4X1VA

Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
b'KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CD2-associated protein
publication title Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4x1vA00
1WLPB 3THKA 3VRZA 2B86A 1AZEA 3M0SA 3PVLA 2DF6A 4RTWA 1UGVA 4JJBA 1X6BA 4JJCA 1TG0A 1YWOA 2PNIA 4J9IA 1AWXA 1AEYA 1K1ZA 4RTVA 2AZVA 2LP5A 2CUDA 2YUPA 1ZUYA 3U23A 2EYXA 2F2XA 4E6RA 4OMQA 2GGRA 1NEBA 1T0JA 1WI7A 1UJ0A 2FRWA 4Z8AA 3ZL7C 2K3BA 2D8JA 3NGPA 1J3TA 3VS3A 1G83A 2DL3A 1HJDA 1NLOC 2HCKA 2RF0A 1QKXA 2C0OA 1SHFA 1CKBA 2D8HA 3IQLA 2DBKA 1GCQA 1W70A 4RTXA 1UUEA 1Y57A 2KGTA 1OOTA 1ABOA 3UA6A 2KROA 4K11A 2C0TA 1MV0B 2BZYA 2DJQA 4AFUC 1KIKA 5FW9A 1UG1A 2LQWA 2I0NA 4A63B 3H0HA 2RQVA 2M51A 4J9BA 2HEQA 2CSQA 1K0SA 2LZ6B 1JO8A 1GCPA 2AKLA 2X3WD 1X2KA 2DVJA 2L3PA 2A08A 1E6HA 4JJDA 4OMPA 4D8DA 2BTTA 1GFCA 4LN2A 2KT8A 1KSWA 1W6XA 1T0HA 2JM9A 2W0ZA 4OMLA 2L2PA 3A98A 2BZXA 1RLPC 1ZUKA 4IIMA 4OMNA 1H3HA 1WYXA 2FPDA 4AFZC 2CT4A 2LCSA 2MIOA 2KRNA 1GL5A 2P4RA 1XOVA 4RTYA 4DEYA 2JT4A 1CKAA 5IHNA 3I5SA 1GBQA 1WXUA 2EBPA 3RBBB 4EIKA 4ESRA 2VVKA 2JS0A 3SEMA 2DL8A 2J6KA 4AFQC 2H8HA 1SRLA 2MCNA 5FWCA 4GLMA 4WCIA 3R6NA 1PKSA 2D0NA 2EKHA 2FPEA 2LX7A 3QWYA 1NYFA 2NWMA 1T3LA 3EG2A 1B07A 1PHTA 2JMAA 3O5ZA 2EGEA 2QDLA 3I5RA 5IH2A 2V1RA 3PE0A 3NPFA 2J05A 4X1VA 5I11A 1SEMA 2RQWA 3EG1A 5GJWB 1HD3A 2HSPA 1WFWA 2LJ3A 4CC4B 3NHNA 2K6DA 1OV3A 2KEAA 1SPKA 3M0TA 4GBQA 1BU1A 4ZNXA 1PKTA 1VYVA 1JEGA 1V1CA 4F17A 4RTUA 1GCQC 3H0FA 2ECZA 5IXBA 4KRTA 4JZ3A 2KE9A 2LJ1A 2M0YA 1SRMA 2DNUA 4LUEA 1UE9A 4LNPA 2KXCA 2F2WA 1JXOA 2FO0A 1SSHA 2A37A 2EQIA 3H0IA 2KYBA 2ABLA 2DL5A 3I9QA 4HXJA 1NG2A 1U06A 3RNJA 1TUCA 3QWXX 2LNHB 3I35A 1TUDA 2PZ1A 3M0PA 1ZLMA 2CREA 4M4ZA 2CH4A 1AWWA 2DMOA 4OMOA 2JTEA 1OPKA 1H8KA 2CSIA 4HVUA 2KRMA 2ROTA 1YP5A 2FEIA 1B3QA 2BZ8A 3M0UA 2KNBB 2EVRA 2KT1A 1PRLC 1T3SA 1AOJA 1YN8A 1BB9A 1YWPA 2J6FA 2KYMA 1ZBJA 4J9HA 1AD5A 2F2VA 5IXFA 1WDXA 2O31A 1I0CA 1K9AA 2J7IA 3JV3A 2RPNA 2W10A 1CSKA 1UTIA 1H92A 2JMCA 2JW4A 2YDLA 4JPBW 1BBZA 4CC3A 3TSWA 2FG0A 5I22A 1SHGA 3PVQA 3FJ5A 5GJVB 1RLQC 3EHQA 1K76A 4HVVA 2MOXA 5IHKA 4Z88A 2DX1A 2X3XD 4Y92A 2L3QA 1PRMC 3UF4A 2GNCA 2YUOA 1YNZA 1E6GA 3UATA 1HSQA 1LCKA 2IIMA 1PWTA 1YCSB 2OAWA 2L3SA 1E7OA 2CDTA 4R0KA 2RQTA 4J9CA 4RUGA 2K2MA 4F14A 1Z9QA 5IHIA 3VS6A 4OMMA 2EPDA 2HBWA 1IO6A 4J9FA 3SHWA 1X6GA 3C0CA 2DBMA 2JS2A 2V1QA 1X69A 1WXTA 4JZ4A 1GFDA 2KRSA 4HVWA 2SRCA 1EFNA 2GTJA 2DRMA 3EGUA 4F16A 3CQTA 2O9SA 2HDAA 1M8MA 2CH4W 3TSZA 4CC2A 1K0XA 1M3AA 1X43A 1KFZA 2ED0A 2ED1A 3KFVA 1WIEA 1QWFA 3EG0A 2RNAA 2K9GA 5FWBA 1UDLA 1RUWA 1UFFA 5ECAA 2AKKA 2O9VA 2CUBA 2LMJA 2A36A 2RQUA 1JU5C 1OPLA 1M3CA 1QCFA 1ZSGA 2EGCA 2DRKA 1NM7A 1X2QA 2ENMA 1N5ZA 1U3OA 2EGAA 3REBB 1M30A 1W1FA 1M3BA 1QWEA 1ARKA 1QLYA 3GBQA 2G6FX 1RI9A 1Z9ZA 2XMFA 2ROLA 1AWJA 1AZGB 2DL7A 1A0NB 2D1XA 3VS0A 2RN8A 2O88A 1K4US 3VS1A 1ABQA 1NLPC 3H41A 2JM8A 4AG2C 4DEXA 3VS4A 1VA7A 1Y0MA 2EW3A 2DYBA 1AVZC 2FPFA 1GBRA 1WA7A 1U5SA 4J9EA 3LH5A 1G2BA 2GBQA 2YUQA 4QT7A 3VS7A 4HCKA 1UHCA 1UHFA 2LQNA 3VRYA 1WXBA 2AK5A 5EC7A 1MUZA 1VYUA 3ULRB 4LUDA 2RQRA 4RTTA 3REAB 1JQQA 2YSQA 2KXDA 2GTOA 4RTZA 2OJ2A 2DILA 2FRYA 1JXMA 2L0AA 1X27A 2VWFA 2A28A 2ESWA 1S1NA 3M0QA 1ZX6A 2YT6A 1UECA 2NUZA 4J9DA 5HCKA 2KR3A 1UJYA 3EHRA 4J9GA 1I07A 1PNJA 2J6OA 1I1JA 2EYWA 2SEMA 2PTKA 5L23A 1ZUUA 2GQIA 2K79A 1AWOA 1FMKA 4IIOA 3VS5A 1WX6A 1BK2A 4D8KA 2VKNA 2DA9A 1KJWA 1VYTA 1GRIA 2J06A 2C0IA 3TVTA 1OEBA 4Z89A 2JXBA 4CC7A 3EG3A 3VS2A 2DM1A 2EYZA 3M0RA 4FSSA 2O2OA 2YUNA 4LE9A 2CT3A 1NYGA 3UA7A 2DE0X 2RMOA 2OI3A 2KBTA 2K7AA 1M27C 2LJ0A 4AFSC 1FYNA 1MV3A 1NEGA 1QKWA 2DL4A 2E5KA 2DLPA 2AZSA 2EYYA 4ORZA 3NMZC 4AG1C
chains in the Genus database with same CATH superfamily
2KAFA 1WLPB 3THKA 3VV0A 3G4SA 5LJ5e 4C8QD 1AZEA 2EYQA 3NFCA 4RTWA 2OAUA 3RR6A 1UGPB 4JJCA 1TG0A 3I56A 4J9IA 2LP5A 2EFIA 1M9SA 2YUPA 1ZUYA 4M7AG 4WTOB 2EWNA 2F2XA 2OTLQ 4OB1B 1UJ0A 3JCMV 4Z8AA 3ZL7C 2K5IA 3JCMd 2FL7A 3NGPA 1J3TA 3EH1A 1D3BA 1HJDA 1MMNA 1P92A 1CKBA 2D8HA 2DBKA 3R6OA 3OYGA 2JTFA 4C0DC 1W70A 3CBMA 2QTXA 1UUEA 3CCRQ 1N6AA 2KGTA 8AT1B 3UA6A 2XK0A 1VQLA 1D1CA 4K11A 2AHJB 9ATCB 2X4WA 1K8AU 2DERA 4QW2A 3CBPA 2LT4A 2HAXA 2DTOA 1KHIA 3JCMb 4GY5A 1VQ5Q 3JAME 3OBWA 5LJ5h 1GCPA 4N0AC 3N5BB 3D7SB 3JB9F 2X3WD 2V8IA 4FSXA 2A08A 4D8DA 5KYNA 1YIJA 1KSWA 5GAOr 1D3BB 5AYFA 4V2SA 2W0ZA 2XD0A 4B9XA 3MEVA 2P0KA 1NJIU 3OYNA 2DYIA 4A54A 4IIMA 2DIQA 1RAGB 2FPDA 1BKBA 1D1AA 2P4RA 4RTYA 3RKYA 1UGSB 2P0QA 2JT4A 1VQMQ 2QGGA 1R77A 1IXDA 4E7LA 5I2SA 1GBQA 1M90R 4J6YA 5FU7C 2LCLA 2EBPA 5D6WA 2YRDA 3DB3A 1KQSP 3CD6Q 3EG9A 3F70A 4QQGA 2V8JA 2NYSA 5LJ5f 5J39A 4QQ6A 4BDZA 2FPEA 1EZZB 2O4XB 3EGXA 3PIPA 1ZHIA 4ELZC 2CP5A 2XDDA 1KD1C 1PHTA 2X35A 3I5RA 2OTLA 5IH2A 2V1RA 2QQSA 3M57A 3NPFA 5I11A 3LWHA 2BUDA 5GJWB 1I5OB 1QVFS 4CC4B 4PK4A 3CMAT 4IKFA 3AT1B 4OGCA 3LX7A 1V1CA 5GAN3 1R0CB 3META 5LJ3e 1VQ6T 4J6XA 4F17A 1BI3A 3UWNA 3OS2A 5IXBA 2KE9A 1SKUB 1VQ8A 4QKUA 4C8QG 5CKDA 2DNUA 4KH0B 3EG9B 4LNPA 1BCMA 5FRMA 2F2WA 1JXOA 2FO0A 1Q95G 4MZMA 2XDBA 2NLUA 2KYBA 2KSSA 1VQ5A 3RNJA 3EGXB 3MJXA 2QQRA 2QTVA 4E7HA 1G3YA 5FROA 2DO3A 1M4ZA 3A8GB 3VUBA 2XI9A 2X4JA 2M02A 2YLBA 3V7CA 1D09B 1OPKA 1H8KA 4ZGDB 3HFOA 4L5GA 3OYIA 1YP5A 2KDSA 3C95A 1PD1A 3TU4K 1B3QA 4PFPA 4NL2A 2YHTA 1YJ9Q 2YRVA 1AOJA 4M77B 4E47A 3G6ET 1TUGB 1HXDA 3OYEA 1I0CA 4J8OA 1K9AA 2J7IA 2M0OA 2W10A 1TH7A 5LJ3h 2ZAEA 4AMCA 4E7ZA 1BI2A 1W2BS 2FG0A 4ME7A 5I22A 3QUIA 3M9QA 4P5NA 1PD0A 3CXCS 1LPLA 1SF9A 2X3XD 1VQPQ 4Y92A 2L3QA 3P8HA 3HP9A 2YUOA 5GMKj 1G8XA 3L42A 3UATA 4FIBA 2OAWA 3CPWP 2L3SA 1E7OA 2NUPA 2ZPGB 2QA4Q 4OF1A 1YJWA 1TSFA 2RQTA 1VQ9A 3QPHA 2K2MA 4C0ZA 2HL5C 5GAN5 5IHIA 3VS6A 3M55A 2HBWA 1IO6A 4J9FA 4M75E 1VIEA 1X6GA 2JS2A 4A53A 1MGQA 4HVWA 1X75C 4PJMA 1X6OA 4XAXB 1KQSA 3JCMW 2CH4W 2E4HA 3X24B 3G7ZA 3TSZA 4PJLA 1V29B 2HQEA 3S3NA 2EJ9A 3EFSA 1R0BG 1M3AA 1KFZA 2ED0A 3CCQT 3MKDA 1WIEA 1QWFA 4EMHA 2VXFA 1I5LA 4JRKA 5FWBA 2KVQG 4OB2B 4JLIA 1UDLA 2NUPB 5IAYA 4PJOF 1M2OA 3G1JA 4LD6A 2RQUA 1ZBXA 1YHQA 1OPLA 1M3CA 2M16A 2MF2A 1ZSGA 3EAEA 1NM7A 1QVFA 3J7AF 1U3OA 