2FPDA

Sad structure determination: crystal structure of the intrinsic dimerization sh3 domain of the ib1 scaffold protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-jun-amino-terminal kinase interacting protein 1
publication title A unique set of SH3-SH3 interactions controls IB1 homodimerization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 15
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fpdA00
1G2BA 2DRKA 4AFZC 2KR3A 2BZ8A 2JS0A 4HVUA 4QT7A 1V1CA 1JXOA 1E7OA 4RTXA 4OMOA 5GJWB 4E6RA 4F14A 2L2PA 1GFDA 4RTUA 2KE9A 1SSHA 2EYZA 1QLYA 4WCIA 4RUGA 2D1XA 1WLPB 3NGPA 4LUEA 1YN8A 2RQUA 2HCKA 2DF6A 3LH5A 2RQVA 2O88A 4FSSA 2J05A 4J9GA 4CC4B 5FW9A 2O9SA 2YDLA 4JZ4A 5IHNA 1Z9QA 2A37A 3REBB 4OMQA 2BZYA 1UHFA 5EC7A 1FMKA 4HXJA 2F2XA 2FEIA 5ECAA 1PHTA 1ZX6A 2O2OA 1LCKA 4EIKA 4JJCA 2KT8A 3VS4A 2F2VA 5GJVB 3M0QA 3EG0A 4LNPA 3C0CA 1J3TA 3H0HA 1T0JA 2GBQA 1X6BA 1E6GA 3A98A 1NEBA 3TVTA 1A0NB 2YSQA 1MV3A 4ZNXA 1H3HA 2L3PA 2X3XD 2CH4A 4RTWA 1QKXA 2ABLA 1H92A 1UHCA 2GNCA 2ED0A 2AKKA 2DILA 1UDLA 2JW4A 4J9CA 1ZSGA 1GRIA 1NEGA 2KXCA 1ZBJA 1VYUA 3SHWA 1T3LA 2J7IA 3I5RA 1MV0B 1M3CA 2OAWA 1ARKA 2LCSA 1UUEA 2BTTA 2DA9A 4J9BA 1M30A 2EGAA 4JJBA 5IH2A 1GCQC 5FWCA 2CT3A 2OJ2A 4IIMA 4AFQC 2JT4A 1K76A 3R6NA 2DNUA 4DEXA 2RNAA 2EQIA 4A63B 2DYBA 1HSQA 4DEYA 2HBWA 2RN8A 1AZEA 1NLPC 2SRCA 3RBBB 1AZGB 1OPLA 2J6OA 2DJQA 1UGVA 3M0UA 4AFSC 1U06A 3PVLA 2KNBB 4D8DA 2M51A 2FPFA 2KT1A 2P4RA 2JM8A 1ZLMA 4J9EA 2CUBA 3VS1A 4OMLA 2ECZA 2JS2A 4KRTA 2O9VA 3I35A 1KJWA 1K4US 1NM7A 2EGCA 4ORZA 3UATA 2JXBA 2JMAA 4OMMA 1VYTA 1M3AA 3O5ZA 4RTTA 2KGTA 3UA7A 2ESWA 2ENMA 2G6FX 1JEGA 2DL4A 2V1QA 4CC3A 1H8KA 1WI7A 3U23A 3NMZC 1SPKA 1ZUUA 2KROA 2GGRA 2K6DA 2B86A 1HJDA 2LP5A 1TG0A 2KBTA 4R0KA 2RF0A 1XOVA 1WX6A 3ULRB 2FG0A 2CDTA 2JMCA 4Z88A 4X1VA 1Y57A 4J9FA 1RLPC 4LN2A 1GBQA 4LUDA 3M0RA 2GQIA 1I1JA 1AVZC 1CSKA 2NUZA 2EGEA 2V1RA 1Y0MA 1CKAA 1M3BA 3EHRA 3UF4A 2DL7A 2C0TA 2QDLA 2CREA 3TSZA 2YUNA 3GBQA 1X2KA 2DBMA 2LX7A 1N5ZA 2NWMA 2DE0X 2M0YA 2KRNA 2KYBA 3M0TA 1UTIA 2RPNA 4D8KA 4Z8AA 4Z89A 2H8HA 1T0HA 1RLQC 3PE0A 1RI9A 1YP5A 5FWBA 1K0SA 1UECA 1MUZA 3VS2A 4AFUC 1KIKA 2XMFA 2KRSA 1WXBA 2DL3A 2AK5A 2J06A 4IIOA 5IXBA 4JPBW 3ZL7C 3NHNA 1X69A 2VVKA 1TUCA 1WIEA 2DL8A 2FPEA 4M4ZA 2CT4A 3EGUA 2AZVA 2L3SA 3EHQA 1AEYA 2ROLA 1CKBA 1VYVA 1BBZA 3VS5A 4HCKA 3FJ5A 1QCFA 4RTVA 1UE9A 2J6KA 1UJ0A 1B07A 2VWFA 4JJDA 2EBPA 2K79A 1JQQA 4J9DA 2KRMA 1WXTA 4F17A 2F2WA 1NYFA 2EYXA 1PRMC 3QWXX 1PWTA 2W0ZA 1GFCA 4OMPA 2SEMA 1W70A 1I0CA 4RTZA 3M0SA 2LJ0A 2HDAA 1ABQA 1JO8A 2RQWA 1TUDA 3M0PA 4HVWA 3RNJA 2L0AA 2K3BA 1K1ZA 4HVVA 4J9HA 2A36A 4F16A 2YUPA 1BB9A 3EG3A 2PTKA 1M8MA 2DVJA 4JZ3A 2D8HA 3VS6A 1OEBA 1PNJA 1SRMA 2DM1A 2C0OA 2CSIA 3UA6A 2A08A 3TSWA 2DL5A 1PKSA 1JXMA 1YWOA 1UJYA 3VS3A 1ABOA 5IXFA 1ZUKA 4OMNA 3CQTA 3PVQA 2DLPA 2OI3A 1KSWA 2D0NA 2LZ6B 5IHIA 2EYYA 5IHKA 1X27A 2LMJA 3JV3A 1GCQA 1EFNA 1OPKA 2EVRA 2LJ1A 1QKWA 2K2MA 3EG2A 2IIMA 1SHFA 2CUDA 3IQLA 2DMOA 1WA7A 2I0NA 4AG1C 2FPDA 1SRLA 5I11A 2J6FA 2HEQA 2DX1A 5HCKA 1QWEA 2YUQA 4CC2A 1X2QA 2CH4W 2D8JA 1WYXA 1UFFA 2K7AA 2HSPA 1OOTA 4CC7A 2LNHB 2FO0A 1FYNA 2ROTA 2EYWA 3THKA 3VRYA 1YWPA 2KEAA 1SEMA 1BU1A 1BK2A 2GTOA 2EW3A 1NG2A 2AKLA 1X43A 1W1FA 4J9IA 1U3OA 2CSQA 2LQNA 5I22A 1GCPA 1T3SA 1W6XA 2EPDA 2L3QA 1ZUYA 2RQRA 1VA7A 2AZSA 1AOJA 2RQTA 1AWJA 2X3WD 1QWFA 1WXUA 2K9GA 2FRWA 1PKTA 1OV3A 1SHGA 3VRZA 2ED1A 1U5SA 1E6HA 2VKNA 2C0IA 3H0IA 1WDXA 2O31A 2KXDA 4GLMA 2A28A 1I07A 2LJ3A 1AD5A 2FRYA 3REAB 4RTYA 2JTEA 2E5KA 3SEMA 1JU5C 3EG1A 3NPFA 3I9QA 4LE9A 3KFVA 1AWXA 3QWYA 4ESRA 2KYMA 4AG2C 2MCNA 2GTJA 1UG1A 1S1NA 2DBKA 2MOXA 2PNIA 2DRMA 1M27C 3H0FA 1Z9ZA 1PRLC 3VS0A 2YT6A 2JM9A 2YUOA 1GL5A 1K9AA 1K0XA 3I5SA 2RMOA 4GBQA 1RUWA 2MIOA 1AWWA 1WFWA 1KFZA 1YNZA 4Y92A 2BZXA 1NYGA 5L23A 1X6GA 1GBRA 1G83A 3H41A 2EKHA 1AWOA 3VS7A 1HD3A 1NLOC 1YCSB 1B3QA 2LQWA 2W10A 2PZ1A 4K11A 1IO6A
chains in the Genus database with same CATH superfamily
2WSCE 2QQAA 1N9RA 2QG9B 2KR3A 2BZ8A 2RK2A 1YHQA 1OZ3A 3INZA 4QT7A 1E7OA 1M1FA 5DLQE 2RJDA 3CCEQ 2QA4Q 2KE9A 1SSHA 4CRIA 2QASA 3E1SA 1D0YA 1VQ7A 2OX7A 4C8QA 1VQ5T 2DF6A 2VASA 3KUFA 3A5ZB 2X4XA 5J39A 5LJ5h 3CPWS 2O9SA 4C5GA 5IHNA 2A37A 4JJNK 3QXEB 2BZYA 5EC7A 4HXJA 4C92G 2O2OA 1LCKA 3QJ6A 5GAOq 1TU0B 2A0FB 2LNVA 3M0QA 2IPOB 4LNPA 1UEBA 1LNXA 4PJOB 3OW2P 4DA4A 1NEBA 1UB4A 4FL6A 1H3HA 3CCJQ 2X9HA 3A8GB 2ABLA 2PUKB 3OYAA 4MMLA 1OQKA 1NPPA 4C5HA 4J9CA 1PM3A 1ZBJA 1ZBXA 1M8VA 1VQ6Q 3OYJA 1Y96B 1ARKA 2KMTA 4ZN1A 5IH2A 2DJZA 4PJJA 4IIMA 3TCJA 5GAMd 2JT4A 5D6XA 4KULA 3R6NA 4M75F 4QQGA 3PT9A 2DYBA 4L6V5 4RKUE 3FEOA 2RN8A 1W2BA 1AZEA 3M55A 1YI2T 1OPLA 1QCNA 2YHTA 4B6MA 3M0UA 1G3TA 3C95A 4FW1A 2YRCA 2EQKA 4DBHA 1YJWQ 1TUGB 1ZLMA 4J9EA 4C92C 4FT4A 3CCMQ 1M2OA 3JCMQ 4M7DA 3I35A 4IKFA 3HP9A 1QP2A 1R8OB 1M4ZA 1PC0A 2KY9A 2G3RA 4ORZA 3JCMc 4A53A 2JXBA 2JMAA 2E65A 1M3AA 1XQHA 2R57A 1YI2A 2KGTA 5FU6C 3EFOA 3OB9A 2QEXQ 5CKDA 4FYVB 4EMKB 3WVDB 3PIOA 3JCMJ 3C4SA 2FL7A 2R58A 1H8KA 3P8HA 1VQPQ 1SPKA 4BI4A 2B86A 2RF0A 1XOVA 1X01A 2QQSA 2FG0A 1G5VA 2QXFA 3R6OA 1GBQA 1IRXA 1AVZC 3HKSA 3CCSQ 2NUZA 3S6WA 3HL8A 4JRPA 4N4IA 1K8AR 2IVWA 2DXCA 1Y0MA 2PU9B 1M3BA 5GAOl 2RH2A 3GBQA 4X34A 1X2KA 5LJ3f 3H9NA 4EMHA 4XTYA 5J26A 2LX7A 2NWMA 2KYBA 1K9MU 3EGXA 3MPUB 2DTOA 2EQMA 4Z89A 2RJFA 1RLQC 3PE0A 1RI9A 5FWBA 2EAYA 4M7DC 2PVOB 4OP0A 1G3YA 2J06A 4IIOA 3JCMg 4FU6A 5IAYA 5IXBA 3ZL7C 1VQMT 3D7SB 1AEYA 2ROLA 1VYVA 4ANJA 1BBZA 4J7IA 3FJ5A 4PJOA 2VC8A 2RHZA 1QCFA 3QHSA 4RTVA 2ZPGB 4M75B 2KDSA 2X4YA 4XU2A 4JJDA 2RI3A 4PKCC 4PLLA 1YIJT 1YBYA 3CCUQ 1JJ2S 2F2WA 1NYFA 3V7CA 1MMDA 1VQMA 3QWXX 5KYYA 3UPUA 1I0CA 4RTZA 6AT1B 1I5OB 1JO8A 2P0PA 5GAMf 1TUDA 5GMKe 1VUBA 1WGSA 3SFMA 3PTAA 1K1ZA 4PJMA 2CP0A 4DOVA 1TSFA 4J9HA 1YIJA 2K3XA 1SG5A 4J6WA 2PTKA 1W2BP 2DVJA 4JS4A 3CC7T 2LT1A 1VOMA 2ZAEA 2ZPFB 2NUPB 3VS6A 1WQ7A 1PNJA 2DD4A 5FRNA 1SRMA 3JCMW 3HRSA 4M78E 3CXCS 3UA6A 1YWOA 4FIBA 3VS3A 1ZUKA 1RADB 2YRDA 3EG9B 4PJOC 4KGXB 1KSWA 3CC7A 2D0NA 2EJGA 1OU8A 3HRUA 3LW5E 3CC4Q 1QVGS 2MI6A 4EMKA 2LMJA 1GCQA 1OPKA 2EVRA 2LJ1A 2K2MA 1WA7A 3MCAB 2CP3A 1SRLA 2FPDA 5I11A 2HEQA 