4F7UF

The 6s snrnp assembly intermediate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 15
structure length 73
sequence length 73
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uF00
4EMKB 3L1AA 4A54A 4M75C 4M78D 4M7AB 4PJOF 1BIAA 1KQ2A 1MGQA 2HNIA 4X9DA 4C92D 5GMKl 3QUIA 3RERA 1BIBA 1D3BA 3BFMA 3EFSA 4M78G 5LJ3h 4C92G 4M75D 5GAOm 2DXUA 3PGGA 4M7AF 5LJ3d 5GAOq 4F7UA 5GANe 4NOYA 4M75G 4XU1A 5GAN8 5LJ5h 1JRIA 1LJOA 3V8LA 4EMGA 2EWNA 5LJ5d 4M77E 2E1HA 2DZCA 4N0AA 4PJOA 4M77B 4X9CA 3BW1A 4MMLA 1U1SA 1I8FA 1I81A 3RUXA 5GAOp 5GMKm 2VXEA 4M7DC 4M77F 5GAN5 4M7AE 4J6WA 3M4GA 4JLIA 5LJ3e 3JCMW 4XTVA 3RKWA 3JCMh 1WPYA 5GANj 5GAMh 1JBMA 3JCMV 4C8QC 3JB9F 1WQ7A 2E64A 3JCMd 4M7DD 5GAMd 5DY9A 2CGHA 3JCMP 1HK9A 4PNOA 5LJ5e 4M78B 2YLCA 1KQ1A 1N9RA 4XU0A 3RIRA 4JRIA 4M7DG 1B34B 1Y96B 4XU3A 4C8QD 4C92B 4QVCA 4NL3A 3JCMb 2YHTA 4M75E 1YCYA 4J6XA 4C8QG 4M75B 3QHSA 3RKXA 2E10A 4M78F 3SWNA 3V8KA 4DQ2A 4M77A 3AHUA 4C92F 2I2LA 2ZGWA 3FB9A 2VC8A 2DTIA 4XTWA 5GAN6 2EJGA 4J5YA 5GANg 3JB9I 3JCMX 3QSUA 4M75F 5LJ3j 5GMKh 4HT9A 4JRKA 4EMKA 4OP0A 3VU3C 5GANf 1WQWA 2FYKA 5GAN7 3BY7A 2DTOA 5GAMe 4M7AA 3QO3A 3SWNC 3V7CA 3V7RA 3BDUA 1I5LA 1TH7A 2Y90A 4J6YA 5LJ5j 2DTHA 1D3BB 3EFRA 3RESA 2JN0A 4N0AC 4RCBA 4F7UG 5GAN4 4PJOC 4HA8A 4MMKA 4M78A 1HXDA 4NL2A 5GAOn 4M78E 1B34A 4C92A 4EMKC 1M5Q1 4C92E 3L2ZA 4XQ3A 4JUVA 5LJ3g 3HFNA 4M7AC 4M7DE 2EAYA 1LNXA 2RD1A 4M75A 4M7DB 2DEQA 2RB6A 4PJOG 5LJ3f 5GAN2 4C8QE 4XU2A 4M7AD 1I4K1 4XTYA 2FB7A 4C8QB 5GMKe 5LJ5g 1LOJA 4M7DF 5GAMj 2E41A 4M7AG 3JB9J 2DZ9A 1X01A 5LJ5f 3SB2A 4V2SA 3JCMe 4C8QF 3FJPA 2EJ9A 2E65A 5I21A 5GAOr 4M77C 2QTXA 1N9SA 1U1TA 2RA2A 4PJOD 4F7UE 3JB9H 3JCMg 4EMHA 2VXFA 4M77D 1Y96A 3V7SA 4F7UB 2RM4A 4Y91A 5GMKi 2DKGA 5GAMg 5GAN3 5GANh 5GAOl 4M7DA 4A53A 4M77G 2YLBA 5GMKj 3FIFA 3INZA 2DXTA 3RKYA 1WNLA 3JCMf 5GANd 3JB9D 3V8JA 3SWNB 5GAMf 4XTUA 4F7UF 3JCMQ 1M8VA 4XTXA 2K57A 4C8QA 4QVDA 3JCMc 4PJOE 3JB9G 4HT8A 2DJZA 3HSBA 3HFOA 4M78C 1H641 4RCCA 4WF2A 4XTZA 3JCMJ 4PJOB 4C92C 2DVEA 5CAIA 2EJFA 3GIBA
chains in the Genus database with same CATH superfamily
1K73R 3O8VA 4M7AB 2LJ0A 1K8AR 5A0DA 1VQ9A 4M75D 2K4YA 2BKDN 2PZ1A 4HXJA 3WVEB 2RHYA 3CPFA 2CP2A 3LGLA 4QQ6A 2X9HA 2MI6A 2J7IA 3G71A 3JCMh 4II1A 4HKEA 1VQ9Q 3C4SA 2FPDA 3OS5A 4PJOD 4C92B 2HDAA 4LDUA 2MOXA 3A8MB 4KUIA 2YSQA 3X28B 1SRMA 3FB9A 4AG2C 4M75F 2FVUA 3HHTB 4BDYA 1WQWA 4J9EA 1UGVA 2C0IA 4B9XA 3G71Q 5FWCA 1M8MA 2J6KA 1QVGP 3FRNA 5L8RE 5EC7A 4RCBA 4M78A 3Q1JA 1ZA2B 2DVJA 1VQKQ 4J9FA 5I2SA 5LJ3g 1SKUB 1TUDA 1OI1A 5LJ3f 4R56A 1YBYA 1Y7XA 2K9GA 2QDYB 1IZ6A 4A63B 1IXDA 2K3XA 2B86A 4J9IA 1JEGA 1PCXA 4EMHA 4F7UB 1EZZB 2K3YA 3A8GB 4Z88A 2VUBA 2WSCE 3M0UA 2P0QA 4JRPA 5GANd 1X2KA 2DBMA 4XTUA 1M90U 3CC7T 2GQIA 2P4TA 4XTZA 1KD1U 4GY5A 1PM3A 1H3HA 2PTKA 5KYYA 3EG2A 5KCHA 4ZGEB 3PVLA 1SEMA 2DXUA 5KE2A 4FT4A 2L0AA 2ZPBB 5AYFA 5L23A 1X69A 1CSKA 2F69A 4PK4A 3R6NA 2DZCA 2LCSA 4X9CA 5I2MA 2MF2A 2RJEA 3LWIA 1OU9A 2YWWA 2W10A 1G83A 2KR3A 3X24B 1M2OA 1AWOA 3DLLA 3A8LB 2VYTA 3S6WA 3I56T 1FWZA 2ED0A 2YLCA 4XU0A 1YJ9T 1VQPT 1YCYA 1UHCA 2LTOA 4N4IA 2DL5A 4F17A 2DE0X 2JZ2A 4MZPA 4IKFA 4J9CA 1K1ZA 5CK9A 3CCSA 1Q86C 2EQUA 4E6RA 1AOJA 3QDFA 5IT9E 2KDSA 1JJ2A 1WHMA 3UWNA 1QP3A 4OMOA 4KBMB 4OMQA 3GP8A 1UGSB 3HFNA 3L2UA 2PNIA 5IXFA 3CCSQ 3OYGA 4EPCA 3E19A 3JRZA 1UEBA 2F2XA 1FMKA 2JJ9A 4OB2B 2EFIA 1BBZA 1MNDA 2GTJA 1ZQ1A 5FU7C 2DKGA 2O4XA 4M7DA 5C0MA 1YHQA 2BZXA 1M90R 2E4HA 2IPOB 4OMLA 4XTXA 3JB9G 1M1FA 4HT8A 2D8HA 1KD1R 2VASA 1GCQC 4EIKA 4J9DA 1T3LA 4E7SA 5CO7A 4GLKA 1WHGA 3UT1A 2CP5A 3QUIA 5A2QE 5LJ3h 3EG9B 5GAOm 1JO8A 1FMWA 4E2FB 3PIOA 1K9AA 2LP5A 1VQ5A 2ENMA 1YHQQ 1RACB 1JU5C 2P84A 2E1HA 1PNJA 3CBMA 4MDWA 1BK2A 4E7IA 1NBEB 2VB6A 2DJQA 3G4ST 1WZOA 5GAN5 1W6XA 4JLIA 4KH0B 3LGFA 4C8QC 2JM8A 4RTWA 1VQ5Q 4M78B 1A0NB 5CKHA 2BZYA 2ECZA 1QCNA 1E6GA 1KG1A 4PJJA 4BY6C 4Y92A 2RJFA 1QVFA 1SHFA 3QKJA 3VJPA 4XK8E 4OP0A 2R58A 2E6ZA 2V8JA 2B8AA 2CSIA 3DB3A 5IAYA 2Y90A 1M27C 3PFSA 1NLPC 3DKMA 2FZCB 2L3SA 2VGNA 3PNWC 1KHIA 2HCKA 4DBHA 1Q95G 1LOJA 2LJ1A 4JDSA 5GAMj 1VQNA 4J9BA 1NPPA 2MWPA 2HMAA 5I21A 2RQWA 4M77C 4PFZA 1B07A 4XAXB 5KYYB 2FL7A 3M0RA 2VXFA 1Y96A 3M0SA 5GAOl 2AK5A 3N5BB 1UECA 3CCRT 3JB9D 3CXCP 1V1CA 1K76A 3M9QA 2MMPA 4QVDA 4FU6A 2BUDA 1LCKA 2M0YA 5KH6A 3QZ5B 4PJOE 4IUVA 1K4US 2IIMA 3H6ZA 3URGA 1Y71A 5CKDA 4ESRA 3NTKA 4C0DB 1BU1A 2L8DA 3OYYA 1X6OA 4D8KA 2DO3A 2F2WA 5FRMA 3KBGA 4KUDK 1JXMA 3EGXB 2J6FA 1YWOA 3A1PA 3EH1A 3F70A 4OMMA 3RMQA 1QKXA 5IHKA 3MP8A 1M2VB 5IXBA 2LQWA 2WSEE 4PJMA 2GTOA 1WPYA 3JB9F 3ZL7C 2OAUA 1AZEA 2FEIA 1WJRA 3I55T 1WI7A 4ELYC 2COYA 3SWNA 5FRNA 1UDLA 2MYSA 5GANg 3SEMA 2CYZB 1YIJT 5GANf 2M1HA 2DTOA 4M7AA 2RHIA 1TH7A 2DD4A 5LJ5j 3HL8A 4N0AC 3OYHA 5FWBA 3M53A 2JVVA 2PVOB 2JS2A 2DLPA 2DILA 1X2QA 2QDLA 4M75A 3OS0A 4M7DB 3MPUB 1KQSA 5GAN2 3IQLA 2PUOB 5KYWB 4CI0C 3ZEHA 3CD6A 3TCJA 2EKHA 2J06A 3I5SA 5J39A 3CCVT 3C0CA 1GRIA 2D0QB 1AEYA 3RDVA 2DBKA 3JAME 2Y4XA 4A4KA 3CC7A 3OW2A 1AHJB 2DYIA 3CCMT 3VUBA 3CD6Q 1TS9A 3NPFA 2RHXA 3FLGA 2KYMA 2CP6A 3M5AA 2MCNA 4A54A 2PVDB 3MJXA 2HNIA 5D6YA 2LNVA 2YRDA 3EFOA 3CC7Q 1WXUA 3AT1B 2SRCA 4XU1A 2X3XD 2AKLA 2E6NA 1WA7A 5I11A 3CC2T 2D0NA 1OV3A 1G3SA 4MMLA 2MK5A 3I5RA 2VXEA 4LUEA 2ZZDA 3I56A 4JJDA 2JOYA 1CKAA 1VQPA 2XHCA 5GAMd 3H0HA 1VQLT 4AG1C 4JRIA 2H8HA 1MHNA 1K9MC 3BE3A 3JCMb 3M56A 4J6XA 4LE9A 2HZYA 3M4YA 3OS1A 4X1VA 3RR6A 2OX7A 4R0KA 3I56Q 2XU8A 3SD4A 5GAN7 2FYKA 2DIQA 2E5KA 3SWNC 1VQPQ 3OMCA 4IUPA 3QWXX 5GAOn 3L2ZA 4XQ3A 4M7AC 3QXEB 3VS4A 1GCPA 2KXDA 4PJOG 3NTHA 5FROA 3UA7A 1JJ2S 1HJDA 4E47A 3L2RA 1Q82R 3QJ6A 4OMNA 1Q7YC 1G2BA 3META 1AWXA 1TXQA 4F14A 4E7JA 4OB3B 4KT0E 4PKCC 3FEOA 4FW1A 1VQ7T 4FM4B 5GANh 5GMKj 4DBFA 2LNHB 2K5FA 3C12A 4C5IA 5CIUA 4Z89A 4BI3A 4C92C 5KCOA 1TUGB 1MV3A 2RJDA 2CP3A 4CC7A 5KYNA 2OI3A 3EFSA 2M16A 1UJYA 2XICA 2L3RA 2A36A 5LJ5d 2JT4A 2RQUA 1O9SA 2ZCFB 1M1KC 4HCCA 3OYLA 1C6VX 3CCQT 1YI2A 5IH2A 4J8OA 3VS0A 1Q86U 3CBOA 2DL4A 2RHUA 2P0PA 1KC8C 4RTVA 1ZHIA 3KFVA 1ZUUA 2QEXT 4M75B 2L2PA 4FYXB 4DQ2A 2CP7A 1UGRB 4XTWA 2EJGA 4J5YA 3HRUA 2X51A 3CMAQ 2NUPA 3MP1A 3LW5E 4B6MA 3VS5A 1YI2Q 2RPNA 2V1QA 1QVFS 4J6YA 2A7YA 2JN0A 1W70A 3EG9A 2NYSA 3HRSA 3NGPA 2RB6A 2KE9A 4C8QE 1QWFA 2KVQG 1X6BA 1Y07A 3HTRA 1OPLA 1N6AA 1X01A 1UGQB 2LCCA 3OY9A 2DK3A 3OYBA 4D8DA 2QAZA 1QCOA 3CCRA 1DJ7B 2K2VA 4Y28E 3EFOB 2K5IA 2RQRA 2X4YA 4BB7A 3L2QA 1K73C 3FIFA 3QDRB 3GF5A 3QG1A 3CCLT 2MAMA 3CBPA 4AT1B 2DF6A 3M0PA 4O5VA 1T3SA 4AFZC 4PJOF 2EQIA 3CCRQ 2DERA 3BFMA 1YNZA 2RQTA 2X3WD 2C06A 1SF9A 4QKUA 2QA4A 4CC2A 1G5VA 4Q5WA 4M77E 1OX8A 1BB9A 4E7ZA 1WGSA 3BW1A 4FSSA 4C0FA 1VQMT 4HCZA 2ED1A 2KYBA 2EYQA 3QIIA 1Y0MA 5LJ3e 4XTVA 3I55A 1Q86R 2E64A 2KAFA 