4F7UF

The 6s snrnp assembly intermediate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 73
sequence length 73
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uF00
2DTOA 2DZCA 1M8VA 5GANd 1B34A 2VXEA 5GANe 5GAN4 4M7DD 2E65A 2RA2A 4M75A 3RIRA 3V8JA 3GIBA 3BDUA 1Y96B 4A54A 4M7DB 5LJ5g 4RCCA 4C8QE 4PJOE 1BIBA 3JB9G 2YHTA 4HA8A 3QUIA 4XTVA 5GANh 3JCMP 4M78E 1I8FA 4JLIA 3SWNB 4XTXA 5LJ3f 1YCYA 4C92F 4EMGA 3JB9I 3HFNA 3JB9J 4C8QG 4EMKC 5LJ5d 1Y96A 1H641 3L2ZA 3PGGA 4M75D 4XTUA 4C8QC 3BW1A 5I21A 4XTWA 3V7SA 5GAN6 5LJ5e 1N9RA 4F7UF 4N0AA 4C92G 5LJ3j 5GAOl 4M7AE 4C92C 1LOJA 4NOYA 3SWNA 3RUXA 4F7UG 1N9SA 2DJZA 2RD1A 3V7CA 5GAOm 2E1HA 5LJ5h 4M7AG 1KQ1A 4J6YA 5GMKe 5GMKi 4M7AC 1JRIA 5GAN8 4WF2A 4M7DE 3QO3A 3JB9F 4RCBA 4JUVA 2ZGWA 3JCMd 3M4GA 3JCMe 3INZA 4M77E 5GAMd 3V8KA 5GAMe 3JCMb 4XU3A 3JCMf 2RM4A 4C8QF 1MGQA 2DTHA 4M77F 1LNXA 4PJOF 1D3BB 5LJ3d 4J6WA 5GAMf 1HXDA 5GMKj 5LJ3e 4M7DG 3VU3C 1U1SA 3FJPA 2VC8A 3HSBA 4M77G 4M78F 4PJOG 2CGHA 3JCMh 4M77C 5GAMj 1KQ2A 5GAOp 2EJGA 2VXFA 4PJOC 4M75E 4X9CA 3JCMc 5GAMh 5DY9A 5GAN7 5LJ3h 4M78G 1D3BA 3JCMg 4M7AF 4M78C 4Y91A 5GAMg 2EJ9A 3QHSA 4QVCA 2E64A 2DEQA 4M75G 5LJ3g 4M75C 2EJFA 1HK9A 4EMKB 2DXTA 3BFMA 4J5YA 1U1TA 4C92D 2DXUA 1I5LA 2FYKA 4EMHA 3FB9A 3V8LA 2DVEA 4XQ3A 5GAN3 4MMKA 4C92B 4M7DF 2Y90A 3QSUA 4V2SA 1I81A 3RKYA 4HT8A 2DTIA 3JCMV 4F7UB 5GMKh 4EMKA 4NL2A 4C8QA 2E41A 4M7DC 4OP0A 5GAOn 2E10A 4N0AC 4C92A 4XTYA 3BY7A 1LJOA 3V7RA 2FB7A 4NL3A 4MMLA 3AHUA 3EFRA 4M75F 3SWNC 3JB9D 1WNLA 3FIFA 4X9DA 1JBMA 4F7UA 3JCMJ 3RESA 4JRIA 2I2LA 3JCMQ 3L1AA 4DQ2A 5GANf 4M7AA 4C8QD 4M77D 5GAOq 4QVDA 4PJOD 2EAYA 4J6XA 4XU2A 4M77B 3RKWA 4C8QB 4PJOB 2HNIA 5GMKl 3SB2A 5GAN5 4XU0A 5GANj 3RERA 2K57A 2RB6A 4M78D 4C92E 3JB9H 3HFOA 5GANg 2YLBA 2YLCA 3EFSA 1WPYA 1TH7A 2EWNA 1BIAA 4M78B 2JN0A 5GMKm 5GAOr 5GAN2 4XU1A 1X01A 4F7UE 4M7DA 1B34B 2QTXA 4JRKA 3JCMX 3RKXA 4M7AD 4HT9A 5CAIA 1I4K1 4M77A 4M75B 5LJ5f 4PJOA 4M7AB 1WQWA 4A53A 2DKGA 1M5Q1 2DZ9A 3JCMW 4PNOA 4XTZA 4M78A 5LJ5j 1WQ7A
chains in the Genus database with same CATH superfamily
2RQRA 1M8VA 2G6FX 3ZFJA 2R57A 1BK2A 1I5OB 3I56A 2FPEA 1KC8U 3J7AF 3G4SA 3A1PA 3QKJA 2L3RA 5FLXE 1I8FA 2KRNA 2MK5A 4PFPA 2K5FA 1MNDA 1Y71A 3JB9J 1KHIA 4PJNA 2KDSA 2GFAA 4AFQC 3V7SA 1VQ6A 2MCNA 1MMGA 3FEOA 4DBRA 2KXCA 1X43A 1NPPA 5FWBA 3S3NA 3CPWP 3DB4A 2MWOA 1VA7A 1QP3A 3VS0A 3PT9A 4M77E 1IHWA 2D6FA 5DLOA 4J9EA 4QVZA 4F17A 4M77F 1D3BB 3LGFA 4CC7A 1VQ9Q 2GTOA 1KHCA 2M0OA 1B7TA 2K3BA 1HJDA 1GXIE 2K2MA 2KK4A 4PFOA 1QCFA 2DILA 2X35A 1WHMA 1AD5A 1HSQA 5LJ3g 5AYFA 1VQ5T 3PMIA 3BE3A 1XJWB 4BE2A 2FYKA 4XQ3A 4TVRA 2DM1A 4M4ZA 3UT1A 1N6AA 3H0IA 3RNJA 4DBHA 2RJFA 4EMKA 3X28B 3EGDA 2AIRB 2FZGB 4N4HA 2D8HA 2F69A 2XKOC 2F5KA 1PG5B 1YCSB 2OJ2A 4Z8AA 1YJWA 4M7AA 1Q86C 2KRMA 3I55Q 4Y28E 4ZGDB 4V2SA 3A8HB 1PRMC 4DA4A 4FYYB 1NG2A 3MHXA 1VQ4A 1YJNQ 4M78B 2K5IA 4X1VA 1M1FA 2LNVA 1S72Q 2NYSA 2PUOB 3H0FA 4O5VA 2HQEA 4DOVA 4K11A 5KYXA 1BI3A 2AHJB 2ZAEA 3LH5A 2BZYA 4FSXA 1Y96B 1ZSZB 4RCCA 4JRPA 2DL3A 4EDUA 3RMSA 1QWEA 2IG0A 1NBEB 2L3SA 1VQKA 2ED0A 3F70A 3X26B 2XD0A 2VKNA 3PFSA 1N9SA 2XI9A 5EG2A 1OQKA 3RR6A 3MJXA 1VQ5A 4M7AG 5GMKe 3CC4T 3CC7Q 2EGAA 4C0DC 1YJNT 3J81E 5KYWA 1M4ZA 1FMWA 5GAOr 5GMKj 3VU3C 2JVVA 3GNGA 3CCMQ 1TOVA 2OTJT 2NWMA 2DERA 5GAMh 3I9QA 2LJ1A 1Q7YR 2C0TA 3L2WA 3QDRB 1HK9A 1K9MU 3PNWC 1IGUA 4KBMB 2O9SA 4OVAA 2WSFE 3OYGA 1H3ZA 3WVEB 1JU5C 5HCKA 2JXBA 5GAOn 2E10A 2RQWA 2RJCA 2JTFA 1YI2Q 4M75F 3NGPA 3FIFA 1JBMA 2FL7A 2JJ9A 4JRIA 3T9NA 4QVDA 1WFWA 1ZUUA 2AKLA 4BDZA 1MHNA 2WACA 1KJWA 5J39A 5FU6B 4OMLA 4LDWA 4Z02A 1GFDA 1NM7A 1YNZA 5IHKA 5CCAA 4J9GA 2RI2A 1UECA 4FU6A 4QKUA 2X4XA 4E47A 4DEYA 1K73C 2CZ6B 4XTZA 1WI7A 1M27C 1M90U 5HK0A 5GANd 3CCEQ 2GCXA 3CC4A 3CXCS 5IHNA 2W0ZA 2VASA 4M7DB 3RMQA 3CCSQ 2B86A 5FWCA 2RH2A 2SEMA 1CKBA 3MCAB 1F1BB 2OTJA 4C5IA 3GOXA 6AT1B 2DYIA 1UE9A 2KEAA 3CQTA 5KCOA 2E3IA 3NTIA 2CDTA 3L2UA 3CC2Q 2JT4A 4WF2A 2RQVA 2XIDA 3V8KA 2COYA 3JCMf 1MGQA 1EIFA 3OYJA 4J6WA 3M0SA 5C0MA 3CD6Q 4M78F 4OGCA 4M77C 4D6WA 4B9WA 2KT8A 2C0IA 4A4FA 1Q86R 1RI0A 2KROA 4P5NA 2QDLA 2MI6A 1VQ7T 1O75A 3OYNA 4C92B 2FZCB 3CPWS 2H8HA 3OA6A 1JXMA 2DTIA 2ZCFB 2M51A 2E41A 2AT1B 1FWZA 1QKWA 4XTYA 4ESRA 4ZNXA 3CCLT 4FCYA 4ZGJB 2LTOA 5GMKl 3G71T 5GANj 1PD0A 3I35A 3PVLA 1X6OA 3PMTA 1QW1A 3PVQA 5IXBA 5GMKm 3X24B 4F7UE 2V8JA 4OB0B 1SEMA 3QIIA 1VQOQ 1D0ZA 1WJRA 3E9GA 5A0DA 2VUBA 3HPWA 4WCIA 1YJ9T 2DIGA 3SD4A 1YWPA 3CMAQ 2RA2A 4M75A 2DD4A 1TUDA 1ZX6A 1W2BP 4PJOE 3VUBA 1U5SA 5L8RE 2AZVA 3KXTA 2L2PA 2FEIA 4ATOA 2KNBB 1YCYA 1NPRA 2XICA 4ELYC 3HFNA 3GPLA 3AT1B 5LJ5d 4XTUA 1YITT 2XDDA 1VQPA 3P8DA 1UB4A 2CP7A 2OX7A 1WGSA 2QQBA 1X6GA 4HKEA 2DJZA 4UC4A 3CEYA 2QA4T 4NS5A 1VQ7A 1M1KR 1NJIU 2IVWA 1RABB 2M16A 1AHJB 1K1ZA 5CQYA 3CCRT 4GY5A 3JAME 1NYGA 5LJ3d 2ZZDA 2CUBA 3EH1A 2PU9B 1VQ8Q 5FRNA 2K6DA 1PSEA 2CGHA 2HBPA 3QYGB 3VKIA 2FRWA 2JW4A 3MP6A 3JCMg 3EG2A 3LWIA 3CCLA 4AT1B 1G2BA 3CCUA 4M75G 2VGMA 3OYFA 2CT4A 2M9UA 4F04B 2R5AA 3G71A 5D6WA 4JS4A 2QQ9A 2KAFA 4J8OA 4M7DF 2O4XA 1M3CA 2J6OA 4J7IA 5GMKh 1T3LA 2DF6A 2KYBA 1K73R 3WVDB 2ZPFB 5CKFA 1Z9QA 2L0AA 3JCMQ 3S6WA 2EAYA 3DKMA 2DBKA 4KGVB 2RK2A 3OYCA 1SPKA 1WX6A 4PKCC 1BYMA 1YITA 4M7AD 2DD5A 1AWJA 3QBYA 2V8KA 2BTTA 2FZKB 2QA4A 1BCOA 1X2QA 5LJ5j 1PKSA 3UWNA 2K3YA 2ZPEB 1C0MA 3RIRA 2L89A 4FL6A 4A54A 4C8QE 2RHYA 4OMOA 1ARKA 1GCQA 4XTVA 4AMCA 2QGFB 1SRMA 4N4IA 3SWNB 4C92F 3S3MA 1IZ6A 3TREA 1A0NB 2K79A 3O8VA 5GAN6 2CP0A 4N0AA 5LJ3j 1YHQQ 1BI1A 2HZYA 4NOYA 2LQNA 2MF2A 3MEVA 3OBWA 4LNPA 3JB9F 1Y57A 3IQLA 5GAMe 1PCXA 2GTJA 2PQWA 2DLPA 4PJMA 1TG0A 2P4TA 5GAMj 5GAOp 1V29B 1AVZC 4M78C 1EFNA 2JUFA 4ZTFA 4RMOA 2DEQA 5IHIA 1WJQA 1X69A 4FT4A 4J7FA 4J5YA 3TSZA 1TUGB 3FB9A 1IHVA 7AT1B 2YRVA 1OYXA 1K9AA 1K76A 4AG1C 1WDXA 1ZSGA 2DIQA 4ZTJA 5CKHA 1FMKA 4HT8A 2R58A 3FC3A 2OAUA 1ZSZC 5I11A 2J7IA 1G3WA 2DFUA 1AWOA 3JCMJ 2XDPA 1VQLT 1D1AA 2DK3A 4AFZC 4M77D 1MV3A 4FM4B 2EYZA 4MZPA 1U8RA 3RKWA 5GAN5 2NUPB 2RB6A 1RAHB 5KYUA 2COWA 1GCQC 2EWNA 1R77A 2RK1A 4M7DA 5KYYB 1OPLA 1IO6A 1I4K1 5HKCA 3CXCP 2LQWA 2CSQA 1ZQ1A 3DB3A 2EQKA 3EG1A 2CP5A 2QAZA 2RJDA 1SRLA 1G3SA 2V26A 2JTMA 3CXCA 2A36A 3VS6A 5GANh 4IURA 4JLIA 2KGTA 3HTRA 2FVUA 1VQ4Q 2DXBA 2MPXC 2PUKB 5I21A 2E3HA 3LGLA 2V1RA 4LDYA 1LOJA 2W10A 4KUDK 2RD1A 5EC7A 3RDVA 4JZ3A 1ZLMA 2MIOA 1LCKA 1RACB 4RTVA 2HKNA 1VYUA 4ORZA 5IN1A 1KK7A 2E70A 1KD1C 2WSCE 2LRQA 1Q81C 1LNXA 3UATA 1HXDA 5KE2A 4M7DG 2DVJA 4HCZA 1W2BS 4AFSC 2OTLQ 2KBTA 3QXEB 3JCMc 4X9CA 4CI0C 5FU6C 2EYWA 1Y7XA 4LUDA 3VJPA 1UGSB 3ZEHA 4BUGA 2ABLA 1KC8C 2GNCA 2EQIA 2BZXA 4A4HA 1E6GA 1U1TA 1AOJA 1N8RU 5FRMA 1V1CA 3CPWA 2B8AA 3CCQQ 4M7DC 1B3QA 3M54A 1PWTA 2JMCA 3BY7A 5FU7C 4JJNK 3G1JA 4IUTA 