2J6FA 4CC2A 1X2QA 2O01E 3OYDA 1OOTA 2FO0A 1FYNA 4MMKA 1YJNQ 3DKMA 1SEMA 1BK2A 1Q81U 1X43A 4J9IA 5CKFA 1VQ9T 1QQJA 2ZPBB 2CSQA 2JOYA 2FYKA 1GCPA 2MK5A 1W6XA 1QW1A 1S72T 1M1KC 2CZ6B 5GAOm 1Q95G 2DK3A 2X3WD 1WXUA 2K9GA 2FRWA 3ZFJA 5GAN4 1PKTA 1Q86C 3CBOA 3CCVT 1SHGA 1E6HA 1X75C 2VKNA 2O31A 3OS2A 1VQ9A 2EJFA 2A28A 1I07A 4R56A 1TTHB 2LJ3A 2FRYA 2E64A 1NBEB 1S72A 3RERA 3CCLQ 2QTVA 3QDFA 4MZTA 4BI8B 4HCCA 4N0AA 5GANg 2MMPA 3NPFA 5J3BA 2EQJA 4EMKC 4M78D 3CMET 3QWYA 4LDUA 3CCVA 4M75A 4AG2C 3P8DA 2M16A 3JB9F 2XDPA 2PNIA 1AHJB 5CK9A 3CC2T 4M7AA 2HBPA 1YITT 2YT6A 8ATCB 5M9OA 5GMKh 1YHQQ 2JM9A 1KQSS 2XK0A 1GL5A 1K9AA 1K0XA 3I5SA 3JCMe 1WHJA 3CMEA 1KFZA 3OYBA 2A7YA 1X6GA 1GBRA 3H41A 3ZEHA 2ZZDA 2GCXA 1YCSB 3SDZA 3CC2A 2QQBA 2W10A 5GAOp 4QVDA 1YITA 3PMIA 4K11A 1UGPB 3M53A 3G6ET 4ZTFA 1ZSZB 1LOJA 3MEUA 2DXTA 4C8QB 4EDUA 2VB6A 5KE2A 1MHNA 1V1CA 1JXOA 2DFUA 3PMTA 2E4HA 4RTXA 4OMOA 4F14A 1VQ4T 2L2PA 1OU9A 2FZCB 4N0AC 1VQ5Q 1QLYA 4WCIA 2GQVA 1WLPB 3MP6A 3G6EA 1VQ8Q 4M75C 2OAUA 4O6JA 3LH5A 3OW2A 1R0CB 2JUFA 2OTJQ 4CC4B 5FW9A 2CP7A 1VQ4A 5GAOn 4Y28E 3REBB 1UHFA 3DLMA 4RCCA 1ZX6A 4X9CA 1RL2A 1HYOA 2JTMA 2DD5A 5GJVB 4E7HA 3EG0A 2QYZA 3C0CA 3H0HA 1X6BA 3QIIA 3TVTA 2Y4XA 3BY7A 1A0NB 2AHJB 3CMAT 1W4SA 2X3XD 4RTWA 1QKXA 2V8KA 4JS5A 4PLIA 4GY5A 2JW4A 3AHUA 2KXCA 1N6AA 3UT1A 1VYUA 2J7IA 1MV0B 3J7AF 2DA9A 2BTTA 3RKWA 4BUGA 1YJ9T 2EFIA 1M30A 3CD6T 1ZA1B 2EGAA 4JJBA 2CT3A 3DB3A 1FMVA 2OJ2A 4NL2A 3G71T 3N5BB 1PSFA 3CMAA 3OQ5A 3NTKA 2DNUA 4M7DE 3JB9J 2NYSA 2Y4YA 4C5EA 2RNAA 4DEXA 5GAMg 4BI3A 4A63B 1HSQA 4DEYA 4AMCA 2DO3A 2HBWA 3CEYA 1Q86R 2RHXA 1NLPC 4C8QD 1KQ2A 1AZGB 5KCHA 2DJQA 1UGVA 1MMNA 3OS0A 3EFOB 4YTLA 5KYNA 3JAME 3OYMA 1YJ9A 3A8OB 1M1KU 3CD6A 2P4RA 1OULA 3JCMh 3CPFA 3VS1A 2O9VA 3G71A 3VJPA 1K8AC 2DEQA 1Q86U 2KVQG 3EAEA 1IGUA 3GP8A 1NM7A 3MEAA 4RG2A 3WXMB 3M58A 1RAEB 3G4ST 1VQ7T 2M02A 4XTWA 3SD4A 2K4YA 3SWNA 3DLLA 5FRMA 5GAMj 2CZ1B 2DL4A 1OX9A 4CC3A 5LJ5f 5GANe 3U23A 1NZ9A 4LD6A 2GGRA 2ZPIB 2BE7D 1PG5B 1WX6A 4IUVA 4B9WA 5LJ3d 1ZSZA 2JMCA 4VUBA 4X1VA 4J9FA 4LN2A 3G4SA 3EGXB 1M9SA 1D1AA 2LCCA 4MZMA 4F7UF 2EJ9A 4C8QG 1VQLT 2QI2A 2V1RA 1JB0E 2LQKA 1CKAA 2V8JA 1LPLA 3EH1A 1LJOA 2QDLA 2IG0A 3FDRA 4JUVA 2DBMA 3G7ZA 4QQDA 2M0YA 2KRNA 4HA8A 4PJOE 2RPNA 4UC4A 4D8KA 4Z8AA 5KCOA 3BE3A 1UECA 4M7DD 1MUZA 3VS2A 1VQMQ 2KRSA 1VQLA 4FYYB 2DL3A 2BIVA 1QVFS 3QJYA 2RB6A 1X69A 1FX7A 2VVKA 1TUCA 3EGUA 2PVDB 2AZVA 3V7SA 2CZ7B 5KYYB 3Q1JA 2R5MA 2J6KA 2V26A 3CCQT 2EBPA 3L2VA 5CO7A 3GLXA 1WXTA 4OB2B 4F17A 3EH2A 5GAN6 3OYYA 1VQNT 1ZSZC 3S3OA 2EYXA 4M7AF 2HKQB 2L5QA 3FIFA 4C8QC 4OMPA 3CPWP 2SEMA 1IGQA 1ABQA 1VQOT 2DXBA 3M5AA 2X51A 2RQWA 3OS5A 5KYXA 3M0PA 3JB9G 4E7ZA 3RNJA 2DYIA 2L0AA 2ZPEB 3CCQA 4FYXB 4QVZA 3CC7Q 4HVVA 4F16A 3TQ7P 4M7DG 1BB9A 3T9NA 1VQNA 3BW1A 4JZ3A 4BE0A 2RA2A 4LD9K 5AT1B 2E6ZA 2JZ2A 3QBYA 5EG2A 3M56A 5A2QE 4ZTJA 1WHMA 2DM1A 2JNGA 4A4KA 3TEEA 1VQOA 1OI1A 2M1HA 3VYGA 3TSWA 3OS1A 1RABB 2RM4A 3MKDA 2E3HA 5IXFA 5GANh 4P5NA 3CQTA 3PVQA 2P84A 1LVKA 4PJOD 2OI3A 2LZ6B 2BUDA 4OB3B 4O5VA 5GAMe 1KG1A 5DY9A 5IHKA 4IUUA 2QGGA 4F04B 3JV3A 3EG2A 4B9XA 2QGFB 4XQ3A 1SHFA 2CUDA 2DMOA 1AT1B 3HSBA 3CXCA 1QWEA 3ER0A 3JB9I 2RJCA 2CH4W 2D8JA 2K7AA 1N8RR 2VXFA 2ROTA 2EYWA 1VQ9Q 1YWPA 1K8AU 3E9GA 2GTOA 3OBWA 1NG2A 2AKLA 1W1FA 1S72Q 3MHXA 2Y90A 1U3OA 2XDDA 2EKOA 2LQ8A 3M59A 2LQNA 5C0MA 5CKEA 2DETA 2L3QA 1VA7A 2AZSA 1VQKT 3CCRQ 2YRVA 2KAFA 2RO0A 7AT1B 2ED1A 1D09B 4FW2A 4M75E 1RACB 4PJOG 4DOWA 1WDXA 3PNWC 2M0OA 4KH1B 4JLGA 4M7AB 1BI0A 5D6YA 4FT2A 4MDWA 1K73C 2PUOB 1VQKA 2E5KA 5HY6A 3NFCA 2QTXA 3SEMA 3CMEQ 4JLIA 1G8XA 4XTVA 3L42A 3LGLA 3I9QA 2DZCA 2DIQA 1VQ6T 1V29B 1WHKA 3CC2Q 1MMAA 1UG1A 1S1NA 4OMFB 3LLRA 3LYIA 1M27C 1Z9ZA 4M77F 2AIRB 1M90C 2LVMA 2DVEA 3WVEB 4NOYA 1ACMB 2F1LA 1M5Q1 2JVVA 3LX7A 1D3BA 4FM4B 4BDZA 1VQ6A 1IXDA 1NYGA 1OYXA 1BI2A 2EYQA 1WNLA 1HD3A 4FSXA 1X6OA 3G6EQ 3JB9H 1M2VA 3CCMT 2CP5A 2V8IA 2QDYB 4LDWA 4XTZA 1G2BA 4OB0B 4XTXA 3E19A 3S3MA 3QZ9B 4NL3A 3OSVA 1JJ2P 4C0DB 4E6RA 1KQSA 5GAMh 4BE1A 2E70A 3G1JA 1Y71A 3X24B 3RKXA 3VUZA 3CCMA 3OYFA 1QP3A 4EMGA 1FXXA 4RUGA 2D1XA 1U1TA 3JSCA 4LUEA 4IUTA 3A8LB 2RQUA 4F7UA 5GAOr 2WACA 4N4HA 5I2SA 4M75D 5LJ5j 3OA6A 2VYTA 2O88A 2O4XA 1PD1A 4FSSA 4JDSA 4J9GA 5KYWA 3CCST 4J6YA 2QEXA 4M7AD 3X28B 1WHGA 2MPXC 4JZ4A 1Z9QA 2DERA 4C92F 2KI7A 2F2XA 2FEIA 4EIKA 2KT8A 3VS4A 3CXCP 2F2VA 1RAAB 2HQHA 3L1AA 4MZPA 1T0JA 3GOXA 2GBQA 1IZ6A 3L2UA 1E6GA 3A98A 1KD1C 2GFAA 1MV3A 4E7LA 1XTDA 3UWNA 3X25B 5LL6S 3CCSA 1H92A 1UHCA 2DKGA 4OF1A 4RG8A 4Z02A 1M1GA 5GAN8 1QVGP 1GRIA 1NEGA 4Y91A 5GMKi 3CD6Q 3SHWA 1IREB 1T3LA 4KGVB 1M3CA 2LCSA 1NE8A 2LT4A 1UUEA 4J9BA 2LCLA 1G3SA 2AT1B 3LGFA 1GCQC 4M77B 5FWCA 3MP1A 1KHIA 2PQWA 3OBYA 1K76A 3C12A 4M75G 4NS5A 1H641 2EQIA 2QAZA 2FZGB 3NTHA 1RAHB 2NLUA 2F69A 2SRCA 3CCUT 4M7AG 2J6OA 2K5LA 2HQXA 4AFSC 3SWNB 2KNBB 3V7RA 4D8DA 1OX8A 2M51A 3CBMA 2FPFA 3S3NA 1NJIR 2CUBA 2COYA 2F5KA 5LJ5d 2JS2A 4KRTA 1QVPA 4E47A 1K73R 1EX4A 1K4US 3FJPA 1VQ7Q 4PFOA 3BDUA 1C0MA 3UATA 2R5AA 4GLKA 1WHHA 1VYTA 1SKUB 3O5ZA 3CCUA 1JRIA 4RTTA 1QMCA 2D9TA 1B34A 2VXEA 3ME9A 4C8QE 2ENMA 1JEGA 4CI0C 2V1QA 1BCOA 1WI7A 3I55T 3NMZC 1M90R 3HTRA 2KROA 3RMQA 4XAXB 2K6DA 1HJDA 2FVUA 2ZGWA 3UDCA 2LC4A 3ULRB 2L3RA 4KBMB 2HNIA 5KYUA 3QYHB 1C1AA 2CDTA 2E41A 3EFSA 4XU0A 4DBRA 1HK9A 3QUIA 4LUDA 1KC8C 3M0RA 5LJ3g 1CSKA 3KBGA 2KK4A 4M78A 4JRQA 4HT9A 2X4WA 4PK4A 5CAIA 1KQSP 1I5LA 2EGEA 3I55A 4OGEA 4M7AC 2DZ9A 2DL7A 2BE9B 3M4GA 3UF4A 3OSSC 2YUNA 2K5IA 2XICA 3JCMP 3OYHA 1Q7YR 3EGDB 2DPPB 3M0TA 1UGSB 1Y07A 3QO3A 1YJNT 4ZGDB 2JN0A 1YP5A 1RAFB 2NUTA 2B8AA 2YLCA 1RAIB 4AFUC 4MDXA 1KIKA 2XMFA 2EWNA 3CC4A 1D1CA 1WXBA 2AK5A 1BYMA 4HT8A 1EIFA 2OTLT 4JPBW 3GIBA 5LJ3j 5CCAA 5CKHA 4XK8E 2FPEA 4M4ZA 2L3SA 2HKNA 4AT1B 3I56T 3CPWA 4HCKA 1TOVA 5HK0A 1TH7A 1UE9A 1BI1A 3JCMf 1UJ0A 5FLXE 1YJNA 1B07A 2VWFA 5KYXB 1VQNQ 2K79A 3TREA 1JQQA 2KRMA 2MF2A 2OTLA 4QKUA 1YI2Q 1VIFA 1BCMA 4PFZA 1WHLA 3MO8A 1PRMC 5GAN2 2DAQA 3I56A 1BIBA 1QVFA 1W70A 3M0SA 4C0DC 1KD1R 2LJ0A 3QG1A 2RD1A 1N9SA 4M77A 2F5TX 4HVWA 5HK3A 2K3BA 3M9QA 4L5GA 2E1HA 5DLOA 3OYKA 1HXDA 2HMAA 1ZHIA 3EG3A 1KHCA 1IHVA 2XKOC 