1T3SA

Structural analysis of the voltage-dependent calcium channel beta subunit functional core
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
294
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the voltage-dependent calcium channel beta subunit functional core and its complex with the alpha 1 interaction domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Dihydropyridine-sensitive L-type, calcium channel beta-2 sub
total genus 93
structure length 294
sequence length 320
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t3sA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t3sA02
2DX1A 1WXTA 4PQYA 2Z83A 4MRSA 3BH0A 3TIFA 2DL7A 1KDTA 1AKYA 2FH5B 3P32A 4ZV4A 1GDDA 1NM7A 3C7KA 4AKIA 1UF9A 3DO6A 1Y3AA 1OHHA 1J8YF 3WXMA 2JA1A 1DAHA 4W9MC 121PA 3HDTA 2GNCA 5GVRA 1G21E 5EXSA 1OYYA 4TTQA 2YOFA 4C0JA 1A2BA 3R20A 5KPDA 2D7CA 2VRWA 4BLTA 1N5ZA 2K7AA 4GL2A 2VHTA 1SRLA 2ROLA 3VS7A 1SVKA 3X1YA 4LUEA 2YWEA 2QM7A 3B9QA 2L3SA 1V43A 2R2AA 3LDAA 5KU1A 1UTIA 4QT7A 3RNJA 2PCJA 2GXQA 2WJHA 1NJFA 5BWMA 2GZDA 1K9AA 4LDJA 1K4US 3BB1A 4N0EA 2CCKA 3HPRA 2O8EA 2HLDA 2UKDA 3WHLA 4WOPA 2ROTA 4BE7B 1K6MA 4ESRA 1EFRD 1OPLA 3E1SA 4I1UA 3L0SA 1MO4A 2CCJA 2VIIA 2YNMA 1II8B 3P4YA 2ZR0A 4H9GA 1PNJA 2OXCA 2W6JD 1GILA 3IPXA 3K1JA 4LJ5A 4F93B 1G5PA 4HVWA 1CKEA 1O87A 1P9NA 1DE0A 4LYJA 1OB5A 4PXAA 1E2KA 4TYNA 2J6KA 2XX3A 2RAPA 4OMNA 2AKYA 2AXPA 3OESA 1OIXA 3Q72A 1GKIA 3EG2A 1NN5A 1UADA 3F5FA 2JMAA 1T8UA 2IC5A 1U2RA 3I4LA 4JS0A 1AK2A 3V9PA 1AZSC 3LX5A 2R9VA 3FFBA 2EWVA 3VS6A 1UDWA 1OJLA 1Q1QA 4IHQA 3CLVA 3GPLA 3IDQA 2J0SA 1Z9QA 2BTTA 3ADDA 1UBGA 2D62A 3B1XA 3BXZA 2CXXA 3C5HA 1N6PA 3SBEA 3IO5A 1E2NA 4PHGA 3ICQB 1Z6GA 3LH5A 2FPEA 4LBZA 1VPLA 1T8TA 3A98A 4F16A 4BZXA 3B5JA 1EFRA 1T0HB 2FPLA 3H86A 4C4PA 4KBGA 1F2UA 1J90A 4TMWA 1E9EA 1XB2A 1KMHB 2JLUA 1VG0B 5KSPA 3IHWA 3KXIA 1NLPC 1U0LA 5JS7A 3QIAA 2GBLC 3SE0A 1ZUIA 2QROA 4I1OA 3NPFA 3AKYA 5JEDA 2E5KA 4B3XA 2ZRNA 4ON9A 1WXUA 2BCGY 3WYFA 2CCGA 1WCV1 3SFZA 1OXVA 5FW9A 2KB0A 5A0FA 4ZPXA 3SFVA 3D8BA 1ZVQA 4OQXA 4TLCA 1E6HA 4A15A 3GLGE 2J0QA 3MSXA 4HUQB 1ABQA 1U98A 2GETA 2ZYTX 5CJ2A 4Z88A 4YLGA 4RTUA 2ODNA 3LX8A 4DT1A 5FBVB 5FBQB 5FOTA 2MMGA 2KNBB 1AWXA 1UBCA 2EFDB 2KBFA 2Q6TA 3FMIA 2QTHA 1JEEA 3D31A 3PQCA 3RSLA 4LK2A 2I1QA 1P60A 5GADl 4L8GA 1UECA 1OXXK 2FZ4A 1TAGA 4GSYA 2P0EA 1RJ9A 1W0KD 3K9NA 1FFHA 4TZ6A 1U81A 2VTKA 3QG1A 3MWKA 5CYPA 4KV9A 4HZUB 4UXHA 5C46F 2VHQA 1DAIA 1E2GA 4BFSA 1R8QA 2A5JA 2GXAA 2IYSA 2CT3A 3TQFA 2CJWA 5DYIA 2GNOA 4M2LA 3IKJA 1D5CA 1AGRA 4TMTA 4QG7A 1VDZA 1WRBA 2ORVA 2VP2A 1RJ9B 2JAQA 1ANKA 3FKSA 1E2HA 2EU8A 1LFDB 3DKPA 1A5TA 3EARA 3QF4A 4JZ4A 2BIFA 2F1IA 4A1FA 1G41A 4C2UA 1JPNA 3BERA 4O2LA 2VHUA 1SQ5A 4PZLA 5KTYA 4JL8A 2CLDX 1S9DA 4JJKA 5E4FA 2AX4A 3CM0A 2VH5R 3L8YA 4KI0A 1TUIA 4DKXA 4Z51A 1KDPA 1R0XA 2GVDC 4OI4A 1CR4A 1SVMA 4Z1MA 1D2MA 3QPVA 1JR3A 5HCIA 2VSOA 1HYQA 2HF9A 3BJIC 4J9HA 1R5BA 2H5EA 4JLKA 4KSBA 1TNDA 4S2EA 2JJ2D 2V54A 2O8FA 1HH4A 2HLDD 2GTJA 2PT5A 1S3GA 1VMAA 5EP4A 2ZRPA 5IH2A 5HR5A 4URYR 1PZNA 1T4GA 2P5TB 4QJ4A 1NY5A 3T1VA 1KFZA 4TT3A 4DB4A 2FE4A 1CR1A 4GOKA 1PRMC 1W5TA 4PSVA 4DZZA 3GLFE 1OH8A 4RTTA 2C9YA 2X3XD 1ZCBA 3FE2A 4G1UC 1ZM7A 4GOXA 4NCNA 3CX7A 4Q1DA 3TKLA 2XZOA 1XDBA 2CDTA 3MWJA 2IBMA 2ED1A 4WAUA 2KBTA 1DG3A 2F43B 5DH9A 1XEXB 1H3HA 4RTVA 3CBQA 1CTQA 4DEXA 4CEHA 1RLQC 1OT3A 2BKEA 3A4MA 3BE4A 3PUZA 2WAXA 3BBPA 4PC3A 1W36D 3OIWA 4KYIB 2H18A 2ZE5A 4JSTA 3BRWD 4POAA 2X8AA 1KK2A 3ZS8A 3M0SA 1W46A 4BLRA 4G0NA 4ZCIA 4LZZA 4LBVA 2PX3A 4TMKA 2C77A 2BMDA 2CNWD 2GEDA 3QVUA 4TTPA 4GLMA 5I22A 3MAAC 4O0MA 2C0OA 4EFNA 3UMSA 2GJKA 4ACBA 4IOKA 5B58C 4PR0A 4D8KA 3CH5A 3A58B 2PEZA 3QKUA 2E9SA 5KNCA 2CHGA 3BH6A 2QP4A 4CEJB 1VIYA 1QHHA 1G19A 1QHXA 3NC0C 2QORA 1F3OA 2BMFA 5HTKA 3VFDA 3KKPA 4PC2A 3AGQA 2WICA 3AV0B 3QKTA 2L3PA 2PEYA 4XH9B 2JATA 2ZETA 1XPRA 4RTZA 5JJLA 3U7EB 2FA9A 3VR1A 4MQBA 3VTKA 1QLYA 1W49A 5ELXA 3C14C 1W4CA 3K9HA 4AFQC 1DG1G 1N5JA 1YHNA 3WRXC 1SHFA 1E0SA 5GVSA 4OMOA 4D25A 1KI8A 3AGPA 2JGNA 3W3ZB 2W0SA 2GA8A 3P20A 3UATA 1AVZC 2V6JA 3SBDA 2WKQA 4LY6A 2FDCA 4BFZA 1F2UB 3H4MA 5F3WB 2VLIA 1BS1A 1EWRA 3I92A 3CPEA 1KNQA 4PHTA 3DHWC 2WTUA 1TQ4A 4TLDA 4WIAA 3SNHA 3BFVA 1H65A 1ZM9A 5B57C 1NL3A 3I72A 3AB3A 1FL9A 2AXNA 2FMXA 4RFVA 4C0HA 1BB9A 2V3CC 4JJZA 2KWIA 4IFEA 4IFBA 1NEBA 2I1VB 3LWNA 2QPTA 2LCSA 3E5HA 3PR1A 4MH0R 1WDTA 2UVQA 1DOAA 5EE1A 1M34E 2EVRA 5FPHA 2ZS9A 3OHMA 1EFUA 4NYIR 3QXSA 5IDVA 1E2PA 1QHYA 3NDBB 4A0FA 3SN6A 2CL7X 3PE0A 1E1QA 3TE6A 5G53C 1J2JA 3KJHA 1ZU5A 1Q21A 1SXJB 2CUBA 2GJ8A 4DSUA 5JI2E 1VYTA 3RBBB 2GCOA 1UE9A 4MDEA 1NYFA 4Q1AA 1UGVA 2GCPA 2FU5C 4DSOA 5AK0A 1KMHA 1XCPA 2WZQA 3GLHB 4AG1C 3DZ8A 3IQWA 3EIQA 2GTOA 2PLFA 2J46A 4WW0A 1XD8A 4MKIA 1NLZA 4KO8A 2F7SA 1FQJA 4IW3B 3A1UA 2D3WA 2ECZA 1R0ZA 2ERYA 3N2EA 4JIMA 4P31A 1KSGA 3TAHA 2IIMA 1UM8A 2MMCA 2MSCB 3I73A 1U99A 2H57A 4ARZA 3ZIAA 5L3SA 2ZRKA 2VP0A 4QJ5A 2IWRA 4A36A 4JBXA 1DO0A 4LV8B 4IEIA 5DO9A 3SYNA 4DDTA 3Q7QA 3P1JA 3OIUA 1ONBA 4OBEA 1JQLB 3RSOA 1NVUQ 2DWQA 2OXRA 2GAAA 2GDJA 4JJCA 5AWFC 1Y0MA 4JLMA 5LD2B 3THYA 2L0XA 