1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
1Z63A 1CXZA 3I3SR 3R8FA 2CDTA 2FRYA 4QNMA 1OFUX 2CLSA 2DHRA 2DBKA 2R65A 4LJAA 4LSGA 4WW0A 3SBEA 3THWB 1F3OA 2W6JD 2RGNA 3KFXA 3M0SA 2GJSA 4CC7A 1KI7A 2XOKD 3QXHA 1E9BA 4MYHA 5AK0A 5HPYB 2C9YA 1AIPA 3U7HB 1ZNYA 1E2JA 2FJUA 3AEZA 4CEIA 2WPDD 1SZPA 4LBWA 1ZBDA 4URWR 1UG1A 3WMEA 1DTSA 4EJSA 3VS7A 1I2DA 2O8FB 2IS6A 1TQ2A 1VG0B 2JDID 1AZTA 3L8YA 4UXHA 3Q7QA 3I5RA 4AFQC 1ZC3A 2BVNA 4LYHA 2JT4A 5K8TA 1J8YF 1SPKA 1GL9B 2G3YA 1YZKA 1GNRA 1Z6GA 2C96A 4MGZR 2P0EA 4MRVA 4PPFA 1U98A 3CRRA 4ZV4A 1G7TA 1UFQA 2ASEA 4Z1MA 2FV8A 4LBVA 4F4JA 5CJPA 1NI3A 3VRYA 4G5RA 5HE8A 3RS7A 5C4GB 1OKKD 2DX1A 5C2JB 1CKEA 1Y3AA 1W47A 1Z5ZA 2FFAA 3NBZC 3CLVA 4JL8A 4HB3A 4NL4H 2HXYA 3AM1A 1YZLA 4Z89A 1QHXA 4IDNA 1KO1A 1U9IC 3OIWA 1RPZA 1UBFA 3PE0A 2JLSA 1Z0DA 1CTQA 4BFWA 1ZU5A 3FPAA 5EE5B 2NO6A 3IBYA 2KT8A 1NIPA 2XEXA 4ZIRA 4MYTA 2ZJ5A 1S8FA 1CR2A 2OCAA 3V9PA 4RVCA 5A0FA 5F98A 2VO1A 3LX5A 4MUAA 2D2EA 4M1MA 4ZI2A 1T6NA 3GCGA 1LS6A 1XBTA 5FPYA 4L15A 5H68A 2BM0A 4GT1A 4AG6A 1W36C 4YMVA 5KU1A 4DLVA 1UTIA 2ZVQX 5LBIA 1NKSA 4WVFA 1M27C 2QM8A 2BJWA 2MSDB 2NZ8A 3IPYA 2VP2A 4FXPA 1GM5A 4FMCF 3NXSA 4HLDA 2KB0A 2EGAA 4PPQA 3REAB 1DE0A 4BZXA 3GLGA 2G1JA 5J4LA 1OYYA 3T5GA 2V4ZA 2YNMA 2YYZA 5DI3B 3MUFA 4Q1CA 4HVVA 5EJEA 2J6FA 4F14A 5K8IA 3UKDA 1RRCA 3RNLA 3CRQA 4A92A 2KJQA 2LNHB 4TMXA 4A6XA 1VTKA 4YXWA 2EQIA 2JJ2D 5DISB 5JCZA 4AG5A 3IGFA 3TVDA 1JAHA 4DB4A 3Q8XB 4HZIA 4BFSA 3NC1C 1ZU4A 5EXSA 2VWFA 1DS6A 2I4IA 2H16A 4NCNA 4C0QC 3B1YA 3LXRA 2IK8A 1P2SA 1SULA 2IYUA 1A2KC 4IVPA 5JSZB 1IHUA 2ESWA 3QE0A 2IBMA 2ED1A 3AUXA 3LXXA 4PQYA 4D6PA 1WBBA 4CEJA 5IK2A 5J4HA 3I72A 2CBZA 3MJRA 4DSOA 4KRTA 4KBFA 5GJVC 3QXCA 1ZCAA 1BYIA 2FH5B 4B73A 1XPOA 3MCAA 1BOFA 1N3BA 2DFTA 5DHFA 1G8YA 2Z5FA 1XX6A 3NMZC 1IN6A 2A5GA 1NYGA 1ZM2A 1R5NA 3W90A 1E4VA 1CIPA 1XD9A 4DCTA 4UJ5A 2JIZD 2GJKA 4Q1BA 1E98A 3DMDA 1Q57A 4M1OA 2KE5A 1AJEA 1SVIA 2DILA 3ZGXA 1WQ1R 2FFQA 4PQRA 1OF1A 3SFZA 5HZHA 5JWOA 4LHXA 3U60B 1OKKA 2H8KA 1VYUA 3KKNA 4BLOA 1XXHB 2AHOA 2ZQ5A 1BYUA 2HCBA 2ATVA 4DLUA 5CLLA 2F3RA 3ZS9A 5JHGB 3G0HA 3CQTA 1KSWA 4F38A 4B43A 1G64A 1M8MA 2HJGA 3FFBA 3WP1B 3KQUA 3CRMA 4LBZA 4I1VA 3IHWA 3R7WA 1OE0A 1NN0A 1N5KA 1RRFA 2ZTSA 1V5WA 2F9MA 3TR0A 1F2UB 4AURA 3UIEA 3AKEA 4M4ZA 1AGRA 1JB1A 2L3QA 3K0AB 4BZPA 4IOJA 4CVNA 1ABQA 3BH7A 2XSZA 5E95A 1GCPA 1RE0A 4U02A 2DL8A 3PEUA 3RLFA 2KNBB 2CHGA 2HUPA 2OT3B 2DWOA 5CIWA 5CK4A 1IBRA 1G3RA 2ZPTX 3FHCB 1ZUNB 2IYZA 1N6KA 4B74A 3ZD6A 4C0JA 1NG9A 2ZSAA 2DPXA 2QRZA 1XEXA 1CKAA 2DF6A 4LV6A 2C5LA 4C0AC 2CCGA 2PH1A 2W58A 1LFDB 1W4CA 1L2TA 2CJWA 4AC9A 2IA5A 1AWXA 4G3XA 2FGKA 4QHSA 3A1SA 5JRZA 2IYQA 4URXR 2A37A 1X2KA 1KSGA 1JU5C 4O25A 2PNIA 1RZ3A 2A7QA 3UPUA 1U8ZA 1FTSA 2DR3A 4GOXA 3AKDA 2P3SA 1M8PA 2GK6A 2ZYVX 2VQSA 4P4TA 4FMCB 3NKVA 5EE0A 1E96A 1CRPA 2ZR9A 4YQFA 1MUZA 2GBLA 4HVWA 3LWNA 4FCTA 2KSQA 3THWA 1EFNA 1XXHA 2AWOA 3KUCA 3U3RA 4QHYA 1T0JB 2D1XA 1XB2A 4I99A 4L5BA 1CJKC 2JMCA 1G6OA 1AA9A 1RW4A 2V8OA 3TW4A 3FTQA 2RMKA 3U4QA 5AJXA 3CKLA 3MFYA 2WOJA 1WRBA 2NQ2C 3UG7A 4D82A 3ZIAD 5H8WA 1JQQA 2YWGA 1U9IA 5FL7D 3NPFA 3LLMA 5FOTA 3QKSA 5IXBA 4X8MA 3KXIA 3VS0A 5FPTA 4EFMA 1N2CE 3QPVA 2JGNA 1MV3A 1I0CA 3B60A 4RTUA 4NE2A 4PSAA 3EZ9A 2WSMA 3QJYA 4J9BA 1NIJA 3QVUA 3LY5A 1R0YA 1NY6A 1QBKC 1NM7A 4HZUB 4DB2A 1FMLA 4A2WA 3ADKA 3P26A 3MG9A 4GP7A 4QM6A 1UHFA 3PVQA 2O88A 1IN4A 2ZITA 4GMXA 1PRMC 4TTQA 1DEKA 2YINC 2O0KA 1ZM9A 4AG1C 2B8TA 1G2BA 1XCPA 1GBRA 4I1UA 4OI0A 3REBB 1E2EA 3PENA 4GBQA 1SVSA 1TMKA 3QKUA 4A0HA 2CL6X 4KLNA 2VSXA 3CX8A 3NBXX 4ESRA 2C0IA 4LYJA 1UBCA 5KO2A 4RZ2A 1CR1A 2ZSBA 4QRHA 1DVRA 1FOEB 2IS1A 2REXB 1A5TA 4KSBA 4ZDIA 3AVVA 1G3QA 1NG1A 3EHQA 3S1AB 4Q7MB 2CVFA 4UJ3A 4DDWA 1OXVA 3SNHA 1QZXA 1R5BA 1VKJA 1G6HA 2DM1A 4HDOB 4TYWA 3DKVA 1Y57A 4JLVA 4WIAA 1X27A 1KJZA 4NPHA 3VS2A 1VDZA 4RD3A 1K76A 3WBKA 2JA1A 2CUDA 1IOZA 4Q9HA 2GF0A 1S9DA 2R6GA 1KK1A 3AF0A 5L3SA 2Q3HA 2IYWA 2XSZD 1CU1A 1R2QA 2W0SA 3I4LA 2ZETA 1LB1B 1PUIA 4OMLA 2Q0HA 2M51A 4RTYA 1W7AA 1FMKA 1MOZA 2Q9AA 1Q22A 4P3YA 1OH6A 3ASYA 2GWHA 3VRZA 2N1BA 1QHHB 1QWFA 1SXJC 2CXXA 2ZRJA 1DELA 1SGWA 2EFCB 3ZS8A 1KDTA 1HUQA 2YWEA 3UXMA 1MABA 1Z0FA 4RSGA 3PEYA 3D7MA 1UEIA 4Q47A 4D4JA 1SKQA 2LKDA 1XMVA 4DBLC 5B58C 2Q21A 2QE7A 3UA7A 4HAUA 4EJSC 5C46F 1P9WA 3QPWA 2G0TA 4TYNA 3PFIA 1G7CA 2QMHA 2IUUA 3ZZUA 1ZSGA 1UDLA 2XNSA 1SEMA 1TG0A 4TLCA 2MSEB 2JS2A 2OJ2A 1OFHA 1P72A 2RGNC 5FTJA 3EG3A 5C18A 3H41A 4B75A 5FWCA 2PT5A 2ZREA 3C16C 2Q3MA 5FOVA 4B3BA 1KO8A 1JPJA 4LC1A 4LJ7A 1JBKA 2ZRKA 3TBKA 2RQUA 2CSIA 4J9FA 1VCOA 1E2HA 1NRJB 6Q21A 3RHFA 4AYWA 4PC2A 2RKOA 5JECA 2ZRMA 3RRMA 1NN5A 1QHYA 3BFXA 2NOAA 2Q9CA 1Z83A 4XD7A 3C41J 4A1FA 1ZNWA 1MO6A 2OBLA 4PO1A 4TLAA 2DL3A 2LCSA 2ZRNA 2ZXUA 2V7QD 5ELXA 3F8TA 5IHIA 2KYBA 3BK7A 4HATA 4OYHA 1MABB 4DCSA 4TSFD 3B1ZA 2F7SA 2DNUA 2QGZA 1TU4A 1FQKA 4FD2A 4OMMA 5TB5A 4C0HA 5AUOB 1G5PA 2DYBA 5HTKA 2PEYA 1E0SA 4HUQB 1NKTA 4E09A 2YUOA 3M0RA 2F1HA 4TN1A 2O8DA 2L3SA 4OK3A 4BLRA 1GFIA 4R0KA 1FP6A 1SRMA 3FJ5A 