1U1TA

Hfq protein from pseudomonas aeruginosa. high-salt crystals
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hfq protein
publication title Structure of Pseudomonas aeruginosa Hfq protein.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u1tA00
2EAYA 4NL2A 5GANg 1JBMA 5GAN8 2YLBA 5GAN5 4J5YA 4M7AG 4PJOB 4EMKC 4M7DG 2DZ9A 2RA2A 4XTYA 3SB2A 4C8QG 4F7UA 2RD1A 5I21A 3SWNB 3QSUA 5GAOl 4XTXA 3BW1A 4WF2A 4EMHA 2RB6A 2E1HA 5GAOn 5LJ5g 2FYKA 5CAIA 5GMKm 4J6XA 4M77A 4M78A 2EJ9A 4M75F 1B34B 2JN0A 2YHTA 1YCYA 2DXUA 2EJFA 3SWNC 3V7RA 5GANe 5GANf 5GAOq 1HK9A 1WPYA 3JB9D 4XU1A 4C92F 2FB7A 3INZA 3JCMc 4M7AA 3BY7A 4N0AA 4M7DA 3L1AA 3JCMW 1LNXA 3RKYA 4DQ2A 4C8QA 4NOYA 3AHUA 1D3BB 3BDUA 4XQ3A 5GANj 4PJOD 1I8FA 3QHSA 2EJGA 4XTVA 2DEQA 2DKGA 1N9SA 4M75D 5GAMh 5GAN3 4F7UF 4PJOE 3M4GA 3FJPA 4EMKA 1LOJA 3FB9A 5LJ5f 5LJ5e 1HXDA 4M75E 5GAMd 1I81A 2EWNA 4C92D 4C92A 2DTOA 3V7CA 1U1TA 4XTZA 3JCMh 4RCBA 2DTHA 4C92E 1Y96B 3JCMd 3JCMP 4M77F 4M78F 2QTXA 2VXEA 4OP0A 5DY9A 5LJ3h 5GMKh 3HSBA 4PJOC 5LJ3g 5LJ5j 3JB9G 4M75C 4X9DA 3QUIA 5LJ3d 3JCMQ 1TH7A 1MGQA 3SWNA 3V7SA 4EMGA 4M7AF 3V8LA 2RM4A 4JUVA 4XU0A 4M7DF 5GAOp 4C92C 1I5LA 4C8QF 2DJZA 4PJOG 3RKWA 5GAOm 2K57A 4M75G 4M77D 4M78D 3V8KA 1KQ2A 5GAN6 2E10A 1B34A 3RERA 3JCMV 1M5Q1 4M78E 4HT8A 4C92G 2ZGWA 5GAN4 4M7AD 5GAMg 2VXFA 4M7DD 4M75B 4JRKA 2I2LA 4PNOA 4C8QD 3JB9J 2DXTA 4M7DE 1D3BA 4X9CA 3JCMg 4C8QE 3V8JA 1WQWA 4C92B 4M78C 3JCMX 1WQ7A 1M8VA 3L2ZA 4XU3A 2DZCA 5GMKi 3RUXA 5GAOr 4J6WA 4PJOA 3VU3C 3PGGA 3QO3A 2YLCA 2DTIA 2CGHA 2Y90A 4JRIA 4QVCA 1N9RA 4HA8A 3RKXA 4F7UE 1Y96A 4M78G 2E64A 4XTWA 4C8QC 1BIBA 4F7UB 5GAMe 5GAMf 3EFRA 5GANh 1JRIA 5GAN2 5GMKl 1WNLA 5GANd 3JB9H 3FIFA 3GIBA 3EFSA 3JCMf 4A53A 5GAN7 3JB9I 2E65A 4JLIA 3JCMe 4M77E 3JB9F 4M77B 4M78B 4V2SA 5GAMj 2E41A 5LJ3f 3JCMb 5GMKe 5LJ3e 3BFMA 2HNIA 4M7AE 4M7AB 1I4K1 5LJ5h 4RCCA 4M7DB 1LJOA 4PJOF 4Y91A 4HT9A 1H641 1X01A 2DVEA 4M77C 4MMKA 4C8QB 4F7UG 4A54A 5LJ5d 4QVDA 5GMKj 5LJ3j 4NL3A 1KQ1A 2VC8A 4M75A 4XTUA 4M7AC 4EMKB 1BIAA 4J6YA 4MMLA 4N0AC 3RESA 3JCMJ 4M7DC 1U1SA 3HFOA 4XU2A 3RIRA 4M77G 3HFNA
chains in the Genus database with same CATH superfamily
4OMFB 2FPFA 1ZBJA 2YLBA 2FVUA 1S72T 1NJIU 4J5YA 3NMZC 3OS2A 3OMGA 4ME7A 1VQPT 1S72A 1GXIE 4RG2A 3SWNB 2CZ1B 3PMTA 3CCJT 1A0NB 4WF2A 1X75C 2J6KA 3A5ZB 1NLPC 3WXMB 3KBGA 1M2OA 2MPXC 4PL6A 3X28B 3CQTA 1YNZA 1K0XA 2R57A 4XU1A 4BI3A 2E6NA 4AFQC 1N8RU 1NJIR 3QYHB 5GANj 2AZVA 4OB3B 2E70A 3OS1A 1VQ8T 4F7UF 1ABOA 3CCEQ 2QG9B 2OTJA 5GJVB 2CUBA 2WSCE 2HEQA 3MEVA 3UDCA 1RAIB 5LJ3g 2F69A 1AOJA 2EQKA 1OZ2A 4BB7A 2AKKA 2PQWA 1N8RR 4K11A 3M9QA 4RMOA 1AVZC 2E10A 2ATCB 3CCRQ 2FZKB 1KHIA 3HRTA 3L2VA 3OYBA 4HCBA 1G5VA 3OYCA 4HVVA 2JVVA 2JUFA 1VQ7T 2ZPIB 3VU3C 2K7AA 2JM8A 1G2BA 2YRCA 4PLLA 1BIBA 1BU1A 2JMCA 4J9BA 3SDZA 1PRMC 3EFSA 3CD6T 2E65A 4M4ZA 4RTXA 1V76A 5CKDA 3MO8A 3CBPA 4ESRA 2DRKA 2L3PA 4LN2A 1QVFS 2DXCA 2VWFA 2CP6A 1SPKA 4MMLA 3VUBA 3RIRA 4OMOA 3MEAA 2GBQA 3WVEB 4IURA 1VQLQ 2SRCA 2FRWA 4ZGEB 1FMKA 2KROA 1VYUA 1RAFB 3S3OA 1RAHB 4JJCA 2RHIA 1T0HA 1KSWA 3OW2P 2K9GA 1UGVA 2EJ9A 1C0MA 1YN8A 1F1BB 2F5KA 2PVGB 5GAOq 1BI3A 2X4YA 2RK1A 4KH0B 4DOWA 4XQ3A 2V1QA 2DEQA 1KG1A 4E7ZA 7AT1B 3C94A 1M8MA 1GCQC 5FU6B 5LJ5f 1HXDA 1AWOA 3MP8A 2A28A 4AFZC 2VXEA 5DY9A 3EG2A 3OYFA 1ABQA 2QASA 1KD1U 3V7SA 4IIMA 3UPUA 1MV0B 1X6GA 3R6NA 3NPFA 3G6ET 2K6DA 4M77D 4M78D 3VYHB 2KRNA 1TG0A 3H6ZA 9ATCB 4FYYB 2EYXA 4LDXA 2R58A 3JCMX 1KD1R 4OB2B 2DM1A 3OYKA 5FRMA 1JEGA 3META 2E64A 2KAFA 4PFPA 1QVGS 2K3YA 2WSFE 4Z02A 2LVMA 2HMAA 3A8HB 2OTJQ 3CC7T 2E41A 1RABB 4HVWA 2DBMA 3LW5E 3KUFA 3CC7A 2OTLT 2DXBA 4C5IA 2CZ7B 2RQTA 4QVDA 4XTUA 4EMKB 4J6YA 4CC7A 2CP7A 4KT0E 4XU2A 2DL4A 2D1XA 2LQNA 2ABLA 5FLXE 1QP2A 4GLMA 2ED0A 2RHZA 4DOVA 3A98A 3QSUA 2XICA 4J9HA 1BYMA 5IHKA 5D6YA 4IUTA 3GF5A 2FYKA 4M77A 4M78A 2JS0A 1VQ4Q 3M0UA 3N5BB 3BY7A 4N0AA 2WACA 2PVOB 1UB4A 3ZBDA 3DKMA 3AHUA 5CR2A 1T3SA 2LJ1A 2LX9A 3E2UA 3VS6A 3U23A 3FB9A 4JJBA 2EWNA 4FM4B 2P0PA 1QCNA 4XTZA 2EKHA 1VQKA 4JJNK 4F14A 5LJ5j 1TH7A 3ME9A 1VQ9T 1JQQA 2JXBA 4BE1A 3M56A 1OOTA 1FWZA 2DL5A 3J7AF 4M7AD 2W10A 8AT1B 4DBHA 4M7DD 2X9HA 1MNDA 2I2LA 2DBKA 1U5SA 2ZPHB 4RKUE 2CREA 2LDMA 3X20B 2M02A 3GLXA 1YJWA 1Q86U 2SEMA 4RUGA 5KE2A 4C0DB 2VYTA 3CCVT 2EFIA 5CO7A 1QP3A 1QKXA 2FHDA 1WXBA 4PFOA 2AKLA 3O8VA 3LGFA 4AFSC 3OYLA 4VUBA 2X51A 1XOVA 1X01A 1NEGA 4FCYA 4RTYA 1Q86R 3GNGA 3O5ZA 2ZPEB 2KT8A 2O31A 5D7UA 2GFAA 5LL6S 1UG1A 2V8JA 4RTTA 4M77G 2J05A 2DMOA 1NPPA 4QW2A 1K73C 4XTYA 3I55T 1OQKA 4ATOA 1JU5C 5GAOl 2K2VA 3IQLA 1GBQA 3I55A 3CXCA 2QQ9A 1AD5A 1UGRB 4O6JA 4FSSA 3V7RA 3CCUT 2QGGA 1OU9A 2DJQA 3X24B 4M7AA 4FYWB 4M7DA 4AG1C 2CH4W 4NOYA 2G3RA 4IUPA 5KYUA 5FU7C 4M75D 2V1RA 3QJ6A 4DBRA 4D8KA 3CCMT 1LOJA 3H41A 2RMOA 2DO3A 2JTEA 3EG9A 5AT1B 4GBQA 1U1TA 4RG8A 4MDWA 1K76A 1SSHA 1M1FA 3CMEA 4JS4A 2L89A 1Q95G 2F2WA 3FLGA 2K57A 3NTIA 2E3IA 3CBMA 4AG2C 3JCMV 4JZ3A 4M78E 4E7KA 2HAXA 1PKTA 2B8AA 4B9XA 3ULRB 1WX6A 1IHVA 5HY6A 2NUPA 3QXEB 1B07A 3V8JA 1E7OA 8ATCB 1WQ7A 3HP9A 2C06A 3BE3A 2DZCA 4PJOA 5GAOr 4A4HA 1M4ZA 4JZ4A 2YLCA 2YUOA 1S1NA 3CMAQ 4F7UE 1RLQC 4Z89A 1UUEA 1JRIA 2JW4A 5IAYA 1BCMA 2KMTA 1YBYA 1QLYA 3OYAA 1VQKQ 3BFMA 3QYGB 3PTAA 2YUPA 3I56Q 4OB0B 4GY5A 1OPLA 1CSKA 4M75A 2VC8A 1G3WA 4A4GA 4LDWA 5J3BA 3SEMA 4KULA 3OS0A 1VYTA 2JMAA 1K4US 4ZGJB 1PNJA 1QMCA 4M7AG 1W2BS 3CCET 4M7DG 2EVRA 2COYA 1JB0E 3MEUA 4R56A 3I5RA 4XK8E 1BK2A 3CCEA 2KXDA 3EAEA 3PFSA 1YJWQ 4Y92A 1G3TA 2ECZA 1D09B 2XHCA 3I35A 4F04B 4BDZA 1KQSA 2BE7D 2COZA 1VQMA 1TS9A 4XTVA 3CCRT 2VUBA 1ZSZC 2IIMA 2LQWA 5KYXA 3CCRA 2RI5A 2DETA 2EYQA 1QCFA 2F1LA 2LP5A 4C0GA 3SWNA 1YFNA 4FU6A 2BZYA 2XMFA 1VQ5Q 4PJOG 3V8KA 2J7IA 2P0QA 1UE9A 5GAMg 1SHGA 2LT1A 2QQAA 4M7DE 2DIQA 3CXCP 3JCMg 1K0SA 4ZNXA 3L2ZA 1OI1A 1X27A 3M0TA 1NM7A 5FW9A 4OB1B 5GAN2 1G3YA 1WNLA 1VQLT 3JB9H 2FZGB 3NTKA 1MNEA 1I07A 2CP5A 3KXTA 1VQLA 3TCJA 3UF4A 2HSPA 3FC3A 3CMEQ 4LDYA 1WXTA 2YT6A 4IKFA 1G8XA 5CK9A 3RDVA 2J6FA 1IGQA 2EAYA 2GGRA 3LH5A 5GAN5 1YHQA 2DL3A 2DZ9A 2H3EB 4LXCA 1K9AA 3H0HA 4J9CA 4P5NA 2HBWA 2OJ2A 2EJFA 5GANe 2L3QA 1QQJA 2G6FX 1M2VB 2CUDA 1IRXA 3QG1A 4MZMA 3UA6A 3JCMW 2YUQA 1M90C 1D3BB 2CKKA 2K4YA 1MHNA 5GAN3 2L0AA 5GAMd 4M75E 1UGSB 4A63B 3NHNA 4PFZA 1WHMA 3M54A 1HJDA 2NWMA 1RAEB 3JCMd 4M77F 4M78F 3VRZA 5GMKh 3CCSQ 3HSBA 2H3JA 3JB9G 3QDFA 2V8IA 1K8AC 2LNVA 2M0OA 2VV5A 1PC0A 1Q81U 2CS7A 4LD6A 2A08A 1M30A 4GLKA 5GAN6 2EQMA 4X1VA 3HHTB 2BUDA 2OTJT 2RQUA 3JB9J 3VS3A 2EQJA 4JPBW 4M78C 1SF9A 3H8ZA 3RMQA 2HDAA 3QO3A 3PE0A 1Q81R 4JRIA 4L5GA 4J9GA 3VJPA 4HA8A 2DVJA 1VQMQ 1KQSP 3TQ7P 1G3SA 2D8HA 3FIFA 2BTTA 1FMWA 1QWEA 2K3BA 4ZGDB 4JLGA 2XK0A 5J39A 5DLOA 3G4SQ 4RCCA 1I0CA 5KYYB 1Q82U 1VQ4T 5KYNA 