2H3JA 2E12A 2JJ9A 4Q5WA 1P92A 3LWIA 3MP8A 3X26B 1N8RC 3F70A 3HHTB 3QSUA 2C0OA 2A08A 2M9UA 1UJYA 3OW2S 2HD0A 1ABOA 1BIAA 2HSEB 1EZZB 1IB8A 2ZPHB 2DLPA 3L2QA 5IHIA 9ATCB 3FC3A 3MJXA 2EYYA 1X27A 4D6WA 2P0QA 1EFNA 2IIMA 4PNOA 2RK1A 3RIRA 4ZGEB 3IQLA 3E9FA 4IURA 4AG1C 2YUQA 4E7IA 3HFOA 1WYXA 1UFFA 4CC7A 2LNHB 3AT1B 3JB9D 4IUPA 3VKIA 3RUXA 3THKA 2KEAA 1U8RA 4M77C 2EW3A 1VQ8T 2D0QB 3OYNA 2CS7A 1VQKQ 4C92A 3PGGA 3NTIA 5I22A 2OTJT 1T3SA 2EPDA 1D0ZA 1FWZA 2RQRA 5D6WA 4LXCA 1AOJA 5FU7C 2RQTA 1AWJA 1KC8R 3SWNC 1VQ5A 2GFUA 3EGDA 1ZQ1A 3VYHB 1H3ZA 5FROA 2C0IA 3O8VA 1VQ8A 1YIJQ 2KXDA 1Y7XA 4GLMA 1XNIA 1NPRA 5LJ3e 2OTJA 4BD3A 2EQUA 4A4FA 1KC8U 2RJEA 4RTYA 5CVIA 2E10A 2JTEA 2VGNA 1I81A 1JU5C 3EG1A 5C6SA 4KH0B 5D7UA 3P8BB 1D3BB 4ESRA 2QQ9A 2KYMA 1KQ1A 2MCNA 4L59A 5GMKj 4OGCA 3OYCA 2DRMA 2VGMA 1GXIE 3OYEA 2DIGA 5GANf 1M2VB 2GF7A 2HL3A 4C0ZA 4A4HA 4BDYA 3TU4K 2RHIA 2RMOA 3V8LA 1QVFP 5GMKl 2MIOA 4DBQA 1WFWA 1AWWA 1JJ2A 4Y92A 4E7JA 2BZXA 5L23A 2DTHA 1G83A 4E7SA 2MAMA 1Q81C 1NLOC 1B3QA 2LQWA 2PZ1A 2PVGB 1R0BG 3RKYA 4J5YA 1RAGB 3A8MB 2DRKA 4F7UB 4F7UE 3DB4A 4AFZC 5I21A 2JS0A 4J8OA 4HVUA 2RI2A 2O4XB 2RHYA 5GJWB 2XU8A 5I2MA 5KYWB 4M78F 1GFDA 4RTUA 4JRKA 4E7KA 3CCET 2K3YA 2EYZA 3GF5A 2QA4T 1BI3A 1PCXA 1WJQA 3NGPA 3V8JA 1YN8A 1Q82C 2HCKA 1YFNA 2CZ0B 1I8FA 2RQVA 1WPYA 2H3EB 2L8DA 5CR2A 1KK7A 1K9MR 5IN1A 2J05A 5CKBA 2YDLA 4C0FA 3JCMV 4OMQA 2DEUA 2MYSA 4II1A 3CCEA 1FMKA 5ECAA 1QVGA 1PHTA 1N8RU 1YCYA 1VIEA 1G3WA 4JJCA 2QA4A 3CCVQ 1TS9A 4BE2A 1J3TA 1MNDA 2HQEA 1WJRA 5HKCA 2E6NA 4BY6B 1W2BS 2YSQA 4ZNXA 5CQXA 2L3PA 4RCBA 4C0GA 2CH4A 3ASKA 5IT9E 2GNCA 2ED0A 2KQWA 4TVRA 1NJIC 2AKKA 2DILA 3CCJT 8AT1B 4M7AE 1UDLA 1V76A 1ZSGA 4ME7A 3ZBDA 2XD0A 5LJ3h 3FLGA 4BB7A 3I5RA 2OAWA 2QQRA 2DTIA 2YWWA 3MEWA 5CQYA 2XG8D 5AYFA 4AFQC 1YITQ 3LWHA 2C06A 2XDBA 2JTFA 4BACA 3MEVA 2CKKA 3CCJA 1U1SA 4ZGJB 1N27A 3RBBB 1Y96A 1C6VX 5A0GA 1B34B 1U06A 2X35A 3PVLA 2CP6A 4R55A 4IUQA 2KT1A 2CGHA 2JM8A 4DQ2A 1IHWA 3VU3C 4OMLA 2ECZA 1D0XA 2A3LA 1YJWT 1KJWA 1XJWB 5LJ5g 1WQWA 4KT0E 2EIFA 2EGCA 3QKJA 4XTUA 5KYUB 4OMMA 1B7TA 3UA7A 3I55Q 2ESWA 4J7FA 1VQ4Q 2G6FX 5GMKm 1Q7YC 4M78B 2ATCB 2QEXT 1ZUUA 3RDVA 1UGRB 1YJWA 2LP5A 1TG0A 1O9SA 2KBTA 2LTOA 4R0KA 3H8ZA 1VQPT 5GAN5 4XU1A 2I2LA 3GNGA 3OYIA 1DJ7B 3OYLA 3V8KA 4Z88A 1Y57A 3C94A 4LDXA 1RLPC 2GQIA 1I1JA 4PJNA 4C8QF 2K2VA 1SSFA 1MNEA 4HCZA 4F7UG 1Q81R 2HAXA 2L89A 2NUTB 3EHRA 3VUBA 2C0TA 2CREA 1VQPA 3TSZA 3HRTA 1N5ZA 2DE0X 3M54A 1QCOA 1UTIA 1D1BA 3CMAQ 2H8HA 1T0HA 4WTOB 2OTLQ 3A8HB 1K0SA 3JCMd 4KUDK 3PFSA 1O75A 4A4EA 4LDVA 3I56Q 1MGQA 3NHNA 1WIEA 2DL8A 3L2WA 3JRZA 2CT4A 1Q82R 1YJ9Q 3EHQA 1WJSA 1CKBA 3VS5A 3CCRT 3G71Q 4KGZB 4ZN3A 4M77E 1MMGA 1ZA2B 3JCMb 3JCMX 3BFMA 1R77A 4PJLA 3KXTA 1Q82U 2ZCFB 4FYWB 4J9DA 2Z0WA 4KUIA 5A0LA 5FU7B 1PWTA 2VUBA 2W0ZA 1GFCA 5L8RE 3QDRB 3X20B 2DXUA 2KSSA 1FMWA 3FRNA 3CCRA 2HDAA 2CP2A 1RI0A 3M57A 1PD0A 2FB7A 2XHCA 5CIUA 3SB2A 4RMOA 3J81E 3G4SQ 4DBFA 2E5QA 2A36A 4XU3A 4M7DF 2YUPA 1I4K1 4X9DA 3L2RA 4A4GA 1M8MA 3J80E 4E2FB 2D8HA 2YLBA 1OEBA 1NJIU 2CSIA 4ELYC 3OMGA 4J83A 5GANj 1PSEA 1K73U 2DL5A 2E3IA 1PKSA 1JXMA 4WF2A 3RR6A 2YXYA 2K5FA 3VV0A 1UGQB 3E2UA 4OMNA 2COWA 2HZYA 2LDMA 4A54A 4N4GA 4HCBA 2NUPA 2FHDA 4BY6C 2MWPA 4OB1B 1VQLQ 1M90U 1F1BB 1TWBA 2RI5A 1QKWA 4C92E 4C92B 3CC4T 4M78G 4EPCA 3CBPA 3QZ5B 4LDYA 2I0NA 2WSFE 1BKBA 2QK0A 2DX1A 4QW2A 5HCKA 3EG9A 2HSPA 4QQ6A 2FZKB 1TXQA 2D6FA 5LJ5e 3VRYA 5FU6B 1BU1A 3HFNA 4M77D 3L2ZA 3FB9A 3H6ZA 2MWOA 1ZUYA 2RHUA 5KE3A 3QPHA 4ATOA 1QWFA 1Q7YU 1WZOA 3M4YA 3RMSA 2HL5C 2XIDA 5GAN3 3GNFB 1OZ2A 1OV3A 3VRZA 3CCQQ 1U5SA 2WSEE 4PJOF 5GAN7 1SF9A 5DM7R 2COZA 3H0IA 4J6XA 5KH6A 1AD5A 3REAB 5A0DA 4C5IA 5GANd 2X4JA 3CCLT 2LX9A 2K57A 3HPWA 4LE9A 3KFVA 3PIPA 2BKDN 1VQOQ 4ELZC 1AWXA 4M78C 3QYGB 2VV5A 4PL6A 2GTJA 3A1PA 2DBKA 2MOXA 1M1KR 4M7DB 3H0FA 4M77G 1PRLC 2CYZB 4HKEA 3VS0A 4JRIA 3LH0A 2LRQA 4OVAA 2YUOA 4QVCA 1KD1U 3GPLA 4V2SA 3RESA 3BDLA 1YHQT 3CCLA 4GBQA 3OMCA 1RUWA 2P4TA 1YNZA 4C92D 3META 1JBMA 3URGA 3OYGA 1AWOA 2EKHA 1K9MC 3VS7A 4PFPA 2XI9A 4FCYA 3EFRA 2P0KA 3OY9A 1IO6A
chains in the Genus database with same CATH topology
1G2BA 2DRKA 4AFZC 2KR3A 2BZ8A 2JS0A 4HVUA 4QT7A 1V1CA 1JXOA 1E7OA 4RTXA 4OMOA 5GJWB 4E6RA 4F14A 2L2PA 1GFDA 4RTUA 2KE9A 1SSHA 2EYZA 1QLYA 4WCIA 4RUGA 2D1XA 1WLPB 3NGPA 4LUEA 1YN8A 2RQUA 2HCKA 2DF6A 3LH5A 2RQVA 2O88A 4FSSA 2J05A 4J9GA 4CC4B 5FW9A 2O9SA 2YDLA 4JZ4A 5IHNA 1Z9QA 2A37A 3REBB 4OMQA 2BZYA 1UHFA 5EC7A 1FMKA 4HXJA 2F2XA 2FEIA 5ECAA 1PHTA 1ZX6A 2O2OA 1LCKA 4EIKA 4JJCA 2KT8A 3VS4A 2F2VA 5GJVB 3M0QA 3EG0A 4LNPA 3C0CA 1J3TA 3H0HA 1T0JA 2GBQA 1X6BA 1E6GA 3A98A 1NEBA 3TVTA 1A0NB 2YSQA 1MV3A 4ZNXA 1H3HA 2L3PA 2X3XD 2CH4A 4RTWA 1QKXA 2ABLA 1H92A 1UHCA 2GNCA 2ED0A 2AKKA 2DILA 1UDLA 2JW4A 4J9CA 1ZSGA 1GRIA 1NEGA 2KXCA 1ZBJA 1VYUA 3SHWA 1T3LA 2J7IA 3I5RA 1MV0B 1M3CA 2OAWA 1ARKA 2LCSA 1UUEA 2BTTA 2DA9A 4J9BA 1M30A 2EGAA 4JJBA 5IH2A 1GCQC 5FWCA 2CT3A 2OJ2A 4IIMA 4AFQC 2JT4A 1K76A 3R6NA 2DNUA 4DEXA 2RNAA 2EQIA 4A63B 2DYBA 1HSQA 4DEYA 2HBWA 2RN8A 1AZEA 1NLPC 2SRCA 3RBBB 1AZGB 1OPLA 2J6OA 2DJQA 1UGVA 3M0UA 4AFSC 1U06A 3PVLA 2KNBB 4D8DA 2M51A 2FPFA 2KT1A 2P4RA 2JM8A 1ZLMA 4J9EA 2CUBA 3VS1A 4OMLA 2ECZA 2JS2A 4KRTA 2O9VA 3I35A 1KJWA 1K4US 1NM7A 2EGCA 4ORZA 3UATA 2JXBA 2JMAA 4OMMA 1VYTA 1M3AA 3O5ZA 4RTTA 2KGTA 3UA7A 2ESWA 2ENMA 2G6FX 1JEGA 2DL4A 2V1QA 4CC3A 1H8KA 1WI7A 3U23A 3NMZC 1SPKA 1ZUUA 2KROA 2GGRA 2K6DA 2B86A 1HJDA 2LP5A 1TG0A 2KBTA 4R0KA 2RF0A 1XOVA 1WX6A 3ULRB 2FG0A 2CDTA 2JMCA 4Z88A 4X1VA 1Y57A 4J9FA 1RLPC 4LN2A 1GBQA 4LUDA 3M0RA 2GQIA 1I1JA 1AVZC 1CSKA 2NUZA 2EGEA 2V1RA 1Y0MA 1CKAA 1M3BA 3EHRA 3UF4A 2DL7A 2C0TA 2QDLA 2CREA 3TSZA 2YUNA 3GBQA 1X2KA 2DBMA 2LX7A 1N5ZA 2NWMA 2DE0X 2M0YA 2KRNA 2KYBA 3M0TA 1UTIA 2RPNA 4D8KA 4Z8AA 4Z89A 2H8HA 1T0HA 1RLQC 3PE0A 1RI9A 1YP5A 5FWBA 1K0SA 1UECA 1MUZA 3VS2A 4AFUC 1KIKA 2XMFA 2KRSA 1WXBA 2DL3A 2AK5A 2J06A 4IIOA 5IXBA 4JPBW 3ZL7C 3NHNA 1X69A 2VVKA 1TUCA 1WIEA 2DL8A 2FPEA 4M4ZA 2CT4A 3EGUA 2AZVA 2L3SA 3EHQA 1AEYA 2ROLA 1CKBA 1VYVA 1BBZA 3VS5A 4HCKA 3FJ5A 1QCFA 4RTVA 1UE9A 2J6KA 1UJ0A 1B07A 2VWFA 4JJDA 2EBPA 2K79A 1JQQA 