2FPDA

Sad structure determination: crystal structure of the intrinsic dimerization sh3 domain of the ib1 scaffold protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords C-jun-amino-terminal kinase interacting protein 1
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 15
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpdA00
2J6KA 1RLQC 1JU5C 2YSQA 1YP5A 2CSQA 1T0JA 1SEMA 4JZ4A 4LN2A 1ZUYA 2EYWA 2DRKA 5IH2A 3VS1A 2D1XA 4OMMA 4M4ZA 4AFQC 2E5KA 1NLOC 2EYZA 1JO8A 4JJBA 1M27C 2O9VA 2GTOA 4HVVA 1CKAA 2K7AA 3EHRA 1JXMA 4WCIA 1B3QA 1UJYA 4D8KA 1FMKA 4Y92A 3TSZA 2HDAA 2KRMA 1E6GA 2YT6A 4EIKA 1K9AA 3ULRB 3TSWA 3UATA 2FRYA 1M3CA 2AZSA 2DJQA 1M30A 2CDTA 1M8MA 2RMOA 2GGRA 2KROA 2OAWA 3C0CA 2CUBA 2K3BA 1MUZA 2K6DA 2SRCA 1HD3A 2FPDA 2LP5A 1WFWA 4RTVA 2AZVA 2A36A 2KEAA 2SEMA 2L3QA 4J9HA 1UHFA 2RF0A 2KYBA 1WXTA 3H0HA 2LJ1A 1UDLA 2G6FX 2BZYA 1YCSB 1W70A 2CT4A 1T3SA 2EKHA 4IIMA 3VS2A 2KE9A 1PKTA 1UE9A 2KR3A 1K1ZA 1X43A 2ROTA 1H8KA 1GCQC 1LCKA 2NUZA 5IXBA 3RBBB 2RPNA 2KRSA 3LH5A 1E6HA 2DYBA 1T3LA 3SEMA 1WXBA 2EW3A 1HSQA 1QLYA 4K11A 3I9QA 1WA7A 2ROLA 4ORZA 2DBKA 3VRZA 2YUNA 2RQUA 2JS2A 1CSKA 1VYVA 2H8HA 1GFCA 1VYTA 1X2QA 2DBMA 2OI3A 1PKSA 2VWFA 2OJ2A 2P4RA 2L2PA 2EYXA 2LCSA 2ESWA 2FG0A 3PVLA 5GJWB 2CREA 1ARKA 2PNIA 2W10A 2DA9A 2EPDA 1N5ZA 1AOJA 2GQIA 3M0QA 4RTYA 1GBQA 2JM8A 2JS0A 4AFSC 1SRLA 2EGAA 1KJWA 2LNHB 4J9CA 2JMAA 2KXCA 2PZ1A 3PVQA 3VS3A 2ECZA 4GBQA 3EG2A 2F2XA 1NYGA 4AG2C 3H0IA 1K4US 5I22A 2EGEA 1ZUUA 2A08A 1GCQA 4ZNXA 1GRIA 4QT7A 1UFFA 1YNZA 2CH4A 3UA6A 3GBQA 2LJ0A 1I07A 2GTJA 2DE0X 2FRWA 4HCKA 2FO0A 2DL3A 2CH4W 1CKBA 2DRMA 1G2BA 2X3XD 1UTIA 2DF6A 2XMFA 1K0XA 3CQTA 1AWWA 1U06A 2JXBA 3I35A 2JM9A 2A28A 3VS5A 1ZBJA 3VS0A 3KFVA 4LNPA 4RTZA 4OMLA 1QWEA 1PWTA 2KGTA 3UF4A 1AZGB 4IIOA 1G83A 3JV3A 2JTEA 1OPKA 4Z8AA 5FWBA 1SSHA 1ZLMA 5ECAA 3M0RA 2EBPA 1U3OA 3RNJA 2J05A 3H0FA 1NEBA 1WYXA 4J9FA 2LJ3A 4DEYA 2ED0A 4JPBW 1AWOA 2DL5A 2O9SA 2ENMA 3REAB 2DL4A 4X1VA 1MV3A 2HSPA 5L23A 1U5SA 2DVJA 3QWXX 1BBZA 2FEIA 2A37A 1NLPC 2C0TA 1JEGA 3VS7A 2IIMA 1K0SA 3VS4A 1X69A 1GL5A 3NPFA 4RTTA 4GLMA 1PRMC 2L0AA 2HBWA 1X6BA 1KFZA 1TUDA 3QWYA 1MV0B 4J9DA 1M3BA 4J9EA 2RQTA 1GCPA 1AD5A 4CC7A 1ZSGA 1UHCA 4AFZC 4HVWA 1I0CA 2KNBB 1ZX6A 2F2VA 1QKXA 2BZXA 2K2MA 1NYFA 4RTUA 2KRNA 3M0PA 4F17A 1WDXA 4E6RA 3UA7A 2VKNA 2KBTA 4ESRA 4RUGA 4J9BA 1KSWA 4RTXA 2J6FA 5EC7A 4AFUC 4R0KA 2FPEA 1Z9QA 3FJ5A 1M3AA 3M0TA 4J9GA 3EHQA 1W6XA 2O31A 3I5RA 2HCKA 4OMPA 1PNJA 2W0ZA 1ABOA 1TG0A 1X2KA 1QWFA 2DMOA 2YDLA 1T0HA 3M0UA 1NEGA 3PE0A 2K9GA 3TVTA 2B86A 4F14A 2DNUA 3A98A 1NG2A 2LMJA 1SHFA 1SRMA 2D8HA 2M0YA 4CC4B 4RTWA 1SHGA 1WIEA 3VS6A 2YUOA 3EG0A 4J9IA 1UG1A 2J06A 1Y0MA 2LQWA 2RQWA 1OPLA 3VRYA 2F2WA 1X6GA 2V1QA 1H3HA 1S1NA 3EG3A 1VA7A 1JQQA 2JT4A 4LUDA 2YUQA 5FW9A 5IHNA 4FSSA 1EFNA 2O2OA 1TUCA 2L3SA 2RNAA 2LZ6B 4HVUA 1GFDA 1OOTA 2HEQA 4KRTA 5IHIA 4D8DA 2GBQA 2QDLA 2DL7A 1SPKA 3NHNA 4Z88A 1ABQA 1RUWA 1BK2A 2JMCA 1YWOA 1OEBA 3M0SA 2ABLA 1H92A 1Z9ZA 2MOXA 1OV3A 1A0NB 2J7IA 2EGCA 2EYYA 2JW4A 2CT3A 1AWJA 1I1JA 2DX1A 2EQIA 2EVRA 3R6NA 2K79A 4DEXA 2CSIA 4AG1C 3EG1A 3O5ZA 1RI9A 4JJDA 1V1CA 2C0OA 2RQVA 1BU1A 3REBB 1HJDA 2BZ8A 2LX7A 3EGUA 1AZEA 5IXFA 5I11A 2KYMA 1KIKA 2D0NA 1JXOA 4HXJA 4OMNA 1XOVA 5GJVB 1ZUKA 1RLPC 1QCFA 3ZL7C 2AK5A 1WLPB 2D8JA 2DLPA 2CUDA 2DILA 2NWMA 4Z89A 5IHKA 1J3TA 1YN8A 1GBRA 4JZ3A 1UUEA 3IQLA 2FPFA 3H41A 4A63B 2BTTA 2ED1A 2J6OA 1PRLC 2VVKA 1E7OA 4F16A 2I0NA 4OMQA 2RQRA 1WXUA 2KT1A 1BB9A 1UGVA 1VYUA 4CC3A 2KT8A 2MCNA 3I5SA 4LUEA 4CC2A 5FWCA 1WX6A 2KXDA 1Y57A 1AWXA 1W1FA 1X27A 3NMZC 1AVZC 1PHTA 2C0IA 1YWPA 1QKWA 1UECA 4LE9A 1FYNA 2RN8A 2LQNA 2O88A 2PTKA 3U23A 2YUPA 2L3PA 1B07A 5HCKA 1IO6A 2AKKA 2AKLA 3SHWA 3THKA 1K76A 2MIOA 4OMOA 2GNCA 4JJCA 2V1RA 2DL8A 2X3WD 2DM1A 2M51A 1UJ0A 1WI7A 1NM7A 1AEYA 3NGPA
chains in the Genus database with same CATH superfamily
2KMTA 2YSQA 2YRVA 1YP5A 3L1AA 2CSQA 2NUTB 4PLLA 3JAME 4EMGA 3CCQT 1SEMA 3VYGA 5KYYB 3GLXA 2DIGA 2EAYA 2HNIA 3VS1A 3HL8A 3CCRA 4X9CA 2VC8A 4M4ZA 4C5IA 2EYZA 1M27C 4C8QE 3CMAQ 1CKAA 3EHRA 3QO3A 2VXFA 3A8LB 4WCIA 4E7SA 1B3QA 4M77F 5D6WA 3JRZA 1Q86U 2YRDA 1X01A 2XDPA 4EIKA 1K9AA 3UATA 2DJQA 2CDTA 2GCXA 4Y91A 3G4SQ 1VQ8T 4Y28E 5I21A 2CUBA 2K3BA 1MUZA 3CCVA 5GAN8 2JNGA 2L8DA 2FPDA 3JB9F 1C0MA 4PJOF 1Q7YU 2LP5A 4RTVA 2L3QA 2HMAA 3V7SA 4J83A 3CXCP 2LNVA 2XKOC 2MWPA 3VUZA 4KT0E 5A0DA 1WJQA 3CC4A 3SWNC 4IUUA 1Y96A 3A8MB 4OB2B 1UDLA 5CKDA 5EG2A 1YCSB 4MDXA 1T3SA 1K73R 3BFMA 1K1ZA 2GQVA 2ROTA 1W2BP 1D0ZA 5IXBA 2VB6A 2DD4A 2CP2A 3RBBB 1VQKT 4M78F 3QJ6A 1E6HA 1AHJB 2P84A 4XK8E 2EW3A 1S72A 2E1HA 2PUOB 1RAAB 1M90C 4K11A 3CCET 4F7UE 4C8QA 4WF2A 1ZSZC 2DZ9A 1QCOA 2YUNA 2RQUA 1CSKA 2H8HA 5A2QE 4QQGA 2P4RA 2L2PA 3KBGA 2CZ0B 4XAXB 5GJWB 4M7DD 2DEQA 3CC7A 2W10A 3M0QA 1ZBXA 2IVWA 3M57A 1LVKA 5GANe 2JM8A 1YJWA 4AFSC 1SRLA 1D1CA 5CQXA 1Q82C 2LCLA 4J9CA 4M78E 3PVQA 4JS4A 3VS3A 4GBQA 4HCCA 4A4HA 3E9FA 2RJDA 4MZMA 1NYGA 2QG9B 4AG2C 1K4US 2QQAA 1BYMA 1ZUUA 2MK5A 2A08A 3M4YA 1YI2T 1MGQA 1SKUB 1D1AA 4QT7A 1OZ2A 4FIBA 1H641 2A3LA 1XTDA 2ZPEB 2LJ0A 1VQNT 1I07A 2PQWA 4BE1A 4ATOA 2LCCA 3I56T 2EQMA 4HA8A 2DL3A 3JCMX 2CH4W 3C95A 1CKBA 1QCNA 3CPWA 5KYXA 1PD1A 1IZ6A 4BI4A 3CQTA 5GAN5 4M78B 3LYIA 4IUQA 4LNPA 4M75G 1B34A 4FCYA 1VQMT 3VU3C 5HK0A 4HCBA 1LJOA 4F7UA 4IIOA 1KQSS 2LRQA 1YITA 3JV3A 4KGZB 3G4SA 4E7HA 1G3YA 4DA4A 1NPPA 1ZLMA 3RNJA 4IUTA 4ZGDB 3M4GA 2LJ3A 2DERA 3C4SA 1ZQ1A 4JPBW 5A0LA 1WGSA 2EQUA 5GANd 2ENMA 5HK3A 4X1VA 2PVOB 2EQJA 2RB6A 3PGGA 1YBYA 4M7AD 1SG5A 2JTFA 4PJNA 1G8XA 1NLPC 4ZGJB 3VS7A 2IIMA 4ZN1A 4RTTA 2OTJQ 2RJEA 2A7YA 5I2MA 2KI7A 4L5GA 3E19A 1G3TA 1GXIE 1MV0B 4J9DA 3BE3A 2LTOA 2R57A 3VUBA 2CP0A 1VQ5T 1GCPA 1TH7A 1UHCA 5GAN4 1I0CA 2E70A 2KRNA 4HCZA 2LVMA 3UA7A 3LX7A 2YXYA 2KBTA 3QKJA 1IB8A 4PNOA 3E2UA 2FPEA 1Z9QA 3H8ZA 2QA4A 1WJSA 5CVIA 5DLOA 2RHIA 4OMPA 1ABOA 1U8RA 3CMAT 1KD1R 2E4HA 3M0UA 2XICA 2DXTA 2RHZA 3PE0A 3V7CA 2K9GA 5CCAA 2MAMA 3L2VA 2QGFB 1ZSZB 3AT1B 3OMGA 5J3BA 3OS0A 2HBPA 2M0YA 4CC4B 4JRKA 3QSUA 1WIEA 2EQKA 2K2VA 3EG0A 2E12A 1VQ6T 2DTOA 1BI2A 3MEUA 2VXEA 2P0KA 2CZ1B 4L6V5 1ZHIA 1H3HA 