4X1VA

Crystal structure of the 2nd sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 76-91) from human arap1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4x1vA00
2J6OA 4RTXA 2KEAA 1K0XA 2FG0A 2PTKA 5ECAA 4HVWA 4RTUA 2AZSA 1FYNA 3EG3A 2EVRA 2EGCA 3VRZA 2L0AA 2CREA 4LUDA 1GBQA 1QWFA 1UHFA 3M0QA 2LNHB 3RBBB 1T0HA 1PWTA 1RLPC 2KXCA 2DBMA 3IQLA 3VS0A 2RNAA 3VS7A 2JTEA 2CT4A 1SHFA 2K9GA 2BZ8A 1VYTA 1WXBA 1WI7A 1YP5A 1X27A 2IIMA 3PVLA 3ZL7C 5FW9A 5IXFA 1NEBA 2GTOA 1JXMA 4Z88A 2MOXA 1PKSA 4IIOA 2EBPA 1JEGA 4LE9A 2EYWA 2L2PA 1K76A 3I9QA 1K4US 1H8KA 2EGEA 2I0NA 1NYGA 2AK5A 2YUOA 2KR3A 4RUGA 4R0KA 1TUCA 2EPDA 1E6HA 3M0TA 1X2QA 4J9BA 2ROLA 1ZUUA 1ARKA 1RI9A 1AZGB 4F17A 2YUQA 3I5SA 4RTZA 1V1CA 3UA6A 4A63B 2HSPA 2KNBB 2RPNA 2JS2A 1UGVA 2RQVA 3EG2A 4JZ3A 1YWPA 2RQWA 1JU5C 2NWMA 2RQUA 3NGPA 1Y57A 2FEIA 4LN2A 1HD3A 2D0NA 1X69A 1T0JA 2CSIA 4RTYA 1VYUA 2F2VA 4GBQA 4OMPA 1TUDA 2EYZA 1WLPB 2DM1A 2O88A 4OMMA 1RLQC 2A36A 2OJ2A 1GCPA 1RUWA 1GRIA 2JS0A 3M0SA 2LJ1A 3O5ZA 1Z9QA 4AG2C 1AEYA 1SHGA 2DL7A 1NLPC 2HCKA 3REBB 1MV0B 2DL4A 1OV3A 2DYBA 4CC7A 1WYXA 1QKWA 1WA7A 2AKKA 2K2MA 2LJ0A 4JJBA 4OMNA 2KYMA 3I5RA 2L3SA 3UA7A 1AWWA 4CC2A 2ROTA 2KT1A 4F14A 1ZBJA 1ZSGA 2XMFA 3M0RA 3C0CA 1T3LA 2J6FA 3EGUA 1B3QA 1OOTA 4J9HA 2LMJA 2D8JA 3TVTA 4ZNXA 3M0PA 4HVVA 2F2WA 1N5ZA 2YT6A 2D1XA 2ESWA 1GL5A 2DF6A 3TSWA 4JJDA 1MUZA 5HCKA 1UG1A 1W6XA 2VVKA 3VS4A 2O9SA 3H0IA 2DVJA 2DNUA 3NMZC 1ABQA 2MCNA 4J9DA 4RTWA 1TG0A 2KRSA 1UECA 4JPBW 1SPKA 2P4RA 5IHKA 2OI3A 1M8MA 2QDLA 1QLYA 2O9VA 3VS5A 1S1NA 1WIEA 1G2BA 1PRLC 2DMOA 2JMAA 3PE0A 2LJ3A 1ZUKA 1UTIA 2KRMA 2RN8A 4WCIA 3A98A 3SHWA 4D8KA 1QWEA 2GNCA 1BB9A 3PVQA 3REAB 1GCQC 1GFCA 3JV3A 4D8DA 1NM7A 4AFZC 2HBWA 4Z8AA 2O2OA 1OEBA 1ZLMA 2J06A 2KXDA 1W70A 1WX6A 1GCQA 2EW3A 1AOJA 5GJVB 1CSKA 2HEQA 5EC7A 2FPDA 1PKTA 3H0FA 1UE9A 2DBKA 2YSQA 4Y92A 4OMQA 2VWFA 4ESRA 2KROA 3H0HA 2GGRA 2BZYA 2KGTA 2EYXA 2EKHA 3FJ5A 1QCFA 2KRNA 3VS3A 4AFSC 2L3QA 2NUZA 3M0UA 2E5KA 5IHNA 2LCSA 4AG1C 1X2KA 2JM8A 2DL3A 1CKBA 2DA9A 2M51A 3VS2A 2J05A 3EG0A 5FWCA 3UF4A 1SSHA 1BU1A 2LQNA 2MIOA 2HDAA 1WXTA 2GQIA 1IO6A 3EHQA 2K6DA 1FMKA 2YUNA 5L23A 1U06A 4Z89A 1YWOA 3SEMA 2X3WD 2AZVA 1E7OA 2CUDA 3VS6A 1PRMC 1CKAA 3I35A 1YN8A 1AZEA 1J3TA 1PNJA 2DL8A 1PHTA 3RNJA 3NPFA 3R6NA 2JMCA 1GBRA 1H92A 2V1QA 2DL5A 2J6KA 2JM9A 5I22A 4HVUA 2FRYA 2J7IA 4CC3A 2LQWA 2ED0A 1KIKA 1NEGA 4AFQC 2EYYA 1SEMA 4OMOA 4RTTA 4EIKA 1AWJA 2CH4W 2W0ZA 4RTVA 2SRCA 1LCKA 2LZ6B 2YDLA 1NYFA 2ENMA 2CH4A 1M27C 2PNIA 3VS1A 2JW4A 3EHRA 5IHIA 2RMOA 4IIMA 2GBQA 2DE0X 2F2XA 2C0IA 1AD5A 1BBZA 1NG2A 2AKLA 1SRLA 1EFNA 1X43A 4JJCA 1ABOA 1I1JA 1M30A 1HJDA 4F16A 2ABLA 1ZX6A 2DLPA 1WFWA 3CQTA 1HSQA 1YNZA 2M0YA 1M3BA 4J9EA 4LNPA 2FPEA 1A0NB 1MV3A 1YCSB 1K0SA 2G6FX 1WXUA 4GLMA 4CC4B 5IH2A 1AWXA 4FSSA 2LX7A 3QWYA 1B07A 2CDTA 3EG1A 2A08A 1JO8A 2CT3A 1K9AA 1JQQA 1T3SA 3THKA 2JT4A 2K79A 3TSZA 1SRMA 1X6BA 4HXJA 1I0CA 1UUEA 2PZ1A 3H41A 2BTTA 3GBQA 1WDXA 2H8HA 1Z9ZA 1X6GA 1M3AA 1M3CA 2FPFA 2GTJA 2A28A 2EQIA 2FO0A 5GJWB 4JZ4A 3U23A 2RQRA 1OPKA 4J9CA 1UDLA 3LH5A 2V1RA 1UJ0A 4K11A 4QT7A 1VA7A 1G83A 4HCKA 2ED1A 4ORZA 4J9FA 2K3BA 1KFZA 4J9GA 1OPLA 2RF0A 2KYBA 1KSWA 1K1ZA 2DILA 3UATA 2KE9A 2CSQA 2KBTA 4DEYA 2EGAA 4X1VA 2LP5A 4LUEA 1AWOA 1VYVA 2ECZA 2W10A 3ULRB 5FWBA 5IXBA 1QKXA 1KJWA 2DX1A 4E6RA 2CUBA 2RQTA 3NHNA 2BZXA 2L3PA 4J9IA 2JXBA 2C0TA 1Y0MA 1NLOC 2VKNA 2O31A 4KRTA 1U5SA 1UJYA 1UFFA 3QWXX 2FRWA 4OMLA 4M4ZA 2A37A 1ZUYA 2DJQA 2SEMA 2KT8A 2B86A 1E6GA 2D8HA 2DRMA 4AFUC 1JXOA 3KFVA 2OAWA 2K7AA 2X3XD 1I07A 2C0OA 1GFDA 1H3HA 4DEXA 1AVZC 1UHCA 2YUPA 2DRKA 3VRYA 1W1FA 1U3OA 1XOVA 5I11A 1BK2A
chains in the Genus database with same CATH superfamily
4RTUA 2IPOB 1FYNA 4DQ2A 3M58A 2EVRA 3SWNC 4LUDA 5GAOp 1QVFP 2MAMA 3JSCA 1KQSA 4EDUA 5M9OA 2XIDA 2VYTA 4M77D 1SHFA 1SSFA 2PVGB 5CKDA 3PNWC 5FW9A 2JTFA 2YHTA 5IXFA 3P8BB 2MOXA 3HL8A 1NPRA 4BY6B 2L2PA 3GNGA 5LJ3h 1K4US 3JRZA 1JJ2P 1NYGA 4PNOA 4C8QE 1D0YA 4C8QB 4RUGA 4KUDK 1C1AA 1QVFS 1BI2A 2ROLA 4J9BA 3G71T 4M78F 1ZUUA 1ARKA 3G6EA 1BYMA 2JOYA 3UA6A 4A63B 1VQ8Q 3T9NA 3L2VA 2E3HA 3CCUQ 5HK0A 1D1CA 2HNIA 3CCJA 1VQOA 4A54A 1IB8A 1U8RA 1VIEA 5FU6B 2CP2A 3JB9I 3GIBA 2CSIA 3CMAQ 5CKHA 2LC4A 3CCJT 4KGVB 3QJ6A 4M75C 4C0DB 2E3IA 1U1TA 1WLPB 3S6WA 4N4HA 4LDUA 2OJ2A 1GCPA 1M1KR 1RUWA 2Y90A 4ZTFA 3M0SA 2LJ1A 3CXCA 2RI3A 3O5ZA 1C0MA 2DJZA 4B6MA 2GFAA 1NLPC 4RKUE 1FMVA 2A0FB 2P4TA 1O9SA 1V29B 2DYBA 5C6SA 2E70A 2LCCA 1WA7A 2ZPFB 3KXTA 3M9QA 3UA7A 2KY9A 4A4EA 4XTWA 5LJ5g 3M53A 2COYA 3EFOA 3QSUA 3EGUA 4II1A 2HQHA 5I21A 3L2RA 3OYYA 2O4XA 2D8JA 3HFOA 4M78C 3CBPA 3M0PA 2WSEE 3X28B 2D1XA 4EMHA 1IGQA 1VQMT 2RH2A 3RKXA 2K5FA 5HCKA 1UG1A 3HPWA 2R58A 2VVKA 1SKUB 4IUPA 4KGXB 4JJNK 1ABQA 1Q7YC 2MCNA 1WZOA 4M78D 3ZFJA 3JB9J 4F7UA 1MMAA 4JLGA 1NJIR 3LX7A 3H9NA 2RJEA 3M57A 1Q7YR 1K8AU 3DB3A 1RAFB 1RAGB 1KQ2A 4R56A 1MNDA 1QLYA 3VS5A 1S1NA 1IZ6A 1PRLC 3OSSC 1LNXA 1OZ2A 4M7AE 4RCBA 4AMCA 1MNEA 2DKGA 4HCCA 1QWEA 2GNCA 1BB9A 1X6OA 1Q82U 3L2WA 1EIFA 4BE2A 4GY5A 3UPUA 4C8QF 1OEBA 1QP2A 5CAIA 1VUBA 1WHGA 2J06A 2DD5A 4MMLA 5D6YA 2KXDA 4C8QG 1WX6A 2BUDA 5GJVB 1CSKA 2HEQA 4PL6A 3QJYA 5GAOl 4IUVA 1UEBA 2CP0A 1HYOA 4O5VA 2YSQA 3S3MA 4Y92A 4OMQA 1KC8C 4M77E 1RI0A 2KDSA 1D3BB 3PMTA 2EKHA 3FJ5A 1QCFA 2L3QA 1BI3A 2EQUA 4L6V5 4IUQA 1Q81U 5IHNA 2RI5A 5GANf 2P0QA 2COWA 2DL3A 1AHJB 3JCMX 3UWNA 3VV0A 3VS2A 4UC4A 4FU6A 3FC3A 3UF4A 2OTLT 2MIOA 2HDAA 3G4SA 3P8HA 3I56Q 3RERA 4A4KA 1FMKA 2CZ0B 5GAMg 2DTHA 2ZPEB 1YWOA 2X4JA 2DVEA 1E7OA 3AHUA 2DK3A 3VS6A 1PC0A 2ZZDA 1PHTA 1UGQB 3CCSQ 3R6NA 1JJ2S 3JCMd 1VQ5A 2DL5A 2NUPB 3QUIA 4HVUA 3LGFA 1DJ7B 4ME7A 4A4GA 4CC3A 2O4XB 1RADB 3VJPA 4EIKA 1AWJA 1YJ9Q 2SRCA 3BFMA 1Q86R 4HA8A 1K9MR 2LZ6B 2RJCA 3CC7T 5LJ5j 2PUKB 4N0AC 1M27C 4BD3A 3VS1A 3FIFA 1R77A 2QEXQ 2MK5A 2DE0X 3OYBA 4DA4A 2M02A 2C0IA 3JCMQ 1WHJA 3SDZA 3OYEA 3HFNA 5GAN8 1BBZA 2WACA 3MP6A 2AKLA 1EFNA 3VUZA 1M30A 3PMIA 1VQMA 1YI2T 1OQKA 1M3BA 3TCJA 1VQ7A 3SB2A 2RB6A 3DKMA 1Y7XA 1MV3A 3CBMA 2DERA 2Y4XA 1D1BA 4FSSA 2LX7A 3JCMb 4M75F 2K3XA 3PFSA 1JO8A 3E9FA 5GANj 2FZCB 3TSZA 1LVKA 1VQ8A 3CC2T 