4J9DA 2KRMA 1WXTA 4F17A 2F2WA 1NYFA 2EYXA 1PRMC 3QWXX 1PWTA 2W0ZA 1GFCA 4OMPA 2SEMA 1W70A 1I0CA 4RTZA 3M0SA 2LJ0A 2HDAA 1ABQA 1JO8A 2RQWA 1TUDA 3M0PA 4HVWA 3RNJA 2L0AA 2K3BA 1K1ZA 4HVVA 4J9HA 2A36A 4F16A 2YUPA 1BB9A 3EG3A 2PTKA 1M8MA 2DVJA 4JZ3A 2D8HA 3VS6A 1OEBA 1PNJA 1SRMA 2DM1A 2C0OA 2CSIA 3UA6A 2A08A 3TSWA 2DL5A 1PKSA 1JXMA 1YWOA 1UJYA 3VS3A 1ABOA 5IXFA 1ZUKA 4OMNA 3CQTA 3PVQA 2DLPA 2OI3A 1KSWA 2D0NA 2LZ6B 5IHIA 2EYYA 5IHKA 1X27A 2LMJA 3JV3A 1GCQA 1EFNA 1OPKA 2EVRA 2LJ1A 1QKWA 2K2MA 3EG2A 2IIMA 1SHFA 2CUDA 3IQLA 2DMOA 1WA7A 2I0NA 4AG1C 2FPDA 1SRLA 5I11A 2J6FA 2HEQA 2DX1A 5HCKA 1QWEA 2YUQA 4CC2A 1X2QA 2CH4W 2D8JA 1WYXA 1UFFA 2K7AA 2HSPA 1OOTA 4CC7A 2LNHB 2FO0A 1FYNA 2ROTA 2EYWA 3THKA 3VRYA 1YWPA 2KEAA 1SEMA 1BU1A 1BK2A 2GTOA 2EW3A 1NG2A 2AKLA 1X43A 1W1FA 4J9IA 1U3OA 2CSQA 2LQNA 5I22A 1GCPA 1T3SA 1W6XA 2EPDA 2L3QA 1ZUYA 2RQRA 1VA7A 2AZSA 1AOJA 2RQTA 1AWJA 2X3WD 1QWFA 1WXUA 2K9GA 2FRWA 1PKTA 1OV3A 1SHGA 3VRZA 2ED1A 1U5SA 1E6HA 2VKNA 2C0IA 3H0IA 1WDXA 2O31A 2KXDA 4GLMA 2A28A 1I07A 2LJ3A 1AD5A 2FRYA 3REAB 4RTYA 2JTEA 2E5KA 3SEMA 1JU5C 3EG1A 3NPFA 3I9QA 4LE9A 3KFVA 1AWXA 3QWYA 4ESRA 2KYMA 4AG2C 2MCNA 2GTJA 1UG1A 1S1NA 2DBKA 2MOXA 2PNIA 2DRMA 1M27C 3H0FA 1Z9ZA 1PRLC 3VS0A 2YT6A 2JM9A 2YUOA 1GL5A 1K9AA 1K0XA 3I5SA 2RMOA 4GBQA 1RUWA 2MIOA 1AWWA 1WFWA 1KFZA 1YNZA 4Y92A 2BZXA 1NYGA 5L23A 1X6GA 1GBRA 1G83A 3H41A 2EKHA 1AWOA 3VS7A 1HD3A 1NLOC 1YCSB 1B3QA 2LQWA 2W10A 2PZ1A 4K11A 1IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  2DRK A;  4AFZ C;  2KR3 A;  2BZ8 A;  2JS0 A;  4HVU A;  4QT7 A;  1V1C A;  1JXO A;  1E7O A;  4RTX A;  4OMO A;  5GJW B;  4E6R A;  4F14 A;  2L2P A;  1GFD A;  4RTU A;  2KE9 A;  1SSH A;  2EYZ A;  1QLY A;  4WCI A;  4RUG A;  2D1X A;  1WLP B;  3NGP A;  4LUE A;  1YN8 A;  2RQU A;  2HCK A;  2DF6 A;  3LH5 A;  2RQV A;  2O88 A;  4FSS A;  2J05 A;  4J9G A;  4CC4 B;  5FW9 A;  2O9S A;  2YDL A;  4JZ4 A;  5IHN A;  1Z9Q A;  2A37 A;  3REB B;  4OMQ A;  2BZY A;  1UHF A;  5EC7 A;  1FMK A;  4HXJ A;  2F2X A;  2FEI A;  5ECA A;  1PHT A;  1ZX6 A;  2O2O A;  1LCK A;  4EIK A;  4JJC A;  2KT8 A;  3VS4 A;  2F2V A;  5GJV B;  3M0Q A;  3EG0 A;  4LNP A;  3C0C A;  1J3T A;  3H0H A;  1T0J A;  2GBQ A;  1X6B A;  1E6G A;  3A98 A;  1NEB A;  3TVT A;  1A0N B;  2YSQ A;  1MV3 A;  4ZNX A;  1H3H A;  2L3P A;  2X3X D;  2CH4 A;  4RTW A;  1QKX A;  2ABL A;  1H92 A;  1UHC A;  2GNC A;  2ED0 A;  2AKK A;  2DIL A;  1UDL A;  2JW4 A;  4J9C A;  1ZSG A;  1GRI A;  1NEG A;  2KXC A;  1ZBJ A;  1VYU A;  3SHW A;  1T3L A;  2J7I A;  3I5R A;  1MV0 B;  1M3C A;  2OAW A;  1ARK A;  2LCS A;  1UUE A;  2BTT A;  2DA9 A;  4J9B A;  1M30 A;  2EGA A;  4JJB A;  5IH2 A;  1GCQ C;  5FWC A;  2CT3 A;  2OJ2 A;  4IIM A;  4AFQ C;  2JT4 A;  1K76 A;  3R6N A;  2DNU A;  4DEX A;  2RNA A;  2EQI A;  4A63 B;  2DYB A;  1HSQ A;  4DEY A;  2HBW A;  2RN8 A;  1AZE A;  1NLP C;  2SRC A;  3RBB B;  1AZG B;  1OPL A;  2J6O A;  2DJQ A;  1UGV A;  3M0U A;  4AFS C;  1U06 A;  3PVL A;  2KNB B;  4D8D A;  2M51 A;  2FPF A;  2KT1 A;  2P4R A;  2JM8 A;  1ZLM A;  4J9E A;  2CUB A;  3VS1 A;  4OML A;  2ECZ A;  2JS2 A;  4KRT A;  2O9V A;  3I35 A;  1KJW A;  1K4U S;  1NM7 A;  2EGC A;  4ORZ A;  3UAT A;  2JXB A;  2JMA A;  4OMM A;  1VYT A;  1M3A A;  3O5Z A;  4RTT A;  2KGT A;  3UA7 A;  2ESW A;  2ENM A;  2G6F X;  1JEG A;  2DL4 A;  2V1Q A;  4CC3 A;  1H8K A;  1WI7 A;  3U23 A;  3NMZ C;  1SPK A;  1ZUU A;  2KRO A;  2GGR A;  2K6D A;  2B86 A;  1HJD A;  2LP5 A;  1TG0 A;  2KBT A;  4R0K A;  2RF0 A;  1XOV A;  1WX6 A;  3ULR B;  2FG0 A;  2CDT A;  2JMC A;  4Z88 A;  4X1V A;  1Y57 A;  4J9F A;  1RLP C;  4LN2 A;  1GBQ A;  4LUD A;  3M0R A;  2GQI A;  1I1J A;  1AVZ C;  1CSK A;  2NUZ A;  2EGE A;  2V1R A;  1Y0M A;  1CKA A;  1M3B A;  3EHR A;  3UF4 A;  2DL7 A;  2C0T A;  2QDL A;  2CRE A;  3TSZ A;  2YUN A;  3GBQ A;  1X2K A;  2DBM A;  2LX7 A;  1N5Z A;  2NWM A;  2DE0 X;  2M0Y A;  2KRN A;  2KYB A;  3M0T A;  1UTI A;  2RPN A;  4D8K A;  4Z8A A;  4Z89 A;  2H8H A;  1T0H A;  1RLQ C;  3PE0 A;  1RI9 A;  1YP5 A;  5FWB A;  1K0S A;  1UEC A;  1MUZ A;  3VS2 A;  4AFU C;  1KIK A;  2XMF A;  2KRS A;  1WXB A;  2DL3 A;  2AK5 A;  2J06 A;  4IIO A;  5IXB A;  4JPB W;  3ZL7 C;  3NHN A;  1X69 A;  2VVK A;  1TUC A;  1WIE A;  2DL8 A;  2FPE A;  4M4Z A;  2CT4 A;  3EGU A;  2AZV A;  2L3S A;  3EHQ A;  1AEY A;  2ROL A;  1CKB A;  1VYV A;  1BBZ A;  3VS5 A;  4HCK A;  3FJ5 A;  1QCF A;  4RTV A;  1UE9 A;  2J6K A;  1UJ0 A;  1B07 A;  2VWF A;  4JJD A;  2EBP A;  2K79 A;  1JQQ A;  4J9D A;  2KRM A;  1WXT A;  4F17 A;  2F2W A;  1NYF A;  2EYX A;  1PRM C;  3QWX X;  1PWT A;  2W0Z A;  1GFC A;  4OMP A;  2SEM A;  1W70 A;  1I0C A;  4RTZ A;  3M0S A;  2LJ0 A;  2HDA A;  1ABQ A;  1JO8 A;  2RQW A;  1TUD A;  3M0P A;  4HVW A;  3RNJ A;  2L0A A;  2K3B A;  1K1Z A;  4HVV A;  4J9H A;  2A36 A;  4F16 A;  2YUP A;  1BB9 A;  3EG3 A;  2PTK A;  1M8M A;  2DVJ A;  4JZ3 A;  2D8H A;  3VS6 A;  1OEB A;  1PNJ A;  1SRM A;  2DM1 A;  2C0O A;  2CSI A;  3UA6 A;  2A08 A;  3TSW A;  2DL5 A;  1PKS A;  1JXM A;  1YWO A;  1UJY A;  3VS3 A;  1ABO A;  5IXF A;  1ZUK A;  4OMN A;  3CQT A;  3PVQ A;  2DLP A;  2OI3 A;  1KSW A;  2D0N A;  2LZ6 B;  5IHI A;  2EYY A;  5IHK A;  1X27 A;  2LMJ A;  3JV3 A;  1GCQ A;  1EFN A;  1OPK A;  2EVR A;  2LJ1 A;  1QKW A;  2K2M A;  3EG2 A;  2IIM A;  1SHF A;  2CUD A;  3IQL A;  2DMO A;  1WA7 A;  2I0N A;  4AG1 C;  2FPD A;  1SRL A;  5I11 A;  2J6F A;  2HEQ A;  2DX1 A;  5HCK A;  1QWE A;  2YUQ A;  4CC2 A;  1X2Q A;  2CH4 W;  2D8J A;  1WYX A;  1UFF A;  2K7A A;  2HSP A;  1OOT A;  4CC7 A;  2LNH B;  2FO0 A;  1FYN A;  2ROT A;  2EYW A;  3THK A;  3VRY A;  1YWP A;  2KEA A;  1SEM A;  1BU1 A;  1BK2 A;  2GTO A;  2EW3 A;  1NG2 A;  2AKL A;  1X43 A;  1W1F A;  4J9I A;  1U3O A;  2CSQ A;  2LQN A;  5I22 A;  1GCP A;  1T3S A;  1W6X A;  2EPD A;  2L3Q A;  1ZUY A;  2RQR A;  1VA7 A;  2AZS A;  1AOJ A;  2RQT A;  1AWJ A;  2X3W D;  1QWF A;  1WXU A;  2K9G A;  2FRW A;  1PKT A;  1OV3 A;  1SHG A;  3VRZ A;  2ED1 A;  1U5S A;  1E6H A;  2VKN A;  2C0I A;  3H0I A;  1WDX A;  2O31 A;  2KXD A;  4GLM A;  2A28 A;  1I07 A;  2LJ3 A;  1AD5 A;  2FRY A;  3REA B;  4RTY A;  2JTE A;  2E5K A;  3SEM A;  1JU5 C;  3EG1 A;  3NPF A;  3I9Q A;  4LE9 A;  3KFV A;  1AWX A;  3QWY A;  4ESR A;  2KYM A;  4AG2 C;  2MCN A;  2GTJ A;  1UG1 A;  1S1N A;  2DBK A;  2MOX A;  2PNI A;  2DRM A;  1M27 C;  3H0F A;  1Z9Z A;  1PRL C;  3VS0 A;  2YT6 A;  2JM9 A;  2YUO A;  1GL5 A;  1K9A A;  1K0X A;  3I5S A;  2RMO A;  4GBQ A;  1RUW A;  2MIO A;  1AWW A;  1WFW A;  1KFZ A;  1YNZ A;  4Y92 A;  2BZX A;  1NYG A;  5L23 A;  1X6G A;  1GBR A;  1G83 A;  3H41 A;  2EKH A;  1AWO A;  3VS7 A;  1HD3 A;  1NLO C;  1YCS B;  1B3Q A;  2LQW A;  2W10 A;  2PZ1 A;  4K11 A;  1IO6 A; 
