2FPDA

Sad structure determination: crystal structure of the intrinsic dimerization sh3 domain of the ib1 scaffold protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords C-jun-amino-terminal kinase interacting protein 1
total genus 15
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpdA00
1AD5A 2FG0A 1UUEA 4A63B 5IH2A 1YWOA 1GFDA 1OPLA 2O9VA 1UHFA 4X1VA 5IHIA 2BTTA 2JW4A 2K2MA 2RQVA 1BU1A 4EIKA 1HD3A 4Z89A 2RF0A 3RBBB 1ARKA 1QKXA 1WXTA 1ABQA 2DNUA 2A36A 2ROLA 2H8HA 2I0NA 2EQIA 3EHRA 2JT4A 2DBMA 2HSPA 2M0YA 2JS2A 1SPKA 4GLMA 1UGVA 1K76A 1SHFA 4OMMA 4M4ZA 4AG1C 5GJVB 1CKBA 2KEAA 2OI3A 1RLQC 1H3HA 1U06A 3JV3A 2GTJA 3VS0A 2JS0A 5L23A 3M0QA 3UF4A 1FYNA 2KXDA 2SRCA 1Z9ZA 1ZBJA 2CUBA 1K0XA 2KE9A 1SRMA 4J9IA 1I1JA 4E6RA 1UECA 1X27A 5FW9A 1VYTA 2ESWA 1T3SA 5I11A 3REBB 1G2BA 3VS4A 1YWPA 4RTUA 1AWWA 1VYVA 2LJ1A 3VS2A 2YUOA 1AOJA 1I07A 2DE0X 1PKSA 4GBQA 2EBPA 3PVLA 1X2QA 2DL7A 2KGTA 2DA9A 2RQRA 2DL4A 1GCPA 1RLPC 2LQNA 2YUPA 2LJ3A 2L2PA 3NPFA 1K0SA 4J9CA 2K6DA 2QDLA 1WX6A 2F2XA 2DMOA 5ECAA 1CSKA 1X6BA 1TG0A 1KFZA 4RTZA 2FPEA 3A98A 2D8HA 4R0KA 1WDXA 1GCQA 1HSQA 2IIMA 1ZUKA 1JQQA 4OMOA 3R6NA 1GRIA 3NGPA 1GCQC 2LNHB 4RTVA 2O31A 5IXFA 3M0UA 3U23A 1W6XA 4CC2A 4K11A 1AWXA 1UTIA 4HVUA 2AKKA 3TSZA 3VS3A 2CH4A 4LN2A 2KRNA 2AZVA 2CSQA 2EYZA 1JO8A 1I0CA 1W70A 2ENMA 3O5ZA 2DL3A 2DILA 4JJDA 4AG2C 1JU5C 3H41A 1NEBA 4LUDA 1AZGB 4F14A 1VA7A 1RI9A 1RUWA 4RTYA 1KSWA 2X3XD 1NEGA 1AZEA 1KIKA 2FEIA 2ECZA 2RPNA 2DYBA 2O88A 2HCKA 1UJ0A 2OJ2A 1IO6A 1AWJA 1SSHA 2CDTA 4ORZA 3EG0A 2DVJA 2LJ0A 2A28A 1TUCA 1ZLMA 2DX1A 2LZ6B 1M30A 2ABLA 2EGEA 2L0AA 1CKAA 4AFZC 1GL5A 1PWTA 4Z88A 3H0IA 1HJDA 2GNCA 2EKHA 1NYFA 2B86A 2FO0A 1LCKA 2L3QA 2CUDA 2J05A 1VYUA 2BZ8A 1GFCA 1ZSGA 2CT4A 5IXBA 2O2OA 2NUZA 1B3QA 2EPDA 3GBQA 3UA6A 1MUZA 2KRMA 4KRTA 1QCFA 4RTWA 1X69A 1E6HA 3M0TA 3VS6A 1N5ZA 1H8KA 2YT6A 4LE9A 1T0JA 1UHCA 3EG3A 2EVRA 1TUDA 4AFQC 1A0NB 4J9BA 2ED0A 1OV3A 2JTEA 1BB9A 2JMAA 1UFFA 1JXOA 1UJYA 3QWXX 1OOTA 4ESRA 1MV0B 1KJWA 1U3OA 1U5SA 2O9SA 2X3WD 2XMFA 4DEXA 3TSWA 5FWCA 1AVZC 2LP5A 2DF6A 5IHNA 2MCNA 2DL8A 4AFUC 2PNIA 3REAB 2HDAA 3I9QA 3QWYA 2GGRA 2FRWA 3M0SA 1GBRA 2G6FX 2KYMA 2K7AA 3C0CA 2GTOA 4RUGA 2L3SA 2CREA 3M0RA 2ED1A 1EFNA 1YP5A 2VKNA 2RQUA 2RN8A 5GJWB 2JMCA 3EHQA 3I5SA 2KYBA 2AZSA 2EYXA 4J9FA 2F2WA 2V1RA 2K79A 3RNJA 2KT1A 4CC4B 3TVTA 2SEMA 1XOVA 1PRLC 2C0IA 4D8DA 3ZL7C 1X2KA 4LNPA 2AKLA 2CT3A 2KR3A 1X43A 1J3TA 4IIOA 1JEGA 3THKA 3KFVA 4QT7A 3VS7A 4HCKA 1K4US 1H92A 3EGUA 1G83A 2C0OA 2JXBA 2PZ1A 2YSQA 1WA7A 2D8JA 1B07A 2FPDA 1NLOC 1PRMC 4JJBA 5I22A 3UA7A 1PKTA 4Y92A 2J6FA 2HEQA 2J06A 4DEYA 2D1XA 2F2VA 2CSIA 1WYXA 2EW3A 3SHWA 2YUQA 3IQLA 2FPFA 2J6KA 2NWMA 1UDLA 2DRMA 3EG2A 2A08A 4FSSA 3I5RA 2KXCA 2JM8A 4WCIA 1K1ZA 1Y57A 2RQWA 1UE9A 1OEBA 2CH4W 2A37A 2ROTA 1WXUA 2YDLA 3H0HA 2JM9A 2K9GA 2YUNA 1QLYA 4Z8AA 2HBWA 1X6GA 1M3CA 1Y0MA 1S1NA 1WXBA 1AEYA 3ULRB 2DLPA 4OMLA 3NHNA 2KROA 5EC7A 3UATA 1V1CA 1OPKA 2KNBB 2E5KA 2GBQA 2D0NA 4JZ4A 2DM1A 4D8KA 2BZXA 2VVKA 1K9AA 4JZ3A 4RTXA 2C0TA 3LH5A 3NMZC 1M27C 4RTTA 3H0FA 1E6GA 2EYWA 3VS5A 1YNZA 2BZYA 1QWEA 1WIEA 4HXJA 2AK5A 1NM7A 2KBTA 3PE0A 4ZNXA 1YCSB 2VWFA 1ZUYA 2RNAA 2LX7A 4HVVA 3EG1A 5FWBA 1FMKA 1SEMA 2W10A 2LMJA 4CC3A 2DL5A 2J7IA 2LQWA 1M3BA 3VRZA 4JJCA 3PVQA 1BK2A 2DJQA 1YN8A 2KT8A 2K3BA 2FRYA 1QWFA 2DRKA 4OMNA 5IHKA 2J6OA 1WFWA 2DBKA 1JXMA 3VRYA 1QKWA 1UG1A 3I35A 4LUEA 3M0PA 1AWOA 1NYGA 4OMPA 1ZUUA 4J9HA 1T3LA 2W0ZA 3FJ5A 4J9GA 1WLPB 4J9DA 1BBZA 2GQIA 2P4RA 3SEMA 1T0HA 1SHGA 3VS1A 1M8MA 1ZX6A 4F17A 4JPBW 4AFSC 1PHTA 2KRSA 1NG2A 4OMQA 5HCKA 4F16A 2V1QA 2EYYA 1MV3A 1Z9QA 2PTKA 4HVWA 2EGCA 2EGAA 2RQTA 1E7OA 3CQTA 4IIMA 2MOXA 2MIOA 2RMOA 2OAWA 4CC7A 1SRLA 2L3PA 1M3AA 1WI7A 1W1FA 1NLPC 1PNJA 2LCSA 4J9EA 2M51A 1GBQA 1ABOA
chains in the Genus database with same CATH superfamily
3CCJQ 1JJ2S 1AD5A 4F7UG 2FG0A 4C8QE 3URGA 3PGGA 1GFDA 3M9QA 1OPLA 2O9VA 1UHFA 1M2VB 2JZ2A 4C8QD 2ZPEB 4QVDA 3M55A 1WHMA 4Z89A 8ATCB 2NUPA 4J83A 1QKXA 4C8QC 1WXTA 2XIDA 1YJNT 2DNUA 2RM4A 2DKGA 4KUIA 4KUDK 1SSFA 1MMAA 5GAN5 2DBMA 3L2UA 2HSPA 2PQWA 2PVGB 4LD9K 2E6NA 3C4SA 2OTJT 1NPPA 1K76A 5FU6C 2BUDA 1YITT 3JCMP 1VQ5Q 5KCOA 4B9WA 1RABB 4BY6B 2GTJA 4JRKA 3VS0A 1RAFB 3UF4A 2SRCA 2CGHA 2DTIA 4C8QA 3JAME 2KAFA 2KE9A 1EIFA 2LQKA 1RAHB 1UECA 3BE3A 5I11A 3E9FA 4MZPA 2DVEA 2XG8D 5CK9A 1YWPA 4RTUA 2XICA 3BY7A 2E65A 1AWWA 2YUOA 1LVKA 1MGQA 5IN1A 1I07A 4GBQA 2OAUA 2KMTA 2MK5A 3LW5E 1GXIE 1PM3A 4J9CA 2QDLA 3CC7A 3OYJA 1CSKA 1TG0A 5CKDA 2FPEA 4M7AD 2D8HA 1YI2T 4R0KA 3JCMb 3OYGA 1GCQA 1JBMA 1M1KR 3CCMQ 2Y4XA 1JQQA 4M75C 1BKBA 2ZAEA 1VQ6Q 2H3JA 1TUGB 3CBOA 5CKFA 4QW2A 3U23A 1W6XA 4FYVB 4K11A 4Q5WA 4J7IA 2AKKA 1YJ9Q 5KCHA 3HFNA 1S72Q 1M1FA 1WPYA 3GPLA 1VQNT 2DTOA 4E7HA 1BIAA 3MEWA 2HAXA 2EQMA 3QIIA 1LJOA 4LUDA 1AZGB 4BDYA 4E7KA 1RI9A 4RTYA 2I2LA 3CMAA 1BIBA 1NEGA 3V8JA 1C6VX 3E1SA 1VIEA 3ER0A 2P4TA 3I56T 1O9SA 3JCMV 2RJDA 5FU6B 3TU4K 3SD4A 1YITA 1I81A 2PVOB 2LJ0A 2DX1A 2RK2A 2L0AA 1CKAA 3VU3C 1BI0A 3BFMA 2O4XB 1QCNA 4XTXA 1HJDA 4CRIA 2ZZDA 3KUFA 2FO0A 2CUDA 1K9MU 4QQGA 2RJFA 1ZSZC 5GANj 1MUZA 4M77F 5GAMf 2VXFA 7AT1B 3VS6A 3OYHA 4LE9A 4A4HA 1MMNA 3X26B 3L2VA 5KYNA 1H641 2COYA 1I5OB 1TUDA 5LJ5j 1D0YA 1YI2A 2XHCA 4AFQC 2XDDA 1A0NB 3OSVA 2DIQA 2BE9B 5KYUA 2ED0A 4PNOA 4FT4A 4O6JA 1UFFA 1KHCA 1OOTA 1EX4A 4PJOG 1G8XA 3A8LB 1U5SA 2ATCB 5FWCA 2LP5A 4O5VA 3J80E 2DF6A 5IHNA 2BE7D 4BACA 3MEAA 2PNIA 4LDWA 5GAMg 2HDAA 2JTFA 3I9QA 4IKFA 3A8GB 1TXQA 2HQEA 2HQXA 1IREB 3OB9A 2K7AA 3EFOB 3OYEA 2Y90A 2GTOA 4RUGA 2L3SA 3PNWC 4M75D 1VUBA 2RN8A 5LJ5f 2JMCA 1VQ7T 3I5SA 4MDWA 1OX8A 2EYXA 3CD6T 2V1RA 2E70A 3RNJA 2KT1A 4CC4B 3TVTA 2V8JA 3OW2S 4LNPA 1K8AU 1OZ2A 3MPUB 2KR3A 1M9SA 2HL3A 3NFCA 4HA8A 2X4JA 1HYOA 4GLKA 3KFVA 4QT7A 1QQJA 3VS7A 1VQKQ 1QVFA 4PKCC 2GF7A 3CC2T 4C0DC 2XK0A 4N0AA 4KGZB 1YJNQ 1M4ZA 1VQ8A 3CC7T 2ZPFB 1YFNA 2YSQA 2PZ1A 2FPDA 2H3EB 3RMQA 1K8AR 4Y92A 4HT8A 4C92D 2BKDN 2A7YA 2EQJA 4JRPA 2F2VA 1VQ9Q 4C92F 2MAMA 5GANf 2EW3A 4P5NA 3OMGA 1BI3A 2YUQA 3HRSA 3DB3A 1H3ZA 3EAEA 3CC4A 2J6KA 2NWMA 2MI6A 1UDLA 1W2BP 2HMAA 3ZBDA 2A08A 3JCMh 3SB2A 4N4HA 