1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
b'EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
3LXXA 3KXIA 3ZZUA 4QGAA 2O8BA 2DL4A 4MYUA 2GXAA 4QJ4A 4JJDA 3CUEF 1WBBA 1CBUA 1GDDA 5FBQB 3KFVA 1P61B 1R5BA 3KKPA 2UZ3A 4BUJA 1YVDA 3EWAA 4CRWB 4DT1B 2QA5A 3EX7C 2RGEA 3A8TA 2NGRA 1B3QA 1YZQA 5H8WA 2VWFA 1HT1E 1KMHB 2VIIA 2QE7D 3A36A 2D8HA 1P9NA 4O2LA 4TMXA 4AYWA 3RS7A 4IVQA 1CKEA 3AEZA 1CTQA 3ZIAD 3U60B 2IYTA 3LLMA 2QL6A 1BKDR 4R71A 2ZRKA 3OESA 1G17A 4XWAA 2X2EA 3GQBA 1G7CA 1V43A 2GESA 5A5GA 2O8EA 4Z89A 2RMOA 3NHBA 4P31A 2ERXA 4LJYA 1UKZA 1GRIA 1GIAA 1HQYE 3C5CA 3QF7A 4V0KA 5KHOC 1CR2A 1X1SA 5KYKA 4P0TA 2KYMA 3OEHA 3IILA 1XMIA 4GZLA 2BMFA 1HYQA 1TUIA 3R7WB 2KYBA 4US2R 2H57A 2K7AA 1E2PA 4HZUB 2RQRA 3KFXA 3VX3A 1SHGA 4LYAA 1NNEA 1US8A 1GL9B 2OZEA 4CEJB 1MV0B 1AN0A 4NCNA 4UNSA 1TPZA 2VHTA 3NH9A 4AKEA 3MWJA 4IEEA 4CF7A 1L2TA 1VG9B 2HYDA 3TW8B 3I72A 1DBSA 4LUEA 1E99A 3K9HA 2HLDA 4JZKA 1PVOA 4HDQB 3K9NA 1G9XA 2DCUA 2DPXA 2IUTA 4Z1MA 3OIVA 3HYRA 3Q7PA 1DEKA 3FJ5A 5FOUA 5FOWA 3KKMA 3TJZA 5EXSA 5J5CA 2FPMA 4II7A 3W3ZB 2RGNC 3RRZA 1XJQA 3SI7A 1D2MA 4WZAE 3TVTA 1ZMXA 2FPFA 3KKNA 3RS2A 2NOAA 2G0NA 1GVNB 2ZRHA 3NHNA 4IRUB 2F2VA 4TYQA 1Q57A 3KXLA 3QBTA 2ZJ8A 3WXMA 4BLOA 5J4YA 5J4LA 2AD1A 3EPKA 2QE7A 2AZVA 3KKOA 1GITA 3KUCA 1W0JD 5EUMA 1AKYA 3UXMA 3SYNA 1Z6AA 1MT0A 4TSFD 1ZRHA 2VP5A 2EPDA 3ZIAA 4UNNA 1CJKC 1VG0B 4EJSC 2XITA 1GBRA 1KIKA 4J9BA 4A6PA 2MOXA 2ZE8A 4RZ3A 3H1TA 2FWRA 4B32A 2FOLA 3ND8A 3GLFB 1B23P 1Q3HA 1RPZA 5G41A 1UJYA 4Q1EA 3B6EA 5DSZA 4JSYA 3VAAA 3W8NA 2F7SA 1PLJA 1W44A 2MSEB 4JLMA 2DE0X 1HE8B 1NVVQ 2OAQ1 3RC3A 2IUUA 2CK3A 2QENA 2I1VB 5JBQA 1OPLA 1I4DD 3AF0A 2YWHA 5FBLB 2PJRA 1MABA 4CW7A 2ZI4A 4D80A 2C03A 4KLNA 1E2KA 2GA8A 4EPTA 3AVWA 5EE5B 4TMKA 1IBRA 1CSKA 3H4MA 1CRPA 5DN6A 2CNWD 2LZ6B 4Y0AA 5C2JB 2NUZA 3AVTA 2LCFA 1OXVA 1KSWA 4RTXA 1T4GA 3A1SA 2LWIA 4KLZA 5SZKB 4BFXA 5D3MB 1VCMA 2GJ8A 1DAMA 1UBEA 3UATA 1Q20A 1YNZA 1M3BA 1S1NA 1ZCBA 2FSIA 2OXRA 2PZGA 2GBLC 4IEIA 4MGKR 3A1TA 3C41J 2EKHA 2O9VA 4M9SA 3NXSA 2EYUA 3B1VA 3LO5A 5FWBA 1E2EA 1T3HA 2GK7A 4WA7A 5TDHA 5I11A 4C0HA 3THYB 2FEIA 1K76A 2RQVA 3Q5DA 1U94A 1KI6B 1XZQA 3H84A 2BCGY 2GVZC 2DYKA 4HDCA 1SSHA 5JJIA 1Q1BA 1E2JA 2J45A 2BZ8A 2IL1A 2G77B 1ZUNB 3AV0B 2GJAA 4PPQA 4M1MA 4CZ2A 1FMLA 2WJVA 3HR7A 3SJAA 2JXBA 5L3RA 5K8UA 1HURA 2A7QA 1W0JA 5E7MA 1UFFA 3QXJA 1AJEA 1OHHD 3FPAA 3L0OA 3R6NA 2JJ1D 2LKDA 2CLSA 5FTMA 2WSSA 4MKIA 1UPTA 3CQTA 4OK5A 2W2TA 4MUAA 3IO5A 1CU1A 5A0FA 2VRWA 3HPRA 2HT6A 1N6NA 1PLKA 4IIMA 2CHVA 3LD9A 3TR0A 1TF5A 2OXCA 5TXGA 4BLQA 5HZHA 2KRSA 2IF0A 3PVLA 1SXJB 1ZU5A 2N42A 1AZEA 3HU2A 1X69A 2GVDC 3U3MA 1KY2A 3VU9B 4NE2A 1K0SA 2O9SA 2VH5R 1J99A 3CX7A 3CH5A 3RLFA 4JBWA 3UWOA 1EFNA 1CIPA 2VP2A 3A4MA 4CT5A 1OIWA 2EFDB 1XEWX 1R0XA 2RGCA 4U5XA 4L9SA 3WP0A 1A2BA 2JATA 2Y8EA 2ZUBA 3UF4A 2ZTSA 4HLCA 1XU4A 2C99A 2VSOA 4R2IA 2QORA 2CCKA 4CC2A 3E5HA 5AJVB 2SRCA 2JLSA 1F2UB 3T1QA 2PZFA 2VSFA 1K5GA 2NMVA 1G5TA 1VHLA 2ROTA 4LN2A 3GJ0A 3U7FB 4JL6A 4MRRA 1G16A 1XF9A 2O8DB 1TF7A 3LXRA 4AG6A 5TARA 2SEMA 1QHIA 3OAAD 4DSNA 4EPXA 4LY6A 3VRZA 1YR7A 1ZIOA 3G0HA 2ED0A 1XBTA 3AP1A 5JCPA 1SGWA 3TBKA 4NL4H 4GBQA 4DLSA 5F2EA 2PBRA 1QHXA 3ZS9A 1RVDA 4F4CA 1T0JB 2HXYA 2ZE7A 3E70C 3FVQA 3SR0A 4C0AC 8OHMA 5KSZA 4P4SA 3M0QA 4D6PA 1GP2A 3VR4A 3AF4A 3L0SA 2YOHA 4XD7D 1XEFA 2GEVA 3GEHA 1QHSA 4J9HA 1TX4B 2L0XA 3ZVLA 2NQ2C 1C1YA 4PANA 1QVRA 1XCPA 3ASZA 4WIAA 4RZUA 1E7OA 3M1IA 4OKSA 3VKGA 1E0KA 4MQBA 2LJ0A 1PUJA 3CB4A 1Z28A 3C0CA 2KEAA 1IY1A 1PJRA 4ACAA 2ZJYA 5JWOA 1CP2A 1QHHA 2O0HA 5JJLA 3W6PA 1GRNA 4FD2A 5J47A 1BYIA 1K8RA 3MLEA 2W2VA 3TSWA 4URUR 2K5UA 5AK0A 4L9WA 4B73A 4AKIA 2QEQA 4NPHA 1W46A 1OH6A 4V0NA 3KQUA 1G3RA 4YDSA 1G19A 4HAZA 4B6EA 3ADCA 4AKHA 2O52A 4H1VA 1FMJA 1N6KA 5FPHA 2V9PA 1E0JA 3GFOA 3X1DA 2VLIA 1HD3A 1DOAA 4FMDF 4GSYA 1OW3B 1YU9A 1WX6A 4KFUA 5KSPA 3VR3A 2OCAA 2WAYA 2A5FA 4U00A 4Q7KA 3D6TB 4Q4JA 4DLWA 2B6HA 4JYBA 3KUDA 1Q0UA 4MYHA 2C8VA 3THXA 3EW9A 3PG5A 1VYUA 2JLXA 4OHWA 3OAAA 2Z6VA 5CK5A 2OCPA 2FZLA 2XZPA 2WMNB 4LPKA 1NLOC 1ANKA 2R6DA 2J0SA 2F1JA 5J40A 1J8MF 2DHRA 1RRFA 4PPNA 2AK5A 2ZI9A 4BZPA 1O87A 2K9GA 4IIOA 1T6NA 2KT1A 4AD8A 4RD2A 2GRJA 4XD7A 4D4MA 3C14C 5FI0B 2H17A 2QRNA 3M0RA 2J7IA 2P65A 2CE7A 4BRUA 4AC9A 1XEXA 1FTSA 2ZRIA 1ZW6A 2OSBA 4JLDA 2C0IA 3N2EA 4A8JA 1G18A 4B75A 4PC3A 1B0UA 1O3YA 5TV2A 5J4KA 5J4VA 1ZLMA 4L4UA 1Q3TA 4PAQA 1WB9A 4Q02A 4P32A 3BBPA 1BO6A 3C16C 4NU0A 1ZD8A 3X2SA 4B74A 3CX6A 4LPSA 2WWXA 4BFWA 1L4YA 3CF2A 4QJ5A 5DNYB 1Z07A 2QP3A 4LJ4A 2PTKA 3NH6A 2ZSAA 2EYZA 2DBKA 3BRWD 1JB1A 1OB2A 2GTOA 5FUYA 1SVOA 3AKEA 4TL7A 4JJKA 2AK2A 2AXPA 2YUPA 1MOZA 1DAHA 3QKSB 1W4RA 2IYSA 3UA7A 3LDAA 1AOJA 3SEMA 3WMFA 4GPTA 1MRNA 1Z08A 4Q1AA 1H3HA 3ZJYA 1DVRA 1E98A 3FMOB 3FE2A 1IY2A 3IIMA 2ZRCA 1XXHE 1R5OA 4DDTA 1NG9A 1HUQA 5DI3A 1GRRA 1WDTA 3UMSA 4A92A 2JLZA 1F3OA 1BBZA 2V1QA 4QBHA 3EIHA 1HJDA 2KT8A 1CULC 2DX1A 3CLVA 1CJMA 2EW1A 3IEUA 3NPFA 4RUGA 2L2PA 1KI1A 5FPYA 5C46F 2ZI6A 5KNCA 1KZ7B 4MH0R 4O2RA 1EWQA 1F2TB 2J7KA 1GBQA 