2MIOA

Solution nmr structure of sh3 domain 1 of rho gtpase-activating protein 10 from homo sapiens, northeast structural genomics consortium (nesg) target hr9129a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
MGHHHHHHSHMIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho GTPase-activating protein 10
publication title Solution NMR Structure of SH3 Domain 1 of Rho GTPase-activating Protein 10 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9129A
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2mioA00
4E6RA 1BK2A 2L0AA 2RF0A 1JEGA 2RQUA 2CSIA 2L2PA 1E7OA 4OMQA 2F2VA 1WX6A 1JXMA 4D8KA 2E5KA 1M3AA 1K9AA 4J9GA 1UTIA 2K3BA 2C0OA 4CC4B 1ZUUA 1K4US 2D8JA 1HD3A 1GFCA 2FEIA 4J9IA 4K11A 1UG1A 2ECZA 1YP5A 2VVKA 3VS5A 4OMNA 1NEBA 3O5ZA 2AK5A 1WYXA 5ECAA 2J6KA 5IHIA 1AWWA 2DX1A 3QWYA 4AG2C 2MOXA 2DVJA 2O2OA 2AZVA 3M0RA 2PNIA 1WI7A 1MV0B 1BU1A 1TUDA 3JV3A 4A63B 1WA7A 3UA6A 4Y92A 2V1RA 1X2QA 2BTTA 4HVUA 1I07A 4OMPA 1G2BA 2CUDA 3VS4A 2DL5A 1UHFA 2DJQA 2RPNA 1X69A 2GTOA 2D1XA 2J6OA 2KGTA 2AKLA 4WCIA 2AZSA 3EG0A 1VA7A 3REBB 3M0QA 4HVVA 3EG1A 3VS1A 2DA9A 2OI3A 4GLMA 2JS0A 4AFUC 4LN2A 5L23A 1X6GA 1SPKA 2A36A 3QWXX 2FPEA 4DEYA 2V1QA 3GBQA 4X1VA 2DL3A 3VS0A 4J9FA 5GJVB 1UUEA 2EGAA 1B07A 1X27A 1OEBA 1ZUKA 4J9DA 4JJCA 2HDAA 4LE9A 3SEMA 3VS2A 1M30A 4EIKA 1UJ0A 2DMOA 1X6BA 2O9SA 2LNHB 2ESWA 2YT6A 5IHNA 1KJWA 3M0TA 1UHCA 1SSHA 2HCKA 2FG0A 2M51A 1PNJA 2FPDA 2ABLA 2A37A 1ZLMA 3H0HA 4DEXA 4JJDA 3I5RA 1TG0A 2KRMA 3KFVA 4IIMA 4ORZA 3EG2A 1H92A 1VYVA 2K7AA 1WLPB 3PE0A 1NYFA 1KSWA 5FWBA 1T3LA 1CKAA 2KNBB 4AFZC 4Z88A 1EFNA 4AG1C 1PRMC 1UFFA 1GRIA 3R6NA 2PZ1A 1AZGB 1GCQA 3M0PA 4RTYA 1WXBA 2YUNA 3A98A 4JJBA 1VYTA 1PWTA 1U3OA 3UA7A 1BBZA 2YDLA 2LQWA 4HVWA 2EGEA 1JO8A 1AVZC 1OPLA 3ZL7C 2ED0A 1SHFA 5IHKA 1M3BA 1YNZA 1ZX6A 2CH4A 1NG2A 2JXBA 2HSPA 1M3CA 1X43A 2F2XA 2DNUA 4RUGA 2EQIA 1E6HA 2CSQA 1RI9A 1B3QA 2EYWA 3FJ5A 1PKSA 1JU5C 2JMCA 1GL5A 1YN8A 2KYBA 1WDXA 1I1JA 1GCPA 4RTWA 1RLPC 4ESRA 4F17A 3C0CA 3U23A 2GNCA 1UDLA 2O31A 2CDTA 4OMOA 2D0NA 1T3SA 4F16A 1K76A 1Y0MA 4J9HA 2F2WA 1AWJA 3IQLA 2LJ3A 1AWXA 2OAWA 2YUQA 1XOVA 3ULRB 2RN8A 2OJ2A 1YCSB 2DRMA 1K1ZA 3I5SA 2KEAA 2KR3A 1UJYA 2CT3A 1ARKA 2H8HA 2RQTA 1JXOA 3RBBB 2L3PA 2KROA 2M0YA 3PVLA 2ED1A 2KE9A 2RNAA 2QDLA 1W6XA 2EVRA 1VYUA 5IH2A 2SEMA 1SRLA 4AFSC 2W10A 1AOJA 1GBRA 2BZYA 2O88A 4R0KA 3TSZA 3EG3A 2EYZA 1NLPC 1RLQC 2LCSA 2MIOA 2NWMA 1K0XA 2KT8A 5HCKA 1QCFA 1UECA 2BZXA 1PHTA 3THKA 2KXDA 3VS6A 1NYGA 1K0SA 1SEMA 4KRTA 2DF6A 3H41A 3TSWA 3H0IA 2LJ1A 1YWOA 2KXCA 1OOTA 4JPBW 1ABQA 2HBWA 1V1CA 1Z9ZA 2GBQA 1WFWA 5I11A 5FW9A 2DBMA 1SRMA 4QT7A 2JW4A 1MUZA 3VS7A 1QWFA 1I0CA 2RQVA 1PRLC 1NEGA 4F14A 2A08A 1AZEA 2K9GA 2A28A 1E6GA 1HSQA 3UATA 1LCKA 3VRYA 1ZSGA 3I35A 1QLYA 2X3WD 2L3QA 1G83A 1WXUA 2DLPA 4LNPA 2EGCA 2G6FX 3UF4A 2J7IA 2LZ6B 5I22A 1JQQA 2DRKA 4RTUA 2EPDA 2FO0A 1ZUYA 2W0ZA 2GGRA 4GBQA 1GCQC 2P4RA 2JT4A 1ABOA 2O9VA 1T0HA 2KYMA 1H8KA 1IO6A 1OV3A 1QKWA 4CC2A 3NMZC 2DL7A 1S1NA 1N5ZA 2FPFA 2KRNA 1KIKA 5EC7A 2LP5A 3EHQA 4AFQC 1MV3A 2DL4A 2J6FA 2LJ0A 2DILA 1WIEA 4IIOA 4Z89A 4RTTA 4HCKA 2B86A 4RTZA 2KBTA 4JZ3A 3TVTA 1WXTA 4ZNXA 3NGPA 2JM8A 4RTVA 1H3HA 2CREA 1W70A 2EYXA 3NHNA 1GFDA 2AKKA 2CT4A 2CH4W 4FSSA 4CC7A 2JS2A 1AD5A 1UGVA 2LMJA 5FWCA 1Z9QA 2BZ8A 1A0NB 1U06A 3REAB 3LH5A 2PTKA 2HEQA 1BB9A 1FMKA 5IXBA 3H0FA 2LX7A 2YUPA 2FRWA 2DM1A 4J9BA 2CUBA 1SHGA 2D8HA 1NLOC 3EGUA 3SHWA 2EW3A 2SRCA 1TUCA 2KT1A 3CQTA 1YWPA 3PVQA 2RQWA 2DE0X 5IXFA 1M8MA 2X3XD 3M0SA 2YSQA 2VWFA 4OMMA 2MCNA 4J9CA 1UE9A 2IIMA 1NM7A 2GQIA 3VRZA 3VS3A 1Y57A 2J06A 1PKTA 2EYYA 1FYNA 1QKXA 2L3SA 3I9QA 5GJWB 4J9EA 2K2MA 1CSKA 2EKHA 1U5SA 4RTXA 4OMLA 1X2KA 1T0JA 2NUZA 1CKBA 1M27C 2JM9A 2KRSA 1AEYA 1OPKA 1ZBJA 2RQRA 2K6DA 1RUWA 2I0NA 2GTJA 2EBPA 2ENMA 2JMAA 3NPFA 4M4ZA 3RNJA 4Z8AA 2VKNA 4CC3A 2ROLA 2C0IA 3M0UA 4JZ4A 1W1FA 1QWEA 4D8DA 4LUDA 1GBQA 2FRYA 2J05A 2ROTA 2DBKA 2RMOA 1AWOA 2XMFA 2DYBA 4HXJA 4LUEA 2JTEA 2LQNA 2YUOA 1KFZA 1J3TA 1HJDA 2C0TA 2DL8A 3EHRA 2K79A
chains in the Genus database with same CATH superfamily
4E6RA 3CXCA 1K8AC 2G3RA 2E4HA 3CC2Q 5CKEA 4II1A 2EJ9A 1VQKT 2CSIA 2L2PA 4BE0A 3L2UA 1UTIA 2C0OA 2DXUA 1YJ9T 3OYJA 4NOYA 2CZ7B 4XTWA 3HHTB 4C8QE 3V7RA 1GFCA 4XU0A 3MEVA 3NTKA 5GANg 1VQ5T 1YP5A 3OMCA 1N6AA 2HKQB 1WYXA 3QSUA 5IHIA 1G3YA 3CCST 1D0YA 1I5OB 2DVJA 2O2OA 4A53A 2PNIA 1WI7A 4V2SA 1MV0B 2HL5C 2QXFA 1TUDA 3JV3A 3L2VA 4BE2A 4PFZA 4C0FA 2RI3A 3OYYA 1YJNQ 4FYVB 2RHZA 1I07A 3OYCA 4OB2B 2A7YA 3VS4A 5LJ5g 1JRIA 1UHFA 4FL6A 2DJQA 1X69A 2E65A 2GTOA 4C92G 3H8ZA 2KGTA 4X34A 3P8BB 3JB9H 4EMKC 3M0QA 5LJ3f 3G4SQ 1LJOA 4AFUC 1ZSZA 5D6YA 2YRDA 1SPKA 1VQPA 1RABB 2EYQA 4X1VA 1P92A 4HT8A 1QVGA 2DL3A 1UUEA 3CD6T 2L3RA 3MEUA 3HSBA 1OEBA 4JLIA 2LC4A 4FT2A 2HDAA 4EIKA 1UJ0A 1YIJQ 4C0DB 3KBGA 4PJOG 5KYXA 3M9QA 2YT6A 5IHNA 3SDZA 5FRMA 2DTOA 1FX7A 2VGNA 2LRQA 2L8DA 4C92B 4QVDA 1PNJA 3CBPA 1ZA1B 2BUDA 2JUFA 2A37A 3I56T 4DEXA 3CCUT 3CPWS 1QVPA 3KFVA 4IIMA 5LJ5h 1M8VA 5FU6C 5KYWB 3LWHA 4M78E 3JCMh 3PE0A 3SWNC 3OS1A 1KSWA 5FWBA 1VQLT 1VQ7T 4Z88A 1PRMC 1MMNA 1UGRB 3RKYA 1GRIA 1WXBA 2YUNA 5CKBA 3ZEHA 5CO7A 4JJBA 1U3OA 2BKDN 3V7SA 1MGQA 3OSVA 1NJIC 2LQWA 5KYUB 4C92F 2QQAA 2HMAA 4PJOB 1OPLA 2X4WA 4M75D 3OMGA 2X4YA 1VQMQ 4XK8E 2CGHA 4QW2A 1H3ZA 1RADB 4N0AC 3E1SA 4B9XA 4ZTFA 1G3SA 1M3CA 4GLKA 1E6HA 2F5TX 1RI9A 1B3QA 5DM7R 4FW1A 1YI2Q 7AT1B 2O4XB 1PKSA 1WGSA 2LVMA 2OTJA 2QAZA 1JU5C 2JMCA 1GL5A 1WDXA 3U23A 5GANe 3A8HB 5IN1A 2VB6A 4M75G 2CDTA 1K76A 2DKGA 3META 1Y0MA 5KYUA 1AWJA 4PJOA 4PJOF 2RJEA 1EZZB 2FZGB 3J80E 2YUQA 3ULRB 3CCEQ 4FYXB 2OTLA 1IB8A 1K1ZA 2KEAA 1S72Q 1D1CA 3RBBB 3OYHA 2L3PA 2M0YA 2HD0A 3FDRA 2RHUA 3GNGA 2KQWA 3M58A 4J7FA 2O4XA 2QDLA 2QTVA 3OBYA 1F1BB 2EIFA 2EVRA 2E64A 4EDUA 1VYUA 1QCNA 1V29B 1KC8R 2W10A 1C1AA 1AOJA 2O88A 3TSZA 1NLPC 3V8LA 2MIOA 4FCYA 2YLBA 3CC2A 3QG1A 2RK1A 4KH0B 3G71Q 3UWNA 1NJIR 1M2OA 2DZCA 4F7UG 2F1LA 4KGZB 3H0IA 4KT0E 4C5HA 5IAYA 1YWOA 3CCVT 1VQ8A 1SG5A 3CPFA 1KHCA 4XTUA 4OB1B 1ABQA 4ZN1A 3CCMA 2O01E 4LDWA 3OYGA 1QWFA 2HNIA 4PJJA 2KDSA 2VV5A 4F14A 2A08A 2K9GA 2A28A 3S3MA 4M75A 3S6WA 1YHQT 1YJNT 1E6GA 1HSQA 2X4XA 