2A37A 1Q82R 2YDLA 3H0HA 1IHVA 2HBWA 2EFIA 1X6GA 4M7DB 1WXBA 5LL6S 2CYZB 2K3XA 2KROA 1V1CA 1OPKA 2DIGA 4HKEA 4M75F 2D0NA 4JZ4A 2DM1A 4D8KA 4FYWB 2QGGA 5KYXA 4NOYA 4OB1B 4ZGJB 3MO8A 3CEYA 4J6XA 1NPRA 5KYYB 3JB9J 4NS5A 3FJPA 1I4K1 3DLMA 3NMZC 2F69A 4C0GA 3L2RA 3GOXA 2MPXC 3TQ7P 3NTIA 2DD5A 3WVDB 4A4EA 2KQWA 4ZNXA 1YCSB 3L42A 2RNAA 3G1JA 3CC2Q 3EG1A 3L2ZA 2OTLT 2M16A 2J7IA 4IURA 3VRZA 3OYYA 3PVQA 2DETA 1VQ7Q 8AT1B 4R56A 3VYGA 2V26A 2FRYA 3C94A 5GAOq 2DRKA 2CP6A 4YTLA 3HRTA 5GAMe 3OQ5A 1KQ2A 2KY9A 4OMPA 5GMKe 1VOMA 3CCJA 1T0HA 1SHGA 2IVWA 3VS1A 1M8MA 4F7UF 1YHQQ 1YIJT 5LJ3h 2NYSA 1KQSA 1X75C 1PSFA 1QW1A 3ZFJA 4AFSC 1PHTA 4J6WA 4DBHA 1Q86C 4OMQA 5HCKA 1WHLA 2V1QA 3R6OA 1QVPA 1Z9QA 2PTKA 2R5MA 3KXTA 1E7OA 1TWBA 4PJOE 2K3YA 1VQ4A 4C5GA 4CC7A 4EMGA 1WJSA 2CP3A 1WI7A 1W1FA 3BDUA 2EJGA 4V2SA 3JB9F 3NTHA 2LCSA 3I55Q 3ULRB 1ZSZB 3JB9H 4M75B 1WHGA 1N9SA 1VQPT 4X1VA 5IHIA 1G3SA 2BTTA 2JW4A 3DB4A 2RQVA 4C5IA 1KQSP 4EIKA 1FWZA 3QZ9B 1Y96B 4II1A 3P8BB 1V76A 3RBBB 1ABQA 3OBWA 3TCJA 2A36A 2DXCA 2ROLA 1D3BA 4XAXB 2OX7A 1XNIA 3QJYA 5LJ5d 4VUBA 3OYLA 3WXMB 2JS2A 1UGVA 1UGRB 4XTZA 1SHFA 1U8RA 4M4ZA 3RKXA 5FRMA 5GJVB 1CKBA 1VQ9T 1YJWT 3OY9A 2KEAA 2IPOB 2OI3A 1H3HA 2QDYB 3JV3A 3CCEA 1D1BA 1KK7A 5L23A 3QDFA 1FYNA 1N9RA 1JRIA 1Z9ZA 3M57A 4B9XA 5FROA 1SF9A 1I1JA 3PMTA 4C5HA 5FW9A 1VYTA 3VUZA 4CI0C 3P8DA 2E3HA 4PFZA 2P0KA 1G2BA 3ASKA 4XU1A 3MHXA 4ATOA 3G4SA 2MMPA 2D0QB 1PKSA 3PVLA 3OMCA 5LJ5e 4A53A 3RERA 2DA9A 4M7AE 5GAOr 1GCPA 2LQNA 2KSSA 4XTYA 1K0SA 1Y07A 1NE8A 2K6DA 2VXEA 4ANJA 4M7DG 1X6BA 2QEXQ 4OVAA 4M75A 4RTZA 2NUTA 4XU0A 3VYHB 5LJ3d 3CCSA 1X6OA 3QKJA 3NTKA 1HSQA 1MHNA 5LJ5h 1ZUKA 1IRXA 5D7UA 3JCMQ 3R6NA 2F5TX 1GRIA 3FLGA 3CCMT 3F70A 2LNHB 4RTVA 2O31A 3GP8A 2B8AA 1ZQ1A 1D3BB 3Q1JA 3JRZA 1UTIA 3CMEQ 1VQ5T 3VS3A 2CH4A 4LN2A 1YITQ 1R0CB 2KRNA 2HQHA 2ENMA 4M77D 5KYWA 2P0QA 3JCMf 2QASA 1Q81C 2E12A 2KDSA 4JJDA 2XD0A 3EGDA 1JU5C 1Q81U 1YIJQ 1RI0A 4ZGEB 2CKKA 2DFUA 4KH0B 1VA7A 3H8ZA 3INZA 1YIJA 1KSWA 4OB0B 4BI8B 5GANh 1K73U 5GAMd 1RAAB 3C12A 5FRNA 2RPNA 2DYBA 1IO6A 2CDTA 1WHJA 1JJ2A 4F7UA 2A28A 3CCRT 2DXUA 4M7DE 3JSCA 4E47A 3GLXA 2LZ6B 1AHJB 4AFZC 4BE1A 4Z88A 3H0IA 1Q95G 3CBMA 3MP6A 1VQ6A 4FCYA 2B86A 2J05A 3OS0A 2CT4A 2DXTA 1FX7A 1VQLA 2FVUA 3MKDA 4M7DA 3S3NA 4M77G 2ZGWA 5GAOp 3RESA 4OB3B 3M0TA 1E6HA 4PJOC 3M54A 2YT6A 3EH1A 2EVRA 2E41A 3M58A 3HFOA 2JUFA 2RHIA 2EAYA 2LRQA 3OW2P 5KYYA 5GAN3 1BB9A 2JMAA 4J5YA 5KYUB 3CCJT 2F5KA 1W4SA 4OGCA 2E64A 3QWXX 2DD4A 3G71A 1KJWA 1U3OA 2O9SA 2PVDB 4EDUA 3VJPA 1AVZC 1RAEB 1OYXA 4M78F 4AFUC 5A2QE 2QG9B 2OTJA 5C0MA 2FZKB 3J81E 1OI1A 2EQUA 2G6FX 3CCSQ 2CREA 2X35A 2ED1A 4L6V5 5GJWB 2RQUA 3EHQA 4FU6A 4JLIA 3MP8A 2RI2A 3CCVA 2X4WA 2K79A 3FB9A 1AT1B 2SEMA 4KGVB 2AT1B 1XOVA 1UGSB 1VQ4Q 1TOVA 1X2KA 2X4YA 1VQOT 1X43A 1VQMT 4ELYC 4C0DB 5CQYA 4JS4A 5CKHA 3LYIA 2X51A 5CKBA 4DBRA 5GMKl 5GAN7 3UT1A 2OTLQ 4LXCA 5I22A 1RL2A 3CCRA 2EQKA 4XU2A 3JB9D 4DEYA 2D1XA 3OYIA 2RI5A 3CCRQ 2CSIA 5GAN8 2K4YA 1G3TA 2DK3A 3SHWA 3IQLA 2O4XA 2CS7A 3PIOA 3CXCS 2DRMA 4L5GA 1KD1R 1RADB 1I8FA 2EJ9A 2E5QA 3CD6Q 2KXCA 2JM8A 4WCIA 1K1ZA 5GAN6 2ZPIB 4M78D 1OEBA 2ROTA 2FZCB 3OYMA 2K9GA 2KK4A 2HD0A 4RCBA 5KE2A 3EFSA 1M3CA 2NLUA 1QVFS 2DLPA 4OMLA 3JCMX 3NHNA 4E7JA 4M7AC 2XKOC 3HSBA 3M53A 5CO7A 4HCBA 3CBPA 2BZXA 3I56A 3E2UA 2VVKA 4OB2B 4X9CA 4C0FA 3PMIA 1M5Q1 3CCET 1KC8C 2C0TA 1X01A 4EPCA 5GMKh 4M7AB 4X34A 2KI7A 1WIEA 4E2FB 2VGNA 1KD1C 2X4XA 1W2BS 4E7LA 1M90C 4LDYA 3JCMW 4Y28E 5IAYA 1QVGP 2RH2A 3QZ5B 5CAIA 5DLQE 5HK3A 4IUPA 3HKSA 4NL2A 4IUQA 4JJNK 3CPWS 2DJQA 1BI2A 2DYIA 2K3BA 2RI3A 1VQ5A 5LJ5g 1I5LA 4M77E 5IHKA 2J6OA 1WFWA 2DBKA 4OGEA 4BDZA 3VRYA 2CZ7B 2EKOA 2A3LA 2ZPBB 1UG1A 2LQ8A 5GMKi 1NYGA 2XDBA 1YJWQ 4J9HA 3FJ5A 4J9GA 1FXXA 3CCUQ 2GQIA 2DAQA 5DM7R 1VQOQ 3CMAT 1N6AA 1KHIA 1D1AA 1PSEA 2KRSA 3CMAQ 4AMCA 1PG5B 4F16A 4HT9A 3OA6A 2E1HA 1UB4A 2MOXA 2MIOA 2P84A 1G3YA 2QQSA 1M3AA 2CP7A 2XI9A 3AT1B 4M75E 4PJOF 4C0ZA 3OYNA 4J9EA 5CIUA 2M51A 3QYGB 2IG0A 4FYXB 4HCZA 1UUEA 4A63B 2LVMA 1YWOA 4C8QF 2FL7A 1B34B 4F04B 4A54A 3CCEQ 1IHWA 2K2MA 2QTVA 4C8QB 2YRVA 1BU1A 4MZMA 3G6ET 1PD1A 1N8RC 2RF0A 5GAOm 4JS5A 3OYAA 2H8HA 2I0NA 2RK1A 3EG9B 2QGFB 2JT4A 4RKUE 2M0YA 4RCCA 4DA4A 1IB8A 4GLMA 4KBMB 3PTAA 2YHTA 1UGQB 2HBPA 5CCAA 4OMMA 4AG1C 2RB6A 3SWNC 4FYYB 1RLQC 1U06A 3PIPA 2JS0A 1M2VA 5AT1B 3M0QA 2LCCA 4ELZC 2KXDA 3OYBA 1Q86R 3HPWA 2HKNA 3ZEHA 5I21A 4FL6A 1TSFA 1SRMA 6AT1B 4N0AC 1X27A 3VUBA 4GY5A 3CC7Q 1YHQT 1T3SA 2VV5A 1Q7YC 4M75G 2LT1A 2VGMA 3CCLT 3JCMg 4BY6C 2DZ9A 4OF1A 1VYVA 2LJ1A 5I2MA 5HY6A 1AOJA 3S3MA 5KH6A 3QYHB 4E7IA 2EBPA 2DPPB 3G71T 4MMLA 2L89A 1VQOA 2KGTA 2RQRA 2VC8A 3OYKA 1RLPC 3V8KA 2LJ3A 3LX7A 4QQ6A 5FLXE 5GMKj 4NL3A 1WX6A 2F2XA 5LJ3g 4LDUA 4M77A 2RO0A 1IXDA 2K57A 3EH2A 3CXCA 1TH7A 1WNLA 1VQ8T 2HSEB 4OMOA 4BE0A 3NGPA 3C95A 3M0UA 5IT9E 1YCYA 1AWXA 5M9OA 1ZHIA 3S6WA 3JB9G 2BIVA 5GAMj 5GAOl 2CSQA 1I0CA 4C5EA 3OW2A 3O5ZA 3V7SA 2DL3A 4PJMA 2OTLA 3CD6A 1R8OB 1M1KC 4D6WA 2O01E 3H41A 1SKUB 3PT9A 1OZ3A 4F14A 2R57A 1WGSA 4BE2A 4A4GA 1Y96A 1WHKA 3ME9A 4XQ3A 3T9NA 3UDCA 3JB9I 1AZEA 4PLLA 1UEBA 1KIKA 1R77A 2FEIA 2ECZA 2HCKA 1UJ0A 3FDRA 1O75A 4ORZA 1VQLT 3CCVT 5GAN2 2AHJB 2DVJA 4JUVA 2R58A 1IGQA 4FM4B 1Q82U 1TS9A 1M90U 1BI1A 1ZLMA 4LDVA 4QKUA 4ZN1A 1M30A 2DERA 2EGEA 3L1AA 1GL5A 5L8RE 4PFOA 1PWTA 3SFMA 4E7ZA 2YLCA 4A4FA 5HK0A 2QYZA 4AT1B 3TEEA 1LCKA 3CCUT 1VYUA 1M1GA 1GFCA 1ZSGA 2BZ8A 2DXBA 5IXBA 3N5BB 2K2VA 4PJOA 1S72A 2EPDA 3BW1A 3GBQA 5FU7B 4JDSA 5LJ3f 1QCFA 4RTWA 3CCLA 4MDXA 2XU8A 1VQ8Q 3CC4T 1KQSS 1H8KA 3CCLQ 1UHCA 2QTXA 1VQ7A 5DLOA 4J9BA 4OMFB 2ZPHB 2QA4Q 1JXOA 3E19A 1UJYA 2WSFE 3QPHA 1OU8A 4ESRA 2QA4T 5DY9A 2WSEE 2X3WD 3TSWA 1ACMB 4UC4A 2MCNA 2L5QA 5GAOn 5LJ3j 5A0LA 1VQ6T 3QWYA 3M0SA 2FRWA 1GBRA 3A8OB 3RR6A 3C0CA 3CC4Q 1KQ1A 2QQ9A 4KT0E 1EFNA 1YP5A 1K9MC 3QG1A 1WHHA 4C92B 3I55A 2V8IA 5J26A 4M7DF 3MEVA 3MCAB 4PJJA 1DJ7B 1WQWA 1YJWA 2C0IA 3ZL7C 2AKLA 2CT3A 3M4YA 2COWA 3CPWP 1WJRA 1JEGA 1M2OA 3THKA 2LDMA 3GF5A 3X28B 3G4ST 1VQMQ 1H92A 4BUGA 4IUTA 1G83A 2C0OA 1U1SA 2LTOA 1WA7A 2D8JA 3UA7A 1PKTA 4BD3A 1VQLQ 2HEQA 2J06A 1BCMA 1ZA2B 3GIBA 1KD1U 