4X1VA

Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords CD2-associated protein
publication title Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
rcsb
source organism Homo sapiens
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4x1vA00
2G6FX 4D8KA 1CKAA 1HD3A 4LNPA 2GTJA 4F16A 2O9VA 2EKHA 4RTWA 3VS7A 1X2KA 2K6DA 2AZSA 2JM9A 3TSWA 1KSWA 4OMQA 4CC3A 1VYTA 2SEMA 3VS5A 2DVJA 2K79A 1ZUUA 1UTIA 5I22A 2LX7A 1M30A 2EVRA 2RF0A 5IH2A 4J9BA 2O88A 2J06A 1ZUYA 2K3BA 1TUDA 3M0PA 4OMMA 3VS1A 2PZ1A 2NWMA 2GTOA 2BZ8A 5IXFA 2HCKA 1ZSGA 1NG2A 2YUOA 5IHIA 1N5ZA 4JPBW 2EYXA 2KT8A 1B07A 3QWYA 2GGRA 2DL5A 2K9GA 1YNZA 3REBB 2KXDA 2CUDA 2LJ3A 4Z88A 2FRWA 1QKWA 1VYUA 2FPFA 1U3OA 2VWFA 1TUCA 2FRYA 2KR3A 2PNIA 3UA6A 3H0FA 1YCSB 1SRLA 4FSSA 1GBRA 1KFZA 2P4RA 1AZGB 1SEMA 2KRSA 1LCKA 1AWXA 1GCPA 1ZUKA 2GNCA 3ULRB 2M51A 2DA9A 2JS0A 2GQIA 2RQTA 1UUEA 3NGPA 1K0XA 4M4ZA 4AG2C 1MV3A 4IIMA 2IIMA 1RUWA 1BBZA 2DBKA 2ECZA 1ZBJA 1UG1A 2EW3A 1JO8A 1WFWA 4RUGA 2DL3A 5IHNA 1EFNA 2KYBA 1KJWA 2FPEA 1G83A 2KROA 2FPDA 3EG2A 1SPKA 4GBQA 1Z9QA 3EG3A 1JEGA 4HVUA 2C0IA 2LJ0A 1UJYA 3EGUA 1WXUA 2JMCA 1NYGA 1H3HA 3VRYA 2DL4A 1PWTA 2KRNA 1W1FA 2FEIA 1AWWA 1T0HA 1B3QA 3C0CA 2V1RA 2DX1A 3U23A 4JJDA 2EBPA 5IHKA 2CDTA 2MIOA 1M8MA 4J9HA 3EHQA 3EG1A 1FMKA 2J6FA 2KT1A 4LUDA 4D8DA 4R0KA 3GBQA 1AVZC 2CUBA 3LH5A 1QKXA 4Z8AA 2F2XA 3EG0A 4J9FA 3UF4A 2C0TA 2ESWA 1GBQA 4J9EA 2ED1A 2J6OA 2V1QA 2YUNA 1J3TA 1TG0A 3RNJA 2DRKA 2JM8A 1SSHA 4HXJA 2L3SA 3NHNA 1BK2A 1X2QA 4J9CA 2YSQA 2HDAA 5GJVB 2F2VA 3M0TA 4Y92A 1JXOA 3VRZA 5GJWB 2DM1A 3UA7A 1K76A 4CC4B 2KBTA 3O5ZA 4JZ3A 4QT7A 1V1CA 1UJ0A 2FG0A 1Z9ZA 2RQWA 2QDLA 3KFVA 1NLOC 4AFUC 4LUEA 2AK5A 3H41A 3FJ5A 2CT3A 1AD5A 1GRIA 1M3CA 1JQQA 2EGEA 2YUPA 2JT4A 4A63B 1AWOA 4X1VA 2ROTA 3TSZA 4RTZA 2O2OA 2EQIA 1M3BA 1K1ZA 2A28A 4OMPA 2RMOA 4RTTA 4LE9A 4ZNXA 3NMZC 4Z89A 3I5RA 2CREA 3A98A 1RLPC 1WXBA 1ZLMA 1CKBA 1WX6A 1W70A 2JW4A 2F2WA 1PRMC 1SRMA 1SHFA 2DE0X 4AFZC 2D8JA 2KXCA 1E7OA 2LQWA 2JMAA 2RN8A 2L3PA 4DEXA 4KRTA 3SHWA 5EC7A 2RPNA 2SRCA 1ZX6A 2OAWA 3R6NA 5IXBA 3I35A 1VYVA 1WI7A 1VA7A 4RTVA 2LNHB 4AG1C 4LN2A 1RLQC 2YUQA 1ABQA 3I9QA 1YP5A 4OMNA 2ROLA 1QCFA 1X43A 1JXMA 2AZVA 1UECA 4RTXA 2GBQA 2ED0A 2CT4A 4HVVA 1U5SA 3PVQA 1S1NA 4AFQC 1HSQA 2LMJA 1GFDA 1GFCA 1NEBA 1PHTA 2A36A 4E6RA 2O9SA 1Y57A 4J9IA 2LCSA 1I0CA 1UFFA 1GCQA 1OPKA 2DJQA 2LJ1A 2M0YA 2YT6A 2FO0A 3QWXX 2CH4A 5FWCA 1T3SA 2AKKA 2EYWA 5L23A 2KEAA 4K11A 1JU5C 2HEQA 1AEYA 1WIEA 5FWBA 2DNUA 1MV0B 1T0JA 1PNJA 2EYYA 2MCNA 1WDXA 4J9GA 3TVTA 1MUZA 2L3QA 3H0HA 5FW9A 4EIKA 1NYFA 1PKTA 1YWOA 2X3WD 2JS2A 2DL7A 1U06A 2ENMA 2HBWA 2DL8A 1AZEA 2E5KA 2JXBA 2KNBB 1UE9A 4GLMA 3THKA 2DYBA 1W6XA 1Y0MA 3VS2A 1NEGA 1WA7A 2KYMA 1WYXA 1PKSA 2LQNA 5ECAA 3RBBB 4DEYA 4WCIA 2OI3A 2KE9A 2VVKA 2ABLA 1ABOA 2RQRA 2YDLA 3SEMA 3VS4A 3M0RA 1X27A 3EHRA 2BTTA 1T3LA 1OEBA 2J7IA 1M3AA 1X6BA 4CC7A 1ARKA 1QLYA 1QWFA 2DLPA 1GL5A 2A08A 2D8HA 3VS6A 1X6GA 2D0NA 1CSKA 1I1JA 4ESRA 1E6HA 1NM7A 3M0SA 1XOVA 4F17A 1WLPB 4RTUA 2DBMA 1UHFA 1H92A 2J05A 1OOTA 3UATA 1K0SA 2JTEA 3REAB 1YWPA 4IIOA 2J6KA 2EYZA 3H0IA 1BU1A 1SHGA 1WXTA 2L0AA 3VS0A 1BB9A 2DRMA 2D1XA 1AWJA 2LZ6B 1OV3A 4RTYA 2A37A 3VS3A 2B86A 1HJDA 2DF6A 2DMOA 1NLPC 2DILA 3ZL7C 4F14A 1PRLC 2EPDA 4CC2A 2VKNA 1A0NB 3M0UA 2K2MA 3PE0A 2KGTA 1UGVA 4HVWA 1M27C 1UHCA 2H8HA 2L2PA 1AOJA 2W0ZA 2EGCA 1YN8A 2K7AA 2AKLA 2RQUA 3IQLA 3JV3A 2CH4W 3PVLA 4JZ4A 1FYNA 4J9DA 2CSQA 2EGAA 2C0OA 2BZYA 5HCKA 5I11A 1QWEA 1K4US 2OJ2A 2MOXA 2BZXA 1H8KA 4OMLA 2KRMA 2RQVA 1KIKA 4JJCA 1X69A 2RNAA 3CQTA 4JJBA 1K9AA 4AFSC 1I07A 2CSIA 3I5SA 4OMOA 1RI9A 4ORZA 1OPLA 2O31A 2HSPA 3M0QA 1G2BA 4HCKA 2I0NA 2W10A 1UDLA 1E6GA 1GCQC 2X3XD 2XMFA 2PTKA 2LP5A 2NUZA 3NPFA 1IO6A
chains in the Genus database with same CATH superfamily
4D8KA 1CKAA 2DXBA 4Y91A 2FZKB 5GAN2 1VQPA 1X2KA 1OQKA 2QAZA 3X26B 1WHMA 4LD9K 3AHUA 2SEMA 3OYAA 1WQ7A 2NYSA 1RAHB 2E3IA 4E7KA 3I55Q 2K3XA 1UTIA 2LX7A 4M78C 2DAQA 2RF0A 5IH2A 2J06A 1TOVA 2K3BA 5FROA 4OB0B 3LGLA 3M0PA 3G71T 2NWMA 2EAYA 1G5VA 5CKFA 1VQ6Q 2HCKA 1ZSGA 1XQHA 1QVFP 2DEUA 2Y4YA 1Y96B 2LT1A 2GFAA 4PK4A 1MMNA 2ZPGB 3UT1A 3GPLA 1YNZA 2LDMA 4BE2A 1F1BB 5CKEA 2ZPFB 1U1SA 2KXDA 2CUDA 2LJ3A 3S6WA 4AT1B 2VWFA 3HFNA 1TUCA 3CMEA 3CCMQ 2PNIA 3M56A 1D1AA 1SEMA 4LDUA 3ULRB 2K4YA 4OF1A 4ZN3A 2JS0A 1UUEA 3CCRQ 2PUKB 2ECZA 1ZBJA 4QVDA 2NUPB 3E1SA 1WFWA 4RUGA 4EMKB 3RMSA 2KYBA 4RKUE 2WACA 3EG2A 2IVWA 3CCST 5CQXA 2RJEA 1MMAA 3OYMA 3DLLA 3CD6T 1JEGA 1H3ZA 5A2QE 3VU3C 5LJ5j 4RG2A 2C0IA 3S3NA 1MMGA 3EFOB 2ZCFB 3SD4A 3EGUA 2JMCA 4JRPA 3HP9A 1H3HA 2JOYA 3JB9F 2E70A 4M7AF 2FEIA 1SF9A 3M59A 3CCLT 3I55A 4YTLA 2XG8D 3X25B 1VQ4A 1D0XA 4C92B 3GNGA 3CBMA 5IHKA 2ZAEA 3MEUA 4B6MA 1KQSS 1M8MA 3SDZA 4J9HA 1FMKA 1TXQA 2QQAA 5KYWB 4GLKA 4EPCA 2YRVA 3UF4A 3EG9B 3LH5A 4Z8AA 2C0TA 1D1CA 1KK7A 5LJ5d 2ESWA 1Y7XA 4C5HA 2ED1A 4XAXB 2J6OA 2V1QA 2X4YA 3SWNA 3RNJA 2DRKA 2VGNA 5GAMh 2LNVA 4ZTJA 1SSHA 4M78F 3JB9I 3H8ZA 3OYDA 4HCCA 2L3SA 3UPUA 3FRNA 1M1FA 2RHUA 5GMKj 4J9CA 5LJ3j 2DTHA 2RHYA 3M55A 5GJVB 3CPFA 5GJWB 1Y71A 1V76A 1UJ0A 2FG0A 1ACMB 2RQWA 3KFVA 2GQVA 7AT1B 4LUEA 2WSCE 1WHJA 5CKHA 3FJ5A 3CPWS 1G3WA 1NJIC 1HYOA 1AD5A 1K73U 1C6VX 2DO3A 1N8RU 3OY9A 1KD1R 4XU2A 3A8HB 1I4K1 2EFIA 3TSZA 3HTRA 5LL6S 1I5OB 2EQIA 1BKBA 4L5GA 2A28A 4D6WA 4EMGA 2P0PA 2E6NA 4LE9A 1QW1A 3ZBDA 2QASA 3OW2S 1WX6A 2HNIA 3OQ5A 2LRQA 3KUFA 2R5AA 1ZHIA 5GANj 2HZYA 1QCOA 3MEWA 3V8KA 1IB8A 1YJ9T 1UGQB 4LD6A 1RAGB 1M9SA 3OBYA 1YFNA 1VQ6T 4KRTA 1LVKA 5DY9A 2HAXA 2B8AA 5LJ5e 1TWBA 3CXCS 3CMAT 4KUDK 1VA7A 2MWOA 3OYGA 4PJOD 1QVGA 4AG1C 4LN2A 3CC7Q 1RLQC 3CC2A 1UECA 3CCMT 2OTJA 5EG2A 2CT4A 1Q86U 3HL8A 1QVGP 1GFDA 2L89A 2EQKA 1GFCA 1NEBA 1VIEA 2A36A 2PVDB 1W2BP 5GANd 2O9SA 4M7AA 4J9IA 1I0CA 1GCQA 3TQ7P 1IGQA 1I81A 2Z0WA 3FJPA 4C8QD 2RHIA 1T3SA 5IAYA 2OTLT 2KEAA 4DBQA 1AEYA 1WIEA 2MCNA 2EYYA 1WHLA 2L3QA 2M1HA 2HKQB 4EIKA 4J6YA 2JS2A 1U06A 1WPYA 3EH1A 2ENMA 3RUXA 2XDBA 5GMKe 5LJ3e 1KHCA 2X35A 4JRQA 1OX8A 3VS2A 5GAOq 4M78G 1WA7A 1WYXA 4C0ZA 4M78A 3RBBB 4QQ6A 4M75B 1ZSZB 1ZBXA 1VQ7T 3UDCA 4EMKC 3C4SA 4X9DA 1ZQ1A 3EHRA 3L2UA 2J7IA 