4II7A 1QWEA 1ZCAA 2WMNB 3CR8A 4YXWA 2EGEA 4OYHA 4JJDA 5CDFE 2OFOA 3QBTA 3H0HA 2JLZA 1KI2A 5HZHA 2QENA 1P61B 3K0FB 1SVWA 4Q7MB 3QY0A 4JBWA 1G3UA 1EGAA 5B30A 4G5QA 2ERXA 1P73A 3VX4A 4RTYA 1E98A 3P26A 1YNZA 2FO0A 1G5TA 1E96A 1Z6YA 1VYVA 2ZRCA 1BO6A 2GEVA 3ZZTA 1R5NA 1YR6A 4ERNA 1GCPA 1IN7A 2ZI7A 4PSKA 3LNCA 4W5WA 4ZKDA 1M2OB 4W5HA 4A63B 1AQYA 2BMEA 5FI0B 1PUJA 2H8HA 2QDLA 1IAQA 2QPOA 1D9ZA 3ZZ0A 1E9CA 1TU4A 1OH7A 2D1XA 1F60A 1YRAA 3VR3A 5AJZA 1AQUA 4D80A 1L2TA 4OJQA 3W3AA 2J6FA 2MOXA 1GNQA 2PZ1A 2IYLD 3PENA 4Q21A 2QMHA 5FTNA 4LHWA 2AD1A 1LS1A 3F8TA 1ZD9A 3AVXA 2JIZA 4DCUA 4AYWA 4M9SA 1FQKA 5FTMA 4D4MA 4CC2A 3OIYA 2QGZA 3QXXA 2OBLA 4K8OA 1WBDA 2O52A 3SS8A 1TF7A 3BD9A 3UWOA 2C78A 2KT1A 3AF2A 2GF9A 2EPDA 3RS3A 3W6NA 1PJRA 1QDEA 2ZJAA 4G5GA 4D0LB 3E2IA 1AGPA 2DYBA 2A5GA 2P6UA 3C4JA 2W83A 3QBVA 3UG7A 2BEKA 1BIFA 3AKCA 4D0NA 4A0RA 5JEEA 2JS0A 2FSGA 1T3LA 3OE7A 3NC1C 2RGDA 4JT2A 5CB6A 1YWPA 1G4UR 1UAAA 2GJAA 1N6KA 1JALA 1QVRA 2ZI5A 5SZJA 2CMKA 2B21A 4CZ2A 5FTLA 2GQIA 2JT4A 3I5SA 3RNLA 2GWHA 4DDWA 5AJWA 2CLSA 2GCNA 4IRUB 2J45A 1I4DD 1KI6B 2C2HA 3CH4B 4Q1BA 1ESMA 3Q85A 2AFIE 4NYMR 4DHEA 1T5IA 3TRFA 4Q9HA 1Z63A 4Z8AA 1NNEA 1ZINA 5DN6A 3IO3A 4RCZA 2IYZA 4EAQA 3CRMA 3QXCA 4XD7D 4MUAA 3UMRA 1KAOA 1ZBDA 2Q3HA 3HU1A 2XTMA 2G9NA 4P4UA 3FWYA 3NMZC 2PJZA 2P2LA 2PTKA 3NEJA 4MYHA 2HYIC 1CSKA 1KI4A 2VP6A 1PHTA 3MJHA 5DI3B 3LXRA 5EP1A 1W47A 1XP8A 2R8RA 4BEJA 4CT5A 3NIBA 3SEMA 4W7SA 1QHNA 4YONB 3AF3A 4E22A 4JMPA 4RUGA 1ABOA 4UXJA 1RC8A 1N2CE 4PZZA 1B23P 4KCGA 1A4RA 1N0WA 2AR7A 3QQ5A 4IKEA 5FTJA 4M1OA 3REFA 1NVXQ 3BK7A 4F91B 3AP1A 3K09A 1ZMXA 1M6NA 1WA7A 3QXJA 3K0FA 2FEMA 2QQ0A 2ZVQX 1QHHB 1DVRA 2M51A 1I4TD 4OJKA 2QL6A 4P4TA 4KFRA 4ZIRB 5FWCA 5F9FA 1SVIA 3QENA 2J5XA 3G5UA 2D8JA 4JZKA 5P21A 2BZYA 4I1SA 1T5LA 2WJIA 3BFXA 4Q9LA 5SZIA 2H16A 1KY3A 1UUEA 1Q1ZA 4FMBB 4OI1A 1XTIA 4HCKA 1Z0KA 1GRQA 2F3RA 2C04A 2LCFA 2QSZA 2KRMA 2IUUA 1UHFA 1FNMA 3TK1A 1RRPA 2W0ZA 1K8RA 3X2SA 1AN0A 1E2IA 2FGJA 5L3VA 5AJYA 3ADBA 5TARA 2XNSA 2ESWA 1GM5A 3EG1A 1YWOA 2QMEA 3L43A 2JLRA 1XJQA 5KO2A 2QUZA 3QKRA 1HE8B 2WPDD 1AS0A 5CIWA 1WLPB 3WMFA 4DLYA 3KJEA 3DDCA 4PO1A 3RRYA 2XNDA 4HAVA 3T34A 3AVOA 3IGFA 4WBSA 2WKRA 2DWOA 3NGPA 3GLHA 2JJ1D 4B71A 4MYUA 1VG1A 3I8XA 4J9IA 1E9BA 1MKYA 4BLSA 1XMVA 4LX0A 1AOJA 3U3MA 5CLQA 3ZH9B 4LJ6A 4OI2A 4YMTA 2L0AA 4LE9A 5LDDC 2AKLA 2B8TA 1U8ZA 4DLRA 2ZVPX 2DLPA 4WCIA 2GEUA 4ABYA 4DDUA 2W2TA 4XJXA 1EX6A 3SU8A 2QBYB 1HURA 3RDPA 4B3GA 1Z3IX 2LX7A 2EW3A 1X43A 4Z54A 1KI7A 4RZ3A 3PITA 2EBPA 4LHVA 4LRWA 4IDQA 2ZJZA 2WJJA 1Q1EA 2CH4W 2KROA 4UXIA 5AJXA 4Q4HB 1T0HA 3DL0A 5E7MA 5H68A 4PTLA 3K9LA 2DFTA 2HJVA 2WWGA 1OFTA 3T5GA 3IIKA 2DL3A 5K8IA 2WIBA 1MV3A 5FI1B 1ZIOA 4TLEA 1OKKD 2JEOA 4U00A 4TL6A 3QEJA 1ZU4A 3VMFA 1OEBA 3ASYA 4BRUA 1XRJA 1LW7A 1PRLC 3EA0A 3U61B 4LSGA 1KZGB 2KR3A 3PCRB 1IN8A 3QUSA 1FMJA 3MGCA 2A5DA 2ORIA 4XVRA 1SKYE 1MV5A 4HDQB 1NVVR 2RB4A 2B6HA 1EFHA 5CJPA 3REAB 4Q9IA 4GPTA 2FPMA 2ZIAA 4N3NA 1OHHD 4PAMA 3GFTA 1KK1A 2OFWA 4U5XA 1CR0A 2C98A 5CK4A 2D74A 5JZVA 1Y63A 2RGNA 1NVWQ 2CJWB 3QF7A 2K2MA 1Z28A 2X2EA 1JI0A 2HT6A 2NO0A 4BLQA 1J70A 4JL5A 4P0TA 3RRNA 4QRHA 4I99A 1YZNA 4URXR 2W6ID 3GEHA 3P4XA 1QHIA 1W0KA 2RGBA 4TYWA 3LY5A 1KGDA 5DIFA 5HCKA 1U8YA 2A36A 5FL7A 1PKTA 3I5YA 2G6BA 3B8HA 4PHFA 2ED0A 3L0OA 1YZKA 2GILA 3CWZA 2DNUA 3IILA 2XXAA 2QAGC 1RRCA 2JM9A 1IO6A 4N1AA 4RD3A 1GBQA 3EIEA 3GJ3A 2C0IA 5DHFA 3IPYA 3RLFA 2H92A 2NPIA 1QKXA 3JZAA 4NBSA 1FNNA 2H17A 2NO9A 1YZTA 1F48A 2CK3D 4EJSA 3GCGA 3NHBA 1AD5A 4BFYA 1IQPA 4DVGA 3TGPA 3AKDA 4BECA 1NVVQ 1M3BA 1L4YA 1JQQA 1P75A 1Q12A 1NEGA 5H1YA 1GTVA 1Z8FA 4XTRA 2WAYA 3ZD6A 1XD2A 1CF4A 1EXMA 2J05A 3NDPA 4F4JA 3LRPA 4ZCLA 4AY2A 1EFNA 4YMSA 5FPSA 4HVVA 1W0JA 1TUEA 5B64A 1E2LA 3RWOA 2OBNA 1TUDA 2AKAB 5DI3A 4XTCS 1KO5A 4QM7A 2W10A 2J59A 2OESA 4B33A 1BBZA 2O0HA 1KSFX 1GIAA 3H41A 4V0OA 1CEEA 2KE9A 2CHVA 1Z0AA 5CIQA 1IY0A 4V0MA 3HYTA 4EPVA 1T0JB 2XAUA 1W1WA 1BYUA 1JNYA 3U4QB 3DEFA 2KT8A 1U90A 2Q21A 1ZC3A 5IXFA 2WJVA 1ZM2A 3WBKA 1XTJA 4B2LA 2B92A 1FUUA 4ESHA 3P27A 4CT4B 3VNUA 3H0IA 3CNNA 1LF5A 3DPUA 1FOEB 1XPUA 4LWZA 3EPLA 2HDAA 5EXXA 3UIEA 4LJYA 4A8JA 3EA5A 4WXPA 3R8CA 3IBYA 1R0YA 2R44A 3U7HB 1NSFA 5IRCD 3I5RA 5JHGB 4D81A 4DSNA 4DIDA 4LBWA 4IOMA 1G4AE 2BBTA 3VAAA 4D8DA 1SKQA 3M0EA 4HB4A 3KQLA 3U60B 4BFWA 4NYIQ 4Z8YA 1Z6XA 3R9WA 4A8JB 4C0AC 2F2XA 1XTKA 2ZRMA 5IHIA 1G291 4KAXA 4Q02A 2ZUBA 4G5OA 1MABA 2AWOA 1DADA 2WHXA 2PJRA 2JLQA 5FL7D 1US8A 3THKA 2LP5A 1N25A 3AP2A 1VCIA 4CC3A 3SI7A 2UZIR 4MKHA 4F92B 4PPGA 1XTRA 2IW3A 2RGAA 2VHJA 2VSFA 3VS0A 2AN9A 3MWLA 1XXHB 5G41A 3T61A 2YOHA 2QAGB 4K46A 2VKNA 1SHKA 4XD7A 1X86B 2ORWA 3CB4A 2A7QA 4NYJR 4A4DA 1NF3A 4KVGA 2A5YB 3QPWA 2IYRA 2ZI3A 4H1VA 2QM8A 3M0TA 1K1ZA 2WJYA 3SZRA 2O8BB 4ZNXA 1YVDA 3BOSA 3LW7A 4Q01A 2IS1A 2VYFA 2ZI9A 1ZW6A 2CVFA 1PWTA 2YUOA 1N5IA 4R71A 3GJ0A 3TQCA 4E09A 1J99A 2ZRFA 3FMFA 4V0ME 3GP8A 3ZD7A 2ZXUA 4Y92A 3K8YA 1KSJA 2BVNA 4CEHB 5TVKA 4EIWA 1OYWA 3EIHA 3U7FB 2QQEA 3IIJA 1YE8A 2C8VA 4LHXA 3KQHA 2D0NA 3SYLA 1Z07A 1N6RA 1MT0A 3I35A 1GFCA 4BFUA 4BQSA 2QY9A 4WA7A 1LB1B 1NJGA 