4UQOA 1QWFA 1TQ2A 1S9DA 5K8TA 2ZYWX 2J0QA 1AZGB 3PCRB 1E9RA 1I2DA 2R8RA 3M0EA 3QF4A 2IW3A 2DM1A 3QUSA 4YDHB 5AUQA 3GLHA 1Z9ZA 1NKTA 4ZI3A 1XTJA 2K6DA 5L3SB 4XWKA 2GZDA 4ESVA 1N6OA 3V4FA 3N5CA 3VS4A 2E87A 1KZGB 2N1BA 2YINC 1G8YA 4MYTA 5EE0A 4OMLA 2PCLA 4A36A 1NMXA 2O88A 4KSCA 4LJ5A 1R10A 2KJQA 3CRRA 4DCNA 2DILA 3DL0A 5JSZA 3IEVA 5B2ZA 2F43B 1JR6A 3I9QA 4RTYA 2QU8A 3CBQA 1AVZC 1DO0A 3R20A 1XJ0A 4KODA 2ODBA 4LBYA 4PAOA 4LYHA 3THWA 1N6RA 4PC1A 2QROA 3QE0A 3I8SA 2RN8A 3GJ3A 1YR6A 1TEXA 1R7RA 1E69A 4FI3C 5HE9A 2OAWA 5FR2A 1GCPA 1JEDA 3QVVA 4A2PA 1JR3E 4ILEA 4JZ3A 2HCJB 1KNQA 3MWKA 4Z8YA 1KAOA 2BC9A 1A7JA 2XTMA 2QI9C 5CDFA 4Q1CA 4RTTA 2VHCA 4O25A 4HZIA 2RQWA 5CYOA 1Q12A 5EP4A 1CXZA 4C0JA 1G7TA 1MO6A 5JWRA 4EKDA 3SU8A 1ZUKA 3MGCA 4OJKA 1EX7A 2QP9X 2WJHA 3IQXA 2J3EA 2F9MA 1KAGA 2V6JA 3SS8A 3RNJA 1Z0DA 1XPOA 1UECA 1D8TA 1M3CA 1RJ9A 1W47A 1MRSA 1FPMA 3BB3A 4Q1BA 2A08A 3F8TA 1ZUHA 3AVVA 2XMFA 1GKIA 1ELOA 3BXZA 1BYUA 3FDIA 2V7QA 4JLOA 1OXTA 1AD5A 1U3OA 3VS0A 4ZO4A 2OJ2A 5AJYA 1XD2A 4ZDWA 4LE9A 3B13B 4B2IA 1E9CA 1CF4A 1G2BA 3BS4A 5C18A 2HUPA 3U7GA 2LX7A 2D06A 4RD1A 4PQFA 5FBVB 4U7DA 1CKAA 2EYWA 4NCHA 4TTQA 2AKLA 1G64A 3EG2A 4OQNA 4FCVA 1U8AA 4FMCF 4C4PA 1LW7A 1N2CE 3X1WA 4UNRA 1SRLA 5KDDA 2ONKA 2MSDB 2QQEA 3CNNA 3RS4A 1XTQA 3FFAA 1AK2A 2CJWA 3QKRA 4LHVA 4NYIQ 4V03A 1E2IA 2ASEA 3WNBA 3ZYCA 3PQCA 2R6CA 2EVRA 3P26A 2XTNA 2BM0A 2NO7A 3KJHA 4YMUA 4RFSA 3E2IA 1D6JA 4AYXA 2NWMA 3L0PA 3TAHA 1KKMA 2YHSA 2OE2A 5FUVA 5JCZA 4DDUA 1CR1A 2KGTA 3OIYA 5HPYB 2KWIA 1IHUA 2ZE5A 2OFXA 3LNCA 2WAXA 4RFVA 4A8JC 1NMYA 2YOGA 1W1WA 4G5RA 5TB5A 1DAGA 1TQDA 2V4ZA 2ESWA 4B48A 5HR5A 2XXAB 2JJ2A 2CCJA 2GZAA 1M7BA 1QHYA 4EFNA 2JDID 4FIDA 4J9DA 1NG2A 4WXPA 2PT5A 2DB3A 2WIAA 1KI8A 2WJYA 2FJUA 1M30A 4G1UC 4Q1DA 3VR2A 4EAQA 5C4MA 1KHTA 4N1AA 1AA9A 1KO7A 1UDLA 4IDPA 1NN0A 2ZU6A 4Z8XA 4TQAA 3DDCA 4FWTA 3L2OB 3QY0A 1U8YA 2EGCA 3MJHA 1OB5A 2HEIA 1UFQA 5LB2A 3SBEA 1IY0A 4TWZA 4US1R 2PZEA 4B33A 2J6KA 2CDTA 4XTCS 5UKDA 3U3KA 4X8MA 2VL7A 3AVOA 4MRNA 3B2EA 2J0VA 2QT0A 2DMOA 1XXHA 4URVR 2JA1A 3ADKA 1GKYA 1OF1A 5DE3A 2FG0A 3SBDA 2ORVA 1JXMA 1WA7A 1CRQA 1GILA 3O47A 4S2EA 2RGNA 2BZYA 1NJFA 1BIFA 3FFBA 4M22A 2HDAA 1G5PA 2QUZA 3PIRA 4IDNA 4QHSA 5TY0A 4ZCIA 1X8KA 1ZJ6A 4IOJA 4BFSA 1JBKA 2BVNA 1SHKA 5FOTA 3V4RA 2CE2X 2CLCX 1YR8A 2GQIA 2R62A 3OIWA 1CS4C 2FFQA 3ZDQA 2OBMA 5FUWA 3QPUA 1GAJA 1MO4A 1VECA 2VBCA 4BLPA 3TVDA 4Z51A 2Z43A 4HB3A 3DMDA 3NDBB 1U5SA 3CX8A 3H0KA 1VHTA 4J9CA 4HUQB 4V02A 5E7IA 4ESRA 1LS6A 3DVLA 2JLUA 1GFDA 2RHMA 2G1JA 3FMPB 1P73A 4EJSA 4K46A 2GXUA 1FZQA 3K0EA 1E6CA 3X1ZA 5TMPA 4M21A 1NEBA 5FW9A 3QBVA 5H68A 3FKSD 2O5VA 3LBNA 3U4QA 3T1TA 2ZRPA 2JDIA 2JS2A 5AJWA 2SHKA 4RD6A 1QHGA 4P33A 2V55B 1XB2A 4TQ9A 2AKYA 4TMVA 1SVKA 2GETA 1FW6A 3ND9A 4EUNA 2QSYA 2RNAA 2V54A 4MGIR 3EPLA 1FP6A 4GBMA 3A4NA 3QEJA 5A4JA 1T9HA 4C7OB 1GNRA 1LY1A 1ZD1A 2CL7X 3EG5A 4RTZA 3NHAA 4CC3A 4IVRA 4NYJQ 6Q21A 4A0GA 3CR8A 1IN4A 2JAQA 3TW4A 3U23A 3PUXA 3L8ZA 1P5ZB 2O31A 2O0JA 2ECZA 1CJUC 2ZSEA 2IYYA 5IF9A 3GLFE 1S9HA 2HF8A 1ZP6A 2D62A 3Q8XB 3C5HA 1PKSA 3ZQJA 2I0NA 1K9AA 2X2FA 3LQQA 4KO8A 1J70A 4HAXA 3CR7A 4PPGA 4IW3B 3UKDA 2BWJA 5KPDA 1DAEA 4RTUA 5DLQC 1XTRA 4B71A 1EWRA 4M4SA 2OESA 2RQUA 1NVVR 4C0KA 4LJAA 5CK4A 1UG1A 2LQWA 1AS0A 1FNNA 1EGAA 1IXRC 1DG1G 2C9OA 4G01B 1OFIA 2ZQ5A 3WYAA 2R6FA 1KI2A 1W2GA 5BN4A 5CIWA 2A37A 1KI3A 4M1OA 2QT1A 3DKVA 2DNUA 3RS5A 4G5GA 1MKYA 5C4GB 2O0KA 3HWSA 2NO0A 2BEKA 1Z6GA 4HSEA 4JKYA 4AG5A 5JHHB 1NJGA 4Q9LA 2FA9A 4HVWA 1X8JA 2VP9A 3QG1A 4QM6A 2WWFA 2FSGA 5DI9A 2DL3A 3PEVA 4G3XA 4JBXA 1U0LA 4AURA 4LHYA 1GRQA 2Z0MA 2MSCB 1ZIPA 3FKSA 2GILA 4DSTA 4C2UA 2PMKA 3EZ7A 5JJKA 4QC2A 4FMBB 1UKYA 4S35A 1YJ5A 3AP3A 3U6KA 5EXXA 2GKSA 2WKPA 2QZ4A 3EC1A 4IOMA 2YSQA 2XGJA 3O8CA 3RC8A 3SQXA 4O0MA 1HV8A 1E9AA 5DIFA 1ZBDA 2ABLA 5CLQA 4TMWA 2FEMA 2X77A 3T06B 3JZAA 1G5RA 4LHZA 2QM7A 2FNAA 2WICA 4Q4AA 4ARZB 4OI2A 2MIOA 3PE0A 1ARKA 2GAOA 1X6GA 2JGNA 2YC2C 3VS5A 4GMDA 1OOTA 4V0ME 3FYHA 4DWJA 3KTAB 1WXQA 3H41A 4OMNA 4X8HA 5G3ZA 4TLEA 1P6XA 1TTTA 2XSZD 4I1UA 1E96A 3EPJA 1UHCA 1SXJE 4DT1A 4Q9JA 2GXQA 1OH7A 3EWSA 4BFTA 2R6AA 4PZLA 2QQ0A 4UNQA 4YQFA 3K0AB 4CEHB 4B3FX 1KMHA 1Z0IA 1AEYA 2F1HA 4DUGA 3F0TA 1XPRA 2DVJA 3AF2A 3AVPA 3OEED 4PX9A 4B34A 4N3NA 3ZD6A 4CC4B 2X8AA 2ZEJA 4G5QA 5E7JA 4EPYA 4TLDA 1KDOA 1JPJA 1UEJA 1U0HC 2B92A 2VPPA 1PLLA 4M2LA 3RWOA 1ESMA 2QPTA 1RFLA 2GBQA 5CM9C 1WCV1 2GNCA 3CM0A 4FCWA 3C7KA 4PAMA 5CB8A 1U98A 4GP6A 3PJRA 5KDOA 3UK6A 2ZETA 3ASYA 1JEEA 3FGNA 1IAQA 4XOIA 3OIUA 5G40A 1S2MA 3R7WA 4JMPA 1M7HA 5JEDA 1YHNA 4HZUA 2RGAA 2IHBA 1E9BA 2A2ZA 4IDQA 4FWIB 4HB4A 4LYJA 1P2SA 1SVMA 2GF0A 2OUKA 2ORWA 2ZE6A 4BFYA 1K5DA 2BM1A 5P21A 1R0YA 4Z8AA 3WMEA 4CEJA 2ZS7A 1E1RD 4AFUC 3AUXA 4FCTA 4LC0A 4D81A 4PPFA 4P4UA 3WP1B 3QXXA 1E9EA 3B9QA 1ZCAA 1ZX6A 4X1VA 1VDZA 4EDHA 4IOKA 3HDTA 1A1VA 2IBMA 1PZNA 5GJVB 1W2HA 1UDXA 2IHYA 3LA6A 2N46A 1YZNA 2WMOB 2Q0HA 3LQRA 4I1SA 4C0BA 1BK2A 1OLOA 3R8CA 1S3GA 4OMOA 2AFIE 2ZROA 4D4LA 3GJ6A 3TNFA 1NN1A 1VYVA 3UWKA 1M3AA 1E2DA 