4BFVA 3BFKA 3THYA 3FKSA 1XRJA 2O8BB 3W6NA 4A0FA 2YT6A 5FBWB 1RVDA 1S2MA 4Q02A 1F2UA 2DWPA 2XB4A 1OH7A 1U0HC 1PRLC 3GLHB 1G19A 2EVWX 3GLFB 3R9WA 4RFSA 1GKYA 2J7KA 1E2QA 3K0FB 2WBLC 3REGA 4AKGA 1DAKA 4RD4A 4US1R 2A2ZA 5SZJA 5KHOC 4M9ZA 4QBIA 1T9HA 4L9SA 1G3UA 2ZS7A 2VEDA 1P5ZB 1NN1A 5GADl 1OXXK 3BBPA 2GGRA 4D25A 1FUUA 4BGDA 2L3PA 4CC2A 1RYFA 2SHKA 1N6OA 2K9GA 2EGEA 1XF9A 2PZ1A 2W0MA 3V00A 4M2LA 4E07A 2OEPA 4TL9A 3B7GA 1W4BA 1DADA 1KZ7B 4G0NA 4RCYA 3HJNA 1S3GA 3X1YA 3EPLA 1F48A 4GI7A 3M6AA 4EQ6B 2P6UA 1XCMA 4KI0A 4GSYA 4Z8YA 2ZAMA 4G5SA 2GKSA 1NVWQ 4XH9B 5FR2A 3RWMB 3PEWA 2VF7A 2GZDA 1VHLA 2GTPA 1FTNA 2HJVA 4GRAA 2C0TA 4NKRA 3ZVNA 2C77A 4QC2A 2FPFA 4ZNXA 2BC9A 4YLGA 2RGAA 1WLPB 1UEJA 2OFXA 3IO5A 1GP2A 4BE7B 3PCRB 2CE2X 2JXBA 2ZVPX 4PC6A 3TRFA 3DPUA 5F9FA 3BIFA 4IDHA 1GRNA 2JDIA 3UANA 1DO2A 2WTUA 3K70B 4I1SA 4OJKA 1EFUA 1PLJA 2H18A 2VHCA 4MKHA 4C0BA 1NVVQ 2H57A 1ZM7A 3AF1A 5SZHB 3EA0A 4CGZA 1XTRA 1JR3A 3HP1A 1EESA 3OAAA 2GF9A 5BXQC 1XXHE 4Q4HA 1C1YA 2ZYTX 1F60A 1TQDA 3K53A 5FUYA 1CULC 5LD2C 1X3SA 2MIOA 2ZE5A 2ZS8A 1KK3A 4B3FX 3BWDD 4MKFA 2DMOA 3DDCA 2OFOA 2KRNA 3OF5A 2X2FA 4OKSA 3EG1A 2KRSA 2FPLA 2IHBA 3ONWA 2A36A 4XJXA 4MGKR 1IM2A 2BZYA 3QWYA 3MWKA 1TF5A 1XZQA 1SXJB 1TF2A 1KNXA 2B21A 2VVKA 5ECAA 4GMDA 2JLVA 3I35A 4V0ME 2CK3D 2HF8A 2WM9B 3MRSA 3X1XA 2QGNA 1N6RA 3W3ZB 1ESNA 5LDDC 5FI1B 1WI7A 1X69A 2QP9X 1TUEA 3KZ1E 4IFBA 3WBJA 3B2EA 3CB4A 4QBGB 4B34A 1EWQA 1RFLA 3PV0A 1AZSC 2ZI6A 4C4PA 3FKQA 4JL5A 1E32A 1HEIA 1FL9A 4F17A 3RWOA 4NYJQ 4JIMA 1W5SA 4Z8AA 1GILA 5KDLA 4U7DA 1OHHA 1ZYUA 5KDOA 5JCPA 4V03A 1US8B 4G01B 2DL4A 3MMPA 1LTQA 3U23A 2BKUA 2XTZA 3G82C 2XXAA 5JZVA 4DT1A 3H0IA 4UNNA 1S4QA 2CE7A 1VG1A 2ZI7A 1VCNA 4A0RA 3CNNA 1XTSA 5JSZA 5K8UA 4RY2A 621PA 2JLWA 3DZ8A 4AFUC 1OFTA 3IILA 5GJBA 2D62A 4JJBA 3UMRA 1AGPA 3AKYA 5JEDA 5JMTA 5EQTA 3EZ2A 4M9QA 1CS4C 2FEIA 2AD5A 1PJRA 4O2RA 5FPHA 3JZMA 1OPXA 2KROA 4XWOA 1YNZA 2X3WD 3LW7A 2BEJA 3AV0B 5FBLB 3CX6A 3M0EA 3VQTA 2QPTA 4RTWA 2ZRDA 3TUIC 2GDJA 1HE8B 2RGGA 2BV3A 2A5YB 2OBNA 1YJ5A 1QG4A 2EYWA 1DAFA 4B35A 2LZ6B 3EXAA 2GEUA 3SEAA 1KI4A 2QM7A 2XZLA 1QDEA 3QWXX 2O8FA 4LV5B 4BRUA 1KHTA 2ZJYA 3GJ6A 5TXGA 5BN5A 3SE0A 1A1VA 2LQNA 1G17A 1Y63A 1YN8A 4J9EA 2QPAA 1COWA 3QKRA 4DUGA 1ZBJA 1XPRA 1KMHA 4B71A 3GMTA 1I07A 1IXZA 3AVTA 4GBMA 1AS0A 1M7GA 1ZRHA 5HE9A 4B47A 3R9XA 1N6IA 2JLQA 3K0CC 1Q1EA 2PTKA 4EKDA 3B6EA 2GK7A 2IIMA 4Y0AA 1W4RA 1ZVQA 1S0UA 2CK3A 5HKKD 4ZKDA 4GOJA 1XEFA 4EPVA 3CPHA 2MMGA 2CSQA 3NHBA 1T8UA 4FINA 3AKCA 2J7PA 2ZJBA 1D2MA 3SHFA 1P73A 1W0JD 4TMWA 1E9EA 3RS2A 3SYNA 3TQCA 3DOEA 2FE4A 1ZNXA 2JJ8A 2VP0A 4QNRA 4UKDA 2O8EB 3KFVA 1U90A 4NONA 1WCV1 3FHOA 1Q1QA 1U0LA 3H1TA 3A8TA 1SVOA 5EXPA 4Z8XA 3RS5A 3WHKA 2FNAA 4TLBA 1CBUA 4LX0A 1B07A 1QCFA 1XTJA 1XTIA 4JLDA 3TUJC 2IUTA 4A4DA 3ZQJA 2DBYA 5FTNA 1QF9A 2RGDA 2P67A 1BS1A 4HB2A 5J4YA 1Z22A 2IS2A 3VS4A 5AJZA 3PUXA 1D9ZA 3LDAA 1ZLMA 4Q01A 4RKFA 2BZ8A 2QAGC 1NBME 4CT4B 2CHVA 2BHRA 3I9QA 3THYB 1U8YA 3CZPA 2VHQA 4PZLA 5BN4A 2QTFA 3CW2A 3RC3A 3MWLA 2X2EA 2X3XD 3GJ8A 3HU3A 3ZQ6A 5KNBA 4D26A 4LHYA 1EX6A 3QEJA 1SQ5A 3B1WA 1ZIOA 2RAPA 3B9QA 1HA3A 2GETA 2ORVA 3I8SA 1WMSA 4HI0E 1T8TA 4DWJA 5JJKA 1O87A 1NEGA 3WYGA 3U7FB 2O8CB 4HSEA 3K09C 5AUPB 4QG7A 1TPZA 1W5TA 1M2OB 3WNBA 2WWXA 3TE6A 2FWRA 1P75A 1II8A 4W9MC 4ZI3A 3EG5A 4JLMA 3A37A 4NCKA 1ZUIA 1Z0IA 1Q1BA 1H8ED 3DEFA 3B13B 3MWYW 2ANBA 2J6KA 4L8GA 4EPRA 1EFTA 4KFRA 1NJFA 3EG0A 1TADA 4HYYA 3U3KA 1VYTA 1E2DA 1DAHA 1ZNZA 2RHDA 4PFSA 4TMVA 1IN5A 2I1QA 4KAXA 1VHTA 2QMUA 5JHHB 1OV4A 3GP8A 1OEBA 2VSFA 3H0FA 2PLFA 2WOOA 3ECCA 1SHKA 3KXLA 4Q4HB 4IXNA 3GFTA 5CK5A 4A2PA 5EE3A 2J0SA 4YDHB 3OHMA 4Q18A 3AP2A 3QPUA 5GVRA 2V1QA 1G18A 1I4LD 3HDTA 3CH5A 3C14C 1W70A 4KHZA 4C9BA 5L3SB 3KJGA 1D6JA 2G9NA 1ONBA 4P32A 5EP2A 4CEHA 1BU1A 1H3HA 1KSFX 1ZAKA 2HLDD 2QP3A 1E6GA 1FNNA 3AVWA 4PO9A 3J81k 4KCGA 3RS4A 2R6CA 3MAAC 2W10A 3B1XA 2ZRIA 2OCYC 3NWJA 2HBWA 4HDQB 4FIDA 4J0QA 3C0CA 4I1OA 1BH2A 1WXUA 4JYBA 3C15C 4L4UA 1GNQA 3LQRA 3EAQA 4KBGA 1OT3A 2BBSA 4XSHA 4ORZA 3BH6A 3BRWD 1E9CA 4N0EA 3WNDA 2LKCA 1UKEA 2ZSDA 2A28A 3BOSA 1ZD1A 5HKKA 2QDLA 1IAQA 2YV5A 2FGJA 2AKLA 4IDQA 3VAAA 8OHMA 1K4US 1GL5A 3BJIC 1ODFA 1ZINA 3NVAA 1UDWA 1P4SA 3B8HA 1LV7A 1KDPA 4DEYA 1Q1ZA 4ZIRB 1KI9A 3QKTA 4GNKA 4IJMA 4OHXA 4PHGA 1K5GA 4HXJA 1JR3E 3QXXA 4UNQA 2ZJZA 4F16A 2KE9A 1XDBA 1QRAA 2FF7A 2J0QA 1Z3IX 2IL1A 5KPDA 2K5UA 3SZRA 3PUYA 4RFVA 2J1LA 2O2OA 2IT1A 1SVMA 2ZU0C 1KI1A 3IQXA 4JLKA 3W5JA 1SVWA 3KKQA 1GZSA 2ERYA 4E22A 1MT0A 2E9SA 1NMXA 2V9PA 3HYRA 2J0VA 1OIXA 5EP4A 5L3QB 2QAJA 4M1KA 3RS3A 3JV3A 3MWJA 1XEXB 5FUWA 1WA7A 4OI4A 4PR0A 2OM2A 1MO5A 1CR4A 4DT1B 4LHVA 4PPGA 4IKEA 4D0GA 3KUDA 4CEHB 4ILEA 2YC2C 3DVLA 4P4UA 2V6JA 4RCZA 2QY9A 4C2TA 2W6IA 2YOHA 2IXFA 3TIFA 2DCUA 2L0AA 4EPWA 5JS8A 3FYHA 4BZQA 3ZZ0A 4A15A 3UMFA 3D8BA 4Q4JB 5AWFC 3U3OA 3C5HA 1HE1C 2V6IA 3MSXA 1AVZC 3IUYA 1YU9A 5CB8A 1RIFA 3RRNA 4KODA 2HCKA 1DOAA 3CZQA 2Z0MA 1MV5A 1CLUA 1YWOA 1G41A 3AUYA 5FI0B 2GILA 2PJRA 1IN7A 1FQJA 2DLPA 1D2NA 4MKGA 3EC2A 