1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
1AN0A 4BLRA 1CJUC 1NG9A 2Q3FA 3ADKA 1RPZA 1ABQA 4BFWA 2O8EA 3K9NA 3AVOA 3CX8A 2WJGA 1E9FA 4F4IA 4YXWA 4DSOA 4FCVA 2LJ1A 1XMIA 2ZYTX 3FMFA 3KKMA 3I8XA 3MJRA 2MMCA 4JL6A 3NHNA 2QP3A 1UUEA 2F9MA 1G21E 2HYDA 4GI7A 4HVVA 2OFXA 2DRMA 4URXR 4X8OA 1YNZA 2MSDB 4IDPA 2PEYA 3VS7A 2WPDD 3OEHD 5DE3A 4QRHA 3ZVMA 2FWRA 2ZE8A 1UBCA 1GM5A 1GCQC 4KBFA 1GITA 2ZRIA 2FFBA 3K9LA 1UE9A 4LHWA 1I4LD 3U7HB 4UNQA 4X8HA 4E03A 1KAOA 1A0NB 3E70C 5J4YA 4JYBA 2P67A 4BECA 3WYGA 4EIWA 3X1ZA 2P6RA 1CLUA 1P60A 1KK2A 3L0SA 4JJDA 1W47A 4YC7A 4E5UA 4Q9IA 4MRVA 3TIFA 1XDBA 2D0NA 1S9HA 3EG0A 1M7BA 2REXB 3KXKA 4AURA 1E6CA 2XZOA 1P6XA 4LX0A 1CBUA 3KKPA 4IEEA 3SFZA 2ZJZA 4XOIA 1GBRA 1M6NA 1WFWA 4KI0A 5D3MA 3RC3A 3R8FA 4DEYA 2J0UA 1FMLA 1O3YA 2HJVA 2V3CC 1LCKA 4KU4A 4WXRA 1CJVC 3SYKA 1BKDR 3GEIA 4LPSA 1WX6A 2EU8A 2JLVA 3MG9A 2WHXA 1G4AE 2ODBA 3BB1A 4I1VA 3UG7A 4ACBA 4A2WA 3RS3A 4Y0VA 2HCKA 2WAXA 4JJZA 4BRUA 4XVRA 2CJWB 5E3HA 2K6DA 3FB4A 1FX0B 1RRGA 3WP0A 1N5IA 3GMTA 1QHIA 1XPUA 3SJZA 2RGNA 4JLVA 1ZX6A 2OCPA 1EFNA 3REAB 1FOEB 1YKSA 5P21A 4MGKR 4JYCA 4EDHA 3GD7A 3QXHA 3LLMA 2GESA 5J4KA 2C77A 4KITB 2VHUA 1XXHE 3G82C 2FRYA 4NCHA 4UJ5A 3R9IA 4ARZA 2FSGA 2ZI6A 2AWNA 1CEEA 1OKKD 4C3ZA 3KJEA 2IXGA 3UA6A 1AA9A 5ANRB 1QG2A 2F2VA 2IIMA 1RLQC 1R0YA 1S0UA 1UDWA 1QHSA 1UJ2A 5GJVB 4PO8A 2IXEA 1QVAA 4Q66C 4HB3A 1UEIA 4TL7A 3OESA 4E22A 2J5XA 4UXJA 2B7CA 1ZNWA 3IPYA 3MJHA 4IRUB 3U44A 3I62A 3AKYA 4WZ6A 2QT1A 1U06A 3PE0A 1M74A 1Q22A 2BIFA 1Z0FA 5KDDA 1G17A 1MT0A 2A5GA 4AKIA 2Q9BA 2GAAA 1DAEA 4M1SA 1XCPA 3ASYA 5K8LA 1EESA 2XNSA 3SR0A 2BBTA 2V1UA 1R0ZA 3W90A 4TLCA 3M0EA 2DL8A 4G0NA 1ZC3A 5AJXA 1DAMA 1UGVA 4LJ7A 4BZQA 3GEHA 4PHHA 2DE0X 5LB4A 4CZ2A 1FP7A 2F43B 4TMVA 3GLFA 1JR3E 1XWIA 1WRBA 4CEIB 4H1VA 3PVLA 3ULRB 3ADDA 5JSZB 3RS7A 2XSZA 5F2EA 1EFRD 2WWXA 3DDCA 1I2DA 1G2BA 1EX6A 2RPNA 4IIOA 4HLDA 4BEJA 2CCJA 1ZAKA 1E2KA 1Q12A 2C9YA 3T5GA 5CK4A 5HPYB 5I22A 4M21A 1ZNYA 3VR1A 2OFWA 1VG9B 3WMEA 1G83A 1DG3A 3DO6A 3ZD7A 4C2UA 2EYZA 2ZJ2A 4IVRA 5JWHA 2LZ6B 2M51A 5GJCA 3I35A 3M0TA 4P3YA 3ND9A 3SJAA 2ATVA 3EPLA 3THXB 1HE1C 1U98A 3ONWA 1E9BA 4PC2A 2EYYA 3VAAA 4GOJA 3CLVA 2LWIA 4M4SA 3ADCA 4Q7JB 3AVTA 1KOFA 1KK3A 1KHTA 1P9RA 3VS5A 1R4AA 3VR6A 1AWWA 2HDNB 1TG0A 3KJIA 1PKTA 4J9GA 1X1SA 1IY0A 1U0JA 3OEEA 1WMSA 4RUGA 2ZI7A 3B1VA 3I5YA 1YZGA 3EGUA 1IN7A 1N0VC 1E0KA 2GJKA 3RRYA 1GKYA 4E09A 4CDGA 1PWTA 1KAGA 4D0NA 5L3QA 2QBYB 3NIBA 4Q01A 1H92A 3AP1A 5KU1A 1T4GA 3GPLA 2BWJA 5H1YA 1W36C 1RE0A 1Q20A 1T8TA 1ZP6A 1D9ZA 1RUWA 2SRCA 2PMDA 2HT6A 4PZYA 4HAWA 1II8B 1E4YA 1QHNA 5KHOC 2RF0A 3FHCB 4NYIQ 3IBGA 3QXJA 3GLGB 2QDLA 1KIKA 2H8KA 4A6PA 1OFTA 2YSQA 1VCOA 1IONA 1YR9A 2ECKA 4TTQA 3VNVA 1JAHA 2CE7A 1IN8A 3A6PC 1W5TA 4HAVA 3OEED 4B2PA 4C0SA 1CU1A 4FINA 3RWMB 4XVQA 2BEKA 1CJTC 3LBHA 3LY5A 3GJ8A 3NG1A 4PHTA 3EPKA 3RAPR 1S1NA 2F1JA 4YMUA 2PTKA 1NVXQ 3AUYA 5DN6D 1GDDA 1FMJA 2G83A 3GJ7A 4KO8A 3K8YA 1Q1BA 3K9GA 3A1SA 3DEFA 3FOZA 1HA3A 2KE5A 1WBBA 4CRWB 2Z4RA 2CT3A 4D4JA 3U23A 2IL1A 2RGGA 1JJ7A 2WICA 3S1AA 3O8DA 2O0HA 2QE7A 1RLPC 3PEUA 2QAGA 5B57C 4JL5A 5FUXA 3HU1A 4B3GA 1XJCA 1TF5A 2AK3A 4IJMA 4IW3B 1VHLA 2WWYA 4YMSA 3K9HA 5EE0A 2L0XA 3CF6R 4MKIA 3B78A 1SSHA 3KFVA 5EUMA 1IO6A 4ASUA 3H0IA 3KB1A 4C0LA 1E2NA 1Z6GA 3KFXA 4V0OA 1DPFA 1KO5A 1Z47A 3R7WB 3IQLA 1H8ED 2QL6A 1WLPB 2ZYWX 4LBYA 2GKSA 3LX8A 5FTKA 2I1VB 3K53A 1U0LA 5IK2D 1AKEA 1M34E 1R8QA 4N1AA 5TV2A 2FG0A 2CXXA 2NTYC 1NEBA 1FUUA 3V4RA 2H92A 1RKBA 5KSPA 2XNDD 4M9SA 2W2VA 4LHXA 3VS1A 2TMKA 2BMJA 4A15A 3UWOA 1SULA 3S1AB 4LUCA 2BEJA 1TPZA 4MDFA 4EPYA 1BMFD 2JLQA 3CX6A 1GFDA 2VBCA 2R9VA 2YNMA 3ZVNA 1EFTA 2VP6A 3D8BA 1KIMA 5E7MA 2JS2A 1K8RA 4ZCMA 2VP0A 5DYGA 2GEDA 1KFZA 2IXFA 5FBVB 3QBVA 1ABOA 2FPFA 3LRPA 2ZSAA 1T0HA 2AWOA 1W0JD 4KLZA 4JLMA 5FI0B 3GJ4A 2R2AA 4DIDA 2NPIA 2LCFA 2GDJA 2Q3HA 5BN4A 1G5TA 4OJQA 1FX0A 4EJSC 1OXXK 4DB4A 1VTKA 3B1YA 5IXBA 4TT3A 3TJZA 1ZCAA 3R20A 1YHNA 5GVRA 5FUYA 4B6FA 4Z8AA 3BE4A 2FE4A 1OH7A 2VHTA 2XJ4A 3DZDA 1E96A 3ICEA 1W2GA 3U4QA 4ACAA 1CJMA 2A7QA 4FIDA 5IHKA 1FTSA 4TYWA 1DAGA 2FO0A 3SN6A 1R10A 1XB2A 1C4OA 1Q44A 4NE2A 4EIKA 1NN1A 1ANKA 1X69A 2KE9A 2C2HA 4C0JA 2GTPA 3ZJYA 3PEWA 3BORA 3U5ZB 4C2TA 1KDOA 1DAKA 2CLCX 1M7HA 2OHFA 2P6UA 4TMXA 2QT0A 1FL9A 4AFQC 1QHHB 3ASZA 4BZPA 2XJ9A 4KLNA 1OE0A 4BLPA 4XTCS 2GBLC 2CUDA 3NBZC 4D26A 2FMXA 3EARA 4DWJA 5EJEA 1NMYA 4Q18A 4F16A 4CEJA 1IN4A 1C1YA 3LBIA 1T3LA 2IYZA 4JBYA 4QNRA 3QXXA 5M04A 4RCYA 1AWXA 2J7KA 3RC8A 4QL3A 1WXUA 2QAGB 2ZRDA 2RMOA 2K7AA 3CKLA 4Q9HA 2RAPA 1M27C 4EKDA 3DKPA 3FHTA 5E4FA 2V1XA 3P4XA 1JQQA 2IHYA 2IYYA 2R44A 1GCQA 1S1CA 4Q9LA 5K8UA 3U6KA 1SHFA 3FJ5A 1PRLC 2ZI9A 3R7WA 2D7CA 2ZJYA 421PA 4EPWA 4HSEA 4PPQA 3M0UA 5TB5A 2VIIA 1E32A 2WOOA 2ZETA 2A78A 1E1QA 5FWCA 3BH6A 2YV5A 1RC8A 1NMXA 3QEOA 3N70A 2C96A 5LBIA 1XMJA 3PITA 1AGPA 1S4QA 5FTJA 1U99A 4OK3A 1UBEA 1NLOC 1KI8A 2R6DA 2GJAA 1SHKA 4EJSA 3UF4A 1WIEA 4MUBA 1W4BA 2GEVA 3BGWA 1KSJA 2X8AA 1UADA 2DWOA 2BMFA 4RZUA 2D62A 3WRYC 4CT5A 4BZXA 