1XJWB 3EFSA 1UUEA 1VQKQ 3RMSA 2BTTA 1WDXA 1Z9ZA 1G3TA 1X6GA 2GTJA 2DPPB 2FO0A 5GANg 2RQRA 3EFRA 4OVAA 5GAMj 2V1RA 1B34B 5FU7C 3S3NA 4FL6A 4C5HA 3M54A 1G83A 2HMAA 3FRNA 4EMKA 4L5GA 1VQ9Q 3MCAB 2ED1A 2RM4A 3QKJA 4J9FA 4E7JA 2K3BA 5CCAA 2XD0A 1WHKA 4LD6A 3UATA 2KE9A 2KBTA 2CGHA 2EGAA 3QXEB 4XTVA 2LP5A 4LUEA 1AWOA 4XU2A 2A3LA 2ECZA 3HKSA 3DLMA 5IXBA 1U1SA 1P92A 2VXEA 2CZ6B 2QGFB 4E6RA 3QDRB 1N6AA 2ZAEA 3E1SA 2GQVA 4EMKC 1Y0MA 2QA4T 2GFUA 2E6ZA 2QDYB 3P8DA 3QBYA 3CCQQ 3QWXX 4M7DC 2FRWA 2E64A 4XU3A 4M4ZA 2A37A 1ZUYA 2FHDA 4JUVA 1QVFA 1IGUA 5LJ5e 4RG2A 1M90C 2X3XD 1Q86C 3F70A 3ZBDA 2DRKA 1W1FA 1U3OA 5I11A 4RG8A 4BACA 4RTXA 4M7AC 2EGCA 2CREA 4AT1B 1WJSA 1UHFA 3M0QA 2LNHB 1NZ9A 1D09B 2OTLA 1HK9A 4BE0A 1KC8U 1QCNA 4DBQA 1VQNA 1Q81R 2QTXA 2RNAA 3CCVT 3VS7A 3MJXA 2B8AA 2CT4A 2F5KA 2BZ8A 4NL3A 1WXBA 2NYSA 1WI7A 3ZL7C 1X27A 6AT1B 1BCOA 5LJ5f 3CCQT 3CCUA 1S72A 3ZEHA 4Z88A 1PKSA 1JEGA 4LE9A 5GAN5 1H8KA 5CKEA 1UGPB 1OI1A 2EYQA 4LDVA 3RIRA 1PD1A 2AK5A 4KBMB 4OMFB 2EPDA 5GMKm 3M0TA 1VQLT 3CBOA 1KG1A 4M78A 4F17A 1WJRA 4J7IA 4MZPA 3JCMg 3I5SA 4KH1B 1KQSS 4RTZA 1BI1A 1V1CA 2CZ7B 2HQEA 3WVEB 2HSPA 2KNBB 3NTIA 2JS2A 4MMKA 2BE9B 4JZ3A 5GAN7 4PLLA 2I2LA 3QYGB 1YJWT 2QQ9A 1X69A 1T0JA 4F7UB 1RAHB 5A0LA 3ER0A 5KYUB 4DBRA 2EYZA 2DM1A 1TU0B 1RLQC 3OYJA 3OYNA 2A36A 2JNGA 1GRIA 2JS0A 3VUBA 1Z9QA 4AG2C 2YWWA 1SHGA 4GLKA 1VQ6Q 2DL7A 8AT1B 2HCKA 1M90U 5D7UA 5C0MA 2M0OA 1OV3A 1BIAA 2LDMA 4M77B 3VU3C 2KSSA 4ZGJB 2K2VA 2M1HA 2LJ0A 5GANd 3EFOB 2DEQA 3CD6Q 1AWWA 3M59A 1AT1B 4CC2A 1PSEA 1ZBJA 2XMFA 3MP8A 4N4GA 5KYXB 3C0CA 1QVGS 2HAXA 3G6EQ 4XQ3A 3X24B 1XTDA 1OOTA 5FLXE 1UB4A 3TVTA 2CP7A 2F2WA 1EZZB 3CCLA 1N5ZA 2VGNA 5J39A 1GL5A 4FYXB 1VQ7T 2VASA 1VQPQ 4XTUA 2F1LA 3FLGA 3R6OA 3BW1A 3OS5A 3TSWA 1R0CB 4NS5A 2PVOB 4JJDA 1MUZA 3QZ5B 3H0IA 2DTIA 2LCLA 3CPWP 4RTWA 4IKFA 5DM7R 1YJNQ 3J7AF 1YJ9T 4DOWA 1PM3A 2KRSA 1UECA 4JPBW 1SPKA 4M75D 5HY6A 1YITT 3JCMJ 5IHKA 3FB9A 2MWOA 2QK0A 3HP9A 2DMOA 5CO7A 5AT1B 1ZUKA 2KRMA 4HKEA 4Q5WA 2VUBA 1JB0E 2RN8A 5KYNA 1M1KC 3SWNA 4D8KA 3PVQA 2V26A 1JRIA 5DLOA 1M9SA 2KI7A 3REAB 5IT9E 4D8DA 1PG5B 4XU0A 4C8QA 2HBWA 3L2UA 2MMPA 1SF9A 1YBYA 1W70A 1GCQA 1AOJA 3WXMB 4BUGA 1PKTA 1FMWA 8ATCB 1UE9A 3CC7Q 3TEEA 5LJ3j 5GAMd 2KROA 4E7KA 3GPLA 5LJ3f 2R5MA 5GAN6 2KGTA 2XG8D 2EYXA 2E4HA 3VS3A 2KRNA 1RACB 4LDWA 2NUZA 3KUFA 3M0UA 2E5KA 2RJFA 2LCSA 3V8JA 2OAUA 1CKBA 2M51A 3RKWA 3OA6A 3EG0A 2DZ9A 3C94A 3D7SB 1BU1A 1TWBA 4A4FA 4Z02A 2F69A 3EHQA 4YTLA 2YUNA 5L23A 4J7FA 4Z89A 1UGSB 4OF1A 3NTKA 3I35A 1OU8A 3BDLA 4M7DD 1PNJA 4M75A 1XQHA 2EQKA 3G6ET 5GAOm 2V1QA 7AT1B 2JM9A 3RR6A 5I22A 4PJNA 2MPXC 9ATCB 1M2VA 2LQWA 1MHNA 4AFQC 4OMOA 2CH4W 4RTVA 2CP5A 1YHQQ 5CKFA 2EJFA 2YRDA 3QIIA 4NOYA 4HT8A 2OTJA 5KCHA 2EQJA 2CH4A 4X9CA 1LJOA 2PNIA 3JCMe 4QW2A 5IHIA 2RMOA 4IIMA 4RMOA 2GBQA 2L8DA 4XAXB 2KQWA 4X34A 4OGEA 3GNFB 1N8RU 1SRLA 1X75C 4LXCA 4ELYC 2BIVA 4JJCA 5KYYB 1FWZA 4F16A 4E7SA 1WFWA 3CQTA 1YNZA 1LPLA 5J26A 1ZSZA 3MEWA 3JB9G 1B7TA 1K0SA 1WXUA 4CC4B 5IAYA 3QWYA 1B07A 3CCVQ 5LJ5d 2CDTA 1YJ9A 4PJOG 1YHQA 3LW5E 1KD1C 1OZ3A 1K9AA 2PUOB 4HCZA 3RMQA 2JT4A 5KE3A 3BDUA 4MZTA 4FYYB 3CCST 5GMKj 1I0CA 3GBQA 2H8HA 4BB7A 2K5LA 1UGRB 1M3AA 2JN0A 2K4YA 1TTHB 1YIJT 2F5TX 1VQ8T 3CCLT 5LJ3e 3LH5A 4LDYA 3LGLA 1FXXA 3BE3A 3EH2A 4XTZA 2QYZA 3SFMA 4WTOB 3OSVA 3V7CA 4PJMA 1OYXA 5IN1A 2XI9A 3WVDB 1FX7A 2KYBA 1VQ6T 3EGXB 4PJOA 4NL2A 2DILA 1Q7YU 4P5NA 4DEYA 3MP1A 1VYVA 3CCRT 1YI2Q 1VOMA 1QVPA 1IREB 1IHVA 4FIBA 3OYMA 3CCET 3CD6T 4PJOB 1KK7A 3NHNA 2L3PA 3BY7A 2JXBA 2C0TA 3SD4A 4KRTA 5FRMA 1UFFA 4BDZA 2PU9B 4OMLA 1Q81C 4TVRA 2QG9B 4F7UE 1W4SA 2DRMA 1W2BP 2EFIA 3CCRQ 4ZN3A 4PJOC 5GAOq 1ACMB 4KGZB 3UDCA 2K3YA 1H3HA 1C6VX 2DFUA 3A8HB 2HD0A 4DOVA 1KQ1A 2FL7A 2YUPA 3VRYA 1BKBA 2FZGB 2FG0A 2LX9A 2PTKA 1G3WA 4HVWA 5ECAA 3EG3A 4V2SA 3MEAA 3CMET 1OU9A 1QWFA 2ZPGB 4M75E 4PJOF 4M7DB 1RLPC 2HSEB 2X51A 2NUTB 1N27A 4E7IA 4FW1A 2DBMA 3IQLA 4QKUA 1I4K1 1YJNA 1VYTA 3CCJQ 3CMAT 1YP5A 1S72T 3PVLA 1MMNA 5KYYA 4XTYA 1VQNQ 3V7SA 2GTOA 4C0ZA 2M16A 1JXMA 2QASA 4IIOA 4J6YA 3CCMA 4ELZC 1K76A 2LQ8A 1Q82C 3I9QA 2R5AA 1RAIB 2I0NA 1KD1R 3RKYA 4J83A 2YUOA 2KR3A 1WQWA 3EGDB 4R0KA 1YJWA 1NPPA 2E12A 1VQ4Q 1X2QA 4L59A 3L1AA 3VYHB 5FU7B 2XU8A 2RPNA 4JRKA 4PKCC 3CXCP 3FJPA 2AT1B 1VQPT 3OYFA 5DLQE 1PSFA 3EG2A 1YWPA 3CCVA 2XDPA 1K9MU 3NGPA 1Y57A 2FEIA 4LN2A 2BKDN 1HD3A 4EMGA 4M75B 3C95A 5KYWB 3OYGA 3LH0A 3VYGA 3MKDA 2FZKB 4JS5A 3QHSA 5CKBA 1F1BB 2DEUA 1M8VA 3L2ZA 3META 2MF2A 2WSCE 4GBQA 1TUDA 4B9WA 4JRQA 3CCUT 4C8QD 1VIFA 2BE7D 1AEYA 3CMAA 2IVWA 3I55A 3C4SA 4OB2B 1QVGA 4R55A 3HSBA 3CXCS 1K73C 2DL4A 3A8MB 2ATCB 1WHLA 3A1PA 1NJIU 4ZGDB 1WYXA 2K2MA 2KYMA 3QYHB 4PJOD 1WHHA 2L3SA 1VQ9A 1G3YA 1BI0A 3MHXA 4C8QC 3QPHA 2H3EB 2ROTA 3OBWA 1N9SA 5FROA 2VGMA 1ZSGA 3M0RA 1T3LA 3EGDA 3CCQA 1B3QA 2DIQA 4M78G 2E1HA 4QVZA 4J9HA 1VQ5Q 2DAQA 4ZNXA 4FYVB 4HVVA 2YT6A 4CI0C 2DF6A 2ZPHB 1YI2A 2P84A 1D1AA 3CMEQ 1W6XA 5GAMe 2DTOA 2QA4A 2O9SA 2DVJA 2DNUA 3NMZC 4J9DA 2XHCA 3SWNB 3QG1A 1M90R 1Y96A 1TG0A 4M7DA 2P4RA 4OB1B 4D6WA 5CK9A 4J6XA 2DD4A 3PIOA 1VQMQ 5LL6S 1M8MA 1VQNT 2QDLA 2O9VA 4XK8E 4BE1A 1WIEA 1G2BA 2LJ3A 1UTIA 3J80E 2GF7A 3SHWA 3VKIA 4PJLA 3CC4T 3H8ZA 3LLRA 1VQKA 1GFCA 1Y07A 3JV3A 4M7AD 3GF5A 4AFZC 4VUBA 4E7LA 4PJJA 1YIJQ 1G5VA 4F7UF 3EG9B 1ZLMA 2JTMA 4LDXA 3MEVA 5I2MA 2EW3A 1K8AC 2DXCA 3QDFA 4F04B 3EG9A 3H0FA 4DBFA 1VQLA 1R0BG 3V7RA 3MO8A 2VWFA 4Y91A 5KYXA 5CR2A 4IURA 1ZHIA 4RCCA 3H0HA 2BZYA 2KVQG 3OMCA 3M4YA 3CC2A 4AFSC 5GMKh 4QVDA 2MWPA 2JVVA 1SG5A 3I55T 4LD9K 3CCEA 2G3RA 2E5QA 5GAN2 3EGXA 4X9DA 2XKOC 1YJNT 4AG1C 1X2KA 3LYIA 4M77A 2J05A 3I56A 2QEXA 4JRIA 5FWCA 4A53A 4JS4A 1N8RC 2LQNA 3A8OB 1WXTA 5AYFA 1IO6A 4PFZA 2HKQB 1Y96B 2LQKA 2LT4A 2LTOA 1WHMA 3OY9A 4FM4B 4C92A 2RHIA 2E6NA 5A0GA 3SEMA 2X3WD 2YXYA 2AZVA 2CUDA 3EAEA 1PRMC 1CKAA 3JCMV 1VQPA 1AZEA 1J3TA 2YRVA 4E7ZA 3NPFA 2LRQA 2DYIA 2RJDA 2EIFA 2JMCA 2RD1A 1H92A 2FVUA 4M77C 4IUTA 2RO0A 3URGA 1K73U 2J7IA 5GAOn 1K8AR 1TS9A 2EYYA 2VB6A 2DZCA 2KK4A 1NE8A 4M78B 1ZSZB 1NYFA 2ENMA 4M78E 3G4SQ 3OYDA 4M7AA 4M7AF 5CIUA 2K57A 4C92G 3OYKA 1BIBA 3A5ZB 1NG2A 