3E9FA 1N8RC 2H3EB 1RAEB 2ZPEB 1BCMA 1N9RA 3RIRA 1IHWA 2OTJA 2QA4Q 2D9TA 4NS5A 4RTZA 4O6JA 1M1GA 1NYGA 3I55Q 3QO3A 3PVQA 4Z8AA 2R57A 5HY6A 1S72A 4MDXA 2V8KA 3CCUT 2OTJQ 4OB0B 2FO0A 4GBQA 3OYJA 3EGXA 5I22A 3CCVA 2QQSA 1BCOA 2X4WA 1GBQA 3X20B 5HK0A 3H0IA 1M2VA 2R5AA 1Q81C 3FJPA 2EJ9A 2F1LA 2QTVA 1C1AA 1VYVA 1WDXA 2QTXA 1TG0A 3CCMA 1S72Q 5GMKi 5GAMg 1D09B 1VQ4T 2O88A 2YLBA 2DXTA 4V2SA 5GAMf 3CCVQ 4JJNK 2LT1A 3JCMQ 3NHNA 3OW2S 1WHKA 4M78C 3H9NA 2W0ZA 3ZBDA 4KGVB 3CC2A 3CC4T 1M30A 2ZPHB 1NG2A 1YITT 3SDZA 1ZBJA 2GGRA 4CRIA 3D7SB 3REBB 2EWNA 3DLMA 4IUUA 1WYXA 2CZ0B 1VUBA 2RQVA 5KYWA 2CZ1B 1UHFA 2HEQA 3JCMW 2JUFA 2NUPB 2JNGA 3CC2Q 1WQ7A 1YN8A 1LPLA 2E5QA 2QQ9A 3FDRA 3OYAA 2AIRB 3BDLA 2HQEA 3TQ7P 3GNFB 4C8QG 2E10A 1O75A 3M55A 2CSQA 1SSFA 1IO6A 4HT9A 3VU3C 2DPPB 1FXXA 3V7RA 2AZVA 1RAGB 1BI3A 2A28A 3EFRA 2A08A 2HAXA 4DOVA 2FZKB 5D7UA 4WTOB 4GLMA 2LMJA 1P92A 3EG1A 3M57A 4C0DC 2EQMA 5LJ5g 4ZNXA 1ACMB 4QW2A 2D1XA 1TOVA 5LJ5f 1FX7A 3H0FA 3QZ9B 1VQ7A 2LDMA 2P4RA 3S3NA 1M90C 5FW9A 1ZUKA 4ZN3A 2HSPA 2EQJA 2YRVA 3V7SA 1ARKA 5CVIA 5LL6S 2ZPGB 1RAIB 2VV5A 4M77G 3V8JA 2XIDA 3OYIA 1M8VA 1KIKA 1MMGA 2HL3A 2CUDA 5J26A 1FMVA 2L3PA 2EJFA 3GIBA 2KBTA 1VQ7Q 2E3HA 1W2BA 2KGTA 2XMFA 5AT1B 5IN1A 2LZ6B 4JPBW 2LCLA 3V8LA 3CPWA 3CCQA 1VQKT 1IHVA 1BKBA 5CCAA 1VQNQ 1U1SA 1JJ2P 1K9MU 3M59A 5CKFA 5GMKm 2F5KA 4M7DC 2COWA 2JW4A 4DOWA 5GAMh 5DLQE 1KQ1A 4L59A 4C8QD 1XTDA 2DFUA 2FPEA 4RG8A 4IIOA 3CCQQ 2QQBA 3QPHA 5GAN6 4HCBA 1PSEA 4JRKA 1ZSZA 4A4FA 2DA9A 4KULA 3BDUA 1VQ8T 1KSWA 1I07A 2KXCA 2O01E 2GFUA 4QQGA 4HVVA 1Q7YU 2YUOA 4C0ZA 4N4GA 2EAYA 1SG5A 1NJIU 2ATCB 1T0JA 1Y57A 4C5GA 2HBWA 3OSSC 4YTLA 3VS6A 2CT3A 1MMNA 3PTAA 1VIFA 4C8QF 2J05A 1D0XA 1WHJA 3RBBB 2XDDA 2I0NA 2NLUA 4KGXB 4FYVB 4F7UE 4IUQA 1I5OB 3RMSA 1NYFA 4M77D 3VUZA 3CCLA 2RM4A 4ELZC 5GAN3 1OULA 2X4JA 1WNLA 2EGCA 4TVRA 2QGFB 3MEUA 2JTEA 3R6OA 1VOMA 2QGGA 1TSFA 1HYOA 2QYZA 3EH2A 5GMKl 1TWBA 2LJ3A 4AFQC 3U23A 1M1KU 5GANe 3CCLQ 1QVFP 1WX6A 2XDBA 1H92A 2D6FA 1VQMA 5LJ5h 3OYEA 1MUZA 2RMOA 5EG2A 4JZ3A 4PJOA 1KC8U 2ZPIB 1I8FA 2DXCA 3QWYA 4M77F 1CKBA 3CCST 4IIMA 1G8XA 3CEYA 2NUTA 1UGPB 2CGHA 2ZPFB 3OYFA 2HL5C 1RLQC 2RHZA 1OYXA 2EW3A 1VQMQ 3UF4A 5KE3A 4QQDA 1RABB 2EYWA 3I35A 3I9QA 2DXBA 3QHSA 2SEMA 3OQ5A 2AZSA 4FL6A 3L2WA 2AHJB 2RH2A 3CMET 4CC4B 3O5ZA 3VYGA 3L42A 3BY7A 3E9GA 3V7CA 1T0HA 1D3BB 1YJ9A 4OGCA 4L5GA 4RTYA 1HXDA 4ANJA 4NL2A 3CQTA 4ZTFA 3SHWA 1M5Q1 1UTIA 2DM1A 4LD9K 1AD5A 1NJIR 2OJ2A 2DEQA 1X6GA 3C94A 4JRQA 1WXTA 2DRKA 1ABOA 4BE0A 1VYUA 3ME9A 1YHQT 5D6WA 1D1BA 4AMCA 2E41A 2JMCA 4C0GA 4M7AG 1GBRA 3E1SA 2KK4A 3OSVA 3OBYA 1K73U 3JCMe 2JM9A 1YJ9Q 1H8KA 3KUFA 2P0KA 1N9SA 3MEVA 2BE9B 2OAWA 4LNPA 3OMGA 4J9HA 3ULRB 4A4EA 3MP6A 2RO0A 1QMCA 1QVGA 4ME7A 1VQ5T 4JLGA 3QYHB 2Y4YA 3HKSA 5FU6B 2LRQA 3L2VA 1D0ZA 2ROLA 3EG3A 2OTLT 4QVZA 4M75C 3REAB 5GJWB 1MGQA 1HD3A 1BIBA 2KSSA 1BYMA 5FLXE 4C92G 2V26A 2YT6A 2MIOA 4ATOA 3VS3A 5IHNA 2G3RA 3VS2A 4RMOA 1IB8A 1N8RU 3H8ZA 2VGMA 3FC3A 2VKNA 1QVPA 1ZSZB 3EHRA 3X25B 1N27A 4ZGJB 2EQKA 1KFZA 2CUBA 4N4HA 1KQSP 2ROTA 1RI0A 2DL7A 2M0OA 4XU3A 3NFCA 3TEEA 2YHTA 1ZUYA 3G4SA 1RLPC 4VUBA 1GL5A 1JB0E 3JB9I 2ESWA 3OYKA 3H41A 1M3AA 4BACA 2O9SA 5GMKh 1B3QA 3OW2P 1X75C 1QQJA 3SFMA 4BE2A 2FRWA 2LX7A 1K0SA 2DTHA 4F7UG 4B9WA 4HA8A 1XOVA 2YUNA 3OS2A 1B34A 1Q82C 1Q81U 2R5MA 3QBYA 4J7IA 3G4SQ 2XK0A 1PWTA 2COZA 4M7AD 1YCSB 3E2UA 2QQRA 2DNUA 1K0XA 4LDYA 2V1RA 3QJYA 3PIPA 4MZMA 3OYMA 1JQQA 5GJVB 3THKA 4FT2A 3HP9A 3A5ZB 2BE7D 4BUGA 1PD0A 2LQKA 3MKDA 2DJZA 2K5LA 4PJOB 1G3YA 2KMTA 3OA6A 1QKWA 4EMKB 1VQ6T 2YRCA 5D6XA 2V8IA 4C92D 3TSWA 1YJNT 2H3JA 5A0LA 1YJWT 4M7AF 2NUTB 5GAOq 4BI8B 2GF7A 5M9OA 1VQKA 1W2BS 3VS7A 4BDZA 2HQHA 1N8RR 1WJSA 1XJWB 1NLOC 3M0TA 1K8AC 4X34A 1VYTA 3VKIA 2EYZA 3GNGA 3RUXA 1I81A 4R55A 3CPWS 4LXCA 2K2MA 2CKKA 3T9NA 1AWWA 4RKUE 3VYHB 3MO8A 4C5HA 5ECAA 2PVGB 4M4ZA 2JXBA 4KH1B 4NL3A 1M3CA 2DMOA 4HCKA 2RJCA 3AHUA 3J7AF 1ZA1B 3KXTA 4C92F 1I0CA 3J81E 2DTIA 1VQ8A 1V76A 1YP5A 4L6V5 8ATCB 2XD0A 4HVUA 4HVWA 4AFUC 1UB4A 1R0BG 1I5LA 3GPLA 3CD6T 3JSCA 5GAN4 4FYYB 2CZ6B 1GCQA 1TTHB 1Q81R 1UUEA 1G3WA 2KT1A 4OF1A 4JUVA 4M7DE 1OU8A 3MHXA 2DEUA 1YIJA 1VQ8Q 4KRTA 3J80E 2KY9A 3VS1A 4DEYA 1VQOT 4PLLA 2KT8A 3VRYA 1WJQA 3MCAB 2EYYA 5GAOr 2WSFE 3G6ET 3MEAA 1RL2A 2CH4A 1SSHA 4FW2A 1R77A 3GOXA 1VA7A 1NPRA 1MV0B 2DX1A 2E12A 1YIJQ 4F7UF 2K57A 1RUWA 3TREA 1X43A 4C8QA 4BE1A 5IHIA 3A8HB 3HFOA 1NM7A 2DVEA 2QXFA 1M9SA 4RTUA 3L1AA 5CQXA 1KQSS 4X9DA 1RAAB 2CT4A 3CCJT 4M78G 3VRZA 2M51A 3LX7A 3PGGA 2A3LA 2GNCA 4NOYA 2K6DA 3EGUA 1XQHA 3EHQA 2LC4A 2A0FB 3NMZC 1D1AA 1R8OB 1RADB 1U8RA 3HPWA 2O9VA 1Z9QA 3TVTA 4J6WA 3M4GA 2O2OA 2QASA 3CXCA 4F16A 3RKWA 2HD0A 3RNJA 3JCMV 3CCMQ 3JCMd 2KEAA 1IGUA 2KI7A 1B34B 3CMEA 1ZLMA 4JJBA 5CQYA 3UATA 1IREB 3RKXA 1Z9ZA 3OYCA 4M77A 1TU0B 2HBPA 2ZGWA 3CCET 1M3BA 2CH4W 3TSZA 2CZ7B 3QSUA 5LJ3j 5HK3A 1RAHB 3P8DA 5GAMe 2MWOA 1VQLA 1PRMC 2YUPA 4JZ4A 2JTMA 4OB1B 2KRMA 2HKNA 2JMAA 3UDCA 4PL6A 3LWHA 1WFWA 3CMEQ 4MZTA 2LX9A 2QI2A 2BTTA 4BI4A 1BI0A 1AWJA 2Z0WA 3LH5A 4Z02A 2DL8A 1E6HA 3M58A 4XTYA 4PJLA 2LQNA 2PU9B 1B7TA 4EDUA 3JB9J 3OB9A 1VQLQ 1OQKA 2KQWA 1UE9A 2EIFA 2KRSA 3X26B 3GBQA 1ABQA 2G6FX 2F2VA 2DIGA 4QT7A 3HSBA 1MNEA 2OTLA 2AT1B 3JV3A 4LD6A 3EGDA 2XI9A 3JCMJ 4WF2A 3PE0A 1IGQA 2EGEA 2CP0A 2EGAA 1QVGS 4M78D 4BD3A 1D3BA 3CMAT 2CREA 1YI2T 1QP2A 1QW1A 2ABLA 1KD1C 1S1NA 4FSXA 2OTLQ 1VQ9T 1PD1A 2DAQA 4N0AA 1PKSA 2RI5A 1D0YA 3UPUA 5GAOp 6AT1B 1UG1A 4PLIA 1AZGB 4M7AE 5FU7B 4E7KA 3VV0A 3P8BB 1V29B 4AFSC 1JBMA 4LUDA 3LH0A 3JCMP 1UFFA 1YFNA 1QWEA 5LJ5e 4M7DG 3G71T 4ZN1A 4M75E 3P8HA 2MPXC 4M78F 2RK1A 5CKEA 5DM7R 1W1FA 2DL3A 2EPDA 3JCMX 2LQ8A 9ATCB 2J6OA 3G1JA 2KRNA 3TU4K 3S3MA 2O31A 1U3OA 4MMKA 2QEXA 2GBQA 2FRYA 4C92E 1OEBA 1WXBA 3EAEA 2RD1A 4PFPA 1EX4A 1MMDA 4K11A 2VVKA 4XU2A 3UA6A 3FJ5A 1I4K1 2FB7A 3QYGB 4C8QB 2VWFA 1FYNA 1PC0A 2K3BA 2IG0A 3SB2A 4FIBA 2CS7A 2E65A 2XG8D 2QEXQ 1U1TA 2L89A 2X35A 2RA2A 4A4HA 4BY6B 4D6WA 2YDLA 1VIEA 1F1BB 2RF0A 3M54A 1W4SA 2BZ8A 2FG0A 3RKYA 3G7ZA 5KYXA 1VQ6A 2GFAA 2BIVA 1YJNA 4RCCA 2QA4T 2C0TA 2ZAEA 1QCFA 1YJWA 5KYUA 1NEGA 1BIAA 1OX9A 5C6SA 2EYXA 1XNIA 3RERA 5HKCA 3EG0A 2DRMA 3PMIA 5LJ3d 3DB4A 3MEWA 1AVZC 5GAN8 1GFCA 2RNAA 1JRIA 1ZSGA 1PSFA 4P5NA 4EMGA 2HQXA 2RK2A 3C95A 1VQ6Q 4LDWA 1YWPA 2GQVA 1RAFB 1MMAA 4M77B 1YJNQ 4JJCA 2OTJT 2RI3A 3A98A 2LVMA 4KGZB 1YJWQ 4DA4A 4E7LA 4JS5A 4M7DD 5DY9A 2NUZA 4PNOA 1N5ZA 4QVCA 1PKTA 2O4XB 1GFDA 2DYBA 3ER0A 1S72T 1UJ0A 2I2LA 5CR2A 1BI1A 2XDPA 4PJNA 2E3IA 1TUCA 1Q82U 1K9MR 2L5QA 4EMKA 2C0OA 3LYIA 5J3BA 4OGEA 4UC4A 3HRTA 3RESA 2DETA 1WLPB 2FHDA 5FU6C 3OYDA 2EKOA 4C92A 1JXOA 4IUTA 1LNXA 1RI9A 1VQOA 4LN2A 1W2BP 4LDXA 2X4XA 2FPFA 5A0GA 1E7OA 5GMKe 