4X1VA

Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4x1vA00
4JZ3A 4OMNA 4JPBW 2DL7A 3H0FA 1WA7A 1AZGB 2LQWA 4HVVA 1VYTA 4CC7A 1ZX6A 2LMJA 2J05A 3H0IA 5FWCA 2SEMA 4AFSC 1T0HA 4J9CA 1K76A 1YP5A 1PWTA 1UE9A 2K9GA 2RQTA 4F16A 1S1NA 5HCKA 2EKHA 1WFWA 4X1VA 1ABOA 4JZ4A 2EQIA 1M3BA 1K9AA 2KRNA 3U23A 1H8KA 5FWBA 1WXBA 1JEGA 1IO6A 5FW9A 2DA9A 2XMFA 3THKA 2EYZA 1BB9A 3O5ZA 4Y92A 1NG2A 2C0IA 2AZVA 2L3SA 4E6RA 2CT4A 2AKLA 1AWXA 2DBMA 2LP5A 1TUDA 1X6GA 2YSQA 1UGVA 1WXTA 2DRKA 5ECAA 3NPFA 1GCQC 2ESWA 1QWFA 3EGUA 1CSKA 1GRIA 2P4RA 1JU5C 2CH4A 1M3AA 1UG1A 2PNIA 1AWWA 2A08A 2E5KA 3TSZA 5I22A 1WXUA 2CT3A 4GLMA 2H8HA 2KBTA 2D8JA 4LUEA 2O31A 1K0SA 2K3BA 5GJWB 2FEIA 3KFVA 1JQQA 1AOJA 2PTKA 2EGCA 3EG2A 1HSQA 3SEMA 2CH4W 2DNUA 2CSQA 4OMPA 1AEYA 1M27C 1SEMA 3UF4A 1OPKA 2JS2A 1H3HA 2LQNA 1A0NB 3I5RA 2FPFA 1G83A 4FSSA 2EYXA 2YDLA 1AVZC 1QLYA 1X2KA 4J9IA 1RLPC 1NYGA 2KNBB 1M30A 2BZ8A 2F2WA 2KE9A 4F14A 2KR3A 4DEXA 2ED1A 4AFUC 4AG2C 1SHGA 4J9EA 2YT6A 1K4US 3IQLA 2KXDA 3VS7A 3JV3A 3PVLA 1KIKA 2GTJA 3TSWA 2DVJA 2B86A 2RQVA 5L23A 1NEGA 3VS2A 3EHQA 1M3CA 2MCNA 2BZXA 4F17A 2KYBA 2GBQA 3GBQA 2RPNA 5EC7A 2LNHB 2X3XD 3RBBB 1X27A 1SRMA 1PKSA 4RTUA 1JXMA 4J9FA 1U5SA 2EGEA 2I0NA 2VKNA 2KXCA 1Y57A 1GL5A 1X2QA 2C0OA 3UA7A 2JS0A 2CUDA 1ARKA 4HXJA 1CKBA 3QWYA 1M8MA 1MV3A 2D8HA 4CC2A 4Z8AA 5I11A 1WX6A 1T3LA 3VS1A 1RI9A 1B3QA 1GCQA 4J9DA 1E7OA 1PRLC 1HD3A 1E6GA 4RTTA 1Y0MA 1CKAA 2KYMA 3VS0A 1HJDA 4J9GA 1ZLMA 3R6NA 2X3WD 2RF0A 2L0AA 2DL8A 1KSWA 2F2VA 2FO0A 2KRSA 4LN2A 3C0CA 2OJ2A 2SRCA 2J6FA 1SSHA 4QT7A 3REBB 2GQIA 2J06A 1WYXA 2RNAA 2CSIA 1I1JA 1UFFA 2MIOA 4LE9A 1FYNA 1AWOA 1J3TA 1I0CA 2YUNA 3NMZC 4RTWA 2DL5A 2NWMA 2NUZA 2G6FX 4ZNXA 2LX7A 2DX1A 3EG0A 4HVUA 4LNPA 4JJBA 1NLPC 1SHFA 2K2MA 1GBQA 2YUPA 3H0HA 1E6HA 2D1XA 2KRMA 1X6BA 2ROLA 1YN8A 3EG3A 1BU1A 1PHTA 2QDLA 1AD5A 1XOVA 1OPLA 4RTYA 1YWOA 4AFQC 2RQWA 2O9SA 1H92A 5IHKA 4Z88A 2CDTA 1BK2A 2F2XA 2KT8A 2MOXA 2K79A 2FG0A 2EYYA 2LJ1A 4AFZC 1X69A 1GFCA 3ZL7C 1ABQA 1WI7A 2M0YA 1NM7A 1ZUKA 3CQTA 3NGPA 4OMMA 2GNCA 1WIEA 2EPDA 2JMAA 1UHFA 3PE0A 1V1CA 2JM8A 4IIMA 3I5SA 1G2BA 2AKKA 2GTOA 1UDLA 1Z9QA 2YUOA 2A28A 1QKXA 2FRWA 3RNJA 2RMOA 3A98A 1WLPB 2W10A 4ORZA 1EFNA 1UJYA 3I9QA 1X43A 2RQUA 1TG0A 1WDXA 2HEQA 2C0TA 1MV0B 1OOTA 1GFDA 3M0SA 5IXFA 2ABLA 4CC4B 1PNJA 1VYVA 2ED0A 2KGTA 1PRMC 2AK5A 2DE0X 1GCPA 1N5ZA 4EIKA 2DL3A 2L2PA 2VVKA 1JO8A 4M4ZA 1VYUA 2KEAA 1T0JA 1UTIA 2DLPA 2JM9A 3REAB 2CUBA 3M0QA 2DRMA 3NHNA 2J6KA 2KROA 2EVRA 2KT1A 2L3QA 4RUGA 1AWJA 1UJ0A 2O88A 2EGAA 1OV3A 3LH5A 2RQRA 1T3SA 1ZSGA 1BBZA 2EW3A 1K0XA 1GBRA 2FPEA 4HCKA 5IXBA 3VS3A 2HDAA 4J9HA 4ESRA 1NYFA 1LCKA 2OAWA 2DM1A 2JMCA 4OMQA 2DILA 2V1QA 1W6XA 3M0PA 1MUZA 3M0UA 2JT4A 2DF6A 2L3PA 1QKWA 3UATA 3VRYA 3M0RA 3VRZA 1W1FA 2O9VA 4D8DA 1NEBA 3FJ5A 1U06A 2JW4A 2BTTA 1ZUUA 3EHRA 2IIMA 3ULRB 4HVWA 2ENMA 4R0KA 1FMKA 4WCIA 2J7IA 4D8KA 4RTZA 1RLQC 3VS4A 5IH2A 1JXOA 4JJCA 4LUDA 5IHIA 2GGRA 1VA7A 1QWEA 1ZBJA 1TUCA 2LJ0A 1QCFA 5IHNA 2DMOA 1B07A 2EBPA 4J9BA 4RTVA 2HSPA 2M51A 2DL4A 1ZUYA 3VS5A 4IIOA 3QWXX 4OMOA 4GBQA 2O2OA 2LJ3A 4A63B 2VWFA 1I07A 1AZEA 4K11A 2DYBA 2RN8A 2J6OA 2DJQA 2K6DA 1YNZA 1NLOC 2EYWA 4Z89A 1YWPA 1PKTA 3EG1A 1UUEA 2HBWA 3VS6A 1OEBA 1Z9ZA 4AG1C 3M0TA 2ROTA 1UHCA 4RTXA 3TVTA 1YCSB 4OMLA 2HCKA 4DEYA 4CC3A 1KFZA 2W0ZA 3UA6A 2ECZA 5GJVB 2DBKA 1SPKA 3I35A 2LCSA 2V1RA 2A37A 1SRLA 1U3OA 2CREA 2D0NA 2JXBA 3PVQA 1UECA 4JJDA 2LZ6B 2OI3A 1KJWA 2PZ1A 2JTEA 1K1ZA 2FPDA 2BZYA 3SHWA 2FRYA 2AZSA 2YUQA 1RUWA 2A36A 4KRTA 2K7AA 1W70A 3H41A
chains in the Genus database with same CATH superfamily
1BIAA 2QGGA 5GAN2 2LT4A 3HP9A 1DJ7B 1VQ5T 1VQPQ 4J9CA 2YRVA 1K76A 2A3LA 3ER0A 8AT1B 3Q1JA 2K9GA 5HCKA 2CP0A 3CPWP 1M1KU 4D6WA 1V29B 4X1VA 4XK8E 1M3BA 1VOMA 1YHQT 1BCMA 3ZFJA 5DLQE 5GMKj 4XTUA 2DD4A 4RKUE 2KRNA 4HCBA 4M77E 5GANf 5FW9A 4OMFB 1VIFA 1KG1A 2EYZA 3EFRA 2XHCA 4EMKB 2CS7A 1IREB 2C0IA 2YLBA 3PT9A 4E6RA 2CT4A 2AKLA 2DBMA 2LP5A 1VQOA 1LOJA 3R6OA 2YSQA 4XU3A 2DRKA 3JCMf 1BYMA 3NPFA 1GCQC 2QQ9A 1Q86R 2WSFE 5LJ5e 1JU5C 1UG1A 2XKOC 3G4ST 2PNIA 4OB0B 4FYYB 1LVKA 2FHDA 1IGUA 3TSZA 5GMKi 4EMKC 1N27A 1G8XA 4ATOA 2Y90A 2D8JA 4F7UG 4C92A 1K0SA 2E65A 5LJ3f 2HQEA 3E9FA 4QVCA 5LJ5j 4KGVB 1KHCA 2DKGA 1M27C 3J7AF 2JS2A 3HL8A 2CP7A 2LQNA 4LDYA 3QIIA 4A53A 4TVRA 3I56Q 1G83A 4FSSA 5GMKl 1VQOQ 4KH1B 2GQVA 5FU7B 2KE9A 3CCQQ 2ED1A 4R56A 4BD3A 3CMAT 3CBOA 4XU0A 2JN0A 4C92B 1K4US 1JJ2A 3VS7A 1VQ8T 1PG5B 4PFPA 2CP2A 2RI5A 3X25B 1KHIA 2RHZA 4Y28E 2HMAA 2RQVA 2XDDA 1QW1A 1G3SA 1ZA2B 2KAFA 2AHJB 4F17A 4C0GA 5EC7A 2DETA 1NPPA 2DZCA 2BIVA 2VASA 3SB2A 4C0DC 4E7KA 3G6EA 3P8DA 1U5SA 3TCJA 2K5LA 1GL5A 2KXCA 1N9SA 5GAMh 3UA7A 3QSUA 2CUDA 1MV3A 4Z8AA 1NPRA 1XQHA 1NE8A 1WX6A 1T3LA 3VS1A 3I55A 4HT9A 3QXEB 5FU6C 5FU6B 2WSEE 1Q81R 3CD6Q 2DXTA 4E7IA 3CC4A 4F7UE 1JJ2P 5CCAA 2KYMA 1M9SA 3PNWC 2EWNA 5FRMA 1ZLMA 2RF0A 1YFNA 1ZQ1A 2F2VA 2DTOA 4J6XA 3VUZA 1Q82U 4M7DA 3HPWA 2KSSA 3A8OB 4QT7A 3CCVT 2HKNA 2J06A 2RNAA 5AYFA 2JZ2A 2CSIA 3JCMP 1PM3A 2DIGA 4LE9A 3LYIA 1J3TA 2QI2A 3JCMd 3MHXA 4JRKA 2NWMA 4M77G 1WPYA 2VV5A 3G6ET 1B34A 2AIRB 2K3YA 4IKFA 2XDPA 1D1AA 2LX9A 4C0FA 3V7RA 3L2UA 2QGFB 2O4XB 2OX7A 3JCMg 1Q7YC 1SHFA 2EKOA 2EQUA 3GF5A 5KCOA 3SWNA 3LGLA 1YN8A 2MYSA 1PHTA 1TXQA 5LJ3g 4LD6A 1QCOA 4NOYA 2JNGA 2O9SA 2NYSA 1BK2A 1D1BA 1W2BS 2KT8A 2EAYA 3AT1B 3V8KA 4PLIA 3GIBA 1KC8U 3JB9G 3CC2A 4MZPA 2HD0A 2DZ9A 3LW5E 2BKDN 1OULA 1M1GA 3OA6A 2EPDA 3L42A 3CCVA 4OF1A 4IIMA 3I5SA 3JCMV 2AKKA 5HY6A 3OYDA 1Z9QA 1N6AA 3CPWA 3RNJA 3L2QA 3A98A 2W10A 2V26A 1EFNA 3I9QA 2RJCA 2M16A 3HFNA 1OOTA 1KC8R 3M0SA 3OS0A 4PJJA 1WZOA 2ABLA 4CC4B 4DA4A 1TTHB 2KGTA 1WQ7A 1GCPA 1N5ZA 3FLGA 4EIKA 4JS4A 1I4K1 1NJIU 2JTMA 2CP3A 2RJFA 2DL3A 1G3TA 4BACA 1U1SA 1UTIA 2OTLQ 5GANg 2DRMA 4M75G 1Q95G 4DQ2A 2KROA 2EVRA 2L3QA 4RUGA 4C0ZA 5KYNA 1VQLQ 1IGQA 3PFSA 1VQ5Q 1T3SA 1VQMT 4N4HA 4C92E 3VYHB 4HCKA 4E2FB 2X4YA 4OB3B 1R0BG 4FYWB 1NYFA 1LCKA 2OAWA 2V8JA 2QTVA 2V1QA 1D3BB 3M0PA 2E3IA 3M0UA 3NTHA 2LT1A 4DOVA 5LJ5h 3CC2Q 4D8DA 1NEBA 3FJ5A 3G7ZA 2JW4A 5DM7R 2QA4A 1K9MR 2QQSA 3EHRA 2NUTA 1FMKA 2QEXA 