1YI2A 2DLPA 2L3RA 3SFMA 1EIFA 1LNXA 5GAN4 5HK0A 3OS1A 1XOVA 1PCXA 1N6AA 4RTUA 2VXFA 2JNGA 2D9TA 2DBMA 5CKDA 2RJCA 3UATA 2JTEA 2JVVA 2JTMA 2J6KA 3H0IA 1SHGA 1WXTA 5AT1B 3VS0A 5KCHA 1HK9A 2D1XA 1AWJA 5GANe 4OB1B 4E7LA 5D6YA 3MP1A 3V7SA 1G3TA 3M57A 2B86A 1HJDA 2DF6A 2DMOA 4F14A 3SB2A 3WVDB 5GMKh 2M9UA 5LJ3h 2KGTA 1UHCA 2H8HA 2L2PA 1AOJA 2HQHA 2EGCA 2K5FA 3A8GB 3BY7A 3LH0A 3PVLA 2QTVA 4JZ4A 2EGAA 3QHSA 4ZN1A 5KYUB 1M2OA 1BI1A 4N0AC 4N4HA 2QA4T 5FLXE 2CP7A 3LW5E 4A53A 1WJQA 3MEVA 4MDXA 2MOXA 1YIJQ 4OMLA 2QK0A 1VQOT 4JJBA 4AFSC 1QVPA 1IZ6A 4BE1A 2CZ6B 1FMWA 1OPLA 2O31A 3TU4K 2HSPA 2ZZDA 3M0QA 2IG0A 2NLUA 2KI7A 1E6GA 3EGDB 4IUVA 2F5TX 3JCMf 2DD4A 4OGEA 1YHQT 2XMFA 4PJOB 4NOYA 4PFZA 2LX9A 2G6FX 3EGXA 1HD3A 2DTOA 3A8OB 3CC7T 2O9VA 4BI3A 2X51A 4RTWA 3VS7A 1VQLT 1QP3A 3LWIA 3JCMg 1VYTA 3GNFB 4N4IA 5C6SA 1M2VB 4ANJA 3QSUA 2JJ9A 1VQ8A 4C8QB 3CCVT 3VKIA 5I22A 1M30A 3M58A 2D6FA 1VQKT 3WVEB 1TUDA 3TREA 1YITT 4C92E 3A1PA 1YJNQ 1VQMQ 4ELYC 2EJ9A 1B7TA 2CP5A 5GAN5 3OYKA 3QWYA 1RI0A 2PVOB 4JS4A 1VQPQ 1NJIU 2FVUA 3REBB 3OYLA 2E12A 5GMKm 2FPFA 2E10A 2FRYA 2KR3A 4ME7A 4FSSA 1SRLA 3FLGA 1SSFA 4M7DB 1S72Q 1GCPA 3EFSA 3CCUA 1RACB 2M51A 4FL6A 2DA9A 2GQIA 4C92D 4FM4B 2DFUA 1QQJA 5IT9E 4BUGA 4AG2C 3KBGA 5GAMj 1MV3A 2IIMA 1RUWA 1UG1A 2EW3A 1JO8A 1JJ2A 3A8MB 5IHNA 2YXYA 3GLXA 1VQNA 4IKFA 5GAOp 1SPKA 2RD1A 5D6XA 2DIGA 4DBHA 4J8OA 3LYIA 1JJ2P 2CP2A 2DVEA 2RB6A 3MPUB 5A0DA 2EJFA 1ZSZC 1WXUA 2I2LA 3VUBA 2DZ9A 3BDLA 2DL4A 2V8JA 1PWTA 2QXFA 1W1FA 1WNLA 2VB6A 1AWWA 1TSFA 1PD0A 1M8VA 3M54A 2E1HA 4XQ3A 4JJDA 4JLIA 3QYGB 4XK8E 5GAMd 3HSBA 2CDTA 2E6ZA 3PIOA 4J7IA 1EX4A 2DKGA 1D3BB 2MWPA 3G4SQ 3EG1A 1VQMA 4C0DC 3BFMA 2KT1A 3RR6A 4D8DA 4ZGEB 4R0KA 1AVZC 4IURA 2F2XA 4A4EA 4J5YA 4BACA 5D6WA 4FYYB 4M77D 2ZPEB 1YIJT 2Y4XA 3S3OA 2JN0A 1S72A 2L8DA 3PGGA 2NUPA 2OX7A 3RDVA 1VQ5T 2AT1B 2F1LA 1QVFA 1VQ4Q 1AT1B 3QJ6A 4Y92A 3VRZA 2XU8A 2X4WA 4A4HA 2DM1A 4PKCC 2QEXT 3CBPA 1BI3A 1KQ2A 4QQDA 3EFOA 5KYYA 4AMCA 4HKEA 2PUOB 2QDLA 2P0QA 3H41A 3L2WA 2AIRB 1GRIA 1JQQA 1SG5A 5DLQE 4C92G 2JT4A 4FYWB 2XDDA 5FU6C 2MMPA 3RIRA 3JB9H 2ROTA 4FU6A 2RJDA 4DOVA 2O2OA 4OMPA 4LDWA 2RMOA 1HXDA 5CAIA 2CREA 2H3EB 1IREB 5GAMe 1ZLMA 1W70A 1RAIB 3P8HA 1WHHA 2F2WA 1RAFB 4A54A 1SRMA 4X9CA 4PJOC 4QVCA 1TH7A 3E19A 4M75E 1TTHB 4A4GA 3G4SA 2XKOC 2JMAA 2L3PA 4DEXA 9ATCB 1UGRB 2HBPA 3J80E 3R6NA 5IXBA 3I35A 1WI7A 4XTYA 4RTVA 2P84A 1VQPT 2YUQA 2FL7A 1Q7YR 1YP5A 2ROLA 3Q1JA 4J6WA 1X43A 3HPWA 2GBQA 4C8QC 3M9QA 3CBOA 2LCCA 2COYA 2RM4A 4HVVA 1U5SA 1H641 3PVQA 4AFQC 2F5KA 2HMAA 2LMJA 5LJ5f 4II1A 3PFSA 4M75D 3VV0A 1PD1A 3VYHB 2LCSA 2DJQA 1K8AR 2LJ1A 2EQMA 2FO0A 2YT6A 3QWXX 1KD1U 4OB2B 2YWWA 3I56Q 1T0JA 3QBYA 1PNJA 3CCEA 1YJ9A 5LJ5g 4DA4A 1WDXA 4KGZB 3H0HA 2DYIA 5FW9A 1Q82U 1PKTA 1YWOA 2QGGA 5GAOn 2DL7A 3CC2Q 5GAOm 3CMET 2OTJQ 2DYBA 3CMAA 3UWNA 4HT8A 4TVRA 1NEGA 1KQ1A 3JCMP 3C12A 2LQNA 2RH2A 5ECAA 2COZA 1VQ9T 2NUTA 2RHXA 1OX9A 2KE9A 2VVKA 2XK0A 3TCJA 1Q81R 3SEMA 1U1TA 4CRIA 3M0RA 3F70A 2BTTA 5LJ3f 3KXTA 1T3LA 2MPXC 1X6BA 3ZFJA 3CC4A 2A0FB 1GL5A 4NS5A 2D8HA 5M9OA 1X6GA 1CSKA 1VOMA 1I1JA 2LQKA 2OTLA 4B9XA 2CP0A 4M77B 1RADB 4FW1A 2XHCA 4L59A 2K3YA 5LJ3d 2J05A 1OOTA 1Q82R 4PJOE 5LJ3g 1K0SA 1BU1A 3RERA 4E7SA 4HCBA 5KYXA 2QYZA 2LVMA 2M02A 2KAFA 2LZ6B 2VV5A 3I55T 1NZ9A 1VQ4T 4RTYA 4FYXB 2A37A 1QMCA 1NLPC 2DILA 3V7CA 3ZL7C 3J81E 3GF5A 1YI2Q 4CC2A 2VKNA 4IUTA 1G8XA 1YJWQ 2D0QB 2EIFA 2K2MA 4C8QE 3PE0A 3JCMb 3I56A 5GANf 2W0ZA 4M75G 3CCQQ 3L2VA 2DETA 3OA6A 1YN8A 2OAUA 2K7AA 2DJZA 1W2BA 1OI1A 1B34B 2FYKA 1ZSZA 4FYVB 4J9DA 2BZYA 5I11A 4J7FA 1BYMA 1K4US 3X24B 4JJNK 4P5NA 4BDZA 2RK2A 2RQVA 2ZPBB 5GANg 1X69A 2JTFA 1I07A 2CSIA 3FB9A 3MP8A 3CCRT 4ORZA 4ZGJB 4M7DE 2QG9B 3OBWA 4HCKA 3JAME 4BY6B 2W10A 1UDLA 4JRKA 4KGXB 4QW2A 2DZCA 4ATOA 1FX7A 2PTKA 2O4XA 1OULA 2LP5A 2NUZA 3REAB 1IO6A 1WGSA 2DXTA 2CS7A 2GTJA 4F16A 2CKKA 1LOJA 2EKHA 4Q5WA 3G1JA 2DPPB 1LPLA 2EKOA 3TSWA 5GAN7 1KSWA 2QDYB 4OMQA 4M7DD 5FRNA 3QPHA 3VS5A 3AT1B 3NTIA 2R58A 2K79A 4KUIA 3VUZA 3PMIA 3G6EQ 1VQOA 1YJWA 1M1GA 1Q7YC 2O88A 2DEQA 3OYFA 1ZUYA 2PU9B 3JSCA 6AT1B 2ZPIB 3VS1A 1K9MR 2PZ1A 3CCJA 2GTOA 4JDSA 3V8JA 5IXFA 2YUOA 4FIBA 3CCQA 3FC3A 4JPBW 2X4XA 4VUBA 2PVGB 4KULA 2CZ7B 2X4JA 3CC2T 4C92C 4MDWA 4M7AB 2OTJT 1O9SA 1QKWA 1VYUA 1U3OA 1MMDA 2M16A 3H0FA 4MMLA 4J6XA 1GBRA 1QVFS 1KFZA 3NTKA 1AZGB 2KRSA 2G3RA 4PJOG 1LCKA 1VQ8Q 4Y28E 1ZUKA 2GNCA 4PFPA 3EFRA 2ZGWA 1UB4A 4F7UB 8AT1B 4OP0A 2DXUA 1KC8U 3NGPA 3WXMB 4IIMA 1FWZA 1BBZA 2DL3A 1KQSA 1M2VA 1KJWA 2FPEA 3RKYA 1G83A 2KROA 3X20B 4CI0C 1RAAB 2FPDA 4C8QG 2COWA 3QXEB 2V26A 4M78B 1YITA 4XU1A 3HRSA 2RI3A 4QQGA 4HT9A 4JRIA 2HQXA 1OU9A 2LJ0A 4ELZC 1KQSP 2DERA 2RA2A 1NYGA 1KD1C 3CCUQ 4L6V5 1BCOA 2E64A 1T0HA 1UGSB 3HKSA 3G6EA 2DX1A 3U23A 2EBPA 2C06A 4BI8B 4FT4A 4E7ZA 1Q82C 2MIOA 3L42A 1KC8R 4KH1B 3M5AA 4XTWA 4M77C 1PSFA 3RKWA 3DB4A 2J6FA 1VQNQ 1G3SA 3GBQA 1PM3A 1QKXA 1BI0A 1M90U 3EG0A 1GBQA 3CPWA 4J9EA 4NL2A 1TUGB 2E3HA 1BI2A 1NE8A 3T9NA 1TG0A 2JM8A 1D0ZA 1P92A 4HXJA 3NHNA 4OB3B 3CPWP 1BK2A 5I2SA 2X9HA 2HDAA 2F2VA 3M0TA 5GAOr 4CC4B 2P0KA 2KBTA 2AHJB 2VYTA 3O5ZA 4JZ3A 4QT7A 1R77A 4RMOA 3OW2A 2FB7A 1Z9ZA 4KBMB 1NPRA 1NLOC 4C92F 4AFUC 2CT3A 2R57A 4PFOA 2LC4A 2V8IA 3OW2P 2MI6A 4X34A 2EGEA 2YUPA 1AWOA 1M90R 1JBMA 2MAMA 4C5GA 3R6OA 3CCSQ 3QIIA 3CXCA 3OS2A 1M3BA 1K1ZA 3CD6Q 2VC8A 5KCOA 4OVAA 2O01E 4JLGA 2GCXA 4Z89A 3A98A 3L2ZA 4BY6C 1CKBA 4JUVA 3CXCP 3O8VA 1I5LA 3CCLQ 2RO0A 8ATCB 3QG1A 2DE0X 1BCMA 3EGXB 2KXCA 1E7OA 2DXCA 3BDUA 2LQWA 2KVQG 3URGA 4DQ2A 1D09B 1M4ZA 3SHWA 2LQ8A 2A3LA 3G71A 1MNEA 4PJNA 3JCMc 5GAMf 2FZCB 2RPNA 3GOXA 2SRCA 2OAWA 3A5ZB 4M75C 2E5QA 3PT9A 2LNHB 3PNWC 3INZA 1ABQA 4O6JA 2YRDA 1C0MA 1NBEB 5KE2A 2AZVA 1R8OB 3ER0A 4RCBA 4RTXA 4HCZA 1Y96A 1K9MC 4M77E 2A7YA 4LXCA 2QQ9A 3QYHB 4WF2A 5A0LA 3BE3A 1VQ8T 1X01A 4PNOA 1PHTA 5GAMg 4M77F 1Y07A 4E6RA 1Y57A 2YRCA 1UFFA 5DLOA 1OPKA 1M5Q1 1KHIA 3TEEA 2M0YA 2CH4A 1PSEA 2AKKA 1BIAA 4K11A 2HEQA 5FWBA 3NTHA 3OYEA 1QVGS 1MV0B 4UC4A 4J9GA 4JS5A 1W2BS 1MUZA 1UGPB 1NYFA 2RK1A 4DBFA 3MHXA 3CCSA 2HBWA 4A4FA 1AZEA 1IGUA 2RI5A 1UE9A 3CD6A 4EMKA 1W6XA 1Y0MA 2QI2A 