4LE9A

Crystal structure of a chimeric c-src-sh3 domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
HMTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title 3D domain swapping in a chimeric c-Src SH3 domain takes place through two hinge loops.
pubmed doi rcsb
source organism Gallus gallus
total genus 5
structure length 59
sequence length 59
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4le9A00
2KR3A 2AKLA 4RTWA 1RI9A 3NMZC 1E6HA 1WI7A 1M3CA 1WXTA 2G6FX 4OMLA 2DA9A 2KNBB 2NWMA 2L3SA 3RBBB 1NLPC 1M3AA 2MIOA 5IH2A 2M0YA 2A36A 4GBQA 1K1ZA 2I0NA 1K0SA 2YUOA 5IHNA 1EFNA 1UHFA 1X2QA 1M3BA 1K76A 2DLPA 1SPKA 4OMQA 1T3SA 2JT4A 2RQWA 4RTXA 3O5ZA 1QCFA 2ED0A 4RTZA 3M0UA 1UJYA 1PRMC 1W6XA 5FWBA 2O2OA 2RF0A 2LMJA 2W0ZA 3SHWA 2YUNA 3H0FA 2DL8A 4F14A 1ZLMA 1QKXA 1UE9A 1JXMA 2C0IA 1ABQA 1I07A 4LUEA 2EYXA 2DF6A 3TSZA 5IHKA 1HD3A 4A63B 3FJ5A 2HSPA 2MCNA 1NLOC 5IXFA 2DL4A 3M0SA 4ESRA 3UA6A 1SHFA 1UTIA 2KGTA 3H0IA 3UA7A 1ABOA 1SRLA 1M27C 1PWTA 2GQIA 3VS5A 2FEIA 4CC3A 4R0KA 2JS0A 2CUBA 2ENMA 4J9HA 4E6RA 2EQIA 2FPEA 2V1QA 2EYYA 5GJWB 1K4US 2KXDA 1ZBJA 1AWOA 2JM9A 2BTTA 2KYMA 1UG1A 2DRMA 3EHRA 2DRKA 4LUDA 1QKWA 1FMKA 2RMOA 2DL3A 2D8JA 1AWXA 2YSQA 2VKNA 1JU5C 2L3PA 2KYBA 1JEGA 1RUWA 2DE0X 1UUEA 3PE0A 3VS2A 1GBRA 5EC7A 1RLQC 3VS6A 2O9SA 4LN2A 1JQQA 2YUQA 3M0PA 4F16A 2FPFA 2RN8A 1GCPA 2DX1A 1AZGB 1B07A 5HCKA 3M0RA 2DYBA 2JW4A 2DJQA 2L2PA 2RQVA 1SHGA 4FSSA 1NG2A 2ESWA 2F2WA 1BBZA 1WYXA 2J06A 2JM8A 4OMPA 1V1CA 2B86A 2V1RA 1AVZC 4X1VA 2KEAA 4OMOA 2GTOA 1WA7A 2DILA 3VS0A 4CC2A 1H3HA 1OEBA 2RQUA 2O9VA 3THKA 1X27A 1LCKA 4OMMA 4RTYA 1Z9ZA 2EBPA 3UF4A 2P4RA 3R6NA 1U5SA 1W70A 3LH5A 4JJDA 4RTUA 4J9CA 2OI3A 2YDLA 2KRMA 3EHQA 3UATA 4J9EA 3EG0A 1BK2A 3NGPA 1I1JA 1JO8A 5ECAA 4QT7A 1MV0B 1NYGA 4M4ZA 2GNCA 2VVKA 3VRZA 2DM1A 1U3OA 1WLPB 1YP5A 1VYVA 1UGVA 2KBTA 1GFCA 2CH4A 1QLYA 2W10A 1AD5A 2FRYA 1IO6A 1YWOA 1YNZA 1FYNA 3NHNA 4AG2C 2KRNA 1HJDA 3C0CA 1X69A 2OJ2A 1W1FA 4J9IA 2LP5A 1H8KA 1E6GA 2C0TA 1M30A 5IHIA 1X2KA 2CREA 1T0JA 4AFQC 2J7IA 1KIKA 1KSWA 3M0QA 2DNUA 4KRTA 2GTJA 1OPLA 1AWWA 2L0AA 5I22A 1PNJA 1S1NA 2H8HA 4JZ4A 2LNHB 1T3LA 4AFZC 2YT6A 1A0NB 4WCIA 1VYTA 2HCKA 4HCKA 2K3BA 4F17A 3JV3A 1BB9A 2DL5A 4Z88A 1GBQA 2LJ3A 2PZ1A 1E7OA 2AKKA 4LE9A 2LCSA 3H41A 2LQWA 1OOTA 3TSWA 5IXBA 2KXCA 2D1XA 4Y92A 1J3TA 2J6OA 3QWXX 1PKTA 3M0TA 1MV3A 4HVUA 1UFFA 4IIOA 2PTKA 2JMAA 3VS4A 3I9QA 1Z9QA 3I35A 2EGAA 1Y0MA 2KE9A 2A37A 4J9FA 2O31A 1N5ZA 2C0OA 2OAWA 1PRLC 2XMFA 2DMOA 2JMCA 2DVJA 1ZSGA 2EGCA 1SEMA 2JTEA 1PKSA 2HDAA 2CDTA 2K79A 2D0NA 2F2VA 4LNPA 1T0HA 4EIKA 2EPDA 1ZUYA 3IQLA 2NUZA 4AG1C 1M8MA 1ARKA 1NYFA 2D8HA 3KFVA 1I0CA 2L3QA 1OV3A 2ROTA 2LJ1A 2CSIA 2DBKA 2O88A 1HSQA 5FWCA 1ZUKA 1AOJA 3EGUA 4Z89A 2AZSA 1U06A 3A98A 1BU1A 1WXBA 1GRIA 2LJ0A 1X6GA 4D8KA 2LQNA 3CQTA 2EVRA 1YCSB 1AZEA 1X6BA 1AEYA 2DBMA 3SEMA 1WFWA 1WXUA 2GBQA 4JZ3A 1GL5A 1SRMA 4J9GA 1Y57A 1GCQC 2E5KA 2FRWA 3REBB 4JJCA 4JPBW 2DL7A 3VRYA 2X3WD 4JJBA 1PHTA 2EYWA 1AWJA 1YWPA 1VYUA 1MUZA 1G2BA 1G83A 3VS7A 4ORZA 4RTTA 2K6DA 2MOXA 2J05A 1NEBA 2EKHA 2FO0A 1CSKA 1WDXA 2IIMA 1RLPC 3U23A 4DEXA 2BZ8A 1GFDA 1TUCA 2KROA 4DEYA 2KRSA 1TG0A 1KJWA 2CSQA 3RNJA 4HVWA 3VS3A 1KFZA 2HEQA 2GGRA 4GLMA 4IIMA 1NM7A 2CT4A 1ZUUA 1NEGA 2X3XD 4OMNA 3PVLA 2BZYA 2EGEA 2FPDA 4CC4B 2QDLA 5GJVB 2F2XA 3TVTA 2YUPA 1CKBA 5FW9A 2LX7A 5L23A 1QWFA 2CT3A 1UDLA 2EW3A 3EG2A 4RUGA 3H0HA 2K2MA 2RQTA 1K0XA 2K7AA 2AK5A 4CC7A 3VS1A 1K9AA 2J6FA 2JXBA 2A28A 2BZXA 2RQRA 1B3QA 4HXJA 2PNIA 4ZNXA 2EYZA 2CUDA 3ZL7C 1WX6A 1SSHA 2VWFA 3GBQA 2KT1A 3I5SA 4HVVA 4Z8AA 2A08A 1GCQA 2KT8A 2AZVA 1QWEA 2JS2A 3QWYA 4K11A 1H92A 1YN8A 3REAB 2ABLA 1UECA 1UHCA 4D8DA 3I5RA 1TUDA 4AFUC 3EG1A 2ECZA 3EG3A 2FG0A 4AFSC 2LZ6B 4J9BA 3PVQA 1ZX6A 4RTVA 2CH4W 2HBWA 1UJ0A 3ULRB 1OPKA 1X43A 2RNAA 1VA7A 4J9DA 1JXOA 5I11A 2J6KA 2SEMA 2ROLA 2RPNA 1XOVA 2SRCA 1WIEA 2K9GA 2M51A 2ED1A 3NPFA 1CKAA
chains in the Genus database with same CATH superfamily
1OX9A 2AKLA 4RTWA 1RI9A 2EJFA 2MK5A 4PKCC 3PFSA 4LDYA 3J81E 3WVDB 4M75D 4E2FB 2VB6A 3CCUQ 3OYYA 3A8HB 5GMKh 2A36A 4GBQA 3L42A 4TVRA 2K57A 3OS1A 2YUOA 1R8OB 2EKOA 1VQOT 3CCLQ 1Q86U 5GMKi 2DLPA 3EFSA 1PD0A 1MMNA 5GMKj 5LJ5h 3CCVQ 4RTXA 5DLOA 5GAOn 1QCFA 1KK7A 2PVDB 1YIJT 8ATCB 2CKKA 2K4YA 4BUGA 4A4FA 1UJYA 1KQSA 5LJ5j 2O2OA 2W0ZA 1K73R 3SHWA 2YUNA 3LGLA 3H0FA 3I55Q 1QVGS 2QQAA 1JXMA 4ZN3A 1K73C 1TU0B 2V26A 4PJNA 1ABQA 4J8OA 4RKUE 2DF6A 3TSZA 4M78A 1HD3A 4BY6C 3FJ5A 2VYTA 4L5GA 1RAIB 2HSPA 2MCNA 1WNLA 1ACMB 1BI3A 1NLOC 1K8AR 3I56T 2RI5A 2RHXA 3QXEB 2KGTA 1RAGB 2B8AA 4EMKA 1M27C 4QW2A 3VS5A 4KULA 3X24B 2FPEA 2IPOB 3A8OB 7AT1B 1OZ3A 3JB9D 5FRMA 1RI0A 2D0QB 2K5FA 3BFMA 3JSCA 5KCHA 5FU6B 1RAEB 4EMHA 2X4YA 1QKWA 4M77A 2PUKB 3CCUT 2VKNA 2O4XA 1UUEA 1Y07A 1KQSP 4BI8B 5FRNA 2R5AA 4LN2A 1VQOA 3CCLT 1JQQA 1M2OA 2L89A 2DX1A 2E6NA 2PVGB 2LDMA 3CCVT 3V8KA 4EDUA 2DYBA 4XAXB 3RESA 4FSSA 3P8BB 3JCMQ 1PD1A 3OYKA 5I2MA 1BBZA 2JNGA 5KYWB 2BIVA 1YIJA 4OMPA 2HD0A 3I55T 4BI4A 3G71Q 2V1RA 4F04B 5DY9A 4X1VA 5FROA 3CCEQ 4J7FA 3PGGA 4CC2A 3S3OA 2RQUA 5KE2A 1Q82R 1D3BB 5GAOm 4C92F 2BE7D 4KUIA 3UF4A 1MMAA 4OGCA 3H9NA 3I56A 3KUFA 2EIFA 3NGPA 1JO8A 5ECAA 4QT7A 2VVKA 3SFMA 3CCJT 3L2VA 1GFCA 5A0LA 1QLYA 4X9CA 2OX7A 1IO6A 4D6WA 4EPCA 4PJOC 1YNZA 2NYSA 5KE3A 4AG2C 3HSBA 1HJDA 2D9TA 2OJ2A 4J9IA 2KMTA 1TTHB 3CCUA 5IHIA 1D0XA 4AFQC 3EAEA 2QAZA 2DXCA 2DNUA 1YHQQ 1VQPQ 1OPLA 4PJMA 4FT2A 2RK1A 2L0AA 4JRIA 1KHIA 4JZ4A 3OYNA 2LNHB 3RR6A 3CCVA 2RM4A 3CCRQ 2YT6A 3OMGA 4WCIA 1S72Q 1VYTA 1M2VB 1X75C 2HCKA 2K3BA 5IT9E 2DL5A 4Z88A 2XI9A 1GBQA 2PZ1A 3G71T 1ZA1B 3I55A 5IXBA 3HRUA 1UB4A 2KXCA 1VOMA 2QYZA 1B34B 2QTVA 5D6XA 1PKTA 4E7ZA 3QJYA 2E65A 3I35A 2AHJB 1Y0MA 2EGAA 2O31A 2C0OA 1WQWA 4KH0B 4M78E 1YFNA 2VASA 2XMFA 2DMOA 4BDYA 2CP6A 1SEMA 3OBWA 5GAN2 4C8QE 2LT4A 3VUBA 2CDTA 2EQJA 1PG5B 4IUUA 4EIKA 1K73U 3IQLA 3NTHA 2NUZA 3RKYA 5KYXA 3CCJA 1ARKA 2LX9A 2D8HA 2RO0A 3SD4A 2QQ9A 4OB3B 2L3QA 3TCJA 1OV3A 3QDRB 3V8JA 1N27A 2DFUA 4RCCA 4OB1B 1BU1A 3VKIA 4M78G 5CQXA 3L2RA 1K8AU 3CXCS 1BYMA 1AEYA 2RJCA 2DBMA 2FHDA 2F1LA 4JZ3A 3OW2A 4C8QG 1WPYA 1GL5A 4M77E 1FX7A 1YHQT 1VQPT 