3CCUQ 2H3EB 4C92G 5GANd 2DYIA 5GANh 4JJCA 5IHIA 4ME7A 2OTJA 3E9GA 3A8HB 2GCXA 1YJ9T 1TUCA 2DMOA 4JS5A 1MNDA 4BDZA 1ZUYA 4Z02A 3VS5A 1WQWA 2RK2A 2LCCA 3QWXX 3M59A 1RI0A 4KH0B 4KUDK 1LNXA 5GAMf 1PD1A 1VQMA 1MMAA 1WJSA 5I21A 3FDRA 1Q7YU 2J6OA 2K6DA 4L59A 3J81E 4Z89A 3CCVQ 1BI0A 1PKTA 1UUEA 2HBWA 3RERA 4C8QA 1XJWB 4M77F 1ACMB 3M0TA 2OTJQ 3QBYA 1YITQ 1X75C 2LVMA 3PIPA 3JCMX 1Y71A 3H6ZA 5CQXA 1KFZA 4EPCA 2M1HA 3T9NA 2DBKA 2LCSA 1YJNQ 1SRLA 2EJGA 1RAAB 2LQKA 3EH2A 2D0NA 3BE3A 1VQPA 1UECA 4JJDA 1OZ2A 1KJWA 2BZYA 3SHWA 2O4XA 1IHVA 4QKUA 1YJ9A 2YUQA 4PNOA 1PD0A 3H41A 1K9MC 1YJ9Q 4HCCA 2HL3A 2DL7A 1WA7A 3HHTB 5D7UA 5DLOA 1AZGB 2JTFA 5AT1B 1VYTA 1I81A 4CC7A 4LD9K 1ZX6A 1ZA1B 1KD1R 2X4WA 4PK4A 2PQWA 4C5HA 1PWTA 1UE9A 4MMLA 3M55A 2RQTA 1S1NA 2CKKA 2EKHA 4M7AA 3VYGA 1M8VA 1C0MA 1S72T 3EGDA 3U23A 2D9TA 5FWBA 1WXBA 2RO0A 1Q86U 1JEGA 5KE2A 2QEXQ 2DA9A 2E70A 2XMFA 1Q82R 2DXCA 4C5IA 3G71T 4EMGA 2AZVA 3CMAA 4KGZB 2BUDA 1QVGP 1RAHB 3VU3C 3CXCP 2PVDB 2A7YA 2LC4A 3RIRA 5GAOp 1S72Q 1UB4A 2DJZA 2P4RA 1D1CA 1WHMA 2CH4A 4MDWA 4AMCA 1WHHA 3JCMQ 4CI0C 3MKDA 3V8LA 3RKYA 2E5KA 1WXUA 2VGNA 2XD0A 2COWA 2H8HA 2KBTA 2O31A 4M75F 3D7SB 2QK0A 5GJWB 1JQQA 2ZZDA 1M4ZA 3CCMT 3OBWA 2EGCA 5IN1A 2DTHA 2CH4W 1VQ9Q 4J6WA 3A8GB 1OPKA 5KYYA 3I55T 2YXYA 1S72A 3RDVA 2FZKB 1H3HA 2CZ6B 2E64A 3I5RA 1Y7XA 3CPFA 1M2VB 1UGSB 4M75B 1Q7YR 1RAFB 3WXMB 4ZTFA 4NL2A 1NBEB 1X2KA 1G3YA 2OAUA 5D6WA 3C4SA 1NYGA 4KULA 2F2WA 3G71A 2KR3A 4AFUC 4AG2C 3OYMA 3QYGB 2YT6A 3CCET 4PJOB 1D09B 1YJWA 2ZPGB 4QVZA 3I56T 1KIKA 2GTJA 3TSWA 2CP5A 2B86A 3X24B 4EMHA 1NEGA 3OYJA 4XTYA 2X4XA 3ZEHA 1VQ7Q 2VXFA 3CD6T 1VQNQ 2MCNA 3CMET 3GBQA 1D0XA 1X27A 1ZBXA 1X6OA 1F1BB 1PKSA 3WVEB 1Y96A 1QCNA 2RM4A 3ASKA 2VKNA 2I0NA 1Y57A 3P8HA 5CK9A 2C0OA 4HXJA 1EIFA 1M90R 5FRNA 3E2UA 3BDLA 1U8RA 4XU2A 4J9DA 3BFMA 3M54A 4RTTA 4M7DC 1Q81C 3VS0A 4HA8A 2HQHA 1YCYA 4XTWA 3ME9A 4XAXB 5LJ5f 1KQSA 2DL8A 1OU8A 3NFCA 2CGHA 1WGSA 1TSFA 2ZCFB 2SRCA 2J6FA 3REBB 4EDUA 2GQIA 4NL3A 1WYXA 1EZZB 1RACB 1YI2A 1FYNA 1AWOA 1I0CA 2YUNA 2HKQB 2NUZA 3A5ZB 2DX1A 3QJ6A 2ZPFB 3BW1A 1GBQA 1UEBA 3I55Q 4PFOA 2D1XA 4JLGA 3OSSC 2P84A 3MPUB 3GLXA 4RCCA 3PGGA 1BU1A 4M7AG 4ZGDB 4AFQC 5LJ5g 3HRUA 1H92A 5IHKA 5FROA 5FU7C 2CDTA 2K79A 2FG0A 2LJ1A 4OGCA 1GFCA 1ABQA 3CC7T 1NM7A 2P0PA 1M5Q1 4PJOD 1KQSS 4PJOG 4M7DE 1VQ7A 3OS2A 5EG2A 2HNIA 2GNCA 4JLIA 3JB9F 5GAMd 3GOXA 2RI3A 5LJ3e 5GAOm 1UHFA 2JM8A 2GTOA 1UDLA 4X9DA 3EGXA 4BE1A 3OYIA 1QKXA 4JUVA 4ORZA 2COZA 1X43A 4FYXB 4C8QD 2C0TA 4XTXA 1FMVA 1Q86C 5CQYA 3QG1A 4LDVA 2OTLA 1SG5A 2AK5A 2DE0X 3EG9B 5CKFA 2L2PA 3HRSA 1VYUA 2JM9A 2F5TX 4FCYA 3WVDB 2CUBA 1ZSZB 2KT1A 4M75A 3QPHA 3HRTA 1M90U 1N8RU 2EGAA 1OV3A 1O75A 3LH5A 1IXDA 4IURA 1ZSGA 1BBZA 2Y4XA 1UGRB 5IXBA 2LRQA 4ESRA 4XQ3A 4J83A 1UGQB 4OMQA 2DILA 5GAN6 2LTOA 4C5GA 1W6XA 1RAGB 5LJ5d 2DFUA 2L3PA 1VQOT 3VRYA 3VRZA 1VQNT 1PSFA 3MP1A 5HK0A 5GAOl 4HT8A 1ZUUA 5CKBA 4KGXB 3TQ7P 1VQLA 1VQPT 2ENMA 2E6ZA 2H3JA 3OYBA 1RLQC 2KDSA 3L2WA 3VS4A 3V7SA 1TU0B 3EFOA 5LJ3h 2GGRA 1VA7A 1ZBJA 2D0QB 5CKHA 2LJ0A 5IHNA 1Q81U 4J9BA 1K8AR 3MO8A 4IIOA 3MEWA 2QAZA 3OW2P 1WJRA 2VWFA 3L1AA 4GLKA 4MMKA 3TEEA 3JAME 1BI3A 4K11A 2DYBA 2DJQA 1YNZA 2NUPB 1BIBA 5GAN7 4M77C 2MMPA 2EYWA 1WHJA 3VS6A 4C92D 1OEBA 2ZGWA 4AG1C 4RTXA 4JJNK 3FRNA 2RB6A 1YCSB 4J7FA 4CC3A 5C0MA 3UA6A 1SPKA 3I35A 1QVGS 2V1RA 2DPPB 3CBMA 1O9SA 2CREA 1NJIC 1VQLT 3PVQA 3SDZA 1VQMQ 1BI1A 5DY9A 3V7CA 4A54A 1RL2A 2M02A 2FPDA 1EX4A 3GPLA 5CKEA 4X34A 3JRZA 1RUWA 2F69A 4A4EA 2K7AA 2JJ9A 3HFOA 4BE0A 3CPWS 4FT2A 2IPOB 4OMNA 3MCAB 4JPBW 3META 3H0FA 2LQWA 4WTOB 3GNGA 4HVVA 4M77B 1OYXA 2LMJA 1LJOA 4AFSC 1YP5A 3M4GA 2RK1A 4JRPA 1NZ9A 2PUKB 1KC8C 2LNVA 1ABOA 2VC8A 1VQ4T 2EQIA 4DBFA 4PJNA 1I8FA 4J7IA 1OQKA 1H8KA 2DEUA 4J5YA 2KI7A 3THKA 3O5ZA 4II1A 2YWWA 1D0ZA 4ELYC 4B6MA 2L3SA 2QG9B 5CIUA 1TUDA 2M9UA 3X26B 3G6EQ 1Y07A 1YHQQ 1YBYA 1WXTA 1QQJA 3TU4K 2YRCA 3I56A 1SF9A 1R77A 1YI2Q 4C92F 4OGEA 2HQXA 2KY9A 1M3AA 4E7LA 3VUBA 3OB9A 1W2BA 1QVFP 2RD1A 2A08A 5I22A 4M7DD 4OB2B 2EJFA 1MHNA 1YITT 3C95A 1M1KR 1WHLA 2PU9B 5GAMj 3M57A 4FSXA 2K3BA 2FEIA 3KFVA 4M78F 4A4FA 5KE3A 1AOJA 2PTKA 3EG2A 1HSQA 2QA4Q 4OB1B 2DNUA 2CSQA 2L89A 2EYQA 1RAIB 2QQBA 5KYUB 1A0NB 2FPFA 3M9QA 2HAXA 4PJOE 1M90C 4QQ6A 2YDLA 1AVZC 5L8RE 5KYXB 3FC3A 4FL6A 1QMCA 3PTAA 1B7TA 3KBGA 1K8AC 3CCQA 3QUIA 2BZ8A 4F14A 1RAEB 2G3RA 5KYWA 4A4HA 3IQLA 2WSCE 4A4KA 3DB4A 3QZ9B 9ATCB 5L23A 1VQ6Q 2HSEB 2YRDA 2CZ1B 4FM4B 3VS2A 1QVPA 3GP8A 3PIOA 2E3HA 4FW1A 5GAN4 1M3CA 5A2QE 2R5MA 2KYBA 2GBQA 3OS1A 2RPNA 2XI9A 2LNHB 3RBBB 1YJWQ 5KYXA 1G3WA 3AHUA 1JXMA 2DERA 2XG8D 1ZHIA 3CCST 4JDSA 1X2QA 1MMGA 2K57A 2JS0A 4KT0E 1CKBA 2BE9B 5A0GA 3QWYA 2D8HA 4CC2A 3JB9I 3OSVA 2K2VA 5GANe 1GCQA 1E7OA 1E6GA 4M7AC 3S3NA 2NUTB 3CCQT 2EFIA 2X3WD 3OYAA 3X20B 1KSWA 2FO0A 2KRSA 4M75D 4LN2A 3C0CA 5GMKe 1WNLA 5J26A 4YTLA 2JVVA 1SSHA 2Z0WA 3E1SA 2RHIA 3LGFA 3SD4A 3G1JA 4LDWA 4O5VA 1TUGB 1K73C 1I1JA 4LDXA 3OYCA 2MIOA 1GXIE 1I5OB 2DL5A 5CVIA 1HK9A 3HSBA 1MNEA 4ZNXA 3MP8A 4N4IA 3OYHA 8ATCB 4R55A 3MEAA 2ZPBB 3EG0A 4LNPA 3M5AA 2DEQA 1QVFA 1W2BP 1NLPC 3CBPA 4PL6A 3RMQA 1FX7A 2YUPA 2DAQA 1E6HA 2KRMA 3G4SQ 4DOWA 1X6BA 4JRIA 1N9RA 3EG3A 3CCMA 3EAEA 5CR2A 2K3XA 1XOVA 3OYYA 4LXCA 1NJIR 7AT1B 4ANJA 5CKDA 3QDFA 1FWZA 4Z88A 2ATCB 4DBRA 4E7SA 2F2XA 2E12A 1AHJB 4IUPA 1M1FA 2P4TA 4AFZC 1X69A 4RG2A 1ZUKA 4XTZA 4Y91A 2RHXA 1KQ2A 4C0DB 4OMMA 4E7HA 2E6NA 2F1LA 2JMAA 1TOVA 2PVGB 3PE0A 3QHSA 1G2BA 4LDUA 1VQ8A 5KYYB 2FRWA 2RMOA 2B8AA 1WLPB 4IUQA 1UJYA 4BI4A 3EFOB 3FIFA 4IUTA 1WDXA 1MV0B 2BE7D 2QQAA 4C92C 3CEYA 5IXFA 3QDRB 1TH7A 3OMCA 2EQJA 1VYVA 4EMKA 1PRMC 3CMEA 5KYUA 5GAN5 3E19A 2LCLA 1UGPB 2VVKA 1VQKA 4FT4A 4C8QE 1K8AU 2KEAA 4C8QG 1T0JA 2DLPA 1IRXA 3M0QA 1HXDA 4RG8A 2O88A 2DD5A 3CCLQ 2FYKA 2RQRA 4M7AF 1YHQA 3MEVA 2FPEA 2MK5A 3G71Q 1VUBA 4J9HA 3CC4T 4L5GA 5CO7A 2DM1A 2VYTA 3N5BB 3OMGA 1MUZA 1M2OA 3RKWA 2RHYA 3UATA 3CCJT 4M7DF 4WF2A 3INZA 1MMNA 4F7UA 4M7AD 4QVDA 3TREA 4CRIA 1G5VA 1OX9A 3OQ5A 2ZAEA 2BTTA 2V8IA 2QYZA 3RMSA 1KQ1A 2IIMA 3ULRB 4HVWA 4R0KA 3OW2A 3CXCS 4WCIA 5GMKm 4PJMA 3LWHA 3CCMQ 5IH2A 