1WJRA 2ZPBB 3NTHA 4M75F 2K4YA 5GANg 1F1BB 2G6FX 1AWJA 3MP8A 2Y4YA 4Y91A 3QJYA 2EQKA 5FU6C 1NPRA 4J9EA 2WSFE 3FDRA 1UB4A 3DLLA 2QEXQ 4QT7A 1OZ3A 4C8QC 3KXTA 1UHCA 5KCOA 3VJPA 1QCNA 2AK5A 3JB9D 1MUZA 3E1SA 1N27A 3JCMc 3REAB 2F5TX 4BUGA 1VQPA 1LNXA 2K2VA 4XQ3A 1N8RR 2OJ2A 2DILA 2L0AA 2MK5A 1JJ2S 3LYIA 1X27A 2CKKA 2VUBA 1HK9A 3OQ5A 2COYA 5CAIA 3SWNA 1C0MA 3TCJA 4J9DA 5HCKA 5CKBA 5DM7R 3JCMJ 3GIBA 3I55T 5FLXE 2NUTA 1M2VB 2OTJA 4UC4A 2PTKA 2RH2A 4KH1B 2GQIA 4C5EA 1W2BA 1KQ1A 3VS5A 4EMKC 3CPWA 1WX6A 3CXCA 3QDFA 2VKNA 3BDUA 1GRIA 1BI1A 2J06A 3CBOA 4JRQA 3TVTA 4C92E 1S72Q 4FW2A 3A5ZB 2EYZA 3H6ZA 3L2VA 3E9FA 3DLMA 2O2OA 2CT3A 3JCMg 3G71Q 1KD1R 1YITT 1M5Q1 3SWNB 1UGQB 5C0MA 2LVMA 2WSEE 2CZ6B 1FYNA 5KYUA 3QJ6A 2NUTB 5D6XA 4XTYA 4R56A 3LH0A 2DL4A 3OYMA 2EYYA 4FYVB 2YXYA 5HK3A 1VQ4Q 3FLGA 2B86A 3MP6A 3M0SA 1UGVA 1X6BA 1VQOQ 1YWOA 2PNIA 1AWXA 1G3TA 3TEEA 1AEYA 4M7DF 3S3OA 1I4K1 4RTVA 3PMTA 2AZVA 3FEOA 1QVPA 5GMKi 3V8KA 3HRSA 4C92F 4OMQA 2GGRA 1NEBA 2QEXA 2FRWA 2FYKA 1Q7YR 4RMOA 4BI4A 1G83A 3QO3A 2HCKA 5KYUB 2RF0A 1IREB 2CGHA 2E12A 2LX9A 1OOTA 2VC8A 3FC3A 1YBYA 4M77E 2KROA 1Q82C 1MV0B 2DJQA 4AFUC 4C5IA 2LQWA 3H0HA 5DLQE 2RQVA 4KGXB 2M51A 2CSQA 1K0SA 2MMPA 2E3IA 2JNGA 1VQLQ 2AKLA 3KUFA 3E2UA 4BACA 2DVJA 1E6HA 3L2RA 4OMPA 4M75A 3JCMQ 2BTTA 5CKFA 3JB9G 5CQXA 4KULA 1U8RA 1ZSZB 3SB2A 4OVAA 4A4EA 2JM9A 4RKUE 1MMGA 2DAQA 3M56A 2XKOC 2BZXA 1D0YA 1U1SA 1RABB 1YI2T 3ME9A 4J5YA 1YIJQ 1WYXA 3G71A 2M1HA 5CKEA 2CT4A 2LCSA 2KRNA 4DBRA 4FYYB 2K5LA 2DPPB 3C4SA 2CP3A 4MZPA 1I81A 3QDRB 5A2QE 3Q1JA 1NE8A 3A8HB 3I5SA 3OYCA 3CCJT 1WXUA 4M78F 2H3EB 4EIKA 1VQ4A 4HCZA 4ESRA 2DXCA 3CCET 4M75B 2QXFA 2DL8A 1V76A 4AFQC 2IVWA 2MCNA 1VQOA 2D0NA 5D6YA 5LJ3d 4RG2A 1NYFA 3EG2A 1B07A 2DETA 3O5ZA 3PE0A 4IUPA 4X1VA 1SEMA 1YJNT 2F69A 3JB9J 1WFWA 5A0LA 3J80E 4JS5A 4BE0A 1OV3A 4BDYA 2KEAA 2G3RA 4GBQA 3CMET 2HMAA 4OGEA 4M75D 1PKTA 1VYVA 2RK1A 1JEGA 2XG8D 1LOJA 1GCQC 3H0FA 2QK0A 2A7YA 4FCYA 1PSFA 2CZ1B 4KRTA 4JZ3A 4OMFB 3X26B 3CCVT 4LUEA 4R55A 1PSEA 1UE9A 4PLLA 2RK2A 3TQ7P 2CP2A 1ZA2B 1SSHA 3OW2P 2A37A 2DL5A 1NG2A 4J7FA 3A8LB 1VQ8Q 2LNHB 3I35A 1VQ7Q 1TUDA 3M0PA 3WVEB 3A8MB 4FT2A 2CREA 4MMKA 2ZPFB 4ANJA 2CH4A 3PNWC 2M9UA 2DMOA 2RJCA 1Q86R 4JLGA 2OX7A 1TU0B 2BZ8A 3M0UA 4DOVA 3OYHA 1PRLC 3CCLQ 1SG5A 1Y07A 2CS7A 1AD5A 2COZA 2F2VA 5IXFA 1M90U 4LDUA 3JV3A 2RPNA 4C92A 2LDMA 1N8RC 1UTIA 5I21A 2O4XA 2JW4A 4JPBW 4CC3A 2X51A 2MWOA 3TSWA 2DVEA 3GOXA 1SHGA 3PVQA 1K76A 4HVVA 3MP1A 5FRNA 3CC7T 2X4YA 4PL6A 2V8KA 1YNZA 3G4ST 2RHXA 4WF2A 1KG1A 5AT1B 1KQSS 3QKJA 2PQWA 1IZ6A 4KUIA 3UDCA 1ZQ1A 4L59A 1M1KC 3I56T 2RHZA 4RUGA 1WQ7A 3FIFA 4XU3A 2O01E 5GANe 1WHJA 4JZ4A 2JZ2A 3OS0A 2BKDN 2R58A 4M7DB 3E9GA 2DRMA 4IUQA 4F16A 1HYOA 2PU9B 4C92B 1YJWQ 3CC2T 1VQ9Q 2DD4A 1M8MA 2HKQB 4QQDA 3G6EA 2CP0A 4LXCA 4HCCA 4BD3A 2DZCA 1X43A 3KFVA 3BDLA 2RNAA 1RAIB 2K9GA 4JRIA 3CCUQ 1BCOA 4KUDK 2LMJA 4C92D 1KK7A 1PM3A 2RM4A 4M77A 3GPLA 4XK8E 4Q5WA 3OYFA 2P0PA 1XQHA 1VQ7A 1X2QA 1N5ZA 2ZPHB 1SSFA 2DTIA 3FRNA 1RAFB 5GAOl 4DA4A 2L5QA 1ARKA 1YHQQ 3FB9A 4M75G 5GANh 3VS0A 3BY7A 3OW2A 1Q7YC 5CK9A 2JTMA 1TOVA 1Q82R 4FYXB 3GP8A 4M7AC 3RUXA 5GAMd 1VA7A 3CCLA 2GFAA 2E6NA 1GBRA 2DJZA 3OYYA 1IGQA 3CCQA 2C06A 3VS7A 2E70A 4C0FA 4XU2A 2COWA 1JB0E 2HZYA 2KY9A 4QVDA 1WXBA 3V7SA 2V26A 8ATCB 3ULRB 3SWNC 3EFRA 3M58A 2QASA 4LUDA 2RQRA 5GAMj 3JCMe 2ZPEB 3A1PA 1VQKQ 4FW1A 3CC4Q 4MDWA 1OULA 4BI3A 2VWFA 3ZEHA 3CPWS 1ZX6A 2YT6A 1C1AA 4J9GA 4O6JA 4XTXA 3CCMQ 2DD5A 4PJOE 2OTLT 4M77D 2RI3A 5L23A 5GANf 3X28B 1ACMB 5A0GA 3ER0A 3HSBA 5HK0A 4RCBA 4A4KA 2K79A 1AWOA 1FMKA 2F1LA 4EMGA 2JUFA 2OTJQ 5GAN4 1QQJA 1QW1A 3O8VA 4N4HA 1B7TA 4CC7A 3CCRT 3VS2A 1M8VA 3PT9A 1FWZA 4C0DB 3OS1A 3M0RA 4FSSA 4LE9A 4LD9K 3CCUA 1RACB 2P84A 2RMOA 5KYYB 3J81E 1Q81R 3DKMA 4X9CA 4XTUA 1VQ5T 4LDXA 1PCXA 4B9WA 5HY6A 1K73C 2D0QB 4ZTJA 2E5KA 3V8LA 2E64A 1AHJB 1LJOA 2AZSA 4ORZA 1FMWA 3NMZC 3HFNA 2BE7D 3X25B 2EIFA 4XTVA 3VRZA 1KHCA 3PVLA 2DF6A 3PMIA 4JJBA 2ATCB 3T9NA 4FL6A 1K1ZA 2VB6A 5KE2A 2CUDA 5GAN7 1MMDA 2ZCFB 4E6RA 1MNDA 4C8QF 1T0JA 1WI7A 1QCOA 5IN1A 5A0DA 2K3BA 2D8JA 2DZ9A 4C92G 2HBPA 2EKOA 1M2VA 1VQMT 3DB4A 3PIOA 1N9SA 4MZTA 1U1TA 1WGSA 5IT9E 3MCAB 5CCAA 1SHFA 3IQLA 3P8DA 5FU7B 4RTXA 1VQKA 3CC4A 1Y57A 2FZCB 3JCMf 2EQMA 3CD6T 4HT9A 4KBMB 1ABOA 2ZPIB 1NZ9A 2JN0A 2K57A 1KIKA 5FW9A 2HD0A 3HTRA 1UG1A 2I0NA 3CCSQ 4E7JA 4J9BA 3L2WA 2VXEA 3CCMA 2XIDA 1VQNQ 2LZ6B 1Q86C 1Y7XA 2LCCA 3PGGA 1KC8R 2LT1A 1X2KA 2L3PA 1KQ2A 4JJDA 3ZFJA 4PJJA 3ZBDA 5LJ3g 2EJGA 1W6XA 4PFZA 1IB8A 1T0HA 2LTOA 2RI5A 4OB0B 1KD1U 4OMLA 2E65A 2RB6A 3A98A 5GMKl 1RLPC 2PVGB 1M1KR 1ZUKA 3E19A 4OMNA 1FMVA 1LVKA 4M7DE 2MIOA 1GL5A 4CRIA 3OYLA 2HQXA 1QVGP 3JCMX 3TREA 5GMKe 3CCVQ 5IHNA 5KE3A 4M77G 5LJ5d 3LLRA 3MEWA 2DKGA 6AT1B 4ZTFA 3ASKA 1UGRB 2VVKA 2H8HA 3FJPA 1SRLA 4EPCA 4JJNK 3QYGB 2D6FA 1IHWA 3QWYA 1Q7YU 1YJ9T 1T3LA 2CP7A 5KH6A 2JMAA 1FX7A 1MHNA 1XTDA 2VASA 5GAN8 1G3WA 1NJIC 3EG1A 2LJ3A 3NHNA 1BI0A 1SPKA 2DEQA 1BU1A 4ZNXA 5CQYA 3CPFA 1VQPT 4C0GA 2EJFA 2DFUA 3BFMA 2RHUA 2ZZDA 1SRMA 1ZSZA 3V7RA 5GMKh 2QA4T 3CCJA 2K5FA 3INZA 2VYTA 1I8FA 4MDXA 2DXBA 2EQIA 1OZ2A 3CCSA 2ABLA 2LQ8A 4HXJA 4IURA 3CCEA 1U06A 1VQNA 1TUCA 3QWXX 2BIVA 2PVDB 1TTHB 1XNIA 1ZLMA 4MMLA 2MPXC 1OX9A 1WQWA 4M4ZA 1AWWA 4PJOA 4F7UE 2KK4A 4M78E 4OMOA 2CSIA 1W4SA 4FU6A 1RL2A 2KRMA 2ROTA 2GQVA 1YJNA 5KCHA 4PKCC 4F04B 4LDVA 2KT1A 3CMEA 4J6WA 3QXEB 2J6FA 1ZBJA 2O31A 5CKHA 4C5GA 1YFNA 2L8DA 5D7UA 1H92A 2VV5A 3A8OB 5GAN6 2JMCA 4N4GA 4XU0A 3CCVA 3CMAQ 2BE9B 3L2UA 3GLXA 1RLQC 3EHQA 2LRQA 3HPWA 2QAZA 1VQ6Q 4NOYA 4KGVB 2GNCA 3AHUA 1E6GA 2E10A 1HSQA 1LCKA 2IIMA 4JUVA 1PWTA 3OYDA 4PJOB 4HKEA 2CDTA 4R0KA 4KT0E 3VYGA 3OB9A 4F7UF 2QQ9A 1QVGA 1Z9QA 5GMKm 2HSEB 2EPDA 3QZ9B 1RADB 2GCXA 3GNGA 3SHWA 2DEUA 3OMGA 2LC4A 2DBMA 3C0CA 2CZ0B 2V1QA 1WXTA 2R5AA 2KRSA 3C12A 1R8OB 2QEXT 1RAAB 4X9DA 3HRTA 3OY9A 3CQTA 2MI6A 1K73R 2O9SA 1WZOA 2KI7A 2LNVA 4BY6B 4EMKA 1RI0A 2LQKA 1VIFA 2JJ9A 4CC2A 1K0XA 3H8ZA 4PJOD 4PJNA 1Q81C 5GAMg 3OA6A 2ED1A 4M77C 3EG0A 2EQJA 3RESA 3G6EQ 2D9TA 3M4GA 1O9SA 1RUWA 1XJWB 3SD4A 2E3HA 5LJ3j 4FT4A 1UFFA 3M54A 3M59A 5ECAA 