4C5HA 4A63B 2RQUA 1SSHA 2E5KA 4J6XA 1UGQB 2K57A 1YIJQ 3LW5E 1BIAA 5GAN2 2FPFA 4FYXB 2DEUA 2QTXA 3RKXA 1T0HA 4A53A 2D9TA 4LE9A 3HRUA 1WA7A 1VOMA 5GAN4 2JMAA 2KY9A 3M0UA 3QJ6A 5M9OA 1K0XA 3NPFA 1I07A 1NLOC 1Q86U 3M53A 2AZSA 2P0QA 3JB9G 3EG0A 1VQ9T 1WXUA 2CT3A 1CSKA 2E6NA 4M75D 2D0QB 4C8QC 2LNHB 1YWOA 4C92C 2D0NA 2JS2A 4A4KA 2DAQA 1RAAB 2GQVA 4OF1A 2VGNA 2E1HA 5LJ5h 3EHRA 4ZN3A 1KQ1A 3UA7A 1MNEA 4JUVA 3JCMd 1YIJT 1WXTA 1ZHIA 1ZA2B 2OAWA 1K0SA 5ECAA 1EZZB 3MEWA 4E7HA 3REBB 1U1SA 3FJPA 1JXOA 5IT9E 4C0FA 3VUZA 2ATCB 3M58A 1SKUB 5CR2A 1RAFB 2KVQG 4KT0E 5DY9A 5LJ3h 4FSSA 4OB2B 2JOYA 2K2VA 3C4SA 3THKA 3I55T 2EJFA 3E2UA 4JDSA 2DXUA 1YFNA 1J3TA 2GBQA 2DO3A 1KIKA 4F7UB 1S72T 4ANJA 2JZ2A 2FPDA 2QTVA 2DETA 2CZ0B 4OGEA 4FIBA 3ASKA 1KG1A 2Y4YA 1RL2A 2Z0WA 2ZPHB 1Z9ZA 3MEAA 2NLUA 4PJOB 2X4JA 2Y4XA 1OX8A 1K8AU 2FRYA 4M78D 1VQ9A 1PM3A 3E1SA 1M1KU 4PK4A 1AT1B 2RNAA 4R55A 1WHGA 1G8XA 2RQTA 3OMCA 4M77A 4MDXA 3LH0A 3G6EQ 1BU1A 4RTUA 4DOWA 4E7LA 1FYNA 3GLXA 1WQ7A 1TU0B 1K9MC 1N27A 5J3BA 3CC7T 3I5SA 3MO8A 4BB7A 1R0CB 4II1A 4E7JA 1Q81R 1BIBA 4BI4A 1IGQA 1M2OA 3QUIA 3CBMA 3CCMT 3CBOA 3M0TA 1Q82U 3EFOA 1N5ZA 2F1LA 2EKOA 2CP3A 2LX9A 1KC8R 3I55A 4OMPA 2RHUA 3SFMA 4OMMA 1TUCA 1QCOA 2ZGWA 1YJNA 3EH2A 1ZBXA 3OB9A 5FU7B 1BCMA 4B6MA 3OMGA 1S72A 3ZBDA 3E19A 4M77G 1VIEA 1OU9A 2XHCA 2K9GA 1YI2T 1M90C 1VQPQ 5GAN7 1QVFP 2EFIA 4OB3B 4PL6A 2QQAA 4CRIA 1JQQA 3M59A 3QWXX 1OV3A 1EX4A 3HL8A 4EMHA 5A0GA 3V8LA 1QVFA 3EG9A 2Y90A 1M30A 3RKYA 4NL2A 2L5QA 1WIEA 1H8KA 1AWWA 4KRTA 3TU4K 3A8LB 1QWFA 5A0LA 2XK0A 2A08A 1PRLC 3SWNC 3CCET 2LC4A 3GF5A 2JTEA 2JM9A 3CCST 4C8QB 4IIOA 3GNFB 3CCMA 1FMVA 2YLCA 2KR3A 2GQIA 1VUBA 4FYVB 2JNGA 3JCMX 2CUDA 4AFUC 2ZPBB 2MWPA 1M2VA 3OSVA 3CC2T 3QPHA 4ELZC 2RHXA 1B34A 1XOVA 2EPDA 1M3BA 5GANe 4M7DD 3GIBA 2X3WD 1W1FA 3OS5A 4HA8A 2EYXA 3M9QA 2GF7A 3NFCA 3CD6T 2FHDA 2YSQA 2KMTA 1YI2A 2PNIA 1OULA 4F7UF 5GAOl 4QW2A 9ATCB 2KE9A 3X20B 5GAOm 2QYZA 1W70A 3WXMB 4JS5A 3EGXB 2YUOA 2LCSA 2ECZA 1KQSP 2CKKA 4LXCA 4R0KA 1UDLA 4PLLA 4PJOF 1VQMQ 3KUFA 2KI7A 2DBMA 4Q5WA 5LL6S 3CCVQ 1E7OA 1W2BA 1HD3A 3CCEA 1D3BA 4BY6C 1DJ7B 3N5BB 1WHLA 3M0QA 4QVCA 1RLPC 2E12A 4EMKB 4E7IA 2DL8A 4N4GA 4C92D 2DVEA 5IAYA 3J80E 3EAEA 4ME7A 2DYBA 4PLIA 1VQOT 3CCJQ 2V1QA 1HYOA 1OZ2A 2C06A 5L23A 1VQNQ 2A28A 3QZ9B 3CC2A 4HXJA 3V7RA 3CMAT 3JB9D 1NJIC 1WNLA 2LT1A 4CC3A 3OYKA 4LN2A 3O5ZA 5GANf 2QEXQ 3VRZA 3X25B 4MDWA 4PJLA 3L2RA 1WYXA 3VYGA 2RI5A 4C5EA 1VQMT 2LCCA 2YLBA 3GBQA 3EFSA 1WPYA 1W4SA 5KYXB 2YRDA 4JRKA 1PKTA 3UA6A 4HT9A 2ENMA 2XG8D 2DNUA 3PIPA 4CC2A 1G83A 2DZ9A 2A0FB 3CMEQ 1YJ9A 4M78A 2F2XA 3MKDA 1ACMB 1I1JA 4J9IA 2EBPA 4RTXA 1ABOA 2M0YA 3TCJA 2F2WA 3BDLA 1WJSA 1TXQA 2J6FA 1VQ8T 3A8MB 2EIFA 1UG1A 4L59A 4XTXA 1JJ2P 1M90R 1Y96A 5LJ5e 1ZSZA 1OZ3A 2LT4A 2XDBA 4DEXA 1KSWA 4OB1B 5KYWB 4BACA 1FXXA 1RLQC 2M02A 2KSSA 5GAN8 1WLPB 1PNJA 3OYLA 3CCRA 3M4GA 2YUQA 3UPUA 4C8QF 2DTHA 5D7UA 5LJ3e 1VQOA 3OS0A 1ABQA 1Q95G 4RKUE 2YUPA 3HSBA 3QG1A 3JCMh 3PTAA 3HRSA 3OYBA 2QGGA 1AEYA 1I0CA 3CMAA 3RBBB 4M78G 5CQXA 2BE9B 3HP9A 4FYWB 2IPOB 1X27A 4X34A 4LUEA 1T0JA 1GFCA 1WHHA 1BI0A 1UHCA 3OBYA 3I56Q 3KBGA 3G4SQ 2YUNA 2HEQA 4BE0A 4A4GA 3OQ5A 2FB7A 1ZUKA 4MMLA 1VQ6Q 4OMFB 3C12A 2QI2A 4JZ4A 1UHFA 4L5GA 2E4HA 1QVFS 1YP5A 4XU0A 3R6NA 1VQ8A 1UJYA 4J9CA 1TH7A 2P0KA 4DBQA 2L3QA 3C0CA 1YHQT 5LJ5f 1M5Q1 3MP8A 2DX1A 2DZCA 3MPUB 4GBQA 1QP2A 2CZ7B 1CKAA 2EQMA 8AT1B 3VV0A 4PFZA 2O88A 1YBYA 3JCMP 1ZUYA 4EMGA 5LJ3f 1NEGA 4BY6B 1MV0B 2QDYB 2X9HA 2RN8A 1QKXA 3BW1A 4M7AE 1U06A 1QVGP 2NUTB 1NEBA 5KCHA 2P84A 3L42A 4KGXB 5GMKi 1JRIA 1PC0A 4C0GA 4C0ZA 1YJWQ 3NMZC 1Q7YU 4KGZB 5HK3A 4XU3A 4A4EA 4IUPA 4L6V5 5GAMf 4VUBA 3C95A 1M8MA 4PJOC 3CPFA 2CP6A 2RMOA 3OYYA 3FJ5A 1QCNA 2RF0A 3OW2P 4HVUA 1KFZA 3QHSA 2CH4A 2P4RA 1QVPA 1AWXA 4QQGA 3REAB 2L8DA 2RO0A 1MMNA 3MEUA 5I22A 2O9VA 2JM8A 4IUVA 4BI8B 1PD1A 3OW2A 2HL5C 1G3TA 1WZOA 2E5QA 4C8QA 4LDUA 4OP0A 3GP8A 1SF9A 1MMDA 1KQSS 2EYYA 4C92A 1D0YA 1YN8A 2HD0A 1VQKQ 3AHUA 3EFRA 3ZL7C 1YJWT 1VQLA 1QLYA 3RESA 4D8DA 1BKBA 2EVRA 2HDAA 4XK8E 4BE1A 1X6BA 1C1AA 4MZTA 4KH0B 5AT1B 1VQ5Q 2HNIA 4JRQA 4E7KA 2PZ1A 3DLLA 3HFOA 4J83A 3G7ZA 3MP1A 3VYHB 1VQ4T 2COZA 1X01A 5FROA 5DM7R 2M1HA 4C5GA 2WSEE 1B07A 5CAIA 4M75B 1AZGB 3NTKA 2AKKA 3DLMA 2LJ0A 2MOXA 2E6ZA 3VS3A 3TVTA 2CH4W 3OY9A 2C0OA 5J26A 1N8RC 1UFFA 4QQDA 3V8JA 1R8OB 5LJ5g 3M0PA 5DLQE 4AG2C 3QJYA 3JB9I 4C8QG 3EGXA 2OTLT 1H641 2FG0A 2EW3A 4C92G 1VQKT 3M57A 3ME9A 2CS7A 3D7SB 2QQRA 2AK5A 5C6SA 2DXCA 3URGA 4RCBA 3JCMb 3FLGA 3LX7A 3LLRA 2CREA 3CCQT 4PJJA 2YT6A 2VC8A 3VS5A 4E7SA 2ZPGB 2HKQB 2X4YA 3EGUA 4RG8A 1QQJA 4LD6A 4B9XA 4Y91A 5GAMg 1JJ2S 2O4XB 2EYQA 4HVWA 2A7YA 1D1CA 2F2VA 1BB9A 2X3XD 3BFMA 1MUZA 3CC4Q 2MYSA 5CIUA 4R56A 1H3HA 2A37A 1GL5A 5D6XA 5FW9A 3NTHA 2OTJQ 2RI3A 3QZ5B 2HQXA 4JPBW 2O01E 4KH1B 3L2QA 4X9DA 2YRCA 2VV5A 1Y07A 4E2FB 4XU2A 4O6JA 2K3XA 1QMCA 2JN0A 2K4YA 2OTLA 4HCBA 3P8BB 5CK9A 2KT1A 2DKGA 1GRIA 2R5MA 2PVDB 1TTHB 4Z89A 4RTZA 1E6HA 1BBZA 4F16A 2VXEA 1UJ0A 2H3EB 3UDCA 2ROLA 3BDUA 2HAXA 2DE0X 1D09B 2QASA 2V8IA 2D1XA 1UEBA 2DL4A 2YHTA 3CCQA 2CYZB 2RHZA 4EMKC 4XTWA 1SHFA 3SWNA 2XU8A 4BD3A 1K8AC 4M7AC 2QXFA 1M1KC 1YIJA 1SG5A 3JCMe 3INZA 1KD1R 4CC4B 4HVVA 3VS4A 1TS9A 4RUGA 4HCKA 2EQJA 1D0XA 4M75E 5IXFA 2DRMA 2HSPA 3FRNA 5CKBA 1K73U 4BDYA 1RADB 1UGVA 1QVGS 3Q1JA 1RAGB 5GAN3 2DA9A 3EHQA 1ZBJA 1Q82C 2DRKA 3E9FA 1I81A 2OI3A 3JCMV 5A2QE 1WHKA 4FW1A 3G6ET 1VYVA 3VRYA 3EG3A 4NL3A 4F14A 2G3RA 5KYUB 1N8RR 3LYIA 4DQ2A 5CO7A 4PJOD 1P92A 4ZGEB 2I0NA 1M1GA 2SRCA 1VQ7Q 1NZ9A 2BZ8A 3JRZA 3OYMA 3OW2S 2O31A 2ZPIB 3H41A 2RHIA 3M4YA 1FX7A 1SSFA 3OYAA 3A8OB 3PE0A 1WQWA 2NUPA 1UUEA 4FW2A 5I2SA 1RAIB 2K7AA 2DTOA 5KYYA 1K4US 2IIMA 3CC7A 3CCLQ 3QDFA 1PSFA 1TSFA 3M0RA 2NUTA 3CCUQ 4RTWA 4E7ZA 1OPKA 2DL7A 2VWFA 3SDZA 3G71Q 4M78E 1OX9A 4IUQA 1RAEB 1T3SA 2DPPB 1O9SA 3PGGA 3H0HA 1VQPT 3P8HA 1UGPB 1YJ9Q 1D1BA 2KQWA 2YWWA 1GCPA 4QT7A 2RM4A 2LMJA 1UGRB 2GGRA 3G6EA 2CZ1B 2HL3A 1R0BG 1YITQ 2JS0A 4RTYA 5KH6A 1C6VX 2PTKA 3TSWA 2PVGB 2EKHA 2QA4Q 3CCUT 4KUIA 2FO0A 2HCKA 1I5LA 2KRSA 3CCRQ 3A98A 3QYHB 3HKSA 5GJVB 1WHJA 1KQSA 1WXBA 4C0DB 2VVKA 1X2KA 3HHTB 2QG9B 3L1AA 3TEEA 4C8QD 5GAOq 2J05A 3CCSA 1M9SA 4IIMA 3EGDB 4J9DA 5CKEA 2ED1A 1VYTA 5GJWB 1IB8A 3OSSC 3SEMA 4M7AB 4JJCA 3FDRA 2BE7D 1K9MR 5CVIA 1K8AR 2O2OA 4QQ6A 4EPCA 4RTTA 1VIFA 2E65A 8ATCB 4OMNA 4DBFA 2KYMA 4J9BA 4GLKA 4RG2A 3ULRB 2NUZA 3OYDA 3CD6A 1IXDA 3CCVT 1SHGA 4LD9K 2HQHA 1PHTA 1NYFA 3SHWA 3OYHA 3RUXA 2HBWA 3V7CA 4JLGA 1JEGA 2D8JA 4J6YA 3NHNA 3VS1A 4M7DE 3QO3A 3C94A 3PIOA 3ER0A 1Q82R 2RPNA 2K5LA 1OOTA 5GAMd 3I5RA 1BI2A 3JV3A 3META 2QK0A 4LDXA 3CCJT 1NE8A 2DL5A 3A8GB 2MAMA 2EQUA 3U23A 2DMOA 1VQNT 1TWBA 2EJGA 2VXFA 2LVMA 