1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
3S1AA 4Q9IA 2DF6A 1U8AA 5BW8A 2WM9B 3NWJA 3ZIAD 2YNMA 4O2RA 4DB2A 3U6KA 3SN6A 2YC4C 3CPEA 4BLRA 2HF9A 2MSDB 3CQTA 5IHIA 3GLHE 1WBDA 1Q0UA 2ZVQX 4OK6A 1JXOA 1Q1QA 3KTAB 1ABQA 2QN6A 3FJ5A 1NY5A 2VTKA 2L3PA 2YKGA 1VHLA 3PEWA 2ZM5A 2BKUA 3BORA 2GGRA 4M9XA 3A1TA 5CB8A 1SSHA 3GLIE 1N6HA 1VCIA 2G1JA 2JDID 3PVSA 3J81k 1WIEA 2BJVA 4RKFA 5E7MA 2GTPA 5GJVB 4HYYA 5TY0A 3BH7A 2J0UB 2JM9A 1YR8A 5A0FA 3W34A 1R2QA 4LHXA 2KXCA 4J9BA 2QBYB 2JJ1D 2DBKA 4ESHA 2GESA 4DLZA 1KSGA 2DE0X 4Y0VA 4OMQA 5CJ2A 4NDZA 4DWJA 3THYA 1Q1BA 1YJ5A 3BFVA 1M27C 5L3RA 1H8HD 4BWYA 1S2MA 1XMIA 2QPTA 3TW8B 4P4UA 4R2HA 2PZEA 3L0IB 4N1AA 821PA 2O8BA 1E2QA 4MKIA 1YZUA 1Z8FA 2C78A 1NLYA 3QXXA 3VS7A 1N6PA 2CNWD 3SQWA 4O2LA 2PJRA 1P62B 2FDCA 1IOZA 2AKKA 4A1FA 1H8KA 3BFXA 1G2BA 4DLRA 2IXFA 5AJXA 3SHFA 3ADDA 1MO6A 1P3JA 2CHVA 4JMPA 1KI2A 1E2KA 2EKHA 4LYAA 3RS2A 1X2KA 2WJYA 1LW7A 4D81A 1GRNA 1KK0A 4P4SB 2JGNA 4PR0A 4D82A 3PEUA 1QCFA 2KE9A 2GXSA 1TTTA 5FFMA 2IEZA 1G5RA 1CKBA 1SVIA 1UBCA 1KAGA 3PITA 4EPVA 1X6BA 4ZDWA 2CT4A 1CEEA 2XNDA 4HLQB 4A2QA 2ZRNA 5GADl 1U06A 4BPBA 2Q3MA 4AG5A 1XTQA 2GEUA 2MSCB 4PANA 1MV0B 3U6BA 1MV5A 1VDZA 4M21A 1NJFA 1SKYE 2QMOA 3UPUA 3KQHA 3ZDQA 3LDAA 3CRRA 3SEMA 2QGZA 1DAEA 2CUBA 2K5UA 2A36A 2NMVA 2GCOA 2DM1A 3HPQA 1SHKA 3GJ6A 1FUUA 2JLWA 1T9HA 1ZINA 3QOFA 3IQXA 2ZSFA 4IXMA 3VS2A 2VSXA 3JVVA 1TUIA 4JLMA 3GLIB 3EG0A 4B6EA 4CIDA 1UKZA 1OPXA 4B3DA 1QHSA 2LNHB 1MT0A 3NBZC 2ZRMA 4O3MA 2IYYA 3ZZUA 1BBZA 2HJVA 2ZVPX 1B0UA 1T5IA 4J9EA 4QT7A 1ZNWA 1PV4A 4PHHA 1GG2A 1XD9A 4Q4HB 2I1VB 1K4US 1EXMA 1N6IA 2IUSA 4LUEA 1AIPA 1L7VC 1S1NA 4OI0A 4QM6A 1MO4A 2QTVB 3QF4A 1OKKD 4CC3A 5JEDA 1JPJA 2GA8A 4UNSA 4QM7A 2CE2X 3BBPA 4BRUA 4WAUA 2BOVA 3LXXA 1RRFA 3L2OB 4RFSB 3MRSA 3RRMA 2Q9BA 1Q22A 4QC2A 3PCRB 4BEJA 1Q3HA 3KQKA 4PX9A 3PUXA 4F17A 1P75A 2EGAA 1II0A 1U90A 4ESVA 1AA9A 1D5CA 4FMCF 4AC9A 4V0OA 1Z0KA 3B6EA 3RLFA 4M1WA 4Q1FA 5FOVA 5L3VA 2NO9A 1W0JD 3IO5A 4WXPA 4YC7A 3KXKA 1YZKA 4LJ7A 1NL3A 1P9WA 4OI4A 5I11A 3VR1A 3Q7QA 2BJWA 2I3BA 4Z8YA 5J4VA 4K11A 1W6XA 1ELOA 4C0AC 4F92B 4FCTA 5F2EA 4EJSB 2KXDA 2A9KA 3GP8A 2ORIA 1NVXQ 4EJSC 3Q3JB 3FMOB 1DG3A 1SXJA 4GPTA 4NYMQ 3AKEA 4JJKA 2GKSA 3QVUA 4CEHB 2CJWB 5KDOA 5LDDC 2ZRPA 4PQYA 3T1OA 1Z6GA 1UJ0A 1EFCA 4ZKEA 2FEMA 1CIPA 1IN5A 1E2GA 2QL6A 5F9FA 1JJ7A 4C2TA 1WX6A 1ZC3A 3PUWA 3WMFA 2FSIA 2XTMA 4OHWA 1SKYB 4DHEA 2A78A 3AQ4A 2WWYA 4LHYA 2JJ2A 3CWZA 3VNUA 4QL3A 3TVDA 2R44A 2AK3A 5AJVB 4OHVA 1IY2A 4KHZA 4IVQA 1N2CE 1R0XA 4LYHA 1FP7A 2DL7A 1G41A 1OFHA 3QE0A 3QSYA 1IN4A 1E1RA 2AX4A 1NG2A 2QE7A 1YE8A 3CF0A 2ZXUA 5JI3E 4QGFA 2FN4A 4A2PA 4FWIB 1Q1ZA 3IILA 3H0HA 2B92A 5FOSA 4BECA 2KEAA 3X1WA 1F48A 4KFRA 1E9DA 2ZETA 3TK1A 4DDTA 1K9AA 2OHFA 4YQFA 4C7OA 4DC9A 4ZI2A 2DRMA 1T4GA 1XD8A 1E2MA 1E2HA 2ZJZA 4TLEA 2CL7X 4LI0A 1SULA 4QXAA 4DSTA 1Q3TA 1GFCA 2F43B 5EXXA 1R5NA 4RD0A 1PUIA 2WSSA 3VRZA 3TQFA 2AK2A 1OV3A 1E96A 2QAJA 1RI9A 1ODFA 4M1OA 1NN3A 1TQ4A 5J4YA 5FOTA 3SI7A 1QF9A 4FCVA 3FKSD 5TARA 2NTYC 5EUMA 3RDPA 3P27A 1M8MA 1GRRA 2EW1A 3DOFA 4UNPA 1FW6A 2EQBA 4BZXA 4JVNA 3JV3A 1DAGA 2DA9A 2IC5A 2RKOA 2EYQA 1HA3A 4RD2A 3K1JA 4GL2A 3RC8A 1S1CA 3KKQA 4N0EA 3QXSA 3T61A 3TRFA 4YMSA 1W36B 2AKLA 4L4UA 3KTAA 2ERXA 5CITA 1XX6A 2WWIA 4RCZA 1W36C 4LBYA 3QNUA 1XMJA 4YMVA 1X27A 2JLVA 1BIFA 5EXSA 1OSNA 1UTIA 1D9XA 1FQKA 3MSXA 5TB5A 3T12A 4CRWB 5JJKA 1RIFA 2ZEJA 2IUUA 3SDZA 2R9VA 4ARZB 2O0HA 1PHTA 2NG1A 2ZUCA 2Z83A 2IL1A 2PNIA 1DTSA 1ZLMA 4Y92A 4TQUS 4Z89A 4URVR 4K81B 4BQSA 1E4YA 3KJIA 4KLNA 1H8HA 1KKMA 1S3GA 1CU1A 2VYFA 1N0WA 2NO7A 2EYXA 1NYFA 1W46A 2ZRAA 1NMZA 2HUPA 4POAA 2EFGA 4URWR 3KJGA 4CEIB 3RRNA 3CLVA 2ZANA 1DOAA 1OXTA 3DZ8A 4OQXA 4PPGA 3V9PA 5IH2A 1BOFA 3KXLA 1XCMA 2G88A 5FPHA 2ZYUX 2CNWA 2CMKA 3WYFA 3OHMA 1OPKA 4O25A 5FPSA 3VKGA 3K09A 2O8FB 2OESA 2CXXA 1K6MA 3VU9B 3C4JA 3O8CA 2ZS7A 1T5LA 3BS4A 2FSHA 4B75A 2P3SA 1E6CA 2FPLA 1O87A 4M22A 3U4QB 2J46A 3AB3A 3WBKA 3R7WB 4G5SA 1MUZA 1SHGA 4AG6A 3CR7A 1TF5A 1XEWY 2CDNA 3QBVA 521PA 3VR2A 1NKSA 2HSPA 1W4AA 5JSZA 3M0SA 1WXUA 2KBTA 3T5DA 2KR3A 1HD3A 4AFUC 1X69A 2ZPTX 2Q9AA 4DLVA 4QGGA 5EP4A 1I4LD 1SHZA 2ZI6A 4MGKR 4QNRA 3SFVA 4BUJA 4E09A 4JJBA 4I99A 3NKVA 4HLCA 4F14A 1JB1A 2QU8A 1J70A 1AD5A 5EE5B 4NYMR 1GCQA 4OQNA 2VKNA 3HU1A 2VHUA 3GJ0A 2L0XA 3M0TA 1AWXA 3CBQA 2QSZA 1CSKA 2XB4A 2JCSA 4U5XA 3ZS9A 2GCNA 2EGEA 5BQ5A 1KSFX 4PAOA 5CIQA 4UNRA 2K9GA 1X6VA 1P4SA 2VHCA 4HEJA 2C04A 2DPXA 5IRCD 2REXB 2JIZD 1E6GA 2CLSA 5KSZA 3RYTC 3G5UA 4MYUA 5E4FA 2LCSA 1XOVA 3GLFA 3NEJA 3K0SA 2AR7A 2HV8A 3UA7A 5B2ZA 3U7EB 4RTZA 1P2UA 4H9GA 1DAKA 2WOJA 1RVDA 3K70D 1JEGA 1WA5A 2W83A 3LY5A 5A5GA 1VYTA 3QKTA 1UUEA 2ATXA 1NN1A 1E69A 1NSTA 2ANCA 2QT0A 1K0SA 5JWHA 3B13B 3BAFA 2ODEA 1YR7A 1TUCA 3LWNA 3VS6A 3DOEA 2XJ4A 3C5HA 3SOPA 1HE1C 2EYUA 2G9NA 4Q4HA 3KQNA 2OFOA 1WE2A 1BU1A 2UZ3A 4A92A 1Z6TA 2GRJA 4HZUA 2O88A 4LBWA 4G0NA 2OJ2A 3TVTA 5FL3A 5A4JA 3KFXA 4PC3A 3I9QA 2YOFA 2CREA 4FMDF 2MMCA 4YLGA 3W6NA 4CT5A 1GAJA 3L0OA 3ZS8A 5C1BA 3AKCA 4XSGA 