2MIOA

Solution nmr structure of sh3 domain 1 of rho gtpase-activating protein 10 from homo sapiens, northeast structural genomics consortium (nesg) target hr9129a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
MGHHHHHHSHMIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Rho GTPase-activating protein 10
publication title Solution NMR Structure of SH3 Domain 1 of Rho GTPase-activating Protein 10 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9129A
rcsb
source organism Homo sapiens
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2mioA00
3ULRB 5IHKA 3A98A 2C0TA 2HCKA 2C0IA 2DL7A 2RMOA 2LZ6B 1BK2A 2DYBA 1K0SA 4OMQA 3I5SA 1X43A 2X3XD 1XOVA 5ECAA 2CSIA 1GCQA 2ECZA 3SHWA 4F16A 3PVLA 2CH4W 2J05A 1IO6A 1WI7A 4JZ3A 1GFCA 2D8HA 1SRMA 2V1QA 5HCKA 2I0NA 2DM1A 2EYZA 2JS0A 2KR3A 1X27A 2JS2A 2DBMA 1RUWA 4J9HA 1A0NB 2DL8A 2FRWA 2JTEA 4RTWA 2LJ0A 1PKSA 2DNUA 1CKBA 1RLQC 1KJWA 2MCNA 4AFQC 1VYUA 1NG2A 1X2QA 1I07A 3VS6A 4AFUC 4OMLA 2VWFA 4KRTA 3H41A 1QKXA 1SRLA 1K9AA 1MV0B 5I11A 2EQIA 4Z89A 2BZ8A 2KEAA 2DX1A 2ED0A 4RTUA 1AEYA 1YWOA 1WYXA 2D8JA 3VS5A 1I0CA 3NHNA 1BB9A 1HD3A 2YUOA 2YUQA 2FPFA 1ABQA 3IQLA 1V1CA 2LJ3A 1SHFA 2X3WD 3M0RA 1ZX6A 5EC7A 1MUZA 1PRLC 2FG0A 1K0XA 4X1VA 1OEBA 5FWBA 2J6OA 1UHFA 3NMZC 1SPKA 2ESWA 1GBQA 2GQIA 4EIKA 1UUEA 3VS3A 1JU5C 2K3BA 2A08A 1AOJA 2EPDA 3ZL7C 1LCKA 1Z9QA 2J06A 2EYXA 2RPNA 2AK5A 2O2OA 4HXJA 1GRIA 1B3QA 1YP5A 4M4ZA 1CSKA 2E5KA 3VRZA 2AZSA 1U06A 3VS2A 2RN8A 1WXTA 2RQVA 1KIKA 3M0TA 2LQWA 2DL3A 2GBQA 2A37A 3VS1A 3I5RA 2DVJA 1EFNA 2K6DA 2W10A 4Z8AA 4J9IA 1GL5A 1UTIA 1KFZA 5FWCA 3THKA 2D1XA 1PKTA 3I35A 1GFDA 2OJ2A 3REAB 1G2BA 2DBKA 4JZ4A 2K79A 2CDTA 1Y57A 1UFFA 1T0HA 1MV3A 3EG1A 4Y92A 5IHIA 2HBWA 1W6XA 2RQTA 1M3BA 1ARKA 1M3CA 2LJ1A 1PRMC 1NYGA 2QDLA 1PNJA 2ED1A 5I22A 1ZUKA 2F2VA 2W0ZA 2LMJA 1ZBJA 2KNBB 2ENMA 2NUZA 1X6BA 2OAWA 1QWFA 2KYMA 1UECA 4E6RA 2HSPA 4RTXA 1YWPA 1E6GA 4RUGA 5IHNA 1J3TA 1W1FA 4CC4B 2EGAA 3UA7A 2ROLA 1FMKA 2JM9A 1VYTA 2DRKA 2LP5A 2O9VA 1SEMA 1PWTA 1NYFA 1WLPB 2J6KA 2L3QA 2SEMA 3RNJA 4RTTA 2JM8A 1NM7A 4DEXA 1WA7A 2KROA 4D8DA 2KRMA 4HVWA 1AWOA 1QLYA 3QWYA 3U23A 4HVVA 2YT6A 4IIMA 4A63B 1NEBA 3KFVA 4RTZA 1HSQA 1SHGA 1E7OA 4AG2C 1AZEA 1JXMA 2EGCA 1N5ZA 2KT8A 2CUBA 2DILA 2OI3A 2D0NA 1VA7A 1K1ZA 1ZUUA 4AG1C 2JW4A 1ABOA 1FYNA 2EW3A 5IXBA 2B86A 1B07A 4LE9A 5GJWB 2EKHA 1UJYA 1WXBA 3TSWA 1QWEA 1RLPC 3M0SA 2KXDA 1NLOC 1M3AA 2L0AA 2KYBA 2EGEA 2GGRA 2JMAA 2XMFA 3JV3A 3PVQA 4J9GA 2GTJA 2O31A 4J9EA 2KBTA 2CSQA 1UHCA 2YDLA 5FW9A 2H8HA 2RQUA 3H0HA 2YUPA 2HEQA 1T0JA 5GJVB 3NPFA 4QT7A 3VS7A 1AWWA 2BZYA 3EG3A 2J7IA 2O9SA 4CC7A 1QKWA 2AZVA 1AWXA 3I9QA 2FO0A 4OMNA 1QCFA 2P4RA 2DA9A 2FRYA 3GBQA 3VRYA 1UGVA 2L3SA 2RF0A 1UDLA 1YCSB 3REBB 5L23A 4LNPA 1OPKA 1UG1A 1JXOA 2CH4A 3C0CA 4JJCA 1S1NA 2C0OA 2DE0X 2DJQA 3EG0A 3UATA 1TUCA 2L3PA 1YN8A 1RI9A 1TUDA 2BTTA 4LN2A 1WDXA 1HJDA 3QWXX 1E6HA 4JJBA 4CC2A 2ABLA 2V1RA 1OV3A 3EGUA 2KXCA 3H0IA 4FSSA 1H8KA 2PTKA 1GBRA 3PE0A 4DEYA 2LNHB 2L2PA 2CUDA 1M8MA 2AKLA 2DF6A 4RTYA 4AFZC 4J9FA 5IH2A 1GCPA 2EYYA 4JPBW 4LUDA 1K4US 2ROTA 4LUEA 1I1JA 2SRCA 3VS4A 3EHRA 4GBQA 2M0YA 3FJ5A 2AKKA 3LH5A 4OMOA 1OOTA 1SSHA 4ZNXA 2DL5A 1ZLMA 4HCKA 1G83A 1ZUYA 3NGPA 1VYVA 2YSQA 4CC3A 2MIOA 2G6FX 2PZ1A 1PHTA 1WFWA 1UJ0A 1H92A 2VKNA 4OMMA 1JO8A 2M51A 4OMPA 2A28A 3M0UA 3R6NA 2F2XA 4IIOA 1X6GA 1NLPC 1K76A 3O5ZA 1UE9A 5IXFA 4HVUA 2F2WA 1GCQC 4ESRA 4GLMA 2CT4A 2K7AA 3EG2A 3TSZA 1WXUA 4D8KA 3CQTA 4F17A 1AWJA 1CKAA 1KSWA 2PNIA 1JEGA 2EBPA 2FPDA 1M30A 1W70A 4R0KA 1NEGA 3H0FA 1T3SA 2JT4A 2CT3A 1WX6A 3UA6A 2IIMA 2MOXA 2RQRA 4F14A 1AD5A 2DLPA 1WIEA 3UF4A 3SEMA 4J9CA 2LCSA 1Z9ZA 1OPLA 2KRNA 2O88A 2GNCA 2RNAA 4K11A 1YNZA 2HDAA 3M0PA 1BBZA 3TVTA 2KE9A 1AVZC 2K2MA 3VS0A 2KT1A 1JQQA 4RTVA 2FEIA 2FPEA 1U5SA 4ORZA 2NWMA 2LX7A 4JJDA 2DL4A 2YUNA 3RBBB 2EVRA 2KGTA 2VVKA 1ZSGA 2EYWA 1BU1A 2KRSA 3M0QA 4WCIA 1M27C 4AFSC 2CREA 2DMOA 1X69A 1T3LA 2BZXA 2JXBA 2RQWA 1AZGB 4Z88A 2LQNA 4J9BA 2JMCA 3EHQA 2DRMA 2GTOA 1U3OA 1X2KA 4J9DA 2A36A 1TG0A 2K9GA 1Y0MA 1H3HA 2J6FA
chains in the Genus database with same CATH superfamily
3ULRB 1M1KR 3FDRA 2DZCA 5IHKA 4M78E 3LWIA 1VQMQ 3I55T 2JUFA 1VQKQ 3CCMQ 1ZSZC 5KE3A 2DYBA 1VQ7T 3M56A 2X3XD 1XOVA 3QO3A 5CIUA 2CSIA 2ECZA 2QQRA 2DXTA 5GANg 2CH4W 2LRQA 5GANe 1QCOA 2J05A 2KY9A 1G3WA 3FB9A 2D8HA 5HCKA 2I0NA 3PT9A 4IUUA 5CKDA 2LC4A 2E6NA 4M7DG 3H6ZA 2QGGA 2KR3A 3OYBA 4TVRA 2MMPA 2L3RA 2JTEA 4XU2A 1K8AC 3JCMP 2HSEB 3CXCA 1RLQC 4BE2A 1KJWA 3OYYA 2D9TA 1OULA 3M9QA 1YIJA 1QKXA 4EPCA 2EQIA 4Z89A 2BZ8A 2KEAA 2P0KA 2DX1A 2ED0A 2PQWA 4EMKB 1YI2T 3OS5A 3L42A 5KYXA 4HCCA 1TUGB 3CCUA 2QTXA 4II1A 4FCYA 1D1BA 3VS5A 2BE9B 2V26A 4WTOB 1IGUA 3JB9J 1YJWA 2LQKA 1ABQA 2XDBA 2LJ3A 1WJQA 2BE7D 2X3WD 1VQNT 3RR6A 2FG0A 2ZPHB 4C92A 4MDWA 4BE1A 3V7CA 3QKJA 1GBQA 2RB6A 1NBEB 1KC8R 1D0YA 3C4SA 3CXCS 1VQ7A 2P0PA 1AOJA 4J5YA 1D3BB 1G3SA 2Y90A 4QQDA 1QVFP 4M7AC 2JNGA 2R5MA 3QZ9B 3OYHA 4XTYA 4HXJA 1YP5A 2JJ9A 3P8DA 2M9UA 4JLGA 3SB2A 4PLIA 1CSKA 3VRZA 2K3XA 3NFCA 4R56A 3VS2A 1Q82U 3WXMB 2LQWA 3L2QA 4DA4A 2DL3A 2GBQA 2A37A 3VS1A 2DVJA 2RJDA 5CR2A 2K6DA 2QDYB 2W10A 3OYCA 1VQ9A 4PJOF 4J9IA 4UC4A 1GL5A 3OBYA 3CCQQ 1KFZA 3THKA 3G6ET 1GFDA 5GAN4 1VQMA 4X9CA 3REAB 1WQWA 2E65A 4AT1B 1G2BA 2DBKA 2QXFA 4FYXB 2Z0WA 2ZPGB 1MV3A 3EG1A 1I81A 3NTHA 4BACA 4C92D 1VQNA 2CP5A 2RQTA 1U1SA 3CCVQ 3UDCA 2ED1A 2CS7A 4PJMA 1Q82C 1MMNA 3JCMh 2KNBB 4E6RA 2DYIA 2HL5C 4B6MA 3PFSA 4XTUA 1E6GA 3EH1A 1J3TA 1TU0B 2MK5A 2JM9A 3CCLT 3CCRT 2LP5A 4JRQA 3RNJA 1N9RA 1YJNT 2M1HA 3A8OB 1P92A 3CCSQ 5LJ3g 2KRMA 3LYIA 4HVWA 4F7UB 3X26B 5LJ3e 3QWYA 1G5VA 4F7UE 1M1GA 3G1JA 2XDPA 4Q5WA 3JCMW 1E7OA 3PMTA 3EG9A 1JXMA 5D6XA 5GAMh 2M0OA 1Y07A 4OB1B 3MEVA 1UGSB 2DILA 2OI3A 2D0NA 4RCCA 2OTJQ 1K1ZA 3OYKA 1ZUUA 2NLUA 1ABOA 5CQYA 1WQ7A 3DB3A 1FYNA 3DLMA 2B86A 4MZTA 2EKHA 3E9GA 5GMKl 5KE2A 2IPOB 3MPUB 1QWEA 4HA8A 2E6ZA 4BY6C 1QQJA 3PMIA 4LDWA 2GGRA 2JMAA 2XG8D 3JCMX 2DD5A 4DOVA 3CC2Q 4LDXA 8AT1B 4M7DD 3RMSA 2H8HA 4C8QF 2CP6A 1RAFB 4EMGA 3V7SA 4FL6A 3OW2P 3EG3A 2O9SA 1VOMA 1B34B 2NUTB 4OMNA 1Q7YC 2YXYA 1BIAA 1BI3A 1MMAA 3KUFA 2LTOA 3REBB 1UG1A 1B7TA 3OYAA 4L6V5 