5A2QE 2YLCA 4J9GA 2JUFA 4M75E 4Y28E 2RHYA 3JCMg 2DL7A 3BE3A 3OYFA 3JCMe 4XTWA 1PHTA 3CCRT 1YWPA 4C0FA 3EGDB 2ZPIB 4PLLA 4C0GA 1UGSB 2QASA 3G4SQ 2E10A 1BKBA 2DTHA 4QVZA 2CP2A 1NEBA 3G71A 1CSKA 1QMCA 5IAYA 2IIMA 1M90R 4DEXA 4C0DC 4J6XA 1TUCA 2KROA 4M77G 4DQ2A 1BI0A 3CCQT 3P8DA 3G6EQ 2HEQA 2GGRA 2CT4A 2DTIA 2X3XD 1D1AA 3PVLA 2E1HA 2BZYA 3FLGA 2ATCB 2ZPBB 4IUQA 5D6YA 1IHVA 5FU7C 1VQ4T 2O01E 1QWFA 4C8QB 4M7AA 4N4GA 4JRKA 5AT1B 3VS1A 1K9AA 2J6FA 3OW2P 3MCAB 4JLIA 3CCST 1NBEB 1M1FA 4ZNXA 2RB6A 1WJQA 2EYZA 2CUDA 3D7SB 2E6ZA 1WX6A 4RCBA 1R0CB 2NUTB 3HTRA 2OAUA 3GBQA 2C06A 2DXTA 1IZ6A 2DJZA 2KT1A 4HVVA 4Z8AA 2QG9B 1V76A 1GCQA 1OI1A 2QQRA 2ZPHB 2AZVA 3JCMP 1QWEA 4NL3A 1MGQA 2MYSA 4JS5A 1TUDA 3SB2A 1VQPA 1YHQA 3EG3A 1NZ9A 5DM7R 5CKHA 4M75B 5GAMd 1ZX6A 2X4XA 1ZHIA 1NPRA 3QPHA 2RNAA 1VA7A 3CCRA 2RI2A 2XKOC 4N4IA 2LC4A 3OSVA 5LJ5d 1XOVA 3G4ST 2E64A 3CMEQ 2K9GA 1O75A 5GANe 5IHKA 1TSFA 1OQKA 2HAXA 4EMKC 2GFAA 3M58A 5LJ5f 4M7DA 1I4K1 1E6HA 4OP0A 2HL3A 3JCMc 2KY9A 4C5IA 2G6FX 4OMLA 4PFOA 3G6ET 3META 4O6JA 2DA9A 4BDZA 3CCQA 3BDLA 2LRQA 3LWIA 1YBYA 5FLXE 3RUXA 2KNBB 2CP7A 2MIOA 1K1ZA 2I0NA 1QP2A 2XU8A 1VQ4A 4M77C 3TQ7P 1X2QA 3WVEB 1M3BA 1K76A 4WTOB 3JCMJ 1PSEA 1YJ9Q 2Y90A 1T3SA 2JT4A 2JVVA 2YLBA 4QQGA 4F7UA 2RA2A 2ED0A 3CCSA 5HK0A 1JBMA 1KC8R 3DB3A 4R55A 1W6XA 1PRMC 1M5Q1 5FWBA 2RF0A 2LMJA 3EFRA 3LH0A 1QKXA 3OS5A 3GP8A 3SWNA 1QVGA 2EYXA 3CPWP 4MMLA 1MMGA 3EG9A 5KYUA 4DOWA 1VQOQ 1RAHB 3M0SA 3EFOA 1WHKA 4ESRA 3JCMh 1Q7YC 3H6ZA 2DIGA 3H0IA 1ABOA 3HRTA 4DOVA 3OSSC 4PFZA 2ENMA 3CMET 2V1QA 4KGXB 1K4US 2KXDA 2MMPA 3GLXA 3RKWA 1ZSZA 4M78D 2DTOA 1G3TA 3EGXB 3GF5A 2DETA 8AT1B 2KVQG 3G6EA 4Y91A 2DRMA 3EHRA 4C8QD 1VQMQ 3VUZA 4MZPA 2DL3A 4II1A 1AWXA 2DE0X 3JCMW 1X6OA 3I56Q 2O9SA 1OYXA 3M0PA 4XTXA 1VIFA 1YJ9T 1IGUA 2EWNA 1B07A 3M0RA 3T9NA 1PC0A 2YRCA 1QVGP 2MAMA 5GAN8 2DJQA 1M90U 4M7AE 5GAN3 2ESWA 3OYDA 1PSFA 1WYXA 2J06A 4PL6A 1VQ7Q 2COWA 4DA4A 1V1CA 2B86A 4M77D 1M1KC 4BY6B 3JCMX 4QQDA 4GLKA 5LJ3g 5LJ3e 2GTOA 3QO3A 4HKEA 3CCMQ 3URGA 3VS0A 2XD0A 3THKA 1LNXA 1X27A 4RTYA 5GAMh 1TOVA 2EBPA 2JTFA 1LJOA 2HQXA 2P0KA 2P4RA 4OMFB 1W70A 3LH5A 4UC4A 2NUPA 4JJDA 4RTUA 3R6OA 3CD6T 5GAMj 4M7AG 4XU2A 3FB9A 2WSFE 1BK2A 1WJRA 1I1JA 1MV0B 1NYGA 2GNCA 4PJOE 2DM1A 3X28B 1GXIE 1YP5A 1VYVA 1UGVA 3CMEA 5GANh 3G1JA 2KBTA 3M59A 4A4KA 3A1PA 4PK4A 2W10A 1R77A 2QTXA 3H8ZA 1FYNA 3NHNA 4QVCA 5GANj 4LDWA 4N0AA 1VQMT 2LP5A 1H8KA 2VXEA 2X4WA 4XTYA 3ZEHA 4C92A 5GAN5 4HA8A 1T0JA 2V8JA 5KYYA 2J7IA 1KIKA 4RMOA 4PJOG 4NL2A 4B9XA 3DLLA 3LYIA 1D1BA 3OYJA 1S1NA 1YJ9A 1O9SA 3CCJQ 4FYWB 4AFZC 1A0NB 3MO8A 3A8LB 3OYHA 4HCKA 3X26B 3Q1JA 4XTUA 4F17A 4FCYA 1VQ7T 3JV3A 1U1SA 5KYNA 2YHTA 1WGSA 2LCSA 4XU0A 2FL7A 1OOTA 2E70A 4J6WA 3TSWA 4XQ3A 2LNVA 3CCMT 2D1XA 2DKGA 3QWXX 1MV3A 5C6SA 4HVUA 1UFFA 4IIOA 3VS4A 2RJFA 4J9FA 1N5ZA 2P0PA 1JRIA 2ZAEA 4HCBA 1RAFB 1YJWQ 3RERA 3CD6A 2JMCA 2DVJA 1KC8U 2JTEA 2KI7A 3QYHB 1PKSA 2X51A 1W2BS 2LQKA 5AYFA 3OYAA 2DEUA 2F2VA 4LNPA 1FXXA 2EPDA 1ZUYA 3HPWA 2FVUA 3CPFA 1G3WA 5KH6A 4PJOB 1NYFA 3V8LA 2CSIA 3CBMA 4M7AC 5FWCA 1ZUKA 1AOJA 4BE2A 3EGUA 4Z89A 2AZSA 3M57A 4PJLA 3L1AA 2LJ0A 1GRIA 4E47A 1HXDA 1FMWA 3JCMV 1Q7YU 5CKBA 2EVRA 1AZEA 1VQMA 1X6BA 3QG1A 1OX8A 1ZA2B 4ZN1A 2DERA 2HQEA 3SEMA 1WXUA 2DIQA 3QUIA 2LT1A 3CXCA 1GCQC 2WSCE 3REBB 5HK3A 4JJCA 3MP8A 3VRYA 1N8RR 4A4EA 4JJBA 4J7IA 2EYWA 3VU3C 1BIBA 1MUZA 1N8RC 1G2BA 2VUBA 3VS7A 1N9RA 1UEBA 1NJIC 2E4HA 2HQHA 1VQ7A 3VJPA 4MDXA 4ELZC 3QKJA 2EKHA 1RLPC 3CCMA 2BZ8A 1GFDA 4DEYA 3MEAA 3RNJA 9ATCB 2G3RA 4HVWA 3VS3A 1KFZA 4GLMA 4ZTFA 3G7ZA 4IIMA 1NM7A 3BW1A 3M4GA 4M7DC 2EGEA 4CC4B 2QDLA 3OS2A 1YJWT 2F5TX 1IHWA 2ZPFB 1RADB 1D0YA 4FYVB 4M75F 5L23A 2K2MA 1VQLQ 3O8VA 4RG2A 3MHXA 3TU4K 1IXDA 3GNGA 2DD5A 3NFCA 2BZXA 3CXCP 1B3QA 1Y96B 1I5OB 4XU3A 1D0ZA 2VWFA 5DLQE 3CCQQ 2HBPA 3PMIA 5GAOq 2A08A 3MEVA 1BCMA 3UT1A 2ABLA 1UECA 1VQ4Q 2DZ9A 4M7AD 1VQ5Q 2KSSA 4Z02A 2FG0A 4AFSC 3RMQA 3SWNC 4GY5A 5CKEA 1FWZA 4NOYA 4YTLA 4ZGDB 1VQ6Q 3ER0A 1X43A 4LD6A 4J9DA 2M16A 1I5LA 3BY7A 1JXOA 3CCSQ 1KQ2A 1BI2A 3MEWA 2RPNA 4JUVA 4C0DB 1WIEA 3HHTB 4JLGA 2VGNA 4LDVA 1MHNA 3NPFA 3J7AF 2KR3A 3N5BB 1EZZB 2QA4Q 2HZYA 5D6WA 5A0GA 3NMZC 1BIAA 4E7LA 1WI7A 1WXTA 3PT9A 2LCLA 5GAOp 1KHCA 1M4ZA 1XTDA 1MNDA 3JB9F 2LCCA 1M9SA 1ZSZC 2NWMA 3RBBB 3ZBDA 4PJOD 1M3AA 2HNIA 2M0YA 4BE1A 4KUDK 1YJWA 1NPPA 4E7HA 1K0SA 1Q81C 1IB8A 5IHNA 1EFNA 4QVDA 1VQLT 1H641 4QQ6A 1SPKA 1XJWB 3OS0A 3CBOA 3GIBA 4CRIA 1MNEA 2PVOB 3JCMd 3O5ZA 1M1GA 3GPLA 2COZA 1RAAB 4M7DD 5M9OA 1I81A 4RTZA 2XK0A 3JCMf 1VQNT 3CMAQ 1YJNQ 3S6WA 1BI1A 3JAME 4F14A 1ZLMA 1B7TA 4HCCA 5CAIA 1Y71A 1I07A 4JRQA 1VQKQ 4A4GA 1RACB 4M78B 4A63B 2RHIA 3OMCA 4AT1B 1WZOA 4LDUA 1VQ5T 4A53A 1JJ2S 1QVFS 4X9DA 1VQ6T 3UA6A 1SHFA 2QQSA 1SRLA 4EMKB 4E7JA 1PWTA 2GQIA 2FEIA 4CC3A 4R0KA 2JS0A 4CI0C 1VUBA 2EQIA 4XU1A 5GJWB 1QCNA 2QA4T 1M8VA 2VC8A 2DAQA 1X01A 5A0DA 1OU8A 4OB0B 3M5AA 4X34A 2JM9A 2M1HA 3M54A 2BTTA 1C1AA 2DRKA 3S3NA 1FMKA 4M77B 2D8JA 1H3ZA 1N8RU 1JEGA 1JU5C 2HL5C 2QGFB 4RG8A 1GBRA 2O4XB 5EC7A 1NJIU 1RABB 2M0OA 1RLQC 4KGZB 4N0AC 4OVAA 2YUQA 5GMKe 1WQ7A 1VQLA 5GAMf 3CC7Q 4C92C 3M53A 1AZGB 2CGHA 5HCKA 1BCOA 3MJXA 2JW4A 2L2PA 1SHGA 1NG2A 4P5NA 5LJ5g 2YRVA 5KYWA 2CZ6B 2DK3A 1VQ9Q 3CMAT 1YJNT 1K9MR 1VQNA 5GANd 2DXUA 1WHJA 4BI3A 2DD4A 4OGEA 2FZGB 2KEAA 4OMOA 5GAN6 1YCYA 1K9MC 4HT9A 2DILA 4HCZA 1VQKT 4V2SA 1H3HA 5GANf 1LCKA 1D3BA 4ZTJA 1SSFA 2HMAA 5L8RE 3R6NA 1U5SA 1VQ5A 3UDCA 4BACA 1VQ6A 2Z0WA 4MZMA 3EHQA 3UATA 4J9EA 3L2QA 1QVPA 3ME9A 2JTMA 1HYOA 3VYGA 2E5QA 4M4ZA 5HY6A 3VRZA 1WLPB 2HSEB 4E7SA 4FL6A 2CH4A 3KXTA 2QA4A 2IG0A 1AD5A 2FRYA 3HP9A 1YWOA 3DB4A 2KRNA 2JJ9A 3JB9H 1ZBXA 1Q7YR 1E6GA 2C0TA 3CD6Q 4JDSA 5D7UA 3C4SA 5C0MA 1AWWA 2RI3A 3CC7T 4DBFA 5I22A 1PNJA 3QZ9B 3J80E 2H8HA 4IUPA 3M9QA 4C0ZA 5CKDA 3GOXA 4MZTA 1M2VA 1I8FA 2BKDN 1VQ9T 4ELYC 4FU6A 1YI2Q 1BB9A 1U8RA 3CMAA 4A54A 2LJ3A 1YJNA 2AKKA 5I21A 4BD3A 2LQWA 1Q81U 1LVKA 1B34A 2EQKA 1G3YA 2CZ0B 1VQKA 3RKXA 3I9QA 1Z9QA 2YXYA 2A37A 2OAWA 1TWBA 1PRLC 1N6AA 4FM4B 5J39A 1ZSGA 2EGCA 5KCOA 2HDAA 1TH7A 1M1KR 2D0NA 1C0MA 3S3MA 1T0HA 2RJDA 5GAN4 4E7IA 2K3XA 4E7KA 1W2BA 1I0CA 4PFPA 