3M4YA 2AKKA 2JOYA 2O9VA 2CUBA 3OW2S 2DRKA 1Q86U 2RD1A 2EGAA 1M30A 4HCBA 1M3BA 3QSUA 3RKWA 1QWEA 3VU3C 1K9MR 3HRUA 3GBQA 1D0ZA 4EMKB 2ROLA 1AZGB 2DL7A 3JB9I 3OSSC 2L3RA 2D1XA 2Y4XA 2RN8A 3QZ5B 1A0NB 1S72T 1K4US 3VS1A 2RO0A 1ABQA 3CC2A 4RG8A 4ZGJB 3H41A 2JM8A 2DIGA 3VS4A 2EW3A 2DXTA 1IHVA 2FPFA 3OYKA 1WA7A 1U5SA 3JRZA 3LGFA 3MEAA 3G71T 1G2BA 2YUQA 1UHFA 4XTWA 2LQNA 3VRYA 1AT1B 3URGA 3CMAA 4ATOA 4N4IA 2MAMA 4M7DA 4RTTA 4DOWA 1VQ6A 5HKCA 1JQQA 3CCQQ 2KXDA 2RI2A 2GTOA 3OBYA 4RTZA 4QVCA 1D0XA 1VQ4T 2FRYA 1JXMA 4EDUA 4IUTA 2L89A 4QVZA 1KC8C 3M0QA 4ZN1A 1VQOT 2CP6A 1UECA 2X9HA 2KR3A 2XU8A 1UJYA 3EHRA 1I07A 1PNJA 2J6OA 3UPUA 1I1JA 4E7SA 4B6MA 2SEMA 3EGDA 2KMTA 1K8AR 3S6WA 3P8BB 5M9OA 1ZUUA 1G5VA 2XDPA 4C5HA 3MPUB 4IIOA 4M7AE 1BK2A 4D8KA 4XU1A 2DA9A 1KJWA 1VYTA 3SFMA 2C0IA 1OEBA 4Z89A 4IUVA 2JXBA 2FZGB 3EG3A 4JRPA 2RJEA 2PUOB 1DJ7B 2X4XA 2WACA 5J26A 3QYHB 2OI3A 2KBTA 1NJIR 2LJ0A 4AFSC 5CVIA 4PNOA 3LGLA 1PG5B 1MV3A 3L2QA 1VQLT 1NEGA 4HT8A 2FB7A 2YRCA 1QKWA 3EGDB 5CIUA 2QYZA 1Q82U 4M7DD 2P4TA 4AG1C 3VKIA 1TS9A 3MO8A 2VGNA 4PJOG 1M1GA 3OYAA 4JS4A 4M7AF 5I2MA 4O5VA 1WHKA 4F7UA 3WVDB 3SDZA 3I55Q 4M78A 3RERA 1YIJT 3U23A 2EYXA 2RJDA 4HA8A 1QVFP 1OYXA 3CCRA 2KQWA 3VS3A 2XICA 3RMSA 3HHTB 2DL3A 1NLOC 3PFSA 2B8AA 1QKXA 2C0OA 4TVRA 1OU8A 2GFUA 4Y28E 1GCQA 4DBQA 2C0TA 2HKNA 2BZYA 1EX4A 1YITQ 4A63B 4FM4B 5LJ5g 2HEQA 3NTKA 4F7UB 3JSCA 4M78B 1JO8A 5KYYA 2YWWA 2PVOB 1BIAA 1GXIE 1GFCA 4LN2A 2KT8A 1EIFA 2MYSA 2FHDA 1VOMA 4N0AA 4E7IA 1Q81U 4LDYA 3BE3A 1VQMA 2L2PA 1MMAA 2PUKB 4IUUA 1H641 3UT1A 1H3HA 4M78D 4AFZC 4OB3B 1W2BP 3CD6A 1XOVA 3VYHB 1WJSA 4C8QE 3CXCP 4DEYA 1CKAA 2E41A 1VQ8T 2RHIA 1VQ7T 3OYJA 1QP3A 1WPYA 5GAN2 3RBBB 3EH2A 3JCMh 4FYWB 1X01A 2JS0A 2HL3A 4RCCA 3SEMA 1JRIA 2J6KA 5FWCA 4GLMA 5GAOq 4WCIA 3R6NA 1FXXA 7AT1B 1PKSA 2EKHA 2LX7A 5GAOp 2NWMA 3CCLT 3I55A 3M5AA 1VUBA 2QQAA 2EGEA 2QDLA 4BE1A 4AT1B 1NBEB 2J05A 2RQWA 3MHXA 5LJ3f 1HD3A 2HSPA 1ZSZC 2K6DA 3M0TA 5DY9A 2K3YA 1NPPA 2HQHA 4RTUA 4M7DG 2ECZA 2LJ1A 2M0YA 4PFOA 1N8RU 1YI2Q 3QG1A 1ZA1B 2KXCA 1KC8U 4J83A 1C6VX 2VGMA 1YITA 4XTZA 3H0IA 4PJOC 1K9MC 1OU9A 2QI2A 2RJFA 5CR2A 5GAOm 3I9QA 4BE2A 1UEBA 1QP2A 1YCYA 2PZ1A 3CCJQ 2A0FB 1YJWT 1VQ9T 1YJ9A 4M75C 4E2FB 1M1KU 3CCEQ 2JTEA 3RKXA 1WHHA 4HVUA 4BY6C 4BB7A 2FEIA 1H3ZA 2IPOB 4M7AA 2KNBB 2EVRA 1IGUA 1RAEB 1T3SA 5CO7A 1YN8A 1BB9A 1YWPA 2KYMA 5DLOA 4J9HA 2R57A 3CCUT 2R5MA 1WDXA 1QMCA 2MWPA 3S3MA 5GAMe 1CSKA 1TWBA 4VUBA 2YDLA 1YJNQ 1BBZA 2QA4A 3CMEQ 2RHYA 1QVGS 3FJ5A 5GJVB 4X34A 2MOXA 5IHKA 1WJQA 4Z88A 2DX1A 1IRXA 1JJ2P 2YLCA 3VUZA 1B34A 1PRMC 2E6ZA 3UF4A 1PC0A 2CZ7B 4DBFA 1YHQT 1WHLA 3V8JA 1D1BA 1YCSB 2AT1B 1K8AC 2DTHA 2CYZB 2A3LA 2GF7A 4J9CA 2EAYA 4F14A 1M1FA 4OMMA 4ZGEB 4M7AB 3EFOA 1X69A 4F7UG 1GFDA 4M78G 1BIBA 2E1HA 2SRCA 4J7IA 1EFNA 2GTJA 3EGUA 2QG9B 4A4HA 3H9NA 4ELYC 2HDAA 1M90C 5LJ5j 2HNIA 1OX8A 2H3JA 1VQKT 3GNFB 3CC4T 5GAMh 1B34B 5GAOn 1YI2A 4M7AD 3M53A 5L8RE 3X20B 3LW5E 1OQKA 2FVUA 3CEYA 2A36A 4NS5A 3QIIA 3HKSA 1JU5C 4E7KA 1OI1A 1QCFA 3OMCA 3CCMT 2AIRB 2EGCA 3GF5A 4OP0A 4A4GA 3JB9H 3EFOB 2ENMA 1Y71A 2QGFB 3REBB 1W1FA 3PTAA 3CC7Q 2QDYB 1RAHB 2K3XA 3C94A 3G4SQ 1QLYA 5C6SA 1RI9A 1Z9ZA 2OTJT 2XMFA 1TXQA 2E5QA 3QBYA 5EG2A 2O88A 2JVVA 3WXMB 1NLPC 4JDSA 1Y96A 2DXUA 1WHGA 3OYBA 3I56Q 4AG2C 4DEXA 1Y0MA 2DYBA 1JBMA 1AVZC 4M7DC 3RIRA 3LH5A 4C92C 2GBQA 3L2ZA 4HCKA 1O75A 3OSVA 2QQBA 3JCMP 3CC2Q 3KBGA 3BW1A 3RDVA 2ZGWA 5EC7A 5GAMf 5KYWA 1VYUA 1N9RA 1WNLA 3NTIA 3OS5A 2YSQA 4C8QA 5KYXA 2A28A 2ESWA 1S1NA 2IG0A 5GANd 4YTLA 2Y90A 4PLIA 2NUZA 2XHCA 4ZN3A 4GLKA 1K73U 1Y96B 2EYWA 4A4FA 5J3BA 1S72A 1JJ2A 4CI0C 4L6V5 4DBHA 4D6WA 5GANj 2I2LA 4DQ2A 2FZKB 4Z02A 5KYWB 5FU6B 1G3SA 2EQUA 4M77F 1MNEA 3MEUA 2DM1A 2RA2A 4C8QB 2YUNA 5KYXB 4BI8B 1BYMA 4LDWA 1NYGA 2DK3A 3UA7A 3LWIA 2DE0X 4II1A 2F5KA 3CCST 2K7AA 1M27C 3HL8A 2WSCE 4KGZB 1VQNT 5LL6S 1K9MU 3QHSA 3RMQA 2Z0WA 4NL3A 1WHMA 2DLPA 3CC7A 4M78C 3L1AA
chains in the Genus database with same CATH topology
1WLPB 3THKA 3VRZA 2B86A 1AZEA 3M0SA 3PVLA 2DF6A 4RTWA 1UGVA 4JJBA 1X6BA 4JJCA 1TG0A 1YWOA 2PNIA 4J9IA 1AWXA 1AEYA 1K1ZA 4RTVA 2AZVA 2LP5A 2CUDA 2YUPA 1ZUYA 3U23A 2EYXA 2F2XA 4E6RA 4OMQA 2GGRA 1NEBA 1T0JA 1WI7A 1UJ0A 2FRWA 4Z8AA 3ZL7C 2K3BA 2D8JA 3NGPA 1J3TA 3VS3A 1G83A 2DL3A 1HJDA 1NLOC 2HCKA 2RF0A 1QKXA 2C0OA 1SHFA 1CKBA 2D8HA 3IQLA 2DBKA 1GCQA 1W70A 4RTXA 1UUEA 1Y57A 2KGTA 1OOTA 1ABOA 3UA6A 2KROA 4K11A 2C0TA 1MV0B 2BZYA 2DJQA 4AFUC 1KIKA 5FW9A 1UG1A 2LQWA 2I0NA 4A63B 3H0HA 2RQVA 2M51A 4J9BA 2HEQA 2CSQA 1K0SA 2LZ6B 1JO8A 1GCPA 2AKLA 2X3WD 1X2KA 2DVJA 2L3PA 2A08A 1E6HA 4JJDA 4OMPA 4D8DA 2BTTA 1GFCA 4LN2A 2KT8A 1KSWA 1W6XA 1T0HA 2JM9A 2W0ZA 4OMLA 2L2PA 3A98A 2BZXA 1RLPC 1ZUKA 4IIMA 4OMNA 1H3HA 1WYXA 2FPDA 4AFZC 2CT4A 2LCSA 2MIOA 2KRNA 1GL5A 2P4RA 1XOVA 4RTYA 4DEYA 2JT4A 1CKAA 5IHNA 3I5SA 1GBQA 1WXUA 2EBPA 3RBBB 4EIKA 4ESRA 2VVKA 2JS0A 3SEMA 2DL8A 2J6KA 4AFQC 2H8HA 1SRLA 2MCNA 5FWCA 4GLMA 4WCIA 3R6NA 1PKSA 2D0NA 2EKHA 2FPEA 2LX7A 3QWYA 1NYFA 2NWMA 1T3LA 3EG2A 1B07A 1PHTA 2JMAA 3O5ZA 2EGEA 2QDLA 3I5RA 5IH2A 2V1RA 3PE0A 3NPFA 2J05A 4X1VA 5I11A 1SEMA 2RQWA 3EG1A 5GJWB 1HD3A 2HSPA 1WFWA 2LJ3A 4CC4B 3NHNA 2K6DA 1OV3A 2KEAA 1SPKA 3M0TA 4GBQA 1BU1A 4ZNXA 1PKTA 1VYVA 1JEGA 1V1CA 4F17A 4RTUA 1GCQC 3H0FA 2ECZA 5IXBA 4KRTA 4JZ3A 2KE9A 2LJ1A 2M0YA 1SRMA 2DNUA 4LUEA 1UE9A 4LNPA 2KXCA 2F2WA 1JXOA 2FO0A 1SSHA 2A37A 2EQIA 3H0IA 2KYBA 2ABLA 2DL5A 3I9QA 4HXJA 1NG2A 1U06A 3RNJA 1TUCA 3QWXX 2LNHB 3I35A 1TUDA 2PZ1A 3M0PA 1ZLMA 2CREA 4M4ZA 2CH4A 1AWWA 2DMOA 4OMOA 2JTEA 1OPKA 1H8KA 2CSIA 4HVUA 2KRMA 2ROTA 1YP5A 2FEIA 1B3QA 2BZ8A 3M0UA 2KNBB 2EVRA 2KT1A 1PRLC 1T3SA 1AOJA 1YN8A 1BB9A 1YWPA 2J6FA 2KYMA 1ZBJA 4J9HA 1AD5A 2F2VA 5IXFA 1WDXA 2O31A 1I0CA 1K9AA 2J7IA 3JV3A 2RPNA 2W10A 1CSKA 1UTIA 1H92A 2JMCA 2JW4A 2YDLA 4JPBW 1BBZA 4CC3A 3TSWA 2FG0A 5I22A 1SHGA 3PVQA 3FJ5A 5GJVB 1RLQC 3EHQA 1K76A 4HVVA 2MOXA 5IHKA 4Z88A 2DX1A 2X3XD 4Y92A 2L3QA 1PRMC 3UF4A 2GNCA 2YUOA 1YNZA 1E6GA 3UATA 1HSQA 1LCKA 2IIMA 1PWTA 1YCSB 2OAWA 2L3SA 1E7OA 2CDTA 4R0KA 2RQTA 4J9CA 4RUGA 2K2MA 4F14A 1Z9QA 5IHIA 3VS6A 4OMMA 2EPDA 2HBWA 1IO6A 