA 5JCZA 2VHQA 4HVWA 1Z2AA 4EFNA 1TUDA 3EA5A 3CWQA 2WJIA 5CB8A 5ELXA 4G5RA 5C4MA 4DEXA 2OFXA 2O88A 2DYBA 2AK2A 5G40A 3A37A 3THYA 1K0SA 3ADKA 1JQJC 1OPKA 2OCYC 1YR8A 3BB4A 3RRZA 4JYCA 3GLGA 3WMEA 1XP8A 3NIBA 4KAXA 2NOAA 1E9DA 3C8UA 4KFUA 2P6RA 3ZL7C 4DIDA 3WY9A 3ZVLA 4C0HA 2GXQA 1SXJB 4NYMR 1PRMC 1E0JA 4TMVA 1TQ2A 3T61A 1XEWX 3RNJA 1OH7A 4KRTA 4IXNA 3THKA 1SKYE 2ZI4A 5D3MA 2ZTSA 2IWHA 3EAQA 3SN6A 1NBMA 1JQQA 2GCOA 2H17A 5G3YA 1F3OA 1RI9A 1GFCA 2IW3A 3SJBA 5AUOB 3I5RA 4ASUA 3CKLA 1VDZA 1IHUA 2PT5A 3U4QB 1DVRA 2BKEA 4CF7A 4TL6A 3CM0A 1JB1A 2A5JA 3FKSD 4N3NA 3F0TA 2W6JA 2YC2C 4MRVA 1E6HA 2JM9A 4HUQA 3AVXA 3W3AA 2PX0A 4CC3A 3GQBA 2IUSA 4I1SA 2AKYA 3CZQA 1UFQA 2C04A 4RD4A 4TL8A 3TAHA 2RGBA 4K8OA 1E99A 3U3JA 2J6KA 4C0LA 2BBOA 2ZREA 5B64A 4P4TA 4DVGA 3MD0A 2WKRA 1AA9A 2W83A 2ZQ5A 4MRRA 1N2CE 4RFSB 5EC7A 2D2FA 2BMFA 4JPBW 4A0FA 3K70B 1B0UA 4TLAA 4TMKA 1ZIPA 3UG6A 4C2UA 1WXQA 1IY2A 4CIDA 5EXXA 4F4IA 2YKGA 4RTXA 1OB2A 1K76A 4B2PA 2O8CB 4C0SA 4B2IA 1TUIA 3THOA 4O3MA 4KBGA 1NLFA 3J81k 1UBGA 5JI3E 1KAGA 4A9AA 3BERA 1G18A 5FTMA 5UKDA 4TZ6A 2HUPA 4PC1A 2DFNA 4FWIB 3U60B 1R6BX 2H18A 4AKEA 4QGFA 4XTRA 3RSOA 1W5TA 4QBFA 1ZUKA 4WBSA 4BPBA 4A6XA 1GG2A 1MO5A 4D0LB 5CIWA 1XXHE 2M0YA 1NL3A 1KMHA 1RKBA 4I99A 2PJRA 3ADCA 2QPOA 4IEIA 4DEYA 1S9DA 3IO3A 3GLHB 4ILEA 1KIMA 1HQCA 1X6VA 4H1UA 4MITA 1Z28A 2D8JA 3UIEA 4JLOA 4TLCA 3GFOA 5EUQB 3K70C 1S96A 1UDXA 1QRAA 1R8SA 2H7VA 2VPPA 4IIMA 4TLEA 2QQ0A 3EG5A 2BBWA 3GPLA 5BQ5A 2KBFA 4DDWA 2JIZA 1Q20A 3BH0A 2REBA 3WHKA 2IIMA 1GRRA 3JV3A 2ROTA 2OE2A 3DZ8A 3BXZA 2Q6TA 5JEDA 2DL5A 3T1QA 2WAXA 4OYHA 2C0OA 2F3TA 3THWA 3SZRA 2YC4C 2XB4A 3QUSA 3CO5A 3GJ5A 4YC7A 2E1RA 5AUQA 4MGZR 4A0HA 5AUNB 3R9XA 2O0KA 4DWJA 1L4YA 2ATVA 2VSOA 1ZP6A 4P4UA 4LC1A 1DO0A 2CLSA 1CS4C 2CHGA 2X2FA 3R9IA 4EQ6B 3EA0A 2FV8A 2J45A 2OXCA 4D0NA 4FMBB 1GKUB 3L8ZA 1E9CA 2FGJA 5L3SA 3AB3A 4OHVA 3AP3A 4WZAE 2WPDA 3A98A 1I07A 2L3PA 1FQKA 1J99A 2GK7A 1ABOA 2ZANA 4CEHA 2YV5A 3SJZA 2KYBA 2ZR7A 1KO7A 4ITRC 4TTPA 4D82A 3KB2A 3DHWC 4A8JA 3OIVA 4A1FA 1MO4A 1VG9B 3GJ3A 3A4NA 2YWGA 1LS6A 4EPVA 3CLVA 4PPGA 1M3CA 5KNDA 2BBTA 1S8FA 2N42A 4ZNXA 1YNZA 1RRFA 2DY1A 1SHGA 4LV5B 2PTKA 1DAIA 5FUWA 4TQ9A 2QE7A 2H5EA 3U3OA 2VHTA 4BFZA 2HSPA 3K0SA 3IHWA 3GJ6A 1KI8A 2CK3D 2FPDA 4JLDA 4C2TA 3EWAA 2QTFA 1AD5A 1XFAA 1B23P 2OG2A 2HCBA 1RZ3A 1GFIA 4JT4A 1ZNYA 2NPIA 1N6PA 4V03A 4RTWA 1LS1A 3X1YA 4B3BA 4B48A 1PLLA 4NZYA 4E5UA 5P21A 1GILA 2R9VA 2CVFA 2UVQA 4LUCA 4NYJQ 1XJQA 2ORVA 2OCAA 4M1TA 3VRZA 2PJZA 1U81A 2MMGA 3CWZA 5HCKA 4KO8A 3QNUA 3TAUA 2RKOA 1KKLA 3OEHD 6Q21A 2ZS7A 3VR5A 4ACAA 2W0SA 2QAGA 2HJVA 1GBRA 2RN8A 2GEDA 1N25A 2QT1A 2NPFA 2WWYA 1E2PA 2FH5B 4C3ZA 4UNQA 4RZUA 1ONBA 3QXJA 1XZPA 2BMJA 2BEJA 2VF7A 1VHTA 2ZYWX 4BEBA 2IL1A 1A7JA 4CC2A 5KHOC 3FHOA 1G4UR 3BB1A 3TUZC 4LOAA 5AK0A 2J5XA 4NYJR 3SDZA 2YVUA 1PWTA 4II7A 4L4UA 2A9KA 3U7EB 1YZLA 2D74A 4LJ5A 1EFHA 2WWFA 4LJ6A 3RNLA 1KO1A 1WMSA 4F7WA 4UJ3A 3ND8A 2F7SA 2BJVA 1W36B 4ZI2A 1W4CA 2J1LA 4EPRA 2WJYA 2AKLA 1KYIA 1T9HA 1Z22A 3DDCA 2IWRA 3T1TA 4DT1B 3SC3A 4G01B 4POAA 4PAOA 3PENA 3AEZA 3SHFA 2AXNA 1U2RA 2FFBA 2WWWA 3IPXA 3CB4A 5BYJA 1Z5ZA 3F5FA 2FSIA 4LSGA 1NLZA 4N1AA 4CVNA 4F17A 4KVAA 2XX3A 2OUKA 