4KH1B 3CC4T 2LJ1A 2QQBA 2O88A 1HSQA 1PCXA 2A7YA 2X35A 3LW5E 1WXBA 1X6GA 2DEQA 5LJ3d 2DZCA 5GMKl 1IRXA 3C94A 1WFWA 2XDPA 2GBQA 5LJ3f 4FYYB 1SRMA 2E5KA 2FRWA 2FB7A 3CC7A 4JPBW 4KGVB 2X3WD 2A0FB 4MDWA 1LPLA 2X4JA 4IURA 2Y4XA 3EGDA 3AHUA 3E1SA 2XG8D 5J26A 2DXBA 4ORZA 2Y4YA 3C12A 1YI2T 1VQ9A 2K6DA 1D09B 3OYBA 2J05A 1WDXA 4VUBA 3RIRA 4M7DE 1KD1R 3U23A 1QP3A 4Q5WA 4DBRA 2KQWA 4C5EA 4IUVA 1TG0A 2CSQA 3LX7A 3SDZA 1KD1C 1G5VA 2HKNA 5CQYA 2EYQA 1ZUUA 1NEGA 4OMNA 4OB2B 1W2BP 5LL6S 2DYIA 1FMVA 1NE8A 2FPDA 1SG5A 3HRSA 5GJVB 2F2XA 2QK0A 2RH2A 2YUPA 3UPUA 2H3JA 3LLRA 5FW9A 3L2UA 2RHUA 2RQTA 3E9GA 4C8QA 3JRZA 4M7AB 1YITQ 1K0XA 1K9MU 2AK5A 4CC7A 2QGGA 4F7UE 1UGPB 1K8AC 2LTOA 4M7DG 4PNOA 2ZPGB 2JXBA 3WXMB 3CC4A 2MI6A 2R57A 1P92A 2PNIA 4A4HA 3FEOA 1IGQA 3HKSA 2JOYA 2NUTA 1SSHA 3PTAA 2LVMA 1IREB 3E19A 6AT1B 2JS2A 3QWYA 4K11A 4FW2A 1H92A 2EAYA 5EG2A 1SKUB 2I2LA 3REAB 1UHCA 3I5RA 2PQWA 4BB7A 1Y7XA 2YWWA 3EG1A 2ECZA 4F7UG 4MMKA 2LZ6B 2ZZDA 4M75A 4RTVA 2CH4W 1UJ0A 3ULRB 2E3IA 4FYXB 4J5YA 5I11A 3FC3A 2ROLA 1YI2A 2M51A 2EQUA 3LWHA 1EIFA 4M7DB 2XHCA 1M3CA 3V7CA 1PM3A 1R0BG 1Q95G 5IN1A 1DJ7B 4M78F 2L3SA 4PLIA 1NLPC 2EQMA 3QBYA 5IH2A 4L6V5 2QI2A 5FU6C 1AT1B 3MKDA 1NJIR 4EMGA 4C8QF 2JZ2A 2IVWA 3M56A 1UHFA 3FJPA 1Q82C 4OMQA 1YITT 1KG1A 2RQWA 3ZFJA 3OQ5A 1KQSS 4F7UB 2M9UA 4LXCA 2XICA 3CBPA 2CP3A 2WSEE 3M0UA 5LJ3h 1WJSA 3CC2Q 1WHMA 5CCAA 2DL8A 4FT4A 1UE9A 2VGMA 4R56A 2C0IA 5LJ3j 1XQHA 4LUEA 2XDBA 3SWNB 3INZA 2HKQB 4M77F 3EG9B 5KYUB 4C5GA 2R5MA 2LQ8A 3M55A 3QZ5B 4ZGJB 1M1KU 5I2SA 1G3SA 5IXFA 2VXFA 2X9HA 2DL4A 4PJJA 3EFOB 4ME7A 4IKFA 1TUGB 1UTIA 1JJ2A 2AT1B 3UA7A 1QVFA 2OTLQ 3CCLA 3V7SA 3OYIA 5HKCA 2BUDA 2CUBA 4J9HA 4E6RA 1VQNQ 2EYYA 2ZGWA 2ZPEB 1SF9A 1ZSZB 1ZBJA 3EH1A 1AWOA 3EGXA 1UG1A 2KYMA 3NTIA 5CR2A 3CCET 3LGFA 2F5KA 4LUDA 3BDUA 4C92E 2RMOA 3QIIA 2YSQA 2L3PA 2KYBA 1RUWA 3PE0A 3VS2A 3CEYA 2BE9B 2K3YA 3VS6A 4F16A 2FPFA 2RN8A 3HL8A 5J3BA 5GMKm 3V7RA 2FYKA 4HT8A 1GCPA 4LD9K 2L3RA 1YITA 2AIRB 3C95A 3AT1B 3MP6A 2RQVA 1KD1U 2PU9B 2F2WA 3PMTA 2RHZA 3CC2T 1KQ1A 2JM8A 1TS9A 1TXQA 5FU7B 2CYZB 4C92G 1AVZC 4BE0A 2V8KA 1UGQB 1JJ2P 1WA7A 1QVFP 1WHHA 1Q81R 3QYGB 1OEBA 4ATOA 3TREA 2O9VA 2CS7A 4OMMA 1Z9ZA 3JCMb 2OTJQ 3OYLA 2NUPB 4J9CA 4JRPA 2OI3A 2YDLA 2KRMA 4B9WA 3EG0A 2WACA 2OTLT 4J83A 1MMDA 1U3OA 2JN0A 2E41A 2QEXQ 1S72T 3OA6A 1VQ8Q 2YRDA 2QDYB 3DLMA 3RMSA 1WHGA 2F69A 3JB9J 4AMCA 4XTZA 2CP0A 3C0CA 3A5ZB 1X69A 4ZGEB 2RJEA 3JB9I 3CCEA 1W1FA 3F70A 1M30A 4C92B 1X2KA 2CREA 1M90C 1OULA 4IUTA 4M75G 5KYYB 3UWNA 2DPPB 1KSWA 3M0QA 2P84A 4KRTA 2GTJA 3NTKA 1WHLA 4LDXA 2K5LA 1T3LA 2XIDA 2DVEA 4QKUA 2RK2A 1OU9A 1AHJB 3A8MB 3HFNA 2EJGA 1Q86R 2MWPA 2KDSA 2EFIA 3CC2A 2KAFA 1RL2A 1E7OA 4LE9A 3H41A 3OYGA 1Q86C 4OF1A 4Y92A 1J3TA 2J6OA 3DKMA 1Q82U 4XTVA 3M0TA 1C6VX 2PTKA 2JMAA 5CVIA 2OTJT 4KBMB 1QCOA 2KE9A 4C5HA 2KK4A 5GAMg 2P0QA 3PIOA 4FSXA 5GAMe 2NLUA 1UGRB 3X25B 1LOJA 2H3EB 3FDRA 4FIBA 3L2ZA 2OTLA 2K79A 3QSUA 5LJ5e 3OYEA 4M78C 5CO7A 1HK9A 1N9SA 4KT0E 4AG1C 1M8MA 4PJOA 2QEXT 3KFVA 1VQ8T 3FRNA 3QDFA 3OYCA 1S72A 2ROTA 2GFUA 2V8IA 4C8QC 2DBKA 3CPWA 5GANg 1U06A 3A98A 2GF7A 3M4YA 3JB9G 3OB9A 4D8KA 3OW2S 2LQNA 3CQTA 3OYMA 3MP1A 1YCSB 4JS4A 3MEUA 4J6YA 1QW1A 1G8XA 2GCXA 4NS5A 1D1CA 1F1BB 1ZQ1A 3ASKA 1Y57A 2RD1A 1JB0E 2A3LA 3VYHB 3A8GB 1AWJA 4M7AF 1VYUA 1W4SA 3CC4Q 4M75C 1G83A 3OY9A 2FZKB 4RTTA 1EX4A 2MOXA 5GAOl 2CZ1B 2D6FA 2FO0A 4N4HA 4ANJA 1QQJA 3X20B 4DBQA 3QJ6A 2K5IA 2KRSA 2MWOA 3MPUB 1KJWA 1KC8C 3PIPA 3L2WA 2EJ9A 2R58A 3KBGA 2GQVA 2OTJA 2L5QA 2P4TA 2ZCFB 5CKFA 4WF2A 3TVTA 2M02A 2FZCB 3GNFB 1CKBA 2LX7A 2CT3A 1UDLA 2E12A 2EW3A 3EG2A 4RUGA 2CZ7B 3H0HA 4PJOF 2K7AA 2XDDA 4JJNK 2QEXA 2A28A 2RQRA 3QHSA 1VQ8A 4HXJA 1Y96A 1YIJQ 4C92D 2MF2A 4B6MA 3ZL7C 2CP5A 1OZ2A 1U1TA 2DO3A 3G4SA 2COYA 3EH2A 4M7DF 5GAN7 3E9FA 3I5SA 3OBYA 2KT8A 3VV0A 1VIEA 3RDVA 2PUOB 3E2UA 2MPXC 3FIFA 4O5VA 2VV5A 1YN8A 4D8DA 3HFOA 5CIUA 4XK8E 4DBHA 4AFUC 1XNIA 2K2VA 4J9BA 3PVQA 4L59A 2HBWA 2E3HA 3PNWC 3CPWS 5KYXB 1OPKA 5CK9A 2QXFA 5GAOr 1V29B 2L8DA 2J6KA 2SEMA 4F7UF 2SRCA 3P8HA 4FW1A 2ED1A 1CKAA 3TEEA
chains in the Genus database with same CATH topology
2KR3A 2AKLA 4RTWA 1RI9A 3NMZC 1E6HA 1WI7A 1M3CA 1WXTA 2G6FX 4OMLA 2DA9A 2KNBB 2NWMA 2L3SA 3RBBB 1NLPC 1M3AA 2MIOA 5IH2A 2M0YA 2A36A 4GBQA 1K1ZA 2I0NA 1K0SA 2YUOA 5IHNA 1EFNA 1UHFA 1X2QA 1M3BA 1K76A 2DLPA 1SPKA 4OMQA 1T3SA 2JT4A 2RQWA 4RTXA 3O5ZA 1QCFA 2ED0A 4RTZA 3M0UA 1UJYA 1PRMC 1W6XA 5FWBA 2O2OA 2RF0A 2LMJA 2W0ZA 3SHWA 2YUNA 3H0FA 2DL8A 4F14A 1ZLMA 1QKXA 1UE9A 1JXMA 2C0IA 1ABQA 1I07A 4LUEA 2EYXA 2DF6A 3TSZA 5IHKA 1HD3A 4A63B 3FJ5A 2HSPA 2MCNA 1NLOC 5IXFA 2DL4A 3M0SA 4ESRA 3UA6A 1SHFA 1UTIA 2KGTA 3H0IA 3UA7A 1ABOA 1SRLA 1M27C 1PWTA 2GQIA 3VS5A 2FEIA 4CC3A 4R0KA 2JS0A 2CUBA 2ENMA 4J9HA 4E6RA 2EQIA 2FPEA 2V1QA 2EYYA 5GJWB 1K4US 2KXDA 1ZBJA 1AWOA 2JM9A 2BTTA 2KYMA 1UG1A 2DRMA 3EHRA 2DRKA 4LUDA 1QKWA 1FMKA 2RMOA 2DL3A 2D8JA 1AWXA 2YSQA 2VKNA 1JU5C 2L3PA 2KYBA 1JEGA 1RUWA 2DE0X 1UUEA 3PE0A 3VS2A 1GBRA 5EC7A 1RLQC 3VS6A 2O9SA 4LN2A 1JQQA 2YUQA 3M0PA 4F16A 2FPFA 2RN8A 1GCPA 2DX1A 1AZGB 1B07A 5HCKA 3M0RA 2DYBA 2JW4A 2DJQA 2L2PA 2RQVA 1SHGA 4FSSA 1NG2A 2ESWA 2F2WA 1BBZA 1WYXA 2J06A 2JM8A 4OMPA 1V1CA 2B86A 2V1RA 1AVZC 4X1VA 2KEAA 4OMOA 2GTOA 1WA7A 2DILA 3VS0A 4CC2A 1H3HA 1OEBA 2RQUA 2O9VA 3THKA 1X27A 1LCKA 4OMMA 4RTYA 1Z9ZA 2EBPA 3UF4A 2P4RA 3R6NA 1U5SA 1W70A 3LH5A 4JJDA 4RTUA 4J9CA 2OI3A 2YDLA 2KRMA 3EHQA 3UATA 4J9EA 3EG0A 1BK2A 3NGPA 1I1JA 1JO8A 5ECAA 4QT7A 1MV0B 1NYGA 4M4ZA 2GNCA 2VVKA 3VRZA 2DM1A 1U3OA 1WLPB 1YP5A 1VYVA 1UGVA 2KBTA 1GFCA 2CH4A 1QLYA 2W10A 1AD5A 2FRYA 1IO6A 1YWOA 1YNZA 1FYNA 3NHNA 4AG2C 2KRNA 1HJDA 3C0CA 1X69A 2OJ2A 1W1FA 4J9IA 2LP5A 1H8KA 1E6GA 2C0TA 1M30A 5IHIA 1X2KA 2CREA 1T0JA 4AFQC 2J7IA 1KIKA 1KSWA 3M0QA 2DNUA 4KRTA 2GTJA 1OPLA 1AWWA 2L0AA 5I22A 1PNJA 1S1NA 2H8HA 4JZ4A 2LNHB 1T3LA 4AFZC 2YT6A 1A0NB 4WCIA 1VYTA 2HCKA 4HCKA 2K3BA 4F17A 3JV3A 1BB9A 2DL5A 4Z88A 1GBQA 2LJ3A 2PZ1A 1E7OA 2AKKA 4LE9A 2LCSA 3H41A 2LQWA 1OOTA 3TSWA 5IXBA 2KXCA 2D1XA 4Y92A 1J3TA 2J6OA 3QWXX 1PKTA 3M0TA 1MV3A 4HVUA 1UFFA 4IIOA 2PTKA 2JMAA 3VS4A 3I9QA 1Z9QA 3I35A 