3MG9A 2I3BA 4D4JA 2RH5A 3TUIC 621PA 4RD4A 1X86B 3W34A 4LJ9A 3TIFA 2XSZA 2EGEA 1XTKA 1U99A 2DFLA 3RSOA 3UG7A 3M4YA 3AKCA 4BPBA 1XPUA 4WAUA 1GL6A 2IWHA 5B58C 1BS1A 3OEEA 4NZYA 4ITRC 1KMQA 3PEUA 3P27A 4BFZA 1F6BA 3BFKA 1KJZA 3WRYC 1LCKA 4Q7MB 4PSKA 2FPLA 4LV8B 2PLFA 4NCIA 4OYHA 3K70B 3U6BA 4NKRA 3GLFA 3NWJA 1T3LA 5ECAA 4KFTA 4KYUA 4MDEA 1PHTA 1DS6A 3DO6A 4BEBA 1X2KA 3BB4A 2YVUA 5KNBA 3C4JA 1W4CA 2KE9A 1SXJD 3LWNA 4DLRA 1XEWY 1JXOA 821PA 3ADDA 4NDZA 1XWIA 3LY5A 4Q19A 3VX4A 4CEIB 2KI5A 1QCFA 2OM2A 2W83A 4DIEA 4LX0A 3T35A 4TLCA 2BTTA 1D5CA 4BWYA 4X8LA 2ZRGA 4G0NA 1S96A 4BEJA 4TYPA 5CM8B 1P75A 2P6RA 1JAIA 4HLQB 4LRWA 4DCTA 2YV5A 4NYMQ 4R2HA 1E1RA 1LVGA 1OEBA 1G8PA 3LBHA 3SOPA 1FTNA 4QGGA 3WRXC 521PA 4DB2A 2BBTA 4TSFA 3TRFA 3I5SA 5D3MA 3TGPA 3KQLA 1G3MA 3PITA 4LCBA 1BMFD 4ZKDA 5GADl 4LSGA 3EG0A 5EC7A 2QPOA 4CDGA 3A4LA 2P6NA 4QBIA 2V3CC 1UKVY 1TEVA 3BE4A 3N70A 3BB1A 4UXHA 1I07A 1AS2A 4EPWA 4HB2A 2D4HA 2V1UA 4IDOA 4WCIA 2NIPA 3THYA 3PEYA 2VP0A 3AQ4A 3BORA 2DJQA 1KI6A 1S1MA 2GCOB 3QG5A 2W6JD 3GLIE 2CUDA 1VMAA 2Z4RA 4PO1A 3NIBA 4OHVA 3JVVA 3V00A 2D74A 3OHMA 4GOKA 4FN5A 4TN1A 3LW7A 2IF2A 3U5ZB 3BFVA 2QGZA 4R98A 3AUYA 4JJBA 3QIAA 5LPNA 2CNWA 1YP5A 2W58A 1NBME 5DYGA 4NP6A 1E2QA 4L15A 4DCSA 3EZ6A 2J7PD 2ZIAA 5JS8A 4RCZA 1XMSA 3MD0A 4Q9IA 4ZKEA 5HKKD 1TADA 3WYFA 3TUZC 1ABOA 1JECA 5KPJA 2ZRMA 1GG2A 1X6VA 3AVYA 4AY2A 1KO8A 5FH9A 2J1LA 2AD5A 4Q4HB 1SXJA 1EFRD 2B8TA 1I4TD 1E2FA 2VF8A 2ERYA 4DXAA 3THKA 2ZRFA 2ZR9A 1WRBA 2JT4A 3VU9A 4YXWD 4JL8A 2PL3A 4IHQA 2R44A 3GCGA 4QHTA 2IS1A 4N0EA 3EXAA 3M0PA 5IXFA 1M6NA 2ZSBA 3EASA 4JT2A 3I5XA 1W4AA 2QSZA 1OPXA 4RZXA 4B3CA 1UADA 1OHHA 4XSGA 2JJ1A 2PJZA 1F2UA 1QHHB 1Z6TA 4WOPA 1E2LA 5B57C 4KBFA 2BMJA 2C2HA 2O2OA 1QG2A 2X1VA 4JZ4A 4A63B 2O8DA 2HDNB 4RKFA 1NSTA 2ZJOA 3IHLA 2FFBA 1T3SA 2C0OA 2ZRAA 5KUTA 1A0NB 3A37A 5F98A 3CPEA 3SHWA 4F4JA 2QGNA 2REOA 1HA3A 3BFXA 1T0JA 1VA7A 1ETUA 2W6JA 4YC7A 1OXSC 2REBA 3QKUA 2NO6A 2LKCA 2HEQA 1RYHA 3TKLA 1G7SA 1NP6A 3E1SA 4XH9B 1W0KD 3TR5A 3PVQA 2A30A 4LBVA 3PUWA 2FSFA 4PSVA 1OIVA 3RHFA 4C0SA 4DLTA 2AKKA 3W8RA 3UIEA 3SNHA 3SN6A 5FPSA 2J7PA 2WOOA 3KJEA 1OJLA 4RTWA 1M7GA 5LDDC 3MUFA 2O8CB 2LP5A 1W6XA 2WIBA 3AKDA 2L3PA 2M51A 2RQTA 2O8FB 2RGDA 2OFOA 4OHZA 3B1ZA 1KI7A 1TU3A 2KRNA 1CR0A 2A5YB 1AWXA 2ZYTX 2P3SA 4MRSA 2IYVA 4JKIA 2OHFA 1S0UA 1DTSA 2ZJ2A 4G5SA 4NHOA 5IHPA 1NLFA 5BWMA 4DDVA 4YXWA 1OFHA 3PEWA 4D25A 4FXPA 2MCNA 3VNVA 5B64A 1G6OA 5GJVC 1JALA 3ETLA 2LNHB 1A5TA 3KB1A 4QHYA 2FRYA 5JI3E 2LJ1A 3SEAA 1EFCA 2RKOA 2CMKA 4GRAA 3ZH9B 4KITB 2B86A 3A98A 1GNPA 4KSBA 2WJGA 4GLMA 4FMCB 4HUTA 4Q48A 1LTQA 2QAGB 2B7CA 4Z54A 1W49A 1YZLA 4GZMA 4HDOB 2B21A 1MUZA 3L43A 5GJWB 2AHOA 4KU4A 1K1ZA 4QXAA 2DBYA 4D0GA 5GVSA 3FKQA 2BOVA 2QPAA 3OZXA 4EQ6B 2P5TB 3GLIB 1IM2A 1NKSA 2JLQA 5LBIA 4P4TA 4LJ7A 4UNPA 1AWJA 3NEJA 4NCKA 1D9ZA 2CHQA 2G6BA 4KV9A 3B1XA 5FL7D 1VIAA 1KSGA 3PXGA 4MUBA 1OH5A 4CT4B 2KBTA 1VIYA 3LAWA 4M53A 5H1YA 2R65A 4NYIR 2WVJA 5IHKA 2EBPA 1VG8A 1QKXA 1YRBA 3TUJC 1GSIA 5HE8A 3PUYA 1H8HD 4PZYA 3IO3A 3OFND 1ZM9A 1WBDA 4QBGB 2ECKA 5JRZA 5FOSA 1SVWA 4D82A 2EWVA 1UJ2A 3H0IA 2W2XA 2JMAA 5M04A 1RRGA 4Q00A 1N0VC 4KBGA 4WVFA 1F48A 3SQWA 1S4QA 5ANRB 5DHFA 2I4IA 2XTZA 4MYCA 1IJEA 1KFZA 1G3IA 3GLGB 1MR3F 1VCIA 2OG2A 4ERNA 4B3GA 1II8B 4PXAA 3PVSA 1W48A 3KXKA 2BV3A 4B6FA 3B60A 1OV3A 2IYQA 2ZI5A 3TSOA 2W10A 1FL9A 2OBLA 3T15A 2WWGA 1LF0A 1FUUA 3QKSA 1UKEA 1XTIA 3L0IB 1UEIA 3W6NA 4O3MA 1N25A 3I4LA 5HCKA 1SVIA 3SJZA 3DOEA 3TK1A 4B2LA 3BJIC 4C9BA 4CVNA 1EX6A 4MGZR 2GZHA 3ZLJA 1Y3AA 2C0TA 4M9QA 3GEIA 4B3DA 4MGYR 1SXJC 2IWRA 1WXBA 4AK9A 3LBIA 2ZAOA 4LI0A 2G6FX 5LB4A 3TMKA 4JLVA 3GEEA 1K4US 4PHFA 5SZIA 2IXFA 2PX3A 4PC6A 2K3BA 1P2TA 3VS7A 3IGFA 1KO5A 3NVAA 4C0LA 1X6BA 1J7KA 4TL6A 5AUOB 4OQLA 2PLRA 4TMZA 3SDZA 1T0HB 5AWFC 5C1BA 5FL7A 2J0UB 1NIPA 4D8KA 3FB4A 2A28A 3ADBA 3CRQA 2WWWA 2R9VA 1G21E 1F2TA 4XSHA 2DA9A 1KSHA 1JQJC 2EQBA 2CBZA 2KBEA 1DAKA 1E9FA 4Z88A 1EG7A 1Q1EA 1WMSA 1YZUA 2FMXA 2FV8A 3K0SA 4Q1FA 3OFNA 2EGAA 5I22A 3VNUA 1PWTA 1XJCA 2CT3A 5L3SA 1H8KA 4PQYA 2HXSA 1QVAA 1COWD 5ELXA 1GUAA 3RABA 1QHNA 4D8DA 1E2MA 4F14A 3L8YA 2GJ9A 1PRMC 2OCBA 4JVSB 4Y0VA 5JHGB 1I1JA 4A2WA 1L8QA 5H70A 2AWNA 1SHZA 1R6BX 2F43A 3NEYA 5CJ2A 2YUNA 2VVKA 3VRYA 3DMNA 1AQUA 4JYCA 3KZ1E 4JLKA 1E79D 1KYIA 2QTHA 1M1YE 2WJIA 3AB3A 4LV6A 4CGZA 1IOZA 3EZFA 4KCGA 3A1WA 4RSGA 2NZJA 3P4YA 2AZSA 1G3QA 4F93B 3K09A 1C4OA 3LVRE 1KDTA 4NYJR 2E9SA 4Q9KA 5EQTA 1V5WA 5BN3A 1R0WA 2OV2A 3A6PC 4AKGA 1IJFA 3AF3A 3LFUA 4B44A 3GJ8A 2IYXA 3MAAC 4JT4A 4W7SA 2G9NA 2XEXA 5EXTA 1GFCA 3K1JA 4JLNA 4BFUA 2YC4C 2JM8A 2G0TA 4J9GA 3SZRA 2OEPA 1TUEA 5FI1B 5KSOA 2F9LA 5IT5A 3D7MA 4BFVA 5KNDA 1U9IA 2D7DA 3FHOA 1KY3A 5IK2D 1VCOA 3K0FB 1LFDB 2DLPA 5EE9A 4DRZA 4K11A 3R8FA 3GBQA 1OT3A 1K6MA 1M34E 2MMGA 1GCQC 3QNUA 3CF6R 4M1TA 2ANBA 1QKWA 2CEAA 4ABYA 4OI4A 3W5JA 1NL3A 2DWPA 3BWDD 4Q5IA 2GCNA 3DZ8A 3I5YA 1OYWA 4ZIRB 4DCVA 1W1FA 1M74A 1KTVA 2WWIA 2P6UA 2YWFA 2XB2A 5BYKA 1XD8A 2VP4A 1G1MA 2CREA 1SZPA 1U81A 4NBSA 4TYWA 3QWYA 2G83A 