#chains in the Genus database with same CATH topology
 2WSC E;  2QQA A;  1N9R A;  2QG9 B;  2KR3 A;  2BZ8 A;  2RK2 A;  1YHQ A;  1OZ3 A;  3INZ A;  4QT7 A;  1E7O A;  1M1F A;  5DLQ E;  2RJD A;  3CCE Q;  2QA4 Q;  2KE9 A;  1SSH A;  4CRI A;  2QAS A;  3E1S A;  1D0Y A;  1VQ7 A;  2OX7 A;  4C8Q A;  1VQ5 T;  2DF6 A;  2VAS A;  3KUF A;  3A5Z B;  2X4X A;  5J39 A;  5LJ5 h;  3CPW S;  2O9S A;  4C5G A;  5IHN A;  2A37 A;  4JJN K;  3QXE B;  2BZY A;  5EC7 A;  4HXJ A;  4C92 G;  2O2O A;  1LCK A;  3QJ6 A;  5GAO q;  1TU0 B;  2A0F B;  2LNV A;  3M0Q A;  2IPO B;  4LNP A;  1UEB A;  1LNX A;  4PJO B;  3OW2 P;  4DA4 A;  1NEB A;  1UB4 A;  4FL6 A;  1H3H A;  3CCJ Q;  2X9H A;  3A8G B;  2ABL A;  2PUK B;  3OYA A;  4MML A;  1OQK A;  1NPP A;  4C5H A;  4J9C A;  1PM3 A;  1ZBJ A;  1ZBX A;  1M8V A;  1VQ6 Q;  3OYJ A;  1Y96 B;  1ARK A;  2KMT A;  4ZN1 A;  5IH2 A;  2DJZ A;  4PJJ A;  4IIM A;  3TCJ A;  5GAM d;  2JT4 A;  5D6X A;  4KUL A;  3R6N A;  4M75 F;  4QQG A;  3PT9 A;  2DYB A;  4L6V 5;  4RKU E;  3FEO A;  2RN8 A;  1W2B A;  1AZE A;  3M55 A;  1YI2 T;  1OPL A;  1QCN A;  2YHT A;  4B6M A;  3M0U A;  1G3T A;  3C95 A;  4FW1 A;  2YRC A;  2EQK A;  4DBH A;  1YJW Q;  1TUG B;  1ZLM A;  4J9E A;  4C92 C;  4FT4 A;  3CCM Q;  1M2O A;  3JCM Q;  4M7D A;  3I35 A;  4IKF A;  3HP9 A;  1QP2 A;  1R8O B;  1M4Z A;  1PC0 A;  2KY9 A;  2G3R A;  4ORZ A;  3JCM c;  4A53 A;  2JXB A;  2JMA A;  2E65 A;  1M3A A;  1XQH A;  2R57 A;  1YI2 A;  2KGT A;  5FU6 C;  3EFO A;  3OB9 A;  2QEX Q;  5CKD A;  4FYV B;  4EMK B;  3WVD B;  3PIO A;  3JCM J;  3C4S A;  2FL7 A;  2R58 A;  1H8K A;  3P8H A;  1VQP Q;  1SPK A;  4BI4 A;  2B86 A;  2RF0 A;  1XOV A;  1X01 A;  2QQS A;  2FG0 A;  1G5V A;  2QXF A;  3R6O A;  1GBQ A;  1IRX A;  1AVZ C;  3HKS A;  3CCS Q;  2NUZ A;  3S6W A;  3HL8 A;  4JRP A;  4N4I A;  1K8A R;  2IVW A;  2DXC A;  1Y0M A;  2PU9 B;  1M3B A;  5GAO l;  2RH2 A;  3GBQ A;  4X34 A;  1X2K A;  5LJ3 f;  3H9N A;  4EMH A;  4XTY A;  5J26 A;  2LX7 A;  2NWM A;  2KYB A;  1K9M U;  3EGX A;  3MPU B;  2DTO A;  2EQM A;  4Z89 A;  2RJF A;  1RLQ C;  3PE0 A;  1RI9 A;  5FWB A;  2EAY A;  4M7D C;  2PVO B;  4OP0 A;  1G3Y A;  2J06 A;  4IIO A;  3JCM g;  4FU6 A;  5IAY A;  5IXB A;  3ZL7 C;  1VQM T;  3D7S B;  1AEY A;  2ROL A;  1VYV A;  4ANJ A;  1BBZ A;  4J7I A;  3FJ5 A;  4PJO A;  2VC8 A;  2RHZ A;  1QCF A;  3QHS A;  4RTV A;  2ZPG B;  4M75 B;  2KDS A;  2X4Y A;  4XU2 A;  4JJD A;  2RI3 A;  4PKC C;  4PLL A;  1YIJ T;  1YBY A;  3CCU Q;  1JJ2 S;  2F2W A;  1NYF A;  3V7C A;  1MMD A;  1VQM A;  3QWX X;  5KYY A;  3UPU A;  1I0C A;  4RTZ A;  6AT1 B;  1I5O B;  1JO8 A;  2P0P A;  5GAM f;  1TUD A;  5GMK e;  1VUB A;  1WGS A;  3SFM A;  3PTA A;  1K1Z A;  4PJM A;  2CP0 A;  4DOV A;  1TSF A;  4J9H A;  1YIJ A;  2K3X A;  1SG5 A;  4J6W A;  2PTK A;  1W2B P;  2DVJ A;  4JS4 A;  3CC7 T;  2LT1 A;  1VOM A;  2ZAE A;  2ZPF B;  2NUP B;  3VS6 A;  1WQ7 A;  1PNJ A;  2DD4 A;  5FRN A;  1SRM A;  3JCM W;  3HRS A;  4M78 E;  3CXC S;  3UA6 A;  1YWO A;  4FIB A;  3VS3 A;  1ZUK A;  1RAD B;  2YRD A;  3EG9 B;  4PJO C;  4KGX B;  1KSW A;  3CC7 A;  2D0N A;  2EJG A;  1OU8 A;  3HRU A;  3LW5 E;  3CC4 Q;  1QVG S;  2MI6 A;  4EMK A;  2LMJ A;  1GCQ A;  1OPK A;  2EVR A;  2LJ1 A;  2K2M A;  1WA7 A;  3MCA B;  2CP3 A;  1SRL A;  2FPD A;  5I11 A;  2HEQ A;  2J6F A;  4CC2 A;  1X2Q A;  2O01 E;  3OYD A;  1OOT A;  2FO0 A;  1FYN A;  4MMK A;  1YJN Q;  3DKM A;  1SEM A;  1BK2 A;  1Q81 U;  1X43 A;  4J9I A;  5CKF A;  1VQ9 T;  1QQJ A;  2ZPB B;  2CSQ A;  2JOY A;  2FYK A;  1GCP A;  2MK5 A;  1W6X A;  1QW1 A;  1S72 T;  1M1K C;  2CZ6 B;  5GAO m;  1Q95 G;  2DK3 A;  2X3W D;  1WXU A;  2K9G A;  2FRW A;  3ZFJ A;  5GAN 4;  1PKT A;  1Q86 C;  3CBO A;  3CCV T;  1SHG A;  1E6H A;  1X75 C;  2VKN A;  2O31 A;  3OS2 A;  1VQ9 A;  2EJF A;  2A28 A;  1I07 A;  4R56 A;  1TTH B;  2LJ3 A;  2FRY A;  2E64 A;  1NBE B;  1S72 A;  3RER A;  3CCL Q;  2QTV A;  3QDF A;  4MZT A;  4BI8 B;  4HCC A;  4N0A A;  5GAN g;  2MMP A;  3NPF A;  5J3B A;  2EQJ A;  4EMK C;  4M78 D;  3CME T;  3QWY A;  4LDU A;  3CCV A;  4M75 A;  4AG2 C;  3P8D A;  2M16 A;  3JB9 F;  2XDP A;  2PNI A;  1AHJ B;  5CK9 A;  3CC2 T;  4M7A A;  2HBP A;  1YIT T;  2YT6 A;  8ATC B;  5M9O A;  5GMK h;  1YHQ Q;  2JM9 A;  1KQS S;  2XK0 A;  1GL5 A;  1K9A A;  1K0X A;  3I5S A;  3JCM e;  1WHJ A;  3CME A;  1KFZ A;  3OYB A;  2A7Y A;  1X6G A;  1GBR A;  3H41 A;  3ZEH A;  2ZZD A;  2GCX A;  1YCS B;  3SDZ A;  3CC2 A;  2QQB A;  2W10 A;  5GAO p;  4QVD A;  1YIT A;  3PMI A;  4K11 A;  1UGP B;  3M53 A;  3G6E T;  4ZTF A;  1ZSZ B;  1LOJ A;  3MEU A;  2DXT A;  4C8Q B;  4EDU A;  2VB6 A;  5KE2 A;  1MHN A;  1V1C A;  1JXO A;  2DFU A;  3PMT A;  2E4H A;  4RTX A;  4OMO A;  4F14 A;  1VQ4 T;  2L2P A;  1OU9 A;  2FZC B;  4N0A C;  1VQ5 Q;  1QLY A;  4WCI A;  2GQV A;  1WLP B;  3MP6 A;  3G6E A;  1VQ8 Q;  4M75 C;  2OAU A;  4O6J A;  3LH5 A;  3OW2 A;  1R0C B;  2JUF A;  2OTJ Q;  4CC4 B;  5FW9 A;  2CP7 A;  1VQ4 A;  5GAO n;  4Y28 E;  3REB B;  1UHF A;  3DLM A;  4RCC A;  1ZX6 A;  4X9C A;  1RL2 A;  1HYO A;  2JTM A;  2DD5 A;  5GJV B;  4E7H A;  3EG0 A;  2QYZ A;  3C0C A;  3H0H A;  1X6B A;  3QII A;  3TVT A;  2Y4X A;  3BY7 A;  1A0N B;  2AHJ B;  3CMA T;  1W4S A;  2X3X D;  4RTW A;  1QKX A;  2V8K A;  4JS5 A;  4PLI A;  4GY5 A;  2JW4 A;  3AHU A;  2KXC A;  1N6A A;  3UT1 A;  1VYU A;  2J7I A;  1MV0 B;  3J7A F;  2DA9 A;  2BTT A;  3RKW A;  4BUG A;  1YJ9 T;  2EFI A;  1M30 A;  3CD6 T;  1ZA1 B;  2EGA A;  4JJB A;  2CT3 A;  3DB3 A;  1FMV A;  2OJ2 A;  4NL2 A;  3G71 T;  3N5B B;  1PSF A;  3CMA A;  3OQ5 A;  3NTK