1U1TA

Hfq protein from pseudomonas aeruginosa. high-salt crystals
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pseudomonas aeruginosa Hfq protein.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords Hfq protein
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u1tA00
4C8QF 2Y90A 1U1SA 4J6XA 2E64A 4JLIA 3V7SA 5GAMh 3JCMf 2YLBA 2K57A 4M7DB 4C92A 3QSUA 5GAOm 3SWNC 4EMKC 4X9CA 4C8QG 4A53A 1HK9A 2VC8A 4F7UE 4C92B 1I5LA 1I4K1 4F7UB 4XU3A 4M78D 4RCBA 4C92E 4M77D 1LJOA 4XTYA 3V7RA 4XTZA 4F7UA 2JN0A 4XU1A 5GAN8 5GAN3 5GAMe 4M75G 5GAMj 4NL2A 2EWNA 1KQ1A 5GMKe 5GMKi 1YCYA 4C8QE 2E1HA 3INZA 4HA8A 5GAMf 5LJ3g 3RERA 1LNXA 4M7AF 4M75A 4J6YA 5GMKh 3JCMP 4M75D 2DZ9A 4Y91A 1TH7A 3V8LA 3JB9D 4M75F 2I2LA 3RKWA 5DY9A 5GMKm 2ZGWA 3JCMV 5GAMg 4M7AE 1D3BA 2FYKA 4JRKA 4PJOA 4XU0A 1I81A 2QTXA 4M78F 2E41A 4EMHA 4F7UG 1BIBA 5LJ3j 5LJ3e 4M75B 4XU2A 2DXTA 3FJPA 3JCMg 4C8QB 5GAN4 2VXFA 2E65A 4XTVA 5GAN5 1WNLA 2DZCA 5GANd 5I21A 4PJOF 3QHSA 4M78C 4M78E 3L2ZA 5GAMd 4JRIA 4N0AC 2EJ9A 3V8JA 4XTUA 4X9DA 2RD1A 3EFRA 4M7AD 1N9SA 2DJZA 2DVEA 4JUVA 3JCMX 3JB9G 4C92D 4M7AA 4M7DC 4J6WA 4XTXA 3SWNB 4EMKB 3JCMQ 5LJ3d 3JCMh 3JB9F 4M7DA 4C92C 4M7AC 3L1AA 4C8QA 4EMGA 5GMKl 5GAOn 1HXDA 4V2SA 2EJFA 4M78G 4F7UF 4HT9A 3JCMb 4M77G 3HFOA 3GIBA 4M77C 4PJOC 3QO3A 5LJ5g 4WF2A 1U1TA 3EFSA 3RESA 2RM4A 3M4GA 4NOYA 2DTHA 3VU3C 5GAN7 1WPYA 4M77E 4PJOD 1KQ2A 1JRIA 3HFNA 4PNOA 4XTWA 4RCCA 4M7AG 2RB6A 2DTOA 4NL3A 5GAN2 2CGHA 3PGGA 3BY7A 2DTIA 5LJ3f 4C92F 2FB7A 5LJ5e 4MMKA 5LJ5d 5GAOl 4HT8A 3JB9H 4PJOE 1X01A 5CAIA 3BW1A 4QVDA 1JBMA 2YHTA 1B34A 1M5Q1 2DKGA 3SB2A 1N9RA 3HSBA 1I8FA 4XQ3A 3RKXA 2VXEA 5GANh 4M77A 2YLCA 1WQWA 4DQ2A 5GAN6 4M78A 3AHUA 4M7DE 2HNIA 5LJ5h 1MGQA 3JB9J 5LJ3h 4M75E 3BDUA 3JCMd 2E10A 2EJGA 1WQ7A 2EAYA 1BIAA 4A54A 1M8VA 5GANg 3SWNA 3RIRA 3RUXA 4C92G 4EMKA 3JB9I 4J5YA 5GAOr 4M7AB 1H641 1Y96A 4MMLA 4N0AA 4OP0A 1B34B 4PJOG 5LJ5j 2RA2A 4M77F 4M75C 3RKYA 1LOJA 3JCMc 3FB9A 3BFMA 5GAOq 4M7DG 4C8QC 5LJ5f 1D3BB 4QVCA 2DEQA 3JCMe 4M77B 5GMKj 5GAOp 3JCMW 4PJOB 5GANj 2DXUA 3QUIA 4M78B 3V7CA 5GANe 4M7DF 3JCMJ 4C8QD 1Y96B 5GANf 3FIFA 4M7DD 3V8KA
chains in the Genus database with same CATH superfamily
1G3WA 4C8QF 2LVMA 3VV0A 1VQNT 2YUQA 4LUDA 3CCET 4M7DB 1VQLA 2QEXA 2JOYA 1Y57A 1GCQC 4C8QG 4A53A 1TTHB 2P0QA 4LDXA 4XTZA 1VQ8T 1M27C 1M9SA 2A0FB 2LX9A 4LDYA 1WI7A 1KQ1A 1QKXA 1VQPT 2E1HA 3RERA 3CCJT 1LNXA 2XDBA 2EKOA 5D6YA 3CCLQ 4FW1A 4PJMA 1OULA 3V8LA 5IHKA 2EPDA 4BE2A 3M9QA 2KMTA 1E6HA 2V1RA 2HBPA 2L0AA 2O4XB 4A4EA 2CT4A 2LCLA 4QW2A 3CC4T 5I21A 3A5ZB 5D6XA 4ZN3A 1YN8A 3UPUA 1VYVA 4OB2B 4DOVA 4M7AC 4LD9K 1OYXA 2M16A 1VQ6T 3C94A 4Z88A 3JCMb 3HFOA 2IVWA 4O6JA 2MCNA 4BD3A 2DAQA 4KGVB 3CMAQ 1IHVA 2J6KA 3S3MA 4QQ6A 1M90C 1JXOA 2KRNA 4NL3A 2GFUA 1PD1A 2DERA 4JZ4A 3BW1A 3QDFA 4HVUA 3H0HA 2K3YA 2ROTA 4MZMA 4JRQA 5GANh 2FG0A 2VWFA 3L2WA 1C0MA 2YLCA 4NS5A 1KD1U 2RQTA 2D0QB 1VQ8A 3VJPA 3A8LB 2JVVA 1JU5C 2GTJA 1K0XA 1ZA2B 2FO0A 1IXDA 4CC3A 4K11A 2ZPGB 3CC2Q 4M7DG 3OYEA 1VQKT 2VB6A 3JCMW 5GMKj 4OMFB 2HKQB 1X2KA 3QUIA 4M7DF 2H3JA 1UHFA 2JM9A 2F69A 3M53A 2CP5A 2LT1A 4F7UE 2YWWA 2HSEB 2EGEA 1VQ6A 1K0SA 2E3IA 3EGDA 1BI0A 2KAFA 1RAAB 3QZ5B 5GAN8 1WYXA 1JEGA 1FYNA 1PM3A 1QCNA 1IO6A 1UGSB 3EG2A 4DA4A 4J7FA 1VQ7A 2VV5A 3M0SA 4F16A 2GF7A 4JS4A 1FXXA 1PC0A 3CCQT 2AT1B 2JTMA 2L89A 3S6WA 3EH1A 5LJ3e 3CCUQ 4OGEA 3QBYA 3LH5A 4B9WA 1WHHA 3CCVQ 2EJ9A 2G6FX 2K6DA 3D7SB 2QEXQ 3MO8A 5CKHA 1UGPB 1CKAA 1JJ2A 3JB9F 5CR2A 3CCUA 4C8QA 3LWHA 1BYMA 4EMGA 2D8HA 3CCMA 4PJOC 2DD4A 3NHNA 1E6GA 2DF6A 8ATCB 1Z9ZA 2X4YA 2PUOB 3CD6Q 2FPFA 1RI0A 3T9NA 3J7AF 5LJ3f 4HCBA 1WXTA 3RDVA 3TQ7P 8AT1B 1N27A 2FEIA 2QGFB 2MOXA 2YHTA 3ZEHA 1PSFA 4M77A 3LWIA 1WQWA 1RADB 2HNIA 4C5IA 3CCRT 4Z89A 1RUWA 3NGPA 2RPNA 1KFZA 1M90R 2JUFA 3JB9J 2HL3A 2J05A 2K2MA 1LOJA 2HAXA 3CCQA 2QI2A 2VASA 1K8AC 4PL6A 2DXUA 5IHIA 3BE3A 2CZ0B 1PKTA 5ECAA 2HKNA 2M0OA 4HXJA 1IHWA 4JLIA 2AHJB 2RHXA 3KXTA 4XAXB 4ELYC 1W2BS 4QVZA 2M9UA 1KC8U 1EFNA 1I5LA 1SG5A 1YJ9T 2RQWA 2RJDA 1UJ0A 1GBQA 4KBMB 4FCYA 2MAMA 2CP2A 2RK1A 1PG5B 2CP6A 4HA8A 3OYAA 4M7AF 1Q7YC 2D8JA 4ZGJB 1M30A 2QQ9A 4FU6A 1TU0B 5DY9A 1JQQA 1D3BA 2B8AA 2YT6A 3MPUB 1IZ6A 3OB9A 3UA6A 1T0HA 2O9VA 1M4ZA 4L59A 5GAN5 2KGTA 3TEEA 1AT1B 3DB4A 3ZBDA 5FU7B 1SRLA 3CCRA 2CUBA 3JB9G 4BI3A 3SWNB 4HCCA 2P4TA 2RQRA 3VYHB 5A0LA 1I1JA 5J26A 4V2SA 1OU8A 1Q86U 1G3SA 1HYOA 3RR6A 3TU4K 2LJ0A 3CPWP 1T3LA 2JT4A 4M77E 5HK3A 1KQ2A 1JRIA 4HKEA 4M7AG 1D1BA 1X2QA 1NYFA 1ZSGA 3S3OA 2M51A 3S3NA 1NJIR 2VXEA 3UA7A 3OBWA 3EGXA 2YSQA 1G83A 1QVFS 5HY6A 1J3TA 5FRMA 1WQ7A 1MUZA 4E7IA 1Y96A 2QASA 3O8VA 1WHLA 4EIKA 2K3BA 4M4ZA 1ZUKA 2DRMA 4C8QD 5AT1B 1B3QA 1OPKA 9ATCB 3CBMA 4IUVA 2SRCA 4M78D 3E2UA 2DL5A 2K3XA 3CC7T 3CPWA 1MMGA 2JN0A 4ZGDB 1ARKA 1UFFA 1UGQB 1I0CA 3OYGA 2HSPA 2AZVA 1YBYA 1BBZA 4J9FA 4BI8B 4Y91A 2WSCE 2K2VA 1H3ZA 4PLLA 1UGVA 3OYCA 2QTXA 2EFIA 3FJPA 3PE0A 3M57A 4M78C 2VKNA 1VQ4Q 4JRIA 4II1A 2MWOA 3SDZA 4WCIA 3EFRA 5A0GA 4HCKA 4J6WA 3X20B 1NPRA 1AD5A 1EZZB 2K9GA 1NYGA 2P84A 1YFNA 3WVEB 4E7HA 2MF2A 1SKUB 2EYXA 3CD6A 2HQHA 1NJIC 4IURA 2EW3A 3THKA 2ROLA 4E7SA 2DTOA 2EQIA 4FSSA 3HRTA 1YITA 1KIKA 4PJOE 2FPDA 4F17A 1VQ5A 2KSSA 3LX7A 5IAYA 2CH4W 3RKXA 2V8KA 3ULRB 2DEUA 4PLIA 1YHQA 3PMTA 4A4GA 1KQSP 1VQMT 4AFQC 2MI6A 4E7KA 1ZX6A 4IIMA 1SSHA 3KUFA 1FMKA 2JW4A 4N0AA 1K73R 4GBQA 5CKDA 2GFAA 4AFSC 3OQ5A 5FWCA 2NYSA 1AHJB 1WGSA 2Y90A 5GAMh 3JCMf 2F2XA 3QSUA 3HTRA 2K5IA 2DL7A 1ACMB 1YJ9Q 2YRCA 1IGQA 2FRYA 3HP9A 4C92E 2BKDN 2FZGB 1YJWT 2X51A 1MNEA 3EG0A 3V7RA 3R6OA 3C95A 1K9MU 2J6OA 4B6MA 4KGXB 2DXBA 4NL2A 5CKFA 4C8QE 5LJ3g 4FYYB 2DNUA 4OVAA 2JS2A 1YJ9A 2EBPA 1YHQQ 2KYMA 1MMAA 1TH7A 5CK9A 4M75F 2I2LA 5GJVB 3RKWA 1NEBA 5DLOA 1M1KC 4C8QB 4X1VA 4J83A 1FWZA 2DYBA 2LMJA 3CMEQ 1KQSA 1R0CB 1YHQT 4E7JA 4FIBA 3CMAT 4A4FA 2DBMA 2DJZA 1K73U 1VQMA 4M7DC 2O01E 4OMPA 1RAFB 1U3OA 3GNGA 3RNJA 1AZEA 1WXBA 1RACB 5LJ5g 2PVDB 5J39A 3OS1A 1KSWA 3VU3C 1VQMQ 4LUEA 2DE0X 4A4HA 1FMVA 2DILA 2L3RA 3JRZA 2P4RA 4OMLA 1NLOC 3JV3A 4BE1A 3UATA 2X3WD 1ZUYA 2LQ8A 2L5QA 4LXCA 3CCSQ 5KYWA 4QT7A 1YJWA 4N4GA 2CS7A 5C0MA 3G4SQ 1Z9QA 1RAHB 3AHUA 3H0FA 1YIJA 4PFZA 4M7DE 3G6ET 5LJ5h 1RI9A 2AK5A 4M75E 4BB7A 1BIAA 2CSIA 5GAOr 4D6WA 2JM8A 3REAB 4ZTJA 3FB9A 2NUPB 1AOJA 3CMET 2DRKA 2FVUA 2Y4YA 1WJSA 2HQXA 5FW9A 2LJ1A 3JCMJ 4MDXA 1UEBA 1P92A 5GANf 1NJIU 4C5HA 4C0GA 1Y71A 2YLBA 2K57A 4J9CA 5GAOm 1D0XA 1I5OB 1GXIE 4C92B 3H0IA 3LH0A 1KHIA 2NUPA 3HHTB 4XU3A 4OMQA 1RABB 1TG0A 4XTYA 4P5NA 2ED0A 3L42A 4F7UA 2LT4A 1K9AA 4JJDA 4M75G 1SEMA 2EWNA 1K73C 3LLRA 2PQWA 3G4SA 2XD0A 3HL8A 2DZ9A 3VUZA 5CCAA 3E1SA 2ZGWA 2C0IA 2WACA 1VQ6Q 3EHQA 3CBPA 4OB3B 2O4XA 5LJ3j 2E41A 2PU9B 1V29B 2KBTA 2XMFA 5J3BA 1QVFA 