4X1VA

Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CD2-associated protein
publication title Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4x1vA00
1W1FA 2J6FA 5L23A 1UG1A 4CC4B 3I9QA 1KIKA 2DBMA 2HDAA 1WA7A 2CT4A 2V1RA 2JS0A 2ED0A 4Y92A 1OOTA 2FRWA 1HJDA 2DL3A 2RQWA 4JPBW 2KGTA 2LCSA 2KBTA 1E7OA 2YDLA 1YP5A 3I5RA 1UUEA 2YUOA 1FMKA 1U5SA 1RUWA 3R6NA 1SSHA 2OJ2A 2O9VA 3EHQA 4JJBA 2YUQA 2L3PA 1TUCA 2JXBA 2LJ3A 4ZNXA 2BTTA 1BK2A 3UA7A 2KRMA 3REBB 1GL5A 1X27A 4GLMA 5GJVB 2FPEA 1AZGB 3VS2A 1GFCA 1QWFA 1NYGA 1KJWA 2K9GA 2BZ8A 1BBZA 1ARKA 2AKLA 2EGAA 1WLPB 2EYXA 2DA9A 1OPKA 4EIKA 1K9AA 3NMZC 2GGRA 1X69A 1WX6A 4QT7A 3PVLA 2F2WA 2JMCA 3CQTA 5FWCA 3UATA 5EC7A 1NEGA 2RQUA 4J9DA 4F16A 1W70A 1W6XA 2DL4A 2RPNA 3EG2A 2LJ1A 1JU5C 2FPFA 2DLPA 1QLYA 5HCKA 2LX7A 2KEAA 2XMFA 2HEQA 4E6RA 2J6KA 4HVWA 2FEIA 2JTEA 1I07A 1CKAA 1ZX6A 2GTOA 2J7IA 5GJWB 4Z88A 2RQTA 2VVKA 4HXJA 4WCIA 2AK5A 2FG0A 2J6OA 2NWMA 4J9BA 4R0KA 4RTVA 3C0CA 2B86A 1NYFA 2GQIA 1JO8A 3I5SA 1T3LA 1RLPC 1PHTA 1QKWA 2D8JA 5IHIA 3M0QA 1SEMA 4D8KA 1I1JA 2DL7A 1UJ0A 4OMOA 4RTWA 1GCPA 2D0NA 1MV0B 1H8KA 1HD3A 2GNCA 2DE0X 3KFVA 2OI3A 1X6GA 1JEGA 2V1QA 4KRTA 1U3OA 2LQWA 2DRMA 4CC7A 5IXFA 2K7AA 1I0CA 2RQRA 2GBQA 4OMLA 2ABLA 4HVUA 1WDXA 1LCKA 1X43A 3VS1A 1GRIA 1YWPA 2X3WD 2FO0A 3SEMA 1YCSB 2EYZA 2EYYA 2GTJA 1YN8A 3GBQA 2YUPA 4RTYA 3THKA 3TSWA 4AG2C 1VYUA 1M30A 3PE0A 5FWBA 2KYBA 1M3AA 3H41A 2JM8A 4CC3A 2J06A 5I11A 1OEBA 2NUZA 1K4US 2EGCA 2ED1A 4LNPA 2DRKA 2DX1A 1XOVA 2KYMA 1ZUYA 1G83A 2VWFA 3ULRB 4HCKA 1WXBA 2DL5A 2RQVA 3EG1A 2L0AA 1WXUA 1ZUKA 4IIMA 2J05A 2L2PA 1M3CA 3UF4A 5I22A 2FRYA 2D8HA 1GFDA 1AZEA 5IHKA 1YNZA 1AOJA 1CSKA 4AG1C 1AEYA 2KE9A 1AWXA 4LE9A 4OMMA 2EKHA 2X3XD 1JXMA 1BB9A 2MCNA 2BZXA 1EFNA 1Y0MA 1UDLA 3O5ZA 1X2QA 2AZSA 2KR3A 2DVJA 2L3QA 3QWYA 2K2MA 2KXDA 2KT8A 1X6BA 3NGPA 2ECZA 3SHWA 3EG3A 4FSSA 4CC2A 4IIOA 4J9EA 1JQQA 3M0UA 1SHGA 4DEXA 2AZVA 2DM1A 2ROTA 2LZ6B 2G6FX 2M51A 4RTUA 1OV3A 3UA6A 2IIMA 2EYWA 1UE9A 2EPDA 2K3BA 1ZLMA 2OAWA 1SPKA 1NM7A 2F2VA 2KRSA 4AFZC 4RTXA 1AVZC 4Z89A 4JZ4A 1RLQC 2F2XA 1VYTA 2EVRA 1ABOA 1UHFA 2YT6A 4JJDA 2PTKA 1E6GA 1B3QA 2LQNA 3NPFA 2EBPA 3ZL7C 3VS7A 1ZBJA 2ENMA 1U06A 1N5ZA 2DJQA 1RI9A 3QWXX 2A37A 2VKNA 3PVQA 4D8DA 2HCKA 2CH4A 2A08A 2C0OA 4OMNA 3VS3A 1SHFA 2RF0A 4AFUC 4AFSC 1NEBA 1UECA 3H0IA 3EGUA 4GBQA 1H3HA 2KNBB 2FPDA 2I0NA 4DEYA 2CH4W 2H8HA 2DNUA 4X1VA 1JXOA 2C0TA 1NLPC 1TG0A 1T0JA 2O2OA 1AWJA 3REAB 2ESWA 2JM9A 4ORZA 4K11A 4J9GA 1YWOA 4JZ3A 2MOXA 2SEMA 1FYNA 4LN2A 5ECAA 5IXBA 2CUBA 1M27C 1MUZA 2PZ1A 3VS4A 3RNJA 2DYBA 3TSZA 1WI7A 2DMOA 2W10A 1B07A 1G2BA 2KROA 1BU1A 4RUGA 4ESRA 3VS6A 1VA7A 5IH2A 1KFZA 1AWWA 3EG0A 2P4RA 4A63B 2CSQA 2RN8A 5IHNA 2MIOA 1QCFA 2O31A 2K6DA 2EQIA 4J9CA 2KRNA 1K0XA 2RMOA 3IQLA 1X2KA 3NHNA 3M0RA 1ZSGA 4J9HA 1E6HA 2HBWA 3U23A 4J9IA 1CKBA 1NG2A 2CUDA 2BZYA 1GBRA 4OMPA 1VYVA 2D1XA 2JT4A 2LNHB 1AWOA 1OPLA 1PRMC 2DF6A 1K0SA 2ROLA 1ABQA 3LH5A 1NLOC 2RNAA 1K76A 2KT1A 1ZUUA 3EHRA 3H0FA 2LMJA 3RBBB 4AFQC 1A0NB 2KXCA 2M0YA 2CSIA 2E5KA 2CT3A 2CREA 1KSWA 1AD5A 2A36A 3VS0A 4HVVA 1UTIA 3A98A 1T3SA 3M0TA 5FW9A 1T0HA 1GCQC 2DBKA 1SRMA 4Z8AA 1WYXA 1IO6A 1UFFA 1S1NA 2JMAA 3VRZA 3VS5A 2JS2A 2W0ZA 1HSQA 2DL8A 1SRLA 2EGEA 1H92A 1PWTA 4LUDA 1J3TA 1QWEA 1K1ZA 1WFWA 1M8MA 3FJ5A 2A28A 1Y57A 2YUNA 1GBQA 3M0SA 4RTZA 1V1CA 3M0PA 2YSQA 1PKTA 2HSPA 1UJYA 2O9SA 2EW3A 4RTTA 3H0HA 1TUDA 3JV3A 2JW4A 1UHCA 2LJ0A 4F17A 1WIEA 2CDTA 2PNIA 2AKKA 1M3BA 1Z9QA 3I35A 1PNJA 4J9FA 4JJCA 1PRLC 1Z9ZA 2LP5A 2SRCA 2O88A 2QDLA 3VRYA 1QKXA 2K79A 4LUEA 4F14A 1MV3A 2L3SA 3TVTA 2C0IA 2DILA 4M4ZA 1WXTA 1UGVA 1GCQA 1PKSA 4OMQA
chains in the Genus database with same CATH superfamily
4QVDA 5L23A 1D1CA 3Q1JA 5CCAA 1UG1A 4CC4B 1KIKA 2DBMA 2E64A 3PGGA 5HY6A 3KBGA 2K5IA 2ED0A 2CZ7B 4FIBA 2K3XA 6AT1B 2DL3A 2KDSA 2KBTA 2RK2A 3I56T 1VQMA 4BDZA 1YP5A 4OB2B 2QI2A 4EDUA 2RB6A 1RUWA 2YRDA 2OJ2A 4JJBA 3HKSA 1BI3A 3EGDB 5GAMj 2YRCA 4ZNXA 5GAN6 2MMPA 2BTTA 3G71Q 1PG5B 4LDUA 3UA7A 3V7CA 1K9MU 3PNWC 5GJVB 1YITQ 3VS2A 2RJFA 3EFOB 3PIOA 1AHJB 3CXCS 5KYUB 3EGDA 3EH2A 2K9GA 3NFCA 4M75D 2E65A 1OPKA 1RABB 3NMZC 1I5LA 4QQGA 4PFZA 1YJ9Q 3EFOA 1WX6A 3M9QA 4QT7A 3L1AA 5KYUA 1WHHA 3OW2A 3LWHA 3QYHB 3TREA 3G71A 4C0DC 2ZPIB 5EC7A 2LCLA 2JN0A 3HRUA 4C92E 3OYIA 4R56A 2M16A 3RKXA 5CKHA 3NTHA 5CKEA 2HNIA 3L2WA 2VGMA 2HD0A 4PKCC 2DTOA 1HYOA 3E9GA 2XMFA 1WQWA 4M78B 2J6KA 4HVWA 5HK0A 2FEIA 2FB7A 1D0ZA 3JB9I 3FLGA 1K73U 2J7IA 2QQAA 4Z88A 8AT1B 4WCIA 1PD1A 2FG0A 3CBOA 3EH1A 4R0KA 1NYFA 3OYNA 1T3LA 1YBYA 1M1KU 5AYFA 4HCZA 4F7UG 4M78A 4D8KA 2DVEA 1VQOQ 3CCLT 5M9OA 3DLLA 2P4TA 3EFRA 2DE0X 3KFVA 1U8RA 4PNOA 5IN1A 4O6JA 1ZSZC 4KRTA 4RKUE 2RQRA 3A8OB 1X43A 1YWPA 3CCRQ 2CGHA 3CCQT 3SFMA 3G4SQ 5KE3A 1VQOA 4AG2C 3ASKA 1VIEA 4C5EA 2L3RA 3H41A 5D6YA 1S72T 2A0FB 3I55T 2J06A 2KY9A 3OQ5A 1YIJQ 4LNPA 3CMAT 1FWZA 2RI5A 3QDRB 2E5QA 2DERA 5KYWB 2KYMA 2XG8D 1M90U 4FU6A 3ULRB 3MJXA 4PFPA 1QVGS 3VU3C 3CD6T 2QEXQ 2J05A 2X51A 3CCRA 4FYYB 5GAMd 2D8HA 3L2VA 1QMCA 1N8RR 4EMGA 5CR2A 1YNZA 1AOJA 1YJWQ 3G4SA 4L59A 2BKDN 5KYWA 2VYTA 3L2RA 1WHLA 4OB1B 4YTLA 2D6FA 1M1FA 2EAYA 1Q81R 4X9DA 2XIDA 1X2QA 2AZSA 3QIIA 2QYZA 1YIJA 2L3QA 3QWYA 1Q81C 3D7SB 1D1AA 4KT0E 3ZEHA 3EG3A 3QUIA 2DIGA 4FSSA 3CPWP 4DBFA 3M55A 3M0UA 1SHGA 2RO0A 1PD0A 2M51A 2G6FX 1OV3A 4ELZC 2K3BA 4N4GA 1ZLMA 1NM7A 2GCXA 4RG8A 1TWBA 4Z89A 3QHSA 3ER0A 4JZ4A 1RLQC 5GAN7 2V8IA 3I56Q 2EVRA 4WF2A 2B8AA 2M9UA 2DD4A 4PJOC 3E19A 2M02A 2LCCA 3JCMd 1KHIA 1VIFA 4M77C 1DJ7B 3QWXX 2VKNA 4E7JA 2RI2A 2HCKA 3HHTB 3OW2S 2C0OA 1SHFA 4XU3A 5KYYB 1NEBA 1UECA 3CC2T 3P8BB 4E7HA 1NPPA 2LRQA 1VQ6Q 4GBQA 2FPDA 2DNUA 4X1VA 3LX7A 1NLPC 1ZHIA 4HCBA 5L8RE 3OYFA 1AWJA 3REAB 3BDLA 4C0GA 5GAN4 1YJNA 1WGSA 2EKOA 2YWWA 4XTXA 4J9GA 3M4GA 1YWOA 4JZ3A 5KYYA 2MOXA 1HK9A 2V8KA 5CIUA 1OQKA 3CCVA 2PZ1A 3VS4A 3RNJA 1Y7XA 2DYBA 1W2BA 1G2BA 4N4HA 3DKMA 2RHXA 3SWNC 4BE1A 2MF2A 2QTVA 4OP0A 1VQ6A 3EG0A 4EMKC 1ZA1B 2JOYA 2CSQA 1LJOA 5IHNA 2MIOA 1TS9A 3T9NA 1QCFA 2K6DA 2EQIA 2RMOA 3IQLA 3M0RA 4B6MA 1E6HA 2DXBA 3BFMA 4M75B 2ZPGB 3CPWA 2BZYA 2E3IA 1GBRA 1EIFA 4OMPA 2XICA 