2ZR0A 5TVKA 2BEJA 4BQSA 3VS3A 1X1RA 3AP2A 1KO4A 4KFRA 4OQXA 1G4AE 2ZJ5A 4LHWA 4QKQA 3LW8A 4BECA 4KVAA 2X3WD 1KI9A 2B8WA 4DB4A 4XVQA 4IJMA 1GFIA 4JLJA 5F9FA 1KK0A 1H92A 2NTYC 4ZCMA 2QBYB 4EIKA 2ZJBA 1QZXA 4RVCA 2JTEA 3RYTC 5KOYA 2IUSA 3TLXA 3LVQE 5L3VA 4LV5B 3BC1A 2WTUA 4E09A 1N5ZA 1E79A 2J9RA 1YRAA 2UKDA 1D9XA 1JR3D 2FPDA 1YWPA 2IK8A 3K9GA 3I62A 1T5IA 2HF9A 3GFPA 3CNLA 2QAGC 3FHTA 2WPDD 3NBZC 4QNMA 3I3SR 3SFVA 1AS3A 5GJWC 2XXAA 1RW4A 4BE7B 4ZDJA 4GNKA 1NY6A 2J87A 1TAGA 2BMDA 3B85A 2FU5C 1U2RA 4RTVA 3K9LA 1FQJA 2JEOA 3VFDA 1UF9A 2YJTD 3REAB 2C98A 2WV9A 3LV8A 4LJ6A 1Z63A 4ACBA 1NIJA 1Q44A 4EPVA 1GM5A 3A1VA 2ZUDA 1IQPA 4QGHA 2F1IA 1J2JA 3UG6A 4I1VA 1QDEA 2YWGA 3ZVRA 5AR1A 1HE1C 5FTJA 1G8FA 2DFTA 2ZSDA 4XTRA 3GJ5A 4IKEA 5EZ6B 1DELA 1FYNA 4DDWA 5BXQC 1NM7A 2OBNA 2DFKB 3KQKA 1AGPA 1OE0A 1ZU4A 3B9PA 5SZHB 3VQTA 4I99A 4B47A 1IONA 1KSJA 1XMVA 4A1FA 4XIGS 1JO8A 1FX0B 3HP1A 4OBEA 2J5XA 4Q18A 2DL8A 4A82A 2HJVA 2ZM5A 3O5ZA 2ZRNA 1XCGB 4D4KA 2DRMA 2YOFA 1Z2AA 3WMGA 1M8MA 1E4VA 2EWWA 2EYXA 4DBLC 3FWYA 4LHXA 2GEDA 4OQMA 2VYFA 4UXJA 4KI0A 2DBMA 1MV5A 1OV4A 5FFMA 2DL7A 2FO0A 1J90A 2LQNA 1NF3A 2VHJA 4Q01A 1Z6XA 3KL4A 5FL3A 3U44B 4LDJA 4URYR 3DZDA 3ZZTA 3ZVNA 2BJVA 3ZD7A 3BH7A 2D1XA 1AWOA 1VKJA 2ZS8A 3AVXA 1DAIA 3AM1A 3CPHA 3UANA 3K8YA 2VEDA 3U61B 5D3QA 1FUKA 2DYBA 2C77A 4OK3A 4K81B 4HUQA 2ODEA 3T1VA 2FSHA 1KI4A 1JR3A 1T8UA 1RZ3A 2Z5FA 3CWQA 3UMFA 2FEOA 2PMDA 2DWQA 1XOVA 1E2HA 5L3QB 2WPDA 2ZJAA 5CLLA 3PUVA 4G5OA 1OSNA 1ODFA 1EFHA 2W00A 4BZQA 1QWEA 1W36D 5FOXA 2IYZA 3DPUA 3PENA 2QTVB 2C9YA 3RS3A 3K53A 1P3JA 2V6IA 1G83A 2KSQA 3CZPA 3QPWA 1YZKA 1MV3A 1E4YA 1I4LD 1II0A 4GI7A 2W0MA 4E6RA 2GK6A 1XDBA 1NLPC 4JLBA 4DVGA 4FSSA 1C9KA 4H9GA 4E03A 4C7OA 1EXMA 1ZSGA 3OEHD 3QOFA 4HLUA 3S1AB 5EJEA 721PA 1X8LA 3K09C 5FTNA 3TH5A 2O8BB 3V9PA 2Q3HA 4JPBW 1CKBA 3VS6A 1H65A 4NONA 5BN5A 1AM4D 3ZGXA 3U3OA 3GFTA 2ZPTX 1ESNA 2CVHA 4JVLA 2FH5B 5K8LA 3NC0C 2W0SA 2UVQA 2RGGA 1JU5C 4AFQC 1NVUQ 1FOEB 4HAUA 3RRNA 3VR6A 4C3ZA 3ZVMA 1UHFA 4DEXA 4A15A 1D2EA 1LF5A 2A5DA 2E5KA 2ZREA 3H2YA 3AGPA 4MKGA 4MRVA 4XWOA 1JQQA 2B7BA 1KDRA 1P72A 1T91A 2IS4A 2HLDD 3W9YA 1W36B 2QY9A 2AWOA 4IFBA 3HU3A 2GXSA 1U9IC 1EFUA 5DH9A 1A82A 4Z1MD 1BB9A 2O8EB 4UJ5A 1Z2CA 2GDJA 3B5JA 1Z06A 1KKLA 2ZANA 3I1FA 4HATA 1G6HA 2GJSA 4NTZA 5CIQA 4LBWA 4POAA 1KK1A 5EP2A 3FHCB 1A4RA 3LX8A 3P20A 1R0ZA 2K2MA 2QN6A 1WXUA 4ZDKA 4UJ3A 2A78A 4NYMR 1FFHA 4JL5A 1CJVC 4PO8A 4JJCA 2QRZA 2ZJZA 3AKYA 3CNOA 3RBBB 1US8B 2A5JA 3CF0A 3GJ7A 1IXSB 2H5EA 2ZYVX 3DEFA 1W70A 3LRPA 2X19A 3RRMA 1Z6YA 2OI3A 3DM5A 3TSZA 4JIMA 3CONA 3T61A 3U3JA 3Q85A 4HCKA 3QXHA 3B1WA 4K8OA 1J3TA 2G88A 1K0XA 2HCKA 3O8DA 2AR7A 3KQNA 4LBZA 5JECA 4KAXA 3H86A 5BQ5A 2XZLA 4OMMA 1NN5A 2L0AA 5KU1A 2NO1A 2V1XA 1FNMA 4C30A 1YQTA 3O8RA 2EYYA 3EARA 4B76A 2J59A 2OFWA 3MFYA 1LS1A 2ATVA 2Z83A 4HVUA 5E3HA 2IYRA 5HTKA 2HCBA 3I73A 2VP6A 2J05A 2OCYC 1AKEA 4QRHA 4GT1A 4DHEA 3ICEA 3REBB 2CK3D 2NZ8A 4Q7JB 5EE3A 2FE4A 4A0RA 2PX0A 1PUIA 5GVRA 2DWOA 4L16A 4WBSA 2D0NA 1OYYA 1YWOA 4ARZA 5DGXA 1R8SA 1NVWQ 4DSUA 5BW8A 2H8HA 3KTAA 4R9UC 5DN6D 1E32A 3A58B 4RKEA 3NBXX 2IT1A 2ROLA 2IS2A 2PZ1A 4LUCA 2P5SA 3M0UA 1DADA 4CEHA 3K0AA 2CSQA 3F3YA 3B8HA 2ZI3A 1AQYA 4NMMA 1Z0FA 4IVPA 2H16A 1YE8A 3QENA 1SEMA 3Q9LA 1SKQA 5EE1A 1DE0A 3IPXA 1Y63A 4CYMA 1OFUX 1XZPA 3K70D 3VS1A 4XVUA 4W9MC 3VKWA 2FDCA 4ZPXA 1KK2A 2VQSA 3IBYA 3RS0A 2YKGA 1HT2E 1Z9QA 4PFSA 1MABB 4GDFA 1RLPC 2WSMA 3CRVA 3TQFA 5KO2A 2EQIA 1EFTA 2R2AA 2V8OA 2IA5A 3O8BA 1G41A 4LZZA 4QNRA 2FPKA 2WSSD 1ZUYA 3PFIA 4FMDB 1X2QA 1RRPA 2DFNA 2LMJA 1Y57A 2F3TA 2BMEA 4QL3A 4HXJA 3B1YA 4ZI2A 3X1XA 4UXIA 5FTLA 2JIZD 4Q21A 1J8YF 2GGRA 2FGJA 4A0HA 1UE9A 2YUQA 4M4ZA 3VKHA 1DG3A 4BZXA 3CRMA 2OILA 2CH4A 1KSFX 1KDPA 3U3RA 2F2WA 1HTWA 1P4SA 3MMPA 2NG1A 2W6ID 4YMWA 1OKKD 3EC2A 4HI0E 4AFSC 4F91B 1TG0A 1XFAA 2ZRJA 2ZXUA 4GL2A 1SHFA 2VO1A 1Q1QA 4I1OA 4B3BA 3QXSA 1W7AA 2RGBA 1X43A 4CIDA 2BKUA 3I32A 1RE0A 1IXZA 2PH1A 2GEUA 3AF1A 4HAVA 4EFMA 2H1LA 4TZ6A 3NBFA 4M8NE 4W5HA 1UBGA 4PC2A 5FBRB 1FMKA 1V1CA 1ZYUA 4F17A 221PA 4HLUC 1GWNA 4F38A 1TMKA 1X3SA 1TNDA 3NTUA 3FTQA 2J41A 3A1UA 4GMXA 2NO9A 1WXTA 121PA 2AX4A 1SVLA 2F1RA 4M9ZA 3THOA 2UZIR 3R9IA 1EK0A 2ODNA 5IH2A 3PUZA 1SRMA 2F55A 1N5KA 4C2TA 1MO5A 4URXR 2DR3A 1GL7A 2J6FA 3R9WA 4OHXA 1E9SA 1XX6A 4TLBA 1P9WA 3CWZA 4JBYA 1YKSA 3REFA 4A2QA 2CHGA 2QDLA 2Z4SA 2FFHA 4I81A 4LYFA 2QM8A 2WKQA 4TLAA 4CEIA 4MA4A 3UMRA 4BASA 3H0HA 1JJVA 1Z83A 2CLDX 5CJPA 1T8TA 3GMTA 2E1RA 3PR1A 1AWWA 4I4LA 5EUQB 4DLVA 1U06A 4KHZA 3K0CA 2WKRA 4URWR 1NVXQ 2QAJA 1W5SA 1E9DA 4EPRA 2ZITA 1JAHA 4QG7A 2JIZA 3CW2A 4IOLA 1KGDA 3NGPA 3QPVA 3H0FA 2M0YA 2G1KA 2IYWA 1KJYA 1SVSA 3AVQA 4OMPA 2AL7A 3FMFA 4EFLA 2W6IA 3VTKA 4BLSA 3I35A 1OKKA 4V0MA 421PA 4AFZC 1E0SA 4D26A 2PEYA 1E6GA 1A2KC 3P1JA 1OPKA 4P4SB 2VA8A 1OH8A 1W36C 3QXCA 4QM7A 1TUDA 1QLYA 2Q9AA 4EIWA 3UPUA 2EFHB 2AKAB 1NY5A 2GCOA 4B3XA 3AVUA 4Q47A 5K8IA 3GLGE 5IRCD 2ENMA 2YWEA 3MCAA 2RMKA 4V0OA 3SHFA 4AWXA 5IHNA 2QTFA 4N0DA 3GPLA 2A9KA 3QVUA 2J06A 1OXXK 