2EGAA 1Y0MA 2KE9A 2A37A 4J9FA 2O31A 1N5ZA 2C0OA 2OAWA 1PRLC 2XMFA 2DMOA 2JMCA 2DVJA 1ZSGA 2EGCA 1SEMA 2JTEA 1PKSA 2HDAA 2CDTA 2K79A 2D0NA 2F2VA 4LNPA 1T0HA 4EIKA 2EPDA 1ZUYA 3IQLA 2NUZA 4AG1C 1M8MA 1ARKA 1NYFA 2D8HA 3KFVA 1I0CA 2L3QA 1OV3A 2ROTA 2LJ1A 2CSIA 2DBKA 2O88A 1HSQA 5FWCA 1ZUKA 1AOJA 3EGUA 4Z89A 2AZSA 1U06A 3A98A 1BU1A 1WXBA 1GRIA 2LJ0A 1X6GA 4D8KA 2LQNA 3CQTA 2EVRA 1YCSB 1AZEA 1X6BA 1AEYA 2DBMA 3SEMA 1WFWA 1WXUA 2GBQA 4JZ3A 1GL5A 1SRMA 4J9GA 1Y57A 1GCQC 2E5KA 2FRWA 3REBB 4JJCA 4JPBW 2DL7A 3VRYA 2X3WD 4JJBA 1PHTA 2EYWA 1AWJA 1YWPA 1VYUA 1MUZA 1G2BA 1G83A 3VS7A 4ORZA 4RTTA 2K6DA 2MOXA 2J05A 1NEBA 2EKHA 2FO0A 1CSKA 1WDXA 2IIMA 1RLPC 3U23A 4DEXA 2BZ8A 1GFDA 1TUCA 2KROA 4DEYA 2KRSA 1TG0A 1KJWA 2CSQA 3RNJA 4HVWA 3VS3A 1KFZA 2HEQA 2GGRA 4GLMA 4IIMA 1NM7A 2CT4A 1ZUUA 1NEGA 2X3XD 4OMNA 3PVLA 2BZYA 2EGEA 2FPDA 4CC4B 2QDLA 5GJVB 2F2XA 3TVTA 2YUPA 1CKBA 5FW9A 2LX7A 5L23A 1QWFA 2CT3A 1UDLA 2EW3A 3EG2A 4RUGA 3H0HA 2K2MA 2RQTA 1K0XA 2K7AA 2AK5A 4CC7A 3VS1A 1K9AA 2J6FA 2JXBA 2A28A 2BZXA 2RQRA 1B3QA 4HXJA 2PNIA 4ZNXA 2EYZA 2CUDA 3ZL7C 1WX6A 1SSHA 2VWFA 3GBQA 2KT1A 3I5SA 4HVVA 4Z8AA 2A08A 1GCQA 2KT8A 2AZVA 1QWEA 2JS2A 3QWYA 4K11A 1H92A 1YN8A 3REAB 2ABLA 1UECA 1UHCA 4D8DA 3I5RA 1TUDA 4AFUC 3EG1A 2ECZA 3EG3A 2FG0A 4AFSC 2LZ6B 4J9BA 3PVQA 1ZX6A 4RTVA 2CH4W 2HBWA 1UJ0A 3ULRB 1OPKA 1X43A 2RNAA 1VA7A 4J9DA 1JXOA 5I11A 2J6KA 2SEMA 2ROLA 2RPNA 1XOVA 2SRCA 1WIEA 2K9GA 2M51A 2ED1A 3NPFA 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR3 A;  2AKL A;  4RTW A;  1RI9 A;  3NMZ C;  1E6H A;  1WI7 A;  1M3C A;  1WXT A;  2G6F X;  4OML A;  2DA9 A;  2KNB B;  2NWM A;  2L3S A;  3RBB B;  1NLP C;  1M3A A;  2MIO A;  5IH2 A;  2M0Y A;  2A36 A;  4GBQ A;  1K1Z A;  2I0N A;  1K0S A;  2YUO A;  5IHN A;  1EFN A;  1UHF A;  1X2Q A;  1M3B A;  1K76 A;  2DLP A;  1SPK A;  4OMQ A;  1T3S A;  2JT4 A;  2RQW A;  4RTX A;  3O5Z A;  1QCF A;  2ED0 A;  4RTZ A;  3M0U A;  1UJY A;  1PRM C;  1W6X A;  5FWB A;  2O2O A;  2RF0 A;  2LMJ A;  2W0Z A;  3SHW A;  2YUN A;  3H0F A;  2DL8 A;  4F14 A;  1ZLM A;  1QKX A;  1UE9 A;  1JXM A;  2C0I A;  1ABQ A;  1I07 A;  4LUE A;  2EYX A;  2DF6 A;  3TSZ A;  5IHK A;  1HD3 A;  4A63 B;  3FJ5 A;  2HSP A;  2MCN A;  1NLO C;  5IXF A;  2DL4 A;  3M0S A;  4ESR A;  3UA6 A;  1SHF A;  1UTI A;  2KGT A;  3H0I A;  3UA7 A;  1ABO A;  1SRL A;  1M27 C;  1PWT A;  2GQI A;  3VS5 A;  2FEI A;  4CC3 A;  4R0K A;  2JS0 A;  2CUB A;  2ENM A;  4J9H A;  4E6R A;  2EQI A;  2FPE A;  2V1Q A;  2EYY A;  5GJW B;  1K4U S;  2KXD A;  1ZBJ A;  1AWO A;  2JM9 A;  2BTT A;  2KYM A;  1UG1 A;  2DRM A;  3EHR A;  2DRK A;  4LUD A;  1QKW A;  1FMK A;  2RMO A;  2DL3 A;  2D8J A;  1AWX A;  2YSQ A;  2VKN A;  1JU5 C;  2L3P A;  2KYB A;  1JEG A;  1RUW A;  2DE0 X;  1UUE A;  3PE0 A;  3VS2 A;  1GBR A;  5EC7 A;  1RLQ C;  3VS6 A;  2O9S A;  4LN2 A;  1JQQ A;  2YUQ A;  3M0P A;  4F16 A;  2FPF A;  2RN8 A;  1GCP A;  2DX1 A;  1AZG B;  1B07 A;  5HCK A;  3M0R A;  2DYB A;  2JW4 A;  2DJQ A;  2L2P A;  2RQV A;  1SHG A;  4FSS A;  1NG2 A;  2ESW A;  2F2W A;  1BBZ A;  1WYX A;  2J06 A;  2JM8 A;  4OMP A;  1V1C A;  2B86 A;  2V1R A;  1AVZ C;  4X1V A;  2KEA A;  4OMO A;  2GTO A;  1WA7 A;  2DIL A;  3VS0 A;  4CC2 A;  1H3H A;  1OEB A;  2RQU A;  2O9V A;  3THK A;  1X27 A;  1LCK A;  4OMM A;  4RTY A;  1Z9Z A;  2EBP A;  3UF4 A;  2P4R A;  3R6N A;  1U5S A;  1W70 A;  3LH5 A;  4JJD A;  4RTU A;  4J9C A;  2OI3 A;  2YDL A;  2KRM A;  3EHQ A;  3UAT A;  4J9E A;  3EG0 A;  1BK2 A;  3NGP A;  1I1J A;  1JO8 A;  5ECA A;  4QT7 A;  1MV0 B;  1NYG A;  4M4Z A;  2GNC A;  2VVK A;  3VRZ A;  2DM1 A;  1U3O A;  1WLP B;  1YP5 A;  1VYV A;  1UGV A;  2KBT A;  1GFC A;  2CH4 A;  1QLY A;  2W10 A;  1AD5 A;  2FRY A;  1IO6 A;  1YWO A;  1YNZ A;  1FYN A;  3NHN A;  4AG2 C;  2KRN A;  1HJD A;  3C0C A;  1X69 A;  2OJ2 A;  1W1F A;  4J9I A;  2LP5 A;  1H8K A;  1E6G A;  2C0T A;  1M30 A;  5IHI A;  1X2K A;  2CRE A;  1T0J A;  4AFQ C;  2J7I A;  1KIK A;  1KSW A;  3M0Q A;  2DNU A;  4KRT A;  2GTJ A;  1OPL A;  1AWW A;  2L0A A;  5I22 A;  1PNJ A;  1S1N A;  2H8H A;  4JZ4 A;  2LNH B;  1T3L A;  4AFZ C;  2YT6 A;  1A0N B;  4WCI A;  1VYT A;  2HCK A;  4HCK A;  2K3B A;  4F17 A;  3JV3 A;  1BB9 A;  2DL5 A;  4Z88 A;  1GBQ A;  2LJ3 A;  2PZ1 A;  1E7O A;  2AKK A;  4LE9 A;  2LCS A;  3H41 A;  2LQW A;  1OOT A;  3TSW A;  5IXB A;  2KXC A;  2D1X A;  4Y92 A;  1J3T A;  2J6O A;  3QWX X;  1PKT A;  3M0T A;  1MV3 A;  4HVU A;  1UFF A;  4IIO A;  2PTK A;  2JMA A;  3VS4 A;  3I9Q A;  1Z9Q A;  3I35 A;  2EGA A;  1Y0M A;  2KE9 A;  2A37 A;  4J9F A;  2O31 A;  1N5Z A;  2C0O A;  2OAW A;  1PRL C;  2XMF A;  2DMO A;  2JMC A;  2DVJ A;  1ZSG A;  2EGC A;  1SEM A;  2JTE A;  1PKS A;  2HDA A;  2CDT A;  2K79 A;  2D0N A;  2F2V A;  4LNP A;  1T0H A;  4EIK A;  2EPD A;  1ZUY A;  3IQL A;  2NUZ A;  4AG1 C;  1M8M A;  1ARK A;  1NYF A;  2D8H A;  3KFV A;  1I0C A;  2L3Q A;  1OV3 A;  2ROT A;  2LJ1 A;  2CSI A;  2DBK A;  2O88 A;  1HSQ A;  5FWC A;  1ZUK A;  1AOJ A;  3EGU A;  4Z89 A;  2AZS A;  1U06 A;  3A98 A;  1BU1 A;  1WXB A;  1GRI A;  2LJ0 A;  1X6G A;  4D8K A;  2LQN A;  3CQT A;  2EVR A;  1YCS B;  1AZE A;  1X6B A;  1AEY A;  2DBM A;  3SEM A;  1WFW A;  1WXU A;  2GBQ A;  4JZ3 A;  1GL5 A;  1SRM A;  4J9G A;  1Y57 A;  1GCQ C;  2E5K A;  2FRW A;  3REB B;  4JJC A;  4JPB W;  2DL7 A;  3VRY A;  2X3W D;  4JJB A;  1PHT A;  2EYW A;  1AWJ A;  1YWP A;  1VYU A;  1MUZ A;  1G2B A;  1G83 A;  3VS7 A;  4ORZ A;  4RTT A;  2K6D A;  2MOX A;  2J05 A;  1NEB A;  2EKH A;  2FO0 A;  1CSK A;  1WDX A;  2IIM A;  1RLP C;  3U23 A;  4DEX A;  2BZ8 A;  1GFD A;  1TUC A;  2KRO A;  4DEY A;  2KRS A;  1TG0 A;  1KJW A;  2CSQ A;  3RNJ A;  4HVW A;  3VS3 A;  1KFZ A;  2HEQ A;  2GGR A;  4GLM A;  4IIM A;  1NM7 A;  2CT4 A;  1ZUU A;  1NEG A;  2X3X D;  4OMN A;  3PVL A;  2BZY A;  2EGE A;  2FPD A;  4CC4 B;  2QDL A;  5GJV B;  2F2X A;  3TVT A;  2YUP A;  1CKB A;  5FW9 A;  2LX7 A;  5L23 A;  1QWF A;  2CT3 A;  1UDL A;  2EW3 A;  3EG2 A;  4RUG A;  3H0H A;  2K2M A;  2RQT A;  1K0X A;  2K7A A;  2AK5 A;  4CC7 A;  3VS1 A;  1K9A A;  2J6F A;  2JXB A;  2A28 A;  2BZX A;  2RQR A;  1B3Q A;  4HXJ A;  2PNI A;  4ZNX A;  2EYZ A;  2CUD A;  3ZL7 C;  1WX6 A;  1SSH A;  2VWF A;  3GBQ A;  2KT1 A;  3I5S A;  4HVV A;  4Z8A A;  2A08 A;  1GCQ A;  2KT8 A;  2AZV A;  1QWE A;  2JS2 A;  3QWY A;  4K11 A;  1H92 A;  1YN8 A;  3REA B;  2ABL A;  1UEC A;  1UHC A;  4D8D A;  3I5R A;  1TUD A;  4AFU C;  3EG1 A;  2ECZ A;  3EG3 A;  2FG0 A;  4AFS C;  2LZ6 B;  4J9B A;  3PVQ A;  1ZX6 A;  4RTV A;  2CH4 W;  2HBW A;  1UJ0 A;  3ULR B;  1OPK A;  1X43 A;  2RNA A;  1VA7 A;  4J9D A;  1JXO A;  5I11 A;  2J6K A;  2SEM A;  2ROL A;  2RPN A;  1XOV A;  2SRC A;  1WIE A;  2K9G A;  2M51 A;  2ED1 A;  3NPF A;  1CKA A; 