3JCMW 1VQ9T 1I1JA 1I5LA 5A0DA 2ABLA 1ZX6A 3CC2Q 1I81A 3G4ST 3QO3A 1HSQA 5GAN4 2M0YA 3JAME 4F7UG 1IHWA 4J9EA 1QMCA 3OYHA 4M7DG 4OB3B 4JDSA 2DXUA 2VC8A 1AWXA 1M2VB 2MI6A 2OTJQ 3E2UA 2R57A 4C0DC 1TXQA 1YIJA 1JQQA 1Q86U 1T3SA 2K79A 2RI2A 4HXJA 1TUGB 3OW2A 3A8LB 3C12A 2FPFA 1KHIA 3OYLA 2L89A 4J8OA 5GJWB 1MMGA 4JZ4A 2V8JA 4C92D 2HL5C 2PQWA 1Y71A 1OX9A 1OPKA 1UDLA 1QW1A 1K9MC 5D6WA 1UJ0A 4ZTJA 4HCKA 3CD6A 3FEOA 3JCMh 4ORZA 4BI4A 4O6JA 3OBYA 2CP3A 1KFZA 2RHXA 2YLBA 2RF0A 3L42A 3N5BB 3M5AA 1M1FA 4M7AB 1W2BA 2CSQA 2QTVA 1VQ6A 2EAYA 4KUIA 3ME9A 2DETA 5LJ3g 3S3OA 2W10A 4FSXA 2EKOA 5FWBA 3ASKA 1KJWA 2DX1A 3HRTA 4FCYA 3CCLQ 2E10A 3OW2S 4ANJA 2EJGA 1I5OB 2AIRB 2VKNA 2DIGA 1UJYA 1W2BS 2DJQA 3H6ZA 4EMKB 2B86A 1E6GA 3M55A 1M1KU 1HXDA 1JXOA 4AFUC 3LWHA 4OB0B 4QVCA 1B34A 4J6WA 1N9RA 1I07A 2C0OA 1GFDA 4FT2A 4C92B 4DEXA 2EWNA 1M5Q1 5KE2A 1VQ4A 1XOVA 4PFOA 2HL3A 2J6OA 2KEAA 1ZBXA 1K0XA 1XNIA 2AZSA 4B9XA 3VRZA 2L0AA 1JJ2A 3L2QA 1GBQA 3RBBB 1T0HA 2ZPIB 1PWTA 2CS7A 5A2QE 1GXIE 4FT4A 2KXCA 4HCBA 1D0XA 3VS0A 2JTEA 2K9GA 2VV5A 2PVDB 2IIMA 4EPCA 2VXFA 1NEBA 2EBPA 2EYWA 2EGEA 5J3BA 2X35A 4ZGEB 1M2OA 3GOXA 3JCMc 1TUCA 1M4ZA 1E6HA 1WJQA 1NBEB 4C92E 2GCXA 5CQYA 2XICA 1RI9A 4A4HA 5CVIA 1AZGB 4C0FA 1VQ5T 1OULA 2YUQA 3OS2A 2IG0A 2D6FA 1I8FA 2L5QA 1TOVA 3O8VA 2QI2A 3G1JA 1UGVA 1K73R 4N4IA 2RQVA 3CCRA 4JRPA 2RQWA 1JU5C 2NWMA 2NUPA 2RQUA 2X9HA 3AT1B 3RESA 2P0KA 1QQJA 5GANh 1Q82R 2D9TA 2D0NA 5KH6A 4ZN1A 2OTLQ 4RTYA 1VYUA 5KYUA 2F2VA 2WSFE 2HQXA 4OMPA 2O88A 4OMMA 4DBHA 4BI8B 2FYKA 1KD1U 3REBB 1MV0B 3G71A 4C5GA 4CC7A 1QKWA 4JJBA 2AKKA 5EG2A 4OMNA 3I5RA 3TREA 4PFPA 2XDDA 3CPWA 2KT1A 4F14A 2CYZB 2J6FA 3TU4K 2RK2A 4BI3A 3TQ7P 2LMJA 3PIPA 1YJWQ 1QVGP 3CPFA 2RA2A 2ESWA 2O01E 5GMKi 4KH0B 2Z0WA 4HT9A 3CCMQ 3CPWS 2JZ2A 1RAAB 2LVMA 4QQDA 1S72Q 3VS4A 4QQ6A 1EX4A 1OX8A 2JJ9A 3NFCA 2MYSA 5GMKl 2CP6A 1D0ZA 4M7DF 1PD0A 5KYWA 1VQ7Q 3V8LA 2X4WA 2FB7A 2OI3A 4BDYA 3A8GB 1KC8R 2ZCFB 2ZPBB 2QQBA 3CCEQ 3PE0A 2JMAA 1G8XA 3PT9A 5GAMh 2C06A 1WPYA 3OQ5A 2EQMA 4WCIA 3A98A 2CKKA 4C92F 1VQOT 2X4XA 4PLIA 3CEYA 3M56A 1YITQ 2CZ1B 1VQLQ 1GCQC 4M77F 4OP0A 4E7HA 5DY9A 1NM7A 4Z8AA 2O2OA 1PCXA 3JB9F 4PJOE 2QGGA 3RDVA 2XK0A 5EC7A 2FPDA 2DBKA 3DB4A 4KT0E 3E9GA 3MPUB 2HBPA 4ESRA 2GGRA 3E19A 1V76A 5CQXA 2NUTA 2QQAA 1QP3A 1H641 2YLCA 2JM8A 4ATOA 2DA9A 2LNVA 1BCMA 3GLXA 5GAN3 5GANe 4QQGA 1KHCA 4C5IA 3OYCA 2DXBA 3OS1A 1SSHA 2EJ9A 2GQIA 3X20B 1JBMA 2K6DA 2P0PA 3PTAA 4XU1A 1U06A 2COZA 1YCYA 3QZ9B 3J81E 3KBGA 2QEXT 2RHYA 3Q1JA 3M4GA 4MDXA 1YN8A 1R8OB 4N0AA 2RK1A 2E65A 2QQSA 4J5YA 1Q95G 2DL8A 3HRSA 3RNJA 1VQ4T 5I2SA 1GBRA 1VQKT 4FYWB 2J6KA 5HKCA 1WNLA 4CRIA 2FRYA 2D0QB 3HHTB 2ED0A 1KIKA 1NEGA 1ZA1B 1SEMA 4RTTA 3JCMP 2W0ZA 1G3SA 1H3ZA 1LCKA 3CCMT 3OB9A 3I56T 4MZMA 2YDLA 4E47A 2RHZA 4Y28E 5FRNA 3OMGA 1YITA 2JW4A 3EHRA 2QXFA 1IXDA 1TH7A 4M75G 5FU6C 2F2XA 3JB9D 3I55Q 2QAZA 3V8KA 1AD5A 4OGCA 3CC4A 2Y4YA 2YRCA 5LJ5h 4KULA 4MDWA 1ZSZC 2X4YA 3HTRA 1X43A 3OW2P 1ABOA 4C5EA 2V8KA 1HJDA 3X26B 3CC4Q 2DLPA 1WGSA 4M7DE 3EH1A 5L8RE 2OX7A 3JCMf 4IUUA 2AHJB 2FPEA 4LNPA 1A0NB 1YCSB 3JB9H 5GAOr 3FDRA 1VQOQ 2G6FX 4GLMA 2HZYA 5IH2A 2K5IA 4E2FB 2QA4Q 5GMKe 1MGQA 3EG1A 2XDBA 2A08A 2CT3A 3OS0A 3THKA 3X25B 1SRMA 2KAFA 1X6BA 2PZ1A 5LJ3d 3H41A 4BY6C 1X01A 1RABB 1QCOA 1RAEB 1M3CA 3OYAA 1LOJA 3CCSA 2A28A 2EQIA 4WF2A 3U23A 3OYIA 4XTXA 2ZGWA 4J9CA 5GAMf 4K11A 4QT7A 1VA7A 2NLUA 5D6XA 4JLIA 1RL2A 1O75A 1ZA2B 2HKNA 3HRUA 2OTJT 4J9GA 1OPLA 1KSWA 2QQRA 2M9UA 2DO3A 1K1ZA 1TSFA 3DLLA 3CMEA 4X1VA 2KMTA 3UT1A 1NJIC 1D3BA 2V8IA 1M1GA 3ULRB 1QKXA 4FW2A 2CUBA 1IRXA 2RQTA 5KCOA 3LWIA 3CC7A 2BZXA 4J9IA 1NLOC 2O31A 2E41A 1U5SA 3RUXA 1YFNA 2SEMA 2KT8A 3G7ZA 2D8HA 2L3RA 3KFVA 4PK4A 3INZA 1N8RR 2OAWA 4M7AG 2K7AA 2RHUA 2LT1A 1KQSP 3PGGA 1MMDA 4C0GA 1YHQT 1AVZC 1UHCA 4M77G 2DXTA 5HK3A 3NTHA 3GP8A 2JUFA 2H3JA 3G71Q 3MEUA 1WQ7A 4C92C 1BK2A 2A7YA 1ZQ1A
chains in the Genus database with same CATH topology
2J6OA 4RTXA 2KEAA 1K0XA 2FG0A 2PTKA 5ECAA 4HVWA 4RTUA 2AZSA 1FYNA 3EG3A 2EVRA 2EGCA 3VRZA 2L0AA 2CREA 4LUDA 1GBQA 1QWFA 1UHFA 3M0QA 2LNHB 3RBBB 1T0HA 1PWTA 1RLPC 2KXCA 2DBMA 3IQLA 3VS0A 2RNAA 3VS7A 2JTEA 2CT4A 1SHFA 2K9GA 2BZ8A 1VYTA 1WXBA 1WI7A 1YP5A 1X27A 2IIMA 3PVLA 3ZL7C 5FW9A 5IXFA 1NEBA 2GTOA 1JXMA 4Z88A 2MOXA 1PKSA 4IIOA 2EBPA 1JEGA 4LE9A 2EYWA 2L2PA 1K76A 3I9QA 1K4US 1H8KA 2EGEA 2I0NA 1NYGA 2AK5A 2YUOA 2KR3A 4RUGA 4R0KA 1TUCA 2EPDA 1E6HA 3M0TA 1X2QA 4J9BA 2ROLA 1ZUUA 1ARKA 1RI9A 1AZGB 4F17A 2YUQA 3I5SA 4RTZA 1V1CA 3UA6A 4A63B 2HSPA 2KNBB 2RPNA 2JS2A 1UGVA 2RQVA 3EG2A 4JZ3A 1YWPA 2RQWA 1JU5C 2NWMA 2RQUA 3NGPA 1Y57A 2FEIA 4LN2A 1HD3A 2D0NA 1X69A 1T0JA 2CSIA 4RTYA 1VYUA 2F2VA 4GBQA 4OMPA 1TUDA 2EYZA 1WLPB 2DM1A 2O88A 4OMMA 1RLQC 2A36A 2OJ2A 1GCPA 1RUWA 1GRIA 2JS0A 3M0SA 2LJ1A 3O5ZA 1Z9QA 4AG2C 1AEYA 1SHGA 2DL7A 1NLPC 2HCKA 3REBB 1MV0B 2DL4A 1OV3A 2DYBA 4CC7A 1WYXA 1QKWA 1WA7A 2AKKA 2K2MA 2LJ0A 4JJBA 4OMNA 2KYMA 3I5RA 2L3SA 3UA7A 1AWWA 4CC2A 2ROTA 2KT1A 4F14A 1ZBJA 1ZSGA 2XMFA 3M0RA 3C0CA 1T3LA 2J6FA 3EGUA 1B3QA 1OOTA 4J9HA 2LMJA 2D8JA 3TVTA 4ZNXA 3M0PA 4HVVA 2F2WA 1N5ZA 2YT6A 2D1XA 2ESWA 1GL5A 2DF6A 3TSWA 4JJDA 1MUZA 5HCKA 1UG1A 1W6XA 2VVKA 3VS4A 2O9SA 3H0IA 2DVJA 2DNUA 3NMZC 1ABQA 2MCNA 4J9DA 4RTWA 1TG0A 2KRSA 1UECA 4JPBW 1SPKA 2P4RA 5IHKA 2OI3A 1M8MA 2QDLA 1QLYA 2O9VA 3VS5A 1S1NA 1WIEA 1G2BA 1PRLC 2DMOA 2JMAA 3PE0A 2LJ3A 1ZUKA 1UTIA 2KRMA 2RN8A 4WCIA 3A98A 3SHWA 4D8KA 1QWEA 2GNCA 1BB9A 3PVQA 3REAB 1GCQC 1GFCA 3JV3A 4D8DA 1NM7A 4AFZC 2HBWA 4Z8AA 2O2OA 1OEBA 1ZLMA 2J06A 2KXDA 1W70A 1WX6A 1GCQA 2EW3A 1AOJA 5GJVB 1CSKA 2HEQA 5EC7A 2FPDA 1PKTA 3H0FA 1UE9A 2DBKA 2YSQA 4Y92A 4OMQA 2VWFA 4ESRA 2KROA 3H0HA 2GGRA 2BZYA 2KGTA 2EYXA 2EKHA 3FJ5A 1QCFA 2KRNA 3VS3A 4AFSC 2L3QA 2NUZA 3M0UA 2E5KA 5IHNA 2LCSA 4AG1C 1X2KA 2JM8A 2DL3A 1CKBA 2DA9A 2M51A 3VS2A 2J05A 3EG0A 5FWCA 3UF4A 1SSHA 1BU1A 2LQNA 2MIOA 2HDAA 1WXTA 2GQIA 1IO6A 3EHQA 2K6DA 1FMKA 2YUNA 5L23A 1U06A 4Z89A 1YWOA 3SEMA 2X3WD 2AZVA 1E7OA 2CUDA 3VS6A 1PRMC 1CKAA 3I35A 1YN8A 1AZEA 1J3TA 1PNJA 2DL8A 1PHTA 3RNJA 3NPFA 3R6NA 2JMCA 1GBRA 1H92A 2V1QA 2DL5A 2J6KA 