3BJIC 3PUZA 1N6PA 3K0FA 3L2OB 4ZV4A 4PHFA 2F2WA 3WHLA 4QBFA 1M3BA 2BZ8A 3QF7A 1TTTA 4HAYA 5FOVA 4LRWA 1WI7A 1KMQA 5FBWB 3NKVA 4GLMA 3O5ZA 4IKEA 5FPSA 121PA 2BKUA 2ZRCA 3B1WA 4B35A 3B85A 1SXJB 4JLOA 3SEMA 1PZNA 3EWSA 3HP1A 4WZAE 2H1LA 3FHOA 3BD9A 4WAUA 5EE9A 2QPAA 1F48A 1H8EA 3D6TB 4IHQA 4NONA 5DISB 4GOKA 5C4GB 2D3WA 2OT3B 1PLKA 4YDSA 1G8HA 5AJWA 5ECAA 3L43A 1Z2AA 2KJQA 3KZ1E 3TUJC 221PA 4BEBA 1Q57A 3FKSD 2LP5A 2QENA 4OK6A 2ZYUX 3GLGA 1Z29A 2V9PA 2FU5C 5AK0A 3W34A 4ZDJA 5C2JB 1F3OA 3P4YA 5EQTA 1UTIA 1VECA 2XB4A 1YWPA 1G3MA 2ZRGA 5H70A 4KJZA 4JVMA 3WRXC 4AWXA 4QJ3A 2R8RA 1DS6A 3A1TA 4LPKA 3H0KA 5L3RA 3R9XA 4LJ4A 4DB2A 1B23P 3M0QA 5EXTA 3IQWA 1GRNA 2HBWA 1XD2A 1I07A 3C0CA 5GVSA 2ZUBA 4WOPA 1KSWA 1OW3B 4QGHA 1S3SA 2HUPA 4LBZA 4BGDA 1J99A 2VH5R 4KVAA 1E2MA 2IWHA 3ZDQA 1GTVA 3KQLA 2KBTA 4TN1A 2RQUA 1M7GA 1NVWQ 2XTZA 1LB1B 4B73A 2GTJA 1ZRHA 3TE6A 2BM0A 5BN5A 4DSTA 5IH2A 1GL7A 1XTKA 4NL4H 1A1VA 3VR4A 1UG1A 5TMPA 1U3OA 1FNMA 5FW9A 3TGPA 2OM2A 2RCNA 1ZBDA 2YYZA 3A37A 3VFDA 3NH6A 4PO9A 3CQTA 4B44A 2YUPA 1AD5A 4RVCA 3B8HA 4B32A 5FPYA 3CO5A 4US0R 1UKZA 2F1HA 3NVAA 1IJFA 3WMGA 1G3UA 2F3RA 2ZAOA 1JO8A 1V5WA 4NPHA 1BB9A 3X2SA 1PLJA 2VHQA 5IDVA 3AKEA 1GIAA 5DH9A 4QKQA 3GLHE 5JCPA 3EPHA 2GXQA 2CVFA 3T61A 2IHBA 1JPNA 1RRPA 1UEJA 2DX1A 2ZSEA 5B2ZA 4A0HA 5J4VA 1YR8A 1SEMA 3KTAA 1Z0IA 1OH8A 2RGNC 2VPPA 4IOJA 3WXMA 1UBGA 2ZE6A 4RZ2A 4RD6A 2K79A 3TVTA 3FFAA 2RGBA 2CUBA 3DMDA 3VNUA 1ZM3A 2VTKA 3REGA 5KDOA 3NH9A 1P72A 1S96A 1KSFX 2HF9A 1VPLA 2FN4A 1F5NA 2KXCA 3H41A 5H68A 2BZXA 2KROA 4KRTA 1E9EA 3AP3A 1XZQA 3CZPA 2P4RA 1VMAA 3C16C 1H65A 2VHJA 4PSAA 2FFHA 5FTMA 3T1TA 2PJRA 2CK3D 2F2XA 2J0VA 2WSSA 2JJ8A 1B0UA 1OXTA 2XB2A 1EWQA 2P2LA 4RFSB 3UA7A 2EFDB 3TMKA 3ZQ6A 5JFGA 3H1TA 3OIVA 5B30A 4KSCA 4D81A 2AD1A 4JLNA 1SVKA 4RTXA 1QVRA 2P6NA 1XTQA 1YZNA 3IBYA 3EWAA 5KYKA 2PL3A 2WKQA 2G1KA 4CYMA 2EGAA 2XXAB 3A8TA 1YR7A 3PQCA 1H8HD 2ZSDA 2XX3A 5SZIA 4I99A 3SQWA 2P0EA 2YOGA 3DPUA 4L5BA 4US1R 2LKDA 1XFAA 4XD7D 1TUDA 2I1QA 5BW8A 2BDTA 2PZGA 2NWMA 5LB2A 1WYXA 2H18A 2FFAA 3QE0A 4AG5A 1XRJA 1YWOA 1DVRA 3RS5A 5LD2B 4II7A 2Y8EA 4DJTA 1ZU5A 4D4MA 2IS4A 4RTZA 2EFCB 1QF9A 3CRQA 2R6GA 1AZSC 3AF1A 2GXUA 1NBME 4WCIA 2P65A 3NXSA 4Q4JB 3GBQA 2HXSA 3GJ0A 2QPOA 3RYTC 2Q3MA 2IYTA 4FI3C 1GRQA 4Q9KA 1GVNB 2J46A 4ESHA 1OT3A 2D06A 1TU4A 3L82B 3NBXX 4UKDA 3I61A 4NU0A 4M22A 2VYFA 4ITRC 3RNLA 1Z5ZA 1HY3A 1MO5A 2AN9A 2OCBA 2ZSBA 1DAFA 1M1YE 2A5JA 4DXAA 5ELXA 2QORA 3MMPA 5GJBA 1BK2A 3DM5A 4LHVA 3V4FA 2IK8A 4ABYA 2OBLA 2YKGA 1IXRC 1II8A 3GLIB 4QGFA 2DHRA 2HXYA 5FTLA 5EP4A 2VKNA 2F1IA 2JAQA 1L8QA 4J9BA 1YP5A 1D2NA 1Z83A 2QMHA 4A82A 3QPVA 5FR2A 2WMOB 1OFUX 2ROLA 3C5HA 2O52A 2W6IA 1S9DA 4GMXA 2YJTD 4Q1FA 5D3MB 1G5RA 2PH1A 5C46F 4CEHB 2V55B 2FEMA 2IUUA 1U90A 5JEEA 2EFEB 1VG8A 1Q3HA 1N6IA 1SVMA 1OJLA 2QUZA 1T0JB 1P4SA 4YXWD 1DBSA 1BBZA 2RKOA 3AKCA 1JR6A 3NGPA 2ZRKA 4WXPA 3VMFA 4DSNA 1Z0KA 2OLKA 3O8BA 3SU8A 4BRWA 4EPXA 4F92B 1ZC4A 1E0JA 4JKYA 3WHKA 1P3JA 4PX9A 2GCPA 2C0IA 2JGNA 1UBFA 4TZ6A 4J9CA 2ONJA 1I1JA 2WPDA 3OEHA 3SQXA 1RJ9B 5C18A 4KFTA 4D0GA 1LVGA 1LS1A 2K2MA 3OFND 3VX4A 3O8RA 2IYQA 5SZJA 3W9YA 4QHTA 2X3XD 4ESRA 2Z4SA 3FDIA 3WP1B 4Q1BA 1PRMC 2KXDA 1E0SA 4P4UA 5JZVA 4PR0A 5CK5A 2CBZA 3QPUA 3KDSE 5HCKA 2GCNA 3BFVA 2D8HA 1L4YA 4MITA 2ANCA 5KUTA 2YUNA 5J5CA 1G6OA 1HTWA 2QAGC 4PZZA 4CF7A 1X43A 1H8KA 3AVYA 3FTQA 2IW3A 1NN0A 3DZ8A 2OAP1 3VTKA 3IEVA 3ETLA 4HAUA 3OFNA 3UKDA 3AVVA 1N2CE 2HEQA 2F7SA 4OMOA 1PJRA 2OE2A 3AF4A 2JMAA 1Q1EA 1XTJA 4JT2A 1E1RA 4JVLA 3GLHA 4RD1A 2O8FB 1GWNA 3EA5A 3GQBA 1H3HA 1DELA 1UKYA 2WIAA 1V43A 1J90A 1U0HC 2VP2A 5FH9A 3LXXA 3PEYA 1G64A 2CDTA 1M3AA 5JECA 1W36D 1NF3A 1WXQA 2VP4A 4IVQA 3L8YA 1FW6A 1NSTA 4G5SA 1NLZA 2WWWA 4RCZA 2IBMA 2V7QD 3UK6A 2ODWA 4PAOA 2ZROA 4Z51A 1T0HB 4A36A 4R9UC 4B75A 2NIPA 1K76A 2KNBB 3P1JA 1JR3A 4IDQA 4YLGA 2EBPA 2IYVA 3DKVA 1HT2E 3RS0A 1E2EA 1E2JA 1GAJA 2A3RA 4J9IA 2RQRA 1TEXA 3N2EA 2DCUA 4WW0A 2BBWA 1WDXA 4HDQB 3TRFA 3PJRA 4L9WA 3K70B 1U9IC 5BN3A 4OMNA 1XBTA 3I8SA 2DMOA 2RB4A 2YZ2A 2PLFA 2DL3A 2A28A 4TYNA 1QKWA 2IF2A 2X2FA 1FZQA 2C78A 1JALA 2OESA 5AJZA 4IXNA 5JCZA 2WBLC 4JJKA 4QJ4A 4AIIA 4LWZA 4HI0E 4GNKA 3NBFA 1DOAA 4JLBA 1SXJC 4PQRA 2O31A 4PPFA 1XD8A 3IHWA 2XOKD 4BFSA 2EVRA 1G8FA 2XSZD 4QFMA 2CDNA 1NLFA 3CPHA 2ODEA 1ZVQA 5CLQA 1OB2A 4Q00A 2XOKA 1HSQA 3BB3A 2RN8A 4QT7A 821PA 3B7GA 4J9EA 4CC3A 1Z8FA 4K11A 3FE2A 4B43A 1T5LA 2EYWA 4D8DA 5DHFA 1XTRA 1KTVA 4JJCA 4TYPA 2EFHB 4C7OA 1W1WA 4HB2A 1EX7A 2OILA 4UXHA 4Z1MA 3E5HA 4B74A 5JWRA 3P26A 4NCNA 2F9LA 3TW8B 4D4LA 4RFSA 4PTLA 2NO0A 2VL7A 1AOJA 2H17A 4HLUC 5B58C 1OFIA 3KQNA 3AM1A 1HE8B 3LVQE 3UG6A 1KK1A 2GBLA 1D2EA 3VR2A 3JV3A 2R6CA 3MWJA 621PA 1TUCA 1CP2A 1GRIA 1D8TA 1PLLA 2OBMA 3OIUA 2HLDD 4NZYA 4B3XA 5KPDA 1W36B 4PC3A 4Q5IA 1QHYA 2N46A 1YN8A 1KO1A 1KNXA 4AG2C 1XZPA 4MKFA 2BC9A 3KTAB 4Q21A 2WJHA 3MGCA 3CIOA 3SS8A 1GZSA 3RABA 3DMNA 1VKJA 4U7DA 1ZUUA 1GSIA 5GJWC 4RKEA 4JIMA 2H57A 5TY0A 2ZRPA 3U4QB 4XWKA 2ROTA 3L0IB 2WM9B 5KNBA 2YOFA 4P0TA 3IIMA 1GG2A 