2VUBA 3P8BB 1OZ3A 1SSFA 3RKXA 3F70A 1D0YA 1B07A 4RTVA 3CCRA 2E10A 2IG0A 3SWNB 4KBMB 2DL4A 3JCMW 3M4YA 4M75E 1KK7A 2O2OA 2LJ3A 2XICA 4F7UB 2HL5C 1AZEA 2DK3A 5GAN8 1YJNT 4M77D 4N0AA 1MMDA 1NLOC 1VQ4A 3BY7A 1YWPA 3EG1A 5KH6A 1Z9ZA 2DIQA 1M2VA 4M78A 1V76A 3CC2T 4OMLA 2HCKA 1TS9A 1VQ7T 1WJQA 4MDXA 1LPLA 2ECZA 3L2VA 2GFAA 1TWBA 2KK4A 4J8OA 2Y4YA 4C8QF 1U3OA 2JXBA 2O01E 2EJ9A 1BI2A 4N4GA 5GANj 1RADB 5IAYA 1H641 1H3ZA 1XTDA 3CD6A 2PZ1A 3UDCA 3CC7Q 1K1ZA 2FRYA 2X9HA 2GF7A 1N8RC 2A36A 4KRTA 5IT9E 3HKSA 3NTIA 1C1AA 1Q82C 4E7ZA 3VJPA 4JZ3A 2MPXC 2V8KA 2OTLT 4O6JA 2CZ0B 2J05A 2ZPEB 3H0IA 3CCUA 5FWCA 2SEMA 3A8MB 1T0HA 3OYGA 4BY6C 2LQ8A 2WACA 4F16A 1YJNA 3M58A 1WFWA 2DVEA 3UPUA 2L3RA 2R58A 5GAOn 1B34B 2KQWA 4JZ4A 4F04B 4ZN3A 1K9AA 3JCMc 2DXUA 1PC0A 4M78E 2A0FB 3MEUA 4M7AB 5J3BA 2KMTA 1IO6A 2CZ7B 1K73U 5HKCA 1BB9A 3EGDB 4MZMA 3OYNA 4Y92A 3NTKA 1NG2A 1C6VX 2E5QA 1AWXA 4GY5A 2PUOB 1X6GA 1UGVA 5ECAA 4OP0A 4VUBA 2QA4T 2KVQG 4J6YA 5GAMg 2ESWA 1ZSZC 1QWFA 5I2MA 4BB7A 3FJPA 3RUXA 3EGUA 1CSKA 1GRIA 2P0KA 2F5KA 4P5NA 5FLXE 1AWWA 4C8QC 4BDYA 2DTIA 2CT3A 2YLCA 5GAMe 3KXTA 4Q5WA 4GLMA 3CMEQ 4LUEA 1PCXA 3FEOA 3CCUT 1VQ5A 3FB9A 2EIFA 3CCSA 3SEMA 1QP3A 3PMIA 4OMPA 4DBHA 4C5EA 4PJOC 1AEYA 1SEMA 4FYVB 3UF4A 1YIJA 5LJ3d 4C8QB 3CCJQ 2MAMA 2EYXA 5J39A 2VB6A 3JCMh 1QLYA 2HZYA 4HCZA 4J9IA 4ZN1A 1RLPC 3S3OA 2XIDA 2KNBB 1M30A 2QXFA 1KQSP 1RABB 4DEXA 2EQKA 1SHGA 4J9EA 1SKUB 1R0CB 2KXDA 3CCEQ 3JV3A 1K9MU 5A0DA 3PVLA 5I2SA 2DVJA 1YIJQ 4BUGA 3VV0A 2D6FA 4PJOA 3EGXB 3G4SA 3EHQA 2I2LA 1JRIA 2BZXA 3C12A 2NLUA 3HTRA 4RMOA 2X3XD 3EFSA 4A4GA 4BI3A 1SRMA 3GNFB 4PLLA 1MGQA 4RTUA 2AT1B 4XTVA 5LL6S 4ZGEB 2FVUA 2X4JA 4V2SA 2QDYB 2IVWA 4J9FA 2L8DA 3DLMA 2EGEA 2E41A 3QO3A 1D3BA 4PJOF 3UT1A 4M75C 3RR6A 1ARKA 3S3MA 1M8MA 1P92A 5I11A 1YIJT 1RI9A 1B3QA 2LDMA 1ZSZA 3JCMJ 1PRLC 4N0AC 1HD3A 3M56A 2RA2A 3LLRA 2R5AA 1Y0MA 3LH0A 1CKAA 1JB0E 1Y96B 4E7JA 4M7DB 1HJDA 4J9GA 3R6NA 5HK3A 3LX7A 2L0AA 3SFMA 1R8OB 2X51A 1VQNA 2OJ2A 2C06A 1K73R 5GAN3 3DB3A 1I5LA 4B9WA 1VQ4Q 1W4SA 2QEXT 3VKIA 2RI2A 1HYOA 1UFFA 1U1TA 3JSCA 3RESA 3NMZC 4RTWA 4IUUA 2JOYA 5GAOr 2EQMA 3CMAQ 2X35A 2G6FX 3PMTA 1KD1U 2LX7A 1QP2A 3CC4Q 4AT1B 4HVUA 4JJBA 3JB9H 1OI1A 2K2MA 4M78G 3H0HA 1VQKT 4NS5A 1VQ9T 3OY9A 2ROLA 3EH1A 3JB9J 3SWNC 1VQ6A 2MWPA 2PVOB 3QKJA 2QDLA 1AD5A 3CXCA 4QQGA 1OPLA 1FMWA 1YWOA 4RTYA 2R57A 2YHTA 2RQWA 3KUFA 1QVGA 3QJYA 5KCHA 3DKMA 2ZPIB 1PSEA 2MOXA 3OYKA 2EYYA 4IUVA 1JJ2S 3ZL7C 2M0YA 1WI7A 4X9CA 2ZPHB 4FU6A 3CQTA 3C94A 2RH2A 3NGPA 4BY6B 1WIEA 4ZGJB 5GAOq 3X28B 3CCRQ 1V1CA 4DBQA 6AT1B 3CCJA 1M1KC 4M77A 2DO3A 2XU8A 3CCEA 1YJWT 2YUOA 2A28A 4B9XA 2VGMA 2RQUA 1TG0A 3V8JA 2HEQA 3CCSQ 1GFDA 4RCBA 4M78D 3M53A 3MJXA 1IZ6A 1PNJA 2ED0A 3JCMb 1WHGA 2K4YA 3ZBDA 1JO8A 2VXEA 4M4ZA 1VQ9A 4HKEA 3CCRT 1X01A 3REAB 4F7UF 3NHNA 1VQ6T 2J6KA 1AT1B 3L2RA 4BI8B 2FZGB 2FZCB 1AWJA 1UJ0A 4QQDA 3L2ZA 3H8ZA 3A1PA 5CAIA 2RHUA 3OBYA 2EW3A 1K0XA 1GBRA 4JRQA 5D6XA 3UWNA 3EG9A 3VS3A 2HDAA 1IB8A 2QASA 2L5QA 4L6V5 3URGA 2MWOA 2JMCA 4BE2A 2K5FA 3H9NA 2K5IA 5A0LA 2JT4A 2DF6A 3QZ5B 1QKWA 1BCOA 3M0RA 1W1FA 1VQKQ 2FL7A 3S6WA 2O9VA 5C6SA 3OYEA 2P0QA 4PFZA 1U06A 4MZTA 4FW2A 2M0OA 3OYLA 3O8VA 3A8LB 3CCLA 2J7IA 3J80E 4D8KA 4RTZA 2FB7A 1IHWA 1YI2T 4E47A 2E4HA 3OW2S 4M7AE 2MI6A 1JXOA 2XDBA 1N8RR 4LUDA 5M9OA 2CYZB 1YITA 4OVAA 1QWEA 2QTXA 1VIEA 1QVFS 1QCFA 4PKCC 2EBPA 2HSPA 2M51A 3DLLA 1OU9A 5GMKh 4OMOA 4GBQA 3BDUA 5KYWB 4A63B 1WHKA 2COYA 1I07A 4PJLA 1XNIA 2XK0A 2RN8A 2MF2A 5LJ3j 4XU1A 4ELZC 4UC4A 2DXBA 2E1HA 3JCMe 3LWIA 2RJEA 2ROTA 1UHCA 2RJDA 4M78C 3TVTA 3CC7A 5D6YA 2JUFA 1FXXA 4DEYA 2NUPA 3OS5A 2W0ZA 5GJVB 4M7DG 4KUIA 2A37A 3JB9D 3CCLT 2GFUA 2QQRA 3MP6A 2LZ6B 2OI3A 4ZTJA 1KD1C 1JBMA 2JTEA 2HBPA 1BKBA 2CP6A 1VQ8Q 4M78B 2OTJT 2AZSA 4QW2A 3QYHB 4FIBA 1W70A 3OYFA 1OX8A
chains in the Genus database with same CATH topology
4JZ3A 4OMNA 4JPBW 2DL7A 3H0FA 1WA7A 1AZGB 2LQWA 4HVVA 1VYTA 4CC7A 1ZX6A 2LMJA 2J05A 3H0IA 5FWCA 2SEMA 4AFSC 1T0HA 4J9CA 1K76A 1YP5A 1PWTA 1UE9A 2K9GA 2RQTA 4F16A 1S1NA 5HCKA 2EKHA 1WFWA 4X1VA 1ABOA 4JZ4A 2EQIA 1M3BA 1K9AA 2KRNA 3U23A 1H8KA 5FWBA 1WXBA 1JEGA 1IO6A 5FW9A 2DA9A 2XMFA 3THKA 2EYZA 1BB9A 3O5ZA 4Y92A 1NG2A 2C0IA 2AZVA 2L3SA 4E6RA 2CT4A 2AKLA 1AWXA 2DBMA 2LP5A 1TUDA 1X6GA 2YSQA 1UGVA 1WXTA 2DRKA 5ECAA 3NPFA 1GCQC 2ESWA 1QWFA 3EGUA 1CSKA 1GRIA 2P4RA 1JU5C 2CH4A 1M3AA 1UG1A 2PNIA 1AWWA 2A08A 2E5KA 3TSZA 5I22A 1WXUA 2CT3A 4GLMA 2H8HA 2KBTA 2D8JA 4LUEA 2O31A 1K0SA 2K3BA 5GJWB 2FEIA 3KFVA 1JQQA 1AOJA 2PTKA 2EGCA 3EG2A 1HSQA 3SEMA 2CH4W 2DNUA 2CSQA 4OMPA 1AEYA 1M27C 1SEMA 3UF4A 1OPKA 2JS2A 1H3HA 2LQNA 1A0NB 3I5RA 2FPFA 1G83A 4FSSA 2EYXA 2YDLA 1AVZC 1QLYA 1X2KA 4J9IA 1RLPC 1NYGA 2KNBB 1M30A 2BZ8A 2F2WA 2KE9A 4F14A 2KR3A 4DEXA 2ED1A 4AFUC 4AG2C 1SHGA 4J9EA 2YT6A 1K4US 3IQLA 2KXDA 3VS7A 3JV3A 3PVLA 1KIKA 2GTJA 3TSWA 2DVJA 2B86A 2RQVA 5L23A 1NEGA 3VS2A 3EHQA 1M3CA 2MCNA 2BZXA 4F17A 2KYBA 2GBQA 3GBQA 2RPNA 5EC7A 2LNHB 2X3XD 3RBBB 1X27A 1SRMA 1PKSA 4RTUA 1JXMA 4J9FA 1U5SA 2EGEA 2I0NA 2VKNA 2KXCA 1Y57A 1GL5A 1X2QA 2C0OA 3UA7A 2JS0A 2CUDA 1ARKA 4HXJA 1CKBA 3QWYA 1M8MA 1MV3A 2D8HA 4CC2A 4Z8AA 5I11A 1WX6A 1T3LA 3VS1A 1RI9A 1B3QA 1GCQA 4J9DA 1E7OA 1PRLC 1HD3A 1E6GA 4RTTA 1Y0MA 1CKAA 2KYMA 3VS0A 1HJDA 4J9GA 1ZLMA 3R6NA 2X3WD 2RF0A 2L0AA 2DL8A 1KSWA 2F2VA 2FO0A 2KRSA 4LN2A 3C0CA 2OJ2A 2SRCA 2J6FA 1SSHA 4QT7A 3REBB 2GQIA 2J06A 1WYXA 2RNAA 2CSIA 1I1JA 1UFFA 2MIOA 4LE9A 1FYNA 1AWOA 1J3TA 1I0CA 2YUNA 3NMZC 4RTWA 2DL5A 2NWMA 2NUZA 2G6FX 4ZNXA 2LX7A 2DX1A 3EG0A 4HVUA 4LNPA 4JJBA 1NLPC 1SHFA 2K2MA 1GBQA 2YUPA 3H0HA 1E6HA 2D1XA 2KRMA 1X6BA 2ROLA 1YN8A 3EG3A 1BU1A 1PHTA 2QDLA 1AD5A 1XOVA 1OPLA 4RTYA 1YWOA 4AFQC 2RQWA 2O9SA 1H92A 5IHKA 4Z88A 2CDTA 1BK2A 2F2XA 2KT8A 2MOXA 2K79A 2FG0A 2EYYA 2LJ1A 4AFZC 1X69A 1GFCA 3ZL7C 1ABQA 1WI7A 2M0YA 1NM7A 1ZUKA 3CQTA 3NGPA 4OMMA 2GNCA 1WIEA 2EPDA 2JMAA 1UHFA 3PE0A 1V1CA 2JM8A 4IIMA 3I5SA 1G2BA 2AKKA 2GTOA 1UDLA 1Z9QA 2YUOA 2A28A 1QKXA 2FRWA 3RNJA 2RMOA 3A98A 1WLPB 2W10A 4ORZA 1EFNA 1UJYA 3I9QA 1X43A 2RQUA 1TG0A 1WDXA 2HEQA 2C0TA 1MV0B 1OOTA 1GFDA 3M0SA 