4PJOD

Minimal u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
98
Chain Sequence
EMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVSKPVNKDRYISKMFLRGDSVIVVLRNPLIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 19
structure length 98
sequence length 107
chains with identical sequence R, d, r
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoD00
4JRIA 4F7UB 5GANg 4PJOC 4M78F 5LJ3g 5GANe 2QTXA 3JCMh 5GMKj 5GMKl 2HNIA 5LJ5j 4M78E 2CGHA 2VC8A 4WF2A 4XTUA 3JCMV 4MMKA 3JCMg 3V7SA 2EJGA 2DXUA 4M7DB 2RB6A 5GMKi 1U1SA 5GMKm 2E41A 5GAN7 3QSUA 1KQ1A 4XU3A 4JUVA 4J6YA 4C8QF 5GAN4 4M7AG 1U1TA 4C92F 1H641 4M7DD 2EAYA 4M75A 3BW1A 5GANd 4M78A 4C8QE 3JB9J 4PJOA 2DXTA 4C92E 4NL2A 1I81A 3AHUA 4M77G 1WQ7A 1HK9A 5GANh 2YHTA 3RERA 1Y96A 5GAMj 1JRIA 4PNOA 3JB9G 3M4GA 4X9DA 4OP0A 2EJFA 4M75C 4M78C 5LJ3h 2Y90A 5CAIA 5GAMh 1I5LA 4XU1A 2RA2A 5GAMg 3V8LA 4M7AF 2RM4A 1YCYA 4M75B 4F7UG 5LJ3e 1I4K1 3INZA 3RESA 4M7AE 5I21A 3SB2A 4PJOB 3JCMW 3JCMe 3JCMJ 4NOYA 4M77F 4EMKA 3FB9A 1Y96B 2FYKA 4M75D 5LJ5h 3QO3A 4M78D 5GMKh 1MGQA 4M77E 4M7DG 5LJ5g 4PJOD 4Y91A 3JB9F 5GAN6 3RUXA 1WQWA 5GAN2 4C92C 5LJ5e 5GMKe 5GAN3 4NL3A 1LJOA 1N9RA 3V7CA 4N0AA 4QVCA 5GAOl 5DY9A 1I8FA 4J5YA 2FB7A 5LJ3d 3GIBA 3RKYA 3V8KA 4EMKC 3VU3C 4F7UF 4XU0A 3JCMc 3JCMd 2DZCA 3EFRA 2DTIA 2E65A 3FIFA 4XTYA 4EMKB 4F7UE 4EMHA 1JBMA 3EFSA 3V7RA 5GAOq 5GAOn 3HFNA 3SWNA 2E1HA 3JB9H 5GAN5 4X9CA 4N0AC 5LJ5d 5GANf 4M7AC 4C8QA 1X01A 4V2SA 5LJ3f 4C92A 2K57A 4XTZA 4M78B 5GAMe 4XTWA 3JCMf 2YLBA 4M75G 4XTVA 3FJPA 3JB9I 2EWNA 4PJOG 3SWNC 1N9SA 2DTOA 4HT9A 4RCCA 1KQ2A 4C8QC 2E10A 3RIRA 3SWNB 2YLCA 3JCMP 1WPYA 5GANj 2DEQA 2DTHA 4C8QB 4A54A 4M7AA 4C92B 3V8JA 2JN0A 5GAMd 5GAOr 2DKGA 4XU2A 2DVEA 5GAOm 1BIBA 3QHSA 3JCMQ 4JRKA 2VXFA 1B34A 4M75F 4M77A 4C8QD 4C92D 1BIAA 1D3BA 3HFOA 4PJOF 5GAN8 3QUIA 5GAOp 1HXDA 4M75E 4XTXA 4M7DF 4PJOE 1LOJA 1WNLA 4JLIA 3RKWA 5GAMf 4M7DE 1M5Q1 2RD1A 4EMGA 3HSBA 4J6WA 3PGGA 4M7AB 4M7DC 4M77C 3JCMX 3BFMA 4F7UA 2EJ9A 3BDUA 4M78G 4RCBA 4HT8A 2E64A 3JCMb 1B34B 4M77B 4QVDA 4M7AD 1M8VA 5LJ5f 1D3BB 4HA8A 3RKXA 2DZ9A 3L1AA 3BY7A 4XQ3A 4A53A 2ZGWA 4M7DA 2I2LA 5LJ3j 2DJZA 4M77D 4DQ2A 1LNXA 4MMLA 4J6XA 3L2ZA 1TH7A 4C8QG 2VXEA 4C92G 3JB9D
chains in the Genus database with same CATH superfamily
1YIJA 1ZHIA 2RJFA 3ER0A 5KYYB 3UATA 1WHGA 3CPWS 1O9SA 2ZPGB 4MZTA 4C8QF 4AFZC 4OMNA 1WI7A 4PJOA 3AHUA 3CMET 1WQ7A 1VQ7Q 3OYAA 2DL4A 3F70A 4X9DA 5D6YA 4N4IA 4PK4A 4FCYA 4HCCA 2L0AA 4PLIA 4J8OA 2GFUA 2IIMA 1UTIA 4A63B 3MP1A 1YNZA 2EGCA 2HAXA 2LC4A 2CH4A 5DY9A 1XOVA 2F2XA 3JCMd 3EFRA 3EG2A 1WXTA 2JJ9A 2R5MA 2P84A 2FPDA 3H9NA 2M51A 5LJ5d 3JV3A 3E9FA 1K0SA 1JEGA 1VQ4Q 3EGDB 1YJ9T 1UUEA 4HT9A 1UJ0A 3X20B 2O9VA 2FL7A 5KH6A 3EGXA 3J80E 1YHQA 2FZCB 2AT1B 3VS7A 3CCRA 4NS5A 4MDWA 1ZSZB 4IURA 1HXDA 4CC7A 4M7DF 1O75A 1NBEB 4J9BA 3HPWA 4BE2A 2AZSA 1BI3A 4BDYA 3CMEQ 4E7JA 1TXQA 1RAIB 1TG0A 5CKDA 1SHFA 2E3IA 2YT6A 1G83A 1FXXA 1VQLT 2Y4XA 2CP5A 4J6XA 4BY6B 2DETA 3L42A 3OS2A 2DL5A 4ATOA 1ZBJA 1WHLA 1W6XA 2HCKA 3QG1A 4OB3B 2QASA 4LDYA 2FZGB 3P8DA 3CPFA 2LTOA 4JJCA 5GAN7 2NWMA 1W2BP 4AG1C 5IH2A 3QDRB 5GANd 2HSEB 2FVUA 1Y96A 1BU1A 4LDUA 1AVZC 2XIDA 4O6JA 1QKXA 2ZCFB 1YJ9Q 2M0OA 1SEMA 2AZVA 1VYVA 1GBQA 1KC8R 4M78D 1QVGS 4Y91A 4OMLA 2MIOA 2WSCE 1GFDA 1I8FA 3CPWA 5LJ3d 3GIBA 1NE8A 2L8DA 4XTYA 2PNIA 3EFSA 3P8BB 1NM7A 5KYWA 5I2MA 1VYUA 1Q81U 5FROA 2EVRA 2I0NA 1N8RC 2WSEE 5IAYA 2LX7A 1VQLQ 2MAMA 2COYA 2R57A 2X9HA 4Q5WA 1E6HA 3OW2A 3A8LB 2BUDA 2YLCA 1UGRB 3MPUB 4B9WA 4C8QB 3CCLT 2EW3A 1VQNA 2A0FB 5GAOm 2CZ1B 2JUFA 3HRUA 2DL8A 2D1XA 2AHJB 1NJIC 3MEUA 5IHNA 1M5Q1 3EFOB 2EYQA 8ATCB 4QQ6A 2A36A 1Q7YR 1KQSS 4F04B 2QQSA 3RKXA 1UDLA 3FRNA 3OS5A 4MMLA 1VQ5T 2FRYA 2QG9B 4C8QG 5IHIA 2OTLT 1MMNA 3JCMh 5LJ5j 2K5LA 1QKWA 1RAFB 5CVIA 5FWCA 2X4YA 1D1AA 2D9TA 2XK0A 1JJ2P 4C8QE 1M1FA 1JU5C 4PNOA 1QVPA 3LH0A 1EZZB 4RMOA 2X51A 2H8HA 5GAMg 1MUZA 4FT2A 2DM1A 2JZ2A 4GBQA 1VQLA 1QQJA 1WDXA 4IUPA 3CCLQ 2QQRA 3HHTB 5GAN6 4BB7A 3MO8A 1B07A 2FB7A 4C0DB 1YJNT 5CQXA 5DM7R 3OYYA 1QWFA 3WVEB 2XDDA 2RI2A 1JBMA 4KH0B 2DYBA 3JSCA 4KGXB 2ED0A 4RG8A 1I5OB 3CXCP 1OPKA 3PVQA 1IXDA 2M02A 2QGFB 3WVDB 2RHZA 3M57A 3LX7A 1VQ5Q 5EC7A 1KK7A 3GPLA 1PWTA 2JTMA 5GANj 2OTLQ 4A54A 3UA7A 4RTXA 1CKAA 1S72T 2X35A 1YWOA 1UGPB 2JW4A 1NPPA 4M7DE 1U5SA 4D8KA 1K8AR 1BBZA 3BFMA 2ZPIB 1OYXA 4JJDA 5LJ5f 4OB1B 2ZGWA 5LJ3j 2DMOA 2EKHA 5D7UA 3CC7A 3CCVT 1AZEA 4HKEA 1Q86R 1Y71A 3AT1B 4PFZA 4Y28E 2QTXA 3ME9A 1D1BA 2MCNA 3CCUA 2OI3A 2RB6A 2V1QA 1U1SA 3I5SA 1YJNQ 2RPNA 1XTDA 2K2VA 1D0YA 2O2OA 2MK5A 