2KROA 3EGDB 4M7DF 3ZFJA 3G6EA 1OPKA 4IURA 4J9GA 2DD5A 4DEXA 1KK7A 4J83A 3CCUA 3CPWP 4DBQA 2HKQB 4RTXA 4OVAA 1Q7YR 3JB9H 2LT4A 3JCMg 1HSQA 1ZSZC 4Y91A 1PHTA 1VQOQ 2KNBB 3JCMf 1NEBA 4PFOA 7AT1B 1BI2A 1X27A 3JCMc 3CCJA 3G6EQ 4OMPA 4RG2A 4ORZA 3CCUQ 1KQ2A 2E70A 1U06A 1VQ4A 1K8AU 1R0CB 4LDVA 4A4GA 4F7UA 4M75G 1QLYA 1SHGA 1LJOA 1U5SA 2D8JA 2PUKB 2IVWA 1H3ZA 1C0MA 4F04B 8AT1B 3PT9A 4FCYA 4E7HA 3CCJQ 3GLXA 2GCXA 3M0QA 1ZBXA 3OBWA 1EIFA 1D1CA 3CC4A 2F5TX 3S3OA 1YITA 1NE8A 1VQ4Q 2EBPA 5GANj 2XKOC 2WACA 1M1KR 5CKBA 2M02A 4J7FA 1OZ2A 1HK9A 2PQWA 1EFNA 1WHHA 3CXCS 3CCEA 2EVRA 1Y96B 2K79A 4RTTA 2JTFA 4OMFB 4WCIA 1PG5B 4JS4A 2QK0A 4RUGA 2VC8A 1KC8R 5DLOA 3WVDB 3A8OB 3CC4Q 3OYNA 2NWMA 1G3TA 1YITQ 4ZTJA 1J3TA 2QG9B 1NZ9A 2QQAA 1NJIC 1WIEA 1KHCA 4PJOC 1GXIE 4FYWB 2HSEB 5HCKA 1LVKA 4M78E 3CCEQ 4EMKC 2FZGB 2A37A 1SPKA 3ASKA 1ZX6A 4DBRA 5KYXB 1KJWA 2M9UA 2RI2A 2L3QA 1M4ZA 4CC3A 2DZ9A 1OOTA 2YXYA 5KYUB 3LLRA 2YUQA 1AT1B 1WHLA 1VQNT 1SRLA 1IRXA 3PMTA 1OZ3A 3WXMB 2CDTA 2JS0A 1PRLC 4ZGDB 4C5EA 4A53A 3INZA 3SWNB 2K7AA 3NTIA 1H641 1I1JA 2RN8A 3CMAA 3V8KA 5CAIA 2AKKA
chains in the Genus database with same CATH topology
1M9SA 3O8VA 3L1AA 4A54A 5CQXA 1KQSS 4M7AB 2PVDB 4X9DA 2HNIA 1W2BA 3CCJT 5A0DA 4M78G 5D6YA 2LNVA 3LX7A 1VQ9A 4M75D 3PGGA 2A3LA 5IN1A 4NOYA 2K4YA 4XU1A 2E6NA 2BKDN 2LCLA 3V8LA 3CPWA 3CC2T 1XQHA 3WVEB 2RHYA 3CCQA 3CPFA 2LC4A 1R8OB 1VQKT 1U8RA 3LGLA 4QQ6A 1BKBA 1G3SA 4MMLA 1U1SA 5CCAA 1K9MU 3M59A 5CKFA 5GMKm 2VXEA 3HPWA 2F5KA 2ZZDA 3I56A 4M7DC 2MI6A 4J6WA 3M4GA 3CXCA 2JOYA 3G71A 3RKWA 3JCMh 2HD0A 4II1A 4DOWA 4HKEA 3JCMV 5GAMh 1VQPA 3JCMd 5DLQE 2XHCA 3C4SA 5GAMd 3OS5A 1VQLT 1KQ1A 4PJOD 4JRIA 4L59A 1B34B 1MHNA 4C8QD 4C92B 1K9MC 3CMEA 3JCMb 1XTDA 3M56A 4J6XA 4LDUA 3A8MB 4KUIA 4RG8A 5CQYA 1IREB 3RKXA 3X28B 3OYCA 4M77A 3M4YA 3T9NA 3OS1A 3FB9A 2HBPA 2ZGWA 3CCET 2QQBA 3QPHA 5GAN6 4HCBA 2CZ7B 3QSUA 4M75F 5HK3A 5LJ3j 2FVUA 3HHTB 3P8DA 4BDYA 1PSEA 4JRKA 2XU8A 3SD4A 1WQWA 2FYKA 5GAN7 2DIQA 5GAMe 4A4FA 4B9XA 3SWNC 2MWOA 1VQLA 4KULA 3BDUA 1VQ8T 3OMCA 2JTMA 4OB1B 4IUPA 3FRNA 5L8RE 4RCBA 2O01E 3UDCA 2GFUA 4M78A 3Q1JA 4PL6A 4QQGA 5GAOn 3LWHA 1Q7YU 3L2ZA 4XQ3A 4C0ZA 5I2SA 5LJ3g 4MZTA 4N4GA 4M7AC 2EAYA 1OI1A 2LX9A 3QXEB 2QI2A 4BI4A 1BI0A 4PJOG 1NJIU 3NTHA 5FROA 1JJ2S 5LJ3f 4R56A 4Z02A 4E47A 3M58A 4XTYA 3L2RA 4C5GA 1YBYA 3OSSC 2PU9B 1Y7XA 3QJ6A 1Q7YC 3META 4YTLA 4EDUA 3JB9J 2QDYB 3OB9A 1VIFA 3PTAA 4C8QF 1IZ6A 4E7JA 2KQWA 2XDDA 2EIFA 2NLUA 2K3XA 4OB3B 4KT0E 3X26B 4PKCC 4F7UE 4IUQA 3RMSA 4EMHA 3FEOA 4M77D 4F7UB 3VUZA 3CCLA 1VQ7T 2RM4A 2K3YA 3A8GB 4FM4B 4ELZC 2VUBA 5GANh 2WSCE 2X4JA 5GAN3 2P0QA 5GMKj 2DIGA 4JRPA 1WNLA 2OTLA 5GANd 3HSBA 4XTUA 4LD6A 1M90U 3CC7T 2K5FA 3C12A 4C5IA 5CIUA 4TVRA 2P4TA 2XI9A 3MEUA 4WF2A 4XTZA 3JCMJ 3R6OA 4BI3A 4C92C 1KD1U 4GY5A 5KCOA 1QVGS 2RJDA 4M78D 5GMKl 4BD3A 1D3BA 3EFSA 3CMAT 2M16A 5KCHA 4ZGEB 1M1KU 2DXUA 2XICA 5KE2A 4FT4A 5GANe 2XDBA 1YI2T 1QP2A 2ZPBB 2L3RA 1QW1A 1KD1C 2D6FA 1VQMA 5AYFA 5LJ5h 3OYEA 4FSXA 2F69A 1VQ9T 5LJ5d 5EG2A 2DAQA 2DZCA 4N0AA 4PJOA 1O9SA 2RI5A 2ZCFB 4X9CA 1KC8U 2ZPIB 3UPUA 5I2MA 1M1KC 4HCCA 1I8FA 2MF2A 5GAOp 2RJEA 3OYLA 2DXCA 3LWIA 4PLIA 3CCQT 4M77F 4M7AE 5FU7B 3CCST 3VV0A 4E7KA 3P8BB 1YI2A 4PJOE 1V29B 4J8OA 1JBMA 3X24B 3CEYA 1Q86U 3DLLA 1UGPB 3CBOA 3LH0A 3A8LB 3JCMP 2CGHA 2RHUA 2ZPFB 2P0PA 2VYTA 3S6WA 3OYFA 3I56T 1FWZA 5LJ5e 2YLCA 2RHZA 1OYXA 4XU0A 1KC8C 3G71T 4M7DG 4ZN1A 1YJ9T 4M75E 1ZHIA 1YCYA 4QQDA 5KE3A 1VQPT 2LTOA 4N4IA 2QEXT 3P8HA 2DXBA 4M75B 3QHSA 3V8KA 4M78F 4DQ2A 3OQ5A 2RK1A 5CKEA 2JZ2A 4MZPA 4FL6A 1UGRB 4IKFA 4XTWA 5DM7R 3CCSA 5CK9A 2EJGA 4J5YA 1Q86C 3L2WA 3HRUA 2AHJB 2RH2A 3JCMX 3CMET 2LQ8A 2EQUA 3VYGA 3L42A 3BY7A 3E9GA 3MP1A 3LW5E 3V7CA 3TU4K 1QVFS 5IT9E 3S3MA 4J6YA 2A7YA 1D3BB 2KDSA 1YJ9A 2JN0A 4MMKA 4L5GA 4OGCA 1HXDA 3UWNA 1QP3A 4NL2A 2QEXA 1JJ2A 4ZTFA 1M5Q1 4C92E 4KBMB 3GP8A 1UGSB 3EAEA 3HFNA 2RD1A 3HRSA 4LD9K 2DEQA 2RB6A 3L2UA 3C94A 4JRQA 4C8QE 4XU2A 4BE0A 1I4K1 2KVQG 2FB7A 3ME9A 3QYGB 1Y07A 4C8QB 1YHQT 5D6WA 3OYGA 4EPCA 2E41A 3E19A 4C0GA 4M7AG 3E1SA 2KK4A 3JRZA 1UEBA 1N6AA 3OSVA 1X01A 2IG0A 3OBYA 1UGQB 3SB2A 2LCCA 3JCMe 4FIBA 1K73U 3OY9A 2DK3A 2CS7A 4OB2B 2E65A 3OYBA 2XG8D 2EFIA 3KUFA 3CCRA 2P0KA 1N9SA 1DJ7B 3MEVA 1U1TA 2K2VA 2L89A 2RA2A 2X35A 4Y28E 4A4HA 4BY6B 4D6WA 1ZQ1A 1VIEA 3OMGA 3M54A 1W4SA 2K5IA 2X4YA 5FU7C 2DKGA 2O4XA 4BB7A 4M7DA 5C0MA 4A4EA 1YHQA 3L2QA 3MP6A 1K73C 3FIFA 2RO0A 3QDRB 3GF5A 3G7ZA 3RKYA 1QVGA 1VQ6A 4ME7A 4XTXA 2GFAA 4JLGA 1VQ5T 3QYHB 2Y4YA 1M1FA 2BIVA 3QG1A 3CCLT 3JB9G 4HT8A 2MAMA 1YJNA 4RCCA 2QA4T 3HKSA 5FU6B 2LRQA 3CBPA 3L2VA 1YJWA 2OTLT 4QVZA 4O5VA 4M75C 5CO7A 4PJOF 1BIAA 4GLKA 1MGQA 3UT1A 5C6SA 1XNIA 3QUIA 5A2QE 3RERA 1BIBA 5HKCA 3BFMA 5LJ3h 2KSSA 1BYMA 5FLXE 4C92G 5GAOm 3PMIA 5LJ3d 3DB4A 3MEWA 3PIOA 2C06A 4ATOA 1VQ5A 5GAN8 2G3RA 1JRIA 1PSFA 4P5NA 4EMGA 2HQXA 2RK2A 3C95A 2QA4A 4LDWA 1G5VA 4RMOA 4M77E 4Q5WA 2E1HA 2GQVA 3CBMA 1N8RU 4MDWA 3H8ZA 4M77B 2VGMA 4E7IA 2OTJT 2RI3A 1WGSA 3BW1A 4C0FA 3FC3A 1VQMT 4HCZA 2LVMA 3G4ST 3GIBA 1QVPA 2EYQA 3QIIA 5GAN5 4ZGJB 3X25B 4JLIA 1N27A 5LJ3e 2EQKA 4XTVA 4DA4A 3I55A 4N4HA 4E7LA 3LGFA 4C8QC 4JS5A 2E64A 2KAFA 4M7DD 3E9FA 1N8RC 1RI0A 5DY9A 4PNOA 2ZPEB 4M78B 1N9RA 3RIRA 5CKHA 2M0OA 4XU3A 3NFCA 2OTJA 4QVCA 2O4XB 2YHTA 3TEEA 2D9TA 3G4SA 3ER0A 4NS5A 1S72T 4VUBA 1KG1A 1JB0E 2I2LA 4O6JA 4BY6C 1BI1A 1M1GA 2XDPA 5CR2A 3JB9I 2RJFA 3OYKA 1Q82U 1QVFA 4BACA 2L5QA 3QKJA 3VJPA 5GMKh 4XK8E 4EMKA 4OP0A 2R58A 1X75C 2E6ZA 2V8JA 3QO3A 3LYIA 5J3BA 3SFMA 4BE2A 2B8AA 3DB3A 5IAYA 4OGEA 4UC4A 2Y90A 3HRTA 2DTHA 3RESA 2R57A 4F7UG 4B9WA 3PFSA 2FHDA 5HY6A 4HA8A 1XOVA 5FU6C 3OS2A 2EKOA 3OYDA 1S72A 1B34A 3DKMA 4C92A 2V8KA 3CCUT 4IUTA 1Q82C 4MDXA 1Q81U 1LNXA 4OB0B 2R5MA 3QBYA 4J7IA 1VQOA 2VGNA 3PNWC 3OYJA 2XK0A 1KHIA 3CCVA 2QQSA 2X4XA 5A0GA 4LDXA 4M7AD 5GMKe 2X4WA 1LOJA 2QQRA 4JDSA 5GAMj 1VQNA 3ZFJA 4M7DF 3X20B 3G6EA 5HK0A 4IURA 1NPPA 2DD5A 2MWPA 2R5AA 4LDYA 1Q81C 3QJYA 4J83A 3FJPA 2EJ9A 5I21A 3CCUA 3PIPA 4M77C 2QTXA 3CCMA 4XAXB 4MZMA 3OYMA 4OVAA 2FL7A 3JB9H 2LT4A 3JCMg 2VXFA 5GMKi 1Y96A 5GAMg 5GAOl 4Y91A 1VQ4T 3N5BB 3HP9A 4FT2A 3A5ZB 3CCRT 2YLBA 3JCMf 2DXTA 3JB9D 4V2SA 4BUGA 5GAMf 5CAIA 2LT1A 3M9QA 3JCMQ 4JJNK 2MMPA 4QVDA 2BUDA 1BI2A 2LQKA 4FU6A 3JCMc 3QZ5B 5KH6A 3OW2S 2DJZA 4IUVA 2K5LA 4M78C 3CCJA 4PJOB 1G3YA 2KMTA 3OA6A 4RG2A 3H6ZA 3URGA 4EMKB 1VQ6T 1Y71A 5D6XA 1KQ2A 2V8IA 2E70A 4C92D 5CKDA 1YJNT 2H3JA 3ZBDA 5A0LA 1VQ4A 1K8AU 3NTKA 3CC2A 3CC4T 4LDVA 1YJWT 4C0DB 2L8DA 2ZPHB 4A4GA 3OYYA 5GAOq 4F7UA 1YITT 4M7AF 1X6OA 4BI8B 2GF7A 3SDZA 4M75G 5M9OA 2DO3A 1W2BS 1VQKA 5FRMA 3KBGA 1LJOA 4CRIA 4BDZA 2PUKB 4KUDK 2IVWA 1H3ZA 2EWNA 3DLMA 3PT9A 4IUUA 1WJSA 