3VRYA 3OSSC 4NL3A 4J6XA 1QVFA 1BIBA 1LPLA 4M7AD 3BY7A 2EFIA 1KK7A 5KH6A 3QUIA 5LJ3e 4F7UB 1NJIU 1Q82C 1ZUYA 4OB0B 3PIOA 2DXBA 2JT4A 1ABOA 2HZYA 3G4ST 3C4SA 1BI0A 1D0ZA 1H8KA 2QA4A 4CC2A 3NMZC 3EFOA 1VQOT 3QDRB 4ELYC 1R77A 4QQGA 5GAOr 1MV3A 2DIGA 2EAYA 4N4GA 1M4ZA 4IIOA 5FU7B 4Z89A 3M56A 2B8AA 3OW2P 4QVZA 3J7AF 2CYZB 3CC4A 3NGPA 1PG5B 1Y07A 2FYKA 4M78C 3EGDA 1YIJT 4OP0A 3A8GB 2WSFE 4F7UF 3NHNA 1V76A 2XG8D 2RJFA 3E9GA 3CPWP 4ZTJA 1WQ7A 4IUPA 5FWCA 3CMEQ 3ER0A 3EG9A 4J5YA 2PTKA 2HEQA 2M02A 2LX7A 1VQ6Q 3OA6A 3VUBA 2E12A 1YJWQ 4M77E 1G5VA 1YJ9Q 2EW3A 2SRCA 3A8LB 3ASKA 4NL2A 5CKDA 2ZPIB 2MCNA 4J9CA 2K3XA 1NM7A 2GQIA 5GAMf 1RI0A 2YHTA 1HXDA 1VQ5Q 1QKXA 3I9QA 2KK4A 1OU8A 1TOVA 5A0GA 2XDPA 3MCAB 3OYIA 3GP8A 3M57A 1OPKA 1YI2T 2RQRA 1RUWA 3SB2A 3NPFA 2VKNA 1VQMA 4X9CA 4JZ4A 2AT1B 4RG8A 2DAQA 2M1HA 2RO0A 2ZZDA 3BDUA 4FYWB 2L5QA 2RK2A 2ROTA 5A0LA 5J26A 1AWOA 2DYBA 3CCET 3HRTA 2JTEA 3WXMB 1KFZA 4M7AC 1J3TA 5J3BA 1HJDA 3EHRA 1MNDA 3BW1A 4OMFB 5GAN8 1O75A 4QQ6A 1S72T 3G1JA 5GANd 1FWZA 1JEGA 1BI3A 2QG9B 1WX6A 9ATCB 4D8KA 1ZUUA 5IT9E 3CD6Q 1M90R 4PJNA 3EH2A 4J9IA 4FM4B 4K11A 4N4IA 4ANJA 1UG1A 2CS7A 3OBWA 3NTHA 5I2SA 3QDFA 1BCOA 1H641 4PFOA 3VS5A 3V8KA 2Y4YA 2D9TA 2CP5A 3EGXA 5GMKj 2OAUA 1Y96B 3I56Q 1AWWA 2FZKB 3CCUQ 1UGPB 3L2QA 2M16A 4JRIA 1I4K1 4TVRA 1Q86R 3G71A 1M1KC 4A54A 4A63B 5D7UA 1VQ7Q 3OYMA 3QZ5B 4ZN3A 1XJWB 2YWWA 4OMPA 1G2BA 1M90U 1IREB 2LCCA 4HA8A 2EQKA 2AKLA 3F70A 3D7SB 2AZSA 4VUBA 2GF7A 2Z0WA 1VA7A 3REBB 3EG1A 1TS9A 3CPWA 4MZPA 3ZBDA 5HK3A 2PVGB 2EJFA 2XICA 4A4GA 5L23A 2CZ1B 3S3NA 1X6GA 4E7IA 1RAFB 2A36A 4IUQA 3QWXX 1OYXA 4DEYA 2V1QA 3HKSA 2EQUA 4FIBA 5GJVB 4M7DC 3P8HA 2EGAA 3JRZA 1O9SA 4JJCA 3M4YA 5LJ3d 1RAAB 3SEMA 4X9DA 1PC0A 3OYEA 3VJPA 2DMOA 1X6BA 3MO8A 1BKBA 4A4EA 2DD5A 5FRNA 3VKIA 1SSHA 2QQSA 2NUTA 1QW1A 4M77C 2FPDA 2EWNA 2ABLA 3H0HA 4DQ2A 3OS2A 2P0KA 4RCBA 1TG0A 3EG2A 4DOVA 2LCLA 1WLPB 2LDMA 3S3OA 2JTMA 4AFZC 1EFNA 3OB9A 3WVDB 4AG1C 4JRPA 3R6NA 1OULA 1VQ6T 1GCQA 4RTYA 2QGGA 2M0OA 4NS5A 1YJWT 1VIFA 1NE8A 1WNLA 1WQWA 3CMEA 1SF9A 1BI2A 3UA7A 3GOXA 5GAMe 2E1HA 2GCXA 4MDWA 1VQKA 1ZQ1A 5KYYB 2KI7A 2RHXA 3JB9J 1B34B 3ZL7C 3T9NA 4BY6C 1SHFA 2PVDB 5IHKA 1ZX6A 1FMWA 1JJ2P 3CCVQ 4DBHA 3CMAT 2F2XA 2DNUA 5HY6A 5GAN4 1N9RA 2CSQA 5LJ5f 3LH0A 1TH7A 2R57A 4C92D 3CCQT 3JCMf 1YN8A 4E7HA 3JB9I 1GCPA 1RLPC 3C0CA 3DLMA 1VQ4T 1M1KU 1LNXA 2VYTA 4OF1A 2GNCA 1YHQQ 3CCSA 5KYYA 4EMHA 2RN8A 1YCSB 2DRMA 2OX7A 3I5SA 2EJGA 2KR3A 3HFNA 2KROA 3PVLA 4JDSA 2RNAA 3JCMb 4XQ3A 1KQ2A 3L1AA 4PJOD 1TXQA 4F04B 5GMKi 5IH2A 1K8AR 5GANh 1AHJB 1VQOQ 2AHJB 1GBRA 5FU6B 4OGEA 3LX7A 3G6ET 2HKNA 2KT8A 3RKWA 3LGFA 1VQ9A 1ZSZC 2BZXA 2XDDA 2KXDA 3PNWC 1W2BP 2Y90A 1R8OB 3OW2S 2DK3A 2MYSA 1U8RA 2XI9A 2E70A 3CD6A 2RI2A 1OOTA 2HBWA 3E19A 3OYNA 1Z9ZA 3JCMJ 5I2MA 2DBMA 1SRMA 4OB3B 3AT1B 4C8QG 3OYDA 1VOMA 5LJ3g 3M55A 4MMKA 1I0CA 1K8AU 1MMGA 1AZEA 1QP3A 3A5ZB 3FIFA 1G3WA 1LCKA 2JZ2A 1B7TA 3I56A 1K9MC 4KUDK 5GAOq 1WPYA 2X3WD 5GAN3 2FHDA 4EMGA 5CCAA 2EGCA 3RMSA 3UF4A 3VU3C 2J7IA 2LZ6B 3HFOA 1VQLA 4RTUA 4C92A 3URGA 2MWOA 2GGRA 3CBOA 4GBQA 1TSFA 4BD3A 2KYMA 1OV3A 4C0DC 5KYWA 4MZTA 2QEXT 3MEWA 1S1NA 1N5ZA 2L89A 1KIKA 4C8QB 2LP5A 4P5NA 4AFQC 1PSEA 2XD0A 1WIEA 2HSEB 2DXTA 4PLIA 4LD9K 3TVTA 2JM8A 5LJ3h 1H3HA 5LJ5j 1KD1C 2CT4A 2JS2A 4LXCA 4XTZA 2EKOA 3REAB 2CP2A 3JCMX 5IXBA 3FB9A 3H0FA 4C8QA 3JCMW 4C8QF 3DB4A 4PJOC 1KQ1A 2WSCE 2CUBA 2RD1A 5KE3A 1SHGA 3AHUA 3SHWA 1PCXA 1TUCA 1YWPA 2VGMA 4M7AE 1M1GA 5IXFA 1K9MR 2X35A 1Q7YC 1UE9A 2DTIA 3VS3A 4IURA 1PKTA 1X75C 2EYYA 4M78G 2FL7A 4J9EA 2K2MA 4OMLA 1SSFA 1T0JA 1M27C 3NFCA 2JM9A 3RKXA 3C12A 1QP2A 4ATOA 1D3BB 1ZBJA 3RMQA 4KUIA 2I0NA 5KYNA 2GTJA 4BUGA 5GAMd 2EBPA 3FLGA 4J6WA 1JBMA 3I55T 2PVOB 3RNJA 4CC3A 3DLLA 3QXEB 1N8RC 2C0IA 3M0UA 1QWEA 4LUDA 5CIUA 3L2RA 3CCVA 2ZPFB 1GBQA 5M9OA 4C5EA 4PLLA 1K9MU 1NZ9A 2YUOA 1W2BA 2DL8A 1W4SA 4M78B 4XAXB 1WZOA 4C0ZA 2L0AA 2RF0A 1D3BA 4M75C 2RQUA 4E7JA 5CK9A 3RR6A 4L5GA 1YHQA 1YJNA 3EFSA 1JXMA 1RAGB 4HCBA 1NPRA 1IZ6A 5HK0A 2E5KA 2LX9A 2ZPGB 1WHKA 2K3BA 4CC4B 2QASA 1YCYA 1TU0B 4O6JA 2K4YA 1HD3A 2F5KA 2PUKB 5I21A 4DBQA 2FEIA 3QBYA 4JS4A 1RAEB 3HL8A 2NLUA 3G4SA 2DD4A 2ECZA 4KGXB 3PTAA 4J83A 4JLGA 3GLXA 1VQOA 2COYA 5GAN7 4M78F 3FRNA 5ECAA 4F7UA 2RB6A 2ZPEB 4ELZC 4M7DE 2DX1A 3QWYA 4AG2C 2MOXA 1KD1U 3TREA 1I8FA 4LDXA 2AZVA 3M0RA 2HQXA 2HAXA 5GAN5 5GAOp 2DYIA 4R55A 3NTIA 1YIJA 2LTOA 4Y92A 2ZAEA 2V1RA 4L59A 4FYYB 4DA4A 2BTTA 4HVUA 1YITT 4PJLA 2E3IA 2E10A 3A1PA 3QHSA 1Y71A 3RUXA 1WJQA 2EQJA 2J6OA 5CQYA 1Q7YU 1MMAA 3QYGB 2OI3A 3OS0A 2KMTA 3PFSA 4LN2A 1Q82R 3CMAQ 2FPEA 1D1BA 3GBQA 1C6VX 2FVUA 4BE1A 2E6NA 4J9FA 2PUOB 2X4JA 1UB4A 4XTXA 4FU6A 3CCQQ 1JJ2S 1TUGB 5DY9A 2BE7D 4RKUE 1ZUKA 3OQ5A 1KQSP 2CP6A 1VQ4Q 5DLQE 1VQNT 2E6ZA 1NPPA 8AT1B 1N8RU 2LNHB 3PIPA 4HCZA 3CXCP 1KJWA 3CCJT 2HCKA 3M53A 2FG0A 4FW2A 2M51A 1M1FA 2FZCB 3CC7T 1YI2A 5CVIA 2PU9B 3TQ7P 4RCCA 4PNOA 3CCLT 2CZ6B 4ORZA 5GAMg 2E3HA 1H92A 2NYSA 1VYVA 2K7AA 1MNEA 3RESA 4JS5A 1NYFA 2Y4XA 1CKAA 2KNBB 1Q82U 2QQRA 1HK9A 2MAMA 4PFPA 3M59A 1AZGB 1K73C 3PGGA 3M54A 3CCEA 2PQWA 3A98A 1N9SA 2R5AA 5AT1B 4HKEA 4M7DG 1VYTA 3G6EQ 1S72A 3MP8A 2K5LA 2EGEA 3X24B 3JB9G 2ZCFB 4E47A 1WHHA 3E9FA 2ED0A 3UT1A 3BE3A 1M3BA 1YNZA 2CKKA 1OU9A 1NG2A 2HSPA 1UGQB 3M4GA 1W2BS 4M77G 1RAIB 4RUGA 2EQIA 4KH1B 4J8OA 1Q95G 4F17A 4J7IA 4E7KA 3V7CA 5GAMh 1UDLA 2O31A 4OMOA 2D0NA 2IG0A 1MMDA 1T3SA 4F16A 4XU1A 2NUPB 3MHXA 4M7DB 3IQLA 2LJ3A 1XOVA 3JAME 2OJ2A 2HQEA 4JRQA 3INZA 3OW2A 1UJYA 3VV0A 3C94A 1X01A 5A2QE 1ARKA 1PSFA 2YRVA 2RQTA 3L42A 1Y7XA 1RL2A 2JN0A 3H6ZA 1QVGP 4MMLA 1Y96A 2KE9A 3FJPA 2MF2A 1GXIE 3RERA 4M77B 2EQMA 2QEXQ 4AFSC 3EH1A 2DEUA 2LT1A 1K73R 3EG3A 5GMKe 2LCSA 1EIFA 3CCRT 3Q1JA 2OTJQ 4M7DF 2COZA 5HCKA 2XU8A 3JB9F 3VS6A 2CZ0B 2P0PA 1NYGA 4KRTA 4UC4A 1U1TA 4PK4A 2V26A 2LJ1A 2KXCA 4OVAA 2OTLQ 1ZA2B 4JPBW 3HPWA 3VYHB 5GMKl 4M77F 2GBQA 1WFWA 5FW9A 1TWBA 4Y28E 4LD6A 2JTFA 5GANf 2IVWA 2RQVA 1OQKA 2DTHA 4BI8B 2K3YA 1M1KR 1QMCA 2RHYA 4DOWA 2CP7A 3UATA 3QZ9B 1K73U 3I35A 4JJNK 1QLYA 2L3QA 4BDZA 3UPUA 2DLPA 4LNPA 1OZ2A 5I22A 2EPDA 2FO0A 4RG2A 2VXEA 5CAIA 3V8JA 1QQJA 1XNIA 4PJOE 4HCCA 3X25B 3ME9A 4LDUA 