2VGNA 3OYLA 1PRMC 1WHMA 1K0SA 1ABQA 2VB6A 2OAUA 2RNAA 3GOXA 1K76A 4B9WA 1ZUUA 3H0FA 4AFQC 2VXFA 2ZZDA 2M0YA 2CT3A 1IREB 5GAOq 2YXYA 2A36A 1BI1A 1UTIA 1B7TA 1O75A 1T3SA 4C8QE 4IUUA 4RMOA 1T0HA 2KQWA 2K57A 4BE2A 2EQJA 3MP1A 1KC8U 4IKFA 3JB9J 3M5AA 3QYGB 2MK5A 2CP6A 3TCJA 2EGEA 3OYDA 5GAN8 2GF7A 1EX4A 2DETA 4M7AC 2KVQG 4RTZA 1V1CA 3HSBA 1IHWA 4PJOG 1VQ5T 3UWNA 1S72Q 4N0AC 2CP7A 3WVDB 2YHTA 3CMAQ 2CDTA 1QVPA 5CKBA 1M2VA 4M77G 1M3BA 1PNJA 1OZ2A 3SD4A 1Z9ZA 2OTJQ 2SRCA 2O88A 1N9SA 1D0YA 1QKXA 3CD6Q 2K79A 1Q86C 3RMQA 4KUIA 4LUEA 4F14A 1M1GA 4ZTFA 1IHVA 3TVTA 3M59A 2QXFA 1VUBA 2PUKB 5LJ5f 4KH0B 3MEWA 2NUTB 2Y4YA 1WA7A 2CT4A 1BCOA 1HJDA 1S72A 4IUTA 1YHQT 1VQ7T 4ZTJA 3OYMA 1G3WA 1UUEA 4E7LA 1FMKA 2COZA 2WSEE 2WSCE 2OTJA 5GANj 1VQKT 2NUTA 1GXIE 2O4XB 3OYHA 2RHUA 2JXBA 2FYKA 3CCMT 1U1SA 2LC4A 4GLMA 1K8AU 2FPEA 3MEVA 4E7ZA 4OGEA 2X4WA 4F7UF 5LJ5j 4DQ2A 4M75E 1NYGA 2O4XA 3META 4C0FA 2BIVA 2QQSA 1ARKA 1RAFB 1Q7YU 2EGAA 3QPHA 4M78C 2EYXA 4B9XA 2LQKA 2XKOC 1W2BS 2GGRA 5AT1B 1X69A 3C95A 3CCJT 3PVLA 3CC2Q 3CCEQ 2F2WA 3BE3A 1VQLT 1NEGA 4J9DA 4M7DC 4F16A 1WHKA 1W6XA 3QJYA 4LDYA 3VYGA 4PLIA 2COWA 4BY6B 3RESA 1JU5C 2FPFA 1SSFA 3HTRA 4HKEA 8ATCB 3S3NA 4GLKA 4C8QF 4RG2A 3V7SA 3LLRA 2DZ9A 3CPWS 1I07A 2DPPB 5GMKm 2QAZA 2GTOA 3OYGA 1SF9A 2LTOA 2RQTA 2F5TX 1Q82R 2J6OA 2LQ8A 4M7AG 3CCEA 3CC2A 3V8JA 1RLPC 1PHTA 2WSFE 3CCST 2D8JA 2L89A 4FT4A 3PTAA 4PL6A 3A8HB 1SEMA 1IXDA 5GAMf 3PFSA 2CKKA 2DL7A 3CPFA 4OMOA 1VQNT 4RTWA 5A0DA 1H8KA 2HQEA 1G5VA 5GAOn 1KHCA 2K5LA 1KD1C 3INZA 2K4YA 2V1QA 4JRKA 1JB0E 1ZBXA 2LQWA 2DRMA 2H3JA 5IXFA 3EGXB 2CZ1B 1MHNA 1I0CA 2R5AA 3ME9A 2FHDA 3JSCA 5KE2A 2ABLA 3FEOA 4HVUA 3E2UA 1GRIA 2JNGA 4LDVA 3SEMA 2EYYA 2OX7A 2GTJA 2DD5A 1YN8A 2CS7A 2XK0A 1G8XA 1FXXA 3TSWA 1M30A 3EGXA 3PE0A 2QA4Q 2I2LA 4HT9A 3A8MB 3A8LB 2HL5C 3OYCA 5I11A 1OEBA 2NUZA 2EGCA 1OU9A 2DRKA 1QCNA 3JCMf 2VWFA 4JDSA 2DL5A 2E6ZA 4XTWA 4AMCA 5GANd 1WXUA 3MPUB 4IIMA 2L2PA 3L2QA 2FRYA 3FB9A 1WNLA 1KK7A 1I81A 1VQ5Q 3JCMV 2CP2A 1AEYA 1UGQB 2KE9A 1AWXA 4LE9A 1N6AA 4IUVA 2QA4A 4JRQA 4M78G 2LVMA 2MWOA 5LJ5d 4M75F 1EFNA 5GAOl 1Y0MA 4KGXB 1UDLA 2GQVA 3FDRA 1UEBA 1YITA 1H641 3WVEB 1X6BA 2ECZA 1H3ZA 4CC2A 4IIOA 4J9EA 1JQQA 4TVRA 2X9HA 1X6OA 2AZVA 4DEXA 4M7DG 1KQSA 2JZ2A 2LZ6B 5IT9E 4QVZA 3M58A 4A53A 4AFZC 1I4K1 5CQYA 1AVZC 1IGUA 3LGLA 5A0LA 3RUXA 1Y96B 5FU7C 2HQXA 1VYTA 2QQRA 4C5IA 1YJ9A 1VQ7Q 1ABOA 2QGFB 2EIFA 2YT6A 4JJDA 3V8KA 1WHJA 1E6GA 2LQNA 3NPFA 2EBPA 4EMHA 1ZBJA 2ENMA 1U06A 2KSSA 3QJ6A 3CC4T 4ZN3A 2A37A 4RCBA 2RHZA 4QVCA 3LWIA 2JTMA 1Y96A 4D8DA 4JRIA 2CH4A 1N8RU 2RF0A 2IG0A 4J5YA 1WZOA 2EYQA 3EGUA 1H3HA 2I0NA 1WHGA 2XDBA 2C0TA 1N27A 2RD1A 1TG0A 4JRPA 1VQPT 4BACA 2FZCB 2ESWA 4XTUA 1VQ7A 1D3BB 3BY7A 2OTLQ 2DZCA 2P0QA 4PK4A 3CBPA 2DXUA 2L5QA 4LN2A 3G6ET 3OS2A 5ECAA 4ZGEB 5IXBA 1MUZA 3CCJQ 5GMKh 3EFSA 4RCCA 2DMOA 2E70A 4F7UB 1VQLQ 1VQ8Q 3AHUA 5FU6B 1BU1A 4RUGA 4PJOD 4ESRA 1VA7A 5C6SA 1MNDA 1KFZA 1AWWA 2XD0A 4PFOA 4M77D 1IGQA 5KYNA 3VUBA 2VXEA 2XDPA 4A4KA 4PJOF 1B34B 1QVFP 4J9CA 1K0XA 4F7UA 1TSFA 3C12A 4LD6A 2OTLA 4ZGDB 2E3HA 4J9HA 2HQHA 5J3BA 1RAAB 1CKBA 3G7ZA 2HBPA 4FYVB 1QP3A 2CZ0B 5LJ3j 3CCJA 2LNHB 1AWOA 1XNIA 2E1HA 5DM7R 3KUFA 1B34A 1MMAA 1NLOC 1M1KC 1VQ8A 4N4IA 2KT1A 1A0NB 1YI2Q 1YFNA 2CREA 4C8QB 1IZ6A 5GMKe 2DAQA 1ACMB 5LJ5h 3JCMW 3CMEQ 2RHYA 3M0TA 2COYA 2QEXA 4HA8A 1NE8A 1SRMA 2M1HA 3V8LA 3L42A 1OZ3A 3EAEA 4A4HA 3VRZA 2XI9A 1YJWA 2LT4A 2W0ZA 4C8QA 2HL3A 3OB9A 1SRLA 4DBHA 3QSUA 4ELYC 3HFNA 3JRZA 4BE0A 1PWTA 4FM4B 3FJ5A 2A28A 2P0PA 1C0MA 2E6NA 2QGGA 3M0SA 1YI2A 2X35A 3M0PA 3GPLA 2ATCB 2YSQA 1PKTA 1UGSB 2HSPA 3S3MA 1UJYA 4RTTA 2IPOB 4XAXB 3CMEA 3JV3A 4BUGA 1UHCA 1VQ4T 4IUPA 4C0DB 2HKQB 1M90C 2DXCA 5LJ5e 1MMDA 3I56A 2PVDB 1KQSS 1RADB 2L3SA 4WTOB 4V2SA 3RMSA 2DILA 4M4ZA 1WXTA 1UGVA 1PKSA 3OMGA 3CC7T 1W1FA 2J6FA 3BDUA 3OYYA 2DEQA 2HDAA 1MMGA 5J39A 4Y92A 2FRWA 1BI2A 2RQWA 2KGTA 4JPBW 3RR6A 2YDLA 4F7UE 5GAMg 2CP5A 3CCUT 4M7AD 2YUOA 1BIAA 4MDWA 2F1LA 2GFUA 1SSHA 3R6NA 2O9VA 1G3TA 2L3PA 1WJQA 4C92C 2NLUA 2KRMA 4JUVA 4M7AF 3CXCP 2DO3A 1VQMT 4C5GA 1ZA2B 4XTYA 2QTXA 1RAHB 2P84A 1ZSZB 3GLXA 1PM3A 1GFCA 1MMNA 4J6XA 2FVUA 5GAMh 2L8DA 2BZ8A 2LNVA 1MNEA 3CCLQ 1WLPB 4AT1B 4M75A 3N5BB 1M5Q1 1ZSZA 4UC4A 2Y90A 1K9AA 3H6ZA 4J7FA 4JJNK 3X25B 3OYEA 3UT1A 1RI0A 5LJ3d 2JMCA 3CQTA 3AT1B 3UATA 3P8HA 3JCMg 3M54A 1VQPQ 2DL4A 5KH6A 2RPNA 3OA6A 3L2ZA 3CCQQ 4XTZA 2LJ1A 3PT9A 1C1AA 2EQKA 2EWNA 2K5FA 4FYWB 3S6WA 2DLPA 3NTIA 5HCKA 2HEQA 4E6RA 3G71T 3M4YA 2JTEA 3CCLA 3URGA 1ZX6A 5HK3A 3JCMP 3OSSC 1AT1B 3I55Q 5GAMe 3A5ZB 4RTVA 3JCMh 3C0CA 4OMFB 2B86A 2GQIA 1JO8A 1TU0B 5GANf 1QKWA 4M78D 1Q86R 3M0QA 2V8JA 2JTFA 1I1JA 3QZ9B 1UJ0A 2ZPFB 3CCQA 1G3YA 1GCPA 2D0NA 1MV0B 2GNCA 2NUPB 1X6GA 1JEGA 4M7DD 3H9NA 1U3OA 3MO8A 4XU0A 5KYXB 1HXDA 3OYAA 4L5GA 4OMLA 3I55A 2O01E 2FO0A 4PJOB 3CMAA 2NUPA 1YCSB 2DJZA 3C94A 3GNFB 2PVGB 3GBQA 5A0GA 3OMCA 1UB4A 4M77B 5KYXA 3CD6A 1VYUA 5FWBA 3JCMe 2KYBA 1M3AA 3LYIA 2JM8A 4PLLA 3JB9G 3PMTA 3RKYA 3OS0A 4FCYA 4PJOA 3JCMQ 1K4US 9ATCB 2VV5A 4O5VA 4PJJA 1Q82U 1KC8C 3CBMA 4D6WA 1UGPB 1NZ9A 4C92G 1G83A 1JRIA 2RQVA 3A1PA 1RL2A 3EG1A 1RAGB 4BDYA 1VQOT 4E47A 4L6V5 3KXTA 5GMKi 1M3CA 3A8GB 2G3RA 5D6WA 1D09B 2HKNA 5IHKA 3NTKA 1C6VX 1CSKA 4AG1C 1M9SA 5HKCA 3BW1A 4BI4A 4OMMA 2EKHA 1VQ4Q 1BB9A 4X9CA 5CKFA 4OMQA 3LH0A 2V26A 4XU2A 4Z02A 3HP9A 1WJRA 2KR3A 3SWNB 1XQHA 1M8VA 2K2MA 2KXDA 4JLIA 2KT8A 2PVOB 3NGPA 2YLCA 2RJCA 4FW1A 3G4ST 1R77A 3LW5E 3X26B 1SKUB 3M56A 4A4EA 4C5HA 4RTUA 1LNXA 5DLQE 4HT8A 3UA6A 2IIMA 2EPDA 4ATOA 3SWNA 2OAWA 1SPKA 2F2VA 2KRSA 3MEAA 3MKDA 1YIJT 2E41A 2F2XA 4R55A 1VQ4A 1UHFA 4QW2A 2PTKA 1B3QA 2R57A 3ZL7C 3FC3A 3VS7A 3OW2P 3TU4K 1N5ZA 2DJQA 2MYSA 4IURA 2E4HA 2RH2A 4II1A 1KD1R 1VQMQ 2A08A 3VS3A 2X4YA 4CI0C 3H0IA 1K8AC 2KMTA 4LDWA 5I2MA 2VC8A 1T0JA 3QZ5B 2O2OA 2R5MA 4OB3B 1PSEA 3O8VA 3M53A 4K11A 2AHJB 1BYMA 2DEUA 3J81E 1OULA 3E9FA 4MMLA 1NJIR 4JS5A 4PJOE 4M7AB 4E7IA 5CQXA 2H3EB 5CO7A 1M27C 2PQWA 3OYJA 3TSZA 1NJIC 1WI7A 2BUDA 2VASA 2X4JA 1NPRA 2W10A 1B07A 4KGVB 2KROA 4KH1B 4E7KA 4M77E 1KQ2A 4NL2A 1OX8A 2P0KA 3C4SA 4MZPA 3VS6A 