4F7UF

The 6s snrnp assembly intermediate
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 15
structure length 73
sequence length 73
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uF00
4PJOF 4F7UF 2YLCA 3RKWA 5GAN2 4XTZA 3JCMJ 4M75C 3GIBA 1B34B 4C8QC 2RB6A 5GAN4 2E64A 2DZCA 3JB9J 5GMKl 1TH7A 3SWNB 3JCMP 3AHUA 4M7AA 4X9CA 5GAMg 2RD1A 2VXFA 4M75F 4M77A 2CGHA 3RUXA 3RESA 4C8QF 4M78A 5DY9A 4M7DG 5GAOq 3M4GA 4M7DB 5GAN7 3BY7A 4QVDA 5LJ5g 2EJGA 4M75D 2K57A 4C8QD 4PNOA 3RKXA 3JB9I 1D3BA 4M78F 3JB9D 3JB9H 1HK9A 4WF2A 5GAOm 3JCMV 4EMHA 4F7UE 4PJOE 3JCMb 5GANf 2JN0A 3HFNA 5GAMd 4PJOG 5LJ3d 4F7UG 3EFRA 4J6YA 4PJOB 4F7UB 4M75E 1I8FA 4C8QE 4HT8A 4J6WA 3L1AA 4PJOA 2YLBA 4MMLA 3JCMQ 4M75G 1U1SA 4C8QG 5GAMj 3EFSA 5LJ3j 3JB9G 2DTIA 3QHSA 4JRIA 4M75B 4C8QB 4JRKA 4EMGA 4V2SA 4HA8A 4C92A 5GANe 4XU2A 4JUVA 2DXTA 4PJOD 4EMKA 1I81A 4M78E 3L2ZA 1I5LA 4M7AC 5GANg 4M77C 5LJ5j 4XTWA 4M78C 3JCMf 5GMKh 5GAOr 1KQ2A 4J6XA 3V7CA 1KQ1A 5GMKe 4M7AF 3FJPA 3PGGA 1LNXA 1B34A 2DEQA 4M77F 4M78B 1M5Q1 4RCBA 5LJ3h 4C92F 4NOYA 5GAMh 5GAOn 3SWNA 4JLIA 5GMKi 5GAN3 3SB2A 3BDUA 4MMKA 3FB9A 4J5YA 4XTVA 4M7AD 3V8JA 4M77D 5LJ5h 1N9RA 2E1HA 4M7DA 1Y96B 1U1TA 4M78D 1BIAA 4DQ2A 2EAYA 3HSBA 3JCMg 2EJFA 4OP0A 5LJ5d 4XTXA 2DVEA 2EWNA 2YHTA 2FYKA 3JCMW 3QSUA 2ZGWA 3JCMe 4M7AE 1BIBA 1YCYA 4M77E 1JBMA 4C92E 4A54A 4QVCA 2E65A 2DTHA 4N0AA 5GMKm 5GAOl 2VXEA 1WQWA 2DKGA 1WPYA 4C92C 4M77G 5GAMf 5LJ3f 1N9SA 4F7UA 3JCMX 4M7AG 1I4K1 4M78G 4XTYA 4M7AB 3HFOA 4M77B 3INZA 3RKYA 3V8KA 4C92B 4EMKC 5GAN8 3QUIA 1WQ7A 3V7SA 3JCMc 4M75A 1HXDA 4C8QA 5LJ5f 2HNIA 4XTUA 2DZ9A 3VU3C 5CAIA 3BW1A 1H641 3SWNC 1MGQA 2E41A 4C92D 1D3BB 3QO3A 1M8VA 5GANd 2QTXA 4NL2A 5GAN6 5LJ3g 3JB9F 4M7DC 4M7DE 5GAN5 2Y90A 4XU1A 2DTOA 2EJ9A 3RERA 5GAMe 2I2LA 2RM4A 2DJZA 3V8LA 5GMKj 5LJ3e 1X01A 1JRIA 3FIFA 3BFMA 5GAOp 5GANj 4HT9A 4M7DF 2RA2A 4A53A 2DXUA 4XU0A 1Y96A 3JCMh 4X9DA 4C92G 4NL3A 5LJ5e 1WNLA 4N0AC 4XU3A 3V7RA 4M7DD 2VC8A 4PJOC 4EMKB 5I21A 3RIRA 3JCMd 2FB7A 4RCCA 4XQ3A 4Y91A 1LJOA 2E10A 1LOJA 5GANh
chains in the Genus database with same CATH superfamily
4A4KA 2MIOA 1JU5C 2YRDA 5CVIA 4C5EA 4J83A 2E64A 2DZCA 2L2PA 1KC8U 2FZGB 2RD1A 2L3QA 2ZPGB 5KYYA 4OMOA 3LX7A 4F16A 5HK3A 3UATA 4IKFA 3VUBA 2EJGA 3JB9D 2JN0A 2FL7A 2JS2A 2CREA 2L0AA 1VQ8A 2VYTA 1WLPB 1VQNQ 2LTOA 1G3SA 4C8QB 4PJMA 2E5QA 4JUVA 3REAB 3I55T 1I5LA 1EX4A 1RI0A 1JJ2P 2EYWA 2QQSA 4C0GA 4B6MA 5I22A 1S72A 4OB3B 1SG5A 4B9WA 2CH4W 1Y96B 1R8OB 1K9MR 4JDSA 1OOTA 3UWNA 2OTJQ 1ZQ1A 1UB4A 1V76A 3J7AF 2CH4A 4FYYB 3OYMA 4JS5A 2AT1B 2KE9A 2YXYA 4PJOA 3TSWA 2JTMA 3HFOA 3E19A 1IHVA 2RQVA 4C0FA 3JCMc 1R0CB 4XTUA 2QG9B 1VQMA 2XU8A 5HK0A 5C6SA 2LP5A 2QTVA 1OPLA 4J7FA 1VQ7Q 3OYYA 1RAEB 4KGVB 5CKDA 2GNCA 3RERA 2ECZA 2BZYA 1K73R 3LWIA 2OJ2A 3CMAT 2MMPA 1AWWA 3R6OA 3QZ5B 7AT1B 3NHNA 1VQ7A 2RHUA 3CCUT 4M7DD 1FWZA 1M3CA 4XQ3A 3MPUB 4KRTA 5GMKl 3C94A 4M7DE 1KG1A 3VS4A 1X75C 2KI7A 3NFCA 2FPDA 3CCSQ 1U3OA 2K57A 1X69A 2HL5C 1YHQQ 2K5FA 5GAMd 1D1BA 4JS4A 1M90R 2BUDA 1W2BA 3M57A 2DL5A 3VRYA 3M9QA 3VRZA 3JCMQ 2EIFA 4PLLA 4QVZA 3CC7A 2DTIA 2NLUA 4JRKA 2F5TX 2H3EB 2DE0X 2P0KA 1I81A 2YSQA 2C0IA 4M77C 2D0NA 3P8HA 2HQXA 4OVAA 2MOXA 4RCBA 1M8MA 1M9SA 3G6EA 3MEUA 4FIBA 3SB2A 5J3BA 5FW9A 3CCJT 2V8IA 1UUEA 2EW3A 2YRCA 1G5VA 4UC4A 2W0ZA 2ZGWA 4AG2C 5HKCA 3H41A 4OB2B 2EPDA 4N0AA 1HD3A 5GAMf 2YUOA 2KRMA 1EZZB 3RKYA 4Z8AA 3L2QA 3PMIA 2DRKA 1GFDA 1Y0MA 3CEYA 3G4SA 1TWBA 3M0SA 3M58A 8AT1B 3U23A 4IIMA 4C92D 1D3BB 1QCFA 1W2BS 1V1CA 5GANd 3CXCP 4RKUE 2P84A 4NL2A 4L59A 2KAFA 1RI9A 2RK2A 4M7DF 3JAME 3NMZC 4LDVA 3M55A 4OF1A 4XU0A 1VQ6Q 1BI2A 2QQ9A 1K9MC 1KFZA 3JCMd 3A8MB 2AIRB 3P8DA 2JMCA 1JJ2A 1VQ6A 3GNFB 3O5ZA 2VXFA 1LVKA 1P92A 3A8GB 5GAOq 4R0KA 3EG9B 4AMCA 2EVRA 2J06A 2JJ9A 2QDLA 3ZFJA 3CC4A 2I0NA 4M75D 2YDLA 3CCVQ 1KQSS 3S3MA 1Q81C 2ZZDA 2MI6A 2KROA 2NUZA 4TVRA 5GANf 2LNVA 2RHIA 1QCNA 1K73C 3CD6T 4M75E 2LC4A 1NPRA 1YIJA 2DPPB 3SFMA 5KH6A 2CT4A 5GAMj 1Q82U 1OQKA 3HKSA 4HA8A 3OMGA 1RACB 1YJWA 2COYA 3FEOA 2CP7A 4GBQA 3JCMf 3CPWP 4C5IA 1AOJA 4QT7A 1TTHB 2FHDA 1YI2T 2MK5A 2Y4XA 4JZ4A 5GJVB 4M78D 1BKBA 2NUPA 4BACA 1IB8A 2YHTA 3E9FA 1M90C 1HYOA 4D8KA 1GFCA 1PRLC 1QVGP 3OS2A 1UE9A 3KFVA 3NTHA 5GAN8 3REBB 1C1AA 3UA7A 2YT6A 1YJNA 5D6XA 4A63B 2LCSA 2FZCB 4QQ6A 4BB7A 2KGTA 2QTXA 5LJ3g 5GAN5 3EGDB 5GANj 2F2XA 2RHXA 2KYMA 5KE3A 2QA4Q 1BI3A 5LL6S 3JCMh 1B3QA 3I55Q 3I56A 3UT1A 1T0JA 1WHMA 2KEAA 4PJOC 5I21A 3OBWA 1OEBA 2L3SA 2JNGA 1G2BA 4ZNXA 4QQGA 4XTZA 2VV5A 2XIDA 3GF5A 1AHJB 2QA4A 4J9HA 4X9CA 4M75F 4DOWA 2VVKA 3VUZA 2BTTA 1IRXA 1WHKA 1TS9A 4ZN1A 2HMAA 2XK0A 4E6RA 1MMAA 3OYFA 4WF2A 2M16A 1OX8A 1C6VX 4J6YA 3WXMB 2AKKA 3X25B 4MMLA 2P4TA 1M1GA 3CC2T 4HCZA 1UECA 2XICA 2QXFA 2PUOB 4PJOD 1JXOA 4JJNK 2LX9A 3GOXA 5FWBA 1KQ1A 1VQKQ 3CMAQ 3CXCA 3BDUA 3CCUQ 2CDTA 2E1HA 4M7DA 2A37A 1AWXA 1WZOA 2VASA 2LCLA 4RG8A 3VS3A 4D6WA 4OMFB 2K3BA 4M7AG 2D8HA 2ZPFB 3LGFA 1I4K1 3URGA 1QKXA 1KC8R 3V7SA 1IZ6A 4FU6A 2OTLT 2P0PA 3M0TA 3OS1A 1UJ0A 1SPKA 5GAN6 3C0CA 1OZ3A 2EJ9A 5LJ3e 2XG8D 5FRNA 3S6WA 1M2OA 2X4WA 5CKBA 4BE2A 2XDBA 4N0AC 1M27C 2VC8A 2FPEA 2E10A 2BE9B 1BB9A 1B34B 1OU9A 3CPWA 2HKQB 1TH7A 3SWNB 1TUDA 4OB0B 4F04B 2K5LA 1TU0B 2ED1A 1VQ9A 4VUBA 2RQTA 4C8QD 3CCLA 2EYYA 2YWWA 5GAOm 4F7UG 2K7AA 3UPUA 2QYZA 4C8QE 2V1QA 3L1AA 1QVGA 3H0HA 3O8VA 2E3HA 2DD5A 4HCCA 5IT9E 3L2RA 4C92A 4NS5A 4J9GA 2X3XD 1GCQA 1FXXA 1QLYA 5GAOr 1KQ2A 3X24B 2M51A 1HJDA 3FJPA 4WCIA 4BUGA 2QEXA 5LJ3h 3GNGA 2JOYA 4C0DB 2DVJA 1VQLT 1SSHA 2ABLA 4E7IA 2CUBA 1QMCA 2ZPHB 4DQ2A 3HSBA 2DXBA 1PSEA 2O4XB 2HDAA 3VS6A 1B07A 4OMQA 3OB9A 3CPWS 2HSPA 5CKFA 1X6OA 1YCYA 1KD1C 1M1KR 3CCMQ 1M2VA 1VIEA 4L6V5 1PRMC 4BY6B 2K6DA 4FYVB 4M75A 5FU6B 1RAIB 3BDLA 4ZGEB 2LRQA 3CCMA 3CD6Q 2R57A 3VYGA 4CC3A 1D0YA 3FC3A 1ACMB 2WSFE 5CO7A 2GTJA 3JV3A 4IURA 4C5GA 1H92A 3MEWA 1W1FA 5L8RE 4NL3A 2RI5A 4E7HA 1M1FA 3DLMA 1VQOT 2FB7A 1W4SA 4PJJA 3RUXA 1VQ5T 2RH2A 5GAN2 2QQRA 3Q1JA 2CKKA 1PHTA 2ZPEB 1KIKA 4QKUA 3ZEHA 3CCRA 1PKTA 3JCMP 2AK5A 1YI2Q 3LH5A 4C8QF 3MEVA 4M78A 2LMJA 4C5HA 2DBKA 2DXCA 2DL3A 5I11A 4Y28E 3JB9H 1HK9A 1K4US 2DMOA 4BI8B 3DKMA 4PLIA 3A8HB 2CS7A 4J9FA 2XDDA 1ZA1B 3THKA 4AFUC 1Q86U 3EGXB 1RLQC 1PG5B 4PJNA 1D1AA 1HSQA 2KRSA 4MZPA 1YJ9A 3TSZA 1FYNA 4XU2A 1QCOA 1NJIU 4E7JA 3LW5E 1QVPA 2HEQA 3RDVA 3P8BB 3PGGA 1WGSA 2DX1A 2DIQA 5I2SA 3D7SB 4OGEA 2J6FA 1N9RA 4RTWA 4N4GA 5CQYA 1GXIE 3ME9A 4OP0A 1OPKA 3QIIA 3KUFA 1NEGA 4FSSA 1ZX6A 4A54A 1QWEA 2DL4A 1VYUA 1RADB 2DKGA 2KXDA 2L89A 4M7AB 2WACA 2KT8A 2DO3A 5CIUA 1SKUB 2IIMA 2E5KA 1FMVA 1VQNA 1WDXA 5LJ5f 3QJYA 4BE1A 1N8RR 1WFWA 5A0GA 2LQNA 2D8JA 3AT1B 2EKOA 3OYKA 4ZTJA 4KGXB 1Z9QA 4M7DC 2LZ6B 2Y90A 1RAAB 3J80E 2KT1A 1SEMA 3CC2Q 2KYBA 2QAZA 