#chains in the Genus database with same CATH topology
 1OX9 A;  2AKL A;  4RTW A;  1RI9 A;  2EJF A;  2MK5 A;  4PKC C;  3PFS A;  4LDY A;  3J81 E;  3WVD B;  4M75 D;  4E2F B;  2VB6 A;  3CCU Q;  3OYY A;  3A8H B;  5GMK h;  2A36 A;  4GBQ A;  3L42 A;  4TVR A;  2K57 A;  3OS1 A;  2YUO A;  1R8O B;  2EKO A;  1VQO T;  3CCL Q;  1Q86 U;  5GMK i;  2DLP A;  3EFS A;  1PD0 A;  1MMN A;  5GMK j;  5LJ5 h;  3CCV Q;  4RTX A;  5DLO A;  5GAO n;  1QCF A;  1KK7 A;  2PVD B;  1YIJ T;  8ATC B;  2CKK A;  2K4Y A;  4BUG A;  4A4F A;  1UJY A;  1KQS A;  5LJ5 j;  2O2O A;  2W0Z A;  1K73 R;  3SHW A;  2YUN A;  3LGL A;  3H0F A;  3I55 Q;  1QVG S;  2QQA A;  1JXM A;  4ZN3 A;  1K73 C;  1TU0 B;  2V26 A;  4PJN A;  1ABQ A;  4J8O A;  4RKU E;  2DF6 A;  3TSZ A;  4M78 A;  1HD3 A;  4BY6 C;  3FJ5 A;  2VYT A;  4L5G A;  1RAI B;  2HSP A;  2MCN A;  1WNL A;  1ACM B;  1BI3 A;  1NLO C;  1K8A R;  3I56 T;  2RI5 A;  2RHX A;  3QXE B;  2KGT A;  1RAG B;  2B8A A;  4EMK A;  1M27 C;  4QW2 A;  3VS5 A;  4KUL A;  3X24 B;  2FPE A;  2IPO B;  3A8O B;  7AT1 B;  1OZ3 A;  3JB9 D;  5FRM A;  1RI0 A;  2D0Q B;  2K5F A;  3BFM A;  3JSC A;  5KCH A;  5FU6 B;  1RAE B;  4EMH A;  2X4Y A;  1QKW A;  4M77 A;  2PUK B;  3CCU T;  2VKN A;  2O4X A;  1UUE A;  1Y07 A;  1KQS P;  4BI8 B;  5FRN A;  2R5A A;  4LN2 A;  1VQO A;  3CCL T;  1JQQ A;  1M2O A;  2L89 A;  2DX1 A;  2E6N A;  2PVG B;  2LDM A;  3CCV T;  3V8K A;  4EDU A;  2DYB A;  4XAX B;  3RES A;  4FSS A;  3P8B B;  3JCM Q;  1PD1 A;  3OYK A;  5I2M A;  1BBZ A;  2JNG A;  5KYW B;  2BIV A;  1YIJ A;  4OMP A;  2HD0 A;  3I55 T;  4BI4 A;  3G71 Q;  2V1R A;  4F04 B;  5DY9 A;  4X1V A;  5FRO A;  3CCE Q;  4J7F A;  3PGG A;  4CC2 A;  3S3O A;  2RQU A;  5KE2 A;  1Q82 R;  1D3B B;  5GAO m;  4C92 F;  2BE7 D;  4KUI A;  3UF4 A;  1MMA A;  4OGC A;  3H9N A;  3I56 A;  3KUF A;  2EIF A;  3NGP A;  1JO8 A;  5ECA A;  4QT7 A;  2VVK A;  3SFM A;  3CCJ T;  3L2V A;  1GFC A;  5A0L A;  1QLY A;  4X9C A;  2OX7 A;  1IO6 A;  4D6W A;  4EPC A;  4PJO C;  1YNZ A;  2NYS A;  5KE3 A;  4AG2 C;  3HSB A;  1HJD A;  2D9T A;  2OJ2 A;  4J9I A;  2KMT A;  1TTH B;  3CCU A;  5IHI A;  1D0X A;  4AFQ C;  3EAE A;  2QAZ A;  2DXC A;  2DNU A;  1YHQ Q;  1VQP Q;  1OPL A;  4PJM A;  4FT2 A;  2RK1 A;  2L0A A;  4JRI A;  1KHI A;  4JZ4 A;  3OYN A;  2LNH B;  3RR6 A;  3CCV A;  2RM4 A;  3CCR Q;  2YT6 A;  3OMG A;  4WCI A;  1S72 Q;  1VYT A;  1M2V B;  1X75 C;  2HCK A;  2K3B A;  5IT9 E;  2DL5 A;  4Z88 A;  2XI9 A;  1GBQ A;  2PZ1 A;  3G71 T;  1ZA1 B;  3I55 A;  5IXB A;  3HRU A;  1UB4 A;  2KXC A;  1VOM A;  2QYZ A;  1B34 B;  2QTV A;  5D6X A;  1PKT A;  4E7Z A;  3QJY A;  2E65 A;  3I35 A;  2AHJ B;  1Y0M A;  2EGA A;  2O31 A;  2C0O A;  1WQW A;  4KH0 B;  4M78 E;  1YFN A;  2VAS A;  2XMF A;  2DMO A;  4BDY A;  2CP6 A;  1SEM A;  3OBW A;  5GAN 2;  4C8Q E;  2LT4 A;  3VUB A;  2CDT A;  2EQJ A;  1PG5 B;  4IUU A;  4EIK A;  1K73 U;  3IQL A;  3NTH A;  2NUZ A;  3RKY A;  5KYX A;  3CCJ A;  1ARK A;  2LX9 A;  2D8H A;  2RO0 A;  3SD4 A;  2QQ9 A;  4OB3 B;  2L3Q A;  3TCJ A;  1OV3 A;  3QDR B;  3V8J A;  1N27 A;  2DFU A;  4RCC A;  4OB1 B;  1BU1 A;  3VKI A;  4M78 G;  5CQX A;  3L2R A;  1K8A U;  3CXC S;  1BYM A;  1AEY A;  2RJC A;  2DBM A;  2FHD A;  2F1L A;  4JZ3 A;  3OW2 A;  4C8Q G;  1WPY A;  1GL5 A;  4M77 E;  1FX7 A;  1YHQ T;  1VQP T;  5A2Q E;  2YLC A;  4J9G A;  2JUF A;  4M75 E;  4Y28 E;  2RHY A;  3JCM g;  2DL7 A;  3BE3 A;  3OYF A;  3JCM e;  4XTW A;  1PHT A;  3CCR T;  1YWP A;  4C0F A;  3EGD B;  2ZPI B;  4PLL A;  4C0G A;  1UGS B;  2QAS A;  3G4S Q;  2E10 A;  1BKB A;  2DTH A;  4QVZ A;  2CP2 A;  1NEB A;  3G71 A;  1CSK A;  1QMC A;  5IAY A;  2IIM A;  1M90 R;  4DEX A;  4C0D C;  4J6X A;  1TUC A;  2KRO A;  4M77 G;  4DQ2 A;  1BI0 A;  3CCQ T;  3P8D A;  3G6E Q;  2HEQ A;  2GGR A;  2CT4 A;  2DTI A;  2X3X D;  1D1A A;  3PVL A;  2E1H A;  2BZY A;  3FLG A;  2ATC B;  2ZPB B;  4IUQ A;  5D6Y A;  1IHV A;  5FU7 C;  1VQ4 T;  2O01 E;  1QWF A;  4C8Q B;  4M7A A;  4N4G A;  4JRK A;  5AT1 B;  3VS1 A;  1K9A A;  2J6F A;  3OW2 P;  3MCA B;  4JLI A;  3CCS T;  1NBE B;  1M1F A;  4ZNX A;  2RB6 A;  1WJQ A;  2EYZ A;  2CUD A;  3D7S B;  2E6Z A;  1WX6 A;  4RCB A;  1R0C B;  2NUT B;  3HTR A;  2OAU A;  3GBQ A;  2C06 A;  2DXT A;  1IZ6 A;  2DJZ A;  2KT1 A;  4HVV A;  4Z8A A;  2QG9 B;  1V76 A;  1GCQ A;  1OI1 A;  2QQR A;  2ZPH B;  2AZV A;  3JCM P;  1QWE A;  4NL3 A;  1MGQ A;  2MYS A;  4JS5 A;  1TUD A;  3SB2 A;  1VQP A;  1YHQ A;  3EG3 A;  1NZ9 A;  5DM7 R;  5CKH A;  4M75 B;  5GAM d;  1ZX6 A;  2X4X A;  1ZHI A;  1NPR A;  3QPH A;  2RNA A;  1VA7 A;  3CCR A;  2RI2 A;  2XKO C;  4N4I A;  2LC4 A;  3OSV A;  5LJ5 d;  1XOV A;  3G4S T;  2E64 A;  3CME Q;  2K9G A;  1O75 A;  5GAN e;  5IHK A;  1TSF A;  1OQK A;  2HAX A;  4EMK C;  2GFA A;  3M58 A;  5LJ5 f;  4M7D A;  1I4K 1;  1E6H A;  4OP0 A;  2HL3 A;  3JCM c;  2KY9 A;  4C5I A;  2G6F X;  4OML A;  4PFO A;  3G6E T;  3MET A;  4O6J A;  2DA9 A;  4BDZ A;  3CCQ A;  3BDL A;  2LRQ A;  3LWI A;  1YBY A;  5FLX E;  3RUX A;  2KNB B;  2CP7 A;  2MIO A;  1K1Z A;  2I0N A;  1QP2 A;  2XU8 A;  1VQ4 A;  4M77 C;  3TQ7 P;  1X2Q A;  3WVE B;  1M3B A;  1K76 A;  4WTO B;  3JCM J;  1PSE A;  1YJ9 Q;  2Y90 A;  1T3S A;  2JT4 A;  2JVV A;  2YLB A;  4QQG A;  4F7U A;  2RA2 A;  2ED0 A;  3CCS A;  5HK0 A;  1JBM A;  1KC8 R;  3DB3 A;  4R55 A;  1W6X A;  1PRM C;  1M5Q 1;  5FWB A;  2RF0 A;  2LMJ A;  3EFR A;  3LH0 A;  1QKX A;  3OS5 A;  3GP8 A;  3SWN A;  1QVG A;  2EYX A;  3CPW P;  4MML A;  1MMG A;  3EG9 A;  5KYU A;  4DOW A;  1VQO Q;  1RAH B;  3M0S A;  3EFO A;  1WHK A;  4ESR A;  