3FEOA 3C94A 2KYMA 1ZA1B 3CCUT 2E41A 4DEYA 4WCIA 1U8RA 1R0CB 2OI3A 2ABLA 3CCLA 1ABOA 2KK4A 3VS4A 3NFCA 2WSFE 4DBRA 5GMKl 1MHNA 2EQUA 1ARKA 5DM7R 5A0GA 1QWFA 2KQWA 1WJSA 2A08A 2LT4A 3VS6A 3CCEQ 1YJ9Q 4O5VA 1Q7YU 1VQNT 4FCYA 4RG8A 4C92A 3META 3JCMQ 1QCNA 1NM7A 3M53A 4A4KA 3M0SA 5CIUA 2XDPA 4XU0A 1GXIE 3CMAQ 1H92A 3JCMh 4PJMA 1YCYA 4BDYA 1EZZB 5GMKi 2GF7A 1KC8C 5KYWA 4E2FB 3JB9J 1OZ3A 3EG9A 3DB3A 2DRMA 4FW2A 1K8AU 2VGMA 4PJJA 1OV3A 5I2MA 3VS3A 3LWHA 2EPDA 1RABB 3CC4Q 2VXEA 1A0NB 1YJNT 1VQ9A 1VQMT 4M75F 2QGFB 3L2RA 3HFOA 1JB0E 1PG5B 4IUPA 1UGVA 4N0AA 4HVWA 1M27C 2OTLQ 4MZTA 5KH6A 1WQWA 3JV3A 2QQSA 3OMCA 3OYBA 5CO7A 2M0OA 2CSQA 2C0OA 1ZA2B 1S72T 5CQYA 1M1KU 1H8KA 1Q81U 2KRMA 5KYYB 4JJCA 4M7AE 3VJPA 3JCMW 4FSXA 2RNAA 1K9AA 4LDYA 3ASKA 3PIPA 4M77G 1RI9A 4IUUA 4M77A 1M90C 2BKDN 4C5EA 5FRMA 1VQ7Q 2K5IA 4F7UE 3OYYA 4IUQA 4XTXA 2X3XD 1WZOA 2K5LA 4F7UF 1VQ6A 4M7DC 2HKNA 4OGCA 1N9RA 3HHTB 3G7ZA 3P8BB 4LNPA 3JB9D 4M7AD 3DLMA 2K6DA 4M78E 3OYJA 2AZSA 2JM9A 2QQRA 1N27A 2KY9A 4CC3A 3CCMA 1M1KR 2DVJA 4F04B 3S3MA 4KGVB 2KMTA 1B34A 1XJWB 1ZUUA 5CR2A 2EVRA 3OB9A 3G4ST 4J9BA 4C5IA 4ZTFA 4OMMA 3QKJA 3CCRA 2BE9B 4N4GA 2FZGB 2BZ8A 1NG2A 3JCMV 1WJRA 5IHIA 1N5ZA 2EYXA 2K2VA 2KT8A 1O75A 1B07A 3MKDA 2GGRA 1FMVA 2DL5A 2K9GA 4M78D 3MCAB 2V8KA 1TS9A 5I21A 2CYZB 4Z88A 1QP2A 2FRWA 4PJOF 2P4TA 1C1AA 3UA6A 2VASA 1YCSB 5KE3A 1RAEB 4WTOB 2P4RA 2YLBA 3QDFA 2EQJA 2QA4Q 3MP6A 1AWXA 3JRZA 1VQOQ 3LX7A 3QDRB 2EWNA 2RQTA 2E4HA 5J3BA 2Y90A 3M4GA 1VQ7A 3SWNB 5CVIA 1K0XA 4M4ZA 5GAN3 3CCJQ 3RMQA 3CEYA 3BW1A 3MO8A 1OU8A 1FXXA 3FIFA 3H9NA 3E2UA 4C8QF 3OYIA 5J26A 2DBKA 4PLLA 3CCET 4M75A 1X75C 5FU7B 1TU0B 3H6ZA 1EFNA 2HD0A 2QQBA 1DJ7B 2YLCA 1YBYA 4QKUA 1I8FA 4GBQA 1YHQQ 4MZPA 2NUTB 1Z9QA 3EG3A 4HVUA 1UJYA 1K73R 1N8RR 2PQWA 4EMHA 3E9GA 3VRYA 2BE7D 1W4SA 1VUBA 1XNIA 2KRNA 4NL3A 1VQLQ 2CP3A 1B3QA 2RI2A 3C0CA 1K9MU 2V1RA 3JB9G 5GAOl 4M7AG 4M7DF 1JJ2S 2LCLA 3CC4T 4J83A 3J7AF 3CCVQ 3EHQA 5D7UA 1VQKQ 2RHZA 2K57A 4LUDA 2EJGA 5KYXB 1IRXA 2CUBA 1VIFA 1YITQ 4F7UG 4XTUA 4J9FA 3RKXA 4F7UA 3OYCA 1UEBA 5HK3A 3LLRA 3OMGA 3GIBA 2YUNA 1J3TA 4PL6A 3X28B 1WHKA 2XI9A 2QA4A 1V29B 2H3JA 2LTOA 1X2QA 3MJXA 3QZ5B 2YSQA 5KYUA 1JXOA 5HKCA 4ZGDB 3UA7A 1K76A 1Q86R 5LJ5h 1V1CA 4EDUA 3I56T 5GAN8 3MEAA 4E7IA 2VUBA 2CZ0B 1JRIA 2AK5A 1Q95G 1AHJB 2MYSA 3PMTA 5L8RE 1M3CA 4PJLA 1K8AC 1YHQA 4A63B 4GY5A 4X1VA 3EGDA 4RTZA 3CC7A 4C0GA 3RESA 2XICA 4C0DB 4PJOA 4RTTA 4ZNXA 3NMZC 4E7JA 3I5RA 1VQLA 3A8LB 1RLPC 3EAEA 1WXBA 4LDVA 3OS0A 2JW4A 2O4XB 4XU3A 1PRMC 3CCVA 1SHFA 2JUFA 4B9WA 4AFZC 5CK9A 2D8JA 2MF2A 1VQKA 2RN8A 1XTDA 4KT0E 4C8QA 2E65A 3QUIA 1M1KC 5EC7A 1Q81C 1ZX6A 1VYVA 4BD3A 3E9FA 1N9SA 1IHWA 3I9QA 4OMFB 4OMNA 1QCFA 1JXMA 2ED0A 4FT2A 4PLIA 2ATCB 1S1NA 2GFUA 4R55A 4LDXA 1HSQA 3L2QA 3OYHA 4C0FA 1YI2T 3QZ9B 4RCCA 5FU6B 1VQ5Q 1YJWT 4V2SA 4BB7A 3QJYA 4M7DG 3CCJT 4QVZA 5FWCA 4M7DA 5IN1A 2QEXQ 2EYWA 3G71Q 2DIQA 5L23A 3CCQT 1JU5C 2DK3A 2DNUA 3PTAA 4R56A 2CZ1B 5CKBA 3TVTA 1KG1A 4HA8A 3QO3A 2X3WD 4DOWA 5C0MA 5J39A 5GANh 2BIVA 1PC0A 2DL8A 3GP8A 2E5KA 2CP6A 2JXBA 1IXDA 2KNBB 4GLMA 3THKA 3V7RA 1R0BG 1G3YA 2ZPHB 1PKSA 3D7SB 3SWNC 2KSSA 4KH0B 3JCMX 1X6OA 3JCMd 1BIBA 3HRUA 5FU7C 2RQRA 2YDLA 1X27A 4MMKA 3FDRA 3P8DA 3HRTA 1OEBA 1M3AA 1K73C 1WHGA 4CC7A 1QLYA 1N8RC 2D0NA 4XTZA 2CGHA 4XTVA 2BUDA 4ESRA 4BI4A 1E6HA 2YHTA 3L1AA 3C95A 5GAN6 4F17A 1WLPB 1IHVA 2XIDA 1RL2A 1UHFA 3OYNA 1D3BA 2R5MA 2DTIA 2HSEB 1YWPA 4IIOA 4E7HA 2EYZA 2WSEE 2JZ2A 1LJOA 2L0AA 1BB9A 1YIJA 3G6ET 2RJFA 1VQ5A 4BE0A 5KYNA 3DKMA 1MNDA 1OYXA 1PRLC 3M0UA 2QEXA 3OS5A 5CCAA 2MK5A 1SKUB 2EYQA 2HL5C 1D0YA 2FHDA 3JCMJ 3LGFA 3ZEHA 5AYFA 2AKLA 4MZMA 2RQUA 3IQLA 3N5BB 2CH4W 1FYNA 2L5QA 1Q86C 2HL3A 5HCKA 3OSVA 3V8LA 3M4YA 1QWEA 2OJ2A 2BZXA 3CMEQ 1KIKA 3JCMe 1NJIR 3CQTA 2HQEA 3EH2A 3I5SA 4OMOA 1VQ9Q 2IPOB 2DD5A 3VYGA 2F69A 2KDSA 1D1BA 1G2BA 3ME9A 4M7AC 2I0NA 5HY6A 4Z02A 1OZ2A 3OSSC 2XD0A 1GCQC 1NPPA 1MGQA 1YJNA 2QTXA 3NPFA 4E47A
chains in the Genus database with same CATH topology
2G6FX 4D8KA 1CKAA 1HD3A 4LNPA 2GTJA 4F16A 2O9VA 2EKHA 4RTWA 3VS7A 1X2KA 2K6DA 2AZSA 2JM9A 3TSWA 1KSWA 4OMQA 4CC3A 1VYTA 2SEMA 3VS5A 2DVJA 2K79A 1ZUUA 1UTIA 5I22A 2LX7A 1M30A 2EVRA 2RF0A 5IH2A 4J9BA 2O88A 2J06A 1ZUYA 2K3BA 1TUDA 3M0PA 4OMMA 3VS1A 2PZ1A 2NWMA 2GTOA 2BZ8A 5IXFA 2HCKA 1ZSGA 1NG2A 2YUOA 5IHIA 1N5ZA 4JPBW 2EYXA 2KT8A 1B07A 3QWYA 2GGRA 2DL5A 2K9GA 1YNZA 3REBB 2KXDA 2CUDA 2LJ3A 4Z88A 2FRWA 1QKWA 1VYUA 2FPFA 1U3OA 2VWFA 1TUCA 2FRYA 2KR3A 2PNIA 3UA6A 3H0FA 1YCSB 1SRLA 4FSSA 1GBRA 1KFZA 2P4RA 1AZGB 1SEMA 2KRSA 1LCKA 1AWXA 1GCPA 1ZUKA 2GNCA 3ULRB 2M51A 2DA9A 2JS0A 2GQIA 2RQTA 1UUEA 3NGPA 1K0XA 4M4ZA 4AG2C 1MV3A 4IIMA 2IIMA 1RUWA 1BBZA 2DBKA 2ECZA 1ZBJA 1UG1A 2EW3A 1JO8A 1WFWA 4RUGA 2DL3A 5IHNA 1EFNA 2KYBA 1KJWA 2FPEA 1G83A 2KROA 2FPDA 3EG2A 1SPKA 4GBQA 1Z9QA 3EG3A 1JEGA 4HVUA 2C0IA 2LJ0A 1UJYA 3EGUA 1WXUA 2JMCA 1NYGA 1H3HA 3VRYA 2DL4A 1PWTA 2KRNA 1W1FA 2FEIA 1AWWA 1T0HA 1B3QA 3C0CA 2V1RA 2DX1A 3U23A 4JJDA 2EBPA 5IHKA 2CDTA 2MIOA 1M8MA 4J9HA 3EHQA 3EG1A 1FMKA 2J6FA 2KT1A 4LUDA 4D8DA 4R0KA 3GBQA 1AVZC 2CUBA 3LH5A 1QKXA 4Z8AA 2F2XA 3EG0A 4J9FA 3UF4A 2C0TA 2ESWA 1GBQA 4J9EA 2ED1A 2J6OA 2V1QA 2YUNA 1J3TA 1TG0A 3RNJA 2DRKA 2JM8A 1SSHA 4HXJA 2L3SA 3NHNA 1BK2A 1X2QA 4J9CA 2YSQA 2HDAA 5GJVB 2F2VA 3M0TA 4Y92A 1JXOA 3VRZA 5GJWB 2DM1A 3UA7A 1K76A 4CC4B 2KBTA 3O5ZA 4JZ3A 4QT7A 1V1CA 1UJ0A 2FG0A 1Z9ZA 2RQWA 2QDLA 3KFVA 1NLOC 4AFUC 4LUEA 2AK5A 3H41A 3FJ5A 2CT3A 1AD5A 1GRIA 1M3CA 1JQQA 2EGEA 2YUPA 2JT4A 4A63B 1AWOA 4X1VA 2ROTA 3TSZA 4RTZA 2O2OA 2EQIA 1M3BA 1K1ZA 2A28A 4OMPA 2RMOA 4RTTA 4LE9A 4ZNXA 3NMZC 4Z89A 3I5RA 2CREA 3A98A 1RLPC 1WXBA 1ZLMA 1CKBA 1WX6A 1W70A 2JW4A 2F2WA 1PRMC 1SRMA 1SHFA 2DE0X 4AFZC 2D8JA 2KXCA 1E7OA 2LQWA 2JMAA 2RN8A 2L3PA 4DEXA 4KRTA 3SHWA 5EC7A 2RPNA 2SRCA 1ZX6A 2OAWA 3R6NA 5IXBA 3I35A 1VYVA 1WI7A 1VA7A 4RTVA 2LNHB 4AG1C 4LN2A 1RLQC 2YUQA 1ABQA 3I9QA 1YP5A 4OMNA 2ROLA 1QCFA 1X43A 1JXMA 2AZVA 1UECA 4RTXA 2GBQA 2ED0A 2CT4A 4HVVA 1U5SA 3PVQA 1S1NA 4AFQC 1HSQA 2LMJA 1GFDA 1GFCA 1NEBA 1PHTA 2A36A 4E6RA 2O9SA 1Y57A 4J9IA 2LCSA 1I0CA 1UFFA 1GCQA 1OPKA 