4X1VA

Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CD2-associated protein
publication title Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4x1vA00
4DEYA 2RPNA 3A98A 5ECAA 1SSHA 2JM9A 4F17A 2GTJA 2K79A 2K2MA 2DJQA 1RLQC 5IHIA 1UDLA 1HD3A 2VVKA 1UTIA 1NLPC 1J3TA 3UATA 4J9BA 3UA6A 1UG1A 2F2XA 2BZXA 1H8KA 2RF0A 1KJWA 4LN2A 4RTUA 1QKWA 1SHGA 2BZYA 3QWXX 3I5SA 1M27C 1WIEA 1XOVA 2DRMA 2DVJA 2KXCA 1WX6A 4OMMA 1GCQA 2KEAA 1YN8A 4GLMA 2CT3A 1AOJA 4E6RA 2DNUA 2OJ2A 2O88A 2FG0A 4JJDA 1UECA 3EHRA 2VKNA 2A08A 2DL8A 3TVTA 1AWOA 2GTOA 2KBTA 2HBWA 2JXBA 2V1QA 2KT8A 4AFSC 2AKLA 2B86A 1IO6A 2FO0A 4Z8AA 5IHNA 4LE9A 1K9AA 2FPFA 2LX7A 1W1FA 2KR3A 2J6KA 1GBQA 3RNJA 1RUWA 3EG3A 1I0CA 1Z9QA 2GBQA 3PE0A 2LNHB 1GFCA 4X1VA 4EIKA 2LMJA 2L3SA 4RTWA 2KT1A 3RBBB 2JTEA 3VS4A 1BU1A 1T3LA 5FW9A 2DBKA 3IQLA 2FRWA 1NLOC 1GL5A 1SEMA 4IIMA 2ESWA 1QWFA 2C0OA 2RMOA 1RI9A 1JEGA 2KYBA 2KRMA 1UHCA 3M0TA 2J6FA 1VA7A 2KRSA 1W6XA 2VWFA 1M3BA 2OI3A 1BK2A 2HCKA 2BZ8A 3TSZA 2EYYA 4OMNA 4Y92A 1FYNA 5HCKA 2YUNA 1NEBA 1K76A 2YUPA 1U3OA 2RNAA 1VYVA 3H0FA 4D8KA 3H0HA 2JMAA 1GCPA 2GQIA 1MUZA 2ABLA 2DBMA 4Z88A 2ENMA 1CSKA 2KRNA 1HSQA 2LCSA 3UA7A 1SHFA 2LQNA 2CH4A 1WDXA 3PVQA 4F14A 3QWYA 2YSQA 2DF6A 2C0IA 2CT4A 3TSWA 2ROLA 2KE9A 1OV3A 1CKAA 2A28A 2DM1A 1ARKA 2CDTA 1M30A 2XMFA 3I9QA 2IIMA 1X6BA 4JJCA 3SHWA 4J9IA 1WYXA 2DL3A 2SRCA 4AG2C 4QT7A 2EW3A 1YWPA 1WA7A 1RLPC 2NWMA 4JZ4A 2W0ZA 2KROA 2J05A 1EFNA 4AFQC 2JS2A 2MIOA 5EC7A 2PNIA 2K3BA 3EG0A 1PRMC 2OAWA 1GRIA 3UF4A 2LQWA 1AZGB 1TG0A 1TUCA 2EPDA 1UHFA 4D8DA 1W70A 1H3HA 1CKBA 2KGTA 2M0YA 5IXBA 1JU5C 1K4US 4RUGA 3VS7A 4HVVA 1A0NB 4M4ZA 1NG2A 4CC7A 1SRLA 2AKKA 2D8HA 2JT4A 3VS3A 2YDLA 2JM8A 1M8MA 2BTTA 4Z89A 2L2PA 1GFDA 2O9VA 1YWOA 2ED1A 1ZBJA 2DL4A 2EGAA 2A36A 1G2BA 4RTVA 1PRLC 2KYMA 2DL7A 1ZUUA 1N5ZA 4ORZA 3NGPA 4ZNXA 5GJWB 3JV3A 2CUBA 4J9EA 2LJ1A 2FPEA 1OPKA 3M0PA 3VS2A 1U06A 2X3XD 2AK5A 1M3CA 5I11A 4OMPA 2KNBB 1UFFA 3O5ZA 3H41A 1YCSB 5IHKA 4IIOA 2D8JA 4LNPA 2DILA 1WI7A 2MCNA 4RTYA 4AFUC 1T0JA 1WXBA 2I0NA 2CREA 1PKTA 2AZSA 4R0KA 2GNCA 1ZUYA 2L0AA 2KXDA 2HSPA 1BBZA 3NPFA 2LZ6B 1VYUA 2ECZA 2M51A 2V1RA 1WFWA 2SEMA 2DA9A 1Y57A 2F2WA 4J9GA 2YUQA 2O9SA 2EYZA 2JW4A 2HDAA 2K6DA 2CSQA 1BB9A 2L3PA 4A63B 2P4RA 4JJBA 1OOTA 1SRMA 4CC3A 2CUDA 3R6NA 3M0RA 2DYBA 3H0IA 4HCKA 1B3QA 4HXJA 2FEIA 1JXMA 2EYXA 2YUOA 2JS0A 1T0HA 1UJ0A 3M0QA 1K1ZA 2PZ1A 2FRYA 4RTZA 2DLPA 5FWCA 2CH4W 2A37A 2L3QA 2H8HA 4KRTA 5IXFA 3EG2A 3REBB 2DRKA 3ZL7C 1NM7A 1VYTA 4WCIA 1UE9A 2PTKA 1YNZA 2LP5A 2E5KA 4CC4B 1SPKA 1MV0B 4OMQA 4DEXA 3VRZA 1KFZA 1KIKA 2AZVA 2RN8A 1X2KA 3PVLA 4RTTA 1T3SA 4RTXA 1JO8A 2O31A 1NEGA 1K0XA 3REAB 3VS1A 1S1NA 4J9FA 2DE0X 4J9CA 1QKXA 2K9GA 1WXUA 4HVWA 3VS0A 1V1CA 1WLPB 4GBQA 4AFZC 2EYWA 4AG1C 2EGEA 2K7AA 1ZLMA 1PWTA 1Z9ZA 2FPDA 2HEQA 5L23A 2EVRA 2ED0A 1OPLA 2CSIA 4OMOA 1UUEA 2NUZA 3EGUA 1I1JA 1JQQA 2J06A 4JZ3A 1Y0MA 2D1XA 1X27A 1ZX6A 3NMZC 1PNJA 2EQIA 4FSSA 3THKA 2RQVA 1X43A 3U23A 1NYFA 2YT6A 2GGRA 2RQTA 1AWXA 1U5SA 1AZEA 2MOXA 1UGVA 3SEMA 1QWEA 1GCQC 2F2VA 1AWWA 1ZSGA 1E6HA 3C0CA 3I5RA 1LCKA 5FWBA 2DMOA 2EBPA 3VRYA 1ABOA 1KSWA 2J7IA 2DL5A 2D0NA 2G6FX 2EKHA 4ESRA 1M3AA 2QDLA 2LJ0A 1AVZC 4J9HA 3EHQA 4K11A 2C0TA 1GBRA 2J6OA 3GBQA 1E7OA 4JPBW 2ROTA 1NYGA 2W10A 3I35A 1K0SA 3KFVA 2RQRA 3M0UA 4LUEA 1I07A 1AWJA 2O2OA 1WXTA 1X69A 2RQWA 4OMLA 2X3WD 4LUDA 1PHTA 4F16A 1H92A 5GJVB 2LJ3A 1AD5A 1YP5A 2RQUA 1ABQA 1E6GA 3CQTA 2EGCA 5IH2A 3ULRB 3EG1A 1OEBA 1X2QA 3VS6A 1UJYA 2DX1A 4HVUA 1QLYA 1JXOA 3FJ5A 5I22A 1MV3A 3LH5A 4CC2A 1QCFA 1AEYA 1X6GA 1FMKA 4J9DA 1HJDA 1PKSA 1B07A 3M0SA 3NHNA 1ZUKA 1TUDA 2JMCA 3VS5A 1G83A
chains in the Genus database with same CATH superfamily
4E7LA 4FT2A 1Q86U 1C0MA 7AT1B 1C6VX 1UGRB 3OS0A 2DJQA 4PLLA 1RLQC 5IHIA 2CP5A 1UTIA 4BE0A 1NZ9A 4IUTA 1RAHB 4C92E 2ZPIB 2QGFB 2Y4YA 2HMAA 3OYDA 3UA6A 1QP3A 4BY6C 3CCMQ 1VQMQ 4M7DC 1VQKQ 1WQ7A 5GMKj 3EG9B 4M75B 2BZYA 5GAOp 3I5SA 2KXCA 1OU8A 1WX6A 5LJ5f 2MWOA 4PJOD 2M02A 4GLMA 2CYZB 1WGSA 4E7KA 2O88A 2VKNA 1HYOA 2A08A 3TVTA 3BY7A 1AWOA 2H3EB 2DPPB 3MHXA 3BE3A 2HSEB 2JXBA 2V1QA 2AKLA 1YJ9A 3L42A 5IHNA 4RG8A 1JBMA 4FT4A 4LE9A 1WHKA 2J6KA 5GAN2 1GBQA 3RNJA 4HA8A 1RUWA 3CC7Q 2RI3A 2ZPFB 3CCST 1I0CA 3WVDB 1Z9QA 2GBQA 2XDBA 3A8OB 3PE0A 3QBYA 2P4TA 4X1VA 4EIKA 1BCMA 4M78D 3HKSA 3RBBB 5GAMj 1IXDA 4AT1B 3EH1A 5KYXA 1NLOC 4WF2A 4C8QC 4F7UA 4IIMA 2ESWA 3V7SA 1RI9A 4DQ2A 1BCOA 3BDLA 3JB9D 2J6FA 2X4XA 4F04B 1YIJA 1VA7A 2KRSA 2VWFA 2BZ8A 1LVKA 2EYYA 4OMNA 1ZBXA 5KYWB 4M7AA 4NS5A 2YUNA 2XK0A 2K3YA 3KBGA 3LW5E 1K76A 1U3OA 1KQSA 2RNAA 3CBOA 2JMAA 3S6WA 2DBMA 1CSKA 4F14A 3QWYA 3DLMA 1U8RA 4XTZA 5CK9A 3C95A 1YITT 5LJ5d 1CKAA 2A28A 1ARKA 2QGGA 2BIVA 1I81A 2CP3A 3CCUA 1YJWA 2E12A 2OX7A 2DXBA 1WYXA 1Q82U 3CC4Q 1RL2A 2OTJT 1RLPC 2NWMA 2KDSA 5GMKl 1D3BA 3RERA 2JJ9A 3CBPA 1N8RR 2J05A 3M57A 2HQEA 2FYKA 3BW1A 1SG5A 2JS2A 3UDCA 5KYYA 3PMTA 2E70A 3JRZA 3C4SA 1PRMC 3OYYA 2OAWA 2LQWA 1UHFA 1UGQB 2E65A 2HQHA 2CZ6B 5KYUB 1QVFA 3CD6A 5HY6A 2M0YA 5IXBA 4QW2A 3VS7A 4E7SA 1PD1A 1I8FA 1FMVA 2MI6A 4A4FA 1VQ4Q 1NG2A 2E3IA 2AT1B 3J80E 1QMCA 5GAOm 5KE3A 2JM8A 2EQKA 1RAAB 1Q81R 3VKIA 1GFDA 3EGDA 4JLGA 2O9VA 2ED1A 1W2BA 1ZBJA 3VUBA 1M2VA 2A36A 2RI5A 2RHZA 2KYMA 3O8VA 1ZUUA 5GJWB 3NGPA 4J9EA 3M0PA 1VQ5A 3ASKA 4FW1A 4F7UG 3RR6A 3ZBDA 3JCMQ 2O4XA 3X28B 2KK4A 3OYGA 2RO0A 5FRMA 2RHIA 3MCAB 2MPXC 4YTLA 4B9XA 4FCYA 1FXXA 5GAN6 4M7AG 4EMHA 2QQBA 2RJEA 4PJOB 4R0KA 1ZUYA 2L0AA 1KD1C 2LX9A 4X9DA 2HSPA 1LNXA 2BUDA 1VYUA 1X75C 1KG1A 1NPPA 2QG9B 2EQJA 2DA9A 4J9GA 1BIBA 2JVVA 3TQ7P 2JW4A 3C12A 2HDAA 2K6DA 3M55A 2L3PA 4JRKA 4B6MA 2COWA 1SRMA 3L2VA 4OGCA 2CUDA 3R6NA 3QIIA 4A4EA 3OYFA 2DYBA 2FEIA 4KULA 2YUOA 1K8AC 3FLGA 3E19A 2MF2A 1VQLA 4M77D 2F5KA 3E1SA 4RTZA 4FU6A 3D7SB 3I56T 1YI2Q 2K2VA 4M78B 4ZN3A 5LJ3e 4CC4B 1MV0B 2HZYA 4XTYA 4OMQA 1QCNA 1KIKA 2AZVA 2RN8A 5KCHA 5LJ3h 1X6OA 1NEGA 3CCRA 1S1NA 5D6XA 4M7DD 2R58A 2K9GA 3VS0A 6AT1B 4HCBA 2DTIA 5LJ3g 3A1PA 3H9NA 4AG1C 3M5AA 1Z9ZA 3M4GA 3M54A 4OMOA 2XDPA 2P84A 2NUZA 1KQ2A 2HQXA 4LDXA 2J06A 4JZ3A 5GAOl 2D1XA 1VQOT 3CC2T 1X27A 2PVOB 2EQIA 4FSSA 5FU6C 