1W0JA 4XWOA 1T6NA 5FH9A 1UDWA 3QWXX 1NN0A 4IDHA 5FTNA 2NPFA 4B34A 1BS1A 1OF1A 5AUOB 1GITA 2P4RA 2ZSAA 3CW2A 2IK8A 1W4RA 5HE9A 4OL0A 3PVQA 4ZDJA 1W1FA 2DY1A 3BB4A 3B1YA 1NLFA 4DEXA 2MMGA 3V00A 2DCUA 1JAHA 4LCBA 1DADA 1UHCA 2RQWA 4NKRA 1XRJA 1IJEA 1UEJA 1I1JA 2BM0A 2PTKA 2FPEA 1GILA 1XMSA 4CVNA 2AWNA 1E0SA 5FPTA 1OYWA 3QPWA 2A5JA 3A4MA 3GJ4A 2RAPA 5DI9A 3A4NA 5EXTA 3MWKA 2OI3A 4LUCA 4MYHA 3VR6A 4E6RA 4ZIRB 1WXTA 4AD8A 3ASZA 2B86A 2KGTA 2ZJ2A 2R6AA 2LP5A 1I07A 3P32A 4JVLA 3A36A 3I5SA 2I1QA 2EQIA 3A6PC 5FPYA 1AEYA 2C77A 1AQUA 2ZU0C 1N5JA 3C0CA 4J9IA 1NY6A 2PX0A 3Q8XB 1W4BA 4Q7KA 4LJ8A 2GETA 1SVLA 3U3KA 2X2FA 4IEIA 1FMKA 2D0NA 3P4XA 4OQFA 1ZAKA 1Z5ZA 4JVMA 2XZOA 3BK7A 4OQLA 3A1UA 1Q44A 2DX1A 4Q02A 3RSLA 3TQCA 4A0HA 4B74A 3ICEA 1T3HA 1YRBA 3I73A 2ZJ5A 2P65A 3H41A 4X1VA 1NBMD 2GXQA 3MJRA 2W2VA 5DYGA 5TDHA 4LOAA 5C4GB 4DUGD 1ZM4A 4BEBA 3FHTA 1CULC 5GVSA 4UNQA 3ZVLA 3GMTA 4BFUA 1QKXA 1VTKA 2W00A 1XXHA 2ZI5A 5E3HA 5EE3A 4PTLA 2BDTA 2IS4A 4GMXA 3QKRA 3N70A 1HYQA 3HU2A 3O8BA 2CSIA 4C0JA 5D3MB 2KNBB 4D0GA 5GJBA 5SZKB 1GKYA 2VP0A 2J0QA 3CPJB 1XEXA 1AKEA 1ZSGA 1VG9B 4HAWA 2H92A 4UXHA 4PPNA 2DMOA 1KSWA 2ECZA 2JM8A 2R6CA 4UXIA 3NC0C 5TVKA 1JR3D 3BB3A 4RJLA 4UJ3A 1WF3A 2VL7A 2Q0HA 2OZEA 4Z8XA 3W6OA 3AV0B 2J41A 4RD6A 1E99A 3NBYC 2QP3A 1RC8A 5JWOA 4V0NA 2QRZA 2RQUA 2B7CA 2V7QD 2WKQA 4JLBA 4BFZA 3TUIC 1UHFA 3MWLA 2YWEA 2REBA 4Q18A 1FNNA 3DKVA 4XVUA 1HY3A 1Z0DA 5J4HA 1G7TA 2SEMA 2XITA 5KU1A 1SGWA 2G0TA 1TQ2A 5FBVB 1FUKA 3M0PA 1KI9A 2EYWA 3EG3A 3GEHA 3MCAA 2ED1A 4Q1DA 2AD5A 2YVUA 1UADA 2C0OA 5LB2A 1R8QA 2QG6A 1CF4A 1IXRC 3ONWA 3VR3A 1I4DD 2FSFA 2WWWA 3I62A 4E07A 5FTJA 4ARZA 2IYVA 5DI3B 1ANKA 5JJIA 1EG7A 1K8RA 4JL5A 3OE7A 2CLDX 4CDGA 2OM2A 1SZPA 4R71A 2C03A 2PH1A 4QGHA 2J7PD 2V4ZA 1WBBA 1QWEA 2BBWA 4JSTA 3LNCA 2ROLA 1PJRA 2GJKA 3HDTA 1W48A 3LRPA 4ESRA 1QHHA 4FN5A 4JJZA 3VMFA 2F2WA 3JZAA 4A2WA 3EGUA 1KO7A 1M8PA 3V4RA 1QWFA 1IY1A 4IIOA 2WBLC 5GJCA 3U7HB 3AVQA 4K8OA 2WOOA 4UJ5A 2RCNA 2ZI7A 1SRLA 2VHQA 4GSYA 2IF0A 2YYZA 3FGNA 4IHQA 4C0LA 4Q00A 4XTCS 3OEHA 4BLTA 2EU8A 3UIEA 5LPNA 5KPJA 3U4QA 3LW7A 4GP7A 5IHKA 3AP3A 2JMAA 4CZ2A 1O3YA 1P7CA 2D7DA 2WWFA 1RJ9A 2XZPA 2MOXA 5F98A 1ZBJA 3HU3A 2BBTA 1US8B 4RTTA 4F4IA 1AWJA 2ODBA 1BYUA 2QNRA 2YC2C 3LW8A 1QHYA 1TMKA 2YT6A 1W1WA 2Q3FA 2QPAA 3TW4A 3WRXC 3FTQA 4P0TA 2MIOA 2ZRFA 1D6JA 1GKIA 2CBZA 3L82B 3ZL7C 1ZBDA 4IOKA 3TSOA 1E9RA 4N0DA 1GNQA 1S9DA 1UM8A 4EFNA 5HKKA 3LBIA 1E7OA 1CJVC 2HEQA 1EX7A 2FA9A 2EFHB 3IQWA 5CYPA 2F1HA 8OHMA 1NP6A 1AM4D 3BGWA 2IF2A 2C5LA 3I5YA 2CUDA 3ETLA 3K9LA 2Z43A 2IA5A 5JEEA 1RRCA 4PAQA 4RTVA 1JECA 1JPNA 1R0YA 1X1RA 2H16A 2O5VA 4HLUC 1A4RA 1Q1EA 4RZ3A 4DDUA 5KYKA 1I0CA 2JLZA 2JW4A 2ECKA 2LKCA 1F2TA 2DFNA 3I8XA 4JBYA 4JYCA 1ZUNB 1KO5A 2V6JA 2YOGA 4ZKDA 2RH5A 3KKNA 3R8FA 1C4OA 3ZD6A 2RNAA 1AWWA 1PRMC 5AUPB 3CX6A 4FIDA 4XJXA 1G4UR 2JS0A 4R7ZA 5J47A 2R6GA 4DLWA 1J90A 3AEZA 1U3OA 3CH4B 2KBFA 4GFDA 4XD7D 3DPUA 5H8WA 1CR0A 2BEJA 2F1IA 4L9WA 1RW4A 4UQOA 4B32A 5BN5A 2EVRA 3R6NA 4LRWA 3SJBA 2J7KA 1CRQA 3AVPA 1U99A 1IN6A 1G6HA 2FFAA 2VPPA 3QPVA 2O52A 4OI1A 4AK9A 3RBBB 4JS0A 3C15C 4TTRA 5FL7A 2J0SA 3G0HA 1R6BX 2ODNA 1TAGA 5JRJA 3EPLA 1WA7A 2HJGA 2IT1A 4MRNA 2QY9A 3ASYA 1G8PA 2R65A 4PPQA 4RVCA 2XGJA 1A2BA 1DAFA 5AR1A 5CDFA 2V9PA 4NCHA 4PO8A 3B9PA 1ZUHA 1LFDB 3GFTA 3RHFA 2JJ2D 4PSKA 3CZPA 1KYIA 2W2TA 4GBMA 1ZNXA 4JLNA 5KPDA 3FVQA 4F16A 2GBLA 4PHFA 2CEAA 3PG5A 1K5DA 1HV8A 2A3RA 1OJLA 1AZSC 1E9AA 1EK0A 5FUYA 1CR1A 3EA5A 4LUDA 4Q21A 4Z8AA 3BE4A 3PUYA 1Q12A 4FD2A 3U23A 1QVAA 2F3RA 2UKDA 1FX0B 2FV8A 3O47A 2M0YA 2CHQA 3D31A 3I8SA 2LJ3A 2XOKD 4M4SA 4QJ4A 3OFNA 4W5WA 1G9XA 2CVHA 2P5SA 2GK7A 2N46A 1LS1A 4MKHA 2Z4RA 4LHWA 2ESWA 5J4LA 2FRYA 2D1XA 2C0TA 4NHOA 5DHFA 2WSSD 5ELXA 2HBWA 4ZIRA 3SYLA 1UDXA 3OIUA 5F3WB 3K9NA 2ZE8A 3RS7A 3P20A 1LCKA 3VX4A 1OIXA 1G8YA 2QP9X 4B2PA 3AF1A 3M4YA 1IN8A 1G8GA 5L3QB 1NBMA 2ZJ8A 2PMDA 4DUGA 3QBTA 2PJZA 4M9QA 1M3BA 1IN7A 1GBQA 1IM2A 2KT8A 1NEGA 1E2EA 3BXZA 3IEUA 4IRUB 5KO2A 3D3QA 2YUPA 3GPLA 2CL6X 2XX3A 1DE0A 4KLZA 4JVSB 4XH9B 3WMEA 1CJUC 1GRIA 1H8ED 2D4HA 3HP1A 3UXMA 4J9DA 2IS2A 1NYGA 5BN4A 1TEXA 2A7QA 2J6KA 3B1XA 2LJ1A 1M30A 2LQWA 3E1SA 2LJ0A 2L2PA 2IXGA 4PXAA 3KUCA 5HTKA 1R10A 2XNSA 2QDLA 1MH1A 1JR3A 1PLLA 1WRBA 3C14C 2CK3A 4IW3B 4EPXA 5D3MA 4F4JA 3GLGB 1UAAA 4QOSA 3SNHA 2GZDA 4OMPA 4JT2A 3REAB 4F7WA 2HXSA 5EXPA 3AF4A 4Q9JA 3KZ1E 3B8HA 2V7QA 4ZDKA 4WZAE 4O0MA 3LLMA 2VRWA 4KYIB 3TLXA 2L3SA 2ZRKA 1LF0A 4FCWA 4KRTA 3EG5A 2YWHA 4GLMA 1FTSA 1GWNA 4GZLA 4M53A 1RYHA 2J05A 5FWBA 4US1R 2YSQA 3SYKA 2BHRA 2A37A 1Q21A 1YU9A 4B71A 5KOYA 1WP9A 4G5RA 1M3AA 1DPFA 1T8TA 1JR6A 2IYTA 4B2IA 1AK2A 1EESA 3TJZA 2NUZA 3CH5A 3SHWA 1HT1E 2HT1A 3K8YA 4HAXA 4CT4B 1VCOA 2ODWA 4F4CA 5JFGA 2Q6TA 2EFEB 3AUXA 3T5GA 2P6RA 4ZCMA 4IEEA 2F3TA 3B7GA 2J7PA 3T34A 4US2R 1TG0A 5E7JA 1N0VC 4TMXA 4JIMA 1D2NA 4Q4JA 4Q4AB 1W5SA 4DIEA 2DBYA 4ACAA 4E5UA 4KITB 2QTHA 1GZSA 4EDHA 1RRPA 2FZ4A 1KIMA 3BIFA 4KVAA 2FE4A 4Q5IA 4C30A 4EQ6A 2O8DB 1S4QA 1Z0JA 2LZ6B 1KHTA 3EX7C 1NKTA 