1WJRA 3HPWA 1AD5A 1NBEB 2GF7A 4J9CA 5C0MA 2SEMA 3V7RA 1Q82R 4EMKB 2OTJA 3MHXA 4II1A 2RQRA 1M1KC 2B8AA 2DBMA 3VV0A 4A4HA 3FLGA 2JVVA 1H8KA 1VQPT 1TSFA 3MJXA 1ZBJA 2OAUA 3AHUA 5HCKA 5KCOA 3CMET 2DM1A 2VUBA 5FU7C 2LDMA 1MV3A 3SD4A 2LQ8A 3H9NA 1UEBA 5GAN7 4JZ3A 4HVWA 2EGCA 4KBMB 4KUDK 1OX9A 2X3WD 1G3TA 3EFRA 2NUTA 4F7UB 1WX6A 3M0QA 4MZMA 2E3IA 3G71T 1LPLA 1U1SA 1OU8A 4JRIA 4EMGA 1NYFA 1UFFA 1IREB 1PD1A 1OI1A 1QKWA 1UHFA 4KT0E 4IIOA 2JUFA 2L3RA 4KH0B 4AFSC 5GANg 5LJ5j 4XTWA 1YITT 1MNDA 3TVTA 1K8AC 3PT9A 2GCXA 5GAOn 4B9XA 2BKDN 4LDXA 2CYZB 2EAYA 3CCSA 3JCMg 2DVEA 3UDCA 4EIKA 3JCMW 3NTKA 3QPHA 3A8LB 1YHQA 3OSVA 4C92C 2LCCA 4ORZA 4M77G 4XTYA 3V8KA 2KNBB 1X6GA 1GCQC 2DK3A 4D8DA 5HY6A 2MF2A 4C8QA 1YBYA 2DZ9A 2ZCFB 1MGQA 4FT4A 3A1PA 4FW2A 1FMKA 1VQ4T 5CQXA 3LGLA 3CCET 3I9QA 2DTOA 5GAMe 3CCQT 3OSSC 3M0PA 1WIEA 2DXUA 4E2FB 2K2VA 1Y96A 4JJBA 3OYHA 1KJWA 3HRSA 1XTDA 1LJOA 1JEGA 4M75C 2RB6A 4BI4A 3PVLA 1VIFA 2EGEA 4F17A 1N8RC 4QVDA 3UA6A 5KYWB 2L3PA 4FSXA 2FG0A 3G1JA 5KYUA 2DNUA 3VS5A 3TCJA 2RK1A 4RTYA 1BK2A 5FRMA 1GBRA 3LH0A 3H0IA 2M1HA 4PFPA 4M78C 4DOVA 1YFNA 2ZPBB 3OW2A 2COWA 5GANe 2DRMA 5GAMh 2P4RA 1BU1A 4LUDA 2HBPA 4JLIA 4CC7A 2MCNA 1SRMA 3OYAA 3WVDB 1K9AA 1YCSB 4LDYA 1AWJA 3EH1A 1UG1A 2RJEA 1MMGA 2E6ZA 3MP8A 1VQ5Q 3L42A 3CCVA 1V29B 4QQDA 3JCMe 4RTVA 1YNZA 1K9MU 2DA9A 3INZA 2MWOA 1WQ7A 1WXTA 2CSIA 4E7KA 1NM7A 2HNIA 1G3YA 2QK0A 3VU3C 4Z89A 2A36A 1FX7A 3EFOB 1BCMA 1Z9ZA 2ED0A 2COZA 4RUGA 4OMMA 1ZA2B 4PK4A 3L2VA 1M3BA 2CT3A 3EG3A 1JJ2S 1CSKA 4HT9A 3BFMA 1E6GA 4LN2A 2XDPA 1K1ZA 1QW1A 2EQKA 3GBQA 1Q81U 1MHNA 3T9NA 1K73U 2K3XA 4GLKA 3VYHB 1C0MA 5GANh 2DYIA 3PMTA 2QGFB 1BYMA 3EG0A 4Z88A 2DF6A 5CK9A 4HCKA 1SSFA 2EBPA 1D3BA 4PKCC 3N5BB 4PJOG 2VGMA 3CBMA 1MMNA 4E47A 4DBFA 5FROA 1WJSA 2CP6A 3H6ZA 2M02A 3M56A 3I55A 4FL6A 1VQ8T 1M90U 1D1CA 2XMFA 3MO8A 2DXTA 3QWYA 1U5SA 2E12A 2MWPA 2EQIA 2JW4A 1E7OA 1K0XA 4NOYA 2RI2A 1CKAA 1NZ9A 3E2UA 4J5YA 1S72T 4XTXA 2V1RA 1UDLA 1VQPQ 2FYKA 5J26A 3QSUA 5GAOl 4HXJA 3CMEQ 2DETA 2R58A 4AFQC 4M77B 1E6HA 1ABQA 4C92B 9ATCB 3QUIA 4O6JA 2PQWA 4YTLA 4E7LA 4C0ZA 5DM7R 2KR3A 1H641 2DD4A 3OYCA 2EYXA 1VQMT 1M8VA 3META 2HBWA 4BDYA 1KHIA 1JXMA 5ECAA 3CMAA 1VQKA 4J9BA 2I2LA 4Y92A 2J05A 4ZGJB 1Q86R 1Y07A 2RA2A 2KBTA 3CCUA 3HHTB 2GTOA 2K2MA 4K11A 4OMLA 4PFZA 1YITQ 1PWTA 4EMHA 1VQ7T 1YP5A 3M4YA 4GY5A 4C8QC 2CGHA 2FEIA 5D6YA 1M30A 1ZUUA 3BE3A 1RLPC 1Q7YU 2JTFA 4ESRA 5IH2A 3JCMb 4N4HA 3L2UA 2F1LA 2DAQA 3CXCS 4HT8A 1I07A 3CCJQ 4ATOA 2ROTA 3A5ZB 3CC7T 1AZGB 3SHWA 1VQ4Q 4BD3A 2V8KA 3CCEQ 1GRIA 4LUEA 1I1JA 1YHQT 4J6XA 3CCQQ 4RTZA 1T3SA 4M78B 3DLLA 4L5GA 4RTUA 1G3WA 3CCJA 5GMKi 1XOVA 2L8DA 1WA7A 2JM8A 2SRCA 3FB9A 2CZ6B 3VKIA 3G6ET 3V8JA 4M7AD 1TOVA 2XD0A 3EHRA 5KYXB 4P5NA 2KK4A 4KH1B 3EHQA 4N4IA 4LXCA 5D7UA 1RAFB 4M7AE 1RAHB 1JBMA 2E65A 2DTHA 2VB6A 3GLXA 3PIOA 3QWXX 2XHCA 4E7ZA 2MYSA 5KYYB 2RF0A 2R5MA 1G8XA 2E4HA 2K3YA 4J9IA 3OYNA 2G3RA 3X20B 6AT1B 3G4ST 4IUUA 5FWCA 5L23A 1Y71A 8ATCB 1U8RA 4OGCA 3V8LA 2PUKB 5GMKj 3FIFA 1UJYA 5A2QE 4JJCA 4CRIA 1NEBA 3FRNA 3I5RA 1SF9A 2PZ1A 3RBBB 2JTEA 1I0CA 1X2QA 1OV3A 3EGUA 5GJWB 1GBQA 5KE2A 3VS7A 5IXFA 1K0SA 1VQ6T 3OYDA 1QVGS 1EFNA 4X1VA 2ROLA 2JS0A 4PNOA 2CSQA 4A4EA 2KMTA 5DLOA 4DA4A 3CD6A 4F7UE 3CC4T 3WVEB 1X43A 2LT1A 3X28B 4IUVA 4PJOB 1A0NB 2DL8A 2D1XA 2YUQA 4KULA 2PTKA 4FM4B 1PCXA 2BZ8A 4AFZC 1QP2A 3JB9G 1YIJT 2LJ0A 1KC8C 2JT4A 3CCVT 1KD1U 2BZXA 2MAMA 1D0ZA 3VS2A 1YJWT 2D0QB 4M7AF 1B34A 1LNXA 2DEQA 2D6FA 1ZHIA 3S3OA 5IHIA 2P0QA 3OY9A 3SWNA 1PNJA 1YI2A 3ZBDA 5M9OA 2ZPIB 3ER0A 4MMKA 2EYQA 2YRVA 2AKLA 1KK7A 4DEXA 3GP8A 5A0LA 3EG2A 5LJ5d 2F69A 5J39A 4DEYA 1SHFA 3M54A 3OA6A 2O88A 1WPYA 3JCMX 1N9SA 2X35A 1OZ2A 2YUPA 2ENMA 2KSSA 1WXBA 1VUBA 1KQSP 2XKOC 1WYXA 1YJNT 2E41A 2C0OA 4LD6A 3ULRB 3MP6A 3VS0A 4DBHA 1VQ8Q 2O9SA 5D6WA 1AVZC 4RG2A 5EC7A 5LJ5e 1WNLA 2EKHA 2YUNA 2EQUA 2GQVA 1R77A 1ZSZA 2O4XA 3I56T 3DB4A 2QQBA 3OYBA 2FRWA 1LOJA 1ZUKA 4F14A 4F7UF 2VGNA 3OW2P 1BBZA 5GAN4 3JB9J 1S72Q 5GAMg 1ABOA 2R5AA 5A0DA 2QA4T 5DY9A 4M7DG 2H8HA 3L2WA 1S1NA 3OS5A 3FJ5A 3BY7A 4O5VA 4MDWA 3RKXA 3JB9I 4IUTA 3CQTA 3M59A 2KVQG 2DILA 2J6KA 2X9HA 2J7IA 3QZ9B 1G83A 1KHCA 3HFNA 4Z02A 1N6AA 2EQJA 3CC2A 3A98A 3LWHA 3TU4K 4J6WA 2YLBA 2BIVA 1TUGB 3EFSA 4E7SA 4LE9A 2O01E 4FCYA 1VQMQ 2FVUA 1PSFA 3L2ZA 3QDRB 1ZBXA 1OYXA 2RHYA 1WHHA 3JRZA 4ZGDB 2CP5A 3I35A 2EQMA 2JZ2A 1T3LA 2IPOB 2WSEE 4XTVA 2CZ7B 3E1SA 4FYXB 5LJ5h 1U1TA 2G6FX 1BIAA 3MEAA 1ZLMA 2OTLQ 1Q81R 1TUCA 2FRYA 1WXUA 2V8JA 1JO8A 5KYUB 1VQKT 3H0FA 1M4ZA 4CI0C 3ASKA 3R6NA 3EGXA 1SHGA 2OTLA 1QWFA 3C4SA 2RHZA 1M1KU 1FMWA 4RTTA 2GFUA 5IAYA 3BW1A 5IHNA 2LX7A 3SDZA 4BE0A 4HVVA 2KRNA 4LNPA 3QO3A 1MV0B 3JB9F 3CPFA 4FT2A 2CZ1B 4JLGA 2PU9B 2FPFA 2B86A 2V26A 5KCHA 5CR2A 3CC7Q 4C92G 2LNHB 4OMNA 2QASA 3C12A 1IGUA 2E6NA 2K4YA 3A8OB 1PKSA 1JB0E 1JQQA 2QDYB 2MPXC 3GIBA 3G6EQ 3M53A 4M7AA 4Q5WA 1AT1B 1EIFA 2O9VA 3RESA 3RR6A 1AZEA 2GBQA 4PFOA 2PNIA 2C0TA 2NUPB 1K8AU 2QI2A 2KY9A 4J9EA 1VQ9T 1NPPA 3CCLT 1IGQA 1WI7A 1VQLQ 2KXCA 5AYFA 4M75G 3CBOA 2E70A 5KYNA 3G4SQ 1KQSA 3E9GA 4EMKA 2LT4A 1BI0A 3H8ZA 1W6XA 1VYTA 1VQLA 3MCAB 2F2VA 2QEXT 2DERA 4M77D 2A0FB 3PNWC 1MNEA 3G7ZA 1Q82C 5AT1B 2DEUA 1BIBA 4M77E 2F2WA 4C92E 5GMKm 2A08A 4DBRA 4ME7A 3LYIA 1NG2A 1WQWA 4F7UA 4M78G 2K5IA 2OAWA 2RMOA 1HXDA 4PL6A 4ANJA 3CC4Q 4JJDA 2DIGA 3SWNC 1TXQA 1Q7YR 3X26B 1VQOQ 3ZL7C 1IXDA 1SRLA 1H3ZA 3CCMT 1LCKA 4EPCA 1IO6A 4BDZA 2RM4A 2DJZA 1N8RU 2DJQA 1YIJQ 1JRIA 2OX7A 5IXBA 1KSWA 1U06A 3OBYA 4A53A 1Y7XA 2RO0A 2CUDA 1VQOA 5CCAA 4XK8E 4XU3A 1VQ5A 1YJWQ 4ELYC 4IUPA 3OYJA 3QXEB 3HRTA 3DB3A 4CC4B 2IVWA 3PE0A 2KDSA 3CCRT 3VS1A 3EH2A 4M7DB 2L5QA 3F70A 4ELZC 4C0DC 4DBQA 1N5ZA 2AZVA 4J7IA 2M0YA 2RNAA 2A3LA 3OW2S 1PD0A 2NWMA 3EG1A 4QW2A 5FLXE 1WHGA 1ZSZC 2CP3A 2X4XA 1YJNQ 4V2SA 5IN1A 1D0XA 3TEEA 2CZ0B 3QYHB 3OQ5A 3EAEA 4M78E 2JMAA 4EDUA 1YJ9T 4FYWB 2C06A 1PC0A 3KBGA 4BY6C 4J8OA 5FU7B 2HKNA 4M4ZA 4M77F 5FU6C 4C92F 2RN8A 1M5Q1 2HZYA 4JRPA 5GAN3 1YWOA 3I56Q 5CKHA 3M0RA 5KYWA 3MKDA 3HP9A 2HQHA 1ARKA 4IUQA 2VXEA 1H3HA 2M9UA 2RJDA 4HVUA 2HCKA 1J3TA 1MMDA 5CAIA 2A7YA 1VQNT 2LQKA 1QVFP 3EG9A 1M3AA 4MZTA 4PJLA 2PVDB 1WHLA 4RMOA 2ZAEA 1RUWA 1B7TA 3TQ7P 2HD0A 1VQPA 1UGQB 1KD1R 1IHWA 4OMPA 2YLCA 3RKWA 2OTJT 2RPNA 2QGGA 2KQWA 2FZKB 3CMEA 1F1BB 1XNIA 4FW1A 1O75A 2LQWA 1ZUYA 1NLPC 3G71Q 2X4YA 3QG1A 4KUIA 4XAXB 1O9SA 2Y4YA 3PTAA 3I5SA 2ATCB 2RJCA 1Q7YC 1QQJA 1RAGB 4M78F 2LJ1A 3EFOA 2DYBA 3JCMV 4PJOE 2GFAA 2W10A 2EFIA 3OYIA 5LJ3d 1UGPB 3QJ6A 1M2VB 3G71A 1VA7A 1NJIR 1I8FA 1WHJA 4AT1B 1T0HA 4C8QG 2PVOB 3QHSA 4M75B 2DLPA 4AG1C 1YITA 3MP1A 3C95A 4LDWA 1YWPA 4M7AC 5EG2A 4X34A 5GMKe 3QYGB 2K79A 2RI3A 2GQIA 4HCBA 3TREA 2DL7A 3J81E 2O2OA 3OYEA 1YN8A 3EGDA 