4FYWB 2QTVA 1K9MU 1X43A 4J6WA 3G71Q 3GNGA 2GGRA 2RQTA 1AZEA 1Y07A 1N8RU 4EMKA 3G4SA 1E6HA 2LT4A 3PIPA 5M9OA 3WVEB 3VRYA 3OY9A 1KSWA 2VASA 2QDYB 2CS7A 3RMQA 4ZGDB 4CRIA 3QJYA 5LL6S 3OSVA 3EHQA 3LLRA 4K11A 4OB1B 4BE2A 1KC8U 2YLCA 1GBRA 1GXIE 4C8QD 2GF7A 1E7OA 3CCSQ 2ROTA 4ELYC 2ZZDA 1K0SA 4PK4A 3KFVA 2RQRA 1VQ9A 4C92C 2DEUA 4XTVA 1X69A 3OYLA 3EG9A 1M1KU 2EQUA 4M75A 5D6YA 2X3WD 4C92F 4LUDA 5GJVB 2Y4XA 3V7RA 1YP5A 3CQTA 4PNOA 4D6WA 4LDUA 2DZCA 1JJ2A 2EGCA 3QYGB 4J6XA 1QVGS 3LX7A 3ULRB 2L3RA 1UGSB 2KI7A 3FJ5A 1VQPT 4HKEA 3CCMA 1VQMA 3LH5A 1VOMA 1X6GA 4E7HA 1B07A 3M0SA 2V26A 4Z02A 2OAUA 2RK1A 2JMCA 3RUXA 1G83A 3CCET 2KQWA 5J26A 1W4SA 1RI0A 2EJGA 4B9WA 5HKCA 5GMKe 3CMAA 4QQDA 5J3BA 1SSHA 2LQKA 5GMKh 3G6ET 1YITQ 2GTJA 1MMNA 1IHVA 4OP0A 1HD3A 1NLPC 2PVDB 4FW2A 1J3TA 3G7ZA 4J9BA 4HCCA 3HHTB 4NOYA 3X26B 2HD0A 2OTJQ 1SF9A 3N5BB 4EDUA 4M77B 1FX7A 1SHGA 1M27C 1WIEA 1XOVA 2DRMA 3OYCA 1QVGP 3L2WA 2CT3A 2KAFA 4J7IA 2L89A 1UEBA 2DKGA 3EFOB 4E6RA 1UECA 3EHRA 1YJNA 2JUFA 5KYWA 3ER0A 2GTOA 4PJNA 2HBWA 2XU8A 4RMOA 3CCLA 2DXUA 4IUPA 4AFSC 4PFPA 4RCCA 2HBPA 1DJ7B 4A4KA 5GAMe 3FC3A 1K9AA 1VQ8A 2FPFA 1N9SA 4BY6B 5GAMh 4M7DB 2LNVA 1ZA1B 1TOVA 1IHWA 1VQ6T 1Q81C 2LRQA 4M75G 3CBMA 2ZPHB 3FDRA 3CXCS 2VC8A 2QASA 4DOWA 1YJ9T 5CCAA 3HPWA 2PUKB 2Y90A 4RTWA 1Q82R 2EKOA 5I2SA 5GAMg 3VYGA 2JTEA 4A4HA 5FW9A 3RKYA 4PFZA 2FRWA 2GFAA 2C0OA 2DD5A 2CP2A 1WJSA 1I5LA 5KYUA 1M3BA 2EWNA 2HCKA 2YHTA 2DVEA 2PU9B 4J7FA 4Y92A 4XTUA 1VYVA 5KYNA 3H0HA 5GANg 4IUUA 1GCPA 2C06A 2ENMA 2KRNA 3UA7A 1SHFA 2WSEE 1MMGA 1YIJT 1H641 3DLLA 2CT4A 3TSWA 2DD4A 2KE9A 3OS1A 1OV3A 2DAQA 3CXCP 1M30A 2G3RA 5GMKm 2XMFA 1G8XA 4C8QB 2K5IA 2RHYA 1D0ZA 1U1SA 1X6BA 2SRCA 4AG2C 3HRUA 4QT7A 3CEYA 2K3XA 3V8JA 4JRIA 3I56Q 2KROA 2RJDA 4MMKA 2IVWA 3MKDA 2DXTA 2ZPBB 2QA4A 2K3BA 4PJOA 3CCUT 1TG0A 1TUCA 4D8DA 1W70A 2KSSA 4M7DF 1CKBA 3S3NA 1BI0A 2MWPA 1K4US 1ZSZA 2VV5A 3CCVA 3F70A 4F7UE 2GQVA 3VYHB 3I55T 3VS3A 2YDLA 4ZTFA 1QCOA 2NUPA 2XIDA 2L2PA 4XK8E 1VQNA 2VGMA 1QVPA 3CD6T 5CKEA 2X35A 3Q1JA 4RTVA 4M7AE 1OQKA 1N5ZA 1R77A 2CUBA 2LJ1A 4PJLA 3MEAA 2X3XD 1VQOQ 3CC2Q 4M78A 4OMPA 2OTLT 1YBYA 5IHKA 1OZ3A 1PG5B 2KVQG 1Y71A 3A8MB 2DILA 1WI7A 4IKFA 2WSCE 3QUIA 4KGZB 4R55A 3KXTA 4MMLA 3TU4K 3OYKA 3LH0A 1VQ5T 2GNCA 4AMCA 3DKMA 2WSFE 3JSCA 3FRNA 2HKQB 1BBZA 4KT0E 3NPFA 1H3ZA 2LVMA 2ECZA 2V1RA 4C92D 1G3YA 2PQWA 1YI2A 2F2WA 4EMKC 4C8QF 2YUQA 2X4JA 4MZMA 3VU3C 4A53A 1M90U 4QVDA 2CSQA 1BB9A 4A63B 2P4RA 3BFMA 4FYXB 1OOTA 1LJOA 4CC3A 1S72Q 2A0FB 3M0RA 5GANj 3X24B 1Q86C 4C0FA 3QHSA 1B3QA 4HXJA 5GAN7 1JXMA 3SWNC 2JS0A 3M0QA 3L2QA 2PZ1A 1IRXA 1TTHB 2E3HA 2DLPA 1U1TA 4C5EA 2BKDN 4L6V5 4E47A 2L3QA 2V8JA 2H8HA 4RKUE 4PJOG 3JCMP 3FEOA 3WXMB 4QVCA 4CI0C 4PKCC 2DRKA 2LQ8A 3ZL7C 4M75C 2VXEA 1NM7A 5FU7B 1K9MR 4ANJA 2PTKA 3QO3A 1N27A 4JUVA 1VQLT 2YRCA 2E5KA 1ACMB 1XNIA 1X2KA 1VQPQ 1ZQ1A 4RTXA 3RKWA 1JO8A 3A8HB 4ATOA 2X9HA 3REAB 3VS1A 3QZ5B 3H8ZA 4E7ZA 4J9CA 3CCEQ 3URGA 4WTOB 3G71A 4JS4A 1WHLA 2JTMA 3G6EQ 2FZCB 4P5NA 4BDZA 1TUGB 1KC8R 5D7UA 2QQRA 4XTXA 4M78G 2LC4A 5L23A 3CCRT 2ED0A 1OPLA 1B34A 1UUEA 4DBFA 4DBQA 2LDMA 3JCMe 3EGUA 1JQQA 2QI2A 3JCMh 1M1KR 3NMZC 1PNJA 2VGNA 3JB9G 1BI2A 3CCSA 3RESA 1NYFA 1BIAA 3LWIA 1MMDA 1WQWA 4BACA 3JCMg 1FWZA 3CCQA 2F2VA 1AWWA 5FWBA 1ZA2B 3LGLA 3JAME 2R5AA 2DL5A 5A2QE 4ZN1A 2G6FX 1IGUA 4FSXA 1AVZC 1XJWB 4FIBA 1M1FA 2C0TA 1VQ6Q 1BKBA 2J6OA 4QQGA 2MMPA 3G4ST 2O01E 5CKHA 1NYGA 2W10A 3I35A 3OYIA 4QKUA 5FU6B 1PSEA 4LUEA 4N4GA 4JDSA 4J6YA 1YJ9Q 4X9CA 3META 4HT9A 4M77A 2RQWA 1LOJA 2K57A 3M4YA 4OMLA 3VUZA 1JB0E 4OMFB 1Q82C 1AD5A 1G3WA 1E6GA 3PGGA 1YHQA 2AHJB 4LDWA 1TSFA 4XTWA 2RJCA 5IH2A 1YFNA 4XU0A 4X34A 3VS6A 3FJPA 1UJYA 3JCMV 3LGFA 3QDRB 2DX1A 4HVUA 1JXOA 4HT8A 2OTJA 2LT1A 1RABB 1QCFA 1FMKA 2QEXA 3SB2A 3MP6A 2RM4A 1WHMA 4C92B 4QQ6A 4M7DA 2DTOA 3X20B 4DEYA 2RPNA 3EGXB 2HNIA 1YIJQ 3CCJT 2WACA 2JM9A 4F17A 3NTKA 2KY9A 3OSSC 3PNWC 1UDLA 2FZKB 3S3MA 3DB3A 3PMIA 2VVKA 1VQ7A 3V8KA 3AHUA 1WHHA 4JLIA 1UG1A 2F2XA 5DLOA 2BZXA 3CMAT 2RF0A 4UC4A 1KJWA 4LN2A 2DVJA 2D0QB 2HL5C 1P92A 4C0DB 1GCQA 1Q7YU 2EFIA 1WNLA 3CCUQ 4Q5WA 4JJDA 2RJFA 1FMWA 2DEQA 3CMET 4M75E 4KBMB 1K73U 3RMSA 4KUIA 1QP2A 2E5QA 1O75A 3I55Q 5GAN5 1ZSZC 1I4K1 4PL6A 2LX7A 1W1FA 1YJNT 1R0CB 4M77G 3CD6Q 1QVGA 5DY9A 4C8QA 4BI4A 2XICA 2RB6A 2DETA 3CCLT 3EFSA 3EFRA 3GF5A 4LDYA 3J7AF 5IN1A 4BE1A 2LMJA 3JB9I 1PM3A 2KT1A 5DLQE 3OMGA 2OTLQ 2I2LA 1VQ8T 3EH2A 5LJ5e 1T3LA 2DBKA 5CAIA 1PC0A 1GL5A 1SEMA 1QWFA 3OBWA 2RMOA 2COYA 1UHCA 2IG0A 4FYYB 5FROA 2QQSA 1W6XA 1VQ5Q 3OYHA 4M7DG 1ZHIA 5GAOn 5LJ5g 3GOXA 3H0FA 4D8KA 1V29B 1MUZA 4E7IA 1EX4A 3L2RA 1VQKA 4OB0B 2CH4A 5D6WA 1WDXA 2P0QA 3PVQA 5KCOA 2YSQA 2DF6A 4L5GA 4FL6A 1Y7XA 2C0IA 1NJIU 1EZZB 2K5LA 2QYZA 1RAFB 1M8VA 2CDTA 4M7AC 2YRVA 3I9QA 2IIMA 2M9UA 2DL3A 3MP1A 3OW2S 4M7AF 4JZ4A 1D0XA 1WHGA 2W0ZA 1M5Q1 2DXCA 1AT1B 4N4HA 1PSFA 5KE2A 3V8LA 2E4HA 4Y28E 1EFNA 2MIOA 1N6AA 2B8AA 1K9MC 1VQLQ 1AZGB 4PFOA 3CC7A 3CXCA 1N8RC 2KGTA 2M1HA 4RUGA 1C1AA 4HVVA 3UPUA 1A0NB 2M16A 4II1A 4M4ZA 1D1CA 4CC7A 2LTOA 2QA4T 1RAEB 4C8QG 2DTHA 3KUFA 4BD3A 1M8MA 3SDZA 1M90R 2BTTA 5CKFA 2MK5A 2PUOB 4VUBA 1UGPB 1YWOA 1NBEB 4XU2A 2CZ7B 2DL4A 2X4WA 1KC8C 3CCRQ 2EGAA 1PRLC 5A0LA 3CCVT 2H3JA 1HXDA 3JV3A 2F69A 2FPEA 1OPKA 1U06A 3OS5A 2AK5A 1M3CA 4XAXB 1M1KC 2DFUA 1UFFA 3CPWS 3O5ZA 2DZ9A 3H41A 1VQNT 1S72A 2D8JA 3OBYA 5CIUA 3M53A 3LWHA 4BI8B 1WXBA 2I0NA 1OU9A 2AZSA 5GANe 2KXDA 5LJ3f 4C0GA 5GANh 4NL2A 4C5HA 3NTHA 1SSFA 1WFWA 2CZ1B 1Y57A 1WJRA 5HK3A 2NUTB 3CC4A 3UWNA 4PJOE 1D1BA 1OX9A 5GAN4 1JRIA 5LJ5j 4JJBA 1R8OB 2YWWA 2FZGB 2V8KA 3G4SQ 1LPLA 3PFSA 1T0HA 5A0GA 1WHJA 1K1ZA 2DIQA 5FRNA 3RIRA 5FWCA 4KH0B 2FB7A 2EJFA 2QK0A 2CH4W 3CPWP 3CCEA 2A37A 5HK0A 3M9QA 4KRTA 2Z0WA 1WZOA 3EG2A 5AT1B 2EQMA 3G6EA 4M77C 4V2SA 1VQ4A 1VYTA 3OYBA 3E9FA 4WCIA 2L8DA 3HRSA 2YXYA 3VRZA 3L2ZA 3PVLA 3GLXA 3L1AA 2P0KA 3E2UA 1T3SA 4M78E 1KHIA 5CVIA 1K0XA 1YJWT 2MAMA 4J9FA 3SWNB 2DE0X 1OI1A 4E2FB 4ZTJA 3QDFA 2RHUA 1WXUA 3CCJQ 3ZEHA 4GLKA 1OULA 4DOVA 4OVAA 2EGEA 1ZLMA 1G5VA 2FPDA 4OB3B 2EVRA 2DO3A 1I5OB 3UT1A 1IREB 5LJ3d 1KHCA 4BI3A 3G71T 3CMAQ 