1JO8A 5FH9A 5DYIA 2GQIA 4C7OB 1PWTA 2DL5A 4PHTA 4TMTA 1DO0A 1E2IA 2QORA 3IPXA 2VPPA 4KLZA 5JRJA 1BO6A 4JBXA 2EFEB 4JSTA 2YSQA 2AR7A 1Z9QA 1G291 4NU0A 4QJ4A 4DCNA 1GRIA 5KTYA 4V02A 2W2VA 2EFGA 3C4JA 4YMSA 1VECA 5C1BA 4OQXA 5FUVA 1EFRD 2E1RA 4BFTA 1W2HA 2R8RA 3ZJYA 1EG7A 1RRPA 1NF3A 4G5GA 1NYFA 3SN6A 3NHNA 1UJ2A 3KL4A 2DRKA 1WB9A 3CWZA 2R9VA 2CL0X 3L82B 4TYYA 1E2NA 1X8JA 3SJAA 3GJ0A 4II7A 4D0LB 3K8YA 5L3QA 4C7OA 3OAAD 4ASUD 1T0HB 3RSOA 4KFUA 4XSGA 5JEEA 5J40A 4GZMA 4HZUA 1UKZA 2WSSD 3T34A 2IYSA 5ANRB 3UWOA 1H8EA 1DAEA 1X1RA 3E1SA 3K09A 1WIEA 4QHTA 1AKYA 3T15A 3W5IA 2IWHA 3T1VA 1KOFA 2CDNA 2QZ4A 4DCVA 1QKXA 1SRLA 3LH5A 3QG5A 3O47A 1W6XA 1FZQA 2ZSFA 1PKTA 5KSYA 1N0UA 4EPYA 1F2TA 2IC5A 3F3YA 3VKGA 3IEVA 2A30A 3GLFE 2G0NA 3KTAB 3SYLA 2OZEA 2IYVA 4OMNA 2W2XA 1UJ0A 5DLQC 2ABLA 1GWNA 2EYZA 1II9A 1KFZA 2QPOA 3BB1A 1YVDA 2YOFA 1L7VC 3B1VA 1GKUB 2WSSA 3Q72A 1H8HD 4MUBA 5D3MB 3U3MA 2O8CA 4OHZA 2ZR7A 2ZYUX 1AOJA 4PX9A 3P4YA 4AIIA 221PA 2IYTA 3LV8A 4PO8A 4BFXA 2R2AA 4F91B 1CRQA 1WBDA 2DJQA 1S1MA 1SHFA 3QVVA 4JVSB 1W2GA 4AG2C 2ZI5A 2YKGA 2W6JA 3WYFA 2C99A 5J4KA 3RAPR 2NUZA 2ECZA 4M21A 4F4IA 3WXMA 3FWYA 2PMDA 1E2KA 2IW3A 1OIVA 2VHTA 2WKPA 1BK2A 3K9GA 5M04A 1A7JA 1DPFA 2CH4W 1CF4A 3SYKA 2PEZA 1OJLA 3OE7D 2J7PD 1VYVA 2R6FA 2RHMA 2ZJAA 5HZKA 3RC8A 3WP0A 3A1TA 4NCHA 4S2EA 5FOSA 4PHFA 5B2ZA 2C95A 1E9SA 3B5JA 2A9KA 4FMDB 5KUTA 3D31A 4IOKA 5KNCA 3OZXA 1NY5A 2AWNA 2YJTD 4MYUA 3U44A 3BXZA 2C98A 5JS7A 5LPNA 2GAAA 3OESA 3UWKA 1C9KA 1W1WA 3TAHA 3B78A 3CM0A 5JI3E 1N25A 1QHIA 4CC3A 2WMNB 1ZP6A 1B23P 1NVVR 3GLIA 3HU1A 4Q1AA 2C8VA 4OL0A 1MRSA 2ED0A 3H2YA 2VF8A 3AH8A 4LCBA 2WZQA 1H8KA 3FMPB 5IHPA 1B0UA 1OSNA 1M1YE 2ODEA 2RPNA 4KYUA 1E69A 4XWAA 4WXPA 2C0OA 4IEEA 4IOMA 3EX7C 4PZYA 1N5LA 1YZNA 4Q7JB 3FGNA 3VR1A 2RQVA 1FW6A 3QXJA 2R6DA 3QUSA 4HAWA 4DLSA 1T3LA 3Q7PA 2WWHA 4JMPA 1X6VA 4L9WA 4OQNA 4IFEA 2REOA 2PL3A 3E70C 5KSZA 2JLRA 2NZJA 4Q4AB 2C04A 2W83A 2JAQA 1OB5A 2RQWA 2J59A 2DB3A 1E0AA 1W44A 3IEUA 3KB2A 2VYFA 1GITA 4QXAA 4YMTA 3I5SA 4OMOA 1JPNA 4OHYA 3BFVA 4JLNA 1CEEA 2XITA 3ASZA 3AVOA 2F9LA 3GFPA 3IBGA 1TEVA 1TQ4A 2ZS9A 5D3QA 3TR5A 4RFSB 4PZZA 1PV4A 2HCJB 3R20A 4AWXA 1YR6A 4GP6A 5J4VA 1YRBA 1OHHD 3QF4B 4TL7A 4DEXA 2V3CC 3NHAA 1GL6A 4CF7A 2P6RA 1VIAA 3EC1A 4MRSA 4M1WA 4NYIR 3EPHA 4B2IA 4DDTA 1KI6A 1U81A 2LQWA 4KVAA 4QOSA 1Q21A 2QE7D 1LS1A 2D8JA 5DYGA 4DC9A 4JVMA 4DLTA 4ZCIA 2BCGY 3BC1A 1UHCA 3IDQA 4O0MA 2RQTA 2CL7X 2D2FA 2PZFA 5FL3A 2QBYB 1W49A 5SZIA 1E2PA 1P2UA 2QP4A 2QU8A 2GBLC 1VPLA 1N6PA 1UKVY 2NPFA 1HD3A 1ZD9A 4A8JC 1RI9A 5FBRB 4A36A 1JALA 2RNAA 1GRQA 3GEEA 3QF4A 4EDHA 3ADDA 3IO3A 3RYTC 2JJ1A 3N5CA 2BIFA 4J9DA 2XAUA 3B82A 3ZVLA 1G3IA 2BM1A 3W8RA 2KRMA 3U6BA 2XX3A 2ZJ8A 2AN9A 2J41A 3OE7A 1P9NA 2OHFA 1M74A 2LP5A 2WMOB 1HURA 1XJ0A 4MGYR 1YR9A 3BD9A 3CUEF 2LWIA 1HYQA 2BBOA 1EFCA 5EZ5A 3I5XA 1ZUKA 5A4JA 3A1WA 4HUQA 3C5CA 2IYXA 3P27A 2DFNA 1P6XA 2HXSA 4DIEA 3NDPA 1TUDA 1KI6B 5E3HA 1QLYA 4IIMA 1GVNB 2QT0A 1QVRA 2NWMA 1FPMA 4BFZA 5AUQA 4M9XA 4IW3B 4UNSA 5DIFA 4ZDWA 3O5ZA 1H8HA 3LX8A 3P1JA 2YUNA 4F7WA 1JR6A 1RUWA 3BAFA 1NLYA 4YDSA 2JLXA 1NMZA 2IYLD 2WAYA 1U5SA 3DZDA 5H1YA 4G1UC 2RGBA 1OYWA 5FL7A 4LJ9A 4Z1MD 1U8AA 5JBQA 4URYR 4RUGA 3VHLB 5B30A 1SVKA 4XTCS 5G3YA 1QVAA 4M53A 2VRWA 3AP1A 4B3GA 1ZMXA 1AWOA 1XMSA 4Y0VA 3WRYC 2BTTA 2CT4A 2O8EA 421PA 1FUKA 4OQMA 2GCOB 4RTZA 2QAGB 3I1FA 1GSIA 2AFIE 2SRCA 4JPBW 1CR0A 1N0WA 5GJWC 4ZCMA 1EFHA 3RVBA 3E2IA 4U00A 4NCIA 4ASUA 1UJYA 5HCKA 1CSKA 1X6BA 4V0NA 2FOLA 1NLFA 1R0ZA 2XOKA 3DOFA 3A36A 2WIBA 1UGVA 1KKMA 1TNDA 2VP5A 1W0KD 2F2VA 1K6MA 3IKJA 5EP1A 4EJSB 1W0JA 2GCPA 3VKWA 2ZUCA 4JL6A 1JEGA 2ECKA 4U5XA 1UPTA 1EFRA 3FE2A 4URZR 1NVUQ 3NBFA 2YUQA 5G41A 2ZRCA 4ON9A 2DBMA 4MRRA 1BBZA 5TV2A 1BIFA 1OPLA 4LJYA 2CNWD 2XNDA 4RKEA 3DL0A 1NLPC 4PC3A 1NMYA 2CUBA 2I1VB 5A5GA 1FMJA 1AS3A 1Q3HA 3JVUA 1PNJA 3CBQA 1W46A 4XD7D 1JNYA 4DZZA 2JS0A 4A0GA 1KO4A 2GBQA 1UKYA 4HAYA 2BBWA 2ZI3A 2X19A 1ESMA 1N6HA 2UKDA 2K7AA 3CH4B 4UNPA 1S96A 3SR0A 2JMAA 2DVJA 4JZ3A 1LNZA 2CCJA 1T0HA 2QENA 3CR7A 1KYIA 3EZ6A 2JM9A 1E9AA 2CMKA 1XU4A 5UKDA 4O2LA 3T1OA 3K0SA 1NNEA 1HH4A 4HVUA 2VBCA 2ZIAA 1KAGA 1KI3A 4H1UA 4PHHA 3VTKA 1ZUUA 1IXSB 3K0EA 1G20E 5KSPA 5CLQA 1OPKA 4OI2A 1OH8A 1ZX6A 2P6NA 3SQXA 4OHVA 3KQNA 1G1MA 2DWQA 2VLIA 4LZZA 2J7IA 4WZBE 1WDXA 3TSOA 1FYNA 1UBEA 1NL3A 3VNVA 3FFAA 1Z6TA 2LJ1A 1FP7A 2GJ8A 3CRW1 2WJVA 3QKSB 4YMUA 3LBHA 2A78A 3GJ5A 2IUSA 2ZRFA 4DLRA 2WVJA 2B8WA 4HAZA 2GCNA 4J9CA 2G6FX 3VX3A 1UF9A 2JW4A 3UF4A 2GTOA 1HT1E 2PCJA 3PVSA 5TMPA 1ZM4A 2G1KA 4BECA 1KO7A 2CNWA 1AD5A 2VA8A 1QHSA 1U2RA 1G4AE 2K6DA 2J0UB 2NIPA 2WV9A 3PIRA 5AJVB 3O8RA 4LUCA 3PJRA 1ZC4A 1KKLA 2X77A 2ZI9A 4KSCA 2FFBA 3K9NA 4IXMA 4Q1EA 4IDOA 1A4RA 3DMNA 1XD2B 4Z88A 4FN5A 2IX3A 5FOWA 2FU5C 4IEIA 5CYOA 3RRYA 4CYMA 5AJWA 3KXKA 2D0NA 2C9CA 4ABYA 1NP6A 4QJ5A 2FPMA 2QL6A 2F1IA 2W2TA 3EWAA 2I3BA 1C4OA 3KB1A 1PHTA 1N5ZA 1W0KA 2GXSA 4K81B 3TUZC 3HYTA 2RB4A 2YUPA 2TMKA 2YOGA 3IIMA 4XIGS 2JEOA 1E7OA 4EIKA 2N42A 4TLDA 3U6KA 1ZW6A 3O8CA 3THXB 