2DF6A 1NEBA 2NYSA 1VQ4A 2KYMA 3LWHA 2XG8D 1WFWA 3OBWA 3PIPA 5HCKA 3NFCA 1Q7YU 1JJ2A 4CC4B 2NUTB 2QTVA 3OYNA 2O4XB 1LPLA 1Q82R 1EFNA 2W0ZA 2DXUA 3M0QA 3AT1B 1TWBA 1HK9A 1WPYA 2D9TA 3UWNA 1P92A 4J83A 4BE0A 3PVLA 2DD4A 4DQ2A 2MWPA 2QQBA 3WVDB 1Q7YR 1W6XA 5GAMh 4EMKA 5KH6A 2A3LA 2EKOA 3GBQA 3JCMh 3M0RA 5EC7A 1WHKA 1YJ9Q 3L42A 5DM7R 1QWFA 3EGUA 2X4XA 1J3TA 1SHFA 1TTHB 2RI2A 5LJ3d 4M7AF 2DL7A 2RM4A 4M7DF 1I5LA 1WJSA 1U8RA 5GAOm 1RL2A 2A0FB 1YHQQ 2PU9B 2ZAEA 1GBRA 4HT8A 3VYGA 3LH0A 5M9OA 4J9DA 4JRKA 2DXTA 4X9CA 2CP0A 2MYSA 2KSSA 4ZN1A 5CVIA 2FEIA 3QDRB 3ZL7C 3J80E 2QA4A 4QVCA 1KC8U 2Y4YA 1X43A 3A1PA 2VVKA 1M1KU 1YJNQ 2VASA 1JXOA 3OW2S 5GAN7 3EG0A 3JCMb 4BACA 1D0XA 1V1CA 1W70A 4PJOF 4FT2A 2RPNA 4MMKA 4HCCA 4ORZA 2RQWA 1PG5B 2MWOA 1KQ1A 1KC8R 1M1KR 3HFNA 5D6XA 2K5FA 1WJQA 3LYIA 4E47A 1VQPQ 2LNHB 1NLOC 3CBOA 1KK7A 2GQVA 3CCJQ 2DERA 3OMCA 2RB6A 1TSFA 1M9SA 1HYOA 4M75F 4BY6C 1BI2A 6AT1B 1ZSZB 3FEOA 1FXXA 3HKSA 2VKNA 1OZ3A 2ESWA 1PCXA 3ZFJA 5LJ5e 1WZOA 3DLLA 2E4HA 2PVDB 1ZUKA 5IHIA 2C0TA 1Y07A 3EFOB 3FJ5A 1NYFA 3EGXB 1LCKA 5LJ3h 4E7JA 4M75C 4BE2A 3QUIA 1QVPA 2X3XD 3M0PA 4LDUA 4Q5WA 3BDLA 3CMAT 1NBEB 1Y7XA 2XIDA 2LX7A 4RTZA 3CMAA 1IREB 1VQNQ 2CZ0B 3PT9A 3CC2A 1D0ZA 4C92G 3C12A 1VQKT 3T9NA 2PUKB 1JJ2P 2YXYA 3GP8A 2HKNA 4C92B 1X6OA 3MHXA 2JOYA 4QVZA 2QDYB 5GMKi 3I56A 1WYXA 3PGGA 1TXQA 2CSQA 5GAMf 5CKEA 5GMKl 4EDUA 1DJ7B 2JJ9A 4HCZA 3JCMf 2PZ1A 3JB9F 2XDBA 1UHFA 1YI2A 2CT4A 4ELZC 5I11A 2GFUA 4O5VA 3EH1A 4C8QB 3A8MB 4HCKA 1YJWT 1D0YA 5GMKj 2GQIA 1U06A 5CQXA 3VS7A 3OYYA 2O9SA 1SG5A 4IUVA 3DLMA 4FW1A 2P4RA 1BBZA 5I21A 3BW1A 4F16A 3MJXA 2KQWA 2RN8A 5IH2A 3QWXX 1AZEA 4JJDA 1ARKA 3OYEA 1CKBA 1YCYA 2QA4Q 3UATA 2KXCA 4J9FA 1YITA 1VQ5T 1XQHA 5IN1A 4AFUC 1VIEA 1MMGA 3CPWA 1BB9A 3OSVA 5HK0A 1VQ5A 2DEUA 4PJOD 3QHSA 1O9SA 4EIKA 5HK3A 4JRQA 4JS5A 1OX9A 1KFZA 3LX7A 2DTHA 5CKFA 3CC4Q 3I9QA 1IXDA 2EYWA 2CP3A 1TOVA 1SRMA 1W4SA 3ZEHA 4PK4A 5CKBA 2OX7A 4OMQA 4BI8B 3G6EQ 4ZTJA 1E6GA 2DYIA 3VS4A 1OEBA 2EGAA 2L5QA 1C6VX 2CYZB 3VS2A 2JNGA 2GNCA 1N5ZA 3CCQA 5I2SA 3HPWA 1WHLA 4MZPA 3CMET 2O2OA 2YWWA 4ZN3A 2EPDA 2HD0A 4QT7A 2KI7A 3RUXA 4J6WA 2DRMA 1YCSB 3S6WA 2IG0A 2NLUA 2DTIA 2OI3A 2RNAA 1N9RA 3HRUA 3OSSC 4F7UB 4PKCC 5KCHA 2HQEA 2L3RA 3GIBA 2QXFA 1YIJA 1WIEA 4M77E 4C0ZA 5GAMj 5LJ3f 2KNBB 3M59A 1WDXA 4Y91A 3QPHA 2QEXQ 3NTHA 3C4SA 1NE8A 3PVQA 2RHXA 2EYYA 2RQVA 4KUDK 1T3LA 2AIRB 2JM9A 3HFOA 3JRZA 4A4FA 1RI0A 4BD3A 1PKSA 3CC2Q 2IPOB 4DEYA 3G7ZA 4OMLA 2LC4A 1IO6A 4A4EA 1NJIC 1M3AA 3MCAB 4QQGA 3CCST 3CCSA 3JB9D 2LCSA 1AZGB 1PHTA 3JCMc 2LMJA 1RUWA 2VB6A 3OYIA 3SFMA 1QCOA 2I0NA 1N9SA 2XKOC 4ELYC 1YI2Q 1QW1A 2QAZA 1N8RC 2KDSA 1I81A 2COWA 1IGUA 1SKUB 4OP0A 1ZX6A 4LE9A 1VQOQ 1V29B 2LZ6B 2MMPA 2GCXA 2K5LA 2ZZDA 3MP1A 3HTRA 2B86A 2Y4XA 2DJZA 1VQMT 3OB9A 2D6FA 2HCKA 1G83A 2RI3A 1M5Q1 1M2VA 1M3CA 5KYWB 1GRIA 3RNJA 3G4ST 1D3BA 1B3QA 3QZ9B 2HSEB 3PNWC 1KJWA 3G4SA 2ZPBB 2RH2A 2HQXA 5DLQE 1YITQ 3M5AA 3VS5A 2Y90A 2AK5A 1Q82C 3CPWP 2LQ8A 1QVFA 3H0IA 2MAMA 4NS5A 2QQSA 4M7AE 4CRIA 4R55A 2DVEA 2YRVA 5LJ3j 2F2VA 3P8HA 4BUGA 4RTWA 3JCMJ 3RESA 1K73U 2DNUA 4MZTA 3RBBB 3C95A 1M1GA 2E3HA 4II1A 2M0YA 1JBMA 1T0JA 1PD0A 2BKDN 2ED1A 5J26A 4BY6B 2JT4A 2RD1A 3CCQQ 2XDDA 2DILA 3CPWS 1YJ9T 4EMHA 2E1HA 3R6OA 4FW2A 3E19A 5GAOn 5A0LA 1YJ9A 2BZXA 1K73R 1VUBA 4KBMB 2LT4A 1BI1A 3A8GB 1EIFA 2FB7A 2DX1A 3L1AA 4B9WA 3RKYA 3CXCS 1VYVA 1YHQT 1HD3A 1YIJQ 1U3OA 5KYYA 2OAUA 4PJOE 3FJPA 2X35A 3FDRA 2RF0A 4OMPA 5GJWB 3JSCA 4X34A 1WLPB 2VGMA 1UJ0A 3ASKA 3JCMQ 1MGQA 4PJLA 2NUTA 4XU0A 3G71A 4C5EA 2O4XA 4AT1B 1YJNT 1KD1C 3RERA 1ACMB 3L2RA 5CIUA 1YJNA 2L8DA 4C0DC 2YSQA 1RAGB 1X2QA 4C5GA 1NYGA 1UTIA 1QVGA 3S3NA 2QYZA 3VV0A 4EPCA 1GFDA 5C0MA 1OULA 1K9MU 1BKBA 4J7IA 4OF1A 1Y57A 2LRQA 2CZ6B 2LCLA 4CC3A 2L3SA 1MMAA 5L23A 1VQPA 3EGDB 3OYGA 1FYNA 1I4K1 3SHWA 2D8JA 3EHRA 4HT9A 5IHNA 3CCJA 1H641 4M77C 4A54A 5A0DA 1OU8A 3GPLA 3OS5A 1K9MR 2X4JA 4N0AC 1YWOA 1M3BA 1JO8A 4IIOA 1Z9QA 4PJJA 3THKA 2RA2A 3HRSA 1VQ8A 3H9NA 2DD5A 4RTVA 1QKWA 1N6AA 1TU0B 2DYBA 1MV3A 5GMKm 4JRPA 1UHCA 4QQDA 4OGCA 1B34B 3CEYA 3TU4K 1VQ6Q 2EW3A 2LJ0A 2P0KA 2QDLA 1UEBA 3BDUA 5A2QE 1VQNT 2KEAA 1QVFP 1VQNA 4C92D 2PNIA 3L2WA 3V7CA 1Y96B 2QI2A 1KQSS 1H3HA 1D1CA 5CKHA 3QIIA 3EH2A 3UT1A 2L2PA 5FU7B 1VQ7A 3V8LA 4E7HA 3MPUB 3FRNA 4BDYA 1ZHIA 1KQ2A 3Q1JA 1VA7A 1YWPA 1ZSZA 1H92A 2CDTA 3M55A 4FSXA 3CD6A 4C8QD 1X2KA 2FL7A 3L2QA 1UFFA 4QQ6A 1VIFA 4XTWA 3EFOA 4XAXB 1UJYA 2EGCA 3EFRA 3EGXA 1OV3A 3DB3A 2HBPA 4LUDA 4FIBA 1Q86C 2FPEA 4V2SA 1RLPC 4PLIA 2JTFA 4QKUA 2FO0A 2EYZA 2ROLA 2GTJA 2QA4T 3G71Q 2M16A 4NL3A 2JTMA 5IT9E 1SEMA 4B6MA 1XTDA 4M7AC 4J7FA 1BIAA 3CPFA 4M7DC 1GCPA 3REBB 1U1SA 2RJFA 2JZ2A 4C92A 3CCLQ 2RK2A 5GANg 1E6HA 1WHHA 4IUQA 2F2XA 2V8KA 5KE3A 3OYMA 2D0NA 2LJ3A 2O88A 4XTXA 5IXFA 3CC4T 1QVGP 2E5QA 1M90U 2LTOA 3CC4A 3MP6A 3UA7A 1K1ZA 2QK0A 1AWWA 2CH4A 4LUEA 2KRSA 4C8QA 4YTLA 3OQ5A 1S72Q 2DKGA 3G6EA 2DPPB 3M4GA 1NPRA 1K8AU 3GOXA 1M90R 4PJOC 1PRLC 3MKDA 3JAME 2KE9A 2RJEA 2DFUA 1I5OB 1GL5A 3VKIA 1D1BA 3D7SB 3EHQA 3G1JA 1BI0A 2KRMA 2ZGWA 1NG2A 1VQ8Q 1K8AR 1M27C 1UECA 2VXFA 2KBTA 2YUNA 1O75A 4F17A 2K3XA 3M57A 4LDVA 2J06A 2RJDA 3LGLA 4ZTFA 2QEXT 4XU3A 3E9FA 3GNFB 2OTLA 1I1JA 1SSFA 2QEXA 2CGHA 2FZCB 3RKXA 3A8OB 3CC2T 2J6OA 5GANd 2ZCFB 2LCCA 1Y71A 4BI4A 5GMKe 1AWJA 3I56T 2HL3A 2MI6A 1C1AA 3M0SA 1W2BA 1VQ7Q 4L59A 1PSFA 4KH1B 5FRNA 5D6WA 4L6V5 1KIKA 2AT1B 2P4TA 5ECAA 4NL2A 1YI2T 3E1SA 3PIOA 3CD6Q 2RJCA 2R5AA 2ROTA 3SB2A 2CP2A 1TUGB 4C8QG 4F7UA 1IHWA 3PMIA 1JXMA 2HQHA 5CAIA 1VQOT 3LLRA 3SWNC 1WI7A 1VQOA 3M53A 1OX8A 1JJ2S 2F5TX 4E7LA 1VQ9A 1W1FA 1LNXA 2CSIA 1RADB 2PUOB 1UGQB 1UGPB 2XI9A 4KGZB 4FT4A 4JDSA 2M9UA 2MCNA 1GFCA 4RCBA 2ENMA 4J8OA 4C92E 2E12A 4X9DA 1YITT 1RACB 5IXBA 4RTUA 2R5MA 3URGA 1X69A 2DLPA 4HVUA 4J9IA 3CCVA 2E5KA 4IUUA 4HKEA 1RAAB 4PNOA 1WHGA 2C0OA 1WHJA 3LWIA 4C8QE 1M8VA 2EQUA 2PTKA 3OYJA 3H0FA 5AYFA 1OYXA 4CI0C 4M78G 5GANh 5GAMe 2KK4A 1H3ZA 1TUCA 2M1HA 3X25B 3JCMe 4A4KA 3JV3A 4M77B 4M78B 4D8DA 2DIGA 3CCQT 1GCQA 3X26B 1R8OB 2O01E 3OYHA 1LJOA 4DEXA 2BIVA 4N4HA 4F7UG 1PD1A 2DE0X 2RQRA 1XJWB 2RHUA 3C0CA 3EG3A 1ZA1B 1ZUYA 1AEYA 5KYWA 2XD0A 2O9VA 4KRTA 4FYXB 1FX7A 3EG1A 3CCUA 5FROA 1R0BG 1YIJT 5KCOA 3I5SA 2ZPGB 2KGTA 1UDLA 2M51A 3QWYA 3CCMA 3CC7Q 1HSQA 4E2FB 2KT1A 2LQKA 2OTLQ 3TSWA 5EG2A 1WJRA 5LJ5g 2MOXA 3QZ5B 1WA7A 5L8RE 3F70A 3OBYA 1R77A 1H8KA 2MF2A 1VOMA 1I8FA 2EGEA 4OMNA 3TEEA 1KHCA 2DAQA 2A7YA 3OA6A 2DTOA 2GF7A 1B7TA 2VGNA 1AWXA 5A0GA 2KY9A 2QTXA 4KUIA 5FU6C 1W2BP 1OPKA 2V26A 2HZYA 2FG0A 2RHYA 2RO0A 4JUVA 2YRDA 5GAOp 1FMVA 1EX4A 3RKWA 4N4IA 1PSEA 3M4YA 4Z88A 4E6RA 1PWTA 1IB8A 2K79A 1NZ9A 1K9MC 1Q81C 5FWBA 1N27A 2MIOA 1Z9ZA 1ZLMA 3QBYA 3DB4A 4FL6A 2YDLA 1WQWA 