1Y0MA 3VJPA 4IURA 5A0DA 1TS9A 1NPRA 1VQ6A 1Q95G 2VYTA 3OYNA 5I21A 1AWXA 1U5SA 3BDUA 2MOXA 3M59A 3CMEQ 1GCQC 2D6FA 3C0CA 1LCKA 2LCCA 2DMOA 2EBPA 2YRDA 1ABOA 4C92A 2J7IA 4N0AA 3JB9H 2M0OA 3OA6A 4DA4A 2D0NA 3EGXA 1AHJB 2EKHA 4ESRA 1D1AA 2QDLA 2LJ0A 5GAOr 1YJNQ 2E41A 4JJNK 3CCQT 1M9SA 4ZGEB 3M0UA 3CCLQ 2E64A 2ZAEA 1I07A 4LDVA 3OYJA 1Y96B 1WXTA 2QXFA 1TH7A 2V8IA 1VQ8Q 4PLIA 4F16A 1H92A 4JRQA 2JZ2A 3INZA 2RQUA 2BE7D 1ABQA 1EIFA 1Q7YR 3EG1A 2RD1A 1X2QA 1KD1U 2EAYA 2A3LA 1QLYA 3A8GB 5I22A 1MV3A 2EYQA 3QPHA 4CC2A 4C0ZA 4M7AD 1AEYA 3OB9A 3CPFA 1K73R 1TUDA 2CP7A 2COZA 2D9TA 3MPUB 4M75F 3PTAA 3VS5A 1YHQT 2FL7A 2XI9A 2HKNA 4J83A 3A98A 2JTFA 5ECAA 5GAMf 4QVZA 2RA2A 1K8AU 2K79A 2K2MA 3ZFJA 2EJ9A 3A5ZB 2QEXT 5IAYA 3UATA 3QKJA 2CGHA 1KQSS 4KGXB 3I55A 3JCMW 1H8KA 4RCBA 4RTUA 1QKWA 3QWXX 8AT1B 4OMMA 4TVRA 3HL8A 3P8BB 2KEAA 5GANf 1VQ7T 1YN8A 1AOJA 2X4YA 4C92G 2DNUA 2OJ2A 2FG0A 2DL8A 4M77E 1TU0B 2NYSA 4DBHA 4R56A 1N9RA 2CKKA 2KBTA 2OTLA 2KT8A 3QJ6A 4PJMA 2B86A 3R6OA 4E7JA 1IO6A 2FO0A 2QA4Q 4Z8AA 1TWBA 5CKBA 2KR3A 1M90C 2DIGA 2DYIA 1NJIR 3EG3A 3X25B 1QVFS 3CCVQ 3GP8A 2RK2A 1KQSP 1PCXA 1D09B 2LNHB 1GFCA 3RKXA 2R5MA 5C0MA 2L3SA 2JNGA 3M58A 3OYEA 4M7DE 3VS4A 1BU1A 3S3OA 2F5TX 4BDYA 1VQNQ 3IQLA 5I2MA 2ZGWA 1JEGA 3OYAA 1W2BS 2KYBA 3LYIA 2KRMA 3RDVA 4LXCA 3GPLA 5FU7C 5L8RE 3M0TA 5GAMd 1ZSZB 2OI3A 1YITA 1BK2A 5AYFA 3TSZA 1IB8A 3EFOA 1FYNA 5HCKA 2FHDA 4FYVB 1VQ9T 1VIFA 1NEBA 1RAGB 2EIFA 2YUPA 4MZPA 4HCZA 1PD0A 2NUPB 3L2UA 1RAIB 4Z88A 2GQIA 2ABLA 3MJXA 1HSQA 2LCSA 2LQNA 5KH6A 1SKUB 1QW1A 2ROLA 2ZCFB 1QVFP 4IUVA 2ATCB 2DM1A 5GANd 5EG2A 2F1LA 1B7TA 4JJCA 2VB6A 3QYHB 3SHWA 4J9IA 1BI3A 1IGQA 2EW3A 1YWPA 1OZ2A 1WA7A 5CQYA 4ME7A 3CCMT 1VQMT 1VQKT 4JRPA 4BUGA 1W2BP 4BB7A 4XU1A 2AIRB 4AFQC 3P8HA 5EC7A 1KQ1A 3P8DA 4C8QE 3JCMX 2PNIA 2HL3A 3EG0A 4NL3A 5KYXB 4F7UB 4DBRA 1GRIA 3UF4A 2EPDA 3HFNA 1H3HA 8ATCB 4JS5A 1KK7A 2XHCA 1MHNA 1JU5C 3VV0A 2CZ0B 3QXEB 1YJWQ 2NUTA 1YCYA 2E6ZA 2R57A 4MDXA 4PJJA 1XTDA 4M7AB 1BYMA 2VXFA 4KGVB 1SRLA 2AKKA 2D8HA 2JT4A 4L59A 4PJOC 1TXQA 4FM4B 3C94A 3NFCA 4ZGJB 1WJQA 4Z89A 2XDDA 1VUBA 2XKOC 3CC7T 4PJOF 2DK3A 3GNFB 4IUQA 1G2BA 2DL7A 4ORZA 4ZNXA 1HK9A 4ELZC 3FB9A 3VS2A 2FVUA 3M56A 5I11A 4O6JA 3ME9A 2KNBB 4KH1B 4LD9K 4OB2B 3TEEA 4J8OA 4OGEA 1YCSB 2QQ9A 3HP9A 1D3BB 4IIOA 4LNPA 1IZ6A 2RI2A 2MCNA 4RTYA 4AFUC 3OS2A 5KYYB 1T0JA 5CR2A 2CREA 3V7CA 1PKTA 5LJ5h 5CKDA 4M78C 2IPOB 2X51A 3SWNA 2XG8D 2LZ6B 2M51A 2SEMA 1Q86R 3TREA 3OW2A 5DM7R 1OX8A 1S72T 2O9SA 2EYZA 4M78F 1D0YA 5GMKi 3DB4A 4EMGA 1Q81U 4N0AC 3I56A 1X01A 3NTIA 2VUBA 3PIOA 5GAOq 1B34B 3CCQQ 3H0IA 4HCKA 3EGDB 3HRTA 3JB9F 2EYXA 2XD0A 1UJ0A 1XQHA 1M2VB 1NE8A 3J81E 4F7UF 2FRYA 4A4GA 4M75D 3JCMJ 1VIEA 3CC4T 3JCMf 4C5GA 2RHXA 5IXFA 2QQAA 3CCJA 1R0BG 3REBB 2O4XB 1UE9A 3H6ZA 1WPYA 2HAXA 2CP0A 1YNZA 2LP5A 4GY5A 1M1GA 4C0DC 1SPKA 3QZ9B 1Q7YC 4DEXA 1KFZA 1MNDA 2ZPEB 2K4YA 4RTTA 2O31A 2KMTA 3JCMc 1RACB 1K73C 2QAZA 1VQ4T 5FLXE 1YHQQ 1QKXA 2QTXA 3QG1A 3FIFA 3HTRA 1OYXA 5GAN8 4HVWA 3CPWA 1JJ2S 1VQOA 3CC2A 1G3SA 1V1CA 1WLPB 2NLUA 3EAEA 3SD4A 4C5IA 4GBQA 4AFZC 5LJ3j 2EYWA 3CMEA 2K7AA 1PWTA 3JB9J 2HEQA 3G1JA 3PT9A 1Y96A 2QEXQ 4A54A 2CSIA 5CQXA 1I1JA 1V76A 4MDWA 1M2OA 1ZX6A 3JCMb 3OYMA 3OW2P 2P0PA 1F1BB 2ZPGB 3THKA 2GFUA 2RQVA 5CO7A 4XQ3A 5J39A 3U23A 3GIBA 1VQ7Q 2YT6A 4KUDK 3MEUA 4LD6A 3MEVA 4J5YA 2E1HA 2DERA 1KD1R 1UGVA 3SEMA 1QWEA 1MMAA 4RG2A 2YLBA 1ZSGA 5IT9E 1G3TA 3I5RA 2LCLA 3OQ5A 1M4ZA 4EPCA 2RH2A 1JJ2P 2DJZA 3JCMd 1BI1A 1M3AA 3HFOA 2GCXA 1MGQA 2PVGB 3TCJA 4J9HA 3AT1B 2JOYA 2JN0A 3A8LB 4N4IA 3GBQA 4JPBW 1K8AR 2A7YA 1NJIC 1QQJA 5GAN3 3E9GA 1UB4A 3SFMA 1AWJA 2O2OA 2E6NA 3MO8A 2L5QA 1VQPA 4O5VA 3HSBA 2K5FA 1PHTA 1RADB 2LJ3A 1YI2T 3QSUA 5C6SA 4XU3A 3MEWA 1OEBA 3MP8A 2E10A 2MYSA 3T9NA 1O9SA 4Y91A 2BE9B 4OF1A 3OMCA 2CP6A 4J9DA 4EMKB 1VQ9Q 9ATCB 1HJDA 1PKSA 1MNEA 4MZTA 4M77F 3NHNA 1ZUKA
chains in the Genus database with same CATH topology
4DEYA 2RPNA 3A98A 5ECAA 1SSHA 2JM9A 4F17A 2GTJA 2K79A 2K2MA 2DJQA 1RLQC 5IHIA 1UDLA 1HD3A 2VVKA 1UTIA 1NLPC 1J3TA 3UATA 4J9BA 3UA6A 1UG1A 2F2XA 2BZXA 1H8KA 2RF0A 1KJWA 4LN2A 4RTUA 1QKWA 1SHGA 2BZYA 3QWXX 3I5SA 1M27C 1WIEA 1XOVA 2DRMA 2DVJA 2KXCA 1WX6A 4OMMA 1GCQA 2KEAA 1YN8A 4GLMA 2CT3A 1AOJA 4E6RA 2DNUA 2OJ2A 2O88A 2FG0A 4JJDA 1UECA 3EHRA 2VKNA 2A08A 2DL8A 3TVTA 1AWOA 2GTOA 2KBTA 2HBWA 2JXBA 2V1QA 2KT8A 4AFSC 2AKLA 2B86A 1IO6A 2FO0A 4Z8AA 5IHNA 4LE9A 1K9AA 2FPFA 2LX7A 1W1FA 2KR3A 2J6KA 1GBQA 3RNJA 1RUWA 3EG3A 1I0CA 1Z9QA 2GBQA 3PE0A 2LNHB 1GFCA 4X1VA 4EIKA 2LMJA 2L3SA 4RTWA 2KT1A 3RBBB 2JTEA 3VS4A 1BU1A 1T3LA 5FW9A 2DBKA 3IQLA 2FRWA 1NLOC 1GL5A 1SEMA 4IIMA 2ESWA 1QWFA 2C0OA 2RMOA 1RI9A 1JEGA 2KYBA 2KRMA 1UHCA 3M0TA 2J6FA 1VA7A 2KRSA 1W6XA 2VWFA 1M3BA 2OI3A 1BK2A 2HCKA 2BZ8A 3TSZA 2EYYA 4OMNA 4Y92A 1FYNA 5HCKA 2YUNA 1NEBA 1K76A 2YUPA 1U3OA 2RNAA 1VYVA 3H0FA 4D8KA 3H0HA 2JMAA 1GCPA 2GQIA 1MUZA 2ABLA 2DBMA 4Z88A 2ENMA 1CSKA 2KRNA 1HSQA 2LCSA 3UA7A 1SHFA 2LQNA 2CH4A 1WDXA 3PVQA 4F14A 3QWYA 2YSQA 2DF6A 2C0IA 2CT4A 3TSWA 2ROLA 2KE9A 1OV3A 1CKAA 2A28A 2DM1A 1ARKA 2CDTA 1M30A 2XMFA 3I9QA 2IIMA 1X6BA 4JJCA 3SHWA 4J9IA 1WYXA 2DL3A 2SRCA 4AG2C 4QT7A 2EW3A 1YWPA 1WA7A 1RLPC 2NWMA 4JZ4A 2W0ZA 2KROA 2J05A 1EFNA 4AFQC 2JS2A 2MIOA 5EC7A 2PNIA 2K3BA 3EG0A 1PRMC 2OAWA 1GRIA 3UF4A 2LQWA 1AZGB 1TG0A 1TUCA 2EPDA 1UHFA 4D8DA 1W70A 1H3HA 1CKBA 2KGTA 2M0YA 5IXBA 1JU5C 1K4US 4RUGA 3VS7A 4HVVA 1A0NB 4M4ZA 1NG2A 4CC7A 1SRLA 2AKKA 2D8HA 2JT4A 3VS3A 2YDLA 2JM8A 1M8MA 2BTTA 4Z89A 2L2PA 1GFDA 2O9VA 1YWOA 2ED1A 1ZBJA 2DL4A 2EGAA 2A36A 1G2BA 4RTVA 1PRLC 2KYMA 2DL7A 1ZUUA 1N5ZA 4ORZA 3NGPA 4ZNXA 5GJWB 3JV3A 2CUBA 4J9EA 2LJ1A 2FPEA 1OPKA 3M0PA 3VS2A 1U06A 2X3XD 2AK5A 1M3CA 5I11A 4OMPA 2KNBB 1UFFA 3O5ZA 3H41A 1YCSB 5IHKA 4IIOA 2D8JA 4LNPA 2DILA 1WI7A 2MCNA 4RTYA 4AFUC 1T0JA 1WXBA 2I0NA 2CREA 1PKTA 2AZSA 4R0KA 2GNCA 1ZUYA 2L0AA 2KXDA 2HSPA 1BBZA 3NPFA 2LZ6B 1VYUA 2ECZA 2M51A 2V1RA 1WFWA 2SEMA 2DA9A 1Y57A 2F2WA 4J9GA 2YUQA 2O9SA 2EYZA 2JW4A 2HDAA 2K6DA 2CSQA 1BB9A 2L3PA 4A63B 2P4RA 4JJBA 1OOTA 1SRMA 4CC3A 2CUDA 3R6NA 3M0RA 2DYBA 3H0IA 4HCKA 1B3QA 4HXJA 