3OS0A 3FDRA 3M5AA 2FO0A 2IG0A 1GL5A 2EJFA 2EWNA 3CCST 4JPBW 2HAXA 4RTXA 1R0BG 2WSCE 1VYVA 2QQAA 2EGAA 2HL3A 3NGPA 5LJ3f 4EMKC 3RMSA 2D9TA 1K76A 1X6BA 3KXTA 2EYZA 1VQ9Q 1UGVA 1GCPA 3M0UA 4JRQA 2CP0A 1VQ4A 3CCLQ 3CCEA 3OYLA 3CCQA 1NE8A 2O31A 4XU1A 1AWOA 3OMCA 1X27A 5GAOp 1X01A 2K9GA 3SEMA 1BI1A 4A4GA 3QBYA 2VWFA 2Z0WA 2JXBA 1ZSGA 4J9DA 4CC2A 2H3JA 2LJ3A 3NTIA 4Y91A 5GMKh 1D09B 2OI3A 4PJOF 4LDUA 3JCMJ 1NLOC 2M0OA 1PM3A 1UHCA 2QEXQ 2X51A 1TG0A 1UTIA 2BE7D 2RQWA 3PFSA 4M77A 1WJQA 4LD9K 3M4GA 2X4JA 1UGRB 3NPFA 5LJ5g 1I5OB 5IHKA 3RNJA 3OYGA 4GLMA 2AHJB 3GPLA 3QDFA 2RQUA 3S3NA 1ZSZB 4HKEA 3VJPA 1XJWB 5LJ3j 2HQEA 1Q95G 5DLQE 4ZN3A 2VKNA 1NYGA 3V7CA 1QVFA 1UGSB 2J6OA 2GGRA 4WTOB 1OULA 2F5KA 2PVGB 3CBPA 3PVQA 1Q86C 4BI3A 2LVMA 3JSCA 4R56A 1MUZA 4ZTFA 1W2BP 4OB1B 1NJIC 4QVCA 4A4FA 3IQLA 3CCRQ 1RABB 4R55A 1AEYA 1N27A 2A28A 1QP3A 3HTRA 1K8AR 1VOMA 2NYSA 1RL2A 5I2MA 3HL8A 2ESWA 1BCOA 3UF4A 2NUTB 1XQHA 1Y57A 3HRUA 2AZSA 3QKJA 2JM9A 2XI9A 2DFUA 3PIPA 2RJFA 4X9DA 5KYXA 1YJ9Q 1X2KA 4KGZB 2CP2A 1W70A 3RMQA 2HSEB 1QVFS 1DJ7B 5CKEA 4MDXA 1CKBA 3RIRA 3LLRA 4RCCA
chains in the Genus database with same CATH topology
4A4KA 2QDYB 3PMTA 1B34B 3GIBA 5CVIA 3CPWA 4C5EA 4J83A 2E64A 2DZCA 1BYMA 1TH7A 3SWNB 3M53A 1KC8U 4M7AA 4Q5WA 2RD1A 4OB0B 1EIFA 2ZPGB 3RESA 2K5LA 5CK9A 3LX7A 5HK3A 4IKFA 3VUBA 1VQ9A 1SSFA 4VUBA 2EJGA 1K8AU 4C8QD 2QI2A 3CCLA 1D3BA 2KY9A 3JB9D 1VQ9T 4PKCC 5GAOm 1NPPA 2JN0A 3CCLT 3N5BB 4PJOG 2VGMA 2FL7A 3CBMA 4F7UG 3UPUA 4E47A 4C8QE 5FROA 3CD6A 3L1AA 1QVGA 3O8VA 5AYFA 1VQ8A 4M75G 3CBOA 2DD5A 2VYTA 1WJSA 4HCCA 3H6ZA 2LTOA 3M56A 2E70A 3I55A 1G3SA 4C8QB 5IT9E 4FL6A 3L2RA 4C92A 2E5QA 1M90U 1VQ8T 4NS5A 3MO8A 4JUVA 2DXTA 3E9GA 1KQSA 4EMKA 3I55T 1I5LA 2LT4A 1BI0A 3H8ZA 2E12A 1FXXA 1RI0A 2MWPA 5GAOr 1VQLA 1KQ2A 3X24B 2QQSA 3FJPA 4BUGA 2QEXA 5LJ3h 3GNGA 4NOYA 2JOYA 4C0DB 2RI2A 3MCAB 4C0GA 1NZ9A 1S72A 1VQLT 4OB3B 2QEXT 4E7IA 4B9WA 4J5YA 4M77D 1S72T 1Y96B 2ZPHB 3PNWC 4DQ2A 1R8OB 3HSBA 4JDSA 2DXBA 1PSEA 3UWNA 1ZQ1A 2O4XB 3G7ZA 4XTXA 1K73U 1UB4A 2FYKA 3CPWS 3OB9A 5J26A 1Q82C 3QSUA 5CKFA 3J7AF 1BIBA 1X6OA 1YCYA 4M77E 4C92E 5GMKm 5GAOl 3OYMA 4JS5A 1KD1C 4ME7A 3LYIA 1WQWA 1VIEA 4PJOA 4F7UA 4M78G 2R58A 2JTMA 3HFOA 4M77B 4C92B 3E19A 4L6V5 4BY6B 2K5IA 3QUIA 4C0FA 3JCMc 4O6JA 2PQWA 4M75A 1HXDA 4YTLA 5FU6B 4XTUA 3BDLA 4C0ZA 4ZGEB 5DM7R 4E7LA 2XU8A 1VQMA 2LRQA 4PL6A 1H641 2DIGA 2DD4A 3SWNC 5HK0A 5C6SA 3OYCA 3CCMA 4J7FA 3X26B 1VQMT 1M8VA 3META 2R57A 3OYYA 4BDYA 1KHIA 1H3ZA 3CCMT 3VYGA 4EPCA 3CMAA 1VQKA 5CKDA 4BDZA 3RERA 3FC3A 2I2LA 2RM4A 2DJZA 2WSFE 1N8RU 1JRIA 4ZGJB 5CO7A 3LWIA 1Y07A 3CMAT 2RA2A 4IURA 2MMPA 3OBYA 4A53A 4C5GA 3CCUA 3R6OA 1Y7XA 2RO0A 3HHTB 3MEWA 3QZ5B 1VQOA 5L8RE 4NL3A 2RI5A 5CCAA 1VQ7A 4E7HA 4XK8E 2RHUA 4XU3A 3CCUT 1VQ5A 1M1FA 4M7DD 1FWZA 3DLMA 4ELYC 1VQOT 2FB7A 1W4SA 4XQ3A 3RUXA 4EMHA 1VQ7T 1VQ5T 4IUPA 2RH2A 3M4YA 5GAN2 3QXEB 3OYJA 2QQRA 3HRTA 3DB3A 2CKKA 2ZPEB 3Q1JA 4GY5A 4C8QC 3ZEHA 3CCRA 5GMKl 3C94A 3JCMP 4M7DE 1KG1A 4C8QF 2CGHA 1X75C 2IVWA 3MEVA 4M78A 3NFCA 2KDSA 5D6YA 3CCRT 4C5HA 4M7DB 2L5QA 1Q7YU 3F70A 4ELZC 4C0DC 2JTFA 2DXCA 2K57A 4Y28E 3JB9H 1HK9A 4J7IA 4BI8B 3DKMA 4PLIA 3JCMb 2A3LA 4N4HA 3L2UA 2K5FA 3A8HB 5GAMd 4JS4A 2CS7A 3OW2S 2BUDA 2XDDA 1W2BA 4QW2A 2DAQA 3M57A 5FLXE 3CXCS 1Q86U 4HT8A 3M9QA 3JCMQ 2EIFA 4PLLA 2X4XA 4QVZA 4MZPA 3CC7A 4V2SA 2DTIA 5IN1A 2NLUA 1YJ9A 4JRKA 2F5TX 3TEEA 4ATOA 4XU2A 2CZ0B 3QYHB 3A5ZB 3OQ5A 3CC7T 1NJIU 2P0KA 1I81A 3EAEA 4M78E 3LW5E 4BD3A 4EDUA 4E7JA 2V8KA 4M77C 1QVPA 1YJ9T 2C06A 3KBGA 4BY6C 3P8HA 2HQXA 4J8OA 5FU7B 4OVAA 1YHQT 4J6XA 4M77F 3P8BB 3PGGA 4M78B 5FU6C 4C92F 4RCBA 1M5Q1 4L5GA 3DLLA 1M9SA 3G6EA 1G3WA 3MEUA 4JRPA 3CCJA 1WGSA 4FIBA 1XOVA 2DIQA 5GMKi 5GAN3 5I2SA 3SB2A 4OGEA 5J3BA 2L8DA 3VKIA 3FB9A 3G6ET 2CZ6B 4M7AD 3V8JA 3CCJT 1N9RA 2V8IA 2XD0A 4P5NA 1G5VA 4N4GA 5CKHA 2KK4A 5CQYA 1GXIE 4UC4A 3ME9A 4OP0A 4N4IA 3HP9A 3KUFA 3QIIA 2ZGWA 5HKCA 4M7AE 4OB2B 1JBMA 4A54A 2E65A 2DTHA 4N0AA 4IUQA 2VXEA 3GLXA 2DKGA 5GAMf 3PIOA 2M9UA 2L89A 2RJDA 4M7AB 3RKYA 2WACA 2XHCA 2DO3A 5CIUA 3L2QA 3PMIA 2R5MA 1VQNA 2K3YA 5LJ5f 3QJYA 3CEYA 3G4SA 4BE1A 5CAIA 3M58A 3OYNA 2G3RA 2A7YA 1VQNT 3X20B 5A0GA 2LQKA 4C92D 1D3BB 3G4ST 4IUUA 1W2BS 5GANd 4MZTA 4RKUE 2EKOA 3OYKA 4ZTJA 4NL2A 1Y71A 4L59A 4M7DC 2PVDB 2KAFA 2Y90A 3J80E 2RK2A 1U8RA 4OGCA 3V8LA 2PUKB 5GMKj 3FIFA 4M7DF 1WJRA 3HPWA 3JAME 4RMOA 5A2QE 4LDVA 3M55A 4OF1A 4XU0A 1BI2A 2GF7A 2QQ9A 1K9MC 4CRIA 5C0MA 3FRNA 3V7RA 4EMKB 2OTJA 3MHXA 4II1A 2HD0A 3JCMd 1VQPA 1UGQB 3A8MB 1M1KC 2B8AA 3VV0A 4A4HA 3FLGA 2YLCA 3P8DA 3RKWA 2OTJT 2JVVA 1VQPT 2KQWA 1JJ2A 2OAUA 1VQ6A 3CMEA 3AHUA 5KE2A 3GNFB 2VXFA 1XNIA 5KCOA 1VQ6T 1O75A 3OYDA 1P92A 3A8GB 2VUBA 5FU7C 3CMET 2LDMA 3SD4A 5GAOq 1QVGS 2LQ8A 2X4YA 3QG1A 4KUIA 4XAXB 1O9SA 2Y4YA 3PTAA 1UEBA 5GAN7 2RJCA 3ZFJA 1Q7YC 3CC4A 4M75D 4PNOA 1KQSS 3S3MA 4M78F 4KBMB 4A4EA 2KMTA 5DLOA 4DA4A 3JCMV 2ZZDA 4F7UE 2GFAA 2MI6A 3WVEB 3CC4T 1Q81C 4TVRA 5GANf 4KUDK 2LNVA 2EFIA 2RHIA 1G3TA 2LT1A 3OYIA 1K73C 3X28B 5LJ3d 1UGPB 3QJ6A 3EFRA 3G71A 3CD6T 4IUVA 4PJOB 4F7UB 4M75E 1I8FA 1NPRA 2LC4A 4MZMA 1YIJA 2DPPB 3SFMA 4KULA 5KH6A 3G71T 4FM4B 1U1SA 4C8QG 5GAMj 1QP2A 3JB9G 2PVOB 3QHSA 4JRIA 4M75B 1YIJT 4EMGA 3HKSA 1Q82U 4HA8A 1IREB 4KT0E 1OI1A 1YITA 1KC8C 3OMGA 3CCVT 2JUFA 2L3RA 3C95A 3MP1A 4LDWA 1YJWA 1KD1U 4MDXA 4M7AC 3FEOA 5GANg 2MAMA 4X34A 5EG2A 4XTWA 5LJ5j 1YITT 3JCMf 4C5IA 5GMKe 1YJWT 2D0QB 4M7AF 3QYGB 1K8AC 1B34A 1LNXA 2DEQA 2RI3A 2D6FA 3PT9A 1ZHIA 3S3OA 2GCXA 5GAOn 3TREA 3J81E 2P0QA 3OY9A 3SWNA 4HCBA 1YI2A 4B9XA 3ZBDA 5M9OA 2ZPIB 3ER0A 3OYEA 4MMKA 2EYQA 2YRVA 2FHDA 3OS0A 1YI2T 2BKDN 2Y4XA 4LDXA 2CYZB 4M78D 3FDRA 1BKBA 2EAYA 2IG0A 3M5AA 3GP8A 3CCSA 4BACA 5A0LA 3JCMg 2EJFA 5LJ5d 2DVEA 2F69A 5J39A 2EWNA 2YHTA 3UDCA 3E9FA 3JCMW 3CCST 1M90C 3M54A 3NTKA 3QPHA 2HAXA 3OA6A 3A8LB 1YHQA 2WSCE 3OSVA 2QQAA 4C92C 2LCCA 1WPYA 4M77G 3JCMX 5LJ3f 1N9SA 2X35A 3OS2A 4XTYA 1OZ2A 3V8KA 3NTHA 4EMKC 3RMSA 5GAN8 2KSSA 2D9TA 1VUBA 2DK3A 1YJNA 2XKOC 2MF2A 5HY6A 4C8QA 3KXTA 5D6XA 1YBYA 2DZ9A 4JRQA 1VQ4A 2ZCFB 1MGQA 1YJNT 4FT4A 4QQ6A 2E41A 3CCEA 4BB7A 3OYLA 2QTXA 1VQ4T 5CQXA 3CCQA 5LJ3g 1NE8A 3LGLA 3CCET 5GAN5 4XU1A 2DTOA 4LD6A 5GAMe 3OMCA 3CCQT 3MP6A 1X01A 5GAOp 5GANj 2RHXA 3OSSC 5KE3A 4A4GA 1BI1A 2DXUA 3QBYA 5D6WA 1BI3A 2K2VA 5LL6S 1Y96A 3JCMh 4RG2A 3OYHA 3I56A 3UT1A 1WNLA 5LJ5e 2EQUA 3HRSA 2GQVA 4PJOC 5I21A 2O4XA 3OBWA 2H3JA 1XTDA 3DB4A 3NTIA 2QQBA 4Y91A 1LJOA 5GMKh 3OYBA 3I56T 1LOJA 2JNGA 4PJOF 4F7UF 4LDUA 3JCMJ 4QQGA 4XTZA 2VV5A 4M75C 2M0OA 2VGNA 2XIDA 1AHJB 3GF5A 2QA4A 2RB6A 4BI4A 5GAN4 3JB9J 1VIFA 3PFSA 4X9CA 4M75F 2R5AA 4M77A 5GAMg 4DOWA 5A0DA 2QA4T 5DY9A 3VUZA 1WJQA 4M7DG 4LD9K 