1U1TA

Hfq protein from pseudomonas aeruginosa. high-salt crystals
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pseudomonas aeruginosa Hfq protein.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords Hfq protein
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u1tA00
1BIBA 4M7AF 2EJGA 2DTHA 3QHSA 4XTVA 4M7AA 5GMKl 5GAN5 5DY9A 3JCMV 4X9CA 4PJOE 1TH7A 3EFRA 2I2LA 5GAOm 5GANe 2JN0A 2RM4A 3GIBA 4JRKA 5LJ3f 4EMHA 2RD1A 2DZCA 4J5YA 4XTWA 4NL3A 1H641 5GAN2 1I8FA 3JB9J 4XU2A 5LJ3h 4EMKC 5GAN4 3JCMQ 4JLIA 3L1AA 3VU3C 5GANd 1U1TA 2CGHA 2DTOA 1WQ7A 4M77G 4PJOG 5GAMh 5GAN8 5GMKm 5CAIA 3JCMP 5GAMe 1N9SA 4PJOA 2ZGWA 5LJ5f 4M7DC 4M7DD 2EAYA 1KQ1A 4MMKA 4M75A 5GMKi 2E1HA 1MGQA 5GAMg 3RERA 1WNLA 2VXEA 3SWNA 3QSUA 3RKXA 4C92G 3BW1A 4Y91A 3M4GA 1KQ2A 4C92B 2E65A 1I5LA 4M77E 4JUVA 4XTYA 4PJOB 4RCBA 1I81A 3HSBA 3HFOA 4HT9A 1N9RA 2E10A 4F7UF 4X9DA 4M7AG 5LJ3d 4M75B 3V7RA 1B34B 4F7UB 3AHUA 3SB2A 5GANg 4C8QF 4C8QD 4C8QC 4OP0A 3JB9I 2FB7A 3JCMh 4C92E 3JCMW 3JB9G 4C92A 5LJ3j 1HK9A 4DQ2A 5GAN3 3V8LA 1LJOA 5GAOl 2Y90A 4M7AB 5GANf 2RB6A 4M77F 1X01A 3V7SA 2DZ9A 5GMKe 2QTXA 4MMLA 5GAOq 4HA8A 3QUIA 4XU3A 2EWNA 1M8VA 4M75E 5GAOn 4EMGA 3SWNC 3RUXA 4WF2A 5LJ5j 4XTUA 4M78C 4M78D 3JCMc 4J6WA 3BFMA 4PJOC 4PJOD 4A54A 1JRIA 4JRIA 4QVDA 4PNOA 2HNIA 2DTIA 3RKYA 5GAOr 1BIAA 3V7CA 3EFSA 3RIRA 1LNXA 4M75G 1YCYA 2DJZA 4F7UG 4HT8A 2VC8A 1M5Q1 1WPYA 4C8QG 5GMKj 2EJ9A 4M75F 5GMKh 4N0AC 4NL2A 4V2SA 5GAN6 1HXDA 4N0AA 3L2ZA 4PJOF 4M7AC 4M7AD 5LJ5g 3JCMg 1JBMA 4XTZA 2DVEA 4M7AE 2DEQA 2FYKA 3V8JA 3JCMe 3JCMd 2DXUA 3RESA 2YLCA 4M78F 2EJFA 3SWNB 4M7DE 3PGGA 4C8QA 1Y96B 4M78B 3QO3A 5LJ5e 4M78A 4J6YA 4M78G 4XQ3A 3HFNA 4J6XA 4XU0A 4F7UE 4QVCA 2DKGA 3JCMb 4M77B 5GAMd 4M77D 4M77C 5GANh 1U1SA 3JCMJ 5GANj 4XU1A 3FJPA 4XTXA 3FIFA 2E64A 3JB9F 2RA2A 3JCMf 1D3BA 5LJ3g 2K57A 4EMKB 2VXFA 3RKWA 4C92C 4C92D 2YHTA 4M77A 1WQWA 3V8KA 5LJ3e 5GAMj 4M75D 4M75C 4M7DG 1B34A 4F7UA 4M7DA 1LOJA 2DXTA 4C8QB 5GAN7 4M7DB 1Y96A 1I4K1 4M78E 4A53A 4C92F 5I21A 3FB9A 3JB9H 4M7DF 5LJ5d 5LJ5h 3BY7A 4C8QE 3JCMX 3INZA 3BDUA 4NOYA 2YLBA 2E41A 1D3BB 4RCCA 5GAOp 3JB9D 4EMKA 5GAMf
chains in the Genus database with same CATH superfamily
4M7AF 2MWOA 1EX4A 1MV0B 1YI2T 1UJYA 4OF1A 2OTLT 2L3QA 2LDMA 4NL3A 1VQ4Q 4PJLA 3PE0A 1I8FA 5HCKA 3VU3C 3HRTA 3JV3A 5GMKm 3OMGA 1Q82C 2KT1A 1YJ9T 1YJWA 2AKLA 1MMGA 1M1GA 2FEIA 5CKFA 3RKXA 4Y91A 2YXYA 1CKBA 4C92B 4PJOB 2YRCA 2RHYA 1N9RA 1C1AA 4OB1B 4M7AG 1OEBA 3V7RA 4C8QF 2QQBA 5A2QE 1DJ7B 3GLXA 1GRIA 5GJWB 4A4EA 2M0YA 3OYYA 3CMEQ 3MHXA 5ECAA 1ARKA 1RUWA 3QUIA 4XU3A 1KC8C 1M8VA 1RACB 2JS0A 5DLOA 3M0UA 3OY9A 3CCET 2L3SA 2K79A 3X20B 1G3YA 3I5RA 4QVDA 2H3JA 1IGQA 1ABOA 2ZPFB 3L2UA 2CP5A 1TUCA 1VQMT 2EJ9A 2RI3A 3JRZA 3OYDA 2LT4A 1PD1A 1M1KU 4FW2A 5GAN6 1Q81R 1HXDA 1QCOA 2IG0A 2RHXA 5LJ5g 3NTHA 5KE2A 2B8AA 2DEQA 3DLLA 1K1ZA 2LJ0A 2R5MA 1SPKA 1YI2Q 1JXMA 4C8QA 1Y96B 2GBQA 3QO3A 5J3BA 5CCAA 2R58A 2BIVA 4F7UE 5KYUB 3CC2Q 1NPRA 3EGXB 2LQKA 3GF5A 2RHUA 4J83A 4XU1A 2QQAA 3Q1JA 1ZHIA 3UT1A 3VJPA 1VQ8T 3CC4Q 4OMQA 4C92D 1M1KC 1PSFA 2EIFA 4LUEA 3V8KA 2RQVA 1X43A 1B34A 3M58A 2DILA 1XTDA 2COZA 3WVEB 3FB9A 4M7DF 3CC7Q 1GCQA 2DL3A 4EPCA 1Q86U 2RJCA 2EQKA 2CP2A 9ATCB 2KDSA 2D0NA 3L2RA 1VQKQ 2RQWA 3VV0A 2RHZA 5KCOA 3OYNA 4PJOA 3OA6A 2K3BA 2VGNA 4N4IA 4BDZA 4QT7A 2DD5A 2K7AA 1M2OA 3CCLA 3EH2A 2Z0WA 4BUGA 5LJ3d 3EG1A 4D8KA 3G4SA 1KQSS 2CZ7B 1H3ZA 1QKXA 2RH2A 3CPWS 5GAOl 4LDVA 1T0HA 1UE9A 3PMIA 2KT8A 2DD4A 3MEUA 3UPUA 3CBPA 1A0NB 1H8KA 1KQSP 2F2VA 1W4SA 4PNOA 2XDBA 3RIRA 3CMEA 2EYZA 2VC8A 3OYBA 1PNJA 4ZNXA 1TUDA 4IUQA 4ZGEB 1Q81C 3CCMQ 4LD9K 3P8DA 2KQWA 2FZKB 2JTMA 3WXMB 2QEXQ 1N8RR 3O8VA 1QKWA 2M16A 2ROTA 2MYSA 3QIIA 2YUOA 1OQKA 1FMVA 2JNGA 1YI2A 2K3XA 4AMCA 1VQ9Q 4M75D 2X4XA 4LDWA 4FL6A 3O5ZA 2D8HA 4E7IA 4R55A 3INZA 1W2BA 3JB9D 1D09B 3S3OA 4GY5A 3I55A 3MEVA 2OTJT 5DY9A 3I55T 1AZGB 1OULA 1X27A 5A0DA 2RD1A 4K11A 2AIRB 4X1VA 4C0DC 1K8AC 4MZPA 1M90C 1KFZA 2D6FA 2RN8A 3M53A 1QWEA 5FU7B 2YDLA 2HL5C 5GMKi 4R56A 2E1HA 2X3WD 2CKKA 3PTAA 2OX7A 3HRUA 4JJBA 1N27A 3A8MB 2WACA 2R57A 4X9DA 3H8ZA 2QQSA 1E6HA 2QXFA 1SSFA 4OP0A 2K6DA 2FB7A 4ATOA 2KSSA 1X2QA 4QVZA 2XI9A 1LJOA 2COWA 2SRCA 2DL4A 2KEAA 1K9MR 2IIMA 5CO7A 4WF2A 1OPKA 2JM9A 1IZ6A 2Y4XA 2RQTA 3KBGA 2F69A 5HY6A 3A8LB 3C0CA 1X75C 1JU5C 2HKNA 2A28A 2F2WA 2CUBA 5FWCA 3P8BB 1JBMA 3ZFJA 2GTJA 2RK2A 4J9GA 1FWZA 2M51A 1UG1A 4C0GA 2EVRA 1VIEA 5FLXE 3ASKA 2NUTB 5LJ5e 3PT9A 4A4GA 4M78G 2HMAA 3X25B 1S72Q 3ME9A 3L42A 3E19A 4OB3B 3LH5A 2HQEA 2FPEA 1BCMA 1MUZA 2ZAEA 2CSQA 1YITT 2L8DA 3OQ5A 2FZCB 2AZVA 3UA6A 5D6XA 3G7ZA 1LOJA 4P5NA 1VA7A 2NUZA 4E7ZA 3BY7A 3SEMA 2X4WA 1WHLA 1T0JA 3CCVT 3U23A 1NLPC 1SHGA 4XTVA 2HDAA 2CP0A 2L89A 3CCVA 4M7AA 4C5HA 2GCXA 2EYWA 2DF6A 3H0HA 2DNUA 2QEXA 1G3WA 1CSKA 1WA7A 3HRSA 5GAN2 2VGMA 1J3TA 5DM7R 4HCBA 1BBZA 4WTOB 3G4ST 3VYGA 5CAIA 2M02A 4JRQA 1GFCA 4IIOA 3KXTA 2ZGWA 1N5ZA 2EAYA 3CCJT 1MNEA 1VQPT 2GTOA 3PMTA 4J9FA 3QBYA 2D1XA 1I81A 3OBYA 4Y92A 1RI9A 2EQJA 4Z88A 3NMZC 3QWYA 3AHUA 1ACMB 5J26A 3F70A 5CK9A 4LXCA 3M0PA 2A0FB 2MF2A 2KRNA 4JJNK 1VQ7Q 1TWBA 4MMLA 5GAOq 1ZSGA 1YFNA 3OS2A 2DFUA 4M78C 4J6WA 1JJ2A 3BFMA 4E7LA 4A54A 3CCQT 2A36A 3PIPA 1NEGA 4AG1C 3CCJQ 1YCYA 1RLPC 1EFNA 4UC4A 1ZSZC 1N6AA 1M30A 4E7KA 5L23A 3CMAQ 4RUGA 3CC7T 2ATCB 2DE0X 1BI0A 1M90U 2YLCA 4BI3A 2EJFA 2M0OA 5IXFA 1ZQ1A 3TCJA 4ESRA 2LCSA 1RAHB 3CBMA 1VQ7A 2QTVA 4J9IA 5A0LA 4JRPA 1HJDA 3FJPA 3QYHB 4NS5A 4N4HA 3CCSQ 1D3BA 4E2FB 4EMKB 3CXCA 2OTJA 5IHNA 2FVUA 4F7UA 4M7DA 1I1JA 3OS1A 3RBBB 5I21A 1I4K1 1XQHA 3RMSA 4HCKA 1AEYA 2O4XA 2DBMA 1KSWA 1W70A 1GBRA 2LZ6B 3OB9A 2DTHA 2C0IA 2O31A 3TQ7P 1UB4A 2M1HA 5LJ3f 5KYWB 3HP9A 4DOVA 2MK5A 2EKHA 1JJ2P 1YJNA 4DBFA 2NUPA 2CGHA 1N9SA 2GNCA 2DX1A 4RTUA 4M77E 1NPPA 2LNVA 3H0FA 3CPWA 4FYWB 2E10A 5HK0A 5IT9E 1KHIA 1RABB 2W0ZA 1K73R 3NHNA 3E2UA 1QCNA 1GXIE 1AWWA 3A8OB 2V26A 1X01A 2A3LA 4Q5WA 2DZ9A 4A4KA 4VUBA 1VQOQ 4EMGA 3SWNC 3LH0A 4PFZA 1H92A 1D0ZA 2FPFA 3OYCA 1BKBA 2HNIA 2P4TA 3V7CA 1G3SA 1UUEA 4M75G 1PWTA 4C5EA 4BI8B 3D7SB 1UGSB 1WHGA 2E6NA 1IO6A 3EG0A 4AFSC 4BI4A 2RJFA 4TVRA 1WJSA 1VYVA 1YITA 3JCMd 2DXUA 4HVUA 4M78F 3QYGB 1VQLQ 2V8KA 4ZN3A 3A5ZB 2NWMA 3E9GA 1NJIR 1YJWQ 3CXCS 3FC3A 3PIOA 4JPBW 3C12A 3CQTA 3GNGA 3CCMT 3H0IA 1VQNT 1Y7XA 2GFAA 2EW3A 1VQNA 3NPFA 3RKWA 4AFUC 4HVWA 1HD3A 4BB7A 3M59A 1D0XA 4YTLA 4C92F 3M0RA 4RTWA 4MZMA 1BIBA 2XK0A 4RTXA 3M57A 4PJOE 3EFRA 2I2LA 3UDCA 2RM4A 1BYMA 1B3QA 1YCSB 3CD6Q 2HZYA 4XU2A 5GAN4 1VUBA 2O88A 3CCVQ 3JCMQ 1GCQC 3PFSA 3GBQA 1W6XA 3G71T 3OW2P 1QVPA 1XOVA 1SG5A 2KE9A 1AWXA 3EAEA 5I11A 4C92G 5CKEA 3I5SA 3MO8A 1FYNA 2Y4YA 4F7UF 2DIQA 2EFIA 1Y07A 3QDFA 1JO8A 3JCMW 1N8RU 2QQ9A 3UATA 3VS7A 1K73C 1Q81U 2O2OA 