2FEIA 1JXMA 2EYXA 2YUOA 2JS0A 1T0HA 1UJ0A 3M0QA 1K1ZA 2PZ1A 2FRYA 4RTZA 2DLPA 5FWCA 2CH4W 2A37A 2L3QA 2H8HA 4KRTA 5IXFA 3EG2A 3REBB 2DRKA 3ZL7C 1NM7A 1VYTA 4WCIA 1UE9A 2PTKA 1YNZA 2LP5A 2E5KA 4CC4B 1SPKA 1MV0B 4OMQA 4DEXA 3VRZA 1KFZA 1KIKA 2AZVA 2RN8A 1X2KA 3PVLA 4RTTA 1T3SA 4RTXA 1JO8A 2O31A 1NEGA 1K0XA 3REAB 3VS1A 1S1NA 4J9FA 2DE0X 4J9CA 1QKXA 2K9GA 1WXUA 4HVWA 3VS0A 1V1CA 1WLPB 4GBQA 4AFZC 2EYWA 4AG1C 2EGEA 2K7AA 1ZLMA 1PWTA 1Z9ZA 2FPDA 2HEQA 5L23A 2EVRA 2ED0A 1OPLA 2CSIA 4OMOA 1UUEA 2NUZA 3EGUA 1I1JA 1JQQA 2J06A 4JZ3A 1Y0MA 2D1XA 1X27A 1ZX6A 3NMZC 1PNJA 2EQIA 4FSSA 3THKA 2RQVA 1X43A 3U23A 1NYFA 2YT6A 2GGRA 2RQTA 1AWXA 1U5SA 1AZEA 2MOXA 1UGVA 3SEMA 1QWEA 1GCQC 2F2VA 1AWWA 1ZSGA 1E6HA 3C0CA 3I5RA 1LCKA 5FWBA 2DMOA 2EBPA 3VRYA 1ABOA 1KSWA 2J7IA 2DL5A 2D0NA 2G6FX 2EKHA 4ESRA 1M3AA 2QDLA 2LJ0A 1AVZC 4J9HA 3EHQA 4K11A 2C0TA 1GBRA 2J6OA 3GBQA 1E7OA 4JPBW 2ROTA 1NYGA 2W10A 3I35A 1K0SA 3KFVA 2RQRA 3M0UA 4LUEA 1I07A 1AWJA 2O2OA 1WXTA 1X69A 2RQWA 4OMLA 2X3WD 4LUDA 1PHTA 4F16A 1H92A 5GJVB 2LJ3A 1AD5A 1YP5A 2RQUA 1ABQA 1E6GA 3CQTA 2EGCA 5IH2A 3ULRB 3EG1A 1OEBA 1X2QA 3VS6A 1UJYA 2DX1A 4HVUA 1QLYA 1JXOA 3FJ5A 5I22A 1MV3A 3LH5A 4CC2A 1QCFA 1AEYA 1X6GA 1FMKA 4J9DA 1HJDA 1PKSA 1B07A 3M0SA 3NHNA 1ZUKA 1TUDA 2JMCA 3VS5A 1G83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEY A;  2RPN A;  3A98 A;  5ECA A;  1SSH A;  2JM9 A;  4F17 A;  2GTJ A;  2K79 A;  2K2M A;  2DJQ A;  1RLQ C;  5IHI A;  1UDL A;  1HD3 A;  2VVK A;  1UTI A;  1NLP C;  1J3T A;  3UAT A;  4J9B A;  3UA6 A;  1UG1 A;  2F2X A;  2BZX A;  1H8K A;  2RF0 A;  1KJW A;  4LN2 A;  4RTU A;  1QKW A;  1SHG A;  2BZY A;  3QWX X;  3I5S A;  1M27 C;  1WIE A;  1XOV A;  2DRM A;  2DVJ A;  2KXC A;  1WX6 A;  4OMM A;  1GCQ A;  2KEA A;  1YN8 A;  4GLM A;  2CT3 A;  1AOJ A;  4E6R A;  2DNU A;  2OJ2 A;  2O88 A;  2FG0 A;  4JJD A;  1UEC A;  3EHR A;  2VKN A;  2A08 A;  2DL8 A;  3TVT A;  1AWO A;  2GTO A;  2KBT A;  2HBW A;  2JXB A;  2V1Q A;  2KT8 A;  4AFS C;  2AKL A;  2B86 A;  1IO6 A;  2FO0 A;  4Z8A A;  5IHN A;  4LE9 A;  1K9A A;  2FPF A;  2LX7 A;  1W1F A;  2KR3 A;  2J6K A;  1GBQ A;  3RNJ A;  1RUW A;  3EG3 A;  1I0C A;  1Z9Q A;  2GBQ A;  3PE0 A;  2LNH B;  1GFC A;  4X1V A;  4EIK A;  2LMJ A;  2L3S A;  4RTW A;  2KT1 A;  3RBB B;  2JTE A;  3VS4 A;  1BU1 A;  1T3L A;  5FW9 A;  2DBK A;  3IQL A;  2FRW A;  1NLO C;  1GL5 A;  1SEM A;  4IIM A;  2ESW A;  1QWF A;  2C0O A;  2RMO A;  1RI9 A;  1JEG A;  2KYB A;  2KRM A;  1UHC A;  3M0T A;  2J6F A;  1VA7 A;  2KRS A;  1W6X A;  2VWF A;  1M3B A;  2OI3 A;  1BK2 A;  2HCK A;  2BZ8 A;  3TSZ A;  2EYY A;  4OMN A;  4Y92 A;  1FYN A;  5HCK A;  2YUN A;  1NEB A;  1K76 A;  2YUP A;  1U3O A;  2RNA A;  1VYV A;  3H0F A;  4D8K A;  3H0H A;  2JMA A;  1GCP A;  2GQI A;  1MUZ A;  2ABL A;  2DBM A;  4Z88 A;  2ENM A;  1CSK A;  2KRN A;  1HSQ A;  2LCS A;  3UA7 A;  1SHF A;  2LQN A;  2CH4 A;  1WDX A;  3PVQ A;  4F14 A;  3QWY A;  2YSQ A;  2DF6 A;  2C0I A;  2CT4 A;  3TSW A;  2ROL A;  2KE9 A;  1OV3 A;  1CKA A;  2A28 A;  2DM1 A;  1ARK A;  2CDT A;  1M30 A;  2XMF A;  3I9Q A;  2IIM A;  1X6B A;  4JJC A;  3SHW A;  4J9I A;  1WYX A;  2DL3 A;  2SRC A;  4AG2 C;  4QT7 A;  2EW3 A;  1YWP A;  1WA7 A;  1RLP C;  2NWM A;  4JZ4 A;  2W0Z A;  2KRO A;  2J05 A;  1EFN A;  4AFQ C;  2JS2 A;  2MIO A;  5EC7 A;  2PNI A;  2K3B A;  3EG0 A;  1PRM C;  2OAW A;  1GRI A;  3UF4 A;  2LQW A;  1AZG B;  1TG0 A;  1TUC A;  2EPD A;  1UHF A;  4D8D A;  1W70 A;  1H3H A;  1CKB A;  2KGT A;  2M0Y A;  5IXB A;  1JU5 C;  1K4U S;  4RUG A;  3VS7 A;  4HVV A;  1A0N B;  4M4Z A;  1NG2 A;  4CC7 A;  1SRL A;  2AKK A;  2D8H A;  2JT4 A;  3VS3 A;  2YDL A;  2JM8 A;  1M8M A;  2BTT A;  4Z89 A;  2L2P A;  1GFD A;  2O9V A;  1YWO A;  2ED1 A;  1ZBJ A;  2DL4 A;  2EGA A;  2A36 A;  1G2B A;  4RTV A;  1PRL C;  2KYM A;  2DL7 A;  1ZUU A;  1N5Z A;  4ORZ A;  3NGP A;  4ZNX A;  5GJW B;  3JV3 A;  2CUB A;  4J9E A;  2LJ1 A;  2FPE A;  1OPK A;  3M0P A;  3VS2 A;  1U06 A;  2X3X D;  2AK5 A;  1M3C A;  5I11 A;  4OMP A;  2KNB B;  1UFF A;  3O5Z A;  3H41 A;  1YCS B;  5IHK A;  4IIO A;  2D8J A;  4LNP A;  2DIL A;  1WI7 A;  2MCN A;  4RTY A;  4AFU C;  1T0J A;  1WXB A;  2I0N A;  2CRE A;  1PKT A;  2AZS A;  4R0K A;  2GNC A;  1ZUY A;  2L0A A;  2KXD A;  2HSP A;  1BBZ A;  3NPF A;  2LZ6 B;  1VYU A;  2ECZ A;  2M51 A;  2V1R A;  1WFW A;  2SEM A;  2DA9 A;  1Y57 A;  2F2W A;  4J9G A;  2YUQ A;  2O9S A;  2EYZ A;  2JW4 A;  2HDA A;  2K6D A;  2CSQ A;  1BB9 A;  2L3P A;  4A63 B;  2P4R A;  4JJB A;  1OOT A;  1SRM A;  4CC3 A;  2CUD A;  3R6N A;  3M0R A;  2DYB A;  3H0I A;  4HCK A;  1B3Q A;  4HXJ A;  2FEI A;  1JXM A;  2EYX A;  2YUO A;  2JS0 A;  1T0H A;  1UJ0 A;  3M0Q A;  1K1Z A;  2PZ1 A;  2FRY A;  4RTZ A;  2DLP A;  5FWC A;  2CH4 W;  2A37 A;  2L3Q A;  2H8H A;  4KRT A;  5IXF A;  3EG2 A;  3REB B;  2DRK A;  3ZL7 C;  1NM7 A;  1VYT A;  4WCI A;  1UE9 A;  2PTK A;  1YNZ A;  2LP5 A;  2E5K A;  4CC4 B;  1SPK A;  1MV0 B;  4OMQ A;  4DEX A;  3VRZ A;  1KFZ A;  1KIK A;  2AZV A;  2RN8 A;  1X2K A;  3PVL A;  4RTT A;  1T3S A;  4RTX A;  1JO8 A;  2O31 A;  1NEG A;  1K0X A;  3REA B;  3VS1 A;  1S1N A;  4J9F A;  2DE0 X;  4J9C A;  1QKX A;  2K9G A;  1WXU A;  4HVW A;  3VS0 A;  1V1C A;  1WLP B;  4GBQ A;  4AFZ C;  2EYW A;  4AG1 C;  2EGE A;  2K7A A;  1ZLM A;  1PWT A;  1Z9Z A;  2FPD A;  2HEQ A;  5L23 A;  2EVR A;  2ED0 A;  1OPL A;  2CSI A;  4OMO A;  1UUE A;  2NUZ A;  3EGU A;  1I1J A;  1JQQ A;  2J06 A;  4JZ3 A;  1Y0M A;  2D1X A;  1X27 A;  1ZX6 A;  3NMZ C;  1PNJ A;  2EQI A;  4FSS A;  3THK A;  2RQV A;  1X43 A;  3U23 A;  1NYF A;  2YT6 A;  2GGR A;  2RQT A;  1AWX A;  1U5S A;  1AZE A;  2MOX A;  1UGV A;  3SEM A;  1QWE A;  1GCQ C;  2F2V A;  1AWW A;  1ZSG A;  1E6H A;  3C0C A;  3I5R A;  1LCK A;  5FWB A;  2DMO A;  2EBP A;  3VRY A;  1ABO A;  1KSW A;  2J7I A;  2DL5 A;  2D0N A;  2G6F X;  2EKH A;  4ESR A;  1M3A A;  2QDL A;  2LJ0 A;  1AVZ C;  4J9H A;  3EHQ A;  4K11 A;  2C0T A;  1GBR A;  2J6O A;  3GBQ A;  1E7O A;  4JPB W;  2ROT A;  1NYG A;  2W10 A;  3I35 A;  1K0S A;  3KFV A;  2RQR A;  3M0U A;  4LUE A;  1I07 A;  1AWJ A;  2O2O A;  1WXT A;  1X69 A;  2RQW A;  4OML A;  2X3W D;  4LUD A;  1PHT A;  4F16 A;  1H92 A;  5GJV B;  2LJ3 A;  1AD5 A;  1YP5 A;  2RQU A;  1ABQ A;  1E6G A;  3CQT A;  2EGC A;  5IH2 A;  3ULR B;  3EG1 A;  1OEB A;  1X2Q A;  3VS6 A;  1UJY A;  2DX1 A;  4HVU A;  1QLY A;  1JXO A;  3FJ5 A;  5I22 A;  1MV3 A;  3LH5 A;  4CC2 A;  1QCF A;  1AEY A;  1X6G A;  1FMK A;  4J9D A;  1HJD A;  1PKS A;  1B07 A;  3M0S A;  3NHN A;  1ZUK A;  1TUD A;  2JMC A;  3VS5 A;  1G83 A; 