2EPDA 2L3PA 1ZLMA 3QXEB 1MNEA 1N27A 1VQ6T 4KULA 2DD4A 4PLLA 1N5ZA 1TWBA 3M4GA 3UT1A 4IUQA 4X1VA 1M1KC 3HKSA 5DLOA 3SB2A 3GLXA 1H92A 4EMKA 2E70A 2JM8A 5CK9A 1YI2Q 3R6OA 2Y4YA 3QO3A 5GMKh 1MGQA 2RNAA 2YUQA 3KUFA 1S72Q 4J7FA 1RLQC 3CBMA 3WXMB 2CP7A 4N4HA 4WTOB 4E7SA 3V8KA 4EMKC 3S3MA 2L3SA 2E65A 1OX8A 1PHTA 2XICA 2L2PA 1Q81R 1VQMT 5GANf 2DL3A 4KGZB 1N8RU 2VV5A 1J3TA 3SD4A 2GCXA 1OU9A 2YLBA 3G6ET 4Z02A 2RN8A 3CCVQ 1SF9A 3L2UA 5GJWB 2ED1A 1M90R 4OGEA 1V1CA 1X43A 3M54A 3HL8A 1W2BA 2EQMA 3FJ5A 5FW9A 4M77A 3CXCS 4C92D 3HFOA 5GAOp 2EQUA 4DBRA 2DERA 2RH2A 5C0MA 2RD1A 5KCHA 1B3QA 1NEBA 1VQ6Q 4M77C 2DNUA 2LP5A 4LN2A 1YIJT 2LJ0A 4BI8B 4M7AD 4ELZC 2DLPA 4A53A 1MMAA 4PJLA 2FPEA 1TH7A 2KYBA 2ROTA 4J7IA 4XTUA 1ZSGA 2QI2A 2D0QB 5KYUA 4DOWA 2C0OA 2VC8A 4Z88A 3EAEA 3MHXA 1OQKA 1Y0MA 1YI2A 3CCSA 4HCKA 2VGNA 3OYGA 3GNGA 4M75A 1IHVA 4J9EA 1VQMQ 3H0FA 2LX9A 4RUGA 2RHIA 5IXBA 4OP0A 2LCLA 3G6EQ 4M75C 2FRWA 2Y90A 3OS1A 2KYMA 3JCMJ 3UF4A 1XJWB 4FYWB 4PJOD 2PVDB 5GAN3 2NUTA 3V7CA 4QVCA 1SHGA 2E5KA 2K6DA 4BD3A 1RACB 4F7UF 4MZPA 3JCMc 2DZCA 3VS2A 4BDZA 2LNVA 3BDLA 3HFNA 2E6NA 1YIJQ 3MP8A 1YHQT 3VUBA 3CCRT 3I56T 1PRMC 2P0QA 2DTOA 2OAUA 2JMCA 1UGSB 1KQ2A 4M4ZA 1M4ZA 3RIRA 1VIEA 2C0TA 1KSWA 1GCQA 5IN1A 2QDLA 1K9MR 4FYYB 1C1AA 1JJ2A 2BE7D 3URGA 3JCMQ 2EYWA 4JRPA 3MEAA 3UDCA 1GCQC 2D6FA 1IZ6A 3A8MB 2M0YA 2V8JA 3LLRA 4JLIA 1K73C 2X4JA 4KUDK 1NG2A 2K5FA 4ME7A 3M0QA 4BE0A 4M7DA 3PVLA 1VQPA 2FHDA 2OX7A 1PC0A 3PIOA 3JB9D 1ZUKA 2FPFA 2RQTA 4OB0B 2J06A 2HZYA 4L59A 3DB3A 4M7DC 4WF2A 5C6SA 2EJGA 5J26A 1KQ1A 3CCEA 3OY9A 4C0DC 1GRIA 3OQ5A 1VOMA 2KK4A 4E7HA 3X28B 3FC3A 3BE3A 3KXTA 2NUPA 1ZBXA 3ASKA 1YHQQ 3CCRQ 3I56Q 2XDBA 1M1KU 2EJFA 4C0FA 1K9AA 5KCOA 1T0JA 1QMCA 1BKBA 8AT1B 3CCQA 3HRTA 3VS5A 2GNCA 2KT8A 2DF6A 5GAN2 5HCKA 4FL6A 1SSFA 4ORZA 2K9GA 2NLUA 1GXIE 4OMFB 3RMQA 4DBFA 3OYIA 3M59A 2CT3A 3M56A 3OW2S 3EH1A 1T3SA 2K57A 1UJYA 1VQNT 2VB6A 3REAB 3G1JA 3X24B 1UECA 1XQHA 3SFMA 2YRCA 1NYGA 3NTHA 1QCFA 1X6OA 5CR2A 1HYOA 1D09B 2DKGA 2P4TA 1NJIR 4XTXA 1GCPA 1G8XA 4QVZA 4UC4A 3CC4A 2COZA 1WHKA 4FIBA 4CC2A 2OJ2A 3C95A 3CD6T 1RAGB 1B34B 4OMMA 3HRSA 4JLGA 2JOYA 2RK1A 3I56A 1BYMA 2DD5A 1H3ZA 4F7UB 1QCOA 3JCMg 4J9FA 2NUZA 1Y07A 2AK5A 1V29B 1YFNA 4J6YA 4JUVA 4A4FA 4C92F 3BW1A 5FU6B 2NYSA 1M2VB 2F2VA 3JAME 4OF1A 3C94A 1H8KA 1M3BA 4FW2A 1VQNQ 1PRLC 5M9OA 2O4XB 2RQRA 3NPFA 1M8MA 4OMOA 2V8KA 4M7AF 3OYFA 4DOVA 4F7UG 3INZA 2ZPHB 2IPOB 2KXCA 3Q1JA 2JNGA 3A5ZB 2XI9A 2CUBA 4FSXA 3I35A 2EKOA 4BE1A 4HVUA 4XU0A 1H3HA 4JRQA 2LQ8A 4F7UE 5GAOq 2EQJA 1WHHA 3O5ZA 3MP6A 3CD6Q 1G3WA 3QIIA 1B7TA 2RI5A 1ACMB 3PTAA 4XTZA 3OBYA 1G5VA 1YN8A 3M53A 4J9DA 1RI9A 1TTHB 1EFNA 3SWNB 2JVVA 2KT1A 1UFFA 3SHWA 2QXFA 2JN0A 1OZ2A 4JJNK 4CC3A 1RAHB 3QDFA 2ZPEB 5L23A 1UGVA 3MEWA 2YDLA 5CQYA 1BIAA 1KG1A 2BTTA 4PJOF 4QT7A 5I22A 5FU7C 3DLLA 3H0IA 4KBMB 1KHIA 3CC7T 1K73U 4ZNXA 3VS6A 1BI1A 4RCBA 2GTOA 2O88A 1M8VA 2J7IA 3TVTA 3HP9A 5KYXB 3CCUT 2PTKA 3EG0A 2JT4A 1WXBA 1LNXA 1RAEB 2CP2A 1QWEA 2DBMA 3L2ZA 2LQKA 2E4HA 1UHCA 2PQWA 4ELYC 3VYHB 2QGGA 4GY5A 5LJ3g 2DILA 2HNIA 2B86A 3G7ZA 3I55A 1ZUYA 1WX6A 2EFIA 2M1HA 3QBYA 4KH1B 2E41A 4RTZA 2DRMA 2LT4A 1G2BA 2SRCA 3L2RA 4F17A 4NL2A 1KJWA 2AKKA 1UB4A 3TU4K 1QLYA 2LRQA 3CQTA 1M1KR 3OMCA 4ZTJA 3CD6A 1AD5A 4PL6A 1EIFA 2C06A 1JB0E 2L89A 5LL6S 3M5AA 3CC2A 5LJ5h 2DAQA 3JB9F 5GMKe 2LZ6B 3ZFJA 4FM4B 1V76A 2CZ0B 2XU8A 2HQHA 3CC7Q 2EQKA 4LD6A 3OBWA 4EMHA 3PMIA 2ENMA 4Z8AA 3RBBB 2XG8D 1UHFA 1Z9QA 2HQXA 4E47A 1YJWA 4FYXB 5GAMe 4EDUA 1OOTA 1IREB 3SEMA 3CCUQ 1LVKA 4PFPA 5IT9E 1W2BS 1JXOA 2X4XA 4YTLA 2DXBA 3FDRA 1OEBA 1A0NB 1WPYA 3GF5A 1WA7A 4PJJA 4C92B 4Y92A 4IUTA 2RJDA 1SKUB 5A0DA 4JRKA 5I2SA 1D3BA 4CRIA 5EG2A 2P0KA 4K11A 2MYSA 1LOJA 4E7LA 1FYNA 4M7AB 1QVFP 4FSSA 5KYYA 2E64A 3OSVA 3JCMb 3NFCA 1C0MA 2Z0WA 2EIFA 4M77D 4JPBW 4D6WA 1YI2T 1AHJB 3CCST 4TVRA 1X69A 2KVQG 1MMDA 3I5RA 4C92G 5GANh 3G71A 3FLGA 1FMVA 2RJEA 1LPLA 3EG9B 4L6V5 1M1GA 3NGPA 3OB9A 3PE0A 3OSSC 2L5QA 4M7AG 4L5GA 3DB4A 2DXTA 4C92E 4RTTA 1X6GA 1X27A 2XHCA 3CCJA 5CCAA 2XMFA 4E7ZA 4HVWA 4DEXA 4Z89A 3T9NA 5FLXE 2A37A 4D8DA 4CI0C 2F5TX 5LJ3h 2QA4T 2P0PA 3RESA 4M7AE 4PJOB 3QYGB 1TUGB 3ULRB 4M75D 1OX9A 2KXDA 3CBPA 7AT1B 5FRMA 2CP6A 3RUXA 5GAOl 1OZ3A 4N0AA 3EGDA 1CKBA 1WGSA 1WJSA 4EPCA 4R55A 2KROA 2YSQA 3C4SA 4HCBA 2KRNA 3V7RA 5J3BA 4N0AC 1BB9A 3OMGA 2CSQA 1VQ9A 4XAXB 2XKOC 4J9IA 1ZSZA 3FJPA 4PJOG 3CCSQ 1N9SA 2WSFE 1JJ2S 4BUGA 2E10A 1RLPC 2FO0A 4F16A 3PNWC 2DEQA 2MF2A 1ZSZC 4XU2A 3VS4A 3QHSA 1KD1C 2VXFA 1VQKA 1U3OA 2KI7A 4PJOE 1VQPT 2L3RA 1ABOA 1WXUA 1TS9A 