4BI3A 2MF2A 5DM7R 3OY9A 1YHQT 5IHNA 3OW2P 1B7TA 4EMKC 2HSEB 5LJ3g 3P8DA 4PJLA 3BDUA 2ZPGB 1VQLT 2WACA 1SSFA 4D8DA 2GBQA 2RD1A 1QP2A 1SPKA 2QQ9A 4Z88A 5GAOp 3O8VA 1ABQA 3SB2A 3QJYA 1Z9ZA 1WZOA 1OV3A 1A0NB 2J7IA 2EGCA 2GFUA 2CT3A 3V8JA 2DX1A 2EVRA 3MEWA 4C92A 2QTXA 2VASA 4XU1A 4M7AC 1F1BB 4N0AA 3CC2A 2K79A 2LDMA 4DEXA 2M16A 3CCLA 2O4XB 4JJDA 1LOJA 2NUPB 2RQVA 1JJ2A 1VQ8Q 1BU1A 3JCMe 3REBB 2KY9A 1N6AA 2RK1A 3EGDB 2RJCA 4PFOA 1M2VB 3HFOA 2AK5A 4ANJA 2D8JA 1YJNA 4FSXA 3JCMc 2B8AA 1BCOA 3EAEA 1J3TA 4JZ3A 1UUEA 4XTWA 4OB1B 4M77D 2DXBA 2J6OA 2VVKA 2K5FA 3FEOA 3RMQA 2EWNA 1RAFB 1WXUA 1Q86R 1VYUA 2R5MA 2DVEA 2KT8A 2MCNA 4M7DE 4CC2A 3SD4A 1M1KC 1Y57A 5FRNA 3S3OA 1PHTA 2C0IA 3QBYA 4LE9A 3JB9D 4PJOD 2PTKA 4OP0A 2R58A 4JLIA 1NPRA 1VQKQ 1RAHB 4BACA 1IO6A 2AKKA 1IRXA 2RI2A 4N4GA 4XTUA 4M75A 2GNCA 2DM1A 5CAIA 3OYEA 4X9DA 3NGPA 3ER0A 3RIRA 4M7DB 1JB0E 3G71A 4GY5A 4CRIA 3JCMd 4LN2A 4M7AF 5DLQE 2DRKA 5IH2A 1VQPA 4JRPA 3LGLA 4P5NA 1NLOC 4C8QG 2F5TX 2O9VA 3SFMA 4RG2A 2EJGA 1UJYA 4KGVB 1FMKA 4Y92A 5GAOn 2KRMA 3TSWA 1YI2Q 3QZ9B 1PG5B 5CKBA 1M30A 3CBMA 2QTVA 4ME7A 5GMKj 2CZ6B 4RCBA 3CCQA 2GF7A 3RR6A 1KQ1A 2ZPFB 1VQNQ 4PJJA 3A1PA 2RH2A 3I56Q 1HD3A 5KYWA 2AT1B 1KD1U 5LJ5h 2AZVA 4A54A 3NTHA 3RKWA 2CS7A 1NJIC 2DD5A 4DOWA 1WQ7A 1QVFP 1KQSA 1UHFA 3WVDB 2Y4XA 2E6ZA 2M1HA 1R8OB 2DIQA 1RL2A 1WJRA 1VQMQ 1M90R 4PFZA 3H0HA 2BZYA 2R5AA 1W70A 2CT4A 4IIMA 3VS2A 2KE9A 1PKTA 2L89A 1UE9A 5A0GA 2FVUA 5CR2A 4A4KA 2CP6A 3I55A 4AT1B 2VGNA 2NUZA 1BI1A 4M7AB 1TWBA 2H3JA 3LGFA 2D6FA 1VQ7A 4OVAA 5C0MA 4ZTJA 3LH5A 3D7SB 3CCSA 5LJ3j 2V8JA 2BIVA 4EDUA 1HSQA 4XU3A 4F7UG 1H3ZA 1NJIU 1QLYA 3S3MA 1LPLA 1Q82R 1QVGP 4ORZA 3CD6T 2M9UA 1Y71A 1RABB 2HQHA 2KQWA 2K3YA 3EFOA 2X4WA 4QVDA 1GFCA 4HT9A 1VYTA 5GMKm 2DBMA 2OI3A 3TCJA 4C0FA 5IAYA 2LCSA 2ZZDA 2FG0A 1VIEA 1Y07A 3HKSA 4NS5A 4OB0B 2CREA 4PFPA 2PNIA 2QEXQ 6AT1B 2EPDA 5GAMg 3G1JA 4RTYA 2QXFA 2HD0A 1VQ9A 1I5OB 3QIIA 1VQKA 1PCXA 4JUVA 2JS0A 5LJ5g 3VKIA 2LNHB 2PZ1A 4BDZA 3CCEA 4O5VA 4N4HA 3H0IA 1HK9A 2EGEA 1GCQA 2ZCFB 1YNZA 2CH4A 1HYOA 3UA6A 4XTYA 4ZN3A 4HCKA 2FO0A 2MPXC 3INZA 4KH0B 1UTIA 2KVQG 3OB9A 4OGCA 2DF6A 2X4YA 2XMFA 2FZGB 4OGEA 3QPHA 2WSFE 4EPCA 2QI2A 3I35A 5CK9A 2XI9A 3OYGA 1VQ6Q 3WVEB 3VS5A 1N8RC 2P0PA 1OULA 4DQ2A 2E64A 1VQ4T 1R77A 4RTZA 2NUTA 3CMET 2A0FB 3CCMA 1PWTA 2KGTA 3X20B 3HPWA 3QDFA 1JJ2S 3G6ET 1YHQQ 1UB4A 1YI2A 1G83A 4Z8AA 3EG9A 5FWBA 1BCMA 3FRNA 3M0RA 2J05A 1VQLQ 1WYXA 4DEYA 3JB9J 3EGXB 3I56A 4M77E 3REAB 5LL6S 2F1LA 3QWXX 5CKFA 1BBZA 2FEIA 4M75D 2HKNA 1MMNA 2C0TA 3MEVA 4A4FA 1JEGA 2E6NA 1N9SA 1K0SA 4FM4B 3VS4A 3X28B 1N8RU 1X69A 2X9HA 1WHJA 4XQ3A 4KULA 4PJOE 1BI3A 2QDYB 1TUDA 3GNGA 1RAGB 1KHCA 4DBRA 4LXCA 4CC7A 1ZSGA 4M77B 1D0YA 3QG1A 2QGGA 2AIRB 1ZX6A 1MNDA 2BZXA 2ZPBB 4C92G 1NYFA 3VV0A 4JRIA 3E1SA 1WDXA 1PC0A 5LJ3f 4MMKA 4EMHA 4NOYA 4ESRA 4RUGA 3JB9I 5KH6A 2HL3A 1KSWA 4AFUC 4NL3A 2QAZA 2KAFA 2NYSA 3CCRT 3M0TA 2Y4YA 1MMDA 2O31A 2AHJB 4PJOB 2W0ZA 2V26A 2DPPB 3OA6A 2XG8D 1X2KA 1QWFA 2DMOA 2YDLA 4C92C 1XQHA 4N0AC 3TVTA 4DBHA 3URGA 3TEEA 5KCHA 1M90U 3CBPA 2RI5A 1VQ5A 4Q5WA 3P8BB 1B34B 4RTWA 4KH1B 1SHGA 3OYNA 3VS6A 2YUOA 5GANh 1Y0MA 5L8RE 3RKXA 4XTVA 7AT1B 1XNIA 4FYYB 4FW2A 3S3NA 1YJ9Q 1M9SA 3MO8A 3X24B 3EG3A 1RADB 1VA7A 5GAOm 3NTIA 1TTHB 5GMKe 2JT4A 2YLBA 2Z0WA 4LUDA 1WHMA 3CMAA 1TUCA 1OI1A 4HVUA 1GFDA 1Q82U 3ASKA 1G3SA 2ZPHB 2VV5A 2DL7A 3NHNA 5CQYA 1RUWA 4J6YA 1YWOA 1OEBA 3MPUB 3M0SA 3KXTA 4FYWB 2ABLA 1H92A 2COWA 1YIJT 1AWJA 1I1JA 1MHNA 5HKCA 5GAMj 4M75C 2CSIA 1Q81C 5GMKi 2CZ7B 1YHQA 3O5ZA 1RI9A 2C0OA 3UDCA 4ZTFA 3OQ5A 2BZ8A 1AZEA 4E7IA 1M1KR 4OMNA 3QYGB 1PD0A 1XOVA 5LJ3e 1ZUKA 4C92F 3PMIA 4M78A 1WLPB 1SF9A 5IN1A 3AHUA 4Z89A 1OZ3A 3H9NA 2ED1A 5GANg 1E7OA 3TREA 3SWNB 3RDVA 4E47A 4F16A 3RMSA 3LH0A 2QEXT 3CC7T 4CC3A 4E7KA 3X26B 1Q81U 1W1FA 2FHDA 3NMZC 1AVZC 2DTHA 4FW1A 3HP9A 1UECA 2LQNA 3OW2S 2O88A 3U23A 2L3PA 5HCKA 1OQKA 3HTRA 2AKLA 2DEUA 3N5BB 3THKA 4QKUA 5AT1B 4JJCA 2X3WD 2M51A 1AWWA 1NM7A 1AEYA 3GOXA 1RLQC 3V7RA 1JU5C 3CD6Q 2CP5A 3CBOA 4QQDA 2MI6A 2EYWA 3OSSC 2EYQA 4M75F 3A5ZB 2PVGB 5LJ3d 2D1XA 5M9OA 2E5KA 3UPUA 2HQXA 1JO8A 1LNXA 5KE3A 1YITT 2GTOA 4JDSA 3M5AA 2LT4A 2XK0A 4IUVA 3PIPA 3NTKA 3CCJQ 4D8KA 1NJIR 3TSZA 2YT6A 3PMTA 3ZBDA 2FRYA 2AZSA 4J6XA 2GGRA 1W2BA 1KK7A 3C0CA 2E65A 3RUXA 1ZSZA 2KSSA 4BDYA 5KCOA 4C8QD 3JB9H 3DLMA 1UEBA 4C5GA 1WFWA 2SEMA 2A36A 2KEAA 4KGXB 5GAOl 1O9SA 3HSBA 4J9HA 1KG1A 2KYBA 1WXTA 1FWZA 2EIFA 4NL2A 1VQ4Q 3CMEQ 2LJ1A 4R56A 5GAMf 1WNLA 1TUGB 2V8KA 3DB4A 3G6EQ 4BUGA 3OSVA 5LJ5f 4L59A 1X43A 3OMCA 3QDRB 2DK3A 1H8KA 1GCQC 3JCMh 2F69A 4LDUA 4JRQA 2QA4T 3BY7A 1LCKA 3L2QA 8ATCB 4M75B 3OYDA 1D3BA 3OS1A 2BE9B 2OTJA 2XDDA 1OU9A 2L3RA 3SEMA 5DY9A 2RHYA 2MWOA 2RA2A 3MHXA 3ZEHA 3I9QA 3NFCA 2H3EB 4IURA 2ROLA 2O4XA 3MP1A 4LDVA 4IUPA 4LDWA 2MMPA 5FRMA 2JS2A 2ZAEA 1V29B 1VYVA 2EKOA 1X2QA 4HT8A 1XJWB 2EYXA 2E41A 2VYTA 3E9GA 3EGDA 3H6ZA 1YJ9T 1M2VA 3L42A 3PVLA 5KYUB 3VJPA 1ARKA 1NBEB 1M5Q1 2DA9A 3EH2A 4WTOB 3V8LA 5FLXE 2EGAA 1M1KU 2X4XA 4LDXA 3EG2A 4QW2A 1NE8A 4XU2A 3CCRQ 5I22A 1QVFS 3A8OB 1N8RR 4UC4A 3CEYA 1UFFA 2DE0X 4PL6A 1VOMA 3CCUT 2FRWA 3TU4K 4E7ZA 3JCMg 4QQ6A 3CC2T 2DRMA 2PU9B 3A8HB 1G2BA 3CCLT 2X3XD 3R6OA 2ATCB 1K0XA 4C8QC 2FZCB 2JXBA 4C0ZA 2JM9A 4FYXB 3EH1A 3CCVQ 4B6MA 1ZBJA 3HRUA 3KFVA 4M7DA 5HY6A 5GAN7 4N4IA 3OYHA 3QHSA 4M7AE 1QWEA 2DAQA 1YJNT 4EMKB 3UF4A 1AZGB 5KE2A 2JTEA 2P0QA 4RCCA 1WQWA 5ECAA 1QVGS 3H0FA 2XD0A 1MNEA 4JJNK 3C12A 1AWOA 2RI3A 2DL5A 2O9SA 3CPWP 1M1FA 2DZCA 1VQOT 2HSPA 5L23A 1VQ8A 2A37A 3OYIA 1YIJQ 4A4EA 4J7IA 2XDBA 1VQ4A 1GL5A 3NPFA 3M53A 3JB9G 3HHTB 2IPOB 1M8VA 4GLMA 2L0AA 2K5LA 2EJFA 4RKUE 1S72Q 1KFZA 3QWYA 4J6WA 2PUKB 2BUDA 2YHTA 1AD5A 1N9RA 3QXEB 1RAIB 4HVWA 4BE0A 2X35A 3G71T 1QKXA 2K2MA 5FU6C 3Q1JA 2M02A 3OYBA 4RTUA 4BB7A 3M0PA 1BKBA 3EFRA 5J26A 3DLLA 2OTLT 4J9BA 1WHKA 5GAOr 2J6FA 4R0KA 2DJZA 3CC7Q 2LT1A 4C8QF 1IXDA 3I5RA 3OW2A 2HCKA 4TVRA 1PNJA 3OYFA 4FYVB 4MDWA 2RJFA 1TG0A 3PNWC 1YJWQ 4ELYC 1T0HA 4M78G 1NEGA 1OU8A 3FDRA 3OYYA 4M7AA 3CCJT 2B86A 3A98A 1NG2A 5GAN6 4C92D 3CXCS 4LD9K 4B9XA 4XU0A 1SRMA 3WXMB 3BDLA 1IGQA 1QP3A 1UG1A 4FL6A 2LQWA 4M78C 