4TYPA 2W10A 3O8DA 3R9WA 2D06A 1WQ1R 2KE5A 4LYJA 3GLHB 3CX7A 5B64A 4KV9A 3RNLA 4PSVA 1CXZA 1U9IA 4LSGA 1T8UA 2GNCA 2XZLA 3VKHA 5EC7A 1IONA 2D7CA 1VG1A 4MUBA 4AURA 1XEFA 1K76A 1ZJ6A 3CR8A 4Q9KA 2PLFA 1QHGA 1L4UA 4YONB 1YN8A 1VIAA 2C9OA 3LO5A 1E6HA 3TKLA 2A28A 4OKSA 1XCPA 4H1UA 4Q19A 3PUVA 4D6PA 2D8HA 2D2EA 2BC9A 4PC1A 4W5HA 5CIWA 2XEXA 3EZ6A 1AWOA 3WP0A 3HPRA 1CJTC 4QG7A 3ND9A 2TMKA 1GVNB 2ATVA 4IKEA 1JJVA 2ZRBA 1ZUKA 4FMBB 1XCGB 2RGCA 1LNZA 1RUWA 4RZUA 2VA8A 3KKPA 5DO9A 3SFZA 1NM7A 5KDDA 4X8MA 1AGPA 4XTRA 4Z51A 3TE6A 2PCLA 4TN1A 1M7BA 2DYBA 2GJAA 2V1RA 2CL0X 3FPAA 4KVGA 3LX5A 1BMFD 5CYOA 2V1QA 2J9RA 2DR3A 1R4AA 4NH0A 4CEJA 2VF7A 3AKYA 4W7SA 1OHHD 3VR4A 2O8EB 1QVRA 5F9HA 4M9SA 1VG8A 1WDTA 2IYSA 5SZHB 4HLUA 3VRYA 1IAQA 2ZUBA 3TGPA 1KI7A 2WJHA 3VS5A 1UBEA 4XD7A 4JPBW 3ZD7A 2VF8A 2FOLA 5JECA 1E94E 1XTJA 4P33A 1JAIA 4TSFD 2ZREA 1KJZA 1EWQA 1RYFA 4FINA 4EPWA 1M1YE 1TX4B 3C41J 3BC1A 1GIAA 2BKEA 4IDPA 4URUR 4DBLC 3GD7A 2PEZA 3EG1A 4RZ2A 1E2LA 3TR5A 3VAAA 1RZ3A 3EARA 4W9MC 1G291 4RFVA 1GNRA 1SVKA 1V5WA 1IQPA 4LJYA 5P21A 2J7IA 5KSPA 5CM9C 2FZLA 1FZQA 3QENA 2D2FA 1D2MA 4MQBA 5CK4A 3R9IA 1RPZA 1N6OA 2H7VA 4YMUA 5HR5A 3AP1A 1Y63A 5D3QA 4AIIA 2WV9A 2C96A 4I1UA 1AGRA 1XPOA 1V43A 4JJCA 2IX3A 1JO8A 4RY2A 4I1OA 2DLPA 3GJXC 5JS8A 4NL4H 3O5ZA 2RF0A 5KUTA 5L8VA 1ZMXA 1ZUYA 1MABB 1G83A 1IXZA 2FG5A 3U3OA 4OMMA 3I3SR 3THOA 4PO1A 1Z06A 3MMPA 4DT1B 2VLIA 6Q21A 3F5FA 1R5BA 3X1YA 2PZGA 3T1TA 1L4YA 1RKBA 1CKEA 2ANBA 3IIKA 4B43A 4BFXA 1YNZA 1MRSA 4HDQB 4J9FA 3EC1A 4GRAA 4PZYA 4TMKA 4TMWA 2RPNA 2XOKA 4URZR 1K5GA 1D8TA 4OK5A 1E2JA 3SC3A 2HCBA 4R0KA 1FX0A 1KK2A 4M1YA 1TU4A 2BVNA 4DXAA 4QJ5A 1CRPA 1OFIA 3F0TA 5J40A 1SVMA 3REFA 3I1FA 4LYFA 2ZRJA 2OXCA 2KB0A 3K9HA 3VQTA 1E79A 2FMXA 4DLUA 3M0UA 5HZKA 3UMRA 1B23P 2GVDC 4PFSA 2PX3A 3IO3A 1OB2A 2DL4A 1ZM2A 2I0NA 4D80A 5IXFA 1XNJA 621PA 4A6PA 2F2VA 1PVOA 1Z63A 4JJDA 5FUVA 4Z1MA 2Q21A 1E9CA 3IEVA 2BMJA 3M1IA 1H8EA 3BH0A 4QBGB 1ZYUA 1DAHA 1Z08A 1WI7A 2W0SA 2OCBA 5GJWB 4I1SA 1XD2B 2NPIA 2R62A 1AZEA 2WMOB 3HR7A 4HAVA 4II7A 4IOLA 1KFZA 2ZYWX 5GJWC 3TAHA 4BLOA 4V0MA 4HB4A 3A4LA 2HLDD 3D6TB 2Z6VA 4KJZA 3REGA 4I4LA 2BV3A 2J0UA 2L0AA 2EWVA 1DELA 4WCIA 1KY3A 2DJQA 1VPLA 2QBYA 1TUEA 2BMFA 2DBMA 4DCTA 2BCGY 2C8VA 2A5FA 2OUKA 4WVFA 3NXSA 4EPTA 5JMTA 2IYLD 1EGAA 4DCNA 3LH5A 3E5HA 3OE7D 3QKSB 4JLDA 2FFBA 1H65A 3G82C 4QBHA 1P6XA 2ZSDA 3OAAD 2C2HA 3U61B 4HUQB 4YMWA 4DRZA 5UKDA 3GLGA 2JLSA 5JHHB 1X1SA 3KXIA 2BIFA 3N5CA 2QSYA 2WIBA 4J0QA 3AVVA 3KQLA 3MWYW 3OZXA 2ZJYA 4URYR 2ZQ5A 3TUZC 1NNEA 1OFTA 3I35A 2CHGA 4PZZA 5CM8B 1KJWA 3I32A 3U44B 4GDFA 4D26A 2ZS8A 4B3CA 2VBCA 1N6LA 5L23A 3E2IA 2C9CA 1DO0A 4ZCIA 3GFOA 3OEHD 4NP6A 1RFLA 4WBSA 1J2JA 4WXRA 2EFCB 2D8JA 1GTVA 1JQLB 4GOJA 3WP1B 4A8JB 1BB9A 2IIMA 1P9NA 3GEEA 4UKDA 1J8MF 3IBGA 4P4SA 4A8JC 1UECA 5C18A 1OH6A 3M0QA 3CIOA 1W36D 1GFDA 1RE0A 2OCPA 2RQVA 4TT3A 3KFVA 5G41A 4DLXA 1N6NA 4TL6A 3C8UA 2VEDA 2ED0A 1X43A 2BCJQ 1QG2A 3VS4A 3DM9B 5H70A 5FTLA 2ZRCA 1UEIA 1QHXA 4NCNA 1P60A 3N2IA 4Q47A 1A82A 2F2XA 5DISB 1W70A 2JJ8A 2VH5R 2FRWA 2GCPA 4MITA 4HLDA 1TL7C 3RWMB 5HKKD 2ZR9A 5LB4A 1WB9A 2KYBA 3GLHA 1KSJA 1F5NA 2AL7A 1COWD 1OE0A 1DS6A 2JS2A 3RS5A 3PENA 3ZZ0A 4PC7A 1SHFA 3AF2A 3W3ZB 1YCSB 2WWXA 3P26A 2E5KA 4AFSC 2VP6A 2GEVA 3GLIA 1EWRA 1Q20A 1LF5A 5CB6A 1QZXA 1FMLA 2WSMA 3TAUA 4G5OA 2AZVA 1Z0IA 2GAOA 2NWMA 2WICA 1TQ6A 4TMVA 1OV4A 1KDTA 3RS3A 2ZJBA 4U02A 4D0LB 2QAGB 4QFMA 1UKVY 2IEYA 4QRHA 3SE0A 4J9HA 1J7KA 2QAGC 2GWHA 3NH9A 4KODA 3CNNA 3AKDA 4J9GA 1E1QD 2F9MA 3DKPA 1V1CA 3FHOA 3H2YA 1X6GA 3QG5A 4IOMA 4LJ9A 3THXB 2HCJB 4C2UA 1VYVA 5BYKA 1G4AE 4Y0AA 4NZYA 2IXEA 5SZJA 5K8UA 1CJKC 1NJGA 1TU3A 3EASA 1XWIA 1BMFA 2NO1A 4RCYA 4MRRA 4N3NA 2HYIC 3NBXX 3AGPA 3F8TA 5FL7D 1NLZA 3CWQA 4RFSA 1OHHA 1XJQA 4DSNA 3K9GA 3NHBA 2CVFA 3FKQA 5FPKA 2KWIA 2DFKB 1F3OA 3T15A 4TLCA 4IJMA 2DVJA 4MGYR 1HT2E 4DJTA 4B2LA 3PR1A 4HAZA 4M9ZA 1G21E 2IYQA 1UG1A 2QGNA 1WMSA 5IT5A 3T1QA 2FEIA 3Q72A 4XVRA 3HYRA 2O8EA 4HSEA 4TSFA 3NMZC 1Z2AA 2N42A 4ASUA 2CH4W 3AH8A 4DLYA 2YOHA 1W0KD 4LNPA 3KUDA 3RS4A 2ZJAA 2G0NA 3EPHA 2CCJA 4EJSA 1LB1B 4ERNA 2GILA 1KMHB 4FXPA 5ECAA 2NIPA 4PQFA 3R9XA 2GF0A 4LWZA 4M4ZA 1M3CA 1AKYA 3B82A 1GSIA 4M1SA 4D4LA 3PEVA 3FWYA 3RRYA 3L8YA 1M2OB 5G3ZA 4CEHA 3AM1A 2CJWA 3QKUA 4JLVA 5DLQC 3W6PA 2ZS9A 3A37A 2DNUA 2W0ZA 1PLJA 1KNXA 1U0LA 3OFND 2CCGA 1UFFA 5FWCA 4LZZA 3SU8A 2RGXA 2QA5A 3WMGA 2Q3HA 2ZI9A 121PA 1Z0FA 2NQ2C 1YP5A 4FSSA 2OBLA 2H8HA 4IVPA 2PZ1A 3FMIA 3EIHA 4TZ0A 2C98A 2VP4A 3DMNA 3BD9A 5G40A 4OHYA 2ZR7A 1MRNA 1G3QA 2ZE6A 1G20E 3B1WA 4LJ5A 3GJ3A 1N6RA 3ULRB 2G77B 1N25A 3U3MA 1P2TA 5AUNB 1G8FA 4RTXA 1U2RA 2ZE5A 2F1RA 2ZJOA 4PO9A 5K8IA 1ZCAA 1ZNZA 2W6JD 2ABLA 3BWDD 4LJ4A 1NMYA 4KSBA 4BE7B 4CYMA 1E0KA 1QBKC 1FYNA 1KMQA 1A7JA 3HJNA 4P31A 1NF3A 3RABA 1HQCA 1MO5A 4FMCB 4HDOB 4DCSA 3ZZTA 1HJDA 2DILA 1G3IA 3MG9A 4OHXA 2OILA 4QHYA 2YJTD 3CRQA 1YWOA 2EPDA 1GCPA 3RNJA 2F43A 3CNOA 5DN6D 1YWPA 4Q7LA 1AZGB 1HEIA 3PEYA 2W6IA 3IPXA 1G3MA 1SQ5A 2CK3D 1NLOC 2CE7A 2KRSA 2VP2A 