1MMDA 3P8DA 1WXUA 1Y0MA 2NUZA 2MK5A 2K5IA 2EBPA 2HL5C 2K2MA 1VQ9Q 4TVRA 4A53A 1TUDA 3KFVA 3TSZA 2H8HA 3E9GA 3TREA 2KYBA 1XNIA 2GTOA 4N4GA 3VS0A 3VS1A 5LJ3e 2QQRA 4M7AB 3J81E 4M7DB 2AHJB 1YP5A 1ZQ1A 5LJ5d 2X3WD 4KGXB 5KYUB 1ZA2B 1VQ6T 1MUZA 4LD9K 5CCAA 4AMCA 3EG9B 1VQ6A 4WCIA 2Z0WA 5GAN8 1D1AA 3CCVQ 1ZUUA 3S3MA 4C0FA 3HL8A 3RR6A 4R0KA 4EMKC 3A8LB 4FYVB 3NGPA 2DL8A 2BZ8A 5C6SA 4E7IA 4HXJA 1Q7YC 4J6XA 2YHTA 2JN0A 5GANf 2DA9A 2A36A 4E7SA 3OYDA 4ANJA 3EGDA 4C92F 3INZA 1SRLA 3ER0A 4DBQA 3OY9A 2XU8A 4LNPA 2NUPB 3L2UA 2EJGA 4J9EA 2FRYA 4PJNA 4PJOB 3I55Q 1PM3A 2ZPFB 1IZ6A 2D0QB 4OVAA 1AHJB 4D6WA 4EMGA 3M58A 3CCUQ 4C92C 2P84A 2EIFA 4C8QF 5FWCA 2CT3A 3VRYA 4M75G 1MMNA 1RI9A 1B34A 1LVKA 1AT1B 2EQIA 2WSEE 5GAN4 2A37A 3CCMQ 4UC4A 2AZSA 3P8BB 4Y28E 1WGSA 5CQYA 4M75B 4MDXA 5HKCA 1CKAA 3RMSA 2XDPA 1EZZB 3OW2A 5I2MA 2KVQG 3G71T 2DK3A 2HKQB 3REAB 3MEWA 4Z8AA 2JS2A 2KR3A 1ZBXA 1Y96A 2FPDA 3VUZA 3SD4A 4C8QC 3CCLT 4DA4A 3JCMP 2IVWA 4OMMA 3TVTA 3CCLA 4C5HA 2QGFB 2OAWA 3JB9I 2X4WA 4JLIA 4WTOB 4DBFA 1KC8C 1X6BA 1M1KC 2HNIA 1R0CB 4PJMA 5I22A 4KGVB 5LJ5h 3QKJA 1ZSGA 4OGEA 2BE9B 1BCOA 5KYXB 2C0IA 4CC2A 2E6ZA 3QJYA
chains in the Genus database with same CATH topology
4OMFB 2RK2A 5GANg 2YLBA 2FVUA 3DLMA 1S72T 4IUQA 1NJIU 4J5YA 4ZGJB 3OMGA 2V8KA 4ME7A 5KE3A 3OS2A 3OYMA 1W2BS 3CCET 4M7AG 4M7DG 1JB0E 1VQPT 1S72A 3MEUA 1GXIE 5I21A 4R56A 4RG2A 4XK8E 3SWNB 4XTXA 3BW1A 3CCEA 2CZ1B 3PMTA 3CCJT 3CC4T 4WF2A 1X75C 2KQWA 3A5ZB 3EAEA 3WXMB 3PFSA 2E5QA 3KBGA 2LTOA 1M90U 3CC4A 3OYEA 1YCYA 3MP6A 4PL6A 3X28B 1G3TA 3UWNA 2R57A 4XU1A 4BI3A 1YITA 2XHCA 2E6NA 1VQ5T 1XQHA 5IN1A 4BDZA 1N8RU 1KQSA 1VIEA 3CPWA 4C8QA 3OSVA 3QYHB 1VQMA 4YTLA 5HK0A 5GANj 3OQ5A 3QHSA 4OB3B 1VQ5A 2E70A 4XTVA 3OS1A 2DKGA 2VUBA 2DPPB 3G6EA 3CCRT 1VQ8T 4F7UF 3M4GA 1O9SA 1NPRA 5HK3A 4JRQA 4JS5A 3CCRA 2RI5A 1K8AU 3LX7A 2OTJA 2EYQA 2WSCE 3GOXA 2DTHA 3MEVA 5CKFA 3UDCA 4PJOC 5LJ3g 2F69A 3JAME 2EQKA 2RJEA 1OZ2A 4C0GA 4BB7A 2PQWA 3SWNA 1W4SA 3ZEHA 4FU6A 5CKBA 4PJOG 3VKIA 4BI8B 3M9QA 4RMOA 3V8KA 4ZTJA 2E10A 4LDWA 1BI0A 2P0QA 2L5QA 1KHIA 2ZGWA 3HRTA 3L2VA 5GAMg 2VXFA 3OYBA 4HCBA 1G5VA 1O75A 2LT1A 2CYZB 2QQAA 2JNGA 2K3XA 3CCQA 4M7DE 3M57A 2DIQA 3HPWA 4MZPA 3JCMg 5I2SA 4LDVA 4ZN3A 2JVVA 2JUFA 2RJDA 3LGLA 3CMET 4ZTFA 2QEXT 3L2ZA 2HD0A 4XU3A 1OI1A 3E9FA 3RUXA 3GNFB 4J6WA 1VQ7T 2OTLA 2ZPIB 3VU3C 3S6WA 1SSFA 2IG0A 2NLUA 2QEXA 2DTIA 2CGHA 1N9RA 3HRUA 3A8OB 4PLLA 3RKXA 3OSSC 4F7UB 1BIBA 4OB1B 4PKCC 3SDZA 5KCHA 3CC2T 5GAN2 1G3YA 1WNLA 2HQEA 5GANd 1VQLT 3JB9H 2L3RA 2ZCFB 3NTKA 3GIBA 2QXFA 2LCCA 3EFSA 1YIJA 3CD6T 2E65A 1Y71A 4M77E 3KXTA 1VQLA 3TCJA 5CKDA 4C0ZA 5GAMj 3MO8A 3CBPA 5LJ3f 4BI4A 5GMKe 3M59A 3I56T 3FC3A 4Y91A 3QPHA 2MI6A 4LDYA 3NTHA 3C4SA 2DXCA 1W2BA 1QVFS 4L59A 1NE8A 1PSFA 2RHXA 4IKFA 5FRNA 5D6WA 5CK9A 4KUDK 4L6V5 4MMLA 3VUBA 2P4TA 3HFOA 3JRZA 3RIRA 4A4FA 3MEAA 1RI0A 2EAYA 4NL2A 3WVEB 4BD3A 4IURA 4ZGEB 5GAN5 1YI2T 3E1SA 3PIOA 1YHQA 2RJCA 2DZ9A 2R5AA 3SB2A 3G7ZA 4C8QG 4F7UA 2LC4A 3S3OA 3PMIA 4A4EA 2RHIA 1NJIC 3MCAB 4QQGA 3CCST 4P5NA 5CAIA 1VQOT 3LLRA 2EJ9A 2EJFA 2F5KA 2PVGB 3SWNC 5GANe 5GAOq 3CCSA 1BI3A 3JB9D 3QG1A 1VQOA 4MZMA 3M53A 2X4YA 3JCMc 1JJ2S 2F5TX 4E7LA 1VQ9A 2RK1A 3JCMW 1LNXA 3OYIA 1M90C 4DOWA 1D3BB 2CKKA 4XQ3A 2K4YA 3SFMA 2PUOB 1UGQB 1UGPB 2XI9A 2DEQA 1MHNA 1N9SA 2XKOC 4ELYC 5GAN3 1KG1A 1QW1A 3C94A 5FU6B 4FT4A 5LJ5f 4JDSA 5GAMd 1HXDA 2M9UA 4M75E 2KDSA 1I81A 1UGSB 4RCBA 3M54A 4J8OA 4C92E 3MP8A 3JCMd 4M77F 4M78F 5GMKh 2VXEA 4OP0A 5DY9A 2E12A 2H3JA 3HSBA 3JB9G 3OYFA 2V8IA 4X9DA 1YITT 1K8AC 1V29B 2LNVA 1KD1U 2M0OA 2MMPA 2VV5A 3V7SA 2GCXA 2K5LA 2ZZDA 3MP1A 2R5MA 3UPUA 1Q81U 2CS7A 2DJZA 2Y4XA 4LD6A 3URGA 1VQMT 3OB9A 4GLKA 3G6ET 4M77D 4M78D 2D6FA 5GAN6 3VYHB 2RI3A 2EQMA 1M5Q1 3HHTB 3H6ZA 2BUDA 3CCVA 2OTJT 4IUUA 4HKEA 4PNOA 3JB9J 4LDXA 3G4ST 2R58A 1D3BA 2EQJA 3QZ9B 3LWIA 3PNWC 4C8QE 3JCMX 4DA4A 4M78C 2EQUA 1M8VA 3G4SA 2ZPBB 4OB2B 3H8ZA 3OYKA 3OYJA 5FRMA 3RMQA 2RH2A 2HQXA 5DLQE 5AYFA 3M5AA 3QO3A 1OYXA 2Y90A 4JRIA 4L5GA 4CI0C 3VJPA 4HA8A 3META 4M78G 2E64A 2KAFA 5GANh 5GAMe 1Q82C 2KK4A 1G3SA 1H3ZA 2LQ8A 1QVFA 2M1HA 3FIFA 1QVGS 2K3YA 2WSFE 4Z02A 3X25B 4ZGDB 2LVMA 3JCMe 4A4KA 3A8HB 4M77B 2MAMA 2XK0A 4JLGA 2DIGA 4M78B 5J39A 3CCQT 2E41A 3CC7T 4NS5A 2QQSA 5DLOA 3X26B 1R8OB 3LW5E 4M7AE 2O01E 3KUFA 4RCCA 4CRIA 1LJOA 3OYHA 2BIVA 3CC7A 2DXBA 2OTLT 4C5IA 4R55A 2DVEA 2CZ7B 4N4HA 4F7UG 2RHUA 1Q82U 4QVDA 2YRVA 5LJ3j 3P8HA 4BUGA 1VQ4T 2XD0A 4XTUA 1FX7A 4EMKB 4J6YA 3JCMJ 3RESA 1K73U 4KT0E 4MZTA 3CCUA 4XU2A 5FROA 3C95A 1M1GA 1VQ4A 4II1A 1YIJT 1JBMA 5KCOA 2ZPGB 5FLXE 1QP2A 2BKDN 3LWHA 2XG8D 3OBWA 2RHZA 5J26A 3NFCA 3PIPA 1Q7YU 4BY6B 4DOVA 1JJ2A 2RD1A 3CCMA 3QSUA 4KULA 2XICA 2XDDA 3OYNA 3CPWS 1BYMA 1YJ9T 5D6YA 2LQKA 4PJOD 4EMHA 2O4XB 2E1HA 4IUTA 5EG2A 1WJRA 2FYKA 3GF5A 3R6OA 5LJ5g 3E19A 4M77A 4M78A 5GAOn 5A0LA 1YJ9A 2DXUA 1HK9A 1WPYA 2D9TA 1VUBA 1P92A 2LT4A 1BI1A 3A8GB 3QZ5B 4J83A 1EIFA 2FB7A 3N5BB 4KBMB 4BE0A 2DD4A 3BY7A 4N0AA 5L8RE 3F70A 3L1AA 3OBYA 2WACA 4B9WA 2PVOB 3RKYA 1UB4A 3ZBDA 3DKMA 4DQ2A 2MWPA 2QQBA 3WVDB 5CR2A 3CXCS 2LX9A 2MF2A 1I8FA 1YHQT 2OAUA 5GAMh 3TEEA 1KHCA 4PJOE 2DAQA 2X35A 3FB9A 3FJPA 4EMKA 5KH6A 2A3LA 2EKOA 2EWNA 2A7YA 3OA6A 4FM4B 3FDRA 2DTOA 2GF7A 2P0PA 4XTZA 3JCMh 1VQKA 2VGNA 3JSCA 4X34A 3JCMP 5A0GA 4JJNK 2KY9A 2QTXA 2VGMA 3L42A 4KUIA 5DM7R 5FU6C 2C06A 2X4XA 5LJ5j 3ASKA 5LJ3d 3JCMQ 2RI2A 1TH7A 1MGQA 4M7AF 3ME9A 1VQ9T 4M7DF 2RHYA 2RO0A 2RM4A 4JUVA 4XU0A 5GAOp 3G71A 1I5LA 1WJSA 1U8RA 4C5EA 3RKWA 2O4XA 4N4IA 5GAOm 1RL2A 1PSEA 3M4YA 4BE1A 1YJNT 1KD1C 3M56A 2PU9B 3RERA 1FWZA 4HT8A 1NZ9A 3VYGA 3L2RA 1K9MC 3J7AF 5CIUA 1YJNA 2L8DA 1Q81C 4M7AD 3LH0A 1N27A 5M9OA 4M7DD 4C0DC 4JRKA 2I2LA 2DXTA 4X9CA 3QBYA 4C5GA 3DB4A 2ZPHB 4FL6A 4RKUE 2KSSA 1WQWA 3P8DA 2LDMA 3X20B 4ZN1A 1QVGA 5CVIA 3S3NA 3GLXA 3QDRB 2K5IA 3J80E 3VV0A 1YJWA 1Q86U 2QA4A 4EPCA 5C0MA 4QVCA 1KC8U 2Y4YA 1K9MU 1BKBA 4TVRA 4J7IA 4OF1A 5KE2A 4C0DB 1M1KU 2VYTA 3CCVT 2EFIA 5CO7A 3OW2S 4A53A 5GAN7 2LRQA 2CZ6B 1QP3A 2LCLA 2FHDA 3E9GA 3TREA 1XNIA 4N4GA 3JCMb 3O8VA 3LGFA 5LJ3e 2QQRA 4BACA 1VQPA 3OYGA 4M7AB 3J81E 1I4K1 3OYLA 4VUBA 4M7DB 4PJOF 4FT2A 4HT9A 1XOVA 2AHJB 3CCJA 1H641 1X01A 1ZQ1A 4M77C 4MMKA 5LJ5d 4A54A 3GNGA 5A0DA 4HCCA 2ZPEB 3GPLA 1VQ6T 2MWOA 3OS5A 1KQ1A 4LD9K 5CCAA 2X4JA 2GFAA 4N0AC 5LL6S 2V8JA 1VQ6A 4M77G 3HFNA 5GAN8 1NPPA 4QW2A 5D6XA 2K5FA 1WJQA 3LYIA 3HL8A 4C0FA 3S3MA 1K73C 4EMKC 2RA2A 3A8LB 4XTYA 4E47A 3I55T 3HRSA 4ATOA 1VQ8A 5GAOl 3CBOA 2DD5A 2K2VA 2GQVA 3I55A 3CXCA 2QQ9A 1UGRB 3OMCA 5C6SA 4E7IA 4O6JA 1N6AA 2RB6A 3OYCA 1Q7YC 5GMKm 4JRPA 4J6XA 1M9SA 4M75F 4OGCA 1B34B 2JN0A 2YHTA 4QQDA 3CEYA 3V7RA 4BY6C 1BI2A 5GANf 3TU4K 3CCUT 3OYDA 2P0KA 4C92F 