A;  2DNU A;  4M7D E;  3JB9 J;  2NYS A;  2Y4Y A;  4C5E A;  2RNA A;  4DEX A;  5GAM g;  4BI3 A;  4A63 B;  1HSQ A;  4DEY A;  4AMC A;  2DO3 A;  2HBW A;  3CEY A;  1Q86 R;  2RHX A;  1NLP C;  4C8Q D;  1KQ2 A;  1AZG B;  5KCH A;  2DJQ A;  1UGV A;  1MMN A;  3OS0 A;  3EFO B;  4YTL A;  5KYN A;  3JAM E;  3OYM A;  1YJ9 A;  3A8O B;  1M1K U;  3CD6 A;  2P4R A;  1OUL A;  3JCM h;  3CPF A;  3VS1 A;  2O9V A;  3G71 A;  3VJP A;  1K8A C;  2DEQ A;  1Q86 U;  2KVQ G;  3EAE A;  1IGU A;  3GP8 A;  1NM7 A;  3MEA A;  4RG2 A;  3WXM B;  3M58 A;  1RAE B;  3G4S T;  1VQ7 T;  2M02 A;  4XTW A;  3SD4 A;  2K4Y A;  3SWN A;  3DLL A;  5FRM A;  5GAM j;  2CZ1 B;  2DL4 A;  1OX9 A;  4CC3 A;  5LJ5 f;  5GAN e;  3U23 A;  1NZ9 A;  4LD6 A;  2GGR A;  2ZPI B;  2BE7 D;  1PG5 B;  1WX6 A;  4IUV A;  4B9W A;  5LJ3 d;  1ZSZ A;  2JMC A;  4VUB A;  4X1V A;  4J9F A;  4LN2 A;  3G4S A;  3EGX B;  1M9S A;  1D1A A;  2LCC A;  4MZM A;  4F7U F;  2EJ9 A;  4C8Q G;  1VQL T;  2QI2 A;  2V1R A;  1JB0 E;  2LQK A;  1CKA A;  2V8J A;  1LPL A;  3EH1 A;  1LJO A;  2QDL A;  2IG0 A;  3FDR A;  4JUV A;  2DBM A;  3G7Z A;  4QQD A;  2M0Y A;  2KRN A;  4HA8 A;  4PJO E;  2RPN A;  4UC4 A;  4D8K A;  4Z8A A;  5KCO A;  3BE3 A;  1UEC A;  4M7D D;  1MUZ A;  3VS2 A;  1VQM Q;  2KRS A;  1VQL A;  4FYY B;  2DL3 A;  2BIV A;  1QVF S;  3QJY A;  2RB6 A;  1X69 A;  1FX7 A;  2VVK A;  1TUC A;  3EGU A;  2PVD B;  2AZV A;  3V7S A;  2CZ7 B;  5KYY B;  3Q1J A;  2R5M A;  2J6K A;  2V26 A;  3CCQ T;  2EBP A;  3L2V A;  5CO7 A;  3GLX A;  1WXT A;  4OB2 B;  4F17 A;  3EH2 A;  5GAN 6;  3OYY A;  1VQN T;  1ZSZ C;  3S3O A;  2EYX A;  4M7A F;  2HKQ B;  2L5Q A;  3FIF A;  4C8Q C;  4OMP A;  3CPW P;  2SEM A;  1IGQ A;  1ABQ A;  1VQO T;  2DXB A;  3M5A A;  2X51 A;  2RQW A;  3OS5 A;  5KYX A;  3M0P A;  3JB9 G;  4E7Z A;  3RNJ A;  2DYI A;  2L0A A;  2ZPE B;  3CCQ A;  4FYX B;  4QVZ A;  3CC7 Q;  4HVV A;  4F16 A;  3TQ7 P;  4M7D G;  1BB9 A;  3T9N A;  1VQN A;  3BW1 A;  4JZ3 A;  4BE0 A;  2RA2 A;  4LD9 K;  5AT1 B;  2E6Z A;  2JZ2 A;  3QBY A;  5EG2 A;  3M56 A;  5A2Q E;  4ZTJ A;  1WHM A;  2DM1 A;  2JNG A;  4A4K A;  3TEE A;  1VQO A;  1OI1 A;  2M1H A;  3VYG A;  3TSW A;  3OS1 A;  1RAB B;  2RM4 A;  3MKD A;  2E3H A;  5IXF A;  5GAN h;  4P5N A;  3CQT A;  3PVQ A;  2P84 A;  1LVK A;  4PJO D;  2OI3 A;  2LZ6 B;  2BUD A;  4OB3 B;  4O5V A;  5GAM e;  1KG1 A;  5DY9 A;  5IHK A;  4IUU A;  2QGG A;  4F04 B;  3JV3 A;  3EG2 A;  4B9X A;  2QGF B;  4XQ3 A;  1SHF A;  2CUD A;  2DMO A;  1AT1 B;  3HSB A;  3CXC A;  1QWE A;  3ER0 A;  3JB9 I;  2RJC A;  2CH4 W;  2D8J A;  2K7A A;  1N8R R;  2VXF A;  2ROT A;  2EYW A;  1VQ9 Q;  1YWP A;  1K8A U;  3E9G A;  2GTO A;  3OBW A;  1NG2 A;  2AKL A;  1W1F A;  1S72 Q;  3MHX A;  2Y90 A;  1U3O A;  2XDD A;  2EKO A;  2LQ8 A;  3M59 A;  2LQN A;  5C0M A;  5CKE A;  2DET A;  2L3Q A;  1VA7 A;  2AZS A;  1VQK T;  3CCR Q;  2YRV A;  2KAF A;  2RO0 A;  7AT1 B;  2ED1 A;  1D09 B;  4FW2 A;  4M75 E;  1RAC B;  4PJO G;  4DOW A;  1WDX A;  3PNW C;  2M0O A;  4KH1 B;  4JLG A;  4M7A B;  1BI0 A;  5D6Y A;  4FT2 A;  4MDW A;  1K73 C;  2PUO B;  1VQK A;  2E5K A;  5HY6 A;  3NFC A;  2QTX A;  3SEM A;  3CME Q;  4JLI A;  1G8X A;  4XTV A;  3L42 A;  3LGL A;  3I9Q A;  2DZC A;  2DIQ A;  1VQ6 T;  1V29 B;  1WHK A;  3CC2 Q;  1MMA A;  1UG1 A;  1S1N A;  4OMF B;  3LLR A;  3LYI A;  1M27 C;  1Z9Z A;  4M77 F;  2AIR B;  1M90 C;  2LVM A;  2DVE A;  3WVE B;  4NOY A;  1ACM B;  2F1L A;  1M5Q 1;  2JVV A;  3LX7 A;  1D3B A;  4FM4 B;  4BDZ A;  1VQ6 A;  1IXD A;  1NYG A;  1OYX A;  1BI2 A;  2EYQ A;  1WNL A;  1HD3 A;  4FSX A;  1X6O A;  3G6E Q;  3JB9 H;  1M2V A;  3CCM T;  2CP5 A;  2V8I A;  2QDY B;  4LDW A;  4XTZ A;  1G2B A;  4OB0 B;  4XTX A;  3E19 A;  3S3M A;  3QZ9 B;  4NL3 A;  3OSV A;  1JJ2 P;  4C0D B;  4E6R A;  1KQS A;  5GAM h;  4BE1 A;  2E70 A;  3G1J A;  1Y71 A;  3X24 B;  3RKX A;  3VUZ A;  3CCM A;  3OYF A;  1QP3 A;  4EMG A;  1FXX A;  4RUG A;  2D1X A;  1U1T A;  3JSC A;  4LUE A;  4IUT A;  3A8L B;  2RQU A;  4F7U A;  5GAO r;  2WAC A;  4N4H A;  5I2S A;  4M75 D;  5LJ5 j;  3OA6 A;  2VYT A;  2O88 A;  2O4X A;  1PD1 A;  4FSS A;  4JDS A;  4J9G A;  5KYW A;  3CCS T;  4J6Y A;  2QEX A;  4M7A D;  3X28 B;  1WHG A;  2MPX C;  4JZ4 A;  1Z9Q A;  2DER A;  4C92 F;  2KI7 A;  2F2X A;  2FEI A;  4EIK A;  2KT8 A;  3VS4 A;  3CXC P;  2F2V A;  1RAA B;  2HQH A;  3L1A A;  4MZP A;  1T0J A;  3GOX A;  2GBQ A;  1IZ6 A;  3L2U A;  1E6G A;  3A98 A;  1KD1 C;  2GFA A;  1MV3 A;  4E7L A;  1XTD A;  3UWN A;  3X25 B;  5LL6 S;  3CCS A;  1H92 A;  1UHC A;  2DKG A;  4OF1 A;  4RG8 A;  4Z02 A;  1M1G A;  5GAN 8;  1QVG P;  1GRI A;  1NEG A;  4Y91 A;  5GMK i;  3CD6 Q;  3SHW A;  1IRE B;  1T3L A;  4KGV B;  1M3C A;  2LCS A;  1NE8 A;  2LT4 A;  1UUE A;  4J9B A;  2LCL A;  1G3S A;  2AT1 B;  3LGF A;  1GCQ C;  4M77 B;  5FWC A;  3MP1 A;  1KHI A;  2PQW A;  3OBY A;  1K76 A;  3C12 A;  4M75 G;  4NS5 A;  1H64 1;  2EQI A;  2QAZ A;  2FZG B;  3NTH A;  1RAH B;  2NLU A;  2F69 A;  2SRC A;  3CCU T;  4M7A G;  2J6O A;  2K5L A;  2HQX A;  4AFS C;  3SWN B;  2KNB B;  3V7R A;  4D8D A;  1OX8 A;  2M51 A;  3CBM A;  2FPF A;  3S3N A;  1NJI R;  2CUB A;  2COY A;  2F5K A;  5LJ5 d;  2JS2 A;  4KRT A;  1QVP A;  4E47 A;  1K73 R;  1EX4 A;  1K4U S;  3FJP A;  1VQ7 Q;  4PFO A;  3BDU A;  1C0M A;  3UAT A;  2R5A A;  4GLK A;  1WHH A;  1VYT A;  1SKU B;  3O5Z A;  3CCU A;  1JRI A;  4RTT A;  1QMC A;  2D9T A;  1B34 A;  2VXE A;  3ME9 A;  4C8Q E;  2ENM A;  1JEG A;  4CI0 C;  2V1Q A;  1BCO A;  1WI7 A;  3I55 T;  3NMZ C;  1M90 R;  3HTR A;  2KRO A;  3RMQ A;  4XAX B;  2K6D A;  1HJD A;  2FVU A;  2ZGW A;  3UDC A;  2LC4 A;  3ULR B;  2L3R A;  4KBM B;  2HNI A;  5KYU A;  3QYH B;  1C1A A;  2CDT A;  2E41 A;  3EFS A;  4XU0 A;  4DBR A;  1HK9 A;  3QUI A;  4LUD A;  1KC8 C;  3M0R A;  5LJ3 g;  1CSK A;  3KBG A;  2KK4 A;  4M78 A;  4JRQ A;  4HT9 A;  2X4W A;  4PK4 A;  5CAI A;  1KQS P;  1I5L A;  2EGE A;  3I55 A;  4OGE A;  4M7A C;  2DZ9 A;  2DL7 A;  2BE9 B;  3M4G A;  3UF4 A;  3OSS C;  2YUN A;  2K5I A;  2XIC A;  3JCM P;  3OYH A;  1Q7Y R;  3EGD B;  2DPP B;  3M0T A;  1UGS B;  1Y07 A;  3QO3 A;  1YJN T;  4ZGD B;  2JN0 A;  1YP5 A;  1RAF B;  2NUT A;  