3JCM h;  1Q7Y C;  3H6Z A;  2DIG A;  3H0I A;  1ABO A;  3HRT A;  4DOV A;  3OSS C;  4PFZ A;  2ENM A;  3CME T;  2V1Q A;  4KGX B;  1K4U S;  2KXD A;  2MMP A;  3GLX A;  3RKW A;  1ZSZ A;  4M78 D;  2DTO A;  1G3T A;  3EGX B;  3GF5 A;  2DET A;  8AT1 B;  2KVQ G;  3G6E A;  4Y91 A;  2DRM A;  3EHR A;  4C8Q D;  1VQM Q;  3VUZ A;  4MZP A;  2DL3 A;  4II1 A;  1AWX A;  2DE0 X;  3JCM W;  1X6O A;  3I56 Q;  2O9S A;  1OYX A;  3M0P A;  4XTX A;  1VIF A;  1YJ9 T;  1IGU A;  2EWN A;  1B07 A;  3M0R A;  3T9N A;  1PC0 A;  2YRC A;  1QVG P;  2MAM A;  5GAN 8;  2DJQ A;  1M90 U;  4M7A E;  5GAN 3;  2ESW A;  3OYD A;  1PSF A;  1WYX A;  2J06 A;  4PL6 A;  1VQ7 Q;  2COW A;  4DA4 A;  1V1C A;  2B86 A;  4M77 D;  1M1K C;  4BY6 B;  3JCM X;  4QQD A;  4GLK A;  5LJ3 g;  5LJ3 e;  2GTO A;  3QO3 A;  4HKE A;  3CCM Q;  3URG A;  3VS0 A;  2XD0 A;  3THK A;  1LNX A;  1X27 A;  4RTY A;  5GAM h;  1TOV A;  2EBP A;  2JTF A;  1LJO A;  2HQX A;  2P0K A;  2P4R A;  4OMF B;  1W70 A;  3LH5 A;  4UC4 A;  2NUP A;  4JJD A;  4RTU A;  3R6O A;  3CD6 T;  5GAM j;  4M7A G;  4XU2 A;  3FB9 A;  2WSF E;  1BK2 A;  1WJR A;  1I1J A;  1MV0 B;  1NYG A;  2GNC A;  4PJO E;  2DM1 A;  3X28 B;  1GXI E;  1YP5 A;  1VYV A;  1UGV A;  3CME A;  5GAN h;  3G1J A;  2KBT A;  3M59 A;  4A4K A;  3A1P A;  4PK4 A;  2W10 A;  1R77 A;  2QTX A;  3H8Z A;  1FYN A;  3NHN A;  4QVC A;  5GAN j;  4LDW A;  4N0A A;  1VQM T;  2LP5 A;  1H8K A;  2VXE A;  2X4W A;  4XTY A;  3ZEH A;  4C92 A;  5GAN 5;  4HA8 A;  1T0J A;  2V8J A;  5KYY A;  2J7I A;  1KIK A;  4RMO A;  4PJO G;  4NL2 A;  4B9X A;  3DLL A;  3LYI A;  1D1B A;  3OYJ A;  1S1N A;  1YJ9 A;  1O9S A;  3CCJ Q;  4FYW B;  4AFZ C;  1A0N B;  3MO8 A;  3A8L B;  3OYH A;  4HCK A;  3X26 B;  3Q1J A;  4XTU A;  4F17 A;  4FCY A;  1VQ7 T;  3JV3 A;  1U1S A;  5KYN A;  2YHT A;  1WGS A;  2LCS A;  4XU0 A;  2FL7 A;  1OOT A;  2E70 A;  4J6W A;  3TSW A;  4XQ3 A;  2LNV A;  3CCM T;  2D1X A;  2DKG A;  3QWX X;  1MV3 A;  5C6S A;  4HVU A;  1UFF A;  4IIO A;  3VS4 A;  2RJF A;  4J9F A;  1N5Z A;  2P0P A;  1JRI A;  2ZAE A;  4HCB A;  1RAF B;  1YJW Q;  3RER A;  3CD6 A;  2JMC A;  2DVJ A;  1KC8 U;  2JTE A;  2KI7 A;  3QYH B;  1PKS A;  2X51 A;  1W2B S;  2LQK A;  5AYF A;  3OYA A;  2DEU A;  2F2V A;  4LNP A;  1FXX A;  2EPD A;  1ZUY A;  3HPW A;  2FVU A;  3CPF A;  1G3W A;  5KH6 A;  4PJO B;  1NYF A;  3V8L A;  2CSI A;  3CBM A;  4M7A C;  5FWC A;  1ZUK A;  1AOJ A;  4BE2 A;  3EGU A;  4Z89 A;  2AZS A;  3M57 A;  4PJL A;  3L1A A;  2LJ0 A;  1GRI A;  4E47 A;  1HXD A;  1FMW A;  3JCM V;  1Q7Y U;  5CKB A;  2EVR A;  1AZE A;  1VQM A;  1X6B A;  3QG1 A;  1OX8 A;  1ZA2 B;  4ZN1 A;  2DER A;  2HQE A;  3SEM A;  1WXU A;  2DIQ A;  3QUI A;  2LT1 A;  3CXC A;  1GCQ C;  2WSC E;  3REB B;  5HK3 A;  4JJC A;  3MP8 A;  3VRY A;  1N8R R;  4A4E A;  4JJB A;  4J7I A;  2EYW A;  3VU3 C;  1BIB A;  1MUZ A;  1N8R C;  1G2B A;  2VUB A;  3VS7 A;  1N9R A;  1UEB A;  1NJI C;  2E4H A;  2HQH A;  1VQ7 A;  3VJP A;  4MDX A;  4ELZ C;  3QKJ A;  2EKH A;  1RLP C;  3CCM A;  2BZ8 A;  1GFD A;  4DEY A;  3MEA A;  3RNJ A;  9ATC B;  2G3R A;  4HVW A;  3VS3 A;  1KFZ A;  4GLM A;  4ZTF A;  3G7Z A;  4IIM A;  1NM7 A;  3BW1 A;  3M4G A;  4M7D C;  2EGE A;  4CC4 B;  2QDL A;  3OS2 A;  1YJW T;  2F5T X;  1IHW A;  2ZPF B;  1RAD B;  1D0Y A;  4FYV B;  4M75 F;  5L23 A;  2K2M A;  1VQL Q;  3O8V A;  4RG2 A;  3MHX A;  3TU4 K;  1IXD A;  3GNG A;  2DD5 A;  3NFC A;  2BZX A;  3CXC P;  1B3Q A;  1Y96 B;  1I5O B;  4XU3 A;  1D0Z A;  2VWF A;  5DLQ E;  3CCQ Q;  2HBP A;  3PMI A;  5GAO q;  2A08 A;  3MEV A;  1BCM A;  3UT1 A;  2ABL A;  1UEC A;  1VQ4 Q;  2DZ9 A;  4M7A D;  1VQ5 Q;  2KSS A;  4Z02 A;  2FG0 A;  4AFS C;  3RMQ A;  3SWN C;  4GY5 A;  5CKE A;  1FWZ A;  4NOY A;  4YTL A;  4ZGD B;  1VQ6 Q;  3ER0 A;  1X43 A;  4LD6 A;  4J9D A;  2M16 A;  1I5L A;  3BY7 A;  1JXO A;  3CCS Q;  1KQ2 A;  1BI2 A;  3MEW A;  2RPN A;  4JUV A;  4C0D B;  1WIE A;  3HHT B;  4JLG A;  2VGN A;  4LDV A;  1MHN A;  3NPF A;  3J7A F;  2KR3 A;  3N5B B;  1EZZ B;  2QA4 Q;  2HZY A;  5D6W A;  5A0G A;  3NMZ C;  1BIA A;  4E7L A;  1WI7 A;  1WXT A;  3PT9 A;  2LCL A;  5GAO p;  1KHC A;  1M4Z A;  1XTD A;  1MND A;  3JB9 F;  2LCC A;  1M9S A;  1ZSZ C;  2NWM A;  3RBB B;  3ZBD A;  4PJO D;  1M3A A;  2HNI A;  2M0Y A;  4BE1 A;  4KUD K;  1YJW A;  1NPP A;  4E7H A;  1K0S A;  1Q81 C;  1IB8 A;  5IHN A;  1EFN A;  4QVD A;  1VQL T;  1H64 1;  4QQ6 A;  1SPK A;  1XJW B;  3OS0 A;  3CBO A;  3GIB A;  4CRI A;  1MNE A;  2PVO B;  3JCM d;  3O5Z A;  1M1G A;  3GPL A;  2COZ A;  1RAA B;  4M7D D;  5M9O A;  1I81 A;  4RTZ A;  2XK0 A;  3JCM f;  1VQN T;  3CMA Q;  1YJN Q;  3S6W A;  1BI1 A;  3JAM E;  4F14 A;  1ZLM A;  1B7T A;  4HCC A;  5CAI A;  1Y71 A;  1I07 A;  4JRQ A;  1VQK Q;  4A4G A;  1RAC B;  4M78 B;  4A63 B;  2RHI A;  3OMC A;  4AT1 B;  1WZO A;  4LDU A;  1VQ5 T;  4A53 A;  1JJ2 S;  1QVF S;  4X9D A;  1VQ6 T;  3UA6 A;  1SHF A;  2QQS A;  1SRL A;  4EMK B;  4E7J A;  1PWT A;  2GQI A;  2FEI A;  4CC3 A;  4R0K A;  2JS0 A;  4CI0 C;  1VUB A;  2EQI A;  4XU1 A;  5GJW B;  1QCN A;  2QA4 T;  1M8V A;  2VC8 A;  2DAQ A;  1X01 A;  5A0D A;  1OU8 A;  4OB0 B;  3M5A A;  4X34 A;  2JM9 A;  2M1H A;  3M54 A;  2BTT A;  1C1A A;  2DRK A;  3S3N A;  1FMK A;  4M77 B;  2D8J A;  1H3Z A;  1N8R U;  1JEG A;  1JU5 C;  2HL5 C;  2QGF B;  4RG8 A;  1GBR A;  2O4X B;  5EC7 A;  1NJI U;  1RAB B;  2M0O A;  1RLQ C;  4KGZ B;  4N0A C;  4OVA A;  2YUQ A;  5GMK e;  1WQ7 A;  1VQL A;  5GAM f;  3CC7 Q;  4C92 C;  3M53 A;  1AZG B;  2CGH A;  5HCK A;  1BCO A;  3MJX A;  2JW4 A;  2L2P A;  1SHG A;  1NG2 A;  4P5N A;  5LJ5 g;  2YRV A;  5KYW A;  2CZ6 B;  2DK3 A;  1VQ9 Q;  3CMA T;  1YJN T;  1K9M R;  1VQN A;  5GAN d;  2DXU A;  1WHJ A;  4BI3 A;  2DD4 A;  4OGE A;  2FZG B;  2KEA A;  4OMO A;  5GAN 6;  1YCY A;  1K9M C;  4HT9 A;  2DIL A;  4HCZ A;  1VQK T;  4V2S A;  1H3H A;  5GAN f;  1LCK A;  1D3B A;  4ZTJ A;  1SSF A;  2HMA A;  5L8R E;  3R6N A;  1U5S A;  1VQ5 A;  3UDC A;  4BAC A;  1VQ6 A;  2Z0W A;  4MZM A;  3EHQ A;  3UAT A;  4J9E A;  3L2Q A;  1QVP A;  3ME9 A;  2JTM A;  1HYO A;  3VYG A;  2E5Q A;  4M4Z A;  5HY6 A;  3VRZ A;  1WLP B;  2HSE B;  4E7S A;  4FL6 A;  2CH4 A;  3KXT