3EGXB 3TREA 1NLOC 1K73R 1OV3A 3RR6A 1KHCA 3JCMX 3VS3A 2EJ9A 4HT8A 2LT1A 1WJQA 3BY7A 4BY6C 2QA4Q 3M0RA 3H41A 1UG1A 3CCET 1FMKA 2LNHB 1P92A 1M27C 3OYKA 3NMZC 3TQ7P 2RK2A 4M78F 4LUEA 4ZGEB 3QYHB 3V7SA 1W4SA 2H3JA 4M7DD 1U1TA 2EQIA 2W10A 1C6VX 2CDTA 3CCQT 2DX1A 4ZN1A 4OMQA 4ESRA 2CKKA 3JRZA 3JB9G 3DLMA 2GQIA 3V8LA 1CSKA 1PD0A 1I4K1 2QQBA 2MI6A 3N5BB 1Y96B 4AG2C 1I1JA 4AFQC 2LMJA 2OTJA 1ZA2B 1PKTA 4N4GA 5IXFA 2COWA 4B6MA 1WIEA 4E7KA 2DL7A 1R0CB 2YWWA 4AFSC 1VQPQ 3VU3C 2RMOA 2SEMA 5IHKA 4A4HA 3TSWA 1K4US 2DBKA 2A3LA 3JB9H 3OYBA 1U8RA 3ZBDA 4C8QA 1D1CA 2PZ1A 3QZ9B 1WLPB 4PJNA 4XTVA 4X34A 3QJYA 3CCEQ 5HY6A 2VUBA 4C8QC 5KYWB 3EFOA 3CC4T 2QA4A 5L8RE 3LWHA 4RTVA 2VWFA 2J6FA 2PUOB 3E2UA 2DEUA 2E5QA 5GAN8 1Q86C 2YRVA 4AMCA 4JS4A 1BCOA 4DBHA 5GAMf 1QCNA 4J6WA 4IUUA 3CCQQ 4ZGDB 4GLKA 4ZTFA 2X3WD 4KGVB 5HK0A 2I2LA 2LDMA 2BZ8A 1PKSA 4KRTA 1SPKA 1XNIA 2VXEA 4HXJA 3GNFB 3QPHA 4DEYA 5HK3A 4FW1A 5GAOn 2F1LA 3JCMV 2GF7A 2R5AA 1G3SA 1Q82C 1WFWA 2R58A 5GMKi 2KDSA 5CKEA 4OGCA 4DA4A 4RKUE 1H641 2J6OA 3JB9J 4PFOA 2DFUA 2V1RA 2GQVA 3PIPA 1VQ8A 2HKNA 3CMAA 1G3YA 2YXYA 1R77A 4B9XA 1I5LA 3OYMA 1YCYA 3M9QA 4J9HA 2LQWA 2O9SA 3OYDA 1YP5A 4M77F 2BZXA 3A98A 2A08A 2OAWA 3LGLA 3CC4Q 2FYKA 3EHQA 2KBTA 2YUOA 4C92C 3A8OB 3RMSA 1QVFA 4J5YA 2V8IA 3RKYA 3E1SA 2CSIA 3DKMA 2D0NA 3VS0A 2G3RA 4JDSA 5FRNA 4M7AC 1X01A 1VYTA 5CKFA 4M78B 1FX7A 3TSZA 1IO6A 2CP3A 2CT4A 1KD1U 1Y7XA 1BIBA 2RQVA 4M75F 2HQEA 4GLMA 1D0ZA 2MPXC 4A4EA 3S3OA 1N8RR 4C5IA 2F5KA 2DA9A 4M78G 1NEGA 2LCSA 1AWXA 3HTRA 1PSFA 4HA8A 4C5EA 2K4YA 1QVGP 2ZPBB 2X4WA 2ESWA 3I55T 1RI0A 4JS5A 3REBB 2JMAA 2KSSA 1VIFA 4PJOC 2HKQB 1VQOA 5GMKl 2CYZB 3OYEA 4M78E 4HVVA 2DXUA 3ZL7C 2DIQA 4QQGA 1ABQA 1M9SA 3NTIA 4XU3A 2MWOA 3GBQA 1I0CA 1IHWA 2EAYA 5FWBA 2RO0A 1Z9ZA 2O01E 1Q95G 3EG3A 5CKBA 3G4SA 3SDZA 3CCMQ 3CC2T 2E3HA 4ANJA 3OYCA 2BZYA 2O31A 3OS0A 3U23A 3C12A 5CKHA 1QW1A 2W0ZA 3H6ZA 5HKCA 3JCMe 2MOXA 5LJ5g 4A4GA 2D8JA 5LJ5e 1YITA 2JTEA 1YJWT 1KQSP 1JQQA 1PG5B 1K9MC 2EGAA 4BI3A 1M3AA 2DTIA 1T3LA 1VA7A 4EMKB 2LQNA 4ZGJB 3L2QA 2P4RA 4V2SA 2EYYA 4RTYA 4XTWA 1K8AU 3I55Q 2IG0A 1K0XA 4E7IA 1SG5A 2EWNA 4RCCA 2G6FX 2KR3A 3M55A 2ECZA 2KEAA 1BCMA 1VQ7A 3V8JA 1UE9A 3OYHA 1IRXA 2DPPB 1RUWA 2LCCA 1Q86U 4PJMA 2VGMA 2BIVA 3RNJA 1TUCA 3G71T 3BDUA 3CC2Q 3EG1A 1PD1A 1OPLA 4M77B 4QVDA 1AEYA 2CP0A 2DJZA 3M0TA 4C0GA 3CCMA 4DQ2A 1WHJA 3EH2A 1BK2A 2MWPA 2BKDN 5GANg 4R0KA 1GFCA 5GANe 4IKFA 3P8HA 1Q82U 3FEOA 3CCJT 2JS2A 1VQ4A 1YJWQ 3MKDA 3KFVA 3QSUA 1NYFA 2FEIA 2VVKA 5GAN4 5AYFA 4OVAA 2BE9B 2PUKB 5KYUB 4M77G 5KE3A 4OB2B 1MMGA 4R56A 2H3EB 2PVGB 1JXMA 2FG0A 1WYXA 5A2QE 2HEQA 4M75B 5LJ3e 2KE9A 3CMEA 1OULA 4NOYA 2ZAEA 3EGUA 2K3XA 4M77E 1PCXA 4BACA 1LJOA 1M90U 1VQ9T 4FYVB 1IGQA 3UWNA 4LUDA 3UPUA 3FIFA 2KMTA 3TCJA 3MEVA 3G71Q 2E1HA 3MJXA 2NUTB 3QWYA 5CO7A 3GP8A 4II1A 4M75G 1TU0B 2CREA 2L3QA 1VQKT 2QDYB 3D7SB 4ZN3A 2DTHA 2EBPA 4C0ZA 1X75C 5GAMd 2GTJA 2HDAA 2CS7A 4AFUC 1KD1R 3CCJQ 2YUPA 1W70A 4KT0E 1YJ9A 2HL3A 1M30A 1RAAB 2RHUA 2AIRB 1OI1A 2HMAA 4M75E 2GFAA 1M3CA 2LJ3A 1WNLA 2M9UA 2X3XD 2DYIA 4XK8E 4EMGA 3HSBA 2A28A 2C0IA 1MV3A 2XD0A 1E6GA 3VS1A 2CZ6B 2DZ9A 4FT4A 2RI3A 2CZ7B 1JO8A 1ZUUA 2KQWA 2CUDA 2LVMA 5A0GA 5GJVB 1BI0A 2KNBB 3M0SA 3JB9I 4JZ3A 2MMPA 1EX4A 3S6WA 1VQ9Q 4M7DB 3NHNA 5A0LA 1TOVA 4M78A 1I81A 1HK9A 3RERA 3QWXX 1GBRA 4LD9K 3KBGA 4O5VA 4RTUA 2OTJT 1IB8A 3LWIA 1GL5A 4M78C 4CC4B 2ZZDA 3M4YA 5CAIA 1VQKQ 4XU1A 2RA2A 2RM4A 4JJBA 4QKUA 1K1ZA 1HD3A 2F69A 3TEEA 3JCMW 2NUPB 3MCAB 3FB9A 3I9QA 1KC8C 4M7DG 1VUBA 1WQWA 4NL3A 1UEBA 1K9MU 2DO3A 1NZ9A 2K79A 2PVOB 1YCSB 1QVGA 1OU8A 1HJDA 1MHNA 3O8VA 2J6KA 2CH4W 1X2QA 4E2FB 4MDXA 3H0HA 4WCIA 2K2MA 3JCMf 3LW5E 3C0CA 2VYTA 1DJ7B 4LE9A 3ZEHA 3QJ6A 1BI2A 3JCMP 1R8OB 1W1FA 1T0HA 5KYNA 6AT1B 1YBYA 3VRYA 1ZA1B 1RL2A 2YRDA 3QKJA 2DE0X 2HSPA 4C8QD 1B34A 2QQ9A 2F2WA 2PU9B 3CEYA 3CCLA 3S3NA 2QAZA 4F7UA 3E19A 4MZMA 2OTJQ 1F1BB 4XQ3A 1Q7YC 2ABLA 3M58A 2FZKB 3OA6A 1KQSA 2E12A 2EGEA 2IVWA 4JRIA 1M2VA 1Q82R 3IQLA 5GMKj 1NPRA 1VQ8T 3R6NA 3CMAT 2D8HA 3LGFA 2O4XA 1PNJA 3NTKA 1VQ5A 5FU6C 2KGTA 2XDPA 3A8GB 2ROLA 2KRSA 4J9GA 2OTLA 3J81E 4LNPA 2KY9A 2YHTA 1AT1B 1NLPC 1U06A 5GAMj 3UA6A 1JRIA 1E7OA 2JM9A 4E6RA 4JZ4A 4LDXA 1IGUA 5J39A 5GAMh 1D0XA 1AOJA 1X2KA 4HCZA 2DXCA 1HSQA 4LDVA 3RDVA 5I21A 1QVFS 4LDWA 2E6ZA 4RG2A 3M0PA 1PM3A 3VV0A 1KFZA 2WACA 5AT1B 2K7AA 1I07A 2VKNA 1Y57A 2RQWA 2HL5C 3M0UA 1QP2A 3SWNA 1K76A 1NJIU 5GAN5 4OMPA 1RADB 5LJ3f 1ZX6A 2M16A 3THKA 1TSFA 1YJNA 2QEXT 3SWNC 3EHRA 4BI4A 1UGQB 5CIUA 1QP3A 4A4KA 4J83A 3VKIA 2RJCA 1VQ8Q 5GAOr 2DVEA 