2B8A A;  2YLC A;  1RAI B;  4AFU C;  4MDX A;  1KIK A;  2XMF A;  2EWN A;  3CC4 A;  1D1C A;  1WXB A;  2AK5 A;  1BYM A;  4HT8 A;  1EIF A;  2OTL T;  4JPB W;  3GIB A;  5LJ3 j;  5CCA A;  5CKH A;  4XK8 E;  2FPE A;  4M4Z A;  2L3S A;  2HKN A;  4AT1 B;  3I56 T;  3CPW A;  4HCK A;  1TOV A;  5HK0 A;  1TH7 A;  1UE9 A;  1BI1 A;  3JCM f;  1UJ0 A;  5FLX E;  1YJN A;  1B07 A;  2VWF A;  5KYX B;  1VQN Q;  2K79 A;  3TRE A;  1JQQ A;  2KRM A;  2MF2 A;  2OTL A;  4QKU A;  1YI2 Q;  1VIF A;  1BCM A;  4PFZ A;  1WHL A;  3MO8 A;  1PRM C;  5GAN 2;  2DAQ A;  3I56 A;  1BIB A;  1QVF A;  1W70 A;  3M0S A;  4C0D C;  1KD1 R;  2LJ0 A;  3QG1 A;  2RD1 A;  1N9S A;  4M77 A;  2F5T X;  4HVW A;  5HK3 A;  2K3B A;  3M9Q A;  4L5G A;  2E1H A;  5DLO A;  3OYK A;  1HXD A;  2HMA A;  1ZHI A;  3EG3 A;  1KHC A;  1IHV A;  2XKO C;  2H3J A;  2E12 A;  2JJ9 A;  4Q5W A;  1P92 A;  3LWI A;  3MP8 A;  3X26 B;  1N8R C;  3F70 A;  3HHT B;  3QSU A;  2C0O A;  2A08 A;  2M9U A;  1UJY A;  3OW2 S;  2HD0 A;  1ABO A;  1BIA A;  2HSE B;  1EZZ B;  1IB8 A;  2ZPH B;  2DLP A;  3L2Q A;  5IHI A;  9ATC B;  3FC3 A;  3MJX A;  2EYY A;  1X27 A;  4D6W A;  2P0Q A;  1EFN A;  2IIM A;  4PNO A;  2RK1 A;  3RIR A;  4ZGE B;  3IQL A;  3E9F A;  4IUR A;  4AG1 C;  2YUQ A;  4E7I A;  3HFO A;  1WYX A;  1UFF A;  4CC7 A;  2LNH B;  3AT1 B;  3JB9 D;  4IUP A;  3VKI A;  3RUX A;  3THK A;  2KEA A;  1U8R A;  4M77 C;  2EW3 A;  1VQ8 T;  2D0Q B;  3OYN A;  2CS7 A;  1VQK Q;  4C92 A;  3PGG A;  3NTI A;  5I22 A;  2OTJ T;  1T3S A;  2EPD A;  1D0Z A;  1FWZ A;  2RQR A;  5D6W A;  4LXC A;  1AOJ A;  5FU7 C;  2RQT A;  1AWJ A;  1KC8 R;  3SWN C;  1VQ5 A;  2GFU A;  3EGD A;  1ZQ1 A;  3VYH B;  1H3Z A;  5FRO A;  2C0I A;  3O8V A;  1VQ8 A;  1YIJ Q;  2KXD A;  1Y7X A;  4GLM A;  1XNI A;  1NPR A;  5LJ3 e;  2OTJ A;  4BD3 A;  2EQU A;  4A4F A;  1KC8 U;  2RJE A;  4RTY A;  5CVI A;  2E10 A;  2JTE A;  2VGN A;  1I81 A;  1JU5 C;  3EG1 A;  5C6S A;  4KH0 B;  5D7U A;  3P8B B;  1D3B B;  4ESR A;  2QQ9 A;  2KYM A;  1KQ1 A;  2MCN A;  4L59 A;  5GMK j;  4OGC A;  3OYC A;  2DRM A;  2VGM A;  1GXI E;  3OYE A;  2DIG A;  5GAN f;  1M2V B;  2GF7 A;  2HL3 A;  4C0Z A;  4A4H A;  4BDY A;  3TU4 K;  2RHI A;  2RMO A;  3V8L A;  1QVF P;  5GMK l;  2MIO A;  4DBQ A;  1WFW A;  1AWW A;  1JJ2 A;  4Y92 A;  4E7J A;  2BZX A;  5L23 A;  2DTH A;  1G83 A;  4E7S A;  2MAM A;  1Q81 C;  1NLO C;  1B3Q A;  2LQW A;  2PZ1 A;  2PVG B;  1R0B G;  3RKY A;  4J5Y A;  1RAG B;  3A8M B;  2DRK A;  4F7U B;  4F7U E;  3DB4 A;  4AFZ C;  5I21 A;  2JS0 A;  4J8O A;  4HVU A;  2RI2 A;  2O4X B;  2RHY A;  5GJW B;  2XU8 A;  5I2M A;  5KYW B;  4M78 F;  1GFD A;  4RTU A;  4JRK A;  4E7K A;  3CCE T;  2K3Y A;  2EYZ A;  3GF5 A;  2QA4 T;  1BI3 A;  1PCX A;  1WJQ A;  3NGP A;  3V8J A;  1YN8 A;  1Q82 C;  2HCK A;  1YFN A;  2CZ0 B;  1I8F A;  2RQV A;  1WPY A;  2H3E B;  2L8D A;  5CR2 A;  1KK7 A;  1K9M R;  5IN1 A;  2J05 A;  5CKB A;  2YDL A;  4C0F A;  3JCM V;  4OMQ A;  2DEU A;  2MYS A;  4II1 A;  3CCE A;  1FMK A;  5ECA A;  1QVG A;  1PHT A;  1N8R U;  1YCY A;  1VIE A;  1G3W A;  4JJC A;  2QA4 A;  3CCV Q;  1TS9 A;  4BE2 A;  1J3T A;  1MND A;  2HQE A;  1WJR A;  5HKC A;  2E6N A;  4BY6 B;  1W2B S;  2YSQ A;  4ZNX A;  5CQX A;  2L3P A;  4RCB A;  4C0G A;  2CH4 A;  3ASK A;  5IT9 E;  2GNC A;  2ED0 A;  2KQW A;  4TVR A;  1NJI C;  2AKK A;  2DIL A;  3CCJ T;  8AT1 B;  4M7A E;  1UDL A;  1V76 A;  1ZSG A;  4ME7 A;  3ZBD A;  2XD0 A;  5LJ3 h;  3FLG A;  4BB7 A;  3I5R A;  2OAW A;  2QQR A;  2DTI A;  2YWW A;  3MEW A;  5CQY A;  2XG8 D;  5AYF A;  4AFQ C;  1YIT Q;  3LWH A;  2C06 A;  2XDB A;  2JTF A;  4BAC A;  3MEV A;  2CKK A;  3CCJ A;  1U1S A;  4ZGJ B;  1N27 A;  3RBB B;  1Y96 A;  1C6V X;  5A0G A;  1B34 B;  1U06 A;  2X35 A;  3PVL A;  2CP6 A;  4R55 A;  4IUQ A;  2KT1 A;  2CGH A;  2JM8 A;  4DQ2 A;  1IHW A;  3VU3 C;  4OML A;  2ECZ A;  1D0X A;  2A3L A;  1YJW T;  1KJW A;  1XJW B;  5LJ5 g;  1WQW A;  4KT0 E;  2EIF A;  2EGC A;  3QKJ A;  4XTU A;  5KYU B;  4OMM A;  1B7T A;  3UA7 A;  3I55 Q;  2ESW A;  4J7F A;  1VQ4 Q;  2G6F X;  5GMK m;  1Q7Y C;  4M78 B;  2ATC B;  2QEX T;  1ZUU A;  3RDV A;  1UGR B;  1YJW A;  2LP5 A;  1TG0 A;  1O9S A;  2KBT A;  2LTO A;  4R0K A;  3H8Z A;  1VQP T;  5GAN 5;  4XU1 A;  2I2L A;  3GNG A;  3OYI A;  1DJ7 B;  3OYL A;  3V8K A;  4Z88 A;  1Y57 A;  3C94 A;  4LDX A;  1RLP C;  2GQI A;  1I1J A;  4PJN A;  4C8Q F;  2K2V A;  1SSF A;  1MNE A;  4HCZ A;  4F7U G;  1Q81 R;  2HAX A;  2L89 A;  2NUT B;  3EHR A;  3VUB A;  2C0T A;  2CRE A;  1VQP A;  3TSZ A;  3HRT A;  1N5Z A;  2DE0 X;  3M54 A;  1QCO A;  1UTI A;  1D1B A;  3CMA Q;  2H8H A;  1T0H A;  4WTO B;  2OTL Q;  3A8H B;  1K0S A;  3JCM d;  4KUD K;  3PFS A;  1O75 A;  4A4E A;  4LDV A;  3I56 Q;  1MGQ A;  3NHN A;  1WIE A;  2DL8 A;  3L2W A;  3JRZ A;  2CT4 A;  1Q82 R;  1YJ9 Q;  3EHQ A;  1WJS A;  1CKB A;  3VS5 A;  3CCR T;  3G71 Q;  4KGZ B;  4ZN3 A;  4M77 E;  1MMG A;  1ZA2 B;  3JCM b;  3JCM X;  3BFM A;  1R77 A;  4PJL A;  3KXT A;  1Q82 U;  2ZCF B;  4FYW B;  4J9D A;  2Z0W A;  4KUI A;  5A0L A;  5FU7 B;  1PWT A;  2VUB A;  2W0Z A;  1GFC A;  5L8R E;  3QDR B;  3X20 B;  2DXU A;  2KSS A;  1FMW A;  3FRN A;  3CCR A;  2HDA A;  2CP2 A;  1RI0 A;  3M57 A;  1PD0 A;  2FB7 A;  2XHC A;  5CIU A;  3SB2 A;  4RMO A;  3J81 E;  3G4S Q;  4DBF A;  2E5Q A;  2A36 A;  4XU3 A;  4M7D F;  2YUP A;  1I4K 1;  4X9D A;  3L2R A;  4A4G A;  1M8M A;  3J80 E;  4E2F B;  2D8H A;  2YLB A;  1OEB A;  1NJI U;  2CSI A;  4ELY C;  3OMG A;  4J83 A;  5GAN j;  1PSE A;  1K73 U;  2DL5 A;  2E3I A;  1PKS A;  1JXM A;  4WF2 A;  3RR6 A;  2YXY A;  2K5F A;  3VV0 A;  1UGQ B;  3E2U A;  4OMN A;  2COW A;  2HZY A;  2LDM A;  4A54 A;  4N4G A;  4HCB A;  2NUP A;  2FHD A;  4BY6 C;  2MWP A;  4OB1 B;  1VQL Q;  1M90 U;  1F1B B;  1TWB A;  2RI5 A;  1QKW A;  4C92 E;  4C92 B;  3CC4 T;  4M78 G;  4EPC A;  3CBP A;  3QZ5 B;  4LDY A;  2I0N A;  2WSF E;  1BKB A;  2QK0 A;  2DX1 A;  4QW2 A;  5HCK A;  3EG9 A;  2HSP A;  4QQ6 A;  2FZK B;  1TXQ A;  2D6F A;  5LJ5 e;  3VRY A;  5FU6 B;  1BU1 A;  3HFN A;  4M77 D;  3L2Z A;  3FB9 A;  3H6Z A;  2MWO A;  1ZUY A;  2RHU A;  5KE3 A;  3QPH A;  4ATO A;  1QWF A;  1Q7Y U;  1WZO A;  3M4Y A;  3RMS A;  2HL5 C;  2XID A;  5GAN 3;  3GNF B;  1OZ2 A;  1OV3 A;  3VRZ A;  3CCQ Q;  1U5S A;  2WSE E;  4PJO F;  5GAN 7;  1SF9 A;  5DM7 R;  2COZ A;  3H0I A;  4J6X A;  5KH6 A;  1AD5 A;  3REA B;  5A0D A;  4C5I A;  5GAN d;  2X4J A;  3CCL T;  2LX9 A;  2K57 A;  3HPW A;  4LE9 A;  3KFV A;  3PIP A;  2BKD N;  1VQO Q;  4ELZ C;  1AWX A;  4M78 C;  3QYG B;  2VV5 A;  4PL6 A;  2GTJ A;  3A1P A;  2DBK A;  2MOX A;  1M1K R;  4M7D B;  3H0F A;  4M77 G;  1PRL C;  2CYZ B;  4HKE A;  3VS0 A;  4JRI A;  3LH0 A;  2LRQ A;  4OVA A;  2YUO A;  4QVC A;  1KD1 U;  3GPL A;  4V2S A;  3RES A;  3BDL A;  1YHQ T;  3CCL A;  4GBQ A;  3OMC A;  1RUW A;  2P4T A;  1YNZ A;  4C92 D;  3MET A;  1JBM A;  3URG A;  3OYG A;  1AWO A;  2EKH A;  1K9M C;  3VS7 A;  4PFP A;  2XI9 A;  4FCY A;  3EFR A;  2P0K A;  3OY9 A;  1IO6 A; 