4B44A 1D2EA 1LF0A 3Q3JB 4B6EA 4PXAA 4B6FA 1HSQA 1GIAA 4PTLA 4BASA 2YWFA 2EKHA 4JZKA 4DSUA 2J3EA 4QKQA 2CJWB 1K1ZA 4QBFA 5H70A 3TQFA 4EQ6A 4Q5IA 2C78A 1PLLA 3P4XA 3AF4A 3C8UA 1G5RA 3WHLA 4XTRA 3TGPA 5DI9A 3OEED 3NGPA 1NLOC 3SHWA 2GJ9A 1ZJ6A 4J9GA 5BN3A 3AF2A 1UECA 4MH0R 1D8TA 4M8NE 2V1UA 4QFMA 2VHJA 5GJVB 1ZIPA 3VS5A 3EA5A 3GQBA 4Q9IA 2LMJA 2PLRA 4Q00A 4CEIB 1CJTC 1YHNA 2Z6VA 4FMDF 2BWJA 3L43A 1A0NB 2YC4C 1N6LA 2ZU6A 5EXTA 2EYQA 5FWBA 1E0JA 1OIWA 4W5WA 4D0NA 3BORA 1X6GA 4OHWA 4RD1A 3T12A 3OIVA 2VHUA 5GVSA 1IJEA 1XJCA 4ZPXA 3M1IA 1CJUC 2G88A 4F93B 3LNCA 4QT7A 2ZRLA 1PZNA 1SKYB 1KSHA 3BE4A 4OK6A 4BWYA 1RKBA 2CT3A 4LN2A 1G21E 2LCFA 3L2OB 4D80A 2GEDA 3MGCA 1YZTA 1EXMA 5IRCD 2FG0A 1ARKA 2WPDA 4B2LA 2F6RA 4NYJR 1S1CA 1G7SA 1WF3A 4UNRA 1XD2A 4LOAA 3R9IA 1G9XA 4PQFA 1I4TD 1QHHA 3NC0C 1W4AA 3UG6A 1KY3A 4LBYA 2FN4A 4F92B 3H84A 3L0SA 3Q85A 1GTVA 2HT6A 3QG1A 2ORIA 1XTKA 3M0TA 4AY2A 3LBIA 4KU4A 3ZH9B 4PAQA 2IEYA 4KV9A 4DLXA 1R4AA 1G8HA 1T91A 1Z6XA 3CPEA 3U7GA 3HR7A 3AVUA 5FPKA 3Q5DA 4EPXA 5B64A 3ICEA 1LF5A 5FR1A 3NH9A 3LRPA 4S35A 1FX0B 3CF2A 3SJCA 5EE9A 1A82A 3TJZA 2FO0A 2DY1A 5F9HA 2ZROA 1E9DA 2PMKA 4LK2A 2D7CA 1KIKA 3T1QA 4JYCA 2AKYA 1KTVA 2YHSA 5JJLA 2AXNA 1JXMA 5LB2A 1VCMA 1COWD 2RCNA 1KIMA 3GLHA 3A1UA 3SU8A 4DUGD 3VHXA 3SEMA 1M7HA 1UDXA 5AUNB 2ZI4A 1J8MF 2E87A 4EFNA 4Q1DA 5EUMA 3ADCA 1P3JA 2F43A 1E1RA 4BLPA 1RLPC 2J06A 3H0HA 2ZANA 4Q7KA 1KK2A 3OEEA 2F43B 3NEYA 4Q4LA 5FBQB 4JLAA 2KGTA 1FNMA 4GZLA 1AS2A 4LJ4A 3GJ7A 1SVLA 5EZ6B 4QM7A 3ZL7C 3T5DA 5CM8B 4LC0A 1WDTA 3VR6A 4CT5A 2CLDX 2AXPA 1KK0A 5J47A 2WICA 1G16A 4DDUA 4J9HA 1X2QA 3L0PA 3QQ5A 4LJ6A 4DHEA 3R6NA 4CEJB 4M22A 2KWIA 4TLEA 3TNFA 4AKIA 3HPQA 2CH4A 4JKYA 1ZM3A 4M1SA 5IH2A 5IK2D 1TL7C 4MRPA 2M0YA 1M6NA 3OFNA 5CB6A 4LWZA 1JJVA 2DL7A 2HDNB 3U4QB 3I92A 4ESHA 1OOTA 2NO7A 5L3RA 4RJLA 1Z07A 2ZE8A 5EE1A 2ODWA 4TT3D 3N2IA 5P21A 4FI3C 1N6NA 1M3CA 2BCJQ 2GXQA 2RGXA 1E2FA 3NEJA 5FPSA 4YXWD 5EXXA 4DVGA 1AKEA 4QGFA 3NH6A 3RS0A 1UFFA 3GEHA 2B92A 4N1AA 1E99A 1TQ6A 4E5UA 2EFHB 2WWYA 4KVGA 2F1RA 4C3ZA 1RYHA 1XEWX 3EZFA 1YRAA 2EGCA 1E1QD 1T4GA 3GJXC 2NMVA 4A63B 1E0KA 4LI0A 4NYMR 4X8OA 2FSHA 3CF0A 1H65A 1VG8A 1Z08A 2MMCA 4M1TA 4JKIA 2OO7A 3DO6A 2HV8A 4TQUS 1JI0A 2X8AA 1GNPA 1P7CA 2QI9C 2O9SA 2ZE6A 4KFSA 3IQWA 2OESA 5JFGA 3K9HA 3QOFA 2ZM5A 4MDEA 3FMFA 1MRNA 1Z0KA 2IF2A 1WYXA 1E6HA 3LLUA 4LHZA 3L0IB 3K0AA 1KAOA 1J70A 1R6BX 1JR3D 1ZD8A 4GDFA 1E3MA 5DNYB 2WIAA 4Q4JA 2HDAA 1BB9A 4M4SA 3TW8B 4D8KA 5BYKA 2OV2A 1HJDA 2FPEA 4JJKA 3VU9A 1LY1A 1NVXQ 4YONB 4V0LA 4FWTA 1JJ7A 2OLKA 1OV3A 3THKA 2XZOA 2XTNA 2QQEA 4A8JA 4OMPA 5DN6D 3EW9A 3EG2A 2GVZC 2FZLA 3FMIA 3ZIAA 4NYMQ 2UZ3A 4Q4AA 1NG2A 5CDFA 2OXCA 4Q19A 2HYIC 4QGGA 2ENMA 4LHWA 1E2MA 2FFHA 4RTTA 4GOKA 4M1YA 2EYXA 2O31A 2ROTA 1R5OA 2EW1A 2OCPA 1IN8A 1T5LA 2DYKA 4HEJA 4QGAA 4C0LA 5J5CA 3U3JA 2C03A 3OEHD 3HR8A 4DLZA 1OFIA 1IJFA 4FMBB 3X1DA 2CEAA 4BUJA 1OW3B 1EX7A 2C9OA 2FEOA 2ZRPA 1NSTA 3P20A 4KITB 2O8BA 2EWVA 4TMKA 2OAWA 1GFDA 4ARZA 2ZRGA 4JZ4A 4MGIR 1Q20A 3JZAA 1XWIA 4PC1A 3VR3A 3GLGB 2WWWA 5FBVB 1MKYA 1F2TB 3GJ4A 3GLFA 2AD1A 2WJYA 3U2QA 4US2R 4B32A 521PA 1Q3TA 4BLTA 1K9AA 1WA5A 1HQYE 3OIUA 1LW7A 4BPBA 2E5KA 3KKMA 1AK2A 1D5CA 3QKRB 1U0JA 4XOIA 2ATXA 1GBQA 2D7DA 5FTMA 2F3TA 3KQKA 3LD9A 4UXJA 2PT7A 4IIOA 4PSVA 4DXAA 2P5TB 2WJHA 3ZLJA 5FTLA 2O8DB 4D8DA 1YZGA 1R0WA 3HWSA 4QBHA 1T5IA 1UADA 4B76A 5GJWB 1XCGB 2HF9A 2BMEA 3M0QA 2OUKA 1TAGA 3EASA 2P65A 4TMZA 4RTVA 5TY0A 3W8NA 1J90A 3OEHA 1R8QA 3I73A 4C30A 4GPTA 2DA9A 2H7VA 3EIEA 4OQLA 2GZHA 4P4SA 4A2QA 5C4MA 3T1TA 3AP3A 3FDIA 4LV8B 4MITA 2GAOA 4PPNA 3KJEA 4GLMA 2KEAA 1YE8A 2OFWA 4WZ6A 3VMFA 1V43A 1E4YA 3TLXA 2DFLA 3CR8A 2FSGA 3AB3A 1I1JA 3BS4A 3O8BA 4MKIA 5DGXA 5F2EA 3RANA 5DN6A 1ELOA 3A1VA 3I62A 3UK6A 3DKPA 1EK0A 3KDSE 2FA9A 3QY0A 3CIOA 1R8SA 2WKQA 4ARZB 1V1CA 1KGDA 2NTYC 4RD0A 4V0MA 1O3YA 4Y92A 3MLEA 2O0HA 3CNOA 2EU8A 2J87A 2GVDC 2AK5A 5L3VA 1M3AA 4OJQA 2J5XA 5G3ZA 1XNJA 3WYAA 3VFDA 3FOZA 3BB4A 5CYPA 3FVQA 4TZ0A 2DFKB 3GLIE 2REBA 2HEIA 5I11A 2Q6TA 4IHQA 3X2SA 3IIKA 1SXJD 2FRWA 4Q1FA 3H4MA 3PVLA 4XVRA 2O9VA 4AYXA 2JCSA 2GNOA 5JWHA 1CJVC 1PLKA 3ZDQA 2L2PA 4DLWA 1G8PA 2ORWA 1NBMD 3ND8A 4LGMA 4DSNA 2A5JA 5FOUA 4IVQA 2MOXA 3CRVA 4FWIB 2Q3FA 5CDFE 2IXEA 1HY3A 2KR3A 2BDTA 2RH5A 4EFLA 1X8KA 3SJBA 2WJGA 5EUQB 1YR7A 2B86A 1LCKA 1IQPA 4AKEA 3TKLA 1EWRA 3LAWA 3SS8A 1JECA 1F5NA 1W1FA 4URUR 1OXUA 5BQ5A 1M34E 1E1QA 3LVRE 2OCBA 1X43A 2EYUA 821PA 2D74A 2ZR0A 1KDOA 1JXOA 4R98A 2OAQ1 2NO9A 3EPKA 1CJMA 3ICQB 1AN0A 4UXIA 2KXDA 1NJGA 3A4LA 3LA6A 1L4UA 2Z4RA 4CRWB 3QENA 3CX7A 1GCQC 1HV8A 2BMJA 3EGUA 4AYTA 1Q44A 4Q66C 1XJQA 3NG1A 5KOYA 2ROLA 5JLJA 2NPIA 3N2EA 1T3HA 1Z6YA 3GFOA 1U06A 3HPRA 1E6CA 5JWRA 3KQHA 2JLZA 2XMFA 1ZCBA 1PKSA 2WJIA 2GCOA 3W6PA 2DRMA 2D06A 5B57C 5G53C 1N5JA 2JLYA 4QL3A 2ZEJA 2JASA 1D9XA 3ND9A 2CLCX 3ULRB 3C7KA 3WNCA 1P62B 1S9HA 4TQAA 5CM9C 4B3CA 2WKRA 2CREA 2F2WA 2QA5A 2XJ9A 4LYAA 5FTKA 1G7RA 3LBNA 4I81A 4BEJA 3FMOB 3LFUA 3AVPA 4Q9KA 2QMEA 3A4NA 2QRNA 5L23A 4WBSA 