1VQ6A 3OS5A 1GCQC 2P4RA 2O9VA 1T0HA 1YJWA 1QKWA 3EFRA 1YJ9A 2ZPBB 1G3TA 2DL7A 1VQ8Q 2KRNA 5EC7A 3QYHB 4EMKB 3EHQA 2P4TA 1WHGA 4YTLA 2DL4A 2LJ0A 4OGCA 3CCMQ 2DILA 3I55Q 1IGQA 1VQ5A 2B86A 4RTZA 1PD0A 1BYMA 4JZ3A 1WXTA 3BFMA 3RDVA 1MHNA 2H3JA 4RTVA 2XDBA 3CMAA 2CREA 5AYFA 4MZMA 3MP1A 2V8KA 4E7LA 4FSSA 3CCQA 1B34A 1AD5A 3WVEB 2GQVA 2LMJA 1ZSZB 3DKMA 4HT9A 1ZHIA 1VQ4A 1FMKA 1U1SA 1M9SA 3A8OB 4EMKA 2KVQG 2DM1A 4J9BA 1RAHB 2QA4Q 3MJXA 2A3LA 2D8HA 3EGUA 4JRKA 3MP6A 1VQPT 3DB3A 2JVVA 4IUUA 2VUBA 3M0SA 2YSQA 3JCMg 2VWFA 4OMMA 5KYXB 3SWNB 3VRZA 4C8QD 8ATCB 4ZGEB 4M75E 1RACB 2K57A 3G7ZA 2L3SA 1FYNA 5KE2A 3CC4Q 1VQ9T 1R0BG 5GJWB 1EX4A 1U5SA 1X2KA 3X20B 1G8XA 2KRSA 3G6EA 2HBPA 1TTHB 2JMAA 1QVFP 4M4ZA 5GMKm 1KG1A 1D0XA 1W1FA 1Q81C 3SWNA 4D8DA 1YITQ 2CP0A 1NBEB 1M5Q1 1D1AA 4E2FB 2FRYA 3LYIA 2RH2A 3MKDA 2E5QA 4GY5A 3PMTA 1WHMA 2XMFA 3CCUA 4LUEA 5DLOA 2C0TA 2DVEA 5GANj 4PL6A 4R56A 1VQ7A 1BK2A 1KC8C 4F7UE 2GFUA 1E7OA 3VYGA 4OMQA 2XIDA 2F2VA 1OX9A 3QKJA 1M3AA 1K9AA 4J9GA 4N0AA 2D8JA 1K4US 3X28B 5C0MA 2GFAA 2I2LA 4C92C 4IUTA 1IHVA 1QCOA 3JCMc 2OTJT 1VQNQ 1FMVA 3UDCA 1N27A 5EG2A 4BACA 2QTXA 1KQSS 4LDVA 2COWA 2VVKA 4BI4A 4OMNA 1NEBA 2YLCA 3O5ZA 2QEXA 3CCJQ 2AK5A 1WJSA 2DPPB 3HRSA 2J6KA 3CC7Q 3HTRA 3CXCS 4RMOA 4ME7A 3CCLQ 2OTLT 2QQ9A 4MDXA 1BU1A 1WA7A 4O5VA 1JJ2A 3UA6A 3LGLA 4IKFA 4M78D 1X2QA 3LWIA 3GNFB 2E41A 2VC8A 1VIEA 5CKHA 4J6YA 2LNVA 1Q81R 2CUDA 2DL5A 2RPNA 2D1XA 4WCIA 3A8MB 4C8QC 4E7ZA 3EG0A 1WJRA 3R6OA 4HVVA 3VS1A 2DA9A 3CC2T 4GLMA 1XQHA 4A4FA 2JS0A 1ACMB 2BE9B 5LJ5e 2QDYB 3VS0A 3QO3A 5LJ3j 1VQ8T 3JCMe 2WSEE 2QQBA 4M75B 1B07A 1WHLA 1X27A 1OX8A 4J9DA 2JJ9A 2YRCA 3CCMT 4LE9A 2DXCA 2QI2A 3VS2A 1M30A 2K5IA 4EPCA 2O9SA 1BI1A 1UGSB 2ESWA 2LT4A 2M9UA 1Q81U 6AT1B 3M0TA 3TCJA 1UHCA 4B6MA 5HKCA 4BI3A 4BDYA 3HRUA 1ZLMA 1YFNA 4JJDA 3I5RA 2V8JA 1KD1R 2KRMA 3I55A 3J81E 3OYLA 3EFOB 5A0DA 2X51A 4E7SA 2JOYA 5KCHA 2CP3A 1T3LA 1X6OA 3CBMA 2BIVA 3QIIA 1KC8U 1QVGS 1UFFA 3KXTA 4M75F 2PZ1A 4C0GA 3M0PA 5GAOl 3M5AA 4CI0C 2QA4T 1FXXA 4QQDA 3CCRQ 5GAN6 1PWTA 3EGDB 1BBZA 4QKUA 2YDLA 2AIRB 4HVWA 2QYZA 2HQHA 1JO8A 2DIQA 1AVZC 2V8IA 4N4HA 1Q7YR 4Z02A 4FSXA 4KBMB 3CC4T 3EG9B 2CH4A 4M78A 2KY9A 1WHJA 2JXBA 1X43A 2EYWA 2DEQA 3FJ5A 4AT1B 2FB7A 4M7AG 3GF5A 2KYBA 2DZ9A 1I1JA 4RTWA 3VUZA 4ESRA 1SKUB 4KULA 3OYKA 2QGFB 2YXYA 4J9HA 2F2WA 3TU4K 1N8RR 4XU2A 5CQXA 1AWXA 3JCMV 2OAWA 3GPLA 2CT3A 2WACA 2A0FB 2H8HA 4D6WA 4JUVA 1JXOA 1PM3A 2IPOB 4C5IA 5FROA 2C06A 1VQKQ 3LW5E 2ED1A 4ZGDB 5D6XA 1PD1A 3N5BB 5FU7C 1YITA 1W6XA 4DBRA 3OYAA 2SEMA 2K5FA 5J39A 1M90C 1SRLA 3BDLA 1HYOA 2DFUA 2D0QB 4M7AB 5C6SA 2BZYA 3HP9A 4R0KA 2EYZA 5FLXE 1RLQC 2RM4A 2NWMA 1K0XA 2D6FA 3JCMQ 3CEYA 5LL6S 3MPUB 4Y91A 1QCFA 1UECA 5D6WA 1PHTA 3THKA 3SD4A 1C0MA 2QK0A 4BB7A 1VQMT 1K0SA 3EAEA 1SEMA 2DF6A 3CCSQ 1R0CB 2HL3A 3H41A 1AT1B 3TSWA 1I5LA 1Q86C 5CR2A 3E2UA 1UEBA 4M7DD 4IUVA 2R5MA 2P0QA 1V1CA 5I11A 5GAOn 3GIBA 4QT7A 1DJ7B 2JW4A 2VXFA 1VQNA 2MK5A 1MUZA 4M7AA 3VS7A 4M7AF 5GMKh 3JB9D 1M2VB 3FC3A 5GAN2 4C5GA 4QVCA 1PRLC 4PKCC 1NEGA 3CCJA 2RJDA 3OYFA 2RHIA 3QPHA 1OI1A 2MMPA 3C95A 2XK0A 3CC7A 1ZSGA 2KAFA 2RI5A 3PT9A 4A4HA 1VQPQ 4M77D 2VASA 5L8RE 1G83A 1LVKA 1WXUA 3CCLA 2MWPA 5GAOm 2G6FX 1JQQA 3EGXB 2DRKA 1KHIA 2W0ZA 1VQ9Q 3KUFA 2MPXC 4A4KA 3JCMP 4XU3A 2ZGWA 2LQKA 1IO6A 3L2WA 1OZ3A 1M2VA 3H9NA 2FPFA 2X9HA 2RA2A 2J6FA 4RTTA 4HCKA 1YBYA 2R58A 4WTOB 3G71T 2KBTA 4DBFA 4ZNXA 1QVFS 1W70A 2EYXA 1GFDA 2AKKA 2RJCA 2CH4W 4CC7A 5LJ5d 1IRXA 4FT4A 3MEAA 1IGUA 4LDYA 1UGVA 4L6V5 1Z9QA 3JCMd 2BZ8A 1A0NB 1U06A 3LH5A 3JSCA 1BB9A 1VQLQ 4AMCA 2K2VA 5CKFA 2MI6A 2JNGA 2YUPA 2FRWA 3OYBA 2ATCB 1JB0E 1NLOC 3CQTA 2KT1A 4XTYA 3RIRA 3PVQA 3ZFJA 2RQWA 2DE0X 1M8MA 2X3XD 2DJZA 1ZBXA 2KSSA 2IIMA 2XKOC 2NUPA 4PJMA 4M7DA 3SFMA 1I81A 2NUTB 3PMIA 4ZGJB 3O8VA 2LQ8A 1BIAA 1Y57A 2J06A 1CSKA 3X26B 2EKHA 4RTXA 1IXDA 1LOJA 2DERA 2NUZA 1VUBA 4WF2A 1CKBA 2H3EB 3QJYA 1IHWA 5GAMj 1AEYA 3CCRA 2F69A 2ZPHB 4C92E 3L2ZA 1Q86U 4M77A 3OY9A 3FEOA 2K6DA 2ENMA 4KGVB 4BY6B 1BCMA 3TEEA 3LLRA 4Z8AA 2ROLA 4B9WA 1XTDA 2DO3A 2J05A 1D09B 2DETA 2DBKA 2RMOA 3P8DA 5KCOA 1KQSA 4Q5WA 2P84A 4XTVA 4CRIA 4HXJA 2XHCA 2LQNA 2K79A 3CMET 3QJ6A
chains in the Genus database with same CATH topology
4E6RA 1BK2A 2L0AA 2RF0A 1JEGA 2RQUA 2CSIA 2L2PA 1E7OA 4OMQA 2F2VA 1WX6A 1JXMA 4D8KA 2E5KA 1M3AA 1K9AA 4J9GA 1UTIA 2K3BA 2C0OA 4CC4B 1ZUUA 1K4US 2D8JA 1HD3A 1GFCA 2FEIA 4J9IA 4K11A 1UG1A 2ECZA 1YP5A 2VVKA 3VS5A 4OMNA 1NEBA 3O5ZA 2AK5A 1WYXA 5ECAA 2J6KA 5IHIA 1AWWA 2DX1A 3QWYA 4AG2C 2MOXA 2DVJA 2O2OA 2AZVA 3M0RA 2PNIA 1WI7A 1MV0B 1BU1A 1TUDA 3JV3A 4A63B 1WA7A 3UA6A 4Y92A 2V1RA 1X2QA 2BTTA 4HVUA 1I07A 4OMPA 1G2BA 2CUDA 3VS4A 2DL5A 1UHFA 2DJQA 2RPNA 1X69A 2GTOA 2D1XA 2J6OA 2KGTA 2AKLA 4WCIA 2AZSA 3EG0A 1VA7A 3REBB 3M0QA 4HVVA 3EG1A 3VS1A 2DA9A 2OI3A 4GLMA 2JS0A 4AFUC 4LN2A 5L23A 1X6GA 1SPKA 2A36A 3QWXX 2FPEA 4DEYA 2V1QA 3GBQA 4X1VA 2DL3A 3VS0A 4J9FA 5GJVB 1UUEA 2EGAA 1B07A 1X27A 1OEBA 1ZUKA 4J9DA 4JJCA 2HDAA 4LE9A 3SEMA 3VS2A 1M30A 4EIKA 1UJ0A 2DMOA 1X6BA 2O9SA 2LNHB 2ESWA 2YT6A 5IHNA 1KJWA 3M0TA 1UHCA 1SSHA 2HCKA 2FG0A 2M51A 1PNJA 2FPDA 2ABLA 2A37A 1ZLMA 3H0HA 4DEXA 4JJDA 3I5RA 1TG0A 2KRMA 3KFVA 4IIMA 4ORZA 3EG2A 1H92A 1VYVA 2K7AA 1WLPB 3PE0A 1NYFA 1KSWA 5FWBA 1T3LA 1CKAA 2KNBB 4AFZC 4Z88A 1EFNA 4AG1C 1PRMC 1UFFA 1GRIA 3R6NA 2PZ1A 1AZGB 1GCQA 3M0PA 4RTYA 1WXBA 2YUNA 3A98A 4JJBA 1VYTA 1PWTA 1U3OA 3UA7A 1BBZA 2YDLA 2LQWA 4HVWA 2EGEA 1JO8A 1AVZC 1OPLA 3ZL7C 2ED0A 1SHFA 5IHKA 1M3BA 1YNZA 1ZX6A 2CH4A 1NG2A 2JXBA 2HSPA 1M3CA 1X43A 2F2XA 2DNUA 4RUGA 2EQIA 1E6HA 2CSQA 1RI9A 1B3QA 2EYWA 3FJ5A 1PKSA 1JU5C 2JMCA 1GL5A 1YN8A 2KYBA 1WDXA 1I1JA 1GCPA 4RTWA 1RLPC 4ESRA 4F17A 3C0CA 3U23A 2GNCA 1UDLA 2O31A 2CDTA 4OMOA 2D0NA 1T3SA 4F16A 1K76A 1Y0MA 4J9HA 2F2WA 1AWJA 3IQLA 2LJ3A 1AWXA 2OAWA 2YUQA 1XOVA 3ULRB 2RN8A 2OJ2A 1YCSB 2DRMA 1K1ZA 3I5SA 2KEAA 2KR3A 1UJYA 2CT3A 1ARKA 2H8HA 2RQTA 1JXOA 3RBBB 2L3PA 2KROA 2M0YA 3PVLA 2ED1A 2KE9A 2RNAA 2QDLA 1W6XA 2EVRA 1VYUA 5IH2A 2SEMA 1SRLA 4AFSC 2W10A 1AOJA 1GBRA 2BZYA 2O88A 4R0KA 3TSZA 3EG3A 2EYZA 1NLPC 1RLQC 2LCSA 2MIOA 2NWMA 1K0XA 2KT8A 5HCKA 1QCFA 1UECA 2BZXA 1PHTA 