2DJQA 2LJ1A 2M0YA 2YT6A 2FO0A 3QWXX 2CH4A 5FWCA 1T3SA 2AKKA 2EYWA 5L23A 2KEAA 4K11A 1JU5C 2HEQA 1AEYA 1WIEA 5FWBA 2DNUA 1MV0B 1T0JA 1PNJA 2EYYA 2MCNA 1WDXA 4J9GA 3TVTA 1MUZA 2L3QA 3H0HA 5FW9A 4EIKA 1NYFA 1PKTA 1YWOA 2X3WD 2JS2A 2DL7A 1U06A 2ENMA 2HBWA 2DL8A 1AZEA 2E5KA 2JXBA 2KNBB 1UE9A 4GLMA 3THKA 2DYBA 1W6XA 1Y0MA 3VS2A 1NEGA 1WA7A 2KYMA 1WYXA 1PKSA 2LQNA 5ECAA 3RBBB 4DEYA 4WCIA 2OI3A 2KE9A 2VVKA 2ABLA 1ABOA 2RQRA 2YDLA 3SEMA 3VS4A 3M0RA 1X27A 3EHRA 2BTTA 1T3LA 1OEBA 2J7IA 1M3AA 1X6BA 4CC7A 1ARKA 1QLYA 1QWFA 2DLPA 1GL5A 2A08A 2D8HA 3VS6A 1X6GA 2D0NA 1CSKA 1I1JA 4ESRA 1E6HA 1NM7A 3M0SA 1XOVA 4F17A 1WLPB 4RTUA 2DBMA 1UHFA 1H92A 2J05A 1OOTA 3UATA 1K0SA 2JTEA 3REAB 1YWPA 4IIOA 2J6KA 2EYZA 3H0IA 1BU1A 1SHGA 1WXTA 2L0AA 3VS0A 1BB9A 2DRMA 2D1XA 1AWJA 2LZ6B 1OV3A 4RTYA 2A37A 3VS3A 2B86A 1HJDA 2DF6A 2DMOA 1NLPC 2DILA 3ZL7C 4F14A 1PRLC 2EPDA 4CC2A 2VKNA 1A0NB 3M0UA 2K2MA 3PE0A 2KGTA 1UGVA 4HVWA 1M27C 1UHCA 2H8HA 2L2PA 1AOJA 2W0ZA 2EGCA 1YN8A 2K7AA 2AKLA 2RQUA 3IQLA 3JV3A 2CH4W 3PVLA 4JZ4A 1FYNA 4J9DA 2CSQA 2EGAA 2C0OA 2BZYA 5HCKA 5I11A 1QWEA 1K4US 2OJ2A 2MOXA 2BZXA 1H8KA 4OMLA 2KRMA 2RQVA 1KIKA 4JJCA 1X69A 2RNAA 3CQTA 4JJBA 1K9AA 4AFSC 1I07A 2CSIA 3I5SA 4OMOA 1RI9A 4ORZA 1OPLA 2O31A 2HSPA 3M0QA 1G2BA 4HCKA 2I0NA 2W10A 1UDLA 1E6GA 1GCQC 2X3XD 2XMFA 2PTKA 2LP5A 2NUZA 3NPFA 1IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6F X;  4D8K A;  1CKA A;  1HD3 A;  4LNP A;  2GTJ A;  4F16 A;  2O9V A;  2EKH A;  4RTW A;  3VS7 A;  1X2K A;  2K6D A;  2AZS A;  2JM9 A;  3TSW A;  1KSW A;  4OMQ A;  4CC3 A;  1VYT A;  2SEM A;  3VS5 A;  2DVJ A;  2K79 A;  1ZUU A;  1UTI A;  5I22 A;  2LX7 A;  1M30 A;  2EVR A;  2RF0 A;  5IH2 A;  4J9B A;  2O88 A;  2J06 A;  1ZUY A;  2K3B A;  1TUD A;  3M0P A;  4OMM A;  3VS1 A;  2PZ1 A;  2NWM A;  2GTO A;  2BZ8 A;  5IXF A;  2HCK A;  1ZSG A;  1NG2 A;  2YUO A;  5IHI A;  1N5Z A;  4JPB W;  2EYX A;  2KT8 A;  1B07 A;  3QWY A;  2GGR A;  2DL5 A;  2K9G A;  1YNZ A;  3REB B;  2KXD A;  2CUD A;  2LJ3 A;  4Z88 A;  2FRW A;  1QKW A;  1VYU A;  2FPF A;  1U3O A;  2VWF A;  1TUC A;  2FRY A;  2KR3 A;  2PNI A;  3UA6 A;  3H0F A;  1YCS B;  1SRL A;  4FSS A;  1GBR A;  1KFZ A;  2P4R A;  1AZG B;  1SEM A;  2KRS A;  1LCK A;  1AWX A;  1GCP A;  1ZUK A;  2GNC A;  3ULR B;  2M51 A;  2DA9 A;  2JS0 A;  2GQI A;  2RQT A;  1UUE A;  3NGP A;  1K0X A;  4M4Z A;  4AG2 C;  1MV3 A;  4IIM A;  2IIM A;  1RUW A;  1BBZ A;  2DBK A;  2ECZ A;  1ZBJ A;  1UG1 A;  2EW3 A;  1JO8 A;  1WFW A;  4RUG A;  2DL3 A;  5IHN A;  1EFN A;  2KYB A;  1KJW A;  2FPE A;  1G83 A;  2KRO A;  2FPD A;  3EG2 A;  1SPK A;  4GBQ A;  1Z9Q A;  3EG3 A;  1JEG A;  4HVU A;  2C0I A;  2LJ0 A;  1UJY A;  3EGU A;  1WXU A;  2JMC A;  1NYG A;  1H3H A;  3VRY A;  2DL4 A;  1PWT A;  2KRN A;  1W1F A;  2FEI A;  1AWW A;  1T0H A;  1B3Q A;  3C0C A;  2V1R A;  2DX1 A;  3U23 A;  4JJD A;  2EBP A;  5IHK A;  2CDT A;  2MIO A;  1M8M A;  4J9H A;  3EHQ A;  3EG1 A;  1FMK A;  2J6F A;  2KT1 A;  4LUD A;  4D8D A;  4R0K A;  3GBQ A;  1AVZ C;  2CUB A;  3LH5 A;  1QKX A;  4Z8A A;  2F2X A;  3EG0 A;  4J9F A;  3UF4 A;  2C0T A;  2ESW A;  1GBQ A;  4J9E A;  2ED1 A;  2J6O A;  2V1Q A;  2YUN A;  1J3T A;  1TG0 A;  3RNJ A;  2DRK A;  2JM8 A;  1SSH A;  4HXJ A;  2L3S A;  3NHN A;  1BK2 A;  1X2Q A;  4J9C A;  2YSQ A;  2HDA A;  5GJV B;  2F2V A;  3M0T A;  4Y92 A;  1JXO A;  3VRZ A;  5GJW B;  2DM1 A;  3UA7 A;  1K76 A;  4CC4 B;  2KBT A;  3O5Z A;  4JZ3 A;  4QT7 A;  1V1C A;  1UJ0 A;  2FG0 A;  1Z9Z A;  2RQW A;  2QDL A;  3KFV A;  1NLO C;  4AFU C;  4LUE A;  2AK5 A;  3H41 A;  3FJ5 A;  2CT3 A;  1AD5 A;  1GRI A;  1M3C A;  1JQQ A;  2EGE A;  2YUP A;  2JT4 A;  4A63 B;  1AWO A;  4X1V A;  2ROT A;  3TSZ A;  4RTZ A;  2O2O A;  2EQI A;  1M3B A;  1K1Z A;  2A28 A;  4OMP A;  2RMO A;  4RTT A;  4LE9 A;  4ZNX A;  3NMZ C;  4Z89 A;  3I5R A;  2CRE A;  3A98 A;  1RLP C;  1WXB A;  1ZLM A;  1CKB A;  1WX6 A;  1W70 A;  2JW4 A;  2F2W A;  1PRM C;  1SRM A;  1SHF A;  2DE0 X;  4AFZ C;  2D8J A;  2KXC A;  1E7O A;  2LQW A;  2JMA A;  2RN8 A;  2L3P A;  4DEX A;  4KRT A;  3SHW A;  5EC7 A;  2RPN A;  2SRC A;  1ZX6 A;  2OAW A;  3R6N A;  5IXB A;  3I35 A;  1VYV A;  1WI7 A;  1VA7 A;  4RTV A;  2LNH B;  4AG1 C;  4LN2 A;  1RLQ C;  2YUQ A;  1ABQ A;  3I9Q A;  1YP5 A;  4OMN A;  2ROL A;  1QCF A;  1X43 A;  1JXM A;  2AZV A;  1UEC A;  4RTX A;  2GBQ A;  2ED0 A;  2CT4 A;  4HVV A;  1U5S A;  3PVQ A;  1S1N A;  4AFQ C;  1HSQ A;  2LMJ A;  1GFD A;  1GFC A;  1NEB A;  1PHT A;  2A36 A;  4E6R A;  2O9S A;  1Y57 A;  4J9I A;  2LCS A;  1I0C A;  1UFF A;  1GCQ A;  1OPK A;  2DJQ A;  2LJ1 A;  2M0Y A;  2YT6 A;  2FO0 A;  3QWX X;  2CH4 A;  5FWC A;  1T3S A;  2AKK A;  2EYW A;  5L23 A;  2KEA A;  4K11 A;  1JU5 C;  2HEQ A;  1AEY A;  1WIE A;  5FWB A;  2DNU A;  1MV0 B;  1T0J A;  1PNJ A;  2EYY A;  2MCN A;  1WDX A;  4J9G A;  3TVT A;  1MUZ A;  2L3Q A;  3H0H A;  5FW9 A;  4EIK A;  1NYF A;  1PKT A;  1YWO A;  2X3W D;  2JS2 A;  2DL7 A;  1U06 A;  2ENM A;  2HBW A;  2DL8 A;  1AZE A;  2E5K A;  2JXB A;  2KNB B;  1UE9 A;  4GLM A;  3THK A;  2DYB A;  1W6X A;  1Y0M A;  3VS2 A;  1NEG A;  1WA7 A;  2KYM A;  1WYX A;  1PKS A;  2LQN A;  5ECA A;  3RBB B;  4DEY A;  4WCI A;  2OI3 A;  2KE9 A;  2VVK A;  2ABL A;  1ABO A;  2RQR A;  2YDL A;  3SEM A;  3VS4 A;  3M0R A;  1X27 A;  3EHR A;  2BTT A;  1T3L A;  1OEB A;  2J7I A;  1M3A A;  1X6B A;  4CC7 A;  1ARK A;  1QLY A;  1QWF A;  2DLP A;  1GL5 A;  2A08 A;  2D8H A;  3VS6 A;  1X6G A;  2D0N A;  1CSK A;  1I1J A;  4ESR A;  1E6H A;  1NM7 A;  3M0S A;  1XOV A;  4F17 A;  1WLP B;  4RTU A;  2DBM A;  1UHF A;  1H92 A;  2J05 A;  1OOT A;  3UAT A;  1K0S A;  2JTE A;  3REA B;  1YWP A;  4IIO A;  2J6K A;  2EYZ A;  3H0I A;  1BU1 A;  1SHG A;  1WXT A;  2L0A A;  3VS0 A;  1BB9 A;  2DRM A;  2D1X A;  1AWJ A;  2LZ6 B;  1OV3 A;  4RTY A;  2A37 A;  3VS3 A;  2B86 A;  1HJD A;  2DF6 A;  2DMO A;  1NLP C;  2DIL A;  3ZL7 C;  4F14 A;  1PRL C;  2EPD A;  4CC2 A;  2VKN A;  1A0N B;  3M0U A;  2K2M A;  3PE0 A;  2KGT A;  1UGV A;  4HVW A;  1M27 C;  1UHC A;  2H8H A;  2L2P A;  1AOJ A;  2W0Z A;  2EGC A;  1YN8 A;  2K7A A;  2AKL A;  2RQU A;  3IQL A;  3JV3 A;  2CH4 W;  3PVL A;  4JZ4 A;  1FYN A;  4J9D A;  2CSQ A;  2EGA A;  2C0O A;  2BZY A;  5HCK A;  5I11 A;  1QWE A;  1K4U S;  2OJ2 A;  2MOX A;  2BZX A;  1H8K A;  4OML A;  2KRM A;  2RQV A;  1KIK A;  4JJC A;  1X69 A;  2RNA A;  3CQT A;  4JJB A;  1K9A A;  4AFS C;  1I07 A;  2CSI A;  3I5S A;  4OMO A;  1RI9 A;  4ORZ A;  1OPL A;  2O31 A;  2HSP A;  3M0Q A;  1G2B A;  4HCK A;  2I0N A;  2W10 A;  1UDL A;  1E6G A;  1GCQ C;  2X3X D;  2XMF A;  2PTK A;  2LP5 A;  2NUZ A;  3NPF A;  1IO6 A; 
