1U1TA

Hfq protein from pseudomonas aeruginosa. high-salt crystals
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
b'SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hfq protein
publication title Structure of Pseudomonas aeruginosa Hfq protein.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1u1tA00
3JCMX 4C92C 4M77G 4C92A 3JB9G 3HFOA 3V8JA 3PGGA 4MMKA 2DEQA 4XTVA 4RCBA 4M7AE 4M7DE 4EMKC 4EMKA 3JCMJ 3JB9H 5GMKh 2DVEA 4M75G 2CGHA 4C8QC 1BIBA 3JCMf 3SWNB 1D3BA 2YHTA 4M77C 4M77A 4QVDA 2DTOA 3INZA 5GAOn 4V2SA 1I81A 3SB2A 2E64A 3SWNA 3RKYA 4M75C 4M75A 2RD1A 3V8KA 4PJOD 4M7AG 4M7DG 4C8QD 1M5Q1 1N9SA 1WPYA 2E41A 4HT8A 5LJ3d 2JN0A 4M77D 5GMKe 3JB9D 1JBMA 4HA8A 1X01A 2EJGA 2RB6A 5GAOq 2HNIA 1H641 2FB7A 4RCCA 3JCMd 4M7AC 4M7AA 4M75D 3EFRA 4M7DA 4M7DC 2EWNA 3FJPA 2DXUA 4Y91A 1BIAA 5GAOp 5CAIA 3FIFA 4A54A 4NOYA 5GAMe 4XTWA 5GANe 2EJFA 3QO3A 4X9CA 2YLBA 3JB9J 1MGQA 5LJ3h 4XTXA 3V7SA 5GAN8 3BFMA 4M7DD 2E10A 4JRIA 4C92D 4PNOA 3V8LA 3RUXA 3JCMh 4EMHA 3SWNC 5LJ3g 4M78B 4JUVA 5LJ5j 1KQ1A 2RA2A 3VU3C 2EAYA 1N9RA 2EJ9A 3JCMW 1U1TA 3JCMg 5LJ5f 4PJOB 2VXEA 4M78F 4M78A 5LJ3e 4F7UB 4J5YA 4OP0A 1WNLA 1KQ2A 5DY9A 4M78E 5GMKi 5GAN2 5GAMj 3HFNA 4PJOF 5GANj 2DXTA 3JCMe 3QHSA 4N0AC 4N0AA 2DJZA 3RKWA 4F7UF 4F7UA 3L1AA 3RERA 4PJOE 4X9DA 1B34B 2RM4A 2YLCA 4J6XA 4XTZA 3V7RA 4C8QE 5GAMf 4F7UE 3JCMQ 5GANf 3HSBA 3BW1A 2ZGWA 3GIBA 1Y96B 4NL3A 4JRKA 4XTUA 4M7AD 3QUIA 1B34A 5LJ5d 1U1SA 1LJOA 5GAN4 1I8FA 4M78G 3BDUA 4J6YA 2E65A 4C92B 2DZCA 5GMKj 4JLIA 4XTYA 3JB9F 1TH7A 2DKGA 3M4GA 4QVCA 5GAN5 5LJ3j 2DTIA 4PJOG 4EMKB 5GAOm 4A53A 5GAN6 1I5LA 4F7UG 4WF2A 3JB9I 4C8QB 4C92F 4M78C 2DZ9A 2VXFA 1D3BB 5LJ3f 1WQ7A 4XU3A 4M77B 1HXDA 5GAMd 5GANd 4C92E 2QTXA 2K57A 3JCMV 4XU1A 5LJ5h 1LNXA 5GAOl 4PJOA 4PJOC 4C8QF 1I4K1 4C8QA 4XQ3A 4M75B 3AHUA 4J6WA 4M77F 2DTHA 3RESA 5I21A 5GAN7 1LOJA 3RKXA 4M78D 1HK9A 3JCMc 2Y90A 5GMKm 5LJ5g 4M77E 3QSUA 4MMLA 2E1HA 4NL2A 4M75F 4HT9A 3JCMb 3L2ZA 4XU0A 5GAMh 5GANh 2I2LA 2VC8A 4C92G 4M75E 4M7AB 4EMGA 5GAOr 5LJ5e 1JRIA 1WQWA 3FB9A 5GMKl 4M7DB 1Y96A 2FYKA 3BY7A 3JCMP 1M8VA 4DQ2A 4XU2A 5GAMg 3RIRA 5GANg 3EFSA 1YCYA 5GAN3 4C8QG 3V7CA 4M7AF 4M7DF
chains in the Genus database with same CATH superfamily
4C92A 1NM7A 1AEYA 3S3MA 2KRMA 5CKEA 3VJPA 2DVEA 3VS4A 2FVUA 1MUZA 2SRCA 5CKFA 4A4KA 4QVDA 2V1QA 2JMCA 4HVWA 1K8AR 4CC4B 4FYWB 1YJ9Q 1S1NA 1QKXA 3SHWA 1X75C 2HAXA 2I0NA 1S72T 3H0HA 2MAMA 4QVZA 2F1LA 2QQSA 1AOJA 4C0FA 4R55A 1WIEA 1HJDA 1M2OA 2LTOA 1GBRA 1ZLMA 1VQPA 3VS3A 3GPLA 1FMWA 2RA2A 1BB9A 1M90R 3CC7T 1RAEB 1VQNT 1ZUYA 1QVFA 2KI7A 1NLPC 3LLRA 1ZBJA 2AT1B 1X6OA 2LT4A 4PJMA 2D0NA 2P0PA 3HFNA 1JXOA 2KNBB 3MPUB 5CO7A 2ENMA 5ECAA 3OW2A 1ZBXA 4JJDA 3CMEQ 2E6NA 3AT1B 1YIJA 3GIBA 2RF0A 1UGSB 4FT4A 2M51A 2C0OA 1JJ2S 3FLGA 5FWCA 1NPPA 3QXEB 1MNEA 3TU4K 4J7IA 4C92F 4YTLA 5A0LA 3QJ6A 1W2BA 5FU6B 3TVTA 4C8QF 3CCLQ 3BE3A 3RESA 3I55A 2PZ1A 1QWFA 4MDXA 1QVFP 3H9NA 5FU7C 3UT1A 1F1BB 1UECA 2IVWA 2QQAA 2YRCA 5GANh 3VUBA 3LH5A 3EGXB 2ROLA 3PIOA 3BY7A 1M8VA 4JS4A 4CC3A 2M1HA 3M55A 3OW2P 2M9UA 1JQQA 2AZVA 2RI5A 4IIOA 2DL5A 4E7JA 2AIRB 3QZ5B 2EQUA 1VQOQ 1SSHA 1ABOA 3SB2A 4E7ZA 1R0BG 2MMPA 2RD1A 1X27A 3NHNA 3CCQT 4HT8A 5D6YA 2FRWA 1NPRA 2JNGA 2LQ8A 4JPBW 3VS2A 4RCCA 2QDLA 1VQ7Q 1UE9A 1NJIR 4LE9A 2HBWA 4Z89A 3M53A 3CCRT 1N5ZA 1R8OB 1WJRA 2ZPHB 3CCMQ 2LP5A 2EYXA 1IGUA 2D1XA 2BTTA 5C0MA 2QEXT 2L8DA 2LDMA 2EQIA 3H6ZA 2F2XA 3C94A 3CMAT 3M59A 5LJ3e 3M0TA 3I9QA 4LDUA 3H0IA 2LT1A 3LW5E 5GAN2 5GAMj 4N0AA 5CR2A 2E5QA 5GANf 2NUTB 4BY6C 2KRNA 2DL8A 3DLMA 5A2QE 1YNZA 2J06A 3G4ST 1N6AA 2NUTA 1TH7A 2K5IA 2R5MA 3OB9A 4JZ4A 4WF2A 3JB9I 1VYUA 1VQLT 4J9HA 5CKBA 5GANd 1ABQA 1HXDA 4KGXB 1QWEA 1TUDA 4RTZA 3CPWP 1OU9A 2QXFA 2C0IA 1TUGB 1TOVA 2CZ7B 5CK9A 3RKXA 5GMKm 2FL7A 5D6XA 5CIUA 2JTEA 3M58A 3RMQA 2JTFA 2YWWA 2DL7A 2EKOA 4AFUC 2COWA 2KDSA 2GFAA 4BE2A 1VQ6Q 1K73C 3A8LB 3X20B 3QPHA 2P0QA 1VQMQ 4DBQA 2M0OA 1K9AA 4J9FA 4Z02A 1KFZA 2MF2A 2YUOA 3UA7A 4E7HA 2NUZA 2RJEA 4LD6A 4HCCA 2CYZB 1GFDA 1WPYA 2A36A 1VQKQ 2CP6A 1YP5A 2LNVA 2DFUA 2RI2A 1VQ9T 3G6ET 4Y91A 1DJ7B 1QLYA 2WSCE 1WHJA 4NOYA 2EJFA 2H8HA 1EIFA 3SFMA 3H0FA 3ULRB 5LJ3h 1YI2Q 3CC4Q 2X4YA 2QA4T 5CKHA 5IN1A 3CCEQ 3CCUQ 4HXJA 2ZPEB 2ED1A 1RAFB 1VQ4T 1OI1A 4F14A 3CBPA 1BCOA 2GTOA 1YJWT 2Z0WA 2VASA 3JCMe 3LGFA 3A8MB 2CP3A 4RTWA 2F5KA 2IPOB 3OYHA 4M7AD 4A4HA 2O31A 2D8HA 3CC2T 4RKUE 2XKOC 4BDYA 2XI9A 2JUFA 4A53A 4J9CA 4XU3A 4TVRA 4FW1A 2K57A 4QQDA 2QTVA 2GQIA 1M2VA 1IXDA 1Z9QA 2DTHA 5GAN7 4ZNXA 1VQNA 1VQ5A 1PNJA 3BDLA 1M1GA 5GAMh 4OMPA 1Q81C 1SHGA 5GMKl 1EZZB 1QQJA 5IT9E 3V7CA 2K9GA 1PSFA 2QGGA 4GLKA 3MEAA 1UFFA 2JS0A 1XQHA 2L3QA 4AMCA 1VQKT 3C4SA 4PFOA 3M5AA 4M77C 2BIVA 5GAOn 5DLQE 3TEEA 2KBTA 3PIPA 4PJOD 2MPXC 3CCVQ 2DIQA 2K3BA 5LJ3d 3HRUA 5I2SA 1JXMA 1D0YA 3UWNA 2JZ2A 1VQPT 4RTVA 4M7AA 2EWNA 1O9SA 1MMNA 3VS1A 3QO3A 1KC8R 4XK8E 1SHFA 4RTUA 2RNAA 4OMNA 4M7DD 2G6FX 4Q5WA 1IB8A 4X1VA 5FRNA 1YJ9A 3JCMh 1K9MR 1IO6A 3VS6A 3KXTA 2BKDN 1QVPA 4Z88A 2A28A 1M1KC 1X6BA 1YIJT 3QDRB 4D8KA 2NYSA 1IHWA 3L2WA 1OEBA 2LNHB 2AKLA 4FSSA 2K5FA 1VIFA 5GAMf 2L89A 3CCQA 4FT2A 1VQ8T 4FW2A 3REBB 2ZGWA 2EGCA 1G8XA 1XJWB 2QQBA 2LCCA 2CKKA 3GF5A 2CSIA 1UJ0A 4BE0A 4JDSA 3OS2A 2DKGA 3OW2S 4F7UG 2DRKA 5GAMd 1AWWA 1N27A 3TQ7P 4PJOA 2A37A 4XQ3A 2DERA 3S3NA 3CMEA 3EGUA 2LVMA 1MMDA 3JCMb 4M7DB 2J7IA 1WJQA 2P4RA 2JMAA 1RL2A 4M7AF 4LN2A 4C92C 4M77G 3JB9G 1Q86C 4RCBA 4M7DE 2DPPB 4J9IA 4PK4A 3VS7A 2MCNA 3JCMJ 3CCLA 3GNGA 4C8QC 3JCMf 1GCQA 2J05A 1FYNA 2CP2A 3HPWA 4RG2A 4PLIA 1I1JA 2OAUA 1AZEA 1M5Q1 2LRQA 2EGAA 1OZ2A 2DNUA 2KYMA 4C0DB 1TTHB 1WZOA 3LWIA 3LGLA 3JCMd 4M75D 3HL8A 3LH0A 1WA7A 1RI9A 3OYJA 5IHIA 4FCYA 4X9CA 2LZ6B 3CEYA 1VQOA 2DMOA 4XAXB 4JRIA 1PD1A 2ZPFB 3X25B 3G71Q 2DYBA 2ZPIB 3M0PA 3VYHB 3A1PA 3CPWS 2VXEA 1YITQ 1VQ7A 1D0ZA 1WYXA 1UB4A 2J6FA 2D0QB 2E6ZA 4PJOF 4ZGEB 4IUUA 1QP2A 2LX7A 3L1AA 1KD1U 4NS5A 4XTZA 4OGCA 4RTTA 3CCMA 3BW1A 4PJLA 2BZ8A 3Q1JA 1U1SA 2RQVA 5GAN4 2DAQA 2ZPBB 2G3RA 1PD0A 4MZPA 2DD5A 3OYFA 1D3BB 4OMOA 5KYUB 4L6V5 3VS5A 2O9VA 4M75B 2KRSA 3C0CA 2E1HA 5KCOA 2RH2A 2V1RA 1YJWA 1XNIA 3HRSA 3DLLA 4C92G 4M75E 1EX4A 1G3WA 3M57A 1QCFA 5DM7R 4AFZC 4C8QG 1V1CA 2H3JA 1CSKA 4EMKA 2FZCB 2GNCA 1OPLA 3CC2A 1AWOA 3SWNB 1KD1C 2QK0A 3SWNA 3V8KA 3GNFB 1ZSGA 2P0KA 2D6FA 2OTJQ 1X01A 2EJGA 1QW1A 1YFNA 3RDVA 1VQ6A 3NPFA 4E2FB 1TSFA 5IHKA 3CCJQ 3HHTB 2DL3A 2DD4A 2JOYA 5GANe 1QVGP 3NTIA 3JB9J 2PVDB 1VQMA 1AD5A 2YT6A 4ELYC 3EGDB 1M9SA 5KYYB 1K8AC 1U1TA 1VQKA 4M78F 4JZ3A 2PUKB 4J5YA 1K0XA 4OMMA 1OU8A 4GBQA 1WDXA 5D6WA 1YWPA 2BUDA 4N0AC 3VKIA 3RKWA 1I5OB 2CS7A 2XICA 2RM4A 2L3RA 4C8QE 3HSBA 1YI2A 3CC4A 1Q82R 4AFSC 3CCEA 3VYGA 3HRTA 2DO3A 3VRYA 2E65A 3VS0A 4FYXB 1VQ5T 5GAN6 1M30A 