5IXFA 2ABLA 4CC4B 1PNJA 1VYVA 2ED0A 2KGTA 1PRMC 2AK5A 2DE0X 1GCPA 1N5ZA 4EIKA 2DL3A 2L2PA 2VVKA 1JO8A 4M4ZA 1VYUA 2KEAA 1T0JA 1UTIA 2DLPA 2JM9A 3REAB 2CUBA 3M0QA 2DRMA 3NHNA 2J6KA 2KROA 2EVRA 2KT1A 2L3QA 4RUGA 1AWJA 1UJ0A 2O88A 2EGAA 1OV3A 3LH5A 2RQRA 1T3SA 1ZSGA 1BBZA 2EW3A 1K0XA 1GBRA 2FPEA 4HCKA 5IXBA 3VS3A 2HDAA 4J9HA 4ESRA 1NYFA 1LCKA 2OAWA 2DM1A 2JMCA 4OMQA 2DILA 2V1QA 1W6XA 3M0PA 1MUZA 3M0UA 2JT4A 2DF6A 2L3PA 1QKWA 3UATA 3VRYA 3M0RA 3VRZA 1W1FA 2O9VA 4D8DA 1NEBA 3FJ5A 1U06A 2JW4A 2BTTA 1ZUUA 3EHRA 2IIMA 3ULRB 4HVWA 2ENMA 4R0KA 1FMKA 4WCIA 2J7IA 4D8KA 4RTZA 1RLQC 3VS4A 5IH2A 1JXOA 4JJCA 4LUDA 5IHIA 2GGRA 1VA7A 1QWEA 1ZBJA 1TUCA 2LJ0A 1QCFA 5IHNA 2DMOA 1B07A 2EBPA 4J9BA 4RTVA 2HSPA 2M51A 2DL4A 1ZUYA 3VS5A 4IIOA 3QWXX 4OMOA 4GBQA 2O2OA 2LJ3A 4A63B 2VWFA 1I07A 1AZEA 4K11A 2DYBA 2RN8A 2J6OA 2DJQA 2K6DA 1YNZA 1NLOC 2EYWA 4Z89A 1YWPA 1PKTA 3EG1A 1UUEA 2HBWA 3VS6A 1OEBA 1Z9ZA 4AG1C 3M0TA 2ROTA 1UHCA 4RTXA 3TVTA 1YCSB 4OMLA 2HCKA 4DEYA 4CC3A 1KFZA 2W0ZA 3UA6A 2ECZA 5GJVB 2DBKA 1SPKA 3I35A 2LCSA 2V1RA 2A37A 1SRLA 1U3OA 2CREA 2D0NA 2JXBA 3PVQA 1UECA 4JJDA 2LZ6B 2OI3A 1KJWA 2PZ1A 2JTEA 1K1ZA 2FPDA 2BZYA 3SHWA 2FRYA 2AZSA 2YUQA 1RUWA 2A36A 4KRTA 2K7AA 1W70A 3H41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ3 A;  4OMN A;  4JPB W;  2DL7 A;  3H0F A;  1WA7 A;  1AZG B;  2LQW A;  4HVV A;  1VYT A;  4CC7 A;  1ZX6 A;  2LMJ A;  2J05 A;  3H0I A;  5FWC A;  2SEM A;  4AFS C;  1T0H A;  4J9C A;  1K76 A;  1YP5 A;  1PWT A;  1UE9 A;  2K9G A;  2RQT A;  4F16 A;  1S1N A;  5HCK A;  2EKH A;  1WFW A;  4X1V A;  1ABO A;  4JZ4 A;  2EQI A;  1M3B A;  1K9A A;  2KRN A;  3U23 A;  1H8K A;  5FWB A;  1WXB A;  1JEG A;  1IO6 A;  5FW9 A;  2DA9 A;  2XMF A;  3THK A;  2EYZ A;  1BB9 A;  3O5Z A;  4Y92 A;  1NG2 A;  2C0I A;  2AZV A;  2L3S A;  4E6R A;  2CT4 A;  2AKL A;  1AWX A;  2DBM A;  2LP5 A;  1TUD A;  1X6G A;  2YSQ A;  1UGV A;  1WXT A;  2DRK A;  5ECA A;  3NPF A;  1GCQ C;  2ESW A;  1QWF A;  3EGU A;  1CSK A;  1GRI A;  2P4R A;  1JU5 C;  2CH4 A;  1M3A A;  1UG1 A;  2PNI A;  1AWW A;  2A08 A;  2E5K A;  3TSZ A;  5I22 A;  1WXU A;  2CT3 A;  4GLM A;  2H8H A;  2KBT A;  2D8J A;  4LUE A;  2O31 A;  1K0S A;  2K3B A;  5GJW B;  2FEI A;  3KFV A;  1JQQ A;  1AOJ A;  2PTK A;  2EGC A;  3EG2 A;  1HSQ A;  3SEM A;  2CH4 W;  2DNU A;  2CSQ A;  4OMP A;  1AEY A;  1M27 C;  1SEM A;  3UF4 A;  1OPK A;  2JS2 A;  1H3H A;  2LQN A;  1A0N B;  3I5R A;  2FPF A;  1G83 A;  4FSS A;  2EYX A;  2YDL A;  1AVZ C;  1QLY A;  1X2K A;  4J9I A;  1RLP C;  1NYG A;  2KNB B;  1M30 A;  2BZ8 A;  2F2W A;  2KE9 A;  4F14 A;  2KR3 A;  4DEX A;  2ED1 A;  4AFU C;  4AG2 C;  1SHG A;  4J9E A;  2YT6 A;  1K4U S;  3IQL A;  2KXD A;  3VS7 A;  3JV3 A;  3PVL A;  1KIK A;  2GTJ A;  3TSW A;  2DVJ A;  2B86 A;  2RQV A;  5L23 A;  1NEG A;  3VS2 A;  3EHQ A;  1M3C A;  2MCN A;  2BZX A;  4F17 A;  2KYB A;  2GBQ A;  3GBQ A;  2RPN A;  5EC7 A;  2LNH B;  2X3X D;  3RBB B;  1X27 A;  1SRM A;  1PKS A;  4RTU A;  1JXM A;  4J9F A;  1U5S A;  2EGE A;  2I0N A;  2VKN A;  2KXC A;  1Y57 A;  1GL5 A;  1X2Q A;  2C0O A;  3UA7 A;  2JS0 A;  2CUD A;  1ARK A;  4HXJ A;  1CKB A;  3QWY A;  1M8M A;  1MV3 A;  2D8H A;  4CC2 A;  4Z8A A;  5I11 A;  1WX6 A;  1T3L A;  3VS1 A;  1RI9 A;  1B3Q A;  1GCQ A;  4J9D A;  1E7O A;  1PRL C;  1HD3 A;  1E6G A;  4RTT A;  1Y0M A;  1CKA A;  2KYM A;  3VS0 A;  1HJD A;  4J9G A;  1ZLM A;  3R6N A;  2X3W D;  2RF0 A;  2L0A A;  2DL8 A;  1KSW A;  2F2V A;  2FO0 A;  2KRS A;  4LN2 A;  3C0C A;  2OJ2 A;  2SRC A;  2J6F A;  1SSH A;  4QT7 A;  3REB B;  2GQI A;  2J06 A;  1WYX A;  2RNA A;  2CSI A;  1I1J A;  1UFF A;  2MIO A;  4LE9 A;  1FYN A;  1AWO A;  1J3T A;  1I0C A;  2YUN A;  3NMZ C;  4RTW A;  2DL5 A;  2NWM A;  2NUZ A;  2G6F X;  4ZNX A;  2LX7 A;  2DX1 A;  3EG0 A;  4HVU A;  4LNP A;  4JJB A;  1NLP C;  1SHF A;  2K2M A;  1GBQ A;  2YUP A;  3H0H A;  1E6H A;  2D1X A;  2KRM A;  1X6B A;  2ROL A;  1YN8 A;  3EG3 A;  1BU1 A;  1PHT A;  2QDL A;  1AD5 A;  1XOV A;  1OPL A;  4RTY A;  1YWO A;  4AFQ C;  2RQW A;  2O9S A;  1H92 A;  5IHK A;  4Z88 A;  2CDT A;  1BK2 A;  2F2X A;  2KT8 A;  2MOX A;  2K79 A;  2FG0 A;  2EYY A;  2LJ1 A;  4AFZ C;  1X69 A;  1GFC A;  3ZL7 C;  1ABQ A;  1WI7 A;  2M0Y A;  1NM7 A;  1ZUK A;  3CQT A;  3NGP A;  4OMM A;  2GNC A;  1WIE A;  2EPD A;  2JMA A;  1UHF A;  3PE0 A;  1V1C A;  2JM8 A;  4IIM A;  3I5S A;  1G2B A;  2AKK A;  2GTO A;  1UDL A;  1Z9Q A;  2YUO A;  2A28 A;  1QKX A;  2FRW A;  3RNJ A;  2RMO A;  3A98 A;  1WLP B;  2W10 A;  4ORZ A;  1EFN A;  1UJY A;  3I9Q A;  1X43 A;  2RQU A;  1TG0 A;  1WDX A;  2HEQ A;  2C0T A;  1MV0 B;  1OOT A;  1GFD A;  3M0S A;  5IXF A;  2ABL A;  4CC4 B;  1PNJ A;  1VYV A;  2ED0 A;  2KGT A;  1PRM C;  2AK5 A;  2DE0 X;  1GCP A;  1N5Z A;  4EIK A;  2DL3 A;  2L2P A;  2VVK A;  1JO8 A;  4M4Z A;  1VYU A;  2KEA A;  1T0J A;  1UTI A;  2DLP A;  2JM9 A;  3REA B;  2CUB A;  3M0Q A;  2DRM A;  3NHN A;  2J6K A;  2KRO A;  2EVR A;  2KT1 A;  2L3Q A;  4RUG A;  1AWJ A;  1UJ0 A;  2O88 A;  2EGA A;  1OV3 A;  3LH5 A;  2RQR A;  1T3S A;  1ZSG A;  1BBZ A;  2EW3 A;  1K0X A;  1GBR A;  2FPE A;  4HCK A;  5IXB A;  3VS3 A;  2HDA A;  4J9H A;  4ESR A;  1NYF A;  1LCK A;  2OAW A;  2DM1 A;  2JMC A;  4OMQ A;  2DIL A;  2V1Q A;  1W6X A;  3M0P A;  1MUZ A;  3M0U A;  2JT4 A;  2DF6 A;  2L3P A;  1QKW A;  3UAT A;  3VRY A;  3M0R A;  3VRZ A;  1W1F A;  2O9V A;  4D8D A;  1NEB A;  3FJ5 A;  1U06 A;  2JW4 A;  2BTT A;  1ZUU A;  3EHR A;  2IIM A;  3ULR B;  4HVW A;  2ENM A;  4R0K A;  1FMK A;  4WCI A;  2J7I A;  4D8K A;  4RTZ A;  1RLQ C;  3VS4 A;  5IH2 A;  1JXO A;  4JJC A;  4LUD A;  5IHI A;  2GGR A;  1VA7 A;  1QWE A;  1ZBJ A;  1TUC A;  2LJ0 A;  1QCF A;  5IHN A;  2DMO A;  1B07 A;  2EBP A;  4J9B A;  4RTV A;  2HSP A;  2M51 A;  2DL4 A;  1ZUY A;  3VS5 A;  4IIO A;  3QWX X;  4OMO A;  4GBQ A;  2O2O A;  2LJ3 A;  4A63 B;  2VWF A;  1I07 A;  1AZE A;  4K11 A;  2DYB A;  2RN8 A;  2J6O A;  2DJQ A;  2K6D A;  1YNZ A;  1NLO C;  2EYW A;  4Z89 A;  1YWP A;  1PKT A;  3EG1 A;  1UUE A;  2HBW A;  3VS6 A;  1OEB A;  1Z9Z A;  4AG1 C;  3M0T A;  2ROT A;  1UHC A;  4RTX A;  3TVT A;  1YCS B;  4OML A;  2HCK A;  4DEY A;  4CC3 A;  1KFZ A;  2W0Z A;  3UA6 A;  2ECZ A;  5GJV B;  2DBK A;  1SPK A;  3I35 A;  2LCS A;  2V1R A;  2A37 A;  1SRL A;  1U3O A;  2CRE A;  2D0N A;  2JXB A;  3PVQ A;  1UEC A;  4JJD A;  2LZ6 B;  2OI3 A;  1KJW A;  2PZ1 A;  2JTE A;  1K1Z A;  2FPD A;  2BZY A;  3SHW A;  2FRY A;  2AZS A;  2YUQ A;  1RUW A;  2A36 A;  4KRT A;  2K7A A;  1W70 A;  3H41 A; 