#chains in the Genus database with same CATH topology
 4D8K A;  1CKA A;  2DXB A;  4Y91 A;  2FZK B;  5GAN 2;  1VQP A;  1X2K A;  1OQK A;  2QAZ A;  3X26 B;  1WHM A;  4LD9 K;  3AHU A;  2SEM A;  3OYA A;  1WQ7 A;  2NYS A;  1RAH B;  2E3I A;  4E7K A;  3I55 Q;  2K3X A;  1UTI A;  2LX7 A;  4M78 C;  2DAQ A;  2RF0 A;  5IH2 A;  2J06 A;  1TOV A;  2K3B A;  5FRO A;  4OB0 B;  3LGL A;  3M0P A;  3G71 T;  2NWM A;  2EAY A;  1G5V A;  5CKF A;  1VQ6 Q;  2HCK A;  1ZSG A;  1XQH A;  1QVF P;  2DEU A;  2Y4Y A;  1Y96 B;  2LT1 A;  2GFA A;  4PK4 A;  1MMN A;  2ZPG B;  3UT1 A;  3GPL A;  1YNZ A;  2LDM A;  4BE2 A;  1F1B B;  5CKE A;  2ZPF B;  1U1S A;  2KXD A;  2CUD A;  2LJ3 A;  3S6W A;  4AT1 B;  2VWF A;  3HFN A;  1TUC A;  3CME A;  3CCM Q;  2PNI A;  3M56 A;  1D1A A;  1SEM A;  4LDU A;  3ULR B;  2K4Y A;  4OF1 A;  4ZN3 A;  2JS0 A;  1UUE A;  3CCR Q;  2PUK B;  2ECZ A;  1ZBJ A;  4QVD A;  2NUP B;  3E1S A;  1WFW A;  4RUG A;  4EMK B;  3RMS A;  2KYB A;  4RKU E;  2WAC A;  3EG2 A;  2IVW A;  3CCS T;  5CQX A;  2RJE A;  1MMA A;  3OYM A;  3DLL A;  3CD6 T;  1JEG A;  1H3Z A;  5A2Q E;  3VU3 C;  5LJ5 j;  4RG2 A;  2C0I A;  3S3N A;  1MMG A;  3EFO B;  2ZCF B;  3SD4 A;  3EGU A;  2JMC A;  4JRP A;  3HP9 A;  1H3H A;  2JOY A;  3JB9 F;  2E70 A;  4M7A F;  2FEI A;  1SF9 A;  3M59 A;  3CCL T;  3I55 A;  4YTL A;  2XG8 D;  3X25 B;  1VQ4 A;  1D0X A;  4C92 B;  3GNG A;  3CBM A;  5IHK A;  2ZAE A;  3MEU A;  4B6M A;  1KQS S;  1M8M A;  3SDZ A;  4J9H A;  1FMK A;  1TXQ A;  2QQA A;  5KYW B;  4GLK A;  4EPC A;  2YRV A;  3UF4 A;  3EG9 B;  3LH5 A;  4Z8A A;  2C0T A;  1D1C A;  1KK7 A;  5LJ5 d;  2ESW A;  1Y7X A;  4C5H A;  2ED1 A;  4XAX B;  2J6O A;  2V1Q A;  2X4Y A;  3SWN A;  3RNJ A;  2DRK A;  2VGN A;  5GAM h;  2LNV A;  4ZTJ A;  1SSH A;  4M78 F;  3JB9 I;  3H8Z A;  3OYD A;  4HCC A;  2L3S A;  3UPU A;  3FRN A;  1M1F A;  2RHU A;  5GMK j;  4J9C A;  5LJ3 j;  2DTH A;  2RHY A;  3M55 A;  5GJV B;  3CPF A;  5GJW B;  1Y71 A;  1V76 A;  1UJ0 A;  2FG0 A;  1ACM B;  2RQW A;  3KFV A;  2GQV A;  7AT1 B;  4LUE A;  2WSC E;  1WHJ A;  5CKH A;  3FJ5 A;  3CPW S;  1G3W A;  1NJI C;  1HYO A;  1AD5 A;  1K73 U;  1C6V X;  2DO3 A;  1N8R U;  3OY9 A;  1KD1 R;  4XU2 A;  3A8H B;  1I4K 1;  2EFI A;  3TSZ A;  3HTR A;  5LL6 S;  1I5O B;  2EQI A;  1BKB A;  4L5G A;  2A28 A;  4D6W A;  4EMG A;  2P0P A;  2E6N A;  4LE9 A;  1QW1 A;  3ZBD A;  2QAS A;  3OW2 S;  1WX6 A;  2HNI A;  3OQ5 A;  2LRQ A;  3KUF A;  2R5A A;  1ZHI A;  5GAN j;  2HZY A;  1QCO A;  3MEW A;  3V8K A;  1IB8 A;  1YJ9 T;  1UGQ B;  4LD6 A;  1RAG B;  1M9S A;  3OBY A;  1YFN A;  1VQ6 T;  4KRT A;  1LVK A;  5DY9 A;  2HAX A;  2B8A A;  5LJ5 e;  1TWB A;  3CXC S;  3CMA T;  4KUD K;  1VA7 A;  2MWO A;  3OYG A;  4PJO D;  1QVG A;  4AG1 C;  4LN2 A;  3CC7 Q;  1RLQ C;  3CC2 A;  1UEC A;  3CCM T;  2OTJ A;  5EG2 A;  2CT4 A;  1Q86 U;  3HL8 A;  1QVG P;  1GFD A;  2L89 A;  2EQK A;  1GFC A;  1NEB A;  1VIE A;  2A36 A;  2PVD B;  1W2B P;  5GAN d;  2O9S A;  4M7A A;  4J9I A;  1I0C A;  1GCQ A;  3TQ7 P;  1IGQ A;  1I81 A;  2Z0W A;  3FJP A;  4C8Q D;  2RHI A;  1T3S A;  5IAY A;  2OTL T;  2KEA A;  4DBQ A;  1AEY A;  1WIE A;  2MCN A;  2EYY A;  1WHL A;  2L3Q A;  2M1H A;  2HKQ B;  4EIK A;  4J6Y A;  2JS2 A;  1U06 A;  1WPY A;  3EH1 A;  2ENM A;  3RUX A;  2XDB A;  5GMK e;  5LJ3 e;  1KHC A;  2X35 A;  4JRQ A;  1OX8 A;  3VS2 A;  5GAO q;  4M78 G;  1WA7 A;  1WYX A;  4C0Z A;  4M78 A;  3RBB B;  4QQ6 A;  4M75 B;  1ZSZ B;  1ZBX A;  1VQ7 T;  3UDC A;  4EMK C;  3C4S A;  4X9D A;  1ZQ1 A;  3EHR A;  3L2U A;  2J7I A;  1YI2 A;  2DLP A;  2L3R A;  3SFM A;  1EIF A;  1LNX A;  5GAN 4;  5HK0 A;  3OS1 A;  1XOV A;  1PCX A;  1N6A A;  4RTU A;  2VXF A;  2JNG A;  2D9T A;  2DBM A;  5CKD A;  2RJC A;  3UAT A;  2JTE A;  2JVV A;  2JTM A;  2J6K A;  3H0I A;  1SHG A;  1WXT A;  5AT1 B;  3VS0 A;  5KCH A;  1HK9 A;  2D1X A;  1AWJ A;  5GAN e;  4OB1 B;  4E7L A;  5D6Y A;  3MP1 A;  3V7S A;  1G3T A;  3M57 A;  2B86 A;  1HJD A;  2DF6 A;  2DMO A;  4F14 A;  3SB2 A;  3WVD B;  5GMK h;  2M9U A;  5LJ3 h;  2KGT A;  1UHC A;  2H8H A;  2L2P A;  1AOJ A;  2HQH A;  2EGC A;  2K5F A;  3A8G B;  3BY7 A;  3LH0 A;  3PVL A;  2QTV A;  4JZ4 A;  2EGA A;  3QHS A;  4ZN1 A;  5KYU B;  1M2O A;  1BI1 A;  4N0A C;  4N4H A;  2QA4 T;  5FLX E;  2CP7 A;  3LW5 E;  4A53 A;  1WJQ A;  3MEV A;  4MDX A;  2MOX A;  1YIJ Q;  4OML A;  2QK0 A;  1VQO T;  4JJB A;  4AFS C;  1QVP A;  1IZ6 A;  4BE1 A;  2CZ6 B;  1FMW A;  1OPL A;  2O31 A;  3TU4 K;  2HSP A;  2ZZD A;  3M0Q A;  2IG0 A;  2NLU A;  2KI7 A;  1E6G A;  3EGD B;  4IUV A;  2F5T X;  3JCM f;  2DD4 A;  4OGE A;  1YHQ T;  2XMF A;  4PJO B;  4NOY A;  4PFZ A;  2LX9 A;  2G6F X;  3EGX A;  1HD3 A;  2DTO A;  3A8O B;  3CC7 T;  2O9V A;  4BI3 A;  2X51 A;  4RTW A;  3VS7 A;  1VQL T;  1QP3 A;  3LWI A;  3JCM g;  1VYT A;  3GNF B;  4N4I A;  5C6S A;  1M2V B;  4ANJ A;  3QSU A;  2JJ9 A;  1VQ8 A;  4C8Q B;  3CCV T;  3VKI A;  5I22 A;  1M30 A;  3M58 A;  2D6F A;  1VQK T;  3WVE B;  1TUD A;  3TRE A;  1YIT T;  4C92 E;  3A1P A;  1YJN Q;  1VQM Q;  4ELY C;  2EJ9 A;  1B7T A;  2CP5 A;  5GAN 5;  3OYK A;  3QWY A;  1RI0 A;  2PVO B;  4JS4 A;  1VQP Q;  1NJI U;  2FVU A;  3REB B;  3OYL A;  2E12 A;  5GMK m;  2FPF A;  2E10 A;  2FRY A;  2KR3 A;  4ME7 A;  4FSS A;  1SRL A;  3FLG A;  1SSF A;  4M7D B;  1S72 Q;  1GCP A;  3EFS A;  3CCU A;  1RAC B;  2M51 A;  4FL6 A;  2DA9 A;  2GQI A;  4C92 D;  4FM4 B;  2DFU A;  1QQJ A;  5IT9 E;  4BUG A;  4AG2 C;  3KBG A;  5GAM j;  1MV3 A;  2IIM A;  1RUW A;  1UG1 A;  2EW3 A;  1JO8 A;  1JJ2 A;  3A8M B;  5IHN A;  2YXY A;  3GLX A;  1VQN A;  4IKF A;  5GAO p;  1SPK A;  2RD1 A;  5D6X A;  2DIG A;  