2BEJA 5FFMA 3TW4A 3V00A 4IEEA 2JXBA 1YP5A 4GBQA 1SXJA 2OCPA 5AUPB 1NLOC 2GBQA 2BV3A 1LTQA 3T1TA 2AZVA 3UA7A 1YZUA 4D4KA 1KO8A 2Z5FA 3IEUA 5J40A 2IWHA 1KDRA 3K9GA 5D3MB 4JKIA 4X8HA 1SVSA 1G7RA 1ZAKA 2K6DA 2JTEA 2LWIA 3OEHA 1SULA 3BS4A 5BQ5A 1R4AA 1W7AA 2XB2A 4M22A 2F55A 2PMDA 4QBGB 2Q3FA 4DSTA 1RE0A 4Q03A 3LVRE 1QZXA 2A37A 3S1AB 1SZPA 1D8TA 2IHBA 2Q9BA 4I1VA 4M1TA 4ILEA 4CEJA 1KJYA 1RRGA 2DBYA 3ONWA 5DHAA 4NDZA 1E0KA 1NRJB 1VCNA 4DXAA 3A6PC 1NSTA 2HYDA 2ZS8A 1IY1A 3UK6A 1Z0DA 4LPSA 1NG9A 1GKUB 5IK2D 1Z29A 2JDIA 5IHNA 1EFCA 4CRWB 3EG5A 4JZ3A 4G5SA 2F1JA 4LNPA 3R6NA 5E7JA 3VS5A 3T35A 2XXAB 3ND8A 1GRNA 3MRSA 4CC7A 5KHOC 2O9VA 1A7JA 1X6VA 2ANBA 2KI5A 1FPMA 2LKDA 1DBSA 2XNDD 1G3QA 4LI0A 4R2HA 3TSOA 1E4YA 4H1UA 4IVRA 5C1BA 4NE2A 2P6RA 2J7PD 2IYVA 1KMQA 3THOA 1J7KA 1G8FA 1WX6A 1WF3A 3CF2A 4OK6A 3PXGA 5KDLA 2NGRA 1MABB 2DMOA 4NCJA 5KYKA 4M1WA 2BC9A 2QE7D 2SRCA 3ZJYA 5FUXA 3WYGA 3NBXX 4DCTA 3CNLA 3KQUA 1S9HA 1XBTA 2JW4A 1JR3E 2JIZD 2QP3A 3DMDA 3EAQA 4B2PA 5DYGA 1HE1C 4ESVA 1GCQA 3A1VA 1JEDA 2WSSA 4L9WA 3M4YA 5JWOA 1II0A 3FFAA 2ONJA 1M1YE 5FBRB 3TVDA 2FV8A 3WBJA 2VP9A 2GTPA 4AKEA 4LYFA 2HT1A 2EFGA 2BJVA 3PEWA 1R10A 2O8EB 2FRWA 3I1FA 1W6XA 4NMMA 4R7ZA 1CULC 4LJ4A 2Q0HA 4RKEA 4A2PA 1NLFA 2VBCA 1DAMA 2GZAA 2XJ4A 5EZ6B 3KTAB 1E69A 4YQFA 2RQTA 3BAFA 4EJSB 3VU9B 3FHTA 5FBWB 3Q3JB 2AWNA 2C5LA 2OFXA 2EYZA 2W00A 4MKFA 1GITA 3EC2A 3TNFA 1E9RA 1GOTA 1VECA 4Q7KA 3ZVLA 3ZLJA 3QG5A 1P9WA 1HUQA 3RS4A 721PA 4HVUA 4QHSA 3H0FA 5JBQA 4GBMA 2O8BA 4HAWA 4KXFB 1SRMA 4XVUA 2PL3A 1WDXA 4MRNA 4QBHA 3O8CA 4TN1A 2X3WD 3FGNA 5EUMA 2JLWA 2ZU0C 3BC1A 1R7RA 2R6CA 1IM2A 3W90A 3T5DA 1KI6A 5H70A 2I4IA 1EESA 3KFXA 4JLVA 2A08A 4S35A 2W58A 4DCVA 1N6IA 5JLJA 1U94A 2EQBA 1ZNYA 3EWAA 2BKUA 2EYQA 1XZQA 1JAIA 1X2QA 1CBUA 3W8NA 4NYMQ 1U3OA 1S3SA 1XJCA 2DB3A 4UNQA 3AUYA 1E6CA 3O5ZA 2DVJA 1DS6A 3CO5A 3EASA 4B43A 3W9YA 2PCLA 1H8HD 4QGGA 1QKWA 4X8MA 3RYTC 3WYAA 4L9SA 6Q21A 1G6HA 1NG2A 3EGUA 2JLSA 3DMNA 3AVYA 4Q1FA 3C15C 4FMCF 1IJEA 2J0UA 2YC4C 1ZM4A 4OK5A 3ICEA 1Z2AA 2PZGA 1II9A 1NMZA 2RGGA 2FZLA 2IF2A 2YV5A 4AG2C 4KJZA 1IONA 2FX3A 3RABA 3GD7A 3OF5A 2ZPTX 3GJ4A 3QWXX 2OILA 3VR4A 2F2WA 3O47A 3VRZA 4URUR 1P3JA 3H1TA 5KOYA 2GHIA 1KK0A 2ZJ8A 1DARA 4LPKA 3W5IA 3T12A 4JSYA 1A82A 4QJ3A 3KKMA 4BEBA 1GP2A 4LV6A 4JLNA 1RZ3A 1JBKA 3EZ6A 3KJIA 3MCAA 3DKVA 2K3BA 4Z8XA 1H92A 3I3SR 1KSWA 3RRMA 2OHFA 1CXZA 1GFDA 1KY2A 3M6AA 2V7QD 3MJRA 4JLPA 5A5GA 1SHGA 1MV0B 3R7WB 5IHPA 1QG2A 1BH2A 4PPNA 3ADCA 2NO6A 2QA5A 1H8KA 1VKJA 4LHZA 3UWKA 3M0RA 4L15A 4HZUA 1AM4D 2P4RA 3FVQA 1PLKA 1X6GA 1SXJE 2ZRIA 3E70C 1R0WA 4MGZR 4NHOA 5HZKA 2EFHB 3A4NA 2C95A 2XJ9A 4Q4LA 1UDLA 1KJZA 2GJ9A 5CYOA 4BLPA 1XNJA 3LQRA 1T3HA 3LVQE 3NXSA 2OJ2A 4JVMA 4TQAA 4HLUC 3GLGA 3CUEF 1QHGA 4Z89A 1AEYA 4FI3C 2B7CA 3FJ5A 1FZQA 2X1VA 4FMDB 3WRYC 3VNVA 2BBWA 1YCSB 2BZ8A 1W5SA 3UF4A 2OZEA 2XB4A 1P2TA 4LC0A 4M1MA 4NP6A 4UJ3A 4LUCA 5FUWA 1XU4A 2BZXA 3I8SA 1K0XA 1X8JA 3TVTA 2BCJQ 3D7MA 3RS5A 1OFIA 1OE0A 3EXAA 2DY1A 2GRJA 4FMDF 2WSSD 2ENMA 4LJ8A 3V4FA 2D7DA 4ZKEA 4RJLA 4QC2A 1K0SA 2QT1A 4GDFA 4R98A 3HU2A 2ZSFA 4B73A 3KB1A 1Q1BA 2ZRBA 2ZAOA 3FTQA 2VHCA 2A30A 4J9BA 1QHSA 2I0NA 1I2DA 3LLMA 1TEVA 3M1IA 4NONA 4OKSA 4PO9A 4KFTA 3M0QA 1DO2A 4QGAA 3HYRA 5C4MA 1UJ0A 1Q57A 1QF9A 1A0NB 2RF0A 3B1YA 1MO5A 4IVQA 4ZDKA 2VEDA 3H2YA 4B6EA 2IS4A 4M53A 4IIMA 3HJNA 2G3YA 1FX0A 4QHYA 3AP3A 1UKEA 3CONA 3K53A 4IXMA 4A2WA 3QVVA 2XMFA 1GRIA 1TL7C 2AKKA 1RVDA 2D2EA 2ZUCA 4MGYR 3A1SA 3PVQA 4M1SA 1E2QA 2VQSA 4P4SB 5DGXA 3DZDA 2EYYA 4JBYA 4TMXA 1E32A 4TLAA 3HPQA 4GT1A 1WI7A 5EE3A 4KRTA 1CLUA 1U9IA 2OAP1 3TLXA 1Z08A 2G0TA 1XEXA 2Q9AA 1F2TA 4KFSA 3ZQ6A 2OG2A 3SR0A 4BFTA 1B07A 4LHYA 4EPXA 2ZI6A 4TTRA 5IF9A 5DNYB 3VRYA 2WOOA 1M74A 3IEVA 1NN0A 4V02A 4JPBW 1S0UA 2VL7A 2HV8A 3L82B 3L8ZA 5AUOB 4OHWA 2BWJA 4DLUA 4BUJA 4D2IA 5BW8A 3RRZA 2WMOB 5EQTA 1EFTA 4LN2A 3CZQA 2ZRJA 2DBMA 3AH8A 4PC7A 3CRVA 4J9DA 4JLJA 4OQFA 1OXUA 3NVAA 5DI9A 1ODFA 1RKBA 3AVUA 4A92A 2QG6A 1KOFA 4FWTA 3B2EA 4X8OA 2OM2A 1MO3A 1XMSA 4ARZB 2KYMA 3R9XA 2EGAA 4M4ZA 3THXA 4B2IA 2YKGA 1C1YA 2OUKA 1RLPC 4TZ0A 2YWFA 4RTWA 3BORA 2XSZD 2EKHA 2YWHA 1S96A 4M1YA 1TU3A 4OMPA 5EJEA 1N5KA 4PX9A 5GJBA 4OL0A 1O3YA 4Y0VA 3QKSB 3C41J 1KO1A 1NG1A 1T91A 2RCNA 1GBRA 4US1R 5TY0A 1CIPA 3O8RA 1GUAA 2YUNA 4QFMA 2BMJA 3W34A 2DYKA 1U0HC 2WWFA 4EQ6A 3AF1A 4NCKA 4PPFA 1ZNWA 1X27A 2JDID 4L5BA 1YZLA 5JHHB 1M3AA 4A0GA 4B75A 3Q7PA 5J47A 3UPUA 5F2EA 1M3CA 2O0JA 1L8QA 5DE3A 4C7OB 3A4LA 1AS2A 1GVNB 1E2FA 2X2FA 5FR2A 1SXJC 5EXTA 1E94E 2XITA 2OLKA 4PPQA 1ZUHA 1P2UA 2J7PA 3X1WA 2RPNA 3M0UA 1G8GA 3BIFA 4M9QA 4DWJA 3VR2A 1HD3A 4E6RA 1GAJA 2MSDB 3VKWA 2DE0X 3EW9A 2AHOA 1E0AA 1COWA 1Q22A 1M8MA 4B74A 1M8PA 2WVJA 4QXAA 4RFSB 2EYWA 5L3QA 2IX3A 5I11A 3ADKA 3ZL7C 2FWRA 4LBYA 4OQLA 3MG9A 2QEQA 1FP7A 3RC8A 2NOAA 4HATA 1UEJA 1V5WA 4GRAA 1GL6A 3LXXA 1ZM3A 3G82C 4Q66C 2JMCA 5F98A 2CREA 1ZLMA 1YKSA 1YR8A 3LFUA 4GNKA 5FH9A 4DCSA 5EE0A 3ASZA 3ZVNA 2JJ2A 4Q7LA 8OHMA 3GLIA 4LJ7A 3CX8A 4KU4A 2C0TA 4B3CA 4YMUA 2H1LA 2YUPA 4DT1B 2IL1A 1JJVA 5FPYA 2XTNA 1NP6A 1Q3HA 3OZXA 4LC1A 3U3OA 3QJYA 