2CP0A 3QO3A 1QVFP 4C92E 2FPFA 4XTVA 2V8KA 3LGLA 5HKCA 3DKMA 4FSSA 2PUOB 3I5RA 2RA2A 1YHQA 1Y57A 5C6SA 2CH4W 2F1LA 5GAMh 1WXUA 4PJOD 1PD0A 2JM9A 1QLYA 4Z8AA 1NBEB 3L2QA 1QVGA 1Y0MA 1S1NA 3I55T 1C0MA 2AIRB 4J7FA 5GANg 1IZ6A 5EC7A 1W2BA 3X20B 2KNBB 2E5KA 2A0FB 4JLGA 4N4IA 3EGDB 3VKIA 5A0DA 1LNXA 1K73R 1QVGS 3GNFB 5J39A 1VQPA 4JZ3A 4DOWA 2D9TA 3RUXA 2RHXA 2COZA 4RTTA 3OYCA 1E6GA 1VQNQ 4DOVA 3EGXB 2DEQA 2BZYA 4PJOB 1D1CA 1QWEA 4HXJA 1U1TA 2AK5A 2QA4A 1V29B 4TVRA 1NM7A 2KBTA 2VB6A 4R55A 1ZUYA 4JRQA 2NUTB 3QDRB 5FWBA 4F7UB 1FMKA 2CZ0B 3S3OA 3A5ZB 4CC3A 4JJCA 2KT8A 5EG2A 1RAIB 1MNDA 3A1PA 4OMNA 4WTOB 2EIFA 1MNEA 1QMCA 3MP1A 1QKWA 1PCXA 3DLLA 4LUEA 1ZBXA 1T3LA 1ZSZA 1WLPB 2RJCA 4J9DA 1BBZA 2QQRA 4PJNA 4F17A 4QQDA 3RMSA 4EMKC 3V7RA 3FEOA 4C8QG 2R5AA 2Z0WA 1Q7YU 4RG2A 3L2WA 4RMOA 1Q81R 1HXDA 4IIMA 2K5LA 2RMOA 4M7DC 1SRLA 1HK9A 4QVCA 2L3PA 3X25B 2CZ6B 1PNJA 3QUIA 1TU0B 3VV0A 2G3RA 3X24B 4XK8E 1MMGA 1ABOA 5IH2A 5J3BA 5I2SA 1NZ9A 4J8OA 2RJEA 4ME7A 4X9DA 2E10A 3WVEB 1Q82C 1HD3A 2WSCE 1OULA 2NUPB 3LWHA 2E4HA 1ARKA 4ZTFA 4LD6A 1WZOA 4PJLA 5GMKm 2QEXT 4PL6A 3CC2A 1G5VA 4FSXA 5GANe 1JJ2P 1NJIR 2EQIA 3EHRA 2K5IA 3SWNA 3AHUA 1QP2A 2QI2A 2L8DA 3GNGA 1K9MR 3H6ZA 4FW1A 1SPKA 3CCVQ 2VUBA 1NJIC 3EFOA 4M78B 1D0XA 1JB0E 3RKYA 2P0PA 3HRUA 4KULA 1ZBJA 2CUBA 4QVZA 1K0XA 2HKQB 4J9IA 4E6RA 2PUKB 2ZCFB 1VIFA 3CMEA 4PK4A 2ESWA 1N8RR 3CXCP 3REBB 4DQ2A 1LPLA 3VS4A 4RG8A 4BI3A 1Y7XA 1UGPB 3LH0A 3VS2A 5KYXB 2JTMA 2DE0X 2GCXA 1X2QA 4J6YA 2KVQG 1S72T 2DEUA 2DL7A 4EMKB 2HNIA 2DL4A 2YUPA 1EZZB 2L2PA 3NPFA 2CP2A 3OYFA 4A4KA 2DMOA 3EGXA 5ECAA 4KGXB 1KFZA 3A98A 3QJ6A 1WDXA 4N4GA 2IIMA 2L3RA 1YI2Q 4XU3A 1G3WA 2XDPA 3OBYA 2YWWA 3FIFA 1GCQC 5IXFA 2QQAA 3OYDA 3LWIA 1WJQA 4CC2A 2RHZA 1N27A 1D0ZA 1LOJA 2DJZA 3EFRA 4HVUA 3TSZA 2FZGB 2M02A 4FT2A 2AZVA 2EYZA 1JO8A 4M7AA 1W70A 1M90R 4L59A 1BYMA 2QXFA 2DILA 4M78A 4EMHA 4AG2C 3G71Q 2LNVA 1NEBA 2LT4A 3G6EA 2HZYA 1RUWA 3JCMd 1RACB 2LX9A 1KC8R 2X3XD 3G6EQ 2E3IA 4XTWA 1XTDA 1N8RU 1TTHB 4IUUA 3CCMA 1K73C 4PFPA 2O88A 1QP3A 2OJ2A 3CCQA 1AWJA 1SSHA 2QEXA 4M7AF 3EG0A 3OS5A 3CCQQ 3TREA 3QSUA 1TUCA 5KE3A 1YJ9A 9ATCB 4BB7A 1VQNA 2ABLA 1VQKA 2FYKA 4XTUA 2MYSA 2GQVA 3G7ZA 2YRDA 3V8LA 3A8HB 2GNCA 4DBFA 2MF2A 2EKHA 1NYFA 2L3QA 2C06A 2O2OA 2M9UA 2NUZA 1B3QA 2JJ9A 5A0GA 2RD1A 2FHDA 3V7CA 3UA6A 1Q86U 1IGUA 2KRMA 4KRTA 3SWNB 1X69A 1N5ZA 1XQHA 2FB7A 1T0JA 2JNGA 3EG3A 3SDZA 1K8AC 1MMDA 2OTJQ 3M59A 3MJXA 1VQ4T 3CCST 3OS1A 1OV3A 2JTEA 3E9GA 3FC3A 2E6ZA 3CPFA 1KC8U 1OU9A 4ZTJA 2M0OA 4OP0A 1VQ9A 1MV0B 4M78E 4DEXA 2XMFA 4M77B 4WF2A 4M7AG 4B6MA 2VASA 1Q7YR 4PLIA 2DL8A 2JN0A 3REAB 2JOYA 3OS2A 2GGRA 1OQKA 3G4SQ 2KYMA 1B7TA 3A8MB 2X9HA 3M0RA 4C92C 3UWNA 2VKNA 3LGFA 1P92A 4MMKA 4Z02A 3OSSC 2KYBA 2AZSA 3HP9A 4J9FA 4C92A 2F2WA 4ZN3A 3JCMJ 1PRLC 4D8DA 2EYQA 4IUVA 2RHUA 1J3TA 4IIOA 1B34A 4HCKA 1K4US 2PU9B 5LJ3e 1VQKT 3EGUA 4E7SA 3P8HA 2JXBA 1B07A 2YLBA 1NLOC 1PRMC 3META 4JJBA 3JCMe 1YJ9T 3J7AF 4FW2A 3EG9A 2J6FA 1XJWB 1Y71A 3CPWA 1FMWA 5KYWB 4M78G 1VQPQ 1FMVA 2GFUA 1WYXA 3CCQT 4M77C 5CVIA 5D6WA 3EG2A 1M8VA 5AYFA 3MEUA 2RQWA 1UE9A 2QK0A 4M7DD 3H9NA 3FRNA 3QXEB 5CR2A 4FIBA 2YUNA 1SG5A 5D6YA 4C92G 1YJNA 1AEYA 1PC0A 2JVVA 5GAN4 3CMET 1M1KU 3UATA 3RKWA 2M1HA 4ZGDB 2GBQA 2EJFA 1NJIU 1QCOA 1BCOA 2DZCA 2MWOA 2YRCA 2WACA 1YBYA 4HCCA 4DBQA 1K9AA 2QAZA 4RTXA 1OX9A 3BDLA 1C1AA 3PFSA 2EWNA 3LH5A 2DO3A 1M27C 3UPUA 3H0FA 2EYWA 3VS5A 4KH1B 1YNZA 4LDXA 4F7UE 3PE0A 2VWFA 3D7SB 5FU7C 2LX7A 4HVVA 2DTHA 3QHSA 2HL5C 1F1BB 3JCMc 1SEMA 2W10A 2QQBA 3O8VA 2LMJA 4MZTA 5CQXA 2DL5A 2LQWA 1M3BA 1KG1A 1R0BG 2CZ1B 2VYTA 4EMKA 3M4GA 1BK2A 1YN8A 4M78C 1VQMA 1RAGB 4BI4A 1QWFA 4Y91A 3RIRA 1JXMA 2YXYA 1ZA1B 3LLRA 2D6FA 3I35A 3M0PA 1AWOA 2RHYA 2LCLA 1ZUUA 3KBGA 2W0ZA 3M5AA 2P4RA 4JRIA 3SEMA 1D09B 2ZPGB 5D6XA 3RDVA 1ZX6A 1WQ7A 4JPBW 5CKEA 2LC4A 1NG2A 3I56Q 2Y4YA 5GANd 3QBYA 3M56A 2EYYA 1MV3A 4HVWA 2EGCA 2EGAA 2RQTA 3HHTB 3CQTA 2OAWA 3HL8A 2MWPA 2CP5A 3HTRA 2K5FA 1NLPC 3CCUA 1GBQA 2GFAA
chains in the Genus database with same CATH topology
1AD5A 2FG0A 1UUEA 4A63B 5IH2A 1YWOA 1GFDA 1OPLA 2O9VA 1UHFA 4X1VA 5IHIA 2BTTA 2JW4A 2K2MA 2RQVA 1BU1A 4EIKA 1HD3A 4Z89A 2RF0A 3RBBB 1ARKA 1QKXA 1WXTA 1ABQA 2DNUA 2A36A 2ROLA 2H8HA 2I0NA 2EQIA 3EHRA 2JT4A 2DBMA 2HSPA 2M0YA 2JS2A 1SPKA 4GLMA 1UGVA 1K76A 1SHFA 4OMMA 4M4ZA 4AG1C 5GJVB 1CKBA 2KEAA 2OI3A 1RLQC 1H3HA 1U06A 3JV3A 2GTJA 3VS0A 2JS0A 5L23A 3M0QA 3UF4A 1FYNA 2KXDA 2SRCA 1Z9ZA 1ZBJA 2CUBA 1K0XA 2KE9A 1SRMA 4J9IA 1I1JA 4E6RA 1UECA 1X27A 5FW9A 1VYTA 2ESWA 1T3SA 5I11A 3REBB 1G2BA 3VS4A 1YWPA 4RTUA 1AWWA 1VYVA 2LJ1A 3VS2A 2YUOA 1AOJA 1I07A 2DE0X 1PKSA 4GBQA 2EBPA 3PVLA 1X2QA 2DL7A 2KGTA 2DA9A 2RQRA 2DL4A 1GCPA 1RLPC 2LQNA 2YUPA 2LJ3A 2L2PA 3NPFA 1K0SA 4J9CA 2K6DA 2QDLA 1WX6A 2F2XA 2DMOA 5ECAA 1CSKA 1X6BA 1TG0A 1KFZA 4RTZA 2FPEA 3A98A 2D8HA 4R0KA 1WDXA 1GCQA 1HSQA 2IIMA 1ZUKA 1JQQA 4OMOA 3R6NA 1GRIA 3NGPA 1GCQC 2LNHB 4RTVA 2O31A 5IXFA 3M0UA 3U23A 1W6XA 4CC2A 4K11A 1AWXA 1UTIA 4HVUA 2AKKA 3TSZA 3VS3A 2CH4A 4LN2A 2KRNA 2AZVA 2CSQA 2EYZA 1JO8A 1I0CA 1W70A 2ENMA 3O5ZA 2DL3A 2DILA 4JJDA 4AG2C 1JU5C 3H41A 1NEBA 4LUDA 1AZGB 4F14A 1VA7A 1RI9A 1RUWA 4RTYA 1KSWA 2X3XD 1NEGA 1AZEA 1KIKA 2FEIA 2ECZA 2RPNA 2DYBA 2O88A 2HCKA 1UJ0A 2OJ2A 1IO6A 1AWJA 1SSHA 2CDTA 4ORZA 3EG0A 2DVJA 2LJ0A 2A28A 1TUCA 1ZLMA 2DX1A 2LZ6B 1M30A 2ABLA 2EGEA 2L0AA 1CKAA 4AFZC 1GL5A 1PWTA 4Z88A 3H0IA 1HJDA 2GNCA 2EKHA 1NYFA 2B86A 2FO0A 1LCKA 2L3QA 2CUDA 2J05A 1VYUA 2BZ8A 1GFCA 1ZSGA 2CT4A 5IXBA 2O2OA 2NUZA 1B3QA 2EPDA 3GBQA 3UA6A 1MUZA 2KRMA 4KRTA 1QCFA 4RTWA 1X69A 1E6HA 3M0TA 3VS6A 1N5ZA 1H8KA 2YT6A 4LE9A 1T0JA 1UHCA 3EG3A 2EVRA 1TUDA 4AFQC 1A0NB 4J9BA 2ED0A 1OV3A 2JTEA 1BB9A 2JMAA 1UFFA 1JXOA 1UJYA 3QWXX 1OOTA 4ESRA 1MV0B 1KJWA 1U3OA 1U5SA 2O9SA 2X3WD 2XMFA 4DEXA 3TSWA 5FWCA 1AVZC 2LP5A 2DF6A 5IHNA 2MCNA 2DL8A 4AFUC 2PNIA 3REAB 2HDAA 3I9QA 3QWYA 2GGRA 2FRWA 3M0SA 1GBRA 2G6FX 2KYMA 2K7AA 3C0CA 2GTOA 4RUGA 2L3SA 2CREA 3M0RA 2ED1A 1EFNA 1YP5A 2VKNA 2RQUA 2RN8A 5GJWB 2JMCA 3EHQA 3I5SA 2KYBA 2AZSA 2EYXA 4J9FA 2F2WA 2V1RA 2K79A 3RNJA 2KT1A 4CC4B 3TVTA 2SEMA 1XOVA 1PRLC 2C0IA 