2DVJA 3OY9A 8AT1B 3DKMA 1AVZC 1LNXA 3I56Q 2F5TX 2EQMA 1D1BA 3MCAB 2QQ9A 2X4XA 1OPKA 1YHQQ 1RLPC 4DOWA 1UEBA 3CCST 3A98A 5IAYA 3N5BB 4PLLA 2KEAA 1D1AA 2CP7A 1PKSA 5AT1B 2JM9A 2KXDA 4ZTJA 1HYOA 3EAEA 1RAAB 1VQ8A 2DEQA 4KUIA 1NYFA 1IREB 4C5HA 1PHTA 3S3OA 1OOTA 4C0ZA 1G3SA 3CCJT 1Y0MA 2E64A 2DEUA 5D7UA 4C0GA 1YJNQ 4II1A 4B6MA 4ATOA 1JBMA 2OTLQ 5GAOq 2C0TA 1YJ9T 1AWXA 1NE8A 2H3EB 2KSSA 3EGXA 1Y71A 2NUPB 2DM1A 1T0HA 2EKHA 4XTWA 2GBQA 2DBMA 5HK3A 5DLOA 2NUPA 3M9QA 2L5QA 4J9GA 2CREA 3TSZA 5KYXB 4EMHA 5J39A 2J6OA 3CCVA 1OQKA 2EQJA 2MOXA 4B9XA 5KYXA 3CPFA 3UDCA 1TU0B 1GRIA 4C5GA 4D8DA 2A7YA 3H8ZA 2R58A 5FLXE 3V7RA 2EQKA 1X6GA 3MP8A 6AT1B 3VV0A 1ZX6A 1Y96B 3C12A 3CPWA 3SDZA 3I56T 3RMSA 4E7LA 1NJIC 3EFOB 3ZEHA 5GMKj 2ATCB 3CMET 3EFOA 1MHNA 1K73U 4E7SA 3JSCA 3MEVA 2E4HA 3KFVA 4BE1A 2E70A 3P8HA 1RUWA 3OYEA 1W70A 1UJYA 4KULA 2P4TA 2IIMA 5I21A 2CZ6B 2MWOA 2HQXA 1NBEB 2EYZA 1M3AA 3M54A 1ZSZC 4J83A 1CKBA 1GFCA 2V8KA 3CCLT 7AT1B 1M4ZA 1WHHA 2FYKA 2F69A 5KE2A 4BI8B 4ANJA 4RG8A 4FSXA 5I22A 4LDYA 2RN8A 3OBYA 2JXBA 3QIIA 4B9WA 5J3BA 1SKUB 4A4FA 1T3SA 3E1SA 2KVQG 1SG5A 3A5ZB 2BZXA 1N9SA 4DBFA 5GMKe 4HA8A 1VQOT 2LC4A 2KAFA 1TXQA 2XK0A 3OYCA 4M7AC 2O01E 2XDBA 2X51A 5KYWB 3FIFA 4A54A 5GAMe 2KT8A 3LX7A 3J80E 4DA4A 3SD4A 5KYWA 5GAN8 1VQ7T 2E10A 3M0QA 1GBQA 2YUPA 1OX9A 2EPDA 1KQ1A 3X24B 4J8OA 4A4EA 1UGRB 3CCMT 5I11A 5M9OA 2DL4A 1I0CA 1PRLC 2E3HA 2RJFA 3JAME 5DY9A 4HKEA 3ZL7C 5FU7B 1B34B 2OAWA 3A8GB 3UPUA 2PVGB 1ARKA 2EBPA 1JU5C 1B34A 1Q81U 3G71A 1V76A 1BK2A 1LJOA 3NGPA 9ATCB 5I2MA 1U3OA 4KGVB 3NFCA 4JJCA 1NYGA 1HSQA 1MNDA 2HCKA 4FL6A 1WQ7A 2QTXA 1N8RC 2V26A 3OYAA 4PJOC 3NTHA 4C5EA 4PKCC 1MMGA 3ER0A 2QG9B 1LOJA 2FHDA 3JCMc 4J7FA 3WVEB 3I5RA 2RJDA 4N4HA 2GTJA 2VYTA 1HD3A 2BE7D 4DOVA 3FB9A 3QWYA 2W10A 4JJNK 1BI2A 2RHXA 1WFWA 3L42A 3ZFJA 4XTVA 1QVGS 1G5VA 2DJQA 3JB9H 5GMKh 4R56A 1KIKA 3OMGA 4F16A 1GCQC 1VQ6T 4PJNA 1MV0B 4IKFA 2FEIA 4K11A 1SSFA 4RUGA 1KQSS 4M7AG 1X69A 1M1KU 2E12A 1RACB 1VQMT 1I07A 1NEBA 4BACA 1WX6A 2VUBA 3EFRA 4BY6B 3UATA 3CCSA 3J81E 1OYXA 4KGZB 2M0YA 1XOVA 2RHZA 3I55Q 2ECZA 4L59A 2OX7A 3BFMA 1TUCA 1AHJB 1UGVA 3OS5A 4WCIA 2RJCA 3GOXA 2OTJA 4OB0B 1YI2T 3VRZA 3CC4T 1BI3A 3CCET 3CCUT 3PT9A 1WNLA 1KQ2A 3EG2A 5KCHA 5LL6S 5J26A 3DB3A 3RBBB 5FW9A 2CP0A 3CCJA 5GJWB 5C6SA 1PC0A 2KY9A 2DXCA 2XMFA 2FPFA 1UHFA 2DK3A 3L2UA 3M4GA 4F04B 4PJOG 5EG2A 2DE0X 5A0GA 4M78C 1Q86U 1K9MC 1GXIE 4PL6A 3URGA 2OI3A 1P92A 1AT1B 1D0XA 2AHJB 3WXMB 1SEMA 2KROA 3A8OB 1U06A 5LJ5g 2HQHA 4XU0A 1QP3A 2EVRA 2I2LA 4P5NA 4EMGA 3R6NA 3DB4A 4JJBA 3OYIA 2IG0A 3JCMP 2YUNA 1NLOC 3MHXA 4OF1A 4KT0E 3I56A 4EMKC 2FO0A 1YCSB 3HKSA 1WXTA 2CGHA 1KSWA 1RAGB 1SPKA 2JM8A 1YHQA 1WXUA 1PRMC 2WACA 2KQWA 3META 1UGPB 2CH4W 3KBGA 3X28B 2DIGA 2VWFA 4M77D 3JB9D 2RHYA 3FC3A 4RMOA 4E6RA 4M7DA 1WHGA 1KHIA 3CCVT 5GAOp 5CAIA 2M16A 2YSQA 2RHUA 1MGQA 2L3PA 3UF4A 2YDLA 1YJNA 2C06A 1Q7YU 3VU3C 2OTLA 2KXCA 3JCMW 5CQXA 1QCNA 4F7UB 2DETA 5GMKi 1X2QA 2JVVA 2X4JA 8ATCB 4BUGA 2DJZA 4F7UA 3CQTA 4BI3A 1RAHB 4F7UE 1E6HA 2PVOB 2FRYA 5L23A 4JRKA 4R0KA 1IHVA 2O2OA 3R6OA 4M78G 2MI6A 2YRVA 3PVLA 5KYNA 2VKNA 1C1AA 4UC4A 1OX8A 3CD6Q 2CUBA 1ACMB 4N4IA 3O5ZA 2HKNA 2KGTA 4M77B 1J3TA 5FWBA 3JCMV 4IUQA 5KE3A 2K4YA 3M0SA 2NLUA 1HK9A 3OS0A 1ZUUA 4M77E 3EHRA 1OULA 3OYBA 3OYDA 1PSEA 2GFUA 3L2ZA 1UHCA 2LJ0A 2P84A 1ZQ1A 4JRQA 2X9HA 2KR3A 2A08A 2QDYB 1Q7YC 1SRMA 2CT3A 4M7DF 1Y7XA 1BBZA 2RQWA 1BKBA 1PM3A 2X3WD 1KJWA 1UG1A 1D3BA 5KYUA 1K1ZA 4KRTA 5FU6C 2XDPA 3A8HB 4V2SA 3EG1A 4LUDA 1BCMA 4M75A 2QI2A 1S72Q 1W6XA 4C8QD 1QVGA 2VV5A 1K8AU 2GF7A 3RR6A 3U23A 3X26B 3THKA 3PMTA 2A0FB 2LQWA 2JS2A 2ABLA 5FROA 1KQSA 2EIFA 2VGNA 4QQ6A 2K5LA 3CC7Q 3M4YA 4M4ZA 4ZGDB 2KMTA 3E2UA 3RUXA 2EW3A 1AWJA 1G83A 2XU8A 4DBRA 4OVAA 1H3ZA 1WJSA 4EIKA 2X35A 2GGRA 1BU1A 2CT4A 1KD1R 1H8KA 3G71T 1WHKA 1YN8A 3RERA 3JB9F 3JCMQ 4MDWA 3PTAA 2CSQA 1YITT 3LWHA 2FPEA 4D6WA 1VOMA 2L0AA 3CXCA 3OBWA 1VUBA 4QT7A 4ELZC 1E7OA 1FWZA 2HSPA 2EGEA 4C92B 2K2VA 2XIDA 4PFZA 1KQSP 1NEGA 3EGDA 1K76A 4C8QB 1W1FA 4C92E 4HCBA 3EG3A 5KYYA 1IGQA 4C8QA 1G3TA 2AK5A 2F2VA 3QSUA 4MMLA 3ASKA 2HDAA 2EYWA 4NL2A 2OJ2A 4M75F 2HMAA 2NWMA 3CCUA 2LCSA 3PMIA 3QDFA 3OMCA 1Q82C 3H41A 3S6WA 3I5SA 1X2KA 2AZSA 2M02A 3TCJA 1VYTA 1V29B 3CXCP 3E9FA 1M90C 1SRLA 3MP1A 1D09B 3CCQQ 1GL5A 2HKQB 3QJYA 4A4GA 2HSEB 3IQLA 3OA6A 5CCAA 5CKDA 5KH6A 1K4US 1ZA2B 5CVIA 3CCRQ 3L2QA 3TREA 3FJPA 2DXUA 4N4GA 4MZMA 1B7TA 2DF6A 3OSVA 2LQNA 4OB3B 2OTJT 2QEXQ 2KYBA 2ZCFB 1FMKA 3PVQA 1NJIU 1WGSA 3EH1A 3CMAQ 4IUPA 2E3IA 5LJ5j 2K3YA 1SF9A 4HVVA 1RADB 3VUZA 3EH2A 4KBMB 2DXTA 5FRMA 3G4SQ 1R77A 3E9GA 3LYIA 4NL3A 2X3XD 3QUIA 2WSFE 1VQLQ 4RTXA 2YUQA 2QAZA 3G1JA 2MIOA 4CC7A 4QVCA 5LJ3j 1KK7A 1I5LA 4OMLA 2BZYA 5CQYA 1PWTA 2QGFB 2ESWA 2ROTA 3T9NA 4HCKA 2CP5A 2K79A 3NTKA 2W0ZA 1W2BP 5GAOr 5LJ5e 1Y96A 1YHQT 4FU6A 1U5SA 3JCMX 4MMKA 2MWPA 2DA9A 2L3SA 2DILA 4C5IA 1YWOA 2YHTA 2V8JA 4CC2A 4OMQA 1M1FA 3RKYA 3QYHB 2MK5A 1VQ9Q 3G6EQ 4ME7A 3HP9A 2HL3A 4F17A 2FPDA 2RB6A 1Z9ZA 1YJNT 2RQRA 1BIAA 2QA4Q 4GLMA 2DX1A 2HBPA 2OTLT 1M3CA 2EYQA 4BI4A 2YLBA 1Q95G 5IH2A 4GY5A 1VQ4Q 3V7SA 3CBMA 4BDZA 2QYZA 3FDRA 1YJWQ 1MV3A 2R5AA 1B3QA 2HL5C 3OS1A 4IUVA 3MJXA 1YBYA 2ED0A 4OP0A 4ORZA 1N8RU 1VA7A 3CC2Q 4FIBA 5L8RE 2YLCA 3OYMA 3M0UA 2K6DA 2KT1A 1K73R 3MKDA 4J9DA 4XTYA 1UGQB 2LMJA 2ZPGB 3M0RA 5GAN5 3D7SB 4DEYA 3O8VA 2J6KA 3FRNA 1JO8A 1TWBA 4HVUA 1RLQC 5LJ5h 3EHQA 4FM4B 1Y07A 2A3LA 3OYKA 2KE9A 2Y90A 2RI3A 4HT9A 4LDVA 4IIMA 1FX7A 3JRZA 3CD6A 4XU2A 5GANg 2FZKB 1WXBA 1E6GA 2LQKA 1YITA 2Y4XA 3PGGA 3MO8A 1BIBA 2GQVA 2DTOA 3INZA 5HCKA 4FYVB 1VQPQ 4EDUA 1N8RR 2HEQA 2E41A 4E7KA 2RPNA 1M8MA 2HNIA 3M56A 2COYA 4ZGJB 4M7DC 2MYSA 2DYIA 4PJJA 3G7ZA 3P8DA 1TG0A 3I35A 1JEGA 1PG5B 2RHIA 1LVKA 3E19A 2K7AA 4JLGA 1FMVA 1YIJQ 3V8LA 2B8AA 2VVKA 1S72A 1KC8U 4O6JA 3OYGA 5GJVB 1IRXA 4BB7A 1WHMA 2EAYA 2L2PA 1N9RA 5LJ5f 1M2VB 3FJ5A 2O9SA 1K9MU 2CH4A 1VQ8Q 1NG2A 2V8IA 3QKJA 2PTKA 3QHSA 4HCZA 1WHLA 3HTRA 1U8RA 1IZ6A 5IHNA 3REAB 1ZSZB 2RK1A 2HD0A 4C0DC 1Q81R 1JJ2A 4J6XA 3CC7A 3OSSC 4DEXA 4AFQC 1ZSZA 1UUEA 5LJ5d 4J6YA 2YXYA 2CUDA 1AZGB 2LX9A 1R0CB 1K0SA 2PUOB 1C6VX 3OQ5A 2DTIA 5GAOm 3L2VA 1KHCA 4OGEA 3SEMA 3CXCS 5LJ3f 3WVDB 3KUFA 4ZTFA 4Z8AA 3UA6A 2E5KA 3AHUA 4J6WA 4J9EA 4ZN3A 5AYFA 4M7AB 1WQWA 2DLPA 4FYYB 4OMFB 1KC8C 4CRIA 1JJ2P 4DQ2A 3EFSA 1W4SA 2PU9B 3OYYA 3QYGB 3V8JA 2XDDA 2ZAEA 4M7AE 2PQWA 2RMOA 2RK2A 4WTOB 1Y57A 1X43A 3OYNA 1A0NB 1M1KR 2K3XA 1CKAA 4L5GA 1LCKA 3MP6A 4M75C 1WI7A 4M7DG 1B07A 1PKTA 4E47A 2JN0A 2R57A 1EFNA 2WSEE 2JTMA 1VIEA 4Y92A 1WLPB 1UDLA 2VGMA 1G2BA 3C95A 4OB2B 1ZA1B 1JB0E 2HZYA 1QVFS 2K2MA 1QCOA 3ZBDA 4VUBA 2ZZDA 2XG8D 4XTXA 2RO0A 4OB1B 4QKUA 2JJ9A 2YRDA 3SWNC 5LJ3g 4LDXA 2VB6A 4IUTA 4DBHA 1XTDA 