4E7HA 2CZ0B 1VUBA 1K8AC 4X34A 3GLXA 3VKIA 2CZ1B 2GCXA 3GNGA 3RMQA 3RUXA 3F70A 1I81A 4R55A 3CPWS 1ZBXA 3OBWA 3MP8A 1EIFA 3CC4A 2F5TX 3S3OA 2WSEE 3JCMW 1YITA 2JUFA 1NE8A 1WPYA 2JNGA 5GANj 3JB9F 2CKKA 1WQ7A 2OAUA 2XKOC 2WACA 4RKUE 5CKBA 2E5QA 2QQ9A 3FDRA 4J7FA 3VYHB 3OYAA 3MO8A 1OZ2A 4C5HA 1HK9A 2PQWA 1WJRA 2PVGB 3BDLA 3CXCS 2HQEA 3I55T 3CCEA 1Y96B 4NL3A 3GNFB 2JTFA 4OMFB 4ELYC 4C8QG 2RJCA 4JS4A 3SWNA 2E10A 3AHUA 5FRNA 1O75A 3J7AF 3M55A 3KXTA 4C92F 3J81E 2VC8A 2DTIA 5GANg 1VQ8A 5DLOA 4L6V5 2XD0A 1SSFA 3WVDB 2CYZB 3A8OB 1YIJT 4HT9A 3OYNA 3VU3C 5GANf 2M1HA 1G3TA 1UB4A 2DPPB 2DTOA 4ZTJA 4M7AA 1FXXA 3V7RA 1I5LA 3GPLA 3CD6T 1BI3A 1NZ9A 2QQAA 2RHIA 1TH7A 2DD4A 3JSCA 5LJ5j 3HL8A 1NJIC 3EFRA 5GAN4 1KHCA 4N0AC 3OYHA 4PJOC 2HAXA 4DOVA 1GXIE 3M53A 2CZ6B 4M78E 2JVVA 2PVOB 4EMKC 1G3WA 4OF1A 4JUVA 4M7DE 1P92A 4M75A 3OS0A 3ASKA 3MHXA 4M7DB 1YIJA 3M57A 5GAN2 1KQSA 2PUOB 4C0DC 3J80E 2KY9A 2EQMA 3ZEHA 4CI0C 5LJ5g 2M9UA 3CD6A 2RI2A 4QW2A 3TCJA 1M4ZA 1VQOT 4PLLA 5J39A 2DZ9A 5LJ5f 1FX7A 3CCVT 3QZ9B 3LLRA 1WJQA 3MCAB 1VQ7A 2D0QB 5GAOr 2LDMA 3S3NA 1M90C 1VQNT 2WSFE 3G6ET 3JAME 4ZN3A 3MEAA 2Y4XA 3PMTA 1OZ3A 4A4KA 3WXMB 3CC7A 2EQJA 2YRVA 1RL2A 3V7SA 3GOXA 3OW2A 1AHJB 4ZGDB 5CVIA 1NPRA 5LL6S 2ZPGB 4C5EA 2VV5A 4A53A 4M77G 3CCMT 2E12A 3INZA 3V8JA 3SWNB 4F7UF 2XIDA 3VUBA 2K57A 3TREA 4C8QA 3OYIA 4BE1A 3NTIA 1M8VA 3A8HB 3HFOA 1H641 5J26A 3CMAA 2DVEA 2RHXA 2EJFA 3FLGA 3M5AA 2QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMK B;  3L1A A;  4A54 A;  4M75 C;  4M78 D;  4M7A B;  4PJO F;  1BIA A;  1KQ2 A;  1MGQ A;  2HNI A;  4X9D A;  4C92 D;  5GMK l;  3QUI A;  3RER A;  1BIB A;  1D3B A;  3BFM A;  3EFS A;  4M78 G;  5LJ3 h;  4C92 G;  4M75 D;  5GAO m;  2DXU A;  3PGG A;  4M7A F;  5LJ3 d;  5GAO q;  4F7U A;  5GAN e;  4NOY A;  4M75 G;  4XU1 A;  5GAN 8;  5LJ5 h;  1JRI A;  1LJO A;  3V8L A;  4EMG A;  2EWN A;  5LJ5 d;  4M77 E;  2E1H A;  2DZC A;  4N0A A;  4PJO A;  4M77 B;  4X9C A;  3BW1 A;  4MML A;  1U1S A;  1I8F A;  1I81 A;  3RUX A;  5GAO p;  5GMK m;  2VXE A;  4M7D C;  4M77 F;  5GAN 5;  4M7A E;  4J6W A;  3M4G A;  4JLI A;  5LJ3 e;  3JCM W;  4XTV A;  3RKW A;  3JCM h;  1WPY A;  5GAN j;  5GAM h;  1JBM A;  3JCM V;  4C8Q C;  3JB9 F;  1WQ7 A;  2E64 A;  3JCM d;  4M7D D;  5GAM d;  5DY9 A;  2CGH A;  3JCM P;  1HK9 A;  4PNO A;  5LJ5 e;  4M78 B;  2YLC A;  1KQ1 A;  1N9R A;  4XU0 A;  3RIR A;  4JRI A;  4M7D G;  1B34 B;  1Y96 B;  4XU3 A;  4C8Q D;  4C92 B;  4QVC A;  4NL3 A;  3JCM b;  2YHT A;  4M75 E;  1YCY A;  4J6X A;  4C8Q G;  4M75 B;  3QHS A;  3RKX A;  2E10 A;  4M78 F;  3SWN A;  3V8K A;  4DQ2 A;  4M77 A;  3AHU A;  4C92 F;  2I2L A;  2ZGW A;  3FB9 A;  2VC8 A;  2DTI A;  4XTW A;  5GAN 6;  2EJG A;  4J5Y A;  5GAN g;  3JB9 I;  3JCM X;  3QSU A;  4M75 F;  5LJ3 j;  5GMK h;  4HT9 A;  4JRK A;  4EMK A;  4OP0 A;  3VU3 C;  5GAN f;  1WQW A;  2FYK A;  5GAN 7;  3BY7 A;  2DTO A;  5GAM e;  4M7A A;  3QO3 A;  3SWN C;  3V7C A;  3V7R A;  3BDU A;  1I5L A;  1TH7 A;  2Y90 A;  4J6Y A;  5LJ5 j;  2DTH A;  1D3B B;  3EFR A;  3RES A;  2JN0 A;  4N0A C;  4RCB A;  4F7U G;  5GAN 4;  4PJO C;  4HA8 A;  4MMK A;  4M78 A;  1HXD A;  4NL2 A;  5GAO n;  4M78 E;  1B34 A;  4C92 A;  4EMK C;  1M5Q 1;  4C92 E;  3L2Z A;  4XQ3 A;  4JUV A;  5LJ3 g;  3HFN A;  4M7A C;  4M7D E;  2EAY A;  1LNX A;  2RD1 A;  4M75 A;  4M7D B;  2DEQ A;  2RB6 A;  4PJO G;  5LJ3 f;  5GAN 2;  4C8Q E;  4XU2 A;  4M7A D;  1I4K 1;  4XTY A;  2FB7 A;  4C8Q B;  5GMK e;  5LJ5 g;  1LOJ A;  4M7D F;  5GAM j;  2E41 A;  4M7A G;  3JB9 J;  2DZ9 A;  1X01 A;  5LJ5 f;  3SB2 A;  4V2S A;  3JCM e;  4C8Q F;  3FJP A;  2EJ9 A;  2E65 A;  5I21 A;  5GAO r;  4M77 C;  2QTX A;  1N9S A;  1U1T A;  2RA2 A;  4PJO D;  4F7U E;  3JB9 H;  3JCM g;  4EMH A;  2VXF A;  4M77 D;  1Y96 A;  3V7S A;  4F7U B;  2RM4 A;  4Y91 A;  5GMK i;  2DKG A;  5GAM g;  5GAN 3;  5GAN h;  5GAO l;  4M7D A;  4A53 A;  4M77 G;  2YLB A;  5GMK j;  3FIF A;  3INZ A;  2DXT A;  3RKY A;  1WNL A;  3JCM f;  5GAN d;  3JB9 D;  3V8J A;  3SWN B;  5GAM f;  4XTU A;  4F7U F;  3JCM Q;  1M8V A;  4XTX A;  2K57 A;  4C8Q A;  4QVD A;  3JCM c;  4PJO E;  3JB9 G;  4HT8 A;  2DJZ A;  3HSB A;  3HFO A;  4M78 C;  1H64 1;  4RCC A;  4WF2 A;  4XTZ A;  3JCM J;  4PJO B;  4C92 C;  2DVE A;  5CAI A;  2EJF A;  3GIB A; 
#chains in the Genus database with same CATH topology
 1K73 R;  3O8V A;  4M7A B;  2LJ0 A;  1K8A R;  5A0D A;  1VQ9 A;  4M75 D;  2K4Y A;  2BKD N;  2PZ1 A;  4HXJ A;  3WVE B;  2RHY A;  3CPF A;  2CP2 A;  3LGL A;  4QQ6 A;  2X9H A;  2MI6 A;  2J7I A;  3G71 A;  3JCM h;  4II1 A;  4HKE A;  1VQ9 Q;  3C4S A;  2FPD A;  3OS5 A;  4PJO D;  4C92 B;  2HDA A;  4LDU A;  2MOX A;  3A8M B;  4KUI A;  2YSQ A;  3X28 B;  1SRM A;  3FB9 A;  4AG2 C;  4M75 F;  2FVU A;  3HHT B;  4BDY A;  1WQW A;  4J9E A;  1UGV A;  2C0I A;  4B9X A;  3G71 Q;  5FWC A;  1M8M A;  2J6K A;  1QVG P;  3FRN A;  5L8R E;  5EC7 A;  4RCB A;  4M78 A;  3Q1J A;  1ZA2 B;  2DVJ A;  1VQK Q;  4J9F A;  5I2S A;  5LJ3 g;  1SKU B;  1TUD A;  1OI1 A;  5LJ3 f;  4R56 A;  1YBY A;  1Y7X A;  2K9G A;  2QDY B;  1IZ6 A;  4A63 B;  1IXD A;  2K3X A;  2B86 A;  4J9I A;  1JEG A;  1PCX A;  4EMH A;  4F7U B;  1EZZ B;  2K3Y A;  3A8G B;  4Z88 A;  2VUB A;  2WSC E;  3M0U A;  2P0Q A;  4JRP A;  5GAN d;  1X2K A;  2DBM A;  4XTU A;  1M90 U;  3CC7 T;  2GQI A;  2P4T A;  4XTZ A;  1KD1 U;  4GY5 A;  1PM3 A;  1H3H A;  2PTK A;  5KYY A;  3EG2 A;  5KCH A;  4ZGE B;  3PVL A;  1SEM A;  2DXU A;  5KE2 A;  4FT4 A;  2L0A A;  2ZPB B;  5AYF A;  5L23 A;  1X69 A;  1CSK A;  2F69 A;  4PK4 A;  3R6N A;  2DZC A;  2LCS A;  4X9C A;  5I2M A;  2MF2 A;  2RJE A;  3LWI A;  1OU9 A;  2YWW A;  2W10 A;  1G83 A;  2KR3 A;  3X24 B;  1M2O A;  1AWO A;  3DLL A;  3A8L B;  2VYT A;  3S6W A;  3I56 T;  1FWZ A;  2ED0 A;  2YLC A;  4XU0 A;  1YJ9 T;  1VQP T;  1YCY A;  1UHC A;  2LTO A;  4N4I A;  2DL5 A;  4F17 A;  2DE0 X;  2JZ2 A;  4MZP A;  4IKF A;  4J9C A;  1K1Z A;  5CK9 A;  3CCS A;  1Q86 C;  2EQU A;  4E6R A;  1AOJ A;  3QDF A;  5IT9 E;  2KDS A;  1JJ2 A;  1WHM A;  3UWN A;  1QP3 A;  4OMO A;  4KBM B;  4OMQ A;  3GP8 A;  1UGS B;  3HFN A;  3L2U A;  2PNI A;  5IXF A;  3CCS Q;  3OYG A;  4EPC A;  3E19 A;  3JRZ A;  1UEB A;  2F2X A;  1FMK A;  2JJ9 A;  4OB2 B;  2EFI A;  1BBZ A;  1MND A;  2GTJ A;  1ZQ1 A;  5FU7 C;  2DKG A;  2O4X A;  4M7D A;  5C0M A;  1YHQ A;  2BZX A;  1M90 R;  2E4H A;  2IPO B;  4OML A;  4XTX A;  3JB9 G;  1M1F A;  4HT8 A;  2D8H A;  1KD1 R;  2VAS A;  1GCQ C;  4EIK A;  4J9D A;  1T3L A;  4E7S A;  5CO7 A;  4GLK A;  1WHG A;  3UT1 A;  2CP5 A;  3QUI A;  5A2Q E;  5LJ3 h;  3EG9 B;  5GAO m;  1JO8 A;  1FMW A;  4E2F B;  3PIO A;  1K9A A;  2LP5 A;  1VQ5 A;  2ENM A;  1YHQ Q;  1RAC B;  1JU5 C;  2P84 A;  2E1H A;  