3ASKA 1M90R 1KD1R 1VUBA 1YJNA 4HCBA 1R77A 2F5TX 2RHXA 2QAZA 2RJCA 2MYSA 1TSFA 1IRXA 4M78G 4C5HA 3QBYA 2E12A 3MJXA 3LGFA 3QWXX 5GANd 4JJBA 1WHKA 3MKDA 4KUDK 4M7DB 3H0IA 1BKBA 1GBRA 2HQXA 5GMKe 3M58A 2L2PA 2CUDA 3CCVA 2AKLA 2HQHA 3T9NA 1Q81U 2IG0A 4LUEA 3JCMf 2P84A 2DZ9A 2X4JA 1N8RU 4LDVA 4GBQA 3FJ5A 4E7JA 1QMCA 1OOTA 1TTHB 4J83A 3CD6T 1ZUYA 1VQ8Q 4C0FA 3NGPA 4XTVA 3BDLA 2YSQA 2PZ1A 1WFWA 3AHUA 1PSFA 3CPFA 3OYFA 2M02A 3R6OA 3OQ5A 2F2XA 3CC4Q 3HTRA 3O5ZA 3CPWA 1K9MU 2XIDA 5A2QE 2HNIA 2FB7A 3M4YA 3PNWC 4N4IA 3CC7Q 4PJNA 3SWNB 2VXFA 2F2WA 4MMKA 4LD9K 3OS1A 4ESRA 4R55A 4GLMA 4O5VA 3TSZA 5GAMf 5CAIA 4D8KA 3CQTA 1KSWA 1AHJB 3RERA 2AT1B 2FPDA 3G7ZA 5GAN7 4LD6A 1BI2A 3MP8A 3H0FA 1Q81C 1T3SA 2DTOA 3OYLA 1N8RC 2JZ2A 5I2MA 2FVUA 2MOXA 1NJIU 1QCNA 1IGQA 3DKMA 1AD5A 1YBYA 1WIEA 1BI0A 1OPLA 2GNCA 2RNAA 2HDAA 3JSCA 4XTXA 1M4ZA 3TVTA 3X20B 2KT1A 5CK9A 3HP9A 5FROA 4IUTA 3CC2A 2DL4A 4JUVA 5C6SA 1RAGB 4XTWA 4HT8A 1BU1A 3M0QA 4OB2B 3CPWS 4WCIA 1M1KU 4AFSC 1WHJA 2CREA 1K9MC 8ATCB 4C5EA 1AZGB 3QDRB 3EAEA 1VQLT 2R5AA 2GTOA 1JRIA 1Y0MA 4C92C 2ZPEB 4JRIA 3A98A 2DL7A 2RMOA 5GANj 3VYHB 1I5OB 1K0SA 3X28B 3I5SA 2HKNA 1X43A 2EAYA 1NZ9A 1R0BG 1YITT 2CZ6B 1ZA2B 4F16A 2CZ1B 2HKQB 2L5QA 2COYA 4PJOG 2BKDN 5GAOp 3QHSA 1IO6A 4JZ3A 4J8OA 2O4XB 4M7AF 1GFCA 2DM1A 3HHTB 2EYZA 4XU1A 2JS0A 3AT1B 3UPUA 1M1KC 2RJEA 4ZTJA 1QW1A 2OX7A 3X24B 2JS2A 2DBMA 4FYWB 4BI3A 3CMAT 2FRWA 2LJ0A 2DNUA 2YRVA 1CKBA 5CCAA 2MCNA 4AFQC 3G71T 4M7AB 1O9SA 1IREB 3RUXA 1BIBA 4M7AE 1W2BP 1VQ8A 1MV0B 1IHVA 3CCUQ 1RL2A 3S3OA 5LJ3d 1WYXA 1YJWQ 3CC4A 3BDUA 2VV5A 1BB9A 4NL2A 4EMKA 1KC8U 3MEUA 3CC7A 4F7UG 4PL6A 3RMQA 5HKCA 1SHFA 3LLRA 1KQSP 1ZX6A 1D09B 1PRLC 3I55Q 1ACMB 1KG1A 1K0XA 2H3EB 1OEBA 3V8LA 4KT0E 3NMZC 4IUQA 4P5NA 1SPKA 1D1AA 3CBPA 1Q86C 3SFMA 1JU5C 3OMCA 2LVMA 3BE3A 2EPDA 2EQMA 3QIIA 1LCKA 2CP7A 1Z9QA 2YHTA 5DLQE 1M2VB 2RPNA 2O2OA 4GY5A 4OP0A 1D3BA 2GFAA 3ZEHA 4AMCA 4M4ZA 5LJ5g 1SSFA 2QQAA 2AZSA 4JRKA 5GAN8 5LJ5e 5J3BA 3FJPA 1U06A 2RN8A 1V76A 1WXTA 2RQVA 3CMAA 5FRNA 1KC8C 3JCMc 1KHIA 5DLOA 2NUPB 3G71A 1BYMA 2FL7A 3I5RA 4Z8AA 4M78B 1YI2Q 2ZGWA 5J26A 4PKCC 3MEAA 4KGXB 1Y71A 1PKTA 4XU3A 4RMOA 4C8QG 4BB7A 2DK3A 4M77B 3EGDB 1IXDA 4M77E 3L1AA 4JDSA 3HRTA 2RH2A 1VQNQ 2X4WA 2R57A 4Y92A 4J7IA 5KYYB 3PIOA 1ARKA 1M3CA 1K73R 1PRMC 2QDLA 1S72T 4RKUE 2DD4A 1ZUKA 2F2VA 5C0MA 4E47A 2X9HA 4LDUA 4BE0A 2NUZA 1QWFA 3JCMg 3JCMe 1YWPA 4RUGA 5IHNA 4N4HA 2EQKA 2HBPA 1OX9A 1QP2A 3UA7A 1VYTA 2O9VA 5LJ3j 2J6KA 5A0GA 3LWHA 1QVPA 4RTTA 4DEXA 3JCMb 2KROA 3KBGA 2PVOB 4D8DA 4Y91A 2EJGA 4HVVA 4IIMA 2I2LA 1HSQA 1SHGA 4AG2C 4MZPA 4F7UA 5LL6S 2EGCA 2IVWA 3G6EQ 3RKXA 2QASA 3GOXA 3OYEA 3I55A 4C0GA 4WF2A 4IUPA 3MO8A 3G4ST 2K57A 2F5KA 3N5BB 1M5Q1 1MMDA 2CYZB 5GAN3 1UJYA 3GF5A 1YJ9T 3TSWA 1RADB 2XDDA 1YHQT 4VUBA 1HK9A 3A8MB 1NLOC 2DFUA 2L0AA 1RACB 3LH0A 3HFOA 1WPYA 2ZPBB 1WNLA 4J9EA 2O31A 2XI9A 1JJ2P 1UHCA 1VQ4T 1S72A 2CKKA 2YUPA 4BI4A 1M90U 1AWWA 2BZYA 4C5GA 4CC7A 2OTLT 5FLXE 2MAMA 1QCFA 3CCLQ 3CCRQ 4E7LA 1YCSB 1B34A 2EYQA 3MEWA 2NUTA 3OYDA 1YJNQ 1YI2A 3L2UA 1YCYA 2CH4A 1FWZA 3C0CA 3E19A 4JJCA 2P0QA 5HY6A 3UWNA 3EG0A 2A0FB 3UATA 2RK1A 2L3PA 1VQOT 3S3MA 4E7SA 3HL8A 4PJOB 3JB9F 1WDXA 4PJOE 3FLGA 5GMKj 3OY9A 2QK0A 2F1LA 2V1RA 1K8AR 2RHYA 2KXCA 1MHNA 2VGNA 1VIFA 2E3IA 2K5FA 4C0DC 4O6JA 1Q95G 4M7DA 3G4SA 1N9SA 4J9FA 1M90C 4LUDA 1K4US 3L2VA 1RAIB 2X4YA 3VS4A 1ZA1B 1RI0A 2QI2A 3E1SA 2FZGB 3TQ7P 1YHQA 2JN0A 2EJFA 5HK3A 3VUZA 4ZNXA 2DL5A 3JCMQ 2LT4A 4M7AG 1VQ4A 2G6FX 1PHTA 3S6WA 4C92F 4OMMA 1IHWA 4M75C 3M0UA 2GCXA 1BCMA 1X6GA 3KXTA 2K5IA 1YFNA 2E70A 1M2OA 4ZGEB 5IXFA 4J6WA 3MHXA 5D6WA 2CT4A 4X9DA 3G6EA 1WXUA 5KCOA 2DXBA 1CKAA 3SWNA 4C92E 2JTMA 4A54A 2BUDA 3TU4K 4BI8B 4ZN3A 4QQ6A 2RK2A 3INZA 3DB4A 2IIMA 5GAOr 3Q1JA 4F14A 4J6YA 3OSVA 5IT9E 2LCCA 4J9CA 2LCSA 3RDVA 3M0PA 2KE9A 2K2MA 3VS0A 2XU8A 1UGQB 4Y28E 2FEIA 2FPEA 5LJ5d 3OYJA 2NWMA 2JTFA 1UGPB 2LX7A 1RAHB 5GMKm 1XJWB 2RI5A 9ATCB 3SD4A 1ZSGA 2RD1A 2KRSA 3OYGA 1M27C 2Y4YA 5I21A 3CD6Q 4QQGA 1OZ2A 4DBHA 4EMKC 4RCBA 2VXEA 4C8QB 4J9BA 4OGCA 3CCRA 3CCLA 2JMCA 4C8QE 3L2RA 2DRMA 4A4EA 2QEXT 2FHDA 3QYGB 2E41A 1U3OA 4J9DA 1TG0A 2K9GA 4B9XA 1OZ3A 5M9OA 1G3TA 2LNVA 5CVIA 2C0IA 3M59A 1BCOA 3C12A 1V29B 3OYNA 1WHHA 4FT2A 2WSCE 1BK2A 2E3HA 1BI1A 2DERA 4OMQA 4ZGJB 4M77G 3C94A 2XICA 1R0CB 3X25B 3JCMV 4IURA 4FT4A 3PVLA 1H641 1VIEA 1LVKA 2V1QA 1TOVA 4OB0B 4KBMB 4J7FA 2Y4XA 3CXCP 2O4XA 2DJZA 4PJJA 3JCMd 1RUWA 4N0AA 2YWWA 1RAAB 3EFRA 1MNEA 3PTAA 2DXCA 1VYUA 1NG2A 1I07A 2D0QB 3VS6A 2VWFA 4DQ2A 4E2FB 3J81E 2DETA 4RTUA 4M7AA 4EMHA 4BD3A 1F1BB 1YWOA 1TS9A 2HMAA 3BW1A 5D6YA 1I0CA 1OX8A 3NHNA 1I5LA 4FYYB 2RHZA 1VQLQ 5LJ3h 2YRCA 2YUQA 1D0ZA 3OYMA 2FPFA 4A4KA 1M9SA 5FU6B 3IQLA 3PGGA 3M0RA 4BUGA 3EGXB 5EC7A 1GXIE 1MUZA 3I56T 2FZKB 2LX9A 1PC0A 4X1VA 1ZSZB 5FWBA 3JCMJ 1UHFA 2GFUA 2K2VA 2YLBA 1OYXA 1UUEA 3VS3A 3OYIA 1YITQ 4LDYA 1FMVA 2ATCB 1Q7YR 5CKFA 5LJ5j 2J06A 4QVCA 2EQJA 3RIRA 1GRIA 3H8ZA 4C0ZA 3TEEA 3WVEB 1QVFA 1M2VA 3CMAQ 4QVDA 3CCJT 1QVGP 2QA4T 1G3YA 1SG5A 3G71Q 1KIKA 2KMTA 3M0TA 4QVZA 4X34A 3CD6A 1Y96B 2K5LA 1EFNA 4KH0B 4HKEA 4M7AD 2NUPA 1LPLA 2HL3A 1C0MA 1UTIA 4XQ3A 4FM4B 2D1XA 1NJIC 4M78A 1K73U 5GAN5 2CZ0B 1KQ2A 3DLLA 4OF1A 1NPRA 2GF7A 4JZ4A 2K79A 2CDTA 1OI1A 1FMWA 4M77A 2DEQA 2DIGA 1UFFA 3EGDA 5KYNA 1VQPT 5DY9A 3CMET 2HBWA 3URGA 4MZMA 1W6XA 5D7UA 1QVFS 2LJ1A 3I56A 2V8KA 1KQ1A 1U1TA 1NYGA 2K4YA 2NYSA 3HRUA 3LW5E 4PK4A 5KYYA 2QQBA 4NS5A 2HZYA 3QSUA 1X6BA 1UECA 2CGHA 1MMGA 1VQ6T 2KQWA 1WJSA 3JB9G 1NE8A 2XHCA 3NTKA 4CC4B 3M5AA 3GP8A 1XNIA 2EGAA 3HPWA 1OQKA 1SEMA 1PWTA 1NYFA 1WLPB 1K73C 2SEMA 3CCJA 3GNGA 3C95A 2JM8A 1NM7A 1LJOA 1VQLA 5LJ3f 1AT1B 1NEBA 1WJRA 1UGRB 4RTZA 3LX7A 2COWA 2C06A 4HCZA 2VYTA 4KH1B 2KT8A 2CUBA 4M78D 4JLIA 3EFSA 4C5IA 2JW4A 4M7DC 4C92G 2MWPA 3P8BB 5DM7R 2JVVA 5IXBA 4M77D 4LE9A 1B07A 1YITA 1EX4A 1WXBA 2JOYA 3OS2A 1VQPA 3CMEA 5I2SA 2KYBA 2EGEA 2QG9B 4A4FA 1S72Q 1N27A 3PVQA 1XQHA 2ZAEA 2X51A 2GTJA 5GAOq 2CSQA 4NOYA 2YDLA 3A1PA 3A8GB 1YIJT 1C6VX 2HEQA 2A3LA 3JB9H 3VS7A 2KSSA 4A53A 4M75F 2GQVA 2J7IA 4PJLA 1VQ6A 3CCET 2FO0A 1KHCA 2P4RA 2DA9A 2FRYA 3OW2A 2QTVA 2L3SA 2RF0A 3HFNA 4A4GA 1X01A 