1M8PA 1WDTA 1YZKA 2FGJA 1BU1A 1J8YF 2W0SA 2WAYA 1PHTA 2AK5A 3W6PA 3QJYA 3EIHA 4QBGB 2X1VA 1TQ6A 4NCKA 4DBLC 2OG2A 3W8RA 3VX3A 1ZD8A 2ZXUA 1UJ0A 2LJ3A 3OAAD 1HV8A 4OBEA 1UKEA 3RDPA 2AFIE 3T1OA 1ARKA 3MWKA 1UDXA 3EZ9A 3EZ7A 1P9NA 5TVKA 2ZTSA 2Q9CA 1HURA 5FWBA 1UKVY 3K09C 1KI1A 3ECCA 2VP5A 3AV0B 2BMEA 3SBEA 2VWFA 5DIFA 3WYAA 1OXVA 1GL5A 2ZRBA 3FVQA 3LVRE 1GFIA 1MO6A 1XEWY 2Z6VA 3BH7A 1Z9ZA 4TWZA 2EYXA 1OIVA 5BQ5A 3K09A 4RJLA 5D3QA 3IKJA 3TUZC 3GFTA 1VYUA 4BFZA 2BHRA 2AXNA 1OXUA 2O9VA 2HSPA 2BMDA 1TMKA 1NY6A 3CF2A 3PVSA 4PANA 4RD0A 3AF3A 2M0YA 2KBEA 1FUKA 2QTHA 1CKBA 1KI6A 2ESWA 2QI9C 3WBJA 4CW7A 3O8CA 5EP3A 3H0FA 3VU9A 4GFDA 2C0TA 3MFYA 1R6BX 3AF2A 3LLUA 4MYTA 4KHZA 3RS4A 3KQHA 2D1XA 4JVNA 4Q4JA 2W00A 3EG5A 4A9AA 4QBIA 1OKKA 3EC2A 4URUR 2O9SA 1OIWA 2NZJA 4Y92A 2PJZA 2RHDA 3R9WA 1P61B 1XMVA 2PZ1A 2ZRNA 4ON9A 5JMTA 2CJWA 4EAQA 2IC5A 3LW8A 3CUEF 5CB8A 3MWYW 1SRLA 1SGWA 4NTZA 4W5JA 3UIEA 2B8TA 1NVVQ 2Q0HA 3BIFA 2QZ4A 5FFMA 3THYA 2D7DA 2YVUA 5BXQC 1WBDA 3K0AA 4JBWA 5L3SA 3EZ6A 5KTYA 3LO5A 3VS4A 2ZRLA 2EGEA 2XGJA 1Z28A 5EZ5A 1K5GA 5JI2E 1X6VA 2GEUA 5CDFA 3KUDA 4D4KA 5LPNA 4ZO4A 5E95A 4LV8B 4URWR 1ZJ6A 3DOFA 3L0PA 1GKUB 2V6JA 5F3WB 4F14A 2XNDA 1JJVA 1W49A 2A5YB 2C99A 3KKOA 2JM8A 1G291 4OQXA 1E0AA 2FNAA 3EZFA 4TLEA 1A2KC 1CIPA 1JXOA 2B21A 4Z8YA 1GNQA 4GDFA 4HVUA 1G7RA 2J7PA 2O8CB 2WVJA 4OYHA 4V0MA 2FRWA 3UANA 1TU3A 1N6LA 5IHNA 3HU3A 1XD9A 1UHCA 2GETA 1G1MA 3DHWC 4OQMA 3B13B 5FUWA 1EFUA 2J87A 1ONBA 6Q21A 4TQAA 2A5DA 3AVUA 1G20E 4ZI2A 2ZU0C 4M9QA 2JLXA 4I1SA 4PO1A 4V02A 2VRWA 1W4RA 2CCKA 2J59A 1HH4A 2ZS7A 3IDQA 2ZRAA 4LUDA 1NRJB 1CSKA 1W46A 1E9RA 1N0UA 3ZGXA 1KK0A 4RSGA 1SZPA 1AK2A 3PVQA 2C8VA 2HJGA 4A4DA 2XTNA 4MKGA 1XU4A 3B5JA 2E5KA 1F6BA 3EAQA 2DBYA 4RY2A 1G7CA 4BUJA 3TKLA 4L16A 3RBBB 3UMRA 2A37A 4GP7A 2BTTA 1DO2A 2H7VA 3PENA 4LJAA 4PC6A 5CM8B 2JLYA 2A08A 1L2TA 1ZNZA 4GZLA 4B6EA 721PA 2O8FA 4PPGA 1W0JA 3U2QA 3BWDD 3NTUA 4JBXA 4KXFB 2QRNA 4TTRA 2KWIA 2IEYA 2OSBA 4DDTA 1YCSB 2PT7A 2AKAB 1FQKA 1QHGA 2YUQA 1SQ5A 4IFEA 4QNMA 1NYGA 3BERA 3ZLJA 1P73A 3QIAA 3LX5A 3PUXA 4A2QA 4GRAA 4OQFA 4B3CA 2V6IA 4TLAA 5DSZA 4AKHA 1YR6A 1LV7A 3HYRA 1DG1G 4CEJB 3OHMA 3TK1A 2MCNA 5L3QB 1G5PA 1S3GA 2C5LA 1HYQA 4TMTA 2AKYA 2ZI5A 3SYNA 1UHFA 1YZQA 3FGNA 1W4CA 4NYMR 3GLGE 4A1FA 2EQBA 1E99A 4F7WA 1P2TA 3QVUA 3ZQJA 3K0AB 1E2PA 2W58A 3GLIA 3AVQA 4QG7A 1NMZA 5FR1A 2GGRA 1CTQA 2BCGY 2PX3A 1C9KA 3QKTA 4BLOA 4G3XA 1W5SA 2B6HA 2XEXA 4MQBA 4LYFA 4DZZA 2YWEA 2GAOA 1HEIA 1X8KA 2QSZA 2P5TB 3LBNA 1ZW6A 4HUQB 4LY6A 3E1SA 1Y0MA 5CIQA 3BAFA 3L8ZA 1CRPA 1KJWA 4MRRA 3BFKA 1AS3A 1FFHA 4FXPA 4Q02A 3T1QA 4OMQA 2P3SA 1D5CA 3SEAA 1X3SA 4R2HA 1TAGA 1XTIA 2DBKA 1XP8A 2ZJOA 3HWSA 2LMJA 4LBVA 4FN5A 4TZ0A 1GUAA 1ZCBA 5DN6A 2IS6A 1TQ2A 1L4UA 2BKEA 2OV2A 3UMFA 5LD2C 5JRJA 1NM7A 3CRMA 3I92A 3EG2A 2FZLA 2ORIA 1N6HA 3TNFA 4MGZR 2J0QA 1XEXB 2J06A 2F3TA 3MCAA 2J6KA 3G0HA 1G4UR 1IN5A 1NLYA 2YOHA 5DLQC 1ZM4A 2P5SA 5J4HA 1G8YA 4HXJA 4ZI3A 4OI1A 1DAIA 4Q7LA 4FWIB 2CVHA 4KAXA 4KVGA 4A6XA 3QNUA 2Q6TA 1K1ZA 1ESNA 2WJVA 4CEHA 3M0RA 2VLIA 2J45A 3B82A 1O87A 4MYHA 5GJWB 1Z2CA 4JSTA 3TR0A 2IF0A 1Y63A 4LE9A 4P32A 1LW7A 2JLUA 4AI6A 3IQXA 4WVFA 1NN3A 5FI1B 3OIWA 5CIWA 5DNYB 5CITA 2G9NA 4MA4A 2PMKA 2KT1A 4AFZC 1F60A 1MRSA 5G53C 1XEWX 2NMVA 3QQ5A 2L0AA 1U94A 2GXSA 3W3ZB 4A8JA 5HKKA 1CKAA 4B76A 3UATA 2OCAA 3I3SR 1X2KA 2AKKA 5HE9A 2ORWA 2MSCB 3CH5A 4BLQA 1S1MA 1NKTA 4Q1EA 2ZE7A 1CR1A 1X1RA 2J7PD 3FMIA 1KZ7B 3Q5EA 2G6BA 4X8MA 4V03A 2J41A 3ZYCA 3GJ6A 1KDTA 3OZXA 3U7GA 3C4JA 2ODNA 1VHTA 4DLWA 2EQIA 5CM9C 2W6JA 1VA7A 1TQDA 3EIQA 3X1WA 2DWQA 5CB6A 2RQVA 1ZSGA 2CH4W 4IVPA 1BOFA 2ZANA 5CYPA 4OMPA 1MABB 4M53A 5AUOB 2K3BA 1XOVA 4JT4A 1MV3A 2DBMA 1ZBJA 1D9XA 3IO3A 2ZM5A 1ZIPA 3MAAC 1NLPC 1UDLA 2CCGA 2IYSA 1TQ4A 3SJCA 4HAXA 3RSLA 2ED1A 1Z0DA 2YT6A 1SVWA 2X19A 4HB0A 3C8UA 1T3HA 3CR8A 4OKSA 4B3DA 3KQKA 3K70C 4Q4AB 2R6AA 1Q21A 4ERNA 5DI3A 5JHHB 4F93B 1II0A 1QLYA 1P75A 1Z08A 5HCNA 2E87A 2RGCA 2J05A 1A2BA 2FOLA 3UPUA 3TW4A 4H9GA 3EHRA 1AZGB 2Z43A 4OHXA 2XITA 3QXCA 2G1JA 2QTVB 3QI2A 1GOTA 5DYIA 1QG4A 4MRNA 5J40A 3GFPA 2V1QA 4W7SA 3CNOA 4AFSC 4XH9B 3NDBB 1R0XA 3TSWA 4JS0A 1XPRA 2J1LA 4LN2A 2UKDA 4BPBA 4GMDA 1LF0A 3LAWA 4NKRA 4M4ZA 3U7EB 3CONA 4LSGA 1VG1A 3P27A 3NEYA 4Q4HA 1E2QA 3H2YA 4Z8XA 3THXA 1OH5A 4EQ6B 5F98A 1OPXA 1XEXA 1Z07A 4IFBA 3RLFA 4D0LB 2K9GA 4BFTA 1K0SA 3QKRA 4UXIA 2DILA 1GCPA 2ANBA 3Q72A 2GJSA 2QROA 2KB0A 3THWA 3BB4A 2IUSA 1XEFA 2CMKA 4OHZA 3NHBA 1QBKC 4JPBW 1E69A 1GKIA 4IXMA 4A92A 4ZIRB 4QJ5A 4DDVA 1M8MA 4Z88A 1RIFA 3D31A 4LYHA 3AVXA 3IGFA 3QSYA 3LW7A 2HDAA 2VSXA 2WKPA 1QKXA 4EUNA 2WSSD 3LQQA 3QY0A 2ZE5A 1N6NA 4DVGA 2VF8A 1AZEA 1G3RA 1U8YA 1ZNXA 3ICQB 4O3MA 2EW3A 1E94E 2ZR7A 4NCIA 2ENMA 1HJDA 3QENA 2EKHA 2WJIA 2ZU6A 2KBFA 1PVOA 1NG1A 4B3BA 4U02A 5JJKA 4RD4A 2PEZA 2CNWA 4NYJQ 1W2HA 4P33A 3EASA 3W5IA 3THWB 4M2LA 2CL7X 3MWLA 2ZAMA 4OI2A 2DF6A 4V0ME 1GL6A 1LS6A 5HCIA 2DJQA 2L3QA 3CRVA 1RYHA 2QG6A 5K8IA 3I5XA 4BFVA 1KDRA 1TF7A 4LZZA 1EFHA 2D4HA 3C15C 3K0EA 4DCTA 3LXRA 