3GLHE 1KO1A 4C0QC 5F9HA 1ZUIA 4UKDA 5JZVA 3ECCA 2XOKD 3BH6A 2A3RA 4J0QA 3VS2A 1UBCA 2AFHE 4M1SA 3SJBA 4ZCLA 1TUCA 2P2LA 2W0ZA 1UBFA 1BMFA 2LCSA 3P32A 2HBWA 2NPFA 4E07A 4PQRA 3I5RA 2JJ8A 1BU1A 3LH5A 4F7WA 1CJTC 4P3YA 4Q4HA 4RD3A 1AIPA 2AN9A 3HJNA 4FINA 1GKUB 2CL0X 1BH2A 4DZZA 2ATXA 3EHRA 3C8UA 2ZRLA 3SYKA 2ZS9A 1RUWA 4F92B 3WNDA 5FWCA 1MO3A 2BKEA 3F5FA 3CKLA 4Q4JB 3IDQA 3L82B 1HY3A 2G3YA 3VMFA 1NYFA 3ULRB 2JLYA 1IN7A 4H1UA 3AGQA 4PHHA 5HCNA 1VCNA 2WZQA 2YDLA 3U7HB 1M8PA 3THXB 5FBWB 2HYIC 3QSYA 2OO7A 1BOFA 1N5IA 5CDFE 1FP7A 1LNZA 3B7GA 3G82C 3OF5A 2J6OA 5EP1A 3WYGA 5HKKA 2I1QA 1LB1B 3GD7A 4YMVA 3BERA 5FUXA 3AH8A 2XNDD 2DY1A 3WBJA 2EU8A 3MJRA 4Q03A 2D7CA 4FW9A 1E2NA 2EFCB 2EW3A 1SQ5A 1ZNYA 1IO6A 1EFRA 2RAPA 2VKNA 4F16A 1PRLC 2GHIA 1KOFA 2JMCA 1RC8A 3RVBA 3T12A 1OXUA 2Q3FA 1M2OB 2QP4A 1XEXB 1NBMD 1VG1A 2C96A 2ZRDA 3MWLA 1GZSA 1SPKA 4DC9A 4A8JB 2RGXA 1N6PA 1N6HA 1XD9A 1I0CA 5E95A 4JLAA 3R9XA 3VHXA 5FTKA 2KXDA 1ONBA 2QMHA 2H18A 1GCQA 2XOKA 3ZQ6A 1VTKA 4D2IA 2IXGA 4RD0A 1JJ7A 1YR9A 2C78A 1NRJB 3EGUA 1IN8A 2OAP1 2QMUA 2O8CA 5B30A 1NEGA 4B35A 5JMTA 4Q4LA 2IX3A 2AXNA 2O8FA 3CH4B 3BOSA 3IQWA 2CH4W 1ZD9A 3EAQA 3IBGA 3KX2A 4OQFA 3RRYA 4OJQA 1UGVA 1X27A 2RCNA 2K79A 1B07A 1KJWA 3IKJA 4XVRA 2ZVPX 1Z47A 2IIMA 2NPIA 3SJCA 4PHTA 1YN8A 3MWYW 1ABQA 3G5UA 4AG2C 3QJYA 2P4RA 2KE5A 2ZR7A 2KB0A 2VHUA 1W0KA 2KNBB 3QWXX 3KB2A 5FOVA 2EFGA 3NC1C 5L8VA 3ICQB 4IXNA 1YZGA 5JFGA 1ZINA 5LD2B 5DI3B 4ZV4A 3K70C 3BGWA 1Q22A 4DLUA 2PNIA 2EVWX 1ZM7A 4YMSA 1F5NA 1Q1ZA 2H8KA 2XX3A 2YNMA 2HV8A 4DIDA 4ZDIA 2FF7A 2QAGA 2KBFA 1IN6A 2XJ9A 2ZI7A 2F6RA 2ORIA 2KRMA 1ZBJA 2P0EA 3ONWA 5DHAA 5FR1A 2CSIA 4W5WA 3Q5EA 4NCJA 3EG1A 1ZM2A 3GJXC 1JQLB 1ZUUA 4EQ6A 4ZNXA 3HYTA 2EFEB 3VHLB 1ZAKA 4AYTA 4TZ0A 3GLIA 2XNDA 3T5DA 1CEEA 4PTLA 3DOFA 4PZZA 5HZKA 1N0UA 2ZYUX 1EESA 1RYFA 3FOZA 1DAFA 3Q7QA 3K0CC 1G8HA 1SULA 3QF4B 4TL9A 2C95A 3U2QA 3ZZ0A 3EG3A 4ASUD 4BRWA 1JI0A 1U0JA 3GLHB 2ED1A 2JS0A 2RF0A 4ORZA 1AZTA 1R2QA 5EP3A 2CVFA 1NBMA 2IEYA 1E6HA 2Q9BA 1QG4A 3B78A 1Z0JA 1VYTA 3WY9A 3SC3A 4PR0A 3WNCA 2GF9A 4E22A 4BLTA 2ONJA 3U7EB 5G3YA 1E0AA 3IHWA 4B2PA 2FRWA 5JSZB 3SFZA 2ANCA 3QQ5A 4A4DA 4QJ3A 1D2NA 2FGKA 4LWZA 1G3UA 2X3XD 1Z8FA 3D3QA 4MITA 3THWB 2GAAA 1HQCA 4LJ8A 3JV3A 1I2MA 2JLRA 1II9A 4AIIA 1PV4A 1P60A 5GJBA 2V7QD 3KKQA 1RKBA 2QMEA 3IQLA 1XTSA 3GLGA 1ZC4A 4Q9HA 1KIMA 1II8A 2XAUA 1ZNWA 5KSYA 4M1WA 2JCSA 2OLJA 3BIFA 4HAYA 2BCJQ 3I8XA 4HYYA 4Q7LA 4D0NA 2HSPA 5E4FA 1NYGA 2IYUA 2ZSFA 3EZ9A 4R0KA 2P67A 1RI9A 2GTJA 2VHQA 2ZU0C 2FX3A 4CC7A 1W4BA 5KTYA 1H8HA 1M27C 5G53C 3UA6A 2H7VA 3TAUA 2ZAMA 1XMJA 4JSTA 2PCJA 2VSXA 3EIQA 4M1KA 5L23A 1E2GA 4IXMA 1H8ED 1Z5ZA 2DF6A 2KR3A 1RJ9B 1U8ZA 3VR5A 1HH4A 4TQUS 1YZTA 2GNOA 3MRSA 4W5JA 1GTVA 1NI3A 2L3QA 5F3WB 4D0LB 4IFEA 3EA5A 3HPQA 1T0HA 1CLUA 3BH0A 3NG1A 1KNXA 1XD2B 2J0UA 2JJ2D 4QBFA 4ASUA 4DCUA 2PT7A 1E1QD 2ZUCA 5CB6A 3NMZC 3IPYA 3CIOA 1SKYE 3W90A 2WWYA 3ZS8A 2YT6A 2CT4A 2OT3B 1ZM3A 4HEJA 1RLQC 4AG1C 1DO2A 1UDWA 4HLDA 5AJZA 5GJCA 2ODWA 3BD9A 4LGMA 4A0FA 2FFAA 3J81k 4J9FA 1JEGA 3NDPA 2CJWB 3QKRB 1WE2A 4AI6A 1G20E 2GWHA 3TQCA 1WI7A 2GCPA 4LK2A 2L3SA 2Q3MA 4OK6A 2BZXA 4RFSB 3DKPA 1NG1A 1JPNA 3NKVA 2BJWA 4RCYA 3EA0A 3GJ4A 4U02A 1TQ6A 3RANA 4KFSA 1TQ4A 3NBYC 5IDVA 1WDXA 3WHKA 4KRTA 1ZVQA 4URZR 1GNQA 3QI2A 4GFDA 4YLGA 3CPJB 2R6GA 1P7CA 1R8QA 5FPTA 1U90A 3Q3JB 1N6IA 3T34A 4QOSA 4LNPA 3ZL7C 3JZMA 4B43A 4OI0A 2RPNA 2QG6A 4KJZA 2YUOA 1W5TA 4BGDA 4QT7A 2RB4A 4E5UA 1GOTA 3EZ2A 4DKXA 2A36A 4YMTA 1WQ1R 3CO5A 2D8JA 2PEZA 1JNYA 1COWA 2FPEA 4LUDA 1HSQA 2BHRA 3KQHA 2F2XA 1AZSC 2H92A 1H8EA 1P62B 3RNLA 1NLYA 5JEEA 3B82A 1UAAA 2GJKA 1Z29A 2IC5A 1PKTA 4WZBE 4KYIB 4PO9A 1XNJA 1DPFA 3SE0A 1DARA 3BK7A 1Z3IX 2JLWA 2D2FA 1Y0MA 4BLRA 2LJ3A 1CR4A 4OI1A 3MSXA 1XXHB 3K0FA 2JW4A 1N5LA 2REXB 1G8GA 3D8BA 3KJIA 4ON9A 2WM9B 3CRW1 4Y92A 1E1QA 2JM9A 5JWHA 4A6XA 1N5JA 3VR1A 1WLPB 4J9EA 4MRPA 1L7VC 3OE7D 3REGA 4TT3D 1XP8A 2YZ2A 4DEYA 1TU4A 1NMZA 2ZVQX 4ZIRA 2GTPA 1E94E 2BBOA 2WBLC 3D31A 4J9IA 2CXXA 2BDTA 2KXCA 3BAFA 5AJXA 1KK3A 3C15C 3RAPR 3IIKA 4TL8A 4TMTA 3KJGA 1AGRA 2WHXA 4DLYA 3EHQA 2IXEA 5JLJA 5JS7A 2Q9CA 2AK3A 4GOJA 3T5GA 2J46A 2FG5A 4TYYA 4TTRA 3X1YA 1R4AA 3EIEA 1T5LA 5BYJA 4EJSB 2XZOA 3GP8A 1NSFA 5HCIA 3W6OA 2QBYA 1WP9A 4HVVA 2Q21A 4L5BA 3DM9B 5LD2C 5IK2A 5JRJA 1Z22A 1ZC3A 3JVUA 3EPHA 2XB4A 1NLZA 1WYXA 1S1CA 2HT1A 3U4QB 1L4UA 4GOXA 4LC1A 4WW0A 4R7ZA 4MKFA 2WOJA 3FMIA 5J4HA 3LLUA 2A5GA 4V0LA 3WBKA 4OMQA 3M6AA 1P9RA 3RWMB 4WXRA 1RRCA 2CCGA 1P2UA 2BBWA 2OLKA 3QEOA 5AUPB 4LOAA 2CUBA 3W3AA 3I61A 1IN5A 4TTPA 1E3MA 3RSLA 1G7RA 4L8GA 4PHGA 2FZ4A 1YCSB 4DLZA 2D3WA 2FN4A 3P4XA 2ZRBA 4M0LA 4MDFA 2VTKA 2Q6TA 3CZQA 1SKYB 3DHWC 3HU1A 2IEZA 1WIEA 1TL7C 3M0SA 3M0TA 4RY2A 1PNJA 1WA5A 4GP7A 5DYIA 2IS6A 2WJJA 5DISB 4JVMA 3QKTA 1S3SA 1OFTA 1R5NA 4OL0A 4PC7A 4JJZA 5EZ5A 5FPKA 3IUYA 1ZNXA 4KXFB 4DSOA 2XNSA 4HAWA 3OE7A 4PSAA 4Q66C 1FX0A 2V1RA 2XJ4A 2VF7A 4M9XA 4TT3A 3TE6A 5DO9A 1XCMA 1NN3A 2KROA 5JI2E 4JLPA 2C04A 1WF3A 4US0R 4X8OA 3LX5A 5CYPA 3PV0A 3SYLA 1QF9A 5IHIA 4MKHA 2QMOA 1N6LA 1Q21A 2D2EA 4YONB 4DJTA 4TYNA 2RHDA 1ZNZA 4QGFA 5CITA 3U44A 5KDLA 5IXBA 1RIFA 2YYZA 3W5IA 4ESHA 4IDHA 1G4UR 2JLVA 1S8FA 1XRJA 1UJ0A 1N0WA 2BIFA 2GBLA 1UTIA 2JASA 4XJXA 1FQKA 1VPLA 2CL6X 2IYLD 1N3BA 4HB0A 3HR8A 4JS0A 1OIXA 1WFWA 2EYQA 4F4IA 1LV7A 3WHLA 4DLXA 2TMKA 1UUEA 2QNRA 2F3RA 4JVNA 4M1YA 5L3QA 2BBSA 4DUGD 5EXPA 1Z0AA 1QBKC 2WWHA 3I92A 5AUNB 4WZ6A 1UM8A 2DRKA 4OHYA 2HJGA 4A9AA 4KVGA 2C5LA 1G291 5SZJA 4RJLA 2DL5A 1HEIA 1ZM4A 4RZ2A 4QFMA 3N2IA 1TF2A 2MMCA 3T1OA 1GL5A 4NH0A 1P2VA 3Q72A 3RDPA 1QRAA 1Z0KA 2C9CA 3IIJA 3KDSE 3S1AA 4Q4AB 1MH1A 2CDNA 1F60A