4BDYA 3OBWA 2LQ8A 4LNPA 7AT1B 1K8AU 1OPKA 3OA6A 3V7RA 3SWNC 3EFOB 2YRDA 2DE0X 2DJQA 1WGSA 4M75E 1RI9A 3TREA 2BTTA 1VQ5T 3EH2A 3M57A 1E6HA 4CC2A 4PJOA 4J6XA 5KYWB 4FSSA 3QJ6A 4GLKA 1H8KA 2PTKA 3G4SQ 2DKGA 4DEYA 2LNHB 2FZCB 5KCHA 2H3JA 4RTYA 1YJ9Q 2DVEA 5IH2A 2FYKA 3BY7A 1YHQQ 4BY6B 1SF9A 1X6OA 4XAXB 2SRCA 3QPHA 3OW2S 5CKHA 2M0YA 1I4K1 2AKKA 2RA2A 1EIFA 4OVAA 1VQ4Q 1ZLMA 2COZA 1G83A 2B8AA 3QZ5B 5KYUA 4CC3A 2MIOA 2KI7A 1VQ9T 1H92A 2EIFA 6AT1B 3CPWP 2VKNA 3J80E 2OTLQ 1JO8A 4OMPA 3R6NA 1K76A 3CCEA 1Q86R 1VQMT 4ELZC 2KDSA 5GAMg 1VQKT 4ATOA 3CCMT 5GAMe 4RG2A 1TWBA 3EG2A 1WHMA 3M54A 3META 4F17A 1AWJA 3UT1A 1JEGA 5KH6A 1VQOQ 2XD0A 1IB8A 1NEGA 2PVGB 3VJPA 1JBMA 2JT4A 2PUOB 2DPPB 3RESA 2RQRA 4D6WA 4N0AC 1PG5B 1VQ5A 4PJOD 2DLPA 1Z9ZA 3VUBA 2DEUA 2KRNA 1G8XA 4K11A 1YNZA 5FRMA 1UB4A 1AVZC 4RTVA 1U5SA 4ORZA 1KD1U 4QW2A 4ZTFA 2YUNA 3RBBB 2EVRA 2KGTA 1M1FA 2VVKA 4B9WA 2AIRB 3O8VA 5LJ5h 2EYWA 4E7ZA 3JB9D 2DMOA 3MP1A 1W4SA 3V8JA 1PSEA 2BZXA 2JXBA 4Z88A 4RG8A 2AHJB 3QXEB 1QVGA 3ZFJA 3EHQA 2KAFA 2L89A 3ER0A 5FU7C 1U8RA 4C8QA 2E1HA 1H3HA 4N4GA 2HQEA 2J6FA 2DXUA 3OS0A 4MDXA 2C0TA 4DOWA 2HCKA 4XK8E 2LZ6B 2VGMA 3CBMA 1IZ6A 3VV0A 4BDZA 5ECAA 5GANh 1VQKA 1GCQA 2DTIA 3CCMA 3SDZA 3SHWA 1TXQA 2V8JA 2YLCA 2VB6A 1KD1C 1WI7A 3M55A 1SRMA 1YJ9A 4PFZA 4ELYC 2MWOA 2P4TA 1X27A 4QKUA 5CO7A 2WSFE 4J9HA 5KYUB 1A0NB 2DL8A 3PIPA 3JB9I 3JAME 4RTWA 4E7HA 4CI0C 1PKSA 1QVGS 2QGFB 1X2QA 4AFUC 4OMLA 5A0DA 4L59A 3MP6A 4KRTA 3H41A 4F7UF 1SRLA 1K9AA 4FU6A 5KYXB 5I11A 2X4XA 3E2UA 1WZOA 2G3RA 1HXDA 3WVDB 1W2BA 1AEYA 2OTLA 4M78C 4DBFA 3CCQT 3E9FA 2EWNA 2D8JA 4JJNK 1HD3A 5GMKi 2QEXQ 2QQ9A 2YUOA 1QP3A 4M77C 4OB3B 3FIFA 4C92B 5EG2A 4C8QD 1V1CA 4Z02A 2M16A 2HD0A 1Q7YU 2CP0A 2KK4A 4FW1A 1VQOA 3VU3C 4L5GA 3F70A 2J6OA 2EFIA 1KQSA 3EGXA 2ESWA 2DTHA 2GQIA 5CKBA 4EIKA 2CP3A 3CCVT 3BFMA 1ZSZA 2K3BA 4DBQA 2A08A 1D1CA 3ZL7C 4ZN1A 2D6FA 5L8RE 1FXXA 2EYXA 2AK5A 3HKSA 2RO0A 1SKUB 4JS4A 4FW2A 2XK0A 1KK7A 1B3QA 1W2BS 5HK0A 2E5KA 1WHGA 2QYZA 5LJ5f 1OU9A 3ME9A 2EQUA 3CCST 1M8VA 4LXCA 1MNDA 5AT1B 4XTZA 4E7KA 1EZZB 1Y96A 3A5ZB 5FWCA 2VUBA 1Y7XA 1KQSS 4OGEA 1Q82R 3I35A 4M7DF 3CCQA 2OJ2A 2OTJT 4OMFB 4M75G 1WHLA 4XU0A 2VC8A 2V8IA 2LDMA 3OB9A 2CZ7B 3VYGA 4JS5A 1Y57A 2A7YA 1T0HA 5GANf 4PFOA 1MGQA 3I56Q 3J7AF 1PM3A 5IHIA 3GPLA 2RI3A 2HAXA 2OAUA 1N6AA 3QJYA 2F69A 1M3BA 3LGLA 3ZBDA 1PNJA 4M7DE 5I22A 2W0ZA 2LT1A 2ZPIB 2LMJA 4NL3A 1ZBJA 2E10A 3CC2T 2ENMA 3V8KA 2OAWA 2KYMA 3JRZA 2E5QA 1D0XA 2HSPA 5IN1A 4RTXA 1LOJA 4IKFA 4E7IA 1W1FA 3CCJQ 2ROLA 1FMKA 2QA4Q 4KUIA 1OU8A 2DRKA 3GIBA 4FIBA 1C1AA 2L3QA 1WA7A 4F04B 1AWOA 1UEBA 3EG9B 2RJFA 1QLYA 2X35A 1H3ZA 3U23A 5GAMd 3CCSA 2YT6A 2QEXA 4A63B 3QYHB 3KFVA 1AZEA 4PJOC 3FRNA 3FC3A 1N5ZA 2L8DA 4ANJA 2BIVA 1VA7A 2CP2A 4AG1C 2EW3A 2QQSA 2OTJA 2RHIA 1VQPQ 2DO3A 3M53A 3NTIA 5GJWB 3CMEQ 4CRIA 3TCJA 4FYVB 2E64A 3CEYA 1RLPC 3M0SA 2KXDA 1M3AA 1R8OB 2E4HA 2XMFA 3JV3A 5CKEA 4IUVA 4J9GA 4ZGDB 5IAYA 2KBTA 5FW9A 2RQUA 3H0HA 1VQ6Q 1VQ8T 1PCXA 3L2WA 1T0JA 4V2SA 5GJVB 3NPFA 4QT7A 1JJ2A 4PLLA 3D7SB 4FSXA 1QKWA 2AZVA 1AWXA 2MPXC 4KGVB 3I9QA 2O01E 3GBQA 3OMGA 3CC4T 3VRYA 1UGVA 1UDLA 4EDUA 2PUKB 5L23A 3CBOA 3CC7T 1RAEB 1JXOA 1ZQ1A 2RI2A 5J39A 1S1NA 2C0OA 5GAN6 3GNFB 1TUCA 1YN8A 3EFOA 2R58A 1TUDA 2EKOA 2RM4A 2ZZDA 2ZPFB 3FEOA 4LN2A 2RHUA 4M75A 2MF2A 1HJDA 4KGZB 4DBRA 3MCAB 1DJ7B 2ABLA 4YTLA 1OV3A 5GMKh 3EGUA 1PD0A 3PE0A 3A8HB 4PNOA 3RKWA 1TH7A 1M8MA 2DF6A 5KYWA 3HRSA 5AYFA 4AFZC 1JJ2S 1XTDA 1GCPA 2EYYA 4JPBW 1ZBXA 4KULA 2ROTA 1LNXA 1I1JA 4HT9A 4JRPA 1I8FA 2PVDB 3EHRA 1JB0E 3LH5A 4OMOA 2VASA 1SSHA 3VKIA 3S3NA 1Q86U 4HCKA 1YIJQ 5A0LA 2QA4A 1VYVA 4C8QC 1O75A 1NPPA 1UJ0A 1Q81R 2DIQA 5GAN2 2M51A 3CCEQ 2WACA 1N8RR 2A28A 5GAMj 4IIOA 3QUIA 1NLPC 1UE9A 2DAQA 4HVUA 1RABB 1GCQC 5FU7B 2K7AA 3GLXA 1ZHIA 2PNIA 3P8HA 2EBPA 5CQXA 1M30A 1W70A 4PFPA 1VQ5Q 4R0KA 4M75D 2CT3A 1K9MR 3RKYA 1WX6A 3UA6A 1VQ7Q 3UF4A 3SEMA 2MI6A 4C0DB 2O88A 2LCLA 3A8LB 1X75C 5GAOl 2XKOC 3L2ZA 1BBZA 3HSBA 3OSSC 4MMLA 1JQQA 2PU9B 4JJDA 2WSEE 2KVQG 4ME7A 1PD1A 3M4GA 3QDFA 1NJIR 4M78F 1FX7A 5GAOn 3CCUT 1X69A 1T3LA 3H9NA 2RQWA 4A4HA 2LQNA 5GAOm 1YJWT 1HYOA 2K3YA 3QG1A 4M77F 1VQ9Q 4M75B 1X2KA 2A36A 2EJ9A 5FU6C 2ZCFB
chains in the Genus database with same CATH topology
3ULRB 5IHKA 3A98A 2C0TA 2HCKA 2C0IA 2DL7A 2RMOA 2LZ6B 1BK2A 2DYBA 1K0SA 4OMQA 3I5SA 1X43A 2X3XD 1XOVA 5ECAA 2CSIA 1GCQA 2ECZA 3SHWA 4F16A 3PVLA 2CH4W 2J05A 1IO6A 1WI7A 4JZ3A 1GFCA 2D8HA 1SRMA 2V1QA 5HCKA 2I0NA 2DM1A 2EYZA 2JS0A 2KR3A 1X27A 2JS2A 2DBMA 1RUWA 4J9HA 1A0NB 2DL8A 2FRWA 2JTEA 4RTWA 2LJ0A 1PKSA 2DNUA 1CKBA 1RLQC 1KJWA 2MCNA 4AFQC 1VYUA 1NG2A 1X2QA 1I07A 3VS6A 4AFUC 4OMLA 2VWFA 4KRTA 3H41A 1QKXA 1SRLA 1K9AA 1MV0B 5I11A 2EQIA 4Z89A 2BZ8A 2KEAA 2DX1A 2ED0A 4RTUA 1AEYA 1YWOA 1WYXA 2D8JA 3VS5A 1I0CA 3NHNA 1BB9A 1HD3A 2YUOA 2YUQA 2FPFA 1ABQA 3IQLA 1V1CA 2LJ3A 1SHFA 2X3WD 3M0RA 1ZX6A 5EC7A 1MUZA 1PRLC 2FG0A 1K0XA 4X1VA 1OEBA 5FWBA 2J6OA 1UHFA 3NMZC 1SPKA 2ESWA 1GBQA 2GQIA 4EIKA 1UUEA 3VS3A 1JU5C 2K3BA 2A08A 1AOJA 2EPDA 3ZL7C 1LCKA 1Z9QA 2J06A 2EYXA 2RPNA 2AK5A 2O2OA 4HXJA 1GRIA 1B3QA 1YP5A 4M4ZA 1CSKA 2E5KA 3VRZA 2AZSA 1U06A 3VS2A 2RN8A 1WXTA 2RQVA 1KIKA 3M0TA 2LQWA 2DL3A 2GBQA 2A37A 3VS1A 3I5RA 2DVJA 1EFNA 2K6DA 2W10A 4Z8AA 4J9IA 1GL5A 1UTIA 1KFZA 5FWCA 3THKA 2D1XA 1PKTA 3I35A 1GFDA 2OJ2A 3REAB 1G2BA 2DBKA 4JZ4A 2K79A 2CDTA 1Y57A 1UFFA 1T0HA 1MV3A 3EG1A 4Y92A 5IHIA 2HBWA 1W6XA 2RQTA 1M3BA 1ARKA 1M3CA 2LJ1A 1PRMC 1NYGA 2QDLA 1PNJA 2ED1A 5I22A 1ZUKA 2F2VA 2W0ZA 2LMJA 1ZBJA 2KNBB 2ENMA 2NUZA 1X6BA 2OAWA 1QWFA 2KYMA 1UECA 4E6RA 2HSPA 4RTXA 1YWPA 1E6GA 4RUGA 5IHNA 1J3TA 1W1FA 4CC4B 2EGAA 3UA7A 2ROLA 1FMKA 2JM9A 1VYTA 2DRKA 2LP5A 2O9VA 1SEMA 1PWTA 1NYFA 1WLPB 2J6KA 2L3QA 2SEMA 3RNJA 4RTTA 2JM8A 1NM7A 4DEXA 1WA7A 2KROA 4D8DA 2KRMA 4HVWA 1AWOA 1QLYA 3QWYA 3U23A 4HVVA 2YT6A 4IIMA 4A63B 1NEBA 3KFVA 4RTZA 1HSQA 1SHGA 1E7OA 4AG2C 1AZEA 1JXMA 2EGCA 1N5ZA 2KT8A 2CUBA 2DILA 2OI3A 2D0NA 1VA7A 1K1ZA 1ZUUA 4AG1C 2JW4A 1ABOA 1FYNA 2EW3A 5IXBA 2B86A 1B07A 4LE9A 5GJWB 2EKHA 1UJYA 1WXBA 3TSWA 1QWEA 1RLPC 3M0SA 2KXDA 1NLOC 1M3AA 2L0AA 2KYBA 2EGEA 2GGRA 2JMAA 2XMFA 3JV3A 3PVQA 4J9GA 2GTJA 