4J9FA 3SHWA 1X6GA 3C0CA 2DBMA 2JS2A 2V1QA 1X69A 1WXTA 4JZ4A 1GFDA 2KRSA 4HVWA 2SRCA 1EFNA 2GTJA 2DRMA 3EGUA 4F16A 3CQTA 2O9SA 2HDAA 1M8MA 2CH4W 3TSZA 4CC2A 1K0XA 1M3AA 1X43A 1KFZA 2ED0A 2ED1A 3KFVA 1WIEA 1QWFA 3EG0A 2RNAA 2K9GA 5FWBA 1UDLA 1RUWA 1UFFA 5ECAA 2AKKA 2O9VA 2CUBA 2LMJA 2A36A 2RQUA 1JU5C 1OPLA 1M3CA 1QCFA 1ZSGA 2EGCA 2DRKA 1NM7A 1X2QA 2ENMA 1N5ZA 1U3OA 2EGAA 3REBB 1M30A 1W1FA 1M3BA 1QWEA 1ARKA 1QLYA 3GBQA 2G6FX 1RI9A 1Z9ZA 2XMFA 2ROLA 1AWJA 1AZGB 2DL7A 1A0NB 2D1XA 3VS0A 2RN8A 2O88A 1K4US 3VS1A 1ABQA 1NLPC 3H41A 2JM8A 4AG2C 4DEXA 3VS4A 1VA7A 1Y0MA 2EW3A 2DYBA 1AVZC 2FPFA 1GBRA 1WA7A 1U5SA 4J9EA 3LH5A 1G2BA 2GBQA 2YUQA 4QT7A 3VS7A 4HCKA 1UHCA 1UHFA 2LQNA 3VRYA 1WXBA 2AK5A 5EC7A 1MUZA 1VYUA 3ULRB 4LUDA 2RQRA 4RTTA 3REAB 1JQQA 2YSQA 2KXDA 2GTOA 4RTZA 2OJ2A 2DILA 2FRYA 1JXMA 2L0AA 1X27A 2VWFA 2A28A 2ESWA 1S1NA 3M0QA 1ZX6A 2YT6A 1UECA 2NUZA 4J9DA 5HCKA 2KR3A 1UJYA 3EHRA 4J9GA 1I07A 1PNJA 2J6OA 1I1JA 2EYWA 2SEMA 2PTKA 5L23A 1ZUUA 2GQIA 2K79A 1AWOA 1FMKA 4IIOA 3VS5A 1WX6A 1BK2A 4D8KA 2VKNA 2DA9A 1KJWA 1VYTA 1GRIA 2J06A 2C0IA 3TVTA 1OEBA 4Z89A 2JXBA 4CC7A 3EG3A 3VS2A 2DM1A 2EYZA 3M0RA 4FSSA 2O2OA 2YUNA 4LE9A 2CT3A 1NYGA 3UA7A 2DE0X 2RMOA 2OI3A 2KBTA 2K7AA 1M27C 2LJ0A 4AFSC 1FYNA 1MV3A 1NEGA 1QKWA 2DL4A 2E5KA 2DLPA 2AZSA 2EYYA 4ORZA 3NMZC 4AG1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLP B;  3THK A;  3VRZ A;  2B86 A;  1AZE A;  3M0S A;  3PVL A;  2DF6 A;  4RTW A;  1UGV A;  4JJB A;  1X6B A;  4JJC A;  1TG0 A;  1YWO A;  2PNI A;  4J9I A;  1AWX A;  1AEY A;  1K1Z A;  4RTV A;  2AZV A;  2LP5 A;  2CUD A;  2YUP A;  1ZUY A;  3U23 A;  2EYX A;  2F2X A;  4E6R A;  4OMQ A;  2GGR A;  1NEB A;  1T0J A;  1WI7 A;  1UJ0 A;  2FRW A;  4Z8A A;  3ZL7 C;  2K3B A;  2D8J A;  3NGP A;  1J3T A;  3VS3 A;  1G83 A;  2DL3 A;  1HJD A;  1NLO C;  2HCK A;  2RF0 A;  1QKX A;  2C0O A;  1SHF A;  1CKB A;  2D8H A;  3IQL A;  2DBK A;  1GCQ A;  1W70 A;  4RTX A;  1UUE A;  1Y57 A;  2KGT A;  1OOT A;  1ABO A;  3UA6 A;  2KRO A;  4K11 A;  2C0T A;  1MV0 B;  2BZY A;  2DJQ A;  4AFU C;  1KIK A;  5FW9 A;  1UG1 A;  2LQW A;  2I0N A;  4A63 B;  3H0H A;  2RQV A;  2M51 A;  4J9B A;  2HEQ A;  2CSQ A;  1K0S A;  2LZ6 B;  1JO8 A;  1GCP A;  2AKL A;  2X3W D;  1X2K A;  2DVJ A;  2L3P A;  2A08 A;  1E6H A;  4JJD A;  4OMP A;  4D8D A;  2BTT A;  1GFC A;  4LN2 A;  2KT8 A;  1KSW A;  1W6X A;  1T0H A;  2JM9 A;  2W0Z A;  4OML A;  2L2P A;  3A98 A;  2BZX A;  1RLP C;  1ZUK A;  4IIM A;  4OMN A;  1H3H A;  1WYX A;  2FPD A;  4AFZ C;  2CT4 A;  2LCS A;  2MIO A;  2KRN A;  1GL5 A;  2P4R A;  1XOV A;  4RTY A;  4DEY A;  2JT4 A;  1CKA A;  5IHN A;  3I5S A;  1GBQ A;  1WXU A;  2EBP A;  3RBB B;  4EIK A;  4ESR A;  2VVK A;  2JS0 A;  3SEM A;  2DL8 A;  2J6K A;  4AFQ C;  2H8H A;  1SRL A;  2MCN A;  5FWC A;  4GLM A;  4WCI A;  3R6N A;  1PKS A;  2D0N A;  2EKH A;  2FPE A;  2LX7 A;  3QWY A;  1NYF A;  2NWM A;  1T3L A;  3EG2 A;  1B07 A;  1PHT A;  2JMA A;  3O5Z A;  2EGE A;  2QDL A;  3I5R A;  5IH2 A;  2V1R A;  3PE0 A;  3NPF A;  2J05 A;  4X1V A;  5I11 A;  1SEM A;  2RQW A;  3EG1 A;  5GJW B;  1HD3 A;  2HSP A;  1WFW A;  2LJ3 A;  4CC4 B;  3NHN A;  2K6D A;  1OV3 A;  2KEA A;  1SPK A;  3M0T A;  4GBQ A;  1BU1 A;  4ZNX A;  1PKT A;  1VYV A;  1JEG A;  1V1C A;  4F17 A;  4RTU A;  1GCQ C;  3H0F A;  2ECZ A;  5IXB A;  4KRT A;  4JZ3 A;  2KE9 A;  2LJ1 A;  2M0Y A;  1SRM A;  2DNU A;  4LUE A;  1UE9 A;  4LNP A;  2KXC A;  2F2W A;  1JXO A;  2FO0 A;  1SSH A;  2A37 A;  2EQI A;  3H0I A;  2KYB A;  2ABL A;  2DL5 A;  3I9Q A;  4HXJ A;  1NG2 A;  1U06 A;  3RNJ A;  1TUC A;  3QWX X;  2LNH B;  3I35 A;  1TUD A;  2PZ1 A;  3M0P A;  1ZLM A;  2CRE A;  4M4Z A;  2CH4 A;  1AWW A;  2DMO A;  4OMO A;  2JTE A;  1OPK A;  1H8K A;  2CSI A;  4HVU A;  2KRM A;  2ROT A;  1YP5 A;  2FEI A;  1B3Q A;  2BZ8 A;  3M0U A;  2KNB B;  2EVR A;  2KT1 A;  1PRL C;  1T3S A;  1AOJ A;  1YN8 A;  1BB9 A;  1YWP A;  2J6F A;  2KYM A;  1ZBJ A;  4J9H A;  1AD5 A;  2F2V A;  5IXF A;  1WDX A;  2O31 A;  1I0C A;  1K9A A;  2J7I A;  3JV3 A;  2RPN A;  2W10 A;  1CSK A;  1UTI A;  1H92 A;  2JMC A;  2JW4 A;  2YDL A;  4JPB W;  1BBZ A;  4CC3 A;  3TSW A;  2FG0 A;  5I22 A;  1SHG A;  3PVQ A;  3FJ5 A;  5GJV B;  1RLQ C;  3EHQ A;  1K76 A;  4HVV A;  2MOX A;  5IHK A;  4Z88 A;  2DX1 A;  2X3X D;  4Y92 A;  2L3Q A;  1PRM C;  3UF4 A;  2GNC A;  2YUO A;  1YNZ A;  1E6G A;  3UAT A;  1HSQ A;  1LCK A;  2IIM A;  1PWT A;  1YCS B;  2OAW A;  2L3S A;  1E7O A;  2CDT A;  4R0K A;  2RQT A;  4J9C A;  4RUG A;  2K2M A;  4F14 A;  1Z9Q A;  5IHI A;  3VS6 A;  4OMM A;  2EPD A;  2HBW A;  1IO6 A;  4J9F A;  3SHW A;  1X6G A;  3C0C A;  2DBM A;  2JS2 A;  2V1Q A;  1X69 A;  1WXT A;  4JZ4 A;  1GFD A;  2KRS A;  4HVW A;  2SRC A;  1EFN A;  2GTJ A;  2DRM A;  3EGU A;  4F16 A;  3CQT A;  2O9S A;  2HDA A;  1M8M A;  2CH4 W;  3TSZ A;  4CC2 A;  1K0X A;  1M3A A;  1X43 A;  1KFZ A;  2ED0 A;  2ED1 A;  3KFV A;  1WIE A;  1QWF A;  3EG0 A;  2RNA A;  2K9G A;  5FWB A;  1UDL A;  1RUW A;  1UFF A;  5ECA A;  2AKK A;  2O9V A;  2CUB A;  2LMJ A;  2A36 A;  2RQU A;  1JU5 C;  1OPL A;  1M3C A;  1QCF A;  1ZSG A;  2EGC A;  2DRK A;  1NM7 A;  1X2Q A;  2ENM A;  1N5Z A;  1U3O A;  2EGA A;  3REB B;  1M30 A;  1W1F A;  1M3B A;  1QWE A;  1ARK A;  1QLY A;  3GBQ A;  2G6F X;  1RI9 A;  1Z9Z A;  2XMF A;  2ROL A;  1AWJ A;  1AZG B;  2DL7 A;  1A0N B;  2D1X A;  3VS0 A;  2RN8 A;  2O88 A;  1K4U S;  3VS1 A;  1ABQ A;  1NLP C;  3H41 A;  2JM8 A;  4AG2 C;  4DEX A;  3VS4 A;  1VA7 A;  1Y0M A;  2EW3 A;  2DYB A;  1AVZ C;  2FPF A;  1GBR A;  1WA7 A;  1U5S A;  4J9E A;  3LH5 A;  1G2B A;  2GBQ A;  2YUQ A;  4QT7 A;  3VS7 A;  4HCK A;  1UHC A;  1UHF A;  2LQN A;  3VRY A;  1WXB A;  2AK5 A;  5EC7 A;  1MUZ A;  1VYU A;  3ULR B;  4LUD A;  2RQR A;  4RTT A;  3REA B;  1JQQ A;  2YSQ A;  2KXD A;  2GTO A;  4RTZ A;  2OJ2 A;  2DIL A;  2FRY A;  1JXM A;  2L0A A;  1X27 A;  2VWF A;  2A28 A;  2ESW A;  1S1N A;  3M0Q A;  1ZX6 A;  2YT6 A;  1UEC A;  2NUZ A;  4J9D A;  5HCK A;  2KR3 A;  1UJY A;  3EHR A;  4J9G A;  1I07 A;  1PNJ A;  2J6O A;  1I1J A;  2EYW A;  2SEM A;  2PTK A;  5L23 A;  1ZUU A;  2GQI A;  2K79 A;  1AWO A;  1FMK A;  4IIO A;  3VS5 A;  1WX6 A;  1BK2 A;  4D8K A;  2VKN A;  2DA9 A;  1KJW A;  1VYT A;  1GRI A;  2J06 A;  2C0I A;  3TVT A;  1OEB A;  4Z89 A;  2JXB A;  4CC7 A;  3EG3 A;  3VS2 A;  2DM1 A;  2EYZ A;  3M0R A;  4FSS A;  2O2O A;  2YUN A;  4LE9 A;  2CT3 A;  1NYG A;  3UA7 A;  2DE0 X;  2RMO A;  2OI3 A;  2KBT A;  2K7A A;  1M27 C;  2LJ0 A;  4AFS C;  1FYN A;  1MV3 A;  1NEG A;  1QKW A;  2DL4 A;  2E5K A;  2DLP A;  2AZS A;  2EYY A;  4ORZ A;  3NMZ C;  4AG1 C; 