1W1FA 2DO3A 2GNCA 1VQ4A 4M7AA 4QQGA 3GF5A 4C92D 2RQUA 3CC2T 1D09B 2EQMA 5LJ3d 1NPPA 5GMKl 1OI1A 2PTKA 4QQDA 2GQVA 1VOMA 2HCKA 2QDLA 3PFSA 2BTTA 1OEBA 2K5FA 2XICA 1TS9A 5LJ5e 3FEOA 4MMKA 5LJ5d 5CAIA 1B34A 1TOVA 3SB2A 3H9NA 1RAGB 2QA4T 5IXBA 4JZ3A 1VQOQ 1GCPA 1YITT 1QVPA 2QAZA 4GLMA 4ELZC 5I2SA 2CKKA 5KCOA 5CKEA 3L2RA 2LCSA 3L2VA 1VYUA 1BI1A 2MPXC 1K4US 1UHCA 2MIOA 1YNZA 1OZ2A 4M7AB 1GL5A 1PKSA 2E12A 2XIDA 4M77F 5GAOq 3BFMA 5A2QE 2J6FA 2WSFE 4M7DD 4F14A 2RF0A 5EC7A 4EMKC 2ABLA 2QQBA 1DJ7B 2VC8A 1QP3A 2DLPA 4J8OA 4M77D 3EG1A 3CEYA 3OW2S 5FWBA 4LDUA 2OX7A 5GAMe 2ED1A 3QG1A 1PHTA 4JJCA 2GQIA 2DJQA 1VQOA 1YCYA 3SEMA 2EQJA 1BK2A 2E5QA 2X9HA 2D1XA 2QG9B 1AWWA 1YJNQ 4M7AE 5HK0A 2FYKA 4XU0A 4F7UG 2V8JA 3MEAA 4XU2A 3LGLA 2RJCA 4J9HA 3FJ5A 3ZFJA 3PIOA 2DZCA 5CQXA 2RHIA 2EYQA 4OMOA 4X9DA 1OPLA 4J7IA 2KXCA 2V8IA 4JLGA 2A3LA 1QKWA 4BDZA 3CMAA 3QO3A 1PNJA 3U23A 3M4GA 2DTHA 4JJNK 4RCCA 5KYUA 1F1BB 1UGRB 1K8AU 5GAN2 2EGCA 2CGHA 1OX9A 1M3AA 3R6NA 4QVDA 4E7ZA 2Y4XA 2LX7A 1I8FA 2LJ3A 3I9QA 3CCST 2VYTA 3OYFA 3OA6A 1WIEA 4KH1B 3OBYA 2E10A 4CC7A 3SWNA 2BIVA 2KE9A 1M3BA 1H3HA 1I07A 2PVOB 1Q81U 2COWA 3VS4A 2O31A 4AFZC 5GAOp 4RTTA 3MP1A 2HDAA 2DMOA 3NPFA 2A08A 1HK9A 5I22A 3OSSC 2NUZA 3QYHB 2EKHA 5M9OA 3HRUA 3DLMA 4FW2A 3CXCP 2OJ2A 4C0DC 5CVIA 1QCFA 1HJDA 4B9XA 3CCVT 4J6YA 1QMCA 4E6RA 2GBQA 4PFOA 2HBWA 4CC2A 2LP5A 2P0PA 4FT4A 1IB8A 2VVKA 4M75B 1YWOA 2LRQA 2VXFA 2RJEA 3CCSA 4EDUA 3NTHA 3I5SA 4PJNA 1SF9A 5CO7A 2RI2A 2F2WA 4J9IA 2JMAA 4ANJA 3CCJQ 4TVRA 4M7DA 4OB0B 3L1AA 1QP2A 4M78G 1TUCA 1Q81R 1KC8C 1KD1R 3CPFA 1OX8A 1UUEA 1VQPQ 3HKSA 4IUTA 3CQTA 3VYGA 2FB7A 3I55A 3JB9H 1HD3A 2OI3A 4FM4B 1WHJA 2R58A 1S72A 2QK0A 3CXCA 4DQ2A 2E70A 3DB3A 3PTAA 2EQKA 1UDLA 1BI2A 2CZ7B 3NFCA 3H8ZA 2EAYA 4L6V5 4A54A 3BDLA 3OS5A 4HCZA 1MHNA 1VQNA 4F04B 3G71T 2PVGB 4C8QC 2ZPEB 2RQVA 1MNDA 3UDCA 1Q86R 4PKCC 2RK2A 5KYXA 4N4IA 2L3PA 3A1PA 2VGMA 1VQPA 1I4K1 1WJRA 5I11A 2AKLA 3CCEA 2ECZA 1VQLT 1SSFA 3MJXA 2QEXT 3QIIA 1D1AA 1MMDA 4RTWA 2HZYA 3OYLA 1X69A 3OS2A 3EGUA 4EMHA 1X27A 3M55A 4XTVA 4N4HA 4A63B 3QHSA 3V8JA 2JMCA 2C0OA 3QJYA 4KUIA 1N9SA 3G1JA 4XTXA 1KHCA 4FSXA 2DX1A 2K7AA 1SHGA 3OMCA 1R0BG 1VIEA 3NTIA 3CBOA 4WF2A 3SHWA 2ZPFB 3PVLA 2GGRA 3OYNA 2R5MA 1G3YA 1SRMA 2O9SA 2RB6A 3QPHA 3QZ9B 2ESWA 1GFDA 4LNPA 3UF4A 1VA7A 2PUKB 2Z0WA 2F5TX 4FYXB 1NE8A 1KC8R 3NTKA 2K4YA 4RTUA 3FRNA 5IH2A 3G7ZA 3EG3A 2EJGA 1M8VA 2X4XA 5GJWB 3RUXA 2EQUA 3M0TA 2KXDA 4MMLA 4QKUA 1RAIB 2XKOC 3I5RA 1TWBA 4QVCA 2DL8A 2D6FA 1Y96B 3E19A 3N5BB 1M8MA 3PT9A 2KDSA 2OAWA 3A98A 3DKMA 4PFPA 4Z02A 1BI3A 1LJOA 2CUDA 2E5KA 1G2BA 3G71Q 1M1KR 2CYZB 3META 5KYWB 1IREB 2QQAA 1ABQA 3INZA 4D8KA 5C6SA 2MK5A 1Q86C 1X75C 3M0QA 1I81A 2CP3A 1VUBA 2KR3A 2L8DA 1ZLMA 2CH4A 2G3RA 2GCXA 3FC3A 7AT1B 1Q82C 1VQ7Q 2MYSA 1T3SA 1KG1A 3KFVA 4DEXA 3AT1B 3JCMh 1B7TA 3REBB 4CC4B 2LNHB 2RI3A 3MEVA 1G5VA 2KYBA 1Q7YR 3JAME 1WHKA 4KH0B 3CC4Q 1GRIA 4LD6A 3IQLA 2QDYB 3VS1A 3BY7A 2KT8A 3CCMT 1XJWB 4IUQA 1S72Q 1X01A 4PJLA 3CCMQ 1K76A 2IIMA 2B86A 3CC4A 2XU8A 2ZPBB 3CC7A 4C5EA 2XK0A 2CT3A 1RLPC 2XDPA 2DL4A 2NUTB 2CDTA 3GNFB 3VRZA 3A8OB 1S72T 2CZ6B 3F70A 4JDSA 2RHZA 3C0CA 1G8XA 5FU6C 4C92G 4BUGA 4J9GA 1RL2A 1UJYA 3OY9A 3RKYA 2ZPIB 3PVQA 2JJ9A 1QVFP 3QJ6A 2M0YA 4IIOA 3A8GB 2NWMA 4J6XA 1U1SA 5HCKA 1VQLQ 2NUTA 4C92A 3EFOA 1WLPB 1O75A 5CKBA 3QWXX 5IHNA 5IT9E 1VQ8Q 2COZA 1BKBA 1VQKQ 5GAN3 3M5AA 3CD6T 2KROA 2FHDA 3RMQA 3CCLA 1AEYA 2YRVA 4YTLA 1QCOA 4M75D 2DYIA 3JB9D 3GP8A 2RNAA 5FU6B 1VQKA 3I55Q 1WZOA 1K9MR 2XHCA 3PNWC 1N8RC 5GANd 1UECA 4RG8A 2AZSA 2X3XD 3TCJA 2RD1A 2DVEA 3GLXA 2KNBB 4EMKB 3JCMQ 2YUPA 5FROA 2F1LA 1W70A 1LVKA 1HXDA 4FYWB 3PIPA 4E47A 4RTVA 3RESA 2LNVA 2SEMA 4C0FA 1SPKA 5GAN7 1QWEA 1QLYA 2F5KA 3OYIA 4AG1C 3PGGA 1CKBA 1VQ7T 3E9FA 4E2FB 2PNIA 1OZ3A 1JBMA 5KYXB 3HSBA 4FYVB 1KJWA 1U8RA 1VYTA 4RG2A 2W0ZA 2E6NA 1QQJA 1A0NB 1M3CA 1JB0E 1M2OA 3VUBA 2EIFA 3CCLT 1NZ9A 1Q81C 3L2UA 4J5YA 3VS0A 2KEAA 3C12A 5DLQE 1W2BP 3OYMA 1BCOA 5FRNA 4PJOB 5L8RE 4M78B 2LDMA 1S1NA 3MP6A 4LDVA 2RH2A 2DL3A 1XOVA 1YI2Q 4OGCA 2YXYA 2KY9A 2X4WA 4X9CA 2HEQA 4R55A 4KT0E 2F2VA 4F7UB 1LCKA 1WX6A 4RCBA 4DBQA 3CXCS 4E7LA 2A7YA 2V26A 1WHGA 1K9MC 1M90U 5GMKi 4ZNXA 1AWJA 1KD1C 3E9GA 4CI0C 3CCQQ 5IXFA 4PJOA 1R77A 4ESRA 4M78F 1UE9A 3GOXA 2DXTA 5HKCA 5GAN4 4DOWA 1WNLA 2VGNA 2RMOA 1TXQA 1FX7A 4GLKA 3G6EA 1YIJQ 1BCMA 1VQNQ 4JUVA 3OW2A 2YRDA 1PRLC 4ORZA 1FMWA 1V1CA 2ZPHB 2RHYA 2HL5C 1VQ9Q 3GIBA 2KT1A 1U1TA 3G6EQ 2D9TA 1N8RR 2QQRA 4NOYA 3OYDA 2BZXA 2JS0A 4BDYA 1M1FA 1K8AR 1GFCA 4RKUE 2K79A 3TVTA 1M2VB 2OTJA 3A8HB 2YUNA 3URGA 5D7UA 2AIRB 1M5Q1 4IUPA 1ZBJA 1AZGB 2CREA 1N9RA 2C0TA 3FDRA 2BZ8A 5KH6A 2XDDA 1D0YA 2DPPB 2OTJQ 2DK3A 4WTOB 2LQWA 2QYZA 3JCMd 3M0RA 1W2BA 2M1HA 1C1AA 3ME9A 3X28B 4HT9A 1NG2A 2GTOA 1X43A 2DEQA 2JTEA 4RMOA 2DBKA 3NMZC 3V7CA 1YCSB 1ZHIA 1M2VA 3OW2P 2KRMA 2MMPA 2E64A 4OMNA 3MEWA 2JTFA 3UT1A 4R0KA 3OYKA 1K1ZA 4J9BA 3VS2A 2ZAEA 3X24B 1NEGA 3M0PA 2CZ1B 2DD5A 2FL7A 1M1GA 1TUDA 2EGAA 1Y07A 4ME7A 5GAMj 5GMKe 2O2OA 2RI5A 1U5SA 5GAMf 4BE0A 3MCAB 2O88A 1YWPA 1CSKA 3JCMV 4JRKA 1YJNA 4GY5A 2QA4A 3M59A 2DVJA 1Y0MA 2BE7D 3X25B 2DXCA 4KULA 1Q95G 4AMCA 1O9SA 1T0JA 4XTUA 2VUBA 1YI2T 3JCMX 5CIUA 4ZN1A 3WXMB 3C4SA 2C06A 1UG1A 2W10A 3VS6A 2BE9B 3PMIA 4AFUC 4JS5A 2BZYA 1XNIA 1YP5A 2RM4A 1BU1A 4Q5WA 1IRXA 4OB1B 4JJBA 1Q82U 3TREA 2DTIA 1YIJT 1QVGS 4RTXA 3M0UA 4BACA 3Q1JA 3M4YA 4LN2A 3QYGB 1PD0A 4C0ZA 2ZCFB 3HRSA 1Q7YU 3OSVA 3KBGA 1X6GA 5GAN6 2FPEA 3OS0A 2LC4A 3H6ZA 3OYBA 2MWPA 4LDWA 5I2MA 4KRTA 3OMGA 5D6WA 1X6BA 2ENMA 3EG9A 5GANg 3EGXB 3VS5A 2NLUA 2DA9A 3EFOB 4OP0A 1ZA1B 1WJQA 1NM7A 5LJ5j 3I56A 2LQNA 1ZUUA 2COYA 3QKJA 3FLGA 4Z8AA 4DBRA 4DBHA 1OOTA 5DM7R 3A8MB 4R56A 1ABOA 1EIFA 4BY6B 1VQ5Q 2JNGA 1VQ5T 1M1KU 1U06A 2R5AA 1UTIA 2R57A 1WHMA 4M75A 2HQEA 1W6XA 1LPLA 5FLXE 5GAMg 3JSCA 5AYFA 4KGZB 3EAEA 5LJ5f 1ZQ1A 2E65A 3EHRA 4RTZA 2V1QA 3VKIA 1GCQA 3TSZA 1UB4A 3L2ZA 1SHFA 2LTOA 1N6AA 3OYHA 4M7AD 3LYIA 2LZ6B 3M54A 2CP7A 2D0NA 2RHUA 3M56A 4C92C 1MV3A 2DM1A 2YUOA 4M77G 2EVRA 4M77C 3MP8A 1ZSZB 3EFSA 1AWXA 4PJOD 2E3HA 4J9EA 2JXBA 1YITQ 4O5VA 1QVGP 3VRYA 1WFWA 3RBBB 2WSEE 4C92F 2XG8D 4HT8A 2FZCB 2KRSA 5L23A 4KUDK 4M78A 4C0DB 2OTJT 4AG2C 4RTYA 2L3QA 5KE3A 2EYZA 5KYYB 2KI7A 3BDUA 1XTDA 1H641 3CC7Q 2RA2A 4M75C 1WXUA 3J80E 2ATCB 1D3BB 2K5LA 4M77B 1N5ZA 1R8OB 5GANj 1ZSZC 5GANe 3I35A 1JXMA 3FIFA 4IKFA 3V7SA 5KYYA 4AT1B 3X26B 2J7IA 3SWNC 2P0KA 2CSQA 4Y92A 1G3TA 3CCJA 5A0DA 6AT1B 4ATOA 3P8HA 1NLPC 4UC4A 2I0NA 1QVGA 5KCHA 3CCEQ 2QXFA 2LCCA 2OTLA 1B07A 2A28A 4VUBA 3I56Q 4EPCA 1OQKA 4MZTA 1W4SA 3DLLA 2DFUA 3HPWA 4MZPA 3I55T 3MKDA 1BIBA 2QA4Q 1VQOT 3CMEA 4D8DA 2X35A 1NBEB 2E4HA 1XQHA 2E6ZA 4PJOF 5GAMd 4N0AC 1JJ2P 3MEUA 3OYJA 