#chains in the Genus database with same CATH topology
 1BIA A;  2QGG A;  5GAN 2;  2LT4 A;  3HP9 A;  1DJ7 B;  1VQ5 T;  1VQP Q;  4J9C A;  2YRV A;  1K76 A;  2A3L A;  3ER0 A;  8AT1 B;  3Q1J A;  2K9G A;  5HCK A;  2CP0 A;  3CPW P;  1M1K U;  4D6W A;  1V29 B;  4X1V A;  4XK8 E;  1M3B A;  1VOM A;  1YHQ T;  1BCM A;  3ZFJ A;  5DLQ E;  5GMK j;  4XTU A;  2DD4 A;  4RKU E;  2KRN A;  4HCB A;  4M77 E;  5GAN f;  5FW9 A;  4OMF B;  1VIF A;  1KG1 A;  2EYZ A;  3EFR A;  2XHC A;  4EMK B;  2CS7 A;  1IRE B;  2C0I A;  2YLB A;  3PT9 A;  4E6R A;  2CT4 A;  2AKL A;  2DBM A;  2LP5 A;  1VQO A;  1LOJ A;  3R6O A;  2YSQ A;  4XU3 A;  2DRK A;  3JCM f;  1BYM A;  3NPF A;  1GCQ C;  2QQ9 A;  1Q86 R;  2WSF E;  5LJ5 e;  1JU5 C;  1UG1 A;  2XKO C;  3G4S T;  2PNI A;  4OB0 B;  4FYY B;  1LVK A;  2FHD A;  1IGU A;  3TSZ A;  5GMK i;  4EMK C;  1N27 A;  1G8X A;  4ATO A;  2Y90 A;  2D8J A;  4F7U G;  4C92 A;  1K0S A;  2E65 A;  5LJ3 f;  2HQE A;  3E9F A;  4QVC A;  5LJ5 j;  4KGV B;  1KHC A;  2DKG A;  1M27 C;  3J7A F;  2JS2 A;  3HL8 A;  2CP7 A;  2LQN A;  4LDY A;  3QII A;  4A53 A;  4TVR A;  3I56 Q;  1G83 A;  4FSS A;  5GMK l;  1VQO Q;  4KH1 B;  2GQV A;  5FU7 B;  2KE9 A;  3CCQ Q;  2ED1 A;  4R56 A;  4BD3 A;  3CMA T;  3CBO A;  4XU0 A;  2JN0 A;  4C92 B;  1K4U S;  1JJ2 A;  3VS7 A;  1VQ8 T;  1PG5 B;  4PFP A;  2CP2 A;  2RI5 A;  3X25 B;  1KHI A;  2RHZ A;  4Y28 E;  2HMA A;  2RQV A;  2XDD A;  1QW1 A;  1G3S A;  1ZA2 B;  2KAF A;  2AHJ B;  4F17 A;  4C0G A;  5EC7 A;  2DET A;  1NPP A;  2DZC A;  2BIV A;  2VAS A;  3SB2 A;  4C0D C;  4E7K A;  3G6E A;  3P8D A;  1U5S A;  3TCJ A;  2K5L A;  1GL5 A;  2KXC A;  1N9S A;  5GAM h;  3UA7 A;  3QSU A;  2CUD A;  1MV3 A;  4Z8A A;  1NPR A;  1XQH A;  1NE8 A;  1WX6 A;  1T3L A;  3VS1 A;  3I55 A;  4HT9 A;  3QXE B;  5FU6 C;  5FU6 B;  2WSE E;  1Q81 R;  3CD6 Q;  2DXT A;  4E7I A;  3CC4 A;  4F7U E;  1JJ2 P;  5CCA A;  2KYM A;  1M9S A;  3PNW C;  2EWN A;  5FRM A;  1ZLM A;  2RF0 A;  1YFN A;  1ZQ1 A;  2F2V A;  2DTO A;  4J6X A;  3VUZ A;  1Q82 U;  4M7D A;  3HPW A;  2KSS A;  3A8O B;  4QT7 A;  3CCV T;  2HKN A;  2J06 A;  2RNA A;  5AYF A;  2JZ2 A;  2CSI A;  3JCM P;  1PM3 A;  2DIG A;  4LE9 A;  3LYI A;  1J3T A;  2QI2 A;  3JCM d;  3MHX A;  4JRK A;  2NWM A;  4M77 G;  1WPY A;  2VV5 A;  3G6E T;  1B34 A;  2AIR B;  2K3Y A;  4IKF A;  2XDP A;  1D1A A;  2LX9 A;  4C0F A;  3V7R A;  3L2U A;  2QGF B;  2O4X B;  2OX7 A;  3JCM g;  1Q7Y C;  1SHF A;  2EKO A;  2EQU A;  3GF5 A;  5KCO A;  3SWN A;  3LGL A;  1YN8 A;  2MYS A;  1PHT A;  1TXQ A;  5LJ3 g;  4LD6 A;  1QCO A;  4NOY A;  2JNG A;  2O9S A;  2NYS A;  1BK2 A;  1D1B A;  1W2B S;  2KT8 A;  2EAY A;  3AT1 B;  3V8K A;  4PLI A;  3GIB A;  1KC8 U;  3JB9 G;  3CC2 A;  4MZP A;  2HD0 A;  2DZ9 A;  3LW5 E;  2BKD N;  1OUL A;  1M1G A;  3OA6 A;  2EPD A;  3L42 A;  3CCV A;  4OF1 A;  4IIM A;  3I5S A;  3JCM V;  2AKK A;  5HY6 A;  3OYD A;  1Z9Q A;  1N6A A;  3CPW A;  3RNJ A;  3L2Q A;  3A98 A;  2W10 A;  2V26 A;  1EFN A;  3I9Q A;  2RJC A;  2M16 A;  3HFN A;  1OOT A;  1KC8 R;  3M0S A;  3OS0 A;  4PJJ A;  1WZO A;  2ABL A;  4CC4 B;  4DA4 A;  1TTH B;  2KGT A;  1WQ7 A;  1GCP A;  1N5Z A;  3FLG A;  4EIK A;  4JS4 A;  1I4K 1;  1NJI U;  2JTM A;  2CP3 A;  2RJF A;  2DL3 A;  1G3T A;  4BAC A;  1U1S A;  1UTI A;  2OTL Q;  5GAN g;  2DRM A;  4M75 G;  1Q95 G;  4DQ2 A;  2KRO A;  2EVR A;  2L3Q A;  4RUG A;  4C0Z A;  5KYN A;  1VQL Q;  1IGQ A;  3PFS A;  1VQ5 Q;  1T3S A;  1VQM T;  4N4H A;  4C92 E;  3VYH B;  4HCK A;  4E2F B;  2X4Y A;  4OB3 B;  1R0B G;  4FYW B;  1NYF A;  1LCK A;  2OAW A;  2V8J A;  2QTV A;  2V1Q A;  1D3B B;  3M0P A;  2E3I A;  3M0U A;  3NTH A;  2LT1 A;  4DOV A;  5LJ5 h;  3CC2 Q;  4D8D A;  1NEB A;  3FJ5 A;  3G7Z A;  2JW4 A;  5DM7 R;  2QA4 A;  1K9M R;  2QQS A;  3EHR A;  2NUT A;  1FMK A;  2QEX A;  3CCU Q;  2H3E B;  4C92 G;  5GAN d;  2DYI A;  5GAN h;  4JJC A;  5IHI A;  4ME7 A;  2OTJ A;  3E9G A;  3A8H B;  2GCX A;  1YJ9 T;  1TUC A;  2DMO A;  4JS5 A;  1MND A;  4BDZ A;  1ZUY A;  4Z02 A;  3VS5 A;  1WQW A;  2RK2 A;  2LCC A;  3QWX X;  3M59 A;  1RI0 A;  4KH0 B;  4KUD K;  1LNX A;  5GAM f;  1PD1 A;  1VQM A;  1MMA A;  1WJS A;  5I21 A;  3FDR A;  1Q7Y U;  2J6O A;  2K6D A;  4L59 A;  3J81 E;  4Z89 A;  3CCV Q;  1BI0 A;  1PKT A;  1UUE A;  2HBW A;  3RER A;  4C8Q A;  1XJW B;  4M77 F;  1ACM B;  3M0T A;  2OTJ Q;  3QBY A;  1YIT Q;  1X75 C;  2LVM A;  3PIP A;  3JCM X;  1Y71 A;  3H6Z A;  5CQX A;  1KFZ A;  4EPC A;  2M1H A;  3T9N A;  2DBK A;  2LCS A;  1YJN Q;  1SRL A;  2EJG A;  1RAA B;  2LQK A;  3EH2 A;  2D0N A;  3BE3 A;  1VQP A;  1UEC A;  4JJD A;  1OZ2 A;  1KJW A;  2BZY A;  3SHW A;  2O4X A;  1IHV A;  4QKU A;  1YJ9 A;  2YUQ A;  4PNO A;  1PD0 A;  3H41 A;  1K9M C;  1YJ9 Q;  4HCC A;  2HL3 A;  2DL7 A;  1WA7 A;  3HHT B;  5D7U A;  5DLO A;  1AZG B;  2JTF A;  5AT1 B;  1VYT A;  1I81 A;  4CC7 A;  4LD9 K;  1ZX6 A;  1ZA1 B;  1KD1 R;  2X4W A;  4PK4 A;  2PQW A;  4C5H A;  1PWT A;  1UE9 A;  4MML A;  3M55 A;  2RQT A;  1S1N A;  2CKK A;  2EKH A;  4M7A A;  3VYG A;  1M8V A;  1C0M A;  1S72 T;  3EGD A;  3U23 A;  2D9T A;  5FWB A;  1WXB A;  2RO0 A;  1Q86 U;  1JEG A;  5KE2 A;  2QEX Q;  2DA9 A;  2E70 A;  2XMF A;  1Q82 R;  2DXC A;  4C5I A;  3G71 T;  4EMG A;  2AZV A;  3CMA A;  4KGZ B;  2BUD A;  1QVG P;  1RAH B;  3VU3 C;  3CXC P;  2PVD B;  2A7Y A;  2LC4 A;  3RIR A;  5GAO p;  1S72 Q;  1UB4 A;  2DJZ A;  2P4R A;  1D1C A;  1WHM A;  2CH4 A;  4MDW A;  4AMC A;  1WHH A;  3JCM Q;  4CI0 C;  3MKD A;  3V8L A;  3RKY A;  2E5K A;  1WXU A;  2VGN A;  2XD0 A;  2COW A;  2H8H A;  2KBT A;  2O31 A;  4M75 F;  3D7S B;  2QK0 A;  5GJW B;  1JQQ A;  2ZZD A;  1M4Z A;  3CCM T;  3OBW A;  2EGC A;  5IN1 A;  2DTH A;  2CH4 W;  1VQ9 Q;  4J6W A;  