#chains in the Genus database with same CATH topology
 2KAF A;  1WLP B;  3THK A;  3VV0 A;  3G4S A;  5LJ5 e;  4C8Q D;  1AZE A;  2EYQ A;  3NFC A;  4RTW A;  2OAU A;  3RR6 A;  1UGP B;  4JJC A;  1TG0 A;  3I56 A;  4J9I A;  2LP5 A;  2EFI A;  1M9S A;  2YUP A;  1ZUY A;  4M7A G;  4WTO B;  2EWN A;  2F2X A;  2OTL Q;  4OB1 B;  1UJ0 A;  3JCM V;  4Z8A A;  3ZL7 C;  2K5I A;  3JCM d;  2FL7 A;  3NGP A;  1J3T A;  3EH1 A;  1D3B A;  1HJD A;  1MMN A;  1P92 A;  1CKB A;  2D8H A;  2DBK A;  3R6O A;  3OYG A;  2JTF A;  4C0D C;  1W70 A;  3CBM A;  2QTX A;  1UUE A;  3CCR Q;  1N6A A;  2KGT A;  8AT1 B;  3UA6 A;  2XK0 A;  1VQL A;  1D1C A;  4K11 A;  2AHJ B;  9ATC B;  2X4W A;  1K8A U;  2DER A;  4QW2 A;  3CBP A;  2LT4 A;  2HAX A;  2DTO A;  1KHI A;  3JCM b;  4GY5 A;  1VQ5 Q;  3JAM E;  3OBW A;  5LJ5 h;  1GCP A;  4N0A C;  3N5B B;  3D7S B;  3JB9 F;  2X3W D;  2V8I A;  4FSX A;  2A08 A;  4D8D A;  5KYN A;  1YIJ A;  1KSW A;  5GAO r;  1D3B B;  5AYF A;  4V2S A;  2W0Z A;  2XD0 A;  4B9X A;  3MEV A;  2P0K A;  1NJI U;  3OYN A;  2DYI A;  4A54 A;  4IIM A;  2DIQ A;  1RAG B;  2FPD A;  1BKB A;  1D1A A;  2P4R A;  4RTY A;  3RKY A;  1UGS B;  2P0Q A;  2JT4 A;  1VQM Q;  2QGG A;  1R77 A;  1IXD A;  4E7L A;  5I2S A;  1GBQ A;  1M90 R;  4J6Y A;  5FU7 C;  2LCL A;  2EBP A;  5D6W A;  2YRD A;  3DB3 A;  1KQS P;  3CD6 Q;  3EG9 A;  3F70 A;  4QQG A;  2V8J A;  2NYS A;  5LJ5 f;  5J39 A;  4QQ6 A;  4BDZ A;  2FPE A;  1EZZ B;  2O4X B;  3EGX A;  3PIP A;  1ZHI A;  4ELZ C;  2CP5 A;  2XDD A;  1KD1 C;  1PHT A;  2X35 A;  3I5R A;  2OTL A;  5IH2 A;  2V1R A;  2QQS A;  3M57 A;  3NPF A;  5I11 A;  3LWH A;  2BUD A;  5GJW B;  1I5O B;  1QVF S;  4CC4 B;  4PK4 A;  3CMA T;  4IKF A;  3AT1 B;  4OGC A;  3LX7 A;  1V1C A;  5GAN 3;  1R0C B;  3MET A;  5LJ3 e;  1VQ6 T;  4J6X A;  4F17 A;  1BI3 A;  3UWN A;  3OS2 A;  5IXB A;  2KE9 A;  1SKU B;  1VQ8 A;  4QKU A;  4C8Q G;  5CKD A;  2DNU A;  4KH0 B;  3EG9 B;  4LNP A;  1BCM A;  5FRM A;  2F2W A;  1JXO A;  2FO0 A;  1Q95 G;  4MZM A;  2XDB A;  2NLU A;  2KYB A;  2KSS A;  1VQ5 A;  3RNJ A;  3EGX B;  3MJX A;  2QQR A;  2QTV A;  4E7H A;  1G3Y A;  5FRO A;  2DO3 A;  1M4Z A;  3A8G B;  3VUB A;  2XI9 A;  2X4J A;  2M02 A;  2YLB A;  3V7C A;  1D09 B;  1OPK A;  1H8K A;  4ZGD B;  3HFO A;  4L5G A;  3OYI A;  1YP5 A;  2KDS A;  3C95 A;  1PD1 A;  3TU4 K;  1B3Q A;  4PFP A;  4NL2 A;  2YHT A;  1YJ9 Q;  2YRV A;  1AOJ A;  4M77 B;  4E47 A;  3G6E T;  1TUG B;  1HXD A;  3OYE A;  1I0C A;  4J8O A;  1K9A A;  2J7I A;  2M0O A;  2W10 A;  1TH7 A;  5LJ3 h;  2ZAE A;  4AMC A;  4E7Z A;  1BI2 A;  1W2B S;  2FG0 A;  4ME7 A;  5I22 A;  3QUI A;  3M9Q A;  4P5N A;  1PD0 A;  3CXC S;  1LPL A;  1SF9 A;  2X3X D;  1VQP Q;  4Y92 A;  2L3Q A;  3P8H A;  3HP9 A;  2YUO A;  5GMK j;  1G8X A;  3L42 A;  3UAT A;  4FIB A;  2OAW A;  3CPW P;  2L3S A;  1E7O A;  2NUP A;  2ZPG B;  2QA4 Q;  4OF1 A;  1YJW A;  1TSF A;  2RQT A;  1VQ9 A;  3QPH A;  2K2M A;  4C0Z A;  2HL5 C;  5GAN 5;  5IHI A;  3VS6 A;  3M55 A;  2HBW A;  1IO6 A;  4J9F A;  4M75 E;  1VIE A;  1X6G A;  2JS2 A;  4A53 A;  1MGQ A;  4HVW A;  1X75 C;  4PJM A;  1X6O A;  4XAX B;  1KQS A;  3JCM W;  2CH4 W;  2E4H A;  3X24 B;  3G7Z A;  3TSZ A;  4PJL A;  1V29 B;  2HQE A;  3S3N A;  2EJ9 A;  3EFS A;  1R0B G;  1M3A A;  1KFZ A;  2ED0 A;  3CCQ T;  3MKD A;  1WIE A;  1QWF A;  4EMH A;  2VXF A;  1I5L A;  4JRK A;  5FWB A;  2KVQ G;  4OB2 B;  4JLI A;  1UDL A;  2NUP B;  5IAY A;  4PJO F;  1M2O A;  3G1J A;  4LD6 A;  2RQU A;  1ZBX A;  1YHQ A;  1OPL A;  1M3C A;  2M16 A;  2MF2 A;  1ZSG A;  3EAE A;  1NM7 A;  1QVF A;  3J7A F;  1U3O A;  1WJR A;  2ZPB B;  3NTH A;  4M75 F;  2K4Y A;  5GAN g;  1F1B B;  2G6F X;  1AWJ A;  3MP8 A;  2Y4Y A;  4Y91 A;  3QJY A;  2EQK A;  5FU6 C;  1NPR A;  4J9E A;  2WSF E;  3FDR A;  1UB4 A;  3DLL A;  2QEX Q;  4QT7 A;  1OZ3 A;  4C8Q C;  3KXT A;  1UHC A;  5KCO A;  3VJP A;  1QCN A;  2AK5 A;  3JB9 D;  1MUZ A;  3E1S A;  1N27 A;  3JCM c;  3REA B;  2F5T X;  4BUG A;  1VQP A;  1LNX A;  2K2V A;  4XQ3 A;  1N8R R;  2OJ2 A;  2DIL A;  2L0A A;  2MK5 A;  1JJ2 S;  3LYI A;  1X27 A;  2CKK A;  2VUB A;  1HK9 A;  3OQ5 A;  2COY A;  5CAI A;  3SWN A;  1C0M A;  3TCJ A;  4J9D A;  5HCK A;  5CKB A;  5DM7 R;  3JCM J;  3GIB A;  3I55 T;  5FLX E;  2NUT A;  1M2V B;  2OTJ A;  4UC4 A;  2PTK A;  2RH2 A;  4KH1 B;  2GQI A;  4C5E A;  1W2B A;  1KQ1 A;  3VS5 A;  4EMK C;  3CPW A;  1WX6 A;  3CXC A;  3QDF A;  2VKN A;  3BDU A;  1GRI A;  1BI1 A;  2J06 A;  3CBO A;  4JRQ A;  3TVT A;  4C92 E;  1S72 Q;  4FW2 A;  3A5Z B;  2EYZ A;  3H6Z A;  3L2V A;  3E9F A;  3DLM A;  2O2O A;  2CT3 A;  3JCM g;  3G71 Q;  1KD1 R;  1YIT T;  1M5Q 1;  3SWN B;  1UGQ B;  5C0M A;  2LVM A;  2WSE E;  2CZ6 B;  1FYN A;  5KYU A;  3QJ6 A;  2NUT B;  5D6X A;  4XTY A;  4R56 A;  3LH0 A;  2DL4 A;  3OYM A;  2EYY A;  4FYV B;  2YXY A;  5HK3 A;  1VQ4 Q;  3FLG A;  2B86 A;  3MP6 A;  3M0S A;  1UGV A;  1X6B A;  1VQO Q;  1YWO A;  2PNI A;  1AWX A;  1G3T A;  3TEE A;  1AEY A;  4M7D F;  3S3O A;  1I4K 1;  4RTV A;  3PMT A;  2AZV A;  3FEO A;  1QVP A;  5GMK i;  3V8K A;  3HRS A;  4C92 F;  4OMQ A;  2GGR A;  1NEB A;  2QEX A;  2FRW A;  2FYK A;  1Q7Y R;  4RMO A;  4BI4 A;  1G83 A;  3QO3 A;  2HCK A;  5KYU B;  2RF0 A;  1IRE B;  2CGH A;  2E12 A;  2LX9 A;  1OOT A;  2VC8 A;  3FC3 A;  1YBY A;  4M77 E;  2KRO A;  1Q82 C;  1MV0 B;  2DJQ A;  4AFU C;  4C5I A;  2LQW A;  3H0H A;  5DLQ E;  2RQV A;  4KGX B;  2M51 A;  2CSQ A;  1K0S A;  2MMP A;  2E3I A;  2JNG A;  1VQL Q;  2AKL A;  3KUF A;  3E2U A;  4BAC A;  2DVJ A;  1E6H A;  3L2R A;  4OMP A;  4M75 A;  3JCM Q;  2BTT A;  5CKF A;  3JB9 G;  5CQX A;  4KUL A;  1U8R A;  1ZSZ B;  3SB2 A;  4OVA