3M4GA 1N8RC 3L2WA 3OS5A 2X4JA 4ZN1A 3BY7A 1UGRB 2XK0A 4QVDA 5LJ5g 3OYGA 4O5VA 4MDWA 3RKXA 3JB9I 4IUTA 3M59A 3OYFA 2KVQG 4WF2A 2M16A 3QZ9B 4FSXA 1KHCA 3HFNA 4Z02A 1N6AA 2AHJB 2EQJA 3GPLA 3CC2A 4J6YA 3LWHA 3WXMB 3TU4K 4J6WA 3X25B 2YLBA 3S3NA 2BIVA 3TCJA 4MMLA 2P4TA 1M1GA 3CC2T 4HKEA 2RK1A 3VJPA 3EFSA 5LJ3j 4HCZA 2HQEA 2O01E 2XICA 2QXFA 5FRMA 2PUOB 4PJOD 3LH0A 2FVUA 1PSFA 3L2ZA 2LX9A 3QDRB 1ZBXA 3GOXA 4JJNK 2M1HA 4M78C 1OYXA 2RHYA 5DLQE 4DOVA 3JRZA 2ZPBB 4ZN3A 3OW2A 3V7CA 1KQ1A 4ZGDB 1QVFA 5GANe 4PJOE 5GAMh 3CXCA 1UGSB 2HBPA 4JLIA 2EQMA 2F5KA 2JZ2A 3OYAA 2PVGB 3BDUA 3WVDB 2WSEE 3CBPA 2CZ7B 3E1SA 4XTVA 5LJ5h 1Q86C 4LDYA 2E1HA 2LVMA 4BI3A 4M7DA 1U1TA 3JSCA 1BIAA 2RJEA 3MEAA 2E6ZA 3MP8A 3L42A 4R56A 3CCVA 2V8JA 1V29B 4ZTFA 2LCLA 4QQDA 4RG8A 3JCMe 4D6WA 1VQKT 4OB1B 1NJIC 4QVCA 4OMFB 4A4FA 4CI0C 1M4ZA 4M7AG 1K9MU 3ASKA 2ZPFB 3LGFA 1I4K1 3URGA 3INZA 2MWOA 2OTLA 3V7SA 1WQ7A 3C4SA 4R55A 2RHZA 1N27A 4E7KA 1M1KU 1IZ6A 2HNIA 2GFUA 4FU6A 1G3YA 3VU3C 3BW1A 3SDZA 5IAYA 4BE0A 2OTLT 1QP3A 1FX7A 2P0PA 3QO3A 1RL2A 5I2MA 3OS1A 3HL8A 5GAN6 3JB9F 3CPFA 1OZ3A 2EJ9A 4FT2A 3L2VA 1JJ2S 1XQHA 2CZ1B 4JLGA 5LJ3e 2PU9B 2XG8D 3HRUA 3BFMA 5FRNA 4HT9A 3QKJA 2XI9A 3S6WA 5KCHA 5CR2A 2X4WA 3PIPA 2RJFA 2XDPA 5CKBA 4C92G 1QW1A 2EQKA 4X9DA 4BE2A 1Q81U 2XDBA 4N0AC 3RMQA 1MHNA 2VC8A 1QVFS 1DJ7B 3T9NA 2K3XA 4GLKA 5CKEA 3RIRA 3C12A 3LLRA 2E6NA 2K4YA 4RCCA 3A8OB 2E10A 3VYHB 1JB0E 5GANh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO F;  4F7U F;  2YLC A;  3RKW A;  5GAN 2;  4XTZ A;  3JCM J;  4M75 C;  3GIB A;  1B34 B;  4C8Q C;  2RB6 A;  5GAN 4;  2E64 A;  2DZC A;  3JB9 J;  5GMK l;  1TH7 A;  3SWN B;  3JCM P;  3AHU A;  4M7A A;  4X9C A;  5GAM g;  2RD1 A;  2VXF A;  4M75 F;  4M77 A;  2CGH A;  3RUX A;  3RES A;  4C8Q F;  4M78 A;  5DY9 A;  4M7D G;  5GAO q;  3M4G A;  4M7D B;  5GAN 7;  3BY7 A;  4QVD A;  5LJ5 g;  2EJG A;  4M75 D;  2K57 A;  4C8Q D;  4PNO A;  3RKX A;  3JB9 I;  1D3B A;  4M78 F;  3JB9 D;  3JB9 H;  1HK9 A;  4WF2 A;  5GAO m;  3JCM V;  4EMH A;  4F7U E;  4PJO E;  3JCM b;  5GAN f;  2JN0 A;  3HFN A;  5GAM d;  4PJO G;  5LJ3 d;  4F7U G;  3EFR A;  4J6Y A;  4PJO B;  4F7U B;  4M75 E;  1I8F A;  4C8Q E;  4HT8 A;  4J6W A;  3L1A A;  4PJO A;  2YLB A;  4MML A;  3JCM Q;  4M75 G;  1U1S A;  4C8Q G;  5GAM j;  3EFS A;  5LJ3 j;  3JB9 G;  2DTI A;  3QHS A;  4JRI A;  4M75 B;  4C8Q B;  4JRK A;  4EMG A;  4V2S A;  4HA8 A;  4C92 A;  5GAN e;  4XU2 A;  4JUV A;  2DXT A;  4PJO D;  4EMK A;  1I81 A;  4M78 E;  3L2Z A;  1I5L A;  4M7A C;  5GAN g;  4M77 C;  5LJ5 j;  4XTW A;  4M78 C;  3JCM f;  5GMK h;  5GAO r;  1KQ2 A;  4J6X A;  3V7C A;  1KQ1 A;  5GMK e;  4M7A F;  3FJP A;  3PGG A;  1LNX A;  1B34 A;  2DEQ A;  4M77 F;  4M78 B;  1M5Q 1;  4RCB A;  5LJ3 h;  4C92 F;  4NOY A;  5GAM h;  5GAO n;  3SWN A;  4JLI A;  5GMK i;  5GAN 3;  3SB2 A;  3BDU A;  4MMK A;  3FB9 A;  4J5Y A;  4XTV A;  4M7A D;  3V8J A;  4M77 D;  5LJ5 h;  1N9R A;  2E1H A;  4M7D A;  1Y96 B;  1U1T A;  4M78 D;  1BIA A;  4DQ2 A;  2EAY A;  3HSB A;  3JCM g;  2EJF A;  4OP0 A;  5LJ5 d;  4XTX A;  2DVE A;  2EWN A;  2YHT A;  2FYK A;  3JCM W;  3QSU A;  2ZGW A;  3JCM e;  4M7A E;  1BIB A;  1YCY A;  4M77 E;  1JBM A;  4C92 E;  4A54 A;  4QVC A;  2E65 A;  2DTH A;  4N0A A;  5GMK m;  5GAO l;  2VXE A;  1WQW A;  2DKG A;  1WPY A;  4C92 C;  4M77 G;  5GAM f;  5LJ3 f;  1N9S A;  4F7U A;  3JCM X;  4M7A G;  1I4K 1;  4M78 G;  4XTY A;  4M7A B;  3HFO A;  4M77 B;  3INZ A;  3RKY A;  3V8K A;  4C92 B;  4EMK C;  5GAN 8;  3QUI A;  1WQ7 A;  3V7S A;  3JCM c;  4M75 A;  1HXD A;  4C8Q A;  5LJ5 f;  2HNI A;  4XTU A;  2DZ9 A;  3VU3 C;  5CAI A;  3BW1 A;  1H64 1;  3SWN C;  1MGQ A;  2E41 A;  4C92 D;  1D3B B;  3QO3 A;  1M8V A;  5GAN d;  2QTX A;  4NL2 A;  5GAN 6;  5LJ3 g;  3JB9 F;  4M7D C;  4M7D E;  5GAN 5;  2Y90 A;  4XU1 A;  2DTO A;  2EJ9 A;  3RER A;  5GAM e;  2I2L A;  2RM4 A;  2DJZ A;  3V8L A;  5GMK j;  5LJ3 e;  1X01 A;  1JRI A;  3FIF A;  3BFM A;  5GAO p;  5GAN j;  4HT9 A;  4M7D F;  2RA2 A;  4A53 A;  2DXU A;  4XU0 A;  1Y96 A;  3JCM h;  4X9D A;  4C92 G;  4NL3 A;  5LJ5 e;  1WNL A;  4N0A C;  4XU3 A;  3V7R A;  4M7D D;  2VC8 A;  4PJO C;  4EMK B;  5I21 A;  3RIR A;  3JCM d;  2FB7 A;  4RCC A;  4XQ3 A;  4Y91 A;  1LJO A;  2E10 A;  1LOJ A;  5GAN h; 
#chains in the Genus database with same CATH topology
 4A4K A;  2MIO A;  1JU5 C;  2YRD A;  5CVI A;  4C5E A;  4J83 A;  2E64 A;  2DZC A;  2L2P A;  1KC8 U;  2FZG B;  2RD1 A;  2L3Q A;  2ZPG B;  5KYY A;  4OMO A;  3LX7 A;  4F16 A;  5HK3 A;  3UAT A;  4IKF A;  3VUB A;  2EJG A;  3JB9 D;  2JN0 A;  2FL7 A;  2JS2 A;  2CRE A;  2L0A A;  1VQ8 A;  2VYT A;  1WLP B;  1VQN Q;  2LTO A;  1G3S A;  4C8Q B;  4PJM A;  2E5Q A;  4JUV A;  3REA B;  3I55 T;  1I5L A;  1EX4 A;  1RI0 A;  1JJ2 P;  2EYW A;  2QQS A;  4C0G A;  4B6M A;  5I22 A;  1S72 A;  4OB3 B;  1SG5 A;  4B9W A;  2CH4 W;  1Y96 B;  1R8O B;  1K9M R;  4JDS A;  1OOT A;  3UWN A;  2OTJ Q;  1ZQ1 A;  1UB4 A;  1V76 A;  3J7A F;  2CH4 A;  4FYY B;  3OYM A;  4JS5 A;  2AT1 B;  2KE9 A;  2YXY A;  4PJO A;  3TSW A;  2JTM A;  3HFO A;  3E19 A;  1IHV A;  2RQV A;  4C0F A;  3JCM c;  1R0C B;  4XTU A;  2QG9 B;  1VQM A;  2XU8 A;  5HK0 A;  5C6S A;  2LP5 A;  2QTV A;  1OPL A;  4J7F A;  1VQ7 Q;  3OYY A;  1RAE B;  4KGV B;  5CKD A;  2GNC A;  3RER A;  2ECZ A;  2BZY A;  1K73 R;  3LWI A;  2OJ2 A;  3CMA T;  2MMP A;  1AWW A;  3R6O A;  3QZ5 B;  7AT1 B;  3NHN A;  1VQ7 A;  2RHU A;  3CCU T;  4M7D D;  1FWZ A;  1M3C A;  4XQ3 A;  3MPU B;  4KRT A;  5GMK l;  3C94 A;  4M7D E;  1KG1 A;  3VS4 A;  1X75 C;  2KI7 A;  3NFC A;  2FPD A;  3CCS Q;  1U3O A;  2K57 A;  1X69 A;  2HL5 C;  1YHQ Q;  2K5F A;  5GAM d;  1D1B A;  4JS4 A;  1M90 R;  2BUD A;  1W2B A;  3M57 A;  2DL5 A;  3VRY A;  3M9Q A;  3VRZ A;  3JCM Q;  2EIF A;  4PLL A;  4QVZ A;  3CC7 A;  2DTI A;  2NLU A;  4JRK A;  2F5T X;  2H3E B;  2DE0 X;  2P0K A;  1I81 A;  2YSQ A;  2C0I A;  4M77 C;  2D0N A;  3P8H A;  2HQX A;  4OVA A;  2MOX A;  4RCB A;  1M8M A;  1M9S A;  3G6E A;  3MEU A;  4FIB A;  3SB2 A;  5J3B A;  5FW9 A;  3CCJ T;  2V8I A;  1UUE A;  2EW3 A;  2YRC A;  1G5V A;  4UC4 A;  2W0Z A;  2ZGW A;  4AG2 C;  5HKC A;  3H41 A;  4OB2 B;  2EPD A;  4N0A A;  1HD3 A;  5GAM f;  2YUO A;  2KRM A;  1EZZ B;  3RKY A;  4Z8A A;  3L2Q A;  3PMI A;  2DRK A;  1GFD A;  1Y0M A;  3CEY A;  3G4S A;  1TWB A;  3M0S A;  3M58 A;  8AT1 B;  3U23 A;  4IIM A;  4C92 D;  1D3B B;  1QCF A;  1W2B S;  1V1C A;  5GAN d;  3CXC P;  4RKU E;  2P84 A;  4NL2 A;  4L59 A;  2KAF A;  1RI9 A;  2RK2 A;  4M7D F;  3JAM E;  3NMZ C;  4LDV A;  3M55 A;  4OF1 A;  4XU0 A;  1VQ6 Q;  1BI2 A;  2QQ9 A;  1K9M C;  1KFZ A;  3JCM d;  3A8M B;  2AIR B;  3P8D A;  2JMC A;  1JJ2 A;  1VQ6 A;  3GNF B;  