2D0QB 2RQWA 1OX8A 1OPLA 3META 2F2WA 1X6GA 3OYLA 3L2UA 1Q7YC 3EG9B 2V1QA 3L2ZA 3HRSA 3MP8A 5CKHA 1W2BS 5FW9A 2HQEA 2PVDB 2YUQA 5D6XA 1EFNA 1Y96B 2L3SA 2LZ6B 1Q81R 5GANf 3S6WA 4BY6C 2EFIA 2QDLA 3M9QA 1OYXA 3JCMV 1K9MC 1BK2A 1WHLA 2JMCA 5KYYA 2E10A 1YITQ 5GAOq 5CKEA 2MOXA 3RKYA 3I55T 4R55A 1VQNA 1AT1B 3A8GB 1W4SA 2EQIA 1VQ7T 1ZA2B 3CCST 3OBYA 4C8QB 3EG1A 4B9WA 4F7UF 2HZYA 1V1CA 4FT2A 4C5EA 4BD3A 3EGUA 4YTLA 5IXFA 3RERA 4V2SA 5I11A 1WHHA 1D0XA 1KQ2A 1VQMA 3MP6A 3ZL7C 2DILA 1NZ9A 1IHWA 1K9MU 2NWMA 5IHKA 1D09B 2JVVA 2O01E 2FPFA 4A63B 2OAUA 1VUBA 2BTTA 4PK4A 1UGSB 1PRLC 5FROA 5AYFA 1KC8C 4J7FA 3OYKA 3TQ7P 1YIJA 5J39A 3ZFJA 1Y7XA 1BB9A 1UGVA 1VQ9T 9ATCB 3I5SA 2IG0A 2DYIA 1AWXA 1X27A 3EGXA 3M56A 1JJ2P 2M0OA 3CPFA 4MMLA 1YWPA 5C6SA 1FYNA 2QA4Q 2DKGA 3P8HA 1I4K1 1MMGA 4PKCC 1C6VX 2GFAA 5KYXB 3FC3A 3X25B 1K76A 4D6WA 2MIOA 1KHIA 2QYZA 3M58A 3JCMP 2HL5C 1WI7A 1I5LA 2QEXA 2J6KA 1KC8U 5FU6B 4MZPA 1TXQA 3FIFA 2OX7A 1T0JA 3HRTA 4JZ4A 3J81E 3CCVT 4M77A 1UGPB 1ZUYA 2RHXA 4F7UB 5GMKl 3DB3A 3QYHB 2CP7A 4J8OA 3CCMT 4OMMA 4AFQC 3LWHA 1I81A 1K8AC 4JJBA 4QVZA 2YWWA 1IREB 1QVFA 4HVVA 4E7JA 2K7AA 1JXMA 5D7UA 2DO3A 3CC4T 4PJOA 1EX4A 2HDAA 2QASA 3PT9A 3VYHB 1E6GA 4ELZC 3ULRB 3OYCA 1M3CA 4GLKA 5GMKh 1M8MA 2RMOA 2KROA 1RI0A 2OAWA 1FX7A 3OYJA 2K6DA 1X75C 1VQ6A 3CCUQ 2SRCA 1QMCA 4E7LA 2WSEE 3CC2Q 4J5YA 3CCLQ 5LJ5j 4OB3B 1S72T 2LQ8A 1U1SA 1K8AU 2KDSA 3GNFB 2XHCA 2RF0A 2XIDA 3V8KA 4BY6B 1VQLA 2QQBA 1QQJA 1QVGA 4KUIA 2RO0A 3PIOA 4CI0C 1JRIA 2G6FX 1YJNQ 1R0BG 2EKHA 1UGRB 2BKDN 4A53A 2KR3A 3JCMQ 3C94A 4XTXA 2NLUA 1PSEA 4C5HA 4M7DG 2RPNA 5LJ3h 2KRSA 1YJWT 1QVPA 4AMCA 2DYBA 1T3LA 1WXBA 1VQOQ 2D9TA 2FB7A 1KQSP 1R0CB 1M4ZA 2YRCA 4E2FB 4C0DC 1WA7A 1K73C 3MCAB 5CO7A 3JCMf 2DBKA 2ZPIB 3VRZA 4M7DC 4II1A 4C92E 3ME9A 4A4GA 2VWFA 1PKSA 2OJ2A 2RM4A 3JCMJ 5IT9E 2ESWA 1MMAA 2VUBA 3OBWA 2YLCA 2K4YA 1N5ZA 1AOJA 2GQIA 3G71Q 2JJ9A 1RAEB 1GBQA 1I8FA 4FU6A 1D1BA 2C06A 3SWNA 1KJWA 2JMAA 2KXCA 2OTLQ 5GAN3 1VQPQ 2ECZA 2CKKA 1M1GA 2F2XA 5FU7C 3CXCA 2DFUA 1K73U 4C92B 4ZNXA 2CGHA 4ZGEB 3G4ST 1GRIA 1M2OA 2FL7A 1ACMB 3GBQA 3OS2A 2DTIA 2GTJA 4DBFA 1DJ7B 1PM3A 5CIUA 2VGMA 4RG8A 1YJ9A 4X34A 4OMFB 2G3RA 3GP8A 2WSCE 1EIFA 3F70A 2KK4A 1U06A 3CCQQ 2RK2A 2DXCA 4RMOA 2A28A 3VS0A 4M7AG 4DOVA 4OMLA 4M75E 2FZKB 1HXDA 4FT4A 1D3BB 1FMWA 2COYA 4DBQA 4IKFA 3M59A 3M54A 3BW1A 1OPKA 1SSHA 3UT1A 3T9NA 2K3XA 2EBPA 1U3OA 1X6OA 1NEBA 4J9FA 2ED0A 3CCUA 4M7DF 2E3HA 4C0GA 3GPLA 1WPYA 2DL4A 2COZA 1ZA1B 3GF5A 1MV3A 1U5SA 2DVJA 3I55Q 4LDYA 1IGUA 2LQKA 2JUFA 1BI0A 1JBMA 3J7AF 1VQ7Q 1PRMC 3CCSQ 3LLRA 2HBWA 1TOVA 1X6BA 1BIAA 4O6JA 1QW1A 4Z02A 1M3BA 4J9EA 1YFNA 2RQTA 2DXUA 2FYKA 3G7ZA 1N27A 4AFZC 4HKEA 2KNBB 2F2VA 2NUPA 3GIBA 4F17A 4E6RA 2X51A 3MKDA 2VKNA 5GAN2 1VQOA 4RTXA 1G5VA 5EC7A 3FJ5A 2K57A 1M3AA 4J9GA 3EHQA 3FJPA 3OS5A 1W6XA 1BIBA 2CP3A 3FLGA 2LX9A 2QK0A 1VQ9Q 1Q7YR 3HFNA 4BI8B 4F14A 1RACB 3CCEQ 2DNUA 4C0DB 2LMJA 5I2SA 1SHFA 5KYNA 3CD6A 2D8HA 5KYWB 2P4TA 2EJ9A 4J9IA 4BE2A 4KUDK 1K9MR 2J06A 4LD6A 5GANj 1OX9A 2OTLA 1V76A 3CPWS 3VRYA 2JZ2A 2JOYA 1KD1C 1IHVA 2V8IA 3OYMA 1S1NA 1WHGA 1JQQA 2BE7D 4M78D 2HKQB 4PLIA 4FSSA 4OF1A 2O2OA 2RNAA 3QZ5B 5KYUA 2CYZB 2Y90A 3MEAA 1OOTA 2HEQA 5GAMe 4KRTA 3CCJA 1TS9A 5IHIA 5FU7B 4MZTA 1FXXA 5LJ5e 3CCMQ 3L2WA 3EFSA 3LWIA 2HAXA 3OYAA 2MYSA 2L5QA 3PFSA 3SDZA 2E5QA 1PSFA 2EYYA 2JW4A 4XTZA 3CC4Q 4M77G 5GAMh 3UWNA 1UGQB 3R6NA 2OTJT 4AG1C 2X4JA 1KC8R 3LW5E 5D6YA 3M55A 2LC4A 3EFOB 1TU0B 1HJDA 2LX7A 1P92A 2QQSA 2KYMA 1KIKA 2D0NA 1JXOA 4HXJA 5GJVB 3J80E 4M77C 1RLPC 1QCFA 1YCYA 3CMEA 4PJOG 2DLPA 3JCMb 3PTAA 3FB9A 2CUDA 3G6EA 2K5IA 4QVCA 1YN8A 3JSCA 1GBRA 3IQLA 3H41A 4F04B 1C1AA 1VIFA 1G3WA 2XU8A 2JN0A 3QUIA 3RESA 2E3IA 2I2LA 2JTMA 3DKMA 4EMKA 2I0NA 4OMQA 2RQRA 2KT1A 3JCMW 2F5KA 3L2RA 1TSFA 4PJOC 4LUEA 5FWCA 4JS5A 1WX6A 2KXDA 5GAMd 3MJXA 1O75A 4VUBA 1VQPT 2ZGWA 1QKWA 5LJ5d 1FMVA 2RN8A 4PJMA 8AT1B 2YUPA 4KBMB 1B07A 3KUFA 2QQRA 1Q95G 3SHWA 4OMOA 1K8AR 1U1TA 1Q86C 2V1RA 2DL8A 2DETA 2RHUA 1EZZB 1VQ5Q 1UJ0A 4JLGA
chains in the Genus database with same CATH topology
2J6KA 1RLQC 1JU5C 2YSQA 1YP5A 2CSQA 1T0JA 1SEMA 4JZ4A 4LN2A 1ZUYA 2EYWA 2DRKA 5IH2A 3VS1A 2D1XA 4OMMA 4M4ZA 4AFQC 2E5KA 1NLOC 2EYZA 1JO8A 4JJBA 1M27C 2O9VA 2GTOA 4HVVA 1CKAA 2K7AA 3EHRA 1JXMA 4WCIA 1B3QA 1UJYA 4D8KA 1FMKA 4Y92A 3TSZA 2HDAA 2KRMA 1E6GA 2YT6A 4EIKA 1K9AA 3ULRB 3TSWA 3UATA 2FRYA 1M3CA 2AZSA 2DJQA 1M30A 2CDTA 1M8MA 2RMOA 2GGRA 2KROA 2OAWA 3C0CA 2CUBA 2K3BA 1MUZA 2K6DA 2SRCA 1HD3A 2FPDA 2LP5A 1WFWA 4RTVA 2AZVA 2A36A 2KEAA 2SEMA 2L3QA 4J9HA 1UHFA 2RF0A 2KYBA 1WXTA 3H0HA 2LJ1A 1UDLA 2G6FX 2BZYA 1YCSB 1W70A 2CT4A 1T3SA 2EKHA 4IIMA 3VS2A 2KE9A 1PKTA 1UE9A 2KR3A 1K1ZA 1X43A 2ROTA 1H8KA 1GCQC 1LCKA 2NUZA 5IXBA 3RBBB 2RPNA 2KRSA 3LH5A 1E6HA 2DYBA 1T3LA 3SEMA 1WXBA 2EW3A 1HSQA 1QLYA 4K11A 3I9QA 1WA7A 2ROLA 4ORZA 2DBKA 3VRZA 2YUNA 2RQUA 2JS2A 1CSKA 1VYVA 2H8HA 1GFCA 1VYTA 1X2QA 2DBMA 2OI3A 1PKSA 2VWFA 2OJ2A 2P4RA 2L2PA 2EYXA 2LCSA 2ESWA 2FG0A 3PVLA 5GJWB 2CREA 1ARKA 2PNIA 2W10A 2DA9A 2EPDA 1N5ZA 1AOJA 2GQIA 3M0QA 4RTYA 1GBQA 2JM8A 2JS0A 4AFSC 1SRLA 2EGAA 1KJWA 2LNHB 4J9CA 2JMAA 2KXCA 2PZ1A 3PVQA 3VS3A 2ECZA 4GBQA 3EG2A 2F2XA 1NYGA 4AG2C 3H0IA 1K4US 5I22A 2EGEA 1ZUUA 2A08A 1GCQA 4ZNXA 1GRIA 4QT7A 1UFFA 1YNZA 2CH4A 3UA6A 3GBQA 2LJ0A 1I07A 2GTJA 2DE0X 2FRWA 4HCKA 2FO0A 2DL3A 2CH4W 1CKBA 2DRMA 1G2BA 2X3XD 1UTIA 2DF6A 2XMFA 1K0XA 3CQTA 1AWWA 1U06A 2JXBA 3I35A 2JM9A 2A28A 3VS5A 1ZBJA 3VS0A 3KFVA 4LNPA 4RTZA 4OMLA 1QWEA 1PWTA 2KGTA 3UF4A 1AZGB 4IIOA 1G83A 3JV3A 2JTEA 1OPKA 4Z8AA 5FWBA 1SSHA 1ZLMA 5ECAA 3M0RA 2EBPA 1U3OA 3RNJA 2J05A 3H0FA 1NEBA 1WYXA 4J9FA 2LJ3A 4DEYA 2ED0A 4JPBW 1AWOA 2DL5A 2O9SA 2ENMA 3REAB 2DL4A 4X1VA 1MV3A 2HSPA 5L23A 1U5SA 2DVJA 3QWXX 1BBZA 2FEIA 2A37A 1NLPC 2C0TA 1JEGA 3VS7A 2IIMA 1K0SA 3VS4A 1X69A 1GL5A 3NPFA 4RTTA 4GLMA 1PRMC 2L0AA 2HBWA 1X6BA 1KFZA 1TUDA 3QWYA 1MV0B 4J9DA 1M3BA 4J9EA 2RQTA 1GCPA 1AD5A 4CC7A 1ZSGA 1UHCA 4AFZC 4HVWA 1I0CA 2KNBB 1ZX6A 2F2VA 1QKXA 2BZXA 2K2MA 1NYFA 4RTUA 2KRNA 3M0PA 4F17A 1WDXA 4E6RA 3UA7A 2VKNA 2KBTA 4ESRA 4RUGA 4J9BA 1KSWA 4RTXA 2J6FA 5EC7A 4AFUC 4R0KA 