1PNJ A;  3CBM A;  4MDW A;  1BK2 A;  4E7I A;  1NBE B;  2VB6 A;  2DJQ A;  3G4S T;  1WZO A;  5GAN 5;  1W6X A;  4JLI A;  4KH0 B;  3LGF A;  4C8Q C;  2JM8 A;  4RTW A;  1VQ5 Q;  4M78 B;  1A0N B;  5CKH A;  2BZY A;  2ECZ A;  1QCN A;  1E6G A;  1KG1 A;  4PJJ A;  4BY6 C;  4Y92 A;  2RJF A;  1QVF A;  1SHF A;  3QKJ A;  3VJP A;  4XK8 E;  4OP0 A;  2R58 A;  2E6Z A;  2V8J A;  2B8A A;  2CSI A;  3DB3 A;  5IAY A;  2Y90 A;  1M27 C;  3PFS A;  1NLP C;  3DKM A;  2FZC B;  2L3S A;  2VGN A;  3PNW C;  1KHI A;  2HCK A;  4DBH A;  1Q95 G;  1LOJ A;  2LJ1 A;  4JDS A;  5GAM j;  1VQN A;  4J9B A;  1NPP A;  2MWP A;  2HMA A;  5I21 A;  2RQW A;  4M77 C;  4PFZ A;  1B07 A;  4XAX B;  5KYY B;  2FL7 A;  3M0R A;  2VXF A;  1Y96 A;  3M0S A;  5GAO l;  2AK5 A;  3N5B B;  1UEC A;  3CCR T;  3JB9 D;  3CXC P;  1V1C A;  1K76 A;  3M9Q A;  2MMP A;  4QVD A;  4FU6 A;  2BUD A;  1LCK A;  2M0Y A;  5KH6 A;  3QZ5 B;  4PJO E;  4IUV A;  1K4U S;  2IIM A;  3H6Z A;  3URG A;  1Y71 A;  5CKD A;  4ESR A;  3NTK A;  4C0D B;  1BU1 A;  2L8D A;  3OYY A;  1X6O A;  4D8K A;  2DO3 A;  2F2W A;  5FRM A;  3KBG A;  4KUD K;  1JXM A;  3EGX B;  2J6F A;  1YWO A;  3A1P A;  3EH1 A;  3F70 A;  4OMM A;  3RMQ A;  1QKX A;  5IHK A;  3MP8 A;  1M2V B;  5IXB A;  2LQW A;  2WSE E;  4PJM A;  2GTO A;  1WPY A;  3JB9 F;  3ZL7 C;  2OAU A;  1AZE A;  2FEI A;  1WJR A;  3I55 T;  1WI7 A;  4ELY C;  2COY A;  3SWN A;  5FRN A;  1UDL A;  2MYS A;  5GAN g;  3SEM A;  2CYZ B;  1YIJ T;  5GAN f;  2M1H A;  2DTO A;  4M7A A;  2RHI A;  1TH7 A;  2DD4 A;  5LJ5 j;  3HL8 A;  4N0A C;  3OYH A;  5FWB A;  3M53 A;  2JVV A;  2PVO B;  2JS2 A;  2DLP A;  2DIL A;  1X2Q A;  2QDL A;  4M75 A;  3OS0 A;  4M7D B;  3MPU B;  1KQS A;  5GAN 2;  3IQL A;  2PUO B;  5KYW B;  4CI0 C;  3ZEH A;  3CD6 A;  3TCJ A;  2EKH A;  2J06 A;  3I5S A;  5J39 A;  3CCV T;  3C0C A;  1GRI A;  2D0Q B;  1AEY A;  3RDV A;  2DBK A;  3JAM E;  2Y4X A;  4A4K A;  3CC7 A;  3OW2 A;  1AHJ B;  2DYI A;  3CCM T;  3VUB A;  3CD6 Q;  1TS9 A;  3NPF A;  2RHX A;  3FLG A;  2KYM A;  2CP6 A;  3M5A A;  2MCN A;  4A54 A;  2PVD B;  3MJX A;  2HNI A;  5D6Y A;  2LNV A;  2YRD A;  3EFO A;  3CC7 Q;  1WXU A;  3AT1 B;  2SRC A;  4XU1 A;  2X3X D;  2AKL A;  2E6N A;  1WA7 A;  5I11 A;  3CC2 T;  2D0N A;  1OV3 A;  1G3S A;  4MML A;  2MK5 A;  3I5R A;  2VXE A;  4LUE A;  2ZZD A;  3I56 A;  4JJD A;  2JOY A;  1CKA A;  1VQP A;  2XHC A;  5GAM d;  3H0H A;  1VQL T;  4AG1 C;  4JRI A;  2H8H A;  1MHN A;  1K9M C;  3BE3 A;  3JCM b;  3M56 A;  4J6X A;  4LE9 A;  2HZY A;  3M4Y A;  3OS1 A;  4X1V A;  3RR6 A;  2OX7 A;  4R0K A;  3I56 Q;  2XU8 A;  3SD4 A;  5GAN 7;  2FYK A;  2DIQ A;  2E5K A;  3SWN C;  1VQP Q;  3OMC A;  4IUP A;  3QWX X;  5GAO n;  3L2Z A;  4XQ3 A;  4M7A C;  3QXE B;  3VS4 A;  1GCP A;  2KXD A;  4PJO G;  3NTH A;  5FRO A;  3UA7 A;  1JJ2 S;  1HJD A;  4E47 A;  3L2R A;  1Q82 R;  3QJ6 A;  4OMN A;  1Q7Y C;  1G2B A;  3MET A;  1AWX A;  1TXQ A;  4F14 A;  4E7J A;  4OB3 B;  4KT0 E;  4PKC C;  3FEO A;  4FW1 A;  1VQ7 T;  4FM4 B;  5GAN h;  5GMK j;  4DBF A;  2LNH B;  2K5F A;  3C12 A;  4C5I A;  5CIU A;  4Z89 A;  4BI3 A;  4C92 C;  5KCO A;  1TUG B;  1MV3 A;  2RJD A;  2CP3 A;  4CC7 A;  5KYN A;  2OI3 A;  3EFS A;  2M16 A;  1UJY A;  2XIC A;  2L3R A;  2A36 A;  5LJ5 d;  2JT4 A;  2RQU A;  1O9S A;  2ZCF B;  1M1K C;  4HCC A;  3OYL A;  1C6V X;  3CCQ T;  1YI2 A;  5IH2 A;  4J8O A;  3VS0 A;  1Q86 U;  3CBO A;  2DL4 A;  2RHU A;  2P0P A;  1KC8 C;  4RTV A;  1ZHI A;  3KFV A;  1ZUU A;  2QEX T;  4M75 B;  2L2P A;  4FYX B;  4DQ2 A;  2CP7 A;  1UGR B;  4XTW A;  2EJG A;  4J5Y A;  3HRU A;  2X51 A;  3CMA Q;  2NUP A;  3MP1 A;  3LW5 E;  4B6M A;  3VS5 A;  1YI2 Q;  2RPN A;  2V1Q A;  1QVF S;  4J6Y A;  2A7Y A;  2JN0 A;  1W70 A;  3EG9 A;  2NYS A;  3HRS A;  3NGP A;  2RB6 A;  2KE9 A;  4C8Q E;  1QWF A;  2KVQ G;  1X6B A;  1Y07 A;  3HTR A;  1OPL A;  1N6A A;  1X01 A;  1UGQ B;  2LCC A;  3OY9 A;  2DK3 A;  3OYB A;  4D8D A;  2QAZ A;  1QCO A;  3CCR A;  1DJ7 B;  2K2V A;  4Y28 E;  3EFO B;  2K5I A;  2RQR A;  2X4Y A;  4BB7 A;  3L2Q A;  1K73 C;  3FIF A;  3QDR B;  3GF5 A;  3QG1 A;  3CCL T;  2MAM A;  3CBP A;  4AT1 B;  2DF6 A;  3M0P A;  4O5V A;  1T3S A;  4AFZ C;  4PJO F;  2EQI A;  3CCR Q;  2DER A;  3BFM A;  1YNZ A;  2RQT A;  2X3W D;  2C06 A;  1SF9 A;  4QKU A;  2QA4 A;  4CC2 A;  1G5V A;  4Q5W A;  4M77 E;  1OX8 A;  1BB9 A;  4E7Z A;  1WGS A;  3BW1 A;  4FSS A;  4C0F A;  1VQM T;  4HCZ A;  2ED1 A;  2KYB A;  2EYQ A;  3QII A;  1Y0M A;  5LJ3 e;  4XTV A;  3I55 A;  1Q86 R;  2E64 A;  2KAF A;  3E9F A;  1N8R C;  2H3E B;  1RAE B;  2ZPE B;  1BCM A;  1N9R A;  3RIR A;  1IHW A;  2OTJ A;  2QA4 Q;  2D9T A;  4NS5 A;  4RTZ A;  4O6J A;  1M1G A;  1NYG A;  3I55 Q;  3QO3 A;  3PVQ A;  4Z8A A;  2R57 A;  5HY6 A;  1S72 A;  4MDX A;  2V8K A;  3CCU T;  2OTJ Q;  4OB0 B;  2FO0 A;  4GBQ A;  3OYJ A;  3EGX A;  5I22 A;  3CCV A;  2QQS A;  1BCO A;  2X4W A;  1GBQ A;  3X20 B;  5HK0 A;  3H0I A;  1M2V A;  2R5A A;  1Q81 C;  3FJP A;  2EJ9 A;  2F1L A;  2QTV A;  1C1A A;  1VYV A;  1WDX A;  2QTX A;  1TG0 A;  3CCM A;  1S72 Q;  5GMK i;  5GAM g;  1D09 B;  1VQ4 T;  2O88 A;  2YLB A;  2DXT A;  4V2S A;  5GAM f;  3CCV Q;  4JJN K;  2LT1 A;  3JCM Q;  3NHN A;  3OW2 S;  1WHK A;  4M78 C;  3H9N A;  2W0Z A;  3ZBD A;  4KGV B;  3CC2 A;  3CC4 T;  1M30 A;  2ZPH B;  1NG2 A;  1YIT T;  3SDZ A;  1ZBJ A;  2GGR A;  4CRI A;  3D7S B;  3REB B;  2EWN A;  3DLM A;  4IUU A;  1WYX A;  2CZ0 B;  1VUB A;  2RQV A;  5KYW A;  2CZ1 B;  1UHF A;  2HEQ A;  3JCM W;  2JUF A;  2NUP B;  2JNG A;  3CC2 Q;  1WQ7 A;  1YN8 A;  1LPL A;  2E5Q A;  2QQ9 A;  3FDR A;  3OYA A;  2AIR B;  3BDL A;  2HQE A;  3TQ7 P;  3GNF B;  4C8Q G;  2E10 A;  1O75 A;  3M55 A;  2CSQ A;  1SSF A;  1IO6 A;  4HT9 A;  3VU3 C;  2DPP B;  1FXX A;  3V7R A;  2AZV A;  1RAG B;  1BI3 A;  2A28 A;  3EFR A;  2A08 A;  2HAX A;  4DOV A;  2FZK B;  5D7U A;  4WTO B;  4GLM A;  2LMJ A;  1P92 A;  3EG1 A;  3M57 A;  4C0D C;  2EQM A;  5LJ5 g;  4ZNX A;  1ACM B;  4QW2 A;  2D1X A;  1TOV A;  5LJ5 f;  1FX7 A;  3H0F A;  3QZ9 B;  1VQ7 A;  2LDM A;  2P4R A;  3S3N A;  1M90 C;  5FW9 A;  1ZUK A;  4ZN3 A;  2HSP A;  2EQJ A;  2YRV A;  3V7S A;  1ARK A;  5CVI A;  5LL6 S;  2ZPG B;  1RAI B;  2VV5 A;  4M77 G;  3V8J A;  2XID A;  3OYI A;  1M8V A;  1KIK A;  1MMG A;  2HL3 A;  2CUD A;  5J26 A;  1FMV A;  2L3P A;  2EJF A;  3GIB A;  2KBT A;  1VQ7 Q;  2E3H A;  1W2B A;  2KGT A;  2XMF A;  5AT1 B;  5IN1 A;  2LZ6 B;  4JPB W;  2LCL A;  3V8L A;  3CPW A;  3CCQ A;  1VQK T;  1IHV A;  1BKB A;  5CCA A;  1VQN Q;  1U1S A;  1JJ2 P;  1K9M U;  3M59 A;  5CKF A;  5GMK m;  2F5K A;  4M7D C;  2COW A;  2JW4 A;  4DOW A;  5GAM h;  5DLQ E;  1KQ1 A;  4L59 A;  4C8Q D;  1XTD A;  2DFU A;  2FPE A;  4RG8 A;  4IIO A;  3CCQ Q;  