4PX9A 3VNVA 4LJAA 2FEOA 4ARZB 2DNUA 4CDGA 2F9MA 2A30A 2G9NA 3UF4A 2ANCA 2CBZA 4X1VA 1HT1E 2VP2A 3FE2A 4JVSB 1T91A 1UGVA 3OIYA 4HB4A 1OKKA 2C95A 1CR4A 1ZNWA 5G53C 1BMFA 3NH6A 3CRMA 3DL0A 5FTNA 3D3QA 5E7IA 4JJKA 4UXJA 4XWAA 4NONA 3TSZA 4KV9A 5KSYA 3I8XA 2QP4A 4PSAA 3VS5A 1CKBA 4RZ2A 3CQTA 3CX7A 1W36C 2F9LA 3I92A 2V1RA 4GT1A 4LK2A 2AK3A 2QPAA 5JSZA 4M21A 4QM6A 2P0EA 3CUEF 4LYHA 3QPWA 1CJTC 5G3ZA 1NSTA 1FQJA 2NO1A 1XMSA 2J59A 4HXJA 1AZGB 1G6OA 3ZH9B 3VS3A 2PCLA 1NLYA 3UA6A 2DBYA 3EG1A 3B85A 3IEVA 4DLRA 1BYIA 3V9PA 2XITA 1JPNA 1US8B 1YR6A 4B32A 3REBB 4OMNA 5GJWB 2GXAA 5SZKB 3SQXA 1PLJA 4Q48A 4Z1MD 3VS1A 4W7SA 3V00A 1C1YA 1E79D 3GMTA 4EAQA 1G6HA 5BW8A 4ZKEA 3AVPA 1EFCA 2BBSA 1TQ4A 2PMDA 1KDTA 3RWOA 3HWSA 5A0FA 1LV7A 2C5LA 4F38A 4CEJB 4IVQA 2K5UA 2R44A 3MWJA 4AFSC 3W5JA 3GEHA 1WXTA 1H65A 1AS3A 3QI2A 4G1UC 3RSLA 5JECA 3QE0A 2J9RA 2C0TA 1I1JA 2GXUA 3QWXX 1YWOA 1W2HA 1UUEA 1KKMA 4D80A 3LW7A 2VRWA 2OBLA 2X2EA 3KL4A 3U6KA 3SOPA 4D26A 2Z0MA 1DG1G 5B58C 1QZXA 2ZE5A 1EWRA 4IDPA 2B86A 5J4KA 3TSOA 3AKEA 4GOXA 4YMTA 2AFIE 5L8VA 4M1WA 2ZRAA 1D9XA 2AD1A 1U3OA 1IM2A 5FPHA 2IBMA 1YR7A 4W5JA 3AUXA 3B82A 2EFCB 2Q3HA 2ZRKA 2YJTD 5B2ZA 2Q3FA 5EE3A 4MGIR 3NXSA 4HB0A 1SKYB 1GL6A 1P9NA 4GNKA 1JJ7A 1Z08A 2A3RA 3GLFE 1MRNA 2FMXA 2ZRPA 2HBWA 2D7CA 3B9PA 2B8TA 5FBLB 2F1HA 4TSFA 2G88A 1CBUA 1T5IA 5FPTA 2G1JA 1ZSGA 1U9IA 4LJ9A 4FMDB 3KKPA 3MJRA 4G0NA 2ZRNA 3QKRB 4ZV4A 5CLLA 4OMMA 4F92B 1AWWA 2CLCX 2Z43A 3VS7A 1NY5A 1TADA 3I3SR 3QF4B 4G5OA 4YXWA 1E3MA 4DXAA 4ZDWA 5FUYA 5HTKA 3EXAA 4AWXA 1E9BA 1N6KA 1P5ZB 4PC7A 3C14C 4A63B 8OHMA 1FOEB 4RKEA 5FOWA 2RQTA 3IUYA 3O8RA 1SXJA 1WLPB 4AD8A 1A82A 4UQOA 3R6NA 2RGDA 3U3MA 5FL7A 1IQPA 1M8PA 4AKGA 2DRKA 2IF0A 4DSTA 3KJHA 3QG1A 2IYWA 4XVUA 1Z63A 1GL9B 2Q0HA 3ECCA 1SVMA 3SS8A 4FINA 3ZZ0A 2IXGA 5IXBA 3HU2A 1CEEA 3U4QA 1NLOC 5HKKA 1FMLA 3G82C 2ZE8A 4G5SA 1J70A 5FBQB 1TF7A 2GTJA 1OH6A 2YWHA 4U00A 1RLQC 3LDAA 4BLSA 4HDCA 3OFND 4M0LA 3AM1A 1Z9ZA 2XGJA 3SNHA 3H2YA 5DI9A 1HA3A 3NHBA 4JLVA 2C0IA 2W10A 4GOKA 2CLDX 3MG9A 3S1AB 4D4MA 2ASEA 3I62A 2OILA 1AVZC 2G3YA 5BN3A 4OQXA 1TX4B 2QG6A 2JJ8A 4IOJA 3I5XA 2LCSA 4FMCB 4K81B 4MYTA 4RFSA 2JW4A 2O8EB 4AI6A 1AOJA 2FPFA 1ZIOA 3W8NA 3W9YA 2PT7A 4EIWA 1PNJA 1IY0A 2DB3A 5FR1A 2HXSA 1JR3D 1M7BA 2O8CA 4RD3A 3OEEA 2DFKB 1PKSA 5DLQC 2VSFA 2HLDA 1Y0MA 3LX8A 4PTLA 1W0KD 2EYXA 1CKAA 2EYZA 1OXSC 3GLHE 3EG0A 2DPXA 4J9EA 2C78A 4JLNA 2FFQA 4B2LA 1QWEA 2C96A 1RYFA 3EC2A 5CDFE 1E9AA 1HE1C 2XZOA 4RD2A 2FO0A 3UKDA 5AJVB 2LKDA 1S3SA 3U3KA 4TTQA 4OK5A 3GLIA 1G3MA 1ZM2A 1Z29A 4LHWA 2KE5A 2WM9B 821PA 3AF0A 3KKNA 4QOSA 5TVKA 4AURA 4A6PA 1YQTA 1Z83A 2YINC 4OMPA 1V1CA 1Z06A 1CJMA 3BH7A 2EYWA 1A5TA 2J3EA 1E9FA 1TUCA 1E4YA 4QHSA 1RRCA 1G83A 1NG9A 3EZ9A 3TQCA 1Y57A 2LNHB 3GLHA 4DBLC 1DS6A 3R7WB 2OJ2A 1WXBA 3GFPA 5CDFA 1ABQA 2IYTA 3RDPA 2D4HA 5IDVA 1GM5A 2JJ2D 3GCGA 3MGCA 5EUMA 3RRMA 4WZBE 5H70A 2ZRJA 1WDTA 4AFUC 2EBPA 1KZ7B 3LVQE 2BDTA 5DHFA 2EGCA 2FEIA 1GNPA 1UEJA 2H8HA 1VHLA 3O8BA 4JBYA 1OXXK 1TUEA 2ODNA 2ODWA 2ABLA 4KFTA 2K3BA 1GNQA 1X3SA 1GNRA 4AYXA 1KI6B 3TR0A 2GF9A 3RWMB 4A2QA 4I81A 2SHKA 2IXFA 5H1YA 1Z6GA 1VYTA 4KBFA 4JVLA 2XSZA 3L8YA 1XOVA 2ANBA 4EQ6A 4XTCS 4LYAA 1CF4A 2J7PD 