2FPEA 1Z9QA 3FJ5A 1M3AA 3M0TA 4J9GA 3EHQA 1W6XA 2O31A 3I5RA 2HCKA 4OMPA 1PNJA 2W0ZA 1ABOA 1TG0A 1X2KA 1QWFA 2DMOA 2YDLA 1T0HA 3M0UA 1NEGA 3PE0A 2K9GA 3TVTA 2B86A 4F14A 2DNUA 3A98A 1NG2A 2LMJA 1SHFA 1SRMA 2D8HA 2M0YA 4CC4B 4RTWA 1SHGA 1WIEA 3VS6A 2YUOA 3EG0A 4J9IA 1UG1A 2J06A 1Y0MA 2LQWA 2RQWA 1OPLA 3VRYA 2F2WA 1X6GA 2V1QA 1H3HA 1S1NA 3EG3A 1VA7A 1JQQA 2JT4A 4LUDA 2YUQA 5FW9A 5IHNA 4FSSA 1EFNA 2O2OA 1TUCA 2L3SA 2RNAA 2LZ6B 4HVUA 1GFDA 1OOTA 2HEQA 4KRTA 5IHIA 4D8DA 2GBQA 2QDLA 2DL7A 1SPKA 3NHNA 4Z88A 1ABQA 1RUWA 1BK2A 2JMCA 1YWOA 1OEBA 3M0SA 2ABLA 1H92A 1Z9ZA 2MOXA 1OV3A 1A0NB 2J7IA 2EGCA 2EYYA 2JW4A 2CT3A 1AWJA 1I1JA 2DX1A 2EQIA 2EVRA 3R6NA 2K79A 4DEXA 2CSIA 4AG1C 3EG1A 3O5ZA 1RI9A 4JJDA 1V1CA 2C0OA 2RQVA 1BU1A 3REBB 1HJDA 2BZ8A 2LX7A 3EGUA 1AZEA 5IXFA 5I11A 2KYMA 1KIKA 2D0NA 1JXOA 4HXJA 4OMNA 1XOVA 5GJVB 1ZUKA 1RLPC 1QCFA 3ZL7C 2AK5A 1WLPB 2D8JA 2DLPA 2CUDA 2DILA 2NWMA 4Z89A 5IHKA 1J3TA 1YN8A 1GBRA 4JZ3A 1UUEA 3IQLA 2FPFA 3H41A 4A63B 2BTTA 2ED1A 2J6OA 1PRLC 2VVKA 1E7OA 4F16A 2I0NA 4OMQA 2RQRA 1WXUA 2KT1A 1BB9A 1UGVA 1VYUA 4CC3A 2KT8A 2MCNA 3I5SA 4LUEA 4CC2A 5FWCA 1WX6A 2KXDA 1Y57A 1AWXA 1W1FA 1X27A 3NMZC 1AVZC 1PHTA 2C0IA 1YWPA 1QKWA 1UECA 4LE9A 1FYNA 2RN8A 2LQNA 2O88A 2PTKA 3U23A 2YUPA 2L3PA 1B07A 5HCKA 1IO6A 2AKKA 2AKLA 3SHWA 3THKA 1K76A 2MIOA 4OMOA 2GNCA 4JJCA 2V1RA 2DL8A 2X3WD 2DM1A 2M51A 1UJ0A 1WI7A 1NM7A 1AEYA 3NGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6K A;  1RLQ C;  1JU5 C;  2YSQ A;  1YP5 A;  2CSQ A;  1T0J A;  1SEM A;  4JZ4 A;  4LN2 A;  1ZUY A;  2EYW A;  2DRK A;  5IH2 A;  3VS1 A;  2D1X A;  4OMM A;  4M4Z A;  4AFQ C;  2E5K A;  1NLO C;  2EYZ A;  1JO8 A;  4JJB A;  1M27 C;  2O9V A;  2GTO A;  4HVV A;  1CKA A;  2K7A A;  3EHR A;  1JXM A;  4WCI A;  1B3Q A;  1UJY A;  4D8K A;  1FMK A;  4Y92 A;  3TSZ A;  2HDA A;  2KRM A;  1E6G A;  2YT6 A;  4EIK A;  1K9A A;  3ULR B;  3TSW A;  3UAT A;  2FRY A;  1M3C A;  2AZS A;  2DJQ A;  1M30 A;  2CDT A;  1M8M A;  2RMO A;  2GGR A;  2KRO A;  2OAW A;  3C0C A;  2CUB A;  2K3B A;  1MUZ A;  2K6D A;  2SRC A;  1HD3 A;  2FPD A;  2LP5 A;  1WFW A;  4RTV A;  2AZV A;  2A36 A;  2KEA A;  2SEM A;  2L3Q A;  4J9H A;  1UHF A;  2RF0 A;  2KYB A;  1WXT A;  3H0H A;  2LJ1 A;  1UDL A;  2G6F X;  2BZY A;  1YCS B;  1W70 A;  2CT4 A;  1T3S A;  2EKH A;  4IIM A;  3VS2 A;  2KE9 A;  1PKT A;  1UE9 A;  2KR3 A;  1K1Z A;  1X43 A;  2ROT A;  1H8K A;  1GCQ C;  1LCK A;  2NUZ A;  5IXB A;  3RBB B;  2RPN A;  2KRS A;  3LH5 A;  1E6H A;  2DYB A;  1T3L A;  3SEM A;  1WXB A;  2EW3 A;  1HSQ A;  1QLY A;  4K11 A;  3I9Q A;  1WA7 A;  2ROL A;  4ORZ A;  2DBK A;  3VRZ A;  2YUN A;  2RQU A;  2JS2 A;  1CSK A;  1VYV A;  2H8H A;  1GFC A;  1VYT A;  1X2Q A;  2DBM A;  2OI3 A;  1PKS A;  2VWF A;  2OJ2 A;  2P4R A;  2L2P A;  2EYX A;  2LCS A;  2ESW A;  2FG0 A;  3PVL A;  5GJW B;  2CRE A;  1ARK A;  2PNI A;  2W10 A;  2DA9 A;  2EPD A;  1N5Z A;  1AOJ A;  2GQI A;  3M0Q A;  4RTY A;  1GBQ A;  2JM8 A;  2JS0 A;  4AFS C;  1SRL A;  2EGA A;  1KJW A;  2LNH B;  4J9C A;  2JMA A;  2KXC A;  2PZ1 A;  3PVQ A;  3VS3 A;  2ECZ A;  4GBQ A;  3EG2 A;  2F2X A;  1NYG A;  4AG2 C;  3H0I A;  1K4U S;  5I22 A;  2EGE A;  1ZUU A;  2A08 A;  1GCQ A;  4ZNX A;  1GRI A;  4QT7 A;  1UFF A;  1YNZ A;  2CH4 A;  3UA6 A;  3GBQ A;  2LJ0 A;  1I07 A;  2GTJ A;  2DE0 X;  2FRW A;  4HCK A;  2FO0 A;  2DL3 A;  2CH4 W;  1CKB A;  2DRM A;  1G2B A;  2X3X D;  1UTI A;  2DF6 A;  2XMF A;  1K0X A;  3CQT A;  1AWW A;  1U06 A;  2JXB A;  3I35 A;  2JM9 A;  2A28 A;  3VS5 A;  1ZBJ A;  3VS0 A;  3KFV A;  4LNP A;  4RTZ A;  4OML A;  1QWE A;  1PWT A;  2KGT A;  3UF4 A;  1AZG B;  4IIO A;  1G83 A;  3JV3 A;  2JTE A;  1OPK A;  4Z8A A;  5FWB A;  1SSH A;  1ZLM A;  5ECA A;  3M0R A;  2EBP A;  1U3O A;  3RNJ A;  2J05 A;  3H0F A;  1NEB A;  1WYX A;  4J9F A;  2LJ3 A;  4DEY A;  2ED0 A;  4JPB W;  1AWO A;  2DL5 A;  2O9S A;  2ENM A;  3REA B;  2DL4 A;  4X1V A;  1MV3 A;  2HSP A;  5L23 A;  1U5S A;  2DVJ A;  3QWX X;  1BBZ A;  2FEI A;  2A37 A;  1NLP C;  2C0T A;  1JEG A;  3VS7 A;  2IIM A;  1K0S A;  3VS4 A;  1X69 A;  1GL5 A;  3NPF A;  4RTT A;  4GLM A;  1PRM C;  2L0A A;  2HBW A;  1X6B A;  1KFZ A;  1TUD A;  3QWY A;  1MV0 B;  4J9D A;  1M3B A;  4J9E A;  2RQT A;  1GCP A;  1AD5 A;  4CC7 A;  1ZSG A;  1UHC A;  4AFZ C;  4HVW A;  1I0C A;  2KNB B;  1ZX6 A;  2F2V A;  1QKX A;  2BZX A;  2K2M A;  1NYF A;  4RTU A;  2KRN A;  3M0P A;  4F17 A;  1WDX A;  4E6R A;  3UA7 A;  2VKN A;  2KBT A;  4ESR A;  4RUG A;  4J9B A;  1KSW A;  4RTX A;  2J6F A;  5EC7 A;  4AFU C;  4R0K A;  2FPE A;  1Z9Q A;  3FJ5 A;  1M3A A;  3M0T A;  4J9G A;  3EHQ A;  1W6X A;  2O31 A;  3I5R A;  2HCK A;  4OMP A;  1PNJ A;  2W0Z A;  1ABO A;  1TG0 A;  1X2K A;  1QWF A;  2DMO A;  2YDL A;  1T0H A;  3M0U A;  1NEG A;  3PE0 A;  2K9G A;  3TVT A;  2B86 A;  4F14 A;  2DNU A;  3A98 A;  1NG2 A;  2LMJ A;  1SHF A;  1SRM A;  2D8H A;  2M0Y A;  4CC4 B;  4RTW A;  1SHG A;  1WIE A;  3VS6 A;  2YUO A;  3EG0 A;  4J9I A;  1UG1 A;  2J06 A;  1Y0M A;  2LQW A;  2RQW A;  1OPL A;  3VRY A;  2F2W A;  1X6G A;  2V1Q A;  1H3H A;  1S1N A;  3EG3 A;  1VA7 A;  1JQQ A;  2JT4 A;  4LUD A;  2YUQ A;  5FW9 A;  5IHN A;  4FSS A;  1EFN A;  2O2O A;  1TUC A;  2L3S A;  2RNA A;  2LZ6 B;  4HVU A;  1GFD A;  1OOT A;  2HEQ A;  4KRT A;  5IHI A;  4D8D A;  2GBQ A;  2QDL A;  2DL7 A;  1SPK A;  3NHN A;  4Z88 A;  1ABQ A;  1RUW A;  1BK2 A;  2JMC A;  1YWO A;  1OEB A;  3M0S A;  2ABL A;  1H92 A;  1Z9Z A;  2MOX A;  1OV3 A;  1A0N B;  2J7I A;  2EGC A;  2EYY A;  2JW4 A;  2CT3 A;  1AWJ A;  1I1J A;  2DX1 A;  2EQI A;  2EVR A;  3R6N A;  2K79 A;  4DEX A;  2CSI A;  4AG1 C;  3EG1 A;  3O5Z A;  1RI9 A;  4JJD A;  1V1C A;  2C0O A;  2RQV A;  1BU1 A;  3REB B;  1HJD A;  2BZ8 A;  2LX7 A;  3EGU A;  1AZE A;  5IXF A;  5I11 A;  2KYM A;  1KIK A;  2D0N A;  1JXO A;  4HXJ A;  4OMN A;  1XOV A;  5GJV B;  1ZUK A;  1RLP C;  1QCF A;  3ZL7 C;  2AK5 A;  1WLP B;  2D8J A;  2DLP A;  2CUD A;  2DIL A;  2NWM A;  4Z89 A;  5IHK A;  1J3T A;  1YN8 A;  1GBR A;  4JZ3 A;  1UUE A;  3IQL A;  2FPF A;  3H41 A;  4A63 B;  2BTT A;  2ED1 A;  2J6O A;  1PRL C;  2VVK A;  1E7O A;  4F16 A;  2I0N A;  4OMQ A;  2RQR A;  1WXU A;  2KT1 A;  1BB9 A;  1UGV A;  1VYU A;  4CC3 A;  2KT8 A;  2MCN A;  3I5S A;  4LUE A;  4CC2 A;  5FWC A;  1WX6 A;  2KXD A;  1Y57 A;  1AWX A;  1W1F A;  1X27 A;  3NMZ C;  1AVZ C;  1PHT A;  2C0I A;  1YWP A;  1QKW A;  1UEC A;  4LE9 A;  1FYN A;  2RN8 A;  2LQN A;  2O88 A;  2PTK A;  3U23 A;  2YUP A;  2L3P A;  1B07 A;  5HCK A;  1IO6 A;  2AKK A;  2AKL A;  3SHW A;  3THK A;  1K76 A;  2MIO A;  4OMO A;  2GNC A;  4JJC A;  2V1R A;  2DL8 A;  2X3W D;  2DM1 A;  2M51 A;  1UJ0 A;  1WI7 A;  1NM7 A;  1AEY A;  3NGP A; 