3EA0A 2ZYVX 1KSHA 1Z0JA 2JJ2A 3A4LA 3HR7A 2FZ4A 4N0DA 4RTYA 3RHFA 2YHSA 2CEAA 4D8KA 2NGRA 1JEEA 1UF9A 2XAUA 4LOAA 3AGQA 5AUQA 1II9A 1ZUYA 3K1JA 4KFSA 1P2UA 1NIPA 1G8PA 2OXRA 2LNHB 2G0NA 2ZEJA 1EWRA 4TMZA 3SJBA 3A4MA 3TSZA 1KY3A 4A2PA 2WZQA 2OZEA 5DI9A 2GNOA 4UNSA 5FBRB 5HKKD 4ZDKA 5KPJA 2IYUA 3T5DA 2JJ1A 4MGYR 3D7MA 1OYWA 1CR0A 4BE7B 1G6HA 4R2IA 1BO6A 4LJ9A 4DRZA 3FMOB 4NH0A 4JZKA 2UZIR 2JJ1D 3EW9A 4A63B 5C1BA 2RGXA 2C98A 2LX7A 2QY9A 5FOTA 1G7TA 2FSIA 3VR3A 5AUPB 3N5CA 5HTKA 2HT1A 3OE7A 3GEEA 4G5OA 2QAJA 2QEQA 2NO6A 4HATA 2FEOA 1F2TB 2IEZA 2BOVA 2C95A 3VQTA 3CRRA 3Q7QA 4GZMA 3AVPA 4KV9A 1WA7A 3SHFA 1E79D 1XXHA 3K0CA 4FD2A 4GT1A 4LJ5A 5JI3E 1AEYA 1U2RA 2W6ID 4NDZA 4OL0A 5K8TA 3W8NA 2IS1A 2JLZA 4B34A 1R7RA 2NO9A 1YU9A 1K0XA 3WBKA 3ZZUA 3V9PA 1ZD1A 2DA9A 4LHYA 3CF0A 4XWOA 1R0WA 1OPLA 2R6FA 1S2MA 3TUIC 2CLSA 1IJEA 4CC4B 2RGAA 2PNIA 4DLUA 2XZPA 4OHYA 4TSFD 1VG0B 4Q19A 5CJ2A 2WWFA 3BS4A 3OE7D 8OHMA 1NNEA 5B64A 2N1BA 3DVLA 3IEUA 3W6NA 2GZDA 3PFIA 3BOSA 3QKUA 5FBQB 1K5DA 3B6EA 2FG5A 4LI0A 3C5CA 4W5HA 1DEKA 2C04A 2G77B 2VVKA 2V54A 4RD2A 3CPJB 1E79A 2BM1A 3GLFE 4J9FA 3U61B 1OV3A 2ZRHA 4TL6A 4YMVA 2MMGA 4Q4LA 2BV3A 3T06B 1ZUHA 2AR7A 2ABLA 5AJYA 1IM2A 2PX0A 5JS7A 1W70A 2X77A 2O8DB 2ED0A 4AKEA 5IF9A 3EX7C 2CSQA 1Q3TA 1JQLB 2J9RA 2LCSA 3MSXA 1GNRA 2ZI3A 4QBHA 3V00A 1T5IA 4RZ3A 3ZVLA 4DLSA 3Q85A 521PA 3SOPA 2A2ZA 1U9IA 3TSOA 4AFUC 1E98A 3JZMA 1X6GA 1SVLA 2WJYA 4UQOA 2AKLA 2MIOA 1J2JA 1DO0A 2AL7A 2DFLA 1I2MA 3PG5A 3R6NA 4V0LA 1AM4D 1KKLA 2HEIA 3BRWD 4YDHB 4FCWA 4F4JA 2AHOA 1YRAA 4NHOA 3HJNA 3OF5A 4IOLA 2CREA 4C0HA 2ZVPX 1E2LA 4HLCA 2WV9A 4QM6A 2B7BA 2GWHA 3QVVA 3UMSA 1W4AA 4W5WA 2NZ8A 1XPOA 4K81B 3KKNA 2DL5A 1X6BA 4URVR 4ZDIA 2O0JA 3CR7A 1AS2A 4HEJA 2O8DA 1KMHA 1AKYA 1H8HA 1AQUA 2REOA 4UNNA 4ARZB 4DC9A 3GCGA 3KQUA 2IYWA 3PUWA 4PC7A 3GP8A 5AR1A 2NO7A 2YINC 3X1XA 1B07A 5KO2A 4LNPA 1KO7A 3LNCA 2A5FA 2KT8A 2L3SA 3PEVA 3RSOA 1K6MA 4BWYA 1AGRA 2R65A 3WNCA 4J9HA 1M30A 2FSHA 3K70D 5C4MA 4NCJA 4QGGA 4CC2A 1LY1A 4PAMA 1E2DA 3QF4B 3NC1C 4NYJR 1XJ0A 2V1RA 1KI7A 1HT1E 1PKSA 4G5GA 1NYFA 2DVJA 1KI4A 3CW2A 4FMCF 1OXSC 4YMTA 1ETUA 1FQJA 4O2LA 4B3FX 5F9FA 3TLXA 3NEJA 4KCGA 1XXHB 1N5JA 2BZYA 2WOJA 1D2MA 1G8GA 2EWVA 4I1UA 4WIAA 1JB1A 2DL4A 1DARA 1XMSA 3UWKA 4DHEA 4DUGD 4OI0A 1SVIA 1GBQA 5HZKA 2F43A 3WY9A 4LV6A 4Q4AA 3CZQA 2JJ2D 2YWHA 3THOA 4CEIA 1QWFA 4G5QA 4E07A 2GCOB 2KYMA 1NIJA 4F17A 4UNRA 4G1UC 4AK9A 4D82A 1VCNA 2D2FA 3RWOA 1E2GA 1TF2A 3M6AA 4F91B 1RVDA 3PCRB 3AH8A 1A82A 3FPAA 4LC0A 3HPRA 3Q5DA 4YONB 3SYLA 1KNQA 3SHWA 3QF4A 2OBNA 2QGZA 2RNAA 2N42A 1E6HA 1N5ZA 4C0KA 2Q21A 1T0JA 5A0FA 4QGAA 5DO9A 3ZS9A 2JASA 1E4VA 4HDCA 1W48A 3CRW1 4KFRA 3W6OA 2OJ2A 1IXSB 2HV8A 4PHGA 1ESMA 1QCFA 2GK6A 2KEAA 1EG7A 3HPQA 2KRSA 1TX4B 4G01B 4Q4HB 1T3SA 1ELOA 1EGAA 2ZRMA 2IX3A 4B2LA 3ADBA 4NMMA 2ZS8A 2AZVA 3H4MA 2UVQA 2JEOA 1IQPA 3BC1A 1RJ9A 4DCNA 5KSOA 1HQCA 1Z6XA 1V1CA 1LTQA 4U5XA 1J70A 1FTNA 2VSOA 5EXPA 3PIRA 4M9XA 5BYKA 2ZJ5A 1GP2A 1U8ZA 3I4LA 3HR8A 5BYJA 1MRNA 1N6RA 5FOUA 4DCVA 3EPJA 4B47A 4R71A 3M4YA 1SKYB 2KR3A 2LJ0A 3BFXA 2ZJBA 2QBYA 4PSKA 4M1MA 3Q9LA 4JKIA 5IHPA 1FYNA 3CNNA 4QM7A 4BQSA 3LV8A 2OO7A 2OFOA 4X8LA 5JWOA 1N25A 3U60B 4PZLA 1KO4A 4R0KA 4HZIA 4UJ3A 4DT1A 2XZLA 1UECA 4P4SA 1JBKA 3KL4A 2BCJQ 1EK0A 3T35A 4B71A 1N5LA 1W44A 1NBMD 1WF3A 2EYUA 4UNPA 4FCTA 2Z83A 2A9KA 1JQJC 1KI6B 4AC9A 1UJYA 2E9SA 3IPXA 4V0NA 5EXXA 3I73A 3VU9B 4TQUS 4A0RA 3EIEA 1KI3A 3CPEA 5AJVB 5IRCD 2RQTA 5FOWA 5AUNB 3CNLA 4ZPXA 2PBRA 2DWPA 3QG5A 2GBQA 1NL3A 1P2VA 2R62A 4DEXA 2IYLD 2OI3A 4L15A 2VO1A 1RZ3A 1SXJA 4OJKA 3A1WA 1JAIA 1YE8A 2EW1A 4XSGA 2O8EB 3F8TA 4AYWA 1Q0UA 2C9CA 5CJPA 1NBMA 4LK2A 1E9AA 5KSZA 1FP6A 3IIJA 2GZHA 4KYIB 2VSFA 4HB4A 2CSIA 1IOZA 2J3EA 2ZITA 1Z06A 2YC2C 3VHLB 4ASUD 1SKQA 1KI2A 1PUJA 4ORZA 1XNJA 3Q7PA 4AG6A 1M3CA 4DCUA 1SHZA 1TUEA 1U8AA 3T12A 5G40A 1TEVA 4LV5B 1VYVA 5SZHB 3TR5A 5JEDA 2G3YA 1IXZA 4XVUA 2G0TA 3M0SA 2QGNA 3NMZC 3RRZA 4RTWA 4LJYA 2DB3A 3VKGA 2MOXA 3U3JA 2E1RA 1R5OA 4EPVA 2L3PA 5EC7A 3I9QA 1I0CA 3HDTA 3CH4B 2DL7A 4RTUA 1Z3IX 1KDPA 4HCKA 2YUOA 2ORVA 2NUZA 1AQYA 1NVUQ 4HUTA 2GRJA 3I32A 1NKSA 2YWGA 1E3MA 3THKA 4S35A 1F2UA 2NQ2C 2GF9A 3SC3A 2GHIA 3PUVA 4K8OA 4V0KA 1OH6A 4NBSA 4MDEA 1AIPA 1BIFA 3PXGA 4EQ6A 2AZSA 4C0BA 2F1RA 4OQNA 3I5SA 4RTVA 3P32A 2FPKA 1G3QA 4IOKA 2DYBA 2J6OA 3NPFA 1J3TA 1KKMA 2CHGA 2BJVA 1LNZA 2GILA 2NOAA 2W83A 3P20A 4B33A 1E9CA 4FMDF 1BH2A 3SBDA 3VS2A 1TUIA 3QKSA 1ZD9A 2Q9AA 4FWTA 5JSZA 2W0ZA 1TADA 5KDLA 4JLPA 2CHQA 2KI5A 1ZUIA 2ZREA 1E6GA 2QA5A 2RHMA 4TYYA 3SE0A 3X1DA 1EFRA 1IAQA 5G3ZA 1ZM7A 2JW4A 4JLKA 2CL6X 3CWZA 1BMFA 3NWJA 2HLDA 2QP9X 2YWFA 2FPDA 4XWAA 4J0QA 2ERXA 4FMBB 1R5NA 1DAHA 4BFUA 4TMWA 2RH5A 1JEGA 2J0SA 4M1WA 3VRYA 5UKDA 2BBOA 2WWGA 2BBSA 4DCSA 2KSQA 4PFSA 4TLBA 4ZCLA 3A36A 4F38A 2HYIC 2QP4A 4Q1DA 3EG3A 1XD2B 3C14C 2AXPA 4R7ZA 3PR1A 3QKSB 1J7KA 2IUTA 3QWYA 3VS0A 3SDZA 4C0QC 2JM9A 1NP6A 1E7OA 2RGEA 4POAA 2ECZA 3BXZA 2FX3A 5TXGA 4HLQB 3U3KA 1XCGB 1Z6TA 3W5JA 2DY1A 3X1YA 1QRAA 2FPEA 