3THKA 2KXDA 3VS6A 1NYGA 1K0SA 1SEMA 4KRTA 2DF6A 3H41A 3TSWA 3H0IA 2LJ1A 1YWOA 2KXCA 1OOTA 4JPBW 1ABQA 2HBWA 1V1CA 1Z9ZA 2GBQA 1WFWA 5I11A 5FW9A 2DBMA 1SRMA 4QT7A 2JW4A 1MUZA 3VS7A 1QWFA 1I0CA 2RQVA 1PRLC 1NEGA 4F14A 2A08A 1AZEA 2K9GA 2A28A 1E6GA 1HSQA 3UATA 1LCKA 3VRYA 1ZSGA 3I35A 1QLYA 2X3WD 2L3QA 1G83A 1WXUA 2DLPA 4LNPA 2EGCA 2G6FX 3UF4A 2J7IA 2LZ6B 5I22A 1JQQA 2DRKA 4RTUA 2EPDA 2FO0A 1ZUYA 2W0ZA 2GGRA 4GBQA 1GCQC 2P4RA 2JT4A 1ABOA 2O9VA 1T0HA 2KYMA 1H8KA 1IO6A 1OV3A 1QKWA 4CC2A 3NMZC 2DL7A 1S1NA 1N5ZA 2FPFA 2KRNA 1KIKA 5EC7A 2LP5A 3EHQA 4AFQC 1MV3A 2DL4A 2J6FA 2LJ0A 2DILA 1WIEA 4IIOA 4Z89A 4RTTA 4HCKA 2B86A 4RTZA 2KBTA 4JZ3A 3TVTA 1WXTA 4ZNXA 3NGPA 2JM8A 4RTVA 1H3HA 2CREA 1W70A 2EYXA 3NHNA 1GFDA 2AKKA 2CT4A 2CH4W 4FSSA 4CC7A 2JS2A 1AD5A 1UGVA 2LMJA 5FWCA 1Z9QA 2BZ8A 1A0NB 1U06A 3REAB 3LH5A 2PTKA 2HEQA 1BB9A 1FMKA 5IXBA 3H0FA 2LX7A 2YUPA 2FRWA 2DM1A 4J9BA 2CUBA 1SHGA 2D8HA 1NLOC 3EGUA 3SHWA 2EW3A 2SRCA 1TUCA 2KT1A 3CQTA 1YWPA 3PVQA 2RQWA 2DE0X 5IXFA 1M8MA 2X3XD 3M0SA 2YSQA 2VWFA 4OMMA 2MCNA 4J9CA 1UE9A 2IIMA 1NM7A 2GQIA 3VRZA 3VS3A 1Y57A 2J06A 1PKTA 2EYYA 1FYNA 1QKXA 2L3SA 3I9QA 5GJWB 4J9EA 2K2MA 1CSKA 2EKHA 1U5SA 4RTXA 4OMLA 1X2KA 1T0JA 2NUZA 1CKBA 1M27C 2JM9A 2KRSA 1AEYA 1OPKA 1ZBJA 2RQRA 2K6DA 1RUWA 2I0NA 2GTJA 2EBPA 2ENMA 2JMAA 3NPFA 4M4ZA 3RNJA 4Z8AA 2VKNA 4CC3A 2ROLA 2C0IA 3M0UA 4JZ4A 1W1FA 1QWEA 4D8DA 4LUDA 1GBQA 2FRYA 2J05A 2ROTA 2DBKA 2RMOA 1AWOA 2XMFA 2DYBA 4HXJA 4LUEA 2JTEA 2LQNA 2YUOA 1KFZA 1J3TA 1HJDA 2C0TA 2DL8A 3EHRA 2K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6R A;  1BK2 A;  2L0A A;  2RF0 A;  1JEG A;  2RQU A;  2CSI A;  2L2P A;  1E7O A;  4OMQ A;  2F2V A;  1WX6 A;  1JXM A;  4D8K A;  2E5K A;  1M3A A;  1K9A A;  4J9G A;  1UTI A;  2K3B A;  2C0O A;  4CC4 B;  1ZUU A;  1K4U S;  2D8J A;  1HD3 A;  1GFC A;  2FEI A;  4J9I A;  4K11 A;  1UG1 A;  2ECZ A;  1YP5 A;  2VVK A;  3VS5 A;  4OMN A;  1NEB A;  3O5Z A;  2AK5 A;  1WYX A;  5ECA A;  2J6K A;  5IHI A;  1AWW A;  2DX1 A;  3QWY A;  4AG2 C;  2MOX A;  2DVJ A;  2O2O A;  2AZV A;  3M0R A;  2PNI A;  1WI7 A;  1MV0 B;  1BU1 A;  1TUD A;  3JV3 A;  4A63 B;  1WA7 A;  3UA6 A;  4Y92 A;  2V1R A;  1X2Q A;  2BTT A;  4HVU A;  1I07 A;  4OMP A;  1G2B A;  2CUD A;  3VS4 A;  2DL5 A;  1UHF A;  2DJQ A;  2RPN A;  1X69 A;  2GTO A;  2D1X A;  2J6O A;  2KGT A;  2AKL A;  4WCI A;  2AZS A;  3EG0 A;  1VA7 A;  3REB B;  3M0Q A;  4HVV A;  3EG1 A;  3VS1 A;  2DA9 A;  2OI3 A;  4GLM A;  2JS0 A;  4AFU C;  4LN2 A;  5L23 A;  1X6G A;  1SPK A;  2A36 A;  3QWX X;  2FPE A;  4DEY A;  2V1Q A;  3GBQ A;  4X1V A;  2DL3 A;  3VS0 A;  4J9F A;  5GJV B;  1UUE A;  2EGA A;  1B07 A;  1X27 A;  1OEB A;  1ZUK A;  4J9D A;  4JJC A;  2HDA A;  4LE9 A;  3SEM A;  3VS2 A;  1M30 A;  4EIK A;  1UJ0 A;  2DMO A;  1X6B A;  2O9S A;  2LNH B;  2ESW A;  2YT6 A;  5IHN A;  1KJW A;  3M0T A;  1UHC A;  1SSH A;  2HCK A;  2FG0 A;  2M51 A;  1PNJ A;  2FPD A;  2ABL A;  2A37 A;  1ZLM A;  3H0H A;  4DEX A;  4JJD A;  3I5R A;  1TG0 A;  2KRM A;  3KFV A;  4IIM A;  4ORZ A;  3EG2 A;  1H92 A;  1VYV A;  2K7A A;  1WLP B;  3PE0 A;  1NYF A;  1KSW A;  5FWB A;  1T3L A;  1CKA A;  2KNB B;  4AFZ C;  4Z88 A;  1EFN A;  4AG1 C;  1PRM C;  1UFF A;  1GRI A;  3R6N A;  2PZ1 A;  1AZG B;  1GCQ A;  3M0P A;  4RTY A;  1WXB A;  2YUN A;  3A98 A;  4JJB A;  1VYT A;  1PWT A;  1U3O A;  3UA7 A;  1BBZ A;  2YDL A;  2LQW A;  4HVW A;  2EGE A;  1JO8 A;  1AVZ C;  1OPL A;  3ZL7 C;  2ED0 A;  1SHF A;  5IHK A;  1M3B A;  1YNZ A;  1ZX6 A;  2CH4 A;  1NG2 A;  2JXB A;  2HSP A;  1M3C A;  1X43 A;  2F2X A;  2DNU A;  4RUG A;  2EQI A;  1E6H A;  2CSQ A;  1RI9 A;  1B3Q A;  2EYW A;  3FJ5 A;  1PKS A;  1JU5 C;  2JMC A;  1GL5 A;  1YN8 A;  2KYB A;  1WDX A;  1I1J A;  1GCP A;  4RTW A;  1RLP C;  4ESR A;  4F17 A;  3C0C A;  3U23 A;  2GNC A;  1UDL A;  2O31 A;  2CDT A;  4OMO A;  2D0N A;  1T3S A;  4F16 A;  1K76 A;  1Y0M A;  4J9H A;  2F2W A;  1AWJ A;  3IQL A;  2LJ3 A;  1AWX A;  2OAW A;  2YUQ A;  1XOV A;  3ULR B;  2RN8 A;  2OJ2 A;  1YCS B;  2DRM A;  1K1Z A;  3I5S A;  2KEA A;  2KR3 A;  1UJY A;  2CT3 A;  1ARK A;  2H8H A;  2RQT A;  1JXO A;  3RBB B;  2L3P A;  2KRO A;  2M0Y A;  3PVL A;  2ED1 A;  2KE9 A;  2RNA A;  2QDL A;  1W6X A;  2EVR A;  1VYU A;  5IH2 A;  2SEM A;  1SRL A;  4AFS C;  2W10 A;  1AOJ A;  1GBR A;  2BZY A;  2O88 A;  4R0K A;  3TSZ A;  3EG3 A;  2EYZ A;  1NLP C;  1RLQ C;  2LCS A;  2MIO A;  2NWM A;  1K0X A;  2KT8 A;  5HCK A;  1QCF A;  1UEC A;  2BZX A;  1PHT A;  3THK A;  2KXD A;  3VS6 A;  1NYG A;  1K0S A;  1SEM A;  4KRT A;  2DF6 A;  3H41 A;  3TSW A;  3H0I A;  2LJ1 A;  1YWO A;  2KXC A;  1OOT A;  4JPB W;  1ABQ A;  2HBW A;  1V1C A;  1Z9Z A;  2GBQ A;  1WFW A;  5I11 A;  5FW9 A;  2DBM A;  1SRM A;  4QT7 A;  2JW4 A;  1MUZ A;  3VS7 A;  1QWF A;  1I0C A;  2RQV A;  1PRL C;  1NEG A;  4F14 A;  2A08 A;  1AZE A;  2K9G A;  2A28 A;  1E6G A;  1HSQ A;  3UAT A;  1LCK A;  3VRY A;  1ZSG A;  3I35 A;  1QLY A;  2X3W D;  2L3Q A;  1G83 A;  1WXU A;  2DLP A;  4LNP A;  2EGC A;  2G6F X;  3UF4 A;  2J7I A;  2LZ6 B;  5I22 A;  1JQQ A;  2DRK A;  4RTU A;  2EPD A;  2FO0 A;  1ZUY A;  2W0Z A;  2GGR A;  4GBQ A;  1GCQ C;  2P4R A;  2JT4 A;  1ABO A;  2O9V A;  1T0H A;  2KYM A;  1H8K A;  1IO6 A;  1OV3 A;  1QKW A;  4CC2 A;  3NMZ C;  2DL7 A;  1S1N A;  1N5Z A;  2FPF A;  2KRN A;  1KIK A;  5EC7 A;  2LP5 A;  3EHQ A;  4AFQ C;  1MV3 A;  2DL4 A;  2J6F A;  2LJ0 A;  2DIL A;  1WIE A;  4IIO A;  4Z89 A;  4RTT A;  4HCK A;  2B86 A;  4RTZ A;  2KBT A;  4JZ3 A;  3TVT A;  1WXT A;  4ZNX A;  3NGP A;  2JM8 A;  4RTV A;  1H3H A;  2CRE A;  1W70 A;  2EYX A;  3NHN A;  1GFD A;  2AKK A;  2CT4 A;  2CH4 W;  4FSS A;  4CC7 A;  2JS2 A;  1AD5 A;  1UGV A;  2LMJ A;  5FWC A;  1Z9Q A;  2BZ8 A;  1A0N B;  1U06 A;  3REA B;  3LH5 A;  2PTK A;  2HEQ A;  1BB9 A;  1FMK A;  5IXB A;  3H0F A;  2LX7 A;  2YUP A;  2FRW A;  2DM1 A;  4J9B A;  2CUB A;  1SHG A;  2D8H A;  1NLO C;  3EGU A;  3SHW A;  2EW3 A;  2SRC A;  1TUC A;  2KT1 A;  3CQT A;  1YWP A;  3PVQ A;  2RQW A;  2DE0 X;  5IXF A;  1M8M A;  2X3X D;  3M0S A;  2YSQ A;  2VWF A;  4OMM A;  2MCN A;  4J9C A;  1UE9 A;  2IIM A;  1NM7 A;  2GQI A;  3VRZ A;  3VS3 A;  1Y57 A;  2J06 A;  1PKT A;  2EYY A;  1FYN A;  1QKX A;  2L3S A;  3I9Q A;  5GJW B;  4J9E A;  2K2M A;  1CSK A;  2EKH A;  1U5S A;  4RTX A;  4OML A;  1X2K A;  1T0J A;  2NUZ A;  1CKB A;  1M27 C;  2JM9 A;  2KRS A;  1AEY A;  1OPK A;  1ZBJ A;  2RQR A;  2K6D A;  1RUW A;  2I0N A;  2GTJ A;  2EBP A;  2ENM A;  2JMA A;  3NPF A;  4M4Z A;  3RNJ A;  4Z8A A;  2VKN A;  4CC3 A;  2ROL A;  2C0I A;  3M0U A;  4JZ4 A;  1W1F A;  1QWE A;  4D8D A;  4LUD A;  1GBQ A;  2FRY A;  2J05 A;  2ROT A;  2DBK A;  2RMO A;  1AWO A;  2XMF A;  2DYB A;  4HXJ A;  4LUE A;  2JTE A;  2LQN A;  2YUO A;  1KFZ A;  1J3T A;  1HJD A;  2C0T A;  2DL8 A;  3EHR A;  2K79 A; 
#chains in the Genus database with same CATH topology
 4E6R A;  3CXC A;  1K8A C;  2G3R A;  2E4H A;  3CC2 Q;  5CKE A;  4II1 A;  2EJ9 A;  1VQK T;  2CSI A;  2L2P A;  4BE0 A;  3L2U A;  1UTI A;  2C0O A;  2DXU A;  1YJ9 T;  3OYJ A;  4NOY A;  2CZ7 B;  4XTW A;  3HHT B;  4C8Q E;  3V7R A;  1GFC A;  4XU0 A;  3MEV A;  3NTK A;  5GAN g;  1VQ5 T;  1YP5 A;  3OMC A;  1N6A A;  2HKQ B;  1WYX A;  3QSU A;  5IHI A;  1G3Y A;  3CCS T;  1D0Y A;  1I5O B;  2DVJ A;  2O2O A;  4A53 A;  2PNI A;  1WI7 A;  4V2S A;  1MV0 B;  2HL5 C;  2QXF A;  1TUD A;  3JV3 A;  3L2V A;  4BE2 A;  4PFZ A;  4C0F A;  2RI3 A;  3OYY A;  1YJN Q;  4FYV B;  2RHZ A;  1I07 A;  3OYC A;  4OB2 B;  2A7Y A;  3VS4 A;  5LJ5 g;  1JRI A;  1UHF A;  4FL6 A;  2DJQ A;  1X69 A;  2E65 A;  2GTO A;  4C92 G;  3H8Z A;  2KGT A;  4X34 A;  3P8B B;  3JB9 H;  4EMK C;  3M0Q A;  5LJ3 f;  3G4S Q;  1LJO A;  4AFU C;  1ZSZ A;  5D6Y A;  2YRD A;  1SPK A;  1VQP A;  1RAB B;  2EYQ A;  4X1V A;  1P92 A;  4HT8 A;  1QVG A;  2DL3 A;  1UUE A;  3CD6 T;  2L3R A;  3MEU A;  3HSB A;  1OEB A;  4JLI A;  2LC4 A;  4FT2 A;  2HDA A;  4EIK A;  1UJ0 A;  1YIJ Q;  4C0D B;  3KBG A;  4PJO G;  5KYX A;  3M9Q A;  2YT6 A;  5IHN A;  3SDZ A;  5FRM A;  2DTO A;  1FX7 A;  2VGN A;  2LRQ A;  2L8D A;  4C92 B;  4QVD A;  1PNJ A;  3CBP A;  1ZA1 B;  2BUD A;  2JUF A;  2A37 A;  3I56 T;  4DEX A;  3CCU T;  3CPW S;  1QVP A;  3KFV A;  4IIM A;  5LJ5 h;  1M8V A;  5FU6 C;  5KYW B;  3LWH A;  4M78 E;  3JCM h;  3PE0 A;  3SWN C;  3OS1 A;  1KSW A;  5FWB A;  1VQL T;  1VQ7 T;  4Z88 A;  1PRM C;  1MMN A;  1UGR B;  3RKY A;  1GRI A;  1WXB A;  2YUN A;  5CKB A;  3ZEH A;  5CO7 A;  4JJB A;  1U3O A;  2BKD N;  3V7S A;  1MGQ A;  3OSV A;  1NJI C;  2LQW A;  5KYU B;  4C92 F;  2QQA A;  2HMA A;  4PJO B;  1OPL A;  2X4W A;  4M75 D;  3OMG A;  2X4Y A;  1VQM Q;  4XK8 E;  2CGH A;  4QW2 A;  1H3Z A;  1RAD B;  4N0A C;  3E1S A;  4B9X A;  4ZTF A;  1G3S A;  1M3C A;  4GLK A;  1E6H A;  2F5T X;  1RI9 A;  1B3Q A;  5DM7 R;  4FW1 A;  1YI2 Q;  7AT1 B;  2O4X B;  1PKS A;  1WGS A;  2LVM A;  2OTJ A;  2QAZ A;  1JU5 C;  2JMC A;  1GL5 A;  1WDX A;  3U23 A;  5GAN e;  3A8H B;  5IN1 A;  2VB6 A;  4M75 G;  2CDT A;  1K76 A;  2DKG A;  3MET A;  1Y0M A;  5KYU A;  1AWJ A;  4PJO A;  4PJO F;  2RJE A;  1EZZ B;  2FZG B;  3J80 E;  2YUQ A;  3ULR B;  3CCE Q;  4FYX B;  2OTL A;  1IB8 A;  1K1Z A;  2KEA A;  1S72 Q;  1D1C A;  3RBB B;  3OYH A;  2L3P A;  2M0Y A;  2HD0 A;  3FDR A;  2RHU A;  3GNG A;  2KQW A;  3M58 A;  4J7F A;  2O4X A;  2QDL A;  2QTV A;  3OBY A;  1F1B B;  2EIF A;  2EVR A;  2E64 A;  4EDU A;  1VYU A;  1QCN A;  1V29 B;  1KC8 R;  2W10 A;  1C1A A;  1AOJ A;  2O88 A;  3TSZ A;  1NLP C;  3V8L A;  2MIO A;  4FCY A;  2YLB A;  3CC2 A;  3QG1 A;  2RK1 A;  4KH0 B;  3G71 Q;  3UWN A;  1NJI R;  1M2O A;  2DZC A;  4F7U G;  2F1L A;  4KGZ B;  3H0I A;  4KT0 E;  4C5H A;  5IAY A;  1YWO A;  3CCV T;  1VQ8 A;  1SG5 A;  3CPF A;  1KHC A;  4XTU A;  4OB1 B;  1ABQ A;  4ZN1 A;  3CCM A;  2O01 E;  4LDW A;  3OYG A;  1QWF A;  2HNI A;  4PJJ A;  2KDS A;  2VV5 A;  4F14 A;  2A08 A;  2K9G A;  2A28 A;  3S3M A;  4M75 A;  3S6W A;  1YHQ T;  1YJN T;  1E6G A;  1HSQ A;  2X4X A;  3VRY A;  3OSS C;  4NL3 A;  4J6X A;  1QVF A;  1BIB A;  1LPL A;  4M7A D;  3BY7 A;  2EFI A;  1KK7 A;  5KH6 A;  3QUI A;  5LJ3 e;  4F7U B;  1NJI U;  1Q82 C;  1ZUY A;  4OB0 B;  3PIO A;  2DXB A;  2JT4 A;  1ABO A;  2HZY A;  3G4S T;  3C4S A;  1BI0 A;  1D0Z A;  1H8K A;  2QA4 A;  4CC2 A;  3NMZ C;  3EFO A;  1VQO T;  3QDR B;  4ELY C;  1R77 A;  4QQG A;  5GAO r;  1MV3 A;  2DIG A;  2EAY A;  4N4G A;  1M4Z A;  4IIO A;  5FU7 B;  4Z89 A;  3M56 A;  2B8A A;  3OW2 P;  4QVZ A;  3J7A F;  2CYZ B;  3CC4 A;  3NGP A;  1PG5 B;  1Y07 A;  2FYK A;  4M78 C;  3EGD A;  1YIJ T;  4OP0 A;  3A8G B;  2WSF E;  4F7U F;  3NHN A;  1V76 A;  2XG8 D;  2RJF A;  3E9G A;  3CPW P;  4ZTJ A;  1WQ7 A;  4IUP A;  5FWC A;  3CME Q;  3ER0 A;  3EG9 A;  4J5Y A;  2PTK A;  2HEQ A;  2M02 A;  2LX7 A;  1VQ6 Q;  3OA6 A;  3VUB A;  2E12 A;  1YJW Q;  4M77 E;  1G5V A;  1YJ9 Q;  2EW3 A;  2SRC A;  3A8L B;  3ASK A;  4NL2 A;  5CKD A;  2ZPI B;  2MCN A;  4J9C A;  2K3X A;  1NM7 A;  2GQI A;  5GAM f;  1RI0 A;  2YHT A;  1HXD A;  1VQ5 Q;  1QKX A;  3I9Q A;  2KK4 A;  1OU8 A;  1TOV A;  5A0G A;  2XDP A;  3MCA B;  3OYI A;  3GP8 A;  3M57 A;  1OPK A;  1YI2 T;  2RQR A;  1RUW A;  3SB2 A;  3NPF A;  2VKN A;  1VQM A;  4X9C A;  4JZ4 A;  2AT1 B;  4RG8 A;  2DAQ A;  2M1H A;  2RO0 A;  2ZZD A;  3BDU A;  4FYW B;  2L5Q A;  2RK2 A;  2ROT A;  5A0L A;  5J26 A;  1AWO A;  2DYB A;  3CCE T;  3HRT A;  2JTE A;  3WXM B;  1KFZ A;  4M7A C;  1J3T A;  5J3B A;  1HJD A;  3EHR A;  1MND A;  3BW1 A;  4OMF B;  5GAN 8;  1O75 A;  4QQ6 A;  1S72 T;  3G1J A;  5GAN d;  1FWZ A;  1JEG A;  1BI3 A;  2QG9 B;  1WX6 A;  9ATC B;  4D8K A;  1ZUU A;  5IT9 E;  3CD6 Q;  1M90 R;  4PJN A;  3EH2 A;  4J9I A;  4FM4 B;  4K11 A;  4N4I A;  4ANJ A;  1UG1 A;  2CS7 A;  3OBW A;  3NTH A;  5I2S A;  3QDF A;  1BCO A;  1H64 1;  4PFO A;  3VS5 A;  3V8K A;  2Y4Y A;  2D9T A;  2CP5 A;  3EGX A;  5GMK j;  2OAU A;  1Y96 B;  3I56 Q;  1AWW A;  2FZK B;  3CCU Q;  1UGP B;  3L2Q A;  2M16 A;  4JRI A;  1I4K 1;  4TVR A;  1Q86 R;  3G71 A;  1M1K C;  4A54 A;  4A63 B;  5D7U A;  1VQ7 Q;  3OYM A;  3QZ5 B;  4ZN3 A;  1XJW B;  2YWW A;  4OMP A;  1G2B A;  1M90 U;  1IRE B;  2LCC A;  4HA8 A;  2EQK A;  2AKL A;  3F70 A;  3D7S B;  2AZS A;  4VUB A;  2GF7 A;  2Z0W A;  1VA7 A;  3REB B;  3EG1 A;  1TS9 A;  3CPW A;  4MZP A;  3ZBD A;  5HK3 A;  2PVG B;  2EJF A;  2XIC A;  4A4G