5L3SB 4RZ2A 2G1JA 3PG5A 2CLCX 4HLDA 3A8TA 2ZJYA 3W6PA 3J81k 1DAKA 1NMYA 4A6PA 2HEIA 2EWWA 2ANCA 3KUDA 5DLQC 5GJVB 4ACAA 2HXSA 1E0JA 4HB2A 2QAJA 4JYCA 2FRYA 3WHKA 4EFMA 5E95A 3GLFA 2NUZA 2IUSA 5CK5A 4JVLA 2DM1A 1MRSA 3DOFA 2G77B 1CKBA 5AR1A 2YOGA 4BZPA 4KHZA 1ZUKA 3KX2A 5BYKA 1Z0FA 1ZYUA 2FPKA 2QMOA 3D3QA 2YWGA 3R9IA 1HEIA 1WE2A 4OK3A 5BN5A 1DAGA 4Q5IA 3NEYA 5BYJA 3GLIE 3TUIC 4AKGA 4U7DA 3HU3A 4C9BA 4M9XA 4E07A 3B13B 2YINC 1MUZA 1Z0JA 1KI1A 5GJWC 4GOJA 5G3ZA 1VYUA 2IYXA 3Q9LA 1XEWX 2V6IA 1WXBA 3GLGB 4AWXA 3RS0A 1JAHA 5EC7A 1JO8A 1MOZA 2NIPA 4UQOA 2ZM5A 2W6JA 3F0TA 3PUVA 1R2QA 1SXJD 2CK3A 2X19A 3VX3A 2OO7A 3OFNA 4DUGD 3ZVMA 4PQFA 4YMWA 1GNRA 2J6OA 1CKAA 3WMEA 2N42A 3RHFA 2QZ4A 3TSWA 3QKSA 3OAAA 2Z6VA 4MGIR 1G7CA 1PKSA 2GBLA 4YDHB 4QKQA 2VF7A 1U0JA 1FMKA 3N70A 1ZC4A 2NQ2C 5JFGA 4TL7A 4M4SA 3U3KA 1F2TB 5AUNB 2IS6A 2AK5A 4C0KA 2LQNA 1WP9A 1TQDA 4QGHA 4WZ6A 2CL6X 2SHKA 3RS7A 4J0QA 1Q0UA 4XWAA 1RFLA 3M0PA 1PLJA 2PZFA 2W2VA 2F2VA 4GP7A 4P3YA 4Q1EA 1PUIA 4B32A 2KGTA 3LD9A 4LYAA 2ZQ5A 4F4IA 3JVVA 1XTQA 3U6BA 1TTTA 1TMKA 5JCPA 2FG0A 2DRMA 2V1QA 2RGXA 1KI3A 1J8MF 3ZGXA 4V03A 4B6FA 5E3HA 2E87A 2XOKA 2FGKA 3SJZA 1AJEA 4IXNA 2ABLA 2IXFA 2JJ1A 2V1RA 1G3MA 2GVZC 3LBNA 3NG1A 3TSZA 3LLUA 4RD4A 1Z47A 3BB3A 2DFLA 4RY2A 3AVPA 3MFYA 2VO1A 2RGCA 1M30A 1DAEA 4GI7A 4M8NE 3CNOA 1GL7A 3PUXA 3GLIB 1VIAA 2EFCB 3AF0A 1YZQA 2A28A 1GCQC 1JB1A 5E7IA 4CIDA 2V7QA 4R2IA 2FFHA 4EPYA 1KTVA 4OQMA 1XEFA 4M1KA 1R8SA 2BBOA 4IDOA 5KDDA 4RD1A 2FJUA 2AZSA 3UXMA 2QE7A 1H8ED 4B76A 4Q47A 2NZJA 1F5NA 2O8DA 3PVSA 3UMFA 2KE5A 3NH9A 3QF4B 3EX7C 2DPXA 5D3QA 3SQWA 2QSYA 2QMUA 4TSFD 2RN8A 2LKCA 1NLYA 3H0KA 1I1JA 2OLJA 1P5ZB 621PA 1CJUC 5DSZA 1GSIA 4Z1MD 1JU5C 2F1RA 1NY6A 2VVKA 2EYUA 4R9UC 2V1XA 1ZNZA 1VG8A 2BDTA 4QL3A 2JM8A 2ZJ5A 3TBKA 3TAUA 5KSOA 2WWYA 1HY3A 3PV0A 1Z6TA 4MDFA 4QNRA 4KVAA 3THWA 3VS3A 2HCJB 2N1BA 1X1RA 4LOAA 1G8HA 1LV7A 2DBKA 1UFQA 2CEAA 2HF8A 1I2MA 1UKVY 4P4SA 3MD0A 3SYKA 1I4LD 1CU1A 2LJ3A 5JRZA 1TEXA 3AF4A 3GJ6A 2AK2A 2GCOB 3CRW1 1XWIA 4MA4A 2A3RA 1W44A 2A78A 1TF2A 4JLAA 4BZQA 1MR3F 3CX6A 5KSZA 3AKEA 1OB2A 2C96A 5JWRA 1W36B 4XVQA 1P7CA 2V1UA 2DL4A 5FUYA 5FOUA 4R0KA 1OIWA 1HSQA 1NBMA 3OEED 4FMCB 5J4KA 3HWSA 2ASEA 1RRFA 4AK9A 2YUQA 5G3YA 2OV2A 1WB9A 2YZ2A 4FIDA 4C30A 1HT2E 2NZ8A 5HPYB 4M9ZA 4AKHA 4URVR 1VA7A 2QN6A 4IJMA 4KFUA 4IOJA 1ETUA 4KYUA 1NMXA 5AJVB 5B2ZA 2GZHA 1VHTA 3QOFA 1T6NA 2ZE8A 5EXPA 3VS1A 4M21A 2GJSA 5C18A 4A0HA 3QEOA 4J9FA 5AUQA 4AG6A 2ATVA 5H8WA 2ZSDA 1G8YA 1AWWA 1KHTA 5DN6D 1N6LA 5EE5B 4P32A 2R62A 1UEIA 2PLRA 3A36A 1SVOA 2B86A 1UBFA 2ZRAA 3GJ5A 1J3TA 2VP5A 2DWPA 2O9SA 4FXPA 1LY1A 2IK8A 3VR5A 4MKGA 5LPNA 4MRRA 1E9FA 4O3MA 2EGCA 2O31A 4KBFA 3VS4A 4HAZA 2NPFA 3RS2A 1XEWY 1QCFA 2CUDA 3ZDQA 2QU8A 1G7TA 1DELA 3CWQA 4Q4HA 4TYYA 1NKSA 5GJVC 2IA5A 3FYHA 3NBFA 4O25A 4DC9A 5BXQC 4LGMA 2J1LA 1TPZA 2CT4A 1KO7A 2DFNA 2IEZA 2V55B 4TWZA 3EPHA 2REBA 2R6DA 1W0JD 1YR7A 1Z9ZA 3CF0A 2ECKA 1AS3A 1WQ1R 4AG5A 3THYB 3TR5A 5K8UA 3D6TB 3QKRB 1SVLA 4GP6A 3EPKA 1E9SA 4JVNA 1GRRA 5TV2A 1Y57A 4UNPA 4EUNA 4UNRA 1KKMA 5J4VA 5FR1A 1GFIA 4HYYA 3PEYA 3T1QA 1S2MA 4MITA 2ZEJA 1D9XA 1W2HA 5FPTA 3X1XA 1E99A 1OSNA 4NCIA 2REXB 3FB4A 3TJZA 4HZIA 4Q9KA 5CDFA 2WJGA 1AZEA 2WV9A 3FKQA 2K9GA 2RNAA 3AEZA 2O2OA 4EKDA 3KKNA 4KODA 4DEYA 1BYIA 3SHFA 2ZTSA 3KKOA 4FINA 1UHCA 4RD0A 2P67A 1WBBA 1ESNA 2W2XA 1AA9A 2NO1A 1QVAA 3LBIA 3NKVA 3U6KA 2DR3A 1DAFA 3DM5A 1KJWA 1KYIA 4HUTA 1E79D 4LJ9A 2ZYWX 1C4OA 3T15A 4Q18A 2VA8A 3IBGA 3VU9A 1LF0A 3VR6A 2HCBA 4IIOA 2RQWA 2QTFA 2ZRDA 4I4LA 1U8AA 4XSHA 4HAUA 2XGJA 4J9EA 4Q4AA 1FTNA 1W4AA 2NG1A 1NIPA 3L2OB 4HLQB 3G0HA 2NMVA 1UJ2A 1KIMA 1ZJ6A 2RGEA 5JS8A 3KXKA 1X69A 1ZD1A 3FKSD 1JXMA 2ZSAA 3T06B 4BPBA 1ZNXA 4Y0AA 2BJWA 3KQKA 1E1RD 2CH4A 3CRQA 1EK0A 4X1VA 3RC3A 4V0KA 4RZXA 4JJBA 1G6OA 5HKKD 3K0CC 2OT3B 3SJAA 4OMLA 5F9HA 4ZO4A 3U2QA 1D2NA 1X8LA 1KSHA 3L0PA 1BU1A 3Q5DA 4JLDA 4A82A 1UBEA 3V4RA 3PEVA 3B85A 1SGWA 2LMJA 3CPHA 2L3QA 2EW1A 2G0NA 4Q4JB 3BH7A 1BMFD 4PHHA 3UA6A 1GKYA 2YJTD 1DEKA 1P6XA 4I81A 5FWBA 4RD6A 1OKKA 2QP9X 5L3RA 4KLNA 4B34A 4Q19A 4F17A 1E1QD 4HB0A 5GJWB 1GZSA 1YZGA 3ZYCA 1S1MA 2ZR9A 1GL5A 2ZRLA 4DLXA 2FFBA 1MO6A 4G5RA 3FOZA 4D4JA 2ZYVX 2P6NA 3WP0A 4OMQA 1H8HA 4Q1CA 5HCNA 3HP1A 4MYTA 1XCMA 1IXZA 4Q4JA 3AVWA 2GK7A 2VF8A 2XZPA 4OHXA 5DISB 2YT6A 2BHRA 3ZZUA 2D8HA 2J41A 4HDCA 3U3JA 2EFEB 3AVQA 2MSEB 3ZIAD 3WY9A 4DRZA 4PSAA 4TYPA 2F1HA 2O8CB 2WOJA 3SQXA 4AFZC 3QI2A 1JR6A 3BB4A 3CW2A 4TYQA 2WWWA 2W6IA 3I62A 5IHKA 2IEYA 2ATXA 2GKSA 2L2PA 4GMDA 5KPJA 1Z83A 3SOPA 2RGNC 4W5JA 5GJCA 4RZUA 3A37A 3JVUA 2GGRA 3EZ2A 1UDXA 1MRNA 3NBYC 4OHYA 5C4GB 4A2QA 3R8FA 2O8CA 3U5ZB 2CSQA 4AI6A 1VG9B 1KNXA 2J87A 4HAXA 3EWSA 4V0LA 3L0IB 4TLBA 2EVWX 1S4QA 3PUYA 5J4HA 3DVLA 5JRJA 3ND9A 3THWB 5TDHA 3MMPA 2B8WA 2UZ3A 4HLUA 1AWJA 3MWYW 4CEIA 2QTVB 2ZE7A 1JPJA 3CPJB 2ZE6A 4DLSA 1WMSA 2HEQA 2FPDA 4BGDA 3AVVA 5J5CA 3DM9B 4F7WA 1G9XA 2EYXA 4DLWA 3U4QA 2RQUA 1CR2A 4EDHA 1A1VA 4US0R 4GZLA 1RIFA 2C9OA 4FWIB 5D3MA 2WSMA 2ODBA 5KNDA 2JCSA 3KUCA 3KB2A 5TB5A 4A8JC 3RAPR 3X1DA 3NHNA 2PMKA 2QPAA 4IDHA 4RTXA 1FP6A 