1YJNT 5IH2A 4C8QC 4A63B 4M7AA 3CCVT 2O31A 4N0AA 2CZ6B 2KRNA 5KCHA 5GAOr 1X2KA 3TEEA 1FMVA 2HBWA 3SDZA 3WXMB 1NG2A 1R0BG 2CUDA 4MZMA 1VQ6T 2E12A 3HFOA 4VUBA 3OSVA 2DF6A 1PC0A 1V76A 2BE9B 3QXEB 4J7IA 3UPUA 3EHRA 2LMJA 2XHCA 2E5KA 5CK9A 4FYXB 1TUGB 2ZPHB 4HVVA 3ZBDA 4FL6A 2DTIA 3HPWA 2KI7A 5GAOp 4IUQA 3V7RA 5FW9A 1OI1A 1YCYA 5A2QE 1LPLA 2DFUA 2MAMA 1WYXA 3DLMA 2M0OA 2A3LA 4ZN1A 2JMAA 1VQ5A 3OYBA 4QKUA 2JJ9A 2DL8A 1YHQQ 1RACB 1H92A 1D0XA 1K1ZA 2K2VA 1VQKQ 4OVAA 4NL3A 1Y57A 2YUNA 5CVIA 5EG2A 4ZGJB 4ME7A 2F5KA 1Y07A 1K9MR 4EPCA 1IB8A 3CCMQ 2EW3A 4DBQA 1LVKA 1TUDA 1K9MC 2LJ0A 4F17A 2AKKA 4J9FA 3OYKA 1PRLC 1EZZB 2LP5A 5FRNA 4M7DB 2AIRB 1Q81U 3VRYA 4A4FA 1RAIB 1TH7A 1WJSA 3DB3A 1OYXA 1YHQA 4OB0B 2NYSA 1MV3A 3MP6A 2E10A 1GCQA 5LJ3f 5GAN2 4M75C 1VQKA 4J8OA 3J80E 4PJNA 2BE7D 4M7DA 2FZKB 3I9QA 4P5NA 2V1RA 2JS0A 3RKWA 4M7AE 3CCMA 4FW2A 1OOTA 3GNGA 4MDXA 3MCAB 5GANg 2LCSA 1D3BA 1E7OA 4JLGA 2QQ9A 4KGZB 3X20B 3I5RA 3FJPA 3HL8A 2D9TA 1R0CB 1U5SA 1RAEB 2EQUA 3QO3A 3QKJA 3E1SA 3EHQA 2YUQA 3MEUA 1F1BB 1TUCA 3PMIA 2LJ3A 3P8DA 2CYZB 1K73R 4C8QG 1BK2A 2IVWA 5LJ5g 3REBB 5I21A 1GL5A 4Q5WA 1X27A 4M77F 1K73C 1AZGB 2ZPBB 1M1KR 5GANh 1UGRB 4LD9K 1QWFA 2OTJT 5J26A 5CAIA 2K3YA 1KJWA 5GAN3 3CCSQ 1VQLA 4KUDK 3JCMb 1SG5A 5KCOA 1W2BP 1BBZA 3UDCA 2YRVA 2AKLA 2RM4A 1VQNQ 2DA9A 4EIKA 1QW1A 1P92A 3VV0A 1N8RC 4HCCA 2HZYA 2Y4XA 5FWCA 3VYHB 2JVVA 3OBYA 2RQUA 1M2OA 3JB9D 1W70A 2VUBA 4DA4A 3EG2A 4ANJA 4F04B 5CKDA 4JS4A 1WQ7A 1XJWB 1O9SA 1VQ9T 1JJ2P 3CCSA 4C92D 1QLYA 4FSXA 2LX7A 2RJDA 3S3OA 2KEAA 3JB9F 1NBEB 2HSEB 1VQNA 2QQBA 3QG1A 5GANe 1CKAA 1N9RA 1X01A 3QBYA 4FT2A 5GJWB 2C06A 2VVKA 4HXJA 4M78E 5D6XA 2AK5A 2MWPA 3G1JA 2NWMA 4C92F 4J9BA 5GMKl 2RA2A 1YJNQ 1M90R 4Y28E 3I5SA 2EFIA 2MPXC 5IHIA 3LGFA 4KULA 5IAYA 3CCVQ 4XQ3A 4J6YA 2DIQA 4MMKA 4BD3A 5DLOA 1D1BA 4J6WA 4M7DE 1XTDA 2YLBA 2LDMA 1HD3A 1I5OB 4BI3A 2OI3A 2QG9B 2FL7A 3CCET 2XU8A 2WACA 4CC7A 4X34A 1QVFA 2K7AA 3VKIA 2GBQA 5FU7B 4M75G 1WDXA 1LCKA 1WPYA 3HRSA 3VS1A 3ZFJA 2X3WD 4LDXA 2RHIA 1FX7A 1VOMA 2EYZA 5FROA 5GAN5 1JBMA 2YUPA 2RJEA 1I8FA 4RTYA 3THKA 1LOJA 2LX9A 5DY9A 4CC3A 4OF1A 5C0MA 2ED1A 4BB7A 3L2UA 2EJGA 3QDFA 2DX1A 1XOVA 3GP8A 1ZUYA 4A4GA 4BY6C 4HCKA 1WXBA 1QP2A 1Q86U 2L0AA 4XTVA 1ZUKA 3UF4A 3GIBA 3SB2A 5I22A 3CC4Q 2KK4A 1GFDA 1U1TA 1AZEA 4DBRA 2R58A 3CEYA 5GAOm 1JJ2A 5FRMA 2DYIA 2X3XD 1JXMA 3R6OA 2MCNA 2BZXA 3TQ7P 3RIRA 3O5ZA 1IRXA 1FMWA 2DVJA 3JCMJ 3J7AF 3SHWA 2PUOB 3FIFA 2DM1A 3G6EQ 2ROTA 1MGQA 2QA4T 2X4XA 4PJMA 4BI8B 4DOWA 3CC4A 2EYWA 3MHXA 4E7SA 1UE9A 2CP3A 2DXTA 4C0ZA 2HAXA 3JCMc 4RTXA 1YITT 3PIPA 2AT1B 7AT1B 4E2FB 4OGCA 3X28B 3OY9A 1PCXA 1M2VB 1BCMA 2DK3A 4A54A 5LL6S 2ZCFB 3X24B 1VQPA 1RI9A 4MZTA 1TTHB 2ZPEB 3PVQA 2DTHA 4M78F 4OMNA 1YJ9T 3G6EA 3EG9B 4AFUC 4AFSC 2KNBB 4DEYA 2FZGB 2CH4W 2H8HA 1JXOA 5GMKj 2DKGA 1KQ1A 3FRNA 1TXQA 2LT1A 4QQ6A 2JM9A 3CXCA 4ORZA 4M7DF 2ZGWA 1Y71A 3JAME 2RI3A 3OS1A 3EG9A 1OU8A 2EJFA 2SEMA 2KAFA 1FYNA 2GFAA 2CUBA 1R8OB 1KG1A 3OS5A 4XU1A 1OX9A 1KC8R 1QVGP 2F69A 1Q95G 2P4RA 1VQ9Q 2RN8A 3GF5A 4M77A 3JB9H 5LJ3g 3NHNA 1ZSGA 3U23A 4J9IA 1BKBA 1ZQ1A 4XK8E 1KD1U 2MI6A 1BI0A 1QVFS 3JCMX 3OBWA 2RK1A 1VYVA 2D1XA 4GY5A 2JT4A 1OPLA 2CP0A 2ROLA 3LH5A 2ZAEA 1G3SA 4DOVA 4KBMB 3RBBB 4PJLA 3CCRT 4NOYA 2KXCA 2CSIA 2OTLT 3F70A 4EMKB 1KSWA 1AD5A 3VS0A 1W4SA 1VQ9A 1QQJA 5LJ3h 3A98A 3VJPA 3DB4A 3CC7Q 1NJIU 4QQDA 2HMAA 1GCQC 3H8ZA 2DBKA 4C92B 1QCOA 4Z8AA 2EQMA 5D7UA 5FLXE 1TOVA 1VQ8T 1IO6A 1UFFA 1S1NA 4C8QD 3VS5A 2JS2A 1HSQA 4EMKA 4Y91A 2PU9B 2A7YA 2QK0A 2QDYB 3HRTA 4J83A 3CCUQ 3M57A 4LUDA 1J3TA 1M4ZA 2QASA 1QWEA 1WFWA 1M8MA 2QEXT 4C92A 1GBQA 3RDVA 2XDDA 4NS5A 1JJ2S 1V29B 2O9SA 1YJWT 2Z0WA 1K8AR 3H0HA 5FU6C 2JUFA 3VUZA 2EJ9A 3CC7A 2JW4A 1WIEA 2PNIA 1Z9QA 1KQSP 3MP8A 3I35A 1Q82C 4JJCA 4CRIA 2QDLA 5I2SA 5LJ3e 1BIBA 3RERA 1YI2T 1Q7YR 2D0QB 1X75C 1QVGA 2C0IA 3CCUA 1Q7YC 4LXCA 3CMET 1PSFA
chains in the Genus database with same CATH topology
1W1FA 2J6FA 5L23A 1UG1A 4CC4B 3I9QA 1KIKA 2DBMA 2HDAA 1WA7A 2CT4A 2V1RA 2JS0A 2ED0A 4Y92A 1OOTA 2FRWA 1HJDA 2DL3A 2RQWA 4JPBW 2KGTA 2LCSA 2KBTA 1E7OA 2YDLA 1YP5A 3I5RA 1UUEA 2YUOA 1FMKA 1U5SA 1RUWA 3R6NA 1SSHA 2OJ2A 2O9VA 3EHQA 4JJBA 2YUQA 2L3PA 1TUCA 2JXBA 2LJ3A 4ZNXA 2BTTA 1BK2A 3UA7A 2KRMA 3REBB 1GL5A 1X27A 4GLMA 5GJVB 2FPEA 1AZGB 3VS2A 1GFCA 1QWFA 1NYGA 1KJWA 2K9GA 2BZ8A 1BBZA 1ARKA 2AKLA 2EGAA 1WLPB 2EYXA 2DA9A 1OPKA 4EIKA 1K9AA 3NMZC 2GGRA 1X69A 1WX6A 4QT7A 3PVLA 2F2WA 2JMCA 3CQTA 5FWCA 3UATA 5EC7A 1NEGA 2RQUA 4J9DA 4F16A 1W70A 1W6XA 2DL4A 2RPNA 3EG2A 2LJ1A 1JU5C 2FPFA 2DLPA 1QLYA 5HCKA 2LX7A 2KEAA 2XMFA 2HEQA 4E6RA 2J6KA 4HVWA 2FEIA 2JTEA 1I07A 1CKAA 1ZX6A 2GTOA 2J7IA 5GJWB 4Z88A 2RQTA 2VVKA 4HXJA 4WCIA 2AK5A 2FG0A 2J6OA 2NWMA 4J9BA 4R0KA 4RTVA 3C0CA 2B86A 1NYFA 2GQIA 1JO8A 3I5SA 1T3LA 1RLPC 1PHTA 1QKWA 2D8JA 5IHIA 3M0QA 1SEMA 4D8KA 1I1JA 2DL7A 1UJ0A 4OMOA 4RTWA 1GCPA 2D0NA 1MV0B 1H8KA 1HD3A 2GNCA 2DE0X 3KFVA 2OI3A 1X6GA 1JEGA 2V1QA 4KRTA 1U3OA 2LQWA 2DRMA 4CC7A 5IXFA 2K7AA 1I0CA 2RQRA 2GBQA 4OMLA 2ABLA 4HVUA 1WDXA 1LCKA 1X43A 3VS1A 1GRIA 1YWPA 2X3WD 2FO0A 3SEMA 1YCSB 2EYZA 2EYYA 2GTJA 1YN8A 3GBQA 2YUPA 4RTYA 3THKA 3TSWA 4AG2C 1VYUA 1M30A 3PE0A 5FWBA 2KYBA 1M3AA 3H41A 2JM8A 4CC3A 2J06A 5I11A 1OEBA 2NUZA 1K4US 2EGCA 2ED1A 4LNPA 2DRKA 2DX1A 1XOVA 2KYMA 1ZUYA 1G83A 2VWFA 3ULRB 4HCKA 1WXBA 2DL5A 2RQVA 3EG1A 2L0AA 1WXUA 1ZUKA 4IIMA 2J05A 2L2PA 1M3CA 3UF4A 5I22A 2FRYA 2D8HA 1GFDA 1AZEA 5IHKA 1YNZA 1AOJA 1CSKA 4AG1C 1AEYA 2KE9A 1AWXA 4LE9A 4OMMA 2EKHA 2X3XD 1JXMA 1BB9A 2MCNA 2BZXA 1EFNA 1Y0MA 1UDLA 3O5ZA 1X2QA 2AZSA 2KR3A 2DVJA 2L3QA 3QWYA 2K2MA 2KXDA 2KT8A 1X6BA 3NGPA 2ECZA 3SHWA 3EG3A 4FSSA 4CC2A 4IIOA 4J9EA 1JQQA 3M0UA 1SHGA 4DEXA 2AZVA 2DM1A 2ROTA 2LZ6B 2G6FX 2M51A 4RTUA 1OV3A 3UA6A 2IIMA 2EYWA 1UE9A 2EPDA 2K3BA 1ZLMA 2OAWA 1SPKA 1NM7A 2F2VA 2KRSA 4AFZC 4RTXA 1AVZC 4Z89A 4JZ4A 1RLQC 2F2XA 1VYTA 2EVRA 1ABOA 1UHFA 2YT6A 4JJDA 2PTKA 1E6GA 1B3QA 2LQNA 3NPFA 2EBPA 3ZL7C 3VS7A 1ZBJA 2ENMA 1U06A 1N5ZA 2DJQA 1RI9A 3QWXX 2A37A 2VKNA 3PVQA 4D8DA 2HCKA 2CH4A 2A08A 2C0OA 4OMNA 3VS3A 1SHFA 2RF0A 4AFUC 4AFSC 1NEBA 1UECA 