2EGCA 1XNIA 1UTIA 5D6YA 2QEXT 2E64A 4BI3A 1JJ2A 4IUUA 4M75C 4GLMA 3S3OA 1H92A 2MMPA 1V76A 4MMKA 1X75C 2PVOB 3QSUA 3TQ7P 2LQ8A 1GBRA 2P0PA 1G5VA 4J9FA 5I2MA 2DJQA 3CMET 1OU8A 1LJOA 2ESWA 1JB0E 3OYIA 4F7UA 2H3JA 5HY6A 2I2LA 5IH2A 1RI9A 1LPLA 4M77B 3OS1A 2F5TX 1VQMA 2QQSA 4C92E 2GFUA 2LZ6B 2YDLA 4XU1A 3CCVA 2BUDA 5CKDA 2LQKA 2J06A 1MMAA 4PJOA 1S1NA 2LP5A 4J9HA 3VS7A 4Y92A 3A5ZB 1VQLQ 4KULA 3EFOB 2BKDN 2VYTA 1Y0MA 3UF4A 3CCJA 1IREB 3M56A 4IKFA 4JJDA 1VQNA 3H8ZA 3HRTA 5KE3A 3KFVA 3L2ZA 1XQHA 5GANg 1M3AA 1N9RA 2EGEA 2BIVA 4WTOB 2L3PA 2QEXA 4F7UG 3VS2A 4Z88A 3JSCA 2XMFA 3OYEA 2CP2A 2A3LA 2KXDA 2ROTA 3I56T 1XTDA 3G4ST 1GBQA 1W6XA 4MZMA 2X51A 1ZA1B 4PJOG 3CMEA 1KQ2A 3H9NA 2LJ3A 2YXYA 1VQ6T 2HMAA 4M7AF 3EG9B 2EJ9A 4FT2A 2LCLA 4XAXB 3OS2A 2DXTA 2X4WA 4OMQA 1QVGA 2LDMA 4E6RA 3CBPA 2HSEB 1JO8A 4N0AC 3L2VA 1AZEA 3M55A 1NJIR 1U3OA 3R6OA 1Q7YC 1OEBA 4ZN1A 4LDVA 3SB2A 3RERA 3H6ZA 3JB9H 1M2VB 1NLPC 4HCCA 1RUWA 2VB6A 3LWHA 5KYNA 1B34B 1G3YA 4YTLA 4D8KA 1KD1U 3QWYA 2CSIA 1YHQA 1Q81U 3M5AA 1IRXA 1LVKA 2RJEA 4JJBA 3JCMW 1OI1A 4PNOA 4EIKA 2J6KA 2LX7A
chains in the Genus database with same CATH topology
3QPHA 2K3YA 4ELZC 1M8VA 2RHXA 1B34A 2ZPEB 1XOVA 2VXEA 5GANe 4M7DD 3ZFJA 2R57A 3GIBA 3RIRA 2L89A 3UDCA 4FL6A 2HAXA 3BDUA 4A54A 4C8QE 3I56A 1KC8U 3J7AF 3OS5A 3G4SA 2RHYA 3QKJA 2V8IA 1UEBA 2YHTA 4HA8A 2L3RA 4XTVA 5FLXE 3M9QA 3CCQA 2GF7A 3NFCA 4N4IA 1I8FA 3SWNB 3CD6T 4C92F 2K5FA 1Y71A 2CYZB 2RHZA 3S3MA 1KHIA 3JB9J 1IZ6A 2FHDA 2KDSA 3TREA 4EMKC 2GFAA 2KMTA 1VQMA 1YI2A 3O8VA 4XTWA 3V7SA 5GAN6 1VQ6A 4F7UF 4N0AA 5LJ3j 5GAOl 1BI1A 3FEOA 4QW2A 4NOYA 3X20B 1NPPA 2XU8A 3SWNA 4BD3A 2MF2A 5GAOm 3MEVA 3S3NA 3OBWA 1K8AC 4M7AC 3DB4A 2QXFA 3WXMB 4JS5A 1M1KC 2MWOA 3JB9F 1YIJA 1QP3A 3JCMe 3INZA 3PT9A 4M77E 2CKKA 2D6FA 5GAMe 5DLOA 4QVZA 4M77F 4PLLA 2PQWA 4PJOF 1D3BB 3LGFA 3KUFA 1KHCA 2M0OA 2P4TA 1K8AU 5GAMj 2EQJA 4Q5WA 5LL6S 5GAOp 1V29B 4M75E 1W2BA 1GXIE 3CCEA 2KK4A 1D3BA 4M78C 2X35A 4BY6C 1DJ7B 3FRNA 3N5BB 2JUFA 4ZTFA 5CKBA 4QVCA 4RMOA 1K73U 2DEQA 2E12A 5LJ3g 4BDYA 1WJQA 4FT4A 5AYFA 1VQ5T 4J7FA 4EMKB 4E7IA 4J5YA 3PMIA 4N4GA 1QVGS 3Q1JA 4C92D 4BE2A 2FYKA 3FB9A 2DVEA 4XQ3A 5IAYA 5GAN3 2YRVA 4TVRA 3J80E 1Q82C 1OYXA 3EAEA 3UT1A 3E9FA 4ME7A 1N6AA 1I81A 2DIQA 4ZTJA 5CKHA 4HT8A 4PLIA 3JCMV 1VQOT 2RJFA 2R58A 4EMKA 5A2QE 3FC3A 2OAUA 3X28B 4N4HA 1OZ2A 3G6ET 2C06A 3QZ9B 2F69A 2XKOC 3CC2A 1G3WA 2F5KA 3V7RA 4NL3A 3CMAT 3JB9D 2G3RA 1NJIC 1WNLA 2LT1A 1YJWA 3JCMJ 2XDPA 3OYKA 1VQLT 2DK3A 3LYIA 4DQ2A 5GANf 1Q86C 5CO7A 4M7AA 4M77D 4PJOD 1P92A 3X25B 4FM4B 4MDWA 4ZGEB 1M1GA 4MZPA 4Y28E 4ZGDB 3L2RA 1U8RA 4V2SA 3RKWA 3VYGA 5GAN5 2RI5A 1NZ9A 3JRZA 4C5EA 3A8HB 3OYMA 2RB6A 3OW2S 4DA4A 1VQMT 2LCCA 2YLBA 2ZPIB 3EFSA 3MHXA 1VQ4A 1WPYA 2EWNA 2RHIA 4M78B 3M4YA 1W4SA 2K5IA 1FX7A 1SSFA 2RK1A 3OYAA 4M7DA 4JRKA 1M1FA 4HT9A 2LNVA 2XG8D 3A8OB 1I4K1 5HKCA 3PIPA 1WQWA 2PUOB 2DZ9A 4O5VA 5I2SA 2HQEA 1YJ9A 1ZQ1A 4M78A 3DB3A 4DOVA 2EQKA 2DTOA 1BI3A 2AHJB 2RJDA 3CC7A 1G3SA 2JTMA 4FSXA 1Y96B 3CXCA 1PSFA 4RCCA 3TCJA 4JRPA 3BDLA 1WJSA 3SDZA 1VQ8T 4EDUA 5GANh 3RMSA 3A8MB 4IURA 2EIFA 4JLIA 4L59A 4M78E 4XTXA 4IUQA 2FVUA 2IG0A 2DPPB 1O9SA 2DXBA 1Y96A 2PUKB 3PGGA 5I21A 5LJ5e 1OZ3A 2LT4A 2XDBA 1VQKA 3LGLA 1VQPT 3F70A 3X26B 3P8HA 2XD0A 4LDYA 1LOJA 4OB1B 3PFSA 4KUDK 1UGPB 1FXXA 1N9SA 2RD1A 4BACA 2XI9A 5EG2A 1VQ5A 2KSSA 4M7AG 5GMKe 5GAN8 3CC4T 3OYLA 3CCRA 4C0DC 3M4GA 2KQWA 1YJNT 3J81E 3UPUA 5IN1A 2E70A 1M4ZA 1KD1C 2RM4A 2WSCE 4C8QF 2DTHA 2LRQA 1LNXA 5GMKj 5LJ3e 5GAOr 1VQOA 1Q81C 1HXDA 5KE2A 4M7DG 1UGRB 3VU3C 3OS0A 2JVVA 3GNGA 4RKUE 3G6EA 2CZ1B 3HSBA 3QG1A 4HCZA 1W2BS 2OTJT 3JCMh 3PTAA 3HRSA 3QXEB 3OYBA 3JCMc 4X9CA 5GAMh 4CI0C 5FU6C 5KH6A 3CMAA 1Y7XA 4M78G 5CQXA 1VQ9A 3L2WA 3VJPA 1UGSB 2PVGB 3ZEHA 3QDRB 4BUGA 3HP9A 1KC8C 3CCUT 1HK9A 4A4HA 4KUIA 1K9MU 1U1TA 4X34A 3PNWC 1I5LA 4KBMB 1N8RU 4OVAA 2WSFE 5FRMA 3OYGA 1BI0A 3OBYA 3KBGA 3QYHB 3CPWA 3HKSA 3WVEB 1BYMA 1H3ZA 2B8AA 4M7DC 5GAOn 2E10A 3M54A 3CC2T 2RJCA 4BE0A 5FU7C 3BY7A 1KQSA 2JTFA 4A4GA 3OQ5A 4C0DB 2FB7A 4R55A 4MMLA 4JJNK 4M75F 4OMFB 3C12A 2QI2A 3FIFA 4IUTA 1JBMA 2FL7A 3HHTB 4JRIA 3T9NA 3L1AA 4C5HA 3TEEA 4C8QD 5GAOq 4QVDA 4L5GA 3CCSA 4J6XA 1M9SA 4BDZA 1MHNA 1QVFS 4XU0A 1UGQB 2WACA 1VQ8A 2K57A 5FU6B 5J39A 4PJOB 3LW5E 5CKEA 1TH7A 2P0KA 1BIAA 4LDWA 4Z02A 5GAN2 2QTXA 3OSSC 3RKXA 1YHQT 5CCAA 5LJ5f 4M7AB 2RI2A 4FU6A 4A53A 2X4XA 2D9TA 4E47A 1M5Q1 3HRUA 3FDRA 1K73C 2CZ6B 3MP8A 4XTZA 5CVIA 4QQ6A 4EPCA 2DZCA 5HK0A 1M90U 5GANd 5GAN4 1VIFA 2GCXA 3CC4A 2KY9A 2E65A 3CXCS 1QP2A 3QJ6A 2CZ7B 5M9OA 4M7DB 3RMQA 1Q86U 3M53A 2EQMA 4GLKA 4RG2A 2RH2A 2P0QA 3VV0A 3JB9G 1VQ9T 1YBYA 3OYDA 3JCMP 3CD6A 3MCAB 4EMGA 5LJ3f 4BY6B 2OTJA 2QDYB 4C5IA 3GOXA 2E6NA 4M75D 2D0QB 4C8QC 3CCVT 4LD9K 3BW1A 4M7AE 4C92C 4A4KA 2DAQA 5KCOA 5KCHA 3OYHA 3RUXA 3NTIA 2GQVA 4OF1A 3V7CA 2VGNA 3L42A 3L2UA 4JLGA 2E1HA 5LJ5h 4ZN3A 1KQ1A 4J6YA 5GMKi 1JRIA 4WF2A 5GANj 4C0GA 4C0ZA 2XIDA 4M7DE 3QO3A 3C94A 3PIOA 4JUVA 3ER0A 3JCMd 1Q7YU 1YIJT 1ZHIA 2K5LA 5GAMd 3V8KA 1BI2A 4XU3A 5HK3A 3JCMf 4A4EA 4IUPA 3META 1MGQA 1EIFA 4L6V5 3OYJA 5GAMf 4LDXA 4J6WA 3MEWA 3CCJT 4E7HA 1NE8A 3A8GB 4VUBA 1U1SA 2MAMA 3FJPA 2EQUA 3C95A 5C0MA 4C0FA 3VUZA 5IT9E 1VQNT 4M78F 3M58A 4OGCA 4M77C 4PJOC 5CR2A 2EJGA 2VXFA 4D6WA 3CPFA 4B9WA 2KVQG 2LVMA 4KT0E 5DY9A 3OYYA 5LJ3h 4A4FA 1XNIA 1RI0A 5D6YA 3QHSA 4OB2B 2QEXT 2JOYA 1QVPA 2E64A 2K2VA 4QQGA 4BI3A 3C4SA 4P5NA 4IUUA 2MI6A 3I55T 1JJ2A 2L8DA 2EJFA 4M75C 2RO0A 3MEUA 1VQ7T 4JDSA 1O75A 4IUVA 2DXUA 3S3OA 4BI8B 2MMPA 3OYNA 4MMKA 1X75C 4C92B 2PVOB 3OW2A 3QSUA 2LQ8A 2P0PA 1G5VA 3CPWS 1G3TA 2DO3A 5I2MA 3OA6A 2DTIA 4F7UB 1S72T 2ZCFB 2E5QA 4C8QA 2E41A 4LDUA 4OP0A 3GP8A 1FWZA 1KQSS 2JZ2A 3CMET 4C92A 4XTYA 1LJOA 2HD0A 2CZ0B 3AHUA 4OGEA 3EFRA 4FIBA 1JB0E 3ASKA 1KG1A 3OYIA 4F7UA 1YJWT 2H3JA 1VQLA 5HY6A 3RESA 2Y4YA 3CCLT 2I2LA 1BKBA 4XK8E 4ZGJB 4BE1A 1RL2A 2LTOA 4MZTA 2ZPHB 3MEAA 2NLUA 4M77B 3OS1A 2HNIA 2X4JA 2F5TX 2Y4XA 5GMKl 3G71T 4JRQA 2QQSA 4C92E 4E7KA 4M78D 3DLLA 1X6OA 3PMTA 2GFUA 1QW1A 3HFOA 4J83A 3E1SA 1M1KU 3G7ZA 3MP1A 3VYHB 1VQ4T 5GMKm 4XU1A 3X24B 1X01A 2BUDA 5FROA 4F7UE 5CKDA 2M1HA 4C5GA 2V8JA 2LQKA 4OB0B 2WSEE 5DM7R 3QIIA 5CAIA 3OMCA 4MDXA 4M77A 4PJOA 4M75B 3NTKA 1WJRA 3E9GA 3LH0A 3DLMA 5A0DA 2VUBA 3HPWA 4DOWA 2E6ZA 4E7LA 3GLXA 1YJ9T 1WQ7A 2DIGA 3SD4A 3OY9A 1K9MC 1N27A 5J3BA 5J26A 2RA2A 1N8RC 3A5ZB 4M75A 4QQDA 3MO8A 2DD4A 4KULA 3V8JA 3CC7T 1R8OB 2BKDN 2VYTA 5LJ5g 5DLQE 4BB7A 4PJOE 4II1A 4E7JA 3VUBA 1BIBA 4BI4A 5L8RE 3CCJA 3QUIA 3KXTA 3CCLA 1IREB 3CBMA 3M56A 3CCMT 4IKFA 4ATOA 3QJYA 3CBOA 1YCYA 1NPRA 2XICA 4ELYC 3HFNA 3H8ZA 3HRTA 4C8QG 3JB9I 5KE3A 5LJ5d 3GPLA 1H641 3L2ZA 4XTUA 1XQHA 5GANg 1Q82U 2OTLT 