A;  5L23 A;  2CZ1 B;  3S3N A;  1X6G A;  4E7I A;  1RAF B;  2A36 A;  4IUQ A;  3QWX X;  1OYX A;  4DEY A;  2V1Q A;  3HKS A;  2EQU A;  4FIB A;  5GJV B;  4M7D C;  3P8H A;  2EGA A;  3JRZ A;  1O9S A;  4JJC A;  3M4Y A;  5LJ3 d;  1RAA B;  3SEM A;  4X9D A;  1PC0 A;  3OYE A;  3VJP A;  2DMO A;  1X6B A;  3MO8 A;  1BKB A;  4A4E A;  2DD5 A;  5FRN A;  3VKI A;  1SSH A;  2QQS A;  2NUT A;  1QW1 A;  4M77 C;  2FPD A;  2EWN A;  2ABL A;  3H0H A;  4DQ2 A;  3OS2 A;  2P0K A;  4RCB A;  1TG0 A;  3EG2 A;  4DOV A;  2LCL A;  1WLP B;  2LDM A;  3S3O A;  2JTM A;  4AFZ C;  1EFN A;  3OB9 A;  3WVD B;  4AG1 C;  4JRP A;  3R6N A;  1OUL A;  1VQ6 T;  1GCQ A;  4RTY A;  2QGG A;  2M0O A;  4NS5 A;  1YJW T;  1VIF A;  1NE8 A;  1WNL A;  1WQW A;  3CME A;  1SF9 A;  1BI2 A;  3UA7 A;  3GOX A;  5GAM e;  2E1H A;  2GCX A;  4MDW A;  1VQK A;  1ZQ1 A;  5KYY B;  2KI7 A;  2RHX A;  3JB9 J;  1B34 B;  3ZL7 C;  3T9N A;  4BY6 C;  1SHF A;  2PVD B;  5IHK A;  1ZX6 A;  1FMW A;  1JJ2 P;  3CCV Q;  4DBH A;  3CMA T;  2F2X A;  2DNU A;  5HY6 A;  5GAN 4;  1N9R A;  2CSQ A;  5LJ5 f;  3LH0 A;  1TH7 A;  2R57 A;  4C92 D;  3CCQ T;  3JCM f;  1YN8 A;  4E7H A;  3JB9 I;  1GCP A;  1RLP C;  3C0C A;  3DLM A;  1VQ4 T;  1M1K U;  1LNX A;  2VYT A;  4OF1 A;  2GNC A;  1YHQ Q;  3CCS A;  5KYY A;  4EMH A;  2RN8 A;  1YCS B;  2DRM A;  2OX7 A;  3I5S A;  2EJG A;  2KR3 A;  3HFN A;  2KRO A;  3PVL A;  4JDS A;  2RNA A;  3JCM b;  4XQ3 A;  1KQ2 A;  3L1A A;  4PJO D;  1TXQ A;  4F04 B;  5GMK i;  5IH2 A;  1K8A R;  5GAN h;  1AHJ B;  1VQO Q;  2AHJ B;  1GBR A;  5FU6 B;  4OGE A;  3LX7 A;  3G6E T;  2HKN A;  2KT8 A;  3RKW A;  3LGF A;  1VQ9 A;  1ZSZ C;  2BZX A;  2XDD A;  2KXD A;  3PNW C;  1W2B P;  2Y90 A;  1R8O B;  3OW2 S;  2DK3 A;  2MYS A;  1U8R A;  2XI9 A;  2E70 A;  3CD6 A;  2RI2 A;  1OOT A;  2HBW A;  3E19 A;  3OYN A;  1Z9Z A;  3JCM J;  5I2M A;  2DBM A;  1SRM A;  4OB3 B;  3AT1 B;  4C8Q G;  3OYD A;  1VOM A;  5LJ3 g;  3M55 A;  4MMK A;  1I0C A;  1K8A U;  1MMG A;  1AZE A;  1QP3 A;  3A5Z B;  3FIF A;  1G3W A;  1LCK A;  2JZ2 A;  1B7T A;  3I56 A;  1K9M C;  4KUD K;  5GAO q;  1WPY A;  2X3W D;  5GAN 3;  2FHD A;  4EMG A;  5CCA A;  2EGC A;  3RMS A;  3UF4 A;  3VU3 C;  2J7I A;  2LZ6 B;  3HFO A;  1VQL A;  4RTU A;  4C92 A;  3URG A;  2MWO A;  2GGR A;  3CBO A;  4GBQ A;  1TSF A;  4BD3 A;  2KYM A;  1OV3 A;  4C0D C;  5KYW A;  4MZT A;  2QEX T;  3MEW A;  1S1N A;  1N5Z A;  2L89 A;  1KIK A;  4C8Q B;  2LP5 A;  4P5N A;  4AFQ C;  1PSE A;  2XD0 A;  1WIE A;  2HSE B;  2DXT A;  4PLI A;  4LD9 K;  3TVT A;  2JM8 A;  5LJ3 h;  1H3H A;  5LJ5 j;  1KD1 C;  2CT4 A;  2JS2 A;  4LXC A;  4XTZ A;  2EKO A;  3REA B;  2CP2 A;  3JCM X;  5IXB A;  3FB9 A;  3H0F A;  4C8Q A;  3JCM W;  4C8Q F;  3DB4 A;  4PJO C;  1KQ1 A;  2WSC E;  2CUB A;  2RD1 A;  5KE3 A;  1SHG A;  3AHU A;  3SHW A;  1PCX A;  1TUC A;  1YWP A;  2VGM A;  4M7A E;  1M1G A;  5IXF A;  1K9M R;  2X35 A;  1Q7Y C;  1UE9 A;  2DTI A;  3VS3 A;  4IUR A;  1PKT A;  1X75 C;  2EYY A;  4M78 G;  2FL7 A;  4J9E A;  2K2M A;  4OML A;  1SSF A;  1T0J A;  1M27 C;  3NFC A;  2JM9 A;  3RKX A;  3C12 A;  1QP2 A;  4ATO A;  1D3B B;  1ZBJ A;  3RMQ A;  4KUI A;  2I0N A;  5KYN A;  2GTJ A;  4BUG A;  5GAM d;  2EBP A;  3FLG A;  4J6W A;  1JBM A;  3I55 T;  2PVO B;  3RNJ A;  4CC3 A;  3DLL A;  3QXE B;  1N8R C;  2C0I A;  3M0U A;  1QWE A;  4LUD A;  5CIU A;  3L2R A;  3CCV A;  2ZPF B;  1GBQ A;  5M9O A;  4C5E A;  4PLL A;  1K9M U;  1NZ9 A;  2YUO A;  1W2B A;  2DL8 A;  1W4S A;  4M78 B;  4XAX B;  1WZO A;  4C0Z A;  2L0A A;  2RF0 A;  1D3B A;  4M75 C;  2RQU A;  4E7J A;  5CK9 A;  3RR6 A;  4L5G A;  1YHQ A;  1YJN A;  3EFS A;  1JXM A;  1RAG B;  4HCB A;  1NPR A;  1IZ6 A;  5HK0 A;  2E5K A;  2LX9 A;  2ZPG B;  1WHK A;  2K3B A;  4CC4 B;  2QAS A;  1YCY A;  1TU0 B;  4O6J A;  2K4Y A;  1HD3 A;  2F5K A;  2PUK B;  5I21 A;  4DBQ A;  2FEI A;  3QBY A;  4JS4 A;  1RAE B;  3HL8 A;  2NLU A;  3G4S A;  2DD4 A;  2ECZ A;  4KGX B;  3PTA A;  4J83 A;  4JLG A;  3GLX A;  1VQO A;  2COY A;  5GAN 7;  4M78 F;  3FRN A;  5ECA A;  4F7U A;  2RB6 A;  2ZPE B;  4ELZ C;  4M7D E;  2DX1 A;  3QWY A;  4AG2 C;  2MOX A;  1KD1 U;  3TRE A;  1I8F A;  4LDX A;  2AZV A;  3M0R A;  2HQX A;  2HAX A;  5GAN 5;  5GAO p;  2DYI A;  4R55 A;  3NTI A;  1YIJ A;  2LTO A;  4Y92 A;  2ZAE A;  2V1R A;  4L59 A;  4FYY B;  4DA4 A;  2BTT A;  4HVU A;  1YIT T;  4PJL A;  2E3I A;  2E10 A;  3A1P A;  3QHS A;  1Y71 A;  3RUX A;  1WJQ A;  2EQJ A;  2J6O A;  5CQY A;  1Q7Y U;  1MMA A;  3QYG B;  2OI3 A;  3OS0 A;  2KMT A;  3PFS A;  4LN2 A;  1Q82 R;  3CMA Q;  2FPE A;  1D1B A;  3GBQ A;  1C6V X;  2FVU A;  4BE1 A;  2E6N A;  4J9F A;  2PUO B;  2X4J A;  1UB4 A;  4XTX A;  4FU6 A;  3CCQ Q;  1JJ2 S;  1TUG B;  5DY9 A;  2BE7 D;  4RKU E;  1ZUK A;  3OQ5 A;  1KQS P;  2CP6 A;  1VQ4 Q;  5DLQ E;  1VQN T;  2E6Z A;  1NPP A;  8AT1 B;  1N8R U;  2LNH B;  3PIP A;  4HCZ A;  3CXC P;  1KJW A;  3CCJ T;  2HCK A;  3M53 A;  2FG0 A;  4FW2 A;  2M51 A;  1M1F A;  2FZC B;  3CC7 T;  1YI2 A;  5CVI A;  2PU9 B;  3TQ7 P;  4RCC A;  4PNO A;  3CCL T;  2CZ6 B;  4ORZ A;  5GAM g;  2E3H A;  1H92 A;  2NYS A;  1VYV A;  2K7A A;  1MNE A;  3RES A;  4JS5 A;  1NYF A;  2Y4X A;  1CKA A;  2KNB B;  1Q82 U;  2QQR A;  1HK9 A;  2MAM A;  4PFP A;  3M59 A;  1AZG B;  1K73 C;  3PGG A;  3M54 A;  3CCE A;  2PQW A;  3A98 A;  1N9S A;  2R5A A;  5AT1 B;  4HKE A;  4M7D G;  1VYT A;  3G6E Q;  1S72 A;  3MP8 A;  2K5L A;  2EGE A;  3X24 B;  3JB9 G;  2ZCF B;  4E47 A;  1WHH A;  3E9F A;  2ED0 A;  3UT1 A;  3BE3 A;  1M3B A;  1YNZ A;  2CKK A;  1OU9 A;  1NG2 A;  2HSP A;  1UGQ B;  3M4G A;  1W2B S;  4M77 G;  1RAI B;  4RUG A;  2EQI A;  4KH1 B;  4J8O A;  1Q95 G;  4F17 A;  4J7I A;  4E7K A;  3V7C A;  5GAM h;  1UDL A;  2O31 A;  4OMO A;  2D0N A;  2IG0 A;  1MMD A;  1T3S A;  4F16 A;  4XU1 A;  2NUP B;  3MHX A;  4M7D B;  3IQL A;  2LJ3 A;  1XOV A;  3JAM E;  2OJ2 A;  2HQE A;  4JRQ A;  3INZ A;  3OW2 A;  1UJY A;  3VV0 A;  3C94 A;  1X01 A;  5A2Q E;  1ARK A;  1PSF A;  2YRV A;  2RQT A;  3L42 A;  1Y7X A;  1RL2 A;  2JN0 A;  3H6Z A;  1QVG P;  4MML A;  1Y96 A;  2KE9 A;  3FJP A;  2MF2 A;  1GXI E;  3RER A;  4M77 B;  2EQM A;  2QEX Q;  4AFS C;  3EH1 A;  2DEU A;  2LT1 A;  