3O5Z A;  2VXF A;  1LVK A;  1P92 A;  3A8G B;  5GAO q;  4R0K A;  3EG9 B;  4AMC A;  2EVR A;  2J06 A;  2JJ9 A;  2QDL A;  3ZFJ A;  3CC4 A;  2I0N A;  4M75 D;  2YDL A;  3CCV Q;  1KQS S;  3S3M A;  1Q81 C;  2ZZD A;  2MI6 A;  2KRO A;  2NUZ A;  4TVR A;  5GAN f;  2LNV A;  2RHI A;  1QCN A;  1K73 C;  3CD6 T;  4M75 E;  2LC4 A;  1NPR A;  1YIJ A;  2DPP B;  3SFM A;  5KH6 A;  2CT4 A;  5GAM j;  1Q82 U;  1OQK A;  3HKS A;  4HA8 A;  3OMG A;  1RAC B;  1YJW A;  2COY A;  3FEO A;  2CP7 A;  4GBQ A;  3JCM f;  3CPW P;  4C5I A;  1AOJ A;  4QT7 A;  1TTH B;  2FHD A;  1YI2 T;  2MK5 A;  2Y4X A;  4JZ4 A;  5GJV B;  4M78 D;  1BKB A;  2NUP A;  4BAC A;  1IB8 A;  2YHT A;  3E9F A;  1M90 C;  1HYO A;  4D8K A;  1GFC A;  1PRL C;  1QVG P;  3OS2 A;  1UE9 A;  3KFV A;  3NTH A;  5GAN 8;  3REB B;  1C1A A;  3UA7 A;  2YT6 A;  1YJN A;  5D6X A;  4A63 B;  2LCS A;  2FZC B;  4QQ6 A;  4BB7 A;  2KGT A;  2QTX A;  5LJ3 g;  5GAN 5;  3EGD B;  5GAN j;  2F2X A;  2RHX A;  2KYM A;  5KE3 A;  2QA4 Q;  1BI3 A;  5LL6 S;  3JCM h;  1B3Q A;  3I55 Q;  3I56 A;  3UT1 A;  1T0J A;  1WHM A;  2KEA A;  4PJO C;  5I21 A;  3OBW A;  1OEB A;  2L3S A;  2JNG A;  1G2B A;  4ZNX A;  4QQG A;  4XTZ A;  2VV5 A;  2XID A;  3GF5 A;  1AHJ B;  2QA4 A;  4J9H A;  4X9C A;  4M75 F;  4DOW A;  2VVK A;  3VUZ A;  2BTT A;  1IRX A;  1WHK A;  1TS9 A;  4ZN1 A;  2HMA A;  2XK0 A;  4E6R A;  1MMA A;  3OYF A;  4WF2 A;  2M16 A;  1OX8 A;  1C6V X;  4J6Y A;  3WXM B;  2AKK A;  3X25 B;  4MML A;  2P4T A;  1M1G A;  3CC2 T;  4HCZ A;  1UEC A;  2XIC A;  2QXF A;  2PUO B;  4PJO D;  1JXO A;  4JJN K;  2LX9 A;  3GOX A;  5FWB A;  1KQ1 A;  1VQK Q;  3CMA Q;  3CXC A;  3BDU A;  3CCU Q;  2CDT A;  2E1H A;  4M7D A;  2A37 A;  1AWX A;  1WZO A;  2VAS A;  2LCL A;  4RG8 A;  3VS3 A;  4D6W A;  4OMF B;  2K3B A;  4M7A G;  2D8H A;  2ZPF B;  3LGF A;  1I4K 1;  3URG A;  1QKX A;  1KC8 R;  3V7S A;  1IZ6 A;  4FU6 A;  2OTL T;  2P0P A;  3M0T A;  3OS1 A;  1UJ0 A;  1SPK A;  5GAN 6;  3C0C A;  1OZ3 A;  2EJ9 A;  5LJ3 e;  2XG8 D;  5FRN A;  3S6W A;  1M2O A;  2X4W A;  5CKB A;  4BE2 A;  2XDB A;  4N0A C;  1M27 C;  2VC8 A;  2FPE A;  2E10 A;  2BE9 B;  1BB9 A;  1B34 B;  1OU9 A;  3CPW A;  2HKQ B;  1TH7 A;  3SWN B;  1TUD A;  4OB0 B;  4F04 B;  2K5L A;  1TU0 B;  2ED1 A;  1VQ9 A;  4VUB A;  2RQT A;  4C8Q D;  3CCL A;  2EYY A;  2YWW A;  5GAO m;  4F7U G;  2K7A A;  3UPU A;  2QYZ A;  4C8Q E;  2V1Q A;  3L1A A;  1QVG A;  3H0H A;  3O8V A;  2E3H A;  2DD5 A;  4HCC A;  5IT9 E;  3L2R A;  4C92 A;  4NS5 A;  4J9G A;  2X3X D;  1GCQ A;  1FXX A;  1QLY A;  5GAO r;  1KQ2 A;  3X24 B;  2M51 A;  1HJD A;  3FJP A;  4WCI A;  4BUG A;  2QEX A;  5LJ3 h;  3GNG A;  2JOY A;  4C0D B;  2DVJ A;  1VQL T;  1SSH A;  2ABL A;  4E7I A;  2CUB A;  1QMC A;  2ZPH B;  4DQ2 A;  3HSB A;  2DXB A;  1PSE A;  2O4X B;  2HDA A;  3VS6 A;  1B07 A;  4OMQ A;  3OB9 A;  3CPW S;  2HSP A;  5CKF A;  1X6O A;  1YCY A;  1KD1 C;  1M1K R;  3CCM Q;  1M2V A;  1VIE A;  4L6V 5;  1PRM C;  4BY6 B;  2K6D A;  4FYV B;  4M75 A;  5FU6 B;  1RAI B;  3BDL A;  4ZGE B;  2LRQ A;  3CCM A;  3CD6 Q;  2R57 A;  3VYG A;  4CC3 A;  1D0Y A;  3FC3 A;  1ACM B;  2WSF E;  5CO7 A;  2GTJ A;  3JV3 A;  4IUR A;  4C5G A;  1H92 A;  3MEW A;  1W1F A;  5L8R E;  4NL3 A;  2RI5 A;  4E7H A;  1M1F A;  3DLM A;  1VQO T;  2FB7 A;  1W4S A;  4PJJ A;  3RUX A;  1VQ5 T;  2RH2 A;  5GAN 2;  2QQR A;  3Q1J A;  2CKK A;  1PHT A;  2ZPE B;  1KIK A;  4QKU A;  3ZEH A;  3CCR A;  1PKT A;  3JCM P;  2AK5 A;  1YI2 Q;  3LH5 A;  4C8Q F;  3MEV A;  4M78 A;  2LMJ A;  4C5H A;  2DBK A;  2DXC A;  2DL3 A;  5I11 A;  4Y28 E;  3JB9 H;  1HK9 A;  1K4U S;  2DMO A;  4BI8 B;  3DKM A;  4PLI A;  3A8H B;  2CS7 A;  4J9F A;  2XDD A;  1ZA1 B;  3THK A;  4AFU C;  1Q86 U;  3EGX B;  1RLQ C;  1PG5 B;  4PJN A;  1D1A A;  1HSQ A;  2KRS A;  4MZP A;  1YJ9 A;  3TSZ A;  1FYN A;  4XU2 A;  1QCO A;  1NJI U;  4E7J A;  3LW5 E;  1QVP A;  2HEQ A;  3RDV A;  3P8B B;  3PGG A;  1WGS A;  2DX1 A;  2DIQ A;  5I2S A;  3D7S B;  4OGE A;  2J6F A;  1N9R A;  4RTW A;  4N4G A;  5CQY A;  1GXI E;  3ME9 A;  4OP0 A;  1OPK A;  3QII A;  3KUF A;  1NEG A;  4FSS A;  1ZX6 A;  4A54 A;  1QWE A;  2DL4 A;  1VYU A;  1RAD B;  2DKG A;  2KXD A;  2L89 A;  4M7A B;  2WAC A;  2KT8 A;  2DO3 A;  5CIU A;  1SKU B;  2IIM A;  2E5K A;  1FMV A;  1VQN A;  1WDX A;  5LJ5 f;  3QJY A;  4BE1 A;  1N8R R;  1WFW A;  5A0G A;  2LQN A;  2D8J A;  3AT1 B;  2EKO A;  3OYK A;  4ZTJ A;  4KGX B;  1Z9Q A;  4M7D C;  2LZ6 B;  2Y90 A;  1RAA B;  3J80 E;  2KT1 A;  1SEM A;  3CC2 Q;  2KYB A;  2QAZ A;  1WJR A;  3HPW A;  1AD5 A;  1NBE B;  2GF7 A;  4J9C A;  5C0M A;  2SEM A;  3V7R A;  1Q82 R;  4EMK B;  2OTJ A;  3MHX A;  4II1 A;  2RQR A;  1M1K C;  2B8A A;  2DBM A;  3VV0 A;  4A4H A;  3FLG A;  2JVV A;  1H8K A;  1VQP T;  1TSF A;  3MJX A;  1ZBJ A;  2OAU A;  3AHU A;  5HCK A;  5KCO A;  3CME T;  2DM1 A;  2VUB A;  5FU7 C;  2LDM A;  1MV3 A;  3SD4 A;  2LQ8 A;  3H9N A;  1UEB A;  5GAN 7;  4JZ3 A;  4HVW A;  2EGC A;  4KBM B;  4KUD K;  1OX9 A;  2X3W D;  1G3T A;  3EFR A;  2NUT A;  4F7U B;  1WX6 A;  3M0Q A;  4MZM A;  2E3I A;  3G71 T;  1LPL A;  1U1S A;  1OU8 A;  4JRI A;  4EMG A;  1NYF A;  1UFF A;  1IRE B;  1PD1 A;  1OI1 A;  1QKW A;  1UHF A;  4KT0 E;  4IIO A;  2JUF A;  2L3R A;  4KH0 B;  4AFS C;  5GAN g;  5LJ5 j;  4XTW A;  1YIT T;  1MND A;  3TVT A;  1K8A C;  3PT9 A;  2GCX A;  5GAO n;  4B9X A;  2BKD N;  4LDX A;  2CYZ B;  2EAY A;  3CCS A;  3JCM g;  2DVE A;  3UDC A;  4EIK A;  3JCM W;  3NTK A;  3QPH A;  3A8L B;  1YHQ A;  3OSV A;  4C92 C;  2LCC A;  4ORZ A;  4M77 G;  4XTY A;  3V8K A;  2KNB B;  1X6G A;  1GCQ C;  2DK3 A;  4D8D A;  5HY6 A;  2MF2 A;  4C8Q A;  1YBY A;  2DZ9 A;  2ZCF B;  1MGQ A;  4FT4 A;  3A1P A;  4FW2 A;  1FMK A;  1VQ4 T;  5CQX A;  3LGL A;  3CCE T;  3I9Q A;  2DTO A;  5GAM e;  3CCQ T;  3OSS C;  3M0P A;  1WIE A;  2DXU A;  4E2F B;  2K2V A;  1Y96 A;  4JJB A;  3OYH A;  1KJW A;  3HRS A;  1XTD A;  1LJO A;  1JEG A;  4M75 C;  2RB6 A;  4BI4 A;  3PVL A;  1VIF A;  2EGE A;  4F17 A;  1N8R C;  4QVD A;  3UA6 A;  5KYW B;  2L3P A;  4FSX A;  2FG0 A;  3G1J A;  5KYU A;  2DNU A;  3VS5 A;  3TCJ A;  2RK1 A;  4RTY A;  1BK2 A;  5FRM A;  1GBR A;  3LH0 A;  3H0I A;  2M1H A;  4PFP A;  4M78 C;  4DOV A;  1YFN A;  2ZPB B;  3OW2 A;  2COW A;  5GAN e;  2DRM A;  5GAM h;  2P4R A;  1BU1 A;  4LUD A;  2HBP A;  4JLI A;  4CC7 A;  2MCN A;  1SRM A;  3OYA A;  3WVD B;  1K9A A;  1YCS B;  4LDY A;  1AWJ A;  3EH1 A;  1UG1 A;  2RJE A;  1MMG A;  2E6Z A;  3MP8 A;  1VQ5 Q;  3L42 A;  3CCV A;  1V29 B;  4QQD A;  3JCM e;  4RTV A;  1YNZ A;  1K9M U;  2DA9 A;  3INZ A;  2MWO A;  1WQ7 A;  1WXT A;  2CSI A;  4E7K A;  1NM7 A;  2HNI A;  1G3Y A;  2QK0 A;  3VU3 C;  4Z89 A;  2A36 A;  1FX7 A;  3EFO B;  1BCM A;  1Z9Z A;  2ED0 