1WDXA 1YJNT 2QTVA 2FZKB 1HSQA 4BY6C 2RN8A 5EG2A 3H41A 2QGGA 3EGDB 2DIQA 1GBRA 3RMSA 5GAOn 4F7UF 2DIGA 3QXEB 2FRWA 1YI2A 3CCRQ 1WPYA 1H92A 3M58A 3G4ST 4XTWA 4PNOA 4HVVA 2YDLA 4Y28E 3CPWS 5IN1A 1QWFA 1V76A 2EYWA 4L5GA 5GAOl 2IG0A 5CQYA 2OTLQ 4ZTFA 1YJWQ 2DKGA 1EX4A 4RUGA 1VQ9T 2KQWA 3MHXA 2X4JA 3O5ZA 1AWOA 1VQ4T 3SD4A 4BI4A 5FU7C 1JO8A 4J9DA 3CC2A 2OTLT 2M02A 1ZSZA 4EMKA 3JB9I 2BUDA 1D1CA 1B34B 1TSFA 4PJOG 2L2PA 3JCMe 1QW1A 3OYYA 3UWNA 4OMMA 1PSEA 3GPLA 2AKKA 3ZL7C 3V8KA 2RJFA 3I56T 3QDRB 1VIFA 4X34A 2J06A 1X6OA 4C5GA 4FT2A 2L3SA 3ER0A 2IPOB 2CP0A 4XU1A 3EG9B 1OU9A 1BB9A 1H8KA 5KE2A 3SFMA 1C6VX 4XK8E 3ASKA 5GMKh 3JCMP 1KK7A 1PCXA 2QQSA 5GMKm 1N8RU 1OV3A 2A37A 4PJJA 3JCMg 4DEYA 3CCUT 2XI9A 3CCVA 1JJ2S 2HMAA 3VS3A 1VQ9A 4M78E 1D0ZA 2A36A 3QWYA 4HVWA 2EYYA 1RLQC 2H3EB 1MV0B 2DETA 5LL6S 4OF1A 1PWTA 3TSWA 1MMNA 2EJFA 2H8HA 4LE9A 4IUUA 3J81E 3WVDB 4MDWA 1PRMC 1ZBXA 3HFNA 5KYNA 1IGUA 2RO0A 4FL6A 1WA7A 4JRPA 4JPBW 2PZ1A 3VS7A 3LW5E 3P8DA 2KVQG 1Q82R 4XQ3A 1AVZC 1E7OA 3G71A 2LQKA 2HD0A 4A4KA 3GBQA 5KYUB 3P8BB 1MGQA 3EH2A 1RAEB 5LJ3h 1TUGB 1KQSS 1Y7XA 3RIRA 4CRIA 4ZGEB 3LGFA 2JZ2A 3JCMc 4DBFA 3L2QA 4PK4A 2OAUA 2ZZDA 2KK4A
chains in the Genus database with same CATH topology
1G3WA 4C8QF 2Y90A 2LVMA 2MMPA 2E64A 3VV0A 1VQNT 2RK2A 3MEWA 2JTFA 3JCMf 3UT1A 5GAMh 3CCET 4M7DB 3OYKA 3QSUA 1VQLA 2K5IA 4N4IA 2QEXA 2VGMA 2JOYA 4C8QG 4A53A 1VQPA 3X24B 1I4K1 1WJRA 3HP9A 4C92E 2BKDN 1YJWT 2P0QA 4LDXA 2CZ1B 4XTZA 3V7RA 2DD5A 3R6OA 2FL7A 1VQ8T 1M1GA 3C95A 3CCEA 1K9MU 1Y07A 1VQLT 1M9SA 1SSFA 2LX9A 4LDYA 3QIIA 2DXBA 4ME7A 4NL2A 5CKFA 1KQ1A 5GMKe 5GAMj 4C8QE 1VQPT 2RI5A 2E1HA 5LJ3g 5GAMf 4BE0A 4OVAA 3MCAB 3CCJT 1LNXA 1YJ9A 2XDBA 2EKOA 5D6YA 1TH7A 3V8LA 5CK9A 3OYLA 4M75F 2I2LA 3RKWA 4BE2A 3M9QA 3JCMV 4JRKA 3OS2A 1YJNA 2KMTA 5DLOA 4EMHA 1M1KC 2HBPA 4C8QB 3M55A 2O4XB 4GY5A 4XTVA 4J83A 2LCLA 4QW2A 4A4EA 1FWZA 3M59A 5I21A 3CC4T 4N4HA 2QA4A 1KQSA 3A5ZB 3QHSA 5D6XA 3X25B 2DXCA 1YHQT 4KULA 3V8JA 4ZN3A 4E7JA 1O9SA 4FIBA 4XTUA 3CMAT 2VUBA 4KUIA 3QJYA 4A4FA 1N9SA 2DJZA 3JCMX 3UPUA 5CIUA 1YI2T 4ZN1A 1VQMA 2O01E 1K73U 3WXMB 3C4SA 4XTXA 1KHCA 4FSXA 2C06A 4OB2B 4DOVA 4M7AC 4LD9K 3GNGA 1OYXA 3OMCA 3PMIA 2M16A 1VQ6T 4JS5A 3C94A 1VIEA 3NTIA 3HFOA 2IVWA 1XNIA 3CBOA 3JCMb 5LJ5g 2PVDB 4WF2A 5J39A 4O6JA 2ZPFB 3OS1A 4BD3A 2DAQA 2RM4A 4Q5WA 3VU3C 3OYNA 2R5MA 1G3YA 3S3MA 4OB1B 4QQ6A 1M90C 2RB6A 1Q82U 3QPHA 3TREA 4NL3A 4A4HA 3QZ9B 2GFUA 2L3RA 2DTIA 1YIJT 3JRZA 1QVGS 4BACA 3Q1JA 3M4YA 3QYGB 2PUKB 4BE1A 3BW1A 4C0ZA 2LQ8A 2ZCFB 2K3YA 2L5QA 3HRSA 1Q7YU 2F5TX 4MZMA 4JRQA 3OSVA 3KBGA 5GANh 1YJWA 1NE8A 2CS7A 4N4GA 5C0MA 3L2WA 2YLCA 4NS5A 5GAN6 1KD1U 3OS0A 3AHUA 2D0QB 1YIJA 2LC4A 1VQ8A 3H6ZA 4M7DE 3G6ET 3OYBA 2MWPA 3NTKA 2K4YA 4LDWA 5I2MA 3VJPA 3A8LB 5LJ5h 3FRNA 2JVVA 3OMGA 5D6WA 4M75E 3G7ZA 4BB7A 2EJGA 1M8VA 1BIAA 2X4XA 2ZPGB 5GANg 5GAOr 3RUXA 2EQUA 4D6WA 2NLUA 4OP0A 4MMLA 1WJQA 5LJ5j 3I56A 4ZTJA 4M7DG 3FB9A 3OYEA 1VQKT 2XKOC 4QVCA 3JCMW 3QKJA 5GMKj 4OMFB 3CMET 2FVUA 2Y4YA 3FLGA 3QUIA 1WJSA 2HQXA 4M7DF 5DM7R 3A8MB 2H3JA 1UEBA 1Y96B 1P92A 5GANf 3E19A 3JCMJ 1NJIU 2D6FA 2F69A 4C5HA 3N5BB 4C0GA 4R56A 1Y71A 1EIFA 2YLBA 2K57A 3M53A 4BY6B 3PT9A 5GAOm 2KDSA 2JNGA 2LT1A 3RERA 4F7UE 1VQ5T 1GXIE 4C92B 1M1KU 3LH0A 1KHIA 3DKMA 3HHTB 4XU3A 4Z02A 1BI3A 1LJOA 4XTYA 4P5NA 3L42A 2R5AA 2LT4A 4F7UA 1VQ6A 2CYZB 1BI0A 2KAFA 3QZ5B 3META 5GAN8 4M75G 1IREB 2R57A 2EWNA 2QQAA 1K73C 3LLRA 3INZA 2PQWA 3G4SA 2XD0A 4M75A 3HL8A 2HQEA 1UGSB 5C6SA 4DA4A 2DZ9A 4J7FA 1VQ7A 1Q86C 2VV5A 3VUZA 5FLXE 5CCAA 3E1SA 5GAMg 2GF7A 2ZGWA 1FXXA 2WACA 3JSCA 1X75C 5AYFA 4JS4A 3CBPA 4OB3B 2O4XA 3CCQT 1I81A 3EAEA 5LJ3j 2E41A 2JTMA 2L89A 3S6WA 2PU9B 5LJ3e 5LJ5f 4M7DC 1V29B 1ZQ1A 4OGEA 1VUBA 2E65A 3QBYA 2L8DA 3VKIA 2GCXA 2G3RA 4B9WA 1UB4A 3FC3A 3L2ZA 1Q82C 5J3BA 1QVFA 2EJ9A 2DO3A 2LTOA 1N6AA 3MO8A 1VQ4A 3OYHA 4M7AD 4M7AA 3LYIA 1KG1A 4QQGA 5CKHA 3GF5A 4C92D 3CC2T 1UGPB 3M54A 2EQMA 5LJ3d 3JCMh 1JJ2A 3JB9F 5CR2A 3CCUA 2RHUA 3M56A 4C92C 1NPPA 2RI3A 3MEVA 4C8QA 3LWHA 4EMGA 5GMKl 1BYMA 1G5VA 1OI1A 3JAME 4QQDA 2GQVA 3CCMA 4M77G 4PJOC 3PFSA 4M77C 3MP8A 2DD4A 3EFSA 4PJOD 2X4YA 2PUOB 2K5FA 4LD6A 4O5VA 2QDYB 1RI0A 2XICA 2WSEE 3T9NA 3BY7A 3J7AF 5LJ3f 4HCBA 4C92F 5LJ5e 3CCMT 1N27A 3FEOA 4IUQA 2XG8D 4MMKA 5LJ5d 4HT8A 1X01A 5CAIA 2YHTA 1B34A 3SB2A 3ZEHA 2QA4T 1PSFA 3CC4A 4KUDK 2XU8A 4M77A 3LWIA 2ZPBB 1QVPA 1WQWA 5I2SA 4C5EA 2XK0A 4M78A 4C0DB 4ELZC 2CKKA 3CC7A 2OTJT 5KCOA 2HNIA 5CKEA 4C5IA 3CCRT 2XDPA 5KE3A 3L2RA 3L2VA 2JUFA 3GNFB 3A8OB 1S72T 2CZ6B 1BI1A 3JB9J 3BDUA 3F70A 4JDSA 2RHZA 1OZ2A 5FU6C 4C92G 4BUGA 1RL2A 1XTDA 4M7AB 1H641 2E12A 3OY9A 2XIDA 2RA2A 4M77F 4M75C 3RKYA 1LOJA 5GAOq 2ZPIB 3BFMA 2QI2A 3J80E 3CCQA 2HAXA 1D3BB 1K8AC 2K5LA 4M77B 3QJ6A 1R8OB 1YITT 5A2QE 4PL6A 2DXUA 2WSFE 5GANj 5GANe 2CZ0B 3FIFA 4IKFA 4M7DD 3A8GB 4J6XA 1U1SA 2M0OA 4JLIA 2AHJB 3V7SA 2RHXA 3X26B 3KXTA 4XAXB 4C92A 4ELYC 2P0KA 4QVZA 3SWNC 1O75A 2M9UA 2QQBA 5CKBA 1DJ7B 4EMKC 1W2BS 1KC8U 2VC8A 1G3TA 1I5LA 1QP3A 3CCJA 1YJ9T 2RJDA 4J8OA 5A0DA 4M77D 4ATOA 5IT9E 3P8HA 3CEYA 4KBMB 3OW2S 1BKBA 4UC4A 4LDUA 5GAMe 5GAN3 3M5AA 3QG1A 1QVGA 3CD6T 3RMQA 2FHDA 5KCHA 2MAMA 2RK1A 1VQOA 1YCYA 3CCLA 2EQJA 2QXFA 2LCCA 2YRVA 4HA8A 2OTLA 2E5QA 4YTLA 3OYAA 1Q7YC 4M7AF 4ZGJB 2QQ9A 4VUBA 4M75D 4EPCA 3JB9D 4MZTA 3GP8A 1W4SA 4FU6A 5FU6B 5DY9A 3DLLA 4M7AE 5HK0A 1D3BA 2B8AA 2FYKA 3HPWA 4MZPA 3I55T 1VQKA 4XU0A 1IZ6A 3OB9A 4F7UG 2V8JA 1BIBA 1VQOT 3MEAA 4XU2A 3LGLA 1M4ZA 3CMEA 2RJCA 3ZFJA 2XHCA 4L59A 3PIOA 3PNWC 2X35A 5GAN5 1N8RC 2DZCA 5GANd 3TEEA 1XQHA 2E6ZA 4PJOF 5CQXA 3DB4A 4RG8A 3ZBDA 3TCJA 2RHIA 5GAMd 2EYQA 4N0AC 5FU7B 3MEUA 3OYJA 3CCRA 4X9DA 1YJNT 2RD1A 2DVEA 3JB9G 4BI3A 3GLXA 4BY6C 5EG2A 3SWNB 4EMKB 3JCMQ 4HCCA 4J7IA 2P4TA 2V8IA 3VYHB 5FROA 4JLGA 2A3LA 2DIQA 5A0LA 3RMSA 5J26A 5GAOn 1HXDA 4V2SA 4F7UF 2DIGA 4BDZA 1Q86U 3PIPA 3QXEB 3CMAA 4E47A 3QO3A 1G3SA 1YI2A 3RESA 4C0FA 2LNVA 3M4GA 3TU4K 2DTHA 5GAN7 4JJNK 1WPYA 4M77E 3M58A 5HK3A 3G4ST 1KQ2A 1JRIA 4HKEA 4PNOA 4XTWA 4RCCA 4M7AG 1UGRB 1K8AU 2F5KA 3OYIA 4Y28E 5GAN2 2CGHA 3PGGA 3CPWS 1VQ7T 3E9FA 5IN1A 3S3OA 4L5GA 5GAOl 2IG0A 5CQYA 1OZ3A 4QVDA 4ZTFA 1JBMA 2Y4XA 2DKGA 3HSBA 3S3NA 1I8FA 3CCST 2VXEA 1VQ9T 1U8RA 2VYTA 2KQWA 3MHXA 3OBWA 4RG2A 3OYFA 2E6NA 2X4JA 3OA6A 1VQ4T 3SD4A 4BI4A 5FU7C 1QVFS 1JB0E 5HY6A 3VUBA 3CC2A 2EIFA 3OBYA 3CCLT 1NZ9A 2OTLT 2E10A 5FRMA 1WQ7A 1Q81C 3SWNA 4EMKA 3JB9I 2BIVA 3L2UA 4J5YA 2BUDA 4E7IA 1Y96A 3C12A 5DLQE 1B34B 4PJOG 3OYMA 2PVOB 3O8VA 1Q81U 5FRNA 3JCMe 5GAOp 4PJOB 1QW1A 3OYYA 3MP1A 5L8RE 4M78B 3UWNA 2LDMA 1PSEA 3MP6A 4LDVA 4C8QD 3GPLA 2RH2A 3V8KA 2RJFA 1XOVA 3I56T 3QDRB 1VIFA 4OGCA 4X34A 2KY9A 1X6OA 2X4WA 4X9CA 4R55A 1HK9A 4KT0E 4C5GA 