chains in the Genus database with same CATH superfamily
4CCSA 4MYUA 2P4SA 1TJ3A 1MG5A 3AIMA 1CBUA 5LJ3e 2UZ3A 3QWBA 4MV3A 2WKWA 4AY4A 1HT1E 2VIIA 3LLMA 5A5VA 1BKDR 3G2OA 1FMFA 2X2EA 4TTIA 1W25A 2ERXA 1JMVA 3HADA 5KX5F 5JCJD 4A8HA 3ZXYA 3JWGA 3H65A 2DOKA 2X13A 3LOQA 4ZYWA 4NULA 1XSEA 1VLVA 1QPZA 3UYKA 2WJAA 2QL7A 3F5MA 3AYZB 3FEOA 1ABEA 3FNHA 3PLRA 2DCUA 3AERB 3NKLA 5FOUA 1IREB 1Q0ZA 2PUVA 1ORWA 2VYNA 2ZSHA 3NHNA 4IRUB 2LW7A 3DLBA 1AKYA 2X0RA 4O4HF 2R86A 4EJSC 1MCZA 1S72Q 1GBRA 1CLEA 3BE8A 4J16A 2PGXA 1T6YA 1RPZA 2EF0A 1C81A 5AHRA 1Z38A 3B6EA 3GRZA 1D5WA 4MS1A 2OAQ1 3UA4A 4D80A 4N41A 1E2KA 1JNXX 1RLOA 3CC2A 4EUEA 1J39A 5C2JB 1N2GA 4RTXA 3VKIA 1J2UA 5SZKB 5C31A 1VCMA 6REQB 3DE5X 3WLKX 3QELA 3U1TA 4RTQA 3O3CA 3GG9A 1C0IA 1IZ8A 1SG6A 2BZ8A 3FOEC 5K8UA 2I2WA 3QXJA 1OVGA 1OHHD 4IX9A 3LLSA 3ANSA 3E61A 3CW8X 2H1IA 3OUUA 4IIMA 2PX4A 4FHDA 3DZGA 3MN1A 3L7KA 5LOVB 5I45A 2O59A 1KY2A 1H4QA 4U5XA 2OY0A 5KOJB 1CG6A 2D4AA 3DFIA 4II1A 5AT1B 3OA2A 3L8CA 4TQGA 2EQUA 4BNWA 1J6UA 2X5JO 3MCTA 3NIDB 4DLSA 4F4CA 5AVSA 6PFKA 3M4GA 3WQQA 2BUBA 4JI1B 3C5VA 4NBVA 2DSNA 4KO3S 1OULA 4Y6PA 4KEAA 3NT5A 2LJ0A 2HF2A 2IYOA 5E6RB 3EIFA 2OLEA 3R5HA 4FD2A 1RC0A 5CCBA 5AK0A 4MVJI 4L9WA 3I0NA 3NCTA 3HKBB 3ILXA 3NYIA 4QTXA 1HD3A 1UBKS 4KQ9A 1FNDA 1Z35A 4QDZA 4M7DE 2QEXA 4DLWA 1S8AA 3GN1A 3PG5A 4LY3A 2PD4A 3IBFA 5JY6A 1CUGA 1UXIA 4Z9BA 2F1JA 4R84A 4I4CA 2GNAA 4ZMBA 2WTXA 1XFDA 1VIMA 4M78D 2ZCUA 2R1UA 2COYA 2NUBA 5AXCA 1Q3TA 4PAQA 4Q02A 3SIWA 2CKKA 3CX6A 4BFWA 2GYYA 1HX7A 2DTDA 4MV1A 1V7CA 1ZOSA 3N2GA 3Q6MA 3VPXA 3WMFA 1MRNA 2RBKA 4HV4A 1IY2A 2Z9BA 4A92A 1Q6ZA 3G17A 3BHNA 2W22A 3CEJA 5THQA 4BO3A 2NX2A 4MH0R 4E2FA 2IZ5A 1GBQA 1QWFA 1S9DA 5JU6A 1W8DA 1PJQA 4EFDA 4OXKA 2PQMA 3TQTA 3O8OB 4A36A 2P75A 3OJ0A 3SCZA 4G24A 4R8KA 1HC7A 4ZQCB 5ALKA 5KU7A 3S55A 3QE0A 4U8GA 1IZ7A 2V6FA 2R1VB 3I4CA 1ZLYA 3ZHRA 1ZGBA 3JZDA 4BWVA 3TSAA 3FFTA 5CHEA 4O1IA 5CYOA 4YJ2B 4MTCA 1UPBA 1DUSA 4H0CA 3ORYA 2RH2A 1V1JA 1RZVA 2C7RA 4GR4A 3OQIA 5LQUA 1ZUHA 2PN1A 1BYUA 1U3OA 4P2BA 2C1XA 1V35A 4S12A 4U7DA 2WD8A 2XCUA 1U8AA 3G0DA 3N7AA 3FFAA 4BN0A 5C53B 5IM5A 3IUQA 4KRYA 4K6MA 4DDUA 2R00C 2XRMA 3JVEA 2QF7A 4WXPA 2ZKIA 1CZOA 4JD5A 1TFRA 3Q3CA 3DDCA 4IFTA 3ITKA 1N4DA 3HBAA 1L1EA 3KCNA 1F8UA 2J6KA 3PCTA 2YXEA 2O23A 2ORVA 1Q2UA 1YBFA 1WA7A 1U11A 1QF6A 1BTOA 2HDAA 2P8SA 2BHTA 2E4HA 3CUYA 2OTLT 1N5OX 1IEVA 1VHTA 4FYWB 1JG1A 3K0EA 3JATA 4L85A 1WDWB 3WIUA 5IAKA 1UKAA 5LYJA 4TQ9A 4O4HB 3V8EA 2GZRA 1HOTA 2RKBA 4RTZA 4NYJQ 4Q05A 2YLCA 3WRYA 2JI8A 1CT9A 4UU0A 3QWIA 5G0TA 2D62A 4OGLA 5IDWA 2C2KA 3CE6A 1JIUA 4B31A 4LJAA 5T7BA 2LQWA 3EXFB 2V4MA 2JAHA 4M7RA 5HF5A 3OCCA 5BN4A 1XDSA 4HTAA 4MINA 2XMQA 1UXOA 2UAGA 1Q2XA 3AEKB 3E81A 1VLHA 3SBXA 4DTCA 1ARZA 1OBVA 1LVHA 4UUAA 1E7MA 1ZBDA 2FMKA 2NYUA 3MJTA 5CA1B 4PRZA 3WLMA 2MIOA 3A25A 5GAN6 6YASA 2ZPAA 5KCZA 4OMNA 2R8YA 5G3ZA 5ICGA 3A6DA 1O5TA 4RDXA 5A04A 4PZLA 1SC3A 3CV3A 3VC1A 4N3NA 4CIXA 3AUJB 1EUQA 3OZ7A 3ZWPA 1JEEA 1KYTA 3FGNA 4OFBA 1H23A 3HCFA 3OIUA 4P9NA 4R0MA 2Z5LA 2DQZA 5H5JA 2G8NA 4JHLA 1J0BA 4ZHSA 3KRTA 4RLHA 2BM1A 4Z1OA 4Z8AA 4IMRA 2C31A 4A7PA 2C2OA 4LDUA 1V0JA 2Q5HA 5KYUA 4C0BA 3WTBA 2AFIE 3LVBA 1VYVA 5CT9A 2O7SA 2LZ0A 3MG9A 4DV2B 3DLCA 2RH5A 3DV2A 4D3FA 621PA 4KN8A 4LXYA 1J22A 1U99A 3MTAA 3UG7A 3M4YA 3L2UA 1EXNA 3H9GA 2IZ7A 1KMQA 4ITRC 1Z4KA 4JYZA 1KC8U 2JK1A 2SKCA 5FBZA 4DMMA 3TD9A 3U48A 3CUTA 3L79A 3AJDA 1ESCA 1CUWA 3WK8A 4J03A 3HVJA 3PXXA 1QCFA 2GHRA 4EABA 1NQ5A 1UBTS 1D5CA 4X8LA 1A95A 3BCSA 3D6HA 3C3MA 3ETCA 2QG9B 1CDZA 1ZCFA 5HF6A 4V1CA 2LQ8A 2Y6UA 3GEMA 1RNLA 5LFAA 3FF4A 3EG0A 1FDOA 3TOZA 1PIWA 2OAUA 3BPSA 1AS2A 5BXYA 3PNOA 1D0VA 1T8WA 2DJQA 1YB5A 1UJBA 3V8JA 3VR5H 2KLHA 1B34A 4G09A 5C4IA 1JLHA 3OLCX 1JFFB 3G8AA 2JS7A 4F6RB 2J7PD 4ZYZA 3WA6A 1TCBA 1WDKA 3JRWA 3SIPA 1GG2A 3T4UA 3A9WA 4R51A 3EBOA 1TMGE 5IKEA 5CR2A 2ZRFA 1WRBA 1G6Q1 3GCGA 2IS1A 4WBNA 4A4FA 4N12A 2P5YA 2ZSBA 1ISPA 2QRMA 4OSEA 4I9HA 2Z8YM 2BMJA 3NT4A 2ZXFA 5A6SB 3TXYA 3EYAA 2FXVA 2PXAA 1YTLA 4F4JA 1OXSC 2REBA 3BZUA 5EZYF 1BX3A 1RYEA 2JA2A 4DCJA 3QTLA 4W7HA 4R1MA 2R60A 2OHOA 3AXTA 4J6FA 4QPPA 1T0PA 2J9YB 2BTEA 3AKDA 3U7QA 1M83A 3TG2A 3TR6A 2XR1A 4G5SA 1NLFA 4IIEA 3KFLA 2FRYA 4QWMA 3A98A 1LPAB 3OJOA 3I3OA 5IJ9A 3L43A 3VA7A 3FKQA 3E9RA 1U7OA 3MJDA 1PG5B 2H1VA 4TXJA 2CHQA 4RA9A 1DXHA 4PZYA 2FPGB 2W2XA 3OMWA 4JNKA 1XEAA 5AESA 4YDRA 2YXYA 2OG2A 1AGYA 1XN4A 5FX2A 3C85A 2GK4A 