#chains in the Genus database with same CATH topology
 4E7L A;  4FT2 A;  1Q86 U;  1C0M A;  7AT1 B;  1C6V X;  1UGR B;  3OS0 A;  2DJQ A;  4PLL A;  1RLQ C;  5IHI A;  2CP5 A;  1UTI A;  4BE0 A;  1NZ9 A;  4IUT A;  1RAH B;  4C92 E;  2ZPI B;  2QGF B;  2Y4Y A;  2HMA A;  3OYD A;  3UA6 A;  1QP3 A;  4BY6 C;  3CCM Q;  1VQM Q;  4M7D C;  1VQK Q;  1WQ7 A;  5GMK j;  3EG9 B;  4M75 B;  2BZY A;  5GAO p;  3I5S A;  2KXC A;  1OU8 A;  1WX6 A;  5LJ5 f;  2MWO A;  4PJO D;  2M02 A;  4GLM A;  2CYZ B;  1WGS A;  4E7K A;  2O88 A;  2VKN A;  1HYO A;  2A08 A;  3TVT A;  3BY7 A;  1AWO A;  2H3E B;  2DPP B;  3MHX A;  3BE3 A;  2HSE B;  2JXB A;  2V1Q A;  2AKL A;  1YJ9 A;  3L42 A;  5IHN A;  4RG8 A;  1JBM A;  4FT4 A;  4LE9 A;  1WHK A;  2J6K A;  5GAN 2;  1GBQ A;  3RNJ A;  4HA8 A;  1RUW A;  3CC7 Q;  2RI3 A;  2ZPF B;  3CCS T;  1I0C A;  3WVD B;  1Z9Q A;  2GBQ A;  2XDB A;  3A8O B;  3PE0 A;  3QBY A;  2P4T A;  4X1V A;  4EIK A;  1BCM A;  4M78 D;  3HKS A;  3RBB B;  5GAM j;  1IXD A;  4AT1 B;  3EH1 A;  5KYX A;  1NLO C;  4WF2 A;  4C8Q C;  4F7U A;  4IIM A;  2ESW A;  3V7S A;  1RI9 A;  4DQ2 A;  1BCO A;  3BDL A;  3JB9 D;  2J6F A;  2X4X A;  4F04 B;  1YIJ A;  1VA7 A;  2KRS A;  2VWF A;  2BZ8 A;  1LVK A;  2EYY A;  4OMN A;  1ZBX A;  5KYW B;  4M7A A;  4NS5 A;  2YUN A;  2XK0 A;  2K3Y A;  3KBG A;  3LW5 E;  1K76 A;  1U3O A;  1KQS A;  2RNA A;  3CBO A;  2JMA A;  3S6W A;  2DBM A;  1CSK A;  4F14 A;  3QWY A;  3DLM A;  1U8R A;  4XTZ A;  5CK9 A;  3C95 A;  1YIT T;  5LJ5 d;  1CKA A;  2A28 A;  1ARK A;  2QGG A;  2BIV A;  1I81 A;  2CP3 A;  3CCU A;  1YJW A;  2E12 A;  2OX7 A;  2DXB A;  1WYX A;  1Q82 U;  3CC4 Q;  1RL2 A;  2OTJ T;  1RLP C;  2NWM A;  2KDS A;  5GMK l;  1D3B A;  3RER A;  2JJ9 A;  3CBP A;  1N8R R;  2J05 A;  3M57 A;  2HQE A;  2FYK A;  3BW1 A;  1SG5 A;  2JS2 A;  3UDC A;  5KYY A;  3PMT A;  2E70 A;  3JRZ A;  3C4S A;  1PRM C;  3OYY A;  2OAW A;  2LQW A;  1UHF A;  1UGQ B;  2E65 A;  2HQH A;  2CZ6 B;  5KYU B;  1QVF A;  3CD6 A;  5HY6 A;  2M0Y A;  5IXB A;  4QW2 A;  3VS7 A;  4E7S A;  1PD1 A;  1I8F A;  1FMV A;  2MI6 A;  4A4F A;  1VQ4 Q;  1NG2 A;  2E3I A;  2AT1 B;  3J80 E;  1QMC A;  5GAO m;  5KE3 A;  2JM8 A;  2EQK A;  1RAA B;  1Q81 R;  3VKI A;  1GFD A;  3EGD A;  4JLG A;  2O9V A;  2ED1 A;  1W2B A;  1ZBJ A;  3VUB A;  1M2V A;  2A36 A;  2RI5 A;  2RHZ A;  2KYM A;  3O8V A;  1ZUU A;  5GJW B;  3NGP A;  4J9E A;  3M0P A;  1VQ5 A;  3ASK A;  4FW1 A;  4F7U G;  3RR6 A;  3ZBD A;  3JCM Q;  2O4X A;  3X28 B;  2KK4 A;  3OYG A;  2RO0 A;  5FRM A;  2RHI A;  3MCA B;  2MPX C;  4YTL A;  4B9X A;  4FCY A;  1FXX A;  5GAN 6;  4M7A G;  4EMH A;  2QQB A;  2RJE A;  4PJO B;  4R0K A;  1ZUY A;  2L0A A;  1KD1 C;  2LX9 A;  4X9D A;  2HSP A;  1LNX A;  2BUD A;  1VYU A;  1X75 C;  1KG1 A;  1NPP A;  2QG9 B;  2EQJ A;  2DA9 A;  4J9G A;  1BIB A;  2JVV A;  3TQ7 P;  2JW4 A;  3C12 A;  2HDA A;  2K6D A;  3M55 A;  2L3P A;  4JRK A;  4B6M A;  2COW A;  1SRM A;  3L2V A;  4OGC A;  2CUD A;  3R6N A;  3QII A;  4A4E A;  3OYF A;  2DYB A;  2FEI A;  4KUL A;  2YUO A;  1K8A C;  3FLG A;  3E19 A;  2MF2 A;  1VQL A;  4M77 D;  2F5K A;  3E1S A;  4RTZ A;  4FU6 A;  3D7S B;  3I56 T;  1YI2 Q;  2K2V A;  4M78 B;  4ZN3 A;  5LJ3 e;  4CC4 B;  1MV0 B;  2HZY A;  4XTY A;  4OMQ A;  1QCN A;  1KIK A;  2AZV A;  2RN8 A;  5KCH A;  5LJ3 h;  1X6O A;  1NEG A;  3CCR A;  1S1N A;  5D6X A;  4M7D D;  2R58 A;  2K9G A;  3VS0 A;  6AT1 B;  4HCB A;  2DTI A;  5LJ3 g;  3A1P A;  3H9N A;  4AG1 C;  3M5A A;  1Z9Z A;  3M4G A;  3M54 A;  4OMO A;  2XDP A;  2P84 A;  2NUZ A;  1KQ2 A;  2HQX A;  4LDX A;  2J06 A;  4JZ3 A;  5GAO l;  2D1X A;  1VQO T;  3CC2 T;  1X27 A;  2PVO B;  2EQI A;  4FSS A;  5FU6 C;  4FYW B;  2QTV A;  1K9M U;  1X43 A;  4J6W A;  3G71 Q;  3GNG A;  2GGR A;  2RQT A;  1AZE A;  1Y07 A;  1N8R U;  4EMK A;  3G4S A;  1E6H A;  2LT4 A;  3PIP A;  5M9O A;  3WVE B;  3VRY A;  3OY9 A;  1KSW A;  2VAS A;  2QDY B;  2CS7 A;  3RMQ A;  4ZGD B;  4CRI A;  3QJY A;  5LL6 S;  3OSV A;  3EHQ A;  3LLR A;  4K11 A;  4OB1 B;  4BE2 A;  1KC8 U;  2YLC A;  1GBR A;  1GXI E;  4C8Q D;  2GF7 A;  1E7O A;  3CCS Q;  2ROT A;  4ELY C;  2ZZD A;  1K0S A;  4PK4 A;  3KFV A;  2RQR A;  1VQ9 A;  4C92 C;  2DEU A;  4XTV A;  1X69 A;  3OYL A;  3EG9 A;  1M1K U;  2EQU A;  4M75 A;  5D6Y A;  2X3W D;  4C92 F;  4LUD A;  5GJV B;  2Y4X A;  3V7R A;  1YP5 A;  3CQT A;  4PNO A;  4D6W A;  4LDU A;  2DZC A;  1JJ2 A;  2EGC A;  3QYG B;  4J6X A;  1QVG S;  3LX7 A;  3ULR B;  2L3R A;  1UGS B;  2KI7 A;  3FJ5 A;  1VQP T;  4HKE A;  3CCM A;  1VQM A;  3LH5 A;  1VOM A;  1X6G A;  4E7H A;  1B07 A;  3M0S A;  2V26 A;  4Z02 A;  2OAU A;  2RK1 A;  2JMC A;  3RUX A;  1G83 A;  3CCE T;  2KQW A;  5J26 A;  1W4S A;  1RI0 A;  2EJG A;  4B9W A;  5HKC A;  5GMK e;  3CMA A;  4QQD A;  5J3B A;  1SSH A;  2LQK A;  5GMK h;  3G6E T;  1YIT Q;  2GTJ A;  1MMN A;  1IHV A;  4OP0 A;  1HD3 A;  1NLP C;  2PVD B;  4FW2 A;  1J3T A;  3G7Z A;  4J9B A;  4HCC A;  3HHT B;  4NOY A;  3X26 B;  2HD0 A;  2OTJ Q;  1SF9 A;  3N5B B;  4EDU A;  4M77 B;  1FX7 A;  1SHG A;  1M27 C;  1WIE A;  1XOV A;  2DRM A;  3OYC A;  1QVG P;  3L2W A;  2CT3 A;  2KAF A;  4J7I A;  2L89 A;  1UEB A;  2DKG A;  3EFO B;  4E6R A;  1UEC A;  3EHR A;  1YJN A;  2JUF A;  5KYW A;  3ER0 A;  2GTO A;  4PJN A;  2HBW A;  2XU8 A;  4RMO A;  3CCL A;  2DXU A;  4IUP A;  4AFS C;  4PFP A;  4RCC A;  2HBP A;  1DJ7 B;  4A4K A;  5GAM e;  3FC3 A;  1K9A A;  1VQ8 A;  2FPF A;  1N9S A;  4BY6 B;  5GAM h;  4M7D B;  2LNV A;  1ZA1 B;  1TOV A;  1IHW A;  1VQ6 T;  1Q81 C;  2LRQ A;  4M75 G;  3CBM A;  2ZPH B;  3FDR A;  3CXC S;  2VC8 A;  2QAS A;  4DOW A;  1YJ9 T;  5CCA A;  3HPW A;  2PUK B;  2Y90 A;  4RTW A;  1Q82 R;  