3CBMA 3OSSC 4MDXA 4FT2A 4IUVA 4F7UB 3QYHB 4M78D 3ER0A 4RCBA 5M9OA 4E7LA 3CXCS 3HRUA 2K3XA 2A7YA 3DLMA 3CC7T 3CPWA 4ZGDB 2JN0A 1UGQB 4XU1A 4C0DC 5CVIA 1K9MC 1M90U 3OYGA 5GMKi 5KE2A 3SFMA 1YBYA 4B9XA 4XK8E 3CCVT 3ASKA 4J6YA 4BI8B 5GMKh 1KD1C 3JCMP 3E9GA 4Y91A 4CI0C 2QQSA 2WSCE 5GMKm 2K2VA 1H3ZA 4PLLA 1N8RU 3OYCA 4PJOA 2P0PA 4FT4A 2QTXA 4M78F 2EFIA 4M75B 3GOXA 2DXTA 3FJPA 5HKCA 2LRQA 3JCMg 5GAN4 3M57A 2VXFA 4DOWA 3CCUT 2XI9A 2RJEA 1WNLA 3CCSA 3CCVA 4EDUA 3NTHA 1JJ2S 2VGNA 1VQ9A 4M78C 4M78E 5CO7A 4JRIA 4II1A 1FX7A 2MWOA 2RI2A 4GLKA 3SDZA 3G6EA 3EFRA 4JUVA 3OW2A 5A0GA 4J6WA 5LL6S 3X20B 4OF1A 1NPRA 4TVRA 4M7DA 2ZPHB 4OB0B 3L1AA 3WVEB 2RHYA 1QP2A 2EJFA 4M78G 4E7HA 2MF2A 4IUUA 3J81E 3GIBA 3WVDB 3CD6A 1U1TA 2D9TA 2QQRA 1NJIC 4IURA 4MDWA 4NOYA 3OYDA 1KC8C 1ZBXA 3CPFA 4BDYA 3HFNA 1M1FA 2DTOA 3HKSA 4IUTA 2RO0A 3HRTA 4RKUE 4FL6A 1YITA 2QEXT 4JRPA 2OTJA 3VYGA 2FB7A 3A8HB 3I55A 3JB9H 4PJOE 3URGA 4FM4B 3LW5E 3P8DA 2R58A 1VQ5A 1M5Q1 4IUPA 1S72A 2KVQG 2KSSA 1N9RA 3CXCA 3LX7A 5IAYA 3FDRA 4XQ3A 2V8KA 3RKXA 5KH6A 4DQ2A 2E70A 4PLIA 1YHQA 3DB3A 2XDDA 3PMTA 4A4GA 3PTAA 3G71A 2DPPB 2LQKA 2HD0A 2DK3A 2EQKA 4A4KA 1VQMT 3P8BB 1MGQA 2MI6A 1BI2A 2CZ7B 4E7KA 3NFCA 5LJ3h 3H8ZA 3JCMd 1W2BA 1KQSS 2EAYA 1Y7XA 4L6V5 4A54A 3BDLA 2M1HA 3KUFA 3OS5A 4HCZA 3RIRA 3ME9A 1MHNA 1VQNA 4CRIA 4N0AA 4ZGEB 3LGFA 3X28B 4HT9A 3G71T 2JZ2A 3JCMc 2PVGB 4C8QC 2ZPEB 5CKDA 3UDCA 2DEQA 2GFAA 4RMOA 3OQ5A 3L2QA 2OAUA 1AHJB 3V7CA 2ZZDA 4PKCC 1ZHIA 1WGSA 2KK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q F;  2Y90 A;  1U1S A;  4J6X A;  2E64 A;  4JLI A;  3V7S A;  5GAM h;  3JCM f;  2YLB A;  2K57 A;  4M7D B;  4C92 A;  3QSU A;  5GAO m;  3SWN C;  4EMK C;  4X9C A;  4C8Q G;  4A53 A;  1HK9 A;  2VC8 A;  4F7U E;  4C92 B;  1I5L A;  1I4K 1;  4F7U B;  4XU3 A;  4M78 D;  4RCB A;  4C92 E;  4M77 D;  1LJO A;  4XTY A;  3V7R A;  4XTZ A;  4F7U A;  2JN0 A;  4XU1 A;  5GAN 8;  5GAN 3;  5GAM e;  4M75 G;  5GAM j;  4NL2 A;  2EWN A;  1KQ1 A;  5GMK e;  5GMK i;  1YCY A;  4C8Q E;  2E1H A;  3INZ A;  4HA8 A;  5GAM f;  5LJ3 g;  3RER A;  1LNX A;  4M7A F;  4M75 A;  4J6Y A;  5GMK h;  3JCM P;  4M75 D;  2DZ9 A;  4Y91 A;  1TH7 A;  3V8L A;  3JB9 D;  4M75 F;  2I2L A;  3RKW A;  5DY9 A;  5GMK m;  2ZGW A;  3JCM V;  5GAM g;  4M7A E;  1D3B A;  2FYK A;  4JRK A;  4PJO A;  4XU0 A;  1I81 A;  2QTX A;  4M78 F;  2E41 A;  4EMH A;  4F7U G;  1BIB A;  5LJ3 j;  5LJ3 e;  4M75 B;  4XU2 A;  2DXT A;  3FJP A;  3JCM g;  4C8Q B;  5GAN 4;  2VXF A;  2E65 A;  4XTV A;  5GAN 5;  1WNL A;  2DZC A;  5GAN d;  5I21 A;  4PJO F;  3QHS A;  4M78 C;  4M78 E;  3L2Z A;  5GAM d;  4JRI A;  4N0A C;  2EJ9 A;  3V8J A;  4XTU A;  4X9D A;  2RD1 A;  3EFR A;  4M7A D;  1N9S A;  2DJZ A;  2DVE A;  4JUV A;  3JCM X;  3JB9 G;  4C92 D;  4M7A A;  4M7D C;  4J6W A;  4XTX A;  3SWN B;  4EMK B;  3JCM Q;  5LJ3 d;  3JCM h;  3JB9 F;  4M7D A;  4C92 C;  4M7A C;  3L1A A;  4C8Q A;  4EMG A;  5GMK l;  5GAO n;  1HXD A;  4V2S A;  2EJF A;  4M78 G;  4F7U F;  4HT9 A;  3JCM b;  4M77 G;  3HFO A;  3GIB A;  4M77 C;  4PJO C;  3QO3 A;  5LJ5 g;  4WF2 A;  1U1T A;  3EFS A;  3RES A;  2RM4 A;  3M4G A;  4NOY A;  2DTH A;  3VU3 C;  5GAN 7;  1WPY A;  4M77 E;  4PJO D;  1KQ2 A;  1JRI A;  3HFN A;  4PNO A;  4XTW A;  4RCC A;  4M7A G;  2RB6 A;  2DTO A;  4NL3 A;  5GAN 2;  2CGH A;  3PGG A;  3BY7 A;  2DTI A;  5LJ3 f;  4C92 F;  2FB7 A;  5LJ5 e;  4MMK A;  5LJ5 d;  5GAO l;  4HT8 A;  3JB9 H;  4PJO E;  1X01 A;  5CAI A;  3BW1 A;  4QVD A;  1JBM A;  2YHT A;  1B34 A;  1M5Q 1;  2DKG A;  3SB2 A;  1N9R A;  3HSB A;  1I8F A;  4XQ3 A;  3RKX A;  2VXE A;  5GAN h;  4M77 A;  2YLC A;  1WQW A;  4DQ2 A;  5GAN 6;  4M78 A;  3AHU A;  4M7D E;  2HNI A;  5LJ5 h;  1MGQ A;  3JB9 J;  5LJ3 h;  4M75 E;  3BDU A;  3JCM d;  2E10 A;  2EJG A;  1WQ7 A;  2EAY A;  1BIA A;  4A54 A;  1M8V A;  5GAN g;  3SWN A;  3RIR A;  3RUX A;  4C92 G;  4EMK A;  3JB9 I;  4J5Y A;  5GAO r;  4M7A B;  1H64 1;  1Y96 A;  4MML A;  4N0A A;  4OP0 A;  1B34 B;  4PJO G;  5LJ5 j;  2RA2 A;  4M77 F;  4M75 C;  3RKY A;  1LOJ A;  3JCM c;  3FB9 A;  3BFM A;  5GAO q;  4M7D G;  4C8Q C;  5LJ5 f;  1D3B B;  4QVC A;  2DEQ A;  3JCM e;  4M77 B;  5GMK j;  5GAO p;  3JCM W;  4PJO B;  5GAN j;  2DXU A;  3QUI A;  4M78 B;  3V7C A;  5GAN e;  4M7D F;  3JCM J;  4C8Q D;  1Y96 B;  5GAN f;  3FIF A;  4M7D D;  3V8K A; 
#chains in the Genus database with same CATH topology
 1G3W A;  4C8Q F;  2LVM A;  3VV0 A;  1VQN T;  2YUQ A;  4LUD A;  3CCE T;  4M7D B;  1VQL A;  2QEX A;  2JOY A;  1Y57 A;  1GCQ C;  4C8Q G;  4A53 A;  1TTH B;  2P0Q A;  4LDX A;  4XTZ A;  1VQ8 T;  1M27 C;  1M9S A;  2A0F B;  2LX9 A;  4LDY A;  1WI7 A;  1KQ1 A;  1QKX A;  1VQP T;  2E1H A;  3RER A;  3CCJ T;  1LNX A;  2XDB A;  2EKO A;  5D6Y A;  3CCL Q;  4FW1 A;  4PJM A;  1OUL A;  3V8L A;  5IHK A;  2EPD A;  4BE2 A;  3M9Q A;  2KMT A;  1E6H A;  2V1R A;  2HBP A;  2L0A A;  2O4X B;  4A4E A;  2CT4 A;  2LCL A;  4QW2 A;  3CC4 T;  5I21 A;  3A5Z B;  5D6X A;  4ZN3 A;  1YN8 A;  3UPU A;  1VYV A;  4OB2 B;  4DOV A;  4M7A C;  4LD9 K;  1OYX A;  2M16 A;  1VQ6 T;  3C94 A;  4Z88 A;  3JCM b;  3HFO A;  2IVW A;  4O6J A;  2MCN A;  4BD3 A;  2DAQ A;  4KGV B;  3CMA Q;  1IHV A;  2J6K A;  3S3M A;  4QQ6 A;  1M90 C;  1JXO A;  2KRN A;  4NL3 A;  2GFU A;  1PD1 A;  2DER A;  4JZ4 A;  3BW1 A;  3QDF A;  4HVU A;  3H0H A;  2K3Y A;  2ROT A;  4MZM A;  4JRQ A;  5GAN h;  2FG0 A;  2VWF A;  3L2W A;  1C0M A;  2YLC A;  4NS5 A;  1KD1 U;  2RQT A;  2D0Q B;  1VQ8 A;  3VJP A;  3A8L B;  2JVV A;  1JU5 C;  2GTJ A;  1K0X A;  1ZA2 B;  2FO0 A;  1IXD A;  4CC3 A;  4K11 A;  2ZPG B;  3CC2 Q;  4M7D G;  3OYE A;  1VQK T;  2VB6 A;  3JCM W;  5GMK j;  4OMF B;  2HKQ B;  1X2K A;  3QUI A;  4M7D F;  2H3J A;  1UHF A;  2JM9 A;  2F69 A;  3M53 A;  2CP5 A;  2LT1 A;  4F7U E;  2YWW A;  2HSE B;  2EGE A;  1VQ6 A;  1K0S A;  2E3I A;  3EGD A;  1BI0 A;  2KAF A;  1RAA B;  3QZ5 B;  5GAN 8;  1WYX A;  1JEG A;  1FYN A;  1PM3 A;  1QCN A;  1IO6 A;  1UGS B;  3EG2 A;  4DA4 A;  4J7F A;  1VQ7 A;  2VV5 A;  3M0S A;  4F16 A;  2GF7 A;  4JS4 A;  1FXX A;  1PC0 A;  3CCQ T;  2AT1 B;  2JTM A;  2L89 A;  3S6W A;  3EH1 A;  5LJ3 e;  3CCU Q;  4OGE A;  3QBY A;  3LH5 A;  4B9W A;  1WHH A;  3CCV Q;  2EJ9 A;  2G6F X;  2K6D A;  3D7S B;  2QEX Q;  3MO8 A;  5CKH A;  1UGP B;  1CKA A;  1JJ2 A;  3JB9 F;  5CR2 A;  3CCU A;  4C8Q A;  3LWH A;  1BYM A;  4EMG A;  2D8H A;  3CCM A;  4PJO C;  2DD4 A;  3NHN A;  1E6G A;  2DF6 A;  8ATC B;  1Z9Z A;  2X4Y A;  2PUO B;  3CD6 Q;  2FPF A;  1RI0 A;  3T9N A;  3J7A F;  5LJ3 f;  4HCB A;  1WXT A;  3RDV A;  3TQ7 P;  8AT1 B;  1N27 A;  2FEI A;  2QGF B;  2MOX A;  2YHT A;  3ZEH A;  1PSF A;  4M77 A;  3LWI A;  1WQW A;  1RAD B;  2HNI A;  4C5I A;  3CCR T;  4Z89 A;  