2ZRLA 3EZFA 4LV5B 3KB1A 4D2IA 4JLAA 5KSOA 2A30A 3B1VA 4LC0A 4UNNA 5EP1A 4BZQA 4EFMA 3EW9A 2FNAA 1ZX6A 5EJEA 3THYB 4LHVA 4F91B 2PT5A 2WPDD 3LV8A 2B6HA 3VFDA 3CM0A 1E2DA 3NG1A 1JQJC 1OEBA 5J5CA 3WHKA 2QENA 2ROTA 2VP9A 4G3XA 1PKSA 1C9KA 2H17A 3QY0A 4NE2A 4Q1BA 3X1ZA 1DARA 1WXBA 3WYAA 2BZXA 1YHNA 1KOFA 3OESA 4RKEA 2EYZA 5FUWA 3C7KA 4BFYA 4MUAA 1C1YA 4NYIQ 1MR3F 2HLDA 2XMFA 3EZ7A 3K0EA 1AS3A 1JQQA 1E9FA 4AKIA 1FFHA 2W2XA 2K79A 3D7MA 1TF7A 4LV6A 4D4MA 3U3JA 3K0CC 3A1SA 5EQTA 4PSAA 3IGFA 4TQ9A 2WWGA 3EPKA 4NBSA 1W7AA 2P0EA 5ANRB 3VKWA 4RUGA 3VHXA 1NSFA 2OFWA 4Q48A 3AVWA 4Q1CA 2CSQA 3OAAA 2YWGA 3B9QA 4DKXA 5KNDA 1PKTA 1VCNA 2WJJA 1SXJE 3VS1A 3EC2A 4NYJQ 1W2GA 4LK2A 2O2OA 2ZSEA 3IHLA 3RRZA 3ZGXA 4CEIA 4V03A 5H1YA 4B73A 2QM7A 2X2EA 1HURA 1Z2CA 4G5QA 3GBQA 3SEAA 4YMTA 3R20A 1MO3A 4TTQA 1N6KA 2QMEA 2B8TA 1HUQA 2VIIA 3KQUA 4Q1AA 1R8SA 3ZVRA 5B30A 4JLKA 2O8FA 4EAQA 3VU9A 5FTMA 3LLUA 1UDLA 4WOPA 4BFVA 3PVLA 1X8KA 2YINC 1KAOA 5EZ6B 2ONJA 2X3WD 2KT1A 3TSZA 2KYMA 4HXJA 2CDTA 1KSHA 5EZ5A 4GMDA 4L15A 1BK2A 2GHIA 1I4TD 3R7WA 4LPKA 4B3BA 4B48A 3U44A 1YZGA 5B57C 3H4MA 2RHMA 3WNDA 1G7RA 2H8KA 4KCGA 2J59A 1E2FA 4YDHB 3CKLA 2OAWA 2AFHE 4A8JA 2E9SA 1ARKA 1UE9A 1X2QA 2RMKA 3A58B 3QUSA 1YZLA 2AN9A 3SJAA 3NBFA 4EIKA 1GRQA 2HCKA 2K6DA 3BRWD 3T35A 4DVGA 3LX8A 2WTUA 1E9EA 1COWA 3CUEF 2NGRA 2VQSA 2JMCA 2IHBA 2WVJA 1BKDR 4HAUA 1ABOA 2J45A 1GL7A 4ZCLA 2GXUA 3FFBA 5AWFC 5FI0B 1K1ZA 1F2UB 4DSOA 2PT7A 4MYTA 4F38A 1AQYA 3NC1C 2GJ8A 3CF2A 2OT3B 2QT1A 3A1VA 3B60A 3EA0A 1KY2A 2QORA 2QMUA 4F93B 1BYIA 4AG2C 1E1QA 4DCVA 2E87A 3CRMA 3H0KA 2G1KA 2R6FA 4G5GA 3L43A 2QTFA 4JT4A 3QEOA 3W8NA 3KDSE 1ZNYA 4A15A 4TLBA 2QAGA 4HB0A 4CC4B 1KGDA 1Z6XA 3MWJA 4L5BA 3X1DA 1RRGA 1X86B 3ADKA 1A1VA 4OBEA 1F6BA 3QF7A 1SXJB 1TPZA 2F1JA 1SXJC 1KDRA 2FFHA 4AG1C 2OBNA 2RHDA 3QPUA 4JLOA 2JEOA 4Q1EA 5AJZA 4TYYA 5FR2A 1XEWX 3SR0A 1ZP6A 4Q9LA 5IHPA 2WAXA 3FMFA 1CBUA 1ZRHA 5EE9A 3IHWA 1T3SA 1A2KC 1ZD1A 2FGKA 3SZRA 4WA7A 1KI4A 4V02A 1W0KA 4WZBE 2OO7A 4WIAA 1MOZA 3IIMA 2FF7A 3MD0A 2PL3A 2FPFA 4JBXA 2GVZC 4PC6A 5EP3A 1FQJA 3DZDA 4A0GA 1FOEB 4JZ4A 2G3YA 2PLRA 3LVRE 3AUYA 2GK6A 1KMHA 2WWHA 4Q01A 2HEIA 2ZU6A 2NO0A 1DG1G 3CF6R 2CT3A 4DZZA 4LX0A 1Z83A 1UPTA 3T1VA 1AS0A 4NYJR 4JKYA 3AP2A 4L16A 3U7GA 2ZE7A 2WKPA 1Z0AA 2FWRA 5JI2E 1M74A 3AF0A 3N2EA 3KB2A 3THWB 1N5ZA 3PQCA 2C9YA 4R98A 4NCIA 2JTEA 2W0MA 2A2ZA 1BH2A 2GQIA 1E79D 2NOAA 2W6JA 2XTZA 3QWYA 2PBRA 4PQRA 3TR0A 1S0UA 4B3GA 4FMDB 3VNVA 4HZIA 4MH0R 2FJUA 3GLFE 1WLPB 2BWJA 4Z1MD 2EWWA 3GCGA 5IHNA 3I61A 2VHTA 3NH6A 2IYRA 4IXNA 4OJKA 1UF9A 4X8OA 5DN6A 4A82A 5E7IA 3DO6A 2JT4A 1OXVA 4L8GA 5FUXA 3T06B 3EIQA 3VR5A 4AFQC 1P73A 3OIYA 4HATA 4MKFA 2VWFA 1S96A 3C16C 2A08A 3E70C 3EWAA 2WPDA 5GJVC 2WKRA 4DIDA 4QBIA 5JZVA 2O31A 4G1UC 5FW9A 5JRZA 2HYDA 5JWRA 1FL9A 1S8FA 3CPHA 1HH4A 4HVVA 1G5TA 3IDQA 1P72A 1QDEA 3UG6A 1XFAA 1G19A 3CRVA 1EFRD 2WJGA 4MDFA 2XXAB 3KKOA 4WZ6A 1NEBA 3MUFA 3I5XA 4BLSA 4RTUA 3K09C 4IOJA 1K0XA 1J3TA 4XWKA 3I5RA 1U94A 4PAMA 1UGVA 3TNFA 1G3RA 4ORZA 1XTRA 5DH9A 2BTTA 3MFYA 5FBWB 4OQMA 3MAAC 3K0CA 1NIJA 3LQQA 3K53A 1UFQA 2WAYA 5LD2B 1JEEA 5LD2C 5JSZB 2X3XD 1VMAA 2AHOA 1A0NB 2ZAOA 5DI3A 3ZVNA 4CC7A 2FU5C 3GJ8A 1GKUB 3W5JA 4BGDA 4TT3D 3PUZA 1DEKA 3NDPA 1J99A 1I2DA 4QHSA 3IQLA 1M7GA 5L3SB 2YUQA 4DDVA 2UVQA 5AK0A 2ZRDA 5LBIA 2OFXA 2RGEA 3BERA 1GCQC 1W5TA 2P6UA 4KU4A 4I81A 1Y3AA 3GJ5A 2AXNA 2J6OA 1UKYA 2DFLA 4GOKA 4KO8A 1R5OA 2XJ9A 4GP6A 2ZTSA 2PEYA 3BOSA 2IYWA 2DFTA 2BBSA 2DL8A 1JI0A 2AWOA 2KSQA 1LV7A 3D8BA 3GQBA 3QEJA 5JS7A 4TL9A 1GFIA 5IK2D 3QXJA 2ZIAA 1JEDA 5CLQA 4LBZA 1S1MA 2B7BA 3Q7PA 4QKQA 3TSWA 3GLFB 3LD9A 3U5ZB 4C9BA 2F9LA 4E03A 4KFTA 1NI3A 3FE2A 3LFUA 3Q85A 4Z54A 2BBOA 1JNYA 3DHWC 1ZU4A 2JLRA 3MJHA 2ENMA 3NVAA 4S35A 1US8A 1Q57A 5BXQC 5K8TA 3WY9A 2QM8A 3GFPA 2HT6A 1XB2A 4Q03A 1RLQC 2IW3A 4QBFA 1GL9B 1W2HA 1GUAA 2B8WA 3AGQA 3FDIA 2QP4A 4LDJA 4PHGA 4GZMA 5FOWA 4IFEA 2JLYA 1PUJA 1G5PA 1SKQA 1WDXA 1XXHE 2J87A 1A5TA 1CJMA 1FP6A 3GJ7A 3RANA 1E4VA 1XZQA 2QQEA 3CX8A 2IS6A 1OIWA 4B35A 2D3WA 3U3RA 2E1RA 4M1TA 5HPYB 4EPYA 3FFAA 4PPFA 1YR6A 1Z6YA 4HZUB 4JBWA 3AVYA 1H3HA 1U81A 4GI7A 3RVBA 1XDBA 4M0LA 2IS1A 3LA6A 1SVWA 3FHCB 2Q9CA 1VYUA 5DGXA 2VP5A 1GM5A 3CNLA 2AZSA 1GL5A 4LGMA 1F2UA 3ICQB 1Z28A 1JU5C 4X8HA 3TH5A 4JLPA 1D9ZA 3HWSA 4DLSA 4B33A 4TLAA 4ASUD 4NPHA 2LQNA 3UA6A 2H57A 1X3SA 5IXBA 1QKWA 2FFQA 1KNQA 1E0JA 4QJ3A 5C46F 2AD1A 3SQXA 4RTYA 3NHAA 3ECCA 5SZIA 4FWTA 4ITRC 4OI2A 1YVDA 5FI1B 1KI8A 3H84A 4EUNA 4RD4A 1VA7A 2YWFA 3A1WA 3GEIA 4RTWA 4NU0A 1UJYA 3H86A 1SVOA 1TADA 4GNKA 5TXGA 3UMFA 5K8LA 3EZ9A 5FBRB 5KTYA 4M8NE 5DYIA 4TMZA 4C0HA 1SRMA 5E95A 4KSCA 2KRNA 3LQRA 1CP2A 4B44A 4OHZA 3MLEA 1OH8A 1ESMA 2K2MA 5G53C 1E9SA 1EFUA 1XZPA 3FOZA 2O8CB 1E2IA 4A0FA 1OOTA 2CH4A 4Z88A 3THKA 3K0FB 1YQTA 4IVRA 4Q7JB 4U7DA 1GP2A 3AVXA 3UK6A 5AJYA 2YHSA 1PZNA 2BMEA 4KBGA 4LN2A 3SBDA 3UANA 4LPSA 5KHOC 1TQDA 2J5XA 3UG7A 2GJ9A 2OSBA 2X19A 4V0KA 2K7AA 2EYYA 4XWAA 1E32A 4BFTA 5TV2A 1JALA 5FTKA 4LHZA 5EP2A 3P4YA 3VX3A 2H18A 