1VOMA 1TS9A 1SRLA 1M8MA 4M4ZA 4PLLA 1WI7A 3P8HA 1S72T 1O9SA 5D6YA 2BE9B 3WVDB 1VQ5T 4PFPA 4F16A 2JZ2A 1BU1A 4IUPA 3RR6A 3RKYA 1YIJQ 2ROLA 3QG1A 3HTRA 3OBWA 2AKKA 1TU0B 3NTKA 1W2BP 3TSZA 2ED1A 1VQ6A 4ZGJB 1Y71A 4PKCC 3JCMg 4XTZA 3EG9A 3LX7A 2RJEA 4D6WA 3EGUA 4OGCA 3PGGA 4J8OA 3EHRA 2DXCA 4C0DB 3OSVA 4KH0B 3J7AF 5GANh 2HD0A 4Z89A 1K0XA 3MEWA 5HKCA 3OYAA 2VXFA 4B9WA 3E9FA 4F14A 5LJ3e 1Q95G 4OVAA 4C8QB 2ENMA 2GFUA 1Y96A 3JCMX 3R6NA 3TREA 3C94A 4IUTA 5GAMf 1WIEA 4J9EA 2LTOA 4IUUA 4X9CA 1TH7A 1ZLMA 1WHJA 3FLGA 1R77A 2P0QA 3MP1A 5GANd 1U1TA 1WQ7A 4LNPA 2VB6A 3CCRQ 3A8HB 4MMKA 1ZUKA 3RMQA 3BE3A 1NG2A 1I0CA 5IXBA 4HT9A 4PJJA 4DA4A 5EC7A 3SDZA 5CIUA 3GOXA 1LVKA 2X4YA 2YUQA 1YJWT 2DAQA 5GAN3 2L5QA 1Z9QA 1JEGA 1UHCA 3VRYA 5CKDA 2K4YA 2AK5A 2EWNA 1C0MA 4FCYA 2DERA 3OW2S 2SEMA 3EFSA 3KUFA 1M5Q1 2LQWA 3CCRA 2DA9A 3QZ5B 2RHIA 1PRMC 1P92A 3MKDA 2BTTA 2CP6A 3META 4JS5A 1K4US 2E5QA 1AZEA 2NUTA 1QVGS 2QA4T 1QP3A 2E3IA 8AT1B 1RLQC 4JJDA 4M77C 1EZZB 2PNIA 2QAZA 2KMTA 2P0PA 1T3SA 3H41A 2DEUA 2LX9A 4KGZB 1VQNQ 4M75C 5I2SA 1RAFB 5AYFA 4E7JA 1IB8A 1VQKA 2PVGB 2XICA 3OW2A 2DYIA 4MDXA 5KE3A 4II1A 3X24B 2KBTA 1OYXA 3L1AA 2X3XD 5DLQE 1X69A 3JCMP 2LQ8A 5GAMe 2BZXA 1D1BA 2CT3A 3IQLA 3QWXX 1EIFA 2FPDA 3HFOA 2HCKA 2KYBA 4RTYA 1M90R 2XD0A 1NM7A 1M3AA 3QDRB 2PZ1A 4MZTA 1UTIA 3FRNA 2CP3A 2J6FA 2QDYB 3M5AA 1VQLT 3V7SA 5GMKe 1C6VX 3CC2T 2DYBA 3MP6A 2K9GA 4J9BA 2XIDA 2M9UA 4J7IA 2VKNA 1B07A 2LCLA 2BKDN 3G6EA 1SHFA 1XNIA 2VASA 3T9NA 2QDLA 1IRXA 1AVZC 2GGRA 7AT1B 5EG2A 2GQVA 2ZZDA 4N0AA 3CCEQ 3EG3A 1UGRB 3LW5E 1M2VB 4FU6A 3L2QA 1H3HA 2FYKA 2O4XB 2CH4A 3SWNB 3OYJA 2F2XA 2BZYA 1G5VA 1MV3A 4M78B 1VQ6Q 3CD6T 3HFNA 3HKSA 3DLMA 4BE2A 4Z8AA 2MCNA 2KVQG 2KGTA 4KH1B 1QVFS 3M0SA 4HVVA 2JTFA 1ZA1B 3EH1A 3NFCA 4C5IA 1PRLC 1VQPQ 1YHQA 2J05A 4M7DB 3DB4A 2J7IA 1AHJB 1X2KA 5GAOp 3C95A 4RG2A 2G6FX 2QGGA 4C0ZA 1QVGP 4FSXA 2K2MA 4J5YA 4XTWA 4HXJA 3JB9J 2HEQA 4EMKC 4IIMA 1B7TA 2OJ2A 3L2VA 4E7SA 2CUDA 4OMOA 1KQ1A 2DLPA 1SKUB 1FMWA 2FG0A 2EGEA 2RMOA 2E12A 3G71A 2AHJB 1M2VA 3VS5A 1X6OA 3REBB 4QKUA 1B34B 4LN2A 2ZPIB 4DOWA 3JCMh 2EYYA 1JB0E 2Y90A 1OZ2A 1KC8U 2RB6A 2L2PA 2JM8A 3JSCA 4M78D 2EKOA 4PLIA 2LC4A 4JRIA 2DM1A 2P84A 3CC7A 1S1NA 3TSWA 3MEAA 4C8QG 1ZSZB 3I56A 2RJDA 3HL8A 1OZ3A 2VV5A 5CVIA 1VQMQ 4PJOF 2JMAA 4QQGA 4LDUA 5IHIA 1BI2A 3RDVA 1Y57A 5CKHA 1Q82U 1WXTA 4FM4B 5CQXA 3JCMe 1M3CA 3R6OA 4X34A 1SF9A 5GAMd 1YN8A 2JTEA 1M1FA 4D8DA 3LWHA 3JB9F 1KC8R 2L3RA 2LRQA 4E47A 3CBOA 1IGUA 4M78E 1G83A 3OYFA 1WHHA 4OGEA 3H6ZA 4L5GA 4CI0C 4J9HA 5GANe 4EMHA 3TVTA 1VQ5Q 4AG2C 5KH6A 3GPLA 1FXXA 3OYHA 4A4FA 4M77G 5FWBA 2JS2A 1ZX6A 5LJ5f 1MGQA 4F17A 2VXEA 1Q86R 3OYKA 1QWFA 3REAB 4RCBA 1QQJA 4IURA 1QCFA 2K5IA 1NJIC 2NYSA 1UGQB 4C8QD 5FROA 1PD0A 1E6GA 5IAYA 2NUPB 1G8XA 4O6JA 3EG9B 2MWPA 3G6ET 2HBPA 1M1KR 2IVWA 4M77F 4C5GA 2CDTA 2MMPA 3S3NA 2QG9B 3J81E 4PFOA 2VYTA 2LJ3A 4M75E 4KBMB 3CPWP 1MMNA 4R0KA 2BUDA 5FU6B 2CT4A 1M27C 3M0TA 1R0BG 1TXQA 1GBQA 2E3HA 1OU9A 1LNXA 3CMAA 2CZ6B 2HL3A 5GMKh 1PHTA 1JQQA 1YJ9Q 3J80E 4B6MA 2KY9A 2DVEA 4M7AE 1M9SA 3G4SQ 3CCQQ 2MI6A 1RAGB 5IN1A 3LWIA 1AWJA 3A98A 4J6YA 2DXBA 2QYZA 4JZ4A 2HSPA 3N5BB 5GANj 3TEEA 1Q7YC 3MCAB 1M3BA 3I56T 2RPNA 3JCMf 4CRIA 5D7UA 1U8RA 3OSSC 5LJ5h 3JAME 1RAIB 2RNAA 1YHQQ 1UGPB 1UGVA 3FJ5A 1YJNQ 5I2MA 4JRKA 1Q82R 2DZCA 5LL6S 1OU8A 2EGCA 4JLIA 5KYXA 1TG0A 4PJOG 1N8RC 1ZBXA 3CEYA 5GAMg 1YNZA 3S3MA 1W1FA 1LCKA 2E65A 3CCQA 4KUIA 2XKOC 5M9OA 5A0GA 1OV3A 4OMFB 3CPFA 5GANg 1WLPB 2DK3A 3CCEA 2EQUA 3VRZA 2XMFA 1QVFA 3QPHA 3X26B 1S72A 3HHTB 1IXDA 4M7AB 4BD3A 4DEXA 1VQ5A 4AT1B 2KXCA 5KYYA 2DO3A 2PU9B 4XTUA 2GF7A 4KGXB 3PVQA 4CC3A 4RG8A 2HAXA 1QW1A 1WFWA 1WPYA 4M75F 4RTZA 1KIKA 4M7AC 4GLMA 2JW4A 2FL7A 2JMCA 1K9MU 2PUKB 1OPLA 3V8JA 3CCUA 4LD6A 3CCUT 2CS7A 1U06A 4ZGDB 2KROA 1ZUUA 1U1SA 2J06A 1VYTA 2PQWA 1MNDA 2QGFB 3RNJA 1BB9A 1UECA 1SEMA 1GL5A 4QQ6A 4M77A 2G3RA 2XDPA 5CKBA 4FW1A 3M4YA 4J9CA 1IREB 2XDDA 4BY6B 2E41A 6AT1B 2CZ1B 3QHSA 2A37A 2O9SA 3CCLT 1K9AA 2LCCA 1BK2A 1PG5B 2QEXT 1K76A 4JDSA 3VS1A 4FIBA 4PK4A 1NE8A 4LUDA 1UJ0A 2RI2A 3AT1B 3I55Q 2EBPA 3SFMA 4OB0B 1WYXA 5FW9A 1W2BS 3QKJA 5KYUA 2DETA 1AWOA 3UA7A 5L8RE 4F7UB 3SB2A 2EPDA 2EGAA 1D0YA 2ABLA 5LJ3j 1U5SA 2QA4Q 1HK9A 2PVDB 1D1AA 2FO0A 2LJ1A 2ZPBB 2DL7A 1RADB 1O75A 2HBWA 5KYNA 5GAOn 2YSQA 5IHKA 2YUPA 3H9NA 1FX7A 1JRIA 4EIKA 1AD5A 2JJ9A 1WJQA 1NZ9A 1WGSA 2JVVA 3EGDA 4FYXB 2K5LA 2X35A 4LDXA 4Y28E 2KK4A 1VIFA 1PCXA 4M78A 4IUVA 2DKGA 3JCMb 4M77B 4M77D 1VQ7T 1TOVA 2RA2A 2DL5A 2LX7A 2K57A 1V29B 3CCUQ 3OYIA 1QLYA 2XG8D 3EG2A 1VQ8A 3EFOB 3E1SA 4IKFA 2RI5A 3PNWC 4Z02A 4C8QE 3BDUA 2E5KA 4CC7A 2V8JA 2XU8A 2KXDA 3VS3A 5GMKl 4B9XA 5GAN5 1NBEB 3M9QA 4FSSA 4HCZA 1VQOT 2MIOA 1VQOA 5FU6C 1YP5A 1YJNT 3X28B 2HKQB 4M7DC 1PC0A 1JJ2S 4ZN1A 1KQSA 2KNBB 1XJWB 2MOXA 3BW1A 3EGDB 1TUGB 3HSBA 1VQ8Q 3CC4T 1MHNA 2RQUA 2ED0A 1YITQ 3CC4A 2L0AA 5D6WA 2LP5A 1IHWA 2COYA 4ZTFA 2GQIA 3CC2A 1VQ6T 5GANf 2ECZA 4C0FA 1QVGA 1RL2A 2E70A 1F1BB 4WCIA 4HKEA 4AFZC 4BE0A 4PJOC 2J6OA 3FDRA 2C06A 2E4HA 1YBYA 2DTIA 3VS0A 2L3PA 4HT8A 2WSFE 4RMOA 2DRKA 4KT0E 4FT4A 1ZBJA 1WHMA 2KYMA 2RQRA 3CD6A 3RESA 2QQRA 4M7DE 4F04B 1WXUA 2D8JA 4KULA 2LNHB 2O9VA 4QW2A 3EFOA 3FIFA 1Q86C 3KFVA 2ESWA 1WJRA 2RF0A 2XHCA 1NEBA 4XK8E 3MJXA 3VUBA 4QQDA 2ZPGB 4M7DG 2DBKA 4FYVB 2DXTA 2F5TX 1KD1C 2RO0A 2DMOA 2LVMA 1I5OB 2RK1A 2OTLA 3I56Q 5CR2A 1T3LA 5FRNA 3LGLA 1Q7YU 3JCMV 2YUNA 1VQPA 1U3OA 3EGXA 2V1QA 3GIBA 5KCHA 1BCOA 1NLOC 2WSCE 2CP7A 3A1PA 3BDLA 5GAMh 5GAN8 2LQNA 1PKTA 2DRMA 4M7DD 2CH4W 2KR3A 1AT1B 1UEBA 3URGA 3RERA 3QSUA 3LYIA 2QASA 3SWNA 1FMKA 3M4GA 4EDUA 2PVOB 4XTYA 1QVFP 3DKMA 3MPUB 1ZUYA 1E7OA 4O5VA 3CCRT 3SD4A 4C92E 3JB9G 8ATCB 4A63B 2EQIA 1WHKA 3V8LA 1TSFA 2NLUA 2K3YA 1WXBA 2F5KA 3UF4A 2EYQA 1I07A 5FRMA 3G6EQ 1Q7YR 2CZ0B 2K2VA 1BI3A 1IHVA 1PKSA 3VUZA 4PJOD 5IH2A 1QP2A 1GCPA 1HSQA 2DPPB 1YWOA 4J7FA 5GAOr 2DJZA 4F7UG 4JS4A 1MMAA 2WSEE 2KI7A 3NTIA 4N0AC 2B86A 3G1JA 1YWPA 1RI0A 2E6ZA 3CCST 1VYUA 2BZ8A 2FRYA 4ZTJA 1GFDA 4OMLA 2JT4A 3TU4K 3UWNA 2VUBA 3NGPA 2D0QB 3M0QA 4J6XA 3VS6A 2DL8A 4GLKA 4XTXA 4A4HA 2E64A 1OI1A 2C0OA 3PVLA 4XAXB 3SHWA 4BDYA 4GBQA 1NYFA 2YHTA 1NYGA 1HYOA 1WQWA 5HK3A 1Z9ZA 3QXEB 4KRTA 4E7HA 2X9HA 4ELYC 5LJ5d 2DIGA 1R0CB 1D3BB 2KAFA 4EMKA 4L59A 2EJGA 5CQYA 1VQ4T 3OYEA 1VQ4A 3QJ6A 2LT1A 1V1CA 2YRVA 3CCMA 1ZA2B 1YHQT 1ZSZA 2F1LA 3QJYA 5LJ3h 1TTHB 2X51A 3MP8A 5J39A 3OYLA 5I22A 3ZL7C 2OTLQ 2V1RA 3C4SA 2JXBA 1K8AU 3L2WA 1YIJT 1SSHA 5KYWA 2OAUA 1OX9A 1WNLA 1QMCA 4DBRA 3ZBDA 1KQ2A 1R8OB 3CCJA 1I5LA 3ZEHA 1KJWA 2MPXC 2ZCFB 4M75B 2O01E 3G71Q 4C8QC 1KD1U 3LLRA 3A8GB 4JLGA 2YT6A 1KK7A 3ULRB 2QTXA 2W10A 3GP8A 1V76A 4DEYA 1WX6A 3RUXA 5C6SA 1KHCA 1WZOA 3CMAT 2OAWA 4DBQA 2OI3A 