4DBH A;  4J8O A;  3LYI A;  1JJ2 P;  2CP2 A;  2DVE A;  2RB6 A;  3MPU B;  5A0D A;  2EJF A;  1ZSZ C;  1WXU A;  2I2L A;  3VUB A;  2DZ9 A;  3BDL A;  2DL4 A;  2V8J A;  1PWT A;  2QXF A;  1W1F A;  1WNL A;  2VB6 A;  1AWW A;  1TSF A;  1PD0 A;  1M8V A;  3M54 A;  2E1H A;  4XQ3 A;  4JJD A;  4JLI A;  3QYG B;  4XK8 E;  5GAM d;  3HSB A;  2CDT A;  2E6Z A;  3PIO A;  4J7I A;  1EX4 A;  2DKG A;  1D3B B;  2MWP A;  3G4S Q;  3EG1 A;  1VQM A;  4C0D C;  3BFM A;  2KT1 A;  3RR6 A;  4D8D A;  4ZGE B;  4R0K A;  1AVZ C;  4IUR A;  2F2X A;  4A4E A;  4J5Y A;  4BAC A;  5D6W A;  4FYY B;  4M77 D;  2ZPE B;  1YIJ T;  2Y4X A;  3S3O A;  2JN0 A;  1S72 A;  2L8D A;  3PGG A;  2NUP A;  2OX7 A;  3RDV A;  1VQ5 T;  2AT1 B;  2F1L A;  1QVF A;  1VQ4 Q;  1AT1 B;  3QJ6 A;  4Y92 A;  3VRZ A;  2XU8 A;  2X4W A;  4A4H A;  2DM1 A;  4PKC C;  2QEX T;  3CBP A;  1BI3 A;  1KQ2 A;  4QQD A;  3EFO A;  5KYY A;  4AMC A;  4HKE A;  2PUO B;  2QDL A;  2P0Q A;  3H41 A;  3L2W A;  2AIR B;  1GRI A;  1JQQ A;  1SG5 A;  5DLQ E;  4C92 G;  2JT4 A;  4FYW B;  2XDD A;  5FU6 C;  2MMP A;  3RIR A;  3JB9 H;  2ROT A;  4FU6 A;  2RJD A;  4DOV A;  2O2O A;  4OMP A;  4LDW A;  2RMO A;  1HXD A;  5CAI A;  2CRE A;  2H3E B;  1IRE B;  5GAM e;  1ZLM A;  1W70 A;  1RAI B;  3P8H A;  1WHH A;  2F2W A;  1RAF B;  4A54 A;  1SRM A;  4X9C A;  4PJO C;  4QVC A;  1TH7 A;  3E19 A;  4M75 E;  1TTH B;  4A4G A;  3G4S A;  2XKO C;  2JMA A;  2L3P A;  4DEX A;  9ATC B;  1UGR B;  2HBP A;  3J80 E;  3R6N A;  5IXB A;  3I35 A;  1WI7 A;  4XTY A;  4RTV A;  2P84 A;  1VQP T;  2YUQ A;  2FL7 A;  1Q7Y R;  1YP5 A;  2ROL A;  3Q1J A;  4J6W A;  1X43 A;  3HPW A;  2GBQ A;  4C8Q C;  3M9Q A;  3CBO A;  2LCC A;  2COY A;  2RM4 A;  4HVV A;  1U5S A;  1H64 1;  3PVQ A;  4AFQ C;  2F5K A;  2HMA A;  2LMJ A;  5LJ5 f;  4II1 A;  3PFS A;  4M75 D;  3VV0 A;  1PD1 A;  3VYH B;  2LCS A;  2DJQ A;  1K8A R;  2LJ1 A;  2EQM A;  2FO0 A;  2YT6 A;  3QWX X;  1KD1 U;  4OB2 B;  2YWW A;  3I56 Q;  1T0J A;  3QBY A;  1PNJ A;  3CCE A;  1YJ9 A;  5LJ5 g;  4DA4 A;  1WDX A;  4KGZ B;  3H0H A;  2DYI A;  5FW9 A;  1Q82 U;  1PKT A;  1YWO A;  2QGG A;  5GAO n;  2DL7 A;  3CC2 Q;  5GAO m;  3CME T;  2OTJ Q;  2DYB A;  3CMA A;  3UWN A;  4HT8 A;  4TVR A;  1NEG A;  1KQ1 A;  3JCM P;  3C12 A;  2LQN A;  2RH2 A;  5ECA A;  2COZ A;  1VQ9 T;  2NUT A;  2RHX A;  1OX9 A;  2KE9 A;  2VVK A;  2XK0 A;  3TCJ A;  1Q81 R;  3SEM A;  1U1T A;  4CRI A;  3M0R A;  3F70 A;  2BTT A;  5LJ3 f;  3KXT A;  1T3L A;  2MPX C;  1X6B A;  3ZFJ A;  3CC4 A;  2A0F B;  1GL5 A;  4NS5 A;  2D8H A;  5M9O A;  1X6G A;  1CSK A;  1VOM A;  1I1J A;  2LQK A;  2OTL A;  4B9X A;  2CP0 A;  4M77 B;  1RAD B;  4FW1 A;  2XHC A;  4L59 A;  2K3Y A;  5LJ3 d;  2J05 A;  1OOT A;  1Q82 R;  4PJO E;  5LJ3 g;  1K0S A;  1BU1 A;  3RER A;  4E7S A;  4HCB A;  5KYX A;  2QYZ A;  2LVM A;  2M02 A;  2KAF A;  2LZ6 B;  2VV5 A;  3I55 T;  1NZ9 A;  1VQ4 T;  4RTY A;  4FYX B;  2A37 A;  1QMC A;  1NLP C;  2DIL A;  3V7C A;  3ZL7 C;  3J81 E;  3GF5 A;  1YI2 Q;  4CC2 A;  2VKN A;  4IUT A;  1G8X A;  1YJW Q;  2D0Q B;  2EIF A;  2K2M A;  4C8Q E;  3PE0 A;  3JCM b;  3I56 A;  5GAN f;  2W0Z A;  4M75 G;  3CCQ Q;  3L2V A;  2DET A;  3OA6 A;  1YN8 A;  2OAU A;  2K7A A;  2DJZ A;  1W2B A;  1OI1 A;  1B34 B;  2FYK A;  1ZSZ A;  4FYV B;  4J9D A;  2BZY A;  5I11 A;  4J7F A;  1BYM A;  1K4U S;  3X24 B;  4JJN K;  4P5N A;  4BDZ A;  2RK2 A;  2RQV A;  2ZPB B;  5GAN g;  1X69 A;  2JTF A;  1I07 A;  2CSI A;  3FB9 A;  3MP8 A;  3CCR T;  4ORZ A;  4ZGJ B;  4M7D E;  2QG9 B;  3OBW A;  4HCK A;  3JAM E;  4BY6 B;  2W10 A;  1UDL A;  4JRK A;  4KGX B;  4QW2 A;  2DZC A;  4ATO A;  1FX7 A;  2PTK A;  2O4X A;  1OUL A;  2LP5 A;  2NUZ A;  3REA B;  1IO6 A;  1WGS A;  2DXT A;  2CS7 A;  2GTJ A;  4F16 A;  2CKK A;  1LOJ A;  2EKH A;  4Q5W A;  3G1J A;  2DPP B;  1LPL A;  2EKO A;  3TSW A;  5GAN 7;  1KSW A;  2QDY B;  4OMQ A;  4M7D D;  5FRN A;  3QPH A;  3VS5 A;  3AT1 B;  3NTI A;  2R58 A;  2K79 A;  4KUI A;  3VUZ A;  3PMI A;  3G6E Q;  1VQO A;  1YJW A;  1M1G A;  1Q7Y C;  2O88 A;  2DEQ A;  3OYF A;  1ZUY A;  2PU9 B;  3JSC A;  6AT1 B;  2ZPI B;  3VS1 A;  1K9M R;  2PZ1 A;  3CCJ A;  2GTO A;  4JDS A;  3V8J A;  5IXF A;  2YUO A;  4FIB A;  3CCQ A;  3FC3 A;  4JPB W;  2X4X A;  4VUB A;  2PVG B;  4KUL A;  2CZ7 B;  2X4J A;  3CC2 T;  4C92 C;  4MDW A;  4M7A B;  2OTJ T;  1O9S A;  1QKW A;  1VYU A;  1U3O A;  1MMD A;  2M16 A;  3H0F A;  4MML A;  4J6X A;  1GBR A;  1QVF S;  1KFZ A;  3NTK A;  1AZG B;  2KRS A;  2G3R A;  4PJO G;  1LCK A;  1VQ8 Q;  4Y28 E;  1ZUK A;  2GNC A;  4PFP A;  3EFR A;  2ZGW A;  1UB4 A;  4F7U B;  8AT1 B;  4OP0 A;  2DXU A;  1KC8 U;  3NGP A;  3WXM B;  4IIM A;  1FWZ A;  1BBZ A;  2DL3 A;  1KQS A;  1M2V A;  1KJW A;  2FPE A;  3RKY A;  1G83 A;  2KRO A;  3X20 B;  4CI0 C;  1RAA B;  2FPD A;  4C8Q G;  2COW A;  3QXE B;  2V26 A;  4M78 B;  1YIT A;  4XU1 A;  3HRS A;  2RI3 A;  4QQG A;  4HT9 A;  4JRI A;  2HQX A;  1OU9 A;  2LJ0 A;  4ELZ C;  1KQS P;  2DER A;  2RA2 A;  1NYG A;  1KD1 C;  3CCU Q;  4L6V 5;  1BCO A;  2E64 A;  1T0H A;  1UGS B;  3HKS A;  3G6E A;  2DX1 A;  3U23 A;  2EBP A;  2C06 A;  4BI8 B;  4FT4 A;  4E7Z A;  1Q82 C;  2MIO A;  3L42 A;  1KC8 R;  4KH1 B;  3M5A A;  4XTW A;  4M77 C;  1PSF A;  3RKW A;  3DB4 A;  2J6F A;  1VQN Q;  1G3S A;  3GBQ A;  1PM3 A;  1QKX A;  1BI0 A;  1M90 U;  3EG0 A;  1GBQ A;  3CPW A;  4J9E A;  4NL2 A;  1TUG B;  2E3H A;  1BI2 A;  1NE8 A;  3T9N A;  1TG0 A;  2JM8 A;  1D0Z A;  1P92 A;  4HXJ A;  3NHN A;  4OB3 B;  3CPW P;  1BK2 A;  5I2S A;  2X9H A;  2HDA A;  2F2V A;  3M0T A;  5GAO r;  4CC4 B;  2P0K A;  2KBT A;  2AHJ B;  2VYT A;  3O5Z A;  4JZ3 A;  4QT7 A;  1R77 A;  4RMO A;  3OW2 A;  2FB7 A;  1Z9Z A;  4KBM B;  1NPR A;  1NLO C;  4C92 F;  4AFU C;  2CT3 A;  2R57 A;  4PFO A;  2LC4 A;  2V8I A;  3OW2 P;  2MI6 A;  4X34 A;  2EGE A;  2YUP A;  1AWO A;  1M90 R;  1JBM A;  2MAM A;  4C5G A;  3R6O A;  3CCS Q;  3QII A;  3CXC A;  3OS2 A;  1M3B A;  1K1Z A;  3CD6 Q;  2VC8 A;  5KCO A;  4OVA A;  2O01 E;  4JLG A;  2GCX A;  4Z89 A;  3A98 A;  3L2Z A;  4BY6 C;  1CKB A;  4JUV A;  3CXC P;  3O8V A;  1I5L A;  3CCL Q;  2RO0 A;  8ATC B;  3QG1 A;  2DE0 X;  1BCM