1AWWA 2PJZA 4ZKEA 5BW8A 3AF3A 4LUDA 3CPJB 1SXJA 2VP6A 3K70C 2QTHA 3B9PA 3IQLA 2EW3A 1QG2A 4K8OA 3L0OA 4A82A 4XWKA 1II0A 4UQOA 2BEKA 5IXFA 3AGPA 2XTMA 5FW9A 4D2IA 2EPDA 1I4DD 1MO4A 2IHYA 2Y8EA 1S1NA 1KMQA 4ZDJA 4WAUA 1SHGA 2RMOA 4PAOA 4B2PA 2FPDA 1E9FA 2VIIA 2LJ3A 4FCVA 1N0VC 1Z47A 4E03A 2JM8A 2QMOA 4HDCA 3SJZA 3KKPA 4BLSA 1SHZA 2GESA 4NYIQ 3B85A 4HLUC 3A4MA 3WRXC 2OLJA 4C0SA 2QSZA 2G77B 2RF0A 2IF0A 4PANA 1J7KA 4TTPA 2IWRA 5TVKA 1RC8A 4EAQA 4JJDA 1YWPA 1U3OA 4WOPA 2V1XA 2AZSA 3PUZA 4EUNA 4CZ2A 3K9LA 4HLCA 4BFUA 4LNPA 3CNLA 4W7SA 1KSJA 3EHRA 1I2MA 3EARA 2J46A 5JI2E 5KYKA 2NO0A 1GG2A 3PUVA 4DKXA 4R71A 2Z83A 3QEOA 1WXQA 2BZXA 3LO5A 2I0NA 5EC7A 1U99A 3NIBA 2FG5A 2YDLA 3LVQE 3U5ZB 4I4LA 4PSKA 4Q7LA 1DARA 1IY0A 2A5FA 4NDZA 2PZEA 1UBGA 4NHOA 4P0TA 4AD8A 1A2BA 4NTZA 3VR2A 4LJ5A 3KKOA 4DDVA 1X8LA 1R10A 2XB2A 2K79A 3H0KA 1YCSB 1G3MA 5CJ2A 3GD7A 2GJAA 5KDDA 4KO8A 1L8QA 1Z2CA 2HSPA 1AM4D 2IYYA 2WWFA 3MD0A 2VP4A 3L8ZA 4W5JA 3SC3A 3SQWA 1AQUA 3KQLA 4LY6A 1GFCA 1NSFA 3CWQA 4G5QA 1AEYA 4N0DA 4CIDA 1QKWA 1MV0B 2W0ZA 121PA 1OXSC 2RGEA 5TDHA 2EFDB 2FSIA 2KBEA 3CF6R 1T0JA 3ETLA 3F5FA 1M7BA 4L16A 4YC7A 3TMKA 1RLQC 4JS0A 1IONA 4JLOA 2J0UA 2R6AA 1AQYA 1W48A 4OK5A 4CW7A 3A6PC 3EWSA 5HR5A 3V4FA 2F55A 4CC4B 2O0JA 3UMSA 2OBMA 3WY9A 3N70A 1E2GA 4D4MA 3K1JA 1HT2E 4R2IA 4GL2A 4G5OA 1WFWA 4ZO4A 3QSYA 4RTXA 721PA 3IHLA 1SXJE 1BMFA 4FSSA 1KO5A 3QXSA 2FEMA 3NTUA 3DM5A 1OH5A 1HQCA 2QQ0A 4C2UA 1E79A 1WE2A 1MH1A 5F3WB 2KYMA 1P61B 5D3MA 1AWJA 4JSYA 5CITA 4H1VA 2JIZA 2EBPA 3E5HA 3QI2A 5E7MA 1K0SA 1VA7A 3CONA 2PCLA 2HEQA 2WWIA 3VS6A 4EIWA 3BERA 1US8A 2XJ4A 4MQBA 1VIYA 4RZ3A 4V0OA 4B33A 1UAAA 4POAA 1P2TA 4D4LA 1JQJC 2ZRAA 1OXTA 2ZAOA 2VL7A 1E9RA 2X1VA 2W00A 5LB4A 2Z4SA 4WA7A 5DE3A 3TK1A 1P60A 2GZAA 4TL6A 1G83A 4DSTA 1L4YA 1DG1G 1JAIA 2CHQA 1YZUA 4Z51A 4KYIB 2VTKA 1G4UR 5DSZA 2AFHE 1UE9A 2QNRA 2V55B 3FB4A 4NBSA 4WXRA 3G5UA 4B3DA 1H92A 3OIYA 1TEXA 2FSFA 2F1JA 2NGRA 4R9UC 5E7IA 3I5YA 3ZD7A 1QHNA 1KJWA 1Q0UA 2BMFA 2JJ2A 2GXAA 2F2XA 4Q9JA 1S3SA 4R2HA 2QG6A 3PEVA 4X8HA 3JVVA 4PC7A 1G5TA 1Y0MA 2DE0X 5KNDA 2EVRA 3K0CA 4RD6A 5DHAA 1KDRA 2YZ2A 1XPUA 4TT3A 2H5EA 3K0FA 1YZQA 2JTEA 1QHGA 5DO9A 1IXRC 1GOTA 2P2LA 1VMAA 4MA4A 3CO5A 1WP9A 4A9AA 5FUXA 2KXCA 1RJ9B 2WHXA 5DH9A 2OSBA 2ONJA 1JEDA 5BWMA 4XVQA 4K11A 5FFMA 3OFND 2LJ0A 3PR1A 1Z8FA 3NBYC 2O5VA 1TX4B 2W6ID 2FZ4A 1G8GA 4A8JB 4B3XA 2GNCA 2YVUA 1AZGB 4ZDKA 4KFTA 4OQFA 1XMJA 3QIAA 4AK9A 3KX2A 2H8HA 1OLOA 1E79D 1NEBA 1GL7A 1K8RA 2ZE7A 3KTAA 2PBRA 1ABOA 2V54A 4TWZA 2OI3A 2ZJ2A 2WJJA 3W9YA 1Z28A 1DAMA 1U94A 2CVHA 3RNJA 1AZEA 5HCIA 3NDBB 2OXRA 2A3RA 1KMHB 5AJYA 1WXBA 1IY2A 3U61B 5IDVA 3AGQA 4BLQA 2AKKA 4ERNA 2SEMA 3AVQA 3LW8A 4V0KA 4Z54A 1E1RD 4OBEA 5I22A 1GRRA 3PITA 4M9SA 3QNUA 2VH5R 4JT4A 4JVNA 4Q48A 4HLUA 4JVLA 3VNUA 3ZVRA 5JJIA 3MJHA 1Z0AA 3THXA 3VX4A 4MYCA 3EIHA 4RD2A 1TUCA 1XOVA 2N46A 5K8LA 4A6PA 3GPLA 4R7ZA 3X1ZA 1CP2A 4ZCLA 4ACBA 4HB4A 1FX0A 3T61A 2FMXA 2XNDD 3W3AA 2XZPA 5EP3A 2QAGA 1VG9B 4Q21A 3ZVMA 3VS1A 4DLYA 3S1AA 3Q9LA 5E7JA 3GLIB 2ZYWX 4LE9A 3X1WA 5TARA 3GJ3A 1MR3F 4MDFA 1E2LA 3THOA 3TSZA 4HLQB 1Z06A 5L8VA 1KNQA 4NMMA 5KPJA 1B3QA 2AZVA 2RQRA 1UM8A 2QUZA 2MSCB 2ODBA 2A08A 2Z43A 4TQ9A 3T35A 1KJYA 4P33A 1DAIA 3AQ4A 1WX6A 3W6OA 2NO1A 4LRWA 4HAVA 3ZZTA 1Q12A 2IYRA 3V4RA 2PZGA 2VP9A 1PVOA 3FKSD 4KJZA 4RZUA 2HLDA 2J9RA 5CIQA 2D8HA 4NZYA 4TYQA 2KI5A 1T3SA 1KI2A 2P5SA 2J6OA 3PG5A 1RJ9A 1GUAA 3Q5EA 4JJCA 3LQQA 4QGHA 3ZYCA 1X1SA 4QJ3A 4P31A 2VKNA 3QBVA 3P32A 4NP6A 4TSFA 1KI8A 1YQTA 2WWGA 3TAUA 3W34A 4AFSC 1XMIA 2FX3A 2A5DA 4HAXA 4K46A 2V7QA 3VR5A 4JJZA 3T06B 3SI7A 1K5DA 3I61A 1HTWA 2HYDA 4DRZA 3M4YA 2OG2A 4LUEA 4JLPA 5FOXA 2EQBA 3SBDA 4AKHA 5BYJA 4FW9A 1R0XA 2O52A 5SZKB 1M30A 4ESVA 1WXTA 1TUIA 2AX4A 3EZ7A 2GA8A 3H86A 2AKAB 2R62A 1GDDA 4OI1A 2C2HA 4O3MA 5GJCA 2QN6A 1MO3A 1JEEA 1J2JA 4KXFB 2B7BA 2ERXA 3DHWC 3IIJA 2OE2A 2GHIA 4HUTA 2B7CA 4JLJA 3R7WB 1TU3A 4OMQA 3BH0A 1EGAA 2ZRBA 1DAGA 3BGWA 1Z6AA 3UATA 4GFDA 1NLZA 3SOPA 2VSOA 4CDGA 4ACAA 4IVRA 1CKBA 3K70D 1ANKA 4B48A 3EIQA 2H17A 4IRUB 1TTTA 2FDCA 3I32A 3TSWA 1XFAA 2UVQA 1JQLB 4EPTA 2JJ1D 1DG3A 2KBFA 1IY1A 3DM9B 1W36D 3KJIA 1TF7A 5KSOA 3AVXA 4LDJA 4FCWA 3SDZA 2CCKA 2GRJA 1J3TA 3QF7A 2MCNA 5HCNA 2GEVA 2EWWA 1XP8A 2J45A 2ZRHA 1W36B 2HT1A 1KZGB 2YWHA 1XZPA 3RSLA 4JT2A 1NN3A 2BJVA 3AVYA 1BKDR 1DBSA 4BQSA 3VS3A 3F0TA 4BEBA 3QBTA 4LYFA 4RZXA 3RABA 2AK2A 2GXUA 4M0LA 3M0PA 1YR8A 2JATA 5AR1A 1XEWY 3PQCA 4E6RA 5DI3A 4AFZC 4Q9LA 1R7RA 2PX0A 4W5HA 2QBYA 4LPKA 2OILA 2PX3A 4HB0A 2EYYA 1P9RA 4NCJA 1Z9ZA 4YMWA 3VR4A 3GLGE 4TTRA 1LVGA 3TH5A 4MRNA 2K2MA 4WCIA 2BOVA 4LJ8A 4Q03A 2IS4A 4BFYA 3I8XA 1VCIA 5IHKA 2RGCA 2QSYA 1NBMA 4IOLA 4IDPA 2QROA 1YKSA 3O8DA 2B6HA 2ZUDA 1F6BA 1KY2A 1GCQA 4X1VA 1K0XA 1FFHA 3BB3A 2IXGA 2UZIR 3GLHE 2J05A 1ETUA 3M0UA 1X86B 4JBYA 2JLUA 2QTVB 3RBBB 3PXGA 1Z0JA 4DIDA 2QT1A 3RDPA 4TL8A 2BKEA 1SSHA 2KBTA 2BBTA 1M3BA 2D3WA 2IEZA 3D6TB 4NH0A 3U7EB 1OB2A 1BMFD 2R44A 4X8LA 3EPJA 1PUJA 2H92A 1IO6A 4HCKA 1ZUHA 5E4FA 4TZ6A 2ZSEA 2GTJA 2G6BA 1J99A 3R8CA 4ITRC 3WMFA 3PUWA 4JLBA 2KT1A 3UA6A 2AL7A 2ONKA 1GKIA 2FPKA 2ZJOA 2ZUBA 1RRGA 4LPSA 2V1RA 1Z2AA 1XD8A 2D4HA 3ADBA 2OAP1 1UUEA 3A98A 4TYPA 4BRWA 3A58B 1YP5A 4XVUA 5LD2B 2ANCA 4JBWA 1Z29A 3SFVA 5IF9A 5IT5A 2XGJA 1N5IA 2LX7A 2Q9BA 3VKHA 2P4RA 3D3QA 3WMGA 1QWEA 4URVR 1II8B 2L0XA 2WAXA 2K3BA 3TVTA 3RRZA 4DCUA 3FHTA 3VU9B 2AK3A 1G8FA 2RN8A 1XTQA 4N3NA 1P2VA 4D81A 3GBQA 5IHNA 3GEIA 4H9GA 4US0R 4F4CA 3U44B 3REFA 4J9IA 1GAJA 4WZAE 2H1LA 1SKYE 4P4SB 2NG1A 4PAMA 2QEQA 5G40A 1E94E 1ZUYA 4D4KA 2ODNA 2G83A 2BMDA 4AI6A 2XXAB 3HU2A 3KJHA 4DJTA 4C0KA