2JM9A 5I22A 4HVUA 2FRYA 2J7IA 4CC3A 2LQWA 2ED0A 1KIKA 1NEGA 4AFQC 2EYYA 1SEMA 4OMOA 4RTTA 4EIKA 1AWJA 2CH4W 2W0ZA 4RTVA 2SRCA 1LCKA 2LZ6B 2YDLA 1NYFA 2ENMA 2CH4A 1M27C 2PNIA 3VS1A 2JW4A 3EHRA 5IHIA 2RMOA 4IIMA 2GBQA 2DE0X 2F2XA 2C0IA 1AD5A 1BBZA 1NG2A 2AKLA 1SRLA 1EFNA 1X43A 4JJCA 1ABOA 1I1JA 1M30A 1HJDA 4F16A 2ABLA 1ZX6A 2DLPA 1WFWA 3CQTA 1HSQA 1YNZA 2M0YA 1M3BA 4J9EA 4LNPA 2FPEA 1A0NB 1MV3A 1YCSB 1K0SA 2G6FX 1WXUA 4GLMA 4CC4B 5IH2A 1AWXA 4FSSA 2LX7A 3QWYA 1B07A 2CDTA 3EG1A 2A08A 1JO8A 2CT3A 1K9AA 1JQQA 1T3SA 3THKA 2JT4A 2K79A 3TSZA 1SRMA 1X6BA 4HXJA 1I0CA 1UUEA 2PZ1A 3H41A 2BTTA 3GBQA 1WDXA 2H8HA 1Z9ZA 1X6GA 1M3AA 1M3CA 2FPFA 2GTJA 2A28A 2EQIA 2FO0A 5GJWB 4JZ4A 3U23A 2RQRA 1OPKA 4J9CA 1UDLA 3LH5A 2V1RA 1UJ0A 4K11A 4QT7A 1VA7A 1G83A 4HCKA 2ED1A 4ORZA 4J9FA 2K3BA 1KFZA 4J9GA 1OPLA 2RF0A 2KYBA 1KSWA 1K1ZA 2DILA 3UATA 2KE9A 2CSQA 2KBTA 4DEYA 2EGAA 4X1VA 2LP5A 4LUEA 1AWOA 1VYVA 2ECZA 2W10A 3ULRB 5FWBA 5IXBA 1QKXA 1KJWA 2DX1A 4E6RA 2CUBA 2RQTA 3NHNA 2BZXA 2L3PA 4J9IA 2JXBA 2C0TA 1Y0MA 1NLOC 2VKNA 2O31A 4KRTA 1U5SA 1UJYA 1UFFA 3QWXX 2FRWA 4OMLA 4M4ZA 2A37A 1ZUYA 2DJQA 2SEMA 2KT8A 2B86A 1E6GA 2D8HA 2DRMA 4AFUC 1JXOA 3KFVA 2OAWA 2K7AA 2X3XD 1I07A 2C0OA 1GFDA 1H3HA 4DEXA 1AVZC 1UHCA 2YUPA 2DRKA 3VRYA 1W1FA 1U3OA 1XOVA 5I11A 1BK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6O A;  4RTX A;  2KEA A;  1K0X A;  2FG0 A;  2PTK A;  5ECA A;  4HVW A;  4RTU A;  2AZS A;  1FYN A;  3EG3 A;  2EVR A;  2EGC A;  3VRZ A;  2L0A A;  2CRE A;  4LUD A;  1GBQ A;  1QWF A;  1UHF A;  3M0Q A;  2LNH B;  3RBB B;  1T0H A;  1PWT A;  1RLP C;  2KXC A;  2DBM A;  3IQL A;  3VS0 A;  2RNA A;  3VS7 A;  2JTE A;  2CT4 A;  1SHF A;  2K9G A;  2BZ8 A;  1VYT A;  1WXB A;  1WI7 A;  1YP5 A;  1X27 A;  2IIM A;  3PVL A;  3ZL7 C;  5FW9 A;  5IXF A;  1NEB A;  2GTO A;  1JXM A;  4Z88 A;  2MOX A;  1PKS A;  4IIO A;  2EBP A;  1JEG A;  4LE9 A;  2EYW A;  2L2P A;  1K76 A;  3I9Q A;  1K4U S;  1H8K A;  2EGE A;  2I0N A;  1NYG A;  2AK5 A;  2YUO A;  2KR3 A;  4RUG A;  4R0K A;  1TUC A;  2EPD A;  1E6H A;  3M0T A;  1X2Q A;  4J9B A;  2ROL A;  1ZUU A;  1ARK A;  1RI9 A;  1AZG B;  4F17 A;  2YUQ A;  3I5S A;  4RTZ A;  1V1C A;  3UA6 A;  4A63 B;  2HSP A;  2KNB B;  2RPN A;  2JS2 A;  1UGV A;  2RQV A;  3EG2 A;  4JZ3 A;  1YWP A;  2RQW A;  1JU5 C;  2NWM A;  2RQU A;  3NGP A;  1Y57 A;  2FEI A;  4LN2 A;  1HD3 A;  2D0N A;  1X69 A;  1T0J A;  2CSI A;  4RTY A;  1VYU A;  2F2V A;  4GBQ A;  4OMP A;  1TUD A;  2EYZ A;  1WLP B;  2DM1 A;  2O88 A;  4OMM A;  1RLQ C;  2A36 A;  2OJ2 A;  1GCP A;  1RUW A;  1GRI A;  2JS0 A;  3M0S A;  2LJ1 A;  3O5Z A;  1Z9Q A;  4AG2 C;  1AEY A;  1SHG A;  2DL7 A;  1NLP C;  2HCK A;  3REB B;  1MV0 B;  2DL4 A;  1OV3 A;  2DYB A;  4CC7 A;  1WYX A;  1QKW A;  1WA7 A;  2AKK A;  2K2M A;  2LJ0 A;  4JJB A;  4OMN A;  2KYM A;  3I5R A;  2L3S A;  3UA7 A;  1AWW A;  4CC2 A;  2ROT A;  2KT1 A;  4F14 A;  1ZBJ A;  1ZSG A;  2XMF A;  3M0R A;  3C0C A;  1T3L A;  2J6F A;  3EGU A;  1B3Q A;  1OOT A;  4J9H A;  2LMJ A;  2D8J A;  3TVT A;  4ZNX A;  3M0P A;  4HVV A;  2F2W A;  1N5Z A;  2YT6 A;  2D1X A;  2ESW A;  1GL5 A;  2DF6 A;  3TSW A;  4JJD A;  1MUZ A;  5HCK A;  1UG1 A;  1W6X A;  2VVK A;  3VS4 A;  2O9S A;  3H0I A;  2DVJ A;  2DNU A;  3NMZ C;  1ABQ A;  2MCN A;  4J9D A;  4RTW A;  1TG0 A;  2KRS A;  1UEC A;  4JPB W;  1SPK A;  2P4R A;  5IHK A;  2OI3 A;  1M8M A;  2QDL A;  1QLY A;  2O9V A;  3VS5 A;  1S1N A;  1WIE A;  1G2B A;  1PRL C;  2DMO A;  2JMA A;  3PE0 A;  2LJ3 A;  1ZUK A;  1UTI A;  2KRM A;  2RN8 A;  4WCI A;  3A98 A;  3SHW A;  4D8K A;  1QWE A;  2GNC A;  1BB9 A;  3PVQ A;  3REA B;  1GCQ C;  1GFC A;  3JV3 A;  4D8D A;  1NM7 A;  4AFZ C;  2HBW A;  4Z8A A;  2O2O A;  1OEB A;  1ZLM A;  2J06 A;  2KXD A;  1W70 A;  1WX6 A;  1GCQ A;  2EW3 A;  1AOJ A;  5GJV B;  1CSK A;  2HEQ A;  5EC7 A;  2FPD A;  1PKT A;  3H0F A;  1UE9 A;  2DBK A;  2YSQ A;  4Y92 A;  4OMQ A;  2VWF A;  4ESR A;  2KRO A;  3H0H A;  2GGR A;  2BZY A;  2KGT A;  2EYX A;  2EKH A;  3FJ5 A;  1QCF A;  2KRN A;  3VS3 A;  4AFS C;  2L3Q A;  2NUZ A;  3M0U A;  2E5K A;  5IHN A;  2LCS A;  4AG1 C;  1X2K A;  2JM8 A;  2DL3 A;  1CKB A;  2DA9 A;  2M51 A;  3VS2 A;  2J05 A;  3EG0 A;  5FWC A;  3UF4 A;  1SSH A;  1BU1 A;  2LQN A;  2MIO A;  2HDA A;  1WXT A;  2GQI A;  1IO6 A;  3EHQ A;  2K6D A;  1FMK A;  2YUN A;  5L23 A;  1U06 A;  4Z89 A;  1YWO A;  3SEM A;  2X3W D;  2AZV A;  1E7O A;  2CUD A;  3VS6 A;  1PRM C;  1CKA A;  3I35 A;  1YN8 A;  1AZE A;  1J3T A;  1PNJ A;  2DL8 A;  1PHT A;  3RNJ A;  3NPF A;  3R6N A;  2JMC A;  1GBR A;  1H92 A;  2V1Q A;  2DL5 A;  2J6K A;  2JM9 A;  5I22 A;  4HVU A;  2FRY A;  2J7I A;  4CC3 A;  2LQW A;  2ED0 A;  1KIK A;  1NEG A;  4AFQ C;  2EYY A;  1SEM A;  4OMO A;  4RTT A;  4EIK A;  1AWJ A;  2CH4 W;  2W0Z A;  4RTV A;  2SRC A;  1LCK A;  2LZ6 B;  2YDL A;  1NYF A;  2ENM A;  2CH4 A;  1M27 C;  2PNI A;  3VS1 A;  2JW4 A;  3EHR A;  5IHI A;  2RMO A;  4IIM A;  2GBQ A;  2DE0 X;  2F2X A;  2C0I A;  1AD5 A;  1BBZ A;  1NG2 A;  2AKL A;  1SRL A;  1EFN A;  1X43 A;  4JJC A;  1ABO A;  1I1J A;  1M30 A;  1HJD A;  4F16 A;  2ABL A;  1ZX6 A;  2DLP A;  1WFW A;  3CQT A;  1HSQ A;  1YNZ A;  2M0Y A;  1M3B A;  4J9E A;  4LNP A;  2FPE A;  1A0N B;  1MV3 A;  1YCS B;  1K0S A;  2G6F X;  1WXU A;  4GLM A;  4CC4 B;  5IH2 A;  1AWX A;  4FSS A;  2LX7 A;  3QWY A;  1B07 A;  2CDT A;  3EG1 A;  2A08 A;  1JO8 A;  2CT3 A;  1K9A A;  1JQQ A;  1T3S A;  3THK A;  2JT4 A;  2K79 A;  3TSZ A;  1SRM A;  1X6B A;  4HXJ A;  1I0C A;  1UUE A;  2PZ1 A;  3H41 A;  2BTT A;  3GBQ A;  1WDX A;  2H8H A;  1Z9Z A;  1X6G A;  1M3A A;  1M3C A;  2FPF A;  2GTJ A;  2A28 A;  2EQI A;  2FO0 A;  5GJW B;  4JZ4 A;  3U23 A;  2RQR A;  1OPK A;  4J9C A;  1UDL A;  3LH5 A;  2V1R A;  1UJ0 A;  4K11 A;  4QT7 A;  1VA7 A;  1G83 A;  4HCK A;  2ED1 A;  4ORZ A;  4J9F A;  2K3B A;  1KFZ A;  4J9G A;  1OPL A;  2RF0 A;  2KYB A;  1KSW A;  1K1Z A;  2DIL A;  3UAT A;  2KE9 A;  2CSQ A;  2KBT A;  4DEY A;  2EGA A;  4X1V A;  2LP5 A;  4LUE A;  1AWO A;  1VYV A;  2ECZ A;  2W10 A;  3ULR B;  5FWB A;  5IXB A;  1QKX A;  1KJW A;  2DX1 A;  4E6R A;  2CUB A;  2RQT A;  3NHN A;  2BZX A;  2L3P A;  4J9I A;  2JXB A;  2C0T A;  1Y0M A;  1NLO C;  2VKN A;  2O31 A;  4KRT A;  1U5S A;  1UJY A;  1UFF A;  3QWX X;  2FRW A;  4OML A;  4M4Z A;  2A37 A;  1ZUY A;  2DJQ A;  2SEM A;  2KT8 A;  2B86 A;  1E6G A;  2D8H A;  2DRM A;  4AFU C;  1JXO A;  3KFV A;  2OAW A;  2K7A A;  2X3X D;  1I07 A;  2C0O A;  1GFD A;  1H3H A;  4DEX A;  1AVZ C;  1UHC A;  2YUP A;  2DRK A;  3VRY A;  1W1F A;  1U3O A;  1XOV A;  5I11 A;  1BK2 A; 