4DCUA 1YR9A 2BZYA 5BWMA 2ZRHA 1WCV1 4KXFB 4EPRA 3U60B 1P9RA 3W5IA 2FPDA 2RMOA 3BB1A 1UJ2A 3Q5EA 2FH5B 2GBQA 1EX6A 4KFSA 1IBRA 3W90A 3VS0A 1VG0B 3H1TA 4IDNA 2BEKA 1XXHB 4JL6A 2GXAA 4NTZA 2IWRA 1TUDA 1DVRA 1ZIPA 1CS4C 4B47A 3QKRB 3ADBA 2W6ID 2EW3A 2RQRA 1W44A 3W9YA 4A0RA 2RGDA 1VIYA 1XEXB 4DDWA 3ZIAA 3SJZA 3KJEA 4V0LA 1E9BA 5HE8A 3I92A 1OYYA 1XTKA 3BJIC 4DSUA 3THWA 5L3QA 2V1UA 2JLUA 3EHRA 2JA1A 1LVGA 1G17A 2D62A 2FPKA 1XBTA 2ZUDA 4DLTA 3RAPR 1SVSA 1Z6AA 1CR4A 1N5LA 4MRPA 2WJVA 3ZYCA 3IKJA 1S3SA 1ZC4A 2JDIA 4P32A 1ESNA 1G6OA 1E3MA 1IY0A 1GDDA 4OMNA 3EXAA 4NCKA 1T3LA 3B1ZA 3PJRA 1LTQA 2EVWX 1E98A 1KKLA 4AY2A 5KNCA 4JYBA 1KZ7B 3RC3A 1QLYA 3HR8A 3ADCA 3WNBA 2OLJA 5EE0A 3SBEA 3QXCA 2JJ1A 2WZQA 3CZQA 2ASEA 1E2PA 3DM5A 1AN0A 2IYZA 1T0JB 2X1VA 5BN3A 4ILEA 1IO6A 1DAMA 3L8ZA 1MKYA 5CLLA 3QG1A 2GZHA 2V1XA 1EFRA 2YDLA 4KAXA 3B5JA 4TLDA 2IHYA 4U00A 1B3QA 2VO1A 1XPRA 4TZ6A 3F3YA 3REBB 4C0BA 4A4DA 1SPKA 1ZIOA 2IYUA 2F7SA 1XJ0A 2XSZD 1QHHB 1VCMA 5CDFE 4B3XA 3WNCA 1VKJA 3DVLA 2ZRIA 3C5CA 1DBSA 4FI3C 4BRWA 2I4IA 5H68A 1J8YF 2XXAA 1KIKA 2J6FA 3BFKA 1UKEA 5C4MA 1R0WA 1B07A 5JLJA 4JLJA 2O9VA 2AKYA 4BFSA 4B76A 3WRYC 1KO8A 4HVWA 3M0EA 3KX2A 2DYKA 3PFIA 2OAP1 4IFBA 1RJ9B 4Q4AA 1EFTA 1P2SA 5M04A 2GDJA 2RGAA 5KSYA 1JBKA 1QHNA 1ZM3A 5J4KA 1NLPC 2O8DA 1G7SA 1XJCA 2YZ2A 1EFNA 2V54A 1VECA 1G8HA 1GBRA 1D2EA 5L3SA 1G16A 3W8RA 2F6RA 3ZQ6A 2QROA 721PA 4CW7A 5DE3A 4RD1A 2HF8A 5HCKA 1G3UA 2H5EA 2OAQ1 5IK2A 5TMPA 1YKSA 3MGCA 4D4JA 2R6DA 2J06A 2R2AA 1I2MA 2ZR0A 3IUYA 1S9HA 4R9UC 4URXR 4LC1A 4OMOA 1AVZC 3R8CA 3K0AB 1AJEA 1E2NA 1NIPA 2HDNB 2C0IA 1FPMA 4TWZA 3ZQJA 1XPUA 4EIWA 4M1MA 1T0HB 3DEFA 4PC2A 5DSZA 3EAQA 4LBVA 4JZ3A 1II8B 1NBME 3K70B 2GAAA 2H1LA 3K70C 2GTJA 4C3ZA 4QHTA 3VS3A 1N5IA 3RWOA 1F2TB 1GL6A 2O0JA 3LBNA 3M6AA 2PCJA 4HVUA 4NONA 4EFLA 4J9CA 1P5ZB 1TF2A 3QVVA 2EBPA 1N3BA 2UZIR 2W58A 3FMPB 2DRKA 1KTVA 3OEED 1KK3A 1XU4A 3RS0A 4MDEA 2R8RA 2CCKA 2J3EA 1NG1A 2JXBA 1OKKA 3OF5A 3AVTA 2IYXA 2DWPA 3AF3A 1XP8A 2QI9C 4BLQA 2RB4A 1JR3E 5FBQB 3VTKA 3A8TA 4MRVA 5AUQA 2RGNC 3PE0A 4D8KA 1N0UA 2IUTA 1M34E 4LJAA 4MRSA 3TIFA 1YRAA 421PA 5DNYB 4C0QC 2WIAA 1IJFA 3CONA 4Q66C 4KYUA 2FSGA 2VHJA 4W5JA 3NDBB 2FPMA 2ZRGA 2FGJA 2V55B 1KI6B 3NIBA 3UWKA 1GOTA 1Z9ZA 1Z29A 4RSGA 2XAUA 1P61B 3ND8A 2P2LA 1R7RA 2GBLC 2P6NA 3B78A 4C4PA 1QHIA 1X8JA 2NZ8A 1YZTA 2FG0A 4I1VA 4RZXA 2JLQA 4D4KA 1Z47A 4AWXA 1L2TA 1SEMA 1ZD9A 2ZYVX 4CGZA 3ZH9B 2HDAA 3ZVMA 3U2QA 4MA4A 4CF7A 4B3FX 4TQAA 2BMDA 4ZV4A 2QEQA 1ETUA 3LVQE 4YXWD 2DL3A 2PZFA 4AI6A 2ONKA 3S1AB 2WHXA 4IIMA 4MKGA 4H1VA 2YUNA 4A9AA 1U98A 1KZGB 3Q9LA 5JCZA 4D25A 2OCAA 2LCFA 2Z5FA 3I4LA 3KKMA 4HDCA 1NG9A 1NMXA 1HE8B 1PRLC 1NVUQ 1CTQA 4A63B 2ORVA 4QNMA 2O8CA 1EFHA 1G18A 3QIAA 4ZI3A 4DB4A 1MABA 3K0FA 4ZO4A 3LAWA 4MYCA 4D0NA 5JJLA 4DT1A 1N5KA 5GVRA 3NPFA 3TUJC 3NGPA 4DEYA 1CR2A 2Y8EA 5FR1A 4HCKA 3A98A 4TTPA 2JATA 5CK5A 1G1MA 1PLKA 2QPOA 2LWIA 2LX7A 3X2SA 1PWTA 4XSHA 4A36A 4BLPA 2P5TB 2WJIA 2B21A 4AKHA 4LV8B 5CJPA 4EKDA 3PV0A 5DHAA 5KNBA 3AVOA 1OT3A 3CB4A 3HYTA 3LBHA 4LJ6A 1XF9A 4UXJA 4M1KA 1OH5A 1XTSA 4Q9HA 2QUZA 4R2IA 1ZM9A 4AYTA 1OXXK 1Z9QA 3ZLJA 2SRCA 1AOJA 4KFUA 3B2EA 4OMLA 2GNOA 4TYQA 4S2EA 3FB4A 4YDSA 1OIVA 3B85A 3FKSA 2A5GA 2RGBA 5FBLB 3X1XA 4K46A 3DDCA 2O8BB 3SYNA 4HUTA 4L9SA 1KI3A 2VSOA 1TEVA 1IXSB 1KJYA 4KBFA 4TL7A 1ZUIA 3H0IA 3WYGA 4M2LA 4C0KA 2LMJA 1II9A 2GEDA 4Q4LA 1HQYE 3QI2A 1OB5A 1Z22A 2N1BA 2GJSA 1XD2A 2X8AA 4TL8A 2G83A 4AYXA 4GBQA 2JLXA 4GT1A 1XMVA 4JSYA 2OXRA 4OJQA 4RD3A 4A6XA 5AJWA 1XTIA 1R0ZA 1HSQA 2NO6A 3AVUA 2MSEB 1NVVQ 2OBMA 3QKSA 2NZJA 1ZM7A 1AZTA 3PXGA 4PZLA 2ZAMA 3SJCA 3Q5DA 4Q4JB 2HXYA 2BM1A 3OIVA 4HUQA 1U8YA 5JBQA 1JXMA 2XSZA 4WW0A 2Z0MA 3THXA 3H0FA 2EFDB 2A5DA 3CO5A 1DO2A 2AXPA 4JKIA 4B6FA 1T0JA 3DMDA 4EQ6B 1FTNA 2LKDA 1HTWA 1OXUA 4LY6A 5BYJA 2GTOA 2G6BA 3UKDA 5JHGB 2F55A 1WYXA 2XNDD 2GCOB 3IBYA 2OLKA 1LS6A 1FMJA 1W49A 4QGAA 2OCYC 1U9IC 2SHKA 1OPLA 2MCNA 4JL8A 1P2VA 1U5SA 1KI1A 1ZCBA 4OYHA 3RSOA 3O8RA 1YZQA 2V3CC 1RLPC 2A5YB 1WXQA 2RN8A 3QXHA 3NHNA 2YV5A 1CLUA 2WMNB 2OE2A 1GNPA 3UMSA 3I72A 3QJYA 1OXSC 2JAQA 1UBGA 5G3YA 2KI5A 4TMTA 3M0RA 3CRW1 3QF4B 5I22A 3P1JA 4X8LA 2OEPA 1M6NA 4CC2A 2KRMA 1BO6A 3KJHA 4PHTA 5IF9A 1IHUA 1TNDA 4TYNA 4AKGA 2FX3A 4NMMA 1MV3A 3KL4A 3L0SA 1UBFA 1DAIA 4KI0A 1L8QA 2ZITA 2ORWA 2XTNA 4ZNXA 3OIWA 4JZKA 1AS2A 2JASA 2AFIE 4OK3A 221PA 2JIZA 3UF4A 5EUQB 2IBMA 5JCPA 4BASA 4TYWA 1VHTA 1U8ZA 2ZYTX 2CLCX 4CEJB 2FO0A 3LXRA 2K3BA 1ZU5A 3K0AA 1CKAA 4ABYA 1OH7A 3V4FA 2OV2A 1T0HA 3W3AA 3TMKA 4G01B 2RQTA 3PIRA 2J1LA 5DIFA 2IWHA 1W4CA 2C95A 2QZ4A 4ZDIA 1ZVQA 1II8A 2FEOA 3JZMA 3IPYA 2ERYA 3OEEA 2EGCA 3IIJA 1Z3IX 5HCIA 2DWQA 1OLOA 1ZUUA 1ZD8A 2X77A 2QRNA 2BZ8A 2AK5A 1KDOA 4Q7MB 2ZI4A 4V0ME 5EE1A 4AKEA 2J0VA 1KO4A 4LE9A 1QG4A 1H92A 4MGIR 1W47A 2ZSBA 1NRJB 4NCJA 4ZPXA 1WFWA 2DB3A 5HCNA 2V6IA 2G6FX 3UATA 1T91A 3DL0A 5FOUA 5HZHA 1Z07A 3JVUA 2V8OA 1G64A 4IDQA 1SXJD 2C99A 5KDLA 2QQ0A 1KO1A 3VHLB 4C0SA 1Y0MA 1KK1A 2O0KA 4AFZC 1NVWQ 2RGNA 1G7CA 4HB2A 3GLGE 2GZAA 1E0AA 1ONBA 3WBJA 2AKAB 1FNMA 4GOXA 4MGZR 2XB2A 2KROA 2D74A 2KJQA 3WXMA 4AYWA 4NYIR 2VVKA 2DHRA 4P4TA 3L0PA 4IDOA 4XIGS 2DWOA 4HAYA 1Y57A 4D8DA 1PNJA 2ZROA 4HI0E 4US0R 5C2JB 3U7FB 3NEYA 1KI6A 1X8LA 3EZ2A 2ZI3A 4ACBA 4ON9A 3EHQA 4P3YA 4XVQA 4FW9A 1ZW6A 3ZJYA 2O9SA 2OG2A 3EG2A 5IDVA 3EWSA 4YXWA 1E1RD 2QE7D 3SS8A 2M51A 4E22A 3EPJA 1U0JA 4C7OB 1KDPA 3UWOA 1QRAA 5B58C 3WHLA 1OW3B 3EIEA 2YUOA 1NVVR 1LY1A 2VSFA 3NTUA 2L3QA 2RGGA 3FYHA 1NN5A 5FOXA 1OFUX 2GF9A 4BFWA 3TBKA 2P67A 2PMKA 2Z4SA 2DL5A 4BZPA 2QMHA 1F60A 1U0HC 3BH6A 4XOIA 2REOA 3QQ5A 1M7HA 1YZNA 2KBEA 4HB3A