chains in the Genus database with same CATH superfamily
2TSYB 4QYIB 3HS3A 4X85A 7ADHA 2DHDA 3R8FA 2W6ZA 4QNMA 4EG3A 1M90U 1D1SA 4P0PB 4X90A 2R65A 3ZDAA 1TM7E 1KYTA 2BI8A 3SBEA 4FEEA 1C9EA 3T3OA 1M76A 3E5RA 1M72A 3IX7A 2XOKD 3VU1A 2DAQA 3LIPA 4EUHA 4RMHA 1AIPA 1KH1A 1G55A 1W1IA 3CMAA 2FP4B 2JRLA 1E2JA 2LBPA 3L01A 3P2MA 3AEZA 3KJQA 2PGJA 4PLFA 1K08A 2ZT8A 1ZBDA 4URWR 1I5OB 3K5HA 1E1NA 3F6YA 3NR2A 2CKMA 3VS7A 3O0TA 2Z5LA 4I5FA 4JLUA 5D51S 1HDCA 1TQ2A 4D8UA 5C8XA 4EW3A 1AZTA 1SVNA 5EIEA 4UXHA 3BG5A 3VSBA 1Z3CA 3G13A 2BVNA 1YTLA 3RUIA 4LHEA 1KEZA 1WMBA 2HPAA 1J8YF 3FSJX 4D3SA 1GL9B 4TTVA 5AVXA 3MILA 5TJ9A 2C96A 4PPFA 4MGZR 2X2OA 5D8DA 4O8CA 1IK6A 1T9AA 3ORHA 2FV8A 3UN1A 2AF4C 5C53B 1KJNA 3AZQA 3CCJQ 1NI3A 3VRYA 3P9ZA 4WCFB 1VGVA 2FG7C 3HZRA 4IWNA 5AVUA 4NF2A 1U0TA 1NWCA 3E9MA 3I23A 4BC0A 2I54A 1J1UA 5C2JB 2OENG 3ZWYA 2BGLA 2JHGA 5AM4A 4TSRA 4NL4H 1GPH1 1SBCA 2OYCA 1MHPA 5JSQA 1JH9A 3AM1A 3FMGA 5JQGA 1QHXA 3FNFA 3LQFA 2AZMA 4FTWA 1VQ6Q 4HX5A 3JYOA 4F2HA 1UBFA 3PE0A 4TUYA 4EHAA 2JLSA 3PQDA 4W8HA 3L2ZA 1CTQA 2IX9A 4BFWA 4AXXA 4ZIRA 3HACA 1BFDA 2BE9A 4JDSA 4MYTA 3FWHA 3CX4A 1CZHA 1N7HA 2GCIA 2O06A 4PJOA 2VO1A 2ZT7A 5T41A 1QIIA 4MUAA 2Y1LA 4Z0HO 5U4QA 4AB1A 1CUWA 1EBFA 2KQWA 1LS6A 4G5XA 3HUDA 5FPYA 4OMUA 3WYBA 3S2ZA 4FYJA 2XE4A 4OKIA 2FRDC 5G0WA 5BURA 1U2DC 3JAWB 1GAQA 4F2PA 4R9RA 5H82A 1UTIA 4DLVA 1YBYA 1HF3A 5LBIA 2QM8A 4KGVB 1Y1QA 1WUKS 4S05A 3G4SQ 2BEWB 2GD2A 2P35A 3IPYA 4PPQA 2KB0A 2QM3A 1JDJA 4KPYA 3NDRA 4B09A 4BMCA 5A0LA 2HIHA 2PZMA 3PC3A 4QELA 4MB6A 1OYYA 4XSVA 5JFTA 3CUKA 3P0RA 2J9GA 2V4ZA 4DZTA 4TTJA 1I0LA 4WRRA 1JU9A 4HVVA 4Y3UA 3WLTA 4F7UG 2B4YA 3BREA 4HFMA 3HJFA 3CRQA 1UC4B 2KJQA 2M2IA 4N3GA 5B3JC 1U02A 4RH3A 3NOXA 1VTKA 1JZSA 2H85A 2F1LA 2EQIA 2JJ2D 3O26A 4IQ4A 3ZEHA 1JAHA 1MMFB 1WB6A 2Y1GA 2QNIA 1OU0A 2IVWA 2QRUA 3NC1C 1U2PA 4C0DC 4KR0A 4QOIA 5EXSA 2VWFA 4RIHA 5E6RB 1DS6A 3WKCA 4MZDA 3QIVA 4QJBA 5B5SA 4C0QC 2C61A 1GO2A 2X4LA 3KELA 2CSUA 1J23A 3HEBA 3K92A 5EHXA 1A2KC 1D03A 3GJZA 4GICA 1CE8A 1R18A 4FB4A 1Z2EA 3QE0A 3LXXA 2ED1A 4PQYA 4X91A 5EXDA 3JZDA 4NARA 4D6PA 5IK2A 1FUEA 1UXGA 1JFFB 2D4AA 3A0RB 4MLCA 3K7EA 4G9BA 2CBZA 2UUAB 3LX7A 2X40A 4PFKA 5GQSA 5GJVC 4KBFA 4CG3A 4D4HA 1A9QA 3T9NA 2WKWA 4ZO6A 3KOWA 2V8BA 4YROA 4RKRA 4KFCA 4A8PA 2VXEA 1XX6A 3NMZC 1IN6A 3CZAA 4C08A 3U7IA 3FPLA 1U4SA 1ZM2A 4EB0A 4FFMA 4S1OA 1E4VA 1CIPA 4H60A 4C4YA 1XNIA 1K4MA 1YONA 3L4BA 1SCKA 1XVIA 2EC5A 4QLAA 4AZSA 4BUCA 4DCTA 4NJMA 2H6EA 2UUBB 2GJKA 1BMDA 3KTOA 1QJ4A 2DPGA 1V3UA 1IOWA 3DKRA 2QTZA 1WHTA 2V7WA 2I7TA 3OTQA 2DILA 4G1FA 1NJ6A 4RQTA 2ALJA 2YDYA 4UC4A 3O2NA 3LYIA 4LG1A 5DNDA 1T8WA 3SXUB 4IXWA 3DQQA 2CYAA 4KDRA 4BZWA 5U4XA 3HUTA 3TLYA 4EY6A 2MJLA 2HCBA 1MW9X 3U37A 1FS6A 4LZAA 4PO3X 4J4HA 4C7KA 1IJBA 4ND5A 4OGGA 3K4PA 1BWQA 4OSEA 1WULS 3MMXA 1G64A 3OZUA 2XDAA 4RGYA 2H5IA 3B36A 2GD0A 4EHJA 4FR0A 4IUTA 3IHWA 3IV6A 1OE0A 3BRWA 4BX9A 4CL8A 3I34X 1WXWA 3UW3A 4AURA 1TK9A 2EP5A 3CNEA 4M0PA 3WL5A 2L3QA 4IQ0A 3S70A 5HRUA 1THTA 5DRYA 2BIVA 1BU8A 2DL8A 1PZFA 2TRSB 3DDUA 3RLFA 2KNBB 4KQKA 1RRMA 2HUPA 2VXOA 3N9IA 5H80A 4F9EA 4V39A 1VBNA 1XA0A 3ZWOA 4AZ0A 4QFBA 4PJOC 1N6KA 1I3LA 4RY8A 1JEYB 4BMXA 4YR9A 4C0JA 4IIUA 1MUUA 3T0GA 2DPXA 2QRZA 1QPGA 2X9QA 3WGJA 4AZTA 2CZCA 4RVHA 1XEXA 1CKAA 3E8MA 3WXMB 3R5SA 3GVPA 4K9MA 2CCGA 3HI6A 2W58A 1DP4A 1PEKE 4JLWA 2IYAA 4ZVQA 5EQJB 2CJWA 5TSDA 1C4XA 1CQJB 2FGKA 3GRKA 4QHSA 5HA5A 5JRZA 2IYQA 4L57A 4R8KA 1MEEA 2DP4E 2J5BA 2D6FA 1YI8A 1H0KA 3OBBA 1Z5NA 1RZ3A 3L93A 3UPUA 1RPAA 1U8ZA 4US2R 2GZRA 1SHUX 2DR3A 3L9WA 3OQJA 1JDZA 5AO9A 1X77A 2ZYVX 5E9QA 2O5RA 4DNXA 4FOLA 3M5WA 2DLCX 5EE0A 4COOA 1N1MA 1YIJT 4YQFA 2GBLA 3W77A 4HVWA 3L49A 2KSQA 3WYFA 4RG2A 1XXHA 2PMCA 2J6IA 4UC0A 1X1DA 2ENWA 1XB2A 4I99A 4QSMA 5KWVA 2JMCA 1Z5UA 1AA9A 1U3CA 1RW4A 2OHHA 4J91A 1DEOA 1GAEO 1MVOA 3GRYA 4BDYA 1Y3CE 3MBIA 5AJXA 2WOJA 1WRBA 1SPXA 2NQ2C 5G2OA 3S5UA 2FSPA 3UG7A 3S7ZA 1JQQA 1NXPA 1UFVA 2HKQB 3D5QA 3SBXA 3WGHA 4R83A 1XN1A 2RSLA 3EVNA 3RC2A 4X8MA 5IXBA 2QX9A 3FUUA 3KXIA 3VS0A 4EFMA 4EYGA 2J9XB 3UB4A 1A4IA 3DL4A 3PGKA 1HZZC 1I0CA 4NDAA 3H2IA 4NH4A 1N2IA 4PSAA 5AT1A 3BSSA 1BXRA 2BM8A 3QJYA 3W1WA 4PN7A 1R0YA 1Q11A 4ZRDA 3MEUA 3AI2A 4XAQA 3P26A 4H7DA 3MG9A 2ID9A 4HH4A 3A06A 3TSYA 4QM6A 4P2BA 3C6ZA 4GMXA 1QE3A 1PRMC 1WNFA 3WKDA 2R7MA 3F3MA 2O0KA 1JGTA 1QYCA 1ZM9A 2CJFA 2O6LA 2XH8A 3D0QA 1MX5A 1T9ZA 1Y3IA 5EUQB 5G0TA 4TVSA 1L7EA 3L4KA 3HGTA 3DLTA 