1I7NA 4NOKA 2Q3JA 3D6FA 3T15A 5LJ5d 4NJEA 1VA5A 1O1YA 4CVNA 1KWGA 3B3QA 5BP7A 4B3DA 3FDZA 4JLVA 4MIYA 1X14A 3D2BA 5DHTA 4I5IA 3BMQB 1DMRA 3CISA 2IBSA 2HPVA 2BUCA 3O83A 2XQVA 4Z88A 1PKXA 3PPIA 1WMSA 3K0SA 2Q0QA 3HYNA 4AJ2A 3ZXIA 4X20A 1YAHA 2GFHA 1QVAA 4AT1B 1I2AA 3USCS 3VBCA 4U9UA 1R6BX 5JLAA 4JYCA 4KCGA 4EFKA 1KRWA 3G5LA 3WGGA 2OZKA 1ISIA 1U9CA 3QUIA 2VT2A 3KAPA 4LGYA 4MNTA 5EXTA 2HJRA 4DIMA 4J9GA 2OEPA 4GEKA 1TUEA 3QVTA 2DTIA 2C92A 2GKGA 1OT3A 5CDSA 1VL6A 3K4PA 4BNIA 1PL0A 4S1VA 4HGRA 3RU9A 3B8EA 1WULS 1X2BA 4GG1A 5TVKA 4MV9A 1KO4A 4FYVA 4J90A 1JLMA 3JQ8B 3ITEA 2IUSA 1YIDA 1RXWA 3GB9A 4PX3A 4P53A 2CZQA 1U2RA 4MVWA 1UF9A 1WKVA 4OVKA 2X1MA 2VZ9A 3I2GA 3HI4A 4XTRA 1DDOA 2YYAA 4UBLA 1QYDA 2CFSA 1VP9A 4U4AA 2ZM5A 2VK1A 2FPWA 5HTOA 5FL3A 1KP2A 3F1LA 4QVDA 5AM3A 2D1XA 4L0DA 2VEDA 4LFBB 1N8RU 5JDCA 4PZDA 3ZNQA 4F5YA 4FEAA 4PIVA 4FEEA 1XNGA 1EFHA 1PL6A 2Z3WA 5JALA 2QTVB 1B7TA 3H5NA 3KEQA 1I4LD 2GK6A 4FSSA 4PY2A 1Z4JA 1KL7A 2Q3HA 6LDHA 1TVMA 3FI9A 3ZHYA 4AMYA 1AM4D 3G2QA 3GFTA 5JO0A 3VGPA 1K6EA 1IPHA 1NUPA 2OP0A 2ZREA 2J3DA 3OOJA 2PHZA 4IIDA 3W9YA 1PGQA 5I01A 3GAMA 3GQBB 2GDJA 1KKLA 2DSTA 4YJKA 3PI7A 2ZSJA 1H2XA 3M5AA 1MEOA 4FL6A 3DEFA 4KIWA 3VO9A 4MMZB 4ANJA 1SCKA 2L42A 1DKPA 1NAHA 3KQNA 3CA8A 1DWQA 1OWLA 5JECA 3H86A 3GF4A 4OXIA 2EZ4A 2L0AA 2JL1A 3SXPA 2RHLA 4C92A 4UNIA 3MFYA 4UAUA 1Q7BA 4OBBA 2OCYC 2R97A 1TRHA 1L9XA 3RSGA 2JD2A 2WD7B 4WH0A 4HYTA 4MOWA 2EFIA 3VI3B 2WE7A 5YASA 3JVIA 5H9WA 3F3YA 3LUCA 4QARA 2O5CA 4FBGA 1L5SA 3I1JA 2AUMA 4QASA 1WD5A 4XVUA 3FLAA 2VQSA 4WHMA 1WZOA 2R2AA 1WJQA 2VXBA 5EZYB 5CCEA 3RC2A 5A1TA 2E18A 5DVZA 3ZDFA 5BPHA 2WPNA 1J8YF 4RL4A 3OMLA 1JW9B 1OI7A 1NX6A 4WLUA 3EUWA 5C7LO 3TGLA 4BUCA 4B3BA 4GQAA 4CIDA 2GEUA 5KVAA 1KAEA 4AJJA 3FTQA 3I1YA 3HV0A 2EJTA 2GM4A 4EHNA 2I76A 1UZNA 3EHEA 1K73C 4OM7A 3LWZA 2UZIR 3R9IA 4JBYA 4MPRA 4UC0A 1G8MA 1WLSA 3IOMA 4W9NA 4MA4A 5CG1A 1Z83A 1JVNA 1DOHA 4UZEA 1GGFA 1FRQA 2BKDN 2ZITA 3ZE7A 3CW2A 1P45A 1OWNA 4BLSA 4AFZC 4ZZ3A 4M7AC 4J0DA 3JQ7B 1OPKA 3PHJA 1OH8A 3HEBA 1VQKQ 4COOA 2GZ1A 2XCLA 2Y71A 5PNTA 3P45A 3P52A 4KGZA 3ZBQA 4LE0A 2BMVA 2NPFA 1FRNA 2J9GA 5TC4A 1ZONA 1W96A 3ER6A 4HDNB 3ZEHA 4X91A 3ODPA 4DRXB 2ZS9A 3HUFA 4W9RA 3CD6A 2M02A 4MUYA 2WZQA 3PL5A 1V39A 2DPYA 2BKLA 3HACA 1STOA 3RGWS 1WPRA 1UOPA 1M5RA 3M5CA 1ZNYA 4JJFA 2CXOA 5ALPA 1SRRA 3ZEIA 5D1HA 3ZDDA 4ZFNA 3X44A 4L9RA 2CLOB 3A8HB 3NWEA 4L8WB 2BGMA 3BMOA 1PK8A 1EUZA 3C3DA 5A4AA 3O2SB 2XOKA 3JWJA 4RULA 1NRJB 1XNRB 3RMSA 4M37A 4K5QA 5D3KA 5JPCA 4N47A 5GWXA 4F86A 2WI8A 3K2EA 2RK3A 4C6TB 3L05A 1LTHR 3EWNA 4E7IA 5DHAA 1ZBJA 2PBZA 2CSIA 3OKCA 1LPLA 3PC6A 4JEMA 4A23A 3TB4A 3MILA 1SULA 3UWNA 3PRHA 5IVKA 2X5OA 4V2IA 4MWGA 3K30A 4TM7A 3SC3A 4CBVA 3OZVA 1E0AA 1CQJB 4B2PA 1AQIA 1NW7A 2IPNA 3OYDA 1XE3A 1YOVA 3QLVC 2HBQA 2J5BA 3AR7A 2JLRA 3TPFA 3IMFA 2QMEA 3IP7A 7AT1B 2JZNA 2JCSA 1T1RA 5LVAA 1U0RA 1Y3CE 3I9V1 3OURA 2ZU0C 3ECSA 2L18A 4CC7A 1W4BA 1H8HA 4Y2PA 4CV3A 3GNSA 3H1PA 1YI8A 3H3FA 1IZ6A 1OXMA 2NZVG 3SF8A 1VBFA 3GFRA 4IFEA 4PFJA 4BFLA 2PT7A 5CB6A 1JHQA 3ZS8A 4E5YA 3GRPA 3KWLA 1RWBA 5L4SA 1NDQA 4N0PA 3O90A 1OY1A 3L84A 1TQ4A 5IH3A 4F4DA 1MJ5A 1R8QA 1VZ3A 2PUCA 3HBFA 2Q3BA 4IIXA 4INOA 1NXPA 1LK0A 6ADHA 1XMOB 4J0HA 2DP4E 2QTMA 1C50A 1XXHB 3BXFA 3D8BA 3H83A 3KJIA 4NJMA 4E7KA 1WLPB 1GSOA 1X8XA 1A96A 1F14A 5IJ0B 3SMQA 1S8NA 2CXXA 4UMFA 3E2PA 4H7PA 1QIHA 3L1JA 4HVVA 1LRJA 1CE8B 1VSUA 2O2YA 1J8VA 4FZVA 4F2GA 3WV4A 2ZUSA 5KREA 3KOOA 5AI5A 5TSDA 3RWMB 4WXRA 5E1BA 2J85A 2BUDA 2YFKA 1HF3A 4TTPA 3RDVA 4MDFA 2GO1A 3H2ZA 1RACA 1S3SA 4HTFA 3E9NA 2J9FB 3NGMA 4FHGA 4G1BA 4YT4A 4UFNA 3SYLA 3ANNA 4XR9A 3CMAQ 4N4HA 2RJFA 2JLVA 1P18A 1P4HA 2IYLD 4P5EA 4MDWA 1WZCA 5GAJA 1LV7A 5L3QA 3FPHA 2P40A 4PM4A 1HI9A 3ZWNA 2H1RA 4S1WA 4RJLA 5JAZA 3PIIA 2ZAYA 4EGAA 3S1AA 2V7XA 4ZYUA 3FRIA 1P61B 4DT1B 2ADMA 1XCLA 3A36A 2D8HA 2A5LA 2PVPA 4Q9DA 1C0EA 1SXHA 3WVDB 1L0BA 4R71A 2ZPIB 3FZQA 1SUDA 4AJLA 2XBMA 3RS9A 1VL5A 2DG2A 4EGCB 1Y9EA 3DYBA 4FPXA 4C4ZA 1DBSA 4J8OA 1ZXXA 3EZYA 2DPXA 3FJ5A 3DZJA 3SFMA 3KKMA 5KNBD 2NM0A 3TU4K 1WSBA 1OAKA 2RGNC 4O5OA 3GA7A 3W4KA 3PNKA 3RS2A 3LE8A 2G0NA 1GVNB 2P2ZA 4HJRA 3F5QA 4ZYLA 3UT0A 5B2EA 2AD1A 3ONFA 2P9JA 4TSFD 1KIKA 1Z39A 2WJ6A 1Y96A 1M66A 5G41A 2VJOA 4EVQA 2OVFA 2QE6A 1QH9A 4QQFA 3C6MA 5JR3A 2NQTA 2I1VB 2I4MA 1I4DD 2YWHA 4NOYA 2Q3DA 4I0WB 2Q5FA 3K5PA 3AEQB 2WTNA 1YNZA 3OZUA 1T3HA 4FFRA 2AZ4A 4C0HA 2KX7A 2A9OA 2ZM6B 3S68A 3AINA 5EN4A 2ECPA 4LS3A 2I6GA 2DZCA 1FMLA 1T3TA 2A7QA 5AW4A 1UFFA 3L0OA 5E2AA 1QMGA 3AJAA 2UXCB 1L5MA 2BZ1A 2OV8A 3V2IA 2VCYA 3TQOA 1E7RA 1PLKA 4UBOA 5KMGB 3PXEA 2GBCA 1ABFA 2WTBA 3P9CA 4GX0A 4ETWA 2XK0A 1OIWA 4XLZA 4C5BA 1CUIA 2VSOA 3FF1A 5AJVB 4XU1A 3BQ9A 1MQ9A 5JCPA 3TBKA 2VYQA 4GBQA 5F2EA 1Q0TA 4CM7A 4D6PA 2I9PA 4KRXA 4MQMA 2CFIA 4DBVO 4ARIA 3ZVLA 2ZTMA 4HL6A 1TA0A 1Q7CA 4L8LA 3EODA 1QHHA 1C80A 2VSYA 3KQUA 2IDJA 1ZHIA 3OJFA 2ZB3A 3WQHA 1QJCA 4UTZA 1YU9A 4WDQA 5KSPA 2QPLA 2NSDA 4Q7KA 1I51A 1USGA 4KSYA 2RI2A 1JRIA 1YCHA 1AKVA 1I9GA 5BUSA 2WRZA 1M72A 5KNCD 1MG0A 1YHYA 