4UXHA 1OV3A 2QRZA 5EE9A 5EP3A 3EZFA 2E5KA 4Q01A 3LH5A 1EGAA 1D6JA 2I3BA 1G5TA 2VTKA 1I4TD 3BRWD 4JVNA 5TXGA 2ZVQX 1WBBA 3CR8A 4O2LA 1UTIA 4DCSA 1VCIA 2RGNC 1WA7A 2ZS9A 2J0QA 2YUQA 2KBEA 1GCQA 3K9HA 4OQFA 4QJ5A 1JR6A 1HYQA 1FYNA 4OK6A 2EPDA 2WHXA 1LFDB 2NIPA 4NMMA 3K1JA 4WIAA 3RANA 3SFVA 2W2TA 4AG6A 4GRAA 3AQ4A 3OE7A 4JZKA 4Q18A 4Q9JA 3IIJA 4LC0A 3REFA 4C0QC 4AKHA 3B2EA 2B7CA 3N2EA 3EPJA 2PLFA 4HI0E 3KKQA 1AS0A 1H8KA 1KDOA 1KI2A 2JATA 2JLRA 3DVLA 3K8YA 1U99A 1KO5A 2KEAA 1NVXQ 1KSJA 2PL3A 1CU1A 1KI9A 2W6IA 2GGRA 4ZIRB 2ZYUX 5FI0B 1H8HA 4H9GA 4MYCA 2F2WA 1RRPA 2CE2X 2PNIA 5IF9A 4C9BA 4Q66C 2GZAA 3V4FA 3JZMA 1MO6A 4MGYR 3NBZC 4DDVA 1ZBJA 1D8TA 1SKQA 3CZPA 1L4UA 1ELOA 2PMKA 1C4OA 4AIIA 2KRMA 4I1UA 1G7SA 1MV0B 2V55B 5FOSA 3FTQA 3REGA 2Q9AA 1E9SA 4ESVA 2ZI5A 4L8GA 4BRUA 4URXR 5KUTA 2Z6VA 1CKEA 3EZ2A 1KAOA 5FBWB 5DN6A 2H8KA 1GL7A 1M1YE 1Q22A 4ZKDA 4NHOA 5CYOA 1I2MA 2NGRA 3B6EA 3K0CA 1KNQA 2E87A 3KXLA 1XTIA 2CNWA 2GRJA 1EFNA 4Q5IA 3S1AA 4DT1A 2KI5A 4EPYA 3A1UA 4BLPA 1NN0A 2J05A 1OFHA 4AG1C 2GILA 1WE2A 2MOXA 1E7OA 4KCGA 4S35A 521PA 4LI0A 4A0RA 1TU3A 4XJXA 2DL3A 4EPWA 2J0UB 2MCNA 1OHHD 4WOPA 2VHJA 4XOIA 1ZM3A 2QTVB 3K0EA 4Q00A 4B71A 4HLDA 1K5DA 4ARZA 2NG1A 2GCPA 2W00A 4LBWA 5EE1A 2ZYVX 1DAEA 1N5LA 1OXUA 3TSWA 2YDLA 1F2TB 2KJQA 3DKPA 4RD6A 1SHZA 1ZW6A 5E7JA 3WNCA 4DB4A 5KDOA 3MLEA 3NEYA 1AQYA 3TVTA 2FSFA 4P4SB 2ZR0A 4YONB 3H0FA 2R6FA 3IEUA 2YUPA 1RUWA 1E96A 2V7QD 1JU5C 2WTUA 1XB2A 2ZJBA 1NN5A 4HB2A 1G1MA 3AP1A 2HDNB 5JWHA 1EFRA 1UADA 3L0PA 4JJDA 1E0SA 1X27A 2RB4A 4W5WA 3T35A 1R4AA 4OQLA 3B13B 1UECA 1Z8FA 2PEYA 4Y92A 1YZUA 2VL7A 3W6NA 2QRNA 3DMNA 3DMDA 5TMPA 1SGWA 2P5TB 5JRJA 1KSWA 3RBBB 1UKEA 1XX6A 1W4AA 4PQFA 2QL6A 1N6OA 2VP6A 4M9QA 2RQVA 1JQLB 5D3QA 3ZZUA 2Z4SA 1GL5A 4B35A 1KK3A 1XF9A 1QHGA 4NYMQ 2RCNA 1XEFA 4ZPXA 1XU4A 2A5DA 3CX6A 2DBKA 4E09A 4QKQA 2GJ8A 1US8A 3A36A 1XCMA 4O2RA 2EQBA 1U0LA 2GTOA 4J9CA 3G5UA 4MQBA 1U06A 5J4YA 4LYJA 2HEIA 1XPOA 2OESA 4B3XA 3RC3A 5J40A 4B74A 5I22A 3AF4A 3U7HB 5FUXA 3U23A 3B8HA 2DBMA 1FX0B 3PQCA 4L9WA 3LBHA 3LBNA 2W58A 3F3YA 1W47A 4CEJA 4DUGD 2IT1A 5ECAA 4DLZA 4JLBA 1DOAA 2XB2A 3GLFB 3Q7PA 4GMXA 2JJ1D 2IYRA 4WAUA 4BFYA 4TL9A 2F3RA 4PQYA 4BFSA 5K8IA 2KRNA 3NGPA 1Z3IX 1YWPA 4UXIA 3ZS9A 2NUZA 5IHKA 5BWMA 1EWQA 3I35A 4ASUD 5JFGA 3ULRB 2HCJB 2DHRA 1IJEA 1EX6A 4AYWA 1SHKA 2D3WA 5AJYA 2X19A 1A2BA 1KDPA 4M9ZA 4JJBA 1AKYA 1G8FA 3FYHA 2CJWB 3TIFA 3QVVA 1M27C 4OK3A 4ACBA 2B7BA 4TYYA 2N1BA 4HLUC 1UJ0A 2KXCA 4BLQA 3ZJYA 1TQ6A 1E2LA 2J0VA 3KFXA 3VS6A 3MSXA 3NBXX 4QXAA 3KQKA 3ZYCA 5L3QB 1JNYA 4OI1A 1I4LD 4MGKR 4Q03A 2RH5A 1JEGA 3O8CA 2YSQA 4GZMA 4Q7LA 5EP1A 5EE0A 3RS0A 2FG0A 5CK4A 4A0GA 2HV8A 3QKRA 5JEEA 3FKSA 2GA8A 1AWOA 2D06A 3EIHA 3QF4A 1FNNA 2WSSA 2Z5FA 4BASA 4C0BA 1G3IA 4JKYA 3FHTA 2CXXA 1FMKA 3OIUA 2HT1A 1WB9A 5K8TA 1Y3AA 3IHLA 1CRQA 1ZUUA 3CPHA 3RRYA 4DLTA 5BYKA 2D8HA 1GSIA 1Z6YA 1M3AA 2RF0A 4R71A 1GRIA 4Q1AA 4PFSA 3ETLA 3X1ZA 2VA8A 5SZHB 4DCTA 4PSVA 2MMCA 2NMVA 3M6AA 1UBEA 5HE8A 4HCKA 2KT8A 3Q85A 3IQLA 3TBKA 1DELA 4GDFA 4RUGA 1NM7A 4AY2A 2EFHB 2QNRA 3MMPA 4P0TA 2JASA 2ECKA 4URWR 2OZEA 4MH0R 4EJSB 2JGNA 4U5XA 1YRBA 1ZCBA 4DDTA 3PEVA 1E98A 1XEXA 2FNAA 1NMXA 1K1ZA 1G291 1OW3B 