3INZA 3FEOA 3X24B 4M7AA 3ER0A 4M7DA 1FXXA 1UEBA 3OY9A 2G3RA 4IUPA 2XU8A 3BDUA 3HKSA 4NOYA 5FU7C 5A2QE 1OZ3A 1VQNT 3L2UA 2EJGA 4M75D 3QJ6A 3CCMT 3ZFJA 1VQNA 4PJOB 1LOJA 5LJ5e 2DO3A 3DLLA 4C92A 4C92D 2PVDB 3L2WA 3V7CA 1U1TA 2ZPFB 4RG8A 4MDWA 1Y96B 1IZ6A 2QI2A 1KQSS 1Y07A 2D0QB 4E7JA 5CKHA 5LJ3h 4OVAA 1M1FA 3QIIA 3CMEA 4JS4A 2L89A 4M75C 4BE2A 1AHJB 1QVPA 3QUIA 3UT1A 4D6WA 4LDUA 5FU7B 4Q5WA 3BDLA 3M58A 4EMGA 3V8LA 1VQ7A 3CMAT 4E7HA 4C92C 1Y7XA 3FRNA 2EIFA 4C8QF 2XIDA 3FLGA 4BDYA 1ZHIA 3CMAA 2K57A 3NTIA 4M75G 1IREB 1KQ2A 1B34A 3CBMA 3Q1JA 2CZ0B 3PT9A 3CC2A 3JCMV 2WSEE 4M78E 4E7KA 4C92G 5GAN4 3C12A 3M55A 4FSXA 3P8BB 4UC4A 2HAXA 3CD6A 1VQKT 4Y28E 3T9NA 2PUKB 1WGSA 2B8AA 5CQYA 4M75B 4B9XA 4MDXA 4C8QD 5HKCA 5HY6A 3RMSA 3QXEB 2FL7A 3GP8A 2XDPA 3V8JA 1X6OA 3MHXA 4C92B 1WQ7A 3HP9A 2JOYA 3L2QA 4QVZA 5I2MA 2QDYB 2DZCA 5GMKi 3OW2A 3I56A 2KVQG 4A4HA 5GAOr 1M4ZA 3G71T 2DK3A 4PJOA 3PGGA 2YLCA 4QQ6A 3MEWA 1VIFA 1ZBXA 1Y96A 4C8QC 3VUZA 4XTWA 3SD4A 4F7UE 4XAXB 5GAMf 3CCLT 3EFRA 2IVWA 1JRIA 5CKEA 5GMKl 4EDUA 1DJ7B 4HCZA 3DB3A 2HBPA 5IAYA 4FIBA 1Q86C 3CCLA 3JCMf 4C5HA 2KMTA 3JB9I 2X4WA 1YBYA 4JLIA 3JB9F 1KC8C 2XDBA 4V2SA 1YI2A 3OYAA 4ELZC 1M1KC 4PLIA 2JTFA 3BFMA 2GFUA 2HNIA 3QYGB 4O5VA 3PTAA 5LJ5h 1N8RC 4OB0B 3AHUA 4GY5A 4C8QB 3A8MB 3QKJA 1YJWT 2QA4T 5GMKj 2M16A 4NL3A 2JTMA 4M75A 2VC8A 5IT9E 1G3WA 4OGEA 1XTDA 5CQXA 1BIAA 3CPFA 3OYYA 4J7FA 4M7DC 4M7AC 4A4GA 1U1SA 2E6ZA 5J3BA 2RJFA 2JZ2A 3QJYA 4IUVA 3OS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAY A;  4NL2 A;  5GAN g;  1JBM A;  5GAN 8;  2YLB A;  5GAN 5;  4J5Y A;  4M7A G;  4PJO B;  4EMK C;  4M7D G;  2DZ9 A;  2RA2 A;  4XTY A;  3SB2 A;  4C8Q G;  4F7U A;  2RD1 A;  5I21 A;  3SWN B;  3QSU A;  5GAO l;  4XTX A;  3BW1 A;  4WF2 A;  4EMH A;  2RB6 A;  2E1H A;  5GAO n;  5LJ5 g;  2FYK A;  5CAI A;  5GMK m;  4J6X A;  4M77 A;  4M78 A;  2EJ9 A;  4M75 F;  1B34 B;  2JN0 A;  2YHT A;  1YCY A;  2DXU A;  2EJF A;  3SWN C;  3V7R A;  5GAN e;  5GAN f;  5GAO q;  1HK9 A;  1WPY A;  3JB9 D;  4XU1 A;  4C92 F;  2FB7 A;  3INZ A;  3JCM c;  4M7A A;  3BY7 A;  4N0A A;  4M7D A;  3L1A A;  3JCM W;  1LNX A;  3RKY A;  4DQ2 A;  4C8Q A;  4NOY A;  3AHU A;  1D3B B;  3BDU A;  4XQ3 A;  5GAN j;  4PJO D;  1I8F A;  3QHS A;  2EJG A;  4XTV A;  2DEQ A;  2DKG A;  1N9S A;  4M75 D;  5GAM h;  5GAN 3;  4F7U F;  4PJO E;  3M4G A;  3FJP A;  4EMK A;  1LOJ A;  3FB9 A;  5LJ5 f;  5LJ5 e;  1HXD A;  4M75 E;  5GAM d;  1I81 A;  2EWN A;  4C92 D;  4C92 A;  2DTO A;  3V7C A;  1U1T A;  4XTZ A;  3JCM h;  4RCB A;  2DTH A;  4C92 E;  1Y96 B;  3JCM d;  3JCM P;  4M77 F;  4M78 F;  2QTX A;  2VXE A;  4OP0 A;  5DY9 A;  5LJ3 h;  5GMK h;  3HSB A;  4PJO C;  5LJ3 g;  5LJ5 j;  3JB9 G;  4M75 C;  4X9D A;  3QUI A;  5LJ3 d;  3JCM Q;  1TH7 A;  1MGQ A;  3SWN A;  3V7S A;  4EMG A;  4M7A F;  3V8L A;  2RM4 A;  4JUV A;  4XU0 A;  4M7D F;  5GAO p;  4C92 C;  1I5L A;  4C8Q F;  2DJZ A;  4PJO G;  3RKW A;  5GAO m;  2K57 A;  4M75 G;  4M77 D;  4M78 D;  3V8K A;  1KQ2 A;  5GAN 6;  2E10 A;  1B34 A;  3RER A;  3JCM V;  1M5Q 1;  4M78 E;  4HT8 A;  4C92 G;  2ZGW A;  5GAN 4;  4M7A D;  5GAM g;  2VXF A;  4M7D D;  4M75 B;  4JRK A;  2I2L A;  4PNO A;  4C8Q D;  3JB9 J;  2DXT A;  4M7D E;  1D3B A;  4X9C A;  3JCM g;  4C8Q E;  3V8J A;  1WQW A;  4C92 B;  4M78 C;  3JCM X;  1WQ7 A;  1M8V A;  3L2Z A;  4XU3 A;  2DZC A;  5GMK i;  3RUX A;  5GAO r;  4J6W A;  4PJO A;  3VU3 C;  3PGG A;  3QO3 A;  2YLC A;  2DTI A;  2CGH A;  2Y90 A;  4JRI A;  4QVC A;  1N9R A;  4HA8 A;  3RKX A;  4F7U E;  1Y96 A;  4M78 G;  2E64 A;  4XTW A;  4C8Q C;  1BIB A;  4F7U B;  5GAM e;  5GAM f;  3EFR A;  5GAN h;  1JRI A;  5GAN 2;  5GMK l;  1WNL A;  5GAN d;  3JB9 H;  3FIF A;  3GIB A;  3EFS A;  3JCM f;  4A53 A;  5GAN 7;  3JB9 I;  2E65 A;  4JLI A;  3JCM e;  4M77 E;  3JB9 F;  4M77 B;  4M78 B;  4V2S A;  5GAM j;  2E41 A;  5LJ3 f;  3JCM b;  5GMK e;  5LJ3 e;  3BFM A;  2HNI A;  4M7A E;  4M7A B;  1I4K 1;  5LJ5 h;  4RCC A;  4M7D B;  1LJO A;  4PJO F;  4Y91 A;  4HT9 A;  1H64 1;  1X01 A;  2DVE A;  4M77 C;  4MMK A;  4C8Q B;  4F7U G;  4A54 A;  5LJ5 d;  4QVD A;  5GMK j;  5LJ3 j;  4NL3 A;  1KQ1 A;  2VC8 A;  4M75 A;  4XTU A;  4M7A C;  4EMK B;  1BIA A;  4J6Y A;  4MML A;  4N0A C;  3RES A;  3JCM J;  4M7D C;  1U1S A;  3HFO A;  4XU2 A;  3RIR A;  4M77 G;  3HFN A; 
#chains in the Genus database with same CATH topology
 4OMF B;  2FPF A;  1ZBJ A;  2YLB A;  2FVU A;  1S72 T;  1NJI U;  4J5Y A;  3NMZ C;  3OS2 A;  3OMG A;  4ME7 A;  1VQP T;  1S72 A;  1GXI E;  4RG2 A;  3SWN B;  2CZ1 B;  3PMT A;  3CCJ T;  1A0N B;  4WF2 A;  1X75 C;  2J6K A;  3A5Z B;  1NLP C;  3WXM B;  3KBG A;  1M2O A;  2MPX C;  4PL6 A;  3X28 B;  3CQT A;  1YNZ A;  1K0X A;  2R57 A;  4XU1 A;  4BI3 A;  2E6N A;  4AFQ C;  1N8R U;  1NJI R;  3QYH B;  5GAN j;  2AZV A;  4OB3 B;  2E70 A;  3OS1 A;  1VQ8 T;  4F7U F;  1ABO A;  3CCE Q;  2QG9 B;  2OTJ A;  5GJV B;  2CUB A;  2WSC E;  2HEQ A;  3MEV A;  3UDC A;  1RAI B;  5LJ3 g;  2F69 A;  1AOJ A;  2EQK A;  1OZ2 A;  4BB7 A;  2AKK A;  2PQW A;  1N8R R;  4K11 A;  3M9Q A;  4RMO A;  1AVZ C;  2E10 A;  2ATC B;  3CCR Q;  2FZK B;  1KHI A;  3HRT A;  3L2V A;  3OYB A;  4HCB A;  1G5V A;  3OYC A;  4HVV A;  2JVV A;  2JUF A;  1VQ7 T;  2ZPI B;  3VU3 C;  2K7A A;  2JM8 A;  1G2B A;  2YRC A;  4PLL A;  1BIB A;  1BU1 A;  2JMC A;  4J9B A;  3SDZ A;  1PRM C;  3EFS A;  3CD6 T;  2E65 A;  4M4Z A;  4RTX A;  1V76 A;  5CKD A;  3MO8 A;  3CBP A;  4ESR A;  2DRK A;  2L3P A;  4LN2 A;  1QVF S;  2DXC A;  2VWF A;  2CP6 A;  1SPK A;  4MML A;  3VUB A;  3RIR A;  4OMO A;  3MEA A;  2GBQ A;  3WVE B;  4IUR A;  1VQL Q;  2SRC A;  2FRW A;  4ZGE B;  1FMK A;  2KRO A;  1VYU A;  1RAF B;  3S3O A;  1RAH B;  4JJC A;  2RHI A;  1T0H A;  1KSW A;  3OW2 P;  2K9G A;  1UGV A;  2EJ9 A;  1C0M A;  1YN8 A;  1F1B B;  2F5K A;  2PVG B;  5GAO q;  1BI3 A;  2X4Y A;  2RK1 A;  4KH0 B;  4DOW A;  4XQ3 A;  2V1Q A;  2DEQ A;  1KG1 A;  4E7Z A;  7AT1 B;  3C94 A;  1M8M A;  1GCQ C;  5FU6 B;  5LJ5 f;  1HXD A;  1AWO A;  3MP8 A;  2A28 A;  4AFZ C;  2VXE A;  5DY9 A;  3EG2 A;  3OYF A;  1ABQ A;  2QAS A;  1KD1 U;  3V7S A;  4IIM A;  3UPU A;  1MV0 B;  1X6G A;  3R6N A;  3NPF A;  3G6E T;  2K6D A;  4M77 D;  4M78 D;  3VYH B;  2KRN A;  1TG0 A;  3H6Z A;  9ATC B;  4FYY B;  2EYX A;  4LDX A;  2R58 A;  3JCM X;  1KD1 R;  4OB2 B;  2DM1 A;  3OYK A;  5FRM A;  1JEG A;  3MET A;  2E64 A;  2KAF A;  4PFP A;  1QVG S;  2K3Y A;  2WSF E;  4Z02 A;  2LVM A;  2HMA A;  3A8H B;  2OTJ Q;  3CC7 T;  2E41 A;  1RAB B;  4HVW A;  2DBM A;  3LW5 E;  3KUF A;  3CC7 A;  2OTL T;  2DXB A;  4C5I A;  2CZ7 B;  2RQT A;  4QVD A;  4XTU A;  4EMK B;  4J6Y A;  4CC7 A;  2CP7 A;  4KT0 E;  4XU2 A;  2DL4 A;  2D1X A;  2LQN A;  2ABL A;  5FLX