chains in the Genus database with same CATH superfamily
1WXGA 2VHVA 1Y37A 4R8RA 3GZJA 2H8GA 4G26A 1WBDA 2TECE 1NM5C 3BHIA 3DCNA 4E5YA 2G1JA 3ROFA 1U11A 3DDZX 4RJIA 5GAN4 5LUBA 5B55A 4FFOA 1LV8A 4J9BA 2C9ZA 2DLDA 3D6JA 5CX1B 1L5WA 3GL9A 1NR5A 2I8LA 2BUCA 4KIWA 2CNWD 3LHFA 1P62B 1WEHA 4Y6OA 2IXFA 3SHFA 3A7DA 5ALXA 3SAJA 4LNUB 3WBBA 1PUXA 1EJ6A 4F46A 4CPDA 1N2XA 2ZRNA 3DBOB 5ALDA 5JCJA 2EJ9A 1MC1A 2YY6A 3HPQA 1OASA 1ZIXA 3EULA 4AROA 2BSQA 2OKGA 1BBZA 4J9EA 1D0XA 3DWIA 4D3FA 4X63A 2QTVB 1ACMA 4GX5A 5AKKA 2WDZA 2ZIVB 4WAUA 2FZCA 4CUZA 2E5WA 4QC2A 4PX9A 3E22B 3KU4A 4ESVA 1EPUA 4RDXA 3B6EA 5FOVA 1W0JD 2H1WA 1NL3A 1P9WA 1EVKA 1JL3A 4K11A 4F92B 4UU8A 1DO8A 2ORIA 1NVXQ 3FMOB 1QPGA 1V4VA 4GPD1 1BXRB 5HJ5A 5MN5A 2VHWA 3AKEA 3QVUA 1XGKA 2QQ5A 1XO1A 2UVPB 2QB5A 3RAGA 1GPKA 4PX2A 4JI4B 1RI2A 3A2NA 4JV5B 1VQ7Q 2BHLA 3OYMA 3VNAA 1L4GA 1FUYB 3VNUA 3U4CA 4G1CA 1VI6A 3GXOA 4MVJD 2DHEA 1N2CE 3AY7A 4LYHA 3ZLTA 2AX4A 1HM5A 1XD8A 2XE6A 5F1YA 1QGUA 2H1FA 5SY6A 4M1OA 2RHRA 1QF9A 4XU2A 3RSCA 2EW1A 1GFSA 4YRIA 2RKOA 4F6LA 5LU8A 2DEQA 1EM8B 3R24A 3ZDYB 1GR0A 1OI3A 5EMLA 4B9XA 3T12A 2R9VA 5JQWA 4AZ3B 1DEAA 1DTSA 1ZLMA 5TF4A 1FDSA 1ZH6A 1VI5A 2YV4A 1I7QB 2OV1A 4DV3B 3TEJA 1VIFA 2GHTA 3VU9B 1GGEA 3B6ZA 1KS9A 2NYRA 4IMIB 3OEWA 2WINI 3JALB 5CDSA 2QLNA 2VSQA 2A4KA 3BE5A 1HD3A 2C7PA 1MMFB 2Z1NA 3LPNA 1AD5A 4EVRA 1QZ3A 4G5HA 1ECLA 4N49A 2ABWA 3OKFA 1RQ7A 2I4RA 4B82A 2GFHA 2COWA 1DXOA 5C8YF 5KINB 4CMCA 3AT1B 1FJGB 2PR7A 1T2UA 3ZV4A 1RVDA 4IJKA 4O2BB 5A71A 4NOLA 1HE1C 1DBVO 3ON5A 1AU9A 2DVEA 2ZCFB 4FMDF 4YLGA 1NVGA 3JVDA 3MJVA 2QRVB 1UQUA 1E3LA 1UJBA 4B34A 1KEEA 1IPEA 3U26A 2ZSAA 1SUWA 4XOUA 3HCPA 4NEQA 2DCUA 1A9OA 3FYSA 3LWDA 5TSDA 2VTBB 1Y6JA 2P7IA 3W5BA 4LX8A 3A9TA 3QXEB 4MW1A 1J8DA 1P91A 5ARBA 4NENB 2KGTA 3QEMA 5JNWA 2P2SA 4TVRA 4OQFA 4TUYB 4ENTA 2EJBA 4BE1A 2AFRA 3F7TA 2GERA 3O4GA 1NBMD 3PF8A 1QCZA 3FHTA 1B8OA 4MS4A 2MWOA 2C7OA 3OA0A 1IHPA 1EXWA 3N70A 3IULA 3GLUA 2DUMA 2H92A 4IGKA 1P8JA 2H2WA 4CLRA 3QFCA 4OQYA 1U2DA 1ORRA 1ZMOA 3HWWA 1HY3A 4JROA 3RRJA 2IHZA 4GBED 1H9AA 5CVTA 4L73A 3META 1RM5A 2LR0A 2ROLA 3Q6NA 5FROA 2J85A 4BMNA 1QDUA 3SG0A 1FPQA 2IH4A 4JJ7A 4XQEA 2VHQA 4C0LA 2COYA 3KJZA 3RM3A 2HAXA 2NP6A 4K2AA 1PQWA 3EJ6A 4GI1A 5ENVA 1RXWA 5DKFA 1UBNA 2MIOA 3TSOA 1GNQA 1S9DA 2IF2A 4AO7A 2CLIB 3H9UA 2PMFA 1P3DA 2V4UA 3W6UA 4EYEA 3GNGA 4IHAA 5J2TF 2V6JA 3R8FA 1AWWA 3D8HA 4WCFB 4XD7D 2GFUA 1YR3A 5BN5A 4EF6A 1TUBA 1K92A 3OZBA 3QPVA 1GCIA 3C15C 2RH4A 1IEQA 1G8PA 4CKEA 3FOCA 5JC1A 3WLOA 3B9PA 4RTPA 2HZBA 3V8NA 2O14A 4OO3A 1V3TA 4KQIA 5BQFA 3BGOS 3G9XA 4ND3A 1IMJA 2OORC 1KU6A 4P8RA 1L7NA 1IGQA 1TAHA 4W5WA 1G9XA 2N46A 3J7TA 4LYDA 5HMLA 4F5WA 1SVNA 3PUIA 3UOAB 1OX9A 3M4YA 1BA2A 1WTAA 3AOGA 3L2ZA 3JAKA 3TEMA 1YB7A 4MYRA 5KO2A 2VSYA 3CUWA 1NYGA 3RAEC 2JBAA 3M58A 3H1AA 5E2BA 4B6SA 1PWZA 2CK3A 2C5SA 2VWHA 2QKYA 5DZSA 3ROGA 2F4NA 2GZDA 4MWZA 3AF4A 4QUAA 5KYGA 3LCVB 2HA7A 5HFJA 1XDDA 5DTIA 4BCCA 4H17A 1DB3A 1G8XA 4NBTA 4US1R 3GMIA 5B4UA 7REQA 2A0XA 4GS5A 4DJ5X 1Y9JA 3T5MA 1QV9A 5I9NA 3TDNA 1AUVA 3J81A 4KITB 1G9SA 1WQ1R 4UU0A 2EBFX 3G0IA 2O7QA 4PSVA 1U9IA 1THZA 5EC7A 3OPMA 4XGIA 1VI2A 1XCPA 2D8HA 4YCLA 3C7CB 4UASA 4QDJA 2DPYA 1X0XA 4TRMA 4ZVLA 1JDNA 2LPMA 4P7FA 1PGJA 3ITEA 4C05A 1XVIA 5SZHB 1H2XA 3QEAZ 2J0EA 2JH3A 3R09A 3ZD7A 2ZLBA 3DCIA 2X4JA 4HH1A 5GTDA 1HZJA 4RZ2A 2H2FA 4DM7A 3LUGA 2H5JA 4MDWA 1ICIA 2FHPA 4AJNA 2IGTA 4RY2A 4C92G 2R25B 1X77A 5JS1A 3HL0A 5D87A 4PO1A 5DYTA 1H4TA 1R5BA 3RVMA 3W8DA 4QASA 1EFPA 4BMXA 3FN4A 1ZK4A 4J9FA 5E8RA 3UPDA 2OBXA 1K5GA 3HA5A 2HH9A 4PICA 1NPYA 5GMKj 4R0KA 2YX1A 1OROA 4QJ5A 3NM4A 1SU7A 1JSCA 4LQLA 3G0DA 1EEHA 4NFHA 4GKBA 4U2BA 1IZ0A 1QYRA 2I0NA 2AF4C 3AR4A 3U13A 4OLHA 1N7JA 4JITA 1YB4A 1VQPQ 3P2MA 3LX6A 3LTEA 5DX1A 1ISFA 3L18A 1TCUA 2IEAA 1X1SA 3KXIA 2BIFA 2P40A 3KQLA 2K2VA 3TUZC 3ZUGA 1P1HA 1RPTA 3IQGX 5CM8B 3HXOA 2WF5A 1B1CA 3KHSA 3IQDB 3PDUA 1V5IA 2UUPA 4WBSA 1UDRA 4QBTA 4EKNB 1JE0A 3MOSA 4JOQA 3M0QA 4A26A 2CD7A 2RQVA 2YYSA 3X28B 4AY4A 1W70A 2Z58A 2CZ7B 3ZHXA 4PYNA 4RA9A 4OFXA 3QVWA 5CFLA 2EP8A 2G1PA 2JGEA 2KSSA 1H66A 1R77A 2PZJA 1GPAA 3E3AA 4XDHA 4J9HA 4KODA 5JNSA 4TN5A 1WZEA 4FDAA 4XD2A 5LIPA 3T3PB 5A0LA 3BIWA 1EP9A 3N2LA 5FPKA 3NHBA 1QE3A 4ZMSA 1V8FA 4PSDA 5BSRA 3MHXA 3EEQA 2SECE 4TSFA 4YECA 4MQFA 5FCDA 2H0QA 4DLYA 2QQAA 2G0NA 4EPCA 5M9OA 1DXQA 4D4LA 1GSIA 3B52X 1OMOA 4HRYA 5GV7A 1U0LA 3K2BA 2CCGA 2GFAA 1GFWA 3WR5A 5CD9A 4ZO6A 