1RUW A;  3NGP A;  2RPN A;  1KFZ A;  1M90 R;  2JUF A;  3JB9 J;  2HL3 A;  2J05 A;  2K2M A;  1LOJ A;  2HAX A;  3CCQ A;  2QI2 A;  2VAS A;  1K8A C;  4PL6 A;  2DXU A;  5IHI A;  3BE3 A;  2CZ0 B;  1PKT A;  5ECA A;  2HKN A;  2M0O A;  4HXJ A;  1IHW A;  4JLI A;  2AHJ B;  2RHX A;  3KXT A;  4XAX B;  4ELY C;  1W2B S;  4QVZ A;  2M9U A;  1KC8 U;  1EFN A;  1I5L A;  1SG5 A;  1YJ9 T;  2RQW A;  2RJD A;  1UJ0 A;  1GBQ A;  4KBM B;  4FCY A;  2MAM A;  2CP2 A;  2RK1 A;  1PG5 B;  2CP6 A;  4HA8 A;  3OYA A;  4M7A F;  1Q7Y C;  2D8J A;  4ZGJ B;  1M30 A;  2QQ9 A;  4FU6 A;  1TU0 B;  5DY9 A;  1JQQ A;  1D3B A;  2B8A A;  2YT6 A;  3MPU B;  1IZ6 A;  3OB9 A;  3UA6 A;  1T0H A;  2O9V A;  1M4Z A;  4L59 A;  5GAN 5;  2KGT A;  3TEE A;  1AT1 B;  3DB4 A;  3ZBD A;  5FU7 B;  1SRL A;  3CCR A;  2CUB A;  3JB9 G;  4BI3 A;  3SWN B;  4HCC A;  2P4T A;  2RQR A;  3VYH B;  5A0L A;  1I1J A;  5J26 A;  4V2S A;  1OU8 A;  1Q86 U;  1G3S A;  1HYO A;  3RR6 A;  3TU4 K;  2LJ0 A;  3CPW P;  1T3L A;  2JT4 A;  4M77 E;  5HK3 A;  1KQ2 A;  1JRI A;  4HKE A;  4M7A G;  1D1B A;  1X2Q A;  1NYF A;  1ZSG A;  3S3O A;  2M51 A;  3S3N A;  1NJI R;  2VXE A;  3UA7 A;  3OBW A;  3EGX A;  2YSQ A;  1G83 A;  1QVF S;  5HY6 A;  1J3T A;  5FRM A;  1WQ7 A;  1MUZ A;  4E7I A;  1Y96 A;  2QAS A;  3O8V A;  1WHL A;  4EIK A;  2K3B A;  4M4Z A;  1ZUK A;  2DRM A;  4C8Q D;  5AT1 B;  1B3Q A;  1OPK A;  9ATC B;  3CBM A;  4IUV A;  2SRC A;  4M78 D;  3E2U A;  2DL5 A;  2K3X A;  3CC7 T;  3CPW A;  1MMG A;  2JN0 A;  4ZGD B;  1ARK A;  1UFF A;  1UGQ B;  1I0C A;  3OYG A;  2HSP A;  2AZV A;  1YBY A;  1BBZ A;  4J9F A;  4BI8 B;  4Y91 A;  2WSC E;  2K2V A;  1H3Z A;  4PLL A;  1UGV A;  3OYC A;  2QTX A;  2EFI A;  3FJP A;  3PE0 A;  3M57 A;  4M78 C;  2VKN A;  1VQ4 Q;  4JRI A;  4II1 A;  2MWO A;  3SDZ A;  4WCI A;  3EFR A;  5A0G A;  4HCK A;  4J6W A;  3X20 B;  1NPR A;  1AD5 A;  1EZZ B;  2K9G A;  1NYG A;  2P84 A;  1YFN A;  3WVE B;  4E7H A;  2MF2 A;  1SKU B;  2EYX A;  3CD6 A;  2HQH A;  1NJI C;  4IUR A;  2EW3 A;  3THK A;  2ROL A;  4E7S A;  2DTO A;  2EQI A;  4FSS A;  3HRT A;  1YIT A;  1KIK A;  4PJO E;  2FPD A;  4F17 A;  1VQ5 A;  2KSS A;  3LX7 A;  5IAY A;  2CH4 W;  3RKX A;  2V8K A;  3ULR B;  2DEU A;  4PLI A;  1YHQ A;  3PMT A;  4A4G A;  1KQS P;  1VQM T;  4AFQ C;  2MI6 A;  4E7K A;  1ZX6 A;  4IIM A;  1SSH A;  3KUF A;  1FMK A;  2JW4 A;  4N0A A;  1K73 R;  4GBQ A;  5CKD A;  2GFA A;  4AFS C;  3OQ5 A;  5FWC A;  2NYS A;  1AHJ B;  1WGS A;  2Y90 A;  5GAM h;  3JCM f;  2F2X A;  3QSU A;  3HTR A;  2K5I A;  2DL7 A;  1ACM B;  1YJ9 Q;  2YRC A;  1IGQ A;  2FRY A;  3HP9 A;  4C92 E;  2BKD N;  2FZG B;  1YJW T;  2X51 A;  1MNE A;  3EG0 A;  3V7R A;  3R6O A;  3C95 A;  1K9M U;  2J6O A;  4B6M A;  4KGX B;  2DXB A;  4NL2 A;  5CKF A;  4C8Q E;  5LJ3 g;  4FYY B;  2DNU A;  4OVA A;  2JS2 A;  1YJ9 A;  2EBP A;  1YHQ Q;  2KYM A;  1MMA A;  1TH7 A;  5CK9 A;  4M75 F;  2I2L A;  5GJV B;  3RKW A;  1NEB A;  5DLO A;  1M1K C;  4C8Q B;  4X1V A;  4J83 A;  1FWZ A;  2DYB A;  2LMJ A;  3CME Q;  1KQS A;  1R0C B;  1YHQ T;  4E7J A;  4FIB A;  3CMA T;  4A4F A;  2DBM A;  2DJZ A;  1K73 U;  1VQM A;  4M7D C;  2O01 E;  4OMP A;  1RAF B;  1U3O A;  3GNG A;  3RNJ A;  1AZE A;  1WXB A;  1RAC B;  5LJ5 g;  2PVD B;  5J39 A;  3OS1 A;  1KSW A;  3VU3 C;  1VQM Q;  4LUE A;  2DE0 X;  4A4H A;  1FMV A;  2DIL A;  2L3R A;  3JRZ A;  2P4R A;  4OML A;  1NLO C;  3JV3 A;  4BE1 A;  3UAT A;  2X3W D;  1ZUY A;  2LQ8 A;  2L5Q A;  4LXC A;  3CCS Q;  5KYW A;  4QT7 A;  1YJW A;  4N4G A;  2CS7 A;  5C0M A;  3G4S Q;  1Z9Q A;  1RAH B;  3AHU A;  3H0F A;  1YIJ A;  4PFZ A;  4M7D E;  3G6E T;  5LJ5 h;  1RI9 A;  2AK5 A;  4M75 E;  4BB7 A;  1BIA A;  2CSI A;  5GAO r;  4D6W A;  2JM8 A;  3REA B;  4ZTJ A;  3FB9 A;  2NUP B;  1AOJ A;  3CME T;  2DRK A;  2FVU A;  2Y4Y A;  1WJS A;  2HQX A;  5FW9 A;  2LJ1 A;  3JCM J;  4MDX A;  1UEB A;  1P92 A;  5GAN f;  1NJI U;  4C5H A;  4C0G A;  1Y71 A;  2YLB A;  2K57 A;  4J9C A;  5GAO m;  1D0X A;  1I5O B;  1GXI E;  4C92 B;  3H0I A;  3LH0 A;  1KHI A;  2NUP A;  3HHT B;  4XU3 A;  4OMQ A;  1RAB B;  1TG0 A;  4XTY A;  4P5N A;  2ED0 A;  3L42 A;  4F7U A;  2LT4 A;  1K9A A;  4JJD A;  4M75 G;  1SEM A;  2EWN A;  1K73 C;  3LLR A;  2PQW A;  3G4S A;  2XD0 A;  3HL8 A;  2DZ9 A;  3VUZ A;  5CCA A;  3E1S A;  2ZGW A;  2C0I A;  2WAC A;  1VQ6 Q;  3EHQ A;  3CBP A;  4OB3 B;  2O4X A;  5LJ3 j;  2E41 A;  2PU9 B;  1V29 B;  2KBT A;  2XMF A;  5J3B A;  1QVF A;  1W1F A;  2DO3 A;  2GNC A;  1VQ4 A;  4M7A A;  4QQG A;  3GF5 A;  4C92 D;  2RQU A;  3CC2 T;  1D09 B;  2EQM A;  5LJ3 d;  1NPP A;  5GMK l;  1OI1 A;  2PTK A;  4QQD A;  2GQV A;  1VOM A;  2HCK A;  2QDL A;  3PFS A;  2BTT A;  1OEB A;  2K5F A;  2XIC A;  1TS9 A;  5LJ5 e;  3FEO A;  4MMK A;  5LJ5 d;  5CAI A;  1B34 A;  1TOV A;  3SB2 A;  3H9N A;  1RAG B;  2QA4 T;  5IXB A;  4JZ3 A;  1VQO Q;  1GCP A;  1YIT T;  1QVP A;  2QAZ A;  4GLM A;  4ELZ C;  5I2S A;  2CKK A;  5KCO A;  5CKE A;  3L2R A;  2LCS A;  3L2V A;  1VYU A;  1BI1 A;  2MPX C;  1K4U S;  1UHC A;  2MIO A;  1YNZ A;  1OZ2 A;  4M7A B;  1GL5 A;  1PKS A;  2E12 A;  2XID A;  4M77 F;  5GAO q;  3BFM A;  5A2Q E;  2J6F A;  2WSF E;  4M7D D;  4F14 A;  2RF0 A;  5EC7 A;  4EMK C;  2ABL A;  2QQB A;  1DJ7 B;  2VC8 A;  1QP3 A;  2DLP A;  4J8O A;  4M77 D;  3EG1 A;  3CEY A;  3OW2 S;  5FWB A;  4LDU A;  2OX7 A;  5GAM e;  2ED1 A;  3QG1 A;  1PHT A;  4JJC A;  2GQI A;  2DJQ A;  1VQO A;  1YCY A;  3SEM A;  2EQJ A;  1BK2 A;  2E5Q A;  2X9H A;  2D1X A;  2QG9 B;  1AWW A;  1YJN Q;  4M7A E;  5HK0 A;  2FYK A;  4XU0 A;  4F7U G;  2V8J A;  3MEA A;  4XU2 A;  3LGL A;  2RJC A;  4J9H A;  3FJ5 A;  3ZFJ A;  3PIO A;  2DZC A;  5CQX A;  2RHI A;  2EYQ A;  4OMO A;  4X9D A;  1OPL A;  4J7I A;  2KXC A;  2V8I A;  4JLG A;  2A3L A;  1QKW A;  4BDZ A;  3CMA A;  3QO3 A;  1PNJ A;  3U23 A;  3M4G A;  2DTH A;  4JJN K;  4RCC A;  5KYU A;  1F1B B;  1UGR B;  1K8A U;  5GAN 2;  2EGC A;  2CGH A;  1OX9 A;  1M3A A;  3R6N A;  4QVD A;  4E7Z A;  2Y4X A;  2LX7 A;  1I8F A;  2LJ3 A;  3I9Q A;  3CCS T;  2VYT A;  3OYF A;  3OA6 A;  1WIE A;  4KH1 B;  3OBY A;  2E10 A;  4CC7 A;  3SWN A;  2BIV A;  2KE9 A;  1M3B A;  1H3H A;  1I07 A;  2PVO B;  1Q81 U;  2COW A;  3VS4 A;  2O31 A;  4AFZ C;  5GAO p;  4RTT A;  3MP1 A;  2HDA A;  2DMO A;  3NPF A;  2A08 A;  1HK9 A;  5I22 A;  3OSS C;  2NUZ A;  3QYH B;  2EKH A;  5M9O A;  3HRU A;  3DLM A;  4FW2 A;  3CXC P;  2OJ2 A;  4C0D C;  5CVI A;  1QCF A;  1HJD A;  4B9X A;  3CCV T;  4J6Y A;  1QMC A;  4E6R A;  2GBQ A;  4PFO A;  2HBW A;  4CC2 A;  2LP5 A;  2P0P A;  4FT4 A;  1IB8 A;  2VVK A;  4M75 B;  1YWO A;  2LRQ A;  2VXF A;  2RJE A;  3CCS A;  4EDU A;  3NTH A;  3I5S A;  4PJN A;  1SF9 A;  5CO7 A;  2RI2 A;  2F2W A;  4J9I A;  2JMA A;  4ANJ A;  3CCJ Q;  4TVR A;  4M7D A;  4OB0 B;  3L1A A;  1QP2 A;  4M78 G;  1TUC A;  1Q81 R;  1KC8 C;  1KD1 R;  3CPF A;  1OX8 A;  1UUE A;  1VQP Q;  3HKS A;  4IUT A;  3CQT A;  3VYG A;  2FB7 A;  3I55 A;  3JB9 H;  1HD3 A;  2OI3 A;  4FM4 B;  1WHJ A;  2R58 A;  1S72 A;  2QK0 A;  3CXC A;  4DQ2 A;  2E70 A;  3DB3 A;  3PTA A;  2EQK A;  1UDL A;  1BI2 A;  2CZ7 B;  3NFC A;  3H8Z A;  2EAY A;  4L6V 5;  4A54 A;  3BDL A;  3OS5 A;  4HCZ A;  1MHN A;  1VQN A;  4F04 B;  3G71 T;  2PVG B;  4C8Q C;  2ZPE B;  2RQV A;  1MND A;  3UDC A;  1Q86 R;  4PKC C;  2RK2 A;  5KYX A;  4N4I A;  2L3P A;  3A1P A;  2VGM A;  1VQP A;  1I4K 1;  1WJR A;  5I11 A;  2AKL A;  3CCE A;  2ECZ A;  1VQL T;  1SSF A;  3MJX A;  2QEX T;  3QII A;  1D1A A;  1MMD A;  4RTW A;  2HZY A;  3OYL A;  1X69 A;  3OS2 A;  3EGU A;  4EMH A;  1X27 A;  3M55 A;  4XTV A;  4N4H A;  4A63 B;  3QHS A;  3V8J A;  2JMC A;  2C0O A;  3QJY A;  4KUI A;  1N9S A;  3G1J A;  4XTX A;  1KHC A;  4FSX A;  2DX1 A;  2K7A A;  1SHG A;  3OMC A;  1R0B G;  1VIE A;  3NTI A;  3CBO A;  4WF2 A;  3SHW A;  2ZPF B;  3PVL A;  2GGR A;  3OYN A;  2R5M A;  1G3Y A;  1SRM A;  2O9S A;  2RB6 A;  3QPH A;  3QZ9 B;  2ESW A;  1GFD A;  4LNP A;  3UF4 A;  1VA7 A;  2PUK B;  2Z0W A;  2F5T X;  4FYX B;  1NE8 A;  1KC8 R;  3NTK A;  2K4Y A;  4RTU A;  3FRN A;  5IH2 A;  3G7Z A;  3EG3 A;  2EJG A;  1M8V A;  2X4X A;  5GJW B;  3RUX A;  2EQU A;  3M0T A;  2KXD A;  4MML A;  4QKU A;  1RAI B;  2XKO C;  3I5R A;  1TWB A;  4QVC A;  2DL8 A;  2D6F A;  1Y96 B;  3E19 A;  3N5B B;  1M8M A;  3PT9 A;  2KDS A;  2OAW A;  3A98 A;  3DKM A;  4PFP A;  4Z02 A;  1BI3 A;  1LJO A;  2CUD A;  2E5K A;  1G2B A;  3G71 Q;  1M1K R;  2CYZ B;  3MET A;  5KYW B;  1IRE B;  2QQA A;  1ABQ A;  3INZ A;  4D8K A;  5C6S A;  2MK5 A;  1Q86 C;  1X75 C;  3M0Q A;  1I81 A;  2CP3 A;  1VUB A;  2KR3 A;  2L8D A;  1ZLM A;  2CH4 A;  2G3R A;  2GCX A;  3FC3 A;  7AT1 B;  1Q82 C;  1VQ7 Q;  2MYS A;  1T3S A;  1KG1 A;  3KFV A;  4DEX A;  3AT1 B;  3JCM h;  1B7T A;  3REB B;  4CC4 B;  2LNH B;  2RI3 A;  3MEV A;  1G5V A;  2KYB A;  1Q7Y R;  3JAM E;  1WHK A;  4KH0 B;  3CC4 Q;  1GRI A;  4LD6 A;  3IQL A;  2QDY B;  3VS1 A;  3BY7 A;  2KT8 A;  3CCM T;  1XJW B;  4IUQ A;  1S72 Q;  1X01 A;  4PJL A;  3CCM Q;  1K76 A;  2IIM A;  2B86 A;  3CC4 A;  2XU8 A;  2ZPB B;  3CC7 A;  4C5E A;  2XK0 A;  2CT3 A;  1RLP C;  2XDP A;  2DL4 A;  2NUT B;  2CDT A;  3GNF B;  3VRZ A;  3A8O B;  1S72 T;  2CZ6 B;  3F70 A;  4JDS A;  2RHZ A;  3C0C A;  1G8X A;  5FU6 C;  4C92 G;  4BUG A;  4J9G A;  1RL2 A;  1UJY A;  3OY9 A;  3RKY A;  2ZPI B;  3PVQ A;  2JJ9 A;  1QVF P;  3QJ6 A;  2M0Y A;  4IIO A;  3A8G B;  2NWM A;  4J6X A;  1U1S A;  5HCK A;  1VQL Q;  2NUT A;  4C92 A;  3EFO A;  1WLP B;  1O75 A;  5CKB A;  3QWX X;  5IHN A;  5IT9 E;  1VQ8 Q;  2COZ A;  1BKB A;  1VQK Q;  5GAN 3;  3M5A A;  3CD6 T;  2KRO A;  2FHD A;  3RMQ A;  3CCL A;  1AEY A;  2YRV A;  4YTL A;  1QCO A;  4M75 D;  2DYI A;  3JB9 D;  3GP8 A;  2RNA A;  5FU6 B;  1VQK A;  3I55 Q;  1WZO A;  1K9M R;  2XHC A;  3PNW C;  1N8R C;  5GAN d;  1UEC A;  4RG8 A;  2AZS A;  2X3X D;  3TCJ A;  2RD1 A;  2DVE A;  3GLX A;  2KNB B;  4EMK B;  3JCM Q;  2YUP A;  5FRO A;  2F1L A;  1W70 A;  1LVK A;  1HXD A;  4FYW B;  3PIP A;  4E47 A;  4RTV A;  3RES A;  2LNV A;  2SEM A;  4C0F A;  1SPK A;  5GAN 7;  1QWE A;  1QLY A;  2F5K A;  3OYI A;  4AG1 C;  3PGG A;  1CKB A;  1VQ7 T;  3E9F A;  4E2F B;  2PNI A;  1OZ3 A;  1JBM A;  5KYX B;  3HSB A;  4FYV B;  1KJW A;  1U8R A;  1VYT A;  4RG2 A;  2W0Z A;  2E6N A;  1QQJ A;  1A0N B;  1M3C A;  1JB0 E;  1M2O A;  3VUB A;  2EIF A;  3CCL T;  1NZ9 A;  1Q81 C;  3L2U A;  4J5Y A;  3VS0 A;  2KEA A;  3C12 A;  5DLQ E;  1W2B P;  3OYM A;  1BCO A;  5FRN A;  4PJO B;  5L8R E;  4M78 B;  2LDM A;  1S1N A;  3MP6 A;  4LDV A;  2RH2 A;  2DL3 A;  1XOV A;  1YI2 Q;  4OGC A;  2YXY A;  2KY9 A;  2X4W A;  4X9C A;  2HEQ A;  4R55 A;  4KT0 E;  2F2V A;  4F7U B;  1LCK A;  1WX6 A;  4RCB A;  4DBQ A;  3CXC S;  4E7L A;  2A7Y A;  2V26 A;  1WHG A;  1K9M C;  1M90 U;  5GMK i;  4ZNX A;  1AWJ A;  1KD1 C;  3E9G A;  4CI0 C;  3CCQ Q;  5IXF A;  4PJO A;  1R77 A;  4ESR A;  4M78 F;  1UE9 A;  3GOX A;  2DXT A;  5HKC A;  5GAN 4;  4DOW A;  1WNL A;  2VGN A;  2RMO A;  1TXQ A;  1FX7 A;  4GLK A;  3G6E A;  1YIJ Q;  1BCM A;  1VQN Q;  4JUV A;  3OW2 A;  2YRD A;  1PRL C;  4ORZ A;  1FMW A;  1V1C A;  2ZPH B;  2RHY A;  2HL5 C;  1VQ9 Q;  3GIB A;  2KT1 A;  1U1T A;  3G6E Q;  2D9T A;  1N8R R;  2QQR A;  4NOY A;  3OYD A;  2BZX A;  2JS0 A;  4BDY A;  1M1F A;  1K8A R;  1GFC A;  4RKU E;  2K79 A;  3TVT A;  1M2V B;  2OTJ A;  3A8H B;  2YUN A;  3URG A;  5D7U A;  2AIR B;  1M5Q 1;  4IUP A;  1ZBJ A;  1AZG B;  2CRE A;  1N9R A;  2C0T A;  3FDR A;  2BZ8 A;  5KH6 A;  2XDD A;  1D0Y A;  2DPP B;  2OTJ Q;  2DK3 A;  4WTO B;  2LQW A;  2QYZ A;  3JCM d;  3M0R A;  1W2B A;  2M1H A;  1C1A A;  3ME9 A;  3X28 B;  4HT9 A;  1NG2 A;  2GTO A;  1X43 A;  2DEQ A;  2JTE A;  4RMO A;  2DBK A;  3NMZ C;  3V7C A;  1YCS B;  1ZHI A;  1M2V A;  3OW2 P;  2KRM A;  2MMP A;  2E64 A;  4OMN A;  3MEW A;  2JTF A;  3UT1 A;  4R0K A;  3OYK A;  1K1Z A;  4J9B A;  3VS2 A;  2ZAE A;  3X24 B;  1NEG A;  3M0P A;  2CZ1 B;  2DD5 A;  2FL7 A;  1M1G A;  1TUD A;  2EGA A;  1Y07 A;  4ME7 A;  5GAM j;  5GMK e;  2O2O A;  2RI5 A;  1U5S A;  5GAM f;  4BE0 A;  3MCA B;  2O88 A;  1YWP A;  1CSK A;  3JCM V;  4JRK A;  1YJN A;  4GY5 A;  2QA4 A;  3M59 A;  2DVJ A;  1Y0M A;  2BE7 D;  3X25 B;  2DXC A;  4KUL A;  1Q95 G;  4AMC A;  1O9S A;  1T0J A;  4XTU A;  2VUB A;  1YI2 T;  3JCM X;  5CIU A;  4ZN1 A;  3WXM B;  3C4S A;  2C06 A;  1UG1 A;  2W10 A;  3VS6 A;  2BE9 B;  3PMI A;  4AFU C;  4JS5 A;  2BZY A;  1XNI A;  1YP5 A;  2RM4 A;  1BU1 A;  4Q5W A;  1IRX A;  4OB1 B;  4JJB A;  1Q82 U;  3TRE A;  2DTI A;  1YIJ T;  1QVG S;  4RTX A;  3M0U A;  4BAC A;  3Q1J A;  3M4Y A;  4LN2 A;  3QYG B;  1PD0 A;  4C0Z A;  2ZCF B;  3HRS A;  1Q7Y U;  3OSV A;  3KBG A;  1X6G A;  5GAN 6;  2FPE A;  3OS0 A;  2LC4 A;  3H6Z A;  3OYB A;  2MWP A;  4LDW A;  5I2M A;  4KRT A;  3OMG A;  5D6W A;  1X6B A;  2ENM A;  3EG9 A;  5GAN g;  3EGX B;  3VS5 A;  2NLU A;  2DA9 A;  3EFO B;  4OP0 A;  1ZA1 B;  1WJQ A;  1NM7 A;  5LJ5 j;  3I56 A;  2LQN A;  1ZUU A;  2COY A;  3QKJ A;  3FLG A;  4Z8A A;  4DBR A;  4DBH A;  1OOT A;  5DM7 R;  3A8M B;  4R56 A;  1ABO A;  1EIF A;  4BY6 B;  1VQ5 Q;  2JNG A;  1VQ5 T;  1M1K U;  1U06 A;  2R5A A;  1UTI A;  2R57 A;  1WHM A;  4M75 A;  2HQE A;  1W6X A;  1LPL A;  5FLX E;  5GAM g;  3JSC A;  5AYF A;  4KGZ B;  3EAE A;  5LJ5 f;  1ZQ1 A;  2E65 A;  3EHR A;  4RTZ A;  2V1Q A;  3VKI A;  1GCQ A;  3TSZ A;  1UB4 A;  3L2Z A;  1SHF A;  2LTO A;  1N6A A;  3OYH A;  4M7A D;  3LYI A;  2LZ6 B;  3M54 A;  2CP7 A;  2D0N A;  2RHU A;  3M56 A;  4C92 C;  1MV3 A;  