5FU7C 4CC4B 2KRMA 2AT1B 2C0TA 4CC2A 4V2SA 2CREA 1X6GA 4PJMA 3M54A 3DB3A 2EQMA 1K73U 2LMJA 2IPOB 5GJVB 1D1CA 2X4JA 1PSEA 1RAAB 4ME7A 1OOTA 1VQMA 4AFQC 4XQ3A 2QK0A 2R5AA 2ZPEB 1ABQA 2KRSA 4XU0A 1K0SA 2YRDA 4KGVB 2QA4A 3OYGA 3VS4A 4OB2B 1KG1A 2A08A 2H8HA 1K9MC 2H3EB 5AT1B 2D9TA 2PTKA 2AZSA 3GNFB 3M56A 1YJ9A 4ORZA 4OMPA 1X6BA 4BY6C 4KUDK 4NOYA 1G3TA 2YLBA 2DVJA 3LGFA 1VQKT 3OMCA 2DJQA 1NJIU 4L6V5 2ZPHB 1Y0MA 5GAOm 3OYMA 2JN0A 1UDLA 4ANJA 1H641 2EYXA 1M4ZA 4HCCA 3CXCP 4ELZC 2DTOA 4PJNA 3CCLQ 4M75A 4LE9A 5C0MA 2J6KA 4JJCA 4JUVA 3VS2A 3M55A 1K8AR 2FZGB 3JB9I 2MAMA 1AOJA 5KYXB 4C92A 3OS0A 4DQ2A 1UFFA 1G2BA 4BE1A 2BE7D 2P4RA 1VQLA 2A7YA 4HA8A 1YIJA 1BI1A 1CKAA 1RAEB 1OX8A 2OTJQ 5LJ5j 1KD1R 3JCMc 2HSEB 3CCSA 3FEOA 3EHQA 1BIAA 1LPLA 2FHDA 1UHFA 3VKIA 3QZ9B 5GMKj 2JOYA 2VWFA 4NL2A 3I35A 4DBHA 4BACA 2CSIA 3L2ZA 4M7AD 5KYYB 2YWWA 4FYYB 1MMDA 3I9QA 2HQXA 4RKUE 3CMET 4PL6A 1SRMA 2I0NA 4FT2A 2P0KA 3HPWA 2PUOB 4JZ3A 2VVKA 4LDYA 4QVCA 3THKA 4J9DA 2JUFA 3OS5A 4OMNA 4E6RA 3VYHB 3JCMJ 2HQHA 1VQ9T 2CYZB 1WDXA 1VQ9A 5LJ3g 2K5FA 4C92C 4RTVA 4N4GA 1PM3A 5GAMj 1JXOA 2V8IA 5GAN7 3S6WA 3JB9H 4OMMA 4A53A 2FRWA 4MDWA 4RTTA 3ER0A 4RCCA 2QI2A
chains in the Genus database with same CATH topology
4M7AF 2XU8A 3OB9A 2DTHA 2MWOA 1YI2T 5GMKl 4B9XA 5GAN5 4OF1A 2OTLT 2LDMA 1UB4A 3M9QA 4HCZA 4C0ZA 1VQOT 2M1HA 4FSXA 5LJ3f 3HP9A 1VQOA 4J5YA 4XTWA 4DOVA 4NL3A 1I8FA 3JB9J 4EMKC 1YJNA 5FU6C 3VU3C 2CGHA 3HRTA 1YJNT 3X28B 3L2VA 5GMKm 1N9SA 4M7DC 3OMGA 1KQ1A 1Q82C 1YJ9T 1YJWA 1JJ2S 1M1GA 4ZN1A 5CKFA 1KQSA 3RKXA 2E12A 3BW1A 4Y91A 4C92B 4M77E 1NPPA 3G71A 4PJOB 2AHJB 2LNVA 3CPWA 2RHYA 3HSBA 1N9RA 1MHNA 2E10A 5HK0A 3CC4T 4OB1B 1X6OA 4M7AG 3V7RA 1B34B 3CC4A 5IT9E 1KHIA 2ZPIB 5D6WA 4C8QF 2QQBA 4DOWA 1DJ7B 3JCMh 5A2QE 3GLXA 1GXIE 4ZTFA 3CC2A 3A8OB 1VQ6T 1JB0E 2Y90A 4A4EA 5GANf 1OZ2A 3OYYA 2RB6A 4C0FA 1KC8U 1X01A 2A3LA 3MHXA 4Q5WA 2DZ9A 1QVGA 4A4KA 4VUBA 1RL2A 2E70A 3QUIA 4XU3A 1KC8C 1M8VA 4EMGA 3SWNC 4HKEA 5DLOA 3JSCA 3LH0A 3OY9A 4BE0A 3CCET 4M78D 2EKOA 4PLIA 3X20B 4PJOC 2LC4A 1G3YA 4JRIA 3FDRA 4QVDA 1BKBA 3OYCA 2C06A 1YBYA 2DTIA 2HNIA 2P4TA 2H3JA 3V7CA 1G3SA 2ZPFB 4M75G 3L2UA 3CC7A 4HT8A 3MEAA 1VQMT 4C8QG 4C5EA 4BI8B 2WSFE 2EJ9A 2RI3A 2RJDA 3JRZA 2LT4A 1UGSB 3HL8A 4RMOA 4KT0E 3OYDA 3I56A 2E6NA 1M1KU 5GAN6 1OZ3A 2VV5A 4FT4A 1HXDA 5CVIA 4BI4A 2IG0A 4PJOF 2RHXA 2RJFA 4LDUA 1BI2A 3NTHA 4QQGA 4TVRA 5LJ5g 1WJSA 5CKHA 5KE2A 2B8AA 1Q82U 2DEQA 4FM4B 5CQXA 1YITA 3CD6A 3JCMe 3DLLA 3JCMd 2DXUA 2R5MA 3RESA 4M78F 2QQRA 4M7DE 3QYGB 4C8QA 1Y96B 2V8KA 3QO3A 3A5ZB 4ZN3A 3E9GA 5J3BA 5CCAA 2R58A 2BIVA 3R6OA 4X34A 3CXCS 4F7UE 3FC3A 3PIOA 1NPRA 2LQKA 3C12A 3GF5A 5GAMd 2RHUA 4KULA 3GNGA 4J83A 4QW2A 2QQAA 4XU1A 3Q1JA 3FIFA 3CCMT 1Q86C 1M1FA 1VQNT 3LWHA 1Y7XA 1ZHIA 2GFAA 3UT1A 3VJPA 3JB9F 1WJRA 1VQ8T 1VQNA 2XHCA 3RKWA 4C92D 4XK8E 1M1KC 1PSFA 2L3RA 2LRQA 2EIFA 4QQDA 3VUBA 4E47A 4BB7A 3V8KA 3CBOA 2ZPGB 3M59A 1B34A 4M7DG 3M58A 2DXTA 1XTDA 2F5TX 4YTLA 2RO0A 4M78E 2LVMA 2RK1A 3FB9A 3WVEB 4C92F 3OYFA 1KD1C 4M7DF 2OTLA 4MZMA 1BIBA 2XK0A 5CR2A 4EPCA 5FRNA 3LGLA 4OGEA 1Q86U 1Q7YU 3H6ZA 3JCMV 3M57A 4PJOE 2RJCA 4L5GA 4CI0C 3EFRA 2I2LA 1VQPA 2EQKA 3UDCA 5GANe 2RM4A 3GIBA 4EMHA 1BYMA 5KCHA 4XU2A 2KDSA 1VUBA 2WSCE 5KH6A 5GAN4 3L2RA 3JCMQ 3GPLA 1FXXA 3OYHA 4A4FA 4M77G 3BDLA 2RHZA 3VV0A 5KCOA 5GAMh 5GAN8 3OYNA 3PFSA 3OA6A 4PJOA 5LJ5f 4M7DD 2VGNA 4N4IA 4BDZA 3G71T 1UEBA 2DD5A 1MGQA 1QVPA 1XOVA 4RG2A 3URGA 3RERA 3QSUA 2VXEA 3LYIA 3SWNA 3CCLA 3EAEA 3OYKA 4C92G 5CKEA 3M4GA 4EDUA 2PVOB 4XTYA 3MO8A 3DKMA 4IURA 4RCBA 4O5VA 2Y4YA 4F7UF 2K5IA 4BUGA 2DIQA 5LJ3d 2EFIA 3G4SA 1NJIC 1UGQB 4C8QD 1Y07A 3CCRT 1KQSS 3SD4A 4C92E 5FROA 2CZ7B 3JCMW 5IAYA 3JB9G 2QQ9A 1N8RU 1K73C 1H3ZA 2RH2A 3CPWS 3V8LA 5GAOl 1Q81U 4O6JA 2NLUA 4LDVA 2MWPA 3G6ET 2HBPA 2IVWA 2K3YA 3PMIA 4M77F 2F5KA 4PLLA 4C5GA 2DD4A 2EYQA 2MMPA 3S3NA 3MEUA 3P8HA 1O9SA 3J81E 1S72T 2VYTA 4M75E 5FRMA 4KBMB 5D6YA 3WVDB 2CZ0B 2K2VA 1BI3A 1VQ5T 3VUZA 3UPUA 2BUDA 3CBPA 5FU6B 4PJOD 1QP2A 2JZ2A 1W4SA 2DPPB 4PNOA 4IUPA 4J7FA 3RKYA 2XDBA 5GAOr 3RIRA 3CMEA 1LNXA 2DJZA 4F7UG 3CMAA 2VC8A 3QG1A 4JS4A 2CZ6B 2WSEE 3OBWA 3NTIA 5GMKh 4N0AC 1RI0A 3OYBA 3NTKA 2E6ZA 1VQ6A 4ZGJB 1Y71A 4PKCC 3JCMg 3J80E 3CCST 4IUQA 4XTZA 4ZGEB 1Q81C 2KY9A 2DVEA 4M7AE 3LX7A 4LD9K 4ZTJA 3P8DA 1M9SA 2RJEA 4D6WA 2KQWA 2MI6A 3PGGA 4J8OA 4OGCA 5IN1A 3LWIA 3TU4K 2DXCA 2JTMA 2VUBA 4J6YA 3UWNA 3OSVA 3WXMB 3O8VA 2DXBA 2D0QB 4J6XA 3J7AF 5GANh 2M16A 3N5BB 5GANj 2HD0A 3TEEA 4GLKA 4XTXA 1Q7YC 4A4HA 3MCAB 2E64A 1OI1A 3MEWA 3QIIA 3I56T 5HKCA 3JCMf 2JNGA 3OYAA 1YI2A 2K3XA 2VXFA 4XAXB 4B9WA 4BDYA 4CRIA 2YHTA 3E9FA 1WQWA 5LJ3e 4M75D 5HK3A 3QXEB 2X4XA 4OVAA 4C8QB 1U8RA 4E7HA 2GFUA 1Y96A 4FL6A 4LDWA 4ELYC 3OSSC 4E7IA 5LJ5d 5LJ5h 3JCMX 4R55A 3INZA 2DIGA 3TREA 1D3BB 3C94A 2KAFA 4EMKA 4IUTA 5GAMf 3S3OA 3JB9D 1W2BA 4GY5A 4L59A 3JAME 2EJGA 5CQYA 1VQ4T 3I55A 2LTOA 3MEVA 1UGPB 4IUUA 5DY9A 3OYEA 4X9CA 2OTJT 1TH7A 1VQ4A 3I55T 3QJ6A 2LT1A 2YRVA 5I2MA 5A0DA 4JRKA 3CCMA 2RD1A 1YHQT 2DZCA 5LL6S 3QJYA 3FLGA 4C0DC 5LJ3h 1K8AC 2P0QA 4JLIA 3MP1A 5GANd 1U1TA 4MZPA 1M90C 4PJOG 1WQ7A 3MP8A 5J39A 3OYLA 1N8RC 2D6FA 3M53A 5FU7B 3C4SA 1ZBXA 1K8AU 3A8HB 4MMKA 5GMKi 3L2WA 1YIJT 4R56A 2E1HA 3CEYA 5GAMg 2OAUA 1WNLA 3S3MA 2CKKA 3RMQA 3PTAA 3ZBDA 1KQ2A 1R8OB 2E65A 3CCJA 1I5LA 3HRUA 3CCQA 3ZEHA 4HT9A 1N27A 3A8MB 4KUIA 2WACA 2XKOC 5M9OA 2R57A 4X9DA 3H8ZA 2QQSA 4OMFB 5A0GA 2QXFA 2ZCFB 1SSFA 3CPFA 2O01E 4M75B 3SDZA 4DA4A 5GANg 5CIUA 4C8QC 2DK3A 4OP0A 2FB7A 2EQUA 3GOXA 2KSSA 3CCEA 4ATOA 2X4YA 4QVZA 1QVFA 2XI9A 3LLRA 1KD1U 3A8GB 2DAQA 3QPHA 3X26B 5GAN3 2L5QA 4JLGA 1YJWT 1LJOA 3HHTB 1S72A 4M7AB 4BD3A 1VQ5A 5CKDA 2K4YA 2QTXA 3GP8A 2EWNA 2DO3A 2PU9B 5CO7A 3RUXA 4WF2A 5C6SA 1KHCA 4XTUA 1IZ6A 3CMAT 2GF7A 2Y4XA 3OW2S 3KBGA 5FU7C 2F69A 3EFSA 3A8LB 4RG8A 5HY6A 2HAXA 1QW1A 3KUFA 1M5Q1 1WPYA 1X75C 3CCRA 4IKFA 4M75F 4V2SA 3QZ5B 3M54A 3DB3A 4M7AC 3P8BB 2RHIA 2EQMA 1JBMA 2FL7A 3ZFJA 1K9MU 2PUKB 1P92A 2RK2A 1K73U 1FWZA 3V8JA 3CCUA 4LD6A 4C0GA 3META 4JS5A 5FLXE 1VIEA 3ASKA 2X4JA 1PSEA 3CCUT 4ME7A 2E5QA 5LJ5e 2CS7A 3PT9A 1VQMA 4A4GA 4ZGDB 4M78G 2R5AA 2ZPEB 4XQ3A 4XU0A 1QVGS 3X25B 1QP3A 2QA4T 3ME9A 4M77C 2QA4A 1U1SA 3L42A 3OYGA 2PQWA 3E19A 4OB3B 4OB2B 1KG1A 2HQEA 3OS1A 1YITT 1K9MC 2L8DA 2KMTA 2P0PA 3OQ5A 4QQ6A 4M77A 2G3RA 2XDPA 4C0DB 2LX9A 5D6XA 2D9TA 4M75C 3GNFB 5CKBA 5I2SA 3M56A 3G7ZA 1LOJA 3M4YA 1IREB 4P5NA 1YJ9A 5AYFA 2XDDA 4BY6B 3BY7A 4BY6C 2X4WA 4KUDK 4NOYA 2YLBA 1G3TA 2E41A 3LGFA 3CCVT 1VQKT 3OMCA 1NJIU 2CZ1B 3QHSA 4XTVA 3CCVA 2L89A 4E7JA 1VQKA 4M7AA 2PVGB 2XICA 4L6V5 4C5HA 3OW2A 2GCXA 2ZPHB 4MDXA 5KE3A 2QEXA 5GAOm 3OYMA 3CCLT 2JN0A 1G3WA 4II1A 2LCCA 3X24B 2QEXT 3HRSA 1H641 5GAN2 