A;  2QA4 A;  2IG0 A;  1AD5 A;  2FRY A;  3HP9 A;  1YWO A;  3DB4 A;  2KRN A;  2JJ9 A;  3JB9 H;  1ZBX A;  1Q7Y R;  1E6G A;  2C0T A;  3CD6 Q;  4JDS A;  5D7U A;  3C4S A;  5C0M A;  1AWW A;  2RI3 A;  3CC7 T;  4DBF A;  5I22 A;  1PNJ A;  3QZ9 B;  3J80 E;  2H8H A;  4IUP A;  3M9Q A;  4C0Z A;  5CKD A;  3GOX A;  4MZT A;  1M2V A;  1I8F A;  2BKD N;  1VQ9 T;  4ELY C;  4FU6 A;  1YI2 Q;  1BB9 A;  1U8R A;  3CMA A;  4A54 A;  2LJ3 A;  1YJN A;  2AKK A;  5I21 A;  4BD3 A;  2LQW A;  1Q81 U;  1LVK A;  1B34 A;  2EQK A;  1G3Y A;  2CZ0 B;  1VQK A;  3RKX A;  3I9Q A;  1Z9Q A;  2YXY A;  2A37 A;  2OAW A;  1TWB A;  1PRL C;  1N6A A;  4FM4 B;  5J39 A;  1ZSG A;  2EGC A;  5KCO A;  2HDA A;  1TH7 A;  1M1K R;  2D0N A;  1C0M A;  3S3M A;  1T0H A;  2RJD A;  5GAN 4;  4E7I A;  2K3X A;  4E7K A;  1W2B A;  1I0C A;  4PFP A;  4KH1 B;  3CC4 T;  2LJ1 A;  2QQB A;  2O88 A;  1HSQ A;  1PCX A;  2A7Y A;  2X35 A;  3LW5 E;  1WXB A;  1X6G A;  2DEQ A;  5LJ3 d;  2DZC A;  5GMK l;  1IRX A;  3C94 A;  1WFW A;  2XDP A;  2GBQ A;  5LJ3 f;  4FYY B;  1SRM A;  2E5K A;  2FRW A;  2FB7 A;  3CC7 A;  4JPB W;  4KGV B;  2X3W D;  2A0F B;  4MDW A;  1LPL A;  2X4J A;  4IUR A;  2Y4X A;  3EGD A;  3AHU A;  3E1S A;  2XG8 D;  5J26 A;  2DXB A;  4ORZ A;  2Y4Y A;  3C12 A;  1YI2 T;  1VQ9 A;  2K6D A;  1D09 B;  3OYB A;  2J05 A;  1WDX A;  4VUB A;  3RIR A;  4M7D E;  1KD1 R;  3U23 A;  1QP3 A;  4Q5W A;  4DBR A;  2KQW A;  4C5E A;  4IUV A;  1TG0 A;  2CSQ A;  3LX7 A;  3SDZ A;  1KD1 C;  1G5V A;  2HKN A;  5CQY A;  2EYQ A;  1ZUU A;  1NEG A;  4OMN A;  4OB2 B;  1W2B P;  5LL6 S;  2DYI A;  1FMV A;  1NE8 A;  2FPD A;  1SG5 A;  3HRS A;  5GJV B;  2F2X A;  2QK0 A;  2RH2 A;  2YUP A;  3UPU A;  2H3J A;  3LLR A;  5FW9 A;  3L2U A;  2RHU A;  2RQT A;  3E9G A;  4C8Q A;  3JRZ A;  4M7A B;  1YIT Q;  1K0X A;  1K9M U;  2AK5 A;  4CC7 A;  2QGG A;  4F7U E;  1UGP B;  1K8A C;  2LTO A;  4M7D G;  4PNO A;  2ZPG B;  2JXB A;  3WXM B;  3CC4 A;  2MI6 A;  2R57 A;  1P92 A;  2PNI A;  4A4H A;  3FEO A;  1IGQ A;  3HKS A;  2JOY A;  2NUT A;  1SSH A;  3PTA A;  2LVM A;  1IRE B;  3E19 A;  6AT1 B;  2JS2 A;  3QWY A;  4K11 A;  4FW2 A;  1H92 A;  2EAY A;  5EG2 A;  1SKU B;  2I2L A;  3REA B;  1UHC A;  3I5R A;  2PQW A;  4BB7 A;  1Y7X A;  2YWW A;  3EG1 A;  2ECZ A;  4F7U G;  4MMK A;  2LZ6 B;  2ZZD A;  4M75 A;  4RTV A;  2CH4 W;  1UJ0 A;  3ULR B;  2E3I A;  4FYX B;  4J5Y A;  5I11 A;  3FC3 A;  2ROL A;  1YI2 A;  2M51 A;  2EQU A;  3LWH A;  1EIF A;  4M7D B;  2XHC A;  1M3C A;  3V7C A;  1PM3 A;  1R0B G;  1Q95 G;  5IN1 A;  1DJ7 B;  4M78 F;  2L3S A;  4PLI A;  1NLP C;  2EQM A;  3QBY A;  5IH2 A;  4L6V 5;  2QI2 A;  5FU6 C;  1AT1 B;  3MKD A;  1NJI R;  4EMG A;  4C8Q F;  2JZ2 A;  2IVW A;  3M56 A;  1UHF A;  3FJP A;  1Q82 C;  4OMQ A;  1YIT T;  1KG1 A;  2RQW A;  3ZFJ A;  3OQ5 A;  1KQS S;  4F7U B;  2M9U A;  4LXC A;  2XIC A;  3CBP A;  2CP3 A;  2WSE E;  3M0U A;  5LJ3 h;  1WJS A;  3CC2 Q;  1WHM A;  5CCA A;  2DL8 A;  4FT4 A;  1UE9 A;  2VGM A;  4R56 A;  2C0I A;  5LJ3 j;  1XQH A;  4LUE A;  2XDB A;  3SWN B;  3INZ A;  2HKQ B;  4M77 F;  3EG9 B;  5KYU B;  4C5G A;  2R5M A;  2LQ8 A;  3M55 A;  3QZ5 B;  4ZGJ B;  1M1K U;  5I2S A;  1G3S A;  5IXF A;  2VXF A;  2X9H A;  2DL4 A;  4PJJ A;  3EFO B;  4ME7 A;  4IKF A;  1TUG B;  1UTI A;  1JJ2 A;  2AT1 B;  3UA7 A;  1QVF A;  2OTL Q;  3CCL A;  3V7S A;  3OYI A;  5HKC A;  2BUD A;  2CUB A;  4J9H A;  4E6R A;  1VQN Q;  2EYY A;  2ZGW A;  2ZPE B;  1SF9 A;  1ZSZ B;  1ZBJ A;  3EH1 A;  1AWO A;  3EGX A;  1UG1 A;  2KYM A;  3NTI A;  5CR2 A;  3CCE T;  3LGF A;  2F5K A;  4LUD A;  3BDU A;  4C92 E;  2RMO A;  3QII A;  2YSQ A;  2L3P A;  2KYB A;  1RUW A;  3PE0 A;  3VS2 A;  3CEY A;  2BE9 B;  2K3Y A;  3VS6 A;  4F16 A;  2FPF A;  2RN8 A;  3HL8 A;  5J3B A;  5GMK m;  3V7R A;  2FYK A;  4HT8 A;  1GCP A;  4LD9 K;  2L3R A;  1YIT A;  2AIR B;  3C95 A;  3AT1 B;  3MP6 A;  2RQV A;  1KD1 U;  2PU9 B;  2F2W A;  3PMT A;  2RHZ A;  3CC2 T;  1KQ1 A;  2JM8 A;  1TS9 A;  1TXQ A;  5FU7 B;  2CYZ B;  4C92 G;  1AVZ C;  4BE0 A;  2V8K A;  1UGQ B;  1JJ2 P;  1WA7 A;  1QVF P;  1WHH A;  1Q81 R;  3QYG B;  1OEB A;  4ATO A;  3TRE A;  2O9V A;  2CS7 A;  4OMM A;  1Z9Z A;  3JCM b;  2OTJ Q;  3OYL A;  2NUP B;  4J9C A;  4JRP A;  2OI3 A;  2YDL A;  2KRM A;  4B9W A;  3EG0 A;  2WAC A;  2OTL T;  4J83 A;  1MMD A;  1U3O A;  2JN0 A;  2E41 A;  2QEX Q;  1S72 T;  3OA6 A;  1VQ8 Q;  2YRD A;  2QDY B;  3DLM A;  3RMS A;  1WHG A;  2F69 A;  3JB9 J;  4AMC A;  4XTZ A;  2CP0 A;  3C0C A;  3A5Z B;  1X69 A;  4ZGE B;  2RJE A;  3JB9 I;  3CCE A;  1W1F A;  3F70 A;  1M30 A;  4C92 B;  1X2K A;  2CRE A;  1M90 C;  1OUL A;  4IUT A;  4M75 G;  5KYY B;  3UWN A;  2DPP B;  1KSW A;  3M0Q A;  2P84 A;  4KRT A;  2GTJ A;  3NTK A;  1WHL A;  4LDX A;  2K5L A;  1T3L A;  2XID A;  2DVE A;  4QKU A;  2RK2 A;  1OU9 A;  1AHJ B;  3A8M B;  3HFN A;  2EJG A;  1Q86 R;  2MWP A;  2KDS A;  2EFI A;  3CC2 A;  2KAF A;  1RL2 A;  1E7O A;  4LE9 A;  3H41 A;  3OYG A;  1Q86 C;  4OF1 A;  4Y92 A;  1J3T A;  2J6O A;  3DKM A;  1Q82 U;  4XTV A;  3M0T A;  1C6V X;  2PTK A;  2JMA A;  5CVI A;  2OTJ T;  4KBM B;  1QCO A;  2KE9 A;  4C5H A;  2KK4 A;  5GAM g;  2P0Q A;  3PIO A;  4FSX A;  5GAM e;  2NLU A;  1UGR B;  3X25 B;  1LOJ A;  2H3E B;  3FDR A;  4FIB A;  3L2Z A;  2OTL A;  2K79 A;  3QSU A;  5LJ5 e;  3OYE A;  4M78 C;  5CO7 A;  1HK9 A;  1N9S A;  4KT0 E;  4AG1 C;  1M8M A;  4PJO A;  2QEX T;  3KFV A;  1VQ8 T;  3FRN A;  3QDF A;  3OYC A;  1S72 A;  2ROT A;  2GFU A;  2V8I A;  4C8Q C;  2DBK A;  3CPW A;  5GAN g;  1U06 A;  3A98 A;  2GF7 A;  3M4Y A;  3JB9 G;  3OB9 A;  4D8K A;  3OW2 S;  2LQN A;  3CQT A;  3OYM A;  3MP1 A;  1YCS B;  4JS4 A;  3MEU A;  4J6Y A;  1QW1 A;  1G8X A;  2GCX A;  4NS5 A;  1D1C A;  1F1B B;  1ZQ1 A;  3ASK A;  1Y57 A;  2RD1 A;  1JB0 E;  2A3L A;  3VYH B;  3A8G B;  1AWJ A;  4M7A F;  1VYU A;  1W4S A;  3CC4 Q;  4M75 C;  1G83 A;  3OY9 A;  2FZK B;  4RTT A;  1EX4 A;  2MOX A;  5GAO l;  2CZ1 B;  2D6F A;  2FO0 A;  4N4H A;  4ANJ A;  1QQJ A;  3X20 B;  4DBQ A;  3QJ6 A;  2K5I A;  2KRS A;  2MWO A;  3MPU B;  1KJW A;  1KC8 C;  3PIP A;  3L2W A;  2EJ9 A;  2R58 A;  3KBG A;  2GQV A;  2OTJ A;  2L5Q A;  2P4T A;  2ZCF B;  5CKF A;  4WF2 A;  3TVT A;  2M02 A;  2FZC B;  3GNF B;  1CKB A;  2LX7 A;  2CT3 A;  1UDL A;  2E12 A;  2EW3 A;  3EG2 A;  4RUG A;  2CZ7 B;  3H0H A;  4PJO F;  2K7A A;  2XDD A;  4JJN K;  2QEX A;  2A28 A;  2RQR A;  3QHS A;  1VQ8 A;  4HXJ A;  1Y96 A;  1YIJ Q;  4C92 D;  2MF2 A;  4B6M A;  3ZL7 C;  2CP5 A;  1OZ2 A;  1U1T A;  2DO3 A;  3G4S A;  2COY A;  3EH2 A;  4M7D F;  5GAN 7;  3E9F A;  3I5S A;  3OBY A;  2KT8 A;  3VV0 A;  1VIE A;  3RDV A;  2PUO B;  3E2U A;  2MPX C;  3FIF A;  4O5V A;  2VV5 A;  1YN8 A;  4D8D A;  3HFO A;  5CIU A;  4XK8 E;  4DBH A;  4AFU C;  1XNI A;  2K2V A;  4J9B A;  3PVQ A;  4L59 A;  2HBW A;  2E3H A;  3PNW C;  3CPW S;  5KYX B;  1OPK A;  5CK9 A;  2QXF A;  5GAO r;  1V29 B;  2L8D A;  2J6K A;  2SEM A;  4F7U F;  2SRC A;  3P8H A;  4FW1 A;  2ED1 A;  1CKA A;  3TEE A; 