2QT0A 3GEEA 3I5XA 2RH5A 2CNWA 1YN8A 2FFAA 5K8LA 4MUBA 3EZ7A 1T3SA 2CL0X 2XOKD 3NHAA 4ZCMA 4ZI2A 2NO7A 3GLHE 4C7OA 3UG6A 1K76A 1E2EA 4DIEA 2DL8A 1U06A 1UFFA 1H8EA 4ZDIA 1G7SA 2QBYA 3B1VA 4J9GA 5CLLA 3C16C 2HUPA 5CM9C 2XZLA 5CITA 2FF7A 1OFUX 2JLYA 4C0SA 1E9DA 2RHDA 4DLZA 1NN1A 2FG5A 1F6BA 1KO4A 4UJ5A 1TF5A 3GJXC 1XFAA 5IXBA 4LJAA 1OPKA 2FSHA 2OCBA 3WNCA 1NBME 5JJIA 4B3FX 2Z4SA 1RW4A 1VTKA 2BBSA 1ELOA 2F6RA 1COWD 3ECCA 3LQQA 2DRKA 2VP4A 3CR7A 1P72A 4EJSC 2DILA 1IOZA 3TW8B 2EQIA 4RD2A 4UKDA 4QGFA 1XTSA 4DBLC 3PIRA 1V1CA 1G64A 3THXB 1JXOA 1WXQA 3PUWA 2FSIA 3QNUA 5KDOA 1T9HA 3Q8XB 1WYXA 4A9AA 2V9PA 4G3XA 2YSQA 1Q44A 2Y8EA 2RQVA 1UKZA 1RYFA 1XD9A 4FW9A 5KSYA 4LUDA 1G8PA 2P65A 4UNSA 5JMTA 1E6GA 2FPFA 3CKLA 5FUVA 4FCWA 4MRPA 1KAGA 5FTKA 2ZREA 1OXSC 4FSSA 4OQNA 5JJKA 3VKHA 2GESA 4N0DA 4YC7A 3KXLA 3NWJA 4UNNA 2X77A 1FMLA 2WKPA 3JV3A 4D6PA 1ZIPA 1PV4A 2AL7A 2JLXA 4DB2A 2E1RA 4C0BA 2D2FA 4GFDA 3FMPB 2TMKA 1HJDA 2ODWA 1OV3A 3GQBA 2KBEA 1N6NA 3HR7A 2LQWA 1RI9A 821PA 2QGNA 2LZ6B 2BM0A 2YVUA 3RANA 5HE8A 3SJCA 2D06A 3VHXA 4AURA 2O8FB 4AYXA 1XOVA 1G83A 1Z5ZA 1VHLA 4HI0E 1W4RA 1OPXA 4ITRC 4DCNA 2J7KA 2QRZA 3CRRA 5HE9A 3VHLB 3KJGA 4QBFA 4ASUD 1BOFA 3OIVA 4BRWA 4E03A 3PJRA 4XIGS 2DF6A 2BM1A 1CJTC 4RSGA 4CVNA 5JCZA 1ZUUA 2WWXA 1E7OA 3B78A 3GJ7A 3JZMA 4QHTA 4V0NA 4C0LA 1JR3D 2IS2A 1DPFA 4CC4B 2CE2X 2J7IA 1KDOA 2OI3A 1YRBA 3U44A 1TQ2A 1N5LA 4QM6A 1PLLA 1CJKC 2A2ZA 1N3BA 2H8KA 1AIPA 3WNBA 3N5CA 1XZPA 4HUQA 4OHVA 3QE0A 1OV4A 4Q4AB 4BLOA 5FOXA 5IK2A 1NIJA 4PQRA 3O8BA 2DCUA 2O0KA 4FD2A 3WNDA 1ZBJA 3CF6R 4CEIB 4RVCA 3VS2A 5J4LA 3H84A 4PAOA 4RKFA 3KFVA 4YDSA 1ARKA 4AC9A 3OFND 1GG2A 2ZJBA 4WXRA 4QBIA 5KNBA 1W36C 2C03A 1YR9A 2IT1A 2FNAA 3I9QA 4HLCA 4LCBA 2KXDA 4NKRA 3REGA 4BWYA 5TMPA 2KRSA 2KJQA 2DHRA 2RMKA 1NN3A 2IXGA 2R6GA 3U7GA 4QNMA 2VWFA 2LJ1A 1Q3TA 4NCHA 2FOLA 2Q3MA 2Z4RA 1WFWA 3FHOA 4QOSA 3GMTA 1TUCA 5FOSA 1AKEA 1UKYA 3EPJA 1SSHA 1CJVC 3I32A 3CIOA 1OH5A 4M0LA 4PFSA 2LJ0A 1IBRA 2DFKB 1IXSB 4ZDWA 2SEMA 4HXJA 3AM1A 1FW6A 2RHMA 4U02A 1GL9B 1JECA 2G1KA 4EFLA 5CM8B 3WMGA 1LNZA 2A5FA 2HJGA 1ZUYA 1XXHE 1OLOA 2FEOA 1EX7A 1I0CA 4DLTA 1ZRHA 4AFUC 2PBRA 1XXHA 1X1SA 2CBZA 2OBMA 3PEUA 2DA9A 4JVSB 2Z0MA 3PFIA 3R7WA 2HBWA 5FL3A 1XCGB 4NYJQ 2HSPA 1W2GA 1SEMA 2JS2A 2IYTA 2KRNA 2ZI4A 2YYZA 5LB4A 4NU0A 2OSBA 2IYYA 2C9CA 2ZJ2A 4B44A 5JECA 2RQRA 1ZSGA 3RWMB 1WIEA 1I07A 4NH0A 2XEXA 4ZDJA 4FCVA 3SC3A 1IN4A 5FBLB 2FEIA 4FCTA 1E9AA 2G6FX 4TT3D 1D2EA 3LA6A 3MLEA 2WIAA 1HA3A 1TG0A 1TX4B 2HDNB 3OEHD 2J0VA 3DOEA 4OI0A 2O8DB 5LBIA 1OW3B 1G2BA 5ANRB 1XMIA 2IYWA 3TMKA 4IDNA 2GAOA 2GK6A 3K09C 4L4UA 3HR8A 4EIKA 3BWDD 4NZYA 4YMVA 1UG1A 4BFXA 4EPWA 2GF0A 3WP1B 4BASA 1U9IC 2ZJOA 4PC1A 4K11A 4WZAE 521PA 1OOTA 5TXGA 2AK3A 1CRQA 2FN4A 1QBKC 2F43A 4F4CA 1X3SA 2RMOA 1E1RA 4Q9JA 1VCOA 1D6JA 1Z06A 3GEIA 4CF7A 1G1MA 1P2SA 2FSFA 4XWKA 1KZ7B 4PO8A 1Z2CA 4WVFA 3BFKA 2KXCA 4JT4A 3AUXA 2XSZA 3F3YA 3B1WA 2VSXA 2IYUA 4PC6A 1W1FA 1U5SA 1NKTA 1E2MA 2WWHA 2O5VA 1G18A 4XSGA 2OCAA 1YJ5A 3ULRB 3GJ8A 1X8KA 2KSQA 3K0CA 3MUFA 1S1NA 4ZIRA 5JI3E 2H7VA 1XMJA 4GZMA 4JLBA 3B82A 4JL6A 5SZHB 5FPKA 2C99A 2R65A 2ZAMA 5SZKB 1XD2B 1C9KA 3FHCB 2Z43A 1DTSA 1LS6A 2WM9B 3B9PA 1MH1A 2IXEA 3FMOB 4A6XA 3IHLA 3U44B 1FYNA 1OH6A 3GFOA 4J9CA 4YXWD 1S8FA 1S1CA 2NTYC 1G20E 4C0QC 1RPZA 3FDIA 2J0UB 1W70A 5FOWA 2ZITA 1Q20A 221PA 4IVPA 2DJQA 1SKYB 1G3IA 2AFHE 2JJ8A 2QRNA 1BK2A 1T0JA 2I3BA 4TL8A 2D4HA 1RUWA 3EHQA 2CDNA 2R6AA 2HCKA 3W6OA 2JLVA 3I61A 1QWFA 1FX0B 1E3MA 1VCMA 4CYMA 4EPTA 1P4SA 3LV8A 2M0YA 1GNPA 1HQYE 3QSYA 4JYBA 2CSIA 3SDZA 1HTWA 1OF1A 1JJ7A 5LB2A 4FN5A 5CB8A 3K0AB 4B3DA 4P33A 4AD8A 2YDLA 4AIIA 4Q48A 1R5OA 3C5CA 4PAQA 1UPTA 3SEAA 3ZS9A 4D0GA 1BKDR 1K5DA 1NI3A 2OCYC 1US8B 2REOA 4JLOA 5IT5A 1IXRC 2WWIA 5EZ5A 3CQTA 1KKLA 3IQXA 4TQ9A 4MYCA 3TH5A 4XWOA 1XX6A 3C8UA 1IJFA 2YC2C 2ZS7A 4TQUS 4DJTA 3AVTA 2V4ZA 4AFSC 3K0AA 4TSFA 3LO5A 3W8RA 3ZQJA 4C2TA 1Z0IA 4D26A 2J9RA 2P5SA 1B0UA 1M7GA 2G88A 1IY2A 2CVHA 4B47A 4EQ6B 5JSZB 1E79A 4D4LA 1AZGB 3IUYA 1E4VA 5EP2A 5L8VA 1ZUNB 1IHUA 4HDOB 3LBHA 5EUQB 2PH1A 1QRAA 5KUTA 3OE7D 2BOVA 4IOLA 3T1OA 2FFQA 4URWR 4X8LA 3VQTA 4KITB 1W4BA 3EHRA 1R6BX 1G3RA 2QAGA 4WZBE 3NH6A 1B3QA 3REBB 1OXTA 2JASA 3A1TA 3O8DA 4OHZA 1IN6A 2OE2A 5J4YA 3ETLA 421PA 2ONKA 1G17A 4NPHA 5HKKA 2ZUDA 2KEAA 4CW7A 2PNIA 5M04A 3GLFB 3N2IA 4TL9A 3X1ZA 2CHQA 3B60A 1RYHA 4E5UA 3K0SA 3KTAA 1YQTA 3KKQA 2R6FA 1HQCA 1NBMD 2F9LA 3OEEA 3KQNA 1E2DA 1TQ6A 3C0CA 1W48A 2ZRHA 2MIOA 1UJYA 2IHYA 1WA5A 4RFSA 5L3QB 1ZX6A 1N0UA 4HAYA 4EPRA 5A4JA 2HXYA 4Q7JB 4US2R 2J3EA 1N6HA 2QNRA 2ZR7A 2LNHB 1P2VA 1M7HA 1AZTA 4NTZA 4NL4H 1PVOA 1Z22A 2G83A 3RVBA 2ZRGA 4KLZA 3A1WA 1ZP6A 1CJMA 5EE9A 4LV5B 3EZ9A 5JWHA 2OAQ1 4HSEA 4DUGA 4HB3A 1N6OA 4HEJA 1XJ0A 2IUTA 2P3SA 2K79A 1EWQA 4TMZA 5ECAA 2IYQA 3KZ1E 1M7BA 2F3TA 4PANA 3QWYA 1QG4A 3EZFA 2IF0A 1II8A 1A2KC 2ZSEA 4TMVA 3W5JA 1Z6AA 2CE7A 1IN5A 2J06A 3TR0A 3Q5EA 2ZROA 5EP3A 2A9KA 1LVGA 3S1AA 2GXUA 4BFVA 1SPKA 2AD5A 3KL4A 3OAAD 2PZEA 1XPOA 2MCNA 1ZD8A 4MGKR 4K81B 4ORZA 3U3RA 4DDVA 4B3BA 5BN4A 2OAWA 3IIMA 3K70D 4RCYA 4ASUA 3VKGA 1LCKA 