1OYXA 1M4ZA 2VGMA 4JDSA 4HCCA 3L1AA 5DM7R 4FIBA 3G4ST 4ELZC 1NE8A 4HCBA 2DTOA 5DLQE 3VYGA 3JCMP 5CAIA 2LQ8A 2RI2A 5GAMe 4JRQA 3KXTA 2ZGWA 3SFMA 3CCJT 2EAYA 4OB0B 4M75A 5C0MA 1VQPT 3PMTA 3QBYA 1EIFA 4JUVA 1W2BS 3QKJA 1I81A 3OBYA 3HFOA 2EQJA 5L8RE 4F7UB 3AHUA 2XD0A 3M55A 3SB2A 3JB9I 2MAMA 5J26A 3F70A 4C92A 5CK9A 3QDRB 1HK9A 5LJ3j 4DQ2A 2MF2A 4MZTA 3OS0A 2PVDB 3FRNA 2ZPBB 3M5AA 2QDYB 1VQLT 4BE1A 4JJNK 3V7SA 5GMKe 1VQLA 1O75A 4MMLA 5GAOq 2A7YA 4HA8A 3CC2T 1YIJA 1BI1A 5GAOn 3OS2A 3MP6A 5LJ5j 4M78C 3JCMc 4J6WA 1FX7A 3CCSA 2XIDA 3BFMA 3FEOA 4E7LA 4A54A 1JRIA 2M9UA 1JJ2A 3CCQT 4J7IA 2LCLA 3PIPA 2BKDN 1BIAA 3G6EA 1XNIA 1WJQA 2FHDA 1YCYA 3VKIA 3T9NA 3QZ9B 1NZ9A 4UC4A 1WGSA 2JVVA 2JOYA 5GMKj 1N6AA 4NL2A 4E7KA 5EG2A 2GQVA 2ZZDA 4N0AA 4BACA 3L2ZA 3CC7T 4M7AD 2K5LA 1UGRB 2X35A 3LW5E 4FU6A 3L2QA 4LDXA 2FYKA 2O4XB 2KK4A 2HQXA 4Y28E 1BI0A 4RKUE 1M90U 3SWNB 2YLCA 4BI3A 2EJFA 2M0OA 4PL6A 3OYJA 3CMET 1VIFA 1G5VA 4FT2A 4M78B 1ZQ1A 4M78A 3TCJA 2P0KA 3CD6T 3HPWA 2PUOB 3CBMA 3HFNA 3DLMA 3HKSA 4IUVA 4LDYA 4BE2A 4QVCA 2DKGA 1VQ7A 3JCMb 2JUFA 4M77B 4M77D 1VQ7T 2KVQG 3OS5A 5A0LA 4JRPA 3JCMJ 3VYHB 1QVFS 2JTFA 3FJPA 3QYHB 1VQ9T 4NS5A 2CYZB 4N4HA 2RA2A 1VQ9A 3NFCA 1D3BA 5LJ3g 2K57A 2K5FA 4C5IA 4EMKB 3CXCA 4C92C 1V29B 2OTJA 4N4GA 2FVUA 3OYIA 2XG8D 5GAMj 1VQ8A 2V8IA 4F7UA 1YHQA 4M7DA 4M7DB 3E1SA 5GAN7 2RI5A 3PNWC 3S6WA 1I4K1 1XQHA 4Z02A 4A53A 3DB4A 3RMSA 5I21A 3JB9H 4MDWA 4C8QE 2O4XA 1AHJB 3BDUA 3C95A 3ER0A 5GAOp 4RCCA 2V8JA 2QI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIB A;  4M7A F;  2EJG A;  2DTH A;  3QHS A;  4XTV A;  4M7A A;  5GMK l;  5GAN 5;  5DY9 A;  3JCM V;  4X9C A;  4PJO E;  1TH7 A;  3EFR A;  2I2L A;  5GAO m;  5GAN e;  2JN0 A;  2RM4 A;  3GIB A;  4JRK A;  5LJ3 f;  4EMH A;  2RD1 A;  2DZC A;  4J5Y A;  4XTW A;  4NL3 A;  1H64 1;  5GAN 2;  1I8F A;  3JB9 J;  4XU2 A;  5LJ3 h;  4EMK C;  5GAN 4;  3JCM Q;  4JLI A;  3L1A A;  3VU3 C;  5GAN d;  1U1T A;  2CGH A;  2DTO A;  1WQ7 A;  4M77 G;  4PJO G;  5GAM h;  5GAN 8;  5GMK m;  5CAI A;  3JCM P;  5GAM e;  1N9S A;  4PJO A;  2ZGW A;  5LJ5 f;  4M7D C;  4M7D D;  2EAY A;  1KQ1 A;  4MMK A;  4M75 A;  5GMK i;  2E1H A;  1MGQ A;  5GAM g;  3RER A;  1WNL A;  2VXE A;  3SWN A;  3QSU A;  3RKX A;  4C92 G;  3BW1 A;  4Y91 A;  3M4G A;  1KQ2 A;  4C92 B;  2E65 A;  1I5L A;  4M77 E;  4JUV A;  4XTY A;  4PJO B;  4RCB A;  1I81 A;  3HSB A;  3HFO A;  4HT9 A;  1N9R A;  2E10 A;  4F7U F;  4X9D A;  4M7A G;  5LJ3 d;  4M75 B;  3V7R A;  1B34 B;  4F7U B;  3AHU A;  3SB2 A;  5GAN g;  4C8Q F;  4C8Q D;  4C8Q C;  4OP0 A;  3JB9 I;  2FB7 A;  3JCM h;  4C92 E;  3JCM W;  3JB9 G;  4C92 A;  5LJ3 j;  1HK9 A;  4DQ2 A;  5GAN 3;  3V8L A;  1LJO A;  5GAO l;  2Y90 A;  4M7A B;  5GAN f;  2RB6 A;  4M77 F;  1X01 A;  3V7S A;  2DZ9 A;  5GMK e;  2QTX A;  4MML A;  5GAO q;  4HA8 A;  3QUI A;  4XU3 A;  2EWN A;  1M8V A;  4M75 E;  5GAO n;  4EMG A;  3SWN C;  3RUX A;  4WF2 A;  5LJ5 j;  4XTU A;  4M78 C;  4M78 D;  3JCM c;  4J6W A;  3BFM A;  4PJO C;  4PJO D;  4A54 A;  1JRI A;  4JRI A;  4QVD A;  4PNO A;  2HNI A;  2DTI A;  3RKY A;  5GAO r;  1BIA A;  3V7C A;  3EFS A;  3RIR A;  1LNX A;  4M75 G;  1YCY A;  2DJZ A;  4F7U G;  4HT8 A;  2VC8 A;  1M5Q 1;  1WPY A;  4C8Q G;  5GMK j;  2EJ9 A;  4M75 F;  5GMK h;  4N0A C;  4NL2 A;  4V2S A;  5GAN 6;  1HXD A;  4N0A A;  3L2Z A;  4PJO F;  4M7A C;  4M7A D;  5LJ5 g;  3JCM g;  1JBM A;  4XTZ A;  2DVE A;  4M7A E;  2DEQ A;  2FYK A;  3V8J A;  3JCM e;  3JCM d;  2DXU A;  3RES A;  2YLC A;  4M78 F;  2EJF A;  3SWN B;  4M7D E;  3PGG A;  4C8Q A;  1Y96 B;  4M78 B;  3QO3 A;  5LJ5 e;  4M78 A;  4J6Y A;  4M78 G;  4XQ3 A;  3HFN A;  4J6X A;  4XU0 A;  4F7U E;  4QVC A;  2DKG A;  3JCM b;  4M77 B;  5GAM d;  4M77 D;  4M77 C;  5GAN h;  1U1S A;  3JCM J;  5GAN j;  4XU1 A;  3FJP A;  4XTX A;  3FIF A;  2E64 A;  3JB9 F;  2RA2 A;  3JCM f;  1D3B A;  5LJ3 g;  2K57 A;  4EMK B;  2VXF A;  3RKW A;  4C92 C;  4C92 D;  2YHT A;  4M77 A;  1WQW A;  3V8K A;  5LJ3 e;  5GAM j;  4M75 D;  4M75 C;  4M7D G;  1B34 A;  4F7U A;  4M7D A;  1LOJ A;  2DXT A;  4C8Q B;  5GAN 7;  4M7D B;  1Y96 A;  1I4K 1;  4M78 E;  4A53 A;  4C92 F;  5I21 A;  3FB9 A;  3JB9 H;  4M7D F;  5LJ5 d;  5LJ5 h;  3BY7 A;  4C8Q E;  3JCM X;  3INZ A;  3BDU A;  4NOY A;  2YLB A;  2E41 A;  1D3B B;  4RCC A;  5GAO p;  3JB9 D;  4EMK A;  5GAM f; 
#chains in the Genus database with same CATH topology
 4M7A F;  2MWO A;  1EX4 A;  1MV0 B;  1YI2 T;  1UJY A;  4OF1 A;  2OTL T;  2L3Q A;  2LDM A;  4NL3 A;  1VQ4 Q;  4PJL A;  3PE0 A;  1I8F A;  5HCK A;  3VU3 C;  3HRT A;  3JV3 A;  5GMK m;  3OMG A;  1Q82 C;  2KT1 A;  1YJ9 T;  1YJW A;  2AKL A;  1MMG A;  1M1G A;  2FEI A;  5CKF A;  3RKX A;  4Y91 A;  2YXY A;  1CKB A;  4C92 B;  4PJO B;  2YRC A;  2RHY A;  1N9R A;  1C1A A;  4OB1 B;  4M7A G;  1OEB A;  3V7R A;  4C8Q F;  2QQB A;  5A2Q E;  1DJ7 B;  3GLX A;  1GRI A;  5GJW B;  4A4E A;  2M0Y A;  3OYY A;  3CME Q;  3MHX A;  5ECA A;  1ARK A;  1RUW A;  3QUI A;  4XU3 A;  1KC8 C;  1M8V A;  1RAC B;  2JS0 A;  5DLO A;  3M0U A;  3OY9 A;  3CCE T;  2L3S A;  2K79 A;  3X20 B;  1G3Y A;  3I5R A;  4QVD A;  2H3J A;  1IGQ A;  1ABO A;  2ZPF B;  3L2U A;  2CP5 A;  1TUC A;  1VQM T;  2EJ9 A;  2RI3 A;  3JRZ A;  3OYD A;  2LT4 A;  1PD1 A;  1M1K U;  4FW2 A;  5GAN 6;  1Q81 R;  1HXD A;  1QCO A;  2IG0 A;  2RHX A;  5LJ5 g;  3NTH A;  5KE2 A;  2B8A A;  2DEQ A;  3DLL A;  1K1Z A;  2LJ0 A;  2R5M A;  1SPK A;  1YI2 Q;  1JXM A;  4C8Q A;  1Y96 B;  2GBQ A;  3QO3 A;  5J3B A;  5CCA A;  2R58 A;  2BIV A;  4F7U E;  5KYU B;  3CC2 Q;  1NPR A;  3EGX B;  2LQK A;  3GF5 A;  2RHU A;  4J83 A;  4XU1 A;  2QQA A;  3Q1J A;  1ZHI A;  3UT1 A;  3VJP A;  1VQ8 T;  3CC4 Q;  4OMQ A;  4C92 D;  1M1K C;  1PSF A;  2EIF A;  4LUE A;  3V8K A;  2RQV A;  1X43 A;  1B34 A;  3M58 A;  2DIL A;  1XTD A;  2COZ A;  3WVE B;  3FB9 A;  4M7D F;  3CC7 Q;  1GCQ A;  2DL3 A;  4EPC A;  1Q86 U;  2RJC A;  2EQK A;  2CP2 A;  9ATC B;  2KDS A;  2D0N A;  3L2R A;  1VQK Q;  2RQW A;  3VV0 A;  2RHZ A;  5KCO A;  3OYN A;  4PJO A;  3OA6 A;  2K3B A;  2VGN A;  4N4I A;  4BDZ A;  4QT7 A;  2DD5 A;  2K7A A;  1M2O A;  3CCL A;  3EH2 A;  2Z0W A;  4BUG A;  5LJ3 d;  3EG1 A;  4D8K A;  3G4S A;  1KQS S;  2CZ7 B;  1H3Z A;  1QKX A;  2RH2 A;  3CPW S;  5GAO l;  4LDV A;  1T0H A;  1UE9 A;  3PMI A;  2KT8 A;  2DD4 A;  3MEU A;  3UPU A;  3CBP A;  1A0N B;  1H8K A;  1KQS P;  2F2V A;  1W4S A;  4PNO A;  2XDB A;  3RIR A;  3CME A;  2EYZ A;  2VC8 A;  3OYB A;  1PNJ A;  4ZNX A;  1TUD A;  4IUQ A;  4ZGE B;  1Q81 C;  3CCM Q;  4LD9 K;  3P8D A;  2KQW A;  2FZK B;  2JTM A;  3WXM B;  2QEX Q;  1N8R R;  3O8V A;  1QKW A;  2M16 A;  2ROT A;  2MYS A;  3QII A;  2YUO A;  1OQK A;  1FMV A;  2JNG A;  1YI2 A;  2K3X A;  4AMC A;  