2QQB A;  3QPH A;  5GAN 6;  4HCB A;  1PSE A;  4JRK A;  1ZSZ A;  4A4F A;  2DA9 A;  4KUL A;  3BDU A;  1VQ8 T;  1KSW A;  1I07 A;  2KXC A;  2O01 E;  2GFU A;  4QQG A;  4HVV A;  1Q7Y U;  2YUO A;  4C0Z A;  4N4G A;  2EAY A;  1SG5 A;  1NJI U;  2ATC B;  1T0J A;  1Y57 A;  4C5G A;  2HBW A;  3OSS C;  4YTL A;  3VS6 A;  2CT3 A;  1MMN A;  3PTA A;  1VIF A;  4C8Q F;  2J05 A;  1D0X A;  1WHJ A;  3RBB B;  2XDD A;  2I0N A;  2NLU A;  4KGX B;  4FYV B;  4F7U E;  4IUQ A;  1I5O B;  3RMS A;  1NYF A;  4M77 D;  3VUZ A;  3CCL A;  2RM4 A;  4ELZ C;  5GAN 3;  1OUL A;  2X4J A;  1WNL A;  2EGC A;  4TVR A;  2QGF B;  3MEU A;  2JTE A;  3R6O A;  1VOM A;  2QGG A;  1TSF A;  1HYO A;  2QYZ A;  3EH2 A;  5GMK l;  1TWB A;  2LJ3 A;  4AFQ C;  3U23 A;  1M1K U;  5GAN e;  3CCL Q;  1QVF P;  1WX6 A;  2XDB A;  1H92 A;  2D6F A;  1VQM A;  5LJ5 h;  3OYE A;  1MUZ A;  2RMO A;  5EG2 A;  4JZ3 A;  4PJO A;  1KC8 U;  2ZPI B;  1I8F A;  2DXC A;  3QWY A;  4M77 F;  1CKB A;  3CCS T;  4IIM A;  1G8X A;  3CEY A;  2NUT A;  1UGP B;  2CGH A;  2ZPF B;  3OYF A;  2HL5 C;  1RLQ C;  2RHZ A;  1OYX A;  2EW3 A;  1VQM Q;  3UF4 A;  5KE3 A;  4QQD A;  1RAB B;  2EYW A;  3I35 A;  3I9Q A;  2DXB A;  3QHS A;  2SEM A;  3OQ5 A;  2AZS A;  4FL6 A;  3L2W A;  2AHJ B;  2RH2 A;  3CME T;  4CC4 B;  3O5Z A;  3VYG A;  3L42 A;  3BY7 A;  3E9G A;  3V7C A;  1T0H A;  1D3B B;  1YJ9 A;  4OGC A;  4L5G A;  4RTY A;  1HXD A;  4ANJ A;  4NL2 A;  3CQT A;  4ZTF A;  3SHW A;  1M5Q 1;  1UTI A;  2DM1 A;  4LD9 K;  1AD5 A;  1NJI R;  2OJ2 A;  2DEQ A;  1X6G A;  3C94 A;  4JRQ A;  1WXT A;  2DRK A;  1ABO A;  4BE0 A;  1VYU A;  3ME9 A;  1YHQ T;  5D6W A;  1D1B A;  4AMC A;  2E41 A;  2JMC A;  4C0G A;  4M7A G;  1GBR A;  3E1S A;  2KK4 A;  3OSV A;  3OBY A;  1K73 U;  3JCM e;  2JM9 A;  1YJ9 Q;  1H8K A;  3KUF A;  2P0K A;  1N9S A;  3MEV A;  2BE9 B;  2OAW A;  4LNP A;  3OMG A;  4J9H A;  3ULR B;  4A4E A;  3MP6 A;  2RO0 A;  1QMC A;  1QVG A;  4ME7 A;  1VQ5 T;  4JLG A;  3QYH B;  2Y4Y A;  3HKS A;  5FU6 B;  2LRQ A;  3L2V A;  1D0Z A;  2ROL A;  3EG3 A;  2OTL T;  4QVZ A;  4M75 C;  3REA B;  5GJW B;  1MGQ A;  1HD3 A;  1BIB A;  2KSS A;  1BYM A;  5FLX E;  4C92 G;  2V26 A;  2YT6 A;  2MIO A;  4ATO A;  3VS3 A;  5IHN A;  2G3R A;  3VS2 A;  4RMO A;  1IB8 A;  1N8R U;  3H8Z A;  2VGM A;  3FC3 A;  2VKN A;  1QVP A;  1ZSZ B;  3EHR A;  3X25 B;  1N27 A;  4ZGJ B;  2EQK A;  1KFZ A;  2CUB A;  4N4H A;  1KQS P;  2ROT A;  1RI0 A;  2DL7 A;  2M0O A;  4XU3 A;  3NFC A;  3TEE A;  2YHT A;  1ZUY A;  3G4S A;  1RLP C;  4VUB A;  1GL5 A;  1JB0 E;  3JB9 I;  2ESW A;  3OYK A;  3H41 A;  1M3A A;  4BAC A;  2O9S A;  5GMK h;  1B3Q A;  3OW2 P;  1X75 C;  1QQJ A;  3SFM A;  4BE2 A;  2FRW A;  2LX7 A;  1K0S A;  2DTH A;  4F7U G;  4B9W A;  4HA8 A;  1XOV A;  2YUN A;  3OS2 A;  1B34 A;  1Q82 C;  1Q81 U;  2R5M A;  3QBY A;  4J7I A;  3G4S Q;  2XK0 A;  1PWT A;  2COZ A;  4M7A D;  1YCS B;  3E2U A;  2QQR A;  2DNU A;  1K0X A;  4LDY A;  2V1R A;  3QJY A;  3PIP A;  4MZM A;  3OYM A;  1JQQ A;  5GJV B;  3THK A;  4FT2 A;  3HP9 A;  3A5Z B;  2BE7 D;  4BUG A;  1PD0 A;  2LQK A;  3MKD A;  2DJZ A;  2K5L A;  4PJO B;  1G3Y A;  2KMT A;  3OA6 A;  1QKW A;  4EMK B;  1VQ6 T;  2YRC A;  5D6X A;  2V8I A;  4C92 D;  3TSW A;  1YJN T;  2H3J A;  5A0L A;  1YJW T;  4M7A F;  2NUT B;  5GAO q;  4BI8 B;  2GF7 A;  5M9O A;  1VQK A;  1W2B S;  3VS7 A;  4BDZ A;  2HQH A;  1N8R R;  1WJS A;  1XJW B;  1NLO C;  3M0T A;  1K8A C;  4X34 A;  1VYT A;  3VKI A;  2EYZ A;  3GNG A;  3RUX A;  1I81 A;  4R55 A;  3CPW S;  4LXC A;  2K2M A;  2CKK A;  3T9N A;  1AWW A;  4RKU E;  3VYH B;  3MO8 A;  4C5H A;  5ECA A;  2PVG B;  4M4Z A;  2JXB A;  4KH1 B;  4NL3 A;  1M3C A;  2DMO A;  4HCK A;  2RJC A;  3AHU A;  3J7A F;  1ZA1 B;  3KXT A;  4C92 F;  1I0C A;  3J81 E;  2DTI A;  1VQ8 A;  1V76 A;  1YP5 A;  4L6V 5;  8ATC B;  2XD0 A;  4HVU A;  4HVW A;  4AFU C;  1UB4 A;  1R0B G;  1I5L A;  3GPL A;  3CD6 T;  3JSC A;  5GAN 4;  4FYY B;  2CZ6 B;  1GCQ A;  1TTH B;  1Q81 R;  1UUE A;  1G3W A;  2KT1 A;  4OF1 A;  4JUV A;  4M7D E;  1OU8 A;  3MHX A;  2DEU A;  1YIJ A;  1VQ8 Q;  4KRT A;  3J80 E;  2KY9 A;  3VS1 A;  4DEY A;  1VQO T;  4PLL A;  2KT8 A;  3VRY A;  1WJQ A;  3MCA B;  2EYY A;  5GAO r;  2WSF E;  3G6E T;  3MEA A;  1RL2 A;  2CH4 A;  1SSH A;  4FW2 A;  1R77 A;  3GOX A;  1VA7 A;  1NPR A;  1MV0 B;  2DX1 A;  2E12 A;  1YIJ Q;  4F7U F;  2K57 A;  1RUW A;  3TRE A;  1X43 A;  4C8Q A;  4BE1 A;  5IHI A;  3A8H B;  3HFO A;  1NM7 A;  2DVE A;  2QXF A;  1M9S A;  4RTU A;  3L1A A;  5CQX A;  1KQS S;  4X9D A;  1RAA B;  2CT4 A;  3CCJ T;  4M78 G;  3VRZ A;  2M51 A;  3LX7 A;  3PGG A;  2A3L A;  2GNC A;  4NOY A;  2K6D A;  3EGU A;  1XQH A;  3EHQ A;  2LC4 A;  2A0F B;  3NMZ C;  1D1A A;  1R8O B;  1RAD B;  1U8R A;  3HPW A;  2O9V A;  1Z9Q A;  3TVT A;  4J6W A;  3M4G A;  2O2O A;  2QAS A;  3CXC A;  4F16 A;  3RKW A;  2HD0 A;  3RNJ A;  3JCM V;  3CCM Q;  3JCM d;  2KEA A;  1IGU A;  2KI7 A;  1B34 B;  3CME A;  1ZLM A;  4JJB A;  5CQY A;  3UAT A;  1IRE B;  3RKX A;  1Z9Z A;  3OYC A;  4M77 A;  1TU0 B;  2HBP A;  2ZGW A;  3CCE T;  1M3B A;  2CH4 W;  3TSZ A;  2CZ7 B;  3QSU A;  5LJ3 j;  5HK3 A;  1RAH B;  3P8D A;  5GAM e;  2MWO A;  1VQL A;  1PRM C;  2YUP A;  4JZ4 A;  2JTM A;  4OB1 B;  2KRM A;  2HKN A;  2JMA A;  3UDC A;  4PL6 A;  3LWH A;  1WFW A;  3CME Q;  4MZT A;  2LX9 A;  2QI2 A;  2BTT A;  4BI4 A;  1BI0 A;  1AWJ A;  2Z0W A;  3LH5 A;  4Z02 A;  2DL8 A;  1E6H A;  3M58 A;  4XTY A;  4PJL A;  2LQN A;  2PU9 B;  1B7T A;  4EDU A;  3JB9 J;  3OB9 A;  1VQL Q;  1OQK A;  2KQW A;  1UE9 A;  2EIF A;  2KRS A;  3X26 B;  3GBQ A;  1ABQ A;  2G6F X;  2F2V A;  2DIG A;  4QT7 A;  3HSB A;  1MNE A;  2OTL A;  2AT1 B;  3JV3 A;  4LD6 A;  3EGD A;  2XI9 A;  3JCM J;  4WF2 A;  3PE0 A;  1IGQ A;  2EGE A;  2CP0 A;  2EGA A;  1QVG S;  4M78 D;  4BD3 A;  1D3B A;  3CMA T;  2CRE A;  1YI2 T;  1QP2 A;  1QW1 A;  2ABL A;  1KD1 C;  1S1N A;  4FSX A;  2OTL Q;  1VQ9 T;  1PD1 A;  2DAQ A;  4N0A A;  1PKS A;  2RI5 A;  1D0Y A;  3UPU A;  5GAO p;  6AT1 B;  1UG1 A;  4PLI A;  1AZG B;  4M7A E;  5FU7 B;  4E7K A;  3VV0 A;  3P8B B;  1V29 B;  4AFS C;  1JBM A;  4LUD A;  3LH0 A;  3JCM P;  1UFF A;  1YFN A;  1QWE A;  5LJ5 e;  4M7D G;  3G71 T;  4ZN1 A;  4M75 E;  3P8H A;  2MPX C;  4M78 F;  2RK1 A;  5CKE A;  5DM7 R;  1W1F A;  2DL3 A;  2EPD A;  3JCM X;  2LQ8 A;  9ATC B;  2J6O A;  3G1J A;  2KRN A;  3TU4 K;  3S3M A;  2O31 A;  1U3O A;  4MMK A;  2QEX A;  2GBQ A;  2FRY A;  4C92 E;  1OEB A;  1WXB A;  3EAE A;  2RD1 A;  4PFP A;  1EX4 A;  1MMD A;  4K11 A;  2VVK A;  4XU2 A;  3UA6 A;  3FJ5 A;  1I4K 1;  2FB7 A;  3QYG B;  4C8Q B;  2VWF A;  1FYN A;  1PC0 A;  2K3B A;  2IG0 A;  3SB2 A;  4FIB A;  2CS7 A;  2E65 A;  2XG8 D;  2QEX Q;  1U1T A;  2L89 A;  2X35 