2EKO A;  5I2S A;  5GAM g;  3VYG A;  2JTE A;  4A4H A;  5FW9 A;  3RKY A;  4PFZ A;  2FRW A;  2GFA A;  2C0O A;  2DD5 A;  2CP2 A;  1WJS A;  1I5L A;  5KYU A;  1M3B A;  2EWN A;  2HCK A;  2YHT A;  2DVE A;  2PU9 B;  4J7F A;  4Y92 A;  4XTU A;  1VYV A;  5KYN A;  3H0H A;  5GAN g;  4IUU A;  1GCP A;  2C06 A;  2ENM A;  2KRN A;  3UA7 A;  1SHF A;  2WSE E;  1MMG A;  1YIJ T;  1H64 1;  3DLL A;  2CT4 A;  3TSW A;  2DD4 A;  2KE9 A;  3OS1 A;  1OV3 A;  2DAQ A;  3CXC P;  1M30 A;  2G3R A;  5GMK m;  2XMF A;  1G8X A;  4C8Q B;  2K5I A;  2RHY A;  1D0Z A;  1U1S A;  1X6B A;  2SRC A;  4AG2 C;  3HRU A;  4QT7 A;  3CEY A;  2K3X A;  3V8J A;  4JRI A;  3I56 Q;  2KRO A;  2RJD A;  4MMK A;  2IVW A;  3MKD A;  2DXT A;  2ZPB B;  2QA4 A;  2K3B A;  4PJO A;  3CCU T;  1TG0 A;  1TUC A;  4D8D A;  1W70 A;  2KSS A;  4M7D F;  1CKB A;  3S3N A;  1BI0 A;  2MWP A;  1K4U S;  1ZSZ A;  2VV5 A;  3CCV A;  3F70 A;  4F7U E;  2GQV A;  3VYH B;  3I55 T;  3VS3 A;  2YDL A;  4ZTF A;  1QCO A;  2NUP A;  2XID A;  2L2P A;  4XK8 E;  1VQN A;  2VGM A;  1QVP A;  3CD6 T;  5CKE A;  2X35 A;  3Q1J A;  4RTV A;  4M7A E;  1OQK A;  1N5Z A;  1R77 A;  2CUB A;  2LJ1 A;  4PJL A;  3MEA A;  2X3X D;  1VQO Q;  3CC2 Q;  4M78 A;  4OMP A;  2OTL T;  1YBY A;  5IHK A;  1OZ3 A;  1PG5 B;  2KVQ G;  1Y71 A;  3A8M B;  2DIL A;  1WI7 A;  4IKF A;  2WSC E;  3QUI A;  4KGZ B;  4R55 A;  3KXT A;  4MML A;  3TU4 K;  3OYK A;  3LH0 A;  1VQ5 T;  2GNC A;  4AMC A;  3DKM A;  2WSF E;  3JSC A;  3FRN A;  2HKQ B;  1BBZ A;  4KT0 E;  3NPF A;  1H3Z A;  2LVM A;  2ECZ A;  2V1R A;  4C92 D;  1G3Y A;  2PQW A;  1YI2 A;  2F2W A;  4EMK C;  4C8Q F;  2YUQ A;  2X4J A;  4MZM A;  3VU3 C;  4A53 A;  1M90 U;  4QVD A;  2CSQ A;  1BB9 A;  4A63 B;  2P4R A;  3BFM A;  4FYX B;  1OOT A;  1LJO A;  4CC3 A;  1S72 Q;  2A0F B;  3M0R A;  5GAN j;  3X24 B;  1Q86 C;  4C0F A;  3QHS A;  1B3Q A;  4HXJ A;  5GAN 7;  1JXM A;  3SWN C;  2JS0 A;  3M0Q A;  3L2Q A;  2PZ1 A;  1IRX A;  1TTH B;  2E3H A;  2DLP A;  1U1T A;  4C5E A;  2BKD N;  4L6V 5;  4E47 A;  2L3Q A;  2V8J A;  2H8H A;  4RKU E;  4PJO G;  3JCM P;  3FEO A;  3WXM B;  4QVC A;  4CI0 C;  4PKC C;  2DRK A;  2LQ8 A;  3ZL7 C;  4M75 C;  2VXE A;  1NM7 A;  5FU7 B;  1K9M R;  4ANJ A;  2PTK A;  3QO3 A;  1N27 A;  4JUV A;  1VQL T;  2YRC A;  2E5K A;  1ACM B;  1XNI A;  1X2K A;  1VQP Q;  1ZQ1 A;  4RTX A;  3RKW A;  1JO8 A;  3A8H B;  4ATO A;  2X9H A;  3REA B;  3VS1 A;  3QZ5 B;  3H8Z A;  4E7Z A;  4J9C A;  3CCE Q;  3URG A;  4WTO B;  3G71 A;  4JS4 A;  1WHL A;  2JTM A;  3G6E Q;  2FZC B;  4P5N A;  4BDZ A;  1TUG B;  1KC8 R;  5D7U A;  2QQR A;  4XTX A;  4M78 G;  2LC4 A;  5L23 A;  3CCR T;  2ED0 A;  1OPL A;  1B34 A;  1UUE A;  4DBF A;  4DBQ A;  2LDM A;  3JCM e;  3EGU A;  1JQQ A;  2QI2 A;  3JCM h;  1M1K R;  3NMZ C;  1PNJ A;  2VGN A;  3JB9 G;  1BI2 A;  3CCS A;  3RES A;  1NYF A;  1BIA A;  3LWI A;  1MMD A;  1WQW A;  4BAC A;  3JCM g;  1FWZ A;  3CCQ A;  2F2V A;  1AWW A;  5FWB A;  1ZA2 B;  3LGL A;  3JAM E;  2R5A A;  2DL5 A;  5A2Q E;  4ZN1 A;  2G6F X;  1IGU A;  4FSX A;  1AVZ C;  1XJW B;  4FIB A;  1M1F A;  2C0T A;  1VQ6 Q;  1BKB A;  2J6O A;  4QQG A;  2MMP A;  3G4S T;  2O01 E;  5CKH A;  1NYG A;  2W10 A;  3I35 A;  3OYI A;  4QKU A;  5FU6 B;  1PSE A;  4LUE A;  4N4G A;  4JDS A;  4J6Y A;  1YJ9 Q;  4X9C A;  3MET A;  4HT9 A;  4M77 A;  2RQW A;  1LOJ A;  2K57 A;  3M4Y A;  4OML A;  3VUZ A;  1JB0 E;  4OMF B;  1Q82 C;  1AD5 A;  1G3W A;  1E6G A;  3PGG A;  1YHQ A;  2AHJ B;  4LDW A;  1TSF A;  4XTW A;  2RJC A;  5IH2 A;  1YFN A;  4XU0 A;  4X34 A;  3VS6 A;  3FJP A;  1UJY A;  3JCM V;  3LGF A;  3QDR B;  2DX1 A;  4HVU A;  1JXO A;  4HT8 A;  2OTJ A;  2LT1 A;  1RAB B;  1QCF A;  1FMK A;  2QEX A;  3SB2 A;  3MP6 A;  2RM4 A;  1WHM A;  4C92 B;  4QQ6 A;  4M7D A;  2DTO A;  3X20 B;  4DEY A;  2RPN A;  3EGX B;  2HNI A;  1YIJ Q;  3CCJ T;  2WAC A;  2JM9 A;  4F17 A;  3NTK A;  2KY9 A;  3OSS C;  3PNW C;  1UDL A;  2FZK B;  3S3M A;  3DB3 A;  3PMI A;  2VVK A;  1VQ7 A;  3V8K A;  3AHU A;  1WHH A;  4JLI A;  1UG1 A;  2F2X A;  5DLO A;  2BZX A;  3CMA T;  2RF0 A;  4UC4 A;  1KJW A;  4LN2 A;  2DVJ A;  2D0Q B;  2HL5 C;  1P92 A;  4C0D B;  1GCQ A;  1Q7Y U;  2EFI A;  1WNL A;  3CCU Q;  4Q5W A;  4JJD A;  2RJF A;  1FMW A;  2DEQ A;  3CME T;  4M75 E;  4KBM B;  1K73 U;  3RMS A;  4KUI A;  1QP2 A;  2E5Q A;  1O75 A;  3I55 Q;  5GAN 5;  1ZSZ C;  1I4K 1;  4PL6 A;  2LX7 A;  1W1F A;  1YJN T;  1R0C B;  4M77 G;  3CD6 Q;  1QVG A;  5DY9 A;  4C8Q A;  4BI4 A;  2XIC A;  2RB6 A;  2DET A;  3CCL T;  3EFS A;  3EFR A;  3GF5 A;  4LDY A;  3J7A F;  5IN1 A;  4BE1 A;  2LMJ A;  3JB9 I;  1PM3 A;  2KT1 A;  5DLQ E;  3OMG A;  2OTL Q;  2I2L A;  1VQ8 T;  3EH2 A;  5LJ5 e;  1T3L A;  2DBK A;  5CAI A;  1PC0 A;  1GL5 A;  1SEM A;  1QWF A;  3OBW A;  2RMO A;  2COY A;  1UHC A;  2IG0 A;  4FYY B;  5FRO A;  2QQS A;  1W6X A;  1VQ5 Q;  3OYH A;  4M7D G;  1ZHI A;  5GAO n;  5LJ5 g;  3GOX A;  3H0F A;  4D8K A;  1V29 B;  1MUZ A;  4E7I A;  1EX4 A;  3L2R A;  1VQK A;  4OB0 B;  2CH4 A;  5D6W A;  1WDX A;  2P0Q A;  3PVQ A;  5KCO A;  2YSQ A;  2DF6 A;  4L5G A;  4FL6 A;  1Y7X A;  2C0I A;  1NJI U;  1EZZ B;  2K5L A;  2QYZ A;  1RAF B;  1M8V A;  2CDT A;  4M7A C;  2YRV A;  3I9Q A;  2IIM A;  2M9U A;  2DL3 A;  3MP1 A;  3OW2 S;  4M7A F;  4JZ4 A;  1D0X A;  1WHG A;  2W0Z A;  1M5Q 1;  2DXC A;  1AT1 B;  4N4H A;  1PSF A;  5KE2 A;  3V8L A;  2E4H A;  4Y28 E;  1EFN A;  2MIO A;  1N6A A;  2B8A A;  1K9M C;  1VQL Q;  1AZG B;  4PFO A;  3CC7 A;  3CXC A;  1N8R C;  2KGT A;  2M1H A;  4RUG A;  1C1A A;  4HVV A;  3UPU A;  1A0N B;  2M16 A;  4II1 A;  4M4Z A;  1D1C A;  4CC7 A;  2LTO A;  2QA4 T;  1RAE B;  4C8Q G;  2DTH A;  3KUF A;  4BD3 A;  1M8M A;  3SDZ A;  1M90 R;  2BTT A;  5CKF A;  2MK5 A;  2PUO B;  4VUB A;  1UGP B;  1YWO A;  1NBE B;  4XU2 A;  2CZ7 B;  2DL4 A;  2X4W A;  1KC8 C;  3CCR Q;  2EGA A;  1PRL C;  5A0L A;  3CCV T;  2H3J A;  1HXD A;  3JV3 A;  2F69 A;  2FPE A;  1OPK A;  1U06 A;  3OS5 A;  2AK5 A;  1M3C A;  4XAX B;  1M1K C;  2DFU A;  1UFF A;  3CPW S;  3O5Z A;  2DZ9 A;  3H41 A;  1VQN T;  1S72 A;  2D8J A;  3OBY A;  5CIU A;  3M53 A;  3LWH A;  4BI8 B;  1WXB A;  