2HDAA 1JJVA 1DAKA 2FPEA 2QPTA 2WJHA 3CF2A 2L2PA 3HU1A 1J90A 2AZVA 3RS4A 4D8DA 3PVSA 5DI3B 2ZI3A 3LFUA 2YWFA 3UG7A 2BMEA 1PJRA 2H92A 1DADA 2ZRBA 5CK5A 4LX0A 2F55A 1Q3TA 4JLAA 4PZZA 2AZSA 3B1WA 1QHHB 1VCMA 4LZZA 4OL0A 3LVRE 1WDXA 3AGQA 4HDQB 3VX3A 2O8FA 1KY2A 3W8RA 4QL3A 4YMSA 1ZUHA 4V0ME 5FL3A 5DNYB 1ZVQA 3NKVA 5KNBA 2IYSA 1XXHA 3W3ZB 5FFMA 3AVQA 5FR2A 4PANA 3ZD6A 3WXMA 3TQFA 2WZQA 5C2JB 4I1OA 1K4US 2OBNA 2CREA 1RPZA 2BWJA 2G6BA 4NE2A 2J46A 1K6MA 4Q1CA 2CUBA 4HLQB 1GVNB 2ODEA 3FDIA 2MIOA 2QTHA 3BFKA 2KBTA 1NI3A 1G16A 1VCNA 2P67A 1Z0IA 2ZSEA 121PA 2ZRDA 2L0XA 2WPDD 4EJSC 2B8WA 2VF8A 4URZR 1KO8A 3UPUA 1RFLA 1KSHA 1P4SA 4UKDA 3NHAA 4ABYA 1E2JA 4Z8YA 4IDOA 2A2ZA 1KNXA 4KHZA 1AGPA 4AK9A 1L7VC 2LJ0A 1D2NA 4DLVA 1FFHA 4HAVA 5GVRA 1C9KA 1LVGA 2JDID 2OM2A 4E03A 2ZJZA 4DSNA 1TQDA 1Z0AA 5LDDC 3KQHA 1NG1A 4Z8XA 2K9GA 1ZUNB 1IBRA 2YT6A 3R7WA 1XMVA 2OBMA 4R9UC 2RGNA 2FDCA 3GJ0A 5B30A 4PPFA 1T0JB 4YMWA 3BOSA 2K7AA 1W5SA 5CM9C 1U90A 1P61B 3FMPB 1QVRA 5CYPA 5E4FA 5EXTA 3B1VA 2EGEA 3ASZA 1F2UA 1UPTA 2C99A 3CNOA 4M1OA 3C5CA 3PEWA 4ZO4A 1KK1A 1GCPA 1OFUX 1IOZA 4US2R 2I1VB 2B6HA 3DEFA 3CX8A 4A92A 2IUUA 1AKEA 1ZAKA 3I32A 1KI6A 2HEQA 2FX3A 4XWKA 3KKMA 4JLMA 4NP6A 5IT5A 1G4AE 1G8PA 3CRRA 1WXUA 2VH5R 4JSYA 2ERXA 3MAAC 4Q4AB 1SVKA 4OI2A 4PHGA 2QMOA 2CK3A 3AH8A 5BN4A 1CULC 4YMVA 1ZLMA 3A1TA 5LPNA 5KYKA 2RNAA 4F16A 4Q7JB 3K9LA 3VKHA 3EIEA 2ESWA 4L15A 2F43B 4NCJA 3TW8B 4CT4B 5L3RA 1W7AA 4F4JA 3A1WA 4DCVA 4C0AC 2WJVA 3AP2A 4QM7A 5ANRB 4PC3A 4QG7A 1T3SA 2QBYB 1IXZA 4PXAA 2QT0A 2DLPA 3Q7QA 4X8MA 4FCVA 5B57C 3AKYA 3VAAA
chains in the Genus database with same CATH superfamily
3VYGA 3U7QA 2H2DA 1E59A 1ZBXA 1PS8A 1DQZA 3GNTA 1YIJQ 3BJEA 4TOIA 3TTUA 2DR3A 4X85A 3WJAA 3KDSE 1X80A 3HRIA 1MC8A 4M8SA 2PQ6A 1XWFA 3WTCA 2H5LA 2OGWA 4S1PA 2ID9A 1M2VA 1R00A 4NEGA 1JG3A 5LJ5j 4TTIA 3NM5A 2P0QA 4RETA 2PX5A 2HFKA 2CYAA 3N2LA 3SQWA 1SF9A 4TSKA 1RNLA 1V4NA 2DBZA 5HRUA 2QN2A 4AMZA 1M2WA 2O4XA 1ZSZB 1IE3A 4RL4A 1BHQ1 4OMCA 5BR4A 2GQIA 3EVTA 4NZMA 5ALUA 1RBYA 1J7KA 3O6VA 3ROKA 2HKQB 1K8AC 3TUIC 4PYRA 5DGHA 3ZHSA 3T9DA 5IK2A 4G81A 1Y7HA 4LJKA 4UEQA 1OYOA 2PBZA 3D2LA 3RIMA 4DG8A 4L16A 2WVAA 4QGBA 4D3XA 3IQXA 1JDZA 4R7ZA 5BV7A 1PUIA 3ZVMA 4JLSA 3QYGB 1NRXA 5HCIA 2ZUEA 3D0OA 5F9FA 1ULZA 4YV7A 1NUHA 5K8UA 3L2OB 2G7ZA 1D0ZA 4KYUA 3JCMQ 1MT0A 2BFEB 1EX9A 1E2NA 2C2KA 2R1TA 3EX7C 4FYYB 4FQ7A 3ZLBA 4XSVA 2CP5A 2JRLA 1YRQA 1QIGA 3LRTA 3ZYZA 4DLKA 3V7SA 4FLEA 2K3XA 4RHCA 1UC4B 3VDNB 5JOQA 2O0LA 2XD0A 5IKMA 4J3JA 3HMQA 2PX2A 1XVVA 4HXEB 1SUEA 1VBFA 3V2UA 1SG9A 1BO6A 3CUKA 4UCQA 3EZXA 3E3LA 1E2MA 2GESA 1WHTB 4O4IA 1LDBA 3CEMA 1OV4A 4KC0A 2MPXC 4M1YA 4N7JA 4M75A 4N0EA 3QF7A 4IJMA 4LZAA 3S6WA 4F56A 3OQ6A 1KJ8A 2V3CC 4C8QG 5IC5A 3DKMA 4QWWA 4QX6A 5JRZA 1SWVA 4GOJA 3IKMB 5G0WA 5IJ9A 3MTDA 5LL6P 1NNLA 2AI2A 2Q5JA 2OO7A 3GDOA 4UUNA 2VG8A 3IXQA 4DIOA 1NUTA 4QKUA 1NJ2A 4YRZA 2BE7D 4C0GA 2J7PA 4QDJA 2RIRA 1KC1A 3WK5A 4IURA 2QYZA 3ZEIA 1Y6FA 3T7TA 2EEPA 4R1QA 3N1UA 2WG2A 3WIVA 4MV7A 3IOMA 4HTFA 3HI4A 4WCDA 1P0FA 4QBHA 5DLDA 3WBJA 3HUUA 1MC1A 4UHFA 3PUZA 2AQHA 1Z0DA 4KMMA 4OY3A 4E7PA 4ZHQF 4GLKA 3PKJA 2OECA 3WX0A 3OQ5A 4EJFA 2CNWD 3Q5EA 4OO3A 4RHFA 4DJAA 5E3JA 2HA3A 