2O31A 4J9EA 2KBTA 2CSQA 1UHCA 2YDLA 5FW9A 2H8HA 2RQUA 3H0HA 2YUPA 2HEQA 1T0JA 5GJVB 3NPFA 4QT7A 3VS7A 1AWWA 2BZYA 3EG3A 2J7IA 2O9SA 4CC7A 1QKWA 2AZVA 1AWXA 3I9QA 2FO0A 4OMNA 1QCFA 2P4RA 2DA9A 2FRYA 3GBQA 3VRYA 1UGVA 2L3SA 2RF0A 1UDLA 1YCSB 3REBB 5L23A 4LNPA 1OPKA 1UG1A 1JXOA 2CH4A 3C0CA 4JJCA 1S1NA 2C0OA 2DE0X 2DJQA 3EG0A 3UATA 1TUCA 2L3PA 1YN8A 1RI9A 1TUDA 2BTTA 4LN2A 1WDXA 1HJDA 3QWXX 1E6HA 4JJBA 4CC2A 2ABLA 2V1RA 1OV3A 3EGUA 2KXCA 3H0IA 4FSSA 1H8KA 2PTKA 1GBRA 3PE0A 4DEYA 2LNHB 2L2PA 2CUDA 1M8MA 2AKLA 2DF6A 4RTYA 4AFZC 4J9FA 5IH2A 1GCPA 2EYYA 4JPBW 4LUDA 1K4US 2ROTA 4LUEA 1I1JA 2SRCA 3VS4A 3EHRA 4GBQA 2M0YA 3FJ5A 2AKKA 3LH5A 4OMOA 1OOTA 1SSHA 4ZNXA 2DL5A 1ZLMA 4HCKA 1G83A 1ZUYA 3NGPA 1VYVA 2YSQA 4CC3A 2MIOA 2G6FX 2PZ1A 1PHTA 1WFWA 1UJ0A 1H92A 2VKNA 4OMMA 1JO8A 2M51A 4OMPA 2A28A 3M0UA 3R6NA 2F2XA 4IIOA 1X6GA 1NLPC 1K76A 3O5ZA 1UE9A 5IXFA 4HVUA 2F2WA 1GCQC 4ESRA 4GLMA 2CT4A 2K7AA 3EG2A 3TSZA 1WXUA 4D8KA 3CQTA 4F17A 1AWJA 1CKAA 1KSWA 2PNIA 1JEGA 2EBPA 2FPDA 1M30A 1W70A 4R0KA 1NEGA 3H0FA 1T3SA 2JT4A 2CT3A 1WX6A 3UA6A 2IIMA 2MOXA 2RQRA 4F14A 1AD5A 2DLPA 1WIEA 3UF4A 3SEMA 4J9CA 2LCSA 1Z9ZA 1OPLA 2KRNA 2O88A 2GNCA 2RNAA 4K11A 1YNZA 2HDAA 3M0PA 1BBZA 3TVTA 2KE9A 1AVZC 2K2MA 3VS0A 2KT1A 1JQQA 4RTVA 2FEIA 2FPEA 1U5SA 4ORZA 2NWMA 2LX7A 4JJDA 2DL4A 2YUNA 3RBBB 2EVRA 2KGTA 2VVKA 1ZSGA 2EYWA 1BU1A 2KRSA 3M0QA 4WCIA 1M27C 4AFSC 2CREA 2DMOA 1X69A 1T3LA 2BZXA 2JXBA 2RQWA 1AZGB 4Z88A 2LQNA 4J9BA 2JMCA 3EHQA 2DRMA 2GTOA 1U3OA 1X2KA 4J9DA 2A36A 1TG0A 2K9GA 1Y0MA 1H3HA 2J6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULR B;  5IHK A;  3A98 A;  2C0T A;  2HCK A;  2C0I A;  2DL7 A;  2RMO A;  2LZ6 B;  1BK2 A;  2DYB A;  1K0S A;  4OMQ A;  3I5S A;  1X43 A;  2X3X D;  1XOV A;  5ECA A;  2CSI A;  1GCQ A;  2ECZ A;  3SHW A;  4F16 A;  3PVL A;  2CH4 W;  2J05 A;  1IO6 A;  1WI7 A;  4JZ3 A;  1GFC A;  2D8H A;  1SRM A;  2V1Q A;  5HCK A;  2I0N A;  2DM1 A;  2EYZ A;  2JS0 A;  2KR3 A;  1X27 A;  2JS2 A;  2DBM A;  1RUW A;  4J9H A;  1A0N B;  2DL8 A;  2FRW A;  2JTE A;  4RTW A;  2LJ0 A;  1PKS A;  2DNU A;  1CKB A;  1RLQ C;  1KJW A;  2MCN A;  4AFQ C;  1VYU A;  1NG2 A;  1X2Q A;  1I07 A;  3VS6 A;  4AFU C;  4OML A;  2VWF A;  4KRT A;  3H41 A;  1QKX A;  1SRL A;  1K9A A;  1MV0 B;  5I11 A;  2EQI A;  4Z89 A;  2BZ8 A;  2KEA A;  2DX1 A;  2ED0 A;  4RTU A;  1AEY A;  1YWO A;  1WYX A;  2D8J A;  3VS5 A;  1I0C A;  3NHN A;  1BB9 A;  1HD3 A;  2YUO A;  2YUQ A;  2FPF A;  1ABQ A;  3IQL A;  1V1C A;  2LJ3 A;  1SHF A;  2X3W D;  3M0R A;  1ZX6 A;  5EC7 A;  1MUZ A;  1PRL C;  2FG0 A;  1K0X A;  4X1V A;  1OEB A;  5FWB A;  2J6O A;  1UHF A;  3NMZ C;  1SPK A;  2ESW A;  1GBQ A;  2GQI A;  4EIK A;  1UUE A;  3VS3 A;  1JU5 C;  2K3B A;  2A08 A;  1AOJ A;  2EPD A;  3ZL7 C;  1LCK A;  1Z9Q A;  2J06 A;  2EYX A;  2RPN A;  2AK5 A;  2O2O A;  4HXJ A;  1GRI A;  1B3Q A;  1YP5 A;  4M4Z A;  1CSK A;  2E5K A;  3VRZ A;  2AZS A;  1U06 A;  3VS2 A;  2RN8 A;  1WXT A;  2RQV A;  1KIK A;  3M0T A;  2LQW A;  2DL3 A;  2GBQ A;  2A37 A;  3VS1 A;  3I5R A;  2DVJ A;  1EFN A;  2K6D A;  2W10 A;  4Z8A A;  4J9I A;  1GL5 A;  1UTI A;  1KFZ A;  5FWC A;  3THK A;  2D1X A;  1PKT A;  3I35 A;  1GFD A;  2OJ2 A;  3REA B;  1G2B A;  2DBK A;  4JZ4 A;  2K79 A;  2CDT A;  1Y57 A;  1UFF A;  1T0H A;  1MV3 A;  3EG1 A;  4Y92 A;  5IHI A;  2HBW A;  1W6X A;  2RQT A;  1M3B A;  1ARK A;  1M3C A;  2LJ1 A;  1PRM C;  1NYG A;  2QDL A;  1PNJ A;  2ED1 A;  5I22 A;  1ZUK A;  2F2V A;  2W0Z A;  2LMJ A;  1ZBJ A;  2KNB B;  2ENM A;  2NUZ A;  1X6B A;  2OAW A;  1QWF A;  2KYM A;  1UEC A;  4E6R A;  2HSP A;  4RTX A;  1YWP A;  1E6G A;  4RUG A;  5IHN A;  1J3T A;  1W1F A;  4CC4 B;  2EGA A;  3UA7 A;  2ROL A;  1FMK A;  2JM9 A;  1VYT A;  2DRK A;  2LP5 A;  2O9V A;  1SEM A;  1PWT A;  1NYF A;  1WLP B;  2J6K A;  2L3Q A;  2SEM A;  3RNJ A;  4RTT A;  2JM8 A;  1NM7 A;  4DEX A;  1WA7 A;  2KRO A;  4D8D A;  2KRM A;  4HVW A;  1AWO A;  1QLY A;  3QWY A;  3U23 A;  4HVV A;  2YT6 A;  4IIM A;  4A63 B;  1NEB A;  3KFV A;  4RTZ A;  1HSQ A;  1SHG A;  1E7O A;  4AG2 C;  1AZE A;  1JXM A;  2EGC A;  1N5Z A;  2KT8 A;  2CUB A;  2DIL A;  2OI3 A;  2D0N A;  1VA7 A;  1K1Z A;  1ZUU A;  4AG1 C;  2JW4 A;  1ABO A;  1FYN A;  2EW3 A;  5IXB A;  2B86 A;  1B07 A;  4LE9 A;  5GJW B;  2EKH A;  1UJY A;  1WXB A;  3TSW A;  1QWE A;  1RLP C;  3M0S A;  2KXD A;  1NLO C;  1M3A A;  2L0A A;  2KYB A;  2EGE A;  2GGR A;  2JMA A;  2XMF A;  3JV3 A;  3PVQ A;  4J9G A;  2GTJ A;  2O31 A;  4J9E A;  2KBT A;  2CSQ A;  1UHC A;  2YDL A;  5FW9 A;  2H8H A;  2RQU A;  3H0H A;  2YUP A;  2HEQ A;  1T0J A;  5GJV B;  3NPF A;  4QT7 A;  3VS7 A;  1AWW A;  2BZY A;  3EG3 A;  2J7I A;  2O9S A;  4CC7 A;  1QKW A;  2AZV A;  1AWX A;  3I9Q A;  2FO0 A;  4OMN A;  1QCF A;  2P4R A;  2DA9 A;  2FRY A;  3GBQ A;  3VRY A;  1UGV A;  2L3S A;  2RF0 A;  1UDL A;  1YCS B;  3REB B;  5L23 A;  4LNP A;  1OPK A;  1UG1 A;  1JXO A;  2CH4 A;  3C0C A;  4JJC A;  1S1N A;  2C0O A;  2DE0 X;  2DJQ A;  3EG0 A;  3UAT A;  1TUC A;  2L3P A;  1YN8 A;  1RI9 A;  1TUD A;  2BTT A;  4LN2 A;  1WDX A;  1HJD A;  3QWX X;  1E6H A;  4JJB A;  4CC2 A;  2ABL A;  2V1R A;  1OV3 A;  3EGU A;  2KXC A;  3H0I A;  4FSS A;  1H8K A;  2PTK A;  1GBR A;  3PE0 A;  4DEY A;  2LNH B;  2L2P A;  2CUD A;  1M8M A;  2AKL A;  2DF6 A;  4RTY A;  4AFZ C;  4J9F A;  5IH2 A;  1GCP A;  2EYY A;  4JPB W;  4LUD A;  1K4U S;  2ROT A;  4LUE A;  1I1J A;  2SRC A;  3VS4 A;  3EHR A;  4GBQ A;  2M0Y A;  3FJ5 A;  2AKK A;  3LH5 A;  4OMO A;  1OOT A;  1SSH A;  4ZNX A;  2DL5 A;  1ZLM A;  4HCK A;  1G83 A;  1ZUY A;  3NGP A;  1VYV A;  2YSQ A;  4CC3 A;  2MIO A;  2G6F X;  2PZ1 A;  1PHT A;  1WFW A;  1UJ0 A;  1H92 A;  2VKN A;  4OMM A;  1JO8 A;  2M51 A;  4OMP A;  2A28 A;  3M0U A;  3R6N A;  2F2X A;  4IIO A;  1X6G A;  1NLP C;  1K76 A;  3O5Z A;  1UE9 A;  5IXF A;  4HVU A;  2F2W A;  1GCQ C;  4ESR A;  4GLM A;  2CT4 A;  2K7A A;  3EG2 A;  3TSZ A;  1WXU A;  4D8K A;  3CQT A;  4F17 A;  1AWJ A;  1CKA A;  1KSW A;  2PNI A;  1JEG A;  2EBP A;  2FPD A;  1M30 A;  1W70 A;  4R0K A;  1NEG A;  3H0F A;  1T3S A;  2JT4 A;  2CT3 A;  1WX6 A;  3UA6 A;  2IIM A;  2MOX A;  2RQR A;  4F14 A;  1AD5 A;  2DLP A;  1WIE A;  3UF4 A;  3SEM A;  4J9C A;  2LCS A;  1Z9Z A;  1OPL A;  2KRN A;  2O88 A;  2GNC A;  2RNA A;  4K11 A;  1YNZ A;  2HDA A;  3M0P A;  1BBZ A;  3TVT A;  2KE9 A;  1AVZ C;  2K2M A;  3VS0 A;  2KT1 A;  1JQQ A;  4RTV A;  2FEI A;  2FPE A;  1U5S A;  4ORZ A;  2NWM A;  2LX7 A;  4JJD A;  2DL4 A;  2YUN A;  3RBB B;  2EVR A;  2KGT A;  2VVK A;  1ZSG A;  2EYW A;  1BU1 A;  2KRS A;  3M0Q A;  4WCI A;  1M27 C;  4AFS C;  2CRE A;  2DMO A;  1X69 A;  1T3L A;  2BZX A;  2JXB A;  2RQW A;  1AZG B;  4Z88 A;  2LQN A;  4J9B A;  2JMC A;  3EHQ A;  2DRM A;  2GTO A;  1U3O A;  1X2K A;  4J9D A;  2A36 A;  1TG0 A;  2K9G A;  1Y0M A;  1H3H A;  2J6F A; 