1YITT 2XDDA 1VQPA 1N9RA 3P8DA 2EKOA 4C92G 3M57A 3ME9A 1VQKT 1UB4A 2CS7A 1VQNA 2QQRA 2LX9A 2BIVA 1WGSA 2QQBA 2QEXA 4HKEA 4F7UG 2DJZA 4UC4A 3CEYA 2QA4T 5C6SA 4NS5A 3I55A 3JSCA 1VQ7A 2DXCA 2RHUA 3SFMA 1NJIU 2IVWA 2M16A 3URGA 1AHJB 3OYEA 4RCBA 2ZGWA 2A3LA 1YJNA 5CQYA 3CCRT 1ZBXA 3OB9A 3I56T 1XTDA 4GY5A 3JCMb 3G4ST 3FLGA 3JAME 5FU7B 5LJ3d 3LX7A 3OMGA 1S72A 3LLRA 2ZZDA 3ZBDA 3E19A 2PU9B 5FRNA 3CCQT 4MZMA 2VC8A 2ZPGB 1PSEA 1VIEA 4M77G 4PJOG 2X4YA 2CGHA 2XHCA 3CMEA 1KQ2A 2HBPA 3QYGB 1YI2T 3VKIA 1M90C 1VQ6T 3MP6A 5GAN7 4RG8A 3JCMg 4M7AF 4LD6A 3LWIA 4B9XA 2EFIA 4OB3B 4Y91A 2EJ9A 4PL6A 2O4XB 2EYQA 5GAMg 4FT2A 2QQAA 1JJ2S 3CCUA 2A7YA 4CRIA 4M75G 3M59A 2LCLA 4XAXB 2VGMA 3OS2A 3HL8A 2DXTA 3BFMA 3OYFA 2M9UA 2X4WA 2R5AA 3G71A 5D6WA 4EMHA 5A0GA 3V8LA 4JS4A 1QVGA 1QVFA 2QQ9A 5CIUA 2KAFA 4J8OA 4M7DF 4R56A 2Y90A 2O4XA 2LDMA 4J7IA 3RKYA 3CBPA 5GMKh 4NL2A 2L5QA 5D6XA 3TU4K 3NTHA 4N0AC 3A8LB 2RI3A 3WVDB 3L2VA 3M55A 3QZ5B 2XK0A 2ZPFB 5A0LA 5CKFA 2HQXA 2O01E 3SWNC 3L2QA 3CCET 4X9DA 3R6OA 1Q7YC 2LC4A 2VV5A 3GF5A 3JCMQ 1Y07A 3S6WA 2EAYA 4ZN1A 4XU2A 4C8QB 3CCST 3DKMA 2K3XA 4LDVA 4O6JA 3SB2A 3RERA 3H6ZA 3JB9H 3GNFB 3CCMA 2RK2A 2YLCA 3OYCA 4HCCA 4PKCC 2JN0A 2K4YA 1VUBA 2OTLA 3LWHA 3P8BB 4HCBA 2JNGA 1B34B 1G3YA 4YTLA 3JCMX 1YITA 2DD5A 1YHQA 1KD1U 4M7AD 3QBYA 5CK9A 1Q81U 2V8KA 3CCVA 2DKGA 2ZPBB 2MWPA 3M5AA 2RJEA 2R5MA 3JCMW 1OI1A 4PNOA 2QA4A 3OSVA 2PVDB 5LJ5j 3UWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  2DZC A;  1M8V A;  5GAN d;  1B34 A;  2VXE A;  5GAN e;  5GAN 4;  4M7D D;  2E65 A;  2RA2 A;  4M75 A;  3RIR A;  3V8J A;  3GIB A;  3BDU A;  1Y96 B;  4A54 A;  4M7D B;  5LJ5 g;  4RCC A;  4C8Q E;  4PJO E;  1BIB A;  3JB9 G;  2YHT A;  4HA8 A;  3QUI A;  4XTV A;  5GAN h;  3JCM P;  4M78 E;  1I8F A;  4JLI A;  3SWN B;  4XTX A;  5LJ3 f;  1YCY A;  4C92 F;  4EMG A;  3JB9 I;  3HFN A;  3JB9 J;  4C8Q G;  4EMK C;  5LJ5 d;  1Y96 A;  1H64 1;  3L2Z A;  3PGG A;  4M75 D;  4XTU A;  4C8Q C;  3BW1 A;  5I21 A;  4XTW A;  3V7S A;  5GAN 6;  5LJ5 e;  1N9R A;  4F7U F;  4N0A A;  4C92 G;  5LJ3 j;  5GAO l;  4M7A E;  4C92 C;  1LOJ A;  4NOY A;  3SWN A;  3RUX A;  4F7U G;  1N9S A;  2DJZ A;  2RD1 A;  3V7C A;  5GAO m;  2E1H A;  5LJ5 h;  4M7A G;  1KQ1 A;  4J6Y A;  5GMK e;  5GMK i;  4M7A C;  1JRI A;  5GAN 8;  4WF2 A;  4M7D E;  3QO3 A;  3JB9 F;  4RCB A;  4JUV A;  2ZGW A;  3JCM d;  3M4G A;  3JCM e;  3INZ A;  4M77 E;  5GAM d;  3V8K A;  5GAM e;  3JCM b;  4XU3 A;  3JCM f;  2RM4 A;  4C8Q F;  1MGQ A;  2DTH A;  4M77 F;  1LNX A;  4PJO F;  1D3B B;  5LJ3 d;  4J6W A;  5GAM f;  1HXD A;  5GMK j;  5LJ3 e;  4M7D G;  3VU3 C;  1U1S A;  3FJP A;  2VC8 A;  3HSB A;  4M77 G;  4M78 F;  4PJO G;  2CGH A;  3JCM h;  4M77 C;  5GAM j;  1KQ2 A;  5GAO p;  2EJG A;  2VXF A;  4PJO C;  4M75 E;  4X9C A;  3JCM c;  5GAM h;  5DY9 A;  5GAN 7;  5LJ3 h;  4M78 G;  1D3B A;  3JCM g;  4M7A F;  4M78 C;  4Y91 A;  5GAM g;  2EJ9 A;  3QHS A;  4QVC A;  2E64 A;  2DEQ A;  4M75 G;  5LJ3 g;  4M75 C;  2EJF A;  1HK9 A;  4EMK B;  2DXT A;  3BFM A;  4J5Y A;  1U1T A;  4C92 D;  2DXU A;  1I5L A;  2FYK A;  4EMH A;  3FB9 A;  3V8L A;  2DVE A;  4XQ3 A;  5GAN 3;  4MMK A;  4C92 B;  4M7D F;  2Y90 A;  3QSU A;  4V2S A;  1I81 A;  3RKY A;  4HT8 A;  2DTI A;  3JCM V;  4F7U B;  5GMK h;  4EMK A;  4NL2 A;  4C8Q A;  2E41 A;  4M7D C;  4OP0 A;  5GAO n;  2E10 A;  4N0A C;  4C92 A;  4XTY A;  3BY7 A;  1LJO A;  3V7R A;  2FB7 A;  4NL3 A;  4MML A;  3AHU A;  3EFR A;  4M75 F;  3SWN C;  3JB9 D;  1WNL A;  3FIF A;  4X9D A;  1JBM A;  4F7U A;  3JCM J;  3RES A;  4JRI A;  2I2L A;  3JCM Q;  3L1A A;  4DQ2 A;  5GAN f;  4M7A A;  4C8Q D;  4M77 D;  5GAO q;  4QVD A;  4PJO D;  2EAY A;  4J6X A;  4XU2 A;  4M77 B;  3RKW A;  4C8Q B;  4PJO B;  2HNI A;  5GMK l;  3SB2 A;  5GAN 5;  4XU0 A;  5GAN j;  3RER A;  2K57 A;  2RB6 A;  4M78 D;  4C92 E;  3JB9 H;  3HFO A;  5GAN g;  2YLB A;  2YLC A;  3EFS A;  1WPY A;  1TH7 A;  2EWN A;  1BIA A;  4M78 B;  2JN0 A;  5GMK m;  5GAO r;  5GAN 2;  4XU1 A;  1X01 A;  4F7U E;  4M7D A;  1B34 B;  2QTX A;  4JRK A;  3JCM X;  3RKX A;  4M7A D;  4HT9 A;  5CAI A;  1I4K 1;  4M77 A;  4M75 B;  5LJ5 f;  4PJO A;  4M7A B;  1WQW A;  4A53 A;  2DKG A;  1M5Q 1;  2DZ9 A;  3JCM W;  4PNO A;  4XTZ A;  4M78 A;  5LJ5 j;  1WQ7 A; 
#chains in the Genus database with same CATH topology
 2RQR A;  1M8V A;  2G6F X;  3ZFJ A;  2R57 A;  1BK2 A;  1I5O B;  3I56 A;  2FPE A;  1KC8 U;  3J7A F;  3G4S A;  3A1P A;  3QKJ A;  2L3R A;  5FLX E;  1I8F A;  2KRN A;  2MK5 A;  4PFP A;  2K5F A;  1MND A;  1Y71 A;  3JB9 J;  1KHI A;  4PJN A;  2KDS A;  2GFA A;  4AFQ C;  3V7S A;  1VQ6 A;  2MCN A;  1MMG A;  3FEO A;  4DBR A;  2KXC A;  1X43 A;  1NPP A;  5FWB A;  3S3N A;  3CPW P;  3DB4 A;  2MWO A;  1VA7 A;  1QP3 A;  3VS0 A;  3PT9 A;  4M77 E;  1IHW A;  2D6F A;  5DLO A;  4J9E A;  4QVZ A;  4F17 A;  4M77 F;  1D3B B;  3LGF A;  4CC7 A;  1VQ9 Q;  2GTO A;  1KHC A;  2M0O A;  1B7T A;  2K3B A;  1HJD A;  1GXI E;  2K2M A;  2KK4 A;  4PFO A;  1QCF A;  2DIL A;  2X35 A;  1WHM A;  1AD5 A;  1HSQ A;  5LJ3 g;  5AYF A;  1VQ5 T;  3PMI A;  3BE3 A;  1XJW B;  4BE2 A;  2FYK A;  4XQ3 A;  4TVR A;  2DM1 A;  4M4Z A;  3UT1 A;  1N6A A;  3H0I A;  3RNJ A;  4DBH A;  2RJF A;  4EMK A;  3X28 B;  3EGD A;  2AIR B;  2FZG B;  4N4H A;  2D8H A;  2F69 A;  2XKO C;  2F5K A;  1PG5 B;  1YCS B;  2OJ2 A;  4Z8A A;  1YJW A;  4M7A A;  1Q86 C;  2KRM A;  3I55 Q;  4Y28 E;  4ZGD B;  4V2S A;  3A8H B;  1PRM C;  4DA4 A;  4FYY B;  1NG2 A;  3MHX A;  1VQ4 A;  1YJN Q;  4M78 B;  2K5I A;  4X1V A;  1M1F A;  2LNV A;  1S72 Q;  2NYS A;  2PUO B;  3H0F A;  4O5V A;  2HQE A;  4DOV A;  4K11 A;  5KYX A;  1BI3 A;  2AHJ B;  2ZAE A;  3LH5 A;  2BZY A;  4FSX A;  1Y96 B;  1ZSZ B;  4RCC A;  4JRP A;  2DL3 A;  4EDU A;  3RMS A;  1QWE A;  2IG0 A;  1NBE B;  2L3S A;  1VQK A;  2ED0 A;  3F70 A;  3X26 B;  2XD0 A;  2VKN A;  3PFS A;  1N9S A;  2XI9 A;  5EG2 A;  1OQK A;  3RR6 A;  3MJX A;  1VQ5 A;  4M7A G;  5GMK e;  3CC4 T;  3CC7 Q;  2EGA A;  4C0D C;  1YJN T;  3J81 E;  5KYW A;  1M4Z A;  1FMW A;  5GAO r;  5GMK j;  3VU3 C;  2JVV A;  3GNG A;  3CCM Q;  1TOV A;  2OTJ T;  2NWM A;  2DER A;  5GAM h;  3I9Q A;  2LJ1 A;  1Q7Y R;  2C0T A;  3L2W A;  3QDR B;  1HK9 A;  1K9M U;  3PNW C;  1IGU A;  4KBM B;  2O9S A;  4OVA A;  2WSF E;  3OYG A;  1H3Z A;  3WVE B;  1JU5 C;  5HCK A;  2JXB A;  5GAO n;  2E10 A;  2RQW A;  2RJC A;  2JTF A;  1YI2 Q;  4M75 F;  3NGP A;  3FIF A;  1JBM A;  2FL7 A;  2JJ9 A;  4JRI A;  3T9N A;  4QVD A;  1WFW A;  1ZUU A;  2AKL A;  4BDZ A;  1MHN A;  2WAC A;  1KJW A;  5J39 A;  5FU6 B;  4OML A;  4LDW A;  4Z02 A;  1GFD A;  1NM7 A;  1YNZ A;  5IHK A;  5CCA A;  4J9G A;  2RI2 A;  1UEC A;  4FU6 A;  4QKU A;  2X4X A;  4E47 A;  4DEY