2DM1 A;  2YUO A;  4M77 G;  2EVR A;  4M77 C;  3MP8 A;  1ZSZ B;  3EFS A;  1AWX A;  4PJO D;  2E3H A;  4J9E A;  2JXB A;  1YIT Q;  4O5V A;  1QVG P;  3VRY A;  1WFW A;  3RBB B;  2WSE E;  4C92 F;  2XG8 D;  4HT8 A;  2FZC B;  2KRS A;  5L23 A;  4KUD K;  4M78 A;  4C0D B;  2OTJ T;  4AG2 C;  4RTY A;  2L3Q A;  5KE3 A;  2EYZ A;  5KYY B;  2KI7 A;  3BDU A;  1XTD A;  1H64 1;  3CC7 Q;  2RA2 A;  4M75 C;  1WXU A;  3J80 E;  2ATC B;  1D3B B;  2K5L A;  4M77 B;  1N5Z A;  1R8O B;  5GAN j;  1ZSZ C;  5GAN e;  3I35 A;  1JXM A;  3FIF A;  4IKF A;  3V7S A;  5KYY A;  4AT1 B;  3X26 B;  2J7I A;  3SWN C;  2P0K A;  2CSQ A;  4Y92 A;  1G3T A;  3CCJ A;  5A0D A;  6AT1 B;  4ATO A;  3P8H A;  1NLP C;  4UC4 A;  2I0N A;  1QVG A;  5KCH A;  3CCE Q;  2QXF A;  2LCC A;  2OTL A;  1B07 A;  2A28 A;  4VUB A;  3I56 Q;  4EPC A;  1OQK A;  4MZT A;  1W4S A;  3DLL A;  2DFU A;  3HPW A;  4MZP A;  3I55 T;  3MKD A;  1BIB A;  2QA4 Q;  1VQO T;  3CME A;  4D8D A;  2X35 A;  1NBE B;  2E4H A;  1XQH A;  2E6Z A;  4PJO F;  5GAM d;  4N0A C;  1JJ2 P;  3MEU A;  3OYJ A;  1WDX A;  1YJN T;  2QTV A;  2FZK B;  1HSQ A;  4BY6 C;  2RN8 A;  5EG2 A;  3H41 A;  2QGG A;  3EGD B;  2DIQ A;  1GBR A;  3RMS A;  5GAO n;  4F7U F;  2DIG A;  3QXE B;  2FRW A;  1YI2 A;  3CCR Q;  1WPY A;  1H92 A;  3M58 A;  3G4S T;  4XTW A;  4PNO A;  4HVV A;  2YDL A;  4Y28 E;  3CPW S;  5IN1 A;  1QWF A;  1V76 A;  2EYW A;  4L5G A;  5GAO l;  2IG0 A;  5CQY A;  2OTL Q;  4ZTF A;  1YJW Q;  2DKG A;  1EX4 A;  4RUG A;  1VQ9 T;  2KQW A;  3MHX A;  2X4J A;  3O5Z A;  1AWO A;  1VQ4 T;  3SD4 A;  4BI4 A;  5FU7 C;  1JO8 A;  4J9D A;  3CC2 A;  2OTL T;  2M02 A;  1ZSZ A;  4EMK A;  3JB9 I;  2BUD A;  1D1C A;  1B34 B;  1TSF A;  4PJO G;  2L2P A;  3JCM e;  1QW1 A;  3OYY A;  3UWN A;  4OMM A;  1PSE A;  3GPL A;  2AKK A;  3ZL7 C;  3V8K A;  2RJF A;  3I56 T;  3QDR B;  1VIF A;  4X34 A;  2J06 A;  1X6O A;  4C5G A;  4FT2 A;  2L3S A;  3ER0 A;  2IPO B;  2CP0 A;  4XU1 A;  3EG9 B;  1OU9 A;  1BB9 A;  1H8K A;  5KE2 A;  3SFM A;  1C6V X;  4XK8 E;  3ASK A;  5GMK h;  3JCM P;  1KK7 A;  1PCX A;  2QQS A;  5GMK m;  1N8R U;  1OV3 A;  2A37 A;  4PJJ A;  3JCM g;  4DEY A;  3CCU T;  2XI9 A;  3CCV A;  1JJ2 S;  2HMA A;  3VS3 A;  1VQ9 A;  4M78 E;  1D0Z A;  2A36 A;  3QWY A;  4HVW A;  2EYY A;  1RLQ C;  2H3E B;  1MV0 B;  2DET A;  5LL6 S;  4OF1 A;  1PWT A;  3TSW A;  1MMN A;  2EJF A;  2H8H A;  4LE9 A;  4IUU A;  3J81 E;  3WVD B;  4MDW A;  1PRM C;  1ZBX A;  3HFN A;  5KYN A;  1IGU A;  2RO0 A;  4FL6 A;  1WA7 A;  4JRP A;  4JPB W;  2PZ1 A;  3VS7 A;  3LW5 E;  3P8D A;  2KVQ G;  1Q82 R;  4XQ3 A;  1AVZ C;  1E7O A;  3G71 A;  2LQK A;  2HD0 A;  4A4K A;  3GBQ A;  5KYU B;  3P8B B;  1MGQ A;  3EH2 A;  1RAE B;  5LJ3 h;  1TUG B;  1KQS S;  1Y7X A;  3RIR A;  4CRI A;  4ZGE B;  3LGF A;  2JZ2 A;  3JCM c;  4DBF A;  3L2Q A;  4PK4 A;  2OAU A;  2ZZD A;  2KK4 A; 
#chains in the Genus database with same CATH homology
 1G3W A;  4C8Q F;  2Y90 A;  2LVM A;  2MMP A;  2E64 A;  3VV0 A;  1VQN T;  2RK2 A;  3MEW A;  2JTF A;  3JCM f;  3UT1 A;  5GAM h;  3CCE T;  4M7D B;  3OYK A;  3QSU A;  1VQL A;  2K5I A;  4N4I A;  2QEX A;  2VGM A;  2JOY A;  4C8Q G;  4A53 A;  1VQP A;  3X24 B;  1I4K 1;  1WJR A;  3HP9 A;  4C92 E;  2BKD N;  1YJW T;  2P0Q A;  4LDX A;  2CZ1 B;  4XTZ A;  3V7R A;  2DD5 A;  3R6O A;  2FL7 A;  1VQ8 T;  1M1G A;  3C95 A;  3CCE A;  1K9M U;  1Y07 A;  1VQL T;  1M9S A;  1SSF A;  2LX9 A;  4LDY A;  3QII A;  2DXB A;  4ME7 A;  4NL2 A;  5CKF A;  1KQ1 A;  5GMK e;  5GAM j;  4C8Q E;  1VQP T;  2RI5 A;  2E1H A;  5LJ3 g;  5GAM f;  4BE0 A;  4OVA A;  3MCA B;  3CCJ T;  1LNX A;  1YJ9 A;  2XDB A;  2EKO A;  5D6Y A;  1TH7 A;  3V8L A;  5CK9 A;  3OYL A;  4M75 F;  2I2L A;  3RKW A;  4BE2 A;  3M9Q A;  3JCM V;  4JRK A;  3OS2 A;  1YJN A;  2KMT A;  5DLO A;  4EMH A;  1M1K C;  2HBP A;  4C8Q B;  3M55 A;  2O4X B;  4GY5 A;  4XTV A;  4J83 A;  2LCL A;  4QW2 A;  4A4E A;  1FWZ A;  3M59 A;  5I21 A;  3CC4 T;  4N4H A;  2QA4 A;  1KQS A;  3A5Z B;  3QHS A;  5D6X A;  3X25 B;  2DXC A;  1YHQ T;  4KUL A;  3V8J A;  4ZN3 A;  4E7J A;  1O9S A;  4FIB A;  4XTU A;  3CMA T;  2VUB A;  4KUI A;  3QJY A;  4A4F A;  1N9S A;  2DJZ A;  3JCM X;  3UPU A;  5CIU A;  1YI2 T;  4ZN1 A;  1VQM A;  2O01 E;  1K73 U;  3WXM B;  3C4S A;  4XTX A;  1KHC A;  4FSX A;  2C06 A;  4OB2 B;  4DOV A;  4M7A C;  4LD9 K;  3GNG A;  1OYX A;  3OMC A;  3PMI A;  2M16 A;  1VQ6 T;  4JS5 A;  3C94 A;  1VIE A;  3NTI A;  3HFO A;  2IVW A;  1XNI A;  3CBO A;  3JCM b;  5LJ5 g;  2PVD B;  4WF2 A;  5J39 A;  4O6J A;  2ZPF B;  3OS1 A;  4BD3 A;  2DAQ A;  2RM4 A;  4Q5W A;  3VU3 C;  3OYN A;  2R5M A;  1G3Y A;  3S3M A;  4OB1 B;  4QQ6 A;  1M90 C;  2RB6 A;  1Q82 U;  3QPH A;  3TRE A;  4NL3 A;  4A4H A;  3QZ9 B;  2GFU A;  2L3R A;  2DTI A;  1YIJ T;  3JRZ A;  1QVG S;  4BAC A;  3Q1J A;  3M4Y A;  3QYG B;  2PUK B;  4BE1 A;  3BW1 A;  4C0Z A;  2LQ8 A;  2ZCF B;  2K3Y A;  2L5Q A;  3HRS A;  1Q7Y U;  2F5T X;  4MZM A;  4JRQ A;  3OSV A;  3KBG A;  5GAN h;  1YJW A;  1NE8 A;  2CS7 A;  4N4G A;  5C0M A;  3L2W A;  2YLC A;  4NS5 A;  5GAN 6;  1KD1 U;  3OS0 A;  3AHU A;  2D0Q B;  1YIJ A;  2LC4 A;  1VQ8 A;  3H6Z A;  4M7D E;  3G6E T;  3OYB A;  2MWP A;  3NTK A;  2K4Y A;  4LDW A;  5I2M A;  3VJP A;  3A8L B;  5LJ5 h;  3FRN A;  2JVV A;  3OMG A;  5D6W A;  4M75 E;  3G7Z A;  4BB7 A;  2EJG A;  1M8V A;  1BIA A;  2X4X A;  2ZPG B;  5GAN g;  5GAO r;  3RUX A;  2EQU A;  4D6W A;  2NLU A;  4OP0 A;  4MML A;  1WJQ A;  5LJ5 j;  3I56 A;  4ZTJ A;  4M7D G;  3FB9 A;  3OYE A;  1VQK T;  2XKO C;  4QVC A;  3JCM W;  3QKJ A;  5GMK j;  4OMF B;  3CME T;  2FVU A;  2Y4Y A;  3FLG A;  3QUI A;  1WJS A;  2HQX A;  4M7D F;  5DM7 R;  3A8M B;  2H3J A;  1UEB A;  1Y96 B;  1P92 A;  5GAN f;  3E19 A;  3JCM J;  1NJI U;  2D6F A;  2F69 A;  4C5H A;  3N5B B;  4C0G A;  4R56 A;  1Y71 A;  1EIF A;  2YLB A;  2K57 A;  3M53 A;  4BY6 B;  3PT9 A;  5GAO m;  2KDS A;  2JNG A;  2LT1 A;  3RER A;  4F7U E;  1VQ5 T;  1GXI E;  4C92 B;  1M1K U;  3LH0 A;  1KHI A;  3DKM A;  3HHT B;  4XU3 A;  4Z02 A;  1BI3 A;  1LJO A;  4XTY A;  4P5N A;  3L42 A;  2R5A A;  2LT4 A;  4F7U A;  1VQ6 A;  2CYZ B;  1BI0 A;  2KAF A;  3QZ5 B;  3MET A;  5GAN 8;  4M75 G;  1IRE B;  2R57 A;  2EWN A;  2QQA A;  1K73 C;  3LLR A;  3INZ A;  2PQW A;  3G4S A;  2XD0 A;  4M75 A;  3HL8 A;  2HQE A;  1UGS B;  5C6S A;  4DA4 A;  2DZ9 A;  4J7F A;  1VQ7 A;  1Q86 C;  2VV5 A;  3VUZ A;  5FLX E;  5CCA A;  3E1S A;  5GAM g;  2GF7 A;  2ZGW A;  1FXX A;  2WAC A;  3JSC A;  1X75 C;  5AYF A;  4JS4 A;  3CBP A;  4OB3 B;  2O4X A;  3CCQ T;  1I81 A;  3EAE A;  5LJ3 j;  2E41 A;  2JTM A;  2L89 A;  3S6W A;  2PU9 B;  5LJ3 e;  5LJ5 f;  4M7D C;  1V29 B;  1ZQ1 A;  4OGE A;  1VUB A;  2E65 A;  3QBY A;  2L8D A;  3VKI A;  2GCX A;  