4NPCA 1BSVA 1N6IA 4OB0B 2AB0A 4ENTA 2XNSA 2XUJA 2IV2X 1P31A 4XWTA 1T2FA 4RTTA 1UOPA 3FYCA 5G4LA 1OSNA 2QDLA 2RK2A 2VQDA 1SURA 1QVPA 3CE9A 2ZLBA 2PU5A 3G2LA 4WXPA 3U13A 3H5NA 3FB4A 2XTJA 4U1RA 3VI4B 1Y3DE 1LGYA 1K8YB 5JNVA 5K0FA 4Y2SA 1OX8A 3NIDB 3EXFB 1CZKA 1MKYA 1NKVA 2DECA 2Z2YA 2ZWIA 3WOVA 1MHPA 1WPQA 4BVKA 5E95A 4ELYC 4O63O 4OMFG 1N6AA 2N75A 2PKEA 4GE0A 4DG9A 2JJQA 4YUZA 1GPBA 5FB3A 4RY2A 3GZJA 1XDWA 2FSHA 2CMKA 3PEUA 1SB9A 4DKXA 3O03A 3TM4A 1QRTA 4TN1A 3F98A 4MYUA 2W6JD 4ZGJB 3EVZA 3C43A 4CC4B 4RCVA 2JS7A 3D3EA 1Q17A 2GAJA 4BNDA 4KDFA 3L0DA 4WL0A 1S0UA 1B41A 4RJJA 3FLBA 1XMQB 1HZJA 3UMVA 4OB6A 4O2AF 2E48A 2CV2A 4A16A 4ZTBA 3LPCA 2VK4A 5JJLA 5B3LA 2LIPA 2KB0A 2ZJYA 4R9NA 3FB1A 3A8HB 3CRQA 3E22A 1UFOA 4K46A 1M7GA 1CHDA 3HJGA 4IQFA 4L5AA 4UMDA 4F8YA 3OCJA 1OZFA 2Q5QA 3UOWA 3OUZA 4KI0A 4EECA 4IAOA 4RSMA 1N5KA 4IGAA 2Q7XA 1W6XA 4CTJA 5D00A 5LZ4A 1SA0A 1YZFA 3D0QA 4B2YA 2MSDB 4CI0C 4KR2A 4BMVA 3NKFA 3EHEA 4OSEA 1JUDA 4HNSA 2XLCA 1GNSA 3NT4A 3A6EA 3LGFA 3EN0A 2JXBA 4WLOA 4I5GA 3PITA 4HCJA 4B34A 1J9EA 1SULA 3SC6A 2JBHA 3UH0A 4INJA 3CPWS 4L0MA 4AJOA 3J80E 3QJ5A 5H16A 1RABA 4ALIA 5B53A 4JI4B 5C5EA 3LLUA 1V7PC 4KO3S 2WSBA 4ZZ0A 3PUYA 2V1XA 2BM9A 5EQJB 1PP4A 2C9OA 2QUBA 4J1TA 3K2BA 3N8KA 1PFGA 4F21A 4ZIRA 4FCCA 2LCFA 4IW3B 2V6GA 4YFYA 4KITB 1BMFD 2ZWOA 4P3PA 3U1VA 3TTWA 4X95A 3OJXA 5GVSA 2LD4A 2FMIA 3HCPA 4HS9A 4IFBA 3LC1O 3UM9A 1WXEA 4FCWA 8ABPA 3RGGA 3G68A 1J2JA 3MBKA 1Y4UA 2ZT7A 2I80A 3WTBA 1SBTA 1E1DA 3K0CC 5HCNA 1ZGCA 1U5AA 1GTRA 1N8RR 4M3NA 4IVPA 2VAWA 1IJFA 1U4NA 4DDMA 1G59A 2QY9A 5TARA 4Q4LA 5F23A 1U0OC 3CBQA 4IOMA 3HO1A 2IS2A 1BDMA 3IL2A 1WUJS 4A4HA 1AUQA 2DD5A 3HTXA 5LD2C 3NUZA 5PGMA 4QPDA 1L5LA 4I6GA 3SYNA 3GMDA 5K3FA 3TGWA 3AZQA 2GZDA 1DTSA 3ADOA 1TECE 2FSUA 2NXWA 2CXRA 2YUNA 4HLUA 3RABA 1YKSA 1FDSA 4ZEVA 2FX5A 1DT5A 1RAEB 1Q95A 2MINA 3D31A 3G0CA 2O31A 1L7MA 4RZ3A 1IZ6A 2KNBB 1FC0A 2A4MA 3PWKA 3KNZA 2JLWA 1PK7A 4LY9A 5CRIA 1VL0A 5TR9A 5D6OA 4EI7A 2A9PA 4IO1A 3GLKA 2PQMA 3CGWA 1JKJA 3H3FA 2RI1A 3JASB 1W4BA 3USZA 1XXHB 3IELA 1W19A 2R47A 4RPKA 4MB0A 1KFZA 3N7TA 4LDVA 2PX3A 4PAMA 1EUCB 3CNNA 2O4UX 2WIBA 3EUFA 3M5CA 5LJ5f 5DLEA 4RMHA 1GGNA 1UT6A 4UC4A 4OMLA 4C6SA 1IH8A 3FG9A 3TIGA 3LUDA 1I13A 1NVUQ 5JPDA 4V39A 2GJSA 2A57A 4LTMA 3MMSA 2I6SA 1PUJA 2JD1A 4UHKA 4EZIA 3G6KA 4GH5A 5LVAA 2JMAA 3GJ7A 4LI3X 4XQ0A 4Z0PA 2CDTA 1AUPA 2R8RA 4HQ6A 2HK9A 3GEPA 4P5EA 1YI0A 1CTQA 2OKCA 1ZHHA 1ZCAA 3PD1A 1I6LA 4EYKA 3F2IA 4MVYA 4MDEA 3CLRC 5KJ1A 1BHSA 5HM8A 2DQSA 2W6ID 2ZBVA 3CINA 3TPFA 4WV3A 2QX4A 4F4DA 2Q1XA 1H0KA 1FNMA 2Q9UA 1WDKA 5EAIA 2IYAA 1BYMA 5CKFA 2BH9A 4CG0A 3V42A 3UV3A 1K6IA 2ORWA 2JIOA 2QM8A 3V2GA 1K4YA 3EFSA 3WLPA 1RPNA 1M1KU 1KH2A 1SHFA 2WY2D 1Q0UA 4JB8A 4UBOA 2PVCA 3ACDA 4WFIA 4PBTA 4N0AA 4KYTA 3HU3A 3QFRA 2EDAA 3K32A 4DEVA 1U2GA 1ZM9A 4FIDA 2XNJA 4N0DA 3GBQA 4LTNA 1QYIA 3P0EA 5KX5A 1T9BA 2COWA 3FETA 3DHEA 3L7DA 1S8AA 4TVKA 3OHPA 3ICQB 1CRPA 4R1SA 3LV8A 4P3OA 2XHZA 4LWOA 3KKLA 4LE1A 4I6EA 2ZPAA 1AZLA 1VMKA 1D03A 1UC5B 3OJLA 4HAXA 3IHTA 1ZONA 1NE7A 3C15C 1VKOA 2MAMA 3CD6Q 3KYCA 2Z3ZA 2ZWPA 3KJFA 1YQQA 4UU0A 3OIGA 5CTJA 4HCBA 3H2JA 5C4MA 2Q2OA 4REQB 2AK2A 3U80A 4PGHA 5CVDA 2JVVA 1U3DA 3GLGA 