A;  2RA2 A;  4A4H A;  4BY6 B;  4D6W A;  2YDL A;  1VIE A;  1F1B B;  2RF0 A;  3M54 A;  1W4S A;  2BZ8 A;  2FG0 A;  3RKY A;  3G7Z A;  5KYX A;  1VQ6 A;  2GFA A;  2BIV A;  1YJN A;  4RCC A;  2QA4 T;  2C0T A;  2ZAE A;  1QCF A;  1YJW A;  5KYU A;  1NEG A;  1BIA A;  1OX9 A;  5C6S A;  2EYX A;  1XNI A;  3RER A;  5HKC A;  3EG0 A;  2DRM A;  3PMI A;  5LJ3 d;  3DB4 A;  3MEW A;  1AVZ C;  5GAN 8;  1GFC A;  2RNA A;  1JRI A;  1ZSG A;  1PSF A;  4P5N A;  4EMG A;  2HQX A;  2RK2 A;  3C95 A;  1VQ6 Q;  4LDW A;  1YWP A;  2GQV A;  1RAF B;  1MMA A;  4M77 B;  1YJN Q;  4JJC A;  2OTJ T;  2RI3 A;  3A98 A;  2LVM A;  4KGZ B;  1YJW Q;  4DA4 A;  4E7L A;  4JS5 A;  4M7D D;  5DY9 A;  2NUZ A;  4PNO A;  1N5Z A;  4QVC A;  1PKT A;  2O4X B;  1GFD A;  2DYB A;  3ER0 A;  1S72 T;  1UJ0 A;  2I2L A;  5CR2 A;  1BI1 A;  2XDP A;  4PJN A;  2E3I A;  1TUC A;  1Q82 U;  1K9M R;  2L5Q A;  4EMK A;  2C0O A;  3LYI A;  5J3B A;  4OGE A;  4UC4 A;  3HRT A;  3RES A;  2DET A;  1WLP B;  2FHD A;  5FU6 C;  3OYD A;  2EKO A;  4C92 A;  1JXO A;  4IUT A;  1LNX A;  1RI9 A;  1VQO A;  4LN2 A;  1W2B P;  4LDX A;  2X4X A;  2FPF A;  5A0G A;  1E7O A;  5GMK e;  2KRO A;  3EGD B;  4M7D F;  3ZFJ A;  3G6E A;  1OPK A;  4IUR A;  4J9G A;  2DD5 A;  4DEX A;  1KK7 A;  4J83 A;  3CCU A;  3CPW P;  4DBQ A;  2HKQ B;  4RTX A;  4OVA A;  1Q7Y R;  3JB9 H;  2LT4 A;  3JCM g;  1HSQ A;  1ZSZ C;  4Y91 A;  1PHT A;  1VQO Q;  2KNB B;  3JCM f;  1NEB A;  4PFO A;  7AT1 B;  1BI2 A;  1X27 A;  3JCM c;  3CCJ A;  3G6E Q;  4OMP A;  4RG2 A;  4ORZ A;  3CCU Q;  1KQ2 A;  2E70 A;  1U06 A;  1VQ4 A;  1K8A U;  1R0C B;  4LDV A;  4A4G A;  4F7U A;  4M75 G;  1QLY A;  1SHG A;  1LJO A;  1U5S A;  2D8J A;  2PUK B;  2IVW A;  1H3Z A;  1C0M A;  4F04 B;  8AT1 B;  3PT9 A;  4FCY A;  4E7H A;  3CCJ Q;  3GLX A;  2GCX A;  3M0Q A;  1ZBX A;  3OBW A;  1EIF A;  1D1C A;  3CC4 A;  2F5T X;  3S3O A;  1YIT A;  1NE8 A;  1VQ4 Q;  2EBP A;  5GAN j;  2XKO C;  2WAC A;  1M1K R;  5CKB A;  2M02 A;  4J7F A;  1OZ2 A;  1HK9 A;  2PQW A;  1EFN A;  1WHH A;  3CXC S;  3CCE A;  2EVR A;  1Y96 B;  2K79 A;  4RTT A;  2JTF A;  4OMF B;  4WCI A;  1PG5 B;  4JS4 A;  2QK0 A;  4RUG A;  2VC8 A;  1KC8 R;  5DLO A;  3WVD B;  3A8O B;  3CC4 Q;  3OYN A;  2NWM A;  1G3T A;  1YIT Q;  4ZTJ A;  1J3T A;  2QG9 B;  1NZ9 A;  2QQA A;  1NJI C;  1WIE A;  1KHC A;  4PJO C;  1GXI E;  4FYW B;  2HSE B;  5HCK A;  1LVK A;  4M78 E;  3CCE Q;  4EMK C;  2FZG B;  2A37 A;  1SPK A;  3ASK A;  1ZX6 A;  4DBR A;  5KYX B;  1KJW A;  2M9U A;  2RI2 A;  2L3Q A;  1M4Z A;  4CC3 A;  2DZ9 A;  1OOT A;  2YXY A;  5KYU B;  3LLR A;  2YUQ A;  1AT1 B;  1WHL A;  1VQN T;  1SRL A;  1IRX A;  3PMT A;  1OZ3 A;  3WXM B;  2CDT A;  2JS0 A;  1PRL C;  4ZGD B;  4C5E A;  4A53 A;  3INZ A;  3SWN B;  2K7A A;  3NTI A;  1H64 1;  1I1J A;  2RN8 A;  3CMA A;  3V8K A;  5CAI A;  2AKK A; 
#chains in the Genus database with same CATH homology
 1M9S A;  3O8V A;  3L1A A;  4A54 A;  5CQX A;  1KQS S;  4M7A B;  2PVD B;  4X9D A;  2HNI A;  1W2B A;  3CCJ T;  5A0D A;  4M78 G;  5D6Y A;  2LNV A;  3LX7 A;  1VQ9 A;  4M75 D;  3PGG A;  2A3L A;  5IN1 A;  4NOY A;  2K4Y A;  4XU1 A;  2E6N A;  2BKD N;  2LCL A;  3V8L A;  3CPW A;  3CC2 T;  1XQH A;  3WVE B;  2RHY A;  3CCQ A;  3CPF A;  2LC4 A;  1R8O B;  1VQK T;  1U8R A;  3LGL A;  4QQ6 A;  1BKB A;  1G3S A;  4MML A;  1U1S A;  5CCA A;  1K9M U;  3M59 A;  5CKF A;  5GMK m;  2VXE A;  3HPW A;  2F5K A;  2ZZD A;  3I56 A;  4M7D C;  2MI6 A;  4J6W A;  3M4G A;  3CXC A;  2JOY A;  3G71 A;  3RKW A;  3JCM h;  2HD0 A;  4II1 A;  4DOW A;  4HKE A;  3JCM V;  5GAM h;  1VQP A;  3JCM d;  5DLQ E;  2XHC A;  3C4S A;  5GAM d;  3OS5 A;  1VQL T;  1KQ1 A;  4PJO D;  4JRI A;  4L59 A;  1B34 B;  1MHN A;  4C8Q D;  4C92 B;  1K9M C;  3CME A;  3JCM b;  1XTD A;  3M56 A;  4J6X A;  4LDU A;  3A8M B;  4KUI A;  4RG8 A;  5CQY A;  1IRE B;  3RKX A;  3X28 B;  3OYC A;  4M77 A;  3M4Y A;  3T9N A;  3OS1 A;  3FB9 A;  2HBP A;  2ZGW A;  3CCE T;  2QQB A;  3QPH A;  5GAN 6;  4HCB A;  2CZ7 B;  3QSU A;  4M75 F;  5HK3 A;  5LJ3 j;  2FVU A;  3HHT B;  3P8D A;  4BDY A;  1PSE A;  4JRK A;  2XU8 A;  3SD4 A;  1WQW A;  2FYK A;  5GAN 7;  2DIQ A;  5GAM e;  4A4F A;  4B9X A;  3SWN C;  2MWO A;  1VQL A;  4KUL A;  3BDU A;  1VQ8 T;  3OMC A;  2JTM A;  4OB1 B;  4IUP A;  3FRN A;  5L8R E;  4RCB A;  2O01 E;  3UDC A;  2GFU A;  4M78 A;  3Q1J A;  4PL6 A;  4QQG A;  5GAO n;  3LWH A;  1Q7Y U;  3L2Z A;  4XQ3 A;  4C0Z A;  5I2S A;  5LJ3 g;  4MZT A;  4N4G A;  4M7A C;  2EAY A;  1OI1 A;  2LX9 A;  3QXE B;  2QI2 A;  4BI4 A;  1BI0 A;  4PJO G;  1NJI U;  3NTH A;  5FRO A;  1JJ2 S;  5LJ3 f;  4R56 A;  4Z02 A;  4E47 A;  3M58 A;  4XTY A;  3L2R A;  4C5G A;  1YBY A;  3OSS C;  2PU9 B;  1Y7X A;  3QJ6 A;  1Q7Y C;  3MET A;  4YTL A;  4EDU A;  3JB9 J;  2QDY B;  3OB9 A;  1VIF A;  3PTA A;  4C8Q F;  1IZ6 A;  4E7J A;  2KQW A;  2XDD A;  2EIF A;  2NLU A;  2K3X A;  4OB3 B;  4KT0 E;  3X26 B;  4PKC C;  4F7U E;  4IUQ A;  3RMS A;  4EMH A;  3FEO A;  4M77 D;  4F7U B;  3VUZ A;  3CCL A;  1VQ7 T;  2RM4 A;  2K3Y A;  3A8G B;  4FM4 B;  4ELZ C;  2VUB A;  5GAN h;  2WSC E;  2X4J A;  5GAN 3;  2P0Q A;  5GMK j;  2DIG A;  4JRP A;  1WNL A;  2OTL A;  5GAN d;  3HSB A;  4XTU A;  4LD6 A;  1M90 U;  3CC7 T;  2K5F A;  3C12 A;  4C5I A;  5CIU A;  4TVR A;  2P4T A;  2XI9 A;  3MEU A;  4WF2 A;  4XTZ A;  3JCM J;  3R6O A;  4BI3 A;  4C92 C;  1KD1 U;  4GY5 A;  5KCO A;  1QVG S;  2RJD A;  4M78 D;  5GMK l;  4BD3 A;  1D3B A;  3EFS A;  3CMA T;  2M16 A;  5KCH A;  4ZGE B;  1M1K U;  2DXU A;  2XIC A;  5KE2 A;  4FT4 A;  5GAN e;  2XDB A;  1YI2 T;  1QP2 A;  2ZPB B;  2L3R A;  1QW1 A;  1KD1 C;  2D6F A;  1VQM A;  5AYF A;  5LJ5 h;  3OYE A;  4FSX A;  2F69 A;  1VQ9 T;  5LJ5 d;  5EG2 A;  2DAQ A;  2DZC A;  4N0A A;  4PJO A;  1O9S A;  2RI5 A;  2ZCF B;  4X9C A;  1KC8 U;  2ZPI B;  3UPU A;  5I2M A;  1M1K C;  4HCC A;  1I8F A;  2MF2 A;  5GAO p;  2RJE A;  3OYL A;  2DXC A;  3LWI A;  4PLI A;  3CCQ T;  4M77 F;  4M7A E;  5FU7 B;  3CCS T;  3VV0 A;  4E7K A;  3P8B B;  1YI2 A;  4PJO E;  1V29 B;  4J8O A;  1JBM A;  3X24 B;  3CEY A;  1Q86 U;  3DLL A;  1UGP B;  3CBO A;  3LH0 A;  3A8L B;  3JCM P;  2CGH A;  2RHU A;  2ZPF B;  2P0P A;  2VYT A;  3S6W A;  3OYF A;  3I56 T;  1FWZ A;  5LJ5 e;  2YLC A;  2RHZ A;  1OYX A;  4XU0 A;  1KC8 C;  3G71 T;  4M7D G;  4ZN1 A;  1YJ9 T;  4M75 E;  1ZHI A;  1YCY A;  4QQD A;  5KE3 A;  1VQP T;  2LTO A;  4N4I A;  2QEX T;  3P8H A;  2DXB A;  4M75 B;  3QHS A;  3V8K A;  4M78 F;  4DQ2 A;  3OQ5 A;  2RK1 A;  5CKE A;  2JZ2 A;  4MZP A;  4FL6 A;  1UGR B;  4IKF A;  4XTW A;  5DM7 R;  3CCS A;  5CK9 A;  2EJG A;  4J5Y A;  1Q86 C;  3L2W A;  3HRU A;  2AHJ B;  2RH2 A;  3JCM X;  3CME T;  2LQ8 A;  2EQU A;  3VYG A;  3L42 A;  3BY7 A;  3E9G