3H0IA 3EGUA 4GBQA 1H3HA 2KNBB 2FPDA 2I0NA 4DEYA 2CH4W 2H8HA 2DNUA 4X1VA 1JXOA 2C0TA 1NLPC 1TG0A 1T0JA 2O2OA 1AWJA 3REAB 2ESWA 2JM9A 4ORZA 4K11A 4J9GA 1YWOA 4JZ3A 2MOXA 2SEMA 1FYNA 4LN2A 5ECAA 5IXBA 2CUBA 1M27C 1MUZA 2PZ1A 3VS4A 3RNJA 2DYBA 3TSZA 1WI7A 2DMOA 2W10A 1B07A 1G2BA 2KROA 1BU1A 4RUGA 4ESRA 3VS6A 1VA7A 5IH2A 1KFZA 1AWWA 3EG0A 2P4RA 4A63B 2CSQA 2RN8A 5IHNA 2MIOA 1QCFA 2O31A 2K6DA 2EQIA 4J9CA 2KRNA 1K0XA 2RMOA 3IQLA 1X2KA 3NHNA 3M0RA 1ZSGA 4J9HA 1E6HA 2HBWA 3U23A 4J9IA 1CKBA 1NG2A 2CUDA 2BZYA 1GBRA 4OMPA 1VYVA 2D1XA 2JT4A 2LNHB 1AWOA 1OPLA 1PRMC 2DF6A 1K0SA 2ROLA 1ABQA 3LH5A 1NLOC 2RNAA 1K76A 2KT1A 1ZUUA 3EHRA 3H0FA 2LMJA 3RBBB 4AFQC 1A0NB 2KXCA 2M0YA 2CSIA 2E5KA 2CT3A 2CREA 1KSWA 1AD5A 2A36A 3VS0A 4HVVA 1UTIA 3A98A 1T3SA 3M0TA 5FW9A 1T0HA 1GCQC 2DBKA 1SRMA 4Z8AA 1WYXA 1IO6A 1UFFA 1S1NA 2JMAA 3VRZA 3VS5A 2JS2A 2W0ZA 1HSQA 2DL8A 1SRLA 2EGEA 1H92A 1PWTA 4LUDA 1J3TA 1QWEA 1K1ZA 1WFWA 1M8MA 3FJ5A 2A28A 1Y57A 2YUNA 1GBQA 3M0SA 4RTZA 1V1CA 3M0PA 2YSQA 1PKTA 2HSPA 1UJYA 2O9SA 2EW3A 4RTTA 3H0HA 1TUDA 3JV3A 2JW4A 1UHCA 2LJ0A 4F17A 1WIEA 2CDTA 2PNIA 2AKKA 1M3BA 1Z9QA 3I35A 1PNJA 4J9FA 4JJCA 1PRLC 1Z9ZA 2LP5A 2SRCA 2O88A 2QDLA 3VRYA 1QKXA 2K79A 4LUEA 4F14A 1MV3A 2L3SA 3TVTA 2C0IA 2DILA 4M4ZA 1WXTA 1UGVA 1GCQA 1PKSA 4OMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1F A;  2J6F A;  5L23 A;  1UG1 A;  4CC4 B;  3I9Q A;  1KIK A;  2DBM A;  2HDA A;  1WA7 A;  2CT4 A;  2V1R A;  2JS0 A;  2ED0 A;  4Y92 A;  1OOT A;  2FRW A;  1HJD A;  2DL3 A;  2RQW A;  4JPB W;  2KGT A;  2LCS A;  2KBT A;  1E7O A;  2YDL A;  1YP5 A;  3I5R A;  1UUE A;  2YUO A;  1FMK A;  1U5S A;  1RUW A;  3R6N A;  1SSH A;  2OJ2 A;  2O9V A;  3EHQ A;  4JJB A;  2YUQ A;  2L3P A;  1TUC A;  2JXB A;  2LJ3 A;  4ZNX A;  2BTT A;  1BK2 A;  3UA7 A;  2KRM A;  3REB B;  1GL5 A;  1X27 A;  4GLM A;  5GJV B;  2FPE A;  1AZG B;  3VS2 A;  1GFC A;  1QWF A;  1NYG A;  1KJW A;  2K9G A;  2BZ8 A;  1BBZ A;  1ARK A;  2AKL A;  2EGA A;  1WLP B;  2EYX A;  2DA9 A;  1OPK A;  4EIK A;  1K9A A;  3NMZ C;  2GGR A;  1X69 A;  1WX6 A;  4QT7 A;  3PVL A;  2F2W A;  2JMC A;  3CQT A;  5FWC A;  3UAT A;  5EC7 A;  1NEG A;  2RQU A;  4J9D A;  4F16 A;  1W70 A;  1W6X A;  2DL4 A;  2RPN A;  3EG2 A;  2LJ1 A;  1JU5 C;  2FPF A;  2DLP A;  1QLY A;  5HCK A;  2LX7 A;  2KEA A;  2XMF A;  2HEQ A;  4E6R A;  2J6K A;  4HVW A;  2FEI A;  2JTE A;  1I07 A;  1CKA A;  1ZX6 A;  2GTO A;  2J7I A;  5GJW B;  4Z88 A;  2RQT A;  2VVK A;  4HXJ A;  4WCI A;  2AK5 A;  2FG0 A;  2J6O A;  2NWM A;  4J9B A;  4R0K A;  4RTV A;  3C0C A;  2B86 A;  1NYF A;  2GQI A;  1JO8 A;  3I5S A;  1T3L A;  1RLP C;  1PHT A;  1QKW A;  2D8J A;  5IHI A;  3M0Q A;  1SEM A;  4D8K A;  1I1J A;  2DL7 A;  1UJ0 A;  4OMO A;  4RTW A;  1GCP A;  2D0N A;  1MV0 B;  1H8K A;  1HD3 A;  2GNC A;  2DE0 X;  3KFV A;  2OI3 A;  1X6G A;  1JEG A;  2V1Q A;  4KRT A;  1U3O A;  2LQW A;  2DRM A;  4CC7 A;  5IXF A;  2K7A A;  1I0C A;  2RQR A;  2GBQ A;  4OML A;  2ABL A;  4HVU A;  1WDX A;  1LCK A;  1X43 A;  3VS1 A;  1GRI A;  1YWP A;  2X3W D;  2FO0 A;  3SEM A;  1YCS B;  2EYZ A;  2EYY A;  2GTJ A;  1YN8 A;  3GBQ A;  2YUP A;  4RTY A;  3THK A;  3TSW A;  4AG2 C;  1VYU A;  1M30 A;  3PE0 A;  5FWB A;  2KYB A;  1M3A A;  3H41 A;  2JM8 A;  4CC3 A;  2J06 A;  5I11 A;  1OEB A;  2NUZ A;  1K4U S;  2EGC A;  2ED1 A;  4LNP A;  2DRK A;  2DX1 A;  1XOV A;  2KYM A;  1ZUY A;  1G83 A;  2VWF A;  3ULR B;  4HCK A;  1WXB A;  2DL5 A;  2RQV A;  3EG1 A;  2L0A A;  1WXU A;  1ZUK A;  4IIM A;  2J05 A;  2L2P A;  1M3C A;  3UF4 A;  5I22 A;  2FRY A;  2D8H A;  1GFD A;  1AZE A;  5IHK A;  1YNZ A;  1AOJ A;  1CSK A;  4AG1 C;  1AEY A;  2KE9 A;  1AWX A;  4LE9 A;  4OMM A;  2EKH A;  2X3X D;  1JXM A;  1BB9 A;  2MCN A;  2BZX A;  1EFN A;  1Y0M A;  1UDL A;  3O5Z A;  1X2Q A;  2AZS A;  2KR3 A;  2DVJ A;  2L3Q A;  3QWY A;  2K2M A;  2KXD A;  2KT8 A;  1X6B A;  3NGP A;  2ECZ A;  3SHW A;  3EG3 A;  4FSS A;  4CC2 A;  4IIO A;  4J9E A;  1JQQ A;  3M0U A;  1SHG A;  4DEX A;  2AZV A;  2DM1 A;  2ROT A;  2LZ6 B;  2G6F X;  2M51 A;  4RTU A;  1OV3 A;  3UA6 A;  2IIM A;  2EYW A;  1UE9 A;  2EPD A;  2K3B A;  1ZLM A;  2OAW A;  1SPK A;  1NM7 A;  2F2V A;  2KRS A;  4AFZ C;  4RTX A;  1AVZ C;  4Z89 A;  4JZ4 A;  1RLQ C;  2F2X A;  1VYT A;  2EVR A;  1ABO A;  1UHF A;  2YT6 A;  4JJD A;  2PTK A;  1E6G A;  1B3Q A;  2LQN A;  3NPF A;  2EBP A;  3ZL7 C;  3VS7 A;  1ZBJ A;  2ENM A;  1U06 A;  1N5Z A;  2DJQ A;  1RI9 A;  3QWX X;  2A37 A;  2VKN A;  3PVQ A;  4D8D A;  2HCK A;  2CH4 A;  2A08 A;  2C0O A;  4OMN A;  3VS3 A;  1SHF A;  2RF0 A;  4AFU C;  4AFS C;  1NEB A;  1UEC A;  3H0I A;  3EGU A;  4GBQ A;  1H3H A;  2KNB B;  2FPD A;  2I0N A;  4DEY A;  2CH4 W;  2H8H A;  2DNU A;  4X1V A;  1JXO A;  2C0T A;  1NLP C;  1TG0 A;  1T0J A;  2O2O A;  1AWJ A;  3REA B;  2ESW A;  2JM9 A;  4ORZ A;  4K11 A;  4J9G A;  1YWO A;  4JZ3 A;  2MOX A;  2SEM A;  1FYN A;  4LN2 A;  5ECA A;  5IXB A;  2CUB A;  1M27 C;  1MUZ A;  2PZ1 A;  3VS4 A;  3RNJ A;  2DYB A;  3TSZ A;  1WI7 A;  2DMO A;  2W10 A;  1B07 A;  1G2B A;  2KRO A;  1BU1 A;  4RUG A;  4ESR A;  3VS6 A;  1VA7 A;  5IH2 A;  1KFZ A;  1AWW A;  3EG0 A;  2P4R A;  4A63 B;  2CSQ A;  2RN8 A;  5IHN A;  2MIO A;  1QCF A;  2O31 A;  2K6D A;  2EQI A;  4J9C A;  2KRN A;  1K0X A;  2RMO A;  3IQL A;  1X2K A;  3NHN A;  3M0R A;  1ZSG A;  4J9H A;  1E6H A;  2HBW A;  3U23 A;  4J9I A;  1CKB A;  1NG2 A;  2CUD A;  2BZY A;  1GBR A;  4OMP A;  1VYV A;  2D1X A;  2JT4 A;  2LNH B;  1AWO A;  1OPL A;  1PRM C;  2DF6 A;  1K0S A;  2ROL A;  1ABQ A;  3LH5 A;  1NLO C;  2RNA A;  1K76 A;  2KT1 A;  1ZUU A;  3EHR A;  3H0F A;  2LMJ A;  3RBB B;  4AFQ C;  1A0N B;  2KXC A;  2M0Y A;  2CSI A;  2E5K A;  2CT3 A;  2CRE A;  1KSW A;  1AD5 A;  2A36 A;  3VS0 A;  4HVV A;  1UTI A;  3A98 A;  1T3S A;  3M0T A;  5FW9 A;  1T0H A;  1GCQ C;  2DBK A;  1SRM A;  4Z8A A;  1WYX A;  1IO6 A;  1UFF A;  1S1N A;  2JMA A;  3VRZ A;  3VS5 A;  2JS2 A;  2W0Z A;  1HSQ A;  2DL8 A;  1SRL A;  2EGE A;  1H92 A;  1PWT A;  4LUD A;  1J3T A;  1QWE A;  1K1Z A;  1WFW A;  1M8M A;  3FJ5 A;  2A28 A;  1Y57 A;  2YUN A;  1GBQ A;  3M0S A;  4RTZ A;  1V1C A;  3M0P A;  2YSQ A;  1PKT A;  2HSP A;  1UJY A;  2O9S A;  2EW3 A;  4RTT A;  3H0H A;  1TUD A;  3JV3 A;  2JW4 A;  1UHC A;  2LJ0 A;  4F17 A;  1WIE A;  2CDT A;  2PNI A;  2AKK A;  1M3B A;  1Z9Q A;  3I35 A;  1PNJ A;  4J9F A;  4JJC A;  1PRL C;  1Z9Z A;  2LP5 A;  2SRC A;  2O88 A;  2QDL A;  3VRY A;  1QKX A;  2K79 A;  4LUE A;  4F14 A;  1MV3 A;  2L3S A;  3TVT A;  2C0I A;  2DIL A;  4M4Z A;  1WXT A;  1UGV A;  1GCQ A;  1PKS A;  4OMQ A; 