4DLVA 1XF9A 4KSCA 1FUKA 3CZPA 4LYHA 4PZYA 3UKDA 3B7GA 1P9RA 5LD2C 2XTZA 3EG0A 4IDPA 2PX0A 2WPDA 2ZANA 3UANA 4CGZA 3BGWA 2ZSBA 4GMXA 2QI9C 4L16A 3B1ZA 2Q9CA 5K8TA 3QXHA 1X2KA 2W0MA 1JEGA 1G16A 1HV8A 1KI9A 3TUZC 3PVLA 2N46A 1YU9A 2ODEA 1L4UA 3U23A 4F38A 3K70B 2YHSA 3ZVRA 1TADA 5JSZA 2DL5A 3TUJC 4G01B 1HT1E 3AQ4A 3LAWA 1E2JA 1P62B 2V8OA 2WBLC 1FTSA 4D82A 1SHZA 1KIKA 2ZU6A 3GFPA 4B48A 5L23A 2O88A 1KK3A 4C3ZA 5FOVA 3GBQA 3LW8A 4OMMA 2B7BA 4B35A 5G40A 3IQLA 1CRPA 5UKDA 1OFHA 1BMFA 3KDSE 2NWMA 1N0VC 3EC1A 4JKYA 1K5GA 3FPAA 3EG3A 3SHWA 2KYBA 3K70C 4MRVA 1M27C 2K5UA 2PT7A 2GXSA 4Q00A 4XOIA 1OIVA 5C2JB 1X6BA 2ZYUX 5BN3A 3NTUA 1CP2A 2OEPA 3NBZC 1GWNA 2F9MA 1NYGA 4F14A 1L7VC 4URZR 2RKOA 3K0EA 1G5RA 3QPUA 4O2RA 4AYTA 2VPPA 1AWOA 4ZI3A 1JQJC 1CS4C 3B6EA 3SJBA 1EG7A 4CDGA
chains in the Genus database with same CATH superfamily
1KZHA 2NU6A 2MYSA 3KOMA 1SNYA 3I55T 2BSAA 3AETB 4MRSA 3BH0A 3VNSA 3AL2A 1LPNA 1KDTA 1AKYA 3DUFB 3ACBA 2CN1A 1F4PA 2NUTB 1RHRA 1PJ2A 3C7KA 1IOVA 2EF0A 3WGUA 4WGGA 2IEGA 3HQ4O 8LDHA 2O7RA 1G21E 5EXSA 5G0UA 3I09A 2YOFA 5GVRA 4C0JA 5IT4A 1N75A 5TF0A 1ZICA 2A9VA 2MYUA 3AEYA 4BLTA 4ZALA 5BNFA 1N5ZA 1FLAA 3JCMf 1UZAA 2VHTA 3DO8A 2A3NA 4Y2HA 1E1KA 1OILA 1T2EA 1PK7A 3HVHA 2ZSUA 1UXOA 1LFAA 5GAOm 1NATA 2CW5A 3IEXA 2Z95A 1YB2A 3DZBA 4MDHA 2L3SA 5ER6A 5G1NA 2R2AA 1PQUA 4PFZA 3D5TA 5GONB 3WFZA 4QT7A 3H2KA 3RNJA 4CCYB 2HRDA 3BSYA 4Z4CA 1CUHA 4WY8A 1K4US 3OOYA 2GPTA 2MWOA 5K3BA 5IF3A 2NVBA 3F6PA 2O8EA 4N5NA 3WHLA 5JAOA 1LDEA 3B1JA 2MWPA 1ZMOA 2E85A 4J49A 4WOPA 4GKKB 1ZK2A 5GAOr 1K6MA 3DE3X 3UJ9A 3IP5A 1MO4A 1PE0A 2CCJA 2OV3A 2CXHA 2YNMA 5D5HA 1U1CA 1HQDA 3DBLA 2ZR0A 4PNPA 2BM9A 1PNJA 2GHQA 3V9AA 4F93B 2P9GA 4HVWA 4LYJA 1XE3A 4B87A 1DE0A 1JEQA 2V8IA 1QQ7A 2IEAA 2FYKA 1VQ8Q 3O2SB 4MV3A 1CQJB 4U6QA 2IHKA 2RAPA 2NVWA 5KS2A 1PN3A 4M8LA 4PTYA 3JCMX 5IKMA 2ILVA 3WOVA 1OIXA 5JQGB 5A0VA 5F7ZA 3N74A 2VAVA 3F5FA 3RG8A 2EKBA 3WLKX 3O8OB 3QFSA 1OWMA 4RA9B 3TGLA 5ALOA 2IIVA 1TTQB 3PGJA 4I1IA 3RBVA 3ZV6A 2R9VA 1GTMA 2BONA 1X6OA 3VS6A 1G63A 3I2KA 2FVUA 1Q1QA 2BW0A 1A5BB 1CNFA 2XUDA 2YN0A 3IDQA 1ZJJA 3H0CA 4HH3C 3FHLA 4IHQA 1ZN7A 3OM8A 4ZC1A 4YR9A 4LYDA 4KQHA 1CHNA 2A7YA 1CUIA 1N6PA 4CKXA 3H5NA 3O7WA 4M86A 2PUKB 1R74A 4LBZA 1PK8A 2JKVA 2FW8A 2NV2B 3HKBA 3QVSA 4YRJA 4C78A 5JUWA 3CCJQ 1H2WA 4DJ5X 3QVXA 1QCYA 2XT6A 3N7UA 1IHOA 1T0HB 1JKMA 4HH4A 3I56T 4G4IA 4C4PA 4LX8A 1F2UA 1J90A 1QLWA 1XTTA 1JAYA 1L1RA 3AVTA 4DOWA 2YJ5A 1SA0B 4S1TA 3VR5H 5FWNA 1PL8A 1NLPC 1Y96A 5LBUA 1U0LA 4ZOLF 2C3MA 3QIAA 3SE0A 2H8GA 3GR6A 1K66A 4A23A 5A9TA 3O95A 3AKYA 3KJQA 2WIKA 1QONA 3X1YA 4C7KA 5JEDA 4ZV7A 5KIAA 2BCGY 1L5HA 3GFGA 4M98A 1U8CB 3KR0A 4RIEA 3MTBA 1Y6RA 3B52X 3SPXA 1XTBA 5A0FA 1DG9A 2JGLA 3OTIA 3SFVA 4NJMB 4XFDA 1ZVQA 3IUSA 3MS2A 4TLCA 3ML1A 1E6HA 4A15A 5JRDS 2CYAA 4FYMA 3JQEA 2GETA 1Y7HA 1ATIA 5BOVA 4RTUA 3BD8A 1HGXA 1NPYA 3P9ZA 3H2ZA 3HXPA 5DXAA 2V26A 4BZWA 2MMGA 3IUEA 3Q15C 2Q6TA 2KBFA 4E31A 1JEEA 3RSLA 4J6YA 4QGBA 5KWJA 4Z6KA 1FXUA 5DASA 2J30A 1ODJA 1ONOA 3IPCA 1SKAA 4TZ6A 4UTZA 4AMBA 3M1YA 4TS4A 1GO2A 2D1QA 1XLTC 2GOYA 2HBYA 3TQQA 1D3BB 1LDGA 2MR5A 1Z4KA 3ZWYA 5JV5A 1XSEA 4HZUB 4UXHA 5TE9A 5HDQA 2O19A 4ZJUA 3L2WA 1SUEA 3RARA 4BFSA 2GXAA 3F7TA 4N54A 2IYSA 4QTTB 3O4RA 2CJWA 1XNQB 3CCUQ 1D5CA 1DCMA 1V7PC 1Y6JA 1VQPT 4QG7A 2Y1DA 1VDZA 4I3GA 4R41A 4RX1A 1KD1C 1J8DA 2JAQA 2NYRA 2P30A 2HIHA 3KHKA 3O4JA 4K9SA 1IZ9A 1LFDB 3EARA 4WY5A 4JZ4A 1H5UA 4J90A 1G41A 3G2LA 2ZQZA 3N8KA 3K0BA 2NUAB 1JPNA 5ALDA 2I87A 2FSSA 1QF7A 1WNLA 1KFKB 1W25A 4GX1A 4RHUA 4NPAA 5LC1A 5JH7A 2VDMB 4K86A 1PL6A 4JJKA 1HFEL 1INLA 3CM0A 1D1BA 2OKGA 2ROQA 3K16A 1GN8A 3KEGA 4G1EB 4P86A 5AYVA 5KWEA 5MFZA 4BTLA 1KDPA 2GVDC 3LK6A 5K6RA 1T4MA 3CJRA 4MCJA 3CN7A 1NXVA 3OJEA 5EMLA 3UW3A 4YT4A 2VPTA 2HF9A 3AC0A 3L7NA 3R3WA 5LUBA 2YJGA 1CX9B 9GPBA 1WPYA 4I5IA 1TNDA 2A9OA 1YC5A 1FXXA 2CY0A 3VKVA 2RSLA 2PQ6A 1K5HA 5HZGA 1RWBA 3ZNQA 2LCCA 3RAJA 2ZRPA 4NDNE 5HR5A 4PCAA 3FJYA 2F8SA 1GXSB 3V1NA 5HJEA 4CMEA 2PGAA 2G5GX 5J1SB 1W5TA 3IAS1 3R6WA 1ATZA 1G3YA 1E3EA 5DP1A 1WZ2A 1YD7A 5DNUA 2VV5A 1ZCBA 4B6MA 3FE2A 4CLRB 4NCNA 4GOXA 4MEBA 1GGFA 1RBZA 1Z12A 1Z0SA 4OMFB 1XDBA 1RU3A 3OFVA 3AJRA 3R5SA 4BU0A 4D9FA 4WAUA 3RC7A 1U2ZA 2QD1A 2RB5A 3FWZA 3LHKA 3Q6MA 4YQZA 2HCFA 1C9YA 3W2TA 5IANA 4RLQA 2BEVA 4RTVA 3HNRA 2XG8D 4DEXA 2BCEA 2BI7A 3ZDYB 4CEHA 2M0OA 3A4MA 2R5MA 2AEJA 2VJLA 4PC3A 2BLNA 3OIWA 4MCIA 1A5AB 1TT7A 1FJ2A 2OCDA 3AR4A 1EB9A 2X8AA 3BRWD 1ISGA 3EGXA 1IATA 4RE6A 4GH5A 5FNVA 4H7FA 3L77A 5FA6A 4ABTA 2P2SA 2FLWA 1MHNA 2C77A 4AZ0A 2Y1GA 4UBOA 3X3HA 4QATA 5TT0A 3WOHA 2V7EA 4G24A 4HBZA 2AOUA 2GEDA 3QVUA 4BIMA 1OFUA 4H1TA 2NVOA 5IJ0B 4O0MA 5KNBD 5LUAA 3EVCA 1MIHA 2QV7A 3UMSA 2WMYA 3UUFA 4IOKA 3LDFA 3I83A 3HJFA 3P8HA 4U3JA 3N5BB 1BA2A 2XOXA 3KM0A 3ZHTA 4RVOA 3RKUA 2FZKB 4E7JA 3E3NA 2CHGA 3BH6A 3C3MA 3GZ4A 3VYUB 3AFNA 5BV2P 2PUTA 1VQ9A 4YR7A 4CEJB 5K8JB 1DDGA 4IIUA 5J3JA 1KP9A 4XAQA 1USKA 5CVDA 4DUPA 2ZBPA 3QKIA 3ZK8A 2J08A 4DQ2A 1F3OA 1QV7A 4PNHA 5BMOA 3H1PA 1EXWA 2MSNA 3RVQA 1B7TA 4X45A 4NL2A 4KPFC 3ZU5A 2L3PA 3IVAA 3L18A 5DM1A 1PYDA 1N4AA 