1VQ9 Q;  4M75 D;  2X4X A;  4LDW A;  4FL6 A;  3O5Z A;  2D8H A;  4E7I A;  4R55 A;  3INZ A;  1W2B A;  3JB9 D;  1D09 B;  3S3O A;  4GY5 A;  3I55 A;  3MEV A;  2OTJ T;  5DY9 A;  3I55 T;  1AZG B;  1OUL A;  1X27 A;  5A0D A;  2RD1 A;  4K11 A;  2AIR B;  4X1V A;  4C0D C;  1K8A C;  4MZP A;  1M90 C;  1KFZ A;  2D6F A;  2RN8 A;  3M53 A;  1QWE A;  5FU7 B;  2YDL A;  2HL5 C;  5GMK i;  4R56 A;  2E1H A;  2X3W D;  2CKK A;  3PTA A;  2OX7 A;  3HRU A;  4JJB A;  1N27 A;  3A8M B;  2WAC A;  2R57 A;  4X9D A;  3H8Z A;  2QQS A;  1E6H A;  2QXF A;  1SSF A;  4OP0 A;  2K6D A;  2FB7 A;  4ATO A;  2KSS A;  1X2Q A;  4QVZ A;  2XI9 A;  1LJO A;  2COW A;  2SRC A;  2DL4 A;  2KEA A;  1K9M R;  2IIM A;  5CO7 A;  4WF2 A;  1OPK A;  2JM9 A;  1IZ6 A;  2Y4X A;  2RQT A;  3KBG A;  2F69 A;  5HY6 A;  3A8L B;  3C0C A;  1X75 C;  1JU5 C;  2HKN A;  2A28 A;  2F2W A;  2CUB A;  5FWC A;  3P8B B;  1JBM A;  3ZFJ A;  2GTJ A;  2RK2 A;  4J9G A;  1FWZ A;  2M51 A;  1UG1 A;  4C0G A;  2EVR A;  1VIE A;  5FLX E;  3ASK A;  2NUT B;  5LJ5 e;  3PT9 A;  4A4G A;  4M78 G;  2HMA A;  3X25 B;  1S72 Q;  3ME9 A;  3L42 A;  3E19 A;  4OB3 B;  3LH5 A;  2HQE A;  2FPE A;  1BCM A;  1MUZ A;  2ZAE A;  2CSQ A;  1YIT T;  2L8D A;  3OQ5 A;  2FZC B;  2AZV A;  3UA6 A;  5D6X A;  3G7Z A;  1LOJ A;  4P5N A;  1VA7 A;  2NUZ A;  4E7Z A;  3BY7 A;  3SEM A;  2X4W A;  1WHL A;  1T0J A;  3CCV T;  3U23 A;  1NLP C;  1SHG A;  4XTV A;  2HDA A;  2CP0 A;  2L89 A;  3CCV A;  4M7A A;  4C5H A;  2GCX A;  2EYW A;  2DF6 A;  3H0H A;  2DNU A;  2QEX A;  1G3W A;  1CSK A;  1WA7 A;  3HRS A;  5GAN 2;  2VGM A;  1J3T A;  5DM7 R;  4HCB A;  1BBZ A;  4WTO B;  3G4S T;  3VYG A;  5CAI A;  2M02 A;  4JRQ A;  1GFC A;  4IIO A;  3KXT A;  2ZGW A;  1N5Z A;  2EAY A;  3CCJ T;  1MNE A;  1VQP T;  2GTO A;  3PMT A;  4J9F A;  3QBY A;  2D1X A;  1I81 A;  3OBY A;  4Y92 A;  1RI9 A;  2EQJ A;  4Z88 A;  3NMZ C;  3QWY A;  3AHU A;  1ACM B;  5J26 A;  3F70 A;  5CK9 A;  4LXC A;  3M0P A;  2A0F B;  2MF2 A;  2KRN A;  4JJN K;  1VQ7 Q;  1TWB A;  4MML A;  5GAO q;  1ZSG A;  1YFN A;  3OS2 A;  2DFU A;  4M78 C;  4J6W A;  1JJ2 A;  3BFM A;  4E7L A;  4A54 A;  3CCQ T;  2A36 A;  3PIP A;  1NEG A;  4AG1 C;  3CCJ Q;  1YCY A;  1RLP C;  1EFN A;  4UC4 A;  1ZSZ C;  1N6A A;  1M30 A;  4E7K A;  5L23 A;  3CMA Q;  4RUG A;  3CC7 T;  2ATC B;  2DE0 X;  1BI0 A;  1M90 U;  2YLC A;  4BI3 A;  2EJF A;  2M0O A;  5IXF A;  1ZQ1 A;  3TCJ A;  4ESR A;  2LCS A;  1RAH B;  3CBM A;  1VQ7 A;  2QTV A;  4J9I A;  5A0L A;  4JRP A;  1HJD A;  3FJP A;  3QYH B;  4NS5 A;  4N4H A;  3CCS Q;  1D3B A;  4E2F B;  4EMK B;  3CXC A;  2OTJ A;  5IHN A;  2FVU A;  4F7U A;  4M7D A;  1I1J A;  3OS1 A;  3RBB B;  5I21 A;  1I4K 1;  1XQH A;  3RMS A;  4HCK A;  1AEY A;  2O4X A;  2DBM A;  1KSW A;  1W70 A;  1GBR A;  2LZ6 B;  3OB9 A;  2DTH A;  2C0I A;  2O31 A;  3TQ7 P;  1UB4 A;  2M1H A;  5LJ3 f;  5KYW B;  3HP9 A;  4DOV A;  2MK5 A;  2EKH A;  1JJ2 P;  1YJN A;  4DBF A;  2NUP A;  2CGH A;  1N9S A;  2GNC A;  2DX1 A;  4RTU A;  4M77 E;  1NPP A;  2LNV A;  3H0F A;  3CPW A;  4FYW B;  2E10 A;  5HK0 A;  5IT9 E;  1KHI A;  1RAB B;  2W0Z A;  1K73 R;  3NHN A;  3E2U A;  1QCN A;  1GXI E;  1AWW A;  3A8O B;  2V26 A;  1X01 A;  2A3L A;  4Q5W A;  2DZ9 A;  4A4K A;  4VUB A;  1VQO Q;  4EMG A;  3SWN C;  3LH0 A;  4PFZ A;  1H92 A;  1D0Z A;  2FPF A;  3OYC A;  1BKB A;  2HNI A;  2P4T A;  3V7C A;  1G3S A;  1UUE A;  4M75 G;  1PWT A;  4C5E A;  4BI8 B;  3D7S B;  1UGS B;  1WHG A;  2E6N A;  1IO6 A;  3EG0 A;  4AFS C;  4BI4 A;  2RJF A;  4TVR A;  1WJS A;  1VYV A;  1YIT A;  3JCM d;  2DXU A;  4HVU A;  4M78 F;  3QYG B;  1VQL Q;  2V8K A;  4ZN3 A;  3A5Z B;  2NWM A;  3E9G A;  1NJI R;  1YJW Q;  3CXC S;  3FC3 A;  3PIO A;  4JPB W;  3C12 A;  3CQT A;  3GNG A;  3CCM T;  3H0I A;  1VQN T;  1Y7X A;  2GFA A;  2EW3 A;  1VQN A;  3NPF A;  3RKW A;  4AFU C;  4HVW A;  1HD3 A;  4BB7 A;  3M59 A;  1D0X A;  4YTL A;  4C92 F;  3M0R A;  4RTW A;  4MZM A;  1BIB A;  2XK0 A;  4RTX A;  3M57 A;  4PJO E;  3EFR A;  2I2L A;  3UDC A;  2RM4 A;  1BYM A;  1B3Q A;  1YCS B;  3CD6 Q;  2HZY A;  4XU2 A;  5GAN 4;  1VUB A;  2O88 A;  3CCV Q;  3JCM Q;  1GCQ C;  3PFS A;  3GBQ A;  1W6X A;  3G71 T;  3OW2 P;  1QVP A;  1XOV A;  1SG5 A;  2KE9 A;  1AWX A;  3EAE A;  5I11 A;  4C92 G;  5CKE A;  3I5S A;  3MO8 A;  1FYN A;  2Y4Y A;  4F7U F;  2DIQ A;  2EFI A;  1Y07 A;  3QDF A;  1JO8 A;  3JCM W;  1N8R U;  2QQ9 A;  3UAT A;  3VS7 A;  1K73 C;  1Q81 U;  2O2O A;  1VOM A;  1TS9 A;  1SRL A;  1M8M A;  4M4Z A;  4PLL A;  1WI7 A;  3P8H A;  1S72 T;  1O9S A;  5D6Y A;  2BE9 B;  3WVD B;  1VQ5 T;  4PFP A;  4F16 A;  2JZ2 A;  1BU1 A;  4IUP A;  3RR6 A;  3RKY A;  1YIJ Q;  2ROL A;  3QG1 A;  3HTR A;  3OBW A;  2AKK A;  1TU0 B;  3NTK A;  1W2B P;  3TSZ A;  2ED1 A;  1VQ6 A;  4ZGJ B;  1Y71 A;  4PKC C;  3JCM g;  4XTZ A;  3EG9 A;  3LX7 A;  2RJE A;  4D6W A;  3EGU A;  4OGC A;  3PGG A;  4J8O A;  3EHR A;  2DXC A;  4C0D B;  3OSV A;  4KH0 B;  3J7A F;  5GAN h;  2HD0 A;  4Z89 A;  1K0X A;  3MEW A;  5HKC A;  3OYA A;  2VXF A;  4B9W A;  3E9F A;  4F14 A;  5LJ3 e;  1Q95 G;  4OVA A;  4C8Q B;  2ENM A;  2GFU A;  1Y96 A;  3JCM X;  3R6N A;  3TRE A;  3C94 A;  4IUT A;  5GAM f;  1WIE A;  4J9E A;  2LTO A;  4IUU A;  4X9C A;  1TH7 A;  1ZLM A;  1WHJ A;  3FLG A;  1R77 A;  2P0Q A;  3MP1 A;  5GAN d;  1U1T A;  1WQ7 A;  4LNP A;  2VB6 A;  3CCR Q;  3A8H B;  4MMK A;  1ZUK A;  3RMQ A;  3BE3 A;  1NG2 A;  1I0C A;  5IXB A;  4HT9 A;  4PJJ A;  4DA4 A;  5EC7 A;  3SDZ A;  5CIU A;  3GOX A;  1LVK A;  2X4Y A;  2YUQ A;  1YJW T;  2DAQ A;  5GAN 3;  2L5Q A;  1Z9Q A;  1JEG A;  1UHC A;  3VRY A;  5CKD A;  2K4Y A;  2AK5 A;  2EWN A;  1C0M A;  4FCY A;  2DER A;  3OW2 S;  2SEM A;  3EFS A;  3KUF A;  1M5Q 1;  2LQW A;  3CCR A;  2DA9 A;  3QZ5 B;  2RHI A;  1PRM C;  1P92 A;  3MKD A;  2BTT A;  2CP6 A;  3MET A;  4JS5 A;  1K4U S;  2E5Q A;  1AZE A;  2NUT A;  1QVG S;  2QA4 T;  1QP3 A;  2E3I A;  8AT1 B;  1RLQ C;  4JJD A;  4M77 C;  1EZZ B;  2PNI A;  2QAZ A;  2KMT A;  2P0P A;  1T3S A;  3H41 A;  2DEU A;  2LX9 A;  4KGZ B;  1VQN Q;  4M75 C;  5I2S A;  1RAF B;  5AYF A;  4E7J A;  1IB8 A;  1VQK A;  2PVG B;  2XIC A;  3OW2 A;  2DYI A;  4MDX A;  5KE3 A;  4II1 A;  3X24 B;  2KBT A;  1OYX A;  3L1A A;  2X3X D;  5DLQ E;  1X69 A;  3JCM P;  2LQ8 A;  5GAM e;  2BZX A;  1D1B A;  2CT3 A;  3IQL A;  3QWX X;  1EIF A;  2FPD A;  3HFO A;  2HCK A;  2KYB A;  4RTY A;  1M90 R;  2XD0 A;  1NM7 A;  1M3A A;  3QDR B;  2PZ1 A;  4MZT A;  1UTI A;  3FRN A;  2CP3 A;  2J6F A;  2QDY B;  3M5A A;  1VQL T;  3V7S A;  5GMK e;  1C6V X;  3CC2 T;  2DYB A;  3MP6 A;  2K9G A;  4J9B A;  2XID A;  2M9U A;  4J7I A;  2VKN A;  1B07 A;  2LCL A;  2BKD N;  3G6E A;  1SHF A;  1XNI A;  2VAS A;  3T9N A;  2QDL A;  1IRX A;  1AVZ C;  2GGR