#chains in the Genus database with same CATH topology
 2KMT A;  2YSQ A;  2YRV A;  1YP5 A;  3L1A A;  2CSQ A;  2NUT B;  4PLL A;  3JAM E;  4EMG A;  3CCQ T;  1SEM A;  3VYG A;  5KYY B;  3GLX A;  2DIG A;  2EAY A;  2HNI A;  3VS1 A;  3HL8 A;  3CCR A;  4X9C A;  2VC8 A;  4M4Z A;  4C5I A;  2EYZ A;  1M27 C;  4C8Q E;  3CMA Q;  1CKA A;  3EHR A;  3QO3 A;  2VXF A;  3A8L B;  4WCI A;  4E7S A;  1B3Q A;  4M77 F;  5D6W A;  3JRZ A;  1Q86 U;  2YRD A;  1X01 A;  2XDP A;  4EIK A;  1K9A A;  3UAT A;  2DJQ A;  2CDT A;  2GCX A;  4Y91 A;  3G4S Q;  1VQ8 T;  4Y28 E;  5I21 A;  2CUB A;  2K3B A;  1MUZ A;  3CCV A;  5GAN 8;  2JNG A;  2L8D A;  2FPD A;  3JB9 F;  1C0M A;  4PJO F;  1Q7Y U;  2LP5 A;  4RTV A;  2L3Q A;  2HMA A;  3V7S A;  4J83 A;  3CXC P;  2LNV A;  2XKO C;  2MWP A;  3VUZ A;  4KT0 E;  5A0D A;  1WJQ A;  3CC4 A;  3SWN C;  4IUU A;  1Y96 A;  3A8M B;  4OB2 B;  1UDL A;  5CKD A;  5EG2 A;  1YCS B;  4MDX A;  1T3S A;  1K73 R;  3BFM A;  1K1Z A;  2GQV A;  2ROT A;  1W2B P;  1D0Z A;  5IXB A;  2VB6 A;  2DD4 A;  2CP2 A;  3RBB B;  1VQK T;  4M78 F;  3QJ6 A;  1E6H A;  1AHJ B;  2P84 A;  4XK8 E;  2EW3 A;  1S72 A;  2E1H A;  2PUO B;  1RAA B;  1M90 C;  4K11 A;  3CCE T;  4F7U E;  4C8Q A;  4WF2 A;  1ZSZ C;  2DZ9 A;  1QCO A;  2YUN A;  2RQU A;  1CSK A;  2H8H A;  5A2Q E;  4QQG A;  2P4R A;  2L2P A;  3KBG A;  2CZ0 B;  4XAX B;  5GJW B;  4M7D D;  2DEQ A;  3CC7 A;  2W10 A;  3M0Q A;  1ZBX A;  2IVW A;  3M57 A;  1LVK A;  5GAN e;  2JM8 A;  1YJW A;  4AFS C;  1SRL A;  1D1C A;  5CQX A;  1Q82 C;  2LCL A;  4J9C A;  4M78 E;  3PVQ A;  4JS4 A;  3VS3 A;  4GBQ A;  4HCC A;  4A4H A;  3E9F A;  2RJD A;  4MZM A;  1NYG A;  2QG9 B;  4AG2 C;  1K4U S;  2QQA A;  1BYM A;  1ZUU A;  2MK5 A;  2A08 A;  3M4Y A;  1YI2 T;  1MGQ A;  1SKU B;  1D1A A;  4QT7 A;  1OZ2 A;  4FIB A;  1H64 1;  2A3L A;  1XTD A;  2ZPE B;  2LJ0 A;  1VQN T;  1I07 A;  2PQW A;  4BE1 A;  4ATO A;  2LCC A;  3I56 T;  2EQM A;  4HA8 A;  2DL3 A;  3JCM X;  2CH4 W;  3C95 A;  1CKB A;  1QCN A;  3CPW A;  5KYX A;  1PD1 A;  1IZ6 A;  4BI4 A;  3CQT A;  5GAN 5;  4M78 B;  3LYI A;  4IUQ A;  4LNP A;  4M75 G;  1B34 A;  4FCY A;  1VQM T;  3VU3 C;  5HK0 A;  4HCB A;  1LJO A;  4F7U A;  4IIO A;  1KQS S;  2LRQ A;  1YIT A;  3JV3 A;  4KGZ B;  3G4S A;  4E7H A;  1G3Y A;  4DA4 A;  1NPP A;  1ZLM A;  3RNJ A;  4IUT A;  4ZGD B;  3M4G A;  2LJ3 A;  2DER A;  3C4S A;  1ZQ1 A;  4JPB W;  5A0L A;  1WGS A;  2EQU A;  5GAN d;  2ENM A;  5HK3 A;  4X1V A;  2PVO B;  2EQJ A;  2RB6 A;  3PGG A;  1YBY A;  4M7A D;  1SG5 A;  2JTF A;  4PJN A;  1G8X A;  1NLP C;  4ZGJ B;  3VS7 A;  2IIM A;  4ZN1 A;  4RTT A;  2OTJ Q;  2RJE A;  2A7Y A;  5I2M A;  2KI7 A;  4L5G A;  3E19 A;  1G3T A;  1GXI E;  1MV0 B;  4J9D A;  3BE3 A;  2LTO A;  2R57 A;  3VUB A;  2CP0 A;  1VQ5 T;  1GCP A;  1TH7 A;  1UHC A;  5GAN 4;  1I0C A;  2E70 A;  2KRN A;  4HCZ A;  2LVM A;  3UA7 A;  3LX7 A;  2YXY A;  2KBT A;  3QKJ A;  1IB8 A;  4PNO A;  3E2U A;  2FPE A;  1Z9Q A;  3H8Z A;  2QA4 A;  1WJS A;  5CVI A;  5DLO A;  2RHI A;  4OMP A;  1ABO A;  1U8R A;  3CMA T;  1KD1 R;  2E4H A;  3M0U A;  2XIC A;  2DXT A;  2RHZ A;  3PE0 A;  3V7C A;  2K9G A;  5CCA A;  2MAM A;  3L2V A;  2QGF B;  1ZSZ B;  3AT1 B;  3OMG A;  5J3B A;  3OS0 A;  2HBP A;  2M0Y A;  4CC4 B;  4JRK A;  3QSU A;  1WIE A;  2EQK A;  2K2V A;  3EG0 A;  2E12 A;  1VQ6 T;  2DTO A;  1BI2 A;  3MEU A;  2VXE A;  2P0K A;  2CZ1 B;  4L6V 5;  1ZHI A;  1H3H A;  4BI3 A;  2MF2 A;  5DM7 R;  3OY9 A;  1YHQ T;  5IHN A;  3OW2 P;  1B7T A;  4EMK C;  2HSE B;  5LJ3 g;  3P8D A;  4PJL A;  3BDU A;  2ZPG B;  1VQL T;  2WAC A;  1SSF A;  4D8D A;  2GBQ A;  2RD1 A;  1QP2 A;  1SPK A;  2QQ9 A;  4Z88 A;  5GAO p;  3O8V A;  1ABQ A;  3SB2 A;  3QJY A;  1Z9Z A;  1WZO A;  1OV3 A;  1A0N B;  2J7I A;  2EGC A;  2GFU A;  2CT3 A;  3V8J A;  2DX1 A;  2EVR A;  3MEW A;  4C92 A;  2QTX A;  2VAS A;  4XU1 A;  4M7A C;  1F1B B;  4N0A A;  3CC2 A;  2K79 A;  2LDM A;  4DEX A;  2M16 A;  3CCL A;  2O4X B;  4JJD A;  1LOJ A;  2NUP B;  2RQV A;  1JJ2 A;  1VQ8 Q;  1BU1 A;  3JCM e;  3REB B;  2KY9 A;  1N6A A;  2RK1 A;  3EGD B;  2RJC A;  4PFO A;  1M2V B;  3HFO A;  2AK5 A;  4ANJ A;  2D8J A;  1YJN A;  4FSX A;  3JCM c;  2B8A A;  1BCO A;  3EAE A;  1J3T A;  4JZ3 A;  1UUE A;  4XTW A;  4OB1 B;  4M77 D;  2DXB A;  2J6O A;  2VVK A;  2K5F A;  3FEO A;  3RMQ A;  2EWN A;  1RAF B;  1WXU A;  1Q86 R;  1VYU A;  2R5M A;  2DVE A;  2KT8 A;  2MCN A;  4M7D E;  4CC2 A;  3SD4 A;  1M1K C;  1Y57 A;  5FRN A;  3S3O A;  1PHT A;  2C0I A;  3QBY A;  4LE9 A;  3JB9 D;  4PJO D;  2PTK A;  4OP0 A;  2R58 A;  4JLI A;  1NPR A;  1VQK Q;  1RAH B;  4BAC A;  1IO6 A;  2AKK A;  1IRX A;  2RI2 A;  4N4G A;  4XTU A;  4M75 A;  2GNC A;  2DM1 A;  5CAI A;  3OYE A;  4X9D A;  3NGP A;  3ER0 A;  3RIR A;  4M7D B;  1JB0 E;  3G71 A;  4GY5 A;  4CRI A;  3JCM d;  4LN2 A;  4M7A F;  5DLQ E;  2DRK A;  5IH2 A;  1VQP A;  4JRP A;  3LGL A;  4P5N A;  1NLO C;  4C8Q G;  2F5T X;  2O9V A;  3SFM A;  4RG2 A;  2EJG A;  1UJY A;  4KGV B;  1FMK A;  4Y92 A;  5GAO n;  2KRM A;  3TSW A;  1YI2 Q;  3QZ9 B;  1PG5 B;  5CKB A;  1M30 A;  3CBM A;  2QTV A;  4ME7 A;  5GMK j;  2CZ6 B;  4RCB A;  3CCQ A;  2GF7 A;  3RR6 A;  1KQ1 A;  2ZPF B;  1VQN Q;  4PJJ A;  3A1P A;  2RH2 A;  3I56 Q;  1HD3 A;  5KYW A;  2AT1 B;  1KD1 U;  5LJ5 h;  2AZV A;  4A54 A;  3NTH A;  3RKW A;  2CS7 A;  1NJI C;  2DD5 A;  4DOW A;  1WQ7 A;  1QVF P;  1KQS A;  1UHF A;  3WVD B;  2Y4X A;  2E6Z A;  2M1H A;  1R8O B;  2DIQ A;  1RL2 A;  1WJR A;  1VQM Q;  1M90 R;  4PFZ A;  3H0H A;  2BZY A;  2R5A A;  1W70 A;  2CT4 A;  4IIM A;  3VS2 A;  2KE9 A;  1PKT A;  2L89 A;  1UE9 