3GJ3A 2BGNA 3T7TA 2JNGA 3ASUA 1IZ7A 4PO9A 1D1CA 3OLYA 4KSBA 2AJDA 5CX4A 3N76A 2QZZA 5AFSA 4J2HA 4IPTA 1VQ7A 4OB3B 1V2GA 3LS2A 3MLBA 1AZGB 2W6IA 1BGVA 5AVKA 3ZV6A 2A30A 4ODIA 2FETA 2B6HA 4F72A 1JQJC 2F5KA 4M75E 4NE2A 3WB1A 3GNSA 3TD2A 5GANf 4NE7A 1L8OA 1X01A 5LP6A 2CXTA 1CUDA 4M8SA 1VCNA 3OX2A 1KH1A 9ABPA 2O2OA 4KDRA 1MO3A 3KQUA 1R8SA 4AZ0B 5LWHA 4FLMA 5EZ5A 1N2IA 4DOVA 1OAOA 1P4GA 1G7RA 3CUVA 1FSZA 2H08A 3CKLA 3Q0TA 5JALA 3SQNA 1UE9A 1KR5A 5FYQA 3A58B 4B40A 2YTZA 2JJ9A 1ZDMA 3NBFA 2NYSA 3JQFA 4CKYA 3T35A 2WVAA 1RADA 3CUEF 2JMCA 4N6OA 3OPYB 3IHKA 1UWLA 1TVCA 5AWFC 2PT7A 4TTAA 1YJ9T 3B60A 1X7WA 3KO8A 2IYEA 2OP0A 5FWYB 1ECCA 2QAGA 1F2DA 2WV7A 1KZ4A 3EZLA 1QIMA 3DE5X 1T36A 2N75A 1C7EA 2Y1DA 1JVBA 8ABPA 1WTCA 4I55A 5DGHA 5KTMA 5PNTA 3K05A 3M2TA 1Z4LA 3W2HA 2NSLA 4I7EA 4ZQHA 3PFCA 2EERA 3IIMA 2O2YA 2P4QA 1FQJA 3RTGA 4JHXA 2JFZA 4I50B 3R7BA 1BHJA 1P1CA 2CT3A 1Z83A 4PJOF 1WLYA 2Y67A 1LZLA 1WMDA 1GTL1 4G9GA 1M2VB 3GA7A 3KB2A 3VDQA 2AXQA 4PIMA 4TLLB 3Q12A 2W6JA 3ILVA 5J3BA 2HIHA 4QYMA 5J63A 4YAIA 1K8XB 1ZUD1 5E7IA 4B7UA 2Q27A 1DJOA 1F3LA 1CY1A 4HATA 4GAEA 3GARA 5LDHA 1OZFA 1RWBA 2DQZA 3GK3A 1BH6A 3IDQA 3OCUA 5EWJA 3VZPA 1UGVA 1KWGA 3QXGA 5CVIA 3F2VA 1NFFA 1P7VA 3Q1LA 2VG8A 4DY4A 3GA5A 3BERA 2P6UA 3DTVA 2AW3A 4HDMB 4A91A 1Y6ZA 4OQDA 3BW1A 2JAUA 2PEYA 3R6WA 4AS2A 1GV0A 1OQAA 3HCBA 3OJWA 2PDAA 3ANSA 4ZQCB 4AS1A 3LD9A 1YQDA 2RGRA 4W8OA 2PX8A 5LZ8A 1KIAA 5FOWA 2IS6A 3OTGA 1N8NA 5KREA 1W4ZA 2B35A 3LCRA 1Z38A 2VP5A 5KTPA 3KDAA 1GTZA 4TT8A 4PAWA 3O0DA 2LQNA 2FFQA 5B6JA 1KNQA 1WQ7A 2X1HA 3F8WA 2Y6UA 1XZJA 2EJFA 2CLEB 4PR3A 2G9RA 4BC0A 2C7VA 2QQ9A 5G53C 2G9ZA 2F5TX 1K7FB 4OP0A 3AVXA 3WIEA 3UANA 3NJ4A 3HY4A 3N9IA 4O2AA 3GFFA 4EW2A 5IAJA 4DQLA 3BFJA 4WZZA 2PXAA 4B80A 2X2PA 1UGPB 1Z5PA 3R5XA 1VJ5A 4R2KA 3N0XA 4HQLA 3BJIC 4HQ6A 1YJWQ 2V1UA 2V9ZA 1EK5A 4IXTA 3GHHA 4H6WA 3IKJA 1ZC4A 1L7AA 1M1YB 2B7LA 2JDIA 5NULA 4CMAA 5LJ5e 4QBKA 3EXAA 2KMTA 1T3LA 1KKLA 1DEOA 5ARDA 4BJ3A 4KGVA 2IUYA 1F17A 2VJYA 5KC9A 1MT3A 3ZWDA 1IAVA 4M55A 4JOCA 4R81A 3HI4A 4A54A 1L6RA 2FX2A 3H9GA 1IBLB 2ZRIA 2ZTMA 3N53A 1ULZA 1ZO8A 3GGDA 2YXLA 3G8YA 1ECJA 1U0TA 4RC9A 1QHNA 3LX4A 3WRVA 1G7SA 4DLKA 5AT1B 3R3XA 3RW9A 4Q4CA 1WVIA 1W5FA 4D4JA 1ZN9A 3M5PA 2C5GA 1HK7A 2MK5A 3LK6A 2G1UA 4RVGA 1T2DA 3CG0A 1JKJA 4WASA 3IEIA 3QTBA 1O94C 1U63A 3WDKA 2QTXA 4MK4A 5HF8A 3RDVA 4CM4B 4PNEA 3ZDCA 4CI0C 2CY0A 2QUAA 4HN4B 3F49S 4DZTA 4BV2A 3DV0B 4NOMA 1Z29A 1M6VB 5K99A 5E7QA 2JLQA 5F5NA 1Z47A 2J5KA 1IM5A 3I0MA 2BF4A 1YASA 1SD5A 4OHFA 3F71A 4R6XA 4R9RA 2GO7A 3PRHA 3EG9A 1WG8A 4RA6B 1GU1A 3DLPX 4M7DE 5KS2A 1GAEO 4OXRA 1YE3A 3Q8WA 1PCXA 1LVKA 1IY9A 4D5GA 3K9FC 1WJSA 1WNLA 5DHAA 3OQ5A 1Y5IA 4Z7QB 1OH5A 4Q9HA 1ZM9A 4M88A 4KFUA 4TYQA 1A04A 3ROQA 4PPYA 1L9XA 4IQ0A 3FCXA 4KH0B 3OE1A 4C0KA 2GEDA 3K0KA 3SF8A 5EIFA 5ALNA 2QM3A 3FJYA 2BHTA 2JLXA 3U3DA 2FLKA 2C2XA 3V4PB 3HWRA 2OXRA 4A6XA 2HW8A 2HIMA 2E89A 3QKSA 2NZJA 2OO5C 4YBRA 4C14A 2A86A 1U8YA 3LXUX 1Z4OA 1XA4A 4Z4GA 2PYIA 1CLEA 4P7KA 1CQPA 2OLKA 1L5OA 1VQPA 4MLCA 2K5FA 4BB6A 3PC6A 3RSOA 5BPFA 2XT9A 4BGVA 4YWJA 4AB1A 2JW5A 2Q7XA 1OXSC 5AOAA 1NE2A 3RVLA 5KJCA 5K2MA 2VXBA 3LPCA 3CRW1 2DYIA 3SVLA 2D3TA 1F2VA 2FX3A 1PD0A 3KJNA 4LNHA 4KI0A 2C57A 3O3OB 4M75C 2IBMA 4CF3A 2R5WA 2NTJA 3KTDA 4ABYA 1EQAA 4BQOA 2K3XA 3QU2A 3ZHQA 2OO3A 4Q7MB 1XDWA 1SIWA 3DL0A 1Z07A 4D42A 1NVWQ 4X93A 3IPAA 2D74A 3A1EA 1SURA 4OUDA 4XIGS 2JARA 3GZNA 3AHEA 2JD1A 2YN0A 4M7AG 3MCZA 3S1LA 1E1RD 3RH0A 4AICA 5BRJA 1U02A 1AGYA 2PA3A 2EBUA 4CTMA 3H9QA 1KL7A 1M7HA 2NVBA 1Q86C 3S44A 5AP9A 2YNMA 3DAGA 1SXIA 4LDAA 1ABFA 4TLMB 3SF0A 1AQIA 1Q1QA 3W3AH 1NY5A 4HNQA 3F5QA 3H8VA 2WW8A 4JDUA 3CCJT 5DGDA 5B1HA 2VPWA 3DW3X 3LY9A 3MXOA 3W34A 4WJLA 2YQZA 3FUWA 1UZLA 2QBYB 4U63A 4KDEA 1KPHA 1SZDA 2ZBRA 5AVWA 3B20A 1H4SA 3HKCA 3R41A 2PZEA 5IWCA 2Q41A 3VS7A 2W2QA 1A71A 4ZT3A 4P36A 5LQRA 3GH1A 1NT4A 1E5VA 4J16A 2H7YA 3W4KA 1G5RA 1VB3A 2UZAA 3LFTA 5AW4A 4EPVA 2JN0A 4C4YA 5IDYA 4PSCA 3UPUA 1Z0UA 4R1PA 1Z0ZA 5HM6A 1OC2A 3MGGA 3GJQA 4NK4A 2HMAA 4KLAA 1TUIA 4CKCB 2EFJA 4ZU1X 1TK3A 1L7QA 4HHEA 3ZZUA 1VJRA 5ADVA 1XD9A 3HNRA 3E9DA 3SDBA 5HIAA 2VHEA 1EXMA 4LUEA 1AIPA 1L7VC 4GECA 5LJ5f 1W73A 3RRMA 4S3MA 4R1SA 3PUXA 1P75A 4ZI7B 3GFSA 2G4LA 4FMCF 1Z2NX 3IO5A 4YC7A 3MVEA 1HWYA 4M78F 2A0FA 1EE9A 3HR4A 4MTLA 1TVKA 3ISVA 1DU4A 2ZRPA 1U2ZA 1I1NA 1CIPA 4PLWA 1P7YA 3SS7X 1WXFA 1X2EA 2HPAA 3DB4A 3ZLBA 4KHZA 2DL7A 3KYDB 3EH2A 3BN3A 2XMCA 4NESA 4A2PA 3IILA 4KFRA 3GBPA 1E9DA 1IOVA 2PX4A 1UDCA 4DSTA 5JYDA 1Q3TA 3L7LA 4QECA 2JFHA 4BGIA 1QPZA 2GF2A 1DT3A 1X7XB 1KAQA 1RI1A 4C21A 1NGSA 4N8SA 3NGXA 4L4UA 1OSNA 1FQKA 1QGYA 2NG1A 1EJ0A 2IL1A 4P3KA 4Y92A 1ZQ1A 3QE4A 4KLNA 3F2IA 2PH7A 1ISHA 1NMZA 2HUPA 3KJGA 4G25A 5D51S 4O1IA 2CMKA 4K9LA 2FSHA 3O4FA 1LC0A 2P3SA 4JJIA 3HXPA 1NUTA 1HKUA 4F7UE 3N39C 3HU1A 2JCSA 5BW4A 3PX2A 3PLRA 2C04A 3K2QA 4X91A 3TG2A 4M0CA 3NEJA 3K0SA 4XIIA 5TJHA 1RC0A 2ZBGA 3MJDA 3BAFA 3LP6A 4PBTA 2YBEA 1IEVA 1D1PA 3KYCB 4UVHA 1BU1A 3P94A 2JGFA 2O88A 3JQ7A 3Q88A 5TMEA 1MVLA 1T6NA 