E;  1QP2 A;  4GLM A;  2ED0 A;  2RHZ A;  4DOV A;  3A98 A;  3QSU A;  2XIC A;  4J9H A;  1BYM A;  5IHK A;  5D6Y A;  4IUT A;  3GF5 A;  2FYK A;  4M77 A;  4M78 A;  2JS0 A;  1VQ4 Q;  3M0U A;  3N5B B;  3BY7 A;  4N0A A;  2WAC A;  2PVO B;  1UB4 A;  3ZBD A;  3DKM A;  3AHU A;  5CR2 A;  1T3S A;  2LJ1 A;  2LX9 A;  3E2U A;  3VS6 A;  3U23 A;  3FB9 A;  4JJB A;  2EWN A;  4FM4 B;  2P0P A;  1QCN A;  4XTZ A;  2EKH A;  1VQK A;  4JJN K;  4F14 A;  5LJ5 j;  1TH7 A;  3ME9 A;  1VQ9 T;  1JQQ A;  2JXB A;  4BE1 A;  3M56 A;  1OOT A;  1FWZ A;  2DL5 A;  3J7A F;  4M7A D;  2W10 A;  8AT1 B;  4DBH A;  4M7D D;  2X9H A;  1MND A;  2I2L A;  2DBK A;  1U5S A;  2ZPH B;  4RKU E;  2CRE A;  2LDM A;  3X20 B;  2M02 A;  3GLX A;  1YJW A;  1Q86 U;  2SEM A;  4RUG A;  5KE2 A;  4C0D B;  2VYT A;  3CCV T;  2EFI A;  5CO7 A;  1QP3 A;  1QKX A;  2FHD A;  1WXB A;  4PFO A;  2AKL A;  3O8V A;  3LGF A;  4AFS C;  3OYL A;  4VUB A;  2X51 A;  1XOV A;  1X01 A;  1NEG A;  4FCY A;  4RTY A;  1Q86 R;  3GNG A;  3O5Z A;  2ZPE B;  2KT8 A;  2O31 A;  5D7U A;  2GFA A;  5LL6 S;  1UG1 A;  2V8J A;  4RTT A;  4M77 G;  2J05 A;  2DMO A;  1NPP A;  4QW2 A;  1K73 C;  4XTY A;  3I55 T;  1OQK A;  4ATO A;  1JU5 C;  5GAO l;  2K2V A;  3IQL A;  1GBQ A;  3I55 A;  3CXC A;  2QQ9 A;  1AD5 A;  1UGR B;  4O6J A;  4FSS A;  3V7R A;  3CCU T;  2QGG A;  1OU9 A;  2DJQ A;  3X24 B;  4M7A A;  4FYW B;  4M7D A;  4AG1 C;  2CH4 W;  4NOY A;  2G3R A;  4IUP A;  5KYU A;  5FU7 C;  4M75 D;  2V1R A;  3QJ6 A;  4DBR A;  4D8K A;  3CCM T;  1LOJ A;  3H41 A;  2RMO A;  2DO3 A;  2JTE A;  3EG9 A;  5AT1 B;  4GBQ A;  1U1T A;  4RG8 A;  4MDW A;  1K76 A;  1SSH A;  1M1F A;  3CME A;  4JS4 A;  2L89 A;  1Q95 G;  2F2W A;  3FLG A;  2K57 A;  3NTI A;  2E3I A;  3CBM A;  4AG2 C;  3JCM V;  4JZ3 A;  4M78 E;  4E7K A;  2HAX A;  1PKT A;  2B8A A;  4B9X A;  3ULR B;  1WX6 A;  1IHV A;  5HY6 A;  2NUP A;  3QXE B;  1B07 A;  3V8J A;  1E7O A;  8ATC B;  1WQ7 A;  3HP9 A;  2C06 A;  3BE3 A;  2DZC A;  4PJO A;  5GAO r;  4A4H A;  1M4Z A;  4JZ4 A;  2YLC A;  2YUO A;  1S1N A;  3CMA Q;  4F7U E;  1RLQ C;  4Z89 A;  1UUE A;  1JRI A;  2JW4 A;  5IAY A;  1BCM A;  2KMT A;  1YBY A;  1QLY A;  3OYA A;  1VQK Q;  3BFM A;  3QYG B;  3PTA A;  2YUP A;  3I56 Q;  4OB0 B;  4GY5 A;  1OPL A;  1CSK A;  4M75 A;  2VC8 A;  1G3W A;  4A4G A;  4LDW A;  5J3B A;  3SEM A;  4KUL A;  3OS0 A;  1VYT A;  2JMA A;  1K4U S;  4ZGJ B;  1PNJ A;  1QMC A;  4M7A G;  1W2B S;  3CCE T;  4M7D G;  2EVR A;  2COY A;  1JB0 E;  3MEU A;  4R56 A;  3I5R A;  4XK8 E;  1BK2 A;  3CCE A;  2KXD A;  3EAE A;  3PFS A;  1YJW Q;  4Y92 A;  1G3T A;  2ECZ A;  1D09 B;  2XHC A;  3I35 A;  4F04 B;  4BDZ A;  1KQS A;  2BE7 D;  2COZ A;  1VQM A;  1TS9 A;  4XTV A;  3CCR T;  2VUB A;  1ZSZ C;  2IIM A;  2LQW A;  5KYX A;  3CCR A;  2RI5 A;  2DET A;  2EYQ A;  1QCF A;  2F1L A;  2LP5 A;  4C0G A;  3SWN A;  1YFN A;  4FU6 A;  2BZY A;  2XMF A;  1VQ5 Q;  4PJO G;  3V8K A;  2J7I A;  2P0Q A;  1UE9 A;  5GAM g;  1SHG A;  2LT1 A;  2QQA A;  4M7D E;  2DIQ A;  3CXC P;  3JCM g;  1K0S A;  4ZNX A;  3L2Z A;  1OI1 A;  1X27 A;  3M0T A;  1NM7 A;  5FW9 A;  4OB1 B;  5GAN 2;  1G3Y A;  1WNL A;  1VQL T;  3JB9 H;  2FZG B;  3NTK A;  1MNE A;  1I07 A;  2CP5 A;  3KXT A;  1VQL A;  3TCJ A;  3UF4 A;  2HSP A;  3FC3 A;  3CME Q;  4LDY A;  1WXT A;  2YT6 A;  4IKF A;  1G8X A;  5CK9 A;  3RDV A;  2J6F A;  1IGQ A;  2EAY A;  2GGR A;  3LH5 A;  5GAN 5;  1YHQ A;  2DL3 A;  2DZ9 A;  2H3E B;  4LXC A;  1K9A A;  3H0H A;  4J9C A;  4P5N A;  2HBW A;  2OJ2 A;  2EJF A;  5GAN e;  2L3Q A;  1QQJ A;  2G6F X;  1M2V B;  2CUD A;  1IRX A;  3QG1 A;  4MZM A;  3UA6 A;  3JCM W;  2YUQ A;  1M90 C;  1D3B B;  2CKK A;  2K4Y A;  1MHN A;  5GAN 3;  2L0A A;  5GAM d;  4M75 E;  1UGS B;  4A63 B;  3NHN A;  4PFZ A;  1WHM A;  3M54 A;  1HJD A;  2NWM A;  1RAE B;  3JCM d;  4M77 F;  4M78 F;  3VRZ A;  5GMK h;  3CCS Q;  3HSB A;  2H3J A;  3JB9 G;  3QDF A;  2V8I A;  1K8A C;  2LNV A;  2M0O A;  2VV5 A;  1PC0 A;  1Q81 U;  2CS7 A;  4LD6 A;  2A08 A;  1M30 A;  4GLK A;  5GAN 6;  2EQM A;  4X1V A;  3HHT B;  2BUD A;  2OTJ T;  2RQU A;  3JB9 J;  3VS3 A;  2EQJ A;  4JPB W;  4M78 C;  1SF9 A;  3H8Z A;  3RMQ A;  2HDA A;  3QO3 A;  3PE0 A;  1Q81 R;  4JRI A;  4L5G A;  4J9G A;  3VJP A;  4HA8 A;  2DVJ A;  1VQM Q;  1KQS P;  3TQ7 P;  1G3S A;  2D8H A;  3FIF A;  2BTT A;  1FMW A;  1QWE A;  2K3B A;  4ZGD B;  4JLG A;  2XK0 A;  5J39 A;  5DLO A;  3G4S Q;  4RCC A;  1I0C A;  5KYY B;  1Q82 U;  1VQ4 T;  5KYN A;  2DF6 A;  1NEB A;  2NYS A;  1VQ4 A;  2KYM A;  3LWH A;  2XG8 D;  1WFW A;  3OBW A;  3PIP A;  5HCK A;  3NFC A;  1Q7Y U;  1JJ2 A;  4CC4 B;  2NUT B;  2QTV A;  3OYN A;  2O4X B;  1LPL A;  1Q82 R;  1EFN A;  2W0Z A;  2DXU A;  3M0Q A;  3AT1 B;  1TWB A;  1HK9 A;  1WPY A;  2D9T A;  3UWN A;  1P92 A;  4J83 A;  4BE0 A;  3PVL A;  2DD4 A;  4DQ2 A;  2MWP A;  2QQB A;  3WVD B;  1Q7Y R;  1W6X A;  5GAM h;  4EMK A;  5KH6 A;  2A3L A;  2EKO A;  3GBQ A;  3JCM h;  3M0R A;  5EC7 A;  1WHK A;  1YJ9 Q;  3L42 A;  5DM7 R;  1QWF A;  3EGU A;  2X4X A;  1J3T A;  1SHF A;  1TTH B;  2RI2 A;  5LJ3 d;  4M7A F;  2DL7 A;  2RM4 A;  4M7D F;  1I5L A;  1WJS A;  1U8R A;  5GAO m;  1RL2 A;  2A0F B;  1YHQ Q;  2PU9 B;  2ZAE A;  1GBR A;  4HT8 A;  3VYG A;  3LH0 A;  5M9O A;  4J9D A;  4JRK A;  2DXT A;  4X9C A;  2CP0 A;  2MYS A;  2KSS A;  4ZN1 A;  5CVI A;  2FEI A;  3QDR B;  3ZL7 C;  3J80 E;  2QA4 A;  4QVC A;  1KC8 U;  2Y4Y A;  1X43 A;  3A1P A;  2VVK A;  1M1K U;  1YJN Q;  2VAS A;  1JXO A;  3OW2 S;  5GAN 7;  3EG0 A;  3JCM b;  4BAC A;  1D0X A;  1V1C A;  1W70 A;  4PJO F;  4FT2 A;  2RPN A;  4MMK A;  4HCC A;  4ORZ A;  2RQW A;  1PG5 B;  2MWO A;  1KQ1 A;  1KC8 R;  1M1K R;  3HFN A;  5D6X A;  2K5F A;  1WJQ A;  3LYI A;  4E47 A;  1VQP Q;  2LNH B;  1NLO C;  3CBO A;  1KK7 A;  2GQV A;  3CCJ Q;  2DER A;  3OMC A;  2RB6 A;  1TSF A;  1M9S A;  1HYO A;  4M75 F;  4BY6 C;  1BI2 A;  6AT1 B;  1ZSZ B;  3FEO A;  1FXX A;  3HKS A;  2VKN A;  1OZ3 A;  2ESW A;  1PCX A;  3ZFJ A;  5LJ5 e;  1WZO A;  3DLL A;  2E4H A;  2PVD B;  1ZUK A;  5IHI A;  2C0T A;  1Y07 A;  3EFO B;  3FJ5 A;  1NYF A;  3EGX B;  1LCK A;  5LJ3 h;  4E7J A;  4M75 C;  4BE2 A;  3QUI A;  1QVP A;  2X3X D;  3M0P A;  4LDU A;  4Q5W A;  3BDL A;  3CMA T;  1NBE B;  1Y7X A;  2XID A;  2LX7 A;  4RTZ A;  3CMA A;  1IRE B;  1VQN Q;  2CZ0 B;  3PT9 A;  3CC2 A;  1D0Z A;  4C92 G;  3C12 A;  1VQK T;  3T9N A;  2PUK B;  1JJ2 P;  2YXY A;  3GP8 A;  2HKN A;  4C92 B;  1X6O A;  3MHX A;  2JOY A;  4QVZ A;  2QDY B;  5GMK i;  3I56 A;  1WYX A;  3PGG A;  1TXQ A;  2CSQ A;  5GAM f;  5CKE A;  5GMK l;  4EDU A;  1DJ7 B;  2JJ9 A;  4HCZ A;  3JCM f;  2PZ1 A;  3JB9 F;  2XDB A;  1UHF A;  1YI2 A;  2CT4 A;  4ELZ C;  5I11 A;  2GFU A;  4O5V A;  3EH1 A;  4C8Q B;  3A8M