A;  3EGX B;  2KXC A;  1E7O A;  2DXC A;  3BDU A;  2LQW A;  2KVQ G;  3URG A;  4DQ2 A;  1D09 B;  1M4Z A;  3SHW A;  2LQ8 A;  2A3L A;  3G71 A;  1MNE A;  4PJN A;  3JCM c;  5GAM f;  2FZC B;  2RPN A;  3GOX A;  2SRC A;  2OAW A;  3A5Z B;  4M75 C;  2E5Q A;  3PT9 A;  2LNH B;  3PNW C;  3INZ A;  1ABQ A;  4O6J A;  2YRD A;  1C0M A;  1NBE B;  5KE2 A;  2AZV A;  1R8O B;  3ER0 A;  4RCB A;  4RTX A;  4HCZ A;  1Y96 A;  1K9M C;  4M77 E;  2A7Y A;  4LXC A;  2QQ9 A;  3QYH B;  4WF2 A;  5A0L A;  3BE3 A;  1VQ8 T;  1X01 A;  4PNO A;  1PHT A;  5GAM g;  4M77 F;  1Y07 A;  4E6R A;  1Y57 A;  2YRC A;  1UFF A;  5DLO A;  1OPK A;  1M5Q 1;  1KHI A;  3TEE A;  2M0Y A;  2CH4 A;  1PSE A;  2AKK A;  1BIA A;  4K11 A;  2HEQ A;  5FWB A;  3NTH A;  3OYE A;  1QVG S;  1MV0 B;  4UC4 A;  4J9G A;  4JS5 A;  1W2B S;  1MUZ A;  1UGP B;  1NYF A;  2RK1 A;  4DBF A;  3MHX A;  3CCS A;  2HBW A;  4A4F A;  1AZE A;  1IGU A;  2RI5 A;  1UE9 A;  3CD6 A;  4EMK A;  1W6X A;  1Y0M A;  2QI2 A;  3FEO A;  3C94 A;  2KYM A;  1ZA1 B;  3CCU T;  2E41 A;  4DEY A;  4WCI A;  1U8R A;  1R0C B;  2OI3 A;  2ABL A;  3CCL A;  1ABO A;  2KK4 A;  3VS4 A;  3NFC A;  2WSF E;  4DBR A;  5GMK l;  1MHN A;  2EQU A;  1ARK A;  5DM7 R;  5A0G A;  1QWF A;  2KQW A;  1WJS A;  2A08 A;  2LT4 A;  3VS6 A;  3CCE Q;  1YJ9 Q;  4O5V A;  1Q7Y U;  1VQN T;  4FCY A;  4RG8 A;  4C92 A;  3MET A;  3JCM Q;  1QCN A;  1NM7 A;  3M53 A;  4A4K A;  3M0S A;  5CIU A;  2XDP A;  4XU0 A;  1GXI E;  3CMA Q;  1H92 A;  3JCM h;  4PJM A;  1YCY A;  4BDY A;  1EZZ B;  5GMK i;  2GF7 A;  1KC8 C;  5KYW A;  4E2F B;  3JB9 J;  1OZ3 A;  3EG9 A;  3DB3 A;  2DRM A;  4FW2 A;  1K8A U;  2VGM A;  4PJJ A;  1OV3 A;  5I2M A;  3VS3 A;  3LWH A;  2EPD A;  1RAB B;  3CC4 Q;  2VXE A;  1A0N B;  1YJN T;  1VQ9 A;  1VQM T;  4M75 F;  2QGF B;  3L2R A;  3HFO A;  1JB0 E;  1PG5 B;  4IUP A;  1UGV A;  4N0A A;  4HVW A;  1M27 C;  2OTL Q;  4MZT A;  5KH6 A;  1WQW A;  3JV3 A;  2QQS A;  3OMC A;  3OYB A;  5CO7 A;  2M0O A;  2CSQ A;  2C0O A;  1ZA2 B;  1S72 T;  5CQY A;  1M1K U;  1H8K A;  1Q81 U;  2KRM A;  5KYY B;  4JJC A;  4M7A E;  3VJP A;  3JCM W;  4FSX A;  2RNA A;  1K9A A;  4LDY A;  3ASK A;  3PIP A;  4M77 G;  1RI9 A;  4IUU A;  4M77 A;  1M90 C;  2BKD N;  4C5E A;  5FRM A;  1VQ7 Q;  2K5I A;  4F7U E;  3OYY A;  4IUQ A;  4XTX A;  2X3X D;  1WZO A;  2K5L A;  4F7U F;  1VQ6 A;  4M7D C;  2HKN A;  4OGC A;  1N9R A;  3HHT B;  3G7Z A;  3P8B B;  4LNP A;  3JB9 D;  4M7A D;  3DLM A;  2K6D A;  4M78 E;  3OYJ A;  2AZS A;  2JM9 A;  2QQR A;  1N27 A;  2KY9 A;  4CC3 A;  3CCM A;  1M1K R;  2DVJ A;  4F04 B;  3S3M A;  4KGV B;  2KMT A;  1B34 A;  1XJW B;  1ZUU A;  5CR2 A;  2EVR A;  3OB9 A;  3G4S T;  4J9B A;  4C5I A;  4ZTF A;  4OMM A;  3QKJ A;  3CCR A;  2BE9 B;  4N4G A;  2FZG B;  2BZ8 A;  1NG2 A;  3JCM V;  1WJR A;  5IHI A;  1N5Z A;  2EYX A;  2K2V A;  2KT8 A;  1O75 A;  1B07 A;  3MKD A;  2GGR A;  1FMV A;  2DL5 A;  2K9G A;  4M78 D;  3MCA B;  2V8K A;  1TS9 A;  5I21 A;  2CYZ B;  4Z88 A;  1QP2 A;  2FRW A;  4PJO F;  2P4T A;  1C1A A;  3UA6 A;  2VAS A;  1YCS B;  5KE3 A;  1RAE B;  4WTO B;  2P4R A;  2YLB A;  3QDF A;  2EQJ A;  2QA4 Q;  3MP6 A;  1AWX A;  3JRZ A;  1VQO Q;  3LX7 A;  3QDR B;  2EWN A;  2RQT A;  2E4H A;  5J3B A;  2Y90 A;  3M4G A;  1VQ7 A;  3SWN B;  5CVI A;  1K0X A;  4M4Z A;  5GAN 3;  3CCJ Q;  3RMQ A;  3CEY A;  3BW1 A;  3MO8 A;  1OU8 A;  1FXX A;  3FIF A;  3H9N A;  3E2U A;  4C8Q F;  3OYI A;  5J26 A;  2DBK A;  4PLL A;  3CCE T;  4M75 A;  1X75 C;  5FU7 B;  1TU0 B;  3H6Z A;  1EFN A;  2HD0 A;  2QQB A;  1DJ7 B;  2YLC A;  1YBY A;  4QKU A;  1I8F A;  4GBQ A;  1YHQ Q;  4MZP A;  2NUT B;  1Z9Q A;  3EG3 A;  4HVU A;  1UJY A;  1K73 R;  1N8R R;  2PQW A;  4EMH A;  3E9G A;  3VRY A;  2BE7 D;  1W4S A;  1VUB A;  1XNI A;  2KRN A;  4NL3 A;  1VQL Q;  2CP3 A;  1B3Q A;  2RI2 A;  3C0C A;  1K9M U;  2V1R A;  3JB9 G;  5GAO l;  4M7A G;  4M7D F;  1JJ2 S;  2LCL A;  3CC4 T;  4J83 A;  3J7A F;  3CCV Q;  3EHQ A;  5D7U A;  1VQK Q;  2RHZ A;  2K57 A;  4LUD A;  2EJG A;  5KYX B;  1IRX A;  2CUB A;  1VIF A;  1YIT Q;  4F7U G;  4XTU A;  4J9F A;  3RKX A;  4F7U A;  3OYC A;  1UEB A;  5HK3 A;  3LLR A;  3OMG A;  3GIB A;  2YUN A;  1J3T A;  4PL6 A;  3X28 B;  1WHK A;  2XI9 A;  2QA4 A;  1V29 B;  2H3J A;  2LTO A;  1X2Q A;  3MJX A;  3QZ5 B;  2YSQ A;  5KYU A;  1JXO A;  5HKC A;  4ZGD B;  3UA7 A;  1K76 A;  1Q86 R;  5LJ5 h;  1V1C A;  4EDU A;  3I56 T;  5GAN 8;  3MEA A;  4E7I A;  2VUB A;  2CZ0 B;  1JRI A;  2AK5 A;  1Q95 G;  1AHJ B;  2MYS A;  3PMT A;  5L8R E;  1M3C A;  4PJL A;  1K8A C;  1YHQ A;  4A63 B;  4GY5 A;  4X1V A;  3EGD A;  4RTZ A;  3CC7 A;  4C0G A;  3RES A;  2XIC A;  4C0D B;  4PJO A;  4RTT A;  4ZNX A;  3NMZ C;  4E7J A;  3I5R A;  1VQL A;  3A8L B;  1RLP C;  3EAE A;  1WXB A;  4LDV A;  3OS0 A;  2JW4 A;  2O4X B;  4XU3 A;  1PRM C;  3CCV A;  1SHF A;  2JUF A;  4B9W A;  4AFZ C;  5CK9 A;  2D8J A;  2MF2 A;  1VQK A;  2RN8 A;  1XTD A;  4KT0 E;  4C8Q A;  2E65 A;  3QUI A;  1M1K C;  5EC7 A;  1Q81 C;  1ZX6 A;  1VYV A;  4BD3 A;  3E9F A;  1N9S A;  1IHW A;  3I9Q A;  4OMF B;  4OMN A;  1QCF A;  1JXM A;  2ED0 A;  4FT2 A;  4PLI A;  2ATC B;  1S1N A;  2GFU A;  4R55 A;  4LDX A;  1HSQ A;  3L2Q A;  3OYH A;  4C0F A;  1YI2 T;  3QZ9 B;  4RCC A;  5FU6 B;  1VQ5 Q;  1YJW T;  4V2S A;  4BB7 A;  3QJY A;  4M7D G;  3CCJ T;  4QVZ A;  5FWC A;  4M7D A;  5IN1 A;  2QEX Q;  2EYW A;  3G71 Q;  2DIQ A;  5L23 A;  3CCQ T;  1JU5 C;  2DK3 A;  2DNU A;  3PTA A;  4R56 A;  2CZ1 B;  5CKB A;  3TVT A;  1KG1 A;  4HA8 A;  3QO3 A;  2X3W D;  4DOW A;  5C0M A;  5J39 A;  5GAN h;  2BIV A;  1PC0 A;  2DL8 A;  3GP8 A;  2E5K A;  2CP6 A;  2JXB A;  1IXD A;  2KNB B;  4GLM A;  3THK A;  3V7R A;  1R0B G;  1G3Y A;  2ZPH B;  1PKS A;  3D7S B;  3SWN C;  2KSS A;  4KH0 B;  3JCM X;  1X6O A;  3JCM d;  1BIB A;  3HRU A;  5FU7 C;  2RQR A;  2YDL A;  1X27 A;  4MMK A;  3FDR A;  3P8D A;  3HRT A;  1OEB A;  1M3A A;  1K73 C;  1WHG A;  4CC7 A;  1QLY A;  1N8R C;  2D0N A;  4XTZ A;  2CGH A;  4XTV A;  2BUD A;  4ESR A;  4BI4 A;  1E6H A;  2YHT A;  3L1A A;  3C95 A;  5GAN 6;  4F17 A;  1WLP B;  1IHV A;  2XID A;  1RL2 A;  1UHF A;  3OYN A;  1D3B A;  2R5M A;  2DTI A;  2HSE B;  1YWP A;  4IIO A;  4E7H A;  2EYZ A;  2WSE E;  2JZ2 A;  1LJO A;  2L0A A;  1BB9 A;  1YIJ A;  3G6E T;  2RJF A;  1VQ5 A;  4BE0 A;  5KYN A;  3DKM A;  1MND A;  1OYX A;  1PRL C;  3M0U A;  2QEX A;  3OS5 A;  5CCA A;  2MK5 A;  1SKU B;  2EYQ A;  2HL5 C;  1D0Y A;  2FHD A;  3JCM J;  3LGF A;  3ZEH A;  5AYF A;  2AKL A;  4MZM A;  2RQU A;  3IQL A;  3N5B B;  2CH4 W;  1FYN A;  2L5Q A;  1Q86 C;  2HL3 A;  5HCK A;  3OSV A;  3V8L A;  3M4Y A;  1QWE A;  2OJ2 A;  2BZX A;  3CME Q;  1KIK A;  3JCM e;  1NJI R;  3CQT A;  2HQE A;  3EH2 A;  3I5S A;  4OMO A;  1VQ9 Q;  2IPO B;  2DD5 A;  3VYG A;  2F69 A;  2KDS A;  1D1B A;  1G2B A;  3ME9 A;  4M7A C;  2I0N A;  5HY6 A;  4Z02 A;  1OZ2 A;  3OSS C;  2XD0 A;  1GCQ C;  1NPP A;  1MGQ A;  1YJN A;  2QTX A;  3NPF A;  4E47 A; 