3MCWA 5KWJA 3BUSA 3ZOZA 2O3UA 4FJ2A 1OD6A 1VFPA 2X5KO 2FK8A 4L72A 2P0KA 2F1KA 2FPEA 3NHMA 1BEZA 5TQ2A 1XN1A 1F9AA 2W6MA 2JEYA 4KUDK 3IMEA 1NFQA 4JRPA 2VCYA 4UBKA 1WHKA 1Q44A 2EZ4A 3G3EA 2ZJ5A 4BE4A 4B85A 4D46A 3H41A 3HVRA 5DYGA 1NU8A 3KT6A 2FUCA 1XXHA 3MS7A 2O6LA 3O8BA 2CSIA 1PKEA 5KYYB 1K4KA 1ZSGA 2R6CA 1HG1A 3A3KA 3O9ZA 1C0MA 4YQZA 5JJ5A 5AVRA 2XITA 5KU1A 4RK0A 1PWYE 4TVKA 1CW2B 2YV2A 5EERA 1I4DD 1UJ4A 1TRHA 5DI3B 2QRMA 1K8RA 2W11A 3ZHOA 4GGMX 1YJWA 3HCNA 1S3IA 2Y92A 1TA0A 5ALGA 3HCEA 3ND6A 2V4ZA 1A9XA 3VOAA 3FWZA 3D7KA 4ED9A 1AHJB 3V4RA 3I53A 1NXQA 4UJ5A 1SRLA 4UARA 2PVGB 2DH5A 2VNIA 5EPEA 3NV9A 1I51A 2CDBA 2BBTA 3KR9A 2M1XA 2GPBA 2B2XA 4P0TA 5F7ZA 4BQEA 1EX7A 3QVSA 1Z2EA 4M75D 3BGWA 3HWX1 1A4RA 5KYKA 1CNFA 2NUTA 2JLZA 1F2TA 1JHAA 1ZUNB 5I4CA 3ME9A 2QG9B 4ZKDA 1GXSA 4FDTA 4OP1A 4EB8A 1SR8A 5H8WA 1H2BA 1OLXA 4X6YA 2M2IA 1ISMA 2FE1A 3KZVA 2HK7A 3AVPA 3AHHA 4LJKA 3L92A 1QONA 1A2BA 3I45A 2E48A 1CJCA 1TZBA 3RHFA 1ZNXA 3SWNB 5E3JA 1N9GA 1U5AA 1Q0SA 2W6ZA 4FD2A 3NHYA 5B1DA 1FX0B 1LWNA 4OYRA 1LS1A 4MKHA 1VDMA 2OFFA 2WJWA 4QOFA 3AYZB 2I76A 1IC6A 2PMDA 3QBTA 5KTOA 1M3SA 4DA7A 3ZCSA 2OXTA 1UAGA 5DLOA 1LOJA 3LYUA 1GRIA 3HP1A 5LWQA 2CWWA 2LGJA 4ZK6A 2R87A 3C6KA 3T38A 1RLIA 1P1RA 3QUQA 1V41E 5HTKA 4A1OA 4BV9A 4EPXA 2HY7A 5H9WA 4L6V5 1ZW1A 1IXYA 3KZ1E 5CURA 1QTIA 4O0MA 3M4GA 4KYIB 4GMKA 2AC4A 2BHRA 3MTGA 2Q7DA 2NUBA 1EESA 3TJZA 2HT1A 5IABA 4LQ4A 1Q0ZA 4PZAA 3AX6A 5IVHA 1YTLA 2O50A 1ITZA 5L45A 3F9RA 1NKTA 1R3DA 1QX4A 3DDSA 3ADPA 2W6NA 3GLHB 3USES 4O4LA 2XDPA 2GNCA 1KK7A 4RF5A 1AC5A 4Z0NA 4OHUA 1TSFA 1QHGA 5KZMB 4YONB 1Q15A 3DZCA 4OKSA 4LY3A 1WY5A 4Q19A 3UF0A 3CINA 3FX2A 3RASA 2ZKIA 1JJVA 5F7OA 1AF7A 2O07A 5KDDA 3TNJA 5TGDA 2V1RA 3K0HA 3L9WA 2Z5LA 4A0QA 4DKJA 2B8AA 2IYSA 3OSUA 2Q5HA 5KTKA 3OTQA 3QKIA 4DIOA 2ACKA 1RD4A 3U4GA 1JAIA 1V5FA 4CMEA 1RRVA 1PDVA 2VPZA 1E2LA 4P0PB 1BD4A 3L46A 1GNRA 4YAEA 1YQWA 3WSVA 1FZQA 4N7MA 1D2MA 1G2IA 4K9SA 1N6OA 4OPMA 1WX1A 1H6AA 2P6OA 4K1XA 3EEIA 2I2CA 2DKOA 3LY7A 1ZJWA 3MMPA 3GIBA 1CKEA 3KZMA 1MRSA 1YBVA 4MKRA 2AJLI 2M1ZA 1QIIA 2O0LA 1PYGA 3F0TA 1CRPA 3MUOA 3E7PA 3M5DA 1W8IA 1KC3A 4D9FA 1RHRA 3MKDA 3K2IA 4EG1A 3IELA 621PA 3WMWA 2AH5A 4OH7A 3RT7A 2QXUA 1R37A 4U2GA 5I5GA 2RHYA 5GJWB 1XD2B 3PU6A 3QMPA 4RTRA 4BLOA 1DELA 5AJHA 2BH2A 1QANA 3FDRA 2WSLA 5CX1A 4KXMA 4HUQB 4TVBA 4C76A 2J67A 1SCQA 4J0QA 4E30A 1ZCFA 3ZEAA 2D5IA 3GAAA 1OFTA 1KEKA 4D8UA 3F7NA 5AKIA 4MV0A 2YMLA 4LNUA 1KIFA 1JXQA 2W6OA 4A8JC 3IBGA 5LOVB 4DSZA 3KFVA 2DFVA 3OYDA 1FYDA 4H18A 2B4RO 4JUBA 2HD0A 1P60A 5CCXA 5TRTA 5DISB 1R16A 4E5DA 3LKVA 4PGHA 1A1SA 5KQMA 1BWPA 4FKZA 4EI2A 3AF2A 4IP0A 1IWPB 2HSJA 3WLQA 2E5KA 2VP6A 2PU7A 4HEA6 1QZXA 2H3EA 1TQ6A 1KDTA 4FZ3A 1RRMA 2JFOA 3PK0A 2A6PA 4QDZA 3FHOA 4ER7A 4C2UA 3THXB 4JYZA 2HCJB 1FTGA 5BYKA 4B7XA 2AEEA 4ARCA 2AJCA 3K9GA 3WAGA 3E22A 4ZAXA 5KYXA 2OQRA 2R4TA 1GQFA 3LUHA 4H08A 2GZSA 4EVIA 5JMPA 3WGLA 2O8EA 3AEKB 4CQMD 5CT9A 1SG0A 1UBJS 3OS0A 3RS4A 4D96A 2CCJA 5CP8A 4FXPA 1MEJA 1BXRA 3AXSA 4WBXC 2ZS9A 2W0ZA 1ZGBA 2DXUA 3A8MB 3N74A 2UVPA 5L51A 4XQGA 3VA7A 1NVDA 2PZ1A 3EIHA 4L4ZA 5LM3A 1PBTA 4G89A 3CCFA 4OHYA 5F12A 3FPHA 2ZE6A 2M98A 1DMSA 1T1RA 3JCMP 5K7SA 4S04A 4CYMA 3HRTA 3HJNA 4ANJA 3FUXA 4YUVA 4R84A 3W8EA 3Q3GE 2DILA 4RMOA 4OHXA 2IU6A 5C8ZA 4QHYA 3OZCA 5EJIA 3WL8A 3ZCXA 4ENWA 1X80A 4OAPA 1HEIA 3EQ8A 4MB2A 3UM9A 5C7LO 2AOVA 2PT5A 3HJRA 1E2DA 3WLHA 2OV3A 1SQSA 2D5AA 3GFGA 5K5EA 1KOFA 1RXCA 1MR3F 2QVZX 2BAGA 2PUHA 5EQTA 3DV9A 2KI7A 1MB4A 2P5UA 4Q48A 2E1HA 3B9QA 1PKTA 1SXJE 1X87A 4RZHA 2DZDA 2R7LA 2RHLA 5A5FA 3A4IA 3GBQA 1ENYA 3OW2P 1DX6A 5AQ1A 2EZ8A 4JLKA 3FNFA 3ZZMA 3VU9A 1UDLA 4UU7A 2KT1A 3TSZA 3PE3A 2J09A 2PX5A 4C7MA 3JALA 3RF7A 2AFHE 5EL0A 3IX7A 1RQ2A 1FDRA 1NJSA 1K86A 1DFIA 3N6XA 3QA3E 4K0RA 2VQSA 3MUNA 4E32A 2GJ8A 1TM4E 4O02B 1LI7A 5CJJA 4O2BA 3C3EA 1DFHA 3NHJA 3GEMA 5CQYA 4PLZA 1Z6XA 1VGVA 2CDRA 4JX8A 3SFMA 2D0PB 2QRVA 5DX0A 3NM6B 1NKVA 4B9WA 2OGZA 4CG3A 3OQMA 1X1TA 4OIMA 3WLEA 1QK5A 1B7GO 4YRPA 2UYQA 2VTBA 3RROA 5T57A 2V03A 4ZAGA 1DG1G 5EIBC 1WW3A 1EIFA 2WKPA 1Z0AA 3JQBA 2FWRA 4X95A 4NENA 1HX7A 1VKZA 4ZJZA 5HK0A 1O89A 5IJ9A 2CNKA 4KO3S 4TUYA 2FX5A 2ZXEA 2V59A 2ZUEA 1YUNA 3UV3A 5HS6A 4DIUA 3I61A 2KW5A 1OTXA 4WHMA 3UGJA 4HAIA 4N3AA 3UN1A 1C3VA 1BE1A 1S96A 4QPNA 1OBOA 2R8PA 5A1TA 4G1UC 2O8VA 5JWRA 3CPHA 3OE5A 3NRCA 5EIHA 4OHKA 2QVCA 2XXAB 3M6UA 3K1YA 1VGRA 3R5SA 3M9QA 1S8OA 4NH4A 4FBMA 1JEEA 1T9KA 1ESEA 2PPVA 2QF7A 2LC4A 2RGEA 1GT91 5J59A 1GCQC 2MYUA 4MWGA 1V8BA 2JZNA 1SA0B 3LQ2A 4JC8A 4RVNA 1KYYA 4I3GA 2ONYA 2ZIAA 1S1MA 1YS6A 4ZO9A 2Q1YA 3DHWC 2C94A 3LOUA 3BRWA 1E7YA 4PN3A 1CV2A 4H6VA 3NIGB 3RANA 2GHRA 3FFAA 4CI9A 4EWLA 3RVBA 1NOJA 3N86A 1JU5C 3EVFA 4X8HA 1R0BG 1AUQA 5HFNA 2W2OA 2FXVA 1N2EA 1ZOPA 3LMKA 1NV9A 2W43A 4KIFA 4WCFA 3IDZA 1YVDA 2C4UA 1FP2A 3TL3A 2WWRA 4MW6A 3CXCP 2HCFA 5CA1B 4B44A 1J39A 3H5VA 3JPYA 4L0QA 4Q7JB 2HLPA 3UK6A 5JAIA 3SBDA 2IEIA 2YRXA 4RCCA 4CT0A 1YR1A 3CMEA 5BWMA 3MXTA 2FHSA 1EX6A 4MPDA 4C0DC 3RYFA 5EHIA 2IWRA 3JD3A 2WUGA </