A;  4A4E A;  2JM9 A;  4RKU E;  1MMG A;  2DAQ A;  3M56 A;  2XKO C;  2BZX A;  1D0Y A;  1U1S A;  1RAB B;  1YI2 T;  3ME9 A;  4J5Y A;  1YIJ Q;  1WYX A;  3G71 A;  2M1H A;  5CKE A;  2CT4 A;  2LCS A;  2KRN A;  4DBR A;  4FYY B;  2K5L A;  2DPP B;  3C4S A;  2CP3 A;  4MZP A;  1I81 A;  3QDR B;  5A2Q E;  3Q1J A;  1NE8 A;  3A8H B;  3I5S A;  3OYC A;  3CCJ T;  1WXU A;  4M78 F;  2H3E B;  4EIK A;  1VQ4 A;  4HCZ A;  4ESR A;  2DXC A;  3CCE T;  4M75 B;  2QXF A;  2DL8 A;  1V76 A;  4AFQ C;  2IVW A;  2MCN A;  1VQO A;  2D0N A;  5D6Y A;  5LJ3 d;  4RG2 A;  1NYF A;  3EG2 A;  1B07 A;  2DET A;  3O5Z A;  3PE0 A;  4IUP A;  4X1V A;  1SEM A;  1YJN T;  2F69 A;  3JB9 J;  1WFW A;  5A0L A;  3J80 E;  4JS5 A;  4BE0 A;  1OV3 A;  4BDY A;  2KEA A;  2G3R A;  4GBQ A;  3CME T;  2HMA A;  4OGE A;  4M75 D;  1PKT A;  1VYV A;  2RK1 A;  1JEG A;  2XG8 D;  1LOJ A;  1GCQ C;  3H0F A;  2QK0 A;  2A7Y A;  4FCY A;  1PSF A;  2CZ1 B;  4KRT A;  4JZ3 A;  4OMF B;  3X26 B;  3CCV T;  4LUE A;  4R55 A;  1PSE A;  1UE9 A;  4PLL A;  2RK2 A;  3TQ7 P;  2CP2 A;  1ZA2 B;  1SSH A;  3OW2 P;  2A37 A;  2DL5 A;  1NG2 A;  4J7F A;  3A8L B;  1VQ8 Q;  2LNH B;  3I35 A;  1VQ7 Q;  1TUD A;  3M0P A;  3WVE B;  3A8M B;  4FT2 A;  2CRE A;  4MMK A;  2ZPF B;  4ANJ A;  2CH4 A;  3PNW C;  2M9U A;  2DMO A;  2RJC A;  1Q86 R;  4JLG A;  2OX7 A;  1TU0 B;  2BZ8 A;  3M0U A;  4DOV A;  3OYH A;  1PRL C;  3CCL Q;  1SG5 A;  1Y07 A;  2CS7 A;  1AD5 A;  2COZ A;  2F2V A;  5IXF A;  1M90 U;  4LDU A;  3JV3 A;  2RPN A;  4C92 A;  2LDM A;  1N8R C;  1UTI A;  5I21 A;  2O4X A;  2JW4 A;  4JPB W;  4CC3 A;  2X51 A;  2MWO A;  3TSW A;  2DVE A;  3GOX A;  1SHG A;  3PVQ A;  1K76 A;  4HVV A;  3MP1 A;  5FRN A;  3CC7 T;  2X4Y A;  4PL6 A;  2V8K A;  1YNZ A;  3G4S T;  2RHX A;  4WF2 A;  1KG1 A;  5AT1 B;  1KQS S;  3QKJ A;  2PQW A;  1IZ6 A;  4KUI A;  3UDC A;  1ZQ1 A;  4L59 A;  1M1K C;  3I56 T;  2RHZ A;  4RUG A;  1WQ7 A;  3FIF A;  4XU3 A;  2O01 E;  5GAN e;  1WHJ A;  4JZ4 A;  2JZ2 A;  3OS0 A;  2BKD N;  2R58 A;  4M7D B;  3E9G A;  2DRM A;  4IUQ A;  4F16 A;  1HYO A;  2PU9 B;  4C92 B;  1YJW Q;  3CC2 T;  1VQ9 Q;  2DD4 A;  1M8M A;  2HKQ B;  4QQD A;  3G6E A;  2CP0 A;  4LXC A;  4HCC A;  4BD3 A;  2DZC A;  1X43 A;  3KFV A;  3BDL A;  2RNA A;  1RAI B;  2K9G A;  4JRI A;  3CCU Q;  1BCO A;  4KUD K;  2LMJ A;  4C92 D;  1KK7 A;  1PM3 A;  2RM4 A;  4M77 A;  3GPL A;  4XK8 E;  4Q5W A;  3OYF A;  2P0P A;  1XQH A;  1VQ7 A;  1X2Q A;  1N5Z A;  2ZPH B;  1SSF A;  2DTI A;  3FRN A;  1RAF B;  5GAO l;  4DA4 A;  2L5Q A;  1ARK A;  1YHQ Q;  3FB9 A;  4M75 G;  5GAN h;  3VS0 A;  3BY7 A;  3OW2 A;  1Q7Y C;  5CK9 A;  2JTM A;  1TOV A;  1Q82 R;  4FYX B;  3GP8 A;  4M7A C;  3RUX A;  5GAM d;  1VA7 A;  3CCL A;  2GFA A;  2E6N A;  1GBR A;  2DJZ A;  3OYY A;  1IGQ A;  3CCQ A;  2C06 A;  3VS7 A;  2E70 A;  4C0F A;  4XU2 A;  2COW A;  1JB0 E;  2HZY A;  2KY9 A;  4QVD A;  1WXB A;  3V7S A;  2V26 A;  8ATC B;  3ULR B;  3SWN C;  3EFR A;  3M58 A;  2QAS A;  4LUD A;  2RQR A;  5GAM j;  3JCM e;  2ZPE B;  3A1P A;  1VQK Q;  4FW1 A;  3CC4 Q;  4MDW A;  1OUL A;  4BI3 A;  2VWF A;  3ZEH A;  3CPW S;  1ZX6 A;  2YT6 A;  1C1A A;  4J9G A;  4O6J A;  4XTX A;  3CCM Q;  2DD5 A;  4PJO E;  2OTL T;  4M77 D;  2RI3 A;  5L23 A;  5GAN f;  3X28 B;  1ACM B;  5A0G A;  3ER0 A;  3HSB A;  5HK0 A;  4RCB A;  4A4K A;  2K79 A;  1AWO A;  1FMK A;  2F1L A;  4EMG A;  2JUF A;  2OTJ Q;  5GAN 4;  1QQJ A;  1QW1 A;  3O8V A;  4N4H A;  1B7T A;  4CC7 A;  3CCR T;  3VS2 A;  1M8V A;  3PT9 A;  1FWZ A;  4C0D B;  3OS1 A;  3M0R A;  4FSS A;  4LE9 A;  4LD9 K;  3CCU A;  1RAC B;  2P84 A;  2RMO A;  5KYY B;  3J81 E;  1Q81 R;  3DKM A;  4X9C A;  4XTU A;  1VQ5 T;  4LDX A;  1PCX A;  4B9W A;  5HY6 A;  1K73 C;  2D0Q B;  4ZTJ A;  2E5K A;  3V8L A;  2E64 A;  1AHJ B;  1LJO A;  2AZS A;  4ORZ A;  1FMW A;  3NMZ C;  3HFN A;  2BE7 D;  3X25 B;  2EIF A;  4XTV A;  3VRZ A;  1KHC A;  3PVL A;  2DF6 A;  3PMI A;  4JJB A;  2ATC B;  3T9N A;  4FL6 A;  1K1Z A;  2VB6 A;  5KE2 A;  2CUD A;  5GAN 7;  1MMD A;  2ZCF B;  4E6R A;  1MND A;  4C8Q F;  1T0J A;  1WI7 A;  1QCO A;  5IN1 A;  5A0D A;  2K3B A;  2D8J A;  2DZ9 A;  4C92 G;  2HBP A;  2EKO A;  1M2V A;  1VQM T;  3DB4 A;  3PIO A;  1N9S A;  4MZT A;  1U1T A;  1WGS A;  5IT9 E;  3MCA B;  5CCA A;  1SHF A;  3IQL A;  3P8D A;  5FU7 B;  4RTX A;  1VQK A;  3CC4 A;  1Y57 A;  2FZC B;  3JCM f;  2EQM A;  3CD6 T;  4HT9 A;  4KBM B;  1ABO A;  2ZPI B;  1NZ9 A;  2JN0 A;  2K57 A;  1KIK A;  5FW9 A;  2HD0 A;  3HTR A;  1UG1 A;  2I0N A;  3CCS Q;  4E7J A;  4J9B A;  3L2W A;  2VXE A;  3CCM A;  2XID A;  1VQN Q;  2LZ6 B;  1Q86 C;  1Y7X A;  2LCC A;  3PGG A;  1KC8 R;  2LT1 A;  1X2K A;  2L3P A;  1KQ2 A;  4JJD A;  3ZFJ A;  4PJJ A;  3ZBD A;  5LJ3 g;  2EJG A;  1W6X A;  4PFZ A;  1IB8 A;  1T0H A;  2LTO A;  2RI5 A;  4OB0 B;  1KD1 U;  4OML A;  2E65 A;  2RB6 A;  3A98 A;  5GMK l;  1RLP C;  2PVG B;  1M1K R;  1ZUK A;  3E19 A;  4OMN A;  1FMV A;  1LVK A;  4M7D E;  2MIO A;  1GL5 A;  4CRI A;  3OYL A;  2HQX A;  1QVG P;  3JCM X;  3TRE A;  5GMK e;  3CCV Q;  5IHN A;  5KE3 A;  4M77 G;  5LJ5 d;  3LLR A;  3MEW A;  2DKG A;  6AT1 B;  4ZTF A;  3ASK A;  1UGR B;  2VVK A;  2H8H A;  3FJP A;  1SRL A;  4EPC A;  4JJN K;  3QYG B;  2D6F A;  1IHW A;  3QWY A;  1Q7Y U;  1YJ9 T;  1T3L A;  2CP7 A;  5KH6 A;  2JMA A;  1FX7 A;  1MHN A;  1XTD A;  2VAS A;  5GAN 8;  1G3W A;  1NJI C;  3EG1 A;  2LJ3 A;  3NHN A;  1BI0 A;  1SPK A;  2DEQ A;  1BU1 A;  4ZNX A;  5CQY A;  3CPF A;  1VQP T;  4C0G A;  2EJF A;  2DFU A;  3BFM A;  2RHU A;  2ZZD A;  1SRM A;  1ZSZ A;  3V7R A;  5GMK h;  2QA4 T;  3CCJ A;  2K5F A;  3INZ A;  2VYT A;  1I8F A;  4MDX A;  2DXB A;  2EQI A;  1OZ2 A;  3CCS A;  2ABL A;  2LQ8 A;  4HXJ A;  4IUR A;  3CCE A;  1U06 A;  1VQN A;  1TUC A;  3QWX X;  2BIV A;  2PVD B;  1TTH B;  1XNI A;  1ZLM A;  4MML A;  2MPX C;  1OX9 A;  1WQW A;  4M4Z A;  1AWW A;  4PJO A;  4F7U E;  2KK4 A;  4M78 E;  4OMO A;  2CSI A;  1W4S A;  4FU6 A;  1RL2 A;  2KRM A;  2ROT A;  2GQV A;  1YJN A;  5KCH A;  4PKC C;  4F04 B;  4LDV A;  2KT1 A;  3CME A;  4J6W A;  3QXE B;  2J6F A;  1ZBJ A;  2O31 A;  5CKH A;  4C5G A;  1YFN A;  2L8D A;  5D7U