1K73 R;  3EG3 A;  5GMK e;  2LCS A;  1EIF A;  3CCR T;  3Q1J A;  2OTJ Q;  4M7D F;  2COZ A;  5HCK A;  2XU8 A;  3JB9 F;  3VS6 A;  2CZ0 B;  2P0P A;  1NYG A;  4KRT A;  4UC4 A;  1U1T A;  4PK4 A;  2V26 A;  2LJ1 A;  2KXC A;  4OVA A;  2OTL Q;  1ZA2 B;  4JPB W;  3HPW A;  3VYH B;  5GMK l;  4M77 F;  2GBQ A;  1WFW A;  5FW9 A;  1TWB A;  4Y28 E;  4LD6 A;  2JTF A;  5GAN f;  2IVW A;  2RQV A;  1OQK A;  2DTH A;  4BI8 B;  2K3Y A;  1M1K R;  1QMC A;  2RHY A;  4DOW A;  2CP7 A;  3UAT A;  3QZ9 B;  1K73 U;  3I35 A;  4JJN K;  1QLY A;  2L3Q A;  4BDZ A;  3UPU A;  2DLP A;  4LNP A;  1OZ2 A;  5I22 A;  2EPD A;  2FO0 A;  4RG2 A;  2VXE A;  5CAI A;  3V8J A;  1QQJ A;  1XNI A;  4PJO E;  4HCC A;  3X25 B;  3ME9 A;  4LDU A;  1VQ6 A;  3OS5 A;  1GCQ C;  2P4R A;  2O9V A;  1T0H A;  1YJW A;  1QKW A;  3EFR A;  1YJ9 A;  2ZPB B;  1G3T A;  2DL7 A;  1VQ8 Q;  2KRN A;  5EC7 A;  3QYH B;  4EMK B;  3EHQ A;  2P4T A;  1WHG A;  4YTL A;  2DL4 A;  2LJ0 A;  4OGC A;  3CCM Q;  2DIL A;  3I55 Q;  1IGQ A;  1VQ5 A;  2B86 A;  4RTZ A;  1PD0 A;  1BYM A;  4JZ3 A;  1WXT A;  3BFM A;  3RDV A;  1MHN A;  2H3J A;  4RTV A;  2XDB A;  3CMA A;  2CRE A;  5AYF A;  4MZM A;  3MP1 A;  2V8K A;  4E7L A;  4FSS A;  3CCQ A;  1B34 A;  1AD5 A;  3WVE B;  2GQV A;  2LMJ A;  1ZSZ B;  3DKM A;  4HT9 A;  1ZHI A;  1VQ4 A;  1FMK A;  1U1S A;  1M9S A;  3A8O B;  4EMK A;  2KVQ G;  2DM1 A;  4J9B A;  1RAH B;  2QA4 Q;  3MJX A;  2A3L A;  2D8H A;  3EGU A;  4JRK A;  3MP6 A;  1VQP T;  3DB3 A;  2JVV A;  4IUU A;  2VUB A;  3M0S A;  2YSQ A;  3JCM g;  2VWF A;  4OMM A;  5KYX B;  3SWN B;  3VRZ A;  4C8Q D;  8ATC B;  4ZGE B;  4M75 E;  1RAC B;  2K57 A;  3G7Z A;  2L3S A;  1FYN A;  5KE2 A;  3CC4 Q;  1VQ9 T;  1R0B G;  5GJW B;  1EX4 A;  1U5S A;  1X2K A;  3X20 B;  1G8X A;  2KRS A;  3G6E A;  2HBP A;  1TTH B;  2JMA A;  1QVF P;  4M4Z A;  5GMK m;  1KG1 A;  1D0X A;  1W1F A;  1Q81 C;  3SWN A;  4D8D A;  1YIT Q;  2CP0 A;  1NBE B;  1M5Q 1;  1D1A A;  4E2F B;  2FRY A;  3LYI A;  2RH2 A;  3MKD A;  2E5Q A;  4GY5 A;  3PMT A;  1WHM A;  2XMF A;  3CCU A;  4LUE A;  5DLO A;  2C0T A;  2DVE A;  5GAN j;  4PL6 A;  4R56 A;  1VQ7 A;  1BK2 A;  1KC8 C;  4F7U E;  2GFU A;  1E7O A;  3VYG A;  4OMQ A;  2XID A;  2F2V A;  1OX9 A;  3QKJ A;  1M3A A;  1K9A A;  4J9G A;  4N0A A;  2D8J A;  1K4U S;  3X28 B;  5C0M A;  2GFA A;  2I2L A;  4C92 C;  4IUT A;  1IHV A;  1QCO A;  3JCM c;  2OTJ T;  1VQN Q;  1FMV A;  3UDC A;  1N27 A;  5EG2 A;  4BAC A;  2QTX A;  1KQS S;  4LDV A;  2COW A;  2VVK A;  4BI4 A;  4OMN A;  1NEB A;  2YLC A;  3O5Z A;  2QEX A;  3CCJ Q;  2AK5 A;  1WJS A;  2DPP B;  3HRS A;  2J6K A;  3CC7 Q;  3HTR A;  3CXC S;  4RMO A;  4ME7 A;  3CCL Q;  2OTL T;  2QQ9 A;  4MDX A;  1BU1 A;  1WA7 A;  4O5V A;  1JJ2 A;  3UA6 A;  3LGL A;  4IKF A;  4M78 D;  1X2Q A;  3LWI A;  3GNF B;  2E41 A;  2VC8 A;  1VIE A;  5CKH A;  4J6Y A;  2LNV A;  1Q81 R;  2CUD A;  2DL5 A;  2RPN A;  2D1X A;  4WCI A;  3A8M B;  4C8Q C;  4E7Z A;  3EG0 A;  1WJR A;  3R6O A;  4HVV A;  3VS1 A;  2DA9 A;  3CC2 T;  4GLM A;  1XQH A;  4A4F A;  2JS0 A;  1ACM B;  2BE9 B;  5LJ5 e;  2QDY B;  3VS0 A;  3QO3 A;  5LJ3 j;  1VQ8 T;  3JCM e;  2WSE E;  2QQB A;  4M75 B;  1B07 A;  1WHL A;  1X27 A;  1OX8 A;  4J9D A;  2JJ9 A;  2YRC A;  3CCM T;  4LE9 A;  2DXC A;  2QI2 A;  3VS2 A;  1M30 A;  2K5I A;  4EPC A;  2O9S A;  1BI1 A;  1UGS B;  2ESW A;  2LT4 A;  2M9U A;  1Q81 U;  6AT1 B;  3M0T A;  3TCJ A;  1UHC A;  4B6M A;  5HKC A;  4BI3 A;  4BDY A;  3HRU A;  1ZLM A;  1YFN A;  4JJD A;  3I5R A;  2V8J A;  1KD1 R;  2KRM A;  3I55 A;  3J81 E;  3OYL A;  3EFO B;  5A0D A;  2X51 A;  4E7S A;  2JOY A;  5KCH A;  2CP3 A;  1T3L A;  1X6O A;  3CBM A;  2BIV A;  3QII A;  1KC8 U;  1QVG S;  1UFF A;  3KXT A;  4M75 F;  2PZ1 A;  4C0G A;  3M0P A;  5GAO l;  3M5A A;  4CI0 C;  2QA4 T;  1FXX A;  4QQD A;  3CCR Q;  5GAN 6;  1PWT A;  3EGD B;  1BBZ A;  4QKU A;  2YDL A;  2AIR B;  4HVW A;  2QYZ A;  2HQH A;  1JO8 A;  2DIQ A;  1AVZ C;  2V8I A;  4N4H A;  1Q7Y R;  4Z02 A;  4FSX A;  4KBM B;  3CC4 T;  3EG9 B;  2CH4 A;  4M78 A;  2KY9 A;  1WHJ A;  2JXB A;  1X43 A;  2EYW A;  2DEQ A;  3FJ5 A;  4AT1 B;  2FB7 A;  4M7A G;  3GF5 A;  2KYB A;  2DZ9 A;  1I1J A;  4RTW A;  3VUZ A;  4ESR A;  1SKU B;  4KUL A;  3OYK A;  2QGF B;  2YXY A;  4J9H A;  2F2W A;  3TU4 K;  1N8R R;  4XU2 A;  5CQX A;  1AWX A;  3JCM V;  2OAW A;  3GPL A;  2CT3 A;  2WAC A;  2A0F B;  2H8H A;  4D6W A;  4JUV A;  1JXO A;  1PM3 A;  2IPO B;  4C5I A;  5FRO A;  2C06 A;  1VQK Q;  3LW5 E;  2ED1 A;  4ZGD B;  5D6X A;  1PD1 A;  3N5B B;  5FU7 C;  1YIT A;  1W6X A;  4DBR A;  3OYA A;  2SEM A;  2K5F A;  5J39 A;  1M90 C;  1SRL A;  3BDL A;  1HYO A;  2DFU A;  2D0Q B;  4M7A B;  5C6S A;  2BZY A;  3HP9 A;  4R0K A;  2EYZ A;  5FLX E;  1RLQ C;  2RM4 A;  2NWM A;  1K0X A;  2D6F A;  3JCM Q;  3CEY A;  5LL6 S;  3MPU B;  4Y91 A;  1QCF A;  1UEC A;  5D6W A;  1PHT A;  3THK A;  3SD4 A;  1C0M A;  2QK0 A;  4BB7 A;  1VQM T;  1K0S A;  3EAE A;  1SEM A;  2DF6 A;  3CCS Q;  1R0C B;  2HL3 A;  3H41 A;  1AT1 B;  3TSW A;  1I5L A;  1Q86 C;  5CR2 A;  3E2U A;  1UEB A;  4M7D D;  4IUV A;  2R5M A;  2P0Q A;  1V1C A;  5I11 A;  5GAO n;  3GIB A;  4QT7 A;  1DJ7 B;  2JW4 A;  2VXF A;  1VQN A;  2MK5 A;  1MUZ A;  4M7A A;  3VS7 A;  4M7A F;  5GMK h;  3JB9 D;  1M2V B;  3FC3 A;  5GAN 2;  4C5G A;  4QVC A;  1PRL C;  4PKC C;  1NEG A;  3CCJ A;  2RJD A;  3OYF A;  2RHI A;  3QPH A;  1OI1 A;  2MMP A;  3C95 A;  2XK0 A;  3CC7 A;  1ZSG A;  2KAF A;  2RI5 A;  3PT9 A;  4A4H A;  1VQP Q;  4M77 D;  2VAS A;  5L8R E;  1G83 A;  1LVK A;  1WXU A;  3CCL A;  2MWP A;  5GAO m;  2G6F X;  1JQQ A;  3EGX B;  2DRK A;  1KHI A;  2W0Z A;  1VQ9 Q;  3KUF A;  2MPX C;  4A4K A;  3JCM P;  4XU3 A;  2ZGW A;  2LQK A;  1IO6 A;  3L2W A;  1OZ3 A;  1M2V A;  3H9N A;  2FPF A;  2X9H A;  2RA2 A;  2J6F A;  4RTT A;  4HCK A;  1YBY A;  2R58 A;  4WTO B;  3G71 T;  2KBT A;  4DBF A;  4ZNX A;  1QVF S;  1W70 A;  2EYX A;  1GFD A;  2AKK A;  2RJC A;  2CH4 W;  4CC7 A;  5LJ5 d;  1IRX A;  4FT4 A;  3MEA A;  1IGU A;  4LDY A;  1UGV A;  4L6V 5;  1Z9Q A;  3JCM d;  2BZ8 A;  1A0N B;  1U06 A;  3LH5 A;  3JSC A;  1BB9 A;  1VQL Q;  4AMC A;  2K2V A;  5CKF A;  2MI6 A;  2JNG A;  2YUP A;  2FRW A;  3OYB A;  2ATC B;  1JB0 E;  1NLO C;  3CQT A;  2KT1 A;  4XTY A;  3RIR A;  3PVQ A;  3ZFJ A;  2RQW A;  2DE0 X;  1M8M A;  2X3X D;  2DJZ A;  1ZBX A;  2KSS A;  2IIM A;  2XKO C;  2NUP A;  4PJM A;  4M7D A;  3SFM A;  1I81 A;  2NUT B;  3PMI A;  4ZGJ B;  3O8V A;  2LQ8 A;  1BIA A;  1Y57 A;  2J06 A;  1CSK A;  3X26 B;  2EKH A;  4RTX A;  1IXD A;  1LOJ A;  2DER A;  2NUZ A;  1VUB A;  4WF2 A;  1CKB A;  2H3E B;  3QJY A;  1IHW A;  5GAM j;  1AEY A;  3CCR A;  2F69 A;  2ZPH B;  4C92 E;  3L2Z A;  1Q86 U;  4M77 A;  3OY9 A;  3FEO A;  2K6D A;  2ENM A;  4KGV B;  4BY6 B;  1BCM A;  3TEE A;  3LLR A;  4Z8A A;  2ROL A;  4B9W A;  1XTD A;  2DO3 A;  2J05 A;  1D09 B;  2DET A;  2DBK A;  2RMO A;  3P8D A;  5KCO A;  1KQS A;  4Q5W A;  2P84 A;  4XTV A;  4CRI A;  4HXJ A;  2XHC A;  2LQN A;  2K79 A;  3CME T;  3QJ6 A; 