4D8DA 3ZL7C 1X2KA 4LNPA 2AKLA 2CT3A 2KR3A 1X43A 1J3TA 4IIOA 1JEGA 3THKA 3KFVA 4QT7A 3VS7A 4HCKA 1K4US 1H92A 3EGUA 1G83A 2C0OA 2JXBA 2PZ1A 2YSQA 1WA7A 2D8JA 1B07A 2FPDA 1NLOC 1PRMC 4JJBA 5I22A 3UA7A 1PKTA 4Y92A 2J6FA 2HEQA 2J06A 4DEYA 2D1XA 2F2VA 2CSIA 1WYXA 2EW3A 3SHWA 2YUQA 3IQLA 2FPFA 2J6KA 2NWMA 1UDLA 2DRMA 3EG2A 2A08A 4FSSA 3I5RA 2KXCA 2JM8A 4WCIA 1K1ZA 1Y57A 2RQWA 1UE9A 1OEBA 2CH4W 2A37A 2ROTA 1WXUA 2YDLA 3H0HA 2JM9A 2K9GA 2YUNA 1QLYA 4Z8AA 2HBWA 1X6GA 1M3CA 1Y0MA 1S1NA 1WXBA 1AEYA 3ULRB 2DLPA 4OMLA 3NHNA 2KROA 5EC7A 3UATA 1V1CA 1OPKA 2KNBB 2E5KA 2GBQA 2D0NA 4JZ4A 2DM1A 4D8KA 2BZXA 2VVKA 1K9AA 4JZ3A 4RTXA 2C0TA 3LH5A 3NMZC 1M27C 4RTTA 3H0FA 1E6GA 2EYWA 3VS5A 1YNZA 2BZYA 1QWEA 1WIEA 4HXJA 2AK5A 1NM7A 2KBTA 3PE0A 4ZNXA 1YCSB 2VWFA 1ZUYA 2RNAA 2LX7A 4HVVA 3EG1A 5FWBA 1FMKA 1SEMA 2W10A 2LMJA 4CC3A 2DL5A 2J7IA 2LQWA 1M3BA 3VRZA 4JJCA 3PVQA 1BK2A 2DJQA 1YN8A 2KT8A 2K3BA 2FRYA 1QWFA 2DRKA 4OMNA 5IHKA 2J6OA 1WFWA 2DBKA 1JXMA 3VRYA 1QKWA 1UG1A 3I35A 4LUEA 3M0PA 1AWOA 1NYGA 4OMPA 1ZUUA 4J9HA 1T3LA 2W0ZA 3FJ5A 4J9GA 1WLPB 4J9DA 1BBZA 2GQIA 2P4RA 3SEMA 1T0HA 1SHGA 3VS1A 1M8MA 1ZX6A 4F17A 4JPBW 4AFSC 1PHTA 2KRSA 1NG2A 4OMQA 5HCKA 4F16A 2V1QA 2EYYA 1MV3A 1Z9QA 2PTKA 4HVWA 2EGCA 2EGAA 2RQTA 1E7OA 3CQTA 4IIMA 2MOXA 2MIOA 2RMOA 2OAWA 4CC7A 1SRLA 2L3PA 1M3AA 1WI7A 1W1FA 1NLPC 1PNJA 2LCSA 4J9EA 2M51A 1GBQA 1ABOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD5 A;  2FG0 A;  1UUE A;  4A63 B;  5IH2 A;  1YWO A;  1GFD A;  1OPL A;  2O9V A;  1UHF A;  4X1V A;  5IHI A;  2BTT A;  2JW4 A;  2K2M A;  2RQV A;  1BU1 A;  4EIK A;  1HD3 A;  4Z89 A;  2RF0 A;  3RBB B;  1ARK A;  1QKX A;  1WXT A;  1ABQ A;  2DNU A;  2A36 A;  2ROL A;  2H8H A;  2I0N A;  2EQI A;  3EHR A;  2JT4 A;  2DBM A;  2HSP A;  2M0Y A;  2JS2 A;  1SPK A;  4GLM A;  1UGV A;  1K76 A;  1SHF A;  4OMM A;  4M4Z A;  4AG1 C;  5GJV B;  1CKB A;  2KEA A;  2OI3 A;  1RLQ C;  1H3H A;  1U06 A;  3JV3 A;  2GTJ A;  3VS0 A;  2JS0 A;  5L23 A;  3M0Q A;  3UF4 A;  1FYN A;  2KXD A;  2SRC A;  1Z9Z A;  1ZBJ A;  2CUB A;  1K0X A;  2KE9 A;  1SRM A;  4J9I A;  1I1J A;  4E6R A;  1UEC A;  1X27 A;  5FW9 A;  1VYT A;  2ESW A;  1T3S A;  5I11 A;  3REB B;  1G2B A;  3VS4 A;  1YWP A;  4RTU A;  1AWW A;  1VYV A;  2LJ1 A;  3VS2 A;  2YUO A;  1AOJ A;  1I07 A;  2DE0 X;  1PKS A;  4GBQ A;  2EBP A;  3PVL A;  1X2Q A;  2DL7 A;  2KGT A;  2DA9 A;  2RQR A;  2DL4 A;  1GCP A;  1RLP C;  2LQN A;  2YUP A;  2LJ3 A;  2L2P A;  3NPF A;  1K0S A;  4J9C A;  2K6D A;  2QDL A;  1WX6 A;  2F2X A;  2DMO A;  5ECA A;  1CSK A;  1X6B A;  1TG0 A;  1KFZ A;  4RTZ A;  2FPE A;  3A98 A;  2D8H A;  4R0K A;  1WDX A;  1GCQ A;  1HSQ A;  2IIM A;  1ZUK A;  1JQQ A;  4OMO A;  3R6N A;  1GRI A;  3NGP A;  1GCQ C;  2LNH B;  4RTV A;  2O31 A;  5IXF A;  3M0U A;  3U23 A;  1W6X A;  4CC2 A;  4K11 A;  1AWX A;  1UTI A;  4HVU A;  2AKK A;  3TSZ A;  3VS3 A;  2CH4 A;  4LN2 A;  2KRN A;  2AZV A;  2CSQ A;  2EYZ A;  1JO8 A;  1I0C A;  1W70 A;  2ENM A;  3O5Z A;  2DL3 A;  2DIL A;  4JJD A;  4AG2 C;  1JU5 C;  3H41 A;  1NEB A;  4LUD A;  1AZG B;  4F14 A;  1VA7 A;  1RI9 A;  1RUW A;  4RTY A;  1KSW A;  2X3X D;  1NEG A;  1AZE A;  1KIK A;  2FEI A;  2ECZ A;  2RPN A;  2DYB A;  2O88 A;  2HCK A;  1UJ0 A;  2OJ2 A;  1IO6 A;  1AWJ A;  1SSH A;  2CDT A;  4ORZ A;  3EG0 A;  2DVJ A;  2LJ0 A;  2A28 A;  1TUC A;  1ZLM A;  2DX1 A;  2LZ6 B;  1M30 A;  2ABL A;  2EGE A;  2L0A A;  1CKA A;  4AFZ C;  1GL5 A;  1PWT A;  4Z88 A;  3H0I A;  1HJD A;  2GNC A;  2EKH A;  1NYF A;  2B86 A;  2FO0 A;  1LCK A;  2L3Q A;  2CUD A;  2J05 A;  1VYU A;  2BZ8 A;  1GFC A;  1ZSG A;  2CT4 A;  5IXB A;  2O2O A;  2NUZ A;  1B3Q A;  2EPD A;  3GBQ A;  3UA6 A;  1MUZ A;  2KRM A;  4KRT A;  1QCF A;  4RTW A;  1X69 A;  1E6H A;  3M0T A;  3VS6 A;  1N5Z A;  1H8K A;  2YT6 A;  4LE9 A;  1T0J A;  1UHC A;  3EG3 A;  2EVR A;  1TUD A;  4AFQ C;  1A0N B;  4J9B A;  2ED0 A;  1OV3 A;  2JTE A;  1BB9 A;  2JMA A;  1UFF A;  1JXO A;  1UJY A;  3QWX X;  1OOT A;  4ESR A;  1MV0 B;  1KJW A;  1U3O A;  1U5S A;  2O9S A;  2X3W D;  2XMF A;  4DEX A;  3TSW A;  5FWC A;  1AVZ C;  2LP5 A;  2DF6 A;  5IHN A;  2MCN A;  2DL8 A;  4AFU C;  2PNI A;  3REA B;  2HDA A;  3I9Q A;  3QWY A;  2GGR A;  2FRW A;  3M0S A;  1GBR A;  2G6F X;  2KYM A;  2K7A A;  3C0C A;  2GTO A;  4RUG A;  2L3S A;  2CRE A;  3M0R A;  2ED1 A;  1EFN A;  1YP5 A;  2VKN A;  2RQU A;  2RN8 A;  5GJW B;  2JMC A;  3EHQ A;  3I5S A;  2KYB A;  2AZS A;  2EYX A;  4J9F A;  2F2W A;  2V1R A;  2K79 A;  3RNJ A;  2KT1 A;  4CC4 B;  3TVT A;  2SEM A;  1XOV A;  1PRL C;  2C0I A;  4D8D A;  3ZL7 C;  1X2K A;  4LNP A;  2AKL A;  2CT3 A;  2KR3 A;  1X43 A;  1J3T A;  4IIO A;  1JEG A;  3THK A;  3KFV A;  4QT7 A;  3VS7 A;  4HCK A;  1K4U S;  1H92 A;  3EGU A;  1G83 A;  2C0O A;  2JXB A;  2PZ1 A;  2YSQ A;  1WA7 A;  2D8J A;  1B07 A;  2FPD A;  1NLO C;  1PRM C;  4JJB A;  5I22 A;  3UA7 A;  1PKT A;  4Y92 A;  2J6F A;  2HEQ A;  2J06 A;  4DEY A;  2D1X A;  2F2V A;  2CSI A;  1WYX A;  2EW3 A;  3SHW A;  2YUQ A;  3IQL A;  2FPF A;  2J6K A;  2NWM A;  1UDL A;  2DRM A;  3EG2 A;  2A08 A;  4FSS A;  3I5R A;  2KXC A;  2JM8 A;  4WCI A;  1K1Z A;  1Y57 A;  2RQW A;  1UE9 A;  1OEB A;  2CH4 W;  2A37 A;  2ROT A;  1WXU A;  2YDL A;  3H0H A;  2JM9 A;  2K9G A;  2YUN A;  1QLY A;  4Z8A A;  2HBW A;  1X6G A;  1M3C A;  1Y0M A;  1S1N A;  1WXB A;  1AEY A;  3ULR B;  2DLP A;  4OML A;  3NHN A;  2KRO A;  5EC7 A;  3UAT A;  1V1C A;  1OPK A;  2KNB B;  2E5K A;  2GBQ A;  2D0N A;  4JZ4 A;  2DM1 A;  4D8K A;  2BZX A;  2VVK A;  1K9A A;  4JZ3 A;  4RTX A;  2C0T A;  3LH5 A;  3NMZ C;  1M27 C;  4RTT A;  3H0F A;  1E6G A;  2EYW A;  3VS5 A;  1YNZ A;  2BZY A;  1QWE A;  1WIE A;  4HXJ A;  2AK5 A;  1NM7 A;  2KBT A;  3PE0 A;  4ZNX A;  1YCS B;  2VWF A;  1ZUY A;  2RNA A;  2LX7 A;  4HVV A;  3EG1 A;  5FWB A;  1FMK A;  1SEM A;  2W10 A;  2LMJ A;  4CC3 A;  2DL5 A;  2J7I A;  2LQW A;  1M3B A;  3VRZ A;  4JJC A;  3PVQ A;  1BK2 A;  2DJQ A;  1YN8 A;  2KT8 A;  2K3B A;  2FRY A;  1QWF A;  2DRK A;  4OMN A;  5IHK A;  2J6O A;  1WFW A;  2DBK A;  1JXM A;  3VRY A;  1QKW A;  1UG1 A;  3I35 A;  4LUE A;  3M0P A;  1AWO A;  1NYG A;  4OMP A;  1ZUU A;  4J9H A;  1T3L A;  2W0Z A;  3FJ5 A;  4J9G A;  1WLP B;  4J9D A;  1BBZ A;  2GQI A;  2P4R A;  3SEM A;  1T0H A;  1SHG A;  3VS1 A;  1M8M A;  1ZX6 A;  4F17 A;  4JPB W;  4AFS C;  1PHT A;  2KRS A;  1NG2 A;  4OMQ A;  5HCK A;  4F16 A;  2V1Q A;  2EYY A;  1MV3 A;  1Z9Q A;  2PTK A;  4HVW A;  2EGC A;  2EGA A;  2RQT A;  1E7O A;  3CQT A;  4IIM A;  2MOX A;  2MIO A;  2RMO A;  2OAW A;  4CC7 A;  1SRL A;  2L3P A;  1M3A A;  1WI7 A;  1W1F A;  1NLP C;  1PNJ A;  2LCS A;  4J9E A;  2M51 A;  1GBQ A;  1ABO A; 