3IR6A 2FZVA 4RK1A 4W99A 3QBYA 4GBQA 2GTHA 2MSKA 2BFMA 4Y1RA 4CFZA 4EVQA 1H2AS 3KUFA 1YJWQ 2CL6X 4KLNA 1RC0A 2VSXA 3CX8A 3NBXX 4HNSA 2GZ1A 4KSYA 4R0VA 3RUPA 2VJCA 1UBCA 4GXRA 1I24A 4DN6A 5TJHA 4GPEA 4QOEA 3QELA 1L4EA 4F2GA 2GZ3A 1Z45A 4M7AD 4MCIA 1G3QA 1YDEA 4AJOA 2CVFA 4DDWA 1OXVA 3R7DA 5M9OA 1R5BA 3PTZA 3SNHA 2H0QA 2DM1A 4TYWA 1A9RA 3ZE2B 5K05A 5L6LB 1M73E 1KJZA 3IAAA 1LD3A 3OF3A 4MTLA 4MW0A 1QU3A 2NU9A 1K76A 5KS2A 1Q0TA 2ZYSA 2EHDA 3ROFA 1JFSA 2ODAA 3TKYA 4ZMBA 1S9DA 2W7TA 3PRYA 4MAMA 4QX6A 1BW9A 1CUAA 1E20A 1V29B 2EKQA 1ZNQO 2IYWA 4RGBA 1CU1A 1OCEA 2W0SA 4IZ6A 4WASA 2ZETA 1LB1B 4YAIA 1PUIA 2R00C 3TZHA 1PJBA 1EJBA 1MOZA 4YTLA 2DUMA 2I76A 1C41A 1OH6A 1UJMA 3ANTA 3LOPA 3VRZA 2N1BA 2ZRJA 1URPA 1V16A 1YS1X 1DELA 3CJQA 2WD7B 2WYIA 5KVAA 2XUOA 4LNHA 5B3AA 2RJDA 2AYXA 1DBQA 2IUEA 3D7MA 3AM3A 3GZNA 1KBQA 4DBLC 1U1EA 1K1EA 5FROA 1JB0E 2QE7A 3MCTA 2PU9B 5FWXA 5T64A 5T4FA 4B79A 2G0TA 4TYNA 5COQA 1L1FA 3RS8A 4BATA 1WUIS 2QW1A 4ELYC 2QMHA 2IVZA 3DTVA 2RH4A 3HG7A 1ZSGA 3KVVA 3L3BA 3N8IA 3PNKA 5FRDA 3ZZUA 1SEMA 2O4XB 4XU3A 2BD0A 4BX2A 2P2YA 1H4QA 4TLCA 4ZI7F 4ZK2A 2MSEB 3JD3A 2RH8A 3GBSA 3WQBA 2EBWA 5IJ0B 1SOVA 4G1VA 3A8MB 3ELWA 4J1SA 4NFSA 5FWCA 3FEOA 2Z58A 4HPWA 3TYXA 4PFOA 3L7OA 3C16C 4X7BA 2Q3MA 3CEHA 4WZZA 3O82A 1Z4IA 1JPJA 2EJWA 4YAOA 5COBA 1BX1A 1F51E 4H6PA 5BSVA 3TQIA 4CLHA 1F8FA 4YCDA 2RQUA 3QYFA 5HK8A 4WXMA 4HXGA 5ITSA 4O63O 5ICSA 1C9MA 6Q21A 4FC7A 4FKBA 4JS4A 1P7VA 3R6LA 3ABOB 3CW9A 4IJUA 4N4IA 1U8FO 4PC2A 1CY7A 4AYWA 4DY4A 3HTXA 1QHYA 1FJGB 1VI5A 4E7ZA 2Q9CA 1K7CA 1UFOA 1XDZA 4LOIA 2KS6A 1LRJA 2C94A 2OBLA 3NDJA 4PO1A 3PZBA 4TLAA 2J4DA 2LIVA 2YIJA 4Q3EA 3F8TA 4LSWA 4TV9F 5IHIA 4JYZA 2DKFA 4OYHA 2UZ4A 3OQNA 2HC9A 4ZO9A 5F33A 4LDWA 4YVFA 4PXSA 5AXCA 2F7SA 5BV1A 5LDHA 4BI3A 1JSCA 2H29A 1TU4A 2G9UA 5TB5A 4OMMA 3JD4A 5AUOB 1G5PA 1KL7A 4BFCA 2FW6A 3MT9A 4RK7A 1PTJA 5HTKA 2ZSJA 5F12A 3UGQA 2COWA 5KE2A 4E09A 4KH0A 4KHPB 1YGPA 3ISTA 4J1TC 2O8DA 4GIBA 4EL0A 4BLRA 3AQIA 1L8LA 1R5JA 3OMXA 4IICA 4JI7B 2Q6OA 4S1VA 1SRMA 3LC2O 3E3LA 4MV0A 1T3GA 2O8VA 2C20A 2HRDA 2WI8A 1F8GA 2P2SA 3L6RA 3DTTA 3FPJA 1XMXA 3TOSA 3W6NA 1INLA 2E5FA 1G5QA 4HEHA 1E3WB 2YZKA 1J8VA 1O9HA 4I8XA 2FPUA 4J76A 3I55A 2P9CA 2FHPA 3G23A 4NVRA 3JAMA 3OFJA 2R25B 2DWPA 1SCUA 2W6NA 4FEYA 1UC9A 1Z5VA 2J5QA 3GLHB 3GLFB 1K73C 2QX7A 3FOEC 4N39A 1W96A 2IIPA 3AY7A 1SK9A 2PX5A 2QI9F 2WBLC 3HN6A 3K0FB 1THZA 1UDBA 2JD0A 1LZLA 3RYIA 4EFKA 2WFLA 3L18A 1X7WB 1LV8A 4QBIA 1G3UA 2VEDA 4YJ2F 1XCBA 1P5ZB 4KP7A 1OXXK 4C43A 2GGRA 2XMPA 2CYCA 2YFHA 2QTRA 1FUUA 2NW6A 4CC2A 1BX3A 1TU0A 1BVHA 2HNAA 3E9RA 3G0GA 1P5FA 1N6OA 2K9GA 4RY0A 5DP2A 5JISA 1EZZA 3CC7A 1W35A 4GSLA 3CC2Q 3EQZA 1XJWB 3RKSA 1YJCA 2P3LA 3LUKA 4DQDA 5I51A 1QQTA 2FMIA 3CUUA 4Z7OB 2HPHA 1ADCA 3GZTB 3ORSA 2YYSA 3M6AA 3QVXA 5ER6A 1XCJA 2GQ0A 2GR9A 4GSYA 1M67A 5FNZA 4I19A 2WG2A 1SHLA 5I4IA 3EFOB 4U2KA 3PEWA 1ADGA 1NVBA 3P2JA 4NKRA 5CKDA 1FTNA 2HJVA 3ZVNA 3JW8A 1AKTA 1OXBB 3OO1A 1VA4A 1RQ2A 3VH1A 3N1UA 5LM3A 5EZYA 4GO1A 3GRVA 4JYPA 4U63A 3IO5A 3GT4A 2XECA 1YDHA 2W98A 3PCRB 4G1EB 2CE2X 2JXBA 3HKEB 1DC8A 2OV6A 4MDXA 3TRFA 4Q6WA 3PK0A 3QRWA 4R3NA 4IDHA 2C82A 5DYYA 1DO2A 4FFWA 3K70B 4C0BA 4G25A 3IR7A 4YAWA 1GPNA 1NVVQ 3OEWA 3A1PA 4B87A 5BN1A 3EA0A 4OHMA 4PNPA 1JR3A 2W4IA 3EVAA 1FF9A 1U9YA 1K9SA 1QB7A 2CGEA 3ZNNA 4CM4A 1I6LA 5DTMA 2X4IA 1SNYA 1AHHA 1NNUA 4Q4HA 1E7WA 5LD2C 1WR8A 4BMPB 3TNDA 1KK3A 2M0OA 2W2PA 3DYIA 3BWDD 3A4VA 2ACEA 3FH0A 1YS6A 4JC4A 4IBOA 4MDYA 1K9MR 3RRBA 5DSTA 4A16A 1MMGA 3OF5A 4OXRA 3EG1A 1RLIA 4ZRNA 2MR6A 2Y66A 3BGOS 2G1PA 5I9MA 3STXA 2POQX 1PR9A 4LDPA 1GYPA 2IYFA 3MWKA 2B34A 4LRSB 3WL4A 5DF1A 1TF2A 1KNXA 4MB0A 3WGYA 4GMDA 4KO2S 4R0MA 1LI4A 5HUJA 3H6ZA 2VRBA 3I35A 3GHYA 2HF8A 1CY8A 1ZG3A 1FXSA 1N6RA 1Y7IA 3WKEA 1ESNA 3SF8B 2F17A 5LDDC 5EFOA 1QVGP 1WI7A 3GH1A 3KZ1E 1TUEA 3MINB 2W2QA 4HDSA 4QRIA 4LF4B 3NTKA 3LCUA 2VATA 4QBGB 4CMHA 1CZOA 1WCWA 5B36A 1V0JA 2ZI6A 1PBNA 2VNJA 4JUAA 2OXIA 1A9ZA 1NBOA 4LQDA 3FB1A 3JSXA 4NYJQ 1EHCA 4IIJA 1H6DA 1GUZA 3L2QA 4K0RA 5M3BA 4L0MA 1J06A 4G01B 2EKBA 4INZA 4V03A 4E4TA 5JCPA 3MMPA 2BKUA 5IW8A 5THXA 5IPFA 2IPOA 4I66A 4X7RA 4XEUA 4BB9A 1TO1E 3AZOA 4C6HA 2AS0A 4UNNA 3O75A 4EHLA 5HOQA 1S4QA 2AQHA 2CE7A 2FMHA 1FPQA 5JSZA 4C01A 1C6VX 3E2UA 2GHQA 4JU8A 5TPZD 3DZ8A 3ESYA 4NATA 3E05A 2JBHA 4QYTA 4WK4B 1MG0A 1NC1A 3FNGA 3E7XA 3H1PA 4RF4A 3UF0A 4ARAA 2B6NA 3WTCA 3K6JA 4M9QA 2FEIA 4Z0TA 4RTJA 1HNWB 1QTRA 1OPXA 4M77C 1KMIY 2QA4Q 3EODA 2C3UA 2DXIA 4BN4A 4X34A 3AV0B 5EG5A 1MTZA 3WLEA 3EDRA 3GQBB 5C34B 3VQTA 1MA3A 5GM2A 4RTWA 2ZRDA 3TUIC 1VE6A 4WKCA 2GDJA 1HE8B 2A5YB 1VCHA 5ECDA 4YYZA 1IEXA 2EYWA 3UUGA 1P6UA 4RKYA 2LZ6B 2J67A 3SEAA 2NUPB 2G09A 1D7OA 3KR0A 3X0DA 3JB9H 2FLWA 2YV2A 3ZJ4A 3EN0A 4LV5B 1MNEA 1XZCA 3T6KA 5TXGA 4GQAA 2WC1A 1LDYA 4WNCA 1A1VA 4X9CA 2N0SA 2IXAA 3QKRA 1Z4OA 1FUIA 1GG8A 5F1PA 3QZ9B 1OI7A 4FYMA 4RZIA 1PD1A 1JHXA 1XLWA 1ZI6A 2OOSA 3GMTA 4RDIA 5L3ZA 3R7SA 2OCXA 4I4IA 5JCOA 4BO4A 4DA8A 4OQZA 2FUG6 1H641 3RRXA 1QP2A 2JIRA 4CL3A 1M7GA 4G67A 