1C4KA 1L7NA 3L7CA 3WLNA 3ICOA 3KWMA 4NYMR 3RH0A 4L95C 1SK9A 4Y2VA 1JQQA 2NZYA 3BILA 5ALIA 1NVAA 1B8OA 4DA0A 2DFPA 5HIIA 2GZSA 2JM9A 2JZCA 2YZMA 3EEFA 2PX8A 4MVJH 5BN3B 3CPWP 3A6ZA 4YRFA 1UJ6A 3WB1A 4TLAA 4HDMB 1JJ2A 4RVDA 2R8ZA 2EHDA 1UWKA 3LUKA 5JH7A 5DNDA 3WWEA 2VYNA 4Q4DA 2DKFA 4BBPA 3DV0A 1WETA 5HBRA 4F6CA 2HUPA 3VHRA 2VDVE 4MLDA 2VXYA 4DCPA 3TS1A 3OF2A 1YB2A 1EHCA 4WBSA 3PC6A 4WWHA 2JAOA 1XXHE 3DAHA 4OPMA 4FSXA 3KSBC 2UAGA 4YASA 4MITA 2XMCA 4OIFA 2JIZA 2W90A 1HKUA 2ADFA 2CHFA 3SAJA 3OO0A 1RMTA 2GKOA 4CM6A 1UQRA 2Z2KA 1AQLA 5DXJA 4MV4A 2X2FA 3M6VA 5EGNA 1M2JA 3D5QA 4FEYA 1P0IA 1H2WA 4R16A 2L3PA 2ZANA 5CA1F 3LCJA 1ZMOA 1LS6A 1MENA 3F73A 2CK3D 3CCVQ 2X4DA 3EWAA 3UBTA 4ZAXA 1GFIA 1GQRA 1LS1A 2IY9A 4ZVMA 3CWZA 1EG2A 3DEAA 1CQWA 4Q3DA 1VXOA 3MLAA 2P27A 4O4HF 2JK1A 3FHOA 1IB6A 4EKNB 1MC4A 4LOAA 2PD4A 3W1WA 2GPWA 4LJ6A 1DU4A 3PX3A 1EFVA 2ZCUA 4MLZA 2W8ZA 4YRJA 2WJYA 1WDMA 1NYQA 5ES4B 5ILGA 1TGVA 4G01B 5AHKA 2AXNA 2X1MA 3CB4A 5BR1A 1OZ3A 3BL8A 4H0FA 3LGXA 4LJAA 3VKFA 3UF4A 5DXFA 3WHIA 1WL8A 1COZA 3B1JA 1GTL1 1VKZA 4J2OA 4Z86A 1RHKA 3LUCA 1GZ3A 4MKXA 4C7BA 3I8XA 1HTBA 2GK4A 4GT1A 5JSZA 4M21A 1C30B 3OTIA 4H6XA 3ODPA 3L8GA 4ZN1A 4EMHA 4Q48A 4Q3BA 4HUJA 1FDVA 1EFCA 1ZJYA 4CEJB 3OD1A 3W5JA 3OI7A 3I55T 1I1JA 4HDAA 2QA4T 4DYHA 3IURA 5H02A 4IIXA 2BTQB 3UMGA 1FRZA 2H1RA 4PO3X 4W1RA 2IBMA 3GNFB 2Q3HA 2NXJA 1DRKA 4B8YA 4TS1A 4HADA 5LQNA 5KC8A 2AJDA 1IHYA 3KDAA 3IUEA 5FPTA 2XZTA 3R23A 2YYSA 1GKKA 2O6LA 2OK8A 1UGPB 1VSTA 5FUYA 3H97A 1JFFB 1P5ZB 2TMDA 3DTTA 1UBKS 2RGDA 4X1OA 1V8PA 5CG2A 1J2EA 3GAFA 1NLOC 4MS1A 3QBEA 3KE8A 2ZJ1A 1GTMA 3IBSA 3R4VA 4M7AG 2WE7A 1TX4B 3A9RA 3I5XA 4YJ3F 4Y28E 2B4TO 3FPLA 1VJ5A 3P71T 4UNIA 4Z53A 5J63A 5WRFA 3PQ3A 4LYDA 4MR7B 821PA 1EA5A 1Z06A 3ANNA 1SKUB 1A8QA 1JJAA 3F6CA 2Q5LA 2E3IA 4OOFA 3UOGA 3BIJA 2VPZA 4LXUA 4G0YA 2EBPA 2CLMB 3QKJA 3IIIA 1JIXA 3I9MA 1SO8A 4X94A 4JNKA 2DXBA 2NUPB 4AYXA 1KI6B 3JQAB 1ICIA 4BNNA 4NOMA 4HQFA 3FA2A 3GROA 4XTVA 3FWKA 2Y9PB 3HSYA 3KVYA 3AFNA 1FJGB 3FH0A 2YWBA 3FMVA 3B2EA 3BRCA 2O0MA 4GP9A 1PFWA 1DKNA 4M77A 2YV2A 4NLLA 1SCIA 4M76B 4OVKA 3CMAT 4RUKA 4MVJP 4ZODA 4TXLA 3SMVA 1ZA2A 3NBZC 4YWHA 4A54A 4YS6A 3FR8A 2RGRA 1Q81U 3M5PA 1UKBA 1BCRA 3IIEA 1HNWB 2ZTMA 4L9RA 2YWRA 3IT1A 3L84A 3M3HA 1STOA 4PW0A 3RFVA 3PNLA 3FIJA 1GL7A 3Q8WA 3Q1LA 1E8NA 3QVWA 4DT1A 3DZGA 2DR2A 1CUGA 5FNVA 1DIAA 4WOPA 2VHJA 2GCPA 2ZYVX 4RD6A 3TSWA 4IP0A 4OQDA 2UZ4A 1EFKA 4E5NA 5BMOA 3A0RB 2M1ZA 2NVWA 1XB2A 3GGJA 2QZPA 1JDJA 4L28A 3AP1A 3NC4A 4RS3A 1I3LA 3GJZA 3OIDA 4CUZA 4IZOA 4MGHA 5IXYA 3S70A 4W5NA 1FYFA 5GAOp 3OPYI 2AHJB 3RBBB 2AJ8A 1C4XA 2RCNA 1XU4A 5BNFA 4C92G 3GYGA 4RQUA 4DN6A 1U0LA 3V7NA 3NMUF 4ZHSA 2JIBA 4W5RA 1FX0B 1CNFA 1QCNA 1GAEO 3ER9A 4AZSA 4XUGB 2AOWA 5AJYA 1Z36A 1VQNT 3PNBA 1QX3A 3WNQA 4QXAA 3ZK8A 4HQKA 2G5GX 4LA4A 4Q7LA 3TECE 1P2DA 4QTZA 5K0NA 2B4RO 1C3VA 3QF4A 1Y96A 1E1NA 5BWCA 1ZUUA 1Z6YA 3Q7RA 4EZBA 1PBNA 3A1DA 4MR9B 4UQPA 3PVCA 3O91A 4RUGA 3RYIA 2EFHB 4URWR 3EODA 1OPRA 1OWNA 3PEVA 1XEXA 3OPNA 1UZLA 2CXQA 3DAOA 3WYCA 1TPYA 1TFRA 2YRDA 1PKEA 4EJ0A 1Y8RA 2CP0A 5AVRA 4XLLA 5IASA 1GVNB 3T4UA 1L8LA 1NI3A 3PYMA 4L73A 3OLVA 4EJSC 3RIRA 3OOWA 3OZFA 2CVOA 4OYRA 4E5MA 1KNXA 