#chains in the Genus database with same CATH homology
 1G2B A;  2DRK A;  4AFZ C;  2KR3 A;  2BZ8 A;  2JS0 A;  4HVU A;  4QT7 A;  1V1C A;  1JXO A;  1E7O A;  4RTX A;  4OMO A;  5GJW B;  4E6R A;  4F14 A;  2L2P A;  1GFD A;  4RTU A;  2KE9 A;  1SSH A;  2EYZ A;  1QLY A;  4WCI A;  4RUG A;  2D1X A;  1WLP B;  3NGP A;  4LUE A;  1YN8 A;  2RQU A;  2HCK A;  2DF6 A;  3LH5 A;  2RQV A;  2O88 A;  4FSS A;  2J05 A;  4J9G A;  4CC4 B;  5FW9 A;  2O9S A;  2YDL A;  4JZ4 A;  5IHN A;  1Z9Q A;  2A37 A;  3REB B;  4OMQ A;  2BZY A;  1UHF A;  5EC7 A;  1FMK A;  4HXJ A;  2F2X A;  2FEI A;  5ECA A;  1PHT A;  1ZX6 A;  2O2O A;  1LCK A;  4EIK A;  4JJC A;  2KT8 A;  3VS4 A;  2F2V A;  5GJV B;  3M0Q A;  3EG0 A;  4LNP A;  3C0C A;  1J3T A;  3H0H A;  1T0J A;  2GBQ A;  1X6B A;  1E6G A;  3A98 A;  1NEB A;  3TVT A;  1A0N B;  2YSQ A;  1MV3 A;  4ZNX A;  1H3H A;  2L3P A;  2X3X D;  2CH4 A;  4RTW A;  1QKX A;  2ABL A;  1H92 A;  1UHC A;  2GNC A;  2ED0 A;  2AKK A;  2DIL A;  1UDL A;  2JW4 A;  4J9C A;  1ZSG A;  1GRI A;  1NEG A;  2KXC A;  1ZBJ A;  1VYU A;  3SHW A;  1T3L A;  2J7I A;  3I5R A;  1MV0 B;  1M3C A;  2OAW A;  1ARK A;  2LCS A;  1UUE A;  2BTT A;  2DA9 A;  4J9B A;  1M30 A;  2EGA A;  4JJB A;  5IH2 A;  1GCQ C;  5FWC A;  2CT3 A;  2OJ2 A;  4IIM A;  4AFQ C;  2JT4 A;  1K76 A;  3R6N A;  2DNU A;  4DEX A;  2RNA A;  2EQI A;  4A63 B;  2DYB A;  1HSQ A;  4DEY A;  2HBW A;  2RN8 A;  1AZE A;  1NLP C;  2SRC A;  3RBB B;  1AZG B;  1OPL A;  2J6O A;  2DJQ A;  1UGV A;  3M0U A;  4AFS C;  1U06 A;  3PVL A;  2KNB B;  4D8D A;  2M51 A;  2FPF A;  2KT1 A;  2P4R A;  2JM8 A;  1ZLM A;  4J9E A;  2CUB A;  3VS1 A;  4OML A;  2ECZ A;  2JS2 A;  4KRT A;  2O9V A;  3I35 A;  1KJW A;  1K4U S;  1NM7 A;  2EGC A;  4ORZ A;  3UAT A;  2JXB A;  2JMA A;  4OMM A;  1VYT A;  1M3A A;  3O5Z A;  4RTT A;  2KGT A;  3UA7 A;  2ESW A;  2ENM A;  2G6F X;  1JEG A;  2DL4 A;  2V1Q A;  4CC3 A;  1H8K A;  1WI7 A;  3U23 A;  3NMZ C;  1SPK A;  1ZUU A;  2KRO A;  2GGR A;  2K6D A;  2B86 A;  1HJD A;  2LP5 A;  1TG0 A;  2KBT A;  4R0K A;  2RF0 A;  1XOV A;  1WX6 A;  3ULR B;  2FG0 A;  2CDT A;  2JMC A;  4Z88 A;  4X1V A;  1Y57 A;  4J9F A;  1RLP C;  4LN2 A;  1GBQ A;  4LUD A;  3M0R A;  2GQI A;  1I1J A;  1AVZ C;  1CSK A;  2NUZ A;  2EGE A;  2V1R A;  1Y0M A;  1CKA A;  1M3B A;  3EHR A;  3UF4 A;  2DL7 A;  2C0T A;  2QDL A;  2CRE A;  3TSZ A;  2YUN A;  3GBQ A;  1X2K A;  2DBM A;  2LX7 A;  1N5Z A;  2NWM A;  2DE0 X;  2M0Y A;  2KRN A;  2KYB A;  3M0T A;  1UTI A;  2RPN A;  4D8K A;  4Z8A A;  4Z89 A;  2H8H A;  1T0H A;  1RLQ C;  3PE0 A;  1RI9 A;  1YP5 A;  5FWB A;  1K0S A;  1UEC A;  1MUZ A;  3VS2 A;  4AFU C;  1KIK A;  2XMF A;  2KRS A;  1WXB A;  2DL3 A;  2AK5 A;  2J06 A;  4IIO A;  5IXB A;  4JPB W;  3ZL7 C;  3NHN A;  1X69 A;  2VVK A;  1TUC A;  1WIE A;  2DL8 A;  2FPE A;  4M4Z A;  2CT4 A;  3EGU A;  2AZV A;  2L3S A;  3EHQ A;  1AEY A;  2ROL A;  1CKB A;  1VYV A;  1BBZ A;  3VS5 A;  4HCK A;  3FJ5 A;  1QCF A;  4RTV A;  1UE9 A;  2J6K A;  1UJ0 A;  1B07 A;  2VWF A;  4JJD A;  2EBP A;  2K79 A;  1JQQ A;  4J9D A;  2KRM A;  1WXT A;  4F17 A;  2F2W A;  1NYF A;  2EYX A;  1PRM C;  3QWX X;  1PWT A;  2W0Z A;  1GFC A;  4OMP A;  2SEM A;  1W70 A;  1I0C A;  4RTZ A;  3M0S A;  2LJ0 A;  2HDA A;  1ABQ A;  1JO8 A;  2RQW A;  1TUD A;  3M0P A;  4HVW A;  3RNJ A;  2L0A A;  2K3B A;  1K1Z A;  4HVV A;  4J9H A;  2A36 A;  4F16 A;  2YUP A;  1BB9 A;  3EG3 A;  2PTK A;  1M8M A;  2DVJ A;  4JZ3 A;  2D8H A;  3VS6 A;  1OEB A;  1PNJ A;  1SRM A;  2DM1 A;  2C0O A;  2CSI A;  3UA6 A;  2A08 A;  3TSW A;  2DL5 A;  1PKS A;  1JXM A;  1YWO A;  1UJY A;  3VS3 A;  1ABO A;  5IXF A;  1ZUK A;  4OMN A;  3CQT A;  3PVQ A;  2DLP A;  2OI3 A;  1KSW A;  2D0N A;  2LZ6 B;  5IHI A;  2EYY A;  5IHK A;  1X27 A;  2LMJ A;  3JV3 A;  1GCQ A;  1EFN A;  1OPK A;  2EVR A;  2LJ1 A;  1QKW A;  2K2M A;  3EG2 A;  2IIM A;  1SHF A;  2CUD A;  3IQL A;  2DMO A;  1WA7 A;  2I0N A;  4AG1 C;  2FPD A;  1SRL A;  5I11 A;  2J6F A;  2HEQ A;  2DX1 A;  5HCK A;  1QWE A;  2YUQ A;  4CC2 A;  1X2Q A;  2CH4 W;  2D8J A;  1WYX A;  1UFF A;  2K7A A;  2HSP A;  1OOT A;  4CC7 A;  2LNH B;  2FO0 A;  1FYN A;  2ROT A;  2EYW A;  3THK A;  3VRY A;  1YWP A;  2KEA A;  1SEM A;  1BU1 A;  1BK2 A;  2GTO A;  2EW3 A;  1NG2 A;  2AKL A;  1X43 A;  1W1F A;  4J9I A;  1U3O A;  2CSQ A;  2LQN A;  5I22 A;  1GCP A;  1T3S A;  1W6X A;  2EPD A;  2L3Q A;  1ZUY A;  2RQR A;  1VA7 A;  2AZS A;  1AOJ A;  2RQT A;  1AWJ A;  2X3W D;  1QWF A;  1WXU A;  2K9G A;  2FRW A;  1PKT A;  1OV3 A;  1SHG A;  3VRZ A;  2ED1 A;  1U5S A;  1E6H A;  2VKN A;  2C0I A;  3H0I A;  1WDX A;  2O31 A;  2KXD A;  4GLM A;  2A28 A;  1I07 A;  2LJ3 A;  1AD5 A;  2FRY A;  3REA B;  4RTY A;  2JTE A;  2E5K A;  3SEM A;  1JU5 C;  3EG1 A;  3NPF A;  3I9Q A;  4LE9 A;  3KFV A;  1AWX A;  3QWY A;  4ESR A;  2KYM A;  4AG2 C;  2MCN A;  2GTJ A;  1UG1 A;  1S1N A;  2DBK A;  2MOX A;  2PNI A;  2DRM A;  1M27 C;  3H0F A;  1Z9Z A;  1PRL C;  3VS0 A;  2YT6 A;  2JM9 A;  2YUO A;  1GL5 A;  1K9A A;  1K0X A;  3I5S A;  2RMO A;  4GBQ A;  1RUW A;  2MIO A;  1AWW A;  1WFW A;  1KFZ A;  1YNZ A;  4Y92 A;  2BZX A;  1NYG A;  5L23 A;  1X6G A;  1GBR A;  1G83 A;  3H41 A;  2EKH A;  1AWO A;  3VS7 A;  1HD3 A;  1NLO C;  1YCS B;  1B3Q A;  2LQW A;  2W10 A;  2PZ1 A;  4K11 A;  1IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...