1I4DD 4ZIRA 2IS2A 2OAWA 3KJGA 4MRSA 2AFHE 5DHAA 3OAAA 3EZ2A 3MRSA 2GJ8A 3SI7A 1JI0A 3C7KA 1SHGA 2ZIAA 3W3AA 2REBA 1UFFA 3JZAA 4LCBA 3E2IA 2YDLA 3BH0A 4MYUA 5EP1A 2WIBA 4DLRA 5FUVA 2O8BA 4LYJA 1XF9A 4AKGA 1AZTA 4U00A 2G6FX 5FPKA 1KI9A 4QOSA 3KUCA 4KODA 1CRQA 2QE7D 4DKXA 4D80A 4Q9JA 1TL7C 4Y0AA 1Z6AA 4WA7A 3WNBA 4HUQA 2VHCA 4BFXA 3EG1A 4I4LA 3Q8XB 4IDHA 4N3NA 3U3MA 2IT1A 3M1IA 4JL8A 4DLXA 2DNUA 3EXAA 3IHLA 4YQFA 3IIKA 2GQIA 3AGPA 4S2EA 1E9SA 4WZBE 2WTUA 3AKDA 2GNCA 4R98A 1YZUA 4JLAA 2YC4C 2DPXA 5FBLB 4XJXA 4DDUA 3VS6A 2B8WA 3GFOA 2FJUA 2FGKA 5FOSA 2W10A 5A5GA 4ESVA 1YRBA 5BWMA 4OQLA 5HR5A 2JS0A 4PXAA 3EHQA 4DSUA 3TBKA 3ZL7C 1NEGA 4Q1CA 4PPNA 1SXJD 4IEIA 1U5SA 4M1KA 1KYIA 2FF7A 2IYXA 4Q7KA 5EXSA 3B1ZA 2C03A 4C7OB 4Q1AA 3GJ5A 5DI3B 3THYB 4NYIR 2QSYA 3AP2A 4GOXA 5KOYA 1IY2A 5E7JA 2EWWA 4F4CA 3CB4A 4O2RA 4Z89A 2O0KA 4MKHA 4N0EA 5FL7A 4AYXA 2F6RA 3LA6A 1E9DA 4M1OA 5JRZA 1N0WA 2ONKA 4EFNA 2X3WD 3CWQA 4TYQA 2KGTA 1OIXA 1Q1ZA 3PV0A 2QU8A 4H1UA 4I1OA 1GRRA 1SRMA 1Q1QA 1A4RA 5EZ6B 2ERYA 3AEZA 2ZPTX 4P31A 4E6RA 4Z54A 4PC1A 3VS3A 2W6JD 4KBGA 3FKSA 2JTEA 5GJVC 5JS8A 1ZIOA 3K0CC 3WMFA 1W7AA 2JLWA 3B1XA 4TL8A 4RTTA 4Q7MB 4P4SB 4DLZA 2GA8A 4FMDB 3R8CA 4FSSA 1OPKA 4B48A 1OB5A 1Y57A 1EXMA 5EUQB 3LWNA 1E2FA 1RI9A 1Z22A 3T34A 4BFYA 4C9BA 4P4TA 4CGZA 2G88A 4ZKDA 2AK2A 2GK7A 2O88A 2B86A 2GF0A 2GTOA 5JJLA 1VIYA 4CC7A 1NJGA 4W9MC 1GNPA 2O2OA 1G3IA 2ZUDA 2XMFA 2UZ3A 5E7IA 3QUSA 1KO8A 2J0UB 2HF8A 5IK2A 5IHIA 4X1VA 1AWJA 3F5FA 1WXBA 1AJEA 2QM7A 1ZM2A 2CT4A 1WCV1 3DOEA 1MOZA 1D6JA 4GP6A 5EP2A 1MKYA 1TNDA 4OHVA 3KX2A 1Z0AA 1COWD 1KY2A 4JSYA 5KSYA 3T15A 3RNJA 3A98A 2IYRA 2JA1A 4OK5A 3ZD6A 4GPTA 3GJXC 1COWA 5JHGB 2GZAA 1X8JA 4TT3D 2O8BB 1LFDB 3N2IA 3D3QA 4OMMA 1DADA 3ND8A 4TL9A 2FEIA 3TQCA 1IHUA 4D25A 1CULC 2RQWA 4ILEA 3B9PA 3FMPB 4MH0R 5FPHA 2ZQ5A 2NPFA 4A8JC 1AS0A 4D2IA 1HQYE 4KFUA 4AD8A 4RFVA 2ZS9A 1UFQA 2OAQ1 5IXFA 3AVWA 3ZIAD 4DLTA 2MSEB 2JT4A 3WYFA 1RRFA 2Z5FA 2AX4A 3A58B 2FSFA 3TVDA 2ZVQX 3ZIAA 1W1FA 4US2R 1F2UB 1Z9QA 3GJ3A 4URZR 1T91A 2ZSFA 1CR2A 4C30A 4HZUB 1JEDA 3H86A 5CDFE 4J9DA 1E1QD 1GILA 4M8NE 3LQRA 2W0MA 5FPTA 1MO4A 1CS4C 2WKRA 3I5RA 4HAZA 1KJZA 1N3BA 3LD9A 1CKEA 1SPKA 1KMHB 3KXLA 2FPLA 2QPTA 4LYAA 1XTSA 4OI4A 5H8WA 2CHVA 1SKYE 1ZM9A 1JPJA 5AWFC 5I11A 1M2OB 1XX6A 2PCLA 1DE0A 5KNDA 2EPDA 2QQEA 4TTPA 1P9WA 1NVVR 1IBRA 4EFLA 4OHWA 2SEMA 4MRPA 2WWHA 4GBMA 3BBPA 4HYYA 3FWYA 3CX7A 2DFKB 5CLLA 2OCYC 2CNWD 1AWOA 2C0OA 2QMUA 3JVUA 2BJWA 2EGCA 3A1UA 4L4UA 4LJ8A 5J47A 1B3QA 3EC1A 2QTFA 3OIYA 2ZR0A 3HYTA 3U3OA 4WBSA 3F3YA 1Z63A 2D8JA 2QNRA 5DGXA 3TQFA 3QOFA 1VYTA 2KRNA 1VCMA 3M0PA 2DYKA 4KSBA 1KSGA 4LUEA 2EYQA 2FDCA 5L23A 2GVDC 3CBQA 4IDNA 1VCIA 4YMWA 3ZZTA 1RRCA 3WNDA 2FV8A 1NSFA 1U81A 2AD5A 3SNHA 1X8LA 2BVNA 1G18A 2PCJA 4I81A 4CVNA 4BLSA 1WB9A 4JZ4A 1K9AA 2DRKA 2H5EA 2PZEA 5L3VA 1KGDA 4AY2A 3AQ4A 3KJHA 3VKWA 2JCSA 3K0FB 1ZINA 2CL0X 3H84A 3NHAA 1T8UA 2ZRJA 1E2HA 4PSVA 3RS2A 5LDDC 2I0NA 1WA5A 2W2TA 2ZRFA 4LBWA 4QHYA 5FL7D 3O47A 3TH5A 4DIEA 4XD7A 2VA8A 4GSYA 1YZLA 3JVVA 3ZH9B 1A5TA 4AG1C 3ZVRA 3NBYC 1F2TA 2GJ9A 3VR5A 4JLJA 4HZUA 2XXAA 2NO1A 5JBQA 3AUXA 4L9SA 3MUFA 4OMLA 4RZXA 2VF7A 4FW9A 2HCJB 2LQWA 1ZUKA 3REBB 1BYIA 1W6XA 1GL9B 1W0KA 1RW4A 3BK7A 3MLEA 4MGIR 4MUAA 4EFMA 5CYOA 4EJSB 2K5UA 3U6BA 2QRZA 4B2IA 3FKQA 3VKHA 3PUYA 1CR4A 1R2QA 5HZHA 1BYUA 2PZFA 1KJYA 4EPRA 5L3SB 2ZJAA 3GLIE 3SZRA 1WXTA 3HU2A 4A0GA 1NG2A 4M1TA 4DDWA 2A30A 4ZKEA 1DTSA 3QG1A 1YQTA 1JU5C 2QMEA 1CXZA 1RFLA 4Q47A 1OOTA 4K46A 1J8MF 3UXMA 4HVWA 2W2XA 2HCBA 3FFBA 4HLUA 2DFNA 4KYUA 2WSMA 4BLTA 2EVWX 2V4ZA 1WE2A 1IN6A 4LHZA 4TLDA 1P7CA 1MABA 1PUIA 4JZ3A 2DFTA 3LDAA 3IUYA 4URYR 2V8OA 2KRMA 2JLRA 4IOMA 2J7IA 5G3YA 5EE3A 1L7VC 3QXSA 1UPTA 4A0FA 3ZS8A 2FFQA 2CE2X 4XTRA 4C4PA 4Q03A 3U3RA 2D2EA 1ODFA 4GBQA 1OF1A 1XJQA 1QWEA 5JJIA 1N6OA 4TSFA 3B60A 1HD3A 2PLRA 4DLVA 1MR3F 2JATA 2JDIA 1SVSA 3REFA 1LF5A 1K4US 3Q3JB 4TMKA 1OV4A 3FYHA 1MV5A 3I72A 2CK3A 1E2IA 1VIAA 2Z0MA 1NJFA 3K0SA 2JDID 1SXJE 4JLDA 2QMOA 1MUZA 4IIMA 1I4TD 4FMCB 3J81k 1JNYA 1CJKC 3QEJA 1GFCA 2GXAA 3RANA 1N6KA 2OEPA 2ZR9A 4CIDA 3U44B 4RKFA 2OUKA 3H0HA 1BS1A 5JLJA 3CM0A 1NI3A 1E1RD 3A1VA 4DLYA 1OFHA 3B2EA 4DT1B 2F55A 2I3BA 3IO5A 3DL0A 2ZI4A 1IY1A 1ZUNB 4G5RA 4LDJA 2A36A 3IILA 3RVBA 5SZKB 5EE5B 1G9XA 3ZZ0A 3MD0A 1NN5A 1T9HA 1YVDA 2CH4A 1P62B 1QZXA 4QHSA 4XIGS 4ZDWA 1G16A 3QKRB 3GLFB 5FOXA 3U7FB 5G41A 3G5UA 5TDHA 4QC2A 2X2EA 4CT4B 5F9HA 1G19A 1JR3D 5IT5A 4Q48A 1X86B 1WQ1R 2O5VA 2JIZA 3C41J 3A4NA 1X2QA 1OYYA 4M9ZA 1X27A 3QWXX 1ZYUA 2WJJA 1US8B 1ZMXA 4D6PA 2DM1A 4L8GA 1R8SA 5HE8A 1S8FA 3VHXA 4TQ9A 1R5BA 3RRMA 3AB3A 3QPWA 1FNNA 2QM8A 5EE1A 2QN6A 2LKCA 4O0MA 4XSHA 1A7JA 2O8CA 2DR3A 1YZTA 1Z6YA 4M1YA 1VDZA 2L2PA 2ZUCA 3QBTA 2JMCA 1KZGB 4QXAA 2PT5A 1JECA 2RMKA 4JJBA 1MH1A 5L8VA 2V7QA 1QHXA 2C9OA 3GLHB 2LQNA 4M0LA 2D74A 3F0TA 3AF0A 1SVOA 3NC0C 2H8HA 1G41A 1YJ5A 2JIZD 2XTMA 4NYMQ 3TAUA 4EPTA 1QDEA 1HUQA 2OLJA 1MO3A 1QHHA 1MV0B 5FL3A 1ZU4A 1OHHA 2ASEA 2B92A 4JMPA 2IA5A 3I1FA 2JXBA 2IWRA 3DM9B 2NG1A 1PNJA 1XCMA 1WP9A 2H16A 2KYBA 4JVSB 3SFVA 3KXIA 2VQSA 4LC1A 2SHKA 1EFCA 3T1VA 2WMNB 2VP9A 3KKQA 4O25A 4MYCA 1US8A 2ZJ8A 4C0AC 4DUGA 4Z1MD 5GADl 2RGDA 3KB2A 4AYTA 4LJ6A 4PAQA 1T6NA 1JXMA 1FPMA 1N5KA 4PQYA 4PQFA 5A4JA 3LFUA 1ZLMA 1UAAA 3TAHA 4IDOA 4A8JB 1FMKA 2FA9A 3RRNA 2OXCA 1AVZC 2FPMA 4LGMA 1OLOA 1RYFA 2GCOA 1W0KD 2EFGA 1Y3AA 2VEDA 4NP6A 4GL2A 1OHHD 2QQ0A 3L0OA 4ZNXA 1OEBA 3VRZA 4BASA 4ZCIA 5J4LA 3LH5A 5FTNA 2JLSA 2FH5B 2DLPA 1NY5A 4RD3A 5KNCA 1PV4A 1P2SA 1P5ZB 1OSNA 2I4IA 3NDPA 1CF4A 1G7SA 2J6FA 2ATXA 2GVZC 2WWIA 1UM8A 5TARA 2CLDX 4HDOB 3B9QA