2PKQO 2ZIVB 4E03A 1TQDA 3VR6H 4BOYA 1IBRA 2CKMA 3GJ0A 3IX7A 1E7MA 2K7AA 1UMDA 3FMPB 3MCUA 2C99A 1V5EA 2F64A 1KQ1A 3CR3C 1V1MA 1IOZA 2I1VB 3PPYA 1OBHA 2I65A 1EQUA 2H52A 4OI2A 3SIPA 3SEZA 5KYKA 1QX4A 4Q7JB 4AJ9A 5C1DA 4CJXA 2QT0A 3OT5A 4QVKA 2I1LA 5JROA 3GUUA 5K3SA 3OHMA 3CO0S 1JJFA 4B6MA 1YZGA 2OEPA 5KB3A 3GEMA 2FSVC 3NHLA 1ARKA 4JJZA 1W2BA 5BVGA 2AK5A 3EIXA 3HJTA 2R6GA 1F1JA 4WNYA 3IDOA 5TRTA 1OZ0A 1RLPC 5DYNA 1WWKA 4GPIB 3A04A 1B7GO 1SUDA 5DCUA 3E7FA 4ZT3A 4CGYA 2V7BA 4MUIA 4DDKA 3FMGA 2A3NA 4F1JA 3FUTA 1NF2A 1Z16A 3DW3X 4C7OB 1ENOA 3HEAA 1PNOA 2CZ1B 1Q3KA 3EISA 4A0QA 5CDTA 1YJWA 1V41E 4L6AA 3MIIA 3LXXA 3PGJA 3QKUA 4QRDA 1Q3HA 4EK9A 4RCYA 3C70A 1U0RA 2F2XA 3UH1A 3N28A 2D5LA 4JX8A 4JUCA 3QQPA 4IV5A 4EGJA 4MWBA 3K5PA 3CR7A 4LVUA 1GAWA 1OB5A 1RWPA 2PWYA 4QUEA 3HY3A 1N5DA 1SOVA 2QRVB 3A2LA 3KKOA 3ASYA 1OLSB 5EZ6B 3H8WA 1VM6A 1ZLYA 4M7WA 2RHRA 1DFHA 1D8AA 1AZWA 2YJZA 5CLQA 1SHUX 3ZX4A 4EFDA 2AE2A 3KJGA 2IQ5A 1S7CA 5KSOA 1W85B 2ODQA 1KFKB 4WD3A 3G5TA 1WZUA 4Z3KA 4L4SA 2QQSA 1M90R 4MV5A 1RXWA 1KQFA 1JXQA 4J0JA 4K11A 1PFKA 5E4YA 3U09A 5F2KA 1J8YF 2CJWA 3L1IA 1NW7A 1N1GA 3FAZA 1XD8A 1P4AA 4F4FA 4Q47A 1V1JA 3H1EA 4TKVB 5BR7A 3R2JA 1T4CA 3RYTC 4PCUA 2XEXA 5EKTA 1JR3E 1KI4A 4N47A 5KBYA 1Y7IA 3CH4B 5K3DA 3EULA 3PI6A 2GN0A 4ZEOA 3WKDA 4EBFA 1MNDA 3CVYA 2QN6A 5HG0A 1BMDA 4EPCA 3GJ8A 4D1YA 4Z54A 1PSEA 1AIPA 3WZMA 5DGIA 3PJGA 4OQYA 4OREX 4Y9SA 1I30A 1NYFA 4O1IA 1SVOA 4AROA 5BRNA 4B7CA 3QUTA 4Y9TA 2OAWA 4R6XA 1CUZA 3A9SA 4TT3D 3BYZA 4DMMA 3R8CA 4RFLA 3L8MA 4TKMA 3HKEB 1VGQA 4BO0A 4E6PA 3TJMA 1Z25A 5FWYB 1COWD 5JATA 2HRBA 4IDGA 3HBLA 1NEBA 2BC9A 1T0JA 2X8WA 1GAJA 4GL2A 5CXUA 1RJ9B 1S2GA 2C9BA 3B1XA 1MOZA 5KWSA 2PBRA 1OTHA 2Q4RA 2DJ5A 3H2GA 4F46A 2XQGA 1ECCA 5EGSA 1CVIA 2XMDA 1OJ7A 2PXAA 3T3HA 3SKXA 1K86A 1Y4ZA 4RHYA 3SX2A 4UEJA 4NQZA 4G0WA 3FWZA 1TM1E 1PBTA 2ZBQA 2QRGA 4U0JA 1VECA 3N59A 1T2CA 4OLJA 2A78A 1IDN1 4RMIA 4BY9E 2V59A 3AEQA 3LUFA 1FJXA 1GVHA 1Q1QA 1QIMA 1QK3A 3M54A 1KOGA 1JR4A 3IE0A 2F69A 2EGAA 2OGZA 3IPRA 4A10A 1L7RA 1SIOA 1POXA 4RZXA 4GYYA 5LMNB 3AEUA 4PXYA 1R6AA 2IHZA 1TJNA 2E49A 1CUCA 4WA7A 5G2OA 5E2AA 4Q6WA 1J2YA 2V8JA 4FYMA 5CX4A 1IK4A 2GEBA 4W9RA 1R0CA 4GX1A 1XNIA 3CCMQ 1RYDA 3ZDFA 4CG2A 2REQA 4ZU1X 4M7DB 3ACBA 3K6SB 4G89A 4MUKA 4PLHA 5ER6A 3WK7A 4IDNA 5AKIA 5JU6A 1TEXA 2I6FA 1YONA 1H5UA 4MA0A 3N07A 1J0AA 3IBTA 3R8XA 3WFIA 4F7UG 4MKFA 4XJSA 2I54A 2DZDA 4NV0A 1FDWA 3IGFA 1YQDA 1SUSA 3RYFB 5JNTA 5JV5A 4GF5A 3OF5A 2IYNA 3X1XA 4WBXC 1XZCA 4HWSA 2G6FX 3PHJA 5AM0A 1BMQA 1IZ0A 1W49A 1RLTA 1W48A 2LVMA 1QB8A 4L3WA 4HVTA 4BACA 1GPLA 2CXTA 1EXMA 5T4EA 5EC8A 5D7NA 3M0UA 1BDBA 1Q1BA 2JS2A 3EG9B 2AYXA 4CM1A 4MR8B 1PR9A 3TUJC 3OY9A 2M6LA 3D81A 2AQIA 3RV4A 2JFOA 2VNSA 2CKKA 5ILQA 2BFNA 1A77A 4KN6A 3D0RA 1EB8A 3U7GA 2GETA 3HDYA 5A0TA 3SC2B 2XCSB 3RC9A 3E81A 2D1FA 4PHHA 1R37A 5JDCA 3G13A 5TGDA 3NOOA 3DM5A 1M5RA 4AUKA 2NTYC 5HIMA 1RFGE 3OX4A 2W6CX 5CA0F 3NOQA 1BVHA 1TZ2A 3F46A 1K89A 3IR5A 5SYAA 2BIFA 1ACJA 1WQ3A 3R3ZA 1PK9A 3ZJ5A 4F04A 4C29A 3P9IA 1Q6ZA 1SELA 4EUEA 1RHUA 2OTLT 1H3FA 5DIZA 3KQSA 4IH4A 4IIEA 3S6JA 1QHXA 2EBFX 2FW1A 3HNOA 2O8DB 1N9RA 3I9KA 4BTLA 1S72T 1YR9A 1IZ8A 1AK1A 3DB2A 5IJ0B 1LPBB 3G2IA 2EGGA 