A;  5A0G A;  2FVU A;  5CR2 A;  4A4K A;  2CP6 A;  3I55 A;  4AT1 B;  2VGN A;  2NUZ A;  1BI1 A;  4M7A B;  1TWB A;  2H3J A;  3LGF A;  2D6F A;  1VQ7 A;  4OVA A;  5C0M A;  4ZTJ A;  3LH5 A;  3D7S B;  3CCS A;  5LJ3 j;  2V8J A;  2BIV A;  4EDU A;  1HSQ A;  4XU3 A;  4F7U G;  1H3Z A;  1NJI U;  1QLY A;  3S3M A;  1LPL A;  1Q82 R;  1QVG P;  4ORZ A;  3CD6 T;  2M9U A;  1Y71 A;  1RAB B;  2HQH A;  2KQW A;  2K3Y A;  3EFO A;  2X4W A;  4QVD A;  1GFC A;  4HT9 A;  1VYT A;  5GMK m;  2DBM A;  2OI3 A;  3TCJ A;  4C0F A;  5IAY A;  2LCS A;  2ZZD A;  2FG0 A;  1VIE A;  1Y07 A;  3HKS A;  4NS5 A;  4OB0 B;  2CRE A;  4PFP A;  2PNI A;  2QEX Q;  6AT1 B;  2EPD A;  5GAM g;  3G1J A;  4RTY A;  2QXF A;  2HD0 A;  1VQ9 A;  1I5O B;  3QII A;  1VQK A;  1PCX A;  4JUV A;  2JS0 A;  5LJ5 g;  3VKI A;  2LNH B;  2PZ1 A;  4BDZ A;  3CCE A;  4O5V A;  4N4H A;  3H0I A;  1HK9 A;  2EGE A;  1GCQ A;  2ZCF B;  1YNZ A;  2CH4 A;  1HYO A;  3UA6 A;  4XTY A;  4ZN3 A;  4HCK A;  2FO0 A;  2MPX C;  3INZ A;  4KH0 B;  1UTI A;  2KVQ G;  3OB9 A;  4OGC A;  2DF6 A;  2X4Y A;  2XMF A;  2FZG B;  4OGE A;  3QPH A;  2WSF E;  4EPC A;  2QI2 A;  3I35 A;  5CK9 A;  2XI9 A;  3OYG A;  1VQ6 Q;  3WVE B;  3VS5 A;  1N8R C;  2P0P A;  1OUL A;  4DQ2 A;  2E64 A;  1VQ4 T;  1R77 A;  4RTZ A;  2NUT A;  3CME T;  2A0F B;  3CCM A;  1PWT A;  2KGT A;  3X20 B;  3HPW A;  3QDF A;  1JJ2 S;  3G6E T;  1YHQ Q;  1UB4 A;  1YI2 A;  1G83 A;  4Z8A A;  3EG9 A;  5FWB A;  1BCM A;  3FRN A;  3M0R A;  2J05 A;  1VQL Q;  1WYX A;  4DEY A;  3JB9 J;  3EGX B;  3I56 A;  4M77 E;  3REA B;  5LL6 S;  2F1L A;  3QWX X;  5CKF A;  1BBZ A;  2FEI A;  4M75 D;  2HKN A;  1MMN A;  2C0T A;  3MEV A;  4A4F A;  1JEG A;  2E6N A;  1N9S A;  1K0S A;  4FM4 B;  3VS4 A;  3X28 B;  1N8R U;  1X69 A;  2X9H A;  1WHJ A;  4XQ3 A;  4KUL A;  4PJO E;  1BI3 A;  2QDY B;  1TUD A;  3GNG A;  1RAG B;  1KHC A;  4DBR A;  4LXC A;  4CC7 A;  1ZSG A;  4M77 B;  1D0Y A;  3QG1 A;  2QGG A;  2AIR B;  1ZX6 A;  1MND A;  2BZX A;  2ZPB B;  4C92 G;  1NYF A;  3VV0 A;  4JRI A;  3E1S A;  1WDX A;  1PC0 A;  5LJ3 f;  4MMK A;  4EMH A;  4NOY A;  4ESR A;  4RUG A;  3JB9 I;  5KH6 A;  2HL3 A;  1KSW A;  4AFU C;  4NL3 A;  2QAZ A;  2KAF A;  2NYS A;  3CCR T;  3M0T A;  2Y4Y A;  1MMD A;  2O31 A;  2AHJ B;  4PJO B;  2W0Z A;  2V26 A;  2DPP B;  3OA6 A;  2XG8 D;  1X2K A;  1QWF A;  2DMO A;  2YDL A;  4C92 C;  1XQH A;  4N0A C;  3TVT A;  4DBH A;  3URG A;  3TEE A;  5KCH A;  1M90 U;  3CBP A;  2RI5 A;  1VQ5 A;  4Q5W A;  3P8B B;  1B34 B;  4RTW A;  4KH1 B;  1SHG A;  3OYN A;  3VS6 A;  2YUO A;  5GAN h;  1Y0M A;  5L8R E;  3RKX A;  4XTV A;  7AT1 B;  1XNI A;  4FYY B;  4FW2 A;  3S3N A;  1YJ9 Q;  1M9S A;  3MO8 A;  3X24 B;  3EG3 A;  1RAD B;  1VA7 A;  5GAO m;  3NTI A;  1TTH B;  5GMK e;  2JT4 A;  2YLB A;  2Z0W A;  4LUD A;  1WHM A;  3CMA A;  1TUC A;  1OI1 A;  4HVU A;  1GFD A;  1Q82 U;  3ASK A;  1G3S A;  2ZPH B;  2VV5 A;  2DL7 A;  3NHN A;  5CQY A;  1RUW A;  4J6Y A;  1YWO A;  1OEB A;  3MPU B;  3M0S A;  3KXT A;  4FYW B;  2ABL A;  1H92 A;  2COW A;  1YIJ T;  1AWJ A;  1I1J A;  1MHN A;  5HKC A;  5GAM j;  4M75 C;  2CSI A;  1Q81 C;  5GMK i;  2CZ7 B;  1YHQ A;  3O5Z A;  1RI9 A;  2C0O A;  3UDC A;  4ZTF A;  3OQ5 A;  2BZ8 A;  1AZE A;  4E7I A;  1M1K R;  4OMN A;  3QYG B;  1PD0 A;  1XOV A;  5LJ3 e;  1ZUK A;  4C92 F;  3PMI A;  4M78 A;  1WLP B;  1SF9 A;  5IN1 A;  3AHU A;  4Z89 A;  1OZ3 A;  3H9N A;  2ED1 A;  5GAN g;  1E7O A;  3TRE A;  3SWN B;  3RDV A;  4E47 A;  4F16 A;  3RMS A;  3LH0 A;  2QEX T;  3CC7 T;  4CC3 A;  4E7K A;  3X26 B;  1Q81 U;  1W1F A;  2FHD A;  3NMZ C;  1AVZ C;  2DTH A;  4FW1 A;  3HP9 A;  1UEC A;  2LQN A;  3OW2 S;  2O88 A;  3U23 A;  2L3P A;  5HCK A;  1OQK A;  3HTR A;  2AKL A;  2DEU A;  3N5B B;  3THK A;  4QKU A;  5AT1 B;  4JJC A;  2X3W D;  2M51 A;  1AWW A;  1NM7 A;  1AEY A;  3GOX A;  1RLQ C;  3V7R A;  1JU5 C;  3CD6 Q;  2CP5 A;  3CBO A;  4QQD A;  2MI6 A;  2EYW A;  3OSS C;  2EYQ A;  4M75 F;  3A5Z B;  2PVG B;  5LJ3 d;  2D1X A;  5M9O A;  2E5K A;  3UPU A;  2HQX A;  1JO8 A;  1LNX A;  5KE3 A;  1YIT T;  2GTO A;  4JDS A;  3M5A A;  2LT4 A;  2XK0 A;  4IUV A;  3PIP A;  3NTK A;  3CCJ Q;  4D8K A;  1NJI R;  3TSZ A;  2YT6 A;  3PMT A;  3ZBD A;  2FRY A;  2AZS A;  4J6X A;  2GGR A;  1W2B A;  1KK7 A;  3C0C A;  2E65 A;  3RUX A;  1ZSZ A;  2KSS A;  4BDY A;  5KCO A;  4C8Q D;  3JB9 H;  3DLM A;  1UEB A;  4C5G A;  1WFW A;  2SEM A;  2A36 A;  2KEA A;  4KGX B;  5GAO l;  1O9S A;  3HSB A;  4J9H A;  1KG1 A;  2KYB A;  1WXT A;  1FWZ A;  2EIF A;  4NL2 A;  1VQ4 Q;  3CME Q;  2LJ1 A;  4R56 A;  5GAM f;  1WNL A;  1TUG B;  2V8K A;  3DB4 A;  3G6E Q;  4BUG A;  3OSV A;  5LJ5 f;  4L59 A;  1X43 A;  3OMC A;  3QDR B;  2DK3 A;  1H8K A;  1GCQ C;  3JCM h;  2F69 A;  4LDU A;  4JRQ A;  2QA4 T;  3BY7 A;  1LCK A;  3L2Q A;  8ATC B;  4M75 B;  3OYD A;  1D3B A;  3OS1 A;  2BE9 B;  2OTJ A;  2XDD A;  1OU9 A;  2L3R A;  3SEM A;  5DY9 A;  2RHY A;  2MWO A;  2RA2 A;  3MHX A;  3ZEH A;  3I9Q A;  3NFC A;  2H3E B;  4IUR A;  2ROL A;  2O4X A;  3MP1 A;  4LDV A;  4IUP A;  4LDW A;  2MMP A;  5FRM A;  2JS2 A;  2ZAE A;  1V29 B;  1VYV A;  2EKO A;  1X2Q A;  4HT8 A;  1XJW B;  2EYX A;  2E41 A;  2VYT A;  3E9G A;  3EGD A;  3H6Z A;  1YJ9 T;  1M2V A;  3L42 A;  3PVL A;  5KYU B;  3VJP A;  1ARK A;  1NBE B;  1M5Q 1;  2DA9 A;  3EH2 A;  4WTO B;  3V8L A;  5FLX E;  2EGA A;  1M1K U;  2X4X A;  4LDX A;  3EG2 A;  4QW2 A;  1NE8 A;  4XU2 A;  3CCR Q;  5I22 A;  1QVF S;  3A8O B;  1N8R R;  4UC4 A;  3CEY A;  1UFF A;  2DE0 X;  4PL6 A;  1VOM A;  3CCU T;  2FRW A;  3TU4 K;  4E7Z A;  3JCM g;  4QQ6 A;  3CC2 T;  2DRM A;  2PU9 B;  3A8H B;  1G2B A;  3CCL T;  2X3X D;  3R6O A;  2ATC B;  1K0X A;  4C8Q C;  2FZC B;  2JXB A;  4C0Z A;  2JM9 A;  4FYX B;  3EH1 A;  3CCV Q;  4B6M A;  1ZBJ A;  3HRU A;  3KFV A;  4M7D A;  5HY6 A;  5GAN 7;  4N4I A;  3OYH A;  3QHS A;  4M7A E;  1QWE A;  2DAQ A;  1YJN T;  4EMK B;  3UF4 A;  1AZG B;  5KE2 A;  2JTE A;  2P0Q A;  4RCC A;  1WQW A;  5ECA A;  1QVG S;  3H0F A;  2XD0 A;  1MNE A;  4JJN K;  3C12 A;  1AWO A;  2RI3 A;  2DL5 A;  2O9S A;  3CPW P;  1M1F A;  2DZC A;  1VQO T;  2HSP A;  5L23 A;  1VQ8 A;  2A37 A;  3OYI A;  