3VYGA 3CMAQ 1WHMA 1M2OA 5KYXA 4IIMA 4DBQA 5DLQE 3META 2J05A 5FU7B 2RQUA 3GOXA 2GGRA 1K8AC 3CPWP 2YUNA 1S72A 3OYJA 4QW2A 1VQOT 4VUBA 2RHYA 1SSHA 4F14A 1S1NA 5KE2A 1AWJA 5I11A 3OYLA 5ECAA 3VJPA 1G3TA 4PKCC 2ZPFB 1ARKA 3CBOA 2CGHA 4MMKA 3G4ST 4EIKA 3LYIA 3OW2P 5GMKm 2K5IA 3CCVA 3L2VA 2AKLA 4KUIA 1MNDA 2V26A 3PMTA 2RHXA 2QEXQ 1WJRA 1AZGB 2VASA 1R0BG 2GBQA 1AWOA 3LH5A 1YITT 1FWZA 4J9CA 2EYZA 1VQ6A 2K3YA 1TUDA 3X25B 1KC8U 3L2WA 1SRLA 2QK0A 3VUZA 2EYXA 1N9RA 5D6WA 1WZOA 3PT9A 3J7AF 5D6XA 3H8ZA 1SRMA 4RTWA 2JTFA 9ATCB 3OYNA 2JS0A 2RF0A 2DJQA 4AT1B 2DRKA 4X9CA 3X26B 2QTVA 2KAFA 1Q81C 4C92A 1VQOQ 1VQ7T 2LJ1A 1ZQ1A 4QQDA 2HBWA 3PFSA 4P5NA 1AWWA 1MV0B 4IIOA 1RABB 1VQMA 2DIGA 4M7AA 3VRZA 1M90C 1PSEA 4FU6A 3G4SQ 1KIKA 1YWPA 2A7YA 2HBPA 3G6EA 4LXCA 2DK3A 3E9GA 3QUIA 4C5HA 3A1PA 2QYZA 2B8AA 3RKWA 3CCMT 3CXCA 3PGGA 2JXBA 3A8HB 1N6AA 1X6BA 3QZ5B 1D3BB 1Q7YU 3L1AA 2DVJA 1VQ4T 2HD0A 2K3BA 1YITQ 3EG9A 4C5GA 2ATCB 2QQAA 1FMWA 2KRMA 4IUVA 1LCKA 2QEXA
chains in the Genus database with same CATH topology
5GANg 1YIJA 1ZHIA 5GANe 3FLGA 2QI2A 2RJFA 3ER0A 2D0QB 3P8HA 1Q82U 4IKFA 3FEOA 4DOWA 2VC8A 3EAEA 3CCJT 1VQ4A 3CPWS 3MHXA 2RJEA 1O9SA 2ZPGB 1YI2A 4L6V5 1M1GA 3CCSA 4MZTA 3OB9A 3QSUA 2VGNA 3OSSC 2L5QA 3OYGA 4C8QF 4M7AG 5GAN4 3GNGA 4L5GA 4M75A 5AYFA 4OVAA 4PJOA 3DB4A 2DXTA 4C92E 3AHUA 2PUKB 3CMET 4M77G 1WQ7A 5KE3A 5GANh 2XHCA 2LX9A 4OB2B 5CCAA 4R56A 3OYAA 3CCJA 2PVGB 2RHIA 3F70A 3T9NA 5FLXE 4X9DA 4OP0A 5D6YA 2LCLA 4N4IA 4M75C 2F5TX 4CI0C 5LJ3h 2C06A 2Y90A 5A2QE 4HCCA 3OS1A 2QA4T 4PLIA 4M75B 5LJ3e 2P0PA 3RESA 4J8OA 4M7AE 4PJOB 3CMEA 2GFUA 3QYGB 3JCMJ 4NOYA 4M75D 2K3XA 3CBPA 3MP1A 4M77E 5FRMA 4PJOD 4BACA 2PVDB 3RUXA 5GAN3 2HAXA 1LJOA 3V7CA 4QVCA 1OZ3A 4N0AA 2LC4A 5GAOl 5DY9A 2QEXA 1VQ9T 1M90U 1WGSA 1WJSA 4BD3A 4F7UF 1XOVA 4MZPA 4EPCA 4R55A 3JCMc 3C4SA 2DZCA 3EFRA 3UWNA 3JCMd 4HCBA 3UPUA 3FIFA 2KMTA 3TCJA 3V7RA 2LNVA 4BDZA 3BDLA 3MEVA 3HFNA 2R5MA 2E1HA 2E6NA 5J3BA 4N0AC 5LJ5d 3MP8A 3E9FA 5CO7A 3OMGA 1VQ9A 1YHQT 3GP8A 3VUBA 3CCRT 4II1A 2XKOC 4XAXB 3I56T 2P0QA 4M75G 1YJ9T 3FJPA 4PJOG 1VQKT 1N9SA 2DTOA 2OAUA 2QDYB 2WSFE 1JJ2S 4HT9A 1KQ2A 1UGSB 3X20B 4BUGA 2E10A 3RIRA 1M4ZA 1VIEA 2FL7A 5KH6A 5IN1A 3PNWC 2DEQA 2DTHA 4ZN3A 3J80E 4C0ZA 1X75C 2MF2A 5GAMd 2CS7A 1YHQA 4XU2A 3CCRA 1JJ2A 4NS5A 3URGA 4MDWA 3QHSA 3JCMQ 4KT0E 2VXFA 1YJ9A 4IURA 4JRPA 1KD1C 3MEAA 3UDCA 1VQKA 2RHUA 1HXDA 1OI1A 4M75E 2D6FA 1IZ6A 3A8MB 1O75A 4M7DF 4PJOE 2GFAA 2L3RA 1VQPT 3HPWA 2V8JA 3LLRA 4BE2A 1WNLA 2M9UA 4JLIA 3TREA 1BI3A 4XK8E 4BDYA 4EMGA 3HSBA 1K73C 4E7JA 1KHCA 3JCMX 2X4JA 2EJ9A 2XD0A 4KUDK 5CKDA 2K5FA 4HT8A 4ME7A 2LT1A 1WJQA 2CZ6B 2DZ9A 4FT4A 3BY7A 4BE0A 1FXXA 2RI3A 2CZ7B 4BY6C 1VQPA 1VQLT 4M7DA 2Y4XA 2FHDA 2KQWA 4J6XA 4BY6B 2LVMA 5A0GA 3CCET 3L42A 3OS2A 1P92A 3PIOA 3JB9D 1BI0A 3OYKA 4ATOA 2RK2A 4M78F 4ZGEB 3QYHB 4OB0B 3QG1A 4L59A 3DB3A 4OB3B 3JB9I 4M7DC 4WF2A 5C6SA 2MMPA 4LDYA 3S6WA 3V7SA 2EJGA 1W4SA 4M7DB 3P8DA 5J26A 3CPFA 2LTOA 5GAN7 5A0LA 1KQ1A 3CCEA 3OY9A 2H3JA 4C0DC 4M7DD 1U1TA 3OQ5A 2KK4A 4E7HA 3QDRB 5GANd 4M78A 3X28B 3FC3A 3KXTA 1I81A 3CCQT 1ZBXA 1HK9A 3RERA 2FVUA 3ASKA 1Y96A 4ZN1A 4LD9K 2CKKA 3KBGA 3JRZA 4LDUA 4O5VA 3JB9G 3DLMA 2OTJT 2XIDA 4O6JA 2ZCFB 3LWIA 2XDBA 1M1KU 2EJFA 4C0FA 4M78C 5CAIA 2ZZDA 3M4YA 2M0OA 4XU1A 2RA2A 3V8LA 2RM4A 5KCOA 1I4K1 2F69A 1BKBA 2QQBA 3TEEA 3JCMW 2MI6A 3CCQA 3N5BB 3MCAB 3FB9A 3HRTA 1Y96B 4M78D 1KC8C 4M7DG 1QVGS 4Y91A 2OTJA 1VUBA 1WQWA 5GAN2 4N4GA 4NL3A 2WSCE 1UEBA 4FL6A 1K9MU 1SSFA 1I8FA 3CPWA 4E7KA 5LJ3d 3GIBA 2NLUA 1GXIE 3VU3C 4OMFB 3RMQA 2DO3A 3OYIA 1NE8A 1NZ9A 1QVGA 2PVOB 3M59A 4A4HA 2L8DA 4XTYA 3P8BB 3EFSA 1MHNA 3M56A 3O8VA 3JB9H 2A3LA 5I2MA 1Q81U 3OYBA 1U8RA 3ZBDA 4C8QA 5FROA 3OW2S 4MDXA 3QZ9B 2K57A 1N8RC 2WSEE 3JCMf 3LW5E 5IAYA 1VQNT 2MAMA 1DJ7B 2VYTA 4XTVA 4X34A 3ZEHA 2R57A 3QJYA 3X24B 4Q5WA 1XQHA 5HY6A 3QJ6A 3OW2A 3A8LB 2VUBA 4C8QC 2BUDA 1BI2A 1UGRB 2YLCA 3SFMA 3JCMP 1R8OB 3NTHA 1X6OA 4B9WA 4C8QB 5CR2A 3CC4T 2QA4A 1YBYA 5L8RE 3CCLT 3LWHA 2DKGA 1RL2A 3QKJA 1VQNA 5GAOm 2PUOB 2CZ1B 2JUFA 1B34A 2QQ9A 4C8QD 2E5QA 2P4TA 5GAN8 1Q86C 2YRVA 3HRUA 4JS4A 2PU9B 4XTXA 2AHJB 3CEYA 4QVZA 1NJIC 3MEUA 5GAMf 1M5Q1 4UC4A 3CC4A 4J6WA 4IUUA 3CCLA 2EYQA 4ZGDB 3S3NA 4FIBA 4F7UA 4QQ6A 3E19A 3C95A 3CD6T 4GLKA 4ZTFA 1B34B 1KQSS 4MZMA 2QQSA 3HRSA 4JLGA 3RKXA 4XQ3A 1Q7YC 5HK0A 2I2LA 2JOYA 2LDMA 3FRNA 3M58A 3OS5A 4MMLA 1VQ5T 4C8QG 1XNIA 3OA6A 2VXEA 2RK1A 3I56A 2IVWA 2E12A 2DD5A 1KQSA 1BYMA 1H3ZA 3GNFB 3QPHA 4JRIA 4F7UB 2OTLT 5HK3A 3JCMh 5LJ5j 5GMKj 5GAOn 1NPRA 1VQ8T 2K5LA 5CVIA 3JCMV 