#chains in the Genus database with same CATH topology
 3ULR B;  1M1K R;  3FDR A;  2DZC A;  5IHK A;  4M78 E;  3LWI A;  1VQM Q;  3I55 T;  2JUF A;  1VQK Q;  3CCM Q;  1ZSZ C;  5KE3 A;  2DYB A;  1VQ7 T;  3M56 A;  2X3X D;  1XOV A;  3QO3 A;  5CIU A;  2CSI A;  2ECZ A;  2QQR A;  2DXT A;  5GAN g;  2CH4 W;  2LRQ A;  5GAN e;  1QCO A;  2J05 A;  2KY9 A;  1G3W A;  3FB9 A;  2D8H A;  5HCK A;  2I0N A;  3PT9 A;  4IUU A;  5CKD A;  2LC4 A;  2E6N A;  4M7D G;  3H6Z A;  2QGG A;  2KR3 A;  3OYB A;  4TVR A;  2MMP A;  2L3R A;  2JTE A;  4XU2 A;  1K8A C;  3JCM P;  2HSE B;  3CXC A;  1RLQ C;  4BE2 A;  1KJW A;  3OYY A;  2D9T A;  1OUL A;  3M9Q A;  1YIJ A;  1QKX A;  4EPC A;  2EQI A;  4Z89 A;  2BZ8 A;  2KEA A;  2P0K A;  2DX1 A;  2ED0 A;  2PQW A;  4EMK B;  1YI2 T;  3OS5 A;  3L42 A;  5KYX A;  4HCC A;  1TUG B;  3CCU A;  2QTX A;  4II1 A;  4FCY A;  1D1B A;  3VS5 A;  2BE9 B;  2V26 A;  4WTO B;  1IGU A;  3JB9 J;  1YJW A;  2LQK A;  1ABQ A;  2XDB A;  2LJ3 A;  1WJQ A;  2BE7 D;  2X3W D;  1VQN T;  3RR6 A;  2FG0 A;  2ZPH B;  4C92 A;  4MDW A;  4BE1 A;  3V7C A;  3QKJ A;  1GBQ A;  2RB6 A;  1NBE B;  1KC8 R;  1D0Y A;  3C4S A;  3CXC S;  1VQ7 A;  2P0P A;  1AOJ A;  4J5Y A;  1D3B B;  1G3S A;  2Y90 A;  4QQD A;  1QVF P;  4M7A C;  2JNG A;  2R5M A;  3QZ9 B;  3OYH A;  4XTY A;  4HXJ A;  1YP5 A;  2JJ9 A;  3P8D A;  2M9U A;  4JLG A;  3SB2 A;  4PLI A;  1CSK A;  3VRZ A;  2K3X A;  3NFC A;  4R56 A;  3VS2 A;  1Q82 U;  3WXM B;  2LQW A;  3L2Q A;  4DA4 A;  2DL3 A;  2GBQ A;  2A37 A;  3VS1 A;  2DVJ A;  2RJD A;  5CR2 A;  2K6D A;  2QDY B;  2W10 A;  3OYC A;  1VQ9 A;  4PJO F;  4J9I A;  4UC4 A;  1GL5 A;  3OBY A;  3CCQ Q;  1KFZ A;  3THK A;  3G6E T;  1GFD A;  5GAN 4;  1VQM A;  4X9C A;  3REA B;  1WQW A;  2E65 A;  4AT1 B;  1G2B A;  2DBK A;  2QXF A;  4FYX B;  2Z0W A;  2ZPG B;  1MV3 A;  3EG1 A;  1I81 A;  3NTH A;  4BAC A;  4C92 D;  1VQN A;  2CP5 A;  2RQT A;  1U1S A;  3CCV Q;  3UDC A;  2ED1 A;  2CS7 A;  4PJM A;  1Q82 C;  1MMN A;  3JCM h;  2KNB B;  4E6R A;  2DYI A;  2HL5 C;  4B6M A;  3PFS A;  4XTU A;  1E6G A;  3EH1 A;  1J3T A;  1TU0 B;  2MK5 A;  2JM9 A;  3CCL T;  3CCR T;  2LP5 A;  4JRQ A;  3RNJ A;  1N9R A;  1YJN T;  2M1H A;  3A8O B;  1P92 A;  3CCS Q;  5LJ3 g;  2KRM A;  3LYI A;  4HVW A;  4F7U B;  3X26 B;  5LJ3 e;  3QWY A;  1G5V A;  4F7U E;  1M1G A;  3G1J A;  2XDP A;  4Q5W A;  3JCM W;  1E7O A;  3PMT A;  3EG9 A;  1JXM A;  5D6X A;  5GAM h;  2M0O A;  1Y07 A;  4OB1 B;  3MEV A;  1UGS B;  2DIL A;  2OI3 A;  2D0N A;  4RCC A;  2OTJ Q;  1K1Z A;  3OYK A;  1ZUU A;  2NLU A;  1ABO A;  5CQY A;  1WQ7 A;  3DB3 A;  1FYN A;  3DLM A;  2B86 A;  4MZT A;  2EKH A;  3E9G A;  5GMK l;  5KE2 A;  2IPO B;  3MPU B;  1QWE A;  4HA8 A;  2E6Z A;  4BY6 C;  1QQJ A;  3PMI A;  4LDW A;  2GGR A;  2JMA A;  2XG8 D;  3JCM X;  2DD5 A;  4DOV A;  3CC2 Q;  4LDX A;  8AT1 B;  4M7D D;  3RMS A;  2H8H A;  4C8Q F;  2CP6 A;  1RAF B;  4EMG A;  3V7S A;  4FL6 A;  3OW2 P;  3EG3 A;  2O9S A;  1VOM A;  1B34 B;  2NUT B;  4OMN A;  1Q7Y C;  2YXY A;  1BIA A;  1BI3 A;  1MMA A;  3KUF A;  2LTO A;  3REB B;  1UG1 A;  1B7T A;  3OYA A;  4L6V 5;  3ASK A;  1M90 R;  1KD1 R;  1VUB A;  1YJN A;  4HCB A;  1R77 A;  2F5T X;  2RHX A;  2QAZ A;  2RJC A;  2MYS A;  1TSF A;  1IRX A;  4M78 G;  4C5H A;  3QBY A;  2E12 A;  3MJX A;  3LGF A;  3QWX X;  5GAN d;  4JJB A;  1WHK A;  3MKD A;  4KUD K;  4M7D B;  3H0I A;  1BKB A;  1GBR A;  2HQX A;  5GMK e;  3M58 A;  2L2P A;  2CUD A;  3CCV A;  2AKL A;  2HQH A;  3T9N A;  1Q81 U;  2IG0 A;  4LUE A;  3JCM f;  2P84 A;  2DZ9 A;  2X4J A;  1N8R U;  4LDV A;  4GBQ A;  3FJ5 A;  4E7J A;  1QMC A;  1OOT A;  1TTH B;  4J83 A;  3CD6 T;  1ZUY A;  1VQ8 Q;  4C0F A;  3NGP A;  4XTV A;  3BDL A;  2YSQ A;  2PZ1 A;  1WFW A;  3AHU A;  1PSF A;  3CPF A;  3OYF A;  2M02 A;  3R6O A;  3OQ5 A;  2F2X A;  3CC4 Q;  3HTR A;  3O5Z A;  3CPW A;  1K9M U;  2XID A;  5A2Q E;  2HNI A;  2FB7 A;  3M4Y A;  3PNW C;  4N4I A;  3CC7 Q;  4PJN A;  3SWN B;  2VXF A;  2F2W A;  4MMK A;  4LD9 K;  3OS1 A;  4ESR A;  4R55 A;  4GLM A;  4O5V A;  3TSZ A;  5GAM f;  5CAI A;  4D8K A;  3CQT A;  1KSW A;  1AHJ B;  3RER A;  2AT1 B;  2FPD A;  3G7Z A;  5GAN 7;  4LD6 A;  1BI2 A;  3MP8 A;  3H0F A;  1Q81 C;  1T3S A;  2DTO A;  3OYL A;  1N8R C;  2JZ2 A;  5I2M A;  2FVU A;  2MOX A;  1NJI U;  1QCN A;  1IGQ A;  3DKM A;  1AD5 A;  1YBY A;  1WIE A;  1BI0 A;  1OPL A;  2GNC A;  2RNA A;  2HDA A;  3JSC A;  4XTX A;  1M4Z A;  3TVT A;  3X20 B;  2KT1 A;  5CK9 A;  3HP9 A;  5FRO A;  4IUT A;  3CC2 A;  2DL4 A;  4JUV A;  5C6S A;  1RAG B;  4XTW A;  4HT8 A;  1BU1 A;  3M0Q A;  4OB2 B;  3CPW S;  4WCI A;  1M1K U;  4AFS C;  1WHJ A;  2CRE A;  1K9M C;  8ATC B;  4C5E A;  1AZG B;  3QDR B;  3EAE A;  1VQL T;  2R5A A;  2GTO A;  1JRI A;  1Y0M A;  4C92 C;  2ZPE B;  4JRI A;  3A98 A;  2DL7 A;  2RMO A;  5GAN j;  3VYH B;  1I5O B;  1K0S A;  3X28 B;  3I5S A;  2HKN A;  1X43 A;  2EAY A;  1NZ9 A;  1R0B G;  1YIT T;  2CZ6 B;  1ZA2 B;  4F16 A;  2CZ1 B;  2HKQ B;  2L5Q A;  2COY A;  4PJO G;  2BKD N;  5GAO p;  3QHS A;  1IO6 A;  4JZ3 A;  4J8O A;  2O4X B;  4M7A F;  1GFC A;  2DM1 A;  3HHT B;  2EYZ A;  4XU1 A;  2JS0 A;  3AT1 B;  3UPU A;  1M1K C;  2RJE A;  4ZTJ A;  1QW1 A;  2OX7 A;  3X24 B;  2JS2 A;  2DBM A;  4FYW B;  4BI3 A;  3CMA T;  2FRW A;  2LJ0 A;  2DNU A;  2YRV A;  1CKB A;  5CCA A;  2MCN A;  4AFQ C;  3G71 T;  4M7A B;  1O9S A;  1IRE B;  3RUX A;  1BIB A;  4M7A E;  1W2B P;  1VQ8 A;  1MV0 B;  1IHV A;  3CCU Q;  1RL2 A;  3S3O A;  5LJ3 d;  1WYX A;  1YJW Q;  3CC4 A;  