2I0N A;  1OU9 A;  2AZS A;  5GAN e;  2KXD A;  5LJ3 f;  4C0G A;  5GAN h;  4NL2 A;  4C5H A;  3NTH A;  1SSF A;  1WFW A;  2CZ1 B;  1Y57 A;  1WJR A;  5HK3 A;  2NUT B;  3CC4 A;  3UWN A;  4PJO E;  1D1B A;  1OX9 A;  5GAN 4;  1JRI A;  5LJ5 j;  4JJB A;  1R8O B;  2YWW A;  2FZG B;  2V8K A;  3G4S Q;  1LPL A;  3PFS A;  1T0H A;  5A0G A;  1WHJ A;  1K1Z A;  2DIQ A;  5FRN A;  3RIR A;  5FWC A;  4KH0 B;  2FB7 A;  2EJF A;  2QK0 A;  2CH4 W;  3CPW P;  3CCE A;  2A37 A;  5HK0 A;  3M9Q A;  4KRT A;  2Z0W A;  1WZO A;  3EG2 A;  5AT1 B;  2EQM A;  3G6E A;  4M77 C;  4V2S A;  1VQ4 A;  1VYT A;  3OYB A;  3E9F A;  4WCI A;  2L8D A;  3HRS A;  2YXY A;  3VRZ A;  3L2Z A;  3PVL A;  3GLX A;  3L1A A;  2P0K A;  3E2U A;  1T3S A;  4M78 E;  1KHI A;  5CVI A;  1K0X A;  1YJW T;  2MAM A;  4J9F A;  3SWN B;  2DE0 X;  1OI1 A;  4E2F B;  4ZTJ A;  3QDF A;  2RHU A;  1WXU A;  3CCJ Q;  3ZEH A;  4GLK A;  1OUL A;  4DOV A;  4OVA A;  2EGE A;  1ZLM A;  1G5V A;  2FPD A;  4OB3 B;  2EVR A;  2DO3 A;  1I5O B;  3UT1 A;  1IRE B;  5LJ3 d;  1KHC A;  4BI3 A;  3G71 T;  3CMA Q;  1Y0M A;  3VJP A;  4IUR A;  5A0D A;  1TS9 A;  1NPR A;  1VQ6 A;  1Q95 G;  2VYT A;  3OYN A;  5I21 A;  1AWX A;  1U5S A;  3BDU A;  2MOX A;  3M59 A;  3CME Q;  1GCQ C;  2D6F A;  3C0C A;  1LCK A;  2LCC A;  2DMO A;  2EBP A;  2YRD A;  1ABO A;  4C92 A;  2J7I A;  4N0A A;  3JB9 H;  2M0O A;  3OA6 A;  4DA4 A;  2D0N A;  3EGX A;  1AHJ B;  2EKH A;  4ESR A;  1D1A A;  2QDL A;  2LJ0 A;  5GAO r;  1YJN Q;  2E41 A;  4JJN K;  3CCQ T;  1M9S A;  4ZGE B;  3M0U A;  3CCL Q;  2E64 A;  2ZAE A;  1I07 A;  4LDV A;  3OYJ A;  1Y96 B;  1WXT A;  2QXF A;  1TH7 A;  2V8I A;  1VQ8 Q;  4PLI A;  4F16 A;  1H92 A;  4JRQ A;  2JZ2 A;  3INZ A;  2RQU A;  2BE7 D;  1ABQ A;  1EIF A;  1Q7Y R;  3EG1 A;  2RD1 A;  1X2Q A;  1KD1 U;  2EAY A;  2A3L A;  1QLY A;  3A8G B;  5I22 A;  1MV3 A;  2EYQ A;  3QPH A;  4CC2 A;  4C0Z A;  4M7A D;  1AEY A;  3OB9 A;  3CPF A;  1K73 R;  1TUD A;  2CP7 A;  2COZ A;  2D9T A;  3MPU B;  4M75 F;  3PTA A;  3VS5 A;  1YHQ T;  2FL7 A;  2XI9 A;  2HKN A;  4J83 A;  3A98 A;  2JTF A;  5ECA A;  5GAM f;  4QVZ A;  2RA2 A;  1K8A U;  2K79 A;  2K2M A;  3ZFJ A;  2EJ9 A;  3A5Z B;  2QEX T;  5IAY A;  3UAT A;  3QKJ A;  2CGH A;  1KQS S;  4KGX B;  3I55 A;  3JCM W;  1H8K A;  4RCB A;  4RTU A;  1QKW A;  3QWX X;  8AT1 B;  4OMM A;  4TVR A;  3HL8 A;  3P8B B;  2KEA A;  5GAN f;  1VQ7 T;  1YN8 A;  1AOJ A;  2X4Y A;  4C92 G;  2DNU A;  2OJ2 A;  2FG0 A;  2DL8 A;  4M77 E;  1TU0 B;  2NYS A;  4DBH A;  4R56 A;  1N9R A;  2CKK A;  2KBT A;  2OTL A;  2KT8 A;  3QJ6 A;  4PJM A;  2B86 A;  3R6O A;  4E7J A;  1IO6 A;  2FO0 A;  2QA4 Q;  4Z8A A;  1TWB A;  5CKB A;  2KR3 A;  1M90 C;  2DIG A;  2DYI A;  1NJI R;  3EG3 A;  3X25 B;  1QVF S;  3CCV Q;  3GP8 A;  2RK2 A;  1KQS P;  1PCX A;  1D09 B;  2LNH B;  1GFC A;  3RKX A;  2R5M A;  5C0M A;  2L3S A;  2JNG A;  3M58 A;  3OYE A;  4M7D E;  3VS4 A;  1BU1 A;  3S3O A;  2F5T X;  4BDY A;  1VQN Q;  3IQL A;  5I2M A;  2ZGW A;  1JEG A;  3OYA A;  1W2B S;  2KYB A;  3LYI A;  2KRM A;  3RDV A;  4LXC A;  3GPL A;  5FU7 C;  5L8R E;  3M0T A;  5GAM d;  1ZSZ B;  2OI3 A;  1YIT A;  1BK2 A;  5AYF A;  3TSZ A;  1IB8 A;  3EFO A;  1FYN A;  5HCK A;  2FHD A;  4FYV B;  1VQ9 T;  1VIF A;  1NEB A;  1RAG B;  2EIF A;  2YUP A;  4MZP A;  4HCZ A;  1PD0 A;  2NUP B;  3L2U A;  1RAI B;  4Z88 A;  2GQI A;  2ABL A;  3MJX A;  1HSQ A;  2LCS A;  2LQN A;  5KH6 A;  1SKU B;  1QW1 A;  2ROL A;  2ZCF B;  1QVF P;  4IUV A;  2ATC B;  2DM1 A;  5GAN d;  5EG2 A;  2F1L A;  1B7T A;  4JJC A;  2VB6 A;  3QYH B;  3SHW A;  4J9I A;  1BI3 A;  1IGQ A;  2EW3 A;  1YWP A;  1OZ2 A;  1WA7 A;  5CQY A;  4ME7 A;  3CCM T;  1VQM T;  1VQK T;  4JRP A;  4BUG A;  1W2B P;  4BB7 A;  4XU1 A;  2AIR B;  4AFQ C;  3P8H A;  5EC7 A;  1KQ1 A;  3P8D A;  4C8Q E;  3JCM X;  2PNI A;  2HL3 A;  3EG0 A;  4NL3 A;  5KYX B;  4F7U B;  4DBR A;  1GRI A;  3UF4 A;  2EPD A;  3HFN A;  1H3H A;  8ATC B;  4JS5 A;  1KK7 A;  2XHC A;  1MHN A;  1JU5 C;  3VV0 A;  2CZ0 B;  3QXE B;  1YJW Q;  2NUT A;  1YCY A;  2E6Z A;  2R57 A;  4MDX A;  4PJJ A;  1XTD A;  4M7A B;  1BYM A;  2VXF A;  4KGV B;  1SRL A;  2AKK A;  2D8H A;  2JT4 A;  4L59 A;  4PJO C;  1TXQ A;  4FM4 B;  3C94 A;  3NFC A;  4ZGJ B;  1WJQ A;  4Z89 A;  2XDD A;  1VUB A;  2XKO C;  3CC7 T;  4PJO F;  2DK3 A;  3GNF B;  4IUQ A;  1G2B A;  2DL7 A;  4ORZ A;  4ZNX A;  1HK9 A;  4ELZ C;  3FB9 A;  3VS2 A;  2FVU A;  3M56 A;  5I11 A;  4O6J A;  3ME9 A;  2KNB B;  4KH1 B;  4LD9 K;  4OB2 B;  3TEE A;  4J8O A;  4OGE A;  1YCS B;  2QQ9 A;  3HP9 A;  1D3B B;  4IIO A;  4LNP A;  1IZ6 A;  2RI2 A;  2MCN A;  4RTY A;  4AFU C;  3OS2 A;  5KYY B;  1T0J A;  5CR2 A;  2CRE A;  3V7C A;  1PKT A;  5LJ5 h;  5CKD A;  4M78 C;  2IPO B;  2X51 A;  3SWN A;  2XG8 D;  2LZ6 B;  2M51 A;  2SEM A;  1Q86 R;  3TRE A;  3OW2 A;  5DM7 R;  1OX8 A;  1S72 T;  2O9S A;  2EYZ A;  4M78 F;  1D0Y A;  5GMK i;  3DB4 A;  4EMG A;  1Q81 U;  4N0A C;  3I56 A;  1X01 A;  3NTI A;  2VUB A;  3PIO A;  5GAO q;  1B34 B;  3CCQ Q;  3H0I A;  4HCK A;  3EGD B;  3HRT A;  3JB9 F;  2EYX A;  2XD0 A;  1UJ0 A;  1XQH A;  1M2V B;  1NE8 A;  3J81 E;  4F7U F;  2FRY A;  4A4G A;  4M75 D;  3JCM J;  1VIE A;  3CC4 T;  3JCM f;  4C5G A;  2RHX A;  5IXF A;  2QQA A;  3CCJ A;  1R0B G;  3REB B;  2O4X B;  1UE9 A;  3H6Z A;  1WPY A;  2HAX A;  2CP0 A;  1YNZ A;  2LP5 A;  4GY5 A;  1M1G A;  4C0D C;  1SPK A;  3QZ9 B;  1Q7Y C;  4DEX A;  1KFZ A;  1MND A;  2ZPE B;  2K4Y A;  4RTT A;  2O31 A;  2KMT A;  3JCM c;  1RAC B;  1K73 C;  2QAZ A;  1VQ4 T;  5FLX E;  1YHQ Q;  1QKX A;  2QTX A;  3QG1 A;  3FIF A;  3HTR A;  1OYX A;  5GAN 8;  4HVW A;  3CPW A;  1JJ2 S;  1VQO A;  3CC2 A;  1G3S A;  1V1C A;  1WLP B;  2NLU A;  3EAE A;  3SD4 A;  4C5I A;  4GBQ A;  4AFZ C;  5LJ3 j;  2EYW A;  3CME A;  2K7A A;  1PWT A;  3JB9 J;  2HEQ A;  3G1J A;  3PT9 A;  1Y96 A;  2QEX Q;  4A54 A;  2CSI A;  5CQX A;  1I1J A;  1V76 A;  4MDW A;  1M2O A;  1ZX6 A;  3JCM b;  3OYM A;  3OW2 P;  2P0P A;  1F1B B;  2ZPG B;  3THK A;  2GFU A;  2RQV A;  5CO7 A;  4XQ3 A;  5J39 A;  3U23 A;  3GIB A;  1VQ7 Q;  2YT6 A;  4KUD K;  3MEU A;  4LD6 A;  3MEV A;  4J5Y A;  2E1H A;  2DER A;  1KD1 R;  1UGV A;  3SEM A;  1QWE A;  1MMA A;  4RG2 A;  2YLB A;  1ZSG A;  5IT9 E;  1G3T A;  3I5R A;  2LCL A;  3OQ5 A;  1M4Z A;  4EPC A;  2RH2 A;  1JJ2 P;  2DJZ A;  3JCM d;  1BI1 A;  1M3A A;  3HFO A;  2GCX A;  1MGQ A;  2PVG B;  3TCJ A;  4J9H A;  3AT1 B;  2JOY A;  2JN0 A;  3A8L B;  4N4I A;  3GBQ A;  4JPB W;  1K8A R;  2A7Y A;  1NJI C;  1QQJ A;  5GAN 3;  3E9G A;  1UB4 A;  3SFM A;  1AWJ A;  2O2O A;  2E6N A;  3MO8 A;  2L5Q A;  1VQP A;  4O5V A;  3HSB A;  2K5F A;  1PHT A;  1RAD B;  2LJ3 A;  1YI2 T;  3QSU A;  5C6S A;  4XU3 A;  3MEW A;  1OEB A;  3MP8 A;  2E10 A;  2MYS A;  3T9N A;  1O9S A;  4Y91 A;  2BE9 B;  4OF1 A;  3OMC A;  2CP6 A;  4J9D A;  4EMK B;  1VQ9 Q;  9ATC B;  1HJD A;  1PKS A;  1MNE A;  4MZT A;  4M77 F;  3NHN A;  1ZUK A; 