2GF7A 2R5AA 1G3SA 3JCMg 1Q82C 2R58A 2X4YA 3CMAT 5GMKi 3LGFA 2KDSA 2O4XA 5CKEA 2D9TA 1VQ5A 3NTKA 2XK0A 4OGCA 5FU6C 1Y07A 4DA4A 4JUVA 1V29B 4J6YA 2XDPA 4A4FA 3A8GB 4RKUE 1H641 4C92F 3BW1A 5FU6B 2OTLA 3J81E 4C8QE 3JB9J 3JAME 2GQVA 3PIPA 2KY9A 4OF1A 1M1FA 1VQ8A 2YHTA 3C94A 5GAMj 1JRIA 3CMAA 4PNOA 1G3YA 5M9OA 2O4XB 1QVPA 3LH0A 4LDXA 4B9XA 5J39A 5GAMh 4RMOA 1I5LA 2V8KA 5GAMg 4HCZA 4M7AF 2DXCA 3OYMA 3OYFA 1YCYA 3M9QA 4DOVA 4F7UG 4LDVA 3INZA 2ZPHB 4FT2A 5I21A 3OYDA 1QVFS 2JZ2A 4LDWA 4M77F 2E6ZA 1VQLA 3LGLA 4IUPA 2FYKA 4RG2A 2QQRA 3HHTB 3Q1JA 2JNGA 3VV0A 4BB7A 3MO8A 4C92C 5GAN6 3A8OB 3A5ZB 2XI9A 3RMSA 2WACA 1QVFA 4FSXA 4J5YA 2FB7A 2EKOA 2V8IA 4C0DB 4BE1A 5CQXA 3RKYA 3E1SA 1YJNT 5DM7R 3OYYA 4XU0A 3WVEB 2XDDA 2RI2A 2LQ8A 4JRQA 4F7UE 3DKMA 1JBMA 5GAOq 2EQJA 3JSCA 1QP2A 3SWNA 3MP6A 4RG8A 1NJIU 5GAN5 2G3RA 4JDSA 1G3WA 3QIIA 5FRNA 1X01A 4M7AC 5LJ3f 2RI5A 3PTAA 2M16A 5CKFA 4XTZA 4M78B 1FX7A 3OBYA 1G5VA 3WVDB 1YJNA 2QEXT 2RHZA 3M57A 3M53A 3LX7A 3SWNC 4BI4A 1UGQB 3GPLA 5CIUA 1QP3A 3SWNB 4A4KA 2JTMA 4J83A 2JVVA 5GANj 3VKIA 2RJCA 4A54A 2QXFA 2JN0A 1OZ2A 4JJNK 5GAOr 1KD1U 2DVEA 1Y7XA 3VYGA 1S72T 1BIBA 2X35A 2ZPEB 4M75F 3MEWA 5CQYA 1KG1A 1BIAA 4PJOF 1UGPB 2HQEA 5FU7C 3DLLA 4A4EA 1NPPA 5DLQE 3S3OA 4KBMB 1KHIA 3META 5FU7B 4M7DE 3CC7T 1K73U 4C5IA 2F5KA 3GOXA 3BFMA 1K8AC 1BI1A 4M78G 4RCBA 2ZPIB 1S72A 3OYJA 4QW2A 1OYXA 1VQOT 1M8VA 1PSFA 5LJ5f 4HA8A 4C5EA 2K4YA 3HP9A 4OB1B 3CCUT 2ZPBB 4VUBA 2X4WA 2ZGWA 3I55T 2RHYA 1RI0A 5LJ3j 4JS5A 1LNXA 3CC7A 2KSSA 3L2ZA 5KE2A 3CCVT 2LQKA 3OYLA 2PQWA 4HKEA 4ELYC 3VYHB 1Y71A 1VIFA 3VJPA 1G3TA 4GY5A 2ZPFB 4PKCC 4Y28E 5LJ3g 4PJOC 1VQOA 2QTXA 3ME9A 5GMKl 2CYZB 2HNIA 3CBOA 2CGHA 4M78E 3OYEA 4MMKA 3CCUA 3G7ZA 3G4ST 3I55A 3LYIA 2DXUA 2EFIA 2M1HA 2RB6A 3QBYA 1U1SA 5GMKm 1XTDA 2DIQA 2E41A 2K5IA 4QQGA 1M9SA 2K2VA 2LT4A 3NTIA 4XU3A 3CCVA 2MWOA 3L2VA 2EAYA 3QXEB 2RO0A 3L2RA 4NL2A 1N27A 2O01E 4KUIA 1VQ6T 1UB4A 4KULA 5CKBA 3TU4K 2DD4A 4PLLA 3SDZA 3G4SA 3CC2T 2LRQA 3PMTA 3M4GA 2RHXA 4IUQA 3UT1A 1WJRA 3OYCA 3OMCA 4ZTJA 1YITT 3OS0A 1M1KC 3CD6A 1FWZA 3HKSA 3C12A 5CKHA 4PL6A 1EIFA 1QW1A 5DLOA 1JB0E 2L89A 3H6ZA 5LL6S 3SB2A 3M5AA 5HKCA 3JCMe 3GLXA 1VQ6A 4EMKA 2K3YA 2E70A 3X25B 5CK9A 1KC8U 3R6OA 3CC2A 2Y4YA 5LJ5h 3QO3A 5GMKh 1MGQA 3L2WA 5LJ5g 4A4GA 2DAQA 3JB9F 3KUFA 4J7FA 5LJ5e 5GMKe 3VUZA 3CBMA 3WXMB 3ZFJA 1N9RA 4N4HA 4FM4B 5D6WA 1YITA 1YJWT 2CZ0B 2XU8A 1K9MC 3PT9A 3J7AF 5D6XA 3H8ZA 3V8KA 4BI3A 4EMKC 2JTFA 3S3MA 3OYNA 2DTIA 2E65A 2EQKA 4EMKB 4LD6A 3OBWA 4EMHA 3PMIA 2XICA 4ZGJB 3L2QA 1VQMT 4X9CA 3X26B 5GANf 2XG8D 4V2SA 2KAFA 1Q81C 2HQXA 4C92A 4E47A 1N8RU 1VQ7T 1YJWA 2VV5A 1ZQ1A 4EDUA 5GAMe 1IREB 4XTWA 4QQDA 1K8AU 3SD4A 3PFSA 2GCXA 4P5NA 2YLBA 2IG0A 5IT9E 3G6ET 4Z02A 4E7IA 2X4XA 4YTLA 2EWNA 1W2BS 2DXBA 4RCCA 3FDRA 3M55A 3L2UA 1WPYA 3GF5A 1VQMA 2DIGA 4OGEA 3M54A 3HL8A 1W2BA 4C92B 3V8JA 1M90C 1VQ7A 4M7AA 1PSEA 3OYHA 2DPPB 2EQMA 4FU6A 2A7YA 4IUTA 2HBPA 2RJDA 5A0DA 5I2SA 2LCCA 4JRKA 4M77A 3CXCS 3G6EA 2DK3A 4C92D 1Q86U 1D3BA 3E9GA 3HFOA 5GAOp 2EQUA 3QUIA 4CRIA 2VGMA 4C5HA 5EG2A 2BIVA 2P0KA 1LOJA 2B8AA 2RH2A 3RKWA 5C0MA 3CCMT 4E7LA 2RD1A 5KCHA 3CXCA 4M7AB 3PGGA 4M77C 3G71T 3A8HB 1N6AA 3BDUA 1YIJT 2E64A 3OSVA 4BI8B 3QZ5B 3NFCA 4M77B 4QVDA 3JCMb 4M7AD 1D3BB 1Q7YU 4ELZC 3L1AA 4A53A 1VQ4T 2EIFA 2HD0A 4C5GA 2DJZA 4M77D 4C0GA 4D6WA 2QQAA 3CCMA 4DQ2A 1AHJB 3CCST 4TVRA 1YI2T 2KVQG 4IUVA 1TH7A 2MWPA 4J7IA 4XTUA 4C92G 2BKDN 3G71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRI A;  4F7U B;  5GAN g;  4PJO C;  4M78 F;  5LJ3 g;  5GAN e;  2QTX A;  3JCM h;  5GMK j;  5GMK l;  2HNI A;  5LJ5 j;  4M78 E;  2CGH A;  2VC8 A;  4WF2 A;  4XTU A;  3JCM V;  4MMK A;  3JCM g;  3V7S A;  2EJG A;  2DXU A;  4M7D B;  2RB6 A;  5GMK i;  1U1S A;  5GMK m;  2E41 A;  5GAN 7;  3QSU A;  1KQ1 A;  4XU3 A;  4JUV A;  4J6Y A;  4C8Q F;  5GAN 4;  4M7A G;  1U1T A;  4C92 F;  1H64 1;  4M7D D;  2EAY A;  4M75 A;  3BW1 A;  5GAN d;  4M78 A;  4C8Q E;  3JB9 J;  4PJO A;  2DXT A;  4C92 E;  4NL2 A;  1I81 A;  3AHU A;  4M77 G;  1WQ7 A;  1HK9 A;  5GAN h;  2YHT A;  3RER A;  1Y96 A;  5GAM j;  1JRI A;  4PNO A;  3JB9 G;  3M4G A;  4X9D A;  4OP0 A;  2EJF A;  4M75 C;  4M78 C;  5LJ3 h;  2Y90 A;  5CAI A;  5GAM h;  1I5L A;  4XU1 A;  2RA2 A;  5GAM g;  3V8L A;  4M7A F;  2RM4 A;  1YCY A;  4M75 B;  4F7U G;  5LJ3 e;  1I4K 1;  3INZ A;  3RES A;  4M7A E;  5I21 A;  3SB2 A;  4PJO B;  3JCM W;  3JCM e;  3JCM J;  4NOY A;  4M77 F;  4EMK A;  3FB9 A;  1Y96 B;  2FYK A;  4M75 D;  5LJ5 h;  3QO3 A;  4M78 D;  5GMK h;  1MGQ A;  4M77 E;  4M7D G;  