#chains in the Genus database with same CATH topology
 4RTU A;  2IPO B;  1FYN A;  4DQ2 A;  3M58 A;  2EVR A;  3SWN C;  4LUD A;  5GAO p;  1QVF P;  2MAM A;  3JSC A;  1KQS A;  4EDU A;  5M9O A;  2XID A;  2VYT A;  4M77 D;  1SHF A;  1SSF A;  2PVG B;  5CKD A;  3PNW C;  5FW9 A;  2JTF A;  2YHT A;  5IXF A;  3P8B B;  2MOX A;  3HL8 A;  1NPR A;  4BY6 B;  2L2P A;  3GNG A;  5LJ3 h;  1K4U S;  3JRZ A;  1JJ2 P;  1NYG A;  4PNO A;  4C8Q E;  1D0Y A;  4C8Q B;  4RUG A;  4KUD K;  1C1A A;  1QVF S;  1BI2 A;  2ROL A;  4J9B A;  3G71 T;  4M78 F;  1ZUU A;  1ARK A;  3G6E A;  1BYM A;  2JOY A;  3UA6 A;  4A63 B;  1VQ8 Q;  3T9N A;  3L2V A;  2E3H A;  3CCU Q;  5HK0 A;  1D1C A;  2HNI A;  3CCJ A;  1VQO A;  4A54 A;  1IB8 A;  1U8R A;  1VIE A;  5FU6 B;  2CP2 A;  3JB9 I;  3GIB A;  2CSI A;  3CMA Q;  5CKH A;  2LC4 A;  3CCJ T;  4KGV B;  3QJ6 A;  4M75 C;  4C0D B;  2E3I A;  1U1T A;  1WLP B;  3S6W A;  4N4H A;  4LDU A;  2OJ2 A;  1GCP A;  1M1K R;  1RUW A;  2Y90 A;  4ZTF A;  3M0S A;  2LJ1 A;  3CXC A;  2RI3 A;  3O5Z A;  1C0M A;  2DJZ A;  4B6M A;  2GFA A;  1NLP C;  4RKU E;  1FMV A;  2A0F B;  2P4T A;  1O9S A;  1V29 B;  2DYB A;  5C6S A;  2E70 A;  2LCC A;  1WA7 A;  2ZPF B;  3KXT A;  3M9Q A;  3UA7 A;  2KY9 A;  4A4E A;  4XTW A;  5LJ5 g;  3M53 A;  2COY A;  3EFO A;  3QSU A;  3EGU A;  4II1 A;  2HQH A;  5I21 A;  3L2R A;  3OYY A;  2O4X A;  2D8J A;  3HFO A;  4M78 C;  3CBP A;  3M0P A;  2WSE E;  3X28 B;  2D1X A;  4EMH A;  1IGQ A;  1VQM T;  2RH2 A;  3RKX A;  2K5F A;  5HCK A;  1UG1 A;  3HPW A;  2R58 A;  2VVK A;  1SKU B;  4IUP A;  4KGX B;  4JJN K;  1ABQ A;  1Q7Y C;  2MCN A;  1WZO A;  4M78 D;  3ZFJ A;  3JB9 J;  4F7U A;  1MMA A;  4JLG A;  1NJI R;  3LX7 A;  3H9N A;  2RJE A;  3M57 A;  1Q7Y R;  1K8A U;  3DB3 A;  1RAF B;  1RAG B;  1KQ2 A;  4R56 A;  1MND A;  1QLY A;  3VS5 A;  1S1N A;  1IZ6 A;  1PRL C;  3OSS C;  1LNX A;  1OZ2 A;  4M7A E;  4RCB A;  4AMC A;  1MNE A;  2DKG A;  4HCC A;  1QWE A;  2GNC A;  1BB9 A;  1X6O A;  1Q82 U;  3L2W A;  1EIF A;  4BE2 A;  4GY5 A;  3UPU A;  4C8Q F;  1OEB A;  1QP2 A;  5CAI A;  1VUB A;  1WHG A;  2J06 A;  2DD5 A;  4MML A;  5D6Y A;  2KXD A;  4C8Q G;  1WX6 A;  2BUD A;  5GJV B;  1CSK A;  2HEQ A;  4PL6 A;  3QJY A;  5GAO l;  4IUV A;  1UEB A;  2CP0 A;  1HYO A;  4O5V A;  2YSQ A;  3S3M A;  4Y92 A;  4OMQ A;  1KC8 C;  4M77 E;  1RI0 A;  2KDS A;  1D3B B;  3PMT A;  2EKH A;  3FJ5 A;  1QCF A;  2L3Q A;  1BI3 A;  2EQU A;  4L6V 5;  4IUQ A;  1Q81 U;  5IHN A;  2RI5 A;  5GAN f;  2P0Q A;  2COW A;  2DL3 A;  1AHJ B;  3JCM X;  3UWN A;  3VV0 A;  3VS2 A;  4UC4 A;  4FU6 A;  3FC3 A;  3UF4 A;  2OTL T;  2MIO A;  2HDA A;  3G4S A;  3P8H A;  3I56 Q;  3RER A;  4A4K A;  1FMK A;  2CZ0 B;  5GAM g;  2DTH A;  2ZPE B;  1YWO A;  2X4J A;  2DVE A;  1E7O A;  3AHU A;  2DK3 A;  3VS6 A;  1PC0 A;  2ZZD A;  1PHT A;  1UGQ B;  3CCS Q;  3R6N A;  1JJ2 S;  3JCM d;  1VQ5 A;  2DL5 A;  2NUP B;  3QUI A;  4HVU A;  3LGF A;  1DJ7 B;  4ME7 A;  4A4G A;  4CC3 A;  2O4X B;  1RAD B;  3VJP A;  4EIK A;  1AWJ A;  1YJ9 Q;  2SRC A;  3BFM A;  1Q86 R;  4HA8 A;  1K9M R;  2LZ6 B;  2RJC A;  3CC7 T;  5LJ5 j;  2PUK B;  4N0A C;  1M27 C;  4BD3 A;  3VS1 A;  3FIF A;  1R77 A;  2QEX Q;  2MK5 A;  2DE0 X;  3OYB A;  4DA4 A;  2M02 A;  2C0I A;  3JCM Q;  1WHJ A;  3SDZ A;  3OYE A;  3HFN A;  5GAN 8;  1BBZ A;  2WAC A;  3MP6 A;  2AKL A;  1EFN A;  3VUZ A;  1M30 A;  3PMI A;  1VQM A;  1YI2 T;  1OQK A;  1M3B A;  3TCJ A;  1VQ7 A;  3SB2 A;  2RB6 A;  3DKM A;  1Y7X A;  1MV3 A;  3CBM A;  2DER A;  2Y4X A;  1D1B A;  4FSS A;  2LX7 A;  3JCM b;  4M75 F;  2K3X A;  3PFS A;  1JO8 A;  3E9F A;  5GAN j;  2FZC B;  3TSZ A;  1LVK A;  1VQ8 A;  3CC2 T;  1XJW B;  3EFS A;  1UUE A;  1VQK Q;  3RMS A;  2BTT A;  1WDX A;  1Z9Z A;  1G3T A;  1X6G A;  2GTJ A;  2DPP B;  2FO0 A;  5GAN g;  2RQR A;  3EFR A;  4OVA A;  5GAM j;  2V1R A;  1B34 B;  5FU7 C;  3S3N A;  4FL6 A;  4C5H A;  3M54 A;  1G83 A;  2HMA A;  3FRN A;  4EMK A;  4L5G A;  1VQ9 Q;  3MCA B;  2ED1 A;  2RM4 A;  3QKJ A;  4J9F A;  4E7J A;  2K3B A;  5CCA A;  2XD0 A;  1WHK A;  4LD6 A;  3UAT A;  2KE9 A;  2KBT A;  2CGH A;  2EGA A;  3QXE B;  4XTV A;  2LP5 A;  4LUE A;  1AWO A;  4XU2 A;  2A3L A;  2ECZ A;  3HKS A;  3DLM A;  5IXB A;  1U1S A;  1P92 A;  2VXE A;  2CZ6 B;  2QGF B;  4E6R A;  3QDR B;  1N6A A;  2ZAE A;  3E1S A;  2GQV A;  4EMK C;  1Y0M A;  2QA4 T;  2GFU A;  2E6Z A;  2QDY B;  3P8D A;  3QBY A;  3CCQ Q;  3QWX X;  4M7D C;  2FRW A;  2E64 A;  4XU3 A;  4M4Z A;  2A37 A;  1ZUY A;  2FHD A;  4JUV A;  1QVF A;  1IGU A;  5LJ5 e;  4RG2 A;  1M90 C;  2X3X D;  1Q86 C;  3F70 A;  3ZBD A;  2DRK A;  1W1F A;  1U3O A;  5I11 A;  4RG8 A;  4BAC A;  4RTX A;  4M7A C;  2EGC A;  2CRE A;  4AT1 B;  1WJS A;  1UHF A;  3M0Q A;  2LNH B;  1NZ9 A;  1D09 B;  2OTL A;  1HK9 A;  4BE0 A;  1KC8 U;  1QCN A;  4DBQ A;  1VQN A;  1Q81 R;  2QTX A;  2RNA A;  3CCV T;  3VS7 A;  3MJX A;  2B8A A;  2CT4 A;  2F5K A;  2BZ8 A;  4NL3 A;  1WXB A;  2NYS A;  1WI7 A;  3ZL7 C;  1X27 A;  6AT1 B;  1BCO A;  5LJ5 f;  3CCQ T;  3CCU A;  1S72 A;  3ZEH A;  4Z88 A;  1PKS A;  1JEG A;  4LE9 A;  5GAN 5;  1H8K A;  5CKE A;  1UGP B;  1OI1 A;  2EYQ A;  4LDV A;  3RIR A;  1PD1 A;  2AK5 A;  4KBM B;  4OMF B;  2EPD A;  5GMK m;  3M0T A;  1VQL T;  3CBO A;  1KG1 A;  4M78 A;  4F17 A;  1WJR A;  4J7I A;  4MZP A;  3JCM g;  3I5S A;  4KH1 B;  1KQS S;  4RTZ A;  1BI1 A;  1V1C A;  2CZ7 B;  2HQE A;  3WVE B;  2HSP A;  2KNB B;  3NTI A;  2JS2 A;  4MMK A;  2BE9 B;  4JZ3 A;  5GAN 7;  4PLL A;  2I2L A;  3QYG B;  1YJW T;  2QQ9 A;  1X69 A;  1T0J A;  4F7U B;  1RAH B;  5A0L A;  3ER0 A;  5KYU B;  4DBR A;  2EYZ A;  2DM1 A;  1TU0 B;  1RLQ C;  3OYJ A;  3OYN A;  2A36 A;  2JNG