A;  7AT1 B;  5EG2 A;  2GQV A;  2ZZD A;  4N0A A;  3CCE Q;  3EG3 A;  1UGR B;  3LW5 E;  1M2V B;  4FU6 A;  3L2Q A;  1H3H A;  2FYK A;  2O4X B;  2CH4 A;  3SWN B;  3OYJ A;  2F2X A;  2BZY A;  1G5V A;  1MV3 A;  4M78 B;  1VQ6 Q;  3CD6 T;  3HFN A;  3HKS A;  3DLM A;  4BE2 A;  4Z8A A;  2MCN A;  2KVQ G;  2KGT A;  4KH1 B;  1QVF S;  3M0S A;  4HVV A;  2JTF A;  1ZA1 B;  3EH1 A;  3NFC A;  4C5I A;  1PRL C;  1VQP Q;  1YHQ A;  2J05 A;  4M7D B;  3DB4 A;  2J7I A;  1AHJ B;  1X2K A;  5GAO p;  3C95 A;  4RG2 A;  2G6F X;  2QGG A;  4C0Z A;  1QVG P;  4FSX A;  2K2M A;  4J5Y A;  4XTW A;  4HXJ A;  3JB9 J;  2HEQ A;  4EMK C;  4IIM A;  1B7T A;  2OJ2 A;  3L2V A;  4E7S A;  2CUD A;  4OMO A;  1KQ1 A;  2DLP A;  1SKU B;  1FMW A;  2FG0 A;  2EGE A;  2RMO A;  2E12 A;  3G71 A;  2AHJ B;  1M2V A;  3VS5 A;  1X6O A;  3REB B;  4QKU A;  1B34 B;  4LN2 A;  2ZPI B;  4DOW A;  3JCM h;  2EYY A;  1JB0 E;  2Y90 A;  1OZ2 A;  1KC8 U;  2RB6 A;  2L2P A;  2JM8 A;  3JSC A;  4M78 D;  2EKO A;  4PLI A;  2LC4 A;  4JRI A;  2DM1 A;  2P84 A;  3CC7 A;  1S1N A;  3TSW A;  3MEA A;  4C8Q G;  1ZSZ B;  3I56 A;  2RJD A;  3HL8 A;  1OZ3 A;  2VV5 A;  5CVI A;  1VQM Q;  4PJO F;  2JMA A;  4QQG A;  4LDU A;  5IHI A;  1BI2 A;  3RDV A;  1Y57 A;  5CKH A;  1Q82 U;  1WXT A;  4FM4 B;  5CQX A;  3JCM e;  1M3C A;  3R6O A;  4X34 A;  1SF9 A;  5GAM d;  1YN8 A;  2JTE A;  1M1F A;  4D8D A;  3LWH A;  3JB9 F;  1KC8 R;  2L3R A;  2LRQ A;  4E47 A;  3CBO A;  1IGU A;  4M78 E;  1G83 A;  3OYF A;  1WHH A;  4OGE A;  3H6Z A;  4L5G A;  4CI0 C;  4J9H A;  5GAN e;  4EMH A;  3TVT A;  1VQ5 Q;  4AG2 C;  5KH6 A;  3GPL A;  1FXX A;  3OYH A;  4A4F A;  4M77 G;  5FWB A;  2JS2 A;  1ZX6 A;  5LJ5 f;  1MGQ A;  4F17 A;  2VXE A;  1Q86 R;  3OYK A;  1QWF A;  3REA B;  4RCB A;  1QQJ A;  4IUR A;  1QCF A;  2K5I A;  1NJI C;  2NYS A;  1UGQ B;  4C8Q D;  5FRO A;  1PD0 A;  1E6G A;  5IAY A;  2NUP B;  1G8X A;  4O6J A;  3EG9 B;  2MWP A;  3G6E T;  2HBP A;  1M1K R;  2IVW A;  4M77 F;  4C5G A;  2CDT A;  2MMP A;  3S3N A;  2QG9 B;  3J81 E;  4PFO A;  2VYT A;  2LJ3 A;  4M75 E;  4KBM B;  3CPW P;  1MMN A;  4R0K A;  2BUD A;  5FU6 B;  2CT4 A;  1M27 C;  3M0T A;  1R0B G;  1TXQ A;  1GBQ A;  2E3H A;  1OU9 A;  1LNX A;  3CMA A;  2CZ6 B;  2HL3 A;  5GMK h;  1PHT A;  1JQQ A;  1YJ9 Q;  3J80 E;  4B6M A;  2KY9 A;  2DVE A;  4M7A E;  1M9S A;  3G4S Q;  3CCQ Q;  2MI6 A;  1RAG B;  5IN1 A;  3LWI A;  1AWJ A;  3A98 A;  4J6Y A;  2DXB A;  2QYZ A;  4JZ4 A;  2HSP A;  3N5B B;  5GAN j;  3TEE A;  1Q7Y C;  3MCA B;  1M3B A;  3I56 T;  2RPN A;  3JCM f;  4CRI A;  5D7U A;  1U8R A;  3OSS C;  5LJ5 h;  3JAM E;  1RAI B;  2RNA A;  1YHQ Q;  1UGP B;  1UGV A;  3FJ5 A;  1YJN Q;  5I2M A;  4JRK A;  1Q82 R;  2DZC A;  5LL6 S;  1OU8 A;  2EGC A;  4JLI A;  5KYX A;  1TG0 A;  4PJO G;  1N8R C;  1ZBX A;  3CEY A;  5GAM g;  1YNZ A;  3S3M A;  1W1F A;  1LCK A;  2E65 A;  3CCQ A;  4KUI A;  2XKO C;  5M9O A;  5A0G A;  1OV3 A;  4OMF B;  3CPF A;  5GAN g;  1WLP B;  2DK3 A;  3CCE A;  2EQU A;  3VRZ A;  2XMF A;  1QVF A;  3QPH A;  3X26 B;  1S72 A;  3HHT B;  1IXD A;  4M7A B;  4BD3 A;  4DEX A;  1VQ5 A;  4AT1 B;  2KXC A;  5KYY A;  2DO3 A;  2PU9 B;  4XTU A;  2GF7 A;  4KGX B;  3PVQ A;  4CC3 A;  4RG8 A;  2HAX A;  1QW1 A;  1WFW A;  1WPY A;  4M75 F;  4RTZ A;  1KIK A;  4M7A C;  4GLM A;  2JW4 A;  2FL7 A;  2JMC A;  1K9M U;  2PUK B;  1OPL A;  3V8J A;  3CCU A;  4LD6 A;  3CCU T;  2CS7 A;  1U06 A;  4ZGD B;  2KRO A;  1ZUU A;  1U1S A;  2J06 A;  1VYT A;  2PQW A;  1MND A;  2QGF B;  3RNJ A;  1BB9 A;  1UEC A;  1SEM A;  1GL5 A;  4QQ6 A;  4M77 A;  2G3R A;  2XDP A;  5CKB A;  4FW1 A;  3M4Y A;  4J9C A;  1IRE B;  2XDD A;  4BY6 B;  2E41 A;  6AT1 B;  2CZ1 B;  3QHS A;  2A37 A;  2O9S A;  3CCL T;  1K9A A;  2LCC A;  1BK2 A;  1PG5 B;  2QEX T;  1K76 A;  4JDS A;  3VS1 A;  4FIB A;  4PK4 A;  1NE8 A;  4LUD A;  1UJ0 A;  2RI2 A;  3AT1 B;  3I55 Q;  2EBP A;  3SFM A;  4OB0 B;  1WYX A;  5FW9 A;  1W2B S;  3QKJ A;  5KYU A;  2DET A;  1AWO A;  3UA7 A;  5L8R E;  4F7U B;  3SB2 A;  2EPD A;  2EGA A;  1D0Y A;  2ABL A;  5LJ3 j;  1U5S A;  2QA4 Q;  1HK9 A;  2PVD B;  1D1A A;  2FO0 A;  2LJ1 A;  2ZPB B;  2DL7 A;  1RAD B;  1O75 A;  2HBW A;  5KYN A;  5GAO n;  2YSQ A;  5IHK A;  2YUP A;  3H9N A;  1FX7 A;  1JRI A;  4EIK A;  1AD5 A;  2JJ9 A;  1WJQ A;  1NZ9 A;  1WGS A;  2JVV A;  3EGD A;  4FYX B;  2K5L A;  2X35 A;  4LDX A;  4Y28 E;  2KK4 A;  1VIF A;  1PCX A;  4M78 A;  4IUV A;  2DKG A;  3JCM b;  4M77 B;  4M77 D;  1VQ7 T;  1TOV A;  2RA2 A;  2DL5 A;  2LX7 A;  2K57 A;  1V29 B;  3CCU Q;  3OYI A;  1QLY A;  2XG8 D;  3EG2 A;  1VQ8 A;  3EFO B;  3E1S A;  4IKF A;  2RI5 A;  3PNW C;  4Z02 A;  4C8Q E;  3BDU A;  2E5K A;  4CC7 A;  2V8J A;  2XU8 A;  2KXD A;  3VS3 A;  5GMK l;  4B9X A;  5GAN 5;  1NBE B;  3M9Q A;  4FSS A;  4HCZ A;  1VQO T;  2MIO A;  1VQO A;  5FU6 C;  1YP5 A;  1YJN T;  3X28 B;  2HKQ B;  4M7D C;  1PC0 A;  1JJ2 S;  4ZN1 A;  1KQS A;  2KNB B;  1XJW B;  2MOX A;  3BW1 A;  3EGD B;  1TUG B;  3HSB A;  1VQ8 Q;  3CC4 T;  1MHN A;  2RQU A;  2ED0 A;  1YIT Q;  3CC4 A;  2L0A A;  5D6W A;  2LP5 A;  1IHW A;  2COY A;  4ZTF A;  2GQI A;  3CC2 A;  1VQ6 T;  5GAN f;  2ECZ A;  4C0F A;  1QVG A;  1RL2 A;  2E70 A;  1F1B B;  4WCI A;  4HKE A;  4AFZ C;  4BE0 A;  4PJO C;  2J6O A;  3FDR A;  2C06 A;  2E4H A;  1YBY A;  2DTI A;  3VS0 A;  2L3P A;  4HT8 A;  2WSF E;  4RMO A;  2DRK A;  4KT0 E;  4FT4 A;  1ZBJ A;  1WHM A;  2KYM A;  2RQR A;  3CD6 A;  3RES A;  2QQR A;  4M7D E;  4F04 B;  1WXU A;  2D8J A;  4KUL A;  2LNH B;  2O9V A;  4QW2 A;  3EFO A;  3FIF A;  1Q86 C;  3KFV A;  2ESW A;  1WJR A;  2RF0 A;  2XHC A;  1NEB A;  4XK8 E;  3MJX A;  3VUB A;  4QQD A;  2ZPG B;  4M7D G;  2DBK A;  4FYV B;  2DXT A;  2F5T X;  1KD1 C;  2RO0 A;  2DMO A;  2LVM A;  1I5O B;  2RK1 A;  2OTL A;  3I56 Q;  5CR2 A;  1T3L A;  5FRN A;  3LGL A;  1Q7Y U;  3JCM V;  2YUN A;  1VQP A;  1U3O A;  3EGX A;  2V1Q A;  3GIB A;  5KCH A;  1BCO A;  1NLO C;  2WSC E;  2CP7 A;  3A1P A;  3BDL A;  5GAM h;  5GAN 8;  2LQN A;  1PKT A;  2DRM A;  4M7D D;  2CH4 W;  2KR3 A;  1AT1 B;  1UEB A;  3URG A;  3RER A;  3QSU A;  3LYI A;  2QAS A;  3SWN A;  1FMK A;  3M4G A;  4EDU A;  2PVO B;  4XTY A;  1QVF P;  3DKM A;  3MPU B;  1ZUY A;  1E7O A;  4O5V A;  3CCR T;  3SD4 A;  4C92 E;  3JB9 G;  8ATC B;  4A63 B;  2EQI A;  1WHK A;  3V8L A;  1TSF A;  2NLU A;  2K3Y A;  1WXB A;  2F5K A;  3UF4 A;  2EYQ A;  1I07 A;  5FRM A;  3G6E Q;  1Q7Y R;  2CZ0 B;  2K2V A;  1BI3 A;  1IHV A;  1PKS A;  3VUZ A;  4PJO D;  5IH2 A;  1QP2 A;  1GCP A;  1HSQ A;  2DPP B;  1YWO A;  4J7F A;  5GAO r;  2DJZ A;  4F7U G;  4JS4 A;  1MMA A;  2WSE E;  2KI7 A;  3NTI A;  4N0A C;  2B86 A;  3G1J A;  1YWP A;  1RI0 A;  2E6Z A;  3CCS T;  1VYU A;  2BZ8 A;  2FRY A;  4ZTJ A;  1GFD A;  