5LJ5 g;  4PJO D;  4Y91 A;  3JB9 F;  5GAN 6;  3RUX A;  1WQW A;  5GAN 2;  4C92 C;  5LJ5 e;  5GMK e;  5GAN 3;  4NL3 A;  1LJO A;  1N9R A;  3V7C A;  4N0A A;  4QVC A;  5GAO l;  5DY9 A;  1I8F A;  4J5Y A;  2FB7 A;  5LJ3 d;  3GIB A;  3RKY A;  3V8K A;  4EMK C;  3VU3 C;  4F7U F;  4XU0 A;  3JCM c;  3JCM d;  2DZC A;  3EFR A;  2DTI A;  2E65 A;  3FIF A;  4XTY A;  4EMK B;  4F7U E;  4EMH A;  1JBM A;  3EFS A;  3V7R A;  5GAO q;  5GAO n;  3HFN A;  3SWN A;  2E1H A;  3JB9 H;  5GAN 5;  4X9C A;  4N0A C;  5LJ5 d;  5GAN f;  4M7A C;  4C8Q A;  1X01 A;  4V2S A;  5LJ3 f;  4C92 A;  2K57 A;  4XTZ A;  4M78 B;  5GAM e;  4XTW A;  3JCM f;  2YLB A;  4M75 G;  4XTV A;  3FJP A;  3JB9 I;  2EWN A;  4PJO G;  3SWN C;  1N9S A;  2DTO A;  4HT9 A;  4RCC A;  1KQ2 A;  4C8Q C;  2E10 A;  3RIR A;  3SWN B;  2YLC A;  3JCM P;  1WPY A;  5GAN j;  2DEQ A;  2DTH A;  4C8Q B;  4A54 A;  4M7A A;  4C92 B;  3V8J A;  2JN0 A;  5GAM d;  5GAO r;  2DKG A;  4XU2 A;  2DVE A;  5GAO m;  1BIB A;  3QHS A;  3JCM Q;  4JRK A;  2VXF A;  1B34 A;  4M75 F;  4M77 A;  4C8Q D;  4C92 D;  1BIA A;  1D3B A;  3HFO A;  4PJO F;  5GAN 8;  3QUI A;  5GAO p;  1HXD A;  4M75 E;  4XTX A;  4M7D F;  4PJO E;  1LOJ A;  1WNL A;  4JLI A;  3RKW A;  5GAM f;  4M7D E;  1M5Q 1;  2RD1 A;  4EMG A;  3HSB A;  4J6W A;  3PGG A;  4M7A B;  4M7D C;  4M77 C;  3JCM X;  3BFM A;  4F7U A;  2EJ9 A;  3BDU A;  4M78 G;  4RCB A;  4HT8 A;  2E64 A;  3JCM b;  1B34 B;  4M77 B;  4QVD A;  4M7A D;  1M8V A;  5LJ5 f;  1D3B B;  4HA8 A;  3RKX A;  2DZ9 A;  3L1A A;  3BY7 A;  4XQ3 A;  4A53 A;  2ZGW A;  4M7D A;  2I2L A;  5LJ3 j;  2DJZ A;  4M77 D;  4DQ2 A;  1LNX A;  4MML A;  4J6X A;  3L2Z A;  1TH7 A;  4C8Q G;  2VXE A;  4C92 G;  3JB9 D; 
#chains in the Genus database with same CATH topology
 1YIJ A;  1ZHI A;  2RJF A;  3ER0 A;  5KYY B;  3UAT A;  1WHG A;  3CPW S;  1O9S A;  2ZPG B;  4MZT A;  4C8Q F;  4AFZ C;  4OMN A;  1WI7 A;  4PJO A;  3AHU A;  3CME T;  1WQ7 A;  1VQ7 Q;  3OYA A;  2DL4 A;  3F70 A;  4X9D A;  5D6Y A;  4N4I A;  4PK4 A;  4FCY A;  4HCC A;  2L0A A;  4PLI A;  4J8O A;  2GFU A;  2IIM A;  1UTI A;  4A63 B;  3MP1 A;  1YNZ A;  2EGC A;  2HAX A;  2LC4 A;  2CH4 A;  5DY9 A;  1XOV A;  2F2X A;  3JCM d;  3EFR A;  3EG2 A;  1WXT A;  2JJ9 A;  2R5M A;  2P84 A;  2FPD A;  3H9N A;  2M51 A;  5LJ5 d;  3JV3 A;  3E9F A;  1K0S A;  1JEG A;  1VQ4 Q;  3EGD B;  1YJ9 T;  1UUE A;  4HT9 A;  1UJ0 A;  3X20 B;  2O9V A;  2FL7 A;  5KH6 A;  3EGX A;  3J80 E;  1YHQ A;  2FZC B;  2AT1 B;  3VS7 A;  3CCR A;  4NS5 A;  4MDW A;  1ZSZ B;  4IUR A;  1HXD A;  4CC7 A;  4M7D F;  1O75 A;  1NBE B;  4J9B A;  3HPW A;  4BE2 A;  2AZS A;  1BI3 A;  4BDY A;  3CME Q;  4E7J A;  1TXQ A;  1RAI B;  1TG0 A;  5CKD A;  1SHF A;  2E3I A;  2YT6 A;  1G83 A;  1FXX A;  1VQL T;  2Y4X A;  2CP5 A;  4J6X A;  4BY6 B;  2DET A;  3L42 A;  3OS2 A;  2DL5 A;  4ATO A;  1ZBJ A;  1WHL A;  1W6X A;  2HCK A;  3QG1 A;  4OB3 B;  2QAS A;  4LDY A;  2FZG B;  3P8D A;  3CPF A;  2LTO A;  4JJC A;  5GAN 7;  2NWM A;  1W2B P;  4AG1 C;  5IH2 A;  3QDR B;  5GAN d;  2HSE B;  2FVU A;  1Y96 A;  1BU1 A;  4LDU A;  1AVZ C;  2XID A;  4O6J A;  1QKX A;  2ZCF B;  1YJ9 Q;  2M0O A;  1SEM A;  2AZV A;  1VYV A;  1GBQ A;  1KC8 R;  4M78 D;  1QVG S;  4Y91 A;  4OML A;  2MIO A;  2WSC E;  1GFD A;  1I8F A;  3CPW A;  5LJ3 d;  3GIB A;  1NE8 A;  2L8D A;  4XTY A;  2PNI A;  3EFS A;  3P8B B;  1NM7 A;  5KYW A;  5I2M A;  1VYU A;  1Q81 U;  5FRO A;  2EVR A;  2I0N A;  1N8R C;  2WSE E;  5IAY A;  2LX7 A;  1VQL Q;  2MAM A;  2COY A;  2R57 A;  2X9H A;  4Q5W A;  1E6H A;  3OW2 A;  3A8L B;  2BUD A;  2YLC A;  1UGR B;  3MPU B;  4B9W A;  4C8Q B;  3CCL T;  2EW3 A;  1VQN A;  2A0F B;  5GAO m;  2CZ1 B;  2JUF A;  3HRU A;  2DL8 A;  2D1X A;  2AHJ B;  1NJI C;  3MEU A;  5IHN A;  1M5Q 1;  3EFO B;  2EYQ A;  8ATC B;  4QQ6 A;  2A36 A;  1Q7Y R;  1KQS S;  4F04 B;  2QQS A;  3RKX A;  1UDL A;  3FRN A;  3OS5 A;  4MML A;  1VQ5 T;  2FRY A;  2QG9 B;  4C8Q G;  5IHI A;  2OTL T;  1MMN A;  3JCM h;  5LJ5 j;  2K5L A;  1QKW A;  1RAF B;  5CVI A;  5FWC A;  2X4Y A;  1D1A A;  2D9T A;  2XK0 A;  1JJ2 P;  4C8Q E;  1M1F A;  1JU5 C;  4PNO A;  1QVP A;  3LH0 A;  1EZZ B;  4RMO A;  2X51 A;  2H8H A;  5GAM g;  1MUZ A;  4FT2 A;  2DM1 A;  2JZ2 A;  4GBQ A;  1VQL A;  1QQJ A;  1WDX A;  4IUP A;  3CCL Q;  2QQR A;  3HHT B;  5GAN 6;  4BB7 A;  3MO8 A;  1B07 A;  2FB7 A;  4C0D B;  1YJN T;  5CQX A;  5DM7 R;  3OYY A;  1QWF A;  3WVE B;  2XDD A;  2RI2 A;  1JBM A;  4KH0 B;  2DYB A;  3JSC A;  4KGX B;  2ED0 A;  4RG8 A;  1I5O B;  3CXC P;  1OPK A;  3PVQ A;  1IXD A;  2M02 A;  2QGF B;  