A;  1GRI A;  2JS0 A;  3VUB A;  1Z9Q A;  4AG2 C;  2YWW A;  1SHG A;  4GLK A;  1VQ6 Q;  2DL7 A;  8AT1 B;  2HCK A;  1M90 U;  5D7U A;  5C0M A;  2M0O A;  1OV3 A;  1BIA A;  2LDM A;  4M77 B;  3VU3 C;  2KSS A;  4ZGJ B;  2K2V A;  2M1H A;  2LJ0 A;  5GAN d;  3EFO B;  2DEQ A;  3CD6 Q;  1AWW A;  3M59 A;  1AT1 B;  4CC2 A;  1PSE A;  1ZBJ A;  2XMF A;  3MP8 A;  4N4G A;  5KYX B;  3C0C A;  1QVG S;  2HAX A;  3G6E Q;  4XQ3 A;  3X24 B;  1XTD A;  1OOT A;  5FLX E;  1UB4 A;  3TVT A;  2CP7 A;  2F2W A;  1EZZ B;  3CCL A;  1N5Z A;  2VGN A;  5J39 A;  1GL5 A;  4FYX B;  1VQ7 T;  2VAS A;  1VQP Q;  4XTU A;  2F1L A;  3FLG A;  3R6O A;  3BW1 A;  3OS5 A;  3TSW A;  1R0C B;  4NS5 A;  2PVO B;  4JJD A;  1MUZ A;  3QZ5 B;  3H0I A;  2DTI A;  2LCL A;  3CPW P;  4RTW A;  4IKF A;  5DM7 R;  1YJN Q;  3J7A F;  1YJ9 T;  4DOW A;  1PM3 A;  2KRS A;  1UEC A;  4JPB W;  1SPK A;  4M75 D;  5HY6 A;  1YIT T;  3JCM J;  5IHK A;  3FB9 A;  2MWO A;  2QK0 A;  3HP9 A;  2DMO A;  5CO7 A;  5AT1 B;  1ZUK A;  2KRM A;  4HKE A;  4Q5W A;  2VUB A;  1JB0 E;  2RN8 A;  5KYN A;  1M1K C;  3SWN A;  4D8K A;  3PVQ A;  2V26 A;  1JRI A;  5DLO A;  1M9S A;  2KI7 A;  3REA B;  5IT9 E;  4D8D A;  1PG5 B;  4XU0 A;  4C8Q A;  2HBW A;  3L2U A;  2MMP A;  1SF9 A;  1YBY A;  1W70 A;  1GCQ A;  1AOJ A;  3WXM B;  4BUG A;  1PKT A;  1FMW A;  8ATC B;  1UE9 A;  3CC7 Q;  3TEE A;  5LJ3 j;  5GAM d;  2KRO A;  4E7K A;  3GPL A;  5LJ3 f;  2R5M A;  5GAN 6;  2KGT A;  2XG8 D;  2EYX A;  2E4H A;  3VS3 A;  2KRN A;  1RAC B;  4LDW A;  2NUZ A;  3KUF A;  3M0U A;  2E5K A;  2RJF A;  2LCS A;  3V8J A;  2OAU A;  1CKB A;  2M51 A;  3RKW A;  3OA6 A;  3EG0 A;  2DZ9 A;  3C94 A;  3D7S B;  1BU1 A;  1TWB A;  4A4F A;  4Z02 A;  2F69 A;  3EHQ A;  4YTL A;  2YUN A;  5L23 A;  4J7F A;  4Z89 A;  1UGS B;  4OF1 A;  3NTK A;  3I35 A;  1OU8 A;  3BDL A;  4M7D D;  1PNJ A;  4M75 A;  1XQH A;  2EQK A;  3G6E T;  5GAO m;  2V1Q A;  7AT1 B;  2JM9 A;  3RR6 A;  5I22 A;  4PJN A;  2MPX C;  9ATC B;  1M2V A;  2LQW A;  1MHN A;  4AFQ C;  4OMO A;  2CH4 W;  4RTV A;  2CP5 A;  1YHQ Q;  5CKF A;  2EJF A;  2YRD A;  3QII A;  4NOY A;  4HT8 A;  2OTJ A;  5KCH A;  2EQJ A;  2CH4 A;  4X9C A;  1LJO A;  2PNI A;  3JCM e;  4QW2 A;  5IHI A;  2RMO A;  4IIM A;  4RMO A;  2GBQ A;  2L8D A;  4XAX B;  2KQW A;  4X34 A;  4OGE A;  3GNF B;  1N8R U;  1SRL A;  1X75 C;  4LXC A;  4ELY C;  2BIV A;  4JJC A;  5KYY B;  1FWZ A;  4F16 A;  4E7S A;  1WFW A;  3CQT A;  1YNZ A;  1LPL A;  5J26 A;  1ZSZ A;  3MEW A;  3JB9 G;  1B7T A;  1K0S A;  1WXU A;  4CC4 B;  5IAY A;  3QWY A;  1B07 A;  3CCV Q;  5LJ5 d;  2CDT A;  1YJ9 A;  4PJO G;  1YHQ A;  3LW5 E;  1KD1 C;  1OZ3 A;  1K9A A;  2PUO B;  4HCZ A;  3RMQ A;  2JT4 A;  5KE3 A;  3BDU A;  4MZT A;  4FYY B;  3CCS T;  5GMK j;  1I0C A;  3GBQ A;  2H8H A;  4BB7 A;  2K5L A;  1UGR B;  1M3A A;  2JN0 A;  2K4Y A;  1TTH B;  1YIJ T;  2F5T X;  1VQ8 T;  3CCL T;  5LJ3 e;  3LH5 A;  4LDY A;  3LGL A;  1FXX A;  3BE3 A;  3EH2 A;  4XTZ A;  2QYZ A;  3SFM A;  4WTO B;  3OSV A;  3V7C A;  4PJM A;  1OYX A;  5IN1 A;  2XI9 A;  3WVD B;  1FX7 A;  2KYB A;  1VQ6 T;  3EGX B;  4PJO A;  4NL2 A;  2DIL A;  1Q7Y U;  4P5N A;  4DEY A;  3MP1 A;  1VYV A;  3CCR T;  1YI2 Q;  1VOM A;  1QVP A;  1IRE B;  1IHV A;  4FIB A;  3OYM A;  3CCE T;  3CD6 T;  4PJO B;  1KK7 A;  3NHN A;  2L3P A;  3BY7 A;  2JXB A;  2C0T A;  3SD4 A;  4KRT A;  5FRM A;  1UFF A;  4BDZ A;  2PU9 B;  4OML A;  1Q81 C;  4TVR A;  2QG9 B;  4F7U E;  1W4S A;  2DRM A;  1W2B P;  2EFI A;  3CCR Q;  4ZN3 A;  4PJO C;  5GAO q;  1ACM B;  4KGZ B;  3UDC A;  2K3Y A;  1H3H A;  1C6V X;  2DFU A;  3A8H B;  2HD0 A;  4DOV A;  1KQ1 A;  2FL7 A;  2YUP A;  3VRY A;  1BKB A;  2FZG B;  2FG0 A;  2LX9 A;  2PTK A;  1G3W A;  4HVW A;  5ECA A;  3EG3 A;  4V2S A;  3MEA A;  3CME T;  1OU9 A;  1QWF A;  2ZPG B;  4M75 E;  4PJO F;  4M7D B;  1RLP C;  2HSE B;  2X51 A;  2NUT B;  1N27 A;  4E7I A;  4FW1 A;  2DBM A;  3IQL A;  4QKU A;  1I4K 1;  1YJN A;  1VYT A;  3CCJ Q;  3CMA T;  1YP5 A;  1S72 T;  3PVL A;  1MMN A;  5KYY A;  4XTY A;  1VQN Q;  3V7S A;  2GTO A;  4C0Z A;  2M16 A;  1JXM A;  2QAS A;  4IIO A;  4J6Y A;  3CCM A;  4ELZ C;  1K76 A;  2LQ8 A;  1Q82 C;  3I9Q A;  2R5A A;  1RAI B;  2I0N A;  1KD1 R;  3RKY A;  4J83 A;  2YUO A;  2KR3 A;  1WQW A;  3EGD B;  4R0K A;  1YJW A;  1NPP A;  2E12 A;  1VQ4 Q;  1X2Q A;  4L59 A;  3L1A A;  3VYH B;  5FU7 B;  2XU8 A;  2RPN A;  4JRK A;  4PKC C;  3CXC P;  3FJP A;  2AT1 B;  1VQP T;  3OYF A;  5DLQ E;  1PSF A;  3EG2 A;  1YWP A;  3CCV A;  2XDP A;  1K9M U;  3NGP A;  1Y57 A;  2FEI A;  4LN2 A;  2BKD N;  1HD3 A;  4EMG A;  4M75 B;  3C95 A;  5KYW B;  3OYG A;  3LH0 A;  3VYG A;  3MKD A;  2FZK B;  4JS5 A;  3QHS A;  5CKB A;  1F1B B;  2DEU A;  1M8V A;  3L2Z A;  3MET A;  2MF2 A;  2WSC E;  4GBQ A;  1TUD A;  4B9W A;  4JRQ A;  3CCU T;  4C8Q D;  1VIF A;  2BE7 D;  1AEY A;  3CMA A;  2IVW A;  3I55 A;  3C4S A;  4OB2 B;  1QVG A;  4R55 A;  3HSB A;  3CXC S;  1K73 C;  2DL4 A;  3A8M B;  2ATC B;  1WHL A;  3A1P A;  1NJI U;  4ZGD B;  1WYX A;  2K2M A;  2KYM A;  3QYH B;  4PJO D;  1WHH A;  2L3S A;  1VQ9 A;  1G3Y A;  1BI0 A;  3MHX A;  4C8Q C;  3QPH A;  2H3E B;  2ROT A;  3OBW A;  1N9S A;  5FRO A;  2VGM A;  1ZSG A;  3M0R A;  1T3L A;  3EGD A;  3CCQ A;  1B3Q A;  2DIQ A;  4M78 G;  2E1H A;  4QVZ A;  4J9H A;  1VQ5 Q;  2DAQ A;  4ZNX A;  4FYV B;  4HVV A;  2YT6 A;  4CI0 C;  2DF6 A;  2ZPH B;  1YI2 A;  2P84 A;  1D1A A;  3CME Q;  1W6X A;  5GAM e;  2DTO A;  2QA4 A;  2O9S A;  2DVJ A;  2DNU A;  3NMZ C;  4J9D A;  2XHC A;  3SWN B;  3QG1 A;  1M90 R;  1Y96 A;  1TG0 A;  4M7D A;  2P4R A;  4OB1 B;  4D6W A;  5CK9 A;  4J6X A;  2DD4 A;  3PIO A;  1VQM Q;  5LL6 S;  1M8M A;  1VQN T;  2QDL A;  2O9V A;  4XK8 E;  4BE1 A;  1WIE A;  1G2B A;  2LJ3 A;  1UTI A;  3J80 E;  2GF7 A;  3SHW A;  3VKI A;  4PJL A;  3CC4 T;  3H8Z A;  3LLR A;  1VQK A;  1GFC A;  1Y07 A;  3JV3 A;  4M7A D;  3GF5 A;  4AFZ C;  4VUB A;  4E7L A;  4PJJ A;  1YIJ Q;  1G5V A;  4F7U F;  3EG9 B;  1ZLM A;  2JTM A;  4LDX A;  3MEV A;  5I2M A;  2EW3 A;  1K8A C;  2DXC A;  3QDF A;  4F04 B;  3EG9 A;  3H0F A;  4DBF A;  1VQL A;  1R0B G;  3V7R A;  3MO8 A;  2VWF A;  