3BDU A;  2VV5 A;  1BB9 A;  4NL2 A;  4EMK A;  1KC8 U;  3MEU A;  3CC7 A;  4F7U G;  4PL6 A;  3RMQ A;  5HKC A;  1SHF A;  3LLR A;  1KQS P;  1ZX6 A;  1D09 B;  1PRL C;  3I55 Q;  1ACM B;  1KG1 A;  1K0X A;  2H3E B;  1OEB A;  3V8L A;  4KT0 E;  3NMZ C;  4IUQ A;  4P5N A;  1SPK A;  1D1A A;  3CBP A;  1Q86 C;  3SFM A;  1JU5 C;  3OMC A;  2LVM A;  3BE3 A;  2EPD A;  2EQM A;  3QII A;  1LCK A;  2CP7 A;  1Z9Q A;  2YHT A;  5DLQ E;  1M2V B;  2RPN A;  2O2O A;  4GY5 A;  4OP0 A;  1D3B A;  2GFA A;  3ZEH A;  4AMC A;  4M4Z A;  5LJ5 g;  1SSF A;  2QQA A;  2AZS A;  4JRK A;  5GAN 8;  5LJ5 e;  5J3B A;  3FJP A;  1U06 A;  2RN8 A;  1V76 A;  1WXT A;  2RQV A;  3CMA A;  5FRN A;  1KC8 C;  3JCM c;  1KHI A;  5DLO A;  2NUP B;  3G71 A;  1BYM A;  2FL7 A;  3I5R A;  4Z8A A;  4M78 B;  1YI2 Q;  2ZGW A;  5J26 A;  4PKC C;  3MEA A;  4KGX B;  1Y71 A;  1PKT A;  4XU3 A;  4RMO A;  4C8Q G;  4BB7 A;  2DK3 A;  4M77 B;  3EGD B;  1IXD A;  4M77 E;  3L1A A;  4JDS A;  3HRT A;  2RH2 A;  1VQN Q;  2X4W A;  2R57 A;  4Y92 A;  4J7I A;  5KYY B;  3PIO A;  1ARK A;  1M3C A;  1K73 R;  1PRM C;  2QDL A;  1S72 T;  4RKU E;  2DD4 A;  1ZUK A;  2F2V A;  5C0M A;  4E47 A;  2X9H A;  4LDU A;  4BE0 A;  2NUZ A;  1QWF A;  3JCM g;  3JCM e;  1YWP A;  4RUG A;  5IHN A;  4N4H A;  2EQK A;  2HBP A;  1OX9 A;  1QP2 A;  3UA7 A;  1VYT A;  2O9V A;  5LJ3 j;  2J6K A;  5A0G A;  3LWH A;  1QVP A;  4RTT A;  4DEX A;  3JCM b;  2KRO A;  3KBG A;  2PVO B;  4D8D A;  4Y91 A;  2EJG A;  4HVV A;  4IIM A;  2I2L A;  1HSQ A;  1SHG A;  4AG2 C;  4MZP A;  4F7U A;  5LL6 S;  2EGC A;  2IVW A;  3G6E Q;  3RKX A;  2QAS A;  3GOX A;  3OYE A;  3I55 A;  4C0G A;  4WF2 A;  4IUP A;  3MO8 A;  3G4S T;  2K57 A;  2F5K A;  3N5B B;  1M5Q 1;  1MMD A;  2CYZ B;  5GAN 3;  1UJY A;  3GF5 A;  1YJ9 T;  3TSW A;  1RAD B;  2XDD A;  1YHQ T;  4VUB A;  1HK9 A;  3A8M B;  1NLO C;  2DFU A;  2L0A A;  1RAC B;  3LH0 A;  3HFO A;  1WPY A;  2ZPB B;  1WNL A;  4J9E A;  2O31 A;  2XI9 A;  1JJ2 P;  1UHC A;  1VQ4 T;  1S72 A;  2CKK A;  2YUP A;  4BI4 A;  1M90 U;  1AWW A;  2BZY A;  4C5G A;  4CC7 A;  2OTL T;  5FLX E;  2MAM A;  1QCF A;  3CCL Q;  3CCR Q;  4E7L A;  1YCS B;  1B34 A;  2EYQ A;  3MEW A;  2NUT A;  3OYD A;  1YJN Q;  1YI2 A;  3L2U A;  1YCY A;  2CH4 A;  1FWZ A;  3C0C A;  3E19 A;  4JJC A;  2P0Q A;  5HY6 A;  3UWN A;  3EG0 A;  2A0F B;  3UAT A;  2RK1 A;  2L3P A;  1VQO T;  3S3M A;  4E7S A;  3HL8 A;  4PJO B;  3JB9 F;  1WDX A;  4PJO E;  3FLG A;  5GMK j;  3OY9 A;  2QK0 A;  2F1L A;  2V1R A;  1K8A R;  2RHY A;  2KXC A;  1MHN A;  2VGN A;  1VIF A;  2E3I A;  2K5F A;  4C0D C;  4O6J A;  1Q95 G;  4M7D A;  3G4S A;  1N9S A;  4J9F A;  1M90 C;  4LUD A;  1K4U S;  3L2V A;  1RAI B;  2X4Y A;  3VS4 A;  1ZA1 B;  1RI0 A;  2QI2 A;  3E1S A;  2FZG B;  3TQ7 P;  1YHQ A;  2JN0 A;  2EJF A;  5HK3 A;  3VUZ A;  4ZNX A;  2DL5 A;  3JCM Q;  2LT4 A;  4M7A G;  1VQ4 A;  2G6F X;  1PHT A;  3S6W A;  4C92 F;  4OMM A;  1IHW A;  4M75 C;  3M0U A;  2GCX A;  1BCM A;  1X6G A;  3KXT A;  2K5I A;  1YFN A;  2E70 A;  1M2O A;  4ZGE B;  5IXF A;  4J6W A;  3MHX A;  5D6W A;  2CT4 A;  4X9D A;  3G6E A;  1WXU A;  5KCO A;  2DXB A;  1CKA A;  3SWN A;  4C92 E;  2JTM A;  4A54 A;  2BUD A;  3TU4 K;  4BI8 B;  4ZN3 A;  4QQ6 A;  2RK2 A;  3INZ A;  3DB4 A;  2IIM A;  5GAO r;  3Q1J A;  4F14 A;  4J6Y A;  3OSV A;  5IT9 E;  2LCC A;  4J9C A;  2LCS A;  3RDV A;  3M0P A;  2KE9 A;  2K2M A;  3VS0 A;  2XU8 A;  1UGQ B;  4Y28 E;  2FEI A;  2FPE A;  5LJ5 d;  3OYJ A;  2NWM A;  2JTF A;  1UGP B;  2LX7 A;  1RAH B;  5GMK m;  1XJW B;  2RI5 A;  9ATC B;  3SD4 A;  1ZSG A;  2RD1 A;  2KRS A;  3OYG A;  1M27 C;  2Y4Y A;  5I21 A;  3CD6 Q;  4QQG A;  1OZ2 A;  4DBH A;  4EMK C;  4RCB A;  2VXE A;  4C8Q B;  4J9B A;  4OGC A;  3CCR A;  3CCL A;  2JMC A;  4C8Q E;  3L2R A;  2DRM A;  4A4E A;  2QEX T;  2FHD A;  3QYG B;  2E41 A;  1U3O A;  4J9D A;  1TG0 A;  2K9G A;  4B9X A;  1OZ3 A;  5M9O A;  1G3T A;  2LNV A;  5CVI A;  2C0I A;  3M59 A;  1BCO A;  3C12 A;  1V29 B;  3OYN A;  1WHH A;  4FT2 A;  2WSC E;  1BK2 A;  2E3H A;  1BI1 A;  2DER A;  4OMQ A;  4ZGJ B;  4M77 G;  3C94 A;  2XIC A;  1R0C B;  3X25 B;  3JCM V;  4IUR A;  4FT4 A;  3PVL A;  1H64 1;  1VIE A;  1LVK A;  2V1Q A;  1TOV A;  4OB0 B;  4KBM B;  4J7F A;  2Y4X A;  3CXC P;  2O4X A;  2DJZ A;  4PJJ A;  3JCM d;  1RUW A;  4N0A A;  2YWW A;  1RAA B;  3EFR A;  1MNE A;  3PTA A;  2DXC A;  1VYU A;  1NG2 A;  1I07 A;  2D0Q B;  3VS6 A;  2VWF A;  4DQ2 A;  4E2F B;  3J81 E;  2DET A;  4RTU A;  4M7A A;  4EMH A;  4BD3 A;  1F1B B;  1YWO A;  1TS9 A;  2HMA A;  3BW1 A;  5D6Y A;  1I0C A;  1OX8 A;  3NHN A;  1I5L A;  4FYY B;  2RHZ A;  1VQL Q;  5LJ3 h;  2YRC A;  2YUQ A;  1D0Z A;  3OYM A;  2FPF A;  4A4K A;  1M9S A;  5FU6 B;  3IQL A;  3PGG A;  3M0R A;  4BUG A;  3EGX B;  5EC7 A;  1GXI E;  1MUZ A;  3I56 T;  2FZK B;  2LX9 A;  1PC0 A;  4X1V A;  1ZSZ B;  5FWB A;  3JCM J;  1UHF A;  2GFU A;  2K2V A;  2YLB A;  1OYX A;  1UUE A;  3VS3 A;  3OYI A;  1YIT Q;  4LDY A;  1FMV A;  2ATC B;  1Q7Y R;  5CKF A;  5LJ5 j;  2J06 A;  4QVC A;  2EQJ A;  3RIR A;  1GRI A;  3H8Z A;  4C0Z A;  3TEE A;  3WVE B;  1QVF A;  1M2V A;  3CMA Q;  4QVD A;  3CCJ T;  1QVG P;  2QA4 T;  1G3Y A;  1SG5 A;  3G71 Q;  1KIK A;  2KMT A;  3M0T A;  4QVZ A;  4X34 A;  3CD6 A;  1Y96 B;  2K5L A;  1EFN A;  4KH0 B;  4HKE A;  4M7A D;  2NUP A;  1LPL A;  2HL3 A;  1C0M A;  1UTI A;  4XQ3 A;  4FM4 B;  2D1X A;  1NJI C;  4M78 A;  1K73 U;  5GAN 5;  2CZ0 B;  1KQ2 A;  3DLL A;  4OF1 A;  1NPR A;  2GF7 A;  4JZ4 A;  2K79 A;  2CDT A;  1OI1 A;  1FMW A;  4M77 A;  2DEQ A;  2DIG A;  1UFF A;  3EGD A;  5KYN A;  1VQP T;  5DY9 A;  3CME T;  2HBW A;  3URG A;  4MZM A;  1W6X A;  5D7U A;  1QVF S;  2LJ1 A;  3I56 A;  2V8K A;  1KQ1 A;  1U1T A;  1NYG A;  2K4Y A;  2NYS A;  3HRU A;  3LW5 E;  4PK4 A;  5KYY A;  2QQB A;  4NS5 A;  2HZY A;  3QSU A;  1X6B A;  1UEC A;  2CGH A;  1MMG A;  1VQ6 T;  2KQW A;  1WJS A;  3JB9 G;  1NE8 A;  2XHC A;  3NTK A;  4CC4 B;  3M5A A;  3GP8 A;  1XNI A;  2EGA A;  3HPW A;  1OQK A;  1SEM A;  1PWT A;  1NYF A;  1WLP B;  1K73 C;  2SEM A;  3CCJ A;  3GNG A;  3C95 A;  2JM8 A;  1NM7 A;  1LJO A;  1VQL A;  5LJ3 f;  1AT1 B;  1NEB A;  1WJR A;  1UGR B;  4RTZ A;  3LX7 A;  