chains in the Genus database with same CATH superfamily
1AN0A 3ISJA 5EJ7A 1CJUC 1XPJA 2VYVD 1T8RA 4U5QA 1ABQA 2UXBB 1D1AA 3AVOA 3CX8A 2WJGA 4V39A 1GQRA 5CB0A 1YIDA 4Y2PA 1Z16A 2LJ1A 3RU9A 4DSOA 1ECPA 3DTVA 3FMFA 3CQ9A 3P2MA 3I8XA 5GPBA 5HX7A 2QL7A 1YWGO 4ZO6A 4BAZA 3NHNA 1GTJ1 2EZTA 3QVXA 2ALJA 1PYDA 4U6QA 2F9MA 2NXEA 3G0GA 4AWAA 2MWOA 2BEWB 2OFXA 4DMHA 2O4UX 1AKTA 3FSJX 2E12A 4X8OA 2IU0A 3GFSA 3ZOKA 3NJ4A 3AG5A 2PEYA 3GL9A 2PR2A 2WPDD 4PLZA 3F3KA 2HLHA 3ET5A 3M9WA 3P9CA 1MO2A 3O93A 4LSWA 1XUOA 5LYJA 1JRIA 4I50B 3UHFA 2B30A 2F8TA 4GXRA 2Z5LA 4MWGA 3L6UA 1GM5A 1GITA 3G8AA 2FFBA 3K9LA 4L8VA 1N77A 1N33B 1YQ9A 1Q1AA 3U7HB 2JCXA 4ZU1X 4FZ5A 2MSLA 3C4VA 1KAOA 1QR2A 4X8HA 5EFZA 4JYBA 2P67A 3V4ZA 3RADC 2HSDA 4EIWA 4JJ7A 3L0SA 1KK2A 4HQ6A 5BY2A 1XEAA 3FDRA 1BDMA 1CF4A 1W47A 4YC7A 4H0FA 2G08A 2AIRA 3TF5A 4E5UA 4MUKA 3WLRA 1YQEA 4CMEA 4H6WA 3TIFA 1JG7A 2PUTA 3ELUA 2PD6A 2DD5A 2H1VA 5IAJA 4BGUA 5BUZA 2VUHB 3DE7X 1CDZA 2FP4B 2WTBA 1P0PA 1WHSB 3C74A 1H5QA 3H7IA 2XZOA 2E3IA 4XR9A 1ODTC 4O8ZA 1M5UA 1LK5A 1R9GA 1NXVA 3NVKI 4EMKA 4LX0A 2GBIA 3ID6C 4FFLA 4MQFB 2ZJZA 4XOIA 1XZNA 3OQVA 5U9CA 3FPBA 3PTLA 3ICWA 1DXQA 4Z0PA 2PL5A 3RC3A 2M0OA 3INZA 4MMLA 4DEYA 5ALUA 3E2UA 2J0UA 3AL2A 1FMLA 4J0DA 1ZMOA 1LCKA 1B3BA 3O73A 4KU4A 1A2QA 1G3YA 1Y5MA 3QRWA 4LF4B 1WX6A 3UWNA 2JLVA 5FFFA 1UANA 3F8WA 2VUBA 1G4AE 3CC4A 3VUBA 2ODBA 3Q8WA 4G4SO 3AR8A 4I1VA 4JB8A 4K87A 4U9IS 5CAEB 5LZ5A 3RT1A 5CKFA 2X5KO 3T94A 2K6DA 3KXPA 3OE5A 5CXUA 4UEOA 1FX0B 1P74A 2C4HA 4C1BA 3HM9A 2QJRA 3GDFA 3DZIA 4AZSA 5PGMA 3TO5A 1YCHA 2QS9A 3HH8A 1Z8DA 2HTFA 1TM5E 3RPEA 3W2IA 2OAUA 3QXHA 5J4KA 1J09A 2PRYA 2VHUA 1XXHE 3PX2A 5BMOA 2ZB3A 4ARZA 1RBYA 4WBNA 2ZSJA 4Q12A 4ZVSA 2PAAA 4BMVA 3OYMA 3NBAA 3ORFA 4NECA 4AZ0B 3UA6A 1KQSP 2ZPAA 2BI8A 1T1SA 2OZKA 2XRZA 1Z82A 3IP6A 4MNTA 1T6YA 1QHSA 1YUBA 3OB9A 1P8AA 2X7JA 5DM2A 2LCCA 4DLNA 5KTMA 1QVAA 1YJCA 3O3NB 4Q66C 2E3JA 5LKAA 1UEIA 4TL7A 2XCIA 3WGLA 2H7CA 4GI5A 1B2RA 1R6TA 1GLVA 1V26A 1VJTA 5B1SA 2R0QC 4IRUB 4FM4B 2IH5A 1OJ7A 1S01A 2DR0A 1UFVA 1XTZA 4NHEA 1M74A 1PT8A 1Q22A 1YAHA 2BIFA 5EEGA 4B8YA 2QQ9A 1G17A 4IIBA 1D6NA 1CIVA 1JEJA 3KRTA 4EEZA 1XCPA 3ASYA 1SEPA 1A98A 1Z5VA 1TT5B 4M7AD 3NANA 2BBTA 4ND4A 3W90A 4AY5A 1VKRA 4TLCA 3UFXA 2DL8A 1ZC3A 4DF3A 2HQRA 2R2GA 3IURA 3CRNA 1W35A 2JKYA 1L8XA 3EGCA 3NTIA 5AKKA 3SQOA 3TL6A 2O3QA 3WAJA 1AKQA 1YIAA 3E7FA 4CZ2A 3ICOA 1F0NA 1IXDA 2XT9A 3ZC3A 4D9MA 1M0SA 4TMVA 4YUYA 1BVHA 1MQ8B 1ZZEA 4LRQA 4CF5A 1WRBA 5CCEA 2BKAA 1QVFP 3MTQA 4H1VA 3PVLA 1RD4A 4I08A 3ZG6A 4CEIB 3ADDA 2RK3A 5JSZB 2LTAA 3E48A 1EFRD 1PR9A 4E7KA 4CG2A 1I2DA 1RHUA 1G2BA 1QH9A 2YFYA 2XCQA 2IGTA 4XLZA 3KZNA 2CCJA 2OL4A 1O94D 1YIJT 1R8JA 1Q12A 1TJ3A 3GXOA 4FFPA 2X9VA 2AFVA 2XUZA 4OL9A 5CK4A 4LVUA 5TQVA 4M21A 1ISMA 3VR1A 1L7EA 1VG9B 2NT3A 2ZP1A 5CH8A 3WK9A 3HTXA 3FHLA 3ZD7A 3EGIA 4TRNA 4JI8B 2EYZA 3HYCA 2VAWA 2XMPA 3IEKA 5GJCA 5FWDA 4D4HA 4F0JA 1T36A 1FZTA 3SJAA 2C2XA 3QYJA 4LXGA 1Z3CA 5H81A 1DRUA 5JZMA 4QTXA 3VDMA 1A7KA 4KO2S 2XKKA 3IIIA 3HO6A 3RFFA 2VWPA 3CLVA 2LWIA 4RPGA 4WUVA 4Q7JB 3AVTA 1KOFA 4ND3A 4P0QB 1I5OA 2CKKA 2B20A 1NDUA 5BSTA 4L4YA 1P9RA 3TBHA 1VLHA 4CIVA 2RI3A 1TG0A 1VRVA 4UTXA 1J5EB 1U1CA 3GUVA 1IN1A 2BIVA 3OEEA 3L9XA 1MAHA 1W52X 2IZ0A 3C5EA 3TRHA 3LGLA 5CKEA 3I5YA 1E5QA 1U28C 1VP3A 1YZGA 3O4IA 4GE3A 4NARA 1BXRA 2GJKA 3WLTA 2X1MA 1GKYA 3AINA 4AJ2A 4KPYA 1PWTA 1KAGA 1AOXA 1SQSA 2CD7A 1CW2B 2XQGA 1YVUA 4TWRA 3GPLA 1T4GA 2XDQA 3F9CA 4YCLA 2IDMA 1VIDA 1RE0A 2YNMC 1O2DA 3ISTA 1D3BB 3JXEA 4KXNA 4DIBA 4S04A 4KK3A 4PZYA 1FQOA 4HAWA 1KPHA 1XOIA 5KHOC 3UT1A 2PTHA 3FHCB 4BNKA 4DPMA 4EUEA 1RL2A 2X0NA 2LC4A 4Z7NB 1ABFA 4AZ3B 3G68A 1YVPA 1EVYA 2YSQA 1VCOA 1IONA 1EVLA 1AO3A 1SIWA 2CXPA 2CE7A 3IOEA 4J91A 4O2AA 4TXMA 2I4LA 1W5TA 5GP1A 4EGSA 1BXKA 3V7YA 2R8EA 4WWHA 1CU1A 3H16A 3RWMB 5EJ4A 4XVQA 1YJAA 2BEKA 4YJ3A 2D5IA 2Y1KA 4EYOA 5CA0F 1BZYA 5I7RA 4JCCA 1S1NA 1QYIA 1VJGA 2H9IA 4N5HX 4XYMA 1JG4A 2RKWA 3P8DA 1NVXQ 1X1QA 5DN6D 1GDDA 1KQ2A 2DBQA 2G83A 2PXXA 1J6UA 3IQDB 3KDAA 2PQ2A 4LVNA 1X9GA 3T4UA 2YIDA 3ROEA 2O8CA 1OASA 3FOZA 2KE5A 1RI4A 1UOPA 4KX5A 1I01A 2P75A 3PGVA 2EFYA 1URPA 3M4NA 1AKUA 2QTTA 1FEZA 5HA5A 4M77C 3AFHA 2MYUA 1TVMA 4K6OA 4M8IA 2JFGA 3DXYA 2WICA 4BO5A 3VM6A 2QE7A 3AETB 4PX3A 4JUIA 3EGEA 4PRKA 4XQ0A 2D5CA 4E1BA 3OOYA 1G21A 1W88B 1XJCA 3HU1A 4K9PA 1H2WA 3WWYA 4ZEVA 2P5YA 1Q86U 2LBPA 4IW3B 1O89A 5HZMA 3RIEA 1ACJA 3K9HA 5H02A 3SX4A 5HUJA 