4Y91 A;  5KYX A;  5CR2 A;  4IUR A;  1ZHI A;  4RCC A;  3H0H A;  2BZY A;  2KVQ G;  3OMC A;  3M4Y A;  3CC2 A;  4AFS C;  5GMK h;  4QVD A;  2MWP A;  2JVV A;  1SG5 A;  3I55 T;  4LD9 K;  3CCE A;  2G3R A;  2E5Q A;  5GAN 2;  3EGX A;  4X9D A;  2XKO C;  1YJN T;  4AG1 C;  1X2K A;  3LYI A;  4M77 A;  2J05 A;  3I56 A;  2QEX A;  4JRI A;  5FWC A;  4A53 A;  4JS4 A;  1N8R C;  2LQN A;  3A8O B;  1WXT A;  5AYF A;  1IO6 A;  4PFZ A;  2HKQ B;  1Y96 B;  2LQK A;  2LT4 A;  2LTO A;  1WHM A;  3OY9 A;  4FM4 B;  4C92 A;  2RHI A;  2E6N A;  5A0G A;  3SEM A;  2X3W D;  2YXY A;  2AZV A;  2CUD A;  3EAE A;  1PRM C;  1CKA A;  3JCM V;  1VQP A;  1AZE A;  1J3T A;  2YRV A;  4E7Z A;  3NPF A;  2LRQ A;  2DYI A;  2RJD A;  2EIF A;  2JMC A;  2RD1 A;  1H92 A;  2FVU A;  4M77 C;  4IUT A;  2RO0 A;  3URG A;  1K73 U;  2J7I A;  5GAO n;  1K8A R;  1TS9 A;  2EYY A;  2VB6 A;  2DZC A;  2KK4 A;  1NE8 A;  4M78 B;  1ZSZ B;  1NYF A;  2ENM A;  4M78 E;  3G4S Q;  3OYD A;  4M7A A;  4M7A F;  5CIU A;  2K57 A;  4C92 G;  3OYK A;  1BIB A;  3A5Z B;  1NG2 A;  3JCM W;  1VQ9 T;  1I1J A;  1I5L A;  5A0D A;  2ABL A;  1ZX6 A;  3CC2 Q;  1I81 A;  3G4S T;  3QO3 A;  1HSQ A;  5GAN 4;  2M0Y A;  3JAM E;  4F7U G;  1IHW A;  4J9E A;  1QMC A;  3OYH A;  4M7D G;  4OB3 B;  4JDS A;  2DXU A;  2VC8 A;  1AWX A;  1M2V B;  2MI6 A;  2OTJ Q;  3E2U A;  2R57 A;  4C0D C;  1TXQ A;  1YIJ A;  1JQQ A;  1Q86 U;  1T3S A;  2K79 A;  2RI2 A;  4HXJ A;  1TUG B;  3OW2 A;  3A8L B;  3C12 A;  2FPF A;  1KHI A;  3OYL A;  2L89 A;  4J8O A;  5GJW B;  1MMG A;  4JZ4 A;  2V8J A;  4C92 D;  2HL5 C;  2PQW A;  1Y71 A;  1OX9 A;  1OPK A;  1UDL A;  1QW1 A;  1K9M C;  5D6W A;  1UJ0 A;  4ZTJ A;  4HCK A;  3CD6 A;  3FEO A;  3JCM h;  4ORZ A;  4BI4 A;  4O6J A;  3OBY A;  2CP3 A;  1KFZ A;  2RHX A;  2YLB A;  2RF0 A;  3L42 A;  3N5B B;  3M5A A;  1M1F A;  4M7A B;  1W2B A;  2CSQ A;  2QTV A;  1VQ6 A;  2EAY A;  4KUI A;  3ME9 A;  2DET A;  5LJ3 g;  3S3O A;  2W10 A;  4FSX A;  2EKO A;  5FWB A;  3ASK A;  1KJW A;  2DX1 A;  3HRT A;  4FCY A;  3CCL Q;  2E10 A;  3OW2 S;  4ANJ A;  2EJG A;  1I5O B;  2AIR B;  2VKN A;  2DIG A;  1UJY A;  1W2B S;  2DJQ A;  3H6Z A;  4EMK B;  2B86 A;  1E6G A;  3M55 A;  1M1K U;  1HXD A;  1JXO A;  4AFU C;  3LWH A;  4OB0 B;  4QVC A;  1B34 A;  4J6W A;  1N9R A;  1I07 A;  2C0O A;  1GFD A;  4FT2 A;  4C92 B;  4DEX A;  2EWN A;  1M5Q 1;  5KE2 A;  1VQ4 A;  1XOV A;  4PFO A;  2HL3 A;  2J6O A;  2KEA A;  1ZBX A;  1K0X A;  1XNI A;  2AZS A;  4B9X A;  3VRZ A;  2L0A A;  1JJ2 A;  3L2Q A;  1GBQ A;  3RBB B;  1T0H A;  2ZPI B;  1PWT A;  2CS7 A;  5A2Q E;  1GXI E;  4FT4 A;  2KXC A;  4HCB A;  1D0X A;  3VS0 A;  2JTE A;  2K9G A;  2VV5 A;  2PVD B;  2IIM A;  4EPC A;  2VXF A;  1NEB A;  2EBP A;  2EYW A;  2EGE A;  5J3B A;  2X35 A;  4ZGE B;  1M2O A;  3GOX A;  3JCM c;  1TUC A;  1M4Z A;  1E6H A;  1WJQ A;  1NBE B;  4C92 E;  2GCX A;  5CQY A;  2XIC A;  1RI9 A;  4A4H A;  5CVI A;  1AZG B;  4C0F A;  1VQ5 T;  1OUL A;  2YUQ A;  3OS2 A;  2IG0 A;  2D6F A;  1I8F A;  2L5Q A;  1TOV A;  3O8V A;  2QI2 A;  3G1J A;  1UGV A;  1K73 R;  4N4I A;  2RQV A;  3CCR A;  4JRP A;  2RQW A;  1JU5 C;  2NWM A;  2NUP A;  2RQU A;  2X9H A;  3AT1 B;  3RES A;  2P0K A;  1QQJ A;  5GAN h;  1Q82 R;  2D9T A;  2D0N A;  5KH6 A;  4ZN1 A;  2OTL Q;  4RTY A;  1VYU A;  5KYU A;  2F2V A;  2WSF E;  2HQX A;  4OMP A;  2O88 A;  4OMM A;  4DBH A;  4BI8 B;  2FYK A;  1KD1 U;  3REB B;  1MV0 B;  3G71 A;  4C5G A;  4CC7 A;  1QKW A;  4JJB A;  2AKK A;  5EG2 A;  4OMN A;  3I5R A;  3TRE A;  4PFP A;  2XDD A;  3CPW A;  2KT1 A;  4F14 A;  2CYZ B;  2J6F A;  3TU4 K;  2RK2 A;  4BI3 A;  3TQ7 P;  2LMJ A;  3PIP A;  1YJW Q;  1QVG P;  3CPF A;  2RA2 A;  2ESW A;  2O01 E;  5GMK i;  4KH0 B;  2Z0W A;  4HT9 A;  3CCM Q;  3CPW S;  2JZ2 A;  1RAA B;  2LVM A;  4QQD A;  1S72 Q;  3VS4 A;  4QQ6 A;  1EX4 A;  1OX8 A;  2JJ9 A;  3NFC A;  2MYS A;  5GMK l;  2CP6 A;  1D0Z A;  4M7D F;  1PD0 A;  5KYW A;  1VQ7 Q;  3V8L A;  2X4W A;  2FB7 A;  2OI3 A;  4BDY A;  3A8G B;  1KC8 R;  2ZCF B;  2ZPB B;  2QQB A;  3CCE Q;  3PE0 A;  2JMA A;  1G8X A;  3PT9 A;  5GAM h;  2C06 A;  1WPY A;  3OQ5 A;  2EQM A;  4WCI A;  3A98 A;  2CKK A;  4C92 F;  1VQO T;  2X4X A;  4PLI A;  3CEY A;  3M56 A;  1YIT Q;  2CZ1 B;  1VQL Q;  1GCQ C;  4M77 F;  4OP0 A;  4E7H A;  5DY9 A;  1NM7 A;  4Z8A A;  2O2O A;  1PCX A;  3JB9 F;  4PJO E;  2QGG A;  3RDV A;  2XK0 A;  5EC7 A;  2FPD A;  2DBK A;  3DB4 A;  4KT0 E;  3E9G A;  3MPU B;  2HBP A;  4ESR A;  2GGR A;  3E19 A;  1V76 A;  5CQX A;  2NUT A;  2QQA A;  1QP3 A;  1H64 1;  2YLC A;  2JM8 A;  4ATO A;  2DA9 A;  2LNV A;  1BCM A;  3GLX A;  5GAN 3;  5GAN e;  4QQG A;  1KHC A;  4C5I A;  3OYC A;  2DXB A;  3OS1 A;  1SSH A;  2EJ9 A;  2GQI A;  3X20 B;  1JBM A;  2K6D A;  2P0P A;  3PTA A;  4XU1 A;  1U06 A;  2COZ A;  1YCY A;  3QZ9 B;  3J81 E;  3KBG A;  2QEX T;  2RHY A;  3Q1J A;  3M4G A;  4MDX A;  1YN8 A;  1R8O B;  4N0A A;  2RK1 A;  2E65 A;  2QQS A;  4J5Y A;  1Q95 G;  2DL8 A;  3HRS A;  3RNJ A;  1VQ4 T;  5I2S A;  1GBR A;  1VQK T;  4FYW B;  2J6K A;  5HKC A;  1WNL A;  4CRI A;  2FRY A;  2D0Q B;  3HHT B;  2ED0 A;  1KIK A;  1NEG A;  1ZA1 B;  1SEM A;  4RTT A;  3JCM P;  2W0Z A;  1G3S A;  1H3Z A;  1LCK A;  3CCM T;  3OB9 A;  3I56 T;  4MZM A;  2YDL A;  4E47 A;  2RHZ A;  4Y28 E;  5FRN A;  3OMG A;  1YIT A;  2JW4 A;  3EHR A;  2QXF A;  1IXD A;  1TH7 A;  4M75 G;  5FU6 C;  2F2X A;  3JB9 D;  3I55 Q;  2QAZ A;  3V8K A;  1AD5 A;  4OGC A;  3CC4 A;  2Y4Y A;  2YRC A;  5LJ5 h;  4KUL A;  4MDW A;  1ZSZ C;  2X4Y A;  3HTR A;  1X43 A;  3OW2 P;  1ABO A;  4C5E A;  2V8K A;  1HJD A;  3X26 B;  3CC4 Q;  2DLP A;  1WGS A;  4M7D E;  3EH1 A;  5L8R E;  2OX7 A;  3JCM f;  4IUU A;  2AHJ B;  2FPE A;  4LNP A;  1A0N B;  1YCS B;  3JB9 H;  5GAO r;  3FDR A;  1VQO Q;  2G6F X;  4GLM A;  2HZY A;  5IH2 A;  2K5I A;  4E2F B;  2QA4 Q;  5GMK e;  1MGQ A;  3EG1 A;  2XDB A;  2A08 A;  2CT3 A;  3OS0 A;  3THK A;  3X25 B;  1SRM A;  2KAF A;  1X6B A;  2PZ1 A;  5LJ3 d;  3H41 A;  4BY6 C;  1X01 A;  1RAB B;  1QCO A;  1RAE B;  1M3C A;  3OYA A;  1LOJ A;  3CCS A;  2A28 A;  2EQI A;  4WF2 A;  3U23 A;  3OYI A;  4XTX A;  2ZGW A;  4J9C A;  5GAM f;  4K11 A;  4QT7 A;  1VA7 A;  2NLU A;  5D6X A;  4JLI A;  1RL2 A;  1O75 A;  1ZA2 B;  2HKN A;  3HRU A;  2OTJ T;  4J9G A;  1OPL A;  1KSW A;  2QQR A;  2M9U A;  2DO3 A;  1K1Z A;  1TSF A;  3DLL A;  3CME A;  4X1V A;  2KMT A;  3UT1 A;  1NJI C;  1D3B A;  2V8I A;  1M1G A;  3ULR B;  1QKX A;  4FW2 A;  2CUB A;  1IRX A;  2RQT A;  5KCO A;  3LWI A;  3CC7 A;  2BZX A;  4J9I A;  1NLO C;  2O31 A;  2E41 A;  1U5S A;  3RUX A;  1YFN A;  2SEM A;  2KT8 A;  3G7Z A;  2D8H A;  2L3R A;  3KFV A;  4PK4 A;  3INZ A;  1N8R R;  2OAW A;  4M7A G;  2K7A A;  2RHU A;  2LT1 A;  1KQS P;  3PGG A;  1MMD A;  4C0G A;  1YHQ T;  1AVZ C;  1UHC A;  4M77 G;  2DXT A;  5HK3 A;  3NTH A;  3GP8 A;  2JUF A;  2H3J A;  3G71 Q;  3MEU A;  1WQ7 A;  4C92 C;  1BK2 A;  2A7Y A;  1ZQ1 A; 