2COW A;  2C06 A;  4HCZ A;  2VYT A;  4KH1 B;  2KT8 A;  2CUB A;  4M78 D;  4JLI A;  3EFS A;  4C5I A;  2JW4 A;  4M7D C;  4C92 G;  2MWP A;  3P8B B;  5DM7 R;  2JVV A;  5IXB A;  4M77 D;  4LE9 A;  1B07 A;  1YIT A;  1EX4 A;  1WXB A;  2JOY A;  3OS2 A;  1VQP A;  3CME A;  5I2S A;  2KYB A;  2EGE A;  2QG9 B;  4A4F A;  1S72 Q;  1N27 A;  3PVQ A;  1XQH A;  2ZAE A;  2X51 A;  2GTJ A;  5GAO q;  2CSQ A;  4NOY A;  2YDL A;  3A1P A;  3A8G B;  1YIJ T;  1C6V X;  2HEQ A;  2A3L A;  3JB9 H;  3VS7 A;  2KSS A;  4A53 A;  4M75 F;  2GQV A;  2J7I A;  4PJL A;  1VQ6 A;  3CCE T;  2FO0 A;  1KHC A;  2P4R A;  2DA9 A;  2FRY A;  3OW2 A;  2QTV A;  2L3S A;  2RF0 A;  3HFN A;  4A4G A;  1X01 A;  4BDY A;  3OBW A;  2LQ8 A;  4LNP A;  7AT1 B;  1K8A U;  1OPK A;  3OA6 A;  3V7R A;  3SWN C;  3EFO B;  2YRD A;  2DE0 X;  2DJQ A;  1WGS A;  4M75 E;  1RI9 A;  3TRE A;  2BTT A;  1VQ5 T;  3EH2 A;  3M57 A;  1E6H A;  4CC2 A;  4PJO A;  4J6X A;  5KYW B;  4FSS A;  3QJ6 A;  4GLK A;  1H8K A;  2PTK A;  3G4S Q;  2DKG A;  4DEY A;  2LNH B;  2FZC B;  5KCH A;  2H3J A;  4RTY A;  1YJ9 Q;  2DVE A;  5IH2 A;  2FYK A;  3BY7 A;  1YHQ Q;  4BY6 B;  1SF9 A;  1X6O A;  4XAX B;  2SRC A;  3QPH A;  3OW2 S;  5CKH A;  2M0Y A;  1I4K 1;  2AKK A;  2RA2 A;  1EIF A;  4OVA A;  1VQ4 Q;  1ZLM A;  2COZ A;  1G83 A;  2B8A A;  3QZ5 B;  5KYU A;  4CC3 A;  2MIO A;  2KI7 A;  1VQ9 T;  1H92 A;  2EIF A;  6AT1 B;  3CPW P;  2VKN A;  3J80 E;  2OTL Q;  1JO8 A;  4OMP A;  3R6N A;  1K76 A;  3CCE A;  1Q86 R;  1VQM T;  4ELZ C;  2KDS A;  5GAM g;  1VQK T;  4ATO A;  3CCM T;  5GAM e;  4RG2 A;  1TWB A;  3EG2 A;  1WHM A;  3M54 A;  3MET A;  4F17 A;  1AWJ A;  3UT1 A;  1JEG A;  5KH6 A;  1VQO Q;  2XD0 A;  1IB8 A;  1NEG A;  2PVG B;  3VJP A;  1JBM A;  2JT4 A;  2PUO B;  2DPP B;  3RES A;  2RQR A;  4D6W A;  4N0A C;  1PG5 B;  1VQ5 A;  4PJO D;  2DLP A;  1Z9Z A;  3VUB A;  2DEU A;  2KRN A;  1G8X A;  4K11 A;  1YNZ A;  5FRM A;  1UB4 A;  1AVZ C;  4RTV A;  1U5S A;  4ORZ A;  1KD1 U;  4QW2 A;  4ZTF A;  2YUN A;  3RBB B;  2EVR A;  2KGT A;  1M1F A;  2VVK A;  4B9W A;  2AIR B;  3O8V A;  5LJ5 h;  2EYW A;  4E7Z A;  3JB9 D;  2DMO A;  3MP1 A;  1W4S A;  3V8J A;  1PSE A;  2BZX A;  2JXB A;  4Z88 A;  4RG8 A;  2AHJ B;  3QXE B;  1QVG A;  3ZFJ A;  3EHQ A;  2KAF A;  2L89 A;  3ER0 A;  5FU7 C;  1U8R A;  4C8Q A;  2E1H A;  1H3H A;  4N4G A;  2HQE A;  2J6F A;  2DXU A;  3OS0 A;  4MDX A;  2C0T A;  4DOW A;  2HCK A;  4XK8 E;  2LZ6 B;  2VGM A;  3CBM A;  1IZ6 A;  3VV0 A;  4BDZ A;  5ECA A;  5GAN h;  1VQK A;  1GCQ A;  2DTI A;  3CCM A;  3SDZ A;  3SHW A;  1TXQ A;  2V8J A;  2YLC A;  2VB6 A;  1KD1 C;  1WI7 A;  3M55 A;  1SRM A;  1YJ9 A;  4PFZ A;  4ELY C;  2MWO A;  2P4T A;  1X27 A;  4QKU A;  5CO7 A;  2WSF E;  4J9H A;  5KYU B;  1A0N B;  2DL8 A;  3PIP A;  3JB9 I;  3JAM E;  4RTW A;  4E7H A;  4CI0 C;  1PKS A;  1QVG S;  2QGF B;  1X2Q A;  4AFU C;  4OML A;  5A0D A;  4L59 A;  3MP6 A;  4KRT A;  3H41 A;  4F7U F;  1SRL A;  1K9A A;  4FU6 A;  5KYX B;  5I11 A;  2X4X A;  3E2U A;  1WZO A;  2G3R A;  1HXD A;  3WVD B;  1W2B A;  1AEY A;  2OTL A;  4M78 C;  4DBF A;  3CCQ T;  3E9F A;  2EWN A;  2D8J A;  4JJN K;  1HD3 A;  5GMK i;  2QEX Q;  2QQ9 A;  2YUO A;  1QP3 A;  4M77 C;  4OB3 B;  3FIF A;  4C92 B;  5EG2 A;  4C8Q D;  1V1C A;  4Z02 A;  2M16 A;  2HD0 A;  1Q7Y U;  2CP0 A;  2KK4 A;  4FW1 A;  1VQO A;  3VU3 C;  4L5G A;  3F70 A;  2J6O A;  2EFI A;  1KQS A;  3EGX A;  2ESW A;  2DTH A;  2GQI A;  5CKB A;  4EIK A;  2CP3 A;  3CCV T;  3BFM A;  1ZSZ A;  2K3B A;  4DBQ A;  2A08 A;  1D1C A;  3ZL7 C;  4ZN1 A;  2D6F A;  5L8R E;  1FXX A;  2EYX A;  2AK5 A;  3HKS A;  2RO0 A;  1SKU B;  4JS4 A;  4FW2 A;  2XK0 A;  1KK7 A;  1B3Q A;  1W2B S;  5HK0 A;  2E5K A;  1WHG A;  2QYZ A;  5LJ5 f;  1OU9 A;  3ME9 A;  2EQU A;  3CCS T;  1M8V A;  4LXC A;  1MND A;  5AT1 B;  4XTZ A;  4E7K A;  1EZZ B;  1Y96 A;  3A5Z B;  5FWC A;  2VUB A;  1Y7X A;  1KQS S;  4OGE A;  1Q82 R;  3I35 A;  4M7D F;  3CCQ A;  2OJ2 A;  2OTJ T;  4OMF B;  4M75 G;  1WHL A;  4XU0 A;  2VC8 A;  2V8I A;  2LDM A;  3OB9 A;  2CZ7 B;  3VYG A;  4JS5 A;  1Y57 A;  2A7Y A;  1T0H A;  5GAN f;  4PFO A;  1MGQ A;  3I56 Q;  3J7A F;  1PM3 A;  5IHI A;  3GPL A;  2RI3 A;  2HAX A;  2OAU A;  1N6A A;  3QJY A;  2F69 A;  1M3B A;  3LGL A;  3ZBD A;  1PNJ A;  4M7D E;  5I22 A;  2W0Z A;  2LT1 A;  2ZPI B;  2LMJ A;  4NL3 A;  1ZBJ A;  2E10 A;  3CC2 T;  2ENM A;  3V8K A;  2OAW A;  2KYM A;  3JRZ A;  2E5Q A;  1D0X A;  2HSP A;  5IN1 A;  4RTX A;  1LOJ A;  4IKF A;  4E7I A;  1W1F A;  3CCJ Q;  2ROL A;  1FMK A;  2QA4 Q;  4KUI A;  1OU8 A;  2DRK A;  3GIB A;  4FIB A;  1C1A A;  2L3Q A;  1WA7 A;  4F04 B;  1AWO A;  1UEB A;  3EG9 B;  2RJF A;  1QLY A;  2X35 A;  1H3Z A;  3U23 A;  5GAM d;  3CCS A;  2YT6 A;  2QEX A;  4A63 B;  3QYH B;  3KFV A;  1AZE A;  4PJO C;  3FRN A;  3FC3 A;  1N5Z A;  2L8D A;  4ANJ A;  2BIV A;  1VA7 A;  2CP2 A;  4AG1 C;  2EW3 A;  2QQS A;  2OTJ A;  2RHI A;  1VQP Q;  2DO3 A;  3M53 A;  3NTI A;  5GJW B;  3CME Q;  4CRI A;  3TCJ A;  4FYV B;  2E64 A;  3CEY A;  1RLP C;  3M0S A;  2KXD A;  1M3A A;  1R8O B;  2E4H A;  2XMF A;  3JV3 A;  5CKE A;  4IUV A;  4J9G A;  4ZGD B;  5IAY A;  2KBT A;  5FW9 A;  2RQU A;  3H0H A;  1VQ6 Q;  1VQ8 T;  1PCX A;  3L2W A;  1T0J A;  4V2S A;  5GJV B;  3NPF A;  4QT7 A;  1JJ2 A;  4PLL A;  3D7S B;  4FSX A;  1QKW A;  2AZV A;  1AWX A;  2MPX C;  4KGV B;  3I9Q A;  2O01 E;  3GBQ A;  3OMG A;  3CC4 T;  3VRY A;  1UGV A;  1UDL A;  4EDU A;  2PUK B;  5L23 A;  3CBO A;  3CC7 T;  1RAE B;  1JXO A;  1ZQ1 A;  2RI2 A;  5J39 A;  1S1N A;  2C0O A;  5GAN 6;  3GNF B;  1TUC A;  1YN8 A;  3EFO A;  2R58 A;  1TUD A;  2EKO A;  2RM4 A;  2ZZD A;  2ZPF B;  3FEO A;  4LN2 A;  2RHU A;  4M75 A;  2MF2 A;  1HJD A;  4KGZ B;  4DBR A;  3MCA B;  1DJ7 B;  2ABL A;  4YTL A;  1OV3 A;  5GMK h;  3EGU A;  1PD0 A;  3PE0 A;  3A8H B;  4PNO A;  3RKW A;  1TH7 A;  1M8M A;  2DF6 A;  5KYW A;  3HRS A;  5AYF A;  4AFZ C;  1JJ2 S;  1XTD A;  1GCP A;  2EYY A;  4JPB W;  1ZBX A;  4KUL A;  2ROT A;  1LNX A;  1I1J A;  4HT9 A;  4JRP A;  1I8F A;  2PVD B;  3EHR A;  1JB0 E;  3LH5 A;  4OMO A;  2VAS A;  1SSH A;  3VKI A;  3S3N A;  1Q86 U;  4HCK A;  1YIJ Q;  5A0L A;  2QA4 A;  1VYV A;  4C8Q C;  1O75 A;  1NPP A;  1UJ0 A;  1Q81 R;  2DIQ A;  5GAN 2;  2M51 A;  3CCE Q;  2WAC A;  1N8R R;  2A28 A;  5GAM j;  4IIO A;  3QUI A;  1NLP C;  1UE9 A;  2DAQ A;  4HVU A;  1RAB B;  1GCQ C;  5FU7 B;  2K7A A;  3GLX A;  1ZHI A;  2PNI A;  3P8H A;  2EBP A;  5CQX A;  1M30 A;  1W70 A;  4PFP A;  1VQ5 Q;  4R0K A;  4M75 D;  2CT3 A;  1K9M R;  3RKY A;  1WX6 A;  3UA6 A;  1VQ7 Q;  3UF4 A;  3SEM A;  2MI6 A;  4C0D B;  2O88 A;  2LCL A;  3A8L B;  1X75 C;  5GAO l;  2XKO C;  3L2Z A;  1BBZ A;  3HSB A;  3OSS C;  4MML A;  1JQQ A;  2PU9 B;  4JJD A;  2WSE E;  2KVQ G;  4ME7 A;  1PD1 A;  3M4G A;  3QDF A;  1NJI R;  4M78 F;  1FX7 A;  5GAO n;  3CCU T;  1X69 A;  1T3L A;  3H9N A;  2RQW A;  4A4H A;  2LQN A;  5GAO m;  1YJW T;  1HYO A;  2K3Y A;  3QG1 A;  4M77 F;  1VQ9 Q;  4M75 B;  1X2K A;  2A36 A;  2EJ9 A;  5FU6 C;  2ZCF B; 