3A8G B;  1OPK A;  5KYY A;  3I55 T;  2YXY A;  1S72 A;  3RDV A;  2FZK B;  1H3H A;  2CZ6 B;  2E64 A;  3I5R A;  1Y7X A;  3CPF A;  1M2V B;  1UGS B;  4M75 B;  1Q7Y R;  1RAF B;  3WXM B;  4ZTF A;  4NL2 A;  1NBE B;  1X2K A;  1G3Y A;  2OAU A;  5D6W A;  3C4S A;  1NYG A;  4KUL A;  2F2W A;  3G71 A;  2KR3 A;  4AFU C;  4AG2 C;  3OYM A;  3QYG B;  2YT6 A;  3CCE T;  4PJO B;  1D09 B;  1YJW A;  2ZPG B;  4QVZ A;  3I56 T;  1KIK A;  2GTJ A;  3TSW A;  2CP5 A;  2B86 A;  3X24 B;  4EMH A;  1NEG A;  3OYJ A;  4XTY A;  2X4X A;  3ZEH A;  1VQ7 Q;  2VXF A;  3CD6 T;  1VQN Q;  2MCN A;  3CME T;  3GBQ A;  1D0X A;  1X27 A;  1ZBX A;  1X6O A;  1F1B B;  1PKS A;  3WVE B;  1Y96 A;  1QCN A;  2RM4 A;  3ASK A;  2VKN A;  2I0N A;  1Y57 A;  3P8H A;  5CK9 A;  2C0O A;  4HXJ A;  1EIF A;  1M90 R;  5FRN A;  3E2U A;  3BDL A;  1U8R A;  4XU2 A;  4J9D A;  3BFM A;  3M54 A;  4RTT A;  4M7D C;  1Q81 C;  3VS0 A;  4HA8 A;  2HQH A;  1YCY A;  4XTW A;  3ME9 A;  4XAX B;  5LJ5 f;  1KQS A;  2DL8 A;  1OU8 A;  3NFC A;  2CGH A;  1WGS A;  1TSF A;  2ZCF B;  2SRC A;  2J6F A;  3REB B;  4EDU A;  2GQI A;  4NL3 A;  1WYX A;  1EZZ B;  1RAC B;  1YI2 A;  1FYN A;  1AWO A;  1I0C A;  2YUN A;  2HKQ B;  2NUZ A;  3A5Z B;  2DX1 A;  3QJ6 A;  2ZPF B;  3BW1 A;  1GBQ A;  1UEB A;  3I55 Q;  4PFO A;  2D1X A;  4JLG A;  3OSS C;  2P84 A;  3MPU B;  3GLX A;  4RCC A;  3PGG A;  1BU1 A;  4M7A G;  4ZGD B;  4AFQ C;  5LJ5 g;  3HRU A;  1H92 A;  5IHK A;  5FRO A;  5FU7 C;  2CDT A;  2K79 A;  2FG0 A;  2LJ1 A;  4OGC A;  1GFC A;  1ABQ A;  3CC7 T;  1NM7 A;  2P0P A;  1M5Q 1;  4PJO D;  1KQS S;  4PJO G;  4M7D E;  1VQ7 A;  3OS2 A;  5EG2 A;  2HNI A;  2GNC A;  4JLI A;  3JB9 F;  5GAM d;  3GOX A;  2RI3 A;  5LJ3 e;  5GAO m;  1UHF A;  2JM8 A;  2GTO A;  1UDL A;  4X9D A;  3EGX A;  4BE1 A;  3OYI A;  1QKX A;  4JUV A;  4ORZ A;  2COZ A;  1X43 A;  4FYX B;  4C8Q D;  2C0T A;  4XTX A;  1FMV A;  1Q86 C;  5CQY A;  3QG1 A;  4LDV A;  2OTL A;  1SG5 A;  2AK5 A;  2DE0 X;  3EG9 B;  5CKF A;  2L2P A;  3HRS A;  1VYU A;  2JM9 A;  2F5T X;  4FCY A;  3WVD B;  2CUB A;  1ZSZ B;  2KT1 A;  4M75 A;  3QPH A;  3HRT A;  1M90 U;  1N8R U;  2EGA A;  1OV3 A;  1O75 A;  3LH5 A;  1IXD A;  4IUR A;  1ZSG A;  1BBZ A;  2Y4X A;  1UGR B;  5IXB A;  2LRQ A;  4ESR A;  4XQ3 A;  4J83 A;  1UGQ B;  4OMQ A;  2DIL A;  5GAN 6;  2LTO A;  4C5G A;  1W6X A;  1RAG B;  5LJ5 d;  2DFU A;  2L3P A;  1VQO T;  3VRY A;  3VRZ A;  1VQN T;  1PSF A;  3MP1 A;  5HK0 A;  5GAO l;  4HT8 A;  1ZUU A;  5CKB A;  4KGX B;  3TQ7 P;  1VQL A;  1VQP T;  2ENM A;  2E6Z A;  2H3J A;  3OYB A;  1RLQ C;  2KDS A;  3L2W A;  3VS4 A;  3V7S A;  1TU0 B;  3EFO A;  5LJ3 h;  2GGR A;  1VA7 A;  1ZBJ A;  2D0Q B;  5CKH A;  2LJ0 A;  5IHN A;  1Q81 U;  4J9B A;  1K8A R;  3MO8 A;  4IIO A;  3MEW A;  2QAZ A;  3OW2 P;  1WJR A;  2VWF A;  3L1A A;  4GLK A;  4MMK A;  3TEE A;  3JAM E;  1BI3 A;  4K11 A;  2DYB A;  2DJQ A;  1YNZ A;  2NUP B;  1BIB A;  5GAN 7;  4M77 C;  2MMP A;  2EYW A;  1WHJ A;  3VS6 A;  4C92 D;  1OEB A;  2ZGW A;  4AG1 C;  4RTX A;  4JJN K;  3FRN A;  2RB6 A;  1YCS B;  4J7F A;  4CC3 A;  5C0M A;  3UA6 A;  1SPK A;  3I35 A;  1QVG S;  2V1R A;  2DPP B;  3CBM A;  1O9S A;  2CRE A;  1NJI C;  1VQL T;  3PVQ A;  3SDZ A;  1VQM Q;  1BI1 A;  5DY9 A;  3V7C A;  4A54 A;  1RL2 A;  2M02 A;  2FPD A;  1EX4 A;  3GPL A;  5CKE A;  4X34 A;  3JRZ A;  1RUW A;  2F69 A;  4A4E A;  2K7A A;  2JJ9 A;  3HFO A;  4BE0 A;  3CPW S;  4FT2 A;  2IPO B;  4OMN A;  3MCA B;  4JPB W;  3MET A;  3H0F A;  2LQW A;  4WTO B;  3GNG A;  4HVV A;  4M77 B;  1OYX A;  2LMJ A;  1LJO A;  4AFS C;  1YP5 A;  3M4G A;  2RK1 A;  4JRP A;  1NZ9 A;  2PUK B;  1KC8 C;  2LNV A;  1ABO A;  2VC8 A;  1VQ4 T;  2EQI A;  4DBF A;  4PJN A;  1I8F A;  4J7I A;  1OQK A;  1H8K A;  2DEU A;  4J5Y A;  2KI7 A;  3THK A;  3O5Z A;  4II1 A;  2YWW A;  1D0Z A;  4ELY C;  4B6M A;  2L3S A;  2QG9 B;  5CIU A;  1TUD A;  2M9U A;  3X26 B;  3G6E Q;  1Y07 A;  1YHQ Q;  1YBY A;  1WXT A;  1QQJ A;  3TU4 K;  2YRC A;  3I56 A;  1SF9 A;  1R77 A;  1YI2 Q;  4C92 F;  4OGE A;  2HQX A;  2KY9 A;  1M3A A;  4E7L A;  3VUB A;  3OB9 A;  1W2B A;  1QVF P;  2RD1 A;  2A08 A;  5I22 A;  4M7D D;  4OB2 B;  2EJF A;  1MHN A;  1YIT T;  3C95 A;  1M1K R;  1WHL A;  2PU9 B;  5GAM j;  3M57 A;  4FSX A;  2K3B A;  2FEI A;  3KFV A;  4M78 F;  4A4F A;  5KE3 A;  1AOJ A;  2PTK A;  3EG2 A;  1HSQ A;  2QA4 Q;  4OB1 B;  2DNU A;  2CSQ A;  2L89 A;  2EYQ A;  1RAI B;  2QQB A;  5KYU B;  1A0N B;  2FPF A;  3M9Q A;  2HAX A;  4PJO E;  1M90 C;  4QQ6 A;  2YDL A;  1AVZ C;  5L8R E;  5KYX B;  3FC3 A;  4FL6 A;  1QMC A;  3PTA A;  1B7T A;  3KBG A;  1K8A C;  3CCQ A;  3QUI A;  2BZ8 A;  4F14 A;  1RAE B;  2G3R A;  5KYW A;  4A4H A;  3IQL A;  2WSC E;  4A4K A;  3DB4 A;  3QZ9 B;  9ATC B;  5L23 A;  1VQ6 Q;  2HSE B;  2YRD A;  2CZ1 B;  4FM4 B;  3VS2 A;  1QVP A;  3GP8 A;  3PIO A;  2E3H A;  4FW1 A;  5GAN 4;  1M3C A;  5A2Q E;  2R5M A;  2KYB A;  2GBQ A;  3OS1 A;  2RPN A;  2XI9 A;  2LNH B;  3RBB B;  1YJW Q;  5KYX A;  1G3W A;  3AHU A;  1JXM A;  2DER A;  2XG8 D;  1ZHI A;  3CCS T;  4JDS A;  1X2Q A;  1MMG A;  2K57 A;  2JS0 A;  4KT0 E;  1CKB A;  2BE9 B;  5A0G A;  3QWY A;  2D8H A;  4CC2 A;  3JB9 I;  3OSV A;  2K2V A;  5GAN e;  1GCQ A;  1E7O A;  1E6G A;  4M7A C;  3S3N A;  2NUT B;  3CCQ T;  2EFI A;  2X3W D;  3OYA A;  3X20 B;  1KSW A;  2FO0 A;  2KRS A;  4M75 D;  4LN2 A;  3C0C A;  5GMK e;  1WNL A;  5J26 A;  4YTL A;  2JVV A;  1SSH A;  2Z0W A;  3E1S A;  2RHI A;  3LGF A;  3SD4 A;  3G1J A;  4LDW A;  4O5V A;  1TUG B;  1K73 C;  1I1J A;  4LDX A;  3OYC A;  2MIO A;  1GXI E;  1I5O B;  2DL5 A;  5CVI A;  1HK9 A;  3HSB A;  1MNE A;  4ZNX A;  3MP8 A;  4N4I A;  3OYH A;  8ATC B;  4R55 A;  3MEA A;  2ZPB B;  3EG0 A;  4LNP A;  3M5A A;  2DEQ A;  1QVF A;  1W2B P;  1NLP C;  3CBP A;  4PL6 A;  3RMQ A;  1FX7 A;  2YUP A;  2DAQ A;  1E6H A;  2KRM A;  3G4S Q;  4DOW A;  1X6B A;  4JRI A;  1N9R A;  3EG3 A;  3CCM A;  3EAE A;  5CR2 A;  2K3X A;  1XOV A;  3OYY A;  4LXC A;  1NJI R;  7AT1 B;  4ANJ A;  5CKD A;  3QDF A;  1FWZ A;  4Z88 A;  2ATC B;  4DBR A;  4E7S A;  2F2X A;  2E12 A;  1AHJ B;  4IUP A;  1M1F A;  2P4T A;  