#chains in the Genus database with same CATH homology
 2J6O A;  4RTX A;  2KEA A;  1K0X A;  2FG0 A;  2PTK A;  5ECA A;  4HVW A;  4RTU A;  2AZS A;  1FYN A;  3EG3 A;  2EVR A;  2EGC A;  3VRZ A;  2L0A A;  2CRE A;  4LUD A;  1GBQ A;  1QWF A;  1UHF A;  3M0Q A;  2LNH B;  3RBB B;  1T0H A;  1PWT A;  1RLP C;  2KXC A;  2DBM A;  3IQL A;  3VS0 A;  2RNA A;  3VS7 A;  2JTE A;  2CT4 A;  1SHF A;  2K9G A;  2BZ8 A;  1VYT A;  1WXB A;  1WI7 A;  1YP5 A;  1X27 A;  2IIM A;  3PVL A;  3ZL7 C;  5FW9 A;  5IXF A;  1NEB A;  2GTO A;  1JXM A;  4Z88 A;  2MOX A;  1PKS A;  4IIO A;  2EBP A;  1JEG A;  4LE9 A;  2EYW A;  2L2P A;  1K76 A;  3I9Q A;  1K4U S;  1H8K A;  2EGE A;  2I0N A;  1NYG A;  2AK5 A;  2YUO A;  2KR3 A;  4RUG A;  4R0K A;  1TUC A;  2EPD A;  1E6H A;  3M0T A;  1X2Q A;  4J9B A;  2ROL A;  1ZUU A;  1ARK A;  1RI9 A;  1AZG B;  4F17 A;  2YUQ A;  3I5S A;  4RTZ A;  1V1C A;  3UA6 A;  4A63 B;  2HSP A;  2KNB B;  2RPN A;  2JS2 A;  1UGV A;  2RQV A;  3EG2 A;  4JZ3 A;  1YWP A;  2RQW A;  1JU5 C;  2NWM A;  2RQU A;  3NGP A;  1Y57 A;  2FEI A;  4LN2 A;  1HD3 A;  2D0N A;  1X69 A;  1T0J A;  2CSI A;  4RTY A;  1VYU A;  2F2V A;  4GBQ A;  4OMP A;  1TUD A;  2EYZ A;  1WLP B;  2DM1 A;  2O88 A;  4OMM A;  1RLQ C;  2A36 A;  2OJ2 A;  1GCP A;  1RUW A;  1GRI A;  2JS0 A;  3M0S A;  2LJ1 A;  3O5Z A;  1Z9Q A;  4AG2 C;  1AEY A;  1SHG A;  2DL7 A;  1NLP C;  2HCK A;  3REB B;  1MV0 B;  2DL4 A;  1OV3 A;  2DYB A;  4CC7 A;  1WYX A;  1QKW A;  1WA7 A;  2AKK A;  2K2M A;  2LJ0 A;  4JJB A;  4OMN A;  2KYM A;  3I5R A;  2L3S A;  3UA7 A;  1AWW A;  4CC2 A;  2ROT A;  2KT1 A;  4F14 A;  1ZBJ A;  1ZSG A;  2XMF A;  3M0R A;  3C0C A;  1T3L A;  2J6F A;  3EGU A;  1B3Q A;  1OOT A;  4J9H A;  2LMJ A;  2D8J A;  3TVT A;  4ZNX A;  3M0P A;  4HVV A;  2F2W A;  1N5Z A;  2YT6 A;  2D1X A;  2ESW A;  1GL5 A;  2DF6 A;  3TSW A;  4JJD A;  1MUZ A;  5HCK A;  1UG1 A;  1W6X A;  2VVK A;  3VS4 A;  2O9S A;  3H0I A;  2DVJ A;  2DNU A;  3NMZ C;  1ABQ A;  2MCN A;  4J9D A;  4RTW A;  1TG0 A;  2KRS A;  1UEC A;  4JPB W;  1SPK A;  2P4R A;  5IHK A;  2OI3 A;  1M8M A;  2QDL A;  1QLY A;  2O9V A;  3VS5 A;  1S1N A;  1WIE A;  1G2B A;  1PRL C;  2DMO A;  2JMA A;  3PE0 A;  2LJ3 A;  1ZUK A;  1UTI A;  2KRM A;  2RN8 A;  4WCI A;  3A98 A;  3SHW A;  4D8K A;  1QWE A;  2GNC A;  1BB9 A;  3PVQ A;  3REA B;  1GCQ C;  1GFC A;  3JV3 A;  4D8D A;  1NM7 A;  4AFZ C;  2HBW A;  4Z8A A;  2O2O A;  1OEB A;  1ZLM A;  2J06 A;  2KXD A;  1W70 A;  1WX6 A;  1GCQ A;  2EW3 A;  1AOJ A;  5GJV B;  1CSK A;  2HEQ A;  5EC7 A;  2FPD A;  1PKT A;  3H0F A;  1UE9 A;  2DBK A;  2YSQ A;  4Y92 A;  4OMQ A;  2VWF A;  4ESR A;  2KRO A;  3H0H A;  2GGR A;  2BZY A;  2KGT A;  2EYX A;  2EKH A;  3FJ5 A;  1QCF A;  2KRN A;  3VS3 A;  4AFS C;  2L3Q A;  2NUZ A;  3M0U A;  2E5K A;  5IHN A;  2LCS A;  4AG1 C;  1X2K A;  2JM8 A;  2DL3 A;  1CKB A;  2DA9 A;  2M51 A;  3VS2 A;  2J05 A;  3EG0 A;  5FWC A;  3UF4 A;  1SSH A;  1BU1 A;  2LQN A;  2MIO A;  2HDA A;  1WXT A;  2GQI A;  1IO6 A;  3EHQ A;  2K6D A;  1FMK A;  2YUN A;  5L23 A;  1U06 A;  4Z89 A;  1YWO A;  3SEM A;  2X3W D;  2AZV A;  1E7O A;  2CUD A;  3VS6 A;  1PRM C;  1CKA A;  3I35 A;  1YN8 A;  1AZE A;  1J3T A;  1PNJ A;  2DL8 A;  1PHT A;  3RNJ A;  3NPF A;  3R6N A;  2JMC A;  1GBR A;  1H92 A;  2V1Q A;  2DL5 A;  2J6K A;  2JM9 A;  5I22 A;  4HVU A;  2FRY A;  2J7I A;  4CC3 A;  2LQW A;  2ED0 A;  1KIK A;  1NEG A;  4AFQ C;  2EYY A;  1SEM A;  4OMO A;  4RTT A;  4EIK A;  1AWJ A;  2CH4 W;  2W0Z A;  4RTV A;  2SRC A;  1LCK A;  2LZ6 B;  2YDL A;  1NYF A;  2ENM A;  2CH4 A;  1M27 C;  2PNI A;  3VS1 A;  2JW4 A;  3EHR A;  5IHI A;  2RMO A;  4IIM A;  2GBQ A;  2DE0 X;  2F2X A;  2C0I A;  1AD5 A;  1BBZ A;  1NG2 A;  2AKL A;  1SRL A;  1EFN A;  1X43 A;  4JJC A;  1ABO A;  1I1J A;  1M30 A;  1HJD A;  4F16 A;  2ABL A;  1ZX6 A;  2DLP A;  1WFW A;  3CQT A;  1HSQ A;  1YNZ A;  2M0Y A;  1M3B A;  4J9E A;  4LNP A;  2FPE A;  1A0N B;  1MV3 A;  1YCS B;  1K0S A;  2G6F X;  1WXU A;  4GLM A;  4CC4 B;  5IH2 A;  1AWX A;  4FSS A;  2LX7 A;  3QWY A;  1B07 A;  2CDT A;  3EG1 A;  2A08 A;  1JO8 A;  2CT3 A;  1K9A A;  1JQQ A;  1T3S A;  3THK A;  2JT4 A;  2K79 A;  3TSZ A;  1SRM A;  1X6B A;  4HXJ A;  1I0C A;  1UUE A;  2PZ1 A;  3H41 A;  2BTT A;  3GBQ A;  1WDX A;  2H8H A;  1Z9Z A;  1X6G A;  1M3A A;  1M3C A;  2FPF A;  2GTJ A;  2A28 A;  2EQI A;  2FO0 A;  5GJW B;  4JZ4 A;  3U23 A;  2RQR A;  1OPK A;  4J9C A;  1UDL A;  3LH5 A;  2V1R A;  1UJ0 A;  4K11 A;  4QT7 A;  1VA7 A;  1G83 A;  4HCK A;  2ED1 A;  4ORZ A;  4J9F A;  2K3B A;  1KFZ A;  4J9G A;  1OPL A;  2RF0 A;  2KYB A;  1KSW A;  1K1Z A;  2DIL A;  3UAT A;  2KE9 A;  2CSQ A;  2KBT A;  4DEY A;  2EGA A;  4X1V A;  2LP5 A;  4LUE A;  1AWO A;  1VYV A;  2ECZ A;  2W10 A;  3ULR B;  5FWB A;  5IXB A;  1QKX A;  1KJW A;  2DX1 A;  4E6R A;  2CUB A;  2RQT A;  3NHN A;  2BZX A;  2L3P A;  4J9I A;  2JXB A;  2C0T A;  1Y0M A;  1NLO C;  2VKN A;  2O31 A;  4KRT A;  1U5S A;  1UJY A;  1UFF A;  3QWX X;  2FRW A;  4OML A;  4M4Z A;  2A37 A;  1ZUY A;  2DJQ A;  2SEM A;  2KT8 A;  2B86 A;  1E6G A;  2D8H A;  2DRM A;  4AFU C;  1JXO A;  3KFV A;  2OAW A;  2K7A A;  2X3X D;  1I07 A;  2C0O A;  1GFD A;  1H3H A;  4DEX A;  1AVZ C;  1UHC A;  2YUP A;  2DRK A;  3VRY A;  1W1F A;  1U3O A;  1XOV A;  5I11 A;  1BK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...