5K1ZA 4GLLA 1B8NA 1C7IA 1I4DD 3BQ9A 3JYLA 2I1WA 3IRUA 4KX3A 3HY6A 2PZMA 3EBLA 4Y3UA 5TPWB 2JAXA 2HNBA 3JD3A 2CLEB 2V8BA 1JRLA 1R16A 5CB4F 2B35A 4C7KA 1U0SY 4J4BA 1E3SA 2OD9A 2DL8A 2AXQA 4X8LA 3BTSA 2X0KA 5IZCA 2FZWA 1H85A 3CONA 5JDIC 1BW9B 1DV2A 5JS8A 1AB6A 3DKRA 4DJTA 3X24B 2D1XA 1TAQA 2H9IA 3DMHA 3LZDA 3K20A 1YI2Q 3GQBB 1ZI6A 1ZXBA 4EB0A 4FFSA 3TLGB 1SXJD 3IJEB 2GJAA 1N7HA 3UNXA 1VMAA 1FQOA 4ZT7A 3MXTA 3IDAA 2I6TA 4A03A 4URYR 4YPOA 4JQOA 3A3OA 4DSAA 1N0UA 3NVKI 1KU6A 3QWYA 1VLVA 4FWBA 4W9NA 2DMOA 4RPHA 1V25A 1ML3A 3R0ZA 1A7AA 1UXKA 4LNHA 1HQKA 3UMFA 1J25A 7ABPA 3NHKA 1ILEA 4L07A 3HRKA 5AJHA 2GNPA 2NVUA 1GGEA 2Y27A 1C1DA 4Y1RB 3BZBA 2FB7A 2IYVA 4KPYA 3S1LA 4XLZA 3OZSA 5DWVA 5DBIA 2ATCA 4MCHA 1U8AA 2HI0A 2QTLA 2MR6A 4DV7B 2QU7A 4OJYA 4LXYA 4UEKA 3FCUB 3AJDA 3NATA 3GEEA 1YS6A 4ZEXA 2ZI6A 4O02B 4MV3A 3W6OA 3QKWA 5A2QA 2H5IA 2RHDA 2VP0A 2PRIA 4XD2A 3FVTA 4I6JA 2CJPA 1O89A 4O8ZA 3LS2A 5LUAA 5HKCA 5KHLB 4YDHB 2KE9A 1N7JA 2IG0A 2G5TA 3VV2A 3WGUA 3H0EA 2EZTA 4HN2A 4GKVA 2HJGA 3ILYA 3KSUA 1G66A 5LJ3h 1UM9A 3WQBA 2EVRA 4N6NA 3KB1A 3E1GA 2OFWA 1Y63A 3U7FB 1SH7A 3FDJA 1Y1QA 1DQNA 3V4SA 4JZ3A 4MX8A 4MWCA 3TQ7P 3JCMJ 2WF9A 2X13A 1R5OA 3IVGA 3KUCA 4EI8A 1NAIA 1NJIC 1YU9A 1NQAO 1P4RA 1YFZA 3PEYA 2GKSA 2MR5A 2G80A 5HUHA 2AMFA 2OCLA 3L01A 7ADHA 2OXFA 1KJZA 3UGKA 3RHFA 1W2GA 4PC6A 4KULA 3FMFA 1OHHA 2OYSA 3O8LA 1W0JD 1CQJA 3ET4A 2Q8NA 1Y42X 3DVAA 1CJKC 2ORYA 2OQVA 4YRLA 1XHEA 1HMPA 2IU4A 5EG2A 2DWPA 4O4LF 2LW7A 4QZVA 1E5XA 2X5NA 2PLAA 4KLZA 3C3BA 4G0QA 1QTIA 4G5RA 3MS7A 2O88A 2AFIB 3ADKA 1X7HA 1IG3A 2NOAA 2VT6A 3QU4A 4LDUA 4CL8A 3ZWYA 3UC5A 1B8VA 2D2IA 3OEWA 3ZWPA 2R5WA 4JBGA 2BKEA 3FKSD 2LE0A 3JWEA 4K9NA 1E6HA 2FP4A 2PX0A 1F17A 3JCMP 4K8OA 1E99A 4DLNA 3VAZA 1RJEA 4MW0A 2AW3A 3VNQA 1VA5A 3SFMA 1UBGA 4PCVA 1H3EA 1E61A 3FIUA 4YGYA 4KW7A 1ZVMA 1UWVA 3AHUA 1OI7A 2GZMA 3ZQKA 3E9DA 1R6BX 4XTRA 1M75A 3BA1A 4IUTA 1PR2A 4BXOB 3PXCX 4I99A 1S9DA 4X7PA 1KIMA 4AO8A 3ZW7A 1QIEA 2W6NA 5MGNA 4GLOA 3IAFA 4KZPA 3LCUA 2CNBA 2RHTA 3EXG1 5FT9A 2QLBA 1CUWA 1IYZA 4FW1A 1PTJC 2DL5A 4G37A 3CO5A 4D7AA 2XWJI 1TCUA 3O1LA 3OTWA 4QAJA 1M2OA 1GQQA 3BVPA 3SS9X 4NHEA 1Y6JA 3L8ZA 4WZBB 2V0NA 2O5CA 2UYOA 8MHTA 1RQNA 2J6BA 3DCJA 1T9ZA 3FFXA 5GONA 2HHHB 1VG9B 4HDRA 1Z15A 3URGA 1PT9A 5IN4A 3D2BA 4BGUA 4LV5B 1V7CA 4U6SA 4R9RA 1TYAE 3PPIA 2VA9A 4M87A 1AD5A 3QTTA 3MOGA 3V7WA 4KE6A 4UM8B 2H4WA 4NZYA 5P21A 2CVFA 1KKLA 1RAHA 3VR5A 2ABWA 2RN8A 4OX9B 2HKIA 4OQZA 1XMOB 3NFYA 3V7YA 2A9KA 1GCGA 4FOSA 3LUGA 2IEAA 2J1LA 4Z0HO 2AKLA 4FGKA 3GA0A 3M6FA 4RL6A 1IATA 5AM5A 2GYVA 4U9IS 3AJEA 1WU8A 5K3BA 3HR4A 3ETEA 1PNTA 5DBHX 2Q6IA 2WWTA 3I6ZA 2D3TA 4XA8A 3UK7A 4L8WB 4XU1A 2DTOA 2SKCA 3IP5A 2V4MA 2V7PA 3FWNA 4UXJA 4YJ2A 2JFZA 5GMKl 5KSYA 5C8YB 2M6RA 3VS5A 1FS5A 2AMJA 5KYXA 3EQ7A 1VOTA 1PFUA 2QEXT 3SICE 2P0EA 1IXYA 2OVFA 3DTYA 3QX8A 5DOVA 4YXFA 4B8WA 1VQKA 3V32A 5IYZF 3RMSA 2F62A 3FY4A 1D3BA 2PLNA 2VP3A 4V0RA 2HWYA 1PLJA 5DGCA 3OZDA 2X40A 4ZKEA 5KOHA 2LP4Y 3HWSA 1J4AA 4DCMA 3L79A 4RJ2A 1H65A 4G1UC 1UBLS 3HM9A 5TF0A 1YWOA 2VC8A 3SOPA 3OZEA 4C0FA 3AKEA 3ONNA 2AFIE 2GBGA 1U3OA 3S29A 1XLWA 2RH9B 1EJ6A 4J0IA 2XHCA 4HDKB 2A3RA 2FQQA 4NOKA 2F1HA 4TSFA 2IDMA 3PWTA 5LZ5A