#chains in the Genus database with same CATH topology
 3CCJ Q;  1JJ2 S;  1AD5 A;  4F7U G;  2FG0 A;  4C8Q E;  3URG A;  3PGG A;  1GFD A;  3M9Q A;  1OPL A;  2O9V A;  1UHF A;  1M2V B;  2JZ2 A;  4C8Q D;  2ZPE B;  4QVD A;  3M55 A;  1WHM A;  4Z89 A;  8ATC B;  2NUP A;  4J83 A;  1QKX A;  4C8Q C;  1WXT A;  2XID A;  1YJN T;  2DNU A;  2RM4 A;  2DKG A;  4KUI A;  4KUD K;  1SSF A;  1MMA A;  5GAN 5;  2DBM A;  3L2U A;  2HSP A;  2PQW A;  2PVG B;  4LD9 K;  2E6N A;  3C4S A;  2OTJ T;  1NPP A;  1K76 A;  5FU6 C;  2BUD A;  1YIT T;  3JCM P;  1VQ5 Q;  5KCO A;  4B9W A;  1RAB B;  4BY6 B;  2GTJ A;  4JRK A;  3VS0 A;  1RAF B;  3UF4 A;  2SRC A;  2CGH A;  2DTI A;  4C8Q A;  3JAM E;  2KAF A;  2KE9 A;  1EIF A;  2LQK A;  1RAH B;  1UEC A;  3BE3 A;  5I11 A;  3E9F A;  4MZP A;  2DVE A;  2XG8 D;  5CK9 A;  1YWP A;  4RTU A;  2XIC A;  3BY7 A;  2E65 A;  1AWW A;  2YUO A;  1LVK A;  1MGQ A;  5IN1 A;  1I07 A;  4GBQ A;  2OAU A;  2KMT A;  2MK5 A;  3LW5 E;  1GXI E;  1PM3 A;  4J9C A;  2QDL A;  3CC7 A;  3OYJ A;  1CSK A;  1TG0 A;  5CKD A;  2FPE A;  4M7A D;  2D8H A;  1YI2 T;  4R0K A;  3JCM b;  3OYG A;  1GCQ A;  1JBM A;  1M1K R;  3CCM Q;  2Y4X A;  1JQQ A;  4M75 C;  1BKB A;  2ZAE A;  1VQ6 Q;  2H3J A;  1TUG B;  3CBO A;  5CKF A;  4QW2 A;  3U23 A;  1W6X A;  4FYV B;  4K11 A;  4Q5W A;  4J7I A;  2AKK A;  1YJ9 Q;  5KCH A;  3HFN A;  1S72 Q;  1M1F A;  1WPY A;  3GPL A;  1VQN T;  2DTO A;  4E7H A;  1BIA A;  3MEW A;  2HAX A;  2EQM A;  3QII A;  1LJO A;  4LUD A;  1AZG B;  4BDY A;  4E7K A;  1RI9 A;  4RTY A;  2I2L A;  3CMA A;  1BIB A;  1NEG A;  3V8J A;  1C6V X;  3E1S A;  1VIE A;  3ER0 A;  2P4T A;  3I56 T;  1O9S A;  3JCM V;  2RJD A;  5FU6 B;  3TU4 K;  3SD4 A;  1YIT A;  1I81 A;  2PVO B;  2LJ0 A;  2DX1 A;  2RK2 A;  2L0A A;  1CKA A;  3VU3 C;  1BI0 A;  3BFM A;  2O4X B;  1QCN A;  4XTX A;  1HJD A;  4CRI A;  2ZZD A;  3KUF A;  2FO0 A;  2CUD A;  1K9M U;  4QQG A;  2RJF A;  1ZSZ C;  5GAN j;  1MUZ A;  4M77 F;  5GAM f;  2VXF A;  7AT1 B;  3VS6 A;  3OYH A;  4LE9 A;  4A4H A;  1MMN A;  3X26 B;  3L2V A;  5KYN A;  1H64 1;  2COY A;  1I5O B;  1TUD A;  5LJ5 j;  1D0Y A;  1YI2 A;  2XHC A;  4AFQ C;  2XDD A;  1A0N B;  3OSV A;  2DIQ A;  2BE9 B;  5KYU A;  2ED0 A;  4PNO A;  4FT4 A;  4O6J A;  1UFF A;  1KHC A;  1OOT A;  1EX4 A;  4PJO G;  1G8X A;  3A8L B;  1U5S A;  2ATC B;  5FWC A;  2LP5 A;  4O5V A;  3J80 E;  2DF6 A;  5IHN A;  2BE7 D;  4BAC A;  3MEA A;  2PNI A;  4LDW A;  5GAM g;  2HDA A;  2JTF A;  3I9Q A;  4IKF A;  3A8G B;  1TXQ A;  2HQE A;  2HQX A;  1IRE B;  3OB9 A;  2K7A A;  3EFO B;  3OYE A;  2Y90 A;  2GTO A;  4RUG A;  2L3S A;  3PNW C;  4M75 D;  1VUB A;  2RN8 A;  5LJ5 f;  2JMC A;  1VQ7 T;  3I5S A;  4MDW A;  1OX8 A;  2EYX A;  3CD6 T;  2V1R A;  2E70 A;  3RNJ A;  2KT1 A;  4CC4 B;  3TVT A;  2V8J A;  3OW2 S;  4LNP A;  1K8A U;  1OZ2 A;  3MPU B;  2KR3 A;  1M9S A;  2HL3 A;  3NFC A;  4HA8 A;  2X4J A;  1HYO A;  4GLK A;  3KFV A;  4QT7 A;  1QQJ A;  3VS7 A;  1VQK Q;  1QVF A;  4PKC C;  2GF7 A;  3CC2 T;  4C0D C;  2XK0 A;  4N0A A;  4KGZ B;  1YJN Q;  1M4Z A;  1VQ8 A;  3CC7 T;  2ZPF B;  1YFN A;  2YSQ A;  2PZ1 A;  2FPD A;  2H3E B;  3RMQ A;  1K8A R;  4Y92 A;  4HT8 A;  4C92 D;  2BKD N;  2A7Y A;  2EQJ A;  4JRP A;  2F2V A;  1VQ9 Q;  4C92 F;  2MAM A;  5GAN f;  2EW3 A;  4P5N A;  3OMG A;  1BI3 A;  2YUQ A;  3HRS A;  3DB3 A;  1H3Z A;  3EAE A;  3CC4 A;  2J6K A;  2NWM A;  2MI6 A;  1UDL A;  1W2B P;  2HMA A;  3ZBD A;  2A08 A;  3JCM h;  3SB2 A;  4N4H A;  2A37 A;  1Q82 R;  2YDL A;  3H0H A;  1IHV A;  2HBW A;  2EFI A;  1X6G A;  4M7D B;  1WXB A;  5LL6 S;  2CYZ B;  2K3X A;  2KRO A;  1V1C A;  1OPK A;  2DIG A;  4HKE A;  4M75 F;  2D0N A;  4JZ4 A;  2DM1 A;  4D8K A;  4FYW B;  2QGG A;  5KYX A;  4NOY A;  4OB1 B;  4ZGJ B;  3MO8 A;  3CEY A;  4J6X A;  1NPR A;  5KYY B;  3JB9 J;  4NS5 A;  3FJP A;  1I4K 1;  3DLM A;  3NMZ C;  2F69 A;  4C0G A;  3L2R A;  3GOX A;  2MPX C;  3TQ7 P;  3NTI A;  2DD5 A;  3WVD B;  4A4E A;  2KQW A;  4ZNX A;  1YCS B;  3L42 A;  2RNA A;  3G1J A;  3CC2 Q;  3EG1 A;  3L2Z A;  2OTL T;  2M16 A;  2J7I A;  4IUR A;  3VRZ A;  3OYY A;  3PVQ A;  2DET A;  1VQ7 Q;  8AT1 B;  4R56 A;  3VYG A;  2V26 A;  2FRY A;  3C94 A;  5GAO q;  2DRK A;  2CP6 A;  4YTL A;  3HRT A;  5GAM e;  3OQ5 A;  1KQ2 A;  2KY9 A;  4OMP A;  5GMK e;  1VOM A;  3CCJ A;  1T0H A;  1SHG A;  2IVW A;  3VS1 A;  1M8M A;  4F7U F;  1YHQ Q;  1YIJ T;  5LJ3 h;  2NYS A;  1KQS A;  1X75 C;  1PSF A;  1QW1 A;  3ZFJ A;  4AFS C;  1PHT A;  4J6W A;  4DBH A;  1Q86 C;  4OMQ A;  5HCK A;  1WHL A;  2V1Q A;  3R6O A;  1QVP A;  1Z9Q A;  2PTK A;  2R5M A;  3KXT A;  1E7O A;  1TWB A;  4PJO E;  2K3Y A;  1VQ4 A;  4C5G A;  4CC7 A;  4EMG A;  1WJS A;  2CP3 A;  1WI7 A;  1W1F A;  3BDU A;  2EJG A;  4V2S A;  3JB9 F;  3NTH A;  2LCS A;  3I55 Q;  3ULR B;  1ZSZ B;  3JB9 H;  4M75 B;  1WHG A;  1N9S A;  1VQP T;  4X1V A;  5IHI A;  1G3S A;  2BTT A;  2JW4 A;  3DB4 A;  2RQV A;  4C5I A;  1KQS P;  4EIK A;  1FWZ A;  3QZ9 B;  1Y96 B;  4II1 A;  3P8B B;  1V76 A;  3RBB B;  1ABQ A;  3OBW A;  3TCJ A;  2A36 A;  2DXC A;  2ROL A;  1D3B A;  4XAX B;  2OX7 A;  1XNI A;  3QJY A;  5LJ5 d;  4VUB A;  3OYL A;  3WXM B;  2JS2 A;  1UGV A;  1UGR B;  4XTZ A;  1SHF A;  1U8R A;  4M4Z A;  3RKX A;  5FRM A;  5GJV B;  1CKB A;  1VQ9 T;  1YJW T;  3OY9 A;  2KEA A;  2IPO B;  2OI3 A;  1H3H A;  2QDY B;  3JV3 A;  3CCE A;  1D1B A;  1KK7 A;  5L23 A;  3QDF A;  1FYN A;  1N9R A;  1JRI A;  1Z9Z A;  3M57 A;  4B9X A;  5FRO A;  1SF9 A;  1I1J A;  3PMT A;  4C5H A;  5FW9 A;  1VYT A;  3VUZ A;  4CI0 C;  3P8D A;  2E3H A;  4PFZ A;  2P0K A;  1G2B A;  3ASK A;  4XU1 A;  3MHX A;  