A;  1H92 A;  2VV5 A;  3A8O B;  5GAN 6;  2JMC A;  4N4G A;  4XU0 A;  3CCV A;  3CMA Q;  2BE9 B;  3L2U A;  3GLX A;  1RLQ C;  3EHQ A;  2LRQ A;  3HPW A;  2QAZ A;  1VQ6 Q;  4NOY A;  4KGV B;  2GNC A;  3AHU A;  1E6G A;  2E10 A;  1HSQ A;  1LCK A;  2IIM A;  4JUV A;  1PWT A;  3OYD A;  4PJO B;  4HKE A;  2CDT A;  4R0K A;  4KT0 E;  3VYG A;  3OB9 A;  4F7U F;  2QQ9 A;  1QVG A;  1Z9Q A;  5GMK m;  2HSE B;  2EPD A;  3QZ9 B;  1RAD B;  2GCX A;  3GNG A;  3SHW A;  2DEU A;  3OMG A;  2LC4 A;  2DBM A;  3C0C A;  2CZ0 B;  2V1Q A;  1WXT A;  2R5A A;  2KRS A;  3C12 A;  1R8O B;  2QEX T;  1RAA B;  4X9D A;  3HRT A;  3OY9 A;  3CQT A;  2MI6 A;  1K73 R;  2O9S A;  1WZO A;  2KI7 A;  2LNV A;  4BY6 B;  4EMK A;  1RI0 A;  2LQK A;  1VIF A;  2JJ9 A;  4CC2 A;  1K0X A;  3H8Z A;  4PJO D;  4PJN A;  1Q81 C;  5GAM g;  3OA6 A;  2ED1 A;  4M77 C;  3EG0 A;  2EQJ A;  3RES A;  3G6E Q;  2D9T A;  3M4G A;  1O9S A;  1RUW A;  1XJW B;  3SD4 A;  2E3H A;  5LJ3 j;  4FT4 A;  1UFF A;  3M54 A;  3M59 A;  5ECA A;  3M4Y A;  2AKK A;  2JOY A;  2O9V A;  2CUB A;  3OW2 S;  2DRK A;  1Q86 U;  2RD1 A;  2EGA A;  1M30 A;  4HCB A;  1M3B A;  3QSU A;  3RKW A;  1QWE A;  3VU3 C;  1K9M R;  3HRU A;  3GBQ A;  1D0Z A;  4EMK B;  2ROL A;  1AZG B;  2DL7 A;  3JB9 I;  3OSS C;  2L3R A;  2D1X A;  2Y4X A;  2RN8 A;  3QZ5 B;  1A0N B;  1S72 T;  1K4U S;  3VS1 A;  2RO0 A;  1ABQ A;  3CC2 A;  4RG8 A;  4ZGJ B;  3H41 A;  2JM8 A;  2DIG A;  3VS4 A;  2EW3 A;  2DXT A;  1IHV A;  2FPF A;  3OYK A;  1WA7 A;  1U5S A;  3JRZ A;  3LGF A;  3MEA A;  3G71 T;  1G2B A;  2YUQ A;  1UHF A;  4XTW A;  2LQN A;  3VRY A;  1AT1 B;  3URG A;  3CMA A;  4ATO A;  4N4I A;  2MAM A;  4M7D A;  4RTT A;  4DOW A;  1VQ6 A;  5HKC A;  1JQQ A;  3CCQ Q;  2KXD A;  2RI2 A;  2GTO A;  3OBY A;  4RTZ A;  4QVC A;  1D0X A;  1VQ4 T;  2FRY A;  1JXM A;  4EDU A;  4IUT A;  2L89 A;  4QVZ A;  1KC8 C;  3M0Q A;  4ZN1 A;  1VQO T;  2CP6 A;  1UEC A;  2X9H A;  2KR3 A;  2XU8 A;  1UJY A;  3EHR A;  1I07 A;  1PNJ A;  2J6O A;  3UPU A;  1I1J A;  4E7S A;  4B6M A;  2SEM A;  3EGD A;  2KMT A;  1K8A R;  3S6W A;  3P8B B;  5M9O A;  1ZUU A;  1G5V A;  2XDP A;  4C5H A;  3MPU B;  4IIO A;  4M7A E;  1BK2 A;  4D8K A;  4XU1 A;  2DA9 A;  1KJW A;  1VYT A;  3SFM A;  2C0I A;  1OEB A;  4Z89 A;  4IUV A;  2JXB A;  2FZG B;  3EG3 A;  4JRP A;  2RJE A;  2PUO B;  1DJ7 B;  2X4X A;  2WAC A;  5J26 A;  3QYH B;  2OI3 A;  2KBT A;  1NJI R;  2LJ0 A;  4AFS C;  5CVI A;  4PNO A;  3LGL A;  1PG5 B;  1MV3 A;  3L2Q A;  1VQL T;  1NEG A;  4HT8 A;  2FB7 A;  2YRC A;  1QKW A;  3EGD B;  5CIU A;  2QYZ A;  1Q82 U;  4M7D D;  2P4T A;  4AG1 C;  3VKI A;  1TS9 A;  3MO8 A;  2VGN A;  4PJO G;  1M1G A;  3OYA A;  4JS4 A;  4M7A F;  5I2M A;  4O5V A;  1WHK A;  4F7U A;  3WVD B;  3SDZ A;  3I55 Q;  4M78 A;  3RER A;  1YIJ T;  3U23 A;  2EYX A;  2RJD A;  4HA8 A;  1QVF P;  1OYX A;  3CCR A;  2KQW A;  3VS3 A;  2XIC A;  3RMS A;  3HHT B;  2DL3 A;  1NLO C;  3PFS A;  2B8A A;  1QKX A;  2C0O A;  4TVR A;  1OU8 A;  2GFU A;  4Y28 E;  1GCQ A;  4DBQ A;  2C0T A;  2HKN A;  2BZY A;  1EX4 A;  1YIT Q;  4A63 B;  4FM4 B;  5LJ5 g;  2HEQ A;  3NTK A;  4F7U B;  3JSC A;  4M78 B;  1JO8 A;  5KYY A;  2YWW A;  2PVO B;  1BIA A;  1GXI E;  1GFC A;  4LN2 A;  2KT8 A;  1EIF A;  2MYS A;  2FHD A;  1VOM A;  4N0A A;  4E7I A;  1Q81 U;  4LDY A;  3BE3 A;  1VQM A;  2L2P A;  1MMA A;  2PUK B;  4IUU A;  1H64 1;  3UT1 A;  1H3H A;  4M78 D;  4AFZ C;  4OB3 B;  1W2B P;  3CD6 A;  1XOV A;  3VYH B;  1WJS A;  4C8Q E;  3CXC P;  4DEY A;  1CKA A;  2E41 A;  1VQ8 T;  2RHI A;  1VQ7 T;  3OYJ A;  1QP3 A;  1WPY A;  5GAN 2;  3RBB B;  3EH2 A;  3JCM h;  4FYW B;  1X01 A;  2JS0 A;  2HL3 A;  4RCC A;  3SEM A;  1JRI A;  2J6K A;  5FWC A;  4GLM A;  5GAO q;  4WCI A;  3R6N A;  1FXX A;  7AT1 B;  1PKS A;  2EKH A;  2LX7 A;  5GAO p;  2NWM A;  3CCL T;  3I55 A;  3M5A A;  1VUB A;  2QQA A;  2EGE A;  2QDL A;  4BE1 A;  4AT1 B;  1NBE B;  2J05 A;  2RQW A;  3MHX A;  5LJ3 f;  1HD3 A;  2HSP A;  1ZSZ C;  2K6D A;  3M0T A;  5DY9 A;  2K3Y A;  1NPP A;  2HQH A;  4RTU A;  4M7D G;  2ECZ A;  2LJ1 A;  2M0Y A;  4PFO A;  1N8R U;  1YI2 Q;  3QG1 A;  1ZA1 B;  2KXC A;  1KC8 U;  4J83 A;  1C6V X;  2VGM A;  1YIT A;  4XTZ A;  3H0I A;  4PJO C;  1K9M C;  1OU9 A;  2QI2 A;  2RJF A;  5CR2 A;  5GAO m;  3I9Q A;  4BE2 A;  1UEB A;  1QP2 A;  1YCY A;  2PZ1 A;  3CCJ Q;  2A0F B;  1YJW T;  1VQ9 T;  1YJ9 A;  4M75 C;  4E2F B;  1M1K U;  3CCE Q;  2JTE A;  3RKX A;  1WHH A;  4HVU A;  4BY6 C;  4BB7 A;  2FEI A;  1H3Z A;  2IPO B;  4M7A A;  2KNB B;  2EVR A;  1IGU A;  1RAE B;  1T3S A;  5CO7 A;  1YN8 A;  1BB9 A;  1YWP A;  2KYM A;  5DLO A;  4J9H A;  2R57 A;  3CCU T;  2R5M A;  1WDX A;  1QMC A;  2MWP A;  3S3M A;  5GAM e;  1CSK A;  1TWB A;  4VUB A;  2YDL A;  1YJN Q;  1BBZ A;  2QA4 A;  3CME Q;  2RHY A;  1QVG S;  3FJ5 A;  5GJV B;  4X34 A;  2MOX A;  5IHK A;  1WJQ A;  4Z88 A;  2DX1 A;  1IRX A;  1JJ2 P;  2YLC A;  3VUZ A;  1B34 A;  1PRM C;  2E6Z A;  3UF4 A;  1PC0 A;  2CZ7 B;  4DBF A;  1YHQ T;  1WHL A;  3V8J A;  1D1B A;  1YCS B;  2AT1 B;  1K8A C;  2DTH A;  2CYZ B;  2A3L A;  2GF7 A;  4J9C A;  2EAY A;  4F14 A;  1M1F A;  4OMM A;  4ZGE B;  4M7A B;  3EFO A;  1X69 A;  4F7U G;  1GFD A;  4M78 G;  1BIB A;  2E1H A;  2SRC A;  4J7I A;  1EFN A;  2GTJ A;  3EGU A;  2QG9 B;  4A4H A;  3H9N A;  4ELY C;  2HDA A;  1M90 C;  5LJ5 j;  2HNI A;  1OX8 A;  2H3J A;  1VQK T;  3GNF B;  3CC4 T;  5GAM h;  1B34 B;  5GAO n;  1YI2 A;  4M7A D;  3M53 A;  5L8R E;  3X20 B;  3LW5 E;  1OQK A;  2FVU A;  3CEY A;  2A36 A;  4NS5 A;  3QII A;  3HKS A;  1JU5 C;  4E7K A;  1OI1 A;  1QCF A;  3OMC A;  3CCM T;  2AIR B;  2EGC A;  3GF5 A;  4OP0 A;  4A4G A;  3JB9 H;  3EFO B;  2ENM A;  1Y71 A;  2QGF B;  3REB B;  1W1F A;  3PTA A;  3CC7 Q;  2QDY B;  1RAH B;  2K3X A;  3C94 A;  3G4S Q;  1QLY A;  5C6S A;  1RI9 A;  1Z9Z A;  2OTJ T;  2XMF A;  1TXQ A;  2E5Q A;  3QBY A;  5EG2 A;  2O88 A;  2JVV A;  3WXM B;  1NLP C;  4JDS A;  1Y96 A;  2DXU A;  1WHG A;  3OYB A;  3I56 Q;  4AG2 C;  4DEX A;  1Y0M A;  2DYB A;  1JBM A;  1AVZ C;  4M7D C;  3RIR A;  3LH5 A;  4C92 C;  2GBQ A;  3L2Z A;  4HCK A;  1O75 A;  3OSV A;  2QQB A;  3JCM P;  3CC2 Q;  3KBG A;  3BW1 A;  3RDV A;  2ZGW A;  5EC7 A;  5GAM f;  5KYW A;  1VYU A;  1N9R A;  1WNL A;  3NTI A;  3OS5 A;  2YSQ A;  4C8Q A;  5KYX A;  2A28 A;  2ESW A;  1S1N A;  2IG0 A;  5GAN d;  4YTL A;  2Y90 A;  4PLI A;  2NUZ A;  2XHC A;  4ZN3 A;  4GLK A;  1K73 U;  1Y96 B;  2EYW A;  4A4F A;  5J3B A;  1S72 A;  1JJ2 A;  4CI0 C;  4L6V 5;  4DBH A;  4D6W A;  5GAN j;  2I2L A;  4DQ2 A;  2FZK B;  4Z02 A;  5KYW B;  5FU6 B;  1G3S A;  2EQU A;  4M77 F;  1MNE A;  3MEU A;  2DM1 A;  2RA2 A;  4C8Q B;  2YUN A;  5KYX B;  4BI8 B;  1BYM A;  4LDW A;  1NYG A;  2DK3 A;  3UA7 A;  3LWI A;  2DE0 X;  4II1 A;  2F5K A;  3CCS T;  2K7A A;  1M27 C;  3HL8 A;  2WSC E;  4KGZ B;  1VQN T;  5LL6 S;  1K9M U;  3QHS A;  3RMQ A;  2Z0W A;  4NL3 A;  1WHM A;  2DLP A;  3CC7 A;  4M78 C;  3L1A A; 