3U5TA 1IAVA 1Q0HA 1XQYA 4AQ7A 4RVSA 1N1DA 4ZAZA 1W49A 1XTVA 3KLPX 1Q6ZA 4KIWA 3Q7EA 1OTHA 3UUWA 1OYOA 1VYHA 4HRXA 1PV2A 4AFQC 1N5JA 4N39A 4NX2A 2JGDA 5IH3A 2PS1A 2WKSA 3AR5A 3WRXC 1E9VA 2BKVA 5C8ZA 3HXOA 3V2UA 1A5SB 1QHEA 1ZOSA 3M81A 1R5JA 3AGPA 4MAAA 3MWEA 4ADSG 5B4VA 3KT3A 3ELUA 3OZIA 2JHPA 1F14A 1T5TA 2J32A 2X4IA 2AT1A 1ZXXA 2R25B 1LW6E 3P4UA 2DJIA 1T2FA 2X0JA 4ZTJA 2P9BA 4S3MA 3WZ2A 4M0CA 2CFIA 4DMCA 3ZHZA 1V8DA 2EIXA 5F3WB 3AONB 1PX0A 1ZH0A 4L7QA 1VJRA 2HMWA 5H3HA 1CCWA 1WCIB 4E3ZA 3DE6X 3DHWC 4XYEA 4MHTA 4WIAA 3BFVA 1LVHA 3PGXA 1E8NA 3WV4A 4L8YA 1Y8QB 2FMXA 3AB3A 4RFVA 3X28B 1HYGA 2V3CC 2UXBB 2MSLA 3Q7IA 5HS4A 4KWCA 1PR2A 4IFBA 1G66A 2R2GA 1CS0A 1CUZA 5F5XA 3X43A 1DJQA 3LWNA 1GXSA 5CCAA 3OD1A 5DGCA 3NHKA 1E18A 1NYTA 1IZ6A 1C7EA 5FPHA 2C4UA 2ZS9A 5GANd 1Y37A 3DHYA 4U7WA 4MS4B 1E20A 3OI7A 4M0EA 5IDVA 2QJRA 1E89A 3DQZA 4KTTE 4RPCA 3C39A 4ZT7A 4X61A 5BSEA 3NDBB 2D59A 3H6HA 1W88A 2F5TX 2VDKB 1J2JA 1SSFA 3UFBA 1UZNA 1FNSA 5GAMg 1VQNA 2QG9B 3Q1JA 1VYTA 1QVGS 2GCOA 2X4YA 3A32A 5B53A 3EGEA 3MJ4A 1NYFA 4FE3A 3MINA 5F64A 1MOSA 4F5EA 7AT1A 4DSOA 3L1IA 4C06A 4K6OA 5HDBB 1YS2X 3IRVA 1P5JA 5I5GA 3UAYA 5I6DA 3U7JA 3BWCA 3R0ZA 2YWDA 4BB5A 1V7ZA 3II6X 3IX7A 2F7SA 4K6KA 4IW3B 2RK6A 4FEYA 5JYEA 3DW1X 4INPA 3DBLB 1U7TA 5A04A 4MJLA 2C2WA 4PSDA 1WS6A 1YOVA 2TMYA 5ALTA 3WRVA 1LDMA 3H9NA 2JAUA 1E6MA 3JD3A 4PG6A 3T9AA 4A36A 1PS0A 5ED0A 1JHAA 1H93A 1V47A 4O4JF 2BFPA 3Q7QA 5CBPA 1Y5NA 4LW8A 2CGHA 2XWPA 3EYWA 1KC8U 3ISTA 4L57A 1ONBA 4OBEA 1JQLB 4M9RA 4O5OA 5AM4A 1UK7A 2IDZA 1KBQA 4XLLA 4D9EA 5HQJA 1WL8A 2BGLA 5MN4A 2GAAA 4L6V5 4JJCA 4FDTA 1Y0MA 3O8OA 2JIOA 4JLMA 5ALEA 5AWFC 2IE0A 3LX4A 3CUUA 4I36A 1K2WA 1L4GA 5ELLA 2AEFA 6GPBA 4JJDA 1XCJA 2R1TB 1F1BB 1YDMA 3QBTA 4DYHA 1VM6A 2GN1A 4PYLA 1KPHA 1JB9A 1JT2A 2QMZA 1YZHA 4MWGA 3PFSA 1WHGA 3KE8A 1P61B 3K0FB 4M0FA 4YGXB 4Q7MB 5DBOA 3V34A 4EEKA 5ADWA 1EGAA 1VC2A 4G5QA 3ISJA 2RIPA 4UZEA 1P4RA 3UDCA 1E98A 1NPPA 1KC3A 2DPLA 2Y92A 3EOBI 3ESZA 3GCDA 1WUJS 4OXNA 3UK7A 3UV6A 3SVLA 2LDMA 4FEEA 3ZXUB 1R5NA 4JX8A 3VKFA 4F60A 1ZLXA 1IN7A 1NM5A 4GYWA 5G02A 3I37X 3L0DA 3U9TA 1YS1X 3RTBA 4ZKDA 3PD1A 4W5HA 1MG0A 3H16A 1U2TA 2H8HA 2QDLA 3GUYA 1JSLA 1PHPA 4R1TA 4CTOA 1SBHA 4MV1A 3VR3A 3QPCA 2VCEA 1EHCA 3Q88A 5CPFA 3MK31 2J6FA 4WGFA 1P1JA 1HDOA 3TKYA 3T3NA 4PSCA 2MINA 3LUCA 1YQEA 4QKUA 3P0FA 4MLPA 3LY9A 4Q39A 4F97A 2CS7A 4EGCB 5C8VA 1R3DA 1VQMT 3GIBA 3L5KA 1QYIA 2QGZA 2EXXA 1VL8A 4OJTA 4C88A 2JFBA 3CG4A 3OIGA 4RYLA 2DPPB 1TF7A 3HSKA 4JUIA 4WVLA 1QO0A 3QX9A 4FFPA 3UWOA 5BQFA 5KC9A 5TLSA 2PRZA 1YJXA 3DVQX 4RA9A 4RKRA 1VJGA 3SGLA 1PJRA 2W8BB 1QDEA 2ZJAA 4BMVA 1PL0A 4D0SA 4D0LB 2PX2A 1MNQA 3E2IA 1S8AA 1YQGA 3LKZA 2XV1A 4D0RA 3HVRA 3BX1A 4CUKA 1F4VA 4L22A 3WGTA 4PNEA 3O4FA 3NYWA 4D0NA 4YDQA 2IHNA 1QVFP 4EA7A 2XA1A 1JIIA 2X3FA 5B3AA 3UO8B 1ZO8A 3WSWA 1DO8A 4L0QA 2FPPB 4QDZA 3IQDB 3OT1A 1QVRA 2ZI5A 4LGVA 2CMKA 4LXIA 4IQFA 4QLOA 5E1MA 5I4IA 2WG0A 4FGUA 4R0VA 1SU4A 1Y3IA 4BC0A 4DXHA 2GWHA 1R6DA 2GCNA 1B0PA 4BXOB 5ULLA 3EGVA 2C2HA 1KI6B 1MQ8B 3KLMX 5A4FS 3CZCA 1S02A 3GF4A 1EB8A 1GNSA 3TRFA 2H4ZA 4Q9HA 1Z63A 2MR6A 2IX9A 1NNEA 3IO3A 3Q2KA 4D99A 4EAQA 1SXGA 3CRMA 3QXCA 4OSOA 4MUAA 1BVUA 4EG0A 3K30A 1PDVA 1ZBDA 2Q3HA 2XB6A 4NL3A 4P4UA 3NMZC 1H2RS 2P4HX 1PRYA 4WZZA 1XCBA 1K7FB 1MIOA 1TO1E 2PTKA 4MYHA 1XTPA 4PFOA 3K73O 4KV7A 1CSKA 3A4TA 1KVSA 1E3WA 3GHHA 4TS1A 1KI4A 4RTNA 1PHTA 3G5TA 3MJHA 1AB6A 3LXRA 3WNQA 5EP1A 1W47A 5LJ3d 1O97D 3AJAA 3FLAA 4BEJA 3JB9F 2EEZA 2QL7A 3BJMA 3NIBA 3BMCB 1QHNA 2VAMA 4MIEA 4OM8A 4YONB 1ID1A 2AN5A 4B8YA 2PKRA 1OU8A 4BE2A 1N2CE 3KBOA 3TTTA 4HFJA 2NUPA 1RADA 4AM8A 4E14A 4X1IB 3WNZA 2Q9UA 2IVWA 2KW5A 2QTLA 4PS1A 4UCQA 4F91B 1P2BA 4PCUA 4UNIA 3WIOA 2XXJA 3QXJA 2QTAA 4EB6A 2MMPA 4QW2A 2IH4A 4OJKA 4YRLA 3P52A 3PGVA 2QL6A 4YRRA 3G6EQ 2FWNA 4G0MA 3PICA 3G5UA 2D8JA 1FVOA 2BZYA 2KHZA 5JHHB 4S0XA 2HI0A 3M6XA 1CZKA 4L9AA 4Q9LA 3S2UA 2O54A 1I80A 3S0JA 4OI1A 3DAHA 3C1UA 1UMBB 3ANLA 2N47A 1THTA 4FD3A 4K9KA 5DT2A 5LYYA 3HHPA 3GVPA 3V7UA 4R5MA 2LCFA 1HDCA 2FW9A 5CHEA 2IUUA 5GAOn 1UHFA 1MQSA 3UGQA 1K8RA 2ASVA 1NC3A 1P1KA 2FZVA 4PGFA 3H9CA 3NEAA 4DJAA 5L3VA 4CKEB 3AIMA 2XNSA 4S04A 3NR2A 3EG1A 1DT5A 1YZYA 1ISRA 5JDIC 3AF6A 3WG9A 4KPEC 1XJQA 2NU7B 5KO2A 4DLYA 1WLPB 2RHXA 2O4CA 3RW9A 2VNKA 4N6OA 1Y4ZA 1GPAA 2XNDA 4HAVA 1IC6A 3AUJB 5DV9A 4WBSA 2DXTA 3SLGA 4FW2A 3GLHA 4HGPA 3QEAZ 3DEYX 3EK2A 3PPWA 1QWOA 1Z18A 1VG1A 3I9KA 1JHYA 3E05A 4ONEA 3ANXA 1IY8A 4WNAA 1XZFA 2B34A 3EBOA 1CS0B 2WYHA 4LE9A 3KQVA 2DD5A 4FU6A 1C7JA 1JILA 1WABA 1Y3BE 2FZKA 3RJ5A 3JXEA 2C0CA 3UJDA 3VOSA 1YUNA 2GEUA 4IRMA 3W0LB 2XDQA 4BNHA 4BY6C 2P9HA 2NNLD 2DTIA 3BREA 4J7IA 1TJPB 5YASA 5FLXE 3RDPA 1QAMA 4PIVA 4KWIA 2EW3A 1DEHA 3RR2A 1SN7A 3ELBA 3PP8A 2I3GA 3OQBA 3MMSA 1PHRA 1PIWA 3BWEA 4QFCA 4F4DA 2POCA 2ZJZA 5L40A 5HYVA 4RAQA 1YK1A 2X9HA 2ZXEA 1BXGB 2HSEA 2PGIA 1HG0A 1IU9A 1GXIE 5H68A 3DL0A 3EH1A 5J23A 5E2IA 1QTRA 3IDZA 2ZZKA 1OFTA 2XA2A 2AFIB 3F2VA 4PGAA 4ROSA 1GCOA 3T5GA 3WO0A 5K8IA 2WIBA 5AICA 1NZFA 2A9RA 2H3EA 1V0JA 1ZU4A 3A9SA 4CIWA 1PUXA 1H6BA 2WUEA 3ASYA 5FQOA 1U1IA 4FFRA 4CU5A 