A;  2COZ A;  4RUG A;  4OMM A;  1ZA2 B;  4PK4 A;  3L2V A;  1M3B A;  2CT3 A;  3EG3 A;  1JJ2 S;  1CSK A;  4HT9 A;  3BFM A;  1E6G A;  4LN2 A;  2XDP A;  1K1Z A;  1QW1 A;  2EQK A;  3GBQ A;  1Q81 U;  1MHN A;  3T9N A;  1K73 U;  2K3X A;  4GLK A;  3VYH B;  1C0M A;  5GAN h;  2DYI A;  3PMT A;  2QGF B;  1BYM A;  3EG0 A;  4Z88 A;  2DF6 A;  5CK9 A;  4HCK A;  1SSF A;  2EBP A;  1D3B A;  4PKC C;  3N5B B;  4PJO G;  2VGM A;  3CBM A;  1MMN A;  4E47 A;  4DBF A;  5FRO A;  1WJS A;  2CP6 A;  3H6Z A;  2M02 A;  3M56 A;  3I55 A;  4FL6 A;  1VQ8 T;  1M90 U;  1D1C A;  2XMF A;  3MO8 A;  2DXT A;  3QWY A;  1U5S A;  2E12 A;  2MWP A;  2EQI A;  2JW4 A;  1E7O A;  1K0X A;  4NOY A;  2RI2 A;  1CKA A;  1NZ9 A;  3E2U A;  4J5Y A;  1S72 T;  4XTX A;  2V1R A;  1UDL A;  1VQP Q;  2FYK A;  5J26 A;  3QSU A;  5GAO l;  4HXJ A;  3CME Q;  2DET A;  2R58 A;  4AFQ C;  4M77 B;  1E6H A;  1ABQ A;  4C92 B;  9ATC B;  3QUI A;  4O6J A;  2PQW A;  4YTL A;  4E7L A;  4C0Z A;  5DM7 R;  2KR3 A;  1H64 1;  2DD4 A;  3OYC A;  2EYX A;  1VQM T;  1M8V A;  3MET A;  2HBW A;  4BDY A;  1KHI A;  1JXM A;  5ECA A;  3CMA A;  1VQK A;  4J9B A;  2I2L A;  4Y92 A;  2J05 A;  4ZGJ B;  1Q86 R;  1Y07 A;  2RA2 A;  2KBT A;  3CCU A;  3HHT B;  2GTO A;  2K2M A;  4K11 A;  4OML A;  4PFZ A;  1YIT Q;  1PWT A;  4EMH A;  1VQ7 T;  1YP5 A;  3M4Y A;  4GY5 A;  4C8Q C;  2CGH A;  2FEI A;  5D6Y A;  1M30 A;  1ZUU A;  3BE3 A;  1RLP C;  1Q7Y U;  2JTF A;  4ESR A;  5IH2 A;  3JCM b;  4N4H A;  3L2U A;  2F1L A;  2DAQ A;  3CXC S;  4HT8 A;  1I07 A;  3CCJ Q;  4ATO A;  2ROT A;  3A5Z B;  3CC7 T;  1AZG B;  3SHW A;  1VQ4 Q;  4BD3 A;  2V8K A;  3CCE Q;  1GRI A;  4LUE A;  1I1J A;  1YHQ T;  4J6X A;  3CCQ Q;  4RTZ A;  1T3S A;  4M78 B;  3DLL A;  4L5G A;  4RTU A;  1G3W A;  3CCJ A;  5GMK i;  1XOV A;  2L8D A;  1WA7 A;  2JM8 A;  2SRC A;  3FB9 A;  2CZ6 B;  3VKI A;  3G6E T;  3V8J A;  4M7A D;  1TOV A;  2XD0 A;  3EHR A;  5KYX B;  4P5N A;  2KK4 A;  4KH1 B;  3EHQ A;  4N4I A;  4LXC A;  5D7U A;  1RAF B;  4M7A E;  1RAH B;  1JBM A;  2E65 A;  2DTH A;  2VB6 A;  3GLX A;  3PIO A;  3QWX X;  2XHC A;  4E7Z A;  2MYS A;  5KYY B;  2RF0 A;  2R5M A;  1G8X A;  2E4H A;  2K3Y A;  4J9I A;  3OYN A;  2G3R A;  3X20 B;  6AT1 B;  3G4S T;  4IUU A;  5FWC A;  5L23 A;  1Y71 A;  8ATC B;  1U8R A;  4OGC A;  3V8L A;  2PUK B;  5GMK j;  3FIF A;  1UJY A;  5A2Q E;  4JJC A;  4CRI A;  1NEB A;  3FRN A;  3I5R A;  1SF9 A;  2PZ1 A;  3RBB B;  2JTE A;  1I0C A;  1X2Q A;  1OV3 A;  3EGU A;  5GJW B;  1GBQ A;  5KE2 A;  3VS7 A;  5IXF A;  1K0S A;  1VQ6 T;  3OYD A;  1QVG S;  1EFN A;  4X1V A;  2ROL A;  2JS0 A;  4PNO A;  2CSQ A;  4A4E A;  2KMT A;  5DLO A;  4DA4 A;  3CD6 A;  4F7U E;  3CC4 T;  3WVE B;  1X43 A;  2LT1 A;  3X28 B;  4IUV A;  4PJO B;  1A0N B;  2DL8 A;  2D1X A;  2YUQ A;  4KUL A;  2PTK A;  4FM4 B;  1PCX A;  2BZ8 A;  4AFZ C;  1QP2 A;  3JB9 G;  1YIJ T;  2LJ0 A;  1KC8 C;  2JT4 A;  3CCV T;  1KD1 U;  2BZX A;  2MAM A;  1D0Z A;  3VS2 A;  1YJW T;  2D0Q B;  4M7A F;  1B34 A;  1LNX A;  2DEQ A;  2D6F A;  1ZHI A;  3S3O A;  5IHI A;  2P0Q A;  3OY9 A;  3SWN A;  1PNJ A;  1YI2 A;  3ZBD A;  5M9O A;  2ZPI B;  3ER0 A;  4MMK A;  2EYQ A;  2YRV A;  2AKL A;  1KK7 A;  4DEX A;  3GP8 A;  5A0L A;  3EG2 A;  5LJ5 d;  2F69 A;  5J39 A;  4DEY A;  1SHF A;  3M54 A;  3OA6 A;  2O88 A;  1WPY A;  3JCM X;  1N9S A;  2X35 A;  1OZ2 A;  2YUP A;  2ENM A;  2KSS A;  1WXB A;  1VUB A;  1KQS P;  2XKO C;  1WYX A;  1YJN T;  2E41 A;  2C0O A;  4LD6 A;  3ULR B;  3MP6 A;  3VS0 A;  4DBH A;  1VQ8 Q;  2O9S A;  5D6W A;  1AVZ C;  4RG2 A;  5EC7 A;  5LJ5 e;  1WNL A;  2EKH A;  2YUN A;  2EQU A;  2GQV A;  1R77 A;  1ZSZ A;  2O4X A;  3I56 T;  3DB4 A;  2QQB A;  3OYB A;  2FRW A;  1LOJ A;  1ZUK A;  4F14 A;  4F7U F;  2VGN A;  3OW2 P;  1BBZ A;  5GAN 4;  3JB9 J;  1S72 Q;  5GAM g;  1ABO A;  2R5A A;  5A0D A;  2QA4 T;  5DY9 A;  4M7D G;  2H8H A;  3L2W A;  1S1N A;  3OS5 A;  3FJ5 A;  3BY7 A;  4O5V A;  4MDW A;  3RKX A;  3JB9 I;  4IUT A;  3CQT A;  3M59 A;  2KVQ G;  2DIL A;  2J6K A;  2X9H A;  2J7I A;  3QZ9 B;  1G83 A;  1KHC A;  3HFN A;  4Z02 A;  1N6A A;  2EQJ A;  3CC2 A;  3A98 A;  3LWH A;  3TU4 K;  4J6W A;  2YLB A;  2BIV A;  1TUG B;  3EFS A;  4E7S A;  4LE9 A;  2O01 E;  4FCY A;  1VQM Q;  2FVU A;  1PSF A;  3L2Z A;  3QDR B;  1ZBX A;  1OYX A;  2RHY A;  1WHH A;  3JRZ A;  4ZGD B;  2CP5 A;  3I35 A;  2EQM A;  2JZ2 A;  1T3L A;  2IPO B;  2WSE E;  4XTV A;  2CZ7 B;  3E1S A;  4FYX B;  5LJ5 h;  1U1T A;  2G6F X;  1BIA A;  3MEA A;  1ZLM A;  2OTL Q;  1Q81 R;  1TUC A;  2FRY A;  1WXU A;  2V8J A;  1JO8 A;  5KYU B;  1VQK T;  3H0F A;  1M4Z A;  4CI0 C;  3ASK A;  3R6N A;  3EGX A;  1SHG A;  2OTL A;  1QWF A;  3C4S A;  2RHZ A;  1M1K U;  1FMW A;  4RTT A;  2GFU A;  5IAY A;  3BW1 A;  5IHN A;  2LX7 A;  3SDZ A;  4BE0 A;  4HVV A;  2KRN A;  4LNP A;  3QO3 A;  1MV0 B;  3JB9 F;  3CPF A;  4FT2 A;  2CZ1 B;  4JLG A;  2PU9 B;  2FPF A;  2B86 A;  2V26 A;  5KCH A;  5CR2 A;  3CC7 Q;  4C92 G;  2LNH B;  4OMN A;  2QAS A;  3C12 A;  1IGU A;  2E6N A;  2K4Y A;  3A8O B;  1PKS A;  1JB0 E;  1JQQ A;  2QDY B;  2MPX C;  3GIB A;  3G6E Q;  3M53 A;  4M7A A;  4Q5W A;  1AT1 B;  1EIF A;  2O9V A;  3RES A;  3RR6 A;  1AZE A;  2GBQ A;  4PFO A;  2PNI A;  2C0T A;  2NUP B;  1K8A U;  2QI2 A;  2KY9 A;  4J9E A;  1VQ9 T;  1NPP A;  3CCL T;  1IGQ A;  1WI7 A;  1VQL Q;  2KXC A;  5AYF A;  4M75 G;  3CBO A;  2E70 A;  5KYN A;  3G4S Q;  1KQS A;  3E9G A;  4EMK A;  2LT4 A;  1BI0 A;  3H8Z A;  1W6X A;  1VYT A;  1VQL A;  3MCA B;  2F2V A;  2QEX T;  2DER A;  4M77 D;  2A0F B;  3PNW C;  1MNE A;  3G7Z A;  1Q82 C;  5AT1 B;  2DEU A;  1BIB A;  4M77 E;  2F2W A;  4C92 E;  5GMK m;  2A08 A;  4DBR A;  4ME7 A;  3LYI A;  1NG2 A;  1WQW A;  4F7U A;  4M78 G;  2K5I A;  2OAW A;  2RMO A;  1HXD A;  4PL6 A;  4ANJ A;  3CC4 Q;  4JJD A;  2DIG A;  3SWN C;  1TXQ A;  1Q7Y R;  3X26 B;  1VQO Q;  3ZL7 C;  1IXD A;  1SRL A;  1H3Z A;  3CCM T;  1LCK A;  4EPC A;  1IO6 A;  4BDZ A;  2RM4 A;  2DJZ A;  1N8R U;  2DJQ A;  1YIJ Q;  1JRI A;  2OX7 A;  5IXB A;  1KSW A;  1U06 A;  3OBY A;  4A53 A;  1Y7X A;  2RO0 A;  2CUD A;  1VQO A;  5CCA A;  4XK8 E;  4XU3 A;  1VQ5 A;  1YJW Q;  4ELY C;  4IUP A;  3OYJ A;  3QXE B;  3HRT A;  3DB3 A;  4CC4 B;  2IVW A;  3PE0 A;  2KDS A;  3CCR T;  3VS1 A;  3EH2 A;  4M7D B;  2L5Q A;  3F70 A;  4ELZ C;  4C0D C;  4DBQ A;  1N5Z A;  2AZV A;  4J7I A;  2M0Y A;  2RNA A;  2A3L A;  3OW2 S;  1PD0 A;  2NWM A;  3EG1 A;  4QW2 A;  5FLX E;  1WHG A;  1ZSZ C;  2CP3 A;  2X4X A;  1YJN Q;  4V2S A;  5IN1 A;  1D0X A;  3TEE A;  2CZ0 B;  3QYH B;  3OQ5 A;  3EAE A;  4M78 E;  2JMA A;  4EDU A;  1YJ9 T;  4FYW B;  2C06 A;  1PC0 A;  3KBG A;  4BY6 C;  4J8O A;  5FU7 B;  2HKN A;  4M4Z A;  4M77 F;  5FU6 C;  4C92 F;  2RN8 