4OML A;  2JT4 A;  3TU4 K;  3UWN A;  2VUB A;  3NGP A;  2D0Q B;  3M0Q A;  4J6X A;  3VS6 A;  2DL8 A;  4GLK A;  4XTX A;  4A4H A;  2E64 A;  1OI1 A;  2C0O A;  3PVL A;  4XAX B;  3SHW A;  4BDY A;  4GBQ A;  1NYF A;  2YHT A;  1NYG A;  1HYO A;  1WQW A;  5HK3 A;  1Z9Z A;  3QXE B;  4KRT A;  4E7H A;  2X9H A;  4ELY C;  5LJ5 d;  2DIG A;  1R0C B;  1D3B B;  2KAF A;  4EMK A;  4L59 A;  2EJG A;  5CQY A;  1VQ4 T;  3OYE A;  1VQ4 A;  3QJ6 A;  2LT1 A;  1V1C A;  2YRV A;  3CCM A;  1ZA2 B;  1YHQ T;  1ZSZ A;  2F1L A;  3QJY A;  5LJ3 h;  1TTH B;  2X51 A;  3MP8 A;  5J39 A;  3OYL A;  5I22 A;  3ZL7 C;  2OTL Q;  2V1R A;  3C4S A;  2JXB A;  1K8A U;  3L2W A;  1YIJ T;  1SSH A;  5KYW A;  2OAU A;  1OX9 A;  1WNL A;  1QMC A;  4DBR A;  3ZBD A;  1KQ2 A;  1R8O B;  3CCJ A;  1I5L A;  3ZEH A;  1KJW A;  2MPX C;  2ZCF B;  4M75 B;  2O01 E;  3G71 Q;  4C8Q C;  1KD1 U;  3LLR A;  3A8G B;  4JLG A;  2YT6 A;  1KK7 A;  3ULR B;  2QTX A;  2W10 A;  3GP8 A;  1V76 A;  4DEY A;  1WX6 A;  3RUX A;  5C6S A;  1KHC A;  1WZO A;  3CMA T;  2OAW A;  4DBQ A;  2OI3 A;  5FU7 C;  4CC4 B;  2KRM A;  2AT1 B;  2C0T A;  4CC2 A;  4V2S A;  2CRE A;  1X6G A;  4PJM A;  3M54 A;  3DB3 A;  2EQM A;  1K73 U;  2LMJ A;  2IPO B;  5GJV B;  1D1C A;  2X4J A;  1PSE A;  1RAA B;  4ME7 A;  1OOT A;  1VQM A;  4AFQ C;  4XQ3 A;  2QK0 A;  2R5A A;  2ZPE B;  1ABQ A;  2KRS A;  4XU0 A;  1K0S A;  2YRD A;  4KGV B;  2QA4 A;  3OYG A;  3VS4 A;  4OB2 B;  1KG1 A;  2A08 A;  2H8H A;  1K9M C;  2H3E B;  5AT1 B;  2D9T A;  2PTK A;  2AZS A;  3GNF B;  3M56 A;  1YJ9 A;  4ORZ A;  4OMP A;  1X6B A;  4BY6 C;  4KUD K;  4NOY A;  1G3T A;  2YLB A;  2DVJ A;  3LGF A;  1VQK T;  3OMC A;  2DJQ A;  1NJI U;  4L6V 5;  2ZPH B;  1Y0M A;  5GAO m;  3OYM A;  2JN0 A;  1UDL A;  4ANJ A;  1H64 1;  2EYX A;  1M4Z A;  4HCC A;  3CXC P;  4ELZ C;  2DTO A;  4PJN A;  3CCL Q;  4M75 A;  4LE9 A;  5C0M A;  2J6K A;  4JJC A;  4JUV A;  3VS2 A;  3M55 A;  1K8A R;  2FZG B;  3JB9 I;  2MAM A;  1AOJ A;  5KYX B;  4C92 A;  3OS0 A;  4DQ2 A;  1UFF A;  1G2B A;  4BE1 A;  2BE7 D;  2P4R A;  1VQL A;  2A7Y A;  4HA8 A;  1YIJ A;  1BI1 A;  1CKA A;  1RAE B;  1OX8 A;  2OTJ Q;  5LJ5 j;  1KD1 R;  3JCM c;  2HSE B;  3CCS A;  3FEO A;  3EHQ A;  1BIA A;  1LPL A;  2FHD A;  1UHF A;  3VKI A;  3QZ9 B;  5GMK j;  2JOY A;  2VWF A;  4NL2 A;  3I35 A;  4DBH A;  4BAC A;  2CSI A;  3L2Z A;  4M7A D;  5KYY B;  2YWW A;  4FYY B;  1MMD A;  3I9Q A;  2HQX A;  4RKU E;  3CME T;  4PL6 A;  1SRM A;  2I0N A;  4FT2 A;  2P0K A;  3HPW A;  2PUO B;  4JZ3 A;  2VVK A;  4LDY A;  4QVC A;  3THK A;  4J9D A;  2JUF A;  3OS5 A;  4OMN A;  4E6R A;  3VYH B;  3JCM J;  2HQH A;  1VQ9 T;  2CYZ B;  1WDX A;  1VQ9 A;  5LJ3 g;  2K5F A;  4C92 C;  4RTV A;  4N4G A;  1PM3 A;  5GAM j;  1JXO A;  2V8I A;  5GAN 7;  3S6W A;  3JB9 H;  4OMM A;  4A53 A;  2FRW A;  4MDW A;  4RTT A;  3ER0 A;  4RCC A;  2QI2 A; 
#chains in the Genus database with same CATH homology
 4M7A F;  2XU8 A;  3OB9 A;  2DTH A;  2MWO A;  1YI2 T;  5GMK l;  4B9X A;  5GAN 5;  4OF1 A;  2OTL T;  2LDM A;  1UB4 A;  3M9Q A;  4HCZ A;  4C0Z A;  1VQO T;  2M1H A;  4FSX A;  5LJ3 f;  3HP9 A;  1VQO A;  4J5Y A;  4XTW A;  4DOV A;  4NL3 A;  1I8F A;  3JB9 J;  4EMK C;  1YJN A;  5FU6 C;  3VU3 C;  2CGH A;  3HRT A;  1YJN T;  3X28 B;  3L2V A;  5GMK m;  1N9S A;  4M7D C;  3OMG A;  1KQ1 A;  1Q82 C;  1YJ9 T;  1YJW A;  1JJ2 S;  1M1G A;  4ZN1 A;  5CKF A;  1KQS A;  3RKX A;  2E12 A;  3BW1 A;  4Y91 A;  4C92 B;  4M77 E;  1NPP A;  3G71 A;  4PJO B;  2AHJ B;  2LNV A;  3CPW A;  2RHY A;  3HSB A;  1N9R A;  1MHN A;  2E10 A;  5HK0 A;  3CC4 T;  4OB1 B;  1X6O A;  4M7A G;  3V7R A;  1B34 B;  3CC4 A;  5IT9 E;  1KHI A;  2ZPI B;  5D6W A;  4C8Q F;  2QQB A;  4DOW A;  1DJ7 B;  3JCM h;  5A2Q E;  3GLX A;  1GXI E;  4ZTF A;  3CC2 A;  3A8O B;  1VQ6 T;  1JB0 E;  2Y90 A;  4A4E A;  5GAN f;  1OZ2 A;  3OYY A;  2RB6 A;  4C0F A;  1KC8 U;  1X01 A;  2A3L A;  3MHX A;  4Q5W A;  2DZ9 A;  1QVG A;  4A4K A;  4VUB A;  1RL2 A;  2E70 A;  3QUI A;  4XU3 A;  1KC8 C;  1M8V A;  4EMG A;  3SWN C;  4HKE A;  5DLO A;  3JSC A;  3LH0 A;  3OY9 A;  4BE0 A;  3CCE T;  4M78 D;  2EKO A;  4PLI A;  3X20 B;  4PJO C;  2LC4 A;  1G3Y A;  4JRI A;  3FDR A;  4QVD A;  1BKB A;  3OYC A;  2C06 A;  1YBY A;  2DTI A;  2HNI A;  2P4T A;  2H3J A;  3V7C A;  1G3S A;  2ZPF B;  4M75 G;  3L2U A;  3CC7 A;  4HT8 A;  3MEA A;  1VQM T;  4C8Q G;  4C5E A;  4BI8 B;  2WSF E;  2EJ9 A;  2RI3 A;  2RJD A;  3JRZ A;  2LT4 A;  1UGS B;  3HL8 A;  4RMO A;  4KT0 E;  3OYD A;  3I56 A;  2E6N A;  1M1K U;  5GAN 6;  1OZ3 A;  2VV5 A;  4FT4 A;  1HXD A;  5CVI A;  4BI4 A;  2IG0 A;  4PJO F;  2RHX A;  2RJF A;  4LDU A;  1BI2 A;  3NTH A;  4QQG A;  4TVR A;  5LJ5 g;  1WJS A;  5CKH A;  5KE2 A;  2B8A A;  1Q82 U;  2DEQ A;  4FM4 B;  5CQX A;  1YIT A;  3CD6 A;  3JCM e;  3DLL A;  3JCM d;  2DXU A;  2R5M A;  3RES A;  4M78 F;  2QQR A;  4M7D E;  3QYG B;  4C8Q A;  1Y96 B;  2V8K A;  3QO3 A;  3A5Z B;  4ZN3 A;  3E9G A;  5J3B A;  5CCA A;  2R58 A;  2BIV A;  3R6O A;  4X34 A;  3CXC S;  4F7U E;  3FC3 A;  3PIO A;  1NPR A;  2LQK A;  3C12 A;  3GF5 A;  5GAM d;  2RHU A;  4KUL A;  3GNG A;  4J83 A;  4QW2 A;  2QQA A;  4XU1 A;  3Q1J A;  3FIF A;  3CCM T;  1Q86 C;  1M1F A;  1VQN T;  3LWH A;  1Y7X A;  1ZHI A;  2GFA A;  3UT1 A;  3VJP A;  3JB9 F;  1WJR A;  1VQ8 T;  1VQN A;  2XHC A;  3RKW A;  4C92 D;  4XK8 E;  1M1K C;  1PSF A;  2L3R A;  2LRQ A;  2EIF A;  4QQD A;  3VUB A;  4E47 A;  4BB7 A;  3V8K A;  3CBO A;  2ZPG B;  3M59 A;  1B34 A;  4M7D G;  3M58 A;  2DXT A;  1XTD A;  2F5T X;  4YTL A;  2RO0 A;  4M78 E;  2LVM A;  2RK1 A;  3FB9 A;  3WVE B;  4C92 F;  3OYF A;  1KD1 C;  4M7D F;  2OTL A;  4MZM A;  1BIB A;  2XK0 A;  5CR2 A;  4EPC A;  5FRN A;  3LGL A;  4OGE A;  1Q86 U;  1Q7Y U;  3H6Z A;  3JCM V;  3M57 A;  4PJO E;  2RJC A;  4L5G A;  4CI0 C;  3EFR A;  2I2L A;  1VQP A;  2EQK A;  3UDC A;  5GAN e;  2RM4 A;  3GIB A;  4EMH A;  1BYM A;  5KCH A;  4XU2 A;  2KDS A;  1VUB A;  2WSC E;  5KH6 A;  5GAN 4;  3L2R A;  3JCM Q;  3GPL A;  1FXX A;  3OYH A;  4A4F A;  4M77 G;  3BDL A;  2RHZ A;  3VV0 A;  5KCO A;  5GAM h;  5GAN 8;  3OYN A;  3PFS A;  3OA6 A;  4PJO A;  5LJ5 f;  4M7D D;  2VGN A;  4N4I A;  4BDZ A;  3G71 T;  1UEB A;  2DD5 A;  1MGQ A;  1QVP A;  1XOV A;  4RG2 A;  3URG A;  3RER A;  3QSU A;  2VXE A;  3LYI A;  3SWN A;  3CCL A;  3EAE A;  3OYK A;  4C92 G;  5CKE A;  3M4G A;  4EDU A;  2PVO B;  4XTY A;  3MO8 A;  3DKM A;  4IUR A;  4RCB A;  4O5V A;  2Y4Y A;  4F7U F;  2K5I A;  4BUG A;  2DIQ A;  5LJ3 d;  2EFI A;  3G4S A;  1NJI C;  1UGQ B;  4C8Q D;  1Y07 A;  3CCR T;  1KQS S;  3SD4 A;  4C92 E;  5FRO A;  2CZ7 B;  3JCM W;  5IAY A;  3JB9 G;  2QQ9 A;  1N8R U;  1K73 C;  1H3Z A;  2RH2 A;  3CPW S;  3V8L A;  5GAO l;  1Q81 U;  4O6J A;  