4ATO A;  3G4S A;  2MMP A;  2D0Q B;  1PKS A;  3PVL A;  3OMC A;  5LJ5 e;  4A53 A;  3RER A;  2DA9 A;  4M7A E;  5GAO r;  1GCP A;  2LQN A;  2KSS A;  4XTY A;  1K0S A;  1Y07 A;  1NE8 A;  2K6D A;  2VXE A;  4ANJ A;  4M7D G;  1X6B A;  2QEX Q;  4OVA A;  4M75 A;  4RTZ A;  2NUT A;  4XU0 A;  3VYH B;  5LJ3 d;  3CCS A;  1X6O A;  3QKJ A;  3NTK A;  1HSQ A;  1MHN A;  5LJ5 h;  1ZUK A;  1IRX A;  5D7U A;  3JCM Q;  3R6N A;  2F5T X;  1GRI A;  3FLG A;  3CCM T;  3F70 A;  2LNH B;  4RTV A;  2O31 A;  3GP8 A;  2B8A A;  1ZQ1 A;  1D3B B;  3Q1J A;  3JRZ A;  1UTI A;  3CME Q;  1VQ5 T;  3VS3 A;  2CH4 A;  4LN2 A;  1YIT Q;  1R0C B;  2KRN A;  2HQH A;  2ENM A;  4M77 D;  5KYW A;  2P0Q A;  3JCM f;  2QAS A;  1Q81 C;  2E12 A;  2KDS A;  4JJD A;  2XD0 A;  3EGD A;  1JU5 C;  1Q81 U;  1YIJ Q;  1RI0 A;  4ZGE B;  2CKK A;  2DFU A;  4KH0 B;  1VA7 A;  3H8Z A;  3INZ A;  1YIJ A;  1KSW A;  4OB0 B;  4BI8 B;  5GAN h;  1K73 U;  5GAM d;  1RAA B;  3C12 A;  5FRN A;  2RPN A;  2DYB A;  1IO6 A;  2CDT A;  1WHJ A;  1JJ2 A;  4F7U A;  2A28 A;  3CCR T;  2DXU A;  4M7D E;  3JSC A;  4E47 A;  3GLX A;  2LZ6 B;  1AHJ B;  4AFZ C;  4BE1 A;  4Z88 A;  3H0I A;  1Q95 G;  3CBM A;  3MP6 A;  1VQ6 A;  4FCY A;  2B86 A;  2J05 A;  3OS0 A;  2CT4 A;  2DXT A;  1FX7 A;  1VQL A;  2FVU A;  3MKD A;  4M7D A;  3S3N A;  4M77 G;  2ZGW A;  5GAO p;  3RES A;  4OB3 B;  3M0T A;  1E6H A;  4PJO C;  3M54 A;  2YT6 A;  3EH1 A;  2EVR A;  2E41 A;  3M58 A;  3HFO A;  2JUF A;  2RHI A;  2EAY A;  2LRQ A;  3OW2 P;  5KYY A;  5GAN 3;  1BB9 A;  2JMA A;  4J5Y A;  5KYU B;  3CCJ T;  2F5K A;  1W4S A;  4OGC A;  2E64 A;  3QWX X;  2DD4 A;  3G71 A;  1KJW A;  1U3O A;  2O9S A;  2PVD B;  4EDU A;  3VJP A;  1AVZ C;  1RAE B;  1OYX A;  4M78 F;  4AFU C;  5A2Q E;  2QG9 B;  2OTJ A;  5C0M A;  2FZK B;  3J81 E;  1OI1 A;  2EQU A;  2G6F X;  3CCS Q;  2CRE A;  2X35 A;  2ED1 A;  4L6V 5;  5GJW B;  2RQU A;  3EHQ A;  4FU6 A;  4JLI A;  3MP8 A;  2RI2 A;  3CCV A;  2X4W A;  2K79 A;  3FB9 A;  1AT1 B;  2SEM A;  4KGV B;  2AT1 B;  1XOV A;  1UGS B;  1VQ4 Q;  1TOV A;  1X2K A;  2X4Y A;  1VQO T;  1X43 A;  1VQM T;  4ELY C;  4C0D B;  5CQY A;  4JS4 A;  5CKH A;  3LYI A;  2X51 A;  5CKB A;  4DBR A;  5GMK l;  5GAN 7;  3UT1 A;  2OTL Q;  4LXC A;  5I22 A;  1RL2 A;  3CCR A;  2EQK A;  4XU2 A;  3JB9 D;  4DEY A;  2D1X A;  3OYI A;  2RI5 A;  3CCR Q;  2CSI A;  5GAN 8;  2K4Y A;  1G3T A;  2DK3 A;  3SHW A;  3IQL A;  2O4X A;  2CS7 A;  3PIO A;  3CXC S;  2DRM A;  4L5G A;  1KD1 R;  1RAD B;  1I8F A;  2EJ9 A;  2E5Q A;  3CD6 Q;  2KXC A;  2JM8 A;  4WCI A;  1K1Z A;  5GAN 6;  2ZPI B;  4M78 D;  1OEB A;  2ROT A;  2FZC B;  3OYM A;  2K9G A;  2KK4 A;  2HD0 A;  4RCB A;  5KE2 A;  3EFS A;  1M3C A;  2NLU A;  1QVF S;  2DLP A;  4OML A;  3JCM X;  3NHN A;  4E7J A;  4M7A C;  2XKO C;  3HSB A;  3M53 A;  5CO7 A;  4HCB A;  3CBP A;  2BZX A;  3I56 A;  3E2U A;  2VVK A;  4OB2 B;  4X9C A;  4C0F A;  3PMI A;  1M5Q 1;  3CCE T;  1KC8 C;  2C0T A;  1X01 A;  4EPC A;  5GMK h;  4M7A B;  4X34 A;  2KI7 A;  1WIE A;  4E2F B;  2VGN A;  1KD1 C;  2X4X A;  1W2B S;  4E7L A;  1M90 C;  4LDY A;  3JCM W;  4Y28 E;  5IAY A;  1QVG P;  2RH2 A;  3QZ5 B;  5CAI A;  5DLQ E;  5HK3 A;  4IUP A;  3HKS A;  4NL2 A;  4IUQ A;  4JJN K;  3CPW S;  2DJQ A;  1BI2 A;  2DYI A;  2K3B A;  2RI3 A;  1VQ5 A;  5LJ5 g;  1I5L A;  4M77 E;  5IHK A;  2J6O A;  1WFW A;  2DBK A;  4OGE A;  4BDZ A;  3VRY A;  2CZ7 B;  2EKO A;  2A3L A;  2ZPB B;  1UG1 A;  2LQ8 A;  5GMK i;  1NYG A;  2XDB A;  1YJW Q;  4J9H A;  3FJ5 A;  4J9G A;  1FXX A;  3CCU Q;  2GQI A;  2DAQ A;  5DM7 R;  1VQO Q;  3CMA T;  1N6A A;  1KHI A;  1D1A A;  1PSE A;  2KRS A;  3CMA Q;  4AMC A;  1PG5 B;  4F16 A;  4HT9 A;  3OA6 A;  2E1H A;  1UB4 A;  2MOX A;  2MIO A;  2P84 A;  1G3Y A;  2QQS A;  1M3A A;  2CP7 A;  2XI9 A;  3AT1 B;  4M75 E;  4PJO F;  4C0Z A;  3OYN A;  4J9E A;  5CIU A;  2M51 A;  3QYG B;  2IG0 A;  4FYX B;  4HCZ A;  1UUE A;  4A63 B;  2LVM A;  1YWO A;  4C8Q F;  2FL7 A;  1B34 B;  4F04 B;  4A54 A;  3CCE Q;  1IHW A;  2K2M A;  2QTV A;  4C8Q B;  2YRV A;  1BU1 A;  4MZM A;  3G6E T;  1PD1 A;  1N8R C;  2RF0 A;  5GAO m;  4JS5 A;  3OYA A;  2H8H A;  2I0N A;  2RK1 A;  3EG9 B;  2QGF B;  2JT4 A;  4RKU E;  2M0Y A;  4RCC A;  4DA4 A;  1IB8 A;  4GLM A;  4KBM B;  3PTA A;  2YHT A;  1UGQ B;  2HBP A;  5CCA A;  4OMM A;  4AG1 C;  2RB6 A;  3SWN C;  4FYY B;  1RLQ C;  1U06 A;  3PIP A;  2JS0 A;  1M2V A;  5AT1 B;  3M0Q A;  2LCC A;  4ELZ C;  2KXD A;  3OYB A;  1Q86 R;  3HPW A;  2HKN A;  3ZEH A;  5I21 A;  4FL6 A;  1TSF A;  1SRM A;  6AT1 B;  4N0A C;  1X27 A;  3VUB A;  4GY5 A;  3CC7 Q;  1YHQ T;  1T3S A;  2VV5 A;  1Q7Y C;  4M75 G;  2LT1 A;  2VGM A;  3CCL T;  3JCM g;  4BY6 C;  2DZ9 A;  4OF1 A;  1VYV A;  2LJ1 A;  5I2M A;  5HY6 A;  1AOJ A;  3S3M A;  5KH6 A;  3QYH B;  4E7I A;  2EBP A;  2DPP B;  3G71 T;  4MML A;  2L89 A;  1VQO A;  2KGT A;  2RQR A;  2VC8 A;  3OYK A;  1RLP C;  3V8K A;  2LJ3 A;  3LX7 A;  4QQ6 A;  5FLX E;  5GMK j;  4NL3 A;  1WX6 A;  2F2X A;  5LJ3 g;  4LDU A;  4M77 A;  2RO0 A;  1IXD A;  2K57 A;  3EH2 A;  3CXC A;  1TH7 A;  1WNL A;  1VQ8 T;  2HSE B;  4OMO A;  4BE0 A;  3NGP A;  3C95 A;  3M0U A;  5IT9 E;  1YCY A;  1AWX A;  5M9O A;  1ZHI A;  3S6W A;  3JB9 G;  2BIV A;  5GAM j;  5GAO l;  2CSQ A;  1I0C A;  4C5E A;  3OW2 A;  3O5Z A;  3V7S A;  2DL3 A;  4PJM A;  2OTL A;  3CD6 A;  1R8O B;  1M1K C;  4D6W A;  2O01 E;  3H41 A;  1SKU B;  3PT9 A;  1OZ3 A;  4F14 A;  2R57 A;  1WGS A;  4BE2 A;  4A4G A;  1Y96 A;  1WHK A;  3ME9 A;  4XQ3 A;  3T9N A;  3UDC A;  3JB9 I;  1AZE A;  4PLL A;  1UEB A;  1KIK A;  1R77 A;  2FEI A;  2ECZ A;  2HCK A;  1UJ0 A;  3FDR A;  1O75 A;  4ORZ A;  1VQL T;  3CCV T;  5GAN 2;  2AHJ B;  2DVJ A;  4JUV A;  2R58 A;  1IGQ A;  4FM4 B;  1Q82 U;  1TS9 A;  1M90 U;  1BI1 A;  1ZLM A;  4LDV A;  4QKU A;  4ZN1 A;  1M30 A;  2DER A;  2EGE A;  3L1A A;  1GL5 A;  5L8R E;  4PFO A;  1PWT A;  3SFM A;  4E7Z A;  2YLC A;  4A4F A;  5HK0 A;  2QYZ A;  4AT1 B;  3TEE A;  1LCK A;  3CCU T;  1VYU A;  1M1G A;  1GFC A;  1ZSG A;  2BZ8 A;  2DXB A;  5IXB A;  3N5B B;  2K2V A;  4PJO A;  1S72 A;  2EPD A;  3BW1 A;  3GBQ A;  5FU7 B;  4JDS A;  5LJ3 f;  1QCF A;  4RTW