#chains in the Genus database with same CATH topology
 4QVD A;  5L23 A;  1D1C A;  3Q1J A;  5CCA A;  1UG1 A;  4CC4 B;  1KIK A;  2DBM A;  2E64 A;  3PGG A;  5HY6 A;  3KBG A;  2K5I A;  2ED0 A;  2CZ7 B;  4FIB A;  2K3X A;  6AT1 B;  2DL3 A;  2KDS A;  2KBT A;  2RK2 A;  3I56 T;  1VQM A;  4BDZ A;  1YP5 A;  4OB2 B;  2QI2 A;  4EDU A;  2RB6 A;  1RUW A;  2YRD A;  2OJ2 A;  4JJB A;  3HKS A;  1BI3 A;  3EGD B;  5GAM j;  2YRC A;  4ZNX A;  5GAN 6;  2MMP A;  2BTT A;  3G71 Q;  1PG5 B;  4LDU A;  3UA7 A;  3V7C A;  1K9M U;  3PNW C;  5GJV B;  1YIT Q;  3VS2 A;  2RJF A;  3EFO B;  3PIO A;  1AHJ B;  3CXC S;  5KYU B;  3EGD A;  3EH2 A;  2K9G A;  3NFC A;  4M75 D;  2E65 A;  1OPK A;  1RAB B;  3NMZ C;  1I5L A;  4QQG A;  4PFZ A;  1YJ9 Q;  3EFO A;  1WX6 A;  3M9Q A;  4QT7 A;  3L1A A;  5KYU A;  1WHH A;  3OW2 A;  3LWH A;  3QYH B;  3TRE A;  3G71 A;  4C0D C;  2ZPI B;  5EC7 A;  2LCL A;  2JN0 A;  3HRU A;  4C92 E;  3OYI A;  4R56 A;  2M16 A;  3RKX A;  5CKH A;  3NTH A;  5CKE A;  2HNI A;  3L2W A;  2VGM A;  2HD0 A;  4PKC C;  2DTO A;  1HYO A;  3E9G A;  2XMF A;  1WQW A;  4M78 B;  2J6K A;  4HVW A;  5HK0 A;  2FEI A;  2FB7 A;  1D0Z A;  3JB9 I;  3FLG A;  1K73 U;  2J7I A;  2QQA A;  4Z88 A;  8AT1 B;  4WCI A;  1PD1 A;  2FG0 A;  3CBO A;  3EH1 A;  4R0K A;  1NYF A;  3OYN A;  1T3L A;  1YBY A;  1M1K U;  5AYF A;  4HCZ A;  4F7U G;  4M78 A;  4D8K A;  2DVE A;  1VQO Q;  3CCL T;  5M9O A;  3DLL A;  2P4T A;  3EFR A;  2DE0 X;  3KFV A;  1U8R A;  4PNO A;  5IN1 A;  4O6J A;  1ZSZ C;  4KRT A;  4RKU E;  2RQR A;  3A8O B;  1X43 A;  1YWP A;  3CCR Q;  2CGH A;  3CCQ T;  3SFM A;  3G4S Q;  5KE3 A;  1VQO A;  4AG2 C;  3ASK A;  1VIE A;  4C5E A;  2L3R A;  3H41 A;  5D6Y A;  1S72 T;  2A0F B;  3I55 T;  2J06 A;  2KY9 A;  3OQ5 A;  1YIJ Q;  4LNP A;  3CMA T;  1FWZ A;  2RI5 A;  3QDR B;  2E5Q A;  2DER A;  5KYW B;  2KYM A;  2XG8 D;  1M90 U;  4FU6 A;  3ULR B;  3MJX A;  4PFP A;  1QVG S;  3VU3 C;  3CD6 T;  2QEX Q;  2J05 A;  2X51 A;  3CCR A;  4FYY B;  5GAM d;  2D8H A;  3L2V A;  1QMC A;  1N8R R;  4EMG A;  5CR2 A;  1YNZ A;  1AOJ A;  1YJW Q;  3G4S A;  4L59 A;  2BKD N;  5KYW A;  2VYT A;  3L2R A;  1WHL A;  4OB1 B;  4YTL A;  2D6F A;  1M1F A;  2EAY A;  1Q81 R;  4X9D A;  2XID A;  1X2Q A;  2AZS A;  3QII A;  2QYZ A;  1YIJ A;  2L3Q A;  3QWY A;  1Q81 C;  3D7S B;  1D1A A;  4KT0 E;  3ZEH A;  3EG3 A;  3QUI A;  2DIG A;  4FSS A;  3CPW P;  4DBF A;  3M55 A;  3M0U A;  1SHG A;  2RO0 A;  1PD0 A;  2M51 A;  2G6F X;  1OV3 A;  4ELZ C;  2K3B A;  4N4G A;  1ZLM A;  1NM7 A;  2GCX A;  4RG8 A;  1TWB A;  4Z89 A;  3QHS A;  3ER0 A;  4JZ4 A;  1RLQ C;  5GAN 7;  2V8I A;  3I56 Q;  2EVR A;  4WF2 A;  2B8A A;  2M9U A;  2DD4 A;  4PJO C;  3E19 A;  2M02 A;  2LCC A;  3JCM d;  1KHI A;  1VIF A;  4M77 C;  1DJ7 B;  3QWX X;  2VKN A;  4E7J A;  2RI2 A;  2HCK A;  3HHT B;  3OW2 S;  2C0O A;  1SHF A;  4XU3 A;  5KYY B;  1NEB A;  1UEC A;  3CC2 T;  3P8B B;  4E7H A;  1NPP A;  2LRQ A;  1VQ6 Q;  4GBQ A;  2FPD A;  2DNU A;  4X1V A;  3LX7 A;  1NLP C;  1ZHI A;  4HCB A;  5L8R E;  3OYF A;  1AWJ A;  3REA B;  3BDL A;  4C0G A;  5GAN 4;  1YJN A;  1WGS A;  2EKO A;  2YWW A;  4XTX A;  4J9G A;  3M4G A;  1YWO A;  4JZ3 A;  5KYY A;  2MOX A;  1HK9 A;  2V8K A;  5CIU A;  1OQK A;  3CCV A;  2PZ1 A;  3VS4 A;  3RNJ A;  1Y7X A;  2DYB A;  1W2B A;  1G2B A;  4N4H A;  3DKM A;  2RHX A;  3SWN C;  4BE1 A;  2MF2 A;  2QTV A;  4OP0 A;  1VQ6 A;  3EG0 A;  4EMK C;  1ZA1 B;  2JOY A;  2CSQ A;  1LJO A;  5IHN A;  2MIO A;  1TS9 A;  3T9N A;  1QCF A;  2K6D A;  2EQI A;  2RMO A;  3IQL A;  3M0R A;  4B6M A;  1E6H A;  2DXB A;  3BFM A;  4M75 B;  2ZPG B;  3CPW A;  2BZY A;  2E3I A;  1GBR A;  1EIF A;  4OMP A;  2XIC A;  2VGN A;  3OYL A;  1PRM C;  1WHM A;  1K0S A;  1ABQ A;  2VB6 A;  2OAU A;  2RNA A;  3GOX A;  1K76 A;  4B9W A;  1ZUU A;  3H0F A;  4AFQ C;  2VXF A;  2ZZD A;  2M0Y A;  2CT3 A;  1IRE B;  5GAO q;  2YXY A;  2A36 A;  1BI1 A;  1UTI A;  1B7T A;  1O75 A;  1T3S A;  4C8Q E;  4IUU A;  4RMO A;  1T0H A;  2KQW A;  2K57 A;  4BE2 A;  2EQJ A;  3MP1 A;  1KC8 U;  4IKF A;  3JB9 J;  3M5A A;  3QYG B;  2MK5 A;  2CP6 A;  3TCJ A;  2EGE A;  3OYD A;  5GAN 8;  2GF7 A;  1EX4 A;  2DET A;  4M7A C;  2KVQ G;  4RTZ A;  1V1C A;  3HSB A;  1IHW A;  4PJO G;  1VQ5 T;  3UWN A;  1S72 Q;  4N0A C;  2CP7 A;  3WVD B;  2YHT A;  3CMA Q;  2CDT A;  1QVP A;  5CKB A;  1M2V A;  4M77 G;  1M3B A;  1PNJ A;  1OZ2 A;  3SD4 A;  1Z9Z A;  2OTJ Q;  2SRC A;  2O88 A;  1N9S A;  1D0Y A;  1QKX A;  3CD6 Q;  2K79 A;  1Q86 C;  3RMQ A;  4KUI A;  4LUE A;  4F14 A;  1M1G A;  4ZTF A;  1IHV A;  3TVT A;  3M59 A;  2QXF A;  1VUB A;  2PUK B;  5LJ5 f;  4KH0 B;  3MEW A;  2NUT B;  2Y4Y A;  1WA7 A;  2CT4 A;  1BCO A;  1HJD A;  1S72 A;  4IUT A;  1YHQ T;  1VQ7 T;  4ZTJ A;  3OYM A;  1G3W A;  1UUE A;  4E7L A;  1FMK A;  2COZ A;  2WSE E;  2WSC E;  2OTJ A;  5GAN j;  1VQK T;  2NUT A;  1GXI E;  2O4X B;  3OYH A;  2RHU A;  2JXB A;  2FYK A;  3CCM T;  1U1S A;  2LC4 A;  4GLM A;  1K8A U;  2FPE A;  3MEV A;  4E7Z A;  4OGE A;  2X4W A;  4F7U F;  5LJ5 j;  4DQ2 A;  4M75 E;  1NYG A;  2O4X A;  3MET A;  4C0F A;  2BIV A;  2QQS A;  1ARK A;  1RAF B;  1Q7Y U;  2EGA A;  3QPH A;  4M78 C;  2EYX A;  4B9X A;  2LQK A;  2XKO C;  1W2B S;  2GGR A;  5AT1 B;  1X69 A;  3C95 A;  3CCJ T;  3PVL A;  3CC2 Q;  3CCE Q;  2F2W A;  3BE3 A;  1VQL T;  1NEG A;  4J9D A;  4M7D C;  4F16 A;  1WHK A;  1W6X A;  3QJY A;  4LDY A;  3VYG A;  4PLI A;  2COW A;  4BY6 B;  3RES A;  1JU5 C;  2FPF A;  1SSF A;  3HTR A;  4HKE A;  8ATC B;  3S3N A;  4GLK A;  4C8Q F;  4RG2 A;  3V7S A;  3LLR A;  2DZ9 A;  3CPW S;  1I07 A;  2DPP B;  5GMK m;  2QAZ A;  2GTO A;  3OYG A;  1SF9 A;  2LTO A;  2RQT A;  2F5T X;  