#chains in the Genus database with same CATH homology
 2G6F X;  4D8K A;  1CKA A;  1HD3 A;  4LNP A;  2GTJ A;  4F16 A;  2O9V A;  2EKH A;  4RTW A;  3VS7 A;  1X2K A;  2K6D A;  2AZS A;  2JM9 A;  3TSW A;  1KSW A;  4OMQ A;  4CC3 A;  1VYT A;  2SEM A;  3VS5 A;  2DVJ A;  2K79 A;  1ZUU A;  1UTI A;  5I22 A;  2LX7 A;  1M30 A;  2EVR A;  2RF0 A;  5IH2 A;  4J9B A;  2O88 A;  2J06 A;  1ZUY A;  2K3B A;  1TUD A;  3M0P A;  4OMM A;  3VS1 A;  2PZ1 A;  2NWM A;  2GTO A;  2BZ8 A;  5IXF A;  2HCK A;  1ZSG A;  1NG2 A;  2YUO A;  5IHI A;  1N5Z A;  4JPB W;  2EYX A;  2KT8 A;  1B07 A;  3QWY A;  2GGR A;  2DL5 A;  2K9G A;  1YNZ A;  3REB B;  2KXD A;  2CUD A;  2LJ3 A;  4Z88 A;  2FRW A;  1QKW A;  1VYU A;  2FPF A;  1U3O A;  2VWF A;  1TUC A;  2FRY A;  2KR3 A;  2PNI A;  3UA6 A;  3H0F A;  1YCS B;  1SRL A;  4FSS A;  1GBR A;  1KFZ A;  2P4R A;  1AZG B;  1SEM A;  2KRS A;  1LCK A;  1AWX A;  1GCP A;  1ZUK A;  2GNC A;  3ULR B;  2M51 A;  2DA9 A;  2JS0 A;  2GQI A;  2RQT A;  1UUE A;  3NGP A;  1K0X A;  4M4Z A;  4AG2 C;  1MV3 A;  4IIM A;  2IIM A;  1RUW A;  1BBZ A;  2DBK A;  2ECZ A;  1ZBJ A;  1UG1 A;  2EW3 A;  1JO8 A;  1WFW A;  4RUG A;  2DL3 A;  5IHN A;  1EFN A;  2KYB A;  1KJW A;  2FPE A;  1G83 A;  2KRO A;  2FPD A;  3EG2 A;  1SPK A;  4GBQ A;  1Z9Q A;  3EG3 A;  1JEG A;  4HVU A;  2C0I A;  2LJ0 A;  1UJY A;  3EGU A;  1WXU A;  2JMC A;  1NYG A;  1H3H A;  3VRY A;  2DL4 A;  1PWT A;  2KRN A;  1W1F A;  2FEI A;  1AWW A;  1T0H A;  1B3Q A;  3C0C A;  2V1R A;  2DX1 A;  3U23 A;  4JJD A;  2EBP A;  5IHK A;  2CDT A;  2MIO A;  1M8M A;  4J9H A;  3EHQ A;  3EG1 A;  1FMK A;  2J6F A;  2KT1 A;  4LUD A;  4D8D A;  4R0K A;  3GBQ A;  1AVZ C;  2CUB A;  3LH5 A;  1QKX A;  4Z8A A;  2F2X A;  3EG0 A;  4J9F A;  3UF4 A;  2C0T A;  2ESW A;  1GBQ A;  4J9E A;  2ED1 A;  2J6O A;  2V1Q A;  2YUN A;  1J3T A;  1TG0 A;  3RNJ A;  2DRK A;  2JM8 A;  1SSH A;  4HXJ A;  2L3S A;  3NHN A;  1BK2 A;  1X2Q A;  4J9C A;  2YSQ A;  2HDA A;  5GJV B;  2F2V A;  3M0T A;  4Y92 A;  1JXO A;  3VRZ A;  5GJW B;  2DM1 A;  3UA7 A;  1K76 A;  4CC4 B;  2KBT A;  3O5Z A;  4JZ3 A;  4QT7 A;  1V1C A;  1UJ0 A;  2FG0 A;  1Z9Z A;  2RQW A;  2QDL A;  3KFV A;  1NLO C;  4AFU C;  4LUE A;  2AK5 A;  3H41 A;  3FJ5 A;  2CT3 A;  1AD5 A;  1GRI A;  1M3C A;  1JQQ A;  2EGE A;  2YUP A;  2JT4 A;  4A63 B;  1AWO A;  4X1V A;  2ROT A;  3TSZ A;  4RTZ A;  2O2O A;  2EQI A;  1M3B A;  1K1Z A;  2A28 A;  4OMP A;  2RMO A;  4RTT A;  4LE9 A;  4ZNX A;  3NMZ C;  4Z89 A;  3I5R A;  2CRE A;  3A98 A;  1RLP C;  1WXB A;  1ZLM A;  1CKB A;  1WX6 A;  1W70 A;  2JW4 A;  2F2W A;  1PRM C;  1SRM A;  1SHF A;  2DE0 X;  4AFZ C;  2D8J A;  2KXC A;  1E7O A;  2LQW A;  2JMA A;  2RN8 A;  2L3P A;  4DEX A;  4KRT A;  3SHW A;  5EC7 A;  2RPN A;  2SRC A;  1ZX6 A;  2OAW A;  3R6N A;  5IXB A;  3I35 A;  1VYV A;  1WI7 A;  1VA7 A;  4RTV A;  2LNH B;  4AG1 C;  4LN2 A;  1RLQ C;  2YUQ A;  1ABQ A;  3I9Q A;  1YP5 A;  4OMN A;  2ROL A;  1QCF A;  1X43 A;  1JXM A;  2AZV A;  1UEC A;  4RTX A;  2GBQ A;  2ED0 A;  2CT4 A;  4HVV A;  1U5S A;  3PVQ A;  1S1N A;  4AFQ C;  1HSQ A;  2LMJ A;  1GFD A;  1GFC A;  1NEB A;  1PHT A;  2A36 A;  4E6R A;  2O9S A;  1Y57 A;  4J9I A;  2LCS A;  1I0C A;  1UFF A;  1GCQ A;  1OPK A;  2DJQ A;  2LJ1 A;  2M0Y A;  2YT6 A;  2FO0 A;  3QWX X;  2CH4 A;  5FWC A;  1T3S A;  2AKK A;  2EYW A;  5L23 A;  2KEA A;  4K11 A;  1JU5 C;  2HEQ A;  1AEY A;  1WIE A;  5FWB A;  2DNU A;  1MV0 B;  1T0J A;  1PNJ A;  2EYY A;  2MCN A;  1WDX A;  4J9G A;  3TVT A;  1MUZ A;  2L3Q A;  3H0H A;  5FW9 A;  4EIK A;  1NYF A;  1PKT A;  1YWO A;  2X3W D;  2JS2 A;  2DL7 A;  1U06 A;  2ENM A;  2HBW A;  2DL8 A;  1AZE A;  2E5K A;  2JXB A;  2KNB B;  1UE9 A;  4GLM A;  3THK A;  2DYB A;  1W6X A;  1Y0M A;  3VS2 A;  1NEG A;  1WA7 A;  2KYM A;  1WYX A;  1PKS A;  2LQN A;  5ECA A;  3RBB B;  4DEY A;  4WCI A;  2OI3 A;  2KE9 A;  2VVK A;  2ABL A;  1ABO A;  2RQR A;  2YDL A;  3SEM A;  3VS4 A;  3M0R A;  1X27 A;  3EHR A;  2BTT A;  1T3L A;  1OEB A;  2J7I A;  1M3A A;  1X6B A;  4CC7 A;  1ARK A;  1QLY A;  1QWF A;  2DLP A;  1GL5 A;  2A08 A;  2D8H A;  3VS6 A;  1X6G A;  2D0N A;  1CSK A;  1I1J A;  4ESR A;  1E6H A;  1NM7 A;  3M0S A;  1XOV A;  4F17 A;  1WLP B;  4RTU A;  2DBM A;  1UHF A;  1H92 A;  2J05 A;  1OOT A;  3UAT A;  1K0S A;  2JTE A;  3REA B;  1YWP A;  4IIO A;  2J6K A;  2EYZ A;  3H0I A;  1BU1 A;  1SHG A;  1WXT A;  2L0A A;  3VS0 A;  1BB9 A;  2DRM A;  2D1X A;  1AWJ A;  2LZ6 B;  1OV3 A;  4RTY A;  2A37 A;  3VS3 A;  2B86 A;  1HJD A;  2DF6 A;  2DMO A;  1NLP C;  2DIL A;  3ZL7 C;  4F14 A;  1PRL C;  2EPD A;  4CC2 A;  2VKN A;  1A0N B;  3M0U A;  2K2M A;  3PE0 A;  2KGT A;  1UGV A;  4HVW A;  1M27 C;  1UHC A;  2H8H A;  2L2P A;  1AOJ A;  2W0Z A;  2EGC A;  1YN8 A;  2K7A A;  2AKL A;  2RQU A;  3IQL A;  3JV3 A;  2CH4 W;  3PVL A;  4JZ4 A;  1FYN A;  4J9D A;  2CSQ A;  2EGA A;  2C0O A;  2BZY A;  5HCK A;  5I11 A;  1QWE A;  1K4U S;  2OJ2 A;  2MOX A;  2BZX A;  1H8K A;  4OML A;  2KRM A;  2RQV A;  1KIK A;  4JJC A;  1X69 A;  2RNA A;  3CQT A;  4JJB A;  1K9A A;  4AFS C;  1I07 A;  2CSI A;  3I5S A;  4OMO A;  1RI9 A;  4ORZ A;  1OPL A;  2O31 A;  2HSP A;  3M0Q A;  1G2B A;  4HCK A;  2I0N A;  2W10 A;  1UDL A;  1E6G A;  1GCQ C;  2X3X D;  2XMF A;  2PTK A;  2LP5 A;  2NUZ A;  3NPF A;  1IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...