A;  3CCL A;  4MDX A;  2XU8 A;  1VQ8 Q;  3CC4 T;  1KQS S;  1H8K A;  3CCL Q;  1UHC A;  2QTX A;  1VQ7 A;  5DLO A;  4J9B A;  4OMF B;  2ZPH B;  2QA4 Q;  1JXO A;  3E19 A;  1UJY A;  2WSF E;  3QPH A;  1OU8 A;  4ESR A;  2QA4 T;  5DY9 A;  2WSE E;  2X3W D;  3TSW A;  1ACM B;  4UC4 A;  2MCN A;  2L5Q A;  5GAO n;  5LJ3 j;  5A0L A;  1VQ6 T;  3QWY A;  3M0S A;  2FRW A;  1GBR A;  3A8O B;  3RR6 A;  3C0C A;  3CC4 Q;  1KQ1 A;  2QQ9 A;  4KT0 E;  1EFN A;  1YP5 A;  1K9M C;  3QG1 A;  1WHH A;  4C92 B;  3I55 A;  2V8I A;  5J26 A;  4M7D F;  3MEV A;  3MCA B;  4PJJ A;  1DJ7 B;  1WQW A;  1YJW A;  2C0I A;  3ZL7 C;  2AKL A;  2CT3 A;  3M4Y A;  2COW A;  3CPW P;  1WJR A;  1JEG A;  1M2O A;  3THK A;  2LDM A;  3GF5 A;  3X28 B;  3G4S T;  1VQM Q;  1H92 A;  4BUG A;  4IUT A;  1G83 A;  2C0O A;  1U1S A;  2LTO A;  1WA7 A;  2D8J A;  3UA7 A;  1PKT A;  4BD3 A;  1VQL Q;  2HEQ A;  2J06 A;  1BCM A;  1ZA2 B;  3GIB A;  1KD1 U;  2CP0 A;  3QO3 A;  1QVF P;  4C92 E;  2FPF A;  4XTV A;  2V8K A;  3LGL A;  5HKC A;  3DKM A;  4FSS A;  2PUO B;  3I5R A;  2RA2 A;  1YHQ A;  1Y57 A;  5C6S A;  2CH4 W;  2F1L A;  5GAM h;  1WXU A;  4PJO D;  1PD0 A;  2JM9 A;  1QLY A;  4Z8A A;  1NBE B;  3L2Q A;  1QVG A;  1Y0M A;  1S1N A;  3I55 T;  1C0M A;  2AIR B;  4J7F A;  5GAN g;  1IZ6 A;  5EC7 A;  1W2B A;  3X20 B;  2KNB B;  2E5K A;  2A0F B;  4JLG A;  4N4I A;  3EGD B;  3VKI A;  5A0D A;  1LNX A;  1K73 R;  1QVG S;  3GNF B;  5J39 A;  1VQP A;  4JZ3 A;  4DOW A;  2D9T A;  3RUX A;  2RHX A;  2COZ A;  4RTT A;  3OYC A;  1E6G A;  1VQN Q;  4DOV A;  3EGX B;  2DEQ A;  2BZY A;  4PJO B;  1D1C A;  1QWE A;  4HXJ A;  1U1T A;  2AK5 A;  2QA4 A;  1V29 B;  4TVR A;  1NM7 A;  2KBT A;  2VB6 A;  4R55 A;  1ZUY A;  4JRQ A;  2NUT B;  3QDR B;  5FWB A;  4F7U B;  1FMK A;  2CZ0 B;  3S3O A;  3A5Z B;  4CC3 A;  4JJC A;  2KT8 A;  5EG2 A;  1RAI B;  1MND A;  3A1P A;  4OMN A;  4WTO B;  2EIF A;  1MNE A;  1QMC A;  3MP1 A;  1QKW A;  1PCX A;  3DLL A;  4LUE A;  1ZBX A;  1T3L A;  1ZSZ A;  1WLP B;  2RJC A;  4J9D A;  1BBZ A;  2QQR A;  4PJN A;  4F17 A;  4QQD A;  3RMS A;  4EMK C;  3V7R A;  3FEO A;  4C8Q G;  2R5A A;  2Z0W A;  1Q7Y U;  4RG2 A;  3L2W A;  4RMO A;  1Q81 R;  1HXD A;  4IIM A;  2K5L A;  2RMO A;  4M7D C;  1SRL A;  1HK9 A;  4QVC A;  2L3P A;  3X25 B;  2CZ6 B;  1PNJ A;  3QUI A;  1TU0 B;  3VV0 A;  2G3R A;  3X24 B;  4XK8 E;  1MMG A;  1ABO A;  5IH2 A;  5J3B A;  5I2S A;  1NZ9 A;  4J8O A;  2RJE A;  4ME7 A;  4X9D A;  2E10 A;  3WVE B;  1Q82 C;  1HD3 A;  2WSC E;  1OUL A;  2NUP B;  3LWH A;  2E4H A;  1ARK A;  4ZTF A;  4LD6 A;  1WZO A;  4PJL A;  5GMK m;  2QEX T;  4PL6 A;  3CC2 A;  1G5V A;  4FSX A;  5GAN e;  1JJ2 P;  1NJI R;  2EQI A;  3EHR A;  2K5I A;  3SWN A;  3AHU A;  1QP2 A;  2QI2 A;  2L8D A;  3GNG A;  1K9M R;  3H6Z A;  4FW1 A;  1SPK A;  3CCV Q;  2VUB A;  1NJI C;  3EFO A;  4M78 B;  1D0X A;  1JB0 E;  3RKY A;  2P0P A;  3HRU A;  4KUL A;  1ZBJ A;  2CUB A;  4QVZ A;  1K0X A;  2HKQ B;  4J9I A;  4E6R A;  2PUK B;  2ZCF B;  1VIF A;  3CME A;  4PK4 A;  2ESW A;  1N8R R;  3CXC P;  3REB B;  4DQ2 A;  1LPL A;  3VS4 A;  4RG8 A;  4BI3 A;  1Y7X A;  1UGP B;  3LH0 A;  3VS2 A;  5KYX B;  2JTM A;  2DE0 X;  2GCX A;  1X2Q A;  4J6Y A;  2KVQ G;  1S72 T;  2DEU A;  2DL7 A;  4EMK B;  2HNI A;  2DL4 A;  2YUP A;  1EZZ B;  2L2P A;  3NPF A;  2CP2 A;  3OYF A;  4A4K A;  2DMO A;  3EGX A;  5ECA A;  4KGX B;  1KFZ A;  3A98 A;  3QJ6 A;  1WDX A;  4N4G A;  2IIM A;  2L3R A;  1YI2 Q;  4XU3 A;  1G3W A;  2XDP A;  3OBY A;  2YWW A;  3FIF A;  1GCQ C;  5IXF A;  2QQA A;  3OYD A;  3LWI A;  1WJQ A;  4CC2 A;  2RHZ A;  1N27 A;  1D0Z A;  1LOJ A;  2DJZ A;  3EFR A;  4HVU A;  3TSZ A;  2FZG B;  2M02 A;  4FT2 A;  2AZV A;  2EYZ A;  1JO8 A;  4M7A A;  1W70 A;  1M90 R;  4L59 A;  1BYM A;  2QXF A;  2DIL A;  4M78 A;  4EMH A;  4AG2 C;  3G71 Q;  2LNV A;  1NEB A;  2LT4 A;  3G6E A;  2HZY A;  1RUW A;  3JCM d;  1RAC B;  2LX9 A;  1KC8 R;  2X3X D;  3G6E Q;  2E3I A;  4XTW A;  1XTD A;  1N8R U;  1TTH B;  4IUU A;  3CCM A;  1K73 C;  4PFP A;  2O88 A;  1QP3 A;  2OJ2 A;  3CCQ A;  1AWJ A;  1SSH A;  2QEX A;  4M7A F;  3EG0 A;  3OS5 A;  3CCQ Q;  3TRE A;  3QSU A;  1TUC A;  5KE3 A;  1YJ9 A;  9ATC B;  4BB7 A;  1VQN A;  2ABL A;  1VQK A;  2FYK A;  4XTU A;  2MYS A;  2GQV A;  3G7Z A;  2YRD A;  3V8L A;  3A8H B;  2GNC A;  4DBF A;  2MF2 A;  2EKH A;  1NYF A;  2L3Q A;  2C06 A;  2O2O A;  2M9U A;  2NUZ A;  1B3Q A;  2JJ9 A;  5A0G A;  2RD1 A;  2FHD A;  3V7C A;  3UA6 A;  1Q86 U;  1IGU A;  2KRM A;  4KRT A;  3SWN B;  1X69 A;  1N5Z A;  1XQH A;  2FB7 A;  1T0J A;  2JNG A;  3EG3 A;  3SDZ A;  1K8A C;  1MMD A;  2OTJ Q;  3M59 A;  3MJX A;  1VQ4 T;  3CCS T;  3OS1 A;  1OV3 A;  2JTE A;  3E9G A;  3FC3 A;  2E6Z A;  3CPF A;  1KC8 U;  1OU9 A;  4ZTJ A;  2M0O A;  4OP0 A;  1VQ9 A;  1MV0 B;  4M78 E;  4DEX A;  2XMF A;  4M77 B;  4WF2 A;  4M7A G;  4B6M A;  2VAS A;  1Q7Y R;  4PLI A;  2DL8 A;  2JN0 A;  3REA B;  2JOY A;  3OS2 A;  2GGR A;  1OQK A;  3G4S Q;  2KYM A;  1B7T A;  3A8M B;  2X9H A;  3M0R A;  4C92 C;  3UWN A;  2VKN A;  3LGF A;  1P92 A;  4MMK A;  4Z02 A;  3OSS C;  2KYB A;  2AZS A;  3HP9 A;  4J9F A;  4C92 A;  2F2W A;  4ZN3 A;  3JCM J;  1PRL C;  4D8D A;  2EYQ A;  4IUV A;  2RHU A;  1J3T A;  4IIO A;  1B34 A;  4HCK A;  1K4U S;  2PU9 B;  5LJ3 e;  1VQK T;  3EGU A;  4E7S A;  3P8H A;  2JXB A;  1B07 A;  2YLB A;  1NLO C;  1PRM C;  3MET A;  4JJB A;  3JCM e;  1YJ9 T;  3J7A F;  4FW2 A;  3EG9 A;  2J6F A;  1XJW B;  1Y71 A;  3CPW A;  1FMW A;  5KYW B;  4M78 G;  1VQP Q;  1FMV A;  2GFU A;  1WYX A;  3CCQ T;  4M77 C;  5CVI A;  5D6W A;  3EG2 A;  1M8V A;  5AYF A;  3MEU A;  2RQW A;  1UE9 A;  2QK0 A;  4M7D D;  3H9N A;  3FRN A;  3QXE B;  5CR2 A;  4FIB A;  2YUN A;  1SG5 A;  5D6Y A;  4C92 G;  1YJN A;  1AEY A;  1PC0 A;  2JVV A;  5GAN 4;  3CME T;  1M1K U;  3UAT A;  3RKW A;  2M1H A;  4ZGD B;  2GBQ A;  2EJF A;  1NJI U;  1QCO A;  1BCO A;  2DZC A;  2MWO A;  2YRC A;  2WAC A;  1YBY A;  4HCC A;  4DBQ A;  1K9A A;  2QAZ A;  4RTX A;  1OX9 A;  3BDL A;  1C1A A;  3PFS A;  2EWN A;  3LH5 A;  2DO3 A;  1M27 C;  3UPU A;  3H0F A;  2EYW A;  3VS5 A;  4KH1 B;  1YNZ A;  4LDX A;  4F7U E;  3PE0 A;  2VWF A;  3D7S B;  5FU7 C;  2LX7 A;  4HVV A;  2DTH A;  3QHS A;  2HL5 C;  1F1B B;  3JCM c;  1SEM A;  2W10 A;  2QQB A;  3O8V A;  2LMJ A;  4MZT A;  5CQX A;  2DL5 A;  2LQW A;  1M3B A;  1KG1 A;  1R0B G;  2CZ1 B;  2VYT A;  4EMK A;  3M4G A;  1BK2 A;  1YN8 A;  4M78 C;  1VQM A;  1RAG B;  4BI4 A;  1QWF A;  4Y91 A;  3RIR A;  1JXM A;  2YXY A;  1ZA1 B;  3LLR A;  2D6F A;  3I35 A;  3M0P A;  1AWO A;  2RHY A;  2LCL A;  1ZUU A;  3KBG A;  2W0Z A;  3M5A A;  2P4R A;  4JRI A;  3SEM A;  1D09 B;  2ZPG B;  5D6X A;  3RDV A;  1ZX6 A;  1WQ7 A;  4JPB W;  5CKE A;  2LC4 A;  1NG2 A;  3I56 Q;  2Y4Y A;  5GAN d;  3QBY A;  3M56 A;  2EYY A;  1MV3 A;  4HVW A;  2EGC A;  2EGA A;  2RQT A;  3HHT B;  3CQT A;  2OAW A;  3HL8 A;  2MWP A;  2CP5 A;  3HTR A;  2K5F A;  1NLP C;  3CCU A;  1GBQ A;  2GFA A; 