1YIJ Q;  4A4E A;  4J7I A;  2XDB A;  1VQ4 A;  1GL5 A;  3NPF A;  3M53 A;  3JB9 G;  3HHT B;  2IPO B;  1M8V A;  4GLM A;  2L0A A;  2K5L A;  2EJF A;  4RKU E;  1S72 Q;  1KFZ A;  3QWY A;  4J6W A;  2PUK B;  2BUD A;  2YHT A;  1AD5 A;  1N9R A;  3QXE B;  1RAI B;  4HVW A;  4BE0 A;  2X35 A;  3G71 T;  1QKX A;  2K2M A;  5FU6 C;  3Q1J A;  2M02 A;  3OYB A;  4RTU A;  4BB7 A;  3M0P A;  1BKB A;  3EFR A;  5J26 A;  3DLL A;  2OTL T;  4J9B A;  1WHK A;  5GAO r;  2J6F A;  4R0K A;  2DJZ A;  3CC7 Q;  2LT1 A;  4C8Q F;  1IXD A;  3I5R A;  3OW2 A;  2HCK A;  4TVR A;  1PNJ A;  3OYF A;  4FYV B;  4MDW A;  2RJF A;  1TG0 A;  3PNW C;  1YJW Q;  4ELY C;  1T0H A;  4M78 G;  1NEG A;  1OU8 A;  3FDR A;  3OYY A;  4M7A A;  3CCJ T;  2B86 A;  3A98 A;  1NG2 A;  5GAN 6;  4C92 D;  3CXC S;  4LD9 K;  4B9X A;  4XU0 A;  1SRM A;  3WXM B;  3BDL A;  1IGQ A;  1QP3 A;  1UG1 A;  4FL6 A;  2LQW A;  4M78 C;  2D0Q B;  2RQW A;  1OX8 A;  1OPL A;  3MET A;  2F2W A;  1X6G A;  3OYL A;  3L2U A;  1Q7Y C;  3EG9 B;  2V1Q A;  3L2Z A;  3HRS A;  3MP8 A;  5CKH A;  1W2B S;  5FW9 A;  2HQE A;  2PVD B;  2YUQ A;  5D6X A;  1EFN A;  1Y96 B;  2L3S A;  2LZ6 B;  1Q81 R;  5GAN f;  3S6W A;  4BY6 C;  2EFI A;  2QDL A;  3M9Q A;  1OYX A;  3JCM V;  1K9M C;  1BK2 A;  1WHL A;  2JMC A;  5KYY A;  2E10 A;  1YIT Q;  5GAO q;  5CKE A;  2MOX A;  3RKY A;  3I55 T;  4R55 A;  1VQN A;  1AT1 B;  3A8G B;  1W4S A;  2EQI A;  1VQ7 T;  1ZA2 B;  3CCS T;  3OBY A;  4C8Q B;  3EG1 A;  4B9W A;  4F7U F;  2HZY A;  1V1C A;  4FT2 A;  4C5E A;  4BD3 A;  3EGU A;  4YTL A;  5IXF A;  3RER A;  4V2S A;  5I11 A;  1WHH A;  1D0X A;  1KQ2 A;  1VQM A;  3MP6 A;  3ZL7 C;  2DIL A;  1NZ9 A;  1IHW A;  1K9M U;  2NWM A;  5IHK A;  1D09 B;  2JVV A;  2O01 E;  2FPF A;  4A63 B;  2OAU A;  1VUB A;  2BTT A;  4PK4 A;  1UGS B;  1PRL C;  5FRO A;  5AYF A;  1KC8 C;  4J7F A;  3OYK A;  3TQ7 P;  1YIJ A;  5J39 A;  3ZFJ A;  1Y7X A;  1BB9 A;  1UGV A;  1VQ9 T;  9ATC B;  3I5S A;  2IG0 A;  2DYI A;  1AWX A;  1X27 A;  3EGX A;  3M56 A;  1JJ2 P;  2M0O A;  3CPF A;  4MML A;  1YWP A;  5C6S A;  1FYN A;  2QA4 Q;  2DKG A;  3P8H A;  1I4K 1;  1MMG A;  4PKC C;  1C6V X;  2GFA A;  5KYX B;  3FC3 A;  3X25 B;  1K76 A;  4D6W A;  2MIO A;  1KHI A;  2QYZ A;  3M58 A;  3JCM P;  2HL5 C;  1WI7 A;  1I5L A;  2QEX A;  2J6K A;  1KC8 U;  5FU6 B;  4MZP A;  1TXQ A;  3FIF A;  2OX7 A;  1T0J A;  3HRT A;  4JZ4 A;  3J81 E;  3CCV T;  4M77 A;  1UGP B;  1ZUY A;  2RHX A;  4F7U B;  5GMK l;  3DB3 A;  3QYH B;  2CP7 A;  4J8O A;  3CCM T;  4OMM A;  4AFQ C;  3LWH A;  1I81 A;  1K8A C;  4JJB A;  4QVZ A;  2YWW A;  1IRE B;  1QVF A;  4HVV A;  4E7J A;  2K7A A;  1JXM A;  5D7U A;  2DO3 A;  3CC4 T;  4PJO A;  1EX4 A;  2HDA A;  2QAS A;  3PT9 A;  3VYH B;  1E6G A;  4ELZ C;  3ULR B;  3OYC A;  1M3C A;  4GLK A;  5GMK h;  1M8M A;  2RMO A;  2KRO A;  1RI0 A;  2OAW A;  1FX7 A;  3OYJ A;  2K6D A;  1X75 C;  1VQ6 A;  3CCU Q;  2SRC A;  1QMC A;  4E7L A;  2WSE E;  3CC2 Q;  4J5Y A;  3CCL Q;  5LJ5 j;  4OB3 B;  1S72 T;  2LQ8 A;  1U1S A;  1K8A U;  2KDS A;  3GNF B;  2XHC A;  2RF0 A;  2XID A;  3V8K A;  4BY6 B;  1VQL A;  2QQB A;  1QQJ A;  1QVG A;  4KUI A;  2RO0 A;  3PIO A;  4CI0 C;  1JRI A;  2G6F X;  1YJN Q;  1R0B G;  2EKH A;  1UGR B;  2BKD N;  4A53 A;  2KR3 A;  3JCM Q;  3C94 A;  4XTX A;  2NLU A;  1PSE A;  4C5H A;  4M7D G;  2RPN A;  5LJ3 h;  2KRS A;  1YJW T;  1QVP A;  4AMC A;  2DYB A;  1T3L A;  1WXB A;  1VQO Q;  2D9T A;  2FB7 A;  1KQS P;  1R0C B;  1M4Z A;  2YRC A;  4E2F B;  4C0D C;  1WA7 A;  1K73 C;  3MCA B;  5CO7 A;  3JCM f;  2DBK A;  2ZPI B;  3VRZ A;  4M7D C;  4II1 A;  4C92 E;  3ME9 A;  4A4G A;  2VWF A;  1PKS A;  2OJ2 A;  2RM4 A;  3JCM J;  5IT9 E;  2ESW A;  1MMA A;  2VUB A;  3OBW A;  2YLC A;  2K4Y A;  1N5Z A;  1AOJ A;  2GQI A;  3G71 Q;  2JJ9 A;  1RAE B;  1GBQ A;  1I8F A;  4FU6 A;  1D1B A;  2C06 A;  3SWN A;  1KJW A;  2JMA A;  2KXC A;  2OTL Q;  5GAN 3;  1VQP Q;  2ECZ A;  2CKK A;  1M1G A;  2F2X A;  5FU7 C;  3CXC A;  2DFU A;  1K73 U;  4C92 B;  4ZNX A;  2CGH A;  4ZGE B;  3G4S T;  1GRI A;  1M2O A;  2FL7 A;  1ACM B;  3GBQ A;  3OS2 A;  2DTI A;  2GTJ A;  4DBF A;  1DJ7 B;  1PM3 A;  5CIU A;  2VGM A;  4RG8 A;  1YJ9 A;  4X34 A;  4OMF B;  2G3R A;  3GP8 A;  2WSC E;  1EIF A;  3F70 A;  2KK4 A;  1U06 A;  3CCQ Q;  2RK2 A;  2DXC A;  4RMO A;  2A28 A;  3VS0 A;  4M7A G;  4DOV A;  4OML A;  4M75 E;  2FZK B;  1HXD A;  4FT4 A;  1D3B B;  1FMW A;  2COY A;  4DBQ A;  4IKF A;  3M59 A;  3M54 A;  3BW1 A;  1OPK A;  1SSH A;  3UT1 A;  3T9N A;  2K3X A;  2EBP A;  1U3O A;  1X6O A;  1NEB A;  4J9F A;  2ED0 A;  3CCU A;  4M7D F;  2E3H A;  4C0G A;  3GPL A;  1WPY A;  2DL4 A;  2COZ A;  1ZA1 B;  3GF5 A;  1MV3 A;  1U5S A;  2DVJ A;  3I55 Q;  4LDY A;  1IGU A;  2LQK A;  2JUF A;  1BI0 A;  1JBM A;  3J7A F;  1VQ7 Q;  1PRM C;  3CCS Q;  3LLR A;  2HBW A;  1TOV A;  1X6B A;  1BIA A;  4O6J A;  1QW1 A;  4Z02 A;  1M3B A;  4J9E A;  1YFN A;  2RQT A;  2DXU A;  2FYK A;  3G7Z A;  1N27 A;  4AFZ C;  4HKE A;  2KNB B;  2F2V A;  2NUP A;  3GIB A;  4F17 A;  4E6R A;  2X51 A;  3MKD A;  2VKN A;  5GAN 2;  1VQO A;  4RTX A;  1G5V A;  5EC7 A;  3FJ5 A;  2K57 A;  1M3A A;  4J9G A;  3EHQ A;  3FJP A;  3OS5 A;  1W6X A;  1BIB A;  2CP3 A;  3FLG A;  2LX9 A;  2QK0 A;  1VQ9 Q;  1Q7Y R;  3HFN A;  4BI8 B;  4F14 A;  1RAC B;  3CCE Q;  2DNU A;  4C0D B;  2LMJ A;  5I2S A;  1SHF A;  5KYN A;  3CD6 A;  2D8H A;  5KYW B;  2P4T A;  2EJ9 A;  4J9I A;  4BE2 A;  4KUD K;  1K9M R;  2J06 A;  4LD6 A;  5GAN j;  1OX9 A;  2OTL A;  1V76 A;  3CPW S;  3VRY A;  2JZ2 A;  2JOY A;  1KD1 C;  1IHV A;  2V8I A;  3OYM A;  1S1N A;  1WHG A;  1JQQ A;  2BE7 D;  4M78 D;  2HKQ B;  4PLI A;  4FSS A;  4OF1 A;  2O2O A;  2RNA A;  3QZ5 B;  5KYU A;  2CYZ B;  2Y90 A;  3MEA A;  1OOT A;  2HEQ A;  5GAM e;  4KRT A;  3CCJ A;  1TS9 A;  5IHI A;  5FU7 B;  4MZT A;  1FXX A;  5LJ5 e;  3CCM Q;  3L2W A;  3EFS A;  3LWI A;  2HAX A;  3OYA A;  2MYS A;  2L5Q A;  3PFS A;  3SDZ A;  2E5Q A;  1PSF A;  2EYY A;  2JW4 A;  4XTZ A;  3CC4 Q;  4M77 G;  5GAM h;  3UWN A;  1UGQ B;  3R6N A;  2OTJ T;  4AG1 C;  2X4J A;  1KC8 R;  3LW5 E;  5D6Y A;  3M55 A;  2LC4 A;  3EFO B;  1TU0 B;  1HJD A;  2LX7 A;  1P92 A;  2QQS A;  2KYM A;  1KIK A;  2D0N A;  1JXO A;  4HXJ A;  5GJV B;  3J80 E;  4M77 C;  1RLP C;  1QCF A;  1YCY A;  3CME A;  4PJO G;  2DLP A;  3JCM b;  3PTA A;  3FB9 A;  2CUD A;  3G6E A;  2K5I A;  4QVC A;  1YN8 A;  3JSC A;  1GBR A;  3IQL A;  3H41 A;  4F04 B;  1C1A A;  1VIF A;  1G3W A;  2XU8 A;  2JN0 A;  3QUI A;  3RES A;  2E3I A;  2I2L A;  2JTM A;  3DKM A;  4EMK A;  2I0N A;  4OMQ A;  2RQR A;  2KT1 A;  3JCM W;  2F5K A;  3L2R A;  1TSF A;  4PJO C;  4LUE A;  5FWC A;  4JS5 A;  1WX6 A;  2KXD A;  5GAM d;  3MJX A;  1O75 A;  4VUB A;  1VQP T;  2ZGW A;  1QKW A;  5LJ5 d;  1FMV A;  2RN8 A;  4PJM A;  8AT1 B;  2YUP A;  4KBM B;  1B07 A;  3KUF A;  2QQR A;  1Q95 G;  3SHW A;  4OMO A;  1K8A R;  1U1T A;  1Q86 C;  2V1R A;  2DL8 A;  2DET A;  2RHU A;  1EZZ B;  1VQ5 Q;  1UJ0 A;  4JLG A; 