A;  1K73 C;  2CZ6 B;  4XTZ A;  1WI7 A;  1M27 C;  1M90 U;  5HK0 A;  5GAN d;  3CCE Q;  2GCX A;  3CC4 A;  3CXC S;  5IHN A;  2W0Z A;  2VAS A;  4M7D B;  3RMQ A;  3CCS Q;  2B86 A;  5FWC A;  2RH2 A;  2SEM A;  1CKB A;  3MCA B;  1F1B B;  2OTJ A;  4C5I A;  3GOX A;  6AT1 B;  2DYI A;  1UE9 A;  2KEA A;  3CQT A;  5KCO A;  2E3I A;  3NTI A;  2CDT A;  3L2U A;  3CC2 Q;  2JT4 A;  4WF2 A;  2RQV A;  2XID A;  3V8K A;  2COY A;  3JCM f;  1MGQ A;  1EIF A;  3OYJ A;  4J6W A;  3M0S A;  5C0M A;  3CD6 Q;  4M78 F;  4OGC A;  4M77 C;  4D6W A;  4B9W A;  2KT8 A;  2C0I A;  4A4F A;  1Q86 R;  1RI0 A;  2KRO A;  4P5N A;  2QDL A;  2MI6 A;  1VQ7 T;  1O75 A;  3OYN A;  4C92 B;  2FZC B;  3CPW S;  2H8H A;  3OA6 A;  1JXM A;  2DTI A;  2ZCF B;  2M51 A;  2E41 A;  2AT1 B;  1FWZ A;  1QKW A;  4XTY A;  4ESR A;  4ZNX A;  3CCL T;  4FCY A;  4ZGJ B;  2LTO A;  5GMK l;  3G71 T;  5GAN j;  1PD0 A;  3I35 A;  3PVL A;  1X6O A;  3PMT A;  1QW1 A;  3PVQ A;  5IXB A;  5GMK m;  3X24 B;  4F7U E;  2V8J A;  4OB0 B;  1SEM A;  3QII A;  1VQO Q;  1D0Z A;  1WJR A;  3E9G A;  5A0D A;  2VUB A;  3HPW A;  4WCI A;  1YJ9 T;  2DIG A;  3SD4 A;  1YWP A;  3CMA Q;  2RA2 A;  4M75 A;  2DD4 A;  1TUD A;  1ZX6 A;  1W2B P;  4PJO E;  3VUB A;  1U5S A;  5L8R E;  2AZV A;  3KXT A;  2L2P A;  2FEI A;  4ATO A;  2KNB B;  1YCY A;  1NPR A;  2XIC A;  4ELY C;  3HFN A;  3GPL A;  3AT1 B;  5LJ5 d;  4XTU A;  1YIT T;  2XDD A;  1VQP A;  3P8D A;  1UB4 A;  2CP7 A;  2OX7 A;  1WGS A;  2QQB A;  1X6G A;  4HKE A;  2DJZ A;  4UC4 A;  3CEY A;  2QA4 T;  4NS5 A;  1VQ7 A;  1M1K R;  1NJI U;  2IVW A;  1RAB B;  2M16 A;  1AHJ B;  1K1Z A;  5CQY A;  3CCR T;  4GY5 A;  3JAM E;  1NYG A;  5LJ3 d;  2ZZD A;  2CUB A;  3EH1 A;  2PU9 B;  1VQ8 Q;  5FRN A;  2K6D A;  1PSE A;  2CGH A;  2HBP A;  3QYG B;  3VKI A;  2FRW A;  2JW4 A;  3MP6 A;  3JCM g;  3EG2 A;  3LWI A;  3CCL A;  4AT1 B;  1G2B A;  3CCU A;  4M75 G;  2VGM A;  3OYF A;  2CT4 A;  2M9U A;  4F04 B;  2R5A A;  3G71 A;  5D6W A;  4JS4 A;  2QQ9 A;  2KAF A;  4J8O A;  4M7D F;  2O4X A;  1M3C A;  2J6O A;  4J7I A;  5GMK h;  1T3L A;  2DF6 A;  2KYB A;  1K73 R;  3WVD B;  2ZPF B;  5CKF A;  1Z9Q A;  2L0A A;  3JCM Q;  3S6W A;  2EAY A;  3DKM A;  2DBK A;  4KGV B;  2RK2 A;  3OYC A;  1SPK A;  1WX6 A;  4PKC C;  1BYM A;  1YIT A;  4M7A D;  2DD5 A;  1AWJ A;  3QBY A;  2V8K A;  2BTT A;  2FZK B;  2QA4 A;  1BCO A;  1X2Q A;  5LJ5 j;  1PKS A;  3UWN A;  2K3Y A;  2ZPE B;  1C0M A;  3RIR A;  2L89 A;  4FL6 A;  4A54 A;  4C8Q E;  2RHY A;  4OMO A;  1ARK A;  1GCQ A;  4XTV A;  4AMC A;  2QGF B;  1SRM A;  4N4I A;  3SWN B;  4C92 F;  3S3M A;  1IZ6 A;  3TRE A;  1A0N B;  2K79 A;  3O8V A;  5GAN 6;  2CP0 A;  4N0A A;  5LJ3 j;  1YHQ Q;  1BI1 A;  2HZY A;  4NOY A;  2LQN A;  2MF2 A;  3MEV A;  3OBW A;  4LNP A;  3JB9 F;  1Y57 A;  3IQL A;  5GAM e;  1PCX A;  2GTJ A;  2PQW A;  2DLP A;  4PJM A;  1TG0 A;  2P4T A;  5GAM j;  5GAO p;  1V29 B;  1AVZ C;  4M78 C;  1EFN A;  2JUF A;  4ZTF A;  4RMO A;  2DEQ A;  5IHI A;  1WJQ A;  1X69 A;  4FT4 A;  4J7F A;  4J5Y A;  3TSZ A;  1TUG B;  3FB9 A;  1IHV A;  7AT1 B;  2YRV A;  1OYX A;  1K9A A;  1K76 A;  4AG1 C;  1WDX A;  1ZSG A;  2DIQ A;  4ZTJ A;  5CKH A;  1FMK A;  4HT8 A;  2R58 A;  3FC3 A;  2OAU A;  1ZSZ C;  5I11 A;  2J7I A;  1G3W A;  2DFU A;  1AWO A;  3JCM J;  2XDP A;  1VQL T;  1D1A A;  2DK3 A;  4AFZ C;  4M77 D;  1MV3 A;  4FM4 B;  2EYZ A;  4MZP A;  1U8R A;  3RKW A;  5GAN 5;  2NUP B;  2RB6 A;  1RAH B;  5KYU A;  2COW A;  1GCQ C;  2EWN A;  1R77 A;  2RK1 A;  4M7D A;  5KYY B;  1OPL A;  1IO6 A;  1I4K 1;  5HKC A;  3CXC P;  2LQW A;  2CSQ A;  1ZQ1 A;  3DB3 A;  2EQK A;  3EG1 A;  2CP5 A;  2QAZ A;  2RJD A;  1SRL A;  1G3S A;  2V26 A;  2JTM A;  3CXC A;  2A36 A;  3VS6 A;  5GAN h;  4IUR A;  4JLI A;  2KGT A;  3HTR A;  2FVU A;  1VQ4 Q;  2DXB A;  2MPX C;  2PUK B;  5I21 A;  2E3H A;  3LGL A;  2V1R A;  4LDY A;  1LOJ A;  2W10 A;  4KUD K;  2RD1 A;  5EC7 A;  3RDV A;  4JZ3 A;  1ZLM A;  2MIO A;  1LCK A;  1RAC B;  4RTV A;  2HKN A;  1VYU A;  4ORZ A;  5IN1 A;  1KK7 A;  2E70 A;  1KD1 C;  2WSC E;  2LRQ A;  1Q81 C;  1LNX A;  3UAT A;  1HXD A;  5KE2 A;  4M7D G;  2DVJ A;  4HCZ A;  1W2B S;  4AFS C;  2OTL Q;  2KBT A;  3QXE B;  3JCM c;  4X9C A;  4CI0 C;  5FU6 C;  2EYW A;  1Y7X A;  4LUD A;  3VJP A;  1UGS B;  3ZEH A;  4BUG A;  2ABL A;  1KC8 C;  2GNC A;  2EQI A;  2BZX A;  4A4H A;  1E6G A;  1U1T A;  1AOJ A;  1N8R U;  5FRM A;  1V1C A;  3CPW A;  2B8A A;  3CCQ Q;  4M7D C;  1B3Q A;  3M54 A;  1PWT A;  2JMC A;  3BY7 A;  5FU7 C;  4JJN K;  3G1J A;  4IUT A;  4C5H A;  4A63 B;  2RQU A;  1SSH A;  2E5K A;  4J6X A;  1UGQ B;  2K57 A;  1YIJ Q;  3LW5 E;  1BIA A;  5GAN 2;  2FPF A;  4FYX B;  2DEU A;  2QTX A;  3RKX A;  1T0H A;  4A53 A;  2D9T A;  4LE9 A;  3HRU A;  1WA7 A;  1VOM A;  5GAN 4;  2JMA A;  2KY9 A;  3M0U A;  3QJ6 A;  5M9O A;  1K0X A;  3NPF A;  1I07 A;  1NLO C;  1Q86 U;  3M53 A;  2AZS A;  2P0Q A;  3JB9 G;  3EG0 A;  1VQ9 T;  1WXU A;  2CT3 A;  1CSK A;  2E6N A;  4M75 D;  2D0Q B;  4C8Q C;  2LNH B;  1YWO A;  4C92 C;  2D0N A;  2JS2 A;  4A4K A;  2DAQ A;  1RAA B;  2GQV A;  4OF1 A;  2VGN A;  2E1H A;  5LJ5 h;  3EHR A;  4ZN3 A;  1KQ1 A;  3UA7 A;  1MNE A;  4JUV A;  3JCM d;  1YIJ T;  1WXT A;  1ZHI A;  1ZA2 B;  2OAW A;  1K0S A;  5ECA A;  1EZZ B;  3MEW A;  4E7H A;  3REB B;  1U1S A;  3FJP A;  1JXO A;  5IT9 E;  4C0F A;  3VUZ A;  2ATC B;  3M58 A;  1SKU B;  5CR2 A;  1RAF B;  2KVQ G;  4KT0 E;  5DY9 A;  5LJ3 h;  4FSS A;  4OB2 B;  2JOY A;  2K2V A;  3C4S A;  3THK A;  3I55 T;  2EJF A;  3E2U A;  4JDS A;  2DXU A;  1YFN A;  1J3T A;  2GBQ A;  2DO3 A;  1KIK A;  4F7U B;  1S72 T;  4ANJ A;  2JZ2 A;  2FPD A;  2QTV A;  2DET A;  2CZ0 B;  4OGE A;  4FIB A;  3ASK A;  1KG1 A;  2Y4Y A;  1RL2 A;  2Z0W A;  2ZPH B;  1Z9Z A;  3MEA A;  2NLU A;  4PJO B;  2X4J A;  2Y4X A;  1OX8 A;  1K8A U;  2FRY A;  4M78 D;  1VQ9 A;  1PM3 A;  3E1S A;  1M1K U;  4PK4 A;  1AT1 B;  2RNA A;  4R55 A;  1WHG A;  1G8X A;  2RQT A;  3OMC A;  4M77 A;  4MDX A;  3LH0 A;  3G6E Q;  1BU1 A;  4RTU A;  4DOW A;  4E7L A;  1FYN A;  3GLX A;  1WQ7 A;  1TU0 B;  1K9M C;  1N27 A;  5J3B A;  3CC7 T;  3I5S A;  3MO8 A;  4BB7 A;  1R0C B;  4II1 A;  4E7J A;  1Q81 R;  1BIB A;  4BI4 A;  1IGQ A;  1M2O A;  3QUI A;  3CBM A;  3CCM T;  3CBO A;  3M0T A;  1Q82 U;  3EFO A;  1N5Z A;  2F1L A;  2EKO A;  2CP3 A;  2LX9 A;  1KC8 R;  3I55 A;  4OMP A;  2RHU A;  3SFM A;  4OMM A;  1TUC A;  1QCO A;  2ZGW A;  1YJN A;  3EH2 A;  1ZBX A;  3OB9 A;  5FU7 B;  1BCM A;  4B6M A;  3OMG A;  1S72 A;  3ZBD A;  3E19 A;  4M77 G;  1VIE A;  1OU9 A;  2XHC A;  2K9G A;  1YI2 T;  1M90 C;  1VQP Q;  5GAN 7;  1QVF P;  2EFI A;  4OB3 B;  4PL6 A;  2QQA A;  4CRI A;  1JQQ A;  3M59 A;  3QWX X;  1OV3 A;  1EX4 A;  3HL8 A;  