2DHRA 2ZBVA 4I1RA 4IIOA 3IP5A 4OLFA 5KOHB 2GRJA 3OT4A 1I1OA 4A8JA 1ZK0A 3C1TA 1PWZA 3C16C 5DXJA 3RREA 4MLDA 2WWXA 4TWAA 2HMSA 4TRJA 5FUYA 4OUDA 3EULA 2YUPA 1W85A 3AZQA 3QKSB 1TIBA 2O57A 5CA0A 1EVYA 1H3HA 3E9YA 4URHA 1FVFA 3IIMA 4C4SA 4OMUA 1WHTA 1BBZA 1SQGA 1KQOA 2QUAA 5DRTA 3PNWC 4LZLA 4YA6A 1ORTA 3GT4A 4O2RA 1PZGA 3TM4A 2VYCA 4CLRA 2XUOA 2YS6A 1CF2O 4M8SA 3EIUA 2G80A 4MWCA 3WWZA 4AN4A 2RI5A 4IUDS 1E4EA 4WCFA 2D00A 5EE0A 5I9LA 3VR6H 4UE6A 5FLKA 1REQA 3M6UA 3THWA 3JAKB 4PC1A 3ZDYB 3P5BA 5FOQA 1UM9B 1ACMA 2XGGA 3TTWA 2IXAA 3DZBA 1G8SA 1IDOA 2VRCA 3UENA 2E3IA 1KAGA 1XJ5A 3FIUA 4H17A 1P4JA 5F35A 3TZCA 3CCST 4HGYA 2P6OA 1E9CA 5T4EA 3BS4A 5C18A 2R8BA 1SZDA 1NE2A 3O8VA 3OQ6A 1SRLA 3RS4A 1WVMA 4RFSA 1KKMA 5FUVA 4LEIA 2QB5A 1KJIA 1XIVA 3FMGA 2LNVA 1NE7A 1QHYA 2JDID 5IC4A 4J9DA 1NG2A 1A3CA 2NQ8A 4IDGA 2F90A 4ZN6A 1YJQA 1VJTA 1OFGA 2CSXA 2VZ0A 1IHDA 3EOBI 2Q1WA 5JBIA 1OF1A 5DE3A 1X92A 1ZICA 3CF4G 2VBFA 3TRJA 2QUZA 4QHSA 1DAPA 4YX9A 1YITQ 3UZUA 4JXXA 1YMQA 3DMDA 1KYVA 1U5SA 2ZBDA 5E7IA 2VF2A 3DVLA 3LNTA 1RM3A 4M21A 3ILHA 3GMDA 2YV4A 3RSHA 3MT7A 4RA6A 1V8DA 1KRHA 3P2EA 3E7WA 4XDHA 1SVKA 2IODA 1FP6A 4JQCA 5F7ZA 2JHCA 3RRBA 4TLMB 3QOWA 2JGKA 3PUXA 1TMOA 4LZJA 3UPTA 2LRHA 4CXMA 1MZVA 1T1GA 4H7IA 2ZVJA 5JADA 1DAEA 3RO7A 1KG1A 1JEYA 2QTBA 2ET6A 4B71A 1Y1SA 1QFMA 1UG1A 1DG1G 4N39A 2GEKA 1KI3A 1ZQ9A 1BU8A 4XE5A 4NENA 4L8VA 3ZD8A 1WB4A 3N2YA 4LHYA 1P1BA 1VQKT 4CF4A 1YR3A 5EMKA 3IVMA 4W4TA 4O0MA 3KL2A 5IT9E 4LYGA 5CLQA 4ARZB 3QVKA 5E4JA 3FYHA 3G2JA 5G4KA 4BMOB 3L2RA 3CC7T 1TTTA 4I1UA 3GAFA 1Y1PA 1GZ4A 4CM5A 2WUDA 4Z4QA 4DBFA 1XI2A 3H9NA 1Z0IA 4DUGA 3VDMA 5A3JA 3JD3A 4CC4B 3OX2A 1UEJA 1NBEA 3QU2A 4TUYB 3EVEA 2OYRA 2GNCA 1U98A 4UBMA 4KQJA 3U0BA 5A3SA 3ACCA 2E4UA 4WESB 1IG3A 1MB0A 1JSLA 1KP9A 1O9BA 4S24A 4AFUC 3TW8A 3QEMB 4CMJA 5FWXA 1ZCAA 4I4TF 4ZEOA 3DEKA 1UKCA 3IJ5A 2H00A 4M8KA 2K2VA 4OX9Y 3BA6A 1Z9BA 3SZLA 2AZMA 2A7YA 4WAUA 2G36A 2WLSA 5I6DA 4MP6A 4KQ1A 2HIGA 4NCIA 5G1PA 3FWZA 4MDEA 4YN3A 1QVGA 2YVUA 3JSAA 1JB9A 1RBZA 1Y3BE 4FM9A 3V8MA 2KI5A 4F7UE 4LX0A 3UN1A 1MEJA 3IEKA 1QZUA 2ZRGA 4BEJA 4C3VA 4CIYA 4KPUA 4BX9A 2XUJA 1CNEA 3H17A 3U7RA 4DCTA 1E1CB 1YQXA 2JEZA 1BMFD 4M75D 2V3CC 3RAGA 4V3BA 4AY6A 5TGTA 3JQGA 2BLNA 1BMQA 4XQ3A 2JNWA 2I03A 2W43A 1GZ7A 2E41A 4GOKA 3JTMA 3LT5A 4MVJE 2IH5A 3ESZA 4NP6A 3KT8A 1M90C 4EARA 1YASA 3WYFA 2AG0A 3KYJB 3O75A 2VSNA 3NBAA 2Q0SA 1WQ3A 2W2QA 3THKA 1Y8QA 4FUTA 1H66A 2H7XA 1JQAA 2BGRA 2EQAA 4ILKA 4Q3OA 3T7IA 4C03A 4QFBA 4AICA 1ADBA 3AW8A 3ACDA 4OB8A 1QG2A 2X1VA 3KPUA 2XUHA 3T1YB 1NSTA 3Q2KA 1UK7A 2HQRA 5LQNA 3T9AA 1HA3A 4UCWA 3BSWA 4YC7A 1OLUB 1G7SA 4B87A 2UUOA 4J2OA 2Z5GA 4RMIA 1GTRA 5TQVA 1LDEA 2QSJA 2YTZA 4KUGA 3PR3A 5C0MA 2ZYRA 5EL0A 3CJTA 3DR3A 1OFHA 5TLSA 4QHYA 1FJHA 1V8FA 5IVIA 4JI3B 4Z54A 3H11A 4X45A 2DBYA 3KYBA 3R09A 2BOVA 1IGQA 1QFJA 1IM2A 4NCKA 3A3KA 3CXUA 4PLFA 4MUBA 4X92A 1OH5A 3FC3A 3G1TA 2IHVA 5HE8A 3CN9A 1Z6PA 1BEZA 4QBGB 1GPBA 4LF5B 2EWVA 4B80A 1E6EA 4EO4A 1TEHA 5IKPA 1D1PA 3OOYA 2V3WA 3UK1A 4B6FA 3JQAB 4H3SA 3L0IB 1K73U 1SVIA 3SJZA 4FOTA 2PWZA 1QR2A 1RJGA 2GZHA 1RP7A 2C0TA 3GEIA 4UEKA 4KMRA 5M34A 3LBIA 3GEEA 2ALJA 1QYWA 1CRLA 5C1BA 1PWHA 4DV4B 5DCUA 2JIPA 5EI5A 1XQVA 2EGAA 3VNUA 4LTNA 3PP8A 3KBOA 1COWD 4A8TA 4B85A 4QDUA 2OCBA 1I1JA 4F9FA 3O2JA 4O4IA 4AJ9A 1MA3A 2VWPA 3MRVA 5CJ2A 4FYIA 2WIFA 2O7QA 2QTHA 3D6VA 1KFBB 2F1OA 4YDQA 1QE0A 5DKFA 1ODIA 3IURA 3P4YA 1YBHA 5A4IS 1RZUA 5BN3A 3ENVA 4I50A 2H06A 1BXGA 1R0LA 2QLJA 4XX1A 2JM8A 3NHZA 4LNUB 2I3ZA 3UGKA 4E31A 2ZBFA 2YW9A 4NY1A 4Z4EA 3PEEA 2XUPA 4K11A 2NYSA 3EMVA 1QKWA 3VYTB 3G6EQ 2JHPA 2XB2A 4XD2A 5L4NA 4J76A 1EE2A 4R5HA 5J3BA 5MFZA 2HWWA 3BKXA 4REQB 2Q4RA 2IP4A 3M53A 3UBTA 2J9RA 5DNWA 4WNAB 2IK8A 5C5IA 4Q16A 4FVTA 1ZBXA 1LDBA 5E8RA 2J87A 1FUIA 1I5OB 1Z74A 3SHTA 3K3PA 3WNZA 1AKQA 4UZSA 5JDIA 1QDEA 5FTJA 2VT7A 2DFTA 1PBNA 1TUBB 1DELA 4C06A 1FYNA 1YRWA 5BXQC 3GLRA 4R1TA 1PL8A 1V7QA 4I99A 2CXSA 4BNFA 4A82A 1XCGB 1E4VA 3DVAA 4I4TB 3QP9A 4EYQA 1Y48E 3V4OA 2QTAA 3QY9A 4BD3A 3DE0X 2ZJ1A 1NONA 1O77A 4KH1A 3FRJA 4DLLA 1H9AA 3G4ST 1FBTA 4M7AD 1ZGGA 1VL8A 1UWCA 2E2WA 2C9YA 3W9SA 4K86A 3R5XA 2KSQA 4FYYA 3TLEA 5IZCC 4JCCA 4JR1A 5I5GA 4RKYA 3DYVA 1ZW1A 2Q5EA 1Y34E 1TRKA 2ID7A 4O0LA 3UFBA 3S2SA 3N05A 3LBAA 4BWFB 1YJWA 4L6IA 2K87A 2YWRA 2HLDD 1W36B 4IFBA 1GLGA 1Z06A 2X9LA 5C1PA 4RVHA 4RX1A 3LGFA 5CIQA 3N2ZB 3UUWA 3FPGA 2C2ZA 3JV7A 5ALMA 1F20A 4PO8A 3FBTA 1Y9AA 3GJ7A 4R1PA 2QKYA 3F6PA 5HUQA 2NSYA 3CZMA 3Q85A 5J26A 1RJFA 2HCKA 1EVQA 4ZI5A 3OP1A 2V1XA 1L1QA 4BNVA 1DKMA 1HFWA 4Q4DA 3VU0A 3MZ0A 1K8YB 3F71A 4XU3A 3REBB 4A0RA 5L7YA 1MNEA 2VAMA 2G8LA 5AVVA 5GY7A 2P5SA 2OHJA 1EQ2A 4WK6A 4NMMA 3C8HA 3QENA 4YTEA 1DE0A 1Y63A 5JV5A 1XZPA 2PS1A 1Q91A 4GDFA 1MFZA 4WY5A 3KKZA 2WHYA 3O8BA 1T36B 2A9PA 1QPGA 5ADVA 1FIUA 2G25A 2PWBA 1OQKA 1KU6A 3DTYA 3I5AA 1AURA 1UE9A 5JUWA 4AFSC 4FGKA 4I1OA 4CMBA 3I32A 1J7JA 3NRCA 5ARDA 1NA5A 4EK9A 4TTJA 4W5HA 1V1CA 4DR6B 1GWNA 5DEOA 1BFKA 1TNDA 2HX1A 2AEJA 4MWTA 3IR7A 4QXPA 4DZRA 4M9ZA 2YHUA 4OP0A 1U3FA