1Q82 R;  2J6O A;  2LQ8 A;  4M7A G;  3CCE A;  3CC2 A;  3V8J A;  1RLP C;  1PHT A;  2WSF E;  3CCS T;  2D8J A;  2L89 A;  4FT4 A;  3PTA A;  4PL6 A;  3A8H B;  1SEM A;  1IXD A;  5GAM f;  3PFS A;  2CKK A;  2DL7 A;  3CPF A;  4OMO A;  1VQN T;  4RTW A;  5A0D A;  1H8K A;  2HQE A;  1G5V A;  5GAO n;  1KHC A;  2K5L A;  1KD1 C;  3INZ A;  2K4Y A;  2V1Q A;  4JRK A;  1JB0 E;  1ZBX A;  2LQW A;  2DRM A;  2H3J A;  5IXF A;  3EGX B;  2CZ1 B;  1MHN A;  1I0C A;  2R5A A;  3ME9 A;  2FHD A;  3JSC A;  5KE2 A;  2ABL A;  3FEO A;  4HVU A;  3E2U A;  1GRI A;  2JNG A;  4LDV A;  3SEM A;  2EYY A;  2OX7 A;  2GTJ A;  2DD5 A;  1YN8 A;  2CS7 A;  2XK0 A;  1G8X A;  1FXX A;  3TSW A;  1M30 A;  3EGX A;  3PE0 A;  2QA4 Q;  2I2L A;  4HT9 A;  3A8M B;  3A8L B;  2HL5 C;  3OYC A;  5I11 A;  1OEB A;  2NUZ A;  2EGC A;  1OU9 A;  2DRK A;  1QCN A;  3JCM f;  2VWF A;  4JDS A;  2DL5 A;  2E6Z A;  4XTW A;  4AMC A;  5GAN d;  1WXU A;  3MPU B;  4IIM A;  2L2P A;  3L2Q A;  2FRY A;  3FB9 A;  1WNL A;  1KK7 A;  1I81 A;  1VQ5 Q;  3JCM V;  2CP2 A;  1AEY A;  1UGQ B;  2KE9 A;  1AWX A;  4LE9 A;  1N6A A;  4IUV A;  2QA4 A;  4JRQ A;  4M78 G;  2LVM A;  2MWO A;  5LJ5 d;  4M75 F;  1EFN A;  5GAO l;  1Y0M A;  4KGX B;  1UDL A;  2GQV A;  3FDR A;  1UEB A;  1YIT A;  1H64 1;  3WVE B;  1X6B A;  2ECZ A;  1H3Z A;  4CC2 A;  4IIO A;  4J9E A;  1JQQ A;  4TVR A;  2X9H A;  1X6O A;  2AZV A;  4DEX A;  4M7D G;  1KQS A;  2JZ2 A;  2LZ6 B;  5IT9 E;  4QVZ A;  3M58 A;  4A53 A;  4AFZ C;  1I4K 1;  5CQY A;  1AVZ C;  1IGU A;  3LGL A;  5A0L A;  3RUX A;  1Y96 B;  5FU7 C;  2HQX A;  1VYT A;  2QQR A;  4C5I A;  1YJ9 A;  1VQ7 Q;  1ABO A;  2QGF B;  2EIF A;  2YT6 A;  4JJD A;  3V8K A;  1WHJ A;  1E6G A;  2LQN A;  3NPF A;  2EBP A;  4EMH A;  1ZBJ A;  2ENM A;  1U06 A;  2KSS A;  3QJ6 A;  3CC4 T;  4ZN3 A;  2A37 A;  4RCB A;  2RHZ A;  4QVC A;  3LWI A;  2JTM A;  1Y96 A;  4D8D A;  4JRI A;  2CH4 A;  1N8R U;  2RF0 A;  2IG0 A;  4J5Y A;  1WZO A;  2EYQ A;  3EGU A;  1H3H A;  2I0N A;  1WHG A;  2XDB A;  2C0T A;  1N27 A;  2RD1 A;  1TG0 A;  4JRP A;  1VQP T;  4BAC A;  2FZC B;  2ESW A;  4XTU A;  1VQ7 A;  1D3B B;  3BY7 A;  2OTL Q;  2DZC A;  2P0Q A;  4PK4 A;  3CBP A;  2DXU A;  2L5Q A;  4LN2 A;  3G6E T;  3OS2 A;  5ECA A;  4ZGE B;  5IXB A;  1MUZ A;  3CCJ Q;  5GMK h;  3EFS A;  4RCC A;  2DMO A;  2E70 A;  4F7U B;  1VQL Q;  1VQ8 Q;  3AHU A;  5FU6 B;  1BU1 A;  4RUG A;  4PJO D;  4ESR A;  1VA7 A;  5C6S A;  1MND A;  1KFZ A;  1AWW A;  2XD0 A;  4PFO A;  4M77 D;  1IGQ A;  5KYN A;  3VUB A;  2VXE A;  2XDP A;  4A4K A;  4PJO F;  1B34 B;  1QVF P;  4J9C A;  1K0X A;  4F7U A;  1TSF A;  3C12 A;  4LD6 A;  2OTL A;  4ZGD B;  2E3H A;  4J9H A;  2HQH A;  5J3B A;  1RAA B;  1CKB A;  3G7Z A;  2HBP A;  4FYV B;  1QP3 A;  2CZ0 B;  5LJ3 j;  3CCJ A;  2LNH B;  1AWO A;  1XNI A;  2E1H A;  5DM7 R;  3KUF A;  1B34 A;  1MMA A;  1NLO C;  1M1K C;  1VQ8 A;  4N4I A;  2KT1 A;  1A0N B;  1YI2 Q;  1YFN A;  2CRE A;  4C8Q B;  1IZ6 A;  5GMK e;  2DAQ A;  1ACM B;  5LJ5 h;  3JCM W;  3CME Q;  2RHY A;  3M0T A;  2COY A;  2QEX A;  4HA8 A;  1NE8 A;  1SRM A;  2M1H A;  3V8L A;  3L42 A;  1OZ3 A;  3EAE A;  4A4H A;  3VRZ A;  2XI9 A;  1YJW A;  2LT4 A;  2W0Z A;  4C8Q A;  2HL3 A;  3OB9 A;  1SRL A;  4DBH A;  3QSU A;  4ELY C;  3HFN A;  3JRZ A;  4BE0 A;  1PWT A;  4FM4 B;  3FJ5 A;  2A28 A;  2P0P A;  1C0M A;  2E6N A;  2QGG A;  3M0S A;  1YI2 A;  2X35 A;  3M0P A;  3GPL A;  2ATC B;  2YSQ A;  1PKT A;  1UGS B;  2HSP A;  3S3M A;  1UJY A;  4RTT A;  2IPO B;  4XAX B;  3CME A;  3JV3 A;  4BUG A;  1UHC A;  1VQ4 T;  4IUP A;  4C0D B;  2HKQ B;  1M90 C;  2DXC A;  5LJ5 e;  1MMD A;  3I56 A;  2PVD B;  1KQS S;  1RAD B;  2L3S A;  4WTO B;  4V2S A;  3RMS A;  2DIL A;  4M4Z A;  1WXT A;  1UGV A;  1PKS A;  3OMG A;  3CC7 T;  1W1F A;  2J6F A;  3BDU A;  3OYY A;  2DEQ A;  2HDA A;  1MMG A;  5J39 A;  4Y92 A;  2FRW A;  1BI2 A;  2RQW A;  2KGT A;  4JPB W;  3RR6 A;  2YDL A;  4F7U E;  5GAM g;  2CP5 A;  3CCU T;  4M7A D;  2YUO A;  1BIA A;  4MDW A;  2F1L A;  2GFU A;  1SSH A;  3R6N A;  2O9V A;  1G3T A;  2L3P A;  1WJQ A;  4C92 C;  2NLU A;  2KRM A;  4JUV A;  4M7A F;  3CXC P;  2DO3 A;  1VQM T;  4C5G A;  1ZA2 B;  4XTY A;  2QTX A;  1RAH B;  2P84 A;  1ZSZ B;  3GLX A;  1PM3 A;  1GFC A;  1MMN A;  4J6X A;  2FVU A;  5GAM h;  2L8D A;  2BZ8 A;  2LNV A;  1MNE A;  3CCL Q;  1WLP B;  4AT1 B;  4M75 A;  3N5B B;  1M5Q 1;  1ZSZ A;  4UC4 A;  2Y90 A;  1K9A A;  3H6Z A;  4J7F A;  4JJN K;  3X25 B;  3OYE A;  3UT1 A;  1RI0 A;  5LJ3 d;  2JMC A;  3CQT A;  3AT1 B;  3UAT A;  3P8H A;  3JCM g;  3M54 A;  1VQP Q;  2DL4 A;  5KH6 A;  2RPN A;  3OA6 A;  3L2Z A;  3CCQ Q;  4XTZ A;  2LJ1 A;  3PT9 A;  1C1A A;  2EQK A;  2EWN A;  2K5F A;  4FYW B;  3S6W A;  2DLP A;  3NTI A;  5HCK A;  2HEQ A;  4E6R A;  3G71 T;  3M4Y A;  2JTE A;  3CCL A;  3URG A;  1ZX6 A;  5HK3 A;  3JCM P;  3OSS C;  1AT1 B;  3I55 Q;  5GAM e;  3A5Z B;  4RTV A;  3JCM h;  3C0C A;  4OMF B;  2B86 A;  2GQI A;  1JO8 A;  1TU0 B;  5GAN f;  1QKW A;  4M78 D;  1Q86 R;  3M0Q A;  2V8J A;  2JTF A;  1I1J A;  3QZ9 B;  1UJ0 A;  2ZPF B;  3CCQ A;  1G3Y A;  1GCP A;  2D0N A;  1MV0 B;  2GNC A;  2NUP B;  1X6G A;  1JEG A;  4M7D D;  3H9N A;  1U3O A;  3MO8 A;  4XU0 A;  5KYX B;  1HXD A;  3OYA A;  4L5G A;  4OML A;  3I55 A;  2O01 E;  2FO0 A;  4PJO B;  3CMA A;  2NUP A;  1YCS B;  2DJZ A;  3C94 A;  3GNF B;  2PVG B;  3GBQ A;  5A0G A;  3OMC A;  1UB4 A;  4M77 B;  5KYX A;  3CD6 A;  1VYU A;  5FWB A;  3JCM e;  2KYB A;  1M3A A;  3LYI A;  2JM8 A;  4PLL A;  3JB9 G;  3PMT A;  3RKY A;  3OS0 A;  4FCY A;  4PJO A;  3JCM Q;  1K4U S;  9ATC B;  2VV5 A;  4O5V A;  4PJJ A;  1Q82 U;  1KC8 C;  3CBM A;  4D6W A;  1UGP B;  1NZ9 A;  4C92 G;  1G83 A;  1JRI A;  2RQV A;  3A1P A;  1RL2 A;  3EG1 A;  1RAG B;  4BDY A;  1VQO T;  4E47 A;  4L6V 5;  3KXT A;  5GMK i;  1M3C A;  3A8G B;  2G3R A;  5D6W A;  1D09 B;  2HKN A;  5IHK A;  3NTK A;  1C6V X;  1CSK A;  4AG1 C;  1M9S A;  5HKC A;  3BW1 A;  4BI4 A;  4OMM A;  2EKH A;  1VQ4 Q;  1BB9 A;  4X9C A;  5CKF A;  4OMQ A;  3LH0 A;  2V26 A;  4XU2 A;  4Z02 A;  3HP9 A;  1WJR A;  2KR3 A;  3SWN B;  1XQH A;  1M8V A;  2K2M A;  2KXD A;  