B;  4HCK A;  1YJW T;  1D0Y A;  5GMK j;  2GQI A;  1U06 A;  5CQX A;  3VS7 A;  3OYY A;  2O9S A;  1SG5 A;  4IUV A;  3DLM A;  4FW1 A;  2P4R A;  1BBZ A;  5I21 A;  3BW1 A;  4F16 A;  3MJX A;  2KQW A;  2RN8 A;  5IH2 A;  3QWX X;  1AZE A;  4JJD A;  1ARK A;  3OYE A;  1CKB A;  1YCY A;  2QA4 Q;  3UAT A;  2KXC A;  4J9F A;  1YIT A;  1VQ5 T;  1XQH A;  5IN1 A;  4AFU C;  1VIE A;  1MMG A;  3CPW A;  1BB9 A;  3OSV A;  5HK0 A;  1VQ5 A;  2DEU A;  4PJO D;  3QHS A;  1O9S A;  4EIK A;  5HK3 A;  4JRQ A;  4JS5 A;  1OX9 A;  1KFZ A;  3LX7 A;  2DTH A;  5CKF A;  3CC4 Q;  3I9Q A;  1IXD A;  2EYW A;  2CP3 A;  1TOV A;  1SRM A;  1W4S A;  3ZEH A;  4PK4 A;  5CKB A;  2OX7 A;  4OMQ A;  4BI8 B;  3G6E Q;  4ZTJ A;  1E6G A;  2DYI A;  3VS4 A;  1OEB A;  2EGA A;  2L5Q A;  1C6V X;  2CYZ B;  3VS2 A;  2JNG A;  2GNC A;  1N5Z A;  3CCQ A;  5I2S A;  3HPW A;  1WHL A;  4MZP A;  3CME T;  2O2O A;  2YWW A;  4ZN3 A;  2EPD A;  2HD0 A;  4QT7 A;  2KI7 A;  3RUX A;  4J6W A;  2DRM A;  1YCS B;  3S6W A;  2IG0 A;  2NLU A;  2DTI A;  2OI3 A;  2RNA A;  1N9R A;  3HRU A;  3OSS C;  4F7U B;  4PKC C;  5KCH A;  2HQE A;  2L3R A;  3GIB A;  2QXF A;  1YIJ A;  1WIE A;  4M77 E;  4C0Z A;  5GAM j;  5LJ3 f;  2KNB B;  3M59 A;  1WDX A;  4Y91 A;  3QPH A;  2QEX Q;  3NTH A;  3C4S A;  1NE8 A;  3PVQ A;  2RHX A;  2EYY A;  2RQV A;  4KUD K;  1T3L A;  2AIR B;  2JM9 A;  3HFO A;  3JRZ A;  4A4F A;  1RI0 A;  4BD3 A;  1PKS A;  3CC2 Q;  2IPO B;  4DEY A;  3G7Z A;  4OML A;  2LC4 A;  1IO6 A;  4A4E A;  1NJI C;  1M3A A;  3MCA B;  4QQG A;  3CCS T;  3CCS A;  3JB9 D;  2LCS A;  1AZG B;  1PHT A;  3JCM c;  2LMJ A;  1RUW A;  2VB6 A;  3OYI A;  3SFM A;  1QCO A;  2I0N A;  1N9S A;  2XKO C;  4ELY C;  1YI2 Q;  1QW1 A;  2QAZ A;  1N8R C;  2KDS A;  1I81 A;  2COW A;  1IGU A;  1SKU B;  4OP0 A;  1ZX6 A;  4LE9 A;  1VQO Q;  1V29 B;  2LZ6 B;  2MMP A;  2GCX A;  2K5L A;  2ZZD A;  3MP1 A;  3HTR A;  2B86 A;  2Y4X A;  2DJZ A;  1VQM T;  3OB9 A;  2D6F A;  2HCK A;  1G83 A;  2RI3 A;  1M5Q 1;  1M2V A;  1M3C A;  5KYW B;  1GRI A;  3RNJ A;  3G4S T;  1D3B A;  1B3Q A;  3QZ9 B;  2HSE B;  3PNW C;  1KJW A;  3G4S A;  2ZPB B;  2RH2 A;  2HQX A;  5DLQ E;  1YIT Q;  3M5A A;  3VS5 A;  2Y90 A;  2AK5 A;  1Q82 C;  3CPW P;  2LQ8 A;  1QVF A;  3H0I A;  2MAM A;  4NS5 A;  2QQS A;  4M7A E;  4CRI A;  4R55 A;  2DVE A;  2YRV A;  5LJ3 j;  2F2V A;  3P8H A;  4BUG A;  4RTW A;  3JCM J;  3RES A;  1K73 U;  2DNU A;  4MZT A;  3RBB B;  3C95 A;  1M1G A;  2E3H A;  4II1 A;  2M0Y A;  1JBM A;  1T0J A;  1PD0 A;  2BKD N;  2ED1 A;  5J26 A;  4BY6 B;  2JT4 A;  2RD1 A;  3CCQ Q;  2XDD A;  2DIL A;  3CPW S;  1YJ9 T;  4EMH A;  2E1H A;  3R6O A;  4FW2 A;  3E19 A;  5GAO n;  5A0L A;  1YJ9 A;  2BZX A;  1K73 R;  1VUB A;  4KBM B;  2LT4 A;  1BI1 A;  3A8G B;  1EIF A;  2FB7 A;  2DX1 A;  3L1A A;  4B9W A;  3RKY A;  3CXC S;  1VYV A;  1YHQ T;  1HD3 A;  1YIJ Q;  1U3O A;  5KYY A;  2OAU A;  4PJO E;  3FJP A;  2X35 A;  3FDR A;  2RF0 A;  4OMP A;  5GJW B;  3JSC A;  4X34 A;  1WLP B;  2VGM A;  1UJ0 A;  3ASK A;  3JCM Q;  1MGQ A;  4PJL A;  2NUT A;  4XU0 A;  3G71 A;  4C5E A;  2O4X A;  4AT1 B;  1YJN T;  1KD1 C;  3RER A;  1ACM B;  3L2R A;  5CIU A;  1YJN A;  2L8D A;  4C0D C;  2YSQ A;  1RAG B;  1X2Q A;  4C5G A;  1NYG A;  1UTI A;  1QVG A;  3S3N A;  2QYZ A;  3VV0 A;  4EPC A;  1GFD A;  5C0M A;  1OUL A;  1K9M U;  1BKB A;  4J7I A;  4OF1 A;  1Y57 A;  2LRQ A;  2CZ6 B;  2LCL A;  4CC3 A;  2L3S A;  1MMA A;  5L23 A;  1VQP A;  3EGD B;  3OYG A;  1FYN A;  1I4K 1;  3SHW A;  2D8J A;  3EHR A;  4HT9 A;  5IHN A;  3CCJ A;  1H64 1;  4M77 C;  4A54 A;  5A0D A;  1OU8 A;  3GPL A;  3OS5 A;  1K9M R;  2X4J A;  4N0A C;  1YWO A;  1M3B A;  1JO8 A;  4IIO A;  1Z9Q A;  4PJJ A;  3THK A;  2RA2 A;  3HRS A;  1VQ8 A;  3H9N A;  2DD5 A;  4RTV A;  1QKW A;  1N6A A;  1TU0 B;  2DYB A;  1MV3 A;  5GMK m;  4JRP A;  1UHC A;  4QQD A;  4OGC A;  1B34 B;  3CEY A;  3TU4 K;  1VQ6 Q;  2EW3 A;  2LJ0 A;  2P0K A;  2QDL A;  1UEB A;  3BDU A;  5A2Q E;  1VQN T;  2KEA A;  1QVF P;  1VQN A;  4C92 D;  2PNI A;  3L2W A;  3V7C A;  1Y96 B;  2QI2 A;  1KQS S;  1H3H A;  1D1C A;  5CKH A;  3QII A;  3EH2 A;  3UT1 A;  2L2P A;  5FU7 B;  1VQ7 A;  3V8L A;  4E7H A;  3MPU B;  3FRN A;  4BDY A;  1ZHI A;  1KQ2 A;  3Q1J A;  1VA7 A;  1YWP A;  1ZSZ A;  1H92 A;  2CDT A;  3M55 A;  4FSX A;  3CD6 A;  4C8Q D;  1X2K A;  2FL7 A;  3L2Q A;  1UFF A;  4QQ6 A;  1VIF A;  4XTW A;  3EFO A;  4XAX B;  1UJY A;  2EGC A;  3EFR A;  3EGX A;  1OV3 A;  3DB3 A;  2HBP A;  4LUD A;  4FIB A;  1Q86 C;  2FPE A;  4V2S A;  1RLP C;  4PLI A;  2JTF A;  4QKU A;  2FO0 A;  2EYZ A;  2ROL A;  2GTJ A;  2QA4 T;  3G71 Q;  2M16 A;  4NL3 A;  2JTM A;  5IT9 E;  1SEM A;  4B6M A;  1XTD A;  4M7A C;  4J7F A;  1BIA A;  3CPF A;  4M7D C;  1GCP A;  3REB B;  1U1S A;  2RJF A;  2JZ2 A;  4C92 A;  3CCL Q;  2RK2 A;  5GAN g;  1E6H A;  1WHH A;  4IUQ A;  2F2X A;  2V8K A;  5KE3 A;  3OYM A;  2D0N A;  2LJ3 A;  2O88 A;  4XTX A;  5IXF A;  3CC4 T;  1QVG P;  2E5Q A;  1M90 U;  2LTO A;  3CC4 A;  3MP6 A;  3UA7 A;  1K1Z A;  2QK0 A;  1AWW A;  2CH4 A;  4LUE A;  2KRS A;  4C8Q A;  4YTL A;  3OQ5 A;  1S72 Q;  2DKG A;  3G6E A;  2DPP B;  3M4G A;  1NPR A;  1K8A U;  3GOX A;  1M90 R;  4PJO C;  1PRL C;  3MKD A;  3JAM E;  2KE9 A;  2RJE A;  2DFU A;  1I5O B;  1GL5 A;  3VKI A;  1D1B A;  3D7S B;  3EHQ A;  3G1J A;  1BI0 A;  2KRM A;  2ZGW A;  1NG2 A;  1VQ8 Q;  1K8A R;  1M27 C;  1UEC A;  2VXF A;  2KBT A;  2YUN A;  1O75 A;  4F17 A;  2K3X A;  3M57 A;  4LDV A;  2J06 A;  2RJD A;  3LGL A;  4ZTF A;  2QEX T;  4XU3 A;  3E9F A;  3GNF B;  2OTL A;  1I1J A;  1SSF A;  2QEX A;  2CGH A;  2FZC B;  3RKX A;  3A8O B;  3CC2 T;  2J6O A;  5GAN d;  2ZCF B;  2LCC A;  1Y71 A;  4BI4 A;  5GMK e;  1AWJ A;  3I56 T;  2HL3 A;  2MI6 A;  1C1A A;  3M0S A;  1W2B A;  1VQ7 Q;  4L59 A;  1PSF A;  4KH1 B;  5FRN A;  5D6W A;  4L6V 5;  1KIK A;  2AT1 B;  2P4T A;  5ECA A;  4NL2 A;  1YI2 T;  3E1S A;  3PIO A;  3CD6 Q;  2RJC A;  2R5A A;  2ROT A;  3SB2 A;  2CP2 A;  1TUG B;  4C8Q G;  4F7U A;  1IHW A;  3PMI A;  1JXM A;  2HQH A;  5CAI A;  1VQO T;  3LLR A;  3SWN C;  1WI7 A;  1VQO A;  3M53 A;  1OX8 A;  1JJ2 S;  2F5T X;  4E7L A;  1VQ9 A;  1W1F A;  1LNX A;  2CSI A;  1RAD B;  2PUO B;  1UGQ B;  1UGP B;  2XI9 A;  4KGZ B;  4FT4 A;  4JDS A;  2M9U A;  2MCN A;  1GFC A;  4RCB A;  2ENM A;  4J8O A;  4C92 E;  2E12 A;  4X9D A;  1YIT T;  1RAC B;  5IXB A;  4RTU A;  2R5M A;  3URG A;  1X69 A;  2DLP A;  4HVU A;  4J9I A;  3CCV A;  2E5K A;  4IUU A;  4HKE A;  1RAA B;  4PNO A;  1WHG A;  2C0O A;  1WHJ A;  3LWI A;  4C8Q E;  1M8V A;  2EQU A;  2PTK A;  3OYJ A;  3H0F A;  5AYF A;  1OYX A;  4CI0 C;  4M78 G;  5GAN h;  5GAM e;  2KK4 A;  1H3Z A;  1TUC A;  2M1H A;  3X25 B;  3JCM e;  4A4K A;  3JV3 A;  4M77 