A;  1M5Q 1;  2HZY A;  4JRP A;  5GAN 3;  1YWO A;  3I56 Q;  5CKH A;  3M0R A;  5KYW A;  3MKD A;  3HP9 A;  2HQH A;  1ARK A;  4IUQ A;  2VXE A;  1H3H A;  2M9U A;  2RJD A;  4HVU A;  2HCK A;  1J3T A;  1MMD A;  5CAI A;  2A7Y A;  1VQN T;  2LQK A;  1QVF P;  3EG9 A;  1M3A A;  4MZT A;  4PJL A;  2PVD B;  1WHL A;  4RMO A;  2ZAE A;  1RUW A;  1B7T A;  3TQ7 P;  2HD0 A;  1VQP A;  1UGQ B;  1KD1 R;  1IHW A;  4OMP A;  2YLC A;  3RKW A;  2OTJ T;  2RPN A;  2QGG A;  2KQW A;  2FZK B;  3CME A;  1F1B B;  1XNI A;  4FW1 A;  1O75 A;  2LQW A;  1ZUY A;  1NLP C;  3G71 Q;  2X4Y A;  3QG1 A;  4KUI A;  4XAX B;  1O9S A;  2Y4Y A;  3PTA A;  3I5S A;  2ATC B;  2RJC A;  1Q7Y C;  1QQJ A;  1RAG B;  4M78 F;  2LJ1 A;  3EFO A;  2DYB A;  3JCM V;  4PJO E;  2GFA A;  2W10 A;  2EFI A;  3OYI A;  5LJ3 d;  1UGP B;  3QJ6 A;  1M2V B;  3G71 A;  1VA7 A;  1NJI R;  1I8F A;  1WHJ A;  4AT1 B;  1T0H A;  4C8Q G;  2PVO B;  3QHS A;  4M75 B;  2DLP A;  4AG1 C;  1YIT A;  3MP1 A;  3C95 A;  4LDW A;  1YWP A;  4M7A C;  5EG2 A;  4X34 A;  5GMK e;  3QYG B;  2K79 A;  2RI3 A;  2GQI A;  4HCB A;  3TRE A;  2DL7 A;  3J81 E;  2O2O A;  3OYE A;  1YN8 A;  3EGD A;  3OS0 A;  3FDR A;  3M5A A;  2FO0 A;  2IG0 A;  1GL5 A;  2EJF A;  2EWN A;  3CCS T;  4JPB W;  2HAX A;  4RTX A;  1R0B G;  2WSC E;  1VYV A;  2QQA A;  2EGA A;  2HL3 A;  3NGP A;  5LJ3 f;  4EMK C;  3RMS A;  2D9T A;  1K76 A;  1X6B A;  3KXT A;  2EYZ A;  1VQ9 Q;  1UGV A;  1GCP A;  3M0U A;  4JRQ A;  2CP0 A;  1VQ4 A;  3CCL Q;  3CCE A;  3OYL A;  3CCQ A;  1NE8 A;  2O31 A;  4XU1 A;  1AWO A;  3OMC A;  1X27 A;  5GAO p;  1X01 A;  2K9G A;  3SEM A;  1BI1 A;  4A4G A;  3QBY A;  2VWF A;  2Z0W A;  2JXB A;  1ZSG A;  4J9D A;  4CC2 A;  2H3J A;  2LJ3 A;  3NTI A;  4Y91 A;  5GMK h;  1D09 B;  2OI3 A;  4PJO F;  4LDU A;  3JCM J;  1NLO C;  2M0O A;  1PM3 A;  1UHC A;  2QEX Q;  2X51 A;  1TG0 A;  1UTI A;  2BE7 D;  2RQW A;  3PFS A;  4M77 A;  1WJQ A;  4LD9 K;  3M4G A;  2X4J A;  1UGR B;  3NPF A;  5LJ5 g;  1I5O B;  5IHK A;  3RNJ A;  3OYG A;  4GLM A;  2AHJ B;  3GPL A;  3QDF A;  2RQU A;  3S3N A;  1ZSZ B;  4HKE A;  3VJP A;  1XJW B;  5LJ3 j;  2HQE A;  1Q95 G;  5DLQ E;  4ZN3 A;  2VKN A;  1NYG A;  3V7C A;  1QVF A;  1UGS B;  2J6O A;  2GGR A;  4WTO B;  1OUL A;  2F5K A;  2PVG B;  3CBP A;  3PVQ A;  1Q86 C;  4BI3 A;  2LVM A;  3JSC A;  4R56 A;  1MUZ A;  4ZTF A;  1W2B P;  4OB1 B;  1NJI C;  4QVC A;  4A4F A;  3IQL A;  3CCR Q;  1RAB B;  4R55 A;  1AEY A;  1N27 A;  2A28 A;  1QP3 A;  3HTR A;  1K8A R;  1VOM A;  2NYS A;  1RL2 A;  5I2M A;  3HL8 A;  2ESW A;  1BCO A;  3UF4 A;  2NUT B;  1XQH A;  1Y57 A;  3HRU A;  2AZS A;  3QKJ A;  2JM9 A;  2XI9 A;  2DFU A;  3PIP A;  2RJF A;  4X9D A;  5KYX A;  1YJ9 Q;  1X2K A;  4KGZ B;  2CP2 A;  1W70 A;  3RMQ A;  2HSE B;  1QVF S;  1DJ7 B;  5CKE A;  4MDX A;  1CKB A;  3RIR A;  3LLR A;  4RCC A; 
#chains in the Genus database with same CATH homology
 4A4K A;  2QDY B;  3PMT A;  1B34 B;  3GIB A;  5CVI A;  3CPW A;  4C5E A;  4J83 A;  2E64 A;  2DZC A;  1BYM A;  1TH7 A;  3SWN B;  3M53 A;  1KC8 U;  4M7A A;  4Q5W A;  2RD1 A;  4OB0 B;  1EIF A;  2ZPG B;  3RES A;  2K5L A;  5CK9 A;  3LX7 A;  5HK3 A;  4IKF A;  3VUB A;  1VQ9 A;  1SSF A;  4VUB A;  2EJG A;  1K8A U;  4C8Q D;  2QI2 A;  3CCL A;  1D3B A;  2KY9 A;  3JB9 D;  1VQ9 T;  4PKC C;  5GAO m;  1NPP A;  2JN0 A;  3CCL T;  3N5B B;  4PJO G;  2VGM A;  2FL7 A;  3CBM A;  4F7U G;  3UPU A;  4E47 A;  4C8Q E;  5FRO A;  3CD6 A;  3L1A A;  1QVG A;  3O8V A;  5AYF A;  1VQ8 A;  4M75 G;  3CBO A;  2DD5 A;  2VYT A;  1WJS A;  4HCC A;  3H6Z A;  2LTO A;  3M56 A;  2E70 A;  3I55 A;  1G3S A;  4C8Q B;  5IT9 E;  4FL6 A;  3L2R A;  4C92 A;  2E5Q A;  1M90 U;  1VQ8 T;  4NS5 A;  3MO8 A;  4JUV A;  2DXT A;  3E9G A;  1KQS A;  4EMK A;  3I55 T;  1I5L A;  2LT4 A;  1BI0 A;  3H8Z A;  2E12 A;  1FXX A;  1RI0 A;  2MWP A;  5GAO r;  1VQL A;  1KQ2 A;  3X24 B;  2QQS A;  3FJP A;  4BUG A;  2QEX A;  5LJ3 h;  3GNG A;  4NOY A;  2JOY A;  4C0D B;  2RI2 A;  3MCA B;  4C0G A;  1NZ9 A;  1S72 A;  1VQL T;  4OB3 B;  2QEX T;  4E7I A;  4B9W A;  4J5Y A;  4M77 D;  1S72 T;  1Y96 B;  2ZPH B;  3PNW C;  4DQ2 A;  1R8O B;  3HSB A;  4JDS A;  2DXB A;  1PSE A;  3UWN A;  1ZQ1 A;  2O4X B;  3G7Z A;  4XTX A;  1K73 U;  1UB4 A;  2FYK A;  3CPW S;  3OB9 A;  5J26 A;  1Q82 C;  3QSU A;  5CKF A;  3J7A F;  1BIB A;  1X6O A;  1YCY A;  4M77 E;  4C92 E;  5GMK m;  5GAO l;  3OYM A;  4JS5 A;  1KD1 C;  4ME7 A;  3LYI A;  1WQW A;  1VIE A;  4PJO A;  4F7U A;  4M78 G;  2R58 A;  2JTM A;  3HFO A;  4M77 B;  4C92 B;  3E19 A;  4L6V 5;  4BY6 B;  2K5I A;  3QUI A;  4C0F A;  3JCM c;  4O6J A;  2PQW A;  4M75 A;  1HXD A;  4YTL A;  5FU6 B;  4XTU A;  3BDL A;  4C0Z A;  4ZGE B;  5DM7 R;  4E7L A;  2XU8 A;  1VQM A;  2LRQ A;  4PL6 A;  1H64 1;  2DIG A;  2DD4 A;  3SWN C;  5HK0 A;  5C6S A;  3OYC A;  3CCM A;  4J7F A;  3X26 B;  1VQM T;  1M8V A;  3MET A;  2R57 A;  3OYY A;  4BDY A;  1KHI A;  1H3Z A;  3CCM T;  3VYG A;  4EPC A;  3CMA A;  1VQK A;  5CKD A;  4BDZ A;  3RER A;  3FC3 A;  2I2L A;  2RM4 A;  2DJZ A;  2WSF E;  1N8R U;  1JRI A;  4ZGJ B;  5CO7 A;  3LWI A;  1Y07 A;  3CMA T;  2RA2 A;  4IUR A;  2MMP A;  3OBY A;  4A53 A;  4C5G A;  3CCU A;  3R6O A;  1Y7X A;  2RO0 A;  3HHT B;  3MEW A;  3QZ5 B;  1VQO A;  5L8R E;  4NL3 A;  2RI5 A;  5CCA A;  1VQ7 A;  4E7H A;  4XK8 E;  2RHU A;  4XU3 A;  3CCU T;  1VQ5 A;  1M1F A;  4M7D D;  1FWZ A;  3DLM A;  4ELY C;  1VQO T;  2FB7 A;  1W4S A;  4XQ3 A;  3RUX A;  4EMH A;  1VQ7 T;  1VQ5 T;  4IUP A;  2RH2 A;  3M4Y A;  5GAN 2;  3QXE B;  3OYJ A;  2QQR A;  3HRT A;  3DB3 A;  2CKK A;  2ZPE B;  3Q1J A;  4GY5 A;  4C8Q C;  3ZEH A;  3CCR A;  5GMK l;  3C94 A;  3JCM P;  4M7D E;  1KG1 A;  4C8Q F;  2CGH A;  1X75 C;  2IVW A;  3MEV A;  4M78 A;  3NFC A;  2KDS A;  5D6Y A;  3CCR T;  4C5H A;  4M7D B;  2L5Q A;  1Q7Y U;  3F70 A;  4ELZ C;  4C0D C;  2JTF A;  2DXC A;  2K57 A;  4Y28 E;  3JB9 H;  1HK9 A;  4J7I A;  4BI8 B;  3DKM A;  4PLI A;  3JCM b;  2A3L A;  4N4H A;  3L2U A;  2K5F A;  3A8H B;  5GAM d;  4JS4 A;  2CS7 A;  3OW2 S;  2BUD A;  2XDD A;  1W2B A;  4QW2 A;  2DAQ A;  3M57 A;  5FLX E;  3CXC S;  1Q86 U;  4HT8 A;  3M9Q A;  3JCM Q;  2EIF A;  4PLL A;  2X4X A;  4QVZ A;  4MZP A;  3CC7 A;  4V2S A;  2DTI A;  5IN1 A;  2NLU A;  1YJ9 A;  4JRK A;  2F5T X;  3TEE A;  4ATO A;  4XU2 A;  2CZ0 B;  3QYH B;  3A5Z B;  3OQ5 A;  3CC7 T;  1NJI U;  2P0K A;  1I81 A;  3EAE A;  4M78 E;  3LW5 E;  4BD3 A;  4EDU A;  4E7J A;  2V8K A;  4M77 C;  1QVP A;  1YJ9 T;  2C06 A;  3KBG A;  4BY6 C;  3P8H A;  2HQX A;  4J8O A;  5FU7 B;  4OVA A;  1YHQ T;  4J6X A;  4M77 F;  3P8B B;  3PGG A;  4M78 B;  5FU6 C;  4C92 F;  4RCB A;  1M5Q 1;  4L5G A;  3DLL A;  1M9S A;  3G6E A;  1G3W A;  3MEU A;  4JRP A;  3CCJ A;  1WGS