2NLU A;  4LDV A;  2MWP A;  3G6E T;  2HBP A;  2IVW A;  2K3Y A;  3PMI A;  4M77 F;  2F5K A;  4PLL A;  4C5G A;  2DD4 A;  2EYQ A;  2MMP A;  3S3N A;  3MEU A;  3P8H A;  1O9S A;  3J81 E;  1S72 T;  2VYT A;  4M75 E;  5FRM A;  4KBM B;  5D6Y A;  3WVD B;  2CZ0 B;  2K2V A;  1BI3 A;  1VQ5 T;  3VUZ A;  3UPU A;  2BUD A;  3CBP A;  5FU6 B;  4PJO D;  1QP2 A;  2JZ2 A;  1W4S A;  2DPP B;  4PNO A;  4IUP A;  4J7F A;  3RKY A;  2XDB A;  5GAO r;  3RIR A;  3CME A;  1LNX A;  2DJZ A;  4F7U G;  3CMA A;  2VC8 A;  3QG1 A;  4JS4 A;  2CZ6 B;  2WSE E;  3OBW A;  3NTI A;  5GMK h;  4N0A C;  1RI0 A;  3OYB A;  3NTK A;  2E6Z A;  1VQ6 A;  4ZGJ B;  1Y71 A;  4PKC C;  3JCM g;  3J80 E;  3CCS T;  4IUQ A;  4XTZ A;  4ZGE B;  1Q81 C;  2KY9 A;  2DVE A;  4M7A E;  3LX7 A;  4LD9 K;  4ZTJ A;  3P8D A;  1M9S A;  2RJE A;  4D6W A;  2KQW A;  2MI6 A;  3PGG A;  4J8O A;  4OGC A;  5IN1 A;  3LWI A;  3TU4 K;  2DXC A;  2JTM A;  2VUB A;  4J6Y A;  3UWN A;  3OSV A;  3WXM B;  3O8V A;  2DXB A;  2D0Q B;  4J6X A;  3J7A F;  5GAN h;  2M16 A;  3N5B B;  5GAN j;  2HD0 A;  3TEE A;  4GLK A;  4XTX A;  1Q7Y C;  4A4H A;  3MCA B;  2E64 A;  1OI1 A;  3MEW A;  3QII A;  3I56 T;  5HKC A;  3JCM f;  2JNG A;  3OYA A;  1YI2 A;  2K3X A;  2VXF A;  4XAX B;  4B9W A;  4BDY A;  4CRI A;  2YHT A;  3E9F A;  1WQW A;  5LJ3 e;  4M75 D;  5HK3 A;  3QXE B;  2X4X A;  4OVA A;  4C8Q B;  1U8R A;  4E7H A;  2GFU A;  1Y96 A;  4FL6 A;  4LDW A;  4ELY C;  3OSS C;  4E7I A;  5LJ5 d;  5LJ5 h;  3JCM X;  4R55 A;  3INZ A;  2DIG A;  3TRE A;  1D3B B;  3C94 A;  2KAF A;  4EMK A;  4IUT A;  5GAM f;  3S3O A;  3JB9 D;  1W2B A;  4GY5 A;  4L59 A;  3JAM E;  2EJG A;  5CQY A;  1VQ4 T;  3I55 A;  2LTO A;  3MEV A;  1UGP B;  4IUU A;  5DY9 A;  3OYE A;  4X9C A;  2OTJ T;  1TH7 A;  1VQ4 A;  3I55 T;  3QJ6 A;  2LT1 A;  2YRV A;  5I2M A;  5A0D A;  4JRK A;  3CCM A;  2RD1 A;  1YHQ T;  2DZC A;  5LL6 S;  3QJY A;  3FLG A;  4C0D C;  5LJ3 h;  1K8A C;  2P0Q A;  4JLI A;  3MP1 A;  5GAN d;  1U1T A;  4MZP A;  1M90 C;  4PJO G;  1WQ7 A;  3MP8 A;  5J39 A;  3OYL A;  1N8R C;  2D6F A;  3M53 A;  5FU7 B;  3C4S A;  1ZBX A;  1K8A U;  3A8H B;  4MMK A;  5GMK i;  3L2W A;  1YIJ T;  4R56 A;  2E1H A;  3CEY A;  5GAM g;  2OAU A;  1WNL A;  3S3M A;  2CKK A;  3RMQ A;  3PTA A;  3ZBD A;  1KQ2 A;  1R8O B;  2E65 A;  3CCJ A;  1I5L A;  3HRU A;  3CCQ A;  3ZEH A;  4HT9 A;  1N27 A;  3A8M B;  4KUI A;  2WAC A;  2XKO C;  5M9O A;  2R57 A;  4X9D A;  3H8Z A;  2QQS A;  4OMF B;  5A0G A;  2QXF A;  2ZCF B;  1SSF A;  3CPF A;  2O01 E;  4M75 B;  3SDZ A;  4DA4 A;  5GAN g;  5CIU A;  4C8Q C;  2DK3 A;  4OP0 A;  2FB7 A;  2EQU A;  3GOX A;  2KSS A;  3CCE A;  4ATO A;  2X4Y A;  4QVZ A;  1QVF A;  2XI9 A;  3LLR A;  1KD1 U;  3A8G B;  2DAQ A;  3QPH A;  3X26 B;  5GAN 3;  2L5Q A;  4JLG A;  1YJW T;  1LJO A;  3HHT B;  1S72 A;  4M7A B;  4BD3 A;  1VQ5 A;  5CKD A;  2K4Y A;  2QTX A;  3GP8 A;  2EWN A;  2DO3 A;  2PU9 B;  5CO7 A;  3RUX A;  4WF2 A;  5C6S A;  1KHC A;  4XTU A;  1IZ6 A;  3CMA T;  2GF7 A;  2Y4X A;  3OW2 S;  3KBG A;  5FU7 C;  2F69 A;  3EFS A;  3A8L B;  4RG8 A;  5HY6 A;  2HAX A;  1QW1 A;  3KUF A;  1M5Q 1;  1WPY A;  1X75 C;  3CCR A;  4IKF A;  4M75 F;  4V2S A;  3QZ5 B;  3M54 A;  3DB3 A;  4M7A C;  3P8B B;  2RHI A;  2EQM A;  1JBM A;  2FL7 A;  3ZFJ A;  1K9M U;  2PUK B;  1P92 A;  2RK2 A;  1K73 U;  1FWZ A;  3V8J A;  3CCU A;  4LD6 A;  4C0G A;  3MET A;  4JS5 A;  5FLX E;  1VIE A;  3ASK A;  2X4J A;  1PSE A;  3CCU T;  4ME7 A;  2E5Q A;  5LJ5 e;  2CS7 A;  3PT9 A;  1VQM A;  4A4G A;  4ZGD B;  4M78 G;  2R5A A;  2ZPE B;  4XQ3 A;  4XU0 A;  1QVG S;  3X25 B;  1QP3 A;  2QA4 T;  3ME9 A;  4M77 C;  2QA4 A;  1U1S A;  3L42 A;  3OYG A;  2PQW A;  3E19 A;  4OB3 B;  4OB2 B;  1KG1 A;  2HQE A;  3OS1 A;  1YIT T;  1K9M C;  2L8D A;  2KMT A;  2P0P A;  3OQ5 A;  4QQ6 A;  4M77 A;  2G3R A;  2XDP A;  4C0D B;  2LX9 A;  5D6X A;  2D9T A;  4M75 C;  3GNF B;  5CKB A;  5I2S A;  3M56 A;  3G7Z A;  1LOJ A;  3M4Y A;  1IRE B;  4P5N A;  1YJ9 A;  5AYF A;  2XDD A;  4BY6 B;  3BY7 A;  4BY6 C;  2X4W A;  4KUD K;  4NOY A;  2YLB A;  1G3T A;  2E41 A;  3LGF A;  3CCV T;  1VQK T;  3OMC A;  1NJI U;  2CZ1 B;  3QHS A;  4XTV A;  3CCV A;  2L89 A;  4E7J A;  1VQK A;  4M7A A;  2PVG B;  2XIC A;  4L6V 5;  4C5H A;  3OW2 A;  2GCX A;  2ZPH B;  4MDX A;  5KE3 A;  2QEX A;  5GAO m;  3OYM A;  3CCL T;  2JN0 A;  1G3W A;  4II1 A;  2LCC A;  3X24 B;  2QEX T;  3HRS A;  1H64 1;  5GAN 2;  1OYX A;  1M4Z A;  2VGM A;  4JDS A;  4HCC A;  3L1A A;  5DM7 R;  4FIB A;  3G4S T;  4ELZ C;  1NE8 A;  4HCB A;  2DTO A;  5DLQ E;  3VYG A;  3JCM P;  5CAI A;  2LQ8 A;  2RI2 A;  5GAM e;  4JRQ A;  3KXT A;  2ZGW A;  3SFM A;  3CCJ T;  2EAY A;  4OB0 B;  4M75 A;  5C0M A;  1VQP T;  3PMT A;  3QBY A;  1EIF A;  4JUV A;  1W2B S;  3QKJ A;  1I81 A;  3OBY A;  3HFO A;  2EQJ A;  5L8R E;  4F7U B;  3AHU A;  2XD0 A;  3M55 A;  3SB2 A;  3JB9 I;  2MAM A;  5J26 A;  3F70 A;  4C92 A;  5CK9 A;  3QDR B;  1HK9 A;  5LJ3 j;  4DQ2 A;  2MF2 A;  4MZT A;  3OS0 A;  2PVD B;  3FRN A;  2ZPB B;  3M5A A;  2QDY B;  1VQL T;  4BE1 A;  4JJN K;  3V7S A;  5GMK e;  1VQL A;  1O75 A;  4MML A;  5GAO q;  2A7Y A;  4HA8 A;  3CC2 T;  1YIJ A;  1BI1 A;  5GAO n;  3OS2 A;  3MP6 A;  5LJ5 j;  4M78 C;  3JCM c;  4J6W A;  1FX7 A;  3CCS A;  2XID A;  3BFM A;  3FEO A;  4E7L A;  4A54 A;  1JRI A;  2M9U A;  1JJ2 A;  3CCQ T;  4J7I A;  2LCL A;  3PIP A;  2BKD N;  1BIA A;  3G6E A;  1XNI A;  1WJQ A;  2FHD A;  1YCY A;  3VKI A;  3T9N A;  3QZ9 B;  1NZ9 A;  4UC4 A;  1WGS A;  2JVV A;  2JOY A;  5GMK j;  1N6A A;  4NL2 A;  4E7K A;  5EG2 A;  2GQV A;  2ZZD A;  4N0A A;  4BAC A;  3L2Z A;  3CC7 T;  4M7A D;  2K5L A;  1UGR B;  2X35 A;  3LW5 E;  4FU6 A;  3L2Q A;  4LDX A;  2FYK A;  2O4X B;  2KK4 A;  2HQX A;  4Y28 E;  1BI0 A;  4RKU E;  1M90 U;  3SWN B;  2YLC A;  4BI3 A;  2EJF A;  2M0O A;  4PL6 A;  3OYJ A;  3CME T;  1VIF A;  1G5V A;  4FT2 A;  4M78 B;  1ZQ1 A;  4M78 A;  3TCJ A;  2P0K A;  3CD6 T;  3HPW A;  2PUO B;  3CBM A;  3HFN A;  3DLM A;  3HKS A;  4IUV A;  4LDY A;  4BE2 A;  4QVC A;  2DKG A;  1VQ7 A;  3JCM b;  2JUF A;  4M77 B;  4M77 D;  1VQ7 T;  2KVQ G;  3OS5 A;  5A0L A;  4JRP A;  3JCM J;  3VYH B;  1QVF S;  2JTF A;  3FJP A;  3QYH B;  1VQ9 T;  4NS5 A;  2CYZ B;  4N4H A;  2RA2 A;  1VQ9 A;  3NFC A;  1D3B A;  5LJ3 g;  2K57 A;  2K5F A;  4C5I A;  4EMK B;  3CXC A;  4C92 C;  1V29 B;  2OTJ A;  4N4G A;  2FVU A;  3OYI A;  2XG8 D;  5GAM j;  1VQ8 A;  2V8I A;  4F7U A;  1YHQ A;  4M7D A;  4M7D B;  3E1S A;  5GAN 7;  2RI5 A;  3PNW C;  3S6W A;  1I4K 1;  1XQH A;  4Z02 A;  4A53 A;  3DB4 A;  3RMS A;  5I21 A;  3JB9 H;  4MDW A;  4C8Q E;  2O4X A;  1AHJ B;  3BDU A;  3C95 A;  3ER0 A;  5GAO p;  4RCC A;  2V8J A;  2QI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...