#chains in the Genus database with same CATH homology
 4E6R A;  1BK2 A;  2L0A A;  2RF0 A;  1JEG A;  2RQU A;  2CSI A;  2L2P A;  1E7O A;  4OMQ A;  2F2V A;  1WX6 A;  1JXM A;  4D8K A;  2E5K A;  1M3A A;  1K9A A;  4J9G A;  1UTI A;  2K3B A;  2C0O A;  4CC4 B;  1ZUU A;  1K4U S;  2D8J A;  1HD3 A;  1GFC A;  2FEI A;  4J9I A;  4K11 A;  1UG1 A;  2ECZ A;  1YP5 A;  2VVK A;  3VS5 A;  4OMN A;  1NEB A;  3O5Z A;  2AK5 A;  1WYX A;  5ECA A;  2J6K A;  5IHI A;  1AWW A;  2DX1 A;  3QWY A;  4AG2 C;  2MOX A;  2DVJ A;  2O2O A;  2AZV A;  3M0R A;  2PNI A;  1WI7 A;  1MV0 B;  1BU1 A;  1TUD A;  3JV3 A;  4A63 B;  1WA7 A;  3UA6 A;  4Y92 A;  2V1R A;  1X2Q A;  2BTT A;  4HVU A;  1I07 A;  4OMP A;  1G2B A;  2CUD A;  3VS4 A;  2DL5 A;  1UHF A;  2DJQ A;  2RPN A;  1X69 A;  2GTO A;  2D1X A;  2J6O A;  2KGT A;  2AKL A;  4WCI A;  2AZS A;  3EG0 A;  1VA7 A;  3REB B;  3M0Q A;  4HVV A;  3EG1 A;  3VS1 A;  2DA9 A;  2OI3 A;  4GLM A;  2JS0 A;  4AFU C;  4LN2 A;  5L23 A;  1X6G A;  1SPK A;  2A36 A;  3QWX X;  2FPE A;  4DEY A;  2V1Q A;  3GBQ A;  4X1V A;  2DL3 A;  3VS0 A;  4J9F A;  5GJV B;  1UUE A;  2EGA A;  1B07 A;  1X27 A;  1OEB A;  1ZUK A;  4J9D A;  4JJC A;  2HDA A;  4LE9 A;  3SEM A;  3VS2 A;  1M30 A;  4EIK A;  1UJ0 A;  2DMO A;  1X6B A;  2O9S A;  2LNH B;  2ESW A;  2YT6 A;  5IHN A;  1KJW A;  3M0T A;  1UHC A;  1SSH A;  2HCK A;  2FG0 A;  2M51 A;  1PNJ A;  2FPD A;  2ABL A;  2A37 A;  1ZLM A;  3H0H A;  4DEX A;  4JJD A;  3I5R A;  1TG0 A;  2KRM A;  3KFV A;  4IIM A;  4ORZ A;  3EG2 A;  1H92 A;  1VYV A;  2K7A A;  1WLP B;  3PE0 A;  1NYF A;  1KSW A;  5FWB A;  1T3L A;  1CKA A;  2KNB B;  4AFZ C;  4Z88 A;  1EFN A;  4AG1 C;  1PRM C;  1UFF A;  1GRI A;  3R6N A;  2PZ1 A;  1AZG B;  1GCQ A;  3M0P A;  4RTY A;  1WXB A;  2YUN A;  3A98 A;  4JJB A;  1VYT A;  1PWT A;  1U3O A;  3UA7 A;  1BBZ A;  2YDL A;  2LQW A;  4HVW A;  2EGE A;  1JO8 A;  1AVZ C;  1OPL A;  3ZL7 C;  2ED0 A;  1SHF A;  5IHK A;  1M3B A;  1YNZ A;  1ZX6 A;  2CH4 A;  1NG2 A;  2JXB A;  2HSP A;  1M3C A;  1X43 A;  2F2X A;  2DNU A;  4RUG A;  2EQI A;  1E6H A;  2CSQ A;  1RI9 A;  1B3Q A;  2EYW A;  3FJ5 A;  1PKS A;  1JU5 C;  2JMC A;  1GL5 A;  1YN8 A;  2KYB A;  1WDX A;  1I1J A;  1GCP A;  4RTW A;  1RLP C;  4ESR A;  4F17 A;  3C0C A;  3U23 A;  2GNC A;  1UDL A;  2O31 A;  2CDT A;  4OMO A;  2D0N A;  1T3S A;  4F16 A;  1K76 A;  1Y0M A;  4J9H A;  2F2W A;  1AWJ A;  3IQL A;  2LJ3 A;  1AWX A;  2OAW A;  2YUQ A;  1XOV A;  3ULR B;  2RN8 A;  2OJ2 A;  1YCS B;  2DRM A;  1K1Z A;  3I5S A;  2KEA A;  2KR3 A;  1UJY A;  2CT3 A;  1ARK A;  2H8H A;  2RQT A;  1JXO A;  3RBB B;  2L3P A;  2KRO A;  2M0Y A;  3PVL A;  2ED1 A;  2KE9 A;  2RNA A;  2QDL A;  1W6X A;  2EVR A;  1VYU A;  5IH2 A;  2SEM A;  1SRL A;  4AFS C;  2W10 A;  1AOJ A;  1GBR A;  2BZY A;  2O88 A;  4R0K A;  3TSZ A;  3EG3 A;  2EYZ A;  1NLP C;  1RLQ C;  2LCS A;  2MIO A;  2NWM A;  1K0X A;  2KT8 A;  5HCK A;  1QCF A;  1UEC A;  2BZX A;  1PHT A;  3THK A;  2KXD A;  3VS6 A;  1NYG A;  1K0S A;  1SEM A;  4KRT A;  2DF6 A;  3H41 A;  3TSW A;  3H0I A;  2LJ1 A;  1YWO A;  2KXC A;  1OOT A;  4JPB W;  1ABQ A;  2HBW A;  1V1C A;  1Z9Z A;  2GBQ A;  1WFW A;  5I11 A;  5FW9 A;  2DBM A;  1SRM A;  4QT7 A;  2JW4 A;  1MUZ A;  3VS7 A;  1QWF A;  1I0C A;  2RQV A;  1PRL C;  1NEG A;  4F14 A;  2A08 A;  1AZE A;  2K9G A;  2A28 A;  1E6G A;  1HSQ A;  3UAT A;  1LCK A;  3VRY A;  1ZSG A;  3I35 A;  1QLY A;  2X3W D;  2L3Q A;  1G83 A;  1WXU A;  2DLP A;  4LNP A;  2EGC A;  2G6F X;  3UF4 A;  2J7I A;  2LZ6 B;  5I22 A;  1JQQ A;  2DRK A;  4RTU A;  2EPD A;  2FO0 A;  1ZUY A;  2W0Z A;  2GGR A;  4GBQ A;  1GCQ C;  2P4R A;  2JT4 A;  1ABO A;  2O9V A;  1T0H A;  2KYM A;  1H8K A;  1IO6 A;  1OV3 A;  1QKW A;  4CC2 A;  3NMZ C;  2DL7 A;  1S1N A;  1N5Z A;  2FPF A;  2KRN A;  1KIK A;  5EC7 A;  2LP5 A;  3EHQ A;  4AFQ C;  1MV3 A;  2DL4 A;  2J6F A;  2LJ0 A;  2DIL A;  1WIE A;  4IIO A;  4Z89 A;  4RTT A;  4HCK A;  2B86 A;  4RTZ A;  2KBT A;  4JZ3 A;  3TVT A;  1WXT A;  4ZNX A;  3NGP A;  2JM8 A;  4RTV A;  1H3H A;  2CRE A;  1W70 A;  2EYX A;  3NHN A;  1GFD A;  2AKK A;  2CT4 A;  2CH4 W;  4FSS A;  4CC7 A;  2JS2 A;  1AD5 A;  1UGV A;  2LMJ A;  5FWC A;  1Z9Q A;  2BZ8 A;  1A0N B;  1U06 A;  3REA B;  3LH5 A;  2PTK A;  2HEQ A;  1BB9 A;  1FMK A;  5IXB A;  3H0F A;  2LX7 A;  2YUP A;  2FRW A;  2DM1 A;  4J9B A;  2CUB A;  1SHG A;  2D8H A;  1NLO C;  3EGU A;  3SHW A;  2EW3 A;  2SRC A;  1TUC A;  2KT1 A;  3CQT A;  1YWP A;  3PVQ A;  2RQW A;  2DE0 X;  5IXF A;  1M8M A;  2X3X D;  3M0S A;  2YSQ A;  2VWF A;  4OMM A;  2MCN A;  4J9C A;  1UE9 A;  2IIM A;  1NM7 A;  2GQI A;  3VRZ A;  3VS3 A;  1Y57 A;  2J06 A;  1PKT A;  2EYY A;  1FYN A;  1QKX A;  2L3S A;  3I9Q A;  5GJW B;  4J9E A;  2K2M A;  1CSK A;  2EKH A;  1U5S A;  4RTX A;  4OML A;  1X2K A;  1T0J A;  2NUZ A;  1CKB A;  1M27 C;  2JM9 A;  2KRS A;  1AEY A;  1OPK A;  1ZBJ A;  2RQR A;  2K6D A;  1RUW A;  2I0N A;  2GTJ A;  2EBP A;  2ENM A;  2JMA A;  3NPF A;  4M4Z A;  3RNJ A;  4Z8A A;  2VKN A;  4CC3 A;  2ROL A;  2C0I A;  3M0U A;  4JZ4 A;  1W1F A;  1QWE A;  4D8D A;  4LUD A;  1GBQ A;  2FRY A;  2J05 A;  2ROT A;  2DBK A;  2RMO A;  1AWO A;  2XMF A;  2DYB A;  4HXJ A;  4LUE A;  2JTE A;  2LQN A;  2YUO A;  1KFZ A;  1J3T A;  1HJD A;  2C0T A;  2DL8 A;  3EHR A;  2K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...