3L8FA 3MQ2A 3FRJA 3KAKA 2Z6AA 2W2KA 1VE5A 2GN8A 3KB1A 3QELB 4G84A 4ASUA 3TTVA 4V0OA 2BRUA 1DPFA 1FXXA 4FYKA 3TIVA 4C01A 4QOHA 5C52B 4RJJA 2GKSA 3W1EA 4LGVA 4YUWA 5FTKA 2I1VB 4LQDA 2O5EA 4QUJA 1E9VA 2JVIA 2VRBA 3EYAA 4IXWA 2PWBA 5TF4A 4N1AA 5B4VA 3OMXA 1WVGA 3ZFJA 2FG0A 1SJ9A 1J97A 3BMNB 4EBBA 5CBPA 2CXXA 2C8KA 2NXWA 1FUUA 1OU4A 3FPEA 3HCNA 4HFMA 1V3UA 3AJRA 5FLXE 2W6ZA 3CPSA 2EKZA 2JA2A 3PJGA 1SELA 1R6DA 5D5QA 2PMCA 3UMBA 3TTXA 1TW3A 2FHPA 3S1AB 4IRMA 2BEJA 3ENWA 1O6FA 5TS2A 1MQAA 2ZRQA 1TPZA 4DQDA 1C3XA 1OAOC 2H52A 3QU4A 4FNMA 1GFDA 2VBCA 3RVDA 2QTWB 3UXEA 4G5FA 3VOBA 4GSKA 4JN6B 3IAUA 1OUMA 1EFTA 3D8BA 2IHZA 1KIMA 5M29A 2GFQA 3KWJA 5DM7R 1ZI9A 2HD4A 1H2RS 4EG8A 2I4NA 4Y9TA 4ZI7F 1K8RA 1MC4A 1VCHA 3ZQKA 4YRCA 4ZCMA 4C92A 1S72Q 2HZBA 1KFZA 4E2XA 3MWGA 1EVIA 2FPFA 2VSYA 1UINA 2W8ZA 2XD9A 2ZSAA 3EXEB 2JL1A 1W0JD 4JITA 4JLMA 1FRFS 3ILYA 4K9SA 1C30A 2NPIA 4ZHSA 1T43A 2P69A 4B5LA 4DB4A 4I9GA 1IYZA 4CG3A 4FW2A 1XALA 1UBHS 2ON6A 2X2PA 3G49A 1HR0B 1JDSA 2BGMA 1OH7A 3UV3A 4MICA 5F64A 1G0NA 2VHTA 4WCVA 1NJIR 2GN0A 3DZDA 5HGJA 1E96A 3VU3A 4RHXA 1Y4SA 1P1BA 4J0FA 4S2UA 1L5VA 2ZCVA 3U4QA 4LD9K 2Q8NA 3JB9D 1FMWA 1CJMA 1NVFA 1P19A 1ULAA 1OYOA 5C31A 2XY4A 3ZDZB 5IHKA 3O1HB 2A1TS 2HBRA 5DJ5A 3GOHA 1HI9A 3RDVA 3KR9A 3SGLA 1XB2A 4RF4A 5IT0A 3Q0EA 1TMGE 3D6AA 1AXGA 3T7IA 2P2YA 1I7NA 4EIKA 1NYTA 5AI0A 4KDFA 5IXSA 5IC5A 2Q1TA 3E9NA 4MPPA 2GTPA 4NOMA 3WLJA 1H4QA 4LC9A 3IPRA 4C2TA 1T8PA 2CLCX 3IVMA 3KTOA 4FSHA 4R83A 2PSSA 1W34A 1UBSB 1NOJA 2IOYA 3TVYA 1N4DA 2OM6A 3K4HA 4KLNA 3P8ZA 4JUCA 4YP7A 2GBLC 3QU5A 2COZA 4BO0A 3TREA 5KNCH 5TF0A 1ULUA 2CL5A 2VDMB 2QRKA 3K9CA 1QH8B 4DWJA 1U3DA 3KOUA 2EV9A 1NMYA 3FH0A 3QWAA 5ULLA 4CEJA 1IN4A 1KEEB 1QUFA 3LBIA 4JBYA 4KQ9A 5CW1A 3QXXA 4F8JA 4RCYA 3RC8A 4BNLA 3IUQA 4LYYA 5KJ6A 4EL0A 4WKCA 4MIEA 4D4GA 3ZWYA 5LZ9A 2MYSA 4UUQA 1N1MA 2V1XA 2R86A 1QYCA 4OSOA 3TLMA 4AN1A 4ECEA 2IYYA 1ISFA 1EDBA 4G85A 4GBGA 4QEDA 3U6KA 4PYKA 2FRXA 1FSSA 1G9SA 1QS0B 2ZI9A 4F4UA 5M9OA 2JCGA 1HE2A 1Q0LA 3CEYA 2EKLA 2E4WA 1QF6A 1RS0A 3NC4A 3CNQS 3D6HA 3MJFA 3OMLA 3H11A 3GLRA 3HKSA 1JYSA 1SSFA 2VIIA 2J3HA 5TB5A 1E32A 2Q4OA 2WOOA 3NCTA 2LQKA 4BMPB 1G42A 5IJAA 2J6HA 4PFKA 4YJHB 3K31A 4MPRA 3CKYA 3JYPA 4GPIB 4DCGA 4FE4A 3U9TA 4OVKA 4R8KA 1YQGA 3N6RA 5FTJA 1U99A 1I32A 3DZBA 1QM5A 5K0EA 1NLOC 3TAXA 3RU3A 2GJAA 4S1PA 3NVDA 1CUWA 4LMBA 4EJSA 3L1JA 2Q6OA 3P9RA 4KDCA 4PNHA 3N8HA 1D0ZA 1OR8A 2GOYA 3BMQB 1H2HA 3HZRA 3MB5A 4XCXA 1W5EA 1VHWA 5BV0A 5BWOA 5KHLB 1LNXA 3LWHA 3F7NA 3CNBA 3OF3A 1MZVA 1H85A 2WP8J 3BJIC 3PUZA 3SD7A 1MVOA 3H9EO 1MMGA 2VYND 3L9WA 3WHLA 1LW6E 1ZWLA 1M3BA 2ZAEA 3DTNA 4ID3A 2IOHA 3L7NA 2AYYA 3CC7A 1WI7A 3PCTA 5FBWB 3X2FA 4GLMA 4YCJA 3W7AA 5LU9A 3CLRC 3B1WA 3GLTA 3OZ7A 5A5VA 3KSUA 2G67A 3OEWA 3B85A 1SXJB 4JLOA 5E4TA 3ZNOA 1D1TA 1YIJQ 4H7JA 4LRSB 2K2QB 4Z7QB 1JBEA 4FFNA 1XMQB 3ZN2A 3BD9A 5DM70 2QPAA 3HKEA 3ME9A 2QZSA 1EUDB 3D6TB 4GOKA 5HJ7A 3HM2A 1DJ7B 1PLKA 2QW0X 4YDSA 5AJWA 2RM4A 5FF9A 5ECAA 1FBTA 3L43A 2PKYX 3RWBA 3U13A 1VRWA 2QI2A 1TFRA 1Z5GA 5A0LA 5IT9A 5CKHA 2LP5A 1Q17A 1KQSS 5DHRA 5K4AA 3TQHA 4X9DA 1BMTA 2HHJA 4WCDA 4N03A 2X6TA 1JDBB 5EQTA 3WGOA 1UTIA 4DY4A 2O2XA 1G3MA 3JQ8B 4JVMA 4ZPJA 2R8RA 1QX4A 1DS6A 3A1TA 3QU2A 3H0KA 4LPKA 4BUCA 3R9XA 3F7MA 1YI2Q 2AXQA 4P38A 1B00A 2D0OB 4G1EB 2L8DA 1C0LA 3GNTA 4O4IA 3CCEA 3UKOA 2QRVB 4ARUA 5K4GA 4L6IA 5GVSA 5DBGA 4WOPA 5HIJA 2QE6A 2I6GA 3HCBA 5AK6A 3VU8A 1VLLA 2PFGA 1QZTA 2VDUE 2VKTA 4A4HA 1WD7A 2AEEA 4KVAA 4L08A 4W1RA 3D3NA 2IWHA 3RTDA 2EBWA 4MQEB 2KBTA 2P40A 2RHWA 2RQUA 1M7GA 2YWCA 3HBNA 3D3KA 3R4CA 4IIEA 4NBLA 3TDMA 3VSDA 1LB1B 1DWQA 1RQ7A 2YFHA 3U9SA 4DSTA 3FGOA 4IG9A 1A1VA 2NU7B 3PIPA 1G2OA 1SY7A 2QD2A 2X4LA 2RCNA 1ZBDA 2WD7A 3QBJA 3MMZA 1GT91 5EIBC 3CQTA 3O4JA 5JO9A 2YUPA 2ERCA 1WUKS 3N8GA 1SQFA 1KAHA 5ESRA 1RADB 1SBIA 4E14A 4K6HA 4M46A 2ETVA 3NTKA 1IK4A 1IJFA 2ZBRA 4R51A 3WMGA 3SZ3A 2PKCA 1G3UA 3QX3A 4GAEA 1M1KC 2QG4A 4NPHA 1CQWA 1BB9A 3DMTC 5AKIA 4E7OA 1PLJA 5LP1A 3KE9A 4CDNA 4QECA 1JIIA 1IDOA 4XJSA 4DS3A 3ITNA 3Q3IA 1E66A 1EX4A 4XIJA 2TMDA 1ZL0A 5TQ2B 3N7UA 3PXAA 4KUEA 2CLKB 1YR8A 4JDSA 1SEMA 1QJ4A 2LDBA 4XX1A 1NXOA 2VPPA 4JH0A 3WXMA 1UBGA 2RJNA 1OFGA 3CXCS 4M3NA 3TVTA 1PSEA 1F0KA 1P4AA 1D2RA 4PGAA 1IG0A 1ST2A 2AQHA 2VTKA 3F9RA 4KAFA 3VDRA 4C92G 3DE3X 3HXLA 3NH9A 4JR1A 4UNIA 1KSFX 2HF9A 5JNWA 4RLQA 4OM7A 2BH9A 3DW3X 4ESEA 2KXCA 3H41A 1GZVA 2G9ZA 4KRTA 1Q14A 1MG5A 3IQGX 2K57A 1N7IA 1NP7A 1H65A 2AXEA 2FFHA 1ECBA 2QLMA 2CK3D 5A71A 5T3YA 2WSSA 4J0GA 2XB2A 4M7AG 1H42A 2J30A 3N8DA 3OHSX 1W8DA 3BSWA 4KQMA 3B6JA 4NK4A 5KCMA 3X43A 3UPTA 3CC8A 3O94A 3T7JA 5C8YA 3JCMh 2DAQA 2FR0A 3EGOA 4XPIA 5GAOr 3CBPA 1Y4ZA 1E59A 1C9DB 2P6NA 3EVTA 2DF8A 2E21A 3EY4A 1YZNA 4KW7A 4ZI7A 3EWAA 4KQHA 2RI0A 2K3YA 4K9QA 2TECE 3OX2A 4AP6A 4ZAVA 1TTQB 1NW7A 3A8TA 1LUAA 4CIWA 3OPYI 3OLCX 4BVBA 3G71A 3KCNA 2MCFA 3QX7A 4IHJF 5EESA 3SQWA 2IP4A 2FSUA 1A5ZA 2P0EA 3AX6A 3DPUA 2XB9A 2HJHA 2LKDA 2QN3A 3IKMB 4YV1A 4ZYUA 4ZVNA 2MT9A 2KQWA 2GTHA 1VBMA 1XMXA 1O4VA 3E9FA 1DAPA 