A;  3MP1 A;  3LW5 E;  3V7C A;  3TU4 K;  1QVF S;  5IT9 E;  3S3M A;  4J6Y A;  2A7Y A;  1D3B B;  2KDS A;  1YJ9 A;  2JN0 A;  4MMK A;  4L5G A;  4OGC A;  1HXD A;  3UWN A;  1QP3 A;  4NL2 A;  2QEX A;  1JJ2 A;  4ZTF A;  1M5Q 1;  4C92 E;  4KBM B;  3GP8 A;  1UGS B;  3EAE A;  3HFN A;  2RD1 A;  3HRS A;  4LD9 K;  2DEQ A;  2RB6 A;  3L2U A;  3C94 A;  4JRQ A;  4C8Q E;  4XU2 A;  4BE0 A;  1I4K 1;  2KVQ G;  2FB7 A;  3ME9 A;  3QYG B;  1Y07 A;  4C8Q B;  1YHQ T;  5D6W A;  3OYG A;  4EPC A;  2E41 A;  3E19 A;  4C0G A;  4M7A G;  3E1S A;  2KK4 A;  3JRZ A;  1UEB A;  1N6A A;  3OSV A;  1X01 A;  2IG0 A;  3OBY A;  1UGQ B;  3SB2 A;  2LCC A;  3JCM e;  4FIB A;  1K73 U;  3OY9 A;  2DK3 A;  2CS7 A;  4OB2 B;  2E65 A;  3OYB A;  2XG8 D;  2EFI A;  3KUF A;  3CCR A;  2P0K A;  1N9S A;  1DJ7 B;  3MEV A;  1U1T A;  2K2V A;  2L89 A;  2RA2 A;  2X35 A;  4Y28 E;  4A4H A;  4BY6 B;  4D6W A;  1ZQ1 A;  1VIE A;  3OMG A;  3M54 A;  1W4S A;  2K5I A;  2X4Y A;  5FU7 C;  2DKG A;  2O4X A;  4BB7 A;  4M7D A;  5C0M A;  4A4E A;  1YHQ A;  3L2Q A;  3MP6 A;  1K73 C;  3FIF A;  2RO0 A;  3QDR B;  3GF5 A;  3G7Z A;  3RKY A;  1QVG A;  1VQ6 A;  4ME7 A;  4XTX A;  2GFA A;  4JLG A;  1VQ5 T;  3QYH B;  2Y4Y A;  1M1F A;  2BIV A;  3QG1 A;  3CCL T;  3JB9 G;  4HT8 A;  2MAM A;  1YJN A;  4RCC A;  2QA4 T;  3HKS A;  5FU6 B;  2LRQ A;  3CBP A;  3L2V A;  1YJW A;  2OTL T;  4QVZ A;  4O5V A;  4M75 C;  5CO7 A;  4PJO F;  1BIA A;  4GLK A;  1MGQ A;  3UT1 A;  5C6S A;  1XNI A;  3QUI A;  5A2Q E;  3RER A;  1BIB A;  5HKC A;  3BFM A;  5LJ3 h;  2KSS A;  1BYM A;  5FLX E;  4C92 G;  5GAO m;  3PMI A;  5LJ3 d;  3DB4 A;  3MEW A;  3PIO A;  2C06 A;  4ATO A;  1VQ5 A;  5GAN 8;  2G3R A;  1JRI A;  1PSF A;  4P5N A;  4EMG A;  2HQX A;  2RK2 A;  3C95 A;  2QA4 A;  4LDW A;  1G5V A;  4RMO A;  4M77 E;  4Q5W A;  2E1H A;  2GQV A;  3CBM A;  1N8R U;  4MDW A;  3H8Z A;  4M77 B;  2VGM A;  4E7I A;  2OTJ T;  2RI3 A;  1WGS A;  3BW1 A;  4C0F A;  3FC3 A;  1VQM T;  4HCZ A;  2LVM A;  3G4S T;  3GIB A;  1QVP A;  2EYQ A;  3QII A;  5GAN 5;  4ZGJ B;  3X25 B;  4JLI A;  1N27 A;  5LJ3 e;  2EQK A;  4XTV A;  4DA4 A;  3I55 A;  4N4H A;  4E7L A;  3LGF A;  4C8Q C;  4JS5 A;  2E64 A;  2KAF A;  4M7D D;  3E9F A;  1N8R C;  1RI0 A;  5DY9 A;  4PNO A;  2ZPE B;  4M78 B;  1N9R A;  3RIR A;  5CKH A;  2M0O A;  4XU3 A;  3NFC A;  2OTJ A;  4QVC A;  2O4X B;  2YHT A;  3TEE A;  2D9T A;  3G4S A;  3ER0 A;  4NS5 A;  1S72 T;  4VUB A;  1KG1 A;  1JB0 E;  2I2L A;  4O6J A;  4BY6 C;  1BI1 A;  1M1G A;  2XDP A;  5CR2 A;  3JB9 I;  2RJF A;  3OYK A;  1Q82 U;  1QVF A;  4BAC A;  2L5Q A;  3QKJ A;  3VJP A;  5GMK h;  4XK8 E;  4EMK A;  4OP0 A;  2R58 A;  1X75 C;  2E6Z A;  2V8J A;  3QO3 A;  3LYI A;  5J3B A;  3SFM A;  4BE2 A;  2B8A A;  3DB3 A;  5IAY A;  4OGE A;  4UC4 A;  2Y90 A;  3HRT A;  2DTH A;  3RES A;  2R57 A;  4F7U G;  4B9W A;  3PFS A;  2FHD A;  5HY6 A;  4HA8 A;  1XOV A;  5FU6 C;  3OS2 A;  2EKO A;  3OYD A;  1S72 A;  1B34 A;  3DKM A;  4C92 A;  2V8K A;  3CCU T;  4IUT A;  1Q82 C;  4MDX A;  1Q81 U;  1LNX A;  4OB0 B;  2R5M A;  3QBY A;  4J7I A;  1VQO A;  2VGN A;  3PNW C;  3OYJ A;  2XK0 A;  1KHI A;  3CCV A;  2QQS A;  2X4X A;  5A0G A;  4LDX A;  4M7A D;  5GMK e;  2X4W A;  1LOJ A;  2QQR A;  4JDS A;  5GAM j;  1VQN A;  3ZFJ A;  4M7D F;  3X20 B;  3G6E A;  5HK0 A;  4IUR A;  1NPP A;  2DD5 A;  2MWP A;  2R5A A;  4LDY A;  1Q81 C;  3QJY A;  4J83 A;  3FJP A;  2EJ9 A;  5I21 A;  3CCU A;  3PIP A;  4M77 C;  2QTX A;  3CCM A;  4XAX B;  4MZM A;  3OYM A;  4OVA A;  2FL7 A;  3JB9 H;  2LT4 A;  3JCM g;  2VXF A;  5GMK i;  1Y96 A;  5GAM g;  5GAO l;  4Y91 A;  1VQ4 T;  3N5B B;  3HP9 A;  4FT2 A;  3A5Z B;  3CCR T;  2YLB A;  3JCM f;  2DXT A;  3JB9 D;  4V2S A;  4BUG A;  5GAM f;  5CAI A;  2LT1 A;  3M9Q A;  3JCM Q;  4JJN K;  2MMP A;  4QVD A;  2BUD A;  1BI2 A;  2LQK A;  4FU6 A;  3JCM c;  3QZ5 B;  5KH6 A;  3OW2 S;  2DJZ A;  4IUV A;  2K5L A;  4M78 C;  3CCJ A;  4PJO B;  1G3Y A;  2KMT A;  3OA6 A;  4RG2 A;  3H6Z A;  3URG A;  4EMK B;  1VQ6 T;  1Y71 A;  5D6X A;  1KQ2 A;  2V8I A;  2E70 A;  4C92 D;  5CKD A;  1YJN T;  2H3J A;  3ZBD A;  5A0L A;  1VQ4 A;  1K8A U;  3NTK A;  3CC2 A;  3CC4 T;  4LDV A;  1YJW T;  4C0D B;  2L8D A;  2ZPH B;  4A4G A;  3OYY A;  5GAO q;  4F7U A;  1YIT T;  4M7A F;  1X6O A;  4BI8 B;  2GF7 A;  3SDZ A;  4M75 G;  5M9O A;  2DO3 A;  1W2B S;  1VQK A;  5FRM A;  3KBG A;  1LJO A;  4CRI A;  4BDZ A;  2PUK B;  4KUD K;  2IVW A;  1H3Z A;  2EWN A;  3DLM A;  3PT9 A;  4IUU A;  1WJS A;  4E7H A;  2CZ0 B;  1VUB A;  1K8A C;  4X34 A;  3GLX A;  3VKI A;  2CZ1 B;  2GCX A;  3GNG A;  3RMQ A;  3RUX A;  3F70 A;  1I81 A;  4R55 A;  3CPW S;  1ZBX A;  3OBW A;  3MP8 A;  1EIF A;  3CC4 A;  2F5T X;  3S3O A;  2WSE E;  3JCM W;  1YIT A;  2JUF A;  1NE8 A;  1WPY A;  2JNG A;  5GAN j;  3JB9 F;  2CKK A;  1WQ7 A;  2OAU A;  2XKO C;  2WAC A;  4RKU E;  5CKB A;  2E5Q A;  2QQ9 A;  3FDR A;  4J7F A;  3VYH B;  3OYA A;  3MO8 A;  1OZ2 A;  4C5H A;  1HK9 A;  2PQW A;  1WJR A;  2PVG B;  3BDL A;  3CXC S;  2HQE A;  3I55 T;  3CCE A;  1Y96 B;  4NL3 A;  3GNF B;  2JTF A;  4OMF B;  4ELY C;  4C8Q G;  2RJC A;  4JS4 A;  3SWN A;  2E10 A;  3AHU A;  5FRN A;  1O75 A;  3J7A F;  3M55 A;  3KXT A;  4C92 F;  3J81 E;  2VC8 A;  2DTI A;  5GAN g;  1VQ8 A;  5DLO A;  4L6V 5;  2XD0 A;  1SSF A;  3WVD B;  2CYZ B;  3A8O B;  1YIJ T;  4HT9 A;  3OYN A;  3VU3 C;  5GAN f;  2M1H A;  1G3T A;  1UB4 A;  2DPP B;  2DTO A;  4ZTJ A;  4M7A A;  1FXX A;  3V7R A;  1I5L A;  3GPL A;  3CD6 T;  1BI3 A;  1NZ9 A;  2QQA A;  2RHI A;  1TH7 A;  2DD4 A;  3JSC A;  5LJ5 j;  3HL8 A;  1NJI C;  3EFR A;  5GAN 4;  1KHC A;  4N0A C;  3OYH A;  4PJO C;  2HAX A;  4DOV A;  1GXI E;  3M53 A;  2CZ6 B;  4M78 E;  2JVV A;  2PVO B;  4EMK C;  1G3W A;  4OF1 A;  4JUV A;  4M7D E;  1P92 A;  4M75 A;  3OS0 A;  3ASK A;  3MHX A;  4M7D B;  1YIJ A;  3M57 A;  5GAN 2;  1KQS A;  2PUO B;  4C0D C;  3J80 E;  2KY9 A;  2EQM A;  3ZEH A;  4CI0 C;  5LJ5 g;  2M9U A;  3CD6 A;  2RI2 A;  4QW2 A;  3TCJ A;  1M4Z A;  1VQO T;  4PLL A;  5J39 A;  2DZ9 A;  5LJ5 f;  1FX7 A;  3CCV T;  3QZ9 B;  3LLR A;  1WJQ A;  3MCA B;  1VQ7 A;  2D0Q B;  5GAO r;  2LDM A;  3S3N A;  1M90 C;  1VQN T;  2WSF E;  3G6E T;  3JAM E;  4ZN3 A;  3MEA A;  2Y4X A;  3PMT A;  1OZ3 A;  4A4K A;  3WXM B;  3CC7 A;  2EQJ A;  2YRV A;  1RL2 A;  3V7S A;  3GOX A;  3OW2 A;  1AHJ B;  4ZGD B;  5CVI A;  1NPR A;  5LL6 S;  2ZPG B;  4C5E A;  2VV5 A;  4A53 A;  4M77 G;  3CCM T;  2E12 A;  3INZ A;  3V8J A;  3SWN B;  4F7U F;  2XID A;  3VUB A;  2K57 A;  3TRE A;  4C8Q A;  3OYI A;  4BE1 A;  3NTI A;  1M8V A;  3A8H B;  3HFO A;  1H64 1;  5J26 A;  3CMA A;  2DVE A;  2RHX A;  2EJF A;  3FLG A;  3M5A A;  2QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...