4EMH A;  5A0G A;  3V8L A;  1QVF A;  3EG9 A;  2Y90 A;  1M30 A;  3RKY A;  4NL2 A;  2L5Q A;  1WIE A;  1H8K A;  1AWW A;  4KRT A;  3TU4 K;  3A8L B;  1QWF A;  5A0L A;  2XK0 A;  2A08 A;  1PRL C;  3SWN C;  3CCE T;  2LC4 A;  3GF5 A;  2JTE A;  2JM9 A;  3CCS T;  4C8Q B;  4IIO A;  3GNF B;  3CCM A;  1FMV A;  2YLC A;  2KR3 A;  2GQI A;  1VUB A;  4FYV B;  2JNG A;  3JCM X;  2CUD A;  4AFU C;  2ZPB B;  2MWP A;  1M2V A;  3OSV A;  3CC2 T;  3QPH A;  4ELZ C;  2RHX A;  1B34 A;  1XOV A;  2EPD A;  1M3B A;  5GAN e;  4M7D D;  3GIB A;  2X3W D;  1W1F A;  3OS5 A;  4HA8 A;  2EYX A;  3M9Q A;  2GF7 A;  3NFC A;  3CD6 T;  2FHD A;  2YSQ A;  2KMT A;  1YI2 A;  2PNI A;  1OUL A;  4F7U F;  5GAO l;  4QW2 A;  9ATC B;  2KE9 A;  3X20 B;  5GAO m;  2QYZ A;  1W70 A;  3WXM B;  4JS5 A;  3EGX B;  2YUO A;  2LCS A;  2ECZ A;  1KQS P;  2CKK A;  4LXC A;  4R0K A;  1UDL A;  4PLL A;  4PJO F;  1VQM Q;  3KUF A;  2KI7 A;  2DBM A;  4Q5W A;  5LL6 S;  3CCV Q;  1E7O A;  1W2B A;  1HD3 A;  3CCE A;  1D3B A;  4BY6 C;  1DJ7 B;  3N5B B;  1WHL A;  3M0Q A;  4QVC A;  1RLP C;  2E12 A;  4EMK B;  4E7I A;  2DL8 A;  4N4G A;  4C92 D;  2DVE A;  5IAY A;  3J80 E;  3EAE A;  4ME7 A;  2DYB A;  4PLI A;  1VQO T;  3CCJ Q;  2V1Q A;  1HYO A;  1OZ2 A;  2C06 A;  5L23 A;  1VQN Q;  2A28 A;  3QZ9 B;  3CC2 A;  4HXJ A;  3V7R A;  3CMA T;  3JB9 D;  1NJI C;  1WNL A;  2LT1 A;  4CC3 A;  3OYK A;  4LN2 A;  3O5Z A;  5GAN f;  2QEX Q;  3VRZ A;  3X25 B;  4MDW A;  4PJL A;  3L2R A;  1WYX A;  3VYG A;  2RI5 A;  4C5E A;  1VQM T;  2LCC A;  2YLB A;  3GBQ A;  3EFS A;  1WPY A;  1W4S A;  5KYX B;  2YRD A;  4JRK A;  1PKT A;  3UA6 A;  4HT9 A;  2ENM A;  2XG8 D;  2DNU A;  3PIP A;  4CC2 A;  1G83 A;  2DZ9 A;  2A0F B;  3CME Q;  1YJ9 A;  4M78 A;  2F2X A;  3MKD A;  1ACM B;  1I1J A;  4J9I A;  2EBP A;  4RTX A;  1ABO A;  2M0Y A;  3TCJ A;  2F2W A;  3BDL A;  1WJS A;  1TXQ A;  2J6F A;  1VQ8 T;  3A8M B;  2EIF A;  1UG1 A;  4L59 A;  4XTX A;  1JJ2 P;  1M90 R;  1Y96 A;  5LJ5 e;  1ZSZ A;  1OZ3 A;  2LT4 A;  2XDB A;  4DEX A;  1KSW A;  4OB1 B;  5KYW B;  4BAC A;  1FXX A;  1RLQ C;  2M02 A;  2KSS A;  5GAN 8;  1WLP B;  1PNJ A;  3OYL A;  3CCR A;  3M4G A;  2YUQ A;  3UPU A;  4C8Q F;  2DTH A;  5D7U A;  5LJ3 e;  1VQO A;  3OS0 A;  1ABQ A;  1Q95 G;  4RKU E;  2YUP A;  3HSB A;  3QG1 A;  3JCM h;  3PTA A;  3HRS A;  3OYB A;  2QGG A;  1AEY A;  1I0C A;  3CMA A;  3RBB B;  4M78 G;  5CQX A;  2BE9 B;  3HP9 A;  4FYW B;  2IPO B;  1X27 A;  4X34 A;  4LUE A;  1T0J A;  1GFC A;  1WHH A;  1BI0 A;  1UHC A;  3OBY A;  3I56 Q;  3KBG A;  3G4S Q;  2YUN A;  2HEQ A;  4BE0 A;  4A4G A;  3OQ5 A;  2FB7 A;  1ZUK A;  4MML A;  1VQ6 Q;  4OMF B;  3C12 A;  2QI2 A;  4JZ4 A;  1UHF A;  4L5G A;  2E4H A;  1QVF S;  1YP5 A;  4XU0 A;  3R6N A;  1VQ8 A;  1UJY A;  4J9C A;  1TH7 A;  2P0K A;  4DBQ A;  2L3Q A;  3C0C A;  1YHQ T;  5LJ5 f;  1M5Q 1;  3MP8 A;  2DX1 A;  2DZC A;  3MPU B;  4GBQ A;  1QP2 A;  2CZ7 B;  1CKA A;  2EQM A;  8AT1 B;  3VV0 A;  4PFZ A;  2O88 A;  1YBY A;  3JCM P;  1ZUY A;  4EMG A;  5LJ3 f;  1NEG A;  4BY6 B;  1MV0 B;  2QDY B;  2X9H A;  2RN8 A;  1QKX A;  3BW1 A;  4M7A E;  1U06 A;  1QVG P;  2NUT B;  1NEB A;  5KCH A;  2P84 A;  3L42 A;  4KGX B;  5GMK i;  1JRI A;  1PC0 A;  4C0G A;  4C0Z A;  1YJW Q;  3NMZ C;  1Q7Y U;  4KGZ B;  5HK3 A;  4XU3 A;  4A4E A;  4IUP A;  4L6V 5;  5GAM f;  4VUB A;  3C95 A;  1M8M A;  4PJO C;  3CPF A;  2CP6 A;  2RMO A;  3OYY A;  3FJ5 A;  1QCN A;  2RF0 A;  3OW2 P;  4HVU A;  1KFZ A;  3QHS A;  2CH4 A;  2P4R A;  1QVP A;  1AWX A;  4QQG A;  3REA B;  2L8D A;  2RO0 A;  1MMN A;  3MEU A;  5I22 A;  2O9V A;  2JM8 A;  4IUV A;  4BI8 B;  1PD1 A;  3OW2 A;  2HL5 C;  1G3T A;  1WZO A;  2E5Q A;  4C8Q A;  4LDU A;  4OP0 A;  3GP8 A;  1SF9 A;  1MMD A;  1KQS S;  2EYY A;  4C92 A;  1D0Y A;  1YN8 A;  2HD0 A;  1VQK Q;  3AHU A;  3EFR A;  3ZL7 C;  1YJW T;  1VQL A;  1QLY A;  3RES A;  4D8D A;  1BKB A;  2EVR A;  2HDA A;  4XK8 E;  4BE1 A;  1X6B A;  1C1A A;  4MZT A;  4KH0 B;  5AT1 B;  1VQ5 Q;  2HNI A;  4JRQ A;  4E7K A;  2PZ1 A;  3DLL A;  3HFO A;  4J83 A;  3G7Z A;  3MP1 A;  3VYH B;  1VQ4 T;  2COZ A;  1X01 A;  5FRO A;  5DM7 R;  2M1H A;  4C5G A;  2WSE E;  1B07 A;  5CAI A;  4M75 B;  1AZG B;  3NTK A;  2AKK A;  3DLM A;  2LJ0 A;  2MOX A;  2E6Z A;  3VS3 A;  3TVT A;  2CH4 W;  3OY9 A;  2C0O A;  5J26 A;  1N8R C;  1UFF A;  4QQD A;  3V8J A;  1R8O B;  5LJ5 g;  3M0P A;  5DLQ E;  4AG2 C;  3QJY A;  3JB9 I;  4C8Q G;  3EGX A;  2OTL T;  1H64 1;  2FG0 A;  2EW3 A;  4C92 G;  1VQK T;  3M57 A;  3ME9 A;  2CS7 A;  3D7S B;  2QQR A;  2AK5 A;  5C6S A;  2DXC A;  3URG A;  4RCB A;  3JCM b;  3FLG A;  3LX7 A;  3LLR A;  2CRE A;  3CCQ T;  4PJJ A;  2YT6 A;  2VC8 A;  3VS5 A;  4E7S A;  2ZPG B;  2HKQ B;  2X4Y A;  3EGU A;  4RG8 A;  1QQJ A;  4LD6 A;  4B9X A;  4Y91 A;  5GAM g;  1JJ2 S;  2O4X B;  2EYQ A;  4HVW A;  2A7Y A;  1D1C A;  2F2V A;  1BB9 A;  2X3X D;  3BFM A;  1MUZ A;  3CC4 Q;  2MYS A;  5CIU A;  4R56 A;  1H3H A;  2A37 A;  1GL5 A;  5D6X A;  5FW9 A;  3NTH A;  2OTJ Q;  2RI3 A;  3QZ5 B;  2HQX A;  4JPB W;  2O01 E;  4KH1 B;  3L2Q A;  4X9D A;  2YRC A;  2VV5 A;  1Y07 A;  4E2F B;  4XU2 A;  4O6J A;  2K3X A;  1QMC A;  2JN0 A;  2K4Y A;  2OTL A;  4HCB A;  3P8B B;  5CK9 A;  2KT1 A;  2DKG A;  1GRI A;  2R5M A;  2PVD B;  1TTH B;  4Z89 A;  4RTZ A;  1E6H A;  1BBZ A;  4F16 A;  2VXE A;  1UJ0 A;  2H3E B;  3UDC A;  2ROL A;  3BDU A;  2HAX A;  2DE0 X;  1D09 B;  2QAS A;  2V8I A;  2D1X A;  1UEB A;  2DL4 A;  2YHT A;  3CCQ A;  2CYZ B;  2RHZ A;  4EMK C;  4XTW A;  1SHF A;  3SWN A;  2XU8 A;  4BD3 A;  1K8A C;  4M7A C;  2QXF A;  1M1K C;  1YIJ A;  1SG5 A;  3JCM e;  3INZ A;  1KD1 R;  4CC4 B;  4HVV A;  3VS4 A;  1TS9 A;  4RUG A;  4HCK A;  2EQJ A;  1D0X A;  4M75 E;  5IXF A;  2DRM A;  2HSP A;  3FRN A;  5CKB A;  1K73 U;  4BDY A;  1RAD B;  1UGV A;  1QVG S;  3Q1J A;  1RAG B;  5GAN 3;  2DA9 A;  3EHQ A;  1ZBJ A;  1Q82 C;  2DRK A;  3E9F A;  1I81 A;  2OI3 A;  3JCM V;  5A2Q E;  1WHK A;  4FW1 A;  3G6E T;  1VYV A;  3VRY A;  3EG3 A;  4NL3 A;  4F14 A;  2G3R A;  5KYU B;  1N8R R;  3LYI A;  4DQ2 A;  5CO7 A;  4PJO D;  1P92 A;  4ZGE B;  2I0N A;  1M1G A;  2SRC A;  1VQ7 Q;  1NZ9 A;  2BZ8 A;  3JRZ A;  3OYM A;  3OW2 S;  2O31 A;  2ZPI B;  3H41 A;  2RHI A;  3M4Y A;  1FX7 A;  1SSF A;  3OYA A;  3A8O B;  3PE0 A;  1WQW A;  2NUP A;  1UUE A;  4FW2 A;  5I2S A;  1RAI B;  2K7A A;  2DTO A;  5KYY A;  1K4U S;  2IIM A;  3CC7 A;  3CCL Q;  3QDF A;  1PSF A;  1TSF A;  3M0R A;  2NUT A;  3CCU Q;  4RTW A;  4E7Z A;  1OPK A;  2DL7 A;  2VWF A;  3SDZ A;  3G71 Q;  4M78 E;  1OX9 A;  4IUQ A;  1RAE B;  1T3S A;  2DPP B;  1O9S A;  3PGG A;  3H0H A;  1VQP T;  3P8H A;  1UGP B;  1YJ9 Q;  1D1B A;  2KQW A;  2YWW A;  1GCP A;  4QT7 A;  2RM4 A;  2LMJ A;  