3I55T 2EJ9A 4PJOB 3CCRA 1QKWA 2D9TA 2O4XB 2HQEA 1RI0A 3GLXA 2JT4A 2KK4A 2BE9B 2O4XA 4EPCA 2QEXA 4PJOE 4X9DA 2EYYA 3PE0A 1BYMA 3CMAA 2B86A 1M27C 1W2BS 1C0MA 4QW2A 2Y4YA 4O5VA 3BDUA 1Q86R 4J9BA 4JLIA 1RAIB 2DXBA 1T3LA 1T0JA 5A0DA 1OZ3A 4A63B 2DZ9A 2VXFA 3QWXX 4X34A 5EC7A 1LPLA 5GAOl 1NZ9A 2PNIA 1I4K1 3G4SA 5IXBA 1ZHIA 1ZUKA 4M78D 4BD3A 3RNJA 4ZN1A 1VQLA 3JV3A 2CZ0B 1FXXA 1JRIA 4IURA 1OV3A 4LD9K 1H3HA 5GAMg 3RIRA 1YCYA 5GAN3 3F70A 1GCPA 3GP8A 3HFOA 2XHCA 4JRPA 2CZ1B 3GBQA 2AKKA 2D8JA 4M75G 4LNPA 4M77A 2F2WA 3FEOA 4MZTA 2COZA 1I81A 1RABB 1KG1A 4JS5A 4QQGA 3EG9B 4KH0B 5IXFA 2CDTA 1BI1A 1O75A 3QBYA 4AG2C 2JW4A 1VYVA 1H641 2FB7A 3TSWA 3EG9A 1D1CA 1BI0A 3QZ9B 5HKCA 3ME9A 1PCXA 1Q7YR 4C92D 4PNOA 4E7IA 1VQ9A 4LDWA 4M78B 4JUVA 3G6EA 2SEMA 3JCMg 3MEUA 4M78A 1M3BA 3PFSA 5HY6A 4M78E 4LXCA 3EG0A 2QA4A 4RTYA 5GANj 5HK0A 3QG1A 4PFPA 4F7UF 4ESRA 1VQ4A 1VQNQ 3MEWA 4Y28E 4XTUA 1VQ5Q 2QASA 2DBKA 2O88A 1MMAA 2LCLA 1I8FA 2DZCA 2RQTA 2LJ3A 3CBOA 3P8BB 1Q82U 2FZGB 4EMKB 4KUDK 2RQUA 1G3YA 4AT1B 2X4WA 1M90U 4CI0C 4XU1A 3CCSQ 4LUEA 2EFIA 3CD6T 1TS9A 4M77F 3NMZC 3OYLA 4KH1B 1H92A 1UTIA 2GCXA 2VC8A 1QMCA 2DRMA 2LJ1A 2QQRA 3PNWC 3L2RA 3J7AF 4AG1C 2XD0A 2FG0A
chains in the Genus database with same CATH topology
3JCMX 4C92C 4M77G 4C92A 3JB9G 1Q86C 3ZFJA 4MMKA 2MWPA 4XTVA 4RCBA 3S3MA 4M7DE 2DPPB 1QVGS 5CKEA 3VJPA 1G5VA 3JCMJ 3CCLA 4C5IA 3JB9H 5GMKh 2DVEA 3GNGA 4R56A 2FVUA 4C8QC 3OMGA 3JCMf 5CKFA 2YHTA 1VQ6T 2V8JA 4A4KA 4QVDA 4IKFA 1SSFA 3HPWA 1M1FA 4RG2A 4PLIA 3RKYA 3QYHB 2OAUA 1KQSS 4M7AG 1X75C 2HAXA 4ME7A 1M5Q1 3HP9A 1M1KU 2LRQA 2E12A 1VQMT 1OZ2A 2RB6A 4BACA 4C0DB 3LWIA 3LGLA 3JCMd 2VUBA 4M75D 3EFRA 3HL8A 3LH0A 1S72T 1YJNT 1BIAA 4BY6B 3OYJA 2MAMA 4QVZA 3CCSA 3J81E 2HBPA 2OTLT 1OYXA 4X9CA 2EYQA 2QQSA 4BI4A 1XOVA 2RHZA 2YLBA 4C0FA 3CEYA 4R55A 4GY5A 1VQOA 2LTOA 4L59A 4XAXB 3CBMA 3BFMA 3V7SA 4BDZA 4JRIA 2ZPFB 1AHJB 3FDRA 1VQPA 3X25B 3OS5A 2R5AA 3GPLA 2ZPIB 2RA2A 2RJCA 3VYHB 3OS1A 3GOXA 3CC7T 4IUVA 1VQNT 2OTJA 4OB0B 1QVFA 1YI2T 1YBYA 3LLRA 1BI3A 2VXEA 3CPWS 3CC4T 3CCET 3CCUT 1X6OA 3PT9A 1WNLA 4OP0A 1VQ7A 1KQ2A 2LT4A 1UB4A 5KCHA 1N8RU 5LL6S 5J26A 3DB3A 2D0QB 2E6ZA 2P0PA 3HFNA 4PJOF 4IUUA 4ZGEB 3CCJA 1QP2A 3L1AA 1KD1U 4FIBA 5L8RE 4NS5A 2YLCA 4XTZA 3G6EA 4OGCA 5CO7A 5C6SA 3CCMA 2KY9A 3OW2A 4M7AF 3BW1A 1ZBXA 1YIJA 2E6NA 3GIBA 2DXCA 1UGSB 3Q1JA 3OYMA 4FT4A 1U1SA 5GAN4 2DAQA 1JJ2S 2ZPBB 3FLGA 3L2UA 1NPPA 2DK3A 1UGQB 2G3RA 2ZPGB 4XTYA 3M4GA 5GAN5 4MZPA 4PJOG 2DD5A 3QXEB 5EG2A 3TU4K 5A0GA 3O8VA 4J7IA 3OYFA 4C92F 4M78C 4YTLA 5A0LA 3FRNA 1Q86U 1D3BB 1K9MC 1GXIE 4L6V5 3QJ6A 4PL6A 1W2BA 5FU6B 5LJ5h 3URGA 1P92A 2AHJB 4C8QF 3WXMB 3A8OB 4M7DG 4M75B 4FM4B 3RESA 1Y07A 3I55A 2A3LA 3OYKA 2Y90A 5LJ5g 4MDXA 2E1HA 5FU7C 5KCOA 2RH2A 2RI3A 3UT1A 1YJWA 1XNIA 4LDVA 2IVWA 4HT9A 2QQAA 4XU0A 1QP3A 3HRSA 5GANh 1FX7A 2I2LA 4P5NA 4C92G 3DLLA 4M75E 4EMGA 3DB4A 3VUBA 3OYIA 2IG0A 3JRZA 3PIOA 3BY7A 3JCMP 3CD6A 1M8VA 4JS4A 1G3WA 3M57A 4XU2A 5GANg 2M1HA 5DM7R 4C8QG 3M55A 2M9UA 2LQKA 1YITA 2Y4XA 2RI5A 3MHXA 2H3JA 3PGGA 4OF1A 4KT0E 3I56A 4EMKC 4EMKA 4BUGA 3HKSA 3MO8A 3CC2A 2CGHA 1BIBA 2GQVA 3SWNB 4E7JA 1YHQA 1KD1C 2DTOA 3QZ5B 3INZA 2EQUA 2WACA 2KQWA 3META 1UGPB 3SB2A 3SWNA 1U8RA 2MMPA 2RD1A 3V8KA 3GNFB 3KBGA 4EDUA 3X28B 2P0KA 2DIGA 3CCQT 4HT8A 2E41A 4E7KA 5D6YA 4M77D 2D6FA 3JB9D 2RHYA 3FC3A 1NPRA 1X01A 2EJGA 2JNGA 2LQ8A 1QW1A 4RMOA 2HNIA 1VQ6A 3M56A 4RCCA 4ZGJB 4M7DC 4M7DA 1KHIA 3CCVT 5GAOp 5CAIA 3HHTB 2DD4A 3G7ZA 2JOYA 2M16A 3P8DA 5GANe 3M53A 2RHUA 3CCRT 2RHIA 3NTIA 1R8OB 3JB9J 1WJRA 1MGQA 2ZPHB 2PVDB 1VQMA 3E19A 4JLGA 3V8LA 4ELYC 2B8AA 5C0MA 1S72A 1KC8U 1M9SA 4O6JA 2L8DA 3OYGA 2QEXT 1YJNA 2LDMA 1Q7YU 2C06A 3VU3C 3H6ZA 4BB7A 2EAYA 2OTLA 3C94A 1N9RA 1K8AC 3JCMW 1U1TA 5LJ5f 1VQKA 3CMAT 5CQXA 3M59A 4M78F 5LJ3e 4F7UB 1K9MU 2PUKB 4J5YA 4LDUA 2V8IA 5GMKi 2JVVA 2X4JA 2LT1A 3LW5E 3QKJA 5GAN2 5GAMj 5D6WA 2BUDA 3QHSA 4HCZA 4N0AC 2DJZA 1IZ6A 2CS7A 4N0AA 3RKWA 2RK1A 2HD0A 3VKIA 4C0DC 4F7UA 2XICA 2E5QA 2RM4A 2L3RA 4J6XA 4BI3A 4C8QE 5CR2A 4F7UE 5GANf 3CC7A 2PVOB 3HSBA 3OSSC 4BY6C 1YI2A 3CC4A 4JRKA 3CCEA 3VYGA 5LJ5d 3DLMA 3HRTA 2DO3A 3R6OA 4M78G 5A2QE 2MI6A 2YRVA 2E65A 4J6YA 3G4ST 1N6AA 2LX9A 1TH7A 2K5IA 2PUOB 2R5MA 4UC4A 3OQ5A 2DTIA 5GAOm 1VQ5T 3OB9A 4N4IA 5GAN6 3L2VA 4WF2A 3JB9I 1KHCA 1VQLT 4OGEA 3CXCS 5LJ3f 5CKBA 3WVDB 4M77B 1HXDA 5GANd 3OY9A 3KUFA 4ZTFA 3JCMV 3DKMA 1LNXA 2QXFA 4IUQA 5KE3A 2F5TX 2CZ7B 2EQMA 2K4YA 3MCAB 4J6WA 3AHUA 2QQ9A 3RKXA 5CK9A 2NLUA 1HK9A 2X4XA 5GMKm 3OS0A 2FL7A 4M77E 5D6XA 4DOWA 1UEBA 3OYBA 3OYDA 1PSEA 3CCST 2GFUA 4ZN3A 5CIUA 3M58A 3RMQA 2JTFA 3L2ZA 5IAYA 2EKOA 3N5BB 4PLLA 5AYFA 4M7AB 1WQWA 1ZQ1A 4JRQA 4OMFB 1KC8C 4CRIA 4DQ2A 2QDYB 1Q7YC 2KDSA 3EFSA 1W4SA 2GFAA 4ZTJA 3EAEA 4M7DF 2PU9B 1Y7XA 4BE2A 1VQ8A 3OYYA 1K73C 3QYGB 3V8JA 1BKBA 3A8LB 3X20B 2XDDA 2DEQA 4M7AE 2PQWA 4KUIA 2RK2A 3QPHA 1IREB 4C5HA 3S3OA 1D3BA 3OYNA 2K3XA 2P0QA 4C0ZA 5FU6C 2M0OA 4L5GA 2XDPA 1G3SA 3A8HB 4Z02A 3CCJT 4V2SA 3MP6A 2E64A 2MF2A 4M75C 4M75A 2QI2A 4C0GA 2RJEA 4C8QD 4LD6A 4E7HA 2CYZB 1QVGA 1WPYA 2VV5A 4II1A 4E47A 1K8AU 2JN0A 4ATOA 1JBMA 2R57A 2GF7A 5GAOq 2LNVA 2WSEE 2JTMA 3X26B 1VIEA 1YJ9T 2RI2A 1VQ9T 1NE8A 2VGMA 3C95A 4OB2B 3G6ET 2KSSA 4Y91A 1JB0E 1DJ7B 1Y71A 2WSCE 3PMTA 5FROA 4NOYA 4XTWA 1KQSA 2EJFA 3SFMA 1EIFA 1QVFS 2EIFA 2VGNA 4QQ6A 3ZBDA 2K5LA 2ZZDA 4VUBA 2XG8D 5LJ3h 5HK3A 5DLOA 3M4YA 4XTXA 4ZGDB 2RO0A 3M9QA 2L5QA 4OB1B 2X4YA 2KMTA 5CKHA 2QA4T 5IN1A 3RUXA 4EMHA 2ZPEB 5J39A 3SWNC 5LJ3g 4LDXA 2XU8A 4IUTA 3CCVA 4OVAA 1H3ZA 1WJSA 2EQJA 1XTDA 3I55T 4B9XA 1VQ4T 1OI1A 3CPFA 2EJ9A 2X35A 3UDCA 3CBPA 4PJOB 3CCRA 4C5GA 2D9TA 2O4XB 1YJWT 2HQEA 3G71T 2A7YA 3H8ZA 2R58A 1RI0A 3JCMe 3GLXA 2KK4A 2O4XA 3LGFA 4EPCA 5FLXE 3RERA 2QEXA 4PJOE 4X9DA 3V7RA 2EQKA 3MP8A 4MDWA 3JCMQ 3JB9F 3A8MB 2F5KA 3PTAA 3VV0A 1YITT 3LWHA 1BYMA 1Y96B 3C12A 4D6WA 3CMAA 3CPWA 3OYHA 3SDZA 3I56T 3RMSA 4A4HA 4E7LA 1W2BS 3CXCA 1NJIC 4M7AD 3OBWA 1VUBA 4QW2A 4ELZC 3CC2T 4RKUE 1FWZA 2Y4YA 3BDUA 4O5VA 3ZEHA 4C92B 5GMKj 4JLIA 2XKOC 3CMET 4BDYA 2K2VA 2DXBA 2XIDA 2XI9A 1JJ2A 2JUFA 1MHNA 4A53A 5A0DA 1OZ3A 1K73U 4C8QB 3JSCA 2DZ9A 3MEVA 2VXFA 4XU3A 4BE1A 4TVRA 4C92E 4HCBA 2K57A 4QQDA 4X34A 2E70A 5GAOl 1NZ9A 3P8HA 1I4K1 4C8QA 3OYEA 3G4SA 1G3TA 4KULA 1ZHIA 2DTHA 2P4TA 5I21A 5GAN7 2CZ6B 2MWOA 4M78D 2HQXA 1VQNA 3QSUA 1VQ5A 4MMLA 3ASKA 3BDLA 3M54A 4NL2A 4BD3A 4ZN1A 4M75F 1VQLA 4J83A 1M1GA 2V8KA 5GAMh 3CCLT 3CCUA 1Q81C 2CZ0B 1FXXA 1JRIA 1M4ZA 3PMIA 4IURA 5GMKl 2FYKA 4LD9K 2F69A 5KE2A 4BI8B 3OMCA 5IT9E 5GAMg 3RIRA 4RG8A 1Q82C 1YCYA 4FSXA 3S6WA 3F70A 3V7CA 5GAN3 3GP8A 4LDYA 1PSFA 3OBYA 3HFOA 4GLKA 3MEAA 1V29B 3TCJA 1XQHA 2XHCA 4JRPA 2CZ1B 3QIIA 4B9WA 5J3BA 3E9FA 1M90C 1VQKT 