#chains in the Genus database with same CATH homology
 1AD5 A;  2FG0 A;  1UUE A;  4A63 B;  5IH2 A;  1YWO A;  1GFD A;  1OPL A;  2O9V A;  1UHF A;  4X1V A;  5IHI A;  2BTT A;  2JW4 A;  2K2M A;  2RQV A;  1BU1 A;  4EIK A;  1HD3 A;  4Z89 A;  2RF0 A;  3RBB B;  1ARK A;  1QKX A;  1WXT A;  1ABQ A;  2DNU A;  2A36 A;  2ROL A;  2H8H A;  2I0N A;  2EQI A;  3EHR A;  2JT4 A;  2DBM A;  2HSP A;  2M0Y A;  2JS2 A;  1SPK A;  4GLM A;  1UGV A;  1K76 A;  1SHF A;  4OMM A;  4M4Z A;  4AG1 C;  5GJV B;  1CKB A;  2KEA A;  2OI3 A;  1RLQ C;  1H3H A;  1U06 A;  3JV3 A;  2GTJ A;  3VS0 A;  2JS0 A;  5L23 A;  3M0Q A;  3UF4 A;  1FYN A;  2KXD A;  2SRC A;  1Z9Z A;  1ZBJ A;  2CUB A;  1K0X A;  2KE9 A;  1SRM A;  4J9I A;  1I1J A;  4E6R A;  1UEC A;  1X27 A;  5FW9 A;  1VYT A;  2ESW A;  1T3S A;  5I11 A;  3REB B;  1G2B A;  3VS4 A;  1YWP A;  4RTU A;  1AWW A;  1VYV A;  2LJ1 A;  3VS2 A;  2YUO A;  1AOJ A;  1I07 A;  2DE0 X;  1PKS A;  4GBQ A;  2EBP A;  3PVL A;  1X2Q A;  2DL7 A;  2KGT A;  2DA9 A;  2RQR A;  2DL4 A;  1GCP A;  1RLP C;  2LQN A;  2YUP A;  2LJ3 A;  2L2P A;  3NPF A;  1K0S A;  4J9C A;  2K6D A;  2QDL A;  1WX6 A;  2F2X A;  2DMO A;  5ECA A;  1CSK A;  1X6B A;  1TG0 A;  1KFZ A;  4RTZ A;  2FPE A;  3A98 A;  2D8H A;  4R0K A;  1WDX A;  1GCQ A;  1HSQ A;  2IIM A;  1ZUK A;  1JQQ A;  4OMO A;  3R6N A;  1GRI A;  3NGP A;  1GCQ C;  2LNH B;  4RTV A;  2O31 A;  5IXF A;  3M0U A;  3U23 A;  1W6X A;  4CC2 A;  4K11 A;  1AWX A;  1UTI A;  4HVU A;  2AKK A;  3TSZ A;  3VS3 A;  2CH4 A;  4LN2 A;  2KRN A;  2AZV A;  2CSQ A;  2EYZ A;  1JO8 A;  1I0C A;  1W70 A;  2ENM A;  3O5Z A;  2DL3 A;  2DIL A;  4JJD A;  4AG2 C;  1JU5 C;  3H41 A;  1NEB A;  4LUD A;  1AZG B;  4F14 A;  1VA7 A;  1RI9 A;  1RUW A;  4RTY A;  1KSW A;  2X3X D;  1NEG A;  1AZE A;  1KIK A;  2FEI A;  2ECZ A;  2RPN A;  2DYB A;  2O88 A;  2HCK A;  1UJ0 A;  2OJ2 A;  1IO6 A;  1AWJ A;  1SSH A;  2CDT A;  4ORZ A;  3EG0 A;  2DVJ A;  2LJ0 A;  2A28 A;  1TUC A;  1ZLM A;  2DX1 A;  2LZ6 B;  1M30 A;  2ABL A;  2EGE A;  2L0A A;  1CKA A;  4AFZ C;  1GL5 A;  1PWT A;  4Z88 A;  3H0I A;  1HJD A;  2GNC A;  2EKH A;  1NYF A;  2B86 A;  2FO0 A;  1LCK A;  2L3Q A;  2CUD A;  2J05 A;  1VYU A;  2BZ8 A;  1GFC A;  1ZSG A;  2CT4 A;  5IXB A;  2O2O A;  2NUZ A;  1B3Q A;  2EPD A;  3GBQ A;  3UA6 A;  1MUZ A;  2KRM A;  4KRT A;  1QCF A;  4RTW A;  1X69 A;  1E6H A;  3M0T A;  3VS6 A;  1N5Z A;  1H8K A;  2YT6 A;  4LE9 A;  1T0J A;  1UHC A;  3EG3 A;  2EVR A;  1TUD A;  4AFQ C;  1A0N B;  4J9B A;  2ED0 A;  1OV3 A;  2JTE A;  1BB9 A;  2JMA A;  1UFF A;  1JXO A;  1UJY A;  3QWX X;  1OOT A;  4ESR A;  1MV0 B;  1KJW A;  1U3O A;  1U5S A;  2O9S A;  2X3W D;  2XMF A;  4DEX A;  3TSW A;  5FWC A;  1AVZ C;  2LP5 A;  2DF6 A;  5IHN A;  2MCN A;  2DL8 A;  4AFU C;  2PNI A;  3REA B;  2HDA A;  3I9Q A;  3QWY A;  2GGR A;  2FRW A;  3M0S A;  1GBR A;  2G6F X;  2KYM A;  2K7A A;  3C0C A;  2GTO A;  4RUG A;  2L3S A;  2CRE A;  3M0R A;  2ED1 A;  1EFN A;  1YP5 A;  2VKN A;  2RQU A;  2RN8 A;  5GJW B;  2JMC A;  3EHQ A;  3I5S A;  2KYB A;  2AZS A;  2EYX A;  4J9F A;  2F2W A;  2V1R A;  2K79 A;  3RNJ A;  2KT1 A;  4CC4 B;  3TVT A;  2SEM A;  1XOV A;  1PRL C;  2C0I A;  4D8D A;  3ZL7 C;  1X2K A;  4LNP A;  2AKL A;  2CT3 A;  2KR3 A;  1X43 A;  1J3T A;  4IIO A;  1JEG A;  3THK A;  3KFV A;  4QT7 A;  3VS7 A;  4HCK A;  1K4U S;  1H92 A;  3EGU A;  1G83 A;  2C0O A;  2JXB A;  2PZ1 A;  2YSQ A;  1WA7 A;  2D8J A;  1B07 A;  2FPD A;  1NLO C;  1PRM C;  4JJB A;  5I22 A;  3UA7 A;  1PKT A;  4Y92 A;  2J6F A;  2HEQ A;  2J06 A;  4DEY A;  2D1X A;  2F2V A;  2CSI A;  1WYX A;  2EW3 A;  3SHW A;  2YUQ A;  3IQL A;  2FPF A;  2J6K A;  2NWM A;  1UDL A;  2DRM A;  3EG2 A;  2A08 A;  4FSS A;  3I5R A;  2KXC A;  2JM8 A;  4WCI A;  1K1Z A;  1Y57 A;  2RQW A;  1UE9 A;  1OEB A;  2CH4 W;  2A37 A;  2ROT A;  1WXU A;  2YDL A;  3H0H A;  2JM9 A;  2K9G A;  2YUN A;  1QLY A;  4Z8A A;  2HBW A;  1X6G A;  1M3C A;  1Y0M A;  1S1N A;  1WXB A;  1AEY A;  3ULR B;  2DLP A;  4OML A;  3NHN A;  2KRO A;  5EC7 A;  3UAT A;  1V1C A;  1OPK A;  2KNB B;  2E5K A;  2GBQ A;  2D0N A;  4JZ4 A;  2DM1 A;  4D8K A;  2BZX A;  2VVK A;  1K9A A;  4JZ3 A;  4RTX A;  2C0T A;  3LH5 A;  3NMZ C;  1M27 C;  4RTT A;  3H0F A;  1E6G A;  2EYW A;  3VS5 A;  1YNZ A;  2BZY A;  1QWE A;  1WIE A;  4HXJ A;  2AK5 A;  1NM7 A;  2KBT A;  3PE0 A;  4ZNX A;  1YCS B;  2VWF A;  1ZUY A;  2RNA A;  2LX7 A;  4HVV A;  3EG1 A;  5FWB A;  1FMK A;  1SEM A;  2W10 A;  2LMJ A;  4CC3 A;  2DL5 A;  2J7I A;  2LQW A;  1M3B A;  3VRZ A;  4JJC A;  3PVQ A;  1BK2 A;  2DJQ A;  1YN8 A;  2KT8 A;  2K3B A;  2FRY A;  1QWF A;  2DRK A;  4OMN A;  5IHK A;  2J6O A;  1WFW A;  2DBK A;  1JXM A;  3VRY A;  1QKW A;  1UG1 A;  3I35 A;  4LUE A;  3M0P A;  1AWO A;  1NYG A;  4OMP A;  1ZUU A;  4J9H A;  1T3L A;  2W0Z A;  3FJ5 A;  4J9G A;  1WLP B;  4J9D A;  1BBZ A;  2GQI A;  2P4R A;  3SEM A;  1T0H A;  1SHG A;  3VS1 A;  1M8M A;  1ZX6 A;  4F17 A;  4JPB W;  4AFS C;  1PHT A;  2KRS A;  1NG2 A;  4OMQ A;  5HCK A;  4F16 A;  2V1Q A;  2EYY A;  1MV3 A;  1Z9Q A;  2PTK A;  4HVW A;  2EGC A;  2EGA A;  2RQT A;  1E7O A;  3CQT A;  4IIM A;  2MOX A;  2MIO A;  2RMO A;  2OAW A;  4CC7 A;  1SRL A;  2L3P A;  1M3A A;  1WI7 A;  1W1F A;  1NLP C;  1PNJ A;  2LCS A;  4J9E A;  2M51 A;  1GBQ A;  1ABO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...