4JLI A;  2KT8 A;  2PVO B;  3NGP A;  2YLC A;  2RJC A;  4FW1 A;  3G4S T;  1R77 A;  3LW5 E;  3X26 B;  1SKU B;  3M56 A;  4A4E A;  4C5H A;  4RTU A;  1LNX A;  5DLQ E;  4HT8 A;  3UA6 A;  2IIM A;  2EPD A;  4ATO A;  3SWN A;  2OAW A;  1SPK A;  2F2V A;  2KRS A;  3MEA A;  3MKD A;  1YIJ T;  2E41 A;  2F2X A;  4R55 A;  1VQ4 A;  1UHF A;  4QW2 A;  2PTK A;  1B3Q A;  2R57 A;  3ZL7 C;  3FC3 A;  3VS7 A;  3OW2 P;  3TU4 K;  1N5Z A;  2DJQ A;  2MYS A;  4IUR A;  2E4H A;  2RH2 A;  4II1 A;  1KD1 R;  1VQM Q;  2A08 A;  3VS3 A;  2X4Y A;  4CI0 C;  3H0I A;  1K8A C;  2KMT A;  4LDW A;  5I2M A;  2VC8 A;  1T0J A;  3QZ5 B;  2O2O A;  2R5M A;  4OB3 B;  1PSE A;  3O8V A;  3M53 A;  4K11 A;  2AHJ B;  1BYM A;  2DEU A;  3J81 E;  1OUL A;  3E9F A;  4MML A;  1NJI R;  4JS5 A;  4PJO E;  4M7A B;  4E7I A;  5CQX A;  2H3E B;  5CO7 A;  1M27 C;  2PQW A;  3OYJ A;  3TSZ A;  1NJI C;  1WI7 A;  2BUD A;  2VAS A;  2X4J A;  1NPR A;  2W10 A;  1B07 A;  4KGV B;  2KRO A;  4KH1 B;  4E7K A;  4M77 E;  1KQ2 A;  4NL2 A;  1OX8 A;  2P0K A;  3C4S A;  4MZP A;  3VS6 A;  1YJN T;  5IH2 A;  4C8Q C;  4A63 B;  4M7A A;  3CCV T;  2O31 A;  4N0A A;  2CZ6 B;  2KRN A;  5KCH A;  5GAO r;  1X2K A;  3TEE A;  1FMV A;  2HBW A;  3SDZ A;  3WXM B;  1NG2 A;  1R0B G;  2CUD A;  4MZM A;  1VQ6 T;  2E12 A;  3HFO A;  4VUB A;  3OSV A;  2DF6 A;  1PC0 A;  1V76 A;  2BE9 B;  3QXE B;  4J7I A;  3UPU A;  3EHR A;  2LMJ A;  2XHC A;  2E5K A;  5CK9 A;  4FYX B;  1TUG B;  2ZPH B;  4HVV A;  3ZBD A;  4FL6 A;  2DTI A;  3HPW A;  2KI7 A;  5GAO p;  4IUQ A;  3V7R A;  5FW9 A;  1OI1 A;  1YCY A;  5A2Q E;  1LPL A;  2DFU A;  2MAM A;  1WYX A;  3DLM A;  2M0O A;  2A3L A;  4ZN1 A;  2JMA A;  1VQ5 A;  3OYB A;  4QKU A;  2JJ9 A;  2DL8 A;  1YHQ Q;  1RAC B;  1H92 A;  1D0X A;  1K1Z A;  2K2V A;  1VQK Q;  4OVA A;  4NL3 A;  1Y57 A;  2YUN A;  5CVI A;  5EG2 A;  4ZGJ B;  4ME7 A;  2F5K A;  1Y07 A;  1K9M R;  4EPC A;  1IB8 A;  3CCM Q;  2EW3 A;  4DBQ A;  1LVK A;  1TUD A;  1K9M C;  2LJ0 A;  4F17 A;  2AKK A;  4J9F A;  3OYK A;  1PRL C;  1EZZ B;  2LP5 A;  5FRN A;  4M7D B;  2AIR B;  1Q81 U;  3VRY A;  4A4F A;  1RAI B;  1TH7 A;  1WJS A;  3DB3 A;  1OYX A;  1YHQ A;  4OB0 B;  2NYS A;  1MV3 A;  3MP6 A;  2E10 A;  1GCQ A;  5LJ3 f;  5GAN 2;  4M75 C;  1VQK A;  4J8O A;  3J80 E;  4PJN A;  2BE7 D;  4M7D A;  2FZK B;  3I9Q A;  4P5N A;  2V1R A;  2JS0 A;  3RKW A;  4M7A E;  3CCM A;  4FW2 A;  1OOT A;  3GNG A;  4MDX A;  3MCA B;  5GAN g;  2LCS A;  1D3B A;  1E7O A;  4JLG A;  2QQ9 A;  4KGZ B;  3X20 B;  3I5R A;  3FJP A;  3HL8 A;  2D9T A;  1R0C B;  1U5S A;  1RAE B;  2EQU A;  3QO3 A;  3QKJ A;  3E1S A;  3EHQ A;  2YUQ A;  3MEU A;  1F1B B;  1TUC A;  3PMI A;  2LJ3 A;  3P8D A;  2CYZ B;  1K73 R;  4C8Q G;  1BK2 A;  2IVW A;  5LJ5 g;  3REB B;  5I21 A;  1GL5 A;  4Q5W A;  1X27 A;  4M77 F;  1K73 C;  1AZG B;  2ZPB B;  1M1K R;  5GAN h;  1UGR B;  4LD9 K;  1QWF A;  2OTJ T;  5J26 A;  5CAI A;  2K3Y A;  1KJW A;  5GAN 3;  3CCS Q;  1VQL A;  4KUD K;  3JCM b;  1SG5 A;  5KCO A;  1W2B P;  1BBZ A;  3UDC A;  2YRV A;  2AKL A;  2RM4 A;  1VQN Q;  2DA9 A;  4EIK A;  1QW1 A;  1P92 A;  3VV0 A;  1N8R C;  4HCC A;  2HZY A;  2Y4X A;  5FWC A;  3VYH B;  2JVV A;  3OBY A;  2RQU A;  1M2O A;  3JB9 D;  1W70 A;  2VUB A;  4DA4 A;  3EG2 A;  4ANJ A;  4F04 B;  5CKD A;  4JS4 A;  1WQ7 A;  1XJW B;  1O9S A;  1VQ9 T;  1JJ2 P;  3CCS A;  4C92 D;  1QLY A;  4FSX A;  2LX7 A;  2RJD A;  3S3O A;  2KEA A;  3JB9 F;  1NBE B;  2HSE B;  1VQN A;  2QQB A;  3QG1 A;  5GAN e;  1CKA A;  1N9R A;  1X01 A;  3QBY A;  4FT2 A;  5GJW B;  2C06 A;  2VVK A;  4HXJ A;  4M78 E;  5D6X A;  2AK5 A;  2MWP A;  3G1J A;  2NWM A;  4C92 F;  4J9B A;  5GMK l;  2RA2 A;  1YJN Q;  1M90 R;  4Y28 E;  3I5S A;  2EFI A;  2MPX C;  5IHI A;  3LGF A;  4KUL A;  5IAY A;  3CCV Q;  4XQ3 A;  4J6Y A;  2DIQ A;  4MMK A;  4BD3 A;  5DLO A;  1D1B A;  4J6W A;  4M7D E;  1XTD A;  2YLB A;  2LDM A;  1HD3 A;  1I5O B;  4BI3 A;  2OI3 A;  2QG9 B;  2FL7 A;  3CCE T;  2XU8 A;  2WAC A;  4CC7 A;  4X34 A;  1QVF A;  2K7A A;  3VKI A;  2GBQ A;  5FU7 B;  4M75 G;  1WDX A;  1LCK A;  1WPY A;  3HRS A;  3VS1 A;  3ZFJ A;  2X3W D;  4LDX A;  2RHI A;  1FX7 A;  1VOM A;  2EYZ A;  5FRO A;  5GAN 5;  1JBM A;  2YUP A;  2RJE A;  1I8F A;  4RTY A;  3THK A;  1LOJ A;  2LX9 A;  5DY9 A;  4CC3 A;  4OF1 A;  5C0M A;  2ED1 A;  4BB7 A;  3L2U A;  2EJG A;  3QDF A;  2DX1 A;  1XOV A;  3GP8 A;  1ZUY A;  4A4G A;  4BY6 C;  4HCK A;  1WXB A;  1QP2 A;  1Q86 U;  2L0A A;  4XTV A;  1ZUK A;  3UF4 A;  3GIB A;  3SB2 A;  5I22 A;  3CC4 Q;  2KK4 A;  1GFD A;  1U1T A;  1AZE A;  4DBR A;  2R58 A;  3CEY A;  5GAO m;  1JJ2 A;  5FRM A;  2DYI A;  2X3X D;  1JXM A;  3R6O A;  2MCN A;  2BZX A;  3TQ7 P;  3RIR A;  3O5Z A;  1IRX A;  1FMW A;  2DVJ A;  3JCM J;  3J7A F;  3SHW A;  2PUO B;  3FIF A;  2DM1 A;  3G6E Q;  2ROT A;  1MGQ A;  2QA4 T;  2X4X A;  4PJM A;  4BI8 B;  4DOW A;  3CC4 A;  2EYW A;  3MHX A;  4E7S A;  1UE9 A;  2CP3 A;  2DXT A;  4C0Z A;  2HAX A;  3JCM c;  4RTX A;  1YIT T;  3PIP A;  2AT1 B;  7AT1 B;  4E2F B;  4OGC A;  3X28 B;  3OY9 A;  1PCX A;  1M2V B;  1BCM A;  2DK3 A;  4A54 A;  5LL6 S;  2ZCF B;  3X24 B;  1VQP A;  1RI9 A;  4MZT A;  1TTH B;  2ZPE B;  3PVQ A;  2DTH A;  4M78 F;  4OMN A;  1YJ9 T;  3G6E A;  3EG9 B;  4AFU C;  4AFS C;  2KNB B;  4DEY A;  2FZG B;  2CH4 W;  2H8H A;  1JXO A;  5GMK j;  2DKG A;  1KQ1 A;  3FRN A;  1TXQ A;  2LT1 A;  4QQ6 A;  2JM9 A;  3CXC A;  4ORZ A;  4M7D F;  2ZGW A;  1Y71 A;  3JAM E;  2RI3 A;  3OS1 A;  3EG9 A;  1OU8 A;  2EJF A;  2SEM A;  2KAF A;  1FYN A;  2GFA A;  2CUB A;  1R8O B;  1KG1 A;  3OS5 A;  4XU1 A;  1OX9 A;  1KC8 R;  1QVG P;  2F69 A;  1Q95 G;  2P4R A;  1VQ9 Q;  2RN8 A;  3GF5 A;  4M77 A;  3JB9 H;  5LJ3 g;  3NHN A;  1ZSG A;  3U23 A;  4J9I A;  1BKB A;  1ZQ1 A;  4XK8 E;  1KD1 U;  2MI6 A;  1BI0 A;  1QVF S;  3JCM X;  3OBW A;  2RK1 A;  1VYV A;  2D1X A;  4GY5 A;  2JT4 A;  1OPL A;  2CP0 A;  2ROL A;  3LH5 A;  2ZAE A;  1G3S A;  4DOV A;  4KBM B;  3RBB B;  4PJL A;  3CCR T;  4NOY A;  2KXC A;  2CSI A;  2OTL T;  3F70 A;  4EMK B;  1KSW A;  1AD5 A;  3VS0 A;  1W4S A;  1VQ9 A;  1QQJ A;  5LJ3 h;  3A98 A;  3VJP A;  3DB4 A;  3CC7 Q;  1NJI U;  4QQD A;  2HMA A;  1GCQ C;  3H8Z A;  2DBK A;  4C92 B;  1QCO A;  4Z8A A;  2EQM A;  5D7U A;  5FLX E;  1TOV A;  1VQ8 T;  1IO6 A;  1UFF A;  1S1N A;  4C8Q D;  3VS5 A;  2JS2 A;  1HSQ A;  4EMK A;  4Y91 A;  2PU9 B;  2A7Y A;  2QK0 A;  2QDY B;  3HRT A;  4J83 A;  3CCU Q;  3M57 A;  4LUD A;  1J3T A;  1M4Z A;  2QAS A;  1QWE A;  1WFW A;  1M8M A;  2QEX T;  4C92 A;  1GBQ A;  3RDV A;  2XDD A;  4NS5 A;  1JJ2 S;  1V29 B;  2O9S A;  1YJW T;  2Z0W A;  1K8A R;  3H0H A;  5FU6 C;  2JUF A;  3VUZ A;  2EJ9 A;  3CC7 A;  2JW4 A;  1WIE A;  2PNI A;  1Z9Q A;  1KQS P;  3MP8 A;  3I35 A;  1Q82 C;  4JJC A;  4CRI A;  2QDL A;  5I2S A;  5LJ3 e;  1BIB A;  3RER A;  1YI2 T;  1Q7Y R;  2D0Q B;  1X75 C;  1QVG A;  2C0I A;  3CCU A;  1Q7Y C;  4LXC A;  3CME T;  1PSF A; 