4A4FA 4M75G 3C4SA 3E1SA 3MP1A 3M5AA 4M77C 2KVQG 4M77A 2BIVA 3A5ZB 3FEOA 4MZTA 5GAOn 3QJYA 4A4GA 5DLQE 1I81A 1KG1A 4JS5A 3TEEA 3OA6A 4QQGA 3PIPA 4PJOD 5CCAA 1N9SA 2DIQA 5LJ3d 5GMKe 3HRUA 5CKDA 5KH6A 4HA8A 1VQOT 2LC4A 2KAFA 1BI1A 1O75A 3QBYA 5I2SA 2XK0A 5CVIA 3UWNA 2JZ2A 1VQPT 1H641 2FB7A 3TREA 3L2QA 3OYCA 4M7AC 2O01E 4M7AA 2XDBA 2EWNA 3FJPA 2DXUA 4N4GA 1BI0A 1O9SA 4MZMA 3QZ9B 3FIFA 3OSVA 4A54A 5GAMe 4OB3B 5HKCA 3ME9A 3QO3A 2OTJT 3LX7A 4XK8E 2ZCFB 3J80E 4DA4A 3SD4A 5GAN8 1VQ7T 1NJIU 4M7DD 2E10A 1WGSA 4Q5WA 4C92D 4PNOA 4E7IA 5FRNA 1YJ9A 4IUPA 3JCMh 1VQ9A 4LDWA 3KXTA 2BKDN 4JUVA 4M78B 1KQ1A 3X24B 1QVPA 4J8OA 4A4EA 5LJ5j 1UGRB 2K3YA 3CCMT 1M1KC 5M9OA 1YIJT 3JCMg 3QDRB 3MEUA 4M78A 2RJFA 3PFSA 3JAME 3VUZA 5HY6A 3L2WA 5DY9A 4M78E 4KBMB 4HKEA 2QA4A 5GANj 5HK0A 2DXTA 5FU7B 3QG1A 4F7UF 5FRMA 2K5FA 1B34B 1VIFA 3A8GB 5GAMf 2L89A 3CCQA 3UPUA 2PVGB 3E9GA 4FT2A 1VQ4A 1VQ8T 2ZGWA 3LYIA 4NL3A 3MEWA 4Y28E 4XTUA 2QQBA 3QUIA 2LCCA 2CKKA 3GF5A 1B34A 2WSFE 3G71A 1Q81U 1LJOA 2LCLA 1I8FA 5I2MA 2DZCA 4BE0A 3CBOA 3P8BB 2DKGA 4JDSA 3OS2A 4QVCA 1Q82U 3NFCA 5LJ3j 3OW2S 4EMKB 4KUDK 1I5LA 1G3YA 4F7UG 4FL6A 5GAMd 1WQ7A 1N27A 2QTXA 2X4WA 1M90U 4CI0C 4XU1A 5CQYA 1N8RC 3OYAA 2EFIA 4PJOC 4PJOA 3NTHA 4C5EA 3CD6T 4XQ3A 4PKCC 3ER0A 4M77F 3S3NA 3OYLA 1LOJA 3CMEA 3T9NA 2FHDA 3JCMc 4J7FA 3WVEB 2RJDA 2LVMA 3NTKA 2GCXA 4N4HA 2VYTA 3JCMb 2VC8A 5GAOr 4M7DB 2QQRA 3PNWC 4DOVA 3FB9A 5LJ5e 3L2RA 1Y96A 3J7AF 1YHQT 4FU6A 4JJNK 1BI2A 2RHXA 4HCCA 1WJQA 2XD0A 1RL2A 3L42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM X;  4C92 C;  4M77 G;  4C92 A;  3JB9 G;  3HFO A;  3V8J A;  3PGG A;  4MMK A;  2DEQ A;  4XTV A;  4RCB A;  4M7A E;  4M7D E;  4EMK C;  4EMK A;  3JCM J;  3JB9 H;  5GMK h;  2DVE A;  4M75 G;  2CGH A;  4C8Q C;  1BIB A;  3JCM f;  3SWN B;  1D3B A;  2YHT A;  4M77 C;  4M77 A;  4QVD A;  2DTO A;  3INZ A;  5GAO n;  4V2S A;  1I81 A;  3SB2 A;  2E64 A;  3SWN A;  3RKY A;  4M75 C;  4M75 A;  2RD1 A;  3V8K A;  4PJO D;  4M7A G;  4M7D G;  4C8Q D;  1M5Q 1;  1N9S A;  1WPY A;  2E41 A;  4HT8 A;  5LJ3 d;  2JN0 A;  4M77 D;  5GMK e;  3JB9 D;  1JBM A;  4HA8 A;  1X01 A;  2EJG A;  2RB6 A;  5GAO q;  2HNI A;  1H64 1;  2FB7 A;  4RCC A;  3JCM d;  4M7A C;  4M7A A;  4M75 D;  3EFR A;  4M7D A;  4M7D C;  2EWN A;  3FJP A;  2DXU A;  4Y91 A;  1BIA A;  5GAO p;  5CAI A;  3FIF A;  4A54 A;  4NOY A;  5GAM e;  4XTW A;  5GAN e;  2EJF A;  3QO3 A;  4X9C A;  2YLB A;  3JB9 J;  1MGQ A;  5LJ3 h;  4XTX A;  3V7S A;  5GAN 8;  3BFM A;  4M7D D;  2E10 A;  4JRI A;  4C92 D;  4PNO A;  3V8L A;  3RUX A;  3JCM h;  4EMH A;  3SWN C;  5LJ3 g;  4M78 B;  4JUV A;  5LJ5 j;  1KQ1 A;  2RA2 A;  3VU3 C;  2EAY A;  1N9R A;  2EJ9 A;  3JCM W;  1U1T A;  3JCM g;  5LJ5 f;  4PJO B;  2VXE A;  4M78 F;  4M78 A;  5LJ3 e;  4F7U B;  4J5Y A;  4OP0 A;  1WNL A;  1KQ2 A;  5DY9 A;  4M78 E;  5GMK i;  5GAN 2;  5GAM j;  3HFN A;  4PJO F;  5GAN j;  2DXT A;  3JCM e;  3QHS A;  4N0A C;  4N0A A;  2DJZ A;  3RKW A;  4F7U F;  4F7U A;  3L1A A;  3RER A;  4PJO E;  4X9D A;  1B34 B;  2RM4 A;  2YLC A;  4J6X A;  4XTZ A;  3V7R A;  4C8Q E;  5GAM f;  4F7U E;  3JCM Q;  5GAN f;  3HSB A;  3BW1 A;  2ZGW A;  3GIB A;  1Y96 B;  4NL3 A;  4JRK A;  4XTU A;  4M7A D;  3QUI A;  1B34 A;  5LJ5 d;  1U1S A;  1LJO A;  5GAN 4;  1I8F A;  4M78 G;  3BDU A;  4J6Y A;  2E65 A;  4C92 B;  2DZC A;  5GMK j;  4JLI A;  4XTY A;  3JB9 F;  1TH7 A;  2DKG A;  3M4G A;  4QVC A;  5GAN 5;  5LJ3 j;  2DTI A;  4PJO G;  4EMK B;  5GAO m;  4A53 A;  5GAN 6;  1I5L A;  4F7U G;  4WF2 A;  3JB9 I;  4C8Q B;  4C92 F;  4M78 C;  2DZ9 A;  2VXF A;  1D3B B;  5LJ3 f;  1WQ7 A;  4XU3 A;  4M77 B;  1HXD A;  5GAM d;  5GAN d;  4C92 E;  2QTX A;  2K57 A;  3JCM V;  4XU1 A;  5LJ5 h;  1LNX A;  5GAO l;  4PJO A;  4PJO C;  4C8Q F;  1I4K 1;  4C8Q A;  4XQ3 A;  4M75 B;  3AHU A;  4J6W A;  4M77 F;  2DTH A;  3RES A;  5I21 A;  5GAN 7;  1LOJ A;  3RKX A;  4M78 D;  1HK9 A;  3JCM c;  2Y90 A;  5GMK m;  5LJ5 g;  4M77 E;  3QSU A;  4MML A;  2E1H A;  4NL2 A;  4M75 F;  4HT9 A;  3JCM b;  3L2Z A;  4XU0 A;  5GAM h;  5GAN h;  2I2L A;  2VC8 A;  4C92 G;  4M75 E;  4M7A B;  4EMG A;  5GAO r;  5LJ5 e;  1JRI A;  1WQW A;  3FB9 A;  5GMK l;  4M7D B;  1Y96 A;  2FYK A;  3BY7 A;  3JCM P;  1M8V A;  4DQ2 A;  4XU2 A;  5GAM g;  3RIR A;  5GAN g;  3EFS A;  1YCY A;  5GAN 3;  4C8Q G;  3V7C A;  4M7A F;  4M7D F; 
#chains in the Genus database with same CATH topology
 4C92 A;  1NM7 A;  1AEY A;  3S3M A;  2KRM A;  5CKE A;  3VJP A;  2DVE A;  3VS4 A;  2FVU A;  1MUZ A;  2SRC A;  5CKF A;  4A4K A;  4QVD A;  2V1Q A;  2JMC A;  4HVW A;  1K8A R;  4CC4 B;  4FYW B;  1YJ9 Q;  1S1N A;  1QKX A;  3SHW A;  1X75 C;  2HAX A;  2I0N A;  1S72 T;  3H0H A;  2MAM A;  4QVZ A;  2F1L A;  2QQS A;  1AOJ A;  4C0F A;  4R55 A;  1WIE A;  1HJD A;  1M2O A;  2LTO A;  1GBR A;  1ZLM A;  1VQP A;  3VS3 A;  3GPL A;  1FMW A;  2RA2 A;  1BB9 A;  1M90 R;  3CC7 T;  1RAE B;  1VQN T;  1ZUY A;  1QVF A;  2KI7 A;  1NLP C;  3LLR A;  1ZBJ A;  2AT1 B;  1X6O A;  2LT4 A;  4PJM A;  2D0N A;  2P0P A;  3HFN A;  1JXO A;  2KNB B;  3MPU B;  5CO7 A;  2ENM A;  5ECA A;  3OW2 A;  1ZBX A;  4JJD A;  3CME Q;  2E6N A;  3AT1 B;  1YIJ A;  3GIB A;  2RF0 A;  1UGS B;  4FT4 A;  2M51 A;  2C0O A;  1JJ2 S;  3FLG A;  5FWC A;  1NPP A;  3QXE B;  1MNE A;  3TU4 K;  4J7I A;  4C92 F;  4YTL A;  5A0L A;  3QJ6 A;  1W2B A;  5FU6 B;  3TVT A;  4C8Q F;  3CCL Q;  3BE3 A;  3RES A;  3I55 A;  2PZ1 A;  1QWF A;  4MDX A;  1QVF P;  3H9N A;  5FU7 C;  3UT1 A;  1F1B B;  1UEC A;  2IVW A;  2QQA A;  2YRC A;  5GAN h;  3VUB A;  3LH5 A;  3EGX B;  2ROL A;  3PIO A;  3BY7 A;  1M8V A;  4JS4 A;  4CC3 A;  2M1H A;  3M55 A;  3OW2 P;  2M9U A;  1JQQ A;  2AZV A;  2RI5 A;  4IIO A;  2DL5 A;  4E7J A;  2AIR B;  3QZ5 B;  2EQU A;  1VQO Q;  1SSH A;  1ABO A;  3SB2 A;  4E7Z A;  1R0B G;  2MMP A;  2RD1 A;  1X27 A;  3NHN A;  3CCQ T;  4HT8 A;  5D6Y A;  2FRW A;  1NPR A;  2JNG A;  2LQ8 A;  4JPB W;  3VS2 A;  4RCC A;  2QDL A;  1VQ7 Q;  1UE9 A;  1NJI R;  4LE9 A;  2HBW A;  4Z89 A;  3M53 A;  3CCR T;  1N5Z A;  1R8O B;  1WJR A;  2ZPH B;  3CCM Q;  2LP5 A;  2EYX A;  1IGU A;  2D1X A;  2BTT A;  5C0M A;  2QEX T;  2L8D A;  2LDM A;  2EQI A;  3H6Z A;  2F2X A;  3C94 A;  3CMA T;  3M59 A;  5LJ3 e;  3M0T A;  3I9Q A;  4LDU A;  3H0I A;  2LT1 A;  3LW5 E;  5GAN 2;  5GAM j;  4N0A A;  5CR2 A;  2E5Q A;  5GAN f;  2NUT B;  4BY6 C;  2KRN A;  2DL8 A;  3DLM A;  5A2Q E;  1YNZ A;  2J06 A;  3G4S T;  1N6A A;  2NUT A;  1TH7 A;  2K5I A;  2R5M A;  3OB9 A;  4JZ4 A;  4WF2 A;  3JB9 I;  1VYU A;  1VQL T;  4J9H A;  5CKB A;  5GAN d;  1ABQ A;  1HXD A;  4KGX B;  1QWE A;  1TUD A;  4RTZ A;  3CPW P;  1OU9 A;  2QXF A;  2C0I A;  1TUG B;  1TOV A;  2CZ7 B;  5CK9 A;  3RKX A;  5GMK m;  2FL7 