A;  4FIB A;  1XOV A;  2DIQ A;  5GMK i;  5GAN 3;  5I2S A;  3SB2 A;  4OGE A;  5J3B A;  2L8D A;  3VKI A;  3FB9 A;  3G6E T;  2CZ6 B;  4M7A D;  3V8J A;  3CCJ T;  1N9R A;  2V8I A;  2XD0 A;  4P5N A;  1G5V A;  4N4G A;  5CKH A;  2KK4 A;  5CQY A;  1GXI E;  4UC4 A;  3ME9 A;  4OP0 A;  4N4I A;  3HP9 A;  3KUF A;  3QII A;  2ZGW A;  5HKC A;  4M7A E;  4OB2 B;  1JBM A;  4A54 A;  2E65 A;  2DTH A;  4N0A A;  4IUQ A;  2VXE A;  3GLX A;  2DKG A;  5GAM f;  3PIO A;  2M9U A;  2L89 A;  2RJD A;  4M7A B;  3RKY A;  2WAC A;  2XHC A;  2DO3 A;  5CIU A;  3L2Q A;  3PMI A;  2R5M A;  1VQN A;  2K3Y A;  5LJ5 f;  3QJY A;  3CEY A;  3G4S A;  4BE1 A;  5CAI A;  3M58 A;  3OYN A;  2G3R A;  2A7Y A;  1VQN T;  3X20 B;  5A0G A;  2LQK A;  4C92 D;  1D3B B;  3G4S T;  4IUU A;  1W2B S;  5GAN d;  4MZT A;  4RKU E;  2EKO A;  3OYK A;  4ZTJ A;  4NL2 A;  1Y71 A;  4L59 A;  4M7D C;  2PVD B;  2KAF A;  2Y90 A;  3J80 E;  2RK2 A;  1U8R A;  4OGC A;  3V8L A;  2PUK B;  5GMK j;  3FIF A;  4M7D F;  1WJR A;  3HPW A;  3JAM E;  4RMO A;  5A2Q E;  4LDV A;  3M55 A;  4OF1 A;  4XU0 A;  1BI2 A;  2GF7 A;  2QQ9 A;  1K9M C;  4CRI A;  5C0M A;  3FRN A;  3V7R A;  4EMK B;  2OTJ A;  3MHX A;  4II1 A;  2HD0 A;  3JCM d;  1VQP A;  1UGQ B;  3A8M B;  1M1K C;  2B8A A;  3VV0 A;  4A4H A;  3FLG A;  2YLC A;  3P8D A;  3RKW A;  2OTJ T;  2JVV A;  1VQP T;  2KQW A;  1JJ2 A;  2OAU A;  1VQ6 A;  3CME A;  3AHU A;  5KE2 A;  3GNF B;  2VXF A;  1XNI A;  5KCO A;  1VQ6 T;  1O75 A;  3OYD A;  1P92 A;  3A8G B;  2VUB A;  5FU7 C;  3CME T;  2LDM A;  3SD4 A;  5GAO q;  1QVG S;  2LQ8 A;  2X4Y A;  3QG1 A;  4KUI A;  4XAX B;  1O9S A;  2Y4Y A;  3PTA A;  1UEB A;  5GAN 7;  2RJC A;  3ZFJ A;  1Q7Y C;  3CC4 A;  4M75 D;  4PNO A;  1KQS S;  3S3M A;  4M78 F;  4KBM B;  4A4E A;  2KMT A;  5DLO A;  4DA4 A;  3JCM V;  2ZZD A;  4F7U E;  2GFA A;  2MI6 A;  3WVE B;  3CC4 T;  1Q81 C;  4TVR A;  5GAN f;  4KUD K;  2LNV A;  2EFI A;  2RHI A;  1G3T A;  2LT1 A;  3OYI A;  1K73 C;  3X28 B;  5LJ3 d;  1UGP B;  3QJ6 A;  3EFR A;  3G71 A;  3CD6 T;  4IUV A;  4PJO B;  4F7U B;  4M75 E;  1I8F A;  1NPR A;  2LC4 A;  4MZM A;  1YIJ A;  2DPP B;  3SFM A;  4KUL A;  5KH6 A;  3G71 T;  4FM4 B;  1U1S A;  4C8Q G;  5GAM j;  1QP2 A;  3JB9 G;  2PVO B;  3QHS A;  4JRI A;  4M75 B;  1YIJ T;  4EMG A;  3HKS A;  1Q82 U;  4HA8 A;  1IRE B;  4KT0 E;  1OI1 A;  1YIT A;  1KC8 C;  3OMG A;  3CCV T;  2JUF A;  2L3R A;  3C95 A;  3MP1 A;  4LDW A;  1YJW A;  1KD1 U;  4MDX A;  4M7A C;  3FEO A;  5GAN g;  2MAM A;  4X34 A;  5EG2 A;  4XTW A;  5LJ5 j;  1YIT T;  3JCM f;  4C5I A;  5GMK e;  1YJW T;  2D0Q B;  4M7A F;  3QYG B;  1K8A C;  1B34 A;  1LNX A;  2DEQ A;  2RI3 A;  2D6F A;  3PT9 A;  1ZHI A;  3S3O A;  2GCX A;  5GAO n;  3TRE A;  3J81 E;  2P0Q A;  3OY9 A;  3SWN A;  4HCB A;  1YI2 A;  4B9X A;  3ZBD A;  5M9O A;  2ZPI B;  3ER0 A;  3OYE A;  4MMK A;  2EYQ A;  2YRV A;  2FHD A;  3OS0 A;  1YI2 T;  2BKD N;  2Y4X A;  4LDX A;  2CYZ B;  4M78 D;  3FDR A;  1BKB A;  2EAY A;  2IG0 A;  3M5A A;  3GP8 A;  3CCS A;  4BAC A;  5A0L A;  3JCM g;  2EJF A;  5LJ5 d;  2DVE A;  2F69 A;  5J39 A;  2EWN A;  2YHT A;  3UDC A;  3E9F A;  3JCM W;  3CCS T;  1M90 C;  3M54 A;  3NTK A;  3QPH A;  2HAX A;  3OA6 A;  3A8L B;  1YHQ A;  2WSC E;  3OSV A;  2QQA A;  4C92 C;  2LCC A;  1WPY A;  4M77 G;  3JCM X;  5LJ3 f;  1N9S A;  2X35 A;  3OS2 A;  4XTY A;  1OZ2 A;  3V8K A;  3NTH A;  4EMK C;  3RMS A;  5GAN 8;  2KSS A;  2D9T A;  1VUB A;  2DK3 A;  1YJN A;  2XKO C;  2MF2 A;  5HY6 A;  4C8Q A;  3KXT A;  5D6X A;  1YBY A;  2DZ9 A;  4JRQ A;  1VQ4 A;  2ZCF B;  1MGQ A;  1YJN T;  4FT4 A;  4QQ6 A;  2E41 A;  3CCE A;  4BB7 A;  3OYL A;  2QTX A;  1VQ4 T;  5CQX A;  3CCQ A;  5LJ3 g;  1NE8 A;  3LGL A;  3CCE T;  5GAN 5;  4XU1 A;  2DTO A;  4LD6 A;  5GAM e;  3OMC A;  3CCQ T;  3MP6 A;  1X01 A;  5GAO p;  5GAN j;  2RHX A;  3OSS C;  5KE3 A;  4A4G A;  1BI1 A;  2DXU A;  3QBY A;  5D6W A;  1BI3 A;  2K2V A;  5LL6 S;  1Y96 A;  3JCM h;  4RG2 A;  3OYH A;  3I56 A;  3UT1 A;  1WNL A;  5LJ5 e;  2EQU A;  3HRS A;  2GQV A;  4PJO C;  5I21 A;  2O4X A;  3OBW A;  2H3J A;  1XTD A;  3DB4 A;  3NTI A;  2QQB A;  4Y91 A;  1LJO A;  5GMK h;  3OYB A;  3I56 T;  1LOJ A;  2JNG A;  4PJO F;  4F7U F;  4LDU A;  3JCM J;  4QQG A;  4XTZ A;  2VV5 A;  4M75 C;  2M0O A;  2VGN A;  2XID A;  1AHJ B;  3GF5 A;  2QA4 A;  2RB6 A;  4BI4 A;  5GAN 4;  3JB9 J;  1VIF A;  3PFS A;  4X9C A;  4M75 F;  2R5A A;  4M77 A;  5GAM g;  4DOW A;  5A0D A;  2QA4 T;  5DY9 A;  3VUZ A;  1WJQ A;  4M7D G;  4LD9 K;  3M4G A;  1N8R C;  3L2W A;  3OS5 A;  2X4J A;  4ZN1 A;  3BY7 A;  1UGR B;  2XK0 A;  4QVD A;  5LJ5 g;  3OYG A;  4O5V A;  4MDW A;  3RKX A;  3JB9 I;  4IUT A;  3M59 A;  3OYF A;  2KVQ G;  4WF2 A;  2M16 A;  3QZ9 B;  4FSX A;  1KHC A;  3HFN A;  4Z02 A;  1N6A A;  2AHJ B;  2EQJ A;  3GPL A;  3CC2 A;  4J6Y A;  3LWH A;  3WXM B;  3TU4 K;  4J6W A;  3X25 B;  2YLB A;  3S3N A;  2BIV A;  3TCJ A;  4MML A;  2P4T A;  1M1G A;  3CC2 T;  4HKE A;  2RK1 A;  3VJP A;  3EFS A;  5LJ3 j;  4HCZ A;  2HQE A;  2O01 E;  2XIC A;  2QXF A;  5FRM A;  2PUO B;  4PJO D;  3LH0 A;  2FVU A;  1PSF A;  3L2Z A;  2LX9 A;  3QDR B;  1ZBX A;  3GOX A;  4JJN K;  2M1H A;  4M78 C;  1OYX A;  2RHY A;  5DLQ E;  4DOV A;  3JRZ A;  2ZPB B;  4ZN3 A;  3OW2 A;  3V7C A;  1KQ1 A;  4ZGD B;  1QVF A;  5GAN e;  4PJO E;  5GAM h;  3CXC A;  1UGS B;  2HBP A;  4JLI A;  2EQM A;  2F5K A;  2JZ2 A;  3OYA A;  2PVG B;  3BDU A;  3WVD B;  2WSE E;  3CBP A;  2CZ7 B;  3E1S A;  4XTV A;  5LJ5 h;  1Q86 C;  4LDY A;  2E1H A;  2LVM A;  4BI3 A;  4M7D A;  1U1T A;  3JSC A;  1BIA A;  2RJE A;  3MEA A;  2E6Z A;  3MP8 A;  3L42 A;  4R56 A;  3CCV A;  2V8J A;  1V29 B;  4ZTF A;  2LCL A;  4QQD A;  4RG8 A;  3JCM e;  4D6W A;  1VQK T;  4OB1 B;  1NJI C;  4QVC A;  4OMF B;  4A4F A;  4CI0 C;  1M4Z A;  4M7A G;  1K9M U;  3ASK A;  2ZPF B;  3LGF A;  1I4K 1;  3URG A;  3INZ A;  2MWO A;  2OTL A;  3V7S A;  1WQ7 A;  3C4S A;  4R55 A;  2RHZ A;  1N27 A;  4E7K A;  1M1K U;  1IZ6 A;  2HNI A;  2GFU A;  4FU6 A;  1G3Y A;  3VU3 C;  3BW1 A;  3SDZ A;  5IAY A;  4BE0 A;  2OTL T;  1QP3 A;  1FX7 A;  2P0P A;  3QO3 A;  1RL2 A;  5I2M A;  3OS1 A;  3HL8 A;  5GAN 6;  3JB9 F;  3CPF A;  1OZ3 A;  2EJ9 A;  4FT2 A;  3L2V A;  1JJ2 S;  1XQH A;  2CZ1 B;  4JLG A;  5LJ3 e;  2PU9 B;  2XG8 D;  3HRU A;  3BFM A;  5FRN A;  4HT9 A;  3QKJ A;  2XI9 A;  3S6W A;  5KCH A;  5CR2 A;  2X4W A;  3PIP A;  2RJF A;  2XDP A;  5CKB A;  4C92 G;  1QW1 A;  2EQK A;  4X9D A;  4BE2 A;  1Q81 U;  2XDB A;  4N0A C;  3RMQ A;  1MHN A;  2VC8 A;  1QVF S;  1DJ7 B;  3T9N A;  2K3X A;  4GLK A;  5CKE A;  3RIR A;  3C12 A;  3LLR A;  2E6N A;  2K4Y A;  4RCC A;  3A8O B;  2E10 A;  3VYH B;  1JB0 E;  5GAN h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...