B;  4M78 B;  4D8D A;  2DIG A;  3CCQ T;  1GCQ A;  3X26 B;  1R8O B;  2O01 E;  3OYH A;  1LJO A;  4DEX A;  2BIV A;  4N4H A;  4F7U G;  1PD1 A;  2DE0 X;  2RQR A;  1XJW B;  2RHU A;  3C0C A;  3EG3 A;  1ZA1 B;  1ZUY A;  1AEY A;  5KYW A;  2XD0 A;  2O9V A;  4KRT A;  4FYX B;  1FX7 A;  3EG1 A;  3CCU A;  5FRO A;  1R0B G;  1YIJ T;  5KCO A;  3I5S A;  2ZPG B;  2KGT A;  1UDL A;  2M51 A;  3QWY A;  3CCM A;  3CC7 Q;  1HSQ A;  4E2F B;  2KT1 A;  2LQK A;  2OTL Q;  3TSW A;  5EG2 A;  1WJR A;  5LJ5 g;  2MOX A;  3QZ5 B;  1WA7 A;  5L8R E;  3F70 A;  3OBY A;  1R77 A;  1H8K A;  2MF2 A;  1VOM A;  1I8F A;  2EGE A;  4OMN A;  3TEE A;  1KHC A;  2DAQ A;  2A7Y A;  3OA6 A;  2DTO A;  2GF7 A;  1B7T A;  2VGN A;  1AWX A;  5A0G A;  2KY9 A;  2QTX A;  4KUI A;  5FU6 C;  1W2B P;  1OPK A;  2V26 A;  2HZY A;  2FG0 A;  2RHY A;  2RO0 A;  4JUV A;  2YRD A;  5GAO p;  1FMV A;  1EX4 A;  3RKW A;  4N4I A;  1PSE A;  3M4Y A;  4Z88 A;  4E6R A;  1PWT A;  1IB8 A;  2K79 A;  1NZ9 A;  1K9M C;  1Q81 C;  5FWB A;  1N27 A;  2MIO A;  1Z9Z A;  1ZLM A;  3QBY A;  3DB4 A;  4FL6 A;  2YDL A;  1WQW A;  1MMD A;  3P8D A;  1WXU A;  1Y0M A;  2NUZ A;  2MK5 A;  2K5I A;  2EBP A;  2HL5 C;  2K2M A;  1VQ9 Q;  4TVR A;  4A53 A;  1TUD A;  3KFV A;  3TSZ A;  2H8H A;  3E9G A;  3TRE A;  2KYB A;  1XNI A;  2GTO A;  4N4G A;  3VS0 A;  3VS1 A;  5LJ3 e;  2QQR A;  4M7A B;  3J81 E;  4M7D B;  2AHJ B;  1YP5 A;  1ZQ1 A;  5LJ5 d;  2X3W D;  4KGX B;  5KYU B;  1ZA2 B;  1VQ6 T;  1MUZ A;  4LD9 K;  5CCA A;  4AMC A;  3EG9 B;  1VQ6 A;  4WCI A;  2Z0W A;  5GAN 8;  1D1A A;  3CCV Q;  1ZUU A;  3S3M A;  4C0F A;  3HL8 A;  3RR6 A;  4R0K A;  4EMK C;  3A8L B;  4FYV B;  3NGP A;  2DL8 A;  2BZ8 A;  5C6S A;  4E7I A;  4HXJ A;  1Q7Y C;  4J6X A;  2YHT A;  2JN0 A;  5GAN f;  2DA9 A;  2A36 A;  4E7S A;  3OYD A;  4ANJ A;  3EGD A;  4C92 F;  3INZ A;  1SRL A;  3ER0 A;  4DBQ A;  3OY9 A;  2XU8 A;  4LNP A;  2NUP B;  3L2U A;  2EJG A;  4J9E A;  2FRY A;  4PJN A;  4PJO B;  3I55 Q;  1PM3 A;  2ZPF B;  1IZ6 A;  2D0Q B;  4OVA A;  1AHJ B;  4D6W A;  4EMG A;  3M58 A;  3CCU Q;  4C92 C;  2P84 A;  2EIF A;  4C8Q F;  5FWC A;  2CT3 A;  3VRY A;  4M75 G;  1MMN A;  1RI9 A;  1B34 A;  1LVK A;  1AT1 B;  2EQI A;  2WSE E;  5GAN 4;  2A37 A;  3CCM Q;  4UC4 A;  2AZS A;  3P8B B;  4Y28 E;  1WGS A;  5CQY A;  4M75 B;  4MDX A;  5HKC A;  1CKA A;  3RMS A;  2XDP A;  1EZZ B;  3OW2 A;  5I2M A;  2KVQ G;  3G71 T;  2DK3 A;  2HKQ B;  3REA B;  3MEW A;  4Z8A A;  2JS2 A;  2KR3 A;  1ZBX A;  1Y96 A;  2FPD A;  3VUZ A;  3SD4 A;  4C8Q C;  3CCL T;  4DA4 A;  3JCM P;  2IVW A;  4OMM A;  3TVT A;  3CCL A;  4C5H A;  2QGF B;  2OAW A;  3JB9 I;  2X4W A;  4JLI A;  4WTO B;  4DBF A;  1KC8 C;  1X6B A;  1M1K C;  2HNI A;  1R0C B;  4PJM A;  5I22 A;  4KGV B;  5LJ5 h;  3QKJ A;  1ZSG A;  4OGE A;  2BE9 B;  1BCO A;  5KYX B;  2C0I A;  4CC2 A;  2E6Z A;  3QJY A; 
#chains in the Genus database with same CATH homology
 4OMF B;  2RK2 A;  5GAN g;  2YLB A;  2FVU A;  3DLM A;  1S72 T;  4IUQ A;  1NJI U;  4J5Y A;  4ZGJ B;  3OMG A;  2V8K A;  4ME7 A;  5KE3 A;  3OS2 A;  3OYM A;  1W2B S;  3CCE T;  4M7A G;  4M7D G;  1JB0 E;  1VQP T;  1S72 A;  3MEU A;  1GXI E;  5I21 A;  4R56 A;  4RG2 A;  4XK8 E;  3SWN B;  4XTX A;  3BW1 A;  3CCE A;  2CZ1 B;  3PMT A;  3CCJ T;  3CC4 T;  4WF2 A;  1X75 C;  2KQW A;  3A5Z B;  3EAE A;  3WXM B;  3PFS A;  2E5Q A;  3KBG A;  2LTO A;  1M90 U;  3CC4 A;  3OYE A;  1YCY A;  3MP6 A;  4PL6 A;  3X28 B;  1G3T A;  3UWN A;  2R57 A;  4XU1 A;  4BI3 A;  1YIT A;  2XHC A;  2E6N A;  1VQ5 T;  1XQH A;  5IN1 A;  4BDZ A;  1N8R U;  1KQS A;  1VIE A;  3CPW A;  4C8Q A;  3OSV A;  3QYH B;  1VQM A;  4YTL A;  5HK0 A;  5GAN j;  3OQ5 A;  3QHS A;  4OB3 B;  1VQ5 A;  2E70 A;  4XTV A;  3OS1 A;  2DKG A;  2VUB A;  2DPP B;  3G6E A;  3CCR T;  1VQ8 T;  4F7U F;  3M4G A;  1O9S A;  1NPR A;  5HK3 A;  4JRQ A;  4JS5 A;  3CCR A;  2RI5 A;  1K8A U;  3LX7 A;  2OTJ A;  2EYQ A;  2WSC E;  3GOX A;  2DTH A;  3MEV A;  5CKF A;  3UDC A;  4PJO C;  5LJ3 g;  2F69 A;  3JAM E;  2EQK A;  2RJE A;  1OZ2 A;  4C0G A;  4BB7 A;  2PQW A;  3SWN A;  1W4S A;  3ZEH A;  4FU6 A;  5CKB A;  4PJO G;  3VKI A;  4BI8 B;  3M9Q A;  4RMO A;  3V8K A;  4ZTJ A;  2E10 A;  4LDW A;  1BI0 A;  2P0Q A;  2L5Q A;  1KHI A;  2ZGW A;  3HRT A;  3L2V A;  5GAM g;  2VXF A;  3OYB A;  4HCB A;  1G5V A;  1O75 A;  2LT1 A;  2CYZ B;  2QQA A;  2JNG A;  2K3X A;  3CCQ A;  4M7D E;  3M57 A;  2DIQ A;  3HPW A;  4MZP A;  3JCM g;  5I2S A;  4LDV A;  4ZN3 A;  2JVV A;  2JUF A;  2RJD A;  3LGL A;  3CME T;  4ZTF A;  2QEX T;  3L2Z A;  2HD0 A;  4XU3 A;  1OI1 A;  3E9F A;  3RUX A;  3GNF B;  4J6W A;  1VQ7 T;  2OTL A;  2ZPI B;  3VU3 C;  3S6W A;  1SSF A;  2IG0 A;  2NLU A;  2QEX A;  2DTI A;  2CGH A;  1N9R A;  3HRU A;  3A8O B;  4PLL A;  3RKX A;  3OSS C;  4F7U B;  1BIB A;  4OB1 B;  4PKC C;  3SDZ A;  5KCH A;  3CC2 T;  5GAN 2;  1G3Y A;  1WNL A;  2HQE A;  5GAN d;  1VQL T;  3JB9 H;  2L3R A;  2ZCF B;  3NTK A;  3GIB A;  2QXF A;  2LCC A;  3EFS A;  1YIJ A;  3CD6 T;  2E65 A;  1Y71 A;  4M77 E;  3KXT A;  1VQL A;  3TCJ A;  5CKD A;  4C0Z A;  5GAM j;  3MO8 A;  3CBP A;  5LJ3 f;  4BI4 A;  5GMK e;  3M59 A;  3I56 T;  3FC3 A;  4Y91 A;  3QPH A;  2MI6 A;  4LDY A;  3NTH A;  3C4S A;  2DXC A;  1W2B A;  1QVF S;  4L59 A;  1NE8 A;  1PSF A;  2RHX A;  4IKF A;  5FRN A;  5D6W A;  5CK9 A;  4KUD K;  4L6V 5;  4MML A;  3VUB A;  2P4T A;  3HFO A;  3JRZ A;  3RIR A;  4A4F A;  3MEA A;  1RI0 A;  2EAY A;  4NL2 A;  3WVE B;  4BD3 A;  4IUR A;  4ZGE B;  5GAN 5;  1YI2 T;  3E1S A;  3PIO A;  1YHQ A;  2RJC A;  2DZ9 A;  2R5A A;  3SB2 A;  3G7Z A;  4C8Q G;  4F7U A;  2LC4 A;  3S3O A;  3PMI A;  4A4E A;  2RHI A;  1NJI C;  3MCA B;  4QQG A;  3CCS T;  4P5N A;  5CAI A;  1VQO T;  3LLR A;  2EJ9 A;  2EJF A;  2F5K A;  2PVG B;  3SWN C;  5GAN e;  5GAO q;  3CCS A;  1BI3 A;  3JB9 D;  3QG1 A;  1VQO A;  4MZM A;  3M53 A;  2X4Y A;  3JCM c;  1JJ2 S;  2F5T X;  4E7L A;  1VQ9 A;  2RK1 A;  3JCM W;  1LNX A;  3OYI A;  1M90 C;  4DOW A;  1D3B B;  2CKK A;  4XQ3 A;  2K4Y A;  3SFM A;  2PUO B;  1UGQ B;  1UGP B;  2XI9 A;  2DEQ A;  1MHN A;  1N9S A;  2XKO C;  4ELY C;  5GAN 3;  1KG1 A;  1QW1 A;  3C94 A;  5FU6 B;  4FT4 A;  5LJ5 f;  4JDS A;  5GAM d;  1HXD A;  2M9U A;  4M75 E;  2KDS A;  1I81 A;  1UGS B;  4RCB A;  3M54 A;  4J8O A;  4C92 E;  3MP8 A;  3JCM d;  4M77 F;  4M78 F;  5GMK h;  2VXE A;  4OP0 A;  5DY9 A;  2E12 A;  2H3J A;  3HSB A;  3JB9 G;  3OYF A;  2V8I A;  4X9D A;  1YIT T;  1K8A C;  1V29 B;  2LNV A;  1KD1 U;  2M0O A;  2MMP A;  2VV5 A;  3V7S A;  2GCX A;  2K5L A;  2ZZD A;  3MP1 A;  2R5M A;  3UPU A;  1Q81 U;  2CS7 A;  2DJZ A;  2Y4X A;  4LD6 A;  3URG A;  1VQM T;  3OB9 A;  4GLK A;  3G6E T;  4M77 D;  4M78 D;  2D6F A;  5GAN 6;  3VYH B;  2RI3 A;  2EQM