A;  5D6X A;  5CIU A;  2JTE A;  3M58 A;  3RMQ A;  2JTF A;  2YWW A;  2DL7 A;  2EKO A;  4AFU C;  2COW A;  2KDS A;  2GFA A;  4BE2 A;  1VQ6 Q;  1K73 C;  3A8L B;  3X20 B;  3QPH A;  2P0Q A;  1VQM Q;  4DBQ A;  2M0O A;  1K9A A;  4J9F A;  4Z02 A;  1KFZ A;  2MF2 A;  2YUO A;  3UA7 A;  4E7H A;  2NUZ A;  2RJE A;  4LD6 A;  4HCC A;  2CYZ B;  1GFD A;  1WPY A;  2A36 A;  1VQK Q;  2CP6 A;  1YP5 A;  2LNV A;  2DFU A;  2RI2 A;  1VQ9 T;  3G6E T;  4Y91 A;  1DJ7 B;  1QLY A;  2WSC E;  1WHJ A;  4NOY A;  2EJF A;  2H8H A;  1EIF A;  3SFM A;  3H0F A;  3ULR B;  5LJ3 h;  1YI2 Q;  3CC4 Q;  2X4Y A;  2QA4 T;  5CKH A;  5IN1 A;  3CCE Q;  3CCU Q;  4HXJ A;  2ZPE B;  2ED1 A;  1RAF B;  1VQ4 T;  1OI1 A;  4F14 A;  3CBP A;  1BCO A;  2GTO A;  1YJW T;  2Z0W A;  2VAS A;  3JCM e;  3LGF A;  3A8M B;  2CP3 A;  4RTW A;  2F5K A;  2IPO B;  3OYH A;  4M7A D;  4A4H A;  2O31 A;  2D8H A;  3CC2 T;  4RKU E;  2XKO C;  4BDY A;  2XI9 A;  2JUF A;  4A53 A;  4J9C A;  4XU3 A;  4TVR A;  4FW1 A;  2K57 A;  4QQD A;  2QTV A;  2GQI A;  1M2V A;  1IXD A;  1Z9Q A;  2DTH A;  5GAN 7;  4ZNX A;  1VQN A;  1VQ5 A;  1PNJ A;  3BDL A;  1M1G A;  5GAM h;  4OMP A;  1Q81 C;  1SHG A;  5GMK l;  1EZZ B;  1QQJ A;  5IT9 E;  3V7C A;  2K9G A;  1PSF A;  2QGG A;  4GLK A;  3MEA A;  1UFF A;  2JS0 A;  1XQH A;  2L3Q A;  4AMC A;  1VQK T;  3C4S A;  4PFO A;  3M5A A;  4M77 C;  2BIV A;  5GAO n;  5DLQ E;  3TEE A;  2KBT A;  3PIP A;  4PJO D;  2MPX C;  3CCV Q;  2DIQ A;  2K3B A;  5LJ3 d;  3HRU A;  5I2S A;  1JXM A;  1D0Y A;  3UWN A;  2JZ2 A;  1VQP T;  4RTV A;  4M7A A;  2EWN A;  1O9S A;  1MMN A;  3VS1 A;  3QO3 A;  1KC8 R;  4XK8 E;  1SHF A;  4RTU A;  2RNA A;  4OMN A;  4M7D D;  2G6F X;  4Q5W A;  1IB8 A;  4X1V A;  5FRN A;  1YJ9 A;  3JCM h;  1K9M R;  1IO6 A;  3VS6 A;  3KXT A;  2BKD N;  1QVP A;  4Z88 A;  2A28 A;  1M1K C;  1X6B A;  1YIJ T;  3QDR B;  4D8K A;  2NYS A;  1IHW A;  3L2W A;  1OEB A;  2LNH B;  2AKL A;  4FSS A;  2K5F A;  1VIF A;  5GAM f;  2L89 A;  3CCQ A;  4FT2 A;  1VQ8 T;  4FW2 A;  3REB B;  2ZGW A;  2EGC A;  1G8X A;  1XJW B;  2QQB A;  2LCC A;  2CKK A;  3GF5 A;  2CSI A;  1UJ0 A;  4BE0 A;  4JDS A;  3OS2 A;  2DKG A;  3OW2 S;  4F7U G;  2DRK A;  5GAM d;  1AWW A;  1N27 A;  3TQ7 P;  4PJO A;  2A37 A;  4XQ3 A;  2DER A;  3S3N A;  3CME A;  3EGU A;  2LVM A;  1MMD A;  3JCM b;  4M7D B;  2J7I A;  1WJQ A;  2P4R A;  2JMA A;  1RL2 A;  4M7A F;  4LN2 A;  4C92 C;  4M77 G;  3JB9 G;  1Q86 C;  4RCB A;  4M7D E;  2DPP B;  4J9I A;  4PK4 A;  3VS7 A;  2MCN A;  3JCM J;  3CCL A;  3GNG A;  4C8Q C;  3JCM f;  1GCQ A;  2J05 A;  1FYN A;  2CP2 A;  3HPW A;  4RG2 A;  4PLI A;  1I1J A;  2OAU A;  1AZE A;  1M5Q 1;  2LRQ A;  2EGA A;  1OZ2 A;  2DNU A;  2KYM A;  4C0D B;  1TTH B;  1WZO A;  3LWI A;  3LGL A;  3JCM d;  4M75 D;  3HL8 A;  3LH0 A;  1WA7 A;  1RI9 A;  3OYJ A;  5IHI A;  4FCY A;  4X9C A;  2LZ6 B;  3CEY A;  1VQO A;  2DMO A;  4XAX B;  4JRI A;  1PD1 A;  2ZPF B;  3X25 B;  3G71 Q;  2DYB A;  2ZPI B;  3M0P A;  3VYH B;  3A1P A;  3CPW S;  2VXE A;  1YIT Q;  1VQ7 A;  1D0Z A;  1WYX A;  1UB4 A;  2J6F A;  2D0Q B;  2E6Z A;  4PJO F;  4ZGE B;  4IUU A;  1QP2 A;  2LX7 A;  3L1A A;  1KD1 U;  4NS5 A;  4XTZ A;  4OGC A;  4RTT A;  3CCM A;  3BW1 A;  4PJL A;  2BZ8 A;  3Q1J A;  1U1S A;  2RQV A;  5GAN 4;  2DAQ A;  2ZPB B;  2G3R A;  1PD0 A;  4MZP A;  2DD5 A;  3OYF A;  1D3B B;  4OMO A;  5KYU B;  4L6V 5;  3VS5 A;  2O9V A;  4M75 B;  2KRS A;  3C0C A;  2E1H A;  5KCO A;  2RH2 A;  2V1R A;  1YJW A;  1XNI A;  3HRS A;  3DLL A;  4C92 G;  4M75 E;  1EX4 A;  1G3W A;  3M57 A;  1QCF A;  5DM7 R;  4AFZ C;  4C8Q G;  1V1C A;  2H3J A;  1CSK A;  4EMK A;  2FZC B;  2GNC A;  1OPL A;  3CC2 A;  1AWO A;  3SWN B;  1KD1 C;  2QK0 A;  3SWN A;  3V8K A;  3GNF B;  1ZSG A;  2P0K A;  2D6F A;  2OTJ Q;  1X01 A;  2EJG A;  1QW1 A;  1YFN A;  3RDV A;  1VQ6 A;  3NPF A;  4E2F B;  1TSF A;  5IHK A;  3CCJ Q;  3HHT B;  2DL3 A;  2DD4 A;  2JOY A;  5GAN e;  1QVG P;  3NTI A;  3JB9 J;  2PVD B;  1VQM A;  1AD5 A;  2YT6 A;  4ELY C;  3EGD B;  1M9S A;  5KYY B;  1K8A C;  1U1T A;  1VQK A;  4M78 F;  4JZ3 A;  2PUK B;  4J5Y A;  1K0X A;  4OMM A;  1OU8 A;  4GBQ A;  1WDX A;  5D6W A;  1YWP A;  2BUD A;  4N0A C;  3VKI A;  3RKW A;  1I5O B;  2CS7 A;  2XIC A;  2RM4 A;  2L3R A;  4C8Q E;  3HSB A;  1YI2 A;  3CC4 A;  1Q82 R;  4AFS C;  3CCE A;  3VYG A;  3HRT A;  2DO3 A;  3VRY A;  2E65 A;  3VS0 A;  4FYX B;  1VQ5 T;  5GAN 6;  1M30 A;  2DVJ A;  3OY9 A;  8AT1 B;  3DKM A;  1AVZ C;  1LNX A;  3I56 Q;  2F5T X;  2EQM A;  1D1B A;  3MCA B;  2QQ9 A;  2X4X A;  1OPK A;  1YHQ Q;  1RLP C;  4DOW A;  1UEB A;  3CCS T;  3A98 A;  5IAY A;  3N5B B;  4PLL A;  2KEA A;  1D1A A;  2CP7 A;  1PKS A;  5AT1 B;  2JM9 A;  2KXD A;  4ZTJ A;  1HYO A;  3EAE A;  1RAA B;  1VQ8 A;  2DEQ A;  4KUI A;  1NYF A;  1IRE B;  4C5H A;  1PHT A;  3S3O A;  1OOT A;  4C0Z A;  1G3S A;  3CCJ T;  1Y0M A;  2E64 A;  2DEU A;  5D7U A;  4C0G A;  1YJN Q;  4II1 A;  4B6M A;  4ATO A;  1JBM A;  2OTL Q;  5GAO q;  2C0T A;  1YJ9 T;  1AWX A;  1NE8 A;  2H3E B;  2KSS A;  3EGX A;  1Y71 A;  2NUP B;  2DM1 A;  1T0H A;  2EKH A;  4XTW A;  2GBQ A;  2DBM A;  5HK3 A;  5DLO A;  2NUP A;  3M9Q A;  2L5Q A;  4J9G A;  2CRE A;  3TSZ A;  5KYX B;  4EMH A;  5J39 A;  2J6O A;  3CCV A;  1OQK A;  2EQJ A;  2MOX A;  4B9X A;  5KYX A;  3CPF A;  3UDC A;  1TU0 B;  1GRI A;  4C5G A;  4D8D A;  2A7Y A;  3H8Z A;  2R58 A;  5FLX E;  3V7R A;  2EQK A;  1X6G A;  3MP8 A;  6AT1 B;  3VV0 A;  1ZX6 A;  1Y96 B;  3C12 A;  3CPW A;  3SDZ A;  3I56 T;  3RMS A;  4E7L A;  1NJI C;  3EFO B;  3ZEH A;  5GMK j;  2ATC B;  3CME T;  3EFO A;  1MHN A;  1K73 U;  4E7S A;  3JSC A;  3MEV A;  2E4H A;  3KFV A;  4BE1 A;  2E70 A;  3P8H A;  1RUW A;  3OYE A;  1W70 A;  1UJY A;  4KUL A;  2P4T A;  2IIM A;  5I21 A;  2CZ6 B;  2MWO A;  2HQX A;  1NBE B;  2EYZ A;  1M3A A;  3M54 A;  1ZSZ C;  4J83 A;  1CKB A;  1GFC A;  2V8K A;  3CCL T;  7AT1 B;  1M4Z A;  1WHH A;  2FYK A;  2F69 A;  5KE2 A;  4BI8 B;  4ANJ A;  4RG8 A;  4FSX A;  5I22 A;  4LDY A;  2RN8 A;  3OBY A;  2JXB A;  3QII A;  4B9W A;  5J3B A;  1SKU B;  4A4F A;  1T3S A;  3E1S A;  2KVQ G;  1SG5 A;  3A5Z B;  2BZX A;  1N9S A;  4DBF A;  5GMK e;  4HA8 A;  1VQO T;  2LC4 A;  2KAF A;  1TXQ A;  2XK0 A;  3OYC A;  4M7A C;  2O01 E;  2XDB A;  2X51 A;  5KYW B;  3FIF A;  4A54 A;  5GAM e;  2KT8 A;  3LX7 A;  3J80 E;  4DA4 A;  3SD4 A;  5KYW A;  5GAN 8;  1VQ7 T;  2E10 A;  3M0Q A;  1GBQ A;  2YUP A;  1OX9 A;  2EPD A;  1KQ1 A;  3X24 B;  4J8O A;  4A4E A;  1UGR B;  3CCM T;  5I11 A;  5M9O A;  2DL4 A;  1I0C A;  1PRL C;  2E3H A;  2RJF A;  3JAM E;  5DY9 A;  4HKE A;  3ZL7 C;  5FU7 B;  1B34 B;  2OAW A;  3A8G B;  3UPU A;  2PVG B;  1ARK A;  2EBP A;  1JU5 C;  1B34 A;  1Q81 U;  3G71 A;  1V76 A;  1BK2 A;  1LJO A;  