2G3R A;  4B9W A;  1UB4 A;  3FC3 A;  3L2Z A;  1Q82 C;  5J3B A;  1QVF A;  2EJ9 A;  2DO3 A;  2LTO A;  1N6A A;  3MO8 A;  1VQ4 A;  3OYH A;  4M7A D;  4M7A A;  3LYI A;  1KG1 A;  4QQG A;  5CKH A;  3GF5 A;  4C92 D;  3CC2 T;  1UGP B;  3M54 A;  2EQM A;  5LJ3 d;  3JCM h;  1JJ2 A;  3JB9 F;  5CR2 A;  3CCU A;  2RHU A;  3M56 A;  4C92 C;  1NPP A;  2RI3 A;  3MEV A;  4C8Q A;  3LWH A;  4EMG A;  5GMK l;  1BYM A;  1G5V A;  1OI1 A;  3JAM E;  4QQD A;  2GQV A;  3CCM A;  4M77 G;  4PJO C;  3PFS A;  4M77 C;  3MP8 A;  2DD4 A;  3EFS A;  4PJO D;  2X4Y A;  2PUO B;  2K5F A;  4LD6 A;  4O5V A;  2QDY B;  1RI0 A;  2XIC A;  2WSE E;  3T9N A;  3BY7 A;  3J7A F;  5LJ3 f;  4HCB A;  4C92 F;  5LJ5 e;  3CCM T;  1N27 A;  3FEO A;  4IUQ A;  2XG8 D;  4MMK A;  5LJ5 d;  4HT8 A;  1X01 A;  5CAI A;  2YHT A;  1B34 A;  3SB2 A;  3ZEH A;  2QA4 T;  1PSF A;  3CC4 A;  4KUD K;  2XU8 A;  4M77 A;  3LWI A;  2ZPB B;  1QVP A;  1WQW A;  5I2S A;  4C5E A;  2XK0 A;  4M78 A;  4C0D B;  4ELZ C;  2CKK A;  3CC7 A;  2OTJ T;  5KCO A;  2HNI A;  5CKE A;  4C5I A;  3CCR T;  2XDP A;  5KE3 A;  3L2R A;  3L2V A;  2JUF A;  3GNF B;  3A8O B;  1S72 T;  2CZ6 B;  1BI1 A;  3JB9 J;  3BDU A;  3F70 A;  4JDS A;  2RHZ A;  1OZ2 A;  5FU6 C;  4C92 G;  4BUG A;  1RL2 A;  1XTD A;  4M7A B;  1H64 1;  2E12 A;  3OY9 A;  2XID A;  2RA2 A;  4M77 F;  4M75 C;  3RKY A;  1LOJ A;  5GAO q;  2ZPI B;  3BFM A;  2QI2 A;  3J80 E;  3CCQ A;  2HAX A;  1D3B B;  1K8A C;  2K5L A;  4M77 B;  3QJ6 A;  1R8O B;  1YIT T;  5A2Q E;  4PL6 A;  2DXU A;  2WSF E;  5GAN j;  5GAN e;  2CZ0 B;  3FIF A;  4IKF A;  4M7D D;  3A8G B;  4J6X A;  1U1S A;  2M0O A;  4JLI A;  2AHJ B;  3V7S A;  2RHX A;  3X26 B;  3KXT A;  4XAX B;  4C92 A;  4ELY C;  2P0K A;  4QVZ A;  3SWN C;  1O75 A;  2M9U A;  2QQB A;  5CKB A;  1DJ7 B;  4EMK C;  1W2B S;  1KC8 U;  2VC8 A;  1G3T A;  1I5L A;  1QP3 A;  3CCJ A;  1YJ9 T;  2RJD A;  4J8O A;  5A0D A;  4M77 D;  4ATO A;  5IT9 E;  3P8H A;  3CEY A;  4KBM B;  3OW2 S;  1BKB A;  4UC4 A;  4LDU A;  5GAM e;  5GAN 3;  3M5A A;  3QG1 A;  1QVG A;  3CD6 T;  3RMQ A;  2FHD A;  5KCH A;  2MAM A;  2RK1 A;  1VQO A;  1YCY A;  3CCL A;  2EQJ A;  2QXF A;  2LCC A;  2YRV A;  4HA8 A;  2OTL A;  2E5Q A;  4YTL A;  3OYA A;  1Q7Y C;  4M7A F;  4ZGJ B;  2QQ9 A;  4VUB A;  4M75 D;  4EPC A;  3JB9 D;  4MZT A;  3GP8 A;  1W4S A;  4FU6 A;  5FU6 B;  5DY9 A;  3DLL A;  4M7A E;  5HK0 A;  1D3B A;  2B8A A;  2FYK A;  3HPW A;  4MZP A;  3I55 T;  1VQK A;  4XU0 A;  1IZ6 A;  3OB9 A;  4F7U G;  2V8J A;  1BIB A;  1VQO T;  3MEA A;  4XU2 A;  3LGL A;  1M4Z A;  3CME A;  2RJC A;  3ZFJ A;  2XHC A;  4L59 A;  3PIO A;  3PNW C;  2X35 A;  5GAN 5;  1N8R C;  2DZC A;  5GAN d;  3TEE A;  1XQH A;  2E6Z A;  4PJO F;  5CQX A;  3DB4 A;  4RG8 A;  3ZBD A;  3TCJ A;  2RHI A;  5GAM d;  2EYQ A;  4N0A C;  5FU7 B;  3MEU A;  3OYJ A;  3CCR A;  4X9D A;  1YJN T;  2RD1 A;  2DVE A;  3JB9 G;  4BI3 A;  3GLX A;  4BY6 C;  5EG2 A;  3SWN B;  4EMK B;  3JCM Q;  4HCC A;  4J7I A;  2P4T A;  2V8I A;  3VYH B;  5FRO A;  4JLG A;  2A3L A;  2DIQ A;  5A0L A;  3RMS A;  5J26 A;  5GAO n;  1HXD A;  4V2S A;  4F7U F;  2DIG A;  4BDZ A;  1Q86 U;  3PIP A;  3QXE B;  3CMA A;  4E47 A;  3QO3 A;  1G3S A;  1YI2 A;  3RES A;  4C0F A;  2LNV A;  3M4G A;  3TU4 K;  2DTH A;  5GAN 7;  4JJN K;  1WPY A;  4M77 E;  3M58 A;  5HK3 A;  3G4S T;  1KQ2 A;  1JRI A;  4HKE A;  4PNO A;  4XTW A;  4RCC A;  4M7A G;  1UGR B;  1K8A U;  2F5K A;  3OYI A;  4Y28 E;  5GAN 2;  2CGH A;  3PGG A;  3CPW S;  1VQ7 T;  3E9F A;  5IN1 A;  3S3O A;  4L5G A;  5GAO l;  2IG0 A;  5CQY A;  1OZ3 A;  4QVD A;  4ZTF A;  1JBM A;  2Y4X A;  2DKG A;  3HSB A;  3S3N A;  1I8F A;  3CCS T;  2VXE A;  1VQ9 T;  1U8R A;  2VYT A;  2KQW A;  3MHX A;  3OBW A;  4RG2 A;  3OYF A;  2E6N A;  2X4J A;  3OA6 A;  1VQ4 T;  3SD4 A;  4BI4 A;  5FU7 C;  1QVF S;  1JB0 E;  5HY6 A;  3VUB A;  3CC2 A;  2EIF A;  3OBY A;  3CCL T;  1NZ9 A;  2OTL T;  2E10 A;  5FRM A;  1WQ7 A;  1Q81 C;  3SWN A;  4EMK A;  3JB9 I;  2BIV A;  3L2U A;  4J5Y A;  2BUD A;  4E7I A;  1Y96 A;  3C12 A;  5DLQ E;  1B34 B;  4PJO G;  3OYM A;  2PVO B;  3O8V A;  1Q81 U;  5FRN A;  3JCM e;  5GAO p;  4PJO B;  1QW1 A;  3OYY A;  3MP1 A;  5L8R E;  4M78 B;  3UWN A;  2LDM A;  1PSE A;  3MP6 A;  4LDV A;  4C8Q D;  3GPL A;  2RH2 A;  3V8K A;  2RJF A;  1XOV A;  3I56 T;  3QDR B;  1VIF A;  4OGC A;  4X34 A;  2KY9 A;  1X6O A;  2X4W A;  4X9C A;  4R55 A;  1HK9 A;  4KT0 E;  4C5G A;  3CBM A;  3OSS C;  4MDX A;  4FT2 A;  4IUV A;  4F7U B;  3QYH B;  4M78 D;  3ER0 A;  4RCB A;  5M9O A;  4E7L A;  3CXC S;  3HRU A;  2K3X A;  2A7Y A;  3DLM A;  3CC7 T;  3CPW A;  4ZGD B;  2JN0 A;  1UGQ B;  4XU1 A;  4C0D C;  5CVI A;  1K9M C;  1M90 U;  3OYG A;  5GMK i;  5KE2 A;  3SFM A;  1YBY A;  4B9X A;  4XK8 E;  3CCV T;  3ASK A;  4J6Y A;  4BI8 B;  5GMK h;  1KD1 C;  3JCM P;  3E9G A;  4Y91 A;  4CI0 C;  2QQS A;  2WSC E;  5GMK m;  2K2V A;  1H3Z A;  4PLL A;  1N8R U;  3OYC A;  4PJO A;  2P0P A;  4FT4 A;  2QTX A;  4M78 F;  2EFI A;  4M75 B;  3GOX A;  2DXT A;  3FJP A;  5HKC A;  2LRQ A;  3JCM g;  5GAN 4;  3M57 A;  2VXF A;  4DOW A;  3CCU T;  2XI9 A;  2RJE A;  1WNL A;  3CCS A;  3CCV A;  4EDU A;  3NTH A;  1JJ2 S;  2VGN A;  1VQ9 A;  4M78 C;  4M78 E;  5CO7 A;  4JRI A;  4II1 A;  1FX7 A;  2MWO A;  2RI2 A;  4GLK A;  3SDZ A;  3G6E A;  3EFR A;  4JUV A;  3OW2 A;  5A0G A;  4J6W A;  5LL6 S;  3X20 B;  4OF1 A;  1NPR A;  4TVR A;  4M7D A;  2ZPH B;  4OB0 B;  3L1A A;  3WVE B;  2RHY A;  1QP2 A;  2EJF A;  4M78 G;  4E7H A;  2MF2 A;  4IUU A;  3J81 E;  3GIB A;  3WVD B;  3CD6 A;  1U1T A;  2D9T A;  2QQR A;  1NJI C;  4IUR A;  4MDW A;  4NOY A;  3OYD A;  1KC8 C;  1ZBX A;  3CPF A;  4BDY A;  3HFN A;  1M1F A;  2DTO A;  3HKS A;  4IUT A;  2RO0 A;  3HRT A;  4RKU E;  4FL6 A;  1YIT A;  2QEX T;  4JRP A;  2OTJ A;  3VYG A;  2FB7 A;  3A8H B;  3I55 A;  3JB9 H;  4PJO E;  3URG A;  4FM4 B;  3LW5 E;  3P8D A;  2R58 A;  1VQ5 A;  1M5Q 1;  4IUP A;  1S72 A;  2KVQ G;  2KSS A;  1N9R A;  3CXC A;  3LX7 A;  5IAY A;  3FDR A;  4XQ3 A;  2V8K A;  3RKX A;  5KH6 A;  4DQ2 A;  2E70 A;  4PLI A;  1YHQ A;  3DB3 A;  2XDD A;  3PMT A;  4A4G A;  3PTA A;  3G71 A;  2DPP B;  2LQK A;  2HD0 A;  2DK3 A;  2EQK A;  4A4K A;  1VQM T;  3P8B B;  1MGQ A;  2MI6 A;  1BI2 A;  2CZ7 B;  4E7K A;  3NFC A;  5LJ3 h;  3H8Z A;  3JCM d;  1W2B A;  1KQS S;  2EAY A;  1Y7X A;  4L6V 5;  4A54 A;  3BDL A;  2M1H A;  3KUF A;  3OS5 A;  4HCZ A;  3RIR A;  3ME9 A;  1MHN A;  1VQN A;  4CRI A;  4N0A A;  4ZGE B;  3LGF A;  3X28 B;  4HT9 A;  3G71 T;  2JZ2 A;  3JCM c;  2PVG B;  4C8Q C;  2ZPE B;  5CKD A;  3UDC A;  2DEQ A;  2GFA A;  4RMO A;  3OQ5 A;  3L2Q A;  2OAU A;  1AHJ B;  3V7C A;  2ZZD A;  4PKC C;  1ZHI A;  1WGS A;  2KK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...