1UGR B;  2GGR A;  3G6E A;  2CZ1 B;  2HL3 A;  1R0B G;  1YIT Q;  2JS0 A;  4RTY A;  5KH6 A;  1C6V X;  2PTK A;  3TSW A;  2PVG B;  2EKH A;  2QA4 Q;  3CCU T;  4KUI A;  2FO0 A;  2HCK A;  1I5L A;  2KRS A;  3CCR Q;  3A98 A;  3QYH B;  3HKS A;  5GJV B;  1WHJ A;  1KQS A;  1WXB A;  4C0D B;  2VVK A;  1X2K A;  3HHT B;  2QG9 B;  3L1A A;  3TEE A;  4C8Q D;  5GAO q;  2J05 A;  3CCS A;  1M9S A;  4IIM A;  3EGD B;  4J9D A;  5CKE A;  2ED1 A;  1VYT A;  5GJW B;  1IB8 A;  3OSS C;  3SEM A;  4M7A B;  4JJC A;  3FDR A;  2BE7 D;  1K9M R;  5CVI A;  1K8A R;  2O2O A;  4QQ6 A;  4EPC A;  4RTT A;  1VIF A;  2E65 A;  8ATC B;  4OMN A;  4DBF A;  2KYM A;  4J9B A;  4GLK A;  4RG2 A;  3ULR B;  2NUZ A;  3OYD A;  3CD6 A;  1IXD A;  3CCV T;  1SHG A;  4LD9 K;  2HQH A;  1PHT A;  1NYF A;  3SHW A;  3OYH A;  3RUX A;  2HBW A;  3V7C A;  4JLG A;  1JEG A;  2D8J A;  4J6Y A;  3NHN A;  3VS1 A;  4M7D E;  3QO3 A;  3C94 A;  3PIO A;  3ER0 A;  1Q82 R;  2RPN A;  2K5L A;  1OOT A;  5GAM d;  3I5R A;  1BI2 A;  3JV3 A;  3MET A;  2QK0 A;  4LDX A;  3CCJ T;  1NE8 A;  2DL5 A;  3A8G B;  2MAM A;  2EQU A;  3U23 A;  2DMO A;  1VQN T;  1TWB A;  2EJG A;  2VXF A;  2LVM A;  2EGC A;  1XNI A;  1UTI A;  5D6Y A;  2QEX T;  2E64 A;  4BI3 A;  1JJ2 A;  4IUU A;  4M75 C;  4GLM A;  3S3O A;  1H92 A;  2MMP A;  1V76 A;  4MMK A;  1X75 C;  2PVO B;  3QSU A;  3TQ7 P;  2LQ8 A;  1GBR A;  2P0P A;  1G5V A;  4J9F A;  5I2M A;  2DJQ A;  3CME T;  1OU8 A;  1LJO A;  2ESW A;  1JB0 E;  3OYI A;  4F7U A;  2H3J A;  5HY6 A;  2I2L A;  5IH2 A;  1RI9 A;  1LPL A;  4M77 B;  3OS1 A;  2F5T X;  1VQM A;  2QQS A;  4C92 E;  2GFU A;  2LZ6 B;  2YDL A;  4XU1 A;  3CCV A;  2BUD A;  5CKD A;  2LQK A;  2J06 A;  1MMA A;  4PJO A;  1S1N A;  2LP5 A;  4J9H A;  3VS7 A;  4Y92 A;  3A5Z B;  1VQL Q;  4KUL A;  3EFO B;  2BKD N;  2VYT A;  1Y0M A;  3UF4 A;  3CCJ A;  1IRE B;  3M56 A;  4IKF A;  4JJD A;  1VQN A;  3H8Z A;  3HRT A;  5KE3 A;  3KFV A;  3L2Z A;  1XQH A;  5GAN g;  1M3A A;  1N9R A;  2EGE A;  2BIV A;  4WTO B;  2L3P A;  2QEX A;  4F7U G;  3VS2 A;  4Z88 A;  3JSC A;  2XMF A;  3OYE A;  2CP2 A;  2A3L A;  2KXD A;  2ROT A;  3I56 T;  1XTD A;  3G4S T;  1GBQ A;  1W6X A;  4MZM A;  2X51 A;  1ZA1 B;  4PJO G;  3CME A;  1KQ2 A;  3H9N A;  2LJ3 A;  2YXY A;  1VQ6 T;  2HMA A;  4M7A F;  3EG9 B;  2EJ9 A;  4FT2 A;  2LCL A;  4XAX B;  3OS2 A;  2DXT A;  2X4W A;  4OMQ A;  1QVG A;  2LDM A;  4E6R A;  3CBP A;  2HSE B;  1JO8 A;  4N0A C;  3L2V A;  1AZE A;  3M55 A;  1NJI R;  1U3O A;  3R6O A;  1Q7Y C;  1OEB A;  4ZN1 A;  4LDV A;  3SB2 A;  3RER A;  3H6Z A;  3JB9 H;  1M2V B;  1NLP C;  4HCC A;  1RUW A;  2VB6 A;  3LWH A;  5KYN A;  1B34 B;  1G3Y A;  4YTL A;  4D8K A;  1KD1 U;  3QWY A;  2CSI A;  1YHQ A;  1Q81 U;  3M5A A;  1IRX A;  1LVK A;  2RJE A;  4JJB A;  3JCM W;  1OI1 A;  4PNO A;  4EIK A;  2J6K A;  2LX7 A; 
#chains in the Genus database with same CATH homology
 3QPH A;  2K3Y A;  4ELZ C;  1M8V A;  2RHX A;  1B34 A;  2ZPE B;  1XOV A;  2VXE A;  5GAN e;  4M7D D;  3ZFJ A;  2R57 A;  3GIB A;  3RIR A;  2L89 A;  3UDC A;  4FL6 A;  2HAX A;  3BDU A;  4A54 A;  4C8Q E;  3I56 A;  1KC8 U;  3J7A F;  3OS5 A;  3G4S A;  2RHY A;  3QKJ A;  2V8I A;  1UEB A;  2YHT A;  4HA8 A;  2L3R A;  4XTV A;  5FLX E;  3M9Q A;  3CCQ A;  2GF7 A;  3NFC A;  4N4I A;  1I8F A;  3SWN B;  3CD6 T;  4C92 F;  2K5F A;  1Y71 A;  2CYZ B;  2RHZ A;  3S3M A;  1KHI A;  3JB9 J;  1IZ6 A;  2FHD A;  2KDS A;  3TRE A;  4EMK C;  2GFA A;  2KMT A;  1VQM A;  1YI2 A;  3O8V A;  4XTW A;  3V7S A;  5GAN 6;  1VQ6 A;  4F7U F;  4N0A A;  5LJ3 j;  5GAO l;  1BI1 A;  3FEO A;  4QW2 A;  4NOY A;  3X20 B;  1NPP A;  2XU8 A;  3SWN A;  4BD3 A;  2MF2 A;  5GAO m;  3MEV A;  3S3N A;  3OBW A;  1K8A C;  4M7A C;  3DB4 A;  2QXF A;  3WXM B;  4JS5 A;  1M1K C;  2MWO A;  3JB9 F;  1YIJ A;  1QP3 A;  3JCM e;  3INZ A;  3PT9 A;  4M77 E;  2CKK A;  2D6F A;  5GAM e;  5DLO A;  4QVZ A;  4M77 F;  4PLL A;  2PQW A;  4PJO F;  1D3B B;  3LGF A;  3KUF A;  1KHC A;  2M0O A;  2P4T A;  1K8A U;  5GAM j;  2EQJ A;  4Q5W A;  5LL6 S;  5GAO p;  1V29 B;  4M75 E;  1W2B A;  1GXI E;  3CCE A;  2KK4 A;  1D3B A;  4M78 C;  2X35 A;  4BY6 C;  1DJ7 B;  3FRN A;  3N5B B;  2JUF A;  4ZTF A;  5CKB A;  4QVC A;  4RMO A;  1K73 U;  2DEQ A;  2E12 A;  5LJ3 g;  4BDY A;  1WJQ A;  4FT4 A;  5AYF A;  1VQ5 T;  4J7F A;  4EMK B;  4E7I A;  4J5Y A;  3PMI A;  4N4G A;  1QVG S;  3Q1J A;  4C92 D;  4BE2 A;  2FYK A;  3FB9 A;  2DVE A;  4XQ3 A;  5IAY A;  5GAN 3;  2YRV A;  4TVR A;  3J80 E;  1Q82 C;  1OYX A;  3EAE A;  3UT1 A;  3E9F A;  4ME7 A;  1N6A A;  1I81 A;  2DIQ A;  4ZTJ A;  5CKH A;  4HT8 A;  4PLI A;  3JCM V;  1VQO T;  2RJF A;  2R58 A;  4EMK A;  5A2Q E;  3FC3 A;  2OAU A;  3X28 B;  4N4H A;  1OZ2 A;  3G6E T;  2C06 A;  3QZ9 B;  2F69 A;  2XKO C;  3CC2 A;  1G3W A;  2F5K A;  3V7R A;  4NL3 A;  3CMA T;  3JB9 D;  2G3R A;  1NJI C;  1WNL A;  2LT1 A;  1YJW A;  3JCM J;  2XDP A;  3OYK A;  1VQL T;  2DK3 A;  3LYI A;  4DQ2 A;  5GAN f;  1Q86 C;  5CO7 A;  4M7A A;  4M77 D;  4PJO D;  1P92 A;  3X25 B;  4FM4 B;  4MDW A;  4ZGE B;  1M1G A;  4MZP A;  4Y28 E;  4ZGD B;  3L2R A;  1U8R A;  4V2S A;  3RKW A;  3VYG A;  5GAN 5;  2RI5 A;  1NZ9 A;  3JRZ A;  4C5E A;  3A8H B;  3OYM A;  2RB6 A;  3OW2 S;  4DA4 A;  1VQM T;  2LCC A;  2YLB A;  2ZPI B;  3EFS A;  3MHX A;  1VQ4 A;  1WPY A;  2EWN A;  2RHI A;  4M78 B;  3M4Y A;  1W4S A;  2K5I A;  1FX7 A;  1SSF A;  2RK1 A;  3OYA A;  4M7D A;  4JRK A;  1M1F A;  4HT9 A;  2LNV A;  2XG8 D;  3A8O B;  1I4K 1;  5HKC A;  3PIP A;  1WQW A;  2PUO B;  2DZ9 A;  4O5V A;  5I2S A;  2HQE A;  1YJ9 A;  1ZQ1 A;  4M78 A;  3DB3 A;  4DOV A;  2EQK A;  2DTO A;  1BI3 A;  2AHJ B;  2RJD A;  3CC7 A;  1G3S A;  2JTM A;  4FSX A;  1Y96 B;  3CXC A;  1PSF A;  4RCC A;  3TCJ A;  4JRP A;  3BDL A;  1WJS A;  3SDZ A;  1VQ8 T;  4EDU A;  5GAN h;  3RMS A;  3A8M B;  4IUR A;  2EIF A;  4JLI A;  4L59 A;  4M78 E;  4XTX A;  4IUQ A;  2FVU A;  2IG0 A;  2DPP B;  1O9S A;  2DXB A;  1Y96 A;  2PUK B;  3PGG A;  5I21 A;  5LJ5 e;  1OZ3 A;  2LT4 A;  2XDB A;  1VQK A;  3LGL A;  1VQP T;  3F70 A;  3X26 B;  3P8H A;  2XD0 A;  4LDY A;  1LOJ A;  4OB1 B;  3PFS A;  4KUD K;  1UGP B;  1FXX A;  1N9S A;  2RD1 A;  4BAC A;  2XI9 A;  5EG2 A;  1VQ5 A;  2KSS A;  4M7A G;  5GMK e;  5GAN 8;  3CC4 T;  3OYL A;  3CCR A;  4C0D C;  3M4G A;  2KQW A;  1YJN T;  3J81 E;  3UPU A;  5IN1 A;  2E70 A;  1M4Z A;  1KD1 C;  2RM4 A;  2WSC E;  4C8Q F;  2DTH A;  2LRQ A;  1LNX A;  5GMK j;  5LJ3 e;  5GAO r;  1VQO A;  1Q81 C;  1HXD A;  5KE2 A;  4M7D G;  1UGR B;  3VU3 C;  3OS0 A;  2JVV A;  3GNG A;  4RKU E;  3G6E A;  2CZ1 B;  3HSB A;  3QG1 A;  4HCZ A;  1W2B S;  2OTJ T;  3JCM h;  3PTA A;  3HRS A;  3QXE B;  3OYB A;  3JCM c;  4X9C A;  5GAM h;  4CI0 C;  5FU6 