3WVD B;  2RHZ A;  3M57 A;  3LX7 A;  1VQ5 Q;  5EC7 A;  1KK7 A;  3GPL A;  1PWT A;  2JTM A;  5GAN j;  2OTL Q;  4A54 A;  3UA7 A;  4RTX A;  1CKA A;  1S72 T;  2X35 A;  1YWO A;  1UGP B;  2JW4 A;  1NPP A;  4M7D E;  1U5S A;  4D8K A;  1K8A R;  1BBZ A;  3BFM A;  2ZPI B;  1OYX A;  4JJD A;  5LJ5 f;  4OB1 B;  2ZGW A;  5LJ3 j;  2DMO A;  2EKH A;  5D7U A;  3CC7 A;  3CCV T;  1AZE A;  4HKE A;  1Q86 R;  1Y71 A;  3AT1 B;  4PFZ A;  4Y28 E;  2QTX A;  3ME9 A;  1D1B A;  2MCN A;  3CCU A;  2OI3 A;  2RB6 A;  2V1Q A;  1U1S A;  3I5S A;  1YJN Q;  2RPN A;  1XTD A;  2K2V A;  1D0Y A;  2O2O A;  2MK5 A;  2EPD A;  2L3P A;  1ZLM A;  3QXE B;  1MNE A;  1N27 A;  1VQ6 T;  4KUL A;  2DD4 A;  4PLL A;  1N5Z A;  1TWB A;  3M4G A;  3UT1 A;  4IUQ A;  4X1V A;  1M1K C;  3HKS A;  5DLO A;  3SB2 A;  3GLX A;  1H92 A;  4EMK A;  2E70 A;  2JM8 A;  5CK9 A;  1YI2 Q;  3R6O A;  2Y4Y A;  3QO3 A;  5GMK h;  1MGQ A;  2RNA A;  2YUQ A;  3KUF A;  1S72 Q;  4J7F A;  1RLQ C;  3CBM A;  3WXM B;  2CP7 A;  4N4H A;  4WTO B;  4E7S A;  3V8K A;  4EMK C;  3S3M A;  2L3S A;  2E65 A;  1OX8 A;  1PHT A;  2XIC A;  2L2P A;  1Q81 R;  1VQM T;  5GAN f;  2DL3 A;  4KGZ B;  1N8R U;  2VV5 A;  1J3T A;  3SD4 A;  2GCX A;  1OU9 A;  2YLB A;  3G6E T;  4Z02 A;  2RN8 A;  3CCV Q;  1SF9 A;  3L2U A;  5GJW B;  2ED1 A;  1M90 R;  4OGE A;  1V1C A;  1X43 A;  3M54 A;  3HL8 A;  1W2B A;  2EQM A;  3FJ5 A;  5FW9 A;  4M77 A;  3CXC S;  4C92 D;  3HFO A;  5GAO p;  2EQU A;  4DBR A;  2DER A;  2RH2 A;  5C0M A;  2RD1 A;  5KCH A;  1B3Q A;  1NEB A;  1VQ6 Q;  4M77 C;  2DNU A;  2LP5 A;  4LN2 A;  1YIJ T;  2LJ0 A;  4BI8 B;  4M7A D;  4ELZ C;  2DLP A;  4A53 A;  1MMA A;  4PJL A;  2FPE A;  1TH7 A;  2KYB A;  2ROT A;  4J7I A;  4XTU A;  1ZSG A;  2QI2 A;  2D0Q B;  5KYU A;  4DOW A;  2C0O A;  2VC8 A;  4Z88 A;  3EAE A;  3MHX A;  1OQK A;  1Y0M A;  1YI2 A;  3CCS A;  4HCK A;  2VGN A;  3OYG A;  3GNG A;  4M75 A;  1IHV A;  4J9E A;  1VQM Q;  3H0F A;  2LX9 A;  4RUG A;  2RHI A;  5IXB A;  4OP0 A;  2LCL A;  3G6E Q;  4M75 C;  2FRW A;  2Y90 A;  3OS1 A;  2KYM A;  3JCM J;  3UF4 A;  1XJW B;  4FYW B;  4PJO D;  2PVD B;  5GAN 3;  2NUT A;  3V7C A;  4QVC A;  1SHG A;  2E5K A;  2K6D A;  4BD3 A;  1RAC B;  4F7U F;  4MZP A;  3JCM c;  2DZC A;  3VS2 A;  4BDZ A;  2LNV A;  3BDL A;  3HFN A;  2E6N A;  1YIJ Q;  3MP8 A;  1YHQ T;  3VUB A;  3CCR T;  3I56 T;  1PRM C;  2P0Q A;  2DTO A;  2OAU A;  2JMC A;  1UGS B;  1KQ2 A;  4M4Z A;  1M4Z A;  3RIR A;  1VIE A;  2C0T A;  1KSW A;  1GCQ A;  5IN1 A;  2QDL A;  1K9M R;  4FYY B;  1C1A A;  1JJ2 A;  2BE7 D;  3URG A;  3JCM Q;  2EYW A;  4JRP A;  3MEA A;  3UDC A;  1GCQ C;  2D6F A;  1IZ6 A;  3A8M B;  2M0Y A;  2V8J A;  3LLR A;  4JLI A;  1K73 C;  2X4J A;  4KUD K;  1NG2 A;  2K5F A;  4ME7 A;  3M0Q A;  4BE0 A;  4M7D A;  3PVL A;  1VQP A;  2FHD A;  2OX7 A;  1PC0 A;  3PIO A;  3JB9 D;  1ZUK A;  2FPF A;  2RQT A;  4OB0 B;  2J06 A;  2HZY A;  4L59 A;  3DB3 A;  4M7D C;  4WF2 A;  5C6S A;  2EJG A;  5J26 A;  1KQ1 A;  3CCE A;  3OY9 A;  4C0D C;  1GRI A;  3OQ5 A;  1VOM A;  2KK4 A;  4E7H A;  3X28 B;  3FC3 A;  3BE3 A;  3KXT A;  2NUP A;  1ZBX A;  3ASK A;  1YHQ Q;  3CCR Q;  3I56 Q;  2XDB A;  1M1K U;  2EJF A;  4C0F A;  1K9A A;  5KCO A;  1T0J A;  1QMC A;  1BKB A;  8AT1 B;  3CCQ A;  3HRT A;  3VS5 A;  2GNC A;  2KT8 A;  2DF6 A;  5GAN 2;  5HCK A;  4FL6 A;  1SSF A;  4ORZ A;  2K9G A;  2NLU A;  1GXI E;  4OMF B;  3RMQ A;  4DBF A;  3OYI A;  3M59 A;  2CT3 A;  3M56 A;  3OW2 S;  3EH1 A;  1T3S A;  2K57 A;  1UJY A;  1VQN T;  2VB6 A;  3REA B;  3G1J A;  3X24 B;  1UEC A;  1XQH A;  3SFM A;  2YRC A;  1NYG A;  3NTH A;  1QCF A;  1X6O A;  5CR2 A;  1HYO A;  1D09 B;  2DKG A;  2P4T A;  1NJI R;  4XTX A;  1GCP A;  1G8X A;  4QVZ A;  4UC4 A;  3CC4 A;  2COZ A;  1WHK A;  4FIB A;  4CC2 A;  2OJ2 A;  3C95 A;  3CD6 T;  1RAG B;  1B34 B;  4OMM A;  3HRS A;  4JLG A;  2JOY A;  2RK1 A;  3I56 A;  1BYM A;  2DD5 A;  1H3Z A;  4F7U B;  1QCO A;  3JCM g;  4J9F A;  2NUZ A;  1Y07 A;  2AK5 A;  1V29 B;  1YFN A;  4J6Y A;  4JUV A;  4A4F A;  4C92 F;  3BW1 A;  5FU6 B;  2NYS A;  1M2V B;  2F2V A;  3JAM E;  4OF1 A;  3C94 A;  1H8K A;  1M3B A;  4FW2 A;  1VQN Q;  1PRL C;  5M9O A;  2O4X B;  2RQR A;  3NPF A;  1M8M A;  4OMO A;  2V8K A;  4M7A F;  3OYF A;  4DOV A;  4F7U G;  3INZ A;  2ZPH B;  2IPO B;  2KXC A;  3Q1J A;  2JNG A;  3A5Z B;  2XI9 A;  2CUB A;  4FSX A;  3I35 A;  2EKO A;  4BE1 A;  4HVU A;  4XU0 A;  1H3H A;  4JRQ A;  2LQ8 A;  4F7U E;  5GAO q;  2EQJ A;  1WHH A;  3O5Z A;  3MP6 A;  3CD6 Q;  1G3W A;  3QII A;  1B7T A;  2RI5 A;  1ACM B;  3PTA A;  4XTZ A;  3OBY A;  1G5V