3GRZA 1S2IA 1Y5NA 2FFAA 3ETJA 3QE0A 1XRJA 2V5AA 1I1QB 2RG7A 2Z95A 3VJLA 2FPIA 1U1DA 1KVTA 3OC0A 4II7A 4HNVA 5MN6A 1ZK0A 4F4HA 3AERB 2BHSA 2BEVB 2DSTA 4PLPA 5IAEA 2H07A 4G9GA 1AZSC 1D1PA 1USVA 2YY5A 1N2IA 3BZUA 2GXUA 3I6IA 1SXQA 2P65A 3LKZA 4FI3F 2HXSA 3N0XA 4QPZA 3CXCP 4RK7A 4WN9B 5CU7A 2DQKA 3LOUA 3IVCA 4Q9KA 3IRVA 3WJAA 1ID1A 1ZJZA 2O7RA 4EF5A 4FOOA 1A4UA 3L82B 4RLHA 3I61A 5CQYA 3BE8A 4GEGA 3RNLA 1Z5ZA 3OTGA 2MYNA 2RHUA 2OCBA 1NV8A 1ZUWA 2DFUA 1DAFA 1UAGA 2PUVA 2HRZA 4YAEA 5BSHA 5KVAA 2PNFA 4OHPA 1CZOA 3DM5A 4LHVA 3V4FA 3K72B 2IK8A 3AL0C 4GICA 4K05A 1II8A 2QY6A 4YRNA 5FBZA 4ES6A 3PE3A 5EP4A 1CF2O 1QIGA 2JAQA 1XJWA 3A4TA 5CJJA 3RR2A 3DBLA 1C7IA 4D6XA 1Y6GA 1M9NA 2G9UA 3HV2A 3GP5A 2Q27A 2WMOB 1NHGA 3PRYA 2ROLA 3TEEA 3K92A 3PXUA 1GGKA 4GZ5A 3UDCA 5ALQA 2QBYB 4LDZA 4EW1A 3LLSA 4K9DA 2RHTA 2YJTD 2PUEA 3BDLA 4K5QA 2PH1A 3UEOA 4CEHB 1YONA 2FEMA 4HMQA 3H2JA 1C7QA 4ZC1A 2PRIA 1W4SA 5JSQA 3H19A 2K5IA 2D9TA 1Q3HA 1ZIDA 1N6IA 1U7XA 2BFAA 4MJ7A 4AS2A 4YV2A 3HB9A 4HTFA 2B34A 2CEKA 1P4SA 4YXWD 1D09A 1BBZA 2Q45A 2QYZA 4FEYA 4OHRA 5JCOA 1YC2A 2ZRKA 4WXPA 1ZWKA 5T67A 1TGVA 5TRTA 1Z0KA 3UHJA 3MJVA 3KTFA 1MB9A 5AJHA 3UJCA 4Y1FA 4B9AA 4ABTA 1Z15A 3W8DA 2HO4A 2B8NA 5EXEA 2O4CA 3C5WP 3EIFA 3CCUA 2AYZA 3TSYA 3U16A 1T2AA 2XECA 4UE3S 2V7BA 3RIHA 3ANTA 4CN8A 4TZ6A 1TQHA 2WB4A 1ZGBA 2WPDA 4KOEC 5DVZA 1VQOA 2G1PA 5GMKl 3GI1A 5JBNA 4L27A 1LS1A 2P9YA 4C4TA 5LKRA 3H5IA 3P9PA 2C0QA 1RXIA 1DEOA 1JGTA 5DEOA 2IEIA 2NTEA 2ST1A 4O2AB 3WADA 3AOEA 2Z4SA 5ADVA 5LQMA 4J7UA 3FDIA 1U3CA 2GD0A 3CSUA 1JLSA 3NS7A 5EWMB 3UUFA 3GF5A 3A2LA 1GQSA 3FBTA 4PJOG 3G5AA 2G07A 3AHJA 1PRYA 2PPVA 3IDSA 2P68A 4LA4A 2B4RO 4MVJH 3K4QA 5FJIA 3KDSE 4CHGA 4L4SA 2NAPA 2PQMA 2D8HA 3QK7A 1L4YA 3KSBC 4EENA 5KUTA 2YUNA 4ARVA 5J5CA 3JWJA 4NVRA 5KX5A 4JUVA 4PZZA 3UMVA 4CF7A 5I8WA 1RRVA 1NJIU 1IHOA 1XWFA 3M6MD 1X43A 4WADA 4DJFC 3AVYA 1NN0A 1NUPA 3GT0A 2OAP1 2V6FA 4HAIA 3L05A 4OJTA 1PWYE 3FF1A 1RI3A 5FBHA 3UKDA 3VPXA 3JASB 3FCSB 5F1KA 2WJ3A 4FEAA 5GY7A 1L6RA 2PD3A 1E1RA 4CG1A 1O08A 1N4AA 1H3HA 4WX2B 1AMOA 5F51A 2EFJA 4X84A 2VP2A 1J8QA 3CUVA 5DYYA 2TRSB 1WHJA 1BVYF 3PEYA 2PG3A 5JECA 1A72A 1RYMA 5LCXA 5C3UA 3AIMA 3L8YA 1DNPA 1F8YA 3K6JA 2P6MA 1Y07A 3GVHA 4Z51A 4PAOA 1WJGA 3ZV3A 3TG8A 5HTOA 2ODQA 4FC7A 2I67A 4HWSA 4U7HA 4TXLA 3DC7A 4XEHA 2JGEA 4C05A 2UYYA 4D79A 3Q8MA 4EMGA 2H2IA 1EFDN 1JR3A 3BGDA 4MR7B 4MPJA 5IP5A 5K3SA 4ETWA 2IYVA 3A9SA 5C35A 3IHKA 1AV6A 4DNPA 4WV3A 1V71A 2A3RA 4LMRA 3N2EA 3R5HA 1WDXA 3CC4T 4D98A 5E0OA 4L9WA 5K3DA 1U9IC 3PHGA 3PJRA 4OMNA 5KYUA 3H17A 4J6EA 2XV1A 1MOQA 1JG2A 1B4DA 1EZ1A 2RB4A 4S05A 1SC4A 4CM6A 1DIHA 3A4YA 4PCLA 3CG4A 5EJ2A 2JW5A 2E48A 4FGKA 1C1XB 4JJKA 2VXCA 5IJ0B 5GOTA 2ONZA 3LT5A 1QIKA 1DOAA 2B69A 3IP1A 3DMYA 3LPDA 3NBFA 3OZFA 4LCJA 4BZWA 4D5EA 3DMTA 3IHWA 3LUBA 4KO4S 2CVPA 3EPRA 3NTRA 3K05A 4RWZA 4BFSA 1G8FA 3NRBA 4DM7A 2F1LA 5CM2Z 2CDNA 4M0CA 4YJFB 3CPHA 3ESRA 1CK4A 3TLKA 4EEKA 4M7AA 4FNGA 4CMEC 1HSQA 2C4KA 2RN8A 4N01A 1F17A 2R5NA 2LT1A 1QV6A 4XU1A 4MR7A 5H9VA 4YRZA 1OB5A 1UZAA 4K9OA 3TR6A 5BWBA 2DTDA 4NE7A 2OQIA 4B43A 4LOHA 4M8KA 4OHMA 4BO3A 1JIXA 4KP7A 2ZG6A 4GMGA 1JH8A 2W93A 2DZ9A 4JJCA 1D2AA 4GQBA 3AT1B 4X92A 2BYTA 2OILA 2XQFA 3DLMA 1RWMA 3D4LA 4NCNA 4RNDB 1NLUA 4O6VA 5EJ9A 3TW8B 4RFSA 4ZANA 4PTLA 3TOSA 1KTIA 1K86A 3I45A 4CM4A 1LDNA 4Q34A 4Z9BA 1WMEA 2H17A 2VL7A 3FBGA 2MU1A 3D0QA 4N0AA 1TVCA 3AM1A 3UG6A 1KK1A 1I4EB 3HZHA 4OF4A 4QPDA 2MJLA 2XMCA 1KQ1A 3HMKA 3M1LA 3VR2A 4D3ZA 3OIUA 2D6FA 3T4PA 2C3YA 5D7UA 2HLDD 5F9MA 5JXIA 4Y6QA 1QHYA 3A6EA 3JCMX 1YN8A 1KO1A 2BGGA 2VSQA 1XZPA 3B9RA 4MKFA 4ZU6X 2QTLA 2XE6A 2QQBA 3GAMA 3MGCA 5JAMA 3SS8A 4C8QA 2GAFA 2GYYA 1GZSA 4Z0NA 4DBVO 3DMNA 1VKJA 4LNUB 2M9MA 5KX5B 3S6JA 1DDIA 5AO9A 1ZUUA 4TWAA 1YGPA 5GJWC 4RKEA 1N9ZA 3WSWA 2JI7A 3BHMA 5TY0A 3V7FA 3U4QB 4C5HA 1L9KA 2WVGA 3L0IB 2GSDA 4MVJG 1H2YA 2WR8A 3IIMA 1KS2A 2FWNA 3HJFA 1M8PA 1QRSA 2M1ZA 3HP4A 1BU1A 2WAYA 3FFXA 2VDNB 1ISJA 3GMDA 4G5HA 3W6PA 2YVAA 4XQCA 3A10A 3ROXA 2W42A 3CZ9A 1XLVA 1TQ6A 4AO8A 1R4MA 2D13A 4DBLC 3GFVA 3HKCB 4WMLA 1N32B 2COEA 3JCMe 4YV7A 1O0CA 4YP6A 4QQDA 4MGHA 4OBEA 3S81A 4G4JA 4UOQA 4OO3A 3RVPA 1M2KA 4YV0A 1P5HA 4FGSA 3EZ9A 3PQDA 3PNVA 4KGDA 3SC2B 2Q9CA 3T3HA 2AOVA 3SZMA 3GEDA 4H60A 1CQIB 1VQNQ 1T29A 5DIFA 1L5KA 4EJ6A 1OXVA 4F97A 1CJCA 1Z2DA 4U0KA 5JAHA 1MO6A 1XN1A 4TWZA 4YUXA 1Z9ZA 1X87A 4LXIA 4XEUA 4IAOA 3C98A 2YZ7A 1LPNA 3GJQA 4RJLA 4KV7A 4UBNA 5T41A 1VYUA 4BFZA 2BHRA 4UQPA 2AXNA 1NR7A 1U8EA 1W96A 4PANA 4RD0A 5IDYA 1YU6A 3R74A 4WBNB 4LX8A 1NUAA 5EWJA 2M0YA 2VAPA 1RQLA 1CKBA 1USGA 2X0EA 8LDHA 2IZ5A 2O2SA 3UAYA 2XNJA 5M2QA 1VQKQ 4EMHA 3QMVA 2Z9CA 3GVIA 4KHZA 3KQHA 2FFRA 1UGQB 4F12A 4JVNA 4OBXA 4H7KA 4F2GA 3OBYA 3SF0A 4A9AA 3IJEB 2V03A 2CSXA 1ODCA 2O9SA 1OIWA 2PL1A 4IJUA 6LDHA 1KZHA 1OZ3A 2PJZA 3NYWA 2B83A 3FLMA 3L4BA 4LIPD 3EUEA 1E3DA 4U2GA 4NG5A 2GGSA 4XGRA 2QLJA 4CKWA 4D3DA 4RL6A 3BJRA 2IC5A 4KIUA 4UDOA 5CGQB 3VZSA 1BN7A 1YB6A 1ZLYA 4PJOA 2QMYA 3KNZA 1KARA 3L18A 3QYPA 4PYLA 5EKDA 3UIEA 5AVXA 5HBRA