2KR3A 4PJOB 2GKGA 2BGTA 2VRCD 4ZOEA 3DEJA 2BFWA 2DYIA 1A3CA 1R8YA 1K6JA 2A5DA 2AW3A 3ZHVA 1TKAA 3MAGA 4XVRA 3VO8A 1EU1A 1XCLA 3AX6A 5DRTA 4R2XA 1EFHA 4K1XA 1A4XA 5B6PA 5FRNA 3REAB 3BIWA 3HRIA 4UAVA 4KN8A 1XZJA 4N3NA 4TWBA 1BAPA 1JIQA 3LBFA 2OFWA 3PPXA 4BI4A 1CR0A 4U5XA 3OZEA 4QG3A 5JNSA 3TU4K 2XRZA 1CIJA 5JZVA 1PD0A 2QYOA 1Y63A 3Q7RA 2JIBA 4KI7A 2HT6A 3VU3C 1DQYA 3SJUA 3W5VA 4MCAA 4A5SA 3NAQA 1WMBA 2FUG6 2IKSA 4UEWA 5REQA 3RRNA 1LTKA 3L7LA 5JXWA 3D5EA 4WV3A 5LXTA 1CQIB 1HKHA 3CGWA 4LOJA 3OSSC 4URXR 1RXVA 1STOA 4EUEA 4E4YA 2W6ID 4XX0A 4C92C 1W0KA 1AC5A 1BN6A 3WWOA 4BNNA 4AIRA 4DRXA 2PKXA 1ORTA 4CFYA 3RUHA 1VE5A 2I6UA 5HCKA 1RJEA 2VEOA 2O2HA 2VOJA 1PKTA 4OXQA 4NEQA 1GCUA 4R31A 1YJ9Q 3ZQKA 4RTSA 2Q62A 3HABA 3L0OA 4MO2A 4U2DA 4BZZA 1GFSA 1L7QA 5EHNA 2B0JA 1TVCA 2JM9A 3R0VA 1KY5A 4AVYA 1H85A 4I1PA 3IPYA 3T0FA 2VQ3A 2R96A 3ZLVA 3O1HB 1QKXA 4FOPA 4DJFC 3RMSA 5KOHA 5HF5A 1W5EA 2P78A 2P68A 1FNNA 4DQDA 2ZPIB 4ELZC 5HK3A 4MRMB 1YZTA 3JAWA 1F48A 2O3RA 2OGWA 1Z4MA 2HDOA 3DEIA 3MTGA 4IILA 4MVJA 5CPBA 2RIRA 4EW3A 4CTMA 1IQPA 4DVGA 3FTPA 3OQMA 5I7OA 4OXKA 1BVYF 4BECA 1NVVQ 3BVPA 2QN2A 1JQQA 2FXIA 2JAHA 4RORA 2K2VA 3BDLA 1A96A 1Q12A 2Z9BA 5H1YA 4AP5A 1GTVA 3ZG6A 3FOFC 1V5FA 2WAYA 1CF4A 1UXKA 3KD3A 2J05A 4WXYB 3KJNA 5K3AA 4BMDA 4A4FA 4W9RA 1Z56C 4RA6B 2PPLA 4RJTA 2Q0QA 4AUNA 1B0AA 3KC2A 1TUEA 2ST1A 1QCDA 4YO8A 5LVAA 1B8VA 1BQEA 1LSUA 5EIHA 3RWOA 5DNWA 1TUDA 3WKBA 2I2CA 4XTCS 2XYGA 4CF6A 2J59A 3C3EA 4B33A 4L59A 5I3ZA 1KS9A 1U1DA 4GGPA 5JTUA 2CWWA 1FDVA 4FKZA 1SIBE 1S6YA 5CIQA 3FNFA 3KZOA 1QQAA 1WLYA 3CQ9A 4J91A 2XXBA 4EPVA 4IKFA 1BYUA 1JNYA 1GJRA 2BYTA 1XAGA 3UPTA 4MP8A 2R6JA 2PUVA 3D3EA 3F4BA 3QM1A 3QMPA 2ACKA 5KTOA 2SECE 4M0DA 1YUMA 1FUUA 5B7GA 3P27A 4CT4B 3VNUA 5C1OA 4KP7A 3JW8A 1FOEB 3VC3A 4LWZA 1JQEA 1PW5A 2XRMA 2QYHA 4AY4A 2QTNA 1QNLA 2VNIA 4XEUA 2NV6A 3EA5A 1EBBA 2LIVA 4E2ZA 2PYIA 2Y67A 2JH3A 3PQ7A 4PQEA 3KXDA 1G5VA 2HU2A 3HFJA 1QYDA 1R0YA 4XYMA 1NSFA 5ICGA 5JAHA 3I5RA 1SBQA 1RIIA 3C6YA 4D81A 1C0IA 1ZD2P 3R0QA 4Z86A 1FTQA 1Q92A 1TYBE 2WSLA 5CTAA 1UEBA 3AZPA 4OVKA 3TG2A 1G4AE 5HK0A 3RSQA 4CL2A 1SKQA 3M0EA 4HB4A 4XK8E 2XCQA 4HMPA 4BFWA 4OFXA 4CM5A 3CCRQ 3S4YA 4JASB 1E5QA 4C6RA 2WB4A 2ZRMA 4E7HA 1P6QA 5CX1A 1QVVA 4ISCA 4OMCA 4J3NA 5CM2Z 3J80A 1DADA 1OGYA 3M89A 3DG9A 1AZLA 1FUYB 1N7HA 2BFBB 4MUEA 1Y9ZA 3CU5A 1DIBA 2LP5A 2AX3A 2XKAA 3AP2A 4OY3A 1VCIA 1ZUNA 3B2NA 3RHTA 3LT5A 4ZZ0A 2G5PA 3DW3X 1XTRA 2C4HA 3LLSA 1RJGA 4NATA 3SIXA 1FEZA 1ONPA 2VSFA 3PJGA 2Q8PA 2AN9A 2FW1A 2WU1A 3P2JA 3VU8A 1XXHB 4CMCA 3CUTA 4EKYA 4K46A 4XD7A 1CYEA 4BI8B 4FDMA 4C08A 4HUJA 4A4DA 2ENUA 2EJGA 2XY4A 2AXEA 1JLRA 1X75C 3PE3A 4H1VA 4YP7A 1ZMBA 2F59A 1P19A 4P81A 4P3PA 1YVDA 3KWJA 3LW7A 2OG1A 5CCDA 3V7SA 1XHLA 2K4MA 2ZYAA 3NASA 2CP2A 1H1LA 4FYVA 4Q01A 4G09A 2SKEA 1ZW6A 3DMTC 1PWTA 3IMEA 3VPGA 1N5IA 5GV7A 4MR8A 4J5YA 2EQKA 3A26A 4R71A 2ZRFA 4V0ME 2F1LA 3D1LA 4BTVA 1VKZA 1PP4A 2FN7A 2OP0A 3RCBA 1WDWB 3ELWA 3WLFA 4UEKA 1VE6A 5HF6A 2M9UA 1M2KA 5JC1A 2J3QA 4MDWA 2BVNA 3CZ9A 3M4NA 5JD3A 4ALMA 1OYWA 4CM6A 1C3OA 1PR0A 3K6RA 4OKNA 1K5PA 4CHTA 4ENTA 5IARA 1MMFB 1N6RA 1MT0A 3I35A 1VXRA 1Z07A 4Y1FA 1MVLA 2QY9A 4BFUA 2OORC 4IH1A 2A4MA 1A27A 4B09A 4GBQA 1T8YA 3ETJA 2DPGA 3CCSQ 1ZGAA 2VF4X 2BV3A 4WBXC 3TRIA 4CMKA 5HFNA 5JS6A 3T1TA 4TQ9A 4QUHA 4AUEA 1YZUA 1WP4A 4KQXA 1G5FA 1TAQA 2Z5FA 3VC7A 2YXDA 5CNKA 1DQNA 3WWEA 2IWHA 2JGKA 1Z7GA 3ERCA 3M9QA 4JKIA 4CNBA 4GX2A 2FZGB 1RYZA 2K6DA 1ZAKA 2YY5A 3ZLTA 2HNAA 2LWIA 2VDRB 3OPVA 1L1FA 2Q5LA 1CZHA 2PMDA 5DSXA 1IBCA 5B1IA 3FOZA 2NAFA 4V2IA 4GW3A 1E1CB 4ENVA 3DDWA 2XK0A 1EGMB 3A4IA 4ILEA 4HXGA 2P84A 1EP2B 1RRGA 2BR4A 5HIJA 3ONWA 3AESB 1KPGA 2Z04A 4YS6A 2PPVA 4CQMA 4FT2A 1U8FO 4B8WA 3I1IA 3QW4B 2CDRA 2HYDA 3GV0A 1QS0B 3PXDA 3ISVA 5H0IA 1Z0DA 3SD7A 3UK6A 4YJFB 3SC2B 1QO9A 4JU9A 1WNFA 5IK2D 3I1JA 4AJJA 5GONA 4J0KA 1MD9A 1EFCA 4OUKX 1QE0A 4EB8A 3N7TA 1JF8A 3CCMQ 2CXPA 2E3IA 2F1JA 2P11A 3O90A 5E7JA 5CBPB 1E7SA 3JQAB 3ND8A 2AN4A 2BE9A 4ZTZB 4CC7A 5KHOC 2O9VA 3DL2A 2KI5A 4H4EA 4E1BA 1DBSA 1WEKA 3CC2Q 1G3QA 4FHZA 4LI0A 1E4YA 3FSEA 4H1UA 3TSOA 4D6XA 1B43A 3SQNA 1WG8A 1AH2A 2TMDA 1X13A 4OHRA 3DOIA 1J7KA 3ZFJA 5F2NA 1G8FA 1WX6A 1IUNA 1WF3A 1YIDA 4F12A 5TS2A 1EK2A 1ZSYA 1ZJ5A 3EDRA 3H2SA 1Y6FA 2BC9A 2ORED 5JZ9A 4Y6SA 1G4HA 3WYGA 3PEFA 3RSGA 1DIRA 2HSGA 4XTVA 3CNLA 3KQUA 3EAQA 4WI1A 2C2ZA 2JIZD 3H2JA 4B2PA 4UHCA 4CI9A 1XNGA 2Y77A 3HZOA 2A0UA 5DYGA 3TNDA 1E5VA 3VU0A 3PDJA 4J0FA 3TLJA 1JEDA 1L7OA 3M4YA 1FCJA 1E1NA 1QYWA 3TL2A 1JUDA 4K05A 3D3NA 4BE4A 2HSEB 1BXGA 3WBJA 1OY1A 5K3DA 2GTPA 4LYFA 1GPBA 1MB3A 1NBOA 1PU2A 4I08A 4DHWA 2BJVA 5A9SA 3PEWA 3BSFA 5B4UA 2FRWA 1TA9A 4H18A 3ZE1B 4B3JA 1YJWT 4LJ4A 2AHJB 4A2PA 4C0DC 1MJFA 1NLFA 2VKQA 2WJAA 1LPPA 2VBCA 3L84A 3OPQA 2AZXA 3HDQA 2V7XA 5CGQB 3URGA 3RFXA 4CLEA 1ZMTA 2M02A 3V8KA 3Q3EA 4CCAA 2O14A 4J2TA 4XGRA 1E69A 4YQFA 4PICA 4EJSB 2NX2A 1MDBA 4EX7A 2Q5QA 2XPCA 4GZ3A 4LHEA 3VU9B 1KZ1A 1LA2A 3LC2O 3FHTA 3Q3JB 2Q3BA 1KAMA 2AWNA 2OFXA 1S2LA 3N8HA 3TNFA 3ZVLA 1JPUA 1C3OB 3LFTA 1IMOA 1NQAO 1UJBA 4R1NA 4UUAA 3DYBA 1HUQA 1SEPA 721PA 2W42A