#chains in the Genus database with same CATH homology
 4DEY A;  2RPN A;  3A98 A;  5ECA A;  1SSH A;  2JM9 A;  4F17 A;  2GTJ A;  2K79 A;  2K2M A;  2DJQ A;  1RLQ C;  5IHI A;  1UDL A;  1HD3 A;  2VVK A;  1UTI A;  1NLP C;  1J3T A;  3UAT A;  4J9B A;  3UA6 A;  1UG1 A;  2F2X A;  2BZX A;  1H8K A;  2RF0 A;  1KJW A;  4LN2 A;  4RTU A;  1QKW A;  1SHG A;  2BZY A;  3QWX X;  3I5S A;  1M27 C;  1WIE A;  1XOV A;  2DRM A;  2DVJ A;  2KXC A;  1WX6 A;  4OMM A;  1GCQ A;  2KEA A;  1YN8 A;  4GLM A;  2CT3 A;  1AOJ A;  4E6R A;  2DNU A;  2OJ2 A;  2O88 A;  2FG0 A;  4JJD A;  1UEC A;  3EHR A;  2VKN A;  2A08 A;  2DL8 A;  3TVT A;  1AWO A;  2GTO A;  2KBT A;  2HBW A;  2JXB A;  2V1Q A;  2KT8 A;  4AFS C;  2AKL A;  2B86 A;  1IO6 A;  2FO0 A;  4Z8A A;  5IHN A;  4LE9 A;  1K9A A;  2FPF A;  2LX7 A;  1W1F A;  2KR3 A;  2J6K A;  1GBQ A;  3RNJ A;  1RUW A;  3EG3 A;  1I0C A;  1Z9Q A;  2GBQ A;  3PE0 A;  2LNH B;  1GFC A;  4X1V A;  4EIK A;  2LMJ A;  2L3S A;  4RTW A;  2KT1 A;  3RBB B;  2JTE A;  3VS4 A;  1BU1 A;  1T3L A;  5FW9 A;  2DBK A;  3IQL A;  2FRW A;  1NLO C;  1GL5 A;  1SEM A;  4IIM A;  2ESW A;  1QWF A;  2C0O A;  2RMO A;  1RI9 A;  1JEG A;  2KYB A;  2KRM A;  1UHC A;  3M0T A;  2J6F A;  1VA7 A;  2KRS A;  1W6X A;  2VWF A;  1M3B A;  2OI3 A;  1BK2 A;  2HCK A;  2BZ8 A;  3TSZ A;  2EYY A;  4OMN A;  4Y92 A;  1FYN A;  5HCK A;  2YUN A;  1NEB A;  1K76 A;  2YUP A;  1U3O A;  2RNA A;  1VYV A;  3H0F A;  4D8K A;  3H0H A;  2JMA A;  1GCP A;  2GQI A;  1MUZ A;  2ABL A;  2DBM A;  4Z88 A;  2ENM A;  1CSK A;  2KRN A;  1HSQ A;  2LCS A;  3UA7 A;  1SHF A;  2LQN A;  2CH4 A;  1WDX A;  3PVQ A;  4F14 A;  3QWY A;  2YSQ A;  2DF6 A;  2C0I A;  2CT4 A;  3TSW A;  2ROL A;  2KE9 A;  1OV3 A;  1CKA A;  2A28 A;  2DM1 A;  1ARK A;  2CDT A;  1M30 A;  2XMF A;  3I9Q A;  2IIM A;  1X6B A;  4JJC A;  3SHW A;  4J9I A;  1WYX A;  2DL3 A;  2SRC A;  4AG2 C;  4QT7 A;  2EW3 A;  1YWP A;  1WA7 A;  1RLP C;  2NWM A;  4JZ4 A;  2W0Z A;  2KRO A;  2J05 A;  1EFN A;  4AFQ C;  2JS2 A;  2MIO A;  5EC7 A;  2PNI A;  2K3B A;  3EG0 A;  1PRM C;  2OAW A;  1GRI A;  3UF4 A;  2LQW A;  1AZG B;  1TG0 A;  1TUC A;  2EPD A;  1UHF A;  4D8D A;  1W70 A;  1H3H A;  1CKB A;  2KGT A;  2M0Y A;  5IXB A;  1JU5 C;  1K4U S;  4RUG A;  3VS7 A;  4HVV A;  1A0N B;  4M4Z A;  1NG2 A;  4CC7 A;  1SRL A;  2AKK A;  2D8H A;  2JT4 A;  3VS3 A;  2YDL A;  2JM8 A;  1M8M A;  2BTT A;  4Z89 A;  2L2P A;  1GFD A;  2O9V A;  1YWO A;  2ED1 A;  1ZBJ A;  2DL4 A;  2EGA A;  2A36 A;  1G2B A;  4RTV A;  1PRL C;  2KYM A;  2DL7 A;  1ZUU A;  1N5Z A;  4ORZ A;  3NGP A;  4ZNX A;  5GJW B;  3JV3 A;  2CUB A;  4J9E A;  2LJ1 A;  2FPE A;  1OPK A;  3M0P A;  3VS2 A;  1U06 A;  2X3X D;  2AK5 A;  1M3C A;  5I11 A;  4OMP A;  2KNB B;  1UFF A;  3O5Z A;  3H41 A;  1YCS B;  5IHK A;  4IIO A;  2D8J A;  4LNP A;  2DIL A;  1WI7 A;  2MCN A;  4RTY A;  4AFU C;  1T0J A;  1WXB A;  2I0N A;  2CRE A;  1PKT A;  2AZS A;  4R0K A;  2GNC A;  1ZUY A;  2L0A A;  2KXD A;  2HSP A;  1BBZ A;  3NPF A;  2LZ6 B;  1VYU A;  2ECZ A;  2M51 A;  2V1R A;  1WFW A;  2SEM A;  2DA9 A;  1Y57 A;  2F2W A;  4J9G A;  2YUQ A;  2O9S A;  2EYZ A;  2JW4 A;  2HDA A;  2K6D A;  2CSQ A;  1BB9 A;  2L3P A;  4A63 B;  2P4R A;  4JJB A;  1OOT A;  1SRM A;  4CC3 A;  2CUD A;  3R6N A;  3M0R A;  2DYB A;  3H0I A;  4HCK A;  1B3Q A;  4HXJ A;  2FEI A;  1JXM A;  2EYX A;  2YUO A;  2JS0 A;  1T0H A;  1UJ0 A;  3M0Q A;  1K1Z A;  2PZ1 A;  2FRY A;  4RTZ A;  2DLP A;  5FWC A;  2CH4 W;  2A37 A;  2L3Q A;  2H8H A;  4KRT A;  5IXF A;  3EG2 A;  3REB B;  2DRK A;  3ZL7 C;  1NM7 A;  1VYT A;  4WCI A;  1UE9 A;  2PTK A;  1YNZ A;  2LP5 A;  2E5K A;  4CC4 B;  1SPK A;  1MV0 B;  4OMQ A;  4DEX A;  3VRZ A;  1KFZ A;  1KIK A;  2AZV A;  2RN8 A;  1X2K A;  3PVL A;  4RTT A;  1T3S A;  4RTX A;  1JO8 A;  2O31 A;  1NEG A;  1K0X A;  3REA B;  3VS1 A;  1S1N A;  4J9F A;  2DE0 X;  4J9C A;  1QKX A;  2K9G A;  1WXU A;  4HVW A;  3VS0 A;  1V1C A;  1WLP B;  4GBQ A;  4AFZ C;  2EYW A;  4AG1 C;  2EGE A;  2K7A A;  1ZLM A;  1PWT A;  1Z9Z A;  2FPD A;  2HEQ A;  5L23 A;  2EVR A;  2ED0 A;  1OPL A;  2CSI A;  4OMO A;  1UUE A;  2NUZ A;  3EGU A;  1I1J A;  1JQQ A;  2J06 A;  4JZ3 A;  1Y0M A;  2D1X A;  1X27 A;  1ZX6 A;  3NMZ C;  1PNJ A;  2EQI A;  4FSS A;  3THK A;  2RQV A;  1X43 A;  3U23 A;  1NYF A;  2YT6 A;  2GGR A;  2RQT A;  1AWX A;  1U5S A;  1AZE A;  2MOX A;  1UGV A;  3SEM A;  1QWE A;  1GCQ C;  2F2V A;  1AWW A;  1ZSG A;  1E6H A;  3C0C A;  3I5R A;  1LCK A;  5FWB A;  2DMO A;  2EBP A;  3VRY A;  1ABO A;  1KSW A;  2J7I A;  2DL5 A;  2D0N A;  2G6F X;  2EKH A;  4ESR A;  1M3A A;  2QDL A;  2LJ0 A;  1AVZ C;  4J9H A;  3EHQ A;  4K11 A;  2C0T A;  1GBR A;  2J6O A;  3GBQ A;  1E7O A;  4JPB W;  2ROT A;  1NYG A;  2W10 A;  3I35 A;  1K0S A;  3KFV A;  2RQR A;  3M0U A;  4LUE A;  1I07 A;  1AWJ A;  2O2O A;  1WXT A;  1X69 A;  2RQW A;  4OML A;  2X3W D;  4LUD A;  1PHT A;  4F16 A;  1H92 A;  5GJV B;  2LJ3 A;  1AD5 A;  1YP5 A;  2RQU A;  1ABQ A;  1E6G A;  3CQT A;  2EGC A;  5IH2 A;  3ULR B;  3EG1 A;  1OEB A;  1X2Q A;  3VS6 A;  1UJY A;  2DX1 A;  4HVU A;  1QLY A;  1JXO A;  3FJ5 A;  5I22 A;  1MV3 A;  3LH5 A;  4CC2 A;  1QCF A;  1AEY A;  1X6G A;  1FMK A;  4J9D A;  1HJD A;  1PKS A;  1B07 A;  3M0S A;  3NHN A;  1ZUK A;  1TUD A;  2JMC A;  3VS5 A;  1G83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...