A;  1M5Q 1;  3HHT B;  3H6Z A;  2BUD A;  3CCV A;  2OTJ T;  4IUU A;  4HKE A;  4PNO A;  3JB9 J;  4LDX A;  3G4S T;  2R58 A;  1D3B A;  2EQJ A;  3QZ9 B;  3LWI A;  3PNW C;  4C8Q E;  3JCM X;  4DA4 A;  4M78 C;  2EQU A;  1M8V A;  3G4S A;  2ZPB B;  4OB2 B;  3H8Z A;  3OYK A;  3OYJ A;  5FRM A;  3RMQ A;  2RH2 A;  2HQX A;  5DLQ E;  5AYF A;  3M5A A;  3QO3 A;  1OYX A;  2Y90 A;  4JRI A;  4L5G A;  4CI0 C;  3VJP A;  4HA8 A;  3MET A;  4M78 G;  2E64 A;  2KAF A;  5GAN h;  5GAM e;  1Q82 C;  2KK4 A;  1G3S A;  1H3Z A;  2LQ8 A;  1QVF A;  2M1H A;  3FIF A;  1QVG S;  2K3Y A;  2WSF E;  4Z02 A;  3X25 B;  4ZGD B;  2LVM A;  3JCM e;  4A4K A;  3A8H B;  4M77 B;  2MAM A;  2XK0 A;  4JLG A;  2DIG A;  4M78 B;  5J39 A;  3CCQ T;  2E41 A;  3CC7 T;  4NS5 A;  2QQS A;  5DLO A;  3X26 B;  1R8O B;  3LW5 E;  4M7A E;  2O01 E;  3KUF A;  4RCC A;  4CRI A;  1LJO A;  3OYH A;  2BIV A;  3CC7 A;  2DXB A;  2OTL T;  4C5I A;  4R55 A;  2DVE A;  2CZ7 B;  4N4H A;  4F7U G;  2RHU A;  1Q82 U;  4QVD A;  2YRV A;  5LJ3 j;  3P8H A;  4BUG A;  1VQ4 T;  2XD0 A;  4XTU A;  1FX7 A;  4EMK B;  4J6Y A;  3JCM J;  3RES A;  1K73 U;  4KT0 E;  4MZT A;  3CCU A;  4XU2 A;  5FRO A;  3C95 A;  1M1G A;  1VQ4 A;  4II1 A;  1YIJ T;  1JBM A;  5KCO A;  2ZPG B;  5FLX E;  1QP2 A;  2BKD N;  3LWH A;  2XG8 D;  3OBW A;  2RHZ A;  5J26 A;  3NFC A;  3PIP A;  1Q7Y U;  4BY6 B;  4DOV A;  1JJ2 A;  2RD1 A;  3CCM A;  3QSU A;  4KUL A;  2XIC A;  2XDD A;  3OYN A;  3CPW S;  1BYM A;  1YJ9 T;  5D6Y A;  2LQK A;  4PJO D;  4EMH A;  2O4X B;  2E1H A;  4IUT A;  5EG2 A;  1WJR A;  2FYK A;  3GF5 A;  3R6O A;  5LJ5 g;  3E19 A;  4M77 A;  4M78 A;  5GAO n;  5A0L A;  1YJ9 A;  2DXU A;  1HK9 A;  1WPY A;  2D9T A;  1VUB A;  1P92 A;  2LT4 A;  1BI1 A;  3A8G B;  3QZ5 B;  4J83 A;  1EIF A;  2FB7 A;  3N5B B;  4KBM B;  4BE0 A;  2DD4 A;  3BY7 A;  4N0A A;  5L8R E;  3F70 A;  3L1A A;  3OBY A;  2WAC A;  4B9W A;  2PVO B;  3RKY A;  1UB4 A;  3ZBD A;  3DKM A;  4DQ2 A;  2MWP A;  2QQB A;  3WVD B;  5CR2 A;  3CXC S;  2LX9 A;  2MF2 A;  1I8F A;  1YHQ T;  2OAU A;  5GAM h;  3TEE A;  1KHC A;  4PJO E;  2DAQ A;  2X35 A;  3FB9 A;  3FJP A;  4EMK A;  5KH6 A;  2A3L A;  2EKO A;  2EWN A;  2A7Y A;  3OA6 A;  4FM4 B;  3FDR A;  2DTO A;  2GF7 A;  2P0P A;  4XTZ A;  3JCM h;  1VQK A;  2VGN A;  3JSC A;  4X34 A;  3JCM P;  5A0G A;  4JJN K;  2KY9 A;  2QTX A;  2VGM A;  3L42 A;  4KUI A;  5DM7 R;  5FU6 C;  2C06 A;  2X4X A;  5LJ5 j;  3ASK A;  5LJ3 d;  3JCM Q;  2RI2 A;  1TH7 A;  1MGQ A;  4M7A F;  3ME9 A;  1VQ9 T;  4M7D F;  2RHY A;  2RO0 A;  2RM4 A;  4JUV A;  4XU0 A;  5GAO p;  3G71 A;  1I5L A;  1WJS A;  1U8R A;  4C5E A;  3RKW A;  2O4X A;  4N4I A;  5GAO m;  1RL2 A;  1PSE A;  3M4Y A;  4BE1 A;  1YJN T;  1KD1 C;  3M56 A;  2PU9 B;  3RER A;  1FWZ A;  4HT8 A;  1NZ9 A;  3VYG A;  3L2R A;  1K9M C;  3J7A F;  5CIU A;  1YJN A;  2L8D A;  1Q81 C;  4M7A D;  3LH0 A;  1N27 A;  5M9O A;  4M7D D;  4C0D C;  4JRK A;  2I2L A;  2DXT A;  4X9C A;  3QBY A;  4C5G A;  3DB4 A;  2ZPH B;  4FL6 A;  4RKU E;  2KSS A;  1WQW A;  3P8D A;  2LDM A;  3X20 B;  4ZN1 A;  1QVG A;  5CVI A;  3S3N A;  3GLX A;  3QDR B;  2K5I A;  3J80 E;  3VV0 A;  1YJW A;  1Q86 U;  2QA4 A;  4EPC A;  5C0M A;  4QVC A;  1KC8 U;  2Y4Y A;  1K9M U;  1BKB A;  4TVR A;  4J7I A;  4OF1 A;  5KE2 A;  4C0D B;  1M1K U;  2VYT A;  3CCV T;  2EFI A;  5CO7 A;  3OW2 S;  4A53 A;  5GAN 7;  2LRQ A;  2CZ6 B;  1QP3 A;  2LCL A;  2FHD A;  3E9G A;  3TRE A;  1XNI A;  4N4G A;  3JCM b;  3O8V A;  3LGF A;  5LJ3 e;  2QQR A;  4BAC A;  1VQP A;  3OYG A;  4M7A B;  3J81 E;  1I4K 1;  3OYL A;  4VUB A;  4M7D B;  4PJO F;  4FT2 A;  4HT9 A;  1XOV A;  2AHJ B;  3CCJ A;  1H64 1;  1X01 A;  1ZQ1 A;  4M77 C;  4MMK A;  5LJ5 d;  4A54 A;  3GNG A;  5A0D A;  4HCC A;  2ZPE B;  3GPL A;  1VQ6 T;  2MWO A;  3OS5 A;  1KQ1 A;  4LD9 K;  5CCA A;  2X4J A;  2GFA A;  4N0A C;  5LL6 S;  2V8J A;  1VQ6 A;  4M77 G;  3HFN A;  5GAN 8;  1NPP A;  4QW2 A;  5D6X A;  2K5F A;  1WJQ A;  3LYI A;  3HL8 A;  4C0F A;  3S3M A;  1K73 C;  4EMK C;  2RA2 A;  3A8L B;  4XTY A;  4E47 A;  3I55 T;  3HRS A;  4ATO A;  1VQ8 A;  5GAO l;  3CBO A;  2DD5 A;  2K2V A;  2GQV A;  3I55 A;  3CXC A;  2QQ9 A;  1UGR B;  3OMC A;  5C6S A;  4E7I A;  4O6J A;  1N6A A;  2RB6 A;  3OYC A;  1Q7Y C;  5GMK m;  4JRP A;  4J6X A;  1M9S A;  4M75 F;  4OGC A;  1B34 B;  2JN0 A;  2YHT A;  4QQD A;  3CEY A;  3V7R A;  4BY6 C;  1BI2 A;  5GAN f;  3TU4 K;  3CCU T;  3OYD A;  2P0K A;  4C92 F;  3INZ A;  3FEO A;  3X24 B;  4M7A A;  3ER0 A;  4M7D A;  1FXX A;  1UEB A;  3OY9 A;  2G3R A;  4IUP A;  2XU8 A;  3BDU A;  3HKS A;  4NOY A;  5FU7 C;  5A2Q E;  1OZ3 A;  1VQN T;  3L2U A;  2EJG A;  4M75 D;  3QJ6 A;  3CCM T;  3ZFJ A;  1VQN A;  4PJO B;  1LOJ A;  5LJ5 e;  2DO3 A;  3DLL A;  4C92 A;  4C92 D;  2PVD B;  3L2W A;  3V7C A;  1U1T A;  2ZPF B;  4RG8 A;  4MDW A;  1Y96 B;  1IZ6 A;  2QI2 A;  1KQS S;  1Y07 A;  2D0Q B;  4E7J A;  5CKH A;  5LJ3 h;  4OVA A;  1M1F A;  3QII A;  3CME A;  4JS4 A;  2L89 A;  4M75 C;  4BE2 A;  1AHJ B;  1QVP A;  3QUI A;  3UT1 A;  4D6W A;  4LDU A;  5FU7 B;  4Q5W A;  3BDL A;  3M58 A;  4EMG A;  3V8L A;  1VQ7 A;  3CMA T;  4E7H A;  4C92 C;  1Y7X A;  3FRN A;  2EIF A;  4C8Q F;  2XID A;  3FLG A;  4BDY A;  1ZHI A;  3CMA A;  2K57 A;  3NTI A;  4M75 G;  1IRE B;  1KQ2 A;  1B34 A;  3CBM A;  3Q1J A;  2CZ0 B;  3PT9 A;  3CC2 A;  3JCM V;  2WSE E;  4M78 E;  4E7K A;  4C92 G;  5GAN 4;  3C12 A;  3M55 A;  4FSX A;  3P8B B;  4UC4 A;  2HAX A;  3CD6 A;  1VQK T;  4Y28 E;  3T9N A;  2PUK B;  1WGS A;  2B8A A;  5CQY A;  4M75 B;  4B9X A;  4MDX A;  4C8Q D;  5HKC A;  5HY6 A;  3RMS A;  3QXE B;  2FL7 A;  3GP8 A;  2XDP A;  3V8J A;  1X6O A;  3MHX A;  4C92 B;  1WQ7 A;  3HP9 A;  2JOY A;  3L2Q A;  4QVZ A;  5I2M A;  2QDY B;  2DZC A;  5GMK i;  3OW2 A;  3I56 A;  2KVQ G;  4A4H A;  5GAO r;  1M4Z A;  3G71 T;  2DK3 A;  4PJO A;  3PGG A;  2YLC A;  4QQ6 A;  3MEW A;  1VIF A;  1ZBX A;  1Y96 A;  4C8Q C;  3VUZ A;  4XTW A;  3SD4 A;  4F7U E;  4XAX B;  5GAM f;  3CCL T;  3EFR A;  2IVW A;  1JRI A;  5CKE A;  5GMK l;  4EDU A;  1DJ7 B;  4HCZ A;  3DB3 A;  2HBP A;  5IAY A;  4FIB A;  1Q86 C;  3CCL A;  3JCM f;  4C5H A;  2KMT A;  3JB9 I;  2X4W A;  1YBY A;  4JLI A;  3JB9 F;  1KC8 C;  2XDB A;  4V2S A;  1YI2 A;  3OYA A;  4ELZ C;  1M1K C;  4PLI A;  2JTF A;  3BFM A;  2GFU A;  2HNI A;  3QYG B;  4O5V A;  3PTA A;  5LJ5 h;  1N8R C;  4OB0 B;  3AHU A;  4GY5 A;  4C8Q B;  3A8M B;  3QKJ A;  1YJW T;  2QA4 T;  5GMK j;  2M16 A;  4NL3 A;  2JTM A;  4M75 A;  2VC8 A;  5IT9 E;  1G3W A;  4OGE A;  1XTD A;  5CQX A;  1BIA A;  3CPF A;  3OYY A;  4J7F A;  4M7D C;  4M7A C;  4A4G A;  1U1S A;  2E6Z A;  5J3B A;  2RJF A;  2JZ2 A;  3QJY A;  4IUV A;  3OS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...