4MDWA 4Y9RA 2DXCA 1N6IA 5JD4A 4JJ6A 2PTKA 3MJ4A 1U5AA 3PXDA 4LX8A 4MLPA 1ZVQA 1S0UA 2CK3A 3V1MA 4MW1A 5C8ZA 5BR4A 3AJDA 4JI4B 4EPVA 2OOKA 1SQ0A 4LOKA 4C20A 3NHBA 1Y8CA 5CNKA 3A9RA 1RXUA 2QRHA 1EBUA 2OCDA 1YIOA 2RBGA 2YJ6A 1JIXA 5ELLA 1LX6A 2GEJA 3B7WA 3GGGA 4TMWA 4DA6A 5H4HA 1X0XA 1VUBA 4WJLA 4QNRA 2C2WA 3LO8A 1U90A 3SF8A 5L4LA 1WCV1 2HIMA 3FHOA 3B5IA 3JPYA 1XROA 2P7HA 4QXPA 4RPCA 2BMWA 1QTIA 3CEAA 2I3ZA 2VNKA 4JJEA 3RS5A 2QI2A 2WDZA 2AQKA 2ICAA 2HMTA 4LX0A 3TUJC 5JRDS 3G6EA 4EMBA 3C4VA 3HN7A 1P9LA 1QF9A 1MENA 3GDHA 4XFDA 1J4AA 4ZJYA 4YR7A 1VBKA 1REQA 3BMXA 1ZLMA 4RKFA 5ECWA 5KZMB 1ZKMA 3MJVA 5AFSA 1LI7A 2BHRA 3BILA 4GMKA 4GYYA 5K3BA 2GPNA 4U7WA 3QV2A 2QTFA 2PRYA 5TX7A 2VI5A 3GJ8A 2PXCA 3EUEA 4IV5A 1PNQA 1FLVA 3ZNPA 2P40A 3QEJA 4HVAA 1IUNA 1PVVA 3B1WA 3GRAA 1ZIOA 3L1JA 1JDBB 1RAIA 5EERA 4BCCA 5MGNA 1CT9A 1CEYA 3L06A 2ORVA 4DYHA 2O2DA 1WMSA 4M8KA 4DJJA 4DOMA 1T8TA 2QD1A 4DWJA 1NEGA 4L7QA 5LJ5g 5D00A 5BQOA 3V97A 1LBHA 2EBUA 1CB7A 4QG7A 5DIZA 3LIIA 4FYXA 3I0NA 1NI4A 2AEMA 2PYDA 1W5TA 1VJDA 3DTVB 4HDRB 4A91A 2QTCA 2YV1A 1G8KA 4R1TA 4F3CA 3Q8LA 2VT3A 3EG5A 1HYGA 3R5HA 1D09B 4NBTA 1ZUIA 4BV9A 1IHVA 4ZI3A 4ZT5A 4ZVPA 1QP8A 3B13B 3D3EA 2J6KA 3BDLA 1R8JA 4EPRA 5EXEA 1EFTA 1GGNA 3PT9A 4FNAA 2OV3A 1X1AA 1VYTA 4PFSA 2G07A 1H5QA 3X26B 1P1JA 4TMVA 3T7DA 3GP8A 2J3QA 1PQ4A 2A4KA 2WT9A 2VSFA 3S3MA 4UUNA 3GPBA 1EQAA 3DDWA 5CK5A 3TW4A 5J2TB 5CDHA 2B4AA 2GH1A 3GWZA 3PHGA 3G71T 3IS3A 4YDHB 3C3PA 5FX2A 2J0SA 3AP2A 1G18A 2XHZA 4UHEA 2W2LA 3BM5A 1QQAA 5LDGA 1TFUA 2NSDA 3IAM6 3WFIA 5IM5A 1KC8R 3I64A 2VHZA 4BAZA 4BNHA 2G9NA 2PUWA 2Y9MB 4P32A 3CPSA 1PYDA 4XQ3A 3OPXA 1H3HA 3BFMA 1CEQA 4LJRA 4AWAA 1ZAKA 1AC5A 1AUPA 4BO5A 2VJMB 1FIUA 4Y98A 3RS4A 1T9GR 1DIBA 2R6CA 4QXOA 2NACA 2ZRIA 2OCYC 3R0XA 4HDQB 1FJ2A 3O0DA 4JYMA 4NULA 1X9IA 4FM4B 4YAUA 1X9HA 2EV9A 4JD5A 4JYBA 4EY5A 4LZWA 3CMET 3LFHA 4XVHA 4KBGA 4KTTE 3ORQA 3CCLQ 1OT3A 2BBSA 2COKA 2JIOA 1W76A 2AGVA 5JG7A 4D4IA 1EJ2A 2PKWA 4ZT3A 2ZSDA 1PG2A 4TWAA 1A69A 1F0NA 3GELA 4QTTB 2OQ2A 5TVGA 3OYDA 4IDQA 1PGNA 3IJPA 1K4US 1QNLA 1GL5A 2WT8A 1D6NA 2KSSA 1G60A 2A1UB 4FSXA 1HXDA 2ZYIA 3BEOA 2VRNA 4OHOA 3BDUA 1WJSA 1JAZA 1ZINA 3PCXA 1UDWA 2H3EB 1P4SA 4HPJB 3B8HA 3UHAA 1KDPA 4MIYA 2HFJA 4DEYA 1Q1ZA 3PNQA 1KI9A 4ZIRB 5MHTA 4J6WA 1K4YA 4M6WA 1Z88A 5CAEA 3LUPA 3UA3A 1WD7A 4UNQA 3JCMP 4Q3KA 3HCWA 5J2UB 5C0OE 2FF7A 2IL1A 2XGOA 1ATIA 1I36A 1JZTA 2K5UA 2VPWA 3LT2A 1ZK3A 4ZU1X 5ALIA 1F06A 2GPBA 4C5AA 4DNFA 3L4JA 1KI1A 2BDEA 3R4CA 3HVJA 1JI3A 3IQXA 4ZRMA 1V7ZA 3WJ1A 1MB4A 1A88A 1DKPA 4RYDA 3ABIA 4P92A 4C5HA 1J5PA 1VQLA 1KMNA 2D0DA 3ETGA 1JKJA 5DYNA 2J0VA 3AFGA 3KKLA 2TECE 5P8WA 4PE5B 1XEXB 1Y3DE 4LXCA 1WA7A 1RM0A 4PR0A 2VHEA 2HQEA 5DNVA 4IKEA 2GCGA 2AFHA 3OT1A 3PFCA 1WXIA 4M77F 3NANA 2E4HA 3E6AA 3GRUA 5FO0A 3MPUB 3ISVA 3OYBA 4PG4A 1UBJS 3QX7A 3ZZ0A 3VZPA 3UMFA 4ECAA 3TDNA 4GYKA 4YJGA 4TKUA 3GUZA 4BXOB 4C6RA 5DT2A 1ODCA 4EA7A 1VKHA 1YU9A 4O2AA 2O1WA 3JQGA 4CNQA 1KETA 1DOAA 1PRYA 3A9WA 3CTMA 1ETHA 3JX9A 4M1ZA 3GRPA 2R0QC 2PJRA 5MFPA 1L5FA 2V8KA 1FQJA 4MKGA 3PD0A 4OQEA 3KXTA 1JO8A 2QL5A 2V7VA 5FH9A 1DQRA 1EU1A 1QKIA 2C2KA 3OY7A 4MQFB 4C7JA 4C7OB 1Q0QA 5HKOA 1AHJB 4LRTB 4KLZA 5DSXA 3S2YA 5FBHA 1UINA 2EGGA 1HMPA 4GLBA 4Y2GA 3DKIA 3WDKA 1FVFA 5K6AC 4JGIA 1XQHA 3L0ZA 4QJ4A 1PFGA 3OY2A 1GRIA 2AMJA 5KTYA 3QVOA 1LJLA 2W2VA 2OCLA 1CIJA 4YMSA 1VECA 3OWHA 4IO0A 5C1BA 5FUVA 5KDOA 1Z35A 3R0QA 1LLQA 5AW8A 2B1JA 1NVDA 4DRXB 4ZN3A 1EG7A 2A9QA 3AM4A 1M1GA 1NYFA 1ZA2A 3NJRA 4L8FA 3MJTA 4MRMA 4U5QA 3CCRT 4IDFA 1AHNA 4PG5A 2K2QB 5DHQA 3U39A 4ETMA 4MZTA 1Y34E 4WECA 2Y1FA 3PJDA 4II7A 1ZXLA 1AUOA 4ASUD 4KFUA 3U56A 3JQ7B 2XVAA 3VPHA 6GPBA 3LPAA 3FDZB 2EL9A 2PGOA 5ANRB 1D1PA 1H8EA 3D4BA 5SV2A 5EJFA 3UWOA 4A3SA 3DOHA 1GR1A 2EQKA 3JQGB 3T15A 2IWHA 5JCJA 3W5IA 4I5DA 5EHGA 3GROA 4IMIB 4DCVA 1VLQA 1SRLA 4J9UE 1ILWA 3LCRA 3PE4A 3CLUC 4UVGA 1I1OA 1Q7YU 1CZRA 4MW4A 1FCJA 2NN3C 4PRZA 4CFSA 3J7TA 2OCKA 1DTWA 4H31A 5I7EA 4JC0A 4EPYA 1E92A 2VZ0A 2W4QA 3VKGA 4NFLA 3ZXSA 2ZM6B 3P9IA 4BEWA 1M6EX 2FN9A 3KTAB 1I14A 2IYVA 2OZEA 3HCFA 4D9HA 4UOEA 4OMNA 1JS1X 4HLNA 1I4EB 3OHPA 5DLQC 1KWKA 1JHRA 4KYTA 3GLXA 1JIJA 1T1SA 3AERB 2WSSA 3F2VA 2GASA 3G1WA 3PUKA 3Q72A 2X4XA 1JF8A 2FW7A 4HDNA 4OHZA 3U3MA 3V4LA 3EGXA 1HXHA 3R6DA 4BFXA 6REQA 3LV8A 2IYTA 1E6WA 3BFJA 3LC7O 4J0EA 2R2AA 3WS7A 3ZWPA 4F91B 3I2FA 5GIOE 1L3BA 1ZMBA 4L3OA 4UHCA 2I8LA 4DV2B 3CD6Q 2VFAA 4K8RB 3A2KA 2E2WA 2OZKA 2ZI5A 4EECA 1VQ9Q 1SCUB 2YKGA 1FFXA 1VYHA 2ORYA 2W6JA 4KQMA 4R5HA 5DLPA 3EUWA 2RB5A 1FYDA 2LV8A 2NUZA 1JRLA 2PWYA 2YLBA 2V9CA 2XNJA 2D13A 1CY1A 4K6CA 3ZHCA 3FWYA 1BKSB 5AVKA 3S4YA 1E2KA 3ZWBA 3I01A 5GMKj 3K9GA 3DB4A 2COZA 5WRFA 1LVKA 4TZKA 1A7JA 1O95D 3NT5A 3P0FA 3S0JA 4UTVA 1OJLA 3L8MA 2R6FA 1J25A 1XV5A 3JB9I 4PLZA 4EB8A 1RU3A 3NWPA 1C0IA 2FR8A 2QXUA 4QQNA 1SC3A 5FOSA 1N7IA 1ZHHA 2GCEA 1E9SA 4RTKA 2A9KA 3CCFA 2FHDA 3GGDA 2Q45A 1MN6A 4E5KA 1CR6A 4IGKA 1NY5A 2YJTD 1ISJA 3RVMA 5B6JA 3VTAA 4MPDA 5FLKA 2GAAA 4BLWA 4FUQA 4MW6A 1YHQA 1C9KA 5LJ3e 1W1WA 1QXSA