3NGP A;  9ATC B;  5I2M A;  1U3O A;  4KGV B;  3NFC A;  4JJC A;  1NYG A;  1HSQ A;  1MND A;  2HCK A;  4FL6 A;  1WQ7 A;  2QTX A;  1N8R C;  2V26 A;  3OYA A;  4PJO C;  3NTH A;  4C5E A;  4PKC C;  1MMG A;  3ER0 A;  2QG9 B;  1LOJ A;  2FHD A;  3JCM c;  4J7F A;  3WVE B;  3I5R A;  2RJD A;  4N4H A;  2GTJ A;  2VYT A;  1HD3 A;  2BE7 D;  4DOV A;  3FB9 A;  3QWY A;  2W10 A;  4JJN K;  1BI2 A;  2RHX A;  1WFW A;  3L42 A;  3ZFJ A;  4XTV A;  1QVG S;  1G5V A;  2DJQ A;  3JB9 H;  5GMK h;  4R56 A;  1KIK A;  3OMG A;  4F16 A;  1GCQ C;  1VQ6 T;  4PJN A;  1MV0 B;  4IKF A;  2FEI A;  4K11 A;  1SSF A;  4RUG A;  1KQS S;  4M7A G;  1X69 A;  1M1K U;  2E12 A;  1RAC B;  1VQM T;  1I07 A;  1NEB A;  4BAC A;  1WX6 A;  2VUB A;  3EFR A;  4BY6 B;  3UAT A;  3CCS A;  3J81 E;  1OYX A;  4KGZ B;  2M0Y A;  1XOV A;  2RHZ A;  3I55 Q;  2ECZ A;  4L59 A;  2OX7 A;  3BFM A;  1TUC A;  1AHJ B;  1UGV A;  3OS5 A;  4WCI A;  2RJC A;  3GOX A;  2OTJ A;  4OB0 B;  1YI2 T;  3VRZ A;  3CC4 T;  1BI3 A;  3CCE T;  3CCU T;  3PT9 A;  1WNL A;  1KQ2 A;  3EG2 A;  5KCH A;  5LL6 S;  5J26 A;  3DB3 A;  3RBB B;  5FW9 A;  2CP0 A;  3CCJ A;  5GJW B;  5C6S A;  1PC0 A;  2KY9 A;  2DXC A;  2XMF A;  2FPF A;  1UHF A;  2DK3 A;  3L2U A;  3M4G A;  4F04 B;  4PJO G;  5EG2 A;  2DE0 X;  5A0G A;  4M78 C;  1Q86 U;  1K9M C;  1GXI E;  4PL6 A;  3URG A;  2OI3 A;  1P92 A;  1AT1 B;  1D0X A;  2AHJ B;  3WXM B;  1SEM A;  2KRO A;  3A8O B;  1U06 A;  5LJ5 g;  2HQH A;  4XU0 A;  1QP3 A;  2EVR A;  2I2L A;  4P5N A;  4EMG A;  3R6N A;  3DB4 A;  4JJB A;  3OYI A;  2IG0 A;  3JCM P;  2YUN A;  1NLO C;  3MHX A;  4OF1 A;  4KT0 E;  3I56 A;  4EMK C;  2FO0 A;  1YCS B;  3HKS A;  1WXT A;  2CGH A;  1KSW A;  1RAG B;  1SPK A;  2JM8 A;  1YHQ A;  1WXU A;  1PRM C;  2WAC A;  2KQW A;  3MET A;  1UGP B;  2CH4 W;  3KBG A;  3X28 B;  2DIG A;  2VWF A;  4M77 D;  3JB9 D;  2RHY A;  3FC3 A;  4RMO A;  4E6R A;  4M7D A;  1WHG A;  1KHI A;  3CCV T;  5GAO p;  5CAI A;  2M16 A;  2YSQ A;  2RHU A;  1MGQ A;  2L3P A;  3UF4 A;  2YDL A;  1YJN A;  2C06 A;  1Q7Y U;  3VU3 C;  2OTL A;  2KXC A;  3JCM W;  5CQX A;  1QCN A;  4F7U B;  2DET A;  5GMK i;  1X2Q A;  2JVV A;  2X4J A;  8ATC B;  4BUG A;  2DJZ A;  4F7U A;  3CQT A;  4BI3 A;  1RAH B;  4F7U E;  1E6H A;  2PVO B;  2FRY A;  5L23 A;  4JRK A;  4R0K A;  1IHV A;  2O2O A;  3R6O A;  4M78 G;  2MI6 A;  2YRV A;  3PVL A;  5KYN A;  2VKN A;  1C1A A;  4UC4 A;  1OX8 A;  3CD6 Q;  2CUB A;  1ACM B;  4N4I A;  3O5Z A;  2HKN A;  2KGT A;  4M77 B;  1J3T A;  5FWB A;  3JCM V;  4IUQ A;  5KE3 A;  2K4Y A;  3M0S A;  2NLU A;  1HK9 A;  3OS0 A;  1ZUU A;  4M77 E;  3EHR A;  1OUL A;  3OYB A;  3OYD A;  1PSE A;  2GFU A;  3L2Z A;  1UHC A;  2LJ0 A;  2P84 A;  1ZQ1 A;  4JRQ A;  2X9H A;  2KR3 A;  2A08 A;  2QDY B;  1Q7Y C;  1SRM A;  2CT3 A;  4M7D F;  1Y7X A;  1BBZ A;  2RQW A;  1BKB A;  1PM3 A;  2X3W D;  1KJW A;  1UG1 A;  1D3B A;  5KYU A;  1K1Z A;  4KRT A;  5FU6 C;  2XDP A;  3A8H B;  4V2S A;  3EG1 A;  4LUD A;  1BCM A;  4M75 A;  2QI2 A;  1S72 Q;  1W6X A;  4C8Q D;  1QVG A;  2VV5 A;  1K8A U;  2GF7 A;  3RR6 A;  3U23 A;  3X26 B;  3THK A;  3PMT A;  2A0F B;  2LQW A;  2JS2 A;  2ABL A;  5FRO A;  1KQS A;  2EIF A;  2VGN A;  4QQ6 A;  2K5L A;  3CC7 Q;  3M4Y A;  4M4Z A;  4ZGD B;  2KMT A;  3E2U A;  3RUX A;  2EW3 A;  1AWJ A;  1G83 A;  2XU8 A;  4DBR A;  4OVA A;  1H3Z A;  1WJS A;  4EIK A;  2X35 A;  2GGR A;  1BU1 A;  2CT4 A;  1KD1 R;  1H8K A;  3G71 T;  1WHK A;  1YN8 A;  3RER A;  3JB9 F;  3JCM Q;  4MDW A;  3PTA A;  2CSQ A;  1YIT T;  3LWH A;  2FPE A;  4D6W A;  1VOM A;  2L0A A;  3CXC A;  3OBW A;  1VUB A;  4QT7 A;  4ELZ C;  1E7O A;  1FWZ A;  2HSP A;  2EGE A;  4C92 B;  2K2V A;  2XID A;  4PFZ A;  1KQS P;  1NEG A;  3EGD A;  1K76 A;  4C8Q B;  1W1F A;  4C92 E;  4HCB A;  3EG3 A;  5KYY A;  1IGQ A;  4C8Q A;  1G3T A;  2AK5 A;  2F2V A;  3QSU A;  4MML A;  3ASK A;  2HDA A;  2EYW A;  4NL2 A;  2OJ2 A;  4M75 F;  2HMA A;  2NWM A;  3CCU A;  2LCS A;  3PMI A;  3QDF A;  3OMC A;  1Q82 C;  3H41 A;  3S6W A;  3I5S A;  1X2K A;  2AZS A;  2M02 A;  3TCJ A;  1VYT A;  1V29 B;  3CXC P;  3E9F A;  1M90 C;  1SRL A;  3MP1 A;  1D09 B;  3CCQ Q;  1GL5 A;  2HKQ B;  3QJY A;  4A4G A;  2HSE B;  3IQL A;  3OA6 A;  5CCA A;  5CKD A;  5KH6 A;  1K4U S;  1ZA2 B;  5CVI A;  3CCR Q;  3L2Q A;  3TRE A;  3FJP A;  2DXU A;  4N4G A;  4MZM A;  1B7T A;  2DF6 A;  3OSV A;  2LQN A;  4OB3 B;  2OTJ T;  2QEX Q;  2KYB A;  2ZCF B;  1FMK A;  3PVQ A;  1NJI U;  1WGS A;  3EH1 A;  3CMA Q;  4IUP A;  2E3I A;  5LJ5 j;  2K3Y A;  1SF9 A;  4HVV A;  1RAD B;  3VUZ A;  3EH2 A;  4KBM B;  2DXT A;  5FRM A;  3G4S Q;  1R77 A;  3E9G A;  3LYI A;  4NL3 A;  2X3X D;  3QUI A;  2WSF E;  1VQL Q;  4RTX A;  2YUQ A;  2QAZ A;  3G1J A;  2MIO A;  4CC7 A;  4QVC A;  5LJ3 j;  1KK7 A;  1I5L A;  4OML A;  2BZY A;  5CQY A;  1PWT A;  2QGF B;  2ESW A;  2ROT A;  3T9N A;  4HCK A;  2CP5 A;  2K79 A;  3NTK A;  2W0Z A;  1W2B P;  5GAO r;  5LJ5 e;  1Y96 A;  1YHQ T;  4FU6 A;  1U5S A;  3JCM X;  4MMK A;  2MWP A;  2DA9 A;  2L3S A;  2DIL A;  4C5I A;  1YWO A;  2YHT A;  2V8J A;  4CC2 A;  4OMQ A;  1M1F A;  3RKY A;  3QYH B;  2MK5 A;  1VQ9 Q;  3G6E Q;  4ME7 A;  3HP9 A;  2HL3 A;  4F17 A;  2FPD A;  2RB6 A;  1Z9Z A;  1YJN T;  2RQR A;  1BIA A;  2QA4 Q;  4GLM A;  2DX1 A;  2HBP A;  2OTL T;  1M3C A;  2EYQ A;  4BI4 A;  2YLB A;  1Q95 G;  5IH2 A;  4GY5 A;  1VQ4 Q;  3V7S A;  3CBM A;  4BDZ A;  2QYZ A;  3FDR A;  1YJW Q;  1MV3 A;  2R5A A;  1B3Q A;  2HL5 C;  3OS1 A;  4IUV A;  3MJX A;  1YBY A;  2ED0 A;  4OP0 A;  4ORZ A;  1N8R U;  1VA7 A;  3CC2 Q;  4FIB A;  5L8R E;  2YLC A;  3OYM A;  3M0U A;  2K6D A;  2KT1 A;  1K73 R;  3MKD A;  4J9D A;  4XTY A;  1UGQ B;  2LMJ A;  2ZPG B;  3M0R A;  5GAN 5;  3D7S B;  4DEY A;  3O8V A;  2J6K A;  3FRN A;  1JO8 A;  1TWB A;  4HVU A;  1RLQ C;  5LJ5 h;  3EHQ A;  4FM4 B;  1Y07 A;  2A3L A;  3OYK A;  2KE9 A;  2Y90 A;  2RI3 A;  4HT9 A;  4LDV A;  4IIM A;  1FX7 A;  3JRZ A;  3CD6 A;  4XU2 A;  5GAN g;  2FZK B;  1WXB A;  1E6G A;  2LQK A;  1YIT A;  2Y4X A;  3PGG A;  3MO8 A;  1BIB A;  2GQV A;  2DTO A;  3INZ A;  5HCK A;  4FYV B;  1VQP Q;  4EDU A;  1N8R R;  2HEQ A;  2E41 A;  4E7K A;  2RPN A;  1M8M A;  2HNI A;  3M56 A;  2COY A;  4ZGJ B;  4M7D C;  2MYS A;  2DYI A;  4PJJ A;  3G7Z A;  3P8D A;  1TG0 A;  3I35 A;  1JEG A;  1PG5 B;  2RHI A;  1LVK A;  3E19 A;  2K7A A;  4JLG A;  1FMV A;  1YIJ Q;  3V8L A;  2B8A A;  2VVK A;  1S72 A;  1KC8 U;  4O6J A;  3OYG A;  5GJV B;  1IRX A;  4BB7 A;  1WHM A;  2EAY A;  2L2P A;  1N9R A;  5LJ5 f;  1M2V B;  3FJ5 A;  2O9S A;  1K9M U;  2CH4 A;  1VQ8 Q;  1NG2 A;  2V8I A;  3QKJ A;  2PTK A;  3QHS A;  4HCZ A;  1WHL A;  3HTR A;  1U8R A;  1IZ6 A;  5IHN A;  3REA B;  1ZSZ B;  2RK1 A;  2HD0 A;  4C0D C;  1Q81 R;  1JJ2 A;  4J6X A;  