C;  5KH6 A;  3CMA A;  1Y7X A;  4M78 G;  5CQX A;  1VQ9 A;  3L2W A;  3VJP A;  1UGS B;  2PVG B;  3ZEH A;  3QDR B;  4BUG A;  3HP9 A;  1KC8 C;  3CCU T;  1HK9 A;  4A4H A;  4KUI A;  1K9M U;  1U1T A;  4X34 A;  3PNW C;  1I5L A;  4KBM B;  1N8R U;  4OVA A;  2WSF E;  5FRM A;  3OYG A;  1BI0 A;  3OBY A;  3KBG A;  3QYH B;  3CPW A;  3HKS A;  3WVE B;  1BYM A;  1H3Z A;  2B8A A;  4M7D C;  5GAO n;  2E10 A;  3M54 A;  3CC2 T;  2RJC A;  4BE0 A;  5FU7 C;  3BY7 A;  1KQS A;  2JTF A;  4A4G A;  3OQ5 A;  4C0D B;  2FB7 A;  4R55 A;  4MML A;  4JJN K;  4M75 F;  4OMF B;  3C12 A;  2QI2 A;  3FIF A;  4IUT A;  1JBM A;  2FL7 A;  3HHT B;  4JRI A;  3T9N A;  3L1A A;  4C5H A;  3TEE A;  4C8Q D;  5GAO q;  4QVD A;  4L5G A;  3CCS A;  4J6X A;  1M9S A;  4BDZ A;  1MHN A;  1QVF S;  4XU0 A;  1UGQ B;  2WAC A;  1VQ8 A;  2K57 A;  5FU6 B;  5J39 A;  4PJO B;  3LW5 E;  5CKE A;  1TH7 A;  2P0K A;  1BIA A;  4LDW A;  4Z02 A;  5GAN 2;  2QTX A;  3OSS C;  3RKX A;  1YHQ T;  5CCA A;  5LJ5 f;  4M7A B;  2RI2 A;  4FU6 A;  4A53 A;  2X4X A;  2D9T A;  4E47 A;  1M5Q 1;  3HRU A;  3FDR A;  1K73 C;  2CZ6 B;  3MP8 A;  4XTZ A;  5CVI A;  4QQ6 A;  4EPC A;  2DZC A;  5HK0 A;  1M90 U;  5GAN d;  5GAN 4;  1VIF A;  2GCX A;  3CC4 A;  2KY9 A;  2E65 A;  3CXC S;  1QP2 A;  3QJ6 A;  2CZ7 B;  5M9O A;  4M7D B;  3RMQ A;  1Q86 U;  3M53 A;  2EQM A;  4GLK A;  4RG2 A;  2RH2 A;  2P0Q A;  3VV0 A;  3JB9 G;  1VQ9 T;  1YBY A;  3OYD A;  3JCM P;  3CD6 A;  3MCA B;  4EMG A;  5LJ3 f;  4BY6 B;  2OTJ A;  2QDY B;  4C5I A;  3GOX A;  2E6N A;  4M75 D;  2D0Q B;  4C8Q C;  3CCV T;  4LD9 K;  3BW1 A;  4M7A E;  4C92 C;  4A4K A;  2DAQ A;  5KCO A;  5KCH A;  3OYH A;  3RUX A;  3NTI A;  2GQV A;  4OF1 A;  3V7C A;  2VGN A;  3L42 A;  3L2U A;  4JLG A;  2E1H A;  5LJ5 h;  4ZN3 A;  1KQ1 A;  4J6Y A;  5GMK i;  1JRI A;  4WF2 A;  5GAN j;  4C0G A;  4C0Z A;  2XID A;  4M7D E;  3QO3 A;  3C94 A;  3PIO A;  4JUV A;  3ER0 A;  3JCM d;  1Q7Y U;  1YIJ T;  1ZHI A;  2K5L A;  5GAM d;  3V8K A;  1BI2 A;  4XU3 A;  5HK3 A;  3JCM f;  4A4E A;  4IUP A;  3MET A;  1MGQ A;  1EIF A;  4L6V 5;  3OYJ A;  5GAM f;  4LDX A;  4J6W A;  3MEW A;  3CCJ T;  4E7H A;  1NE8 A;  3A8G B;  4VUB A;  1U1S A;  2MAM A;  3FJP A;  2EQU A;  3C95 A;  5C0M A;  4C0F A;  3VUZ A;  5IT9 E;  1VQN T;  4M78 F;  3M58 A;  4OGC A;  4M77 C;  4PJO C;  5CR2 A;  2EJG A;  2VXF A;  4D6W A;  3CPF A;  4B9W A;  2KVQ G;  2LVM A;  4KT0 E;  5DY9 A;  3OYY A;  5LJ3 h;  4A4F A;  1XNI A;  1RI0 A;  5D6Y A;  3QHS A;  4OB2 B;  2QEX T;  2JOY A;  1QVP A;  2E64 A;  2K2V A;  4QQG A;  4BI3 A;  3C4S A;  4P5N A;  4IUU A;  2MI6 A;  3I55 T;  1JJ2 A;  2L8D A;  2EJF A;  4M75 C;  2RO0 A;  3MEU A;  1VQ7 T;  4JDS A;  1O75 A;  4IUV A;  2DXU A;  3S3O A;  4BI8 B;  2MMP A;  3OYN A;  4MMK A;  1X75 C;  4C92 B;  2PVO B;  3OW2 A;  3QSU A;  2LQ8 A;  2P0P A;  1G5V A;  3CPW S;  1G3T A;  2DO3 A;  5I2M A;  3OA6 A;  2DTI A;  4F7U B;  1S72 T;  2ZCF B;  2E5Q A;  4C8Q A;  2E41 A;  4LDU A;  4OP0 A;  3GP8 A;  1FWZ A;  1KQS S;  2JZ2 A;  3CME T;  4C92 A;  4XTY A;  1LJO A;  2HD0 A;  2CZ0 B;  3AHU A;  4OGE A;  3EFR A;  4FIB A;  1JB0 E;  3ASK A;  1KG1 A;  3OYI A;  4F7U A;  1YJW T;  2H3J A;  1VQL A;  5HY6 A;  3RES A;  2Y4Y A;  3CCL T;  2I2L A;  1BKB A;  4XK8 E;  4ZGJ B;  4BE1 A;  1RL2 A;  2LTO A;  4MZT A;  2ZPH B;  3MEA A;  2NLU A;  4M77 B;  3OS1 A;  2HNI A;  2X4J A;  2F5T X;  2Y4X A;  5GMK l;  3G71 T;  4JRQ A;  2QQS A;  4C92 E;  4E7K A;  4M78 D;  3DLL A;  1X6O A;  3PMT A;  2GFU A;  1QW1 A;  3HFO A;  4J83 A;  3E1S A;  1M1K U;  3G7Z A;  3MP1 A;  3VYH B;  1VQ4 T;  5GMK m;  4XU1 A;  3X24 B;  1X01 A;  2BUD A;  5FRO A;  4F7U E;  5CKD A;  2M1H A;  4C5G A;  2V8J A;  2LQK A;  4OB0 B;  2WSE E;  5DM7 R;  3QII A;  5CAI A;  3OMC A;  4MDX A;  4M77 A;  4PJO A;  4M75 B;  3NTK A;  1WJR A;  3E9G A;  3LH0 A;  3DLM A;  5A0D A;  2VUB A;  3HPW A;  4DOW A;  2E6Z A;  4E7L A;  3GLX A;  1YJ9 T;  1WQ7 A;  2DIG A;  3SD4 A;  3OY9 A;  1K9M C;  1N27 A;  5J3B A;  5J26 A;  2RA2 A;  1N8R C;  3A5Z B;  4M75 A;  4QQD A;  3MO8 A;  2DD4 A;  4KUL A;  3V8J A;  3CC7 T;  1R8O B;  2BKD N;  2VYT A;  5LJ5 g;  5DLQ E;  4BB7 A;  4PJO E;  4II1 A;  4E7J A;  3VUB A;  1BIB A;  4BI4 A;  5L8R E;  3CCJ A;  3QUI A;  3KXT A;  3CCL A;  1IRE B;  3CBM A;  3M56 A;  3CCM T;  4IKF A;  4ATO A;  3QJY A;  3CBO A;  1YCY A;  1NPR A;  2XIC A;  4ELY C;  3HFN A;  3H8Z A;  3HRT A;  4C8Q G;  3JB9 I;  5KE3 A;  5LJ5 d;  3GPL A;  1H64 1;  3L2Z A;  4XTU A;  1XQH A;  5GAN g;  1Q82 U;  2OTL T;  1YIT T;  2XDD A;  1VQP A;  1N9R A;  3P8D A;  2EKO A;  4C92 G;  3M57 A;  3ME9 A;  1VQK T;  1UB4 A;  2CS7 A;  1VQN A;  2QQR A;  2LX9 A;  2BIV A;  1WGS A;  2QQB A;  2QEX A;  4HKE A;  4F7U G;  2DJZ A;  4UC4 A;  3CEY A;  2QA4 T;  5C6S A;  4NS5 A;  3I55 A;  3JSC A;  1VQ7 A;  2DXC A;  2RHU A;  3SFM A;  1NJI U;  2IVW A;  2M16 A;  3URG A;  1AHJ B;  3OYE A;  4RCB A;  2ZGW A;  2A3L A;  1YJN A;  5CQY A;  3CCR T;  1ZBX A;  3OB9 A;  3I56 T;  1XTD A;  4GY5 A;  3JCM b;  3G4S T;  3FLG A;  3JAM E;  5FU7 B;  5LJ3 d;  3LX7 A;  3OMG A;  1S72 A;  3LLR A;  2ZZD A;  3ZBD A;  3E19 A;  2PU9 B;  5FRN A;  3CCQ T;  4MZM A;  2VC8 A;  2ZPG B;  1PSE A;  1VIE A;  4M77 G;  4PJO G;  2X4Y A;  2CGH A;  2XHC A;  3CME A;  1KQ2 A;  2HBP A;  3QYG B;  1YI2 T;  3VKI A;  1M90 C;  1VQ6 T;  3MP6 A;  5GAN 7;  4RG8 A;  3JCM g;  4M7A F;  4LD6 A;  3LWI A;  4B9X A;  2EFI A;  4OB3 B;  4Y91 A;  2EJ9 A;  4PL6 A;  2O4X B;  2EYQ A;  5GAM g;  4FT2 A;  2QQA A;  1JJ2 S;  3CCU A;  2A7Y A;  4CRI A;  4M75 G;  3M59 A;  2LCL A;  4XAX B;  2VGM A;  3OS2 A;  3HL8 A;  2DXT A;  3BFM A;  3OYF A;  2M9U A;  2X4W A;  2R5A A;  3G71 A;  5D6W A;  4EMH A;  5A0G A;  3V8L A;  4JS4 A;  1QVG A;  1QVF A;  2QQ9 A;  5CIU A;  2KAF A;  4J8O A;  4M7D F;  4R56 A;  2Y90 A;  2O4X A;  2LDM A;  4J7I A;  3RKY A;  3CBP A;  5GMK h;  4NL2 A;  2L5Q A;  5D6X A;  3TU4 K;  3NTH A;  4N0A C;  3A8L B;  2RI3 A;  3WVD B;  3L2V A;  3M55 A;  3QZ5 B;  2XK0 A;  2ZPF B;  5A0L A;  5CKF A;  2HQX A;  2O01 E;  3SWN C;  3L2Q A;  3CCE T;  4X9D A;  3R6O A;  1Q7Y C;  2LC4 A;  2VV5 A;  3GF5 A;  3JCM Q;  1Y07 A;  3S6W A;  2EAY A;  4ZN1 A;  4XU2 A;  4C8Q B;  3CCS T;  3DKM A;  2K3X A;  4LDV A;  4O6J A;  3SB2 A;  3RER A;  3H6Z A;  3JB9 H;  3GNF B;  3CCM A;  2RK2 A;  2YLC A;  3OYC A;  4HCC A;  4PKC C;  2JN0 A;  2K4Y A;  1VUB A;  2OTL A;  3LWH A;  3P8B B;  4HCB A;  2JNG A;  1B34 B;  1G3Y A;  4YTL A;  3JCM X;  1YIT A;  2DD5 A;  1YHQ A;  1KD1 U;  4M7A D;  3QBY A;  5CK9 A;  1Q81 U;  2V8K A;  3CCV A;  2DKG A;  2ZPB B;  2MWP A;  3M5A A;  2RJE A;  2R5M A;  3JCM W;  1OI1 A;  4PNO A;  2QA4 A;  3OSV A;  2PVD B;  5LJ5 j;  3UWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...