#chains in the Genus database with same CATH homology
 2KR3 A;  2AKL A;  4RTW A;  1RI9 A;  3NMZ C;  1E6H A;  1WI7 A;  1M3C A;  1WXT A;  2G6F X;  4OML A;  2DA9 A;  2KNB B;  2NWM A;  2L3S A;  3RBB B;  1NLP C;  1M3A A;  2MIO A;  5IH2 A;  2M0Y A;  2A36 A;  4GBQ A;  1K1Z A;  2I0N A;  1K0S A;  2YUO A;  5IHN A;  1EFN A;  1UHF A;  1X2Q A;  1M3B A;  1K76 A;  2DLP A;  1SPK A;  4OMQ A;  1T3S A;  2JT4 A;  2RQW A;  4RTX A;  3O5Z A;  1QCF A;  2ED0 A;  4RTZ A;  3M0U A;  1UJY A;  1PRM C;  1W6X A;  5FWB A;  2O2O A;  2RF0 A;  2LMJ A;  2W0Z A;  3SHW A;  2YUN A;  3H0F A;  2DL8 A;  4F14 A;  1ZLM A;  1QKX A;  1UE9 A;  1JXM A;  2C0I A;  1ABQ A;  1I07 A;  4LUE A;  2EYX A;  2DF6 A;  3TSZ A;  5IHK A;  1HD3 A;  4A63 B;  3FJ5 A;  2HSP A;  2MCN A;  1NLO C;  5IXF A;  2DL4 A;  3M0S A;  4ESR A;  3UA6 A;  1SHF A;  1UTI A;  2KGT A;  3H0I A;  3UA7 A;  1ABO A;  1SRL A;  1M27 C;  1PWT A;  2GQI A;  3VS5 A;  2FEI A;  4CC3 A;  4R0K A;  2JS0 A;  2CUB A;  2ENM A;  4J9H A;  4E6R A;  2EQI A;  2FPE A;  2V1Q A;  2EYY A;  5GJW B;  1K4U S;  2KXD A;  1ZBJ A;  1AWO A;  2JM9 A;  2BTT A;  2KYM A;  1UG1 A;  2DRM A;  3EHR A;  2DRK A;  4LUD A;  1QKW A;  1FMK A;  2RMO A;  2DL3 A;  2D8J A;  1AWX A;  2YSQ A;  2VKN A;  1JU5 C;  2L3P A;  2KYB A;  1JEG A;  1RUW A;  2DE0 X;  1UUE A;  3PE0 A;  3VS2 A;  1GBR A;  5EC7 A;  1RLQ C;  3VS6 A;  2O9S A;  4LN2 A;  1JQQ A;  2YUQ A;  3M0P A;  4F16 A;  2FPF A;  2RN8 A;  1GCP A;  2DX1 A;  1AZG B;  1B07 A;  5HCK A;  3M0R A;  2DYB A;  2JW4 A;  2DJQ A;  2L2P A;  2RQV A;  1SHG A;  4FSS A;  1NG2 A;  2ESW A;  2F2W A;  1BBZ A;  1WYX A;  2J06 A;  2JM8 A;  4OMP A;  1V1C A;  2B86 A;  2V1R A;  1AVZ C;  4X1V A;  2KEA A;  4OMO A;  2GTO A;  1WA7 A;  2DIL A;  3VS0 A;  4CC2 A;  1H3H A;  1OEB A;  2RQU A;  2O9V A;  3THK A;  1X27 A;  1LCK A;  4OMM A;  4RTY A;  1Z9Z A;  2EBP A;  3UF4 A;  2P4R A;  3R6N A;  1U5S A;  1W70 A;  3LH5 A;  4JJD A;  4RTU A;  4J9C A;  2OI3 A;  2YDL A;  2KRM A;  3EHQ A;  3UAT A;  4J9E A;  3EG0 A;  1BK2 A;  3NGP A;  1I1J A;  1JO8 A;  5ECA A;  4QT7 A;  1MV0 B;  1NYG A;  4M4Z A;  2GNC A;  2VVK A;  3VRZ A;  2DM1 A;  1U3O A;  1WLP B;  1YP5 A;  1VYV A;  1UGV A;  2KBT A;  1GFC A;  2CH4 A;  1QLY A;  2W10 A;  1AD5 A;  2FRY A;  1IO6 A;  1YWO A;  1YNZ A;  1FYN A;  3NHN A;  4AG2 C;  2KRN A;  1HJD A;  3C0C A;  1X69 A;  2OJ2 A;  1W1F A;  4J9I A;  2LP5 A;  1H8K A;  1E6G A;  2C0T A;  1M30 A;  5IHI A;  1X2K A;  2CRE A;  1T0J A;  4AFQ C;  2J7I A;  1KIK A;  1KSW A;  3M0Q A;  2DNU A;  4KRT A;  2GTJ A;  1OPL A;  1AWW A;  2L0A A;  5I22 A;  1PNJ A;  1S1N A;  2H8H A;  4JZ4 A;  2LNH B;  1T3L A;  4AFZ C;  2YT6 A;  1A0N B;  4WCI A;  1VYT A;  2HCK A;  4HCK A;  2K3B A;  4F17 A;  3JV3 A;  1BB9 A;  2DL5 A;  4Z88 A;  1GBQ A;  2LJ3 A;  2PZ1 A;  1E7O A;  2AKK A;  4LE9 A;  2LCS A;  3H41 A;  2LQW A;  1OOT A;  3TSW A;  5IXB A;  2KXC A;  2D1X A;  4Y92 A;  1J3T A;  2J6O A;  3QWX X;  1PKT A;  3M0T A;  1MV3 A;  4HVU A;  1UFF A;  4IIO A;  2PTK A;  2JMA A;  3VS4 A;  3I9Q A;  1Z9Q A;  3I35 A;  2EGA A;  1Y0M A;  2KE9 A;  2A37 A;  4J9F A;  2O31 A;  1N5Z A;  2C0O A;  2OAW A;  1PRL C;  2XMF A;  2DMO A;  2JMC A;  2DVJ A;  1ZSG A;  2EGC A;  1SEM A;  2JTE A;  1PKS A;  2HDA A;  2CDT A;  2K79 A;  2D0N A;  2F2V A;  4LNP A;  1T0H A;  4EIK A;  2EPD A;  1ZUY A;  3IQL A;  2NUZ A;  4AG1 C;  1M8M A;  1ARK A;  1NYF A;  2D8H A;  3KFV A;  1I0C A;  2L3Q A;  1OV3 A;  2ROT A;  2LJ1 A;  2CSI A;  2DBK A;  2O88 A;  1HSQ A;  5FWC A;  1ZUK A;  1AOJ A;  3EGU A;  4Z89 A;  2AZS A;  1U06 A;  3A98 A;  1BU1 A;  1WXB A;  1GRI A;  2LJ0 A;  1X6G A;  4D8K A;  2LQN A;  3CQT A;  2EVR A;  1YCS B;  1AZE A;  1X6B A;  1AEY A;  2DBM A;  3SEM A;  1WFW A;  1WXU A;  2GBQ A;  4JZ3 A;  1GL5 A;  1SRM A;  4J9G A;  1Y57 A;  1GCQ C;  2E5K A;  2FRW A;  3REB B;  4JJC A;  4JPB W;  2DL7 A;  3VRY A;  2X3W D;  4JJB A;  1PHT A;  2EYW A;  1AWJ A;  1YWP A;  1VYU A;  1MUZ A;  1G2B A;  1G83 A;  3VS7 A;  4ORZ A;  4RTT A;  2K6D A;  2MOX A;  2J05 A;  1NEB A;  2EKH A;  2FO0 A;  1CSK A;  1WDX A;  2IIM A;  1RLP C;  3U23 A;  4DEX A;  2BZ8 A;  1GFD A;  1TUC A;  2KRO A;  4DEY A;  2KRS A;  1TG0 A;  1KJW A;  2CSQ A;  3RNJ A;  4HVW A;  3VS3 A;  1KFZ A;  2HEQ A;  2GGR A;  4GLM A;  4IIM A;  1NM7 A;  2CT4 A;  1ZUU A;  1NEG A;  2X3X D;  4OMN A;  3PVL A;  2BZY A;  2EGE A;  2FPD A;  4CC4 B;  2QDL A;  5GJV B;  2F2X A;  3TVT A;  2YUP A;  1CKB A;  5FW9 A;  2LX7 A;  5L23 A;  1QWF A;  2CT3 A;  1UDL A;  2EW3 A;  3EG2 A;  4RUG A;  3H0H A;  2K2M A;  2RQT A;  1K0X A;  2K7A A;  2AK5 A;  4CC7 A;  3VS1 A;  1K9A A;  2J6F A;  2JXB A;  2A28 A;  2BZX A;  2RQR A;  1B3Q A;  4HXJ A;  2PNI A;  4ZNX A;  2EYZ A;  2CUD A;  3ZL7 C;  1WX6 A;  1SSH A;  2VWF A;  3GBQ A;  2KT1 A;  3I5S A;  4HVV A;  4Z8A A;  2A08 A;  1GCQ A;  2KT8 A;  2AZV A;  1QWE A;  2JS2 A;  3QWY A;  4K11 A;  1H92 A;  1YN8 A;  3REA B;  2ABL A;  1UEC A;  1UHC A;  4D8D A;  3I5R A;  1TUD A;  4AFU C;  3EG1 A;  2ECZ A;  3EG3 A;  2FG0 A;  4AFS C;  2LZ6 B;  4J9B A;  3PVQ A;  1ZX6 A;  4RTV A;  2CH4 W;  2HBW A;  1UJ0 A;  3ULR B;  1OPK A;  1X43 A;  2RNA A;  1VA7 A;  4J9D A;  1JXO A;  5I11 A;  2J6K A;  2SEM A;  2ROL A;  2RPN A;  1XOV A;  2SRC A;  1WIE A;  2K9G A;  2M51 A;  2ED1 A;  3NPF A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...