4AFZ C;  1X69 A;  4RG2 A;  1ZUK A;  4XTZ A;  4Y91 A;  2RHX A;  1KQ2 A;  4C0D B;  4OMM A;  4E7H A;  2E6N A;  2F1L A;  2JMA A;  1TOV A;  2PVG B;  3PE0 A;  3QHS A;  1G2B A;  4LDU A;  1VQ8 A;  5KYY B;  2FRW A;  2RMO A;  2B8A A;  1WLP B;  4IUQ A;  1UJY A;  4BI4 A;  3EFO B;  3FIF A;  4IUT A;  1WDX A;  1MV0 B;  2BE7 D;  2QQA A;  4C92 C;  3CEY A;  5IXF A;  3QDR B;  1TH7 A;  3OMC A;  2EQJ A;  1VYV A;  4EMK A;  1PRM C;  3CME A;  5KYU A;  5GAN 5;  3E19 A;  2LCL A;  1UGP B;  2VVK A;  1VQK A;  4FT4 A;  4C8Q E;  1K8A U;  2KEA A;  4C8Q G;  1T0J A;  2DLP A;  1IRX A;  3M0Q A;  1HXD A;  4RG8 A;  2O88 A;  2DD5 A;  3CCL Q;  2FYK A;  2RQR A;  4M7A F;  1YHQ A;  3MEV A;  2FPE A;  2MK5 A;  3G71 Q;  1VUB A;  4J9H A;  3CC4 T;  4L5G A;  5CO7 A;  2DM1 A;  2VYT A;  3N5B B;  3OMG A;  1MUZ A;  1M2O A;  3RKW A;  2RHY A;  3UAT A;  3CCJ T;  4M7D F;  4WF2 A;  3INZ A;  1MMN A;  4F7U A;  4M7A D;  4QVD A;  3TRE A;  4CRI A;  1G5V A;  1OX9 A;  3OQ5 A;  2ZAE A;  2BTT A;  2V8I A;  2QYZ A;  3RMS A;  1KQ1 A;  2IIM A;  3ULR B;  4HVW A;  4R0K A;  3OW2 A;  3CXC S;  4WCI A;  5GMK m;  4PJM A;  3LWH A;  3CCM Q;  5IH2 A;  2VUB A;  3P8B B;  1OZ3 A;  1SSF A;  3RKX A;  3F70 A;  1D0Y A;  1B07 A;  4RTV A;  3CCR A;  2E10 A;  2IG0 A;  3SWN B;  4KBM B;  2DL4 A;  3JCM W;  3M4Y A;  4M75 E;  1KK7 A;  2O2O A;  2LJ3 A;  2XIC A;  4F7U B;  2HL5 C;  1AZE A;  2DK3 A;  5GAN 8;  1YJN T;  4M77 D;  4N0A A;  1MMD A;  1NLO C;  1VQ4 A;  3BY7 A;  1YWP A;  3EG1 A;  5KH6 A;  1Z9Z A;  2DIQ A;  1M2V A;  4M78 A;  1V76 A;  3CC2 T;  4OML A;  2HCK A;  1TS9 A;  1VQ7 T;  1WJQ A;  4MDX A;  1LPL A;  2ECZ A;  3L2V A;  2GFA A;  1TWB A;  2KK4 A;  4J8O A;  2Y4Y A;  4C8Q F;  1U3O A;  2JXB A;  2O01 E;  2EJ9 A;  1BI2 A;  4N4G A;  5GAN j;  1RAD B;  5IAY A;  1H64 1;  1H3Z A;  1XTD A;  3CD6 A;  2PZ1 A;  3UDC A;  3CC7 Q;  1K1Z A;  2FRY A;  2X9H A;  2GF7 A;  1N8R C;  2A36 A;  4KRT A;  5IT9 E;  3HKS A;  3NTI A;  1C1A A;  1Q82 C;  4E7Z A;  3VJP A;  4JZ3 A;  2MPX C;  2V8K A;  2OTL T;  4O6J A;  2CZ0 B;  2J05 A;  2ZPE B;  3H0I A;  3CCU A;  5FWC A;  2SEM A;  3A8M B;  1T0H A;  3OYG A;  4BY6 C;  2LQ8 A;  2WAC A;  4F16 A;  1YJN A;  3M58 A;  1WFW A;  2DVE A;  3UPU A;  2L3R A;  2R58 A;  5GAO n;  1B34 B;  2KQW A;  4JZ4 A;  4F04 B;  4ZN3 A;  1K9A A;  3JCM c;  2DXU A;  1PC0 A;  4M78 E;  2A0F B;  3MEU A;  4M7A B;  5J3B A;  2KMT A;  1IO6 A;  2CZ7 B;  1K73 U;  5HKC A;  1BB9 A;  3EGD B;  4MZM A;  3OYN A;  4Y92 A;  3NTK A;  1NG2 A;  1C6V X;  2E5Q A;  1AWX A;  4GY5 A;  2PUO B;  1X6G A;  1UGV A;  5ECA A;  4OP0 A;  4VUB A;  2QA4 T;  2KVQ G;  4J6Y A;  5GAM g;  2ESW A;  1ZSZ C;  1QWF A;  5I2M A;  4BB7 A;  3FJP A;  3RUX A;  3EGU A;  1CSK A;  1GRI A;  2P0K A;  2F5K A;  4P5N A;  5FLX E;  1AWW A;  4C8Q C;  4BDY A;  2DTI A;  2CT3 A;  2YLC A;  5GAM e;  3KXT A;  4Q5W A;  4GLM A;  3CME Q;  4LUE A;  1PCX A;  3FEO A;  3CCU T;  1VQ5 A;  3FB9 A;  2EIF A;  3CCS A;  3SEM A;  1QP3 A;  3PMI A;  4OMP A;  4DBH A;  4C5E A;  4PJO C;  1AEY A;  1SEM A;  4FYV B;  3UF4 A;  1YIJ A;  5LJ3 d;  4C8Q B;  3CCJ Q;  2MAM A;  2EYX A;  5J39 A;  2VB6 A;  3JCM h;  1QLY A;  2HZY A;  4HCZ A;  4J9I A;  4ZN1 A;  1RLP C;  3S3O A;  2XID A;  2KNB B;  1M30 A;  2QXF A;  1KQS P;  1RAB B;  4DEX A;  2EQK A;  1SHG A;  4J9E A;  1SKU B;  1R0C B;  2KXD A;  3CCE Q;  3JV3 A;  1K9M U;  5A0D A;  3PVL A;  5I2S A;  2DVJ A;  1YIJ Q;  4BUG A;  3VV0 A;  2D6F A;  4PJO A;  3EGX B;  3G4S A;  3EHQ A;  2I2L A;  1JRI A;  2BZX A;  3C12 A;  2NLU A;  3HTR A;  4RMO A;  2X3X D;  3EFS A;  4A4G A;  4BI3 A;  1SRM A;  3GNF B;  4PLL A;  1MGQ A;  4RTU A;  2AT1 B;  4XTV A;  5LL6 S;  4ZGE B;  2FVU A;  2X4J A;  4V2S A;  2QDY B;  2IVW A;  4J9F A;  2L8D A;  3DLM A;  2EGE A;  2E41 A;  3QO3 A;  1D3B A;  4PJO F;  3UT1 A;  4M75 C;  3RR6 A;  1ARK A;  3S3M A;  1M8M A;  1P92 A;  5I11 A;  1YIJ T;  1RI9 A;  1B3Q A;  2LDM A;  1ZSZ A;  3JCM J;  1PRL C;  4N0A C;  1HD3 A;  3M56 A;  2RA2 A;  3LLR A;  2R5A A;  1Y0M A;  3LH0 A;  1CKA A;  1JB0 E;  1Y96 B;  4E7J A;  4M7D B;  1HJD A;  4J9G A;  3R6N A;  5HK3 A;  3LX7 A;  2L0A A;  3SFM A;  1R8O B;  2X51 A;  1VQN A;  2OJ2 A;  2C06 A;  1K73 R;  5GAN 3;  3DB3 A;  1I5L A;  4B9W A;  1VQ4 Q;  1W4S A;  2QEX T;  3VKI A;  2RI2 A;  1HYO A;  1UFF A;  1U1T A;  3JSC A;  3RES A;  3NMZ C;  4RTW A;  4IUU A;  2JOY A;  5GAO r;  2EQM A;  3CMA Q;  2X35 A;  2G6F X;  3PMT A;  1KD1 U;  2LX7 A;  1QP2 A;  3CC4 Q;  4AT1 B;  4HVU A;  4JJB A;  3JB9 H;  1OI1 A;  2K2M A;  4M78 G;  3H0H A;  1VQK T;  4NS5 A;  1VQ9 T;  3OY9 A;  2ROL A;  3EH1 A;  3JB9 J;  3SWN C;  1VQ6 A;  2MWP A;  2PVO B;  3QKJ A;  2QDL A;  1AD5 A;  3CXC A;  4QQG A;  1OPL A;  1FMW A;  1YWO A;  4RTY A;  2R57 A;  2YHT A;  2RQW A;  3KUF A;  1QVG A;  3QJY A;  5KCH A;  3DKM A;  2ZPI B;  1PSE A;  2MOX A;  3OYK A;  2EYY A;  4IUV A;  1JJ2 S;  3ZL7 C;  2M0Y A;  1WI7 A;  4X9C A;  2ZPH B;  4FU6 A;  3CQT A;  3C94 A;  2RH2 A;  3NGP A;  4BY6 B;  1WIE A;  4ZGJ B;  5GAO q;  3X28 B;  3CCR Q;  1V1C A;  4DBQ A;  6AT1 B;  3CCJ A;  1M1K C;  4M77 A;  2DO3 A;  2XU8 A;  3CCE A;  1YJW T;  2YUO A;  2A28 A;  4B9X A;  2VGM A;  2RQU A;  1TG0 A;  3V8J A;  2HEQ A;  3CCS Q;  1GFD A;  4RCB A;  4M78 D;  3M53 A;  3MJX A;  1IZ6 A;  1PNJ A;  2ED0 A;  3JCM b;  1WHG A;  2K4Y A;  3ZBD A;  1JO8 A;  2VXE A;  4M4Z A;  1VQ9 A;  4HKE A;  3CCR T;  1X01 A;  3REA B;  4F7U F;  3NHN A;  1VQ6 T;  2J6K A;  1AT1 B;  3L2R A;  4BI8 B;  2FZG B;  2FZC B;  1AWJ A;  1UJ0 A;  4QQD A;  3L2Z A;  3H8Z A;  3A1P A;  5CAI A;  2RHU A;  3OBY A;  2EW3 A;  1K0X A;  1GBR A;  4JRQ A;  5D6X A;  3UWN A;  3EG9 A;  3VS3 A;  2HDA A;  1IB8 A;  2QAS A;  2L5Q A;  4L6V 5;  3URG A;  2MWO A;  2JMC A;  4BE2 A;  2K5F A;  3H9N A;  2K5I A;  5A0L A;  2JT4 A;  2DF6 A;  3QZ5 B;  1QKW A;  1BCO A;  3M0R A;  1W1F A;  1VQK Q;  2FL7 A;  3S6W A;  2O9V A;  5C6S A;  3OYE A;  2P0Q A;  4PFZ A;  1U06 A;  4MZT A;  4FW2 A;  2M0O A;  3OYL A;  3O8V A;  3A8L B;  3CCL A;  2J7I A;  3J80 E;  4D8K A;  4RTZ A;  2FB7 A;  1IHW A;  1YI2 T;  4E47 A;  2E4H A;  3OW2 S;  4M7A E;  2MI6 A;  1JXO A;  2XDB A;  1N8R R;  4LUD A;  5M9O A;  2CYZ B;  1YIT A;  4OVA A;  1QWE A;  2QTX A;  1VIE A;  1QVF S;  1QCF A;  4PKC C;  2EBP A;  2HSP A;  2M51 A;  3DLL A;  1OU9 A;  5GMK h;  4OMO A;  4GBQ A;  3BDU A;  5KYW B;  4A63 B;  1WHK A;  2COY A;  1I07 A;  4PJL A;  1XNI A;  2XK0 A;  2RN8 A;  2MF2 A;  5LJ3 j;  4XU1 A;  4ELZ C;  4UC4 A;  2DXB A;  2E1H A;  3JCM e;  3LWI A;  2RJE A;  2ROT A;  1UHC A;  2RJD A;  4M78 C;  3TVT A;  3CC7 A;  5D6Y A;  2JUF A;  1FXX A;  4DEY A;  2NUP A;  3OS5 A;  2W0Z A;  5GJV B;  4M7D G;  4KUI A;  2A37 A;  3JB9 D;  3CCL T;  2GFU A;  2QQR A;  3MP6 A;  2LZ6 B;  2OI3 A;  4ZTJ A;  1KD1 C;  1JBM A;  2JTE A;  2HBP A;  1BKB A;  2CP6 A;  1VQ8 Q;  4M78 B;  2OTJ T;  2AZS A;  4QW2 A;  3QYH B;  4FIB A;  1W70 A;  3OYF A;  1OX8 A; 