#chains in the Genus database with same CATH homology
 3ULR B;  5IHK A;  3A98 A;  2C0T A;  2HCK A;  2C0I A;  2DL7 A;  2RMO A;  2LZ6 B;  1BK2 A;  2DYB A;  1K0S A;  4OMQ A;  3I5S A;  1X43 A;  2X3X D;  1XOV A;  5ECA A;  2CSI A;  1GCQ A;  2ECZ A;  3SHW A;  4F16 A;  3PVL A;  2CH4 W;  2J05 A;  1IO6 A;  1WI7 A;  4JZ3 A;  1GFC A;  2D8H A;  1SRM A;  2V1Q A;  5HCK A;  2I0N A;  2DM1 A;  2EYZ A;  2JS0 A;  2KR3 A;  1X27 A;  2JS2 A;  2DBM A;  1RUW A;  4J9H A;  1A0N B;  2DL8 A;  2FRW A;  2JTE A;  4RTW A;  2LJ0 A;  1PKS A;  2DNU A;  1CKB A;  1RLQ C;  1KJW A;  2MCN A;  4AFQ C;  1VYU A;  1NG2 A;  1X2Q A;  1I07 A;  3VS6 A;  4AFU C;  4OML A;  2VWF A;  4KRT A;  3H41 A;  1QKX A;  1SRL A;  1K9A A;  1MV0 B;  5I11 A;  2EQI A;  4Z89 A;  2BZ8 A;  2KEA A;  2DX1 A;  2ED0 A;  4RTU A;  1AEY A;  1YWO A;  1WYX A;  2D8J A;  3VS5 A;  1I0C A;  3NHN A;  1BB9 A;  1HD3 A;  2YUO A;  2YUQ A;  2FPF A;  1ABQ A;  3IQL A;  1V1C A;  2LJ3 A;  1SHF A;  2X3W D;  3M0R A;  1ZX6 A;  5EC7 A;  1MUZ A;  1PRL C;  2FG0 A;  1K0X A;  4X1V A;  1OEB A;  5FWB A;  2J6O A;  1UHF A;  3NMZ C;  1SPK A;  2ESW A;  1GBQ A;  2GQI A;  4EIK A;  1UUE A;  3VS3 A;  1JU5 C;  2K3B A;  2A08 A;  1AOJ A;  2EPD A;  3ZL7 C;  1LCK A;  1Z9Q A;  2J06 A;  2EYX A;  2RPN A;  2AK5 A;  2O2O A;  4HXJ A;  1GRI A;  1B3Q A;  1YP5 A;  4M4Z A;  1CSK A;  2E5K A;  3VRZ A;  2AZS A;  1U06 A;  3VS2 A;  2RN8 A;  1WXT A;  2RQV A;  1KIK A;  3M0T A;  2LQW A;  2DL3 A;  2GBQ A;  2A37 A;  3VS1 A;  3I5R A;  2DVJ A;  1EFN A;  2K6D A;  2W10 A;  4Z8A A;  4J9I A;  1GL5 A;  1UTI A;  1KFZ A;  5FWC A;  3THK A;  2D1X A;  1PKT A;  3I35 A;  1GFD A;  2OJ2 A;  3REA B;  1G2B A;  2DBK A;  4JZ4 A;  2K79 A;  2CDT A;  1Y57 A;  1UFF A;  1T0H A;  1MV3 A;  3EG1 A;  4Y92 A;  5IHI A;  2HBW A;  1W6X A;  2RQT A;  1M3B A;  1ARK A;  1M3C A;  2LJ1 A;  1PRM C;  1NYG A;  2QDL A;  1PNJ A;  2ED1 A;  5I22 A;  1ZUK A;  2F2V A;  2W0Z A;  2LMJ A;  1ZBJ A;  2KNB B;  2ENM A;  2NUZ A;  1X6B A;  2OAW A;  1QWF A;  2KYM A;  1UEC A;  4E6R A;  2HSP A;  4RTX A;  1YWP A;  1E6G A;  4RUG A;  5IHN A;  1J3T A;  1W1F A;  4CC4 B;  2EGA A;  3UA7 A;  2ROL A;  1FMK A;  2JM9 A;  1VYT A;  2DRK A;  2LP5 A;  2O9V A;  1SEM A;  1PWT A;  1NYF A;  1WLP B;  2J6K A;  2L3Q A;  2SEM A;  3RNJ A;  4RTT A;  2JM8 A;  1NM7 A;  4DEX A;  1WA7 A;  2KRO A;  4D8D A;  2KRM A;  4HVW A;  1AWO A;  1QLY A;  3QWY A;  3U23 A;  4HVV A;  2YT6 A;  4IIM A;  4A63 B;  1NEB A;  3KFV A;  4RTZ A;  1HSQ A;  1SHG A;  1E7O A;  4AG2 C;  1AZE A;  1JXM A;  2EGC A;  1N5Z A;  2KT8 A;  2CUB A;  2DIL A;  2OI3 A;  2D0N A;  1VA7 A;  1K1Z A;  1ZUU A;  4AG1 C;  2JW4 A;  1ABO A;  1FYN A;  2EW3 A;  5IXB A;  2B86 A;  1B07 A;  4LE9 A;  5GJW B;  2EKH A;  1UJY A;  1WXB A;  3TSW A;  1QWE A;  1RLP C;  3M0S A;  2KXD A;  1NLO C;  1M3A A;  2L0A A;  2KYB A;  2EGE A;  2GGR A;  2JMA A;  2XMF A;  3JV3 A;  3PVQ A;  4J9G A;  2GTJ A;  2O31 A;  4J9E A;  2KBT A;  2CSQ A;  1UHC A;  2YDL A;  5FW9 A;  2H8H A;  2RQU A;  3H0H A;  2YUP A;  2HEQ A;  1T0J A;  5GJV B;  3NPF A;  4QT7 A;  3VS7 A;  1AWW A;  2BZY A;  3EG3 A;  2J7I A;  2O9S A;  4CC7 A;  1QKW A;  2AZV A;  1AWX A;  3I9Q A;  2FO0 A;  4OMN A;  1QCF A;  2P4R A;  2DA9 A;  2FRY A;  3GBQ A;  3VRY A;  1UGV A;  2L3S A;  2RF0 A;  1UDL A;  1YCS B;  3REB B;  5L23 A;  4LNP A;  1OPK A;  1UG1 A;  1JXO A;  2CH4 A;  3C0C A;  4JJC A;  1S1N A;  2C0O A;  2DE0 X;  2DJQ A;  3EG0 A;  3UAT A;  1TUC A;  2L3P A;  1YN8 A;  1RI9 A;  1TUD A;  2BTT A;  4LN2 A;  1WDX A;  1HJD A;  3QWX X;  1E6H A;  4JJB A;  4CC2 A;  2ABL A;  2V1R A;  1OV3 A;  3EGU A;  2KXC A;  3H0I A;  4FSS A;  1H8K A;  2PTK A;  1GBR A;  3PE0 A;  4DEY A;  2LNH B;  2L2P A;  2CUD A;  1M8M A;  2AKL A;  2DF6 A;  4RTY A;  4AFZ C;  4J9F A;  5IH2 A;  1GCP A;  2EYY A;  4JPB W;  4LUD A;  1K4U S;  2ROT A;  4LUE A;  1I1J A;  2SRC A;  3VS4 A;  3EHR A;  4GBQ A;  2M0Y A;  3FJ5 A;  2AKK A;  3LH5 A;  4OMO A;  1OOT A;  1SSH A;  4ZNX A;  2DL5 A;  1ZLM A;  4HCK A;  1G83 A;  1ZUY A;  3NGP A;  1VYV A;  2YSQ A;  4CC3 A;  2MIO A;  2G6F X;  2PZ1 A;  1PHT A;  1WFW A;  1UJ0 A;  1H92 A;  2VKN A;  4OMM A;  1JO8 A;  2M51 A;  4OMP A;  2A28 A;  3M0U A;  3R6N A;  2F2X A;  4IIO A;  1X6G A;  1NLP C;  1K76 A;  3O5Z A;  1UE9 A;  5IXF A;  4HVU A;  2F2W A;  1GCQ C;  4ESR A;  4GLM A;  2CT4 A;  2K7A A;  3EG2 A;  3TSZ A;  1WXU A;  4D8K A;  3CQT A;  4F17 A;  1AWJ A;  1CKA A;  1KSW A;  2PNI A;  1JEG A;  2EBP A;  2FPD A;  1M30 A;  1W70 A;  4R0K A;  1NEG A;  3H0F A;  1T3S A;  2JT4 A;  2CT3 A;  1WX6 A;  3UA6 A;  2IIM A;  2MOX A;  2RQR A;  4F14 A;  1AD5 A;  2DLP A;  1WIE A;  3UF4 A;  3SEM A;  4J9C A;  2LCS A;  1Z9Z A;  1OPL A;  2KRN A;  2O88 A;  2GNC A;  2RNA A;  4K11 A;  1YNZ A;  2HDA A;  3M0P A;  1BBZ A;  3TVT A;  2KE9 A;  1AVZ C;  2K2M A;  3VS0 A;  2KT1 A;  1JQQ A;  4RTV A;  2FEI A;  2FPE A;  1U5S A;  4ORZ A;  2NWM A;  2LX7 A;  4JJD A;  2DL4 A;  2YUN A;  3RBB B;  2EVR A;  2KGT A;  2VVK A;  1ZSG A;  2EYW A;  1BU1 A;  2KRS A;  3M0Q A;  4WCI A;  1M27 C;  4AFS C;  2CRE A;  2DMO A;  1X69 A;  1T3L A;  2BZX A;  2JXB A;  2RQW A;  1AZG B;  4Z88 A;  2LQN A;  4J9B A;  2JMC A;  3EHQ A;  2DRM A;  2GTO A;  1U3O A;  1X2K A;  4J9D A;  2A36 A;  1TG0 A;  2K9G A;  1Y0M A;  1H3H A;  2J6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...