#chains in the Genus database with same CATH homology
 2J6K A;  1RLQ C;  1JU5 C;  2YSQ A;  1YP5 A;  2CSQ A;  1T0J A;  1SEM A;  4JZ4 A;  4LN2 A;  1ZUY A;  2EYW A;  2DRK A;  5IH2 A;  3VS1 A;  2D1X A;  4OMM A;  4M4Z A;  4AFQ C;  2E5K A;  1NLO C;  2EYZ A;  1JO8 A;  4JJB A;  1M27 C;  2O9V A;  2GTO A;  4HVV A;  1CKA A;  2K7A A;  3EHR A;  1JXM A;  4WCI A;  1B3Q A;  1UJY A;  4D8K A;  1FMK A;  4Y92 A;  3TSZ A;  2HDA A;  2KRM A;  1E6G A;  2YT6 A;  4EIK A;  1K9A A;  3ULR B;  3TSW A;  3UAT A;  2FRY A;  1M3C A;  2AZS A;  2DJQ A;  1M30 A;  2CDT A;  1M8M A;  2RMO A;  2GGR A;  2KRO A;  2OAW A;  3C0C A;  2CUB A;  2K3B A;  1MUZ A;  2K6D A;  2SRC A;  1HD3 A;  2FPD A;  2LP5 A;  1WFW A;  4RTV A;  2AZV A;  2A36 A;  2KEA A;  2SEM A;  2L3Q A;  4J9H A;  1UHF A;  2RF0 A;  2KYB A;  1WXT A;  3H0H A;  2LJ1 A;  1UDL A;  2G6F X;  2BZY A;  1YCS B;  1W70 A;  2CT4 A;  1T3S A;  2EKH A;  4IIM A;  3VS2 A;  2KE9 A;  1PKT A;  1UE9 A;  2KR3 A;  1K1Z A;  1X43 A;  2ROT A;  1H8K A;  1GCQ C;  1LCK A;  2NUZ A;  5IXB A;  3RBB B;  2RPN A;  2KRS A;  3LH5 A;  1E6H A;  2DYB A;  1T3L A;  3SEM A;  1WXB A;  2EW3 A;  1HSQ A;  1QLY A;  4K11 A;  3I9Q A;  1WA7 A;  2ROL A;  4ORZ A;  2DBK A;  3VRZ A;  2YUN A;  2RQU A;  2JS2 A;  1CSK A;  1VYV A;  2H8H A;  1GFC A;  1VYT A;  1X2Q A;  2DBM A;  2OI3 A;  1PKS A;  2VWF A;  2OJ2 A;  2P4R A;  2L2P A;  2EYX A;  2LCS A;  2ESW A;  2FG0 A;  3PVL A;  5GJW B;  2CRE A;  1ARK A;  2PNI A;  2W10 A;  2DA9 A;  2EPD A;  1N5Z A;  1AOJ A;  2GQI A;  3M0Q A;  4RTY A;  1GBQ A;  2JM8 A;  2JS0 A;  4AFS C;  1SRL A;  2EGA A;  1KJW A;  2LNH B;  4J9C A;  2JMA A;  2KXC A;  2PZ1 A;  3PVQ A;  3VS3 A;  2ECZ A;  4GBQ A;  3EG2 A;  2F2X A;  1NYG A;  4AG2 C;  3H0I A;  1K4U S;  5I22 A;  2EGE A;  1ZUU A;  2A08 A;  1GCQ A;  4ZNX A;  1GRI A;  4QT7 A;  1UFF A;  1YNZ A;  2CH4 A;  3UA6 A;  3GBQ A;  2LJ0 A;  1I07 A;  2GTJ A;  2DE0 X;  2FRW A;  4HCK A;  2FO0 A;  2DL3 A;  2CH4 W;  1CKB A;  2DRM A;  1G2B A;  2X3X D;  1UTI A;  2DF6 A;  2XMF A;  1K0X A;  3CQT A;  1AWW A;  1U06 A;  2JXB A;  3I35 A;  2JM9 A;  2A28 A;  3VS5 A;  1ZBJ A;  3VS0 A;  3KFV A;  4LNP A;  4RTZ A;  4OML A;  1QWE A;  1PWT A;  2KGT A;  3UF4 A;  1AZG B;  4IIO A;  1G83 A;  3JV3 A;  2JTE A;  1OPK A;  4Z8A A;  5FWB A;  1SSH A;  1ZLM A;  5ECA A;  3M0R A;  2EBP A;  1U3O A;  3RNJ A;  2J05 A;  3H0F A;  1NEB A;  1WYX A;  4J9F A;  2LJ3 A;  4DEY A;  2ED0 A;  4JPB W;  1AWO A;  2DL5 A;  2O9S A;  2ENM A;  3REA B;  2DL4 A;  4X1V A;  1MV3 A;  2HSP A;  5L23 A;  1U5S A;  2DVJ A;  3QWX X;  1BBZ A;  2FEI A;  2A37 A;  1NLP C;  2C0T A;  1JEG A;  3VS7 A;  2IIM A;  1K0S A;  3VS4 A;  1X69 A;  1GL5 A;  3NPF A;  4RTT A;  4GLM A;  1PRM C;  2L0A A;  2HBW A;  1X6B A;  1KFZ A;  1TUD A;  3QWY A;  1MV0 B;  4J9D A;  1M3B A;  4J9E A;  2RQT A;  1GCP A;  1AD5 A;  4CC7 A;  1ZSG A;  1UHC A;  4AFZ C;  4HVW A;  1I0C A;  2KNB B;  1ZX6 A;  2F2V A;  1QKX A;  2BZX A;  2K2M A;  1NYF A;  4RTU A;  2KRN A;  3M0P A;  4F17 A;  1WDX A;  4E6R A;  3UA7 A;  2VKN A;  2KBT A;  4ESR A;  4RUG A;  4J9B A;  1KSW A;  4RTX A;  2J6F A;  5EC7 A;  4AFU C;  4R0K A;  2FPE A;  1Z9Q A;  3FJ5 A;  1M3A A;  3M0T A;  4J9G A;  3EHQ A;  1W6X A;  2O31 A;  3I5R A;  2HCK A;  4OMP A;  1PNJ A;  2W0Z A;  1ABO A;  1TG0 A;  1X2K A;  1QWF A;  2DMO A;  2YDL A;  1T0H A;  3M0U A;  1NEG A;  3PE0 A;  2K9G A;  3TVT A;  2B86 A;  4F14 A;  2DNU A;  3A98 A;  1NG2 A;  2LMJ A;  1SHF A;  1SRM A;  2D8H A;  2M0Y A;  4CC4 B;  4RTW A;  1SHG A;  1WIE A;  3VS6 A;  2YUO A;  3EG0 A;  4J9I A;  1UG1 A;  2J06 A;  1Y0M A;  2LQW A;  2RQW A;  1OPL A;  3VRY A;  2F2W A;  1X6G A;  2V1Q A;  1H3H A;  1S1N A;  3EG3 A;  1VA7 A;  1JQQ A;  2JT4 A;  4LUD A;  2YUQ A;  5FW9 A;  5IHN A;  4FSS A;  1EFN A;  2O2O A;  1TUC A;  2L3S A;  2RNA A;  2LZ6 B;  4HVU A;  1GFD A;  1OOT A;  2HEQ A;  4KRT A;  5IHI A;  4D8D A;  2GBQ A;  2QDL A;  2DL7 A;  1SPK A;  3NHN A;  4Z88 A;  1ABQ A;  1RUW A;  1BK2 A;  2JMC A;  1YWO A;  1OEB A;  3M0S A;  2ABL A;  1H92 A;  1Z9Z A;  2MOX A;  1OV3 A;  1A0N B;  2J7I A;  2EGC A;  2EYY A;  2JW4 A;  2CT3 A;  1AWJ A;  1I1J A;  2DX1 A;  2EQI A;  2EVR A;  3R6N A;  2K79 A;  4DEX A;  2CSI A;  4AG1 C;  3EG1 A;  3O5Z A;  1RI9 A;  4JJD A;  1V1C A;  2C0O A;  2RQV A;  1BU1 A;  3REB B;  1HJD A;  2BZ8 A;  2LX7 A;  3EGU A;  1AZE A;  5IXF A;  5I11 A;  2KYM A;  1KIK A;  2D0N A;  1JXO A;  4HXJ A;  4OMN A;  1XOV A;  5GJV B;  1ZUK A;  1RLP C;  1QCF A;  3ZL7 C;  2AK5 A;  1WLP B;  2D8J A;  2DLP A;  2CUD A;  2DIL A;  2NWM A;  4Z89 A;  5IHK A;  1J3T A;  1YN8 A;  1GBR A;  4JZ3 A;  1UUE A;  3IQL A;  2FPF A;  3H41 A;  4A63 B;  2BTT A;  2ED1 A;  2J6O A;  1PRL C;  2VVK A;  1E7O A;  4F16 A;  2I0N A;  4OMQ A;  2RQR A;  1WXU A;  2KT1 A;  1BB9 A;  1UGV A;  1VYU A;  4CC3 A;  2KT8 A;  2MCN A;  3I5S A;  4LUE A;  4CC2 A;  5FWC A;  1WX6 A;  2KXD A;  1Y57 A;  1AWX A;  1W1F A;  1X27 A;  3NMZ C;  1AVZ C;  1PHT A;  2C0I A;  1YWP A;  1QKW A;  1UEC A;  4LE9 A;  1FYN A;  2RN8 A;  2LQN A;  2O88 A;  2PTK A;  3U23 A;  2YUP A;  2L3P A;  1B07 A;  5HCK A;  1IO6 A;  2AKK A;  2AKL A;  3SHW A;  3THK A;  1K76 A;  2MIO A;  4OMO A;  2GNC A;  4JJC A;  2V1R A;  2DL8 A;  2X3W D;  2DM1 A;  2M51 A;  1UJ0 A;  1WI7 A;  1NM7 A;  1AEY A;  3NGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...