#chains in the Genus database with same CATH homology
 1W1F A;  2J6F A;  5L23 A;  1UG1 A;  4CC4 B;  3I9Q A;  1KIK A;  2DBM A;  2HDA A;  1WA7 A;  2CT4 A;  2V1R A;  2JS0 A;  2ED0 A;  4Y92 A;  1OOT A;  2FRW A;  1HJD A;  2DL3 A;  2RQW A;  4JPB W;  2KGT A;  2LCS A;  2KBT A;  1E7O A;  2YDL A;  1YP5 A;  3I5R A;  1UUE A;  2YUO A;  1FMK A;  1U5S A;  1RUW A;  3R6N A;  1SSH A;  2OJ2 A;  2O9V A;  3EHQ A;  4JJB A;  2YUQ A;  2L3P A;  1TUC A;  2JXB A;  2LJ3 A;  4ZNX A;  2BTT A;  1BK2 A;  3UA7 A;  2KRM A;  3REB B;  1GL5 A;  1X27 A;  4GLM A;  5GJV B;  2FPE A;  1AZG B;  3VS2 A;  1GFC A;  1QWF A;  1NYG A;  1KJW A;  2K9G A;  2BZ8 A;  1BBZ A;  1ARK A;  2AKL A;  2EGA A;  1WLP B;  2EYX A;  2DA9 A;  1OPK A;  4EIK A;  1K9A A;  3NMZ C;  2GGR A;  1X69 A;  1WX6 A;  4QT7 A;  3PVL A;  2F2W A;  2JMC A;  3CQT A;  5FWC A;  3UAT A;  5EC7 A;  1NEG A;  2RQU A;  4J9D A;  4F16 A;  1W70 A;  1W6X A;  2DL4 A;  2RPN A;  3EG2 A;  2LJ1 A;  1JU5 C;  2FPF A;  2DLP A;  1QLY A;  5HCK A;  2LX7 A;  2KEA A;  2XMF A;  2HEQ A;  4E6R A;  2J6K A;  4HVW A;  2FEI A;  2JTE A;  1I07 A;  1CKA A;  1ZX6 A;  2GTO A;  2J7I A;  5GJW B;  4Z88 A;  2RQT A;  2VVK A;  4HXJ A;  4WCI A;  2AK5 A;  2FG0 A;  2J6O A;  2NWM A;  4J9B A;  4R0K A;  4RTV A;  3C0C A;  2B86 A;  1NYF A;  2GQI A;  1JO8 A;  3I5S A;  1T3L A;  1RLP C;  1PHT A;  1QKW A;  2D8J A;  5IHI A;  3M0Q A;  1SEM A;  4D8K A;  1I1J A;  2DL7 A;  1UJ0 A;  4OMO A;  4RTW A;  1GCP A;  2D0N A;  1MV0 B;  1H8K A;  1HD3 A;  2GNC A;  2DE0 X;  3KFV A;  2OI3 A;  1X6G A;  1JEG A;  2V1Q A;  4KRT A;  1U3O A;  2LQW A;  2DRM A;  4CC7 A;  5IXF A;  2K7A A;  1I0C A;  2RQR A;  2GBQ A;  4OML A;  2ABL A;  4HVU A;  1WDX A;  1LCK A;  1X43 A;  3VS1 A;  1GRI A;  1YWP A;  2X3W D;  2FO0 A;  3SEM A;  1YCS B;  2EYZ A;  2EYY A;  2GTJ A;  1YN8 A;  3GBQ A;  2YUP A;  4RTY A;  3THK A;  3TSW A;  4AG2 C;  1VYU A;  1M30 A;  3PE0 A;  5FWB A;  2KYB A;  1M3A A;  3H41 A;  2JM8 A;  4CC3 A;  2J06 A;  5I11 A;  1OEB A;  2NUZ A;  1K4U S;  2EGC A;  2ED1 A;  4LNP A;  2DRK A;  2DX1 A;  1XOV A;  2KYM A;  1ZUY A;  1G83 A;  2VWF A;  3ULR B;  4HCK A;  1WXB A;  2DL5 A;  2RQV A;  3EG1 A;  2L0A A;  1WXU A;  1ZUK A;  4IIM A;  2J05 A;  2L2P A;  1M3C A;  3UF4 A;  5I22 A;  2FRY A;  2D8H A;  1GFD A;  1AZE A;  5IHK A;  1YNZ A;  1AOJ A;  1CSK A;  4AG1 C;  1AEY A;  2KE9 A;  1AWX A;  4LE9 A;  4OMM A;  2EKH A;  2X3X D;  1JXM A;  1BB9 A;  2MCN A;  2BZX A;  1EFN A;  1Y0M A;  1UDL A;  3O5Z A;  1X2Q A;  2AZS A;  2KR3 A;  2DVJ A;  2L3Q A;  3QWY A;  2K2M A;  2KXD A;  2KT8 A;  1X6B A;  3NGP A;  2ECZ A;  3SHW A;  3EG3 A;  4FSS A;  4CC2 A;  4IIO A;  4J9E A;  1JQQ A;  3M0U A;  1SHG A;  4DEX A;  2AZV A;  2DM1 A;  2ROT A;  2LZ6 B;  2G6F X;  2M51 A;  4RTU A;  1OV3 A;  3UA6 A;  2IIM A;  2EYW A;  1UE9 A;  2EPD A;  2K3B A;  1ZLM A;  2OAW A;  1SPK A;  1NM7 A;  2F2V A;  2KRS A;  4AFZ C;  4RTX A;  1AVZ C;  4Z89 A;  4JZ4 A;  1RLQ C;  2F2X A;  1VYT A;  2EVR A;  1ABO A;  1UHF A;  2YT6 A;  4JJD A;  2PTK A;  1E6G A;  1B3Q A;  2LQN A;  3NPF A;  2EBP A;  3ZL7 C;  3VS7 A;  1ZBJ A;  2ENM A;  1U06 A;  1N5Z A;  2DJQ A;  1RI9 A;  3QWX X;  2A37 A;  2VKN A;  3PVQ A;  4D8D A;  2HCK A;  2CH4 A;  2A08 A;  2C0O A;  4OMN A;  3VS3 A;  1SHF A;  2RF0 A;  4AFU C;  4AFS C;  1NEB A;  1UEC A;  3H0I A;  3EGU A;  4GBQ A;  1H3H A;  2KNB B;  2FPD A;  2I0N A;  4DEY A;  2CH4 W;  2H8H A;  2DNU A;  4X1V A;  1JXO A;  2C0T A;  1NLP C;  1TG0 A;  1T0J A;  2O2O A;  1AWJ A;  3REA B;  2ESW A;  2JM9 A;  4ORZ A;  4K11 A;  4J9G A;  1YWO A;  4JZ3 A;  2MOX A;  2SEM A;  1FYN A;  4LN2 A;  5ECA A;  5IXB A;  2CUB A;  1M27 C;  1MUZ A;  2PZ1 A;  3VS4 A;  3RNJ A;  2DYB A;  3TSZ A;  1WI7 A;  2DMO A;  2W10 A;  1B07 A;  1G2B A;  2KRO A;  1BU1 A;  4RUG A;  4ESR A;  3VS6 A;  1VA7 A;  5IH2 A;  1KFZ A;  1AWW A;  3EG0 A;  2P4R A;  4A63 B;  2CSQ A;  2RN8 A;  5IHN A;  2MIO A;  1QCF A;  2O31 A;  2K6D A;  2EQI A;  4J9C A;  2KRN A;  1K0X A;  2RMO A;  3IQL A;  1X2K A;  3NHN A;  3M0R A;  1ZSG A;  4J9H A;  1E6H A;  2HBW A;  3U23 A;  4J9I A;  1CKB A;  1NG2 A;  2CUD A;  2BZY A;  1GBR A;  4OMP A;  1VYV A;  2D1X A;  2JT4 A;  2LNH B;  1AWO A;  1OPL A;  1PRM C;  2DF6 A;  1K0S A;  2ROL A;  1ABQ A;  3LH5 A;  1NLO C;  2RNA A;  1K76 A;  2KT1 A;  1ZUU A;  3EHR A;  3H0F A;  2LMJ A;  3RBB B;  4AFQ C;  1A0N B;  2KXC A;  2M0Y A;  2CSI A;  2E5K A;  2CT3 A;  2CRE A;  1KSW A;  1AD5 A;  2A36 A;  3VS0 A;  4HVV A;  1UTI A;  3A98 A;  1T3S A;  3M0T A;  5FW9 A;  1T0H A;  1GCQ C;  2DBK A;  1SRM A;  4Z8A A;  1WYX A;  1IO6 A;  1UFF A;  1S1N A;  2JMA A;  3VRZ A;  3VS5 A;  2JS2 A;  2W0Z A;  1HSQ A;  2DL8 A;  1SRL A;  2EGE A;  1H92 A;  1PWT A;  4LUD A;  1J3T A;  1QWE A;  1K1Z A;  1WFW A;  1M8M A;  3FJ5 A;  2A28 A;  1Y57 A;  2YUN A;  1GBQ A;  3M0S A;  4RTZ A;  1V1C A;  3M0P A;  2YSQ A;  1PKT A;  2HSP A;  1UJY A;  2O9S A;  2EW3 A;  4RTT A;  3H0H A;  1TUD A;  3JV3 A;  2JW4 A;  1UHC A;  2LJ0 A;  4F17 A;  1WIE A;  2CDT A;  2PNI A;  2AKK A;  1M3B A;  1Z9Q A;  3I35 A;  1PNJ A;  4J9F A;  4JJC A;  1PRL C;  1Z9Z A;  2LP5 A;  2SRC A;  2O88 A;  2QDL A;  3VRY A;  1QKX A;  2K79 A;  4LUE A;  4F14 A;  1MV3 A;  2L3S A;  3TVT A;  2C0I A;  2DIL A;  4M4Z A;  1WXT A;  1UGV A;  1GCQ A;  1PKS A;  4OMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...