3CC7 A;  3OSS C;  4DEX A;  4AFQ C;  1ZSZ A;  1UUE A;  5LJ5 d;  4J6Y A;  2YXY A;  2CUD A;  1AZG B;  2LX9 A;  1R0C B;  1K0S A;  2PUO B;  1C6V X;  3OQ5 A;  2DTI A;  5GAO m;  3L2V A;  1KHC A;  4OGE A;  3SEM A;  3CXC S;  5LJ3 f;  3WVD B;  3KUF A;  4ZTF A;  4Z8A A;  3UA6 A;  2E5K A;  3AHU A;  4J6W A;  4J9E A;  4ZN3 A;  5AYF A;  4M7A B;  1WQW A;  2DLP A;  4FYY B;  4OMF B;  1KC8 C;  4CRI A;  1JJ2 P;  4DQ2 A;  3EFS A;  1W4S A;  2PU9 B;  3OYY A;  3QYG B;  3V8J A;  2XDD A;  2ZAE A;  4M7A E;  2PQW A;  2RMO A;  2RK2 A;  4WTO B;  1Y57 A;  1X43 A;  3OYN A;  1A0N B;  1M1K R;  2K3X A;  1CKA A;  4L5G A;  1LCK A;  3MP6 A;  4M75 C;  1WI7 A;  4M7D G;  1B07 A;  1PKT A;  4E47 A;  2JN0 A;  2R57 A;  1EFN A;  2WSE E;  2JTM A;  1VIE A;  4Y92 A;  1WLP B;  1UDL A;  2VGM A;  1G2B A;  3C95 A;  4OB2 B;  1ZA1 B;  1JB0 E;  2HZY A;  1QVF S;  2K2M A;  1QCO A;  3ZBD A;  4VUB A;  2ZZD A;  2XG8 D;  4XTX A;  2RO0 A;  4OB1 B;  4QKU A;  2JJ9 A;  2YRD A;  3SWN C;  5LJ3 g;  4LDX A;  2VB6 A;  4IUT A;  4DBH A;  1XTD A;  3I55 T;  2EJ9 A;  4PJO B;  3CCR A;  1QKW A;  2D9T A;  2O4X B;  2HQE A;  1RI0 A;  3GLX A;  2JT4 A;  2KK4 A;  2BE9 B;  2O4X A;  4EPC A;  2QEX A;  4PJO E;  4X9D A;  2EYY A;  3PE0 A;  1BYM A;  3CMA A;  2B86 A;  1M27 C;  1W2B S;  1C0M A;  4QW2 A;  2Y4Y A;  4O5V A;  3BDU A;  1Q86 R;  4J9B A;  4JLI A;  1RAI B;  2DXB A;  1T3L A;  1T0J A;  5A0D A;  1OZ3 A;  4A63 B;  2DZ9 A;  2VXF A;  3QWX X;  4X34 A;  5EC7 A;  1LPL A;  5GAO l;  1NZ9 A;  2PNI A;  1I4K 1;  3G4S A;  5IXB A;  1ZHI A;  1ZUK A;  4M78 D;  4BD3 A;  3RNJ A;  4ZN1 A;  1VQL A;  3JV3 A;  2CZ0 B;  1FXX A;  1JRI A;  4IUR A;  1OV3 A;  4LD9 K;  1H3H A;  5GAM g;  3RIR A;  1YCY A;  5GAN 3;  3F70 A;  1GCP A;  3GP8 A;  3HFO A;  2XHC A;  4JRP A;  2CZ1 B;  3GBQ A;  2AKK A;  2D8J A;  4M75 G;  4LNP A;  4M77 A;  2F2W A;  3FEO A;  4MZT A;  2COZ A;  1I81 A;  1RAB B;  1KG1 A;  4JS5 A;  4QQG A;  3EG9 B;  4KH0 B;  5IXF A;  2CDT A;  1BI1 A;  1O75 A;  3QBY A;  4AG2 C;  2JW4 A;  1VYV A;  1H64 1;  2FB7 A;  3TSW A;  3EG9 A;  1D1C A;  1BI0 A;  3QZ9 B;  5HKC A;  3ME9 A;  1PCX A;  1Q7Y R;  4C92 D;  4PNO A;  4E7I A;  1VQ9 A;  4LDW A;  4M78 B;  4JUV A;  3G6E A;  2SEM A;  3JCM g;  3MEU A;  4M78 A;  1M3B A;  3PFS A;  5HY6 A;  4M78 E;  4LXC A;  3EG0 A;  2QA4 A;  4RTY A;  5GAN j;  5HK0 A;  3QG1 A;  4PFP A;  4F7U F;  4ESR A;  1VQ4 A;  1VQN Q;  3MEW A;  4Y28 E;  4XTU A;  1VQ5 Q;  2QAS A;  2DBK A;  2O88 A;  1MMA A;  2LCL A;  1I8F A;  2DZC A;  2RQT A;  2LJ3 A;  3CBO A;  3P8B B;  1Q82 U;  2FZG B;  4EMK B;  4KUD K;  2RQU A;  1G3Y A;  4AT1 B;  2X4W A;  1M90 U;  4CI0 C;  4XU1 A;  3CCS Q;  4LUE A;  2EFI A;  3CD6 T;  1TS9 A;  4M77 F;  3NMZ C;  3OYL A;  4KH1 B;  1H92 A;  1UTI A;  2GCX A;  2VC8 A;  1QMC A;  2DRM A;  2LJ1 A;  2QQR A;  3PNW C;  3L2R A;  3J7A F;  4AG1 C;  2XD0 A;  2FG0 A; 
#chains in the Genus database with same CATH homology
 3JCM X;  4C92 C;  4M77 G;  4C92 A;  3JB9 G;  1Q86 C;  3ZFJ A;  4MMK A;  2MWP A;  4XTV A;  4RCB A;  3S3M A;  4M7D E;  2DPP B;  1QVG S;  5CKE A;  3VJP A;  1G5V A;  3JCM J;  3CCL A;  4C5I A;  3JB9 H;  5GMK h;  2DVE A;  3GNG A;  4R56 A;  2FVU A;  4C8Q C;  3OMG A;  3JCM f;  5CKF A;  2YHT A;  1VQ6 T;  2V8J A;  4A4K A;  4QVD A;  4IKF A;  1SSF A;  3HPW A;  1M1F A;  4RG2 A;  4PLI A;  3RKY A;  3QYH B;  2OAU A;  1KQS S;  4M7A G;  1X75 C;  2HAX A;  4ME7 A;  1M5Q 1;  3HP9 A;  1M1K U;  2LRQ A;  2E12 A;  1VQM T;  1OZ2 A;  2RB6 A;  4BAC A;  4C0D B;  3LWI A;  3LGL A;  3JCM d;  2VUB A;  4M75 D;  3EFR A;  3HL8 A;  3LH0 A;  1S72 T;  1YJN T;  1BIA A;  4BY6 B;  3OYJ A;  2MAM A;  4QVZ A;  3CCS A;  3J81 E;  2HBP A;  2OTL T;  1OYX A;  4X9C A;  2EYQ A;  2QQS A;  4BI4 A;  1XOV A;  2RHZ A;  2YLB A;  4C0F A;  3CEY A;  4R55 A;  4GY5 A;  1VQO A;  2LTO A;  4L59 A;  4XAX B;  3CBM A;  3BFM A;  3V7S A;  4BDZ A;  4JRI A;  2ZPF B;  1AHJ B;  3FDR A;  1VQP A;  3X25 B;  3OS5 A;  2R5A A;  3GPL A;  2ZPI B;  2RA2 A;  2RJC A;  3VYH B;  3OS1 A;  3GOX A;  3CC7 T;  4IUV A;  1VQN T;  2OTJ A;  4OB0 B;  1QVF A;  1YI2 T;  1YBY A;  3LLR A;  1BI3 A;  2VXE A;  3CPW S;  3CC4 T;  3CCE T;  3CCU T;  1X6O A;  3PT9 A;  1WNL A;  4OP0 A;  1VQ7 A;  1KQ2 A;  2LT4 A;  1UB4 A;  5KCH A;  1N8R U;  5LL6 S;  5J26 A;  3DB3 A;  2D0Q B;  2E6Z A;  2P0P A;  3HFN A;  4PJO F;  4IUU A;  4ZGE B;  3CCJ A;  1QP2 A;  3L1A A;  1KD1 U;  4FIB A;  5L8R E;  4NS5 A;  2YLC A;  4XTZ A;  3G6E A;  4OGC A;  5CO7 A;  5C6S A;  3CCM A;  2KY9 A;  3OW2 A;  4M7A F;  3BW1 A;  1ZBX A;  1YIJ A;  2E6N A;  3GIB A;  2DXC A;  1UGS B;  3Q1J A;  3OYM A;  4FT4 A;  1U1S A;  5GAN 4;  2DAQ A;  1JJ2 S;  2ZPB B;  3FLG A;  3L2U A;  1NPP A;  2DK3 A;  1UGQ B;  2G3R A;  2ZPG B;  4XTY A;  3M4G A;  5GAN 5;  4MZP A;  4PJO G;  2DD5 A;  3QXE B;  5EG2 A;  3TU4 K;  5A0G A;  3O8V A;  4J7I A;  3OYF A;  4C92 F;  4M78 C;  4YTL A;  5A0L A;  3FRN A;  1Q86 U;  1D3B B;  1K9M C;  1GXI E;  4L6V 5;  3QJ6 A;  4PL6 A;  1W2B A;  5FU6 B;  5LJ5 h;  3URG A;  1P92 A;  2AHJ B;  4C8Q F;  3WXM B;  3A8O B;  4M7D G;  4M75 B;  4FM4 B;  3RES A;  1Y07 A;  3I55 A;  2A3L A;  3OYK A;  2Y90 A;  5LJ5 g;  4MDX A;  2E1H A;  5FU7 C;  5KCO A;  2RH2 A;  2RI3 A;  3UT1 A;  1YJW A;  1XNI A;  4LDV A;  2IVW A;  4HT9 A;  2QQA A;  4XU0 A;  1QP3 A;  3HRS A;  5GAN h;  1FX7 A;  2I2L A;  4P5N A;  4C92 G;  3DLL A;  4M75 E;  4EMG A;  3DB4 A;  3VUB A;  3OYI A;  2IG0 A;  3JRZ A;  3PIO A;  3BY7 A;  3JCM P;  3CD6 A;  1M8V A;  4JS4 A;  1G3W A;  3M57 A;  4XU2 A;  5GAN g;  2M1H A;  5DM7 R;  4C8Q G;  3M55 A;  2M9U A;  2LQK A;  1YIT A;  2Y4X A;  2RI5 A;  3MHX A;  2H3J A;  3PGG A;  4OF1 A;  4KT0 E;  3I56 A;  4EMK C;  4EMK A;  4BUG A;  3HKS A;  3MO8 A;  3CC2 A;  2CGH A;  1BIB A;  2GQV A;  3SWN B;  4E7J A;  1YHQ A;  1KD1 C;  2DTO A;  3QZ5 B;  3INZ A;  2EQU A;  2WAC A;  2KQW A;  3MET A;  1UGP B;  3SB2 A;  3SWN A;  1U8R A;  2MMP A;  2RD1 A;  3V8K A;  3GNF B;  3KBG A;  4EDU A;  3X28 B;  2P0K A;  2DIG A;  3CCQ T;  4HT8 A;  2E41 A;  4E7K A;  5D6Y A;  4M77 D;  2D6F A;  3JB9 D;  2RHY A;  3FC3 A;  1NPR A;  1X01 A;  2EJG A;  2JNG A;  2LQ8 A;  1QW1 A;  4RMO A;  2HNI A;  1VQ6 A;  3M56 A;  4RCC A;  4ZGJ B;  4M7D C;  4M7D A;  1KHI A;  3CCV T;  5GAO p;  5CAI A;  3HHT B;  2DD4 A;  3G7Z A;  2JOY A;  2M16 A;  3P8D A;  5GAN e;  3M53 A;  2RHU A;  3CCR T;  2RHI A;  3NTI A;  1R8O B;  3JB9 J;  1WJR A;  1MGQ A;  2ZPH B;  2PVD B;  1VQM A;  3E19 A;  4JLG A;  3V8L A;  4ELY C;  2B8A A;  5C0M A;  1S72 A;  1KC8 U;  1M9S A;  4O6J A;  2L8D A;  3OYG A;  2QEX T;  1YJN A;  2LDM A;  1Q7Y U;  2C06 A;  3VU3 C;  3H6Z A;  4BB7 A;  2EAY A;  2OTL A;  3C94 A;  1N9R A;  1K8A C;  3JCM W;  1U1T A;  5LJ5 f;  1VQK A;  3CMA T;  5CQX A;  3M59 A;  