#chains in the Genus database with same CATH homology
 1WLP B;  3THK A;  3VRZ A;  2B86 A;  1AZE A;  3M0S A;  3PVL A;  2DF6 A;  4RTW A;  1UGV A;  4JJB A;  1X6B A;  4JJC A;  1TG0 A;  1YWO A;  2PNI A;  4J9I A;  1AWX A;  1AEY A;  1K1Z A;  4RTV A;  2AZV A;  2LP5 A;  2CUD A;  2YUP A;  1ZUY A;  3U23 A;  2EYX A;  2F2X A;  4E6R A;  4OMQ A;  2GGR A;  1NEB A;  1T0J A;  1WI7 A;  1UJ0 A;  2FRW A;  4Z8A A;  3ZL7 C;  2K3B A;  2D8J A;  3NGP A;  1J3T A;  3VS3 A;  1G83 A;  2DL3 A;  1HJD A;  1NLO C;  2HCK A;  2RF0 A;  1QKX A;  2C0O A;  1SHF A;  1CKB A;  2D8H A;  3IQL A;  2DBK A;  1GCQ A;  1W70 A;  4RTX A;  1UUE A;  1Y57 A;  2KGT A;  1OOT A;  1ABO A;  3UA6 A;  2KRO A;  4K11 A;  2C0T A;  1MV0 B;  2BZY A;  2DJQ A;  4AFU C;  1KIK A;  5FW9 A;  1UG1 A;  2LQW A;  2I0N A;  4A63 B;  3H0H A;  2RQV A;  2M51 A;  4J9B A;  2HEQ A;  2CSQ A;  1K0S A;  2LZ6 B;  1JO8 A;  1GCP A;  2AKL A;  2X3W D;  1X2K A;  2DVJ A;  2L3P A;  2A08 A;  1E6H A;  4JJD A;  4OMP A;  4D8D A;  2BTT A;  1GFC A;  4LN2 A;  2KT8 A;  1KSW A;  1W6X A;  1T0H A;  2JM9 A;  2W0Z A;  4OML A;  2L2P A;  3A98 A;  2BZX A;  1RLP C;  1ZUK A;  4IIM A;  4OMN A;  1H3H A;  1WYX A;  2FPD A;  4AFZ C;  2CT4 A;  2LCS A;  2MIO A;  2KRN A;  1GL5 A;  2P4R A;  1XOV A;  4RTY A;  4DEY A;  2JT4 A;  1CKA A;  5IHN A;  3I5S A;  1GBQ A;  1WXU A;  2EBP A;  3RBB B;  4EIK A;  4ESR A;  2VVK A;  2JS0 A;  3SEM A;  2DL8 A;  2J6K A;  4AFQ C;  2H8H A;  1SRL A;  2MCN A;  5FWC A;  4GLM A;  4WCI A;  3R6N A;  1PKS A;  2D0N A;  2EKH A;  2FPE A;  2LX7 A;  3QWY A;  1NYF A;  2NWM A;  1T3L A;  3EG2 A;  1B07 A;  1PHT A;  2JMA A;  3O5Z A;  2EGE A;  2QDL A;  3I5R A;  5IH2 A;  2V1R A;  3PE0 A;  3NPF A;  2J05 A;  4X1V A;  5I11 A;  1SEM A;  2RQW A;  3EG1 A;  5GJW B;  1HD3 A;  2HSP A;  1WFW A;  2LJ3 A;  4CC4 B;  3NHN A;  2K6D A;  1OV3 A;  2KEA A;  1SPK A;  3M0T A;  4GBQ A;  1BU1 A;  4ZNX A;  1PKT A;  1VYV A;  1JEG A;  1V1C A;  4F17 A;  4RTU A;  1GCQ C;  3H0F A;  2ECZ A;  5IXB A;  4KRT A;  4JZ3 A;  2KE9 A;  2LJ1 A;  2M0Y A;  1SRM A;  2DNU A;  4LUE A;  1UE9 A;  4LNP A;  2KXC A;  2F2W A;  1JXO A;  2FO0 A;  1SSH A;  2A37 A;  2EQI A;  3H0I A;  2KYB A;  2ABL A;  2DL5 A;  3I9Q A;  4HXJ A;  1NG2 A;  1U06 A;  3RNJ A;  1TUC A;  3QWX X;  2LNH B;  3I35 A;  1TUD A;  2PZ1 A;  3M0P A;  1ZLM A;  2CRE A;  4M4Z A;  2CH4 A;  1AWW A;  2DMO A;  4OMO A;  2JTE A;  1OPK A;  1H8K A;  2CSI A;  4HVU A;  2KRM A;  2ROT A;  1YP5 A;  2FEI A;  1B3Q A;  2BZ8 A;  3M0U A;  2KNB B;  2EVR A;  2KT1 A;  1PRL C;  1T3S A;  1AOJ A;  1YN8 A;  1BB9 A;  1YWP A;  2J6F A;  2KYM A;  1ZBJ A;  4J9H A;  1AD5 A;  2F2V A;  5IXF A;  1WDX A;  2O31 A;  1I0C A;  1K9A A;  2J7I A;  3JV3 A;  2RPN A;  2W10 A;  1CSK A;  1UTI A;  1H92 A;  2JMC A;  2JW4 A;  2YDL A;  4JPB W;  1BBZ A;  4CC3 A;  3TSW A;  2FG0 A;  5I22 A;  1SHG A;  3PVQ A;  3FJ5 A;  5GJV B;  1RLQ C;  3EHQ A;  1K76 A;  4HVV A;  2MOX A;  5IHK A;  4Z88 A;  2DX1 A;  2X3X D;  4Y92 A;  2L3Q A;  1PRM C;  3UF4 A;  2GNC A;  2YUO A;  1YNZ A;  1E6G A;  3UAT A;  1HSQ A;  1LCK A;  2IIM A;  1PWT A;  1YCS B;  2OAW A;  2L3S A;  1E7O A;  2CDT A;  4R0K A;  2RQT A;  4J9C A;  4RUG A;  2K2M A;  4F14 A;  1Z9Q A;  5IHI A;  3VS6 A;  4OMM A;  2EPD A;  2HBW A;  1IO6 A;  4J9F A;  3SHW A;  1X6G A;  3C0C A;  2DBM A;  2JS2 A;  2V1Q A;  1X69 A;  1WXT A;  4JZ4 A;  1GFD A;  2KRS A;  4HVW A;  2SRC A;  1EFN A;  2GTJ A;  2DRM A;  3EGU A;  4F16 A;  3CQT A;  2O9S A;  2HDA A;  1M8M A;  2CH4 W;  3TSZ A;  4CC2 A;  1K0X A;  1M3A A;  1X43 A;  1KFZ A;  2ED0 A;  2ED1 A;  3KFV A;  1WIE A;  1QWF A;  3EG0 A;  2RNA A;  2K9G A;  5FWB A;  1UDL A;  1RUW A;  1UFF A;  5ECA A;  2AKK A;  2O9V A;  2CUB A;  2LMJ A;  2A36 A;  2RQU A;  1JU5 C;  1OPL A;  1M3C A;  1QCF A;  1ZSG A;  2EGC A;  2DRK A;  1NM7 A;  1X2Q A;  2ENM A;  1N5Z A;  1U3O A;  2EGA A;  3REB B;  1M30 A;  1W1F A;  1M3B A;  1QWE A;  1ARK A;  1QLY A;  3GBQ A;  2G6F X;  1RI9 A;  1Z9Z A;  2XMF A;  2ROL A;  1AWJ A;  1AZG B;  2DL7 A;  1A0N B;  2D1X A;  3VS0 A;  2RN8 A;  2O88 A;  1K4U S;  3VS1 A;  1ABQ A;  1NLP C;  3H41 A;  2JM8 A;  4AG2 C;  4DEX A;  3VS4 A;  1VA7 A;  1Y0M A;  2EW3 A;  2DYB A;  1AVZ C;  2FPF A;  1GBR A;  1WA7 A;  1U5S A;  4J9E A;  3LH5 A;  1G2B A;  2GBQ A;  2YUQ A;  4QT7 A;  3VS7 A;  4HCK A;  1UHC A;  1UHF A;  2LQN A;  3VRY A;  1WXB A;  2AK5 A;  5EC7 A;  1MUZ A;  1VYU A;  3ULR B;  4LUD A;  2RQR A;  4RTT A;  3REA B;  1JQQ A;  2YSQ A;  2KXD A;  2GTO A;  4RTZ A;  2OJ2 A;  2DIL A;  2FRY A;  1JXM A;  2L0A A;  1X27 A;  2VWF A;  2A28 A;  2ESW A;  1S1N A;  3M0Q A;  1ZX6 A;  2YT6 A;  1UEC A;  2NUZ A;  4J9D A;  5HCK A;  2KR3 A;  1UJY A;  3EHR A;  4J9G A;  1I07 A;  1PNJ A;  2J6O A;  1I1J A;  2EYW A;  2SEM A;  2PTK A;  5L23 A;  1ZUU A;  2GQI A;  2K79 A;  1AWO A;  1FMK A;  4IIO A;  3VS5 A;  1WX6 A;  1BK2 A;  4D8K A;  2VKN A;  2DA9 A;  1KJW A;  1VYT A;  1GRI A;  2J06 A;  2C0I A;  3TVT A;  1OEB A;  4Z89 A;  2JXB A;  4CC7 A;  3EG3 A;  3VS2 A;  2DM1 A;  2EYZ A;  3M0R A;  4FSS A;  2O2O A;  2YUN A;  4LE9 A;  2CT3 A;  1NYG A;  3UA7 A;  2DE0 X;  2RMO A;  2OI3 A;  2KBT A;  2K7A A;  1M27 C;  2LJ0 A;  4AFS C;  1FYN A;  1MV3 A;  1NEG A;  1QKW A;  2DL4 A;  2E5K A;  2DLP A;  2AZS A;  2EYY A;  4ORZ A;  3NMZ C;  4AG1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...