#chains in the Genus database with same CATH homology
 4JZ3 A;  4OMN A;  4JPB W;  2DL7 A;  3H0F A;  1WA7 A;  1AZG B;  2LQW A;  4HVV A;  1VYT A;  4CC7 A;  1ZX6 A;  2LMJ A;  2J05 A;  3H0I A;  5FWC A;  2SEM A;  4AFS C;  1T0H A;  4J9C A;  1K76 A;  1YP5 A;  1PWT A;  1UE9 A;  2K9G A;  2RQT A;  4F16 A;  1S1N A;  5HCK A;  2EKH A;  1WFW A;  4X1V A;  1ABO A;  4JZ4 A;  2EQI A;  1M3B A;  1K9A A;  2KRN A;  3U23 A;  1H8K A;  5FWB A;  1WXB A;  1JEG A;  1IO6 A;  5FW9 A;  2DA9 A;  2XMF A;  3THK A;  2EYZ A;  1BB9 A;  3O5Z A;  4Y92 A;  1NG2 A;  2C0I A;  2AZV A;  2L3S A;  4E6R A;  2CT4 A;  2AKL A;  1AWX A;  2DBM A;  2LP5 A;  1TUD A;  1X6G A;  2YSQ A;  1UGV A;  1WXT A;  2DRK A;  5ECA A;  3NPF A;  1GCQ C;  2ESW A;  1QWF A;  3EGU A;  1CSK A;  1GRI A;  2P4R A;  1JU5 C;  2CH4 A;  1M3A A;  1UG1 A;  2PNI A;  1AWW A;  2A08 A;  2E5K A;  3TSZ A;  5I22 A;  1WXU A;  2CT3 A;  4GLM A;  2H8H A;  2KBT A;  2D8J A;  4LUE A;  2O31 A;  1K0S A;  2K3B A;  5GJW B;  2FEI A;  3KFV A;  1JQQ A;  1AOJ A;  2PTK A;  2EGC A;  3EG2 A;  1HSQ A;  3SEM A;  2CH4 W;  2DNU A;  2CSQ A;  4OMP A;  1AEY A;  1M27 C;  1SEM A;  3UF4 A;  1OPK A;  2JS2 A;  1H3H A;  2LQN A;  1A0N B;  3I5R A;  2FPF A;  1G83 A;  4FSS A;  2EYX A;  2YDL A;  1AVZ C;  1QLY A;  1X2K A;  4J9I A;  1RLP C;  1NYG A;  2KNB B;  1M30 A;  2BZ8 A;  2F2W A;  2KE9 A;  4F14 A;  2KR3 A;  4DEX A;  2ED1 A;  4AFU C;  4AG2 C;  1SHG A;  4J9E A;  2YT6 A;  1K4U S;  3IQL A;  2KXD A;  3VS7 A;  3JV3 A;  3PVL A;  1KIK A;  2GTJ A;  3TSW A;  2DVJ A;  2B86 A;  2RQV A;  5L23 A;  1NEG A;  3VS2 A;  3EHQ A;  1M3C A;  2MCN A;  2BZX A;  4F17 A;  2KYB A;  2GBQ A;  3GBQ A;  2RPN A;  5EC7 A;  2LNH B;  2X3X D;  3RBB B;  1X27 A;  1SRM A;  1PKS A;  4RTU A;  1JXM A;  4J9F A;  1U5S A;  2EGE A;  2I0N A;  2VKN A;  2KXC A;  1Y57 A;  1GL5 A;  1X2Q A;  2C0O A;  3UA7 A;  2JS0 A;  2CUD A;  1ARK A;  4HXJ A;  1CKB A;  3QWY A;  1M8M A;  1MV3 A;  2D8H A;  4CC2 A;  4Z8A A;  5I11 A;  1WX6 A;  1T3L A;  3VS1 A;  1RI9 A;  1B3Q A;  1GCQ A;  4J9D A;  1E7O A;  1PRL C;  1HD3 A;  1E6G A;  4RTT A;  1Y0M A;  1CKA A;  2KYM A;  3VS0 A;  1HJD A;  4J9G A;  1ZLM A;  3R6N A;  2X3W D;  2RF0 A;  2L0A A;  2DL8 A;  1KSW A;  2F2V A;  2FO0 A;  2KRS A;  4LN2 A;  3C0C A;  2OJ2 A;  2SRC A;  2J6F A;  1SSH A;  4QT7 A;  3REB B;  2GQI A;  2J06 A;  1WYX A;  2RNA A;  2CSI A;  1I1J A;  1UFF A;  2MIO A;  4LE9 A;  1FYN A;  1AWO A;  1J3T A;  1I0C A;  2YUN A;  3NMZ C;  4RTW A;  2DL5 A;  2NWM A;  2NUZ A;  2G6F X;  4ZNX A;  2LX7 A;  2DX1 A;  3EG0 A;  4HVU A;  4LNP A;  4JJB A;  1NLP C;  1SHF A;  2K2M A;  1GBQ A;  2YUP A;  3H0H A;  1E6H A;  2D1X A;  2KRM A;  1X6B A;  2ROL A;  1YN8 A;  3EG3 A;  1BU1 A;  1PHT A;  2QDL A;  1AD5 A;  1XOV A;  1OPL A;  4RTY A;  1YWO A;  4AFQ C;  2RQW A;  2O9S A;  1H92 A;  5IHK A;  4Z88 A;  2CDT A;  1BK2 A;  2F2X A;  2KT8 A;  2MOX A;  2K79 A;  2FG0 A;  2EYY A;  2LJ1 A;  4AFZ C;  1X69 A;  1GFC A;  3ZL7 C;  1ABQ A;  1WI7 A;  2M0Y A;  1NM7 A;  1ZUK A;  3CQT A;  3NGP A;  4OMM A;  2GNC A;  1WIE A;  2EPD A;  2JMA A;  1UHF A;  3PE0 A;  1V1C A;  2JM8 A;  4IIM A;  3I5S A;  1G2B A;  2AKK A;  2GTO A;  1UDL A;  1Z9Q A;  2YUO A;  2A28 A;  1QKX A;  2FRW A;  3RNJ A;  2RMO A;  3A98 A;  1WLP B;  2W10 A;  4ORZ A;  1EFN A;  1UJY A;  3I9Q A;  1X43 A;  2RQU A;  1TG0 A;  1WDX A;  2HEQ A;  2C0T A;  1MV0 B;  1OOT A;  1GFD A;  3M0S A;  5IXF A;  2ABL A;  4CC4 B;  1PNJ A;  1VYV A;  2ED0 A;  2KGT A;  1PRM C;  2AK5 A;  2DE0 X;  1GCP A;  1N5Z A;  4EIK A;  2DL3 A;  2L2P A;  2VVK A;  1JO8 A;  4M4Z A;  1VYU A;  2KEA A;  1T0J A;  1UTI A;  2DLP A;  2JM9 A;  3REA B;  2CUB A;  3M0Q A;  2DRM A;  3NHN A;  2J6K A;  2KRO A;  2EVR A;  2KT1 A;  2L3Q A;  4RUG A;  1AWJ A;  1UJ0 A;  2O88 A;  2EGA A;  1OV3 A;  3LH5 A;  2RQR A;  1T3S A;  1ZSG A;  1BBZ A;  2EW3 A;  1K0X A;  1GBR A;  2FPE A;  4HCK A;  5IXB A;  3VS3 A;  2HDA A;  4J9H A;  4ESR A;  1NYF A;  1LCK A;  2OAW A;  2DM1 A;  2JMC A;  4OMQ A;  2DIL A;  2V1Q A;  1W6X A;  3M0P A;  1MUZ A;  3M0U A;  2JT4 A;  2DF6 A;  2L3P A;  1QKW A;  3UAT A;  3VRY A;  3M0R A;  3VRZ A;  1W1F A;  2O9V A;  4D8D A;  1NEB A;  3FJ5 A;  1U06 A;  2JW4 A;  2BTT A;  1ZUU A;  3EHR A;  2IIM A;  3ULR B;  4HVW A;  2ENM A;  4R0K A;  1FMK A;  4WCI A;  2J7I A;  4D8K A;  4RTZ A;  1RLQ C;  3VS4 A;  5IH2 A;  1JXO A;  4JJC A;  4LUD A;  5IHI A;  2GGR A;  1VA7 A;  1QWE A;  1ZBJ A;  1TUC A;  2LJ0 A;  1QCF A;  5IHN A;  2DMO A;  1B07 A;  2EBP A;  4J9B A;  4RTV A;  2HSP A;  2M51 A;  2DL4 A;  1ZUY A;  3VS5 A;  4IIO A;  3QWX X;  4OMO A;  4GBQ A;  2O2O A;  2LJ3 A;  4A63 B;  2VWF A;  1I07 A;  1AZE A;  4K11 A;  2DYB A;  2RN8 A;  2J6O A;  2DJQ A;  2K6D A;  1YNZ A;  1NLO C;  2EYW A;  4Z89 A;  1YWP A;  1PKT A;  3EG1 A;  1UUE A;  2HBW A;  3VS6 A;  1OEB A;  1Z9Z A;  4AG1 C;  3M0T A;  2ROT A;  1UHC A;  4RTX A;  3TVT A;  1YCS B;  4OML A;  2HCK A;  4DEY A;  4CC3 A;  1KFZ A;  2W0Z A;  3UA6 A;  2ECZ A;  5GJV B;  2DBK A;  1SPK A;  3I35 A;  2LCS A;  2V1R A;  2A37 A;  1SRL A;  1U3O A;  2CRE A;  2D0N A;  2JXB A;  3PVQ A;  1UEC A;  4JJD A;  2LZ6 B;  2OI3 A;  1KJW A;  2PZ1 A;  2JTE A;  1K1Z A;  2FPD A;  2BZY A;  3SHW A;  2FRY A;  2AZS A;  2YUQ A;  1RUW A;  2A36 A;  4KRT A;  2K7A A;  1W70 A;  3H41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...