4M78 F;  5LJ3 e;  4F7U B;  1K9M U;  2PUK B;  4J5Y A;  4LDU A;  2V8I A;  5GMK i;  2JVV A;  2X4J A;  2LT1 A;  3LW5 E;  3QKJ A;  5GAN 2;  5GAM j;  5D6W A;  2BUD A;  3QHS A;  4HCZ A;  4N0A C;  2DJZ A;  1IZ6 A;  2CS7 A;  4N0A A;  3RKW A;  2RK1 A;  2HD0 A;  3VKI A;  4C0D C;  4F7U A;  2XIC A;  2E5Q A;  2RM4 A;  2L3R A;  4J6X A;  4BI3 A;  4C8Q E;  5CR2 A;  4F7U E;  5GAN f;  3CC7 A;  2PVO B;  3HSB A;  3OSS C;  4BY6 C;  1YI2 A;  3CC4 A;  4JRK A;  3CCE A;  3VYG A;  5LJ5 d;  3DLM A;  3HRT A;  2DO3 A;  3R6O A;  4M78 G;  5A2Q E;  2MI6 A;  2YRV A;  2E65 A;  4J6Y A;  3G4S T;  1N6A A;  2LX9 A;  1TH7 A;  2K5I A;  2PUO B;  2R5M A;  4UC4 A;  3OQ5 A;  2DTI A;  5GAO m;  1VQ5 T;  3OB9 A;  4N4I A;  5GAN 6;  3L2V A;  4WF2 A;  3JB9 I;  1KHC A;  1VQL T;  4OGE A;  3CXC S;  5LJ3 f;  5CKB A;  3WVD B;  4M77 B;  1HXD A;  5GAN d;  3OY9 A;  3KUF A;  4ZTF A;  3JCM V;  3DKM A;  1LNX A;  2QXF A;  4IUQ A;  5KE3 A;  2F5T X;  2CZ7 B;  2EQM A;  2K4Y A;  3MCA B;  4J6W A;  3AHU A;  2QQ9 A;  3RKX A;  5CK9 A;  2NLU A;  1HK9 A;  2X4X A;  5GMK m;  3OS0 A;  2FL7 A;  4M77 E;  5D6X A;  4DOW A;  1UEB A;  3OYB A;  3OYD A;  1PSE A;  3CCS T;  2GFU A;  4ZN3 A;  5CIU A;  3M58 A;  3RMQ A;  2JTF A;  3L2Z A;  5IAY A;  2EKO A;  3N5B B;  4PLL A;  5AYF A;  4M7A B;  1WQW A;  1ZQ1 A;  4JRQ A;  4OMF B;  1KC8 C;  4CRI A;  4DQ2 A;  2QDY B;  1Q7Y C;  2KDS A;  3EFS A;  1W4S A;  2GFA A;  4ZTJ A;  3EAE A;  4M7D F;  2PU9 B;  1Y7X A;  4BE2 A;  1VQ8 A;  3OYY A;  1K73 C;  3QYG B;  3V8J A;  1BKB A;  3A8L B;  3X20 B;  2XDD A;  2DEQ A;  4M7A E;  2PQW A;  4KUI A;  2RK2 A;  3QPH A;  1IRE B;  4C5H A;  3S3O A;  1D3B A;  3OYN A;  2K3X A;  2P0Q A;  4C0Z A;  5FU6 C;  2M0O A;  4L5G A;  2XDP A;  1G3S A;  3A8H B;  4Z02 A;  3CCJ T;  4V2S A;  3MP6 A;  2E64 A;  2MF2 A;  4M75 C;  4M75 A;  2QI2 A;  4C0G A;  2RJE A;  4C8Q D;  4LD6 A;  4E7H A;  2CYZ B;  1QVG A;  1WPY A;  2VV5 A;  4II1 A;  4E47 A;  1K8A U;  2JN0 A;  4ATO A;  1JBM A;  2R57 A;  2GF7 A;  5GAO q;  2LNV A;  2WSE E;  2JTM A;  3X26 B;  1VIE A;  1YJ9 T;  2RI2 A;  1VQ9 T;  1NE8 A;  2VGM A;  3C95 A;  4OB2 B;  3G6E T;  2KSS A;  4Y91 A;  1JB0 E;  1DJ7 B;  1Y71 A;  2WSC E;  3PMT A;  5FRO A;  4NOY A;  4XTW A;  1KQS A;  2EJF A;  3SFM A;  1EIF A;  1QVF S;  2EIF A;  2VGN A;  4QQ6 A;  3ZBD A;  2K5L A;  2ZZD A;  4VUB A;  2XG8 D;  5LJ3 h;  5HK3 A;  5DLO A;  3M4Y A;  4XTX A;  4ZGD B;  2RO0 A;  3M9Q A;  2L5Q A;  4OB1 B;  2X4Y A;  2KMT A;  5CKH A;  2QA4 T;  5IN1 A;  3RUX A;  4EMH A;  2ZPE B;  5J39 A;  3SWN C;  5LJ3 g;  4LDX A;  2XU8 A;  4IUT A;  3CCV A;  4OVA A;  1H3Z A;  1WJS A;  2EQJ A;  1XTD A;  3I55 T;  4B9X A;  1VQ4 T;  1OI1 A;  3CPF A;  2EJ9 A;  2X35 A;  3UDC A;  3CBP A;  4PJO B;  3CCR A;  4C5G A;  2D9T A;  2O4X B;  1YJW T;  2HQE A;  3G71 T;  2A7Y A;  3H8Z A;  2R58 A;  1RI0 A;  3JCM e;  3GLX A;  2KK4 A;  2O4X A;  3LGF A;  4EPC A;  5FLX E;  3RER A;  2QEX A;  4PJO E;  4X9D A;  3V7R A;  2EQK A;  3MP8 A;  4MDW A;  3JCM Q;  3JB9 F;  3A8M B;  2F5K A;  3PTA A;  3VV0 A;  1YIT T;  3LWH A;  1BYM A;  1Y96 B;  3C12 A;  4D6W A;  3CMA A;  3CPW A;  3OYH A;  3SDZ A;  3I56 T;  3RMS A;  4A4H A;  4E7L A;  1W2B S;  3CXC A;  1NJI C;  4M7A D;  3OBW A;  1VUB A;  4QW2 A;  4ELZ C;  3CC2 T;  4RKU E;  1FWZ A;  2Y4Y A;  3BDU A;  4O5V A;  3ZEH A;  4C92 B;  5GMK j;  4JLI A;  2XKO C;  3CME T;  4BDY A;  2K2V A;  2DXB A;  2XID A;  2XI9 A;  1JJ2 A;  2JUF A;  1MHN A;  4A53 A;  5A0D A;  1OZ3 A;  1K73 U;  4C8Q B;  3JSC A;  2DZ9 A;  3MEV A;  2VXF A;  4XU3 A;  4BE1 A;  4TVR A;  4C92 E;  4HCB A;  2K57 A;  4QQD A;  4X34 A;  2E70 A;  5GAO l;  1NZ9 A;  3P8H A;  1I4K 1;  4C8Q A;  3OYE A;  3G4S A;  1G3T A;  4KUL A;  1ZHI A;  2DTH A;  2P4T A;  5I21 A;  5GAN 7;  2CZ6 B;  2MWO A;  4M78 D;  2HQX A;  1VQN A;  3QSU A;  1VQ5 A;  4MML A;  3ASK A;  3BDL A;  3M54 A;  4NL2 A;  4BD3 A;  4ZN1 A;  4M75 F;  1VQL A;  4J83 A;  1M1G A;  2V8K A;  5GAM h;  3CCL T;  3CCU A;  1Q81 C;  2CZ0 B;  1FXX A;  1JRI A;  1M4Z A;  3PMI A;  4IUR A;  5GMK l;  2FYK A;  4LD9 K;  2F69 A;  5KE2 A;  4BI8 B;  3OMC A;  5IT9 E;  5GAM g;  3RIR A;  4RG8 A;  1Q82 C;  1YCY A;  4FSX A;  3S6W A;  3F70 A;  3V7C A;  5GAN 3;  3GP8 A;  4LDY A;  1PSF A;  3OBY A;  3HFO A;  4GLK A;  3MEA A;  1V29 B;  3TCJ A;  1XQH A;  2XHC A;  4JRP A;  2CZ1 B;  3QII A;  4B9W A;  5J3B A;  3E9F A;  1M90 C;  1VQK T;  4A4F A;  4M75 G;  3C4S A;  3E1S A;  3MP1 A;  3M5A A;  4M77 C;  2KVQ G;  4M77 A;  2BIV A;  3A5Z B;  3FEO A;  4MZT A;  5GAO n;  3QJY A;  4A4G A;  5DLQ E;  1I81 A;  1KG1 A;  4JS5 A;  3TEE A;  3OA6 A;  4QQG A;  3PIP A;  4PJO D;  5CCA A;  1N9S A;  2DIQ A;  5LJ3 d;  5GMK e;  3HRU A;  5CKD A;  5KH6 A;  4HA8 A;  1VQO T;  2LC4 A;  2KAF A;  1BI1 A;  1O75 A;  3QBY A;  5I2S A;  2XK0 A;  5CVI A;  3UWN A;  2JZ2 A;  1VQP T;  1H64 1;  2FB7 A;  3TRE A;  3L2Q A;  3OYC A;  4M7A C;  2O01 E;  4M7A A;  2XDB A;  2EWN A;  3FJP A;  2DXU A;  4N4G A;  1BI0 A;  1O9S A;  4MZM A;  3QZ9 B;  3FIF A;  3OSV A;  4A54 A;  5GAM e;  4OB3 B;  5HKC A;  3ME9 A;  3QO3 A;  2OTJ T;  3LX7 A;  4XK8 E;  2ZCF B;  3J80 E;  4DA4 A;  3SD4 A;  5GAN 8;  1VQ7 T;  1NJI U;  4M7D D;  2E10 A;  1WGS A;  4Q5W A;  4C92 D;  4PNO A;  4E7I A;  5FRN A;  1YJ9 A;  4IUP A;  3JCM h;  1VQ9 A;  4LDW A;  3KXT A;  2BKD N;  4JUV A;  4M78 B;  1KQ1 A;  3X24 B;  1QVP A;  4J8O A;  4A4E A;  5LJ5 j;  1UGR B;  2K3Y A;  3CCM T;  1M1K C;  5M9O A;  1YIJ T;  3JCM g;  3QDR B;  3MEU A;  4M78 A;  2RJF A;  3PFS A;  3JAM E;  3VUZ A;  5HY6 A;  3L2W A;  5DY9 A;  4M78 E;  4KBM B;  4HKE A;  2QA4 A;  5GAN j;  5HK0 A;  2DXT A;  5FU7 B;  3QG1 A;  4F7U F;  5FRM A;  2K5F A;  1B34 B;  1VIF A;  3A8G B;  5GAM f;  2L89 A;  3CCQ A;  3UPU A;  2PVG B;  3E9G A;  4FT2 A;  1VQ4 A;  1VQ8 T;  2ZGW A;  3LYI A;  4NL3 A;  3MEW A;  4Y28 E;  4XTU A;  2QQB A;  3QUI A;  2LCC A;  2CKK A;  3GF5 A;  1B34 A;  2WSF E;  3G71 A;  1Q81 U;  1LJO A;  2LCL A;  1I8F A;  5I2M A;  2DZC A;  4BE0 A;  3CBO A;  3P8B B;  2DKG A;  4JDS A;  3OS2 A;  4QVC A;  1Q82 U;  3NFC A;  5LJ3 j;  3OW2 S;  4EMK B;  4KUD K;  1I5L A;  1G3Y A;  4F7U G;  4FL6 A;  5GAM d;  1WQ7 A;  1N27 A;  2QTX A;  2X4W A;  1M90 U;  4CI0 C;  4XU1 A;  5CQY A;  1N8R C;  3OYA A;  2EFI A;  4PJO C;  4PJO A;  3NTH A;  4C5E A;  3CD6 T;  4XQ3 A;  4PKC C;  3ER0 A;  4M77 F;  3S3N A;  3OYL A;  1LOJ A;  3CME A;  3T9N A;  2FHD A;  3JCM c;  4J7F A;  3WVE B;  2RJD A;  2LVM A;  3NTK A;  2GCX A;  4N4H A;  2VYT A;  3JCM b;  2VC8 A;  5GAO r;  4M7D B;  2QQR A;  3PNW C;  4DOV A;  3FB9 A;  5LJ5 e;  3L2R A;  1Y96 A;  3J7A F;  1YHQ T;  4FU6 A;  4JJN K;  1BI2 A;  2RHX A;  4HCC A;  1WJQ A;  2XD0 A;  1RL2 A;  3L42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...