A;  1YN8 A;  3M53 A;  4J9D A;  1RI9 A;  1TTH B;  1EFN A;  3SWN B;  2JVV A;  2KT1 A;  1UFF A;  3SHW A;  2QXF A;  2JN0 A;  1OZ2 A;  4JJN K;  4CC3 A;  1RAH B;  3QDF A;  2ZPE B;  5L23 A;  1UGV A;  3MEW A;  2YDL A;  5CQY A;  1BIA A;  1KG1 A;  2BTT A;  4PJO F;  4QT7 A;  5I22 A;  5FU7 C;  3DLL A;  3H0I A;  4KBM B;  1KHI A;  3CC7 T;  1K73 U;  4ZNX A;  3VS6 A;  1BI1 A;  4RCB A;  2GTO A;  2O88 A;  1M8V A;  2J7I A;  3TVT A;  3HP9 A;  5KYX B;  3CCU T;  2PTK A;  3EG0 A;  2JT4 A;  1WXB A;  1LNX A;  1RAE B;  2CP2 A;  1QWE A;  2DBM A;  3L2Z A;  2LQK A;  2E4H A;  1UHC A;  2PQW A;  4ELY C;  3VYH B;  2QGG A;  4GY5 A;  5LJ3 g;  2DIL A;  2HNI A;  2B86 A;  3G7Z A;  3I55 A;  1ZUY A;  1WX6 A;  2EFI A;  2M1H A;  3QBY A;  4KH1 B;  2E41 A;  4RTZ A;  2DRM A;  2LT4 A;  1G2B A;  2SRC A;  3L2R A;  4F17 A;  4NL2 A;  1KJW A;  2AKK A;  1UB4 A;  3TU4 K;  1QLY A;  2LRQ A;  3CQT A;  1M1K R;  3OMC A;  4ZTJ A;  3CD6 A;  1AD5 A;  4PL6 A;  1EIF A;  2C06 A;  1JB0 E;  2L89 A;  5LL6 S;  3M5A A;  3CC2 A;  5LJ5 h;  2DAQ A;  3JB9 F;  5GMK e;  2LZ6 B;  3ZFJ A;  4FM4 B;  1V76 A;  2CZ0 B;  2XU8 A;  2HQH A;  3CC7 Q;  2EQK A;  4LD6 A;  3OBW A;  4EMH A;  3PMI A;  2ENM A;  4Z8A A;  3RBB B;  2XG8 D;  1UHF A;  1Z9Q A;  2HQX A;  4E47 A;  1YJW A;  4FYX B;  5GAM e;  4EDU A;  1OOT A;  1IRE B;  3SEM A;  3CCU Q;  1LVK A;  4PFP A;  5IT9 E;  1W2B S;  1JXO A;  2X4X A;  4YTL A;  2DXB A;  3FDR A;  1OEB A;  1A0N B;  1WPY A;  3GF5 A;  1WA7 A;  4PJJ A;  4C92 B;  4Y92 A;  4IUT A;  2RJD A;  1SKU B;  5A0D A;  4JRK A;  5I2S A;  1D3B A;  4CRI A;  5EG2 A;  2P0K A;  4K11 A;  2MYS A;  1LOJ A;  4E7L A;  1FYN A;  4M7A B;  1QVF P;  4FSS A;  5KYY A;  2E64 A;  3OSV A;  3JCM b;  3NFC A;  1C0M A;  2Z0W A;  2EIF A;  4M77 D;  4JPB W;  4D6W A;  1YI2 T;  1AHJ B;  3CCS T;  4TVR A;  1X69 A;  2KVQ G;  1MMD A;  3I5R A;  4C92 G;  5GAN h;  3G71 A;  3FLG A;  1FMV A;  2RJE A;  1LPL A;  3EG9 B;  4L6V 5;  1M1G A;  3NGP A;  3OB9 A;  3PE0 A;  3OSS C;  2L5Q A;  4M7A G;  4L5G A;  3DB4 A;  2DXT A;  4C92 E;  4RTT A;  1X6G A;  1X27 A;  2XHC A;  3CCJ A;  5CCA A;  2XMF A;  4E7Z A;  4HVW A;  4DEX A;  4Z89 A;  3T9N A;  5FLX E;  2A37 A;  4D8D A;  4CI0 C;  2F5T X;  5LJ3 h;  2QA4 T;  2P0P A;  3RES A;  4M7A E;  4PJO B;  3QYG B;  1TUG B;  3ULR B;  4M75 D;  1OX9 A;  2KXD A;  3CBP A;  7AT1 B;  5FRM A;  2CP6 A;  3RUX A;  5GAO l;  1OZ3 A;  4N0A A;  3EGD A;  1CKB A;  1WGS A;  1WJS A;  4EPC A;  4R55 A;  2KRO A;  2YSQ A;  3C4S A;  4HCB A;  2KRN A;  3V7R A;  5J3B A;  4N0A C;  1BB9 A;  3OMG A;  2CSQ A;  1VQ9 A;  4XAX B;  2XKO C;  4J9I A;  1ZSZ A;  3FJP A;  4PJO G;  3CCS Q;  1N9S A;  2WSF E;  1JJ2 S;  4BUG A;  2E10 A;  1RLP C;  2FO0 A;  4F16 A;  3PNW C;  2DEQ A;  2MF2 A;  1ZSZ C;  4XU2 A;  3VS4 A;  3QHS A;  1KD1 C;  2VXF A;  1VQK A;  1U3O A;  2KI7 A;  4PJO E;  1VQP T;  2L3R A;  1ABO A;  1WXU A;  1TS9 A;  3EGX B;  3TRE A;  1NLO C;  1K73 R;  1OV3 A;  3RR6 A;  1KHC A;  3JCM X;  3VS3 A;  2EJ9 A;  4HT8 A;  2LT1 A;  1WJQ A;  3BY7 A;  4BY6 C;  2QA4 Q;  3M0R A;  3H41 A;  1UG1 A;  3CCE T;  1FMK A;  2LNH B;  1P92 A;  1M27 C;  3OYK A;  3NMZ C;  3TQ7 P;  2RK2 A;  4M78 F;  4LUE A;  4ZGE B;  3QYH B;  3V7S A;  1W4S A;  2H3J A;  4M7D D;  1U1T A;  2EQI A;  2W10 A;  1C6V X;  2CDT A;  3CCQ T;  2DX1 A;  4ZN1 A;  4OMQ A;  4ESR A;  2CKK A;  3JRZ A;  3JB9 G;  3DLM A;  2GQI A;  3V8L A;  1CSK A;  1PD0 A;  1I4K 1;  2QQB A;  2MI6 A;  3N5B B;  1Y96 B;  4AG2 C;  1I1J A;  4AFQ C;  2LMJ A;  2OTJ A;  1ZA2 B;  1PKT A;  4N4G A;  5IXF A;  2COW A;  4B6M A;  1WIE A;  4E7K A;  2DL7 A;  1R0C B;  2YWW A;  4AFS C;  1VQP Q;  3VU3 C;  2RMO A;  2SEM A;  5IHK A;  4A4H A;  3TSW A;  1K4U S;  2DBK A;  2A3L A;  3JB9 H;  3OYB A;  1U8R A;  3ZBD A;  4C8Q A;  1D1C A;  2PZ1 A;  3QZ9 B;  1WLP B;  4PJN A;  4XTV A;  4X34 A;  3QJY A;  3CCE Q;  5HY6 A;  2VUB A;  4C8Q C;  5KYW B;  3EFO A;  3CC4 T;  2QA4 A;  5L8R E;  3LWH A;  4RTV A;  2VWF A;  2J6F A;  2PUO B;  3E2U A;  2DEU A;  2E5Q A;  5GAN 8;  1Q86 C;  2YRV A;  4AMC A;  4JS4 A;  1BCO A;  4DBH A;  5GAM f;  1QCN A;  4J6W A;  4IUU A;  3CCQ Q;  4ZGD B;  4GLK A;  4ZTF A;  2X3W D;  4KGV B;  5HK0 A;  2I2L A;  2LDM A;  2BZ8 A;  1PKS A;  4KRT A;  1SPK A;  1XNI A;  2VXE A;  4HXJ A;  3GNF B;  3QPH A;  4DEY A;  5HK3 A;  4FW1 A;  5GAO n;  2F1L A;  3JCM V;  2GF7 A;  2R5A A;  1G3S A;  1Q82 C;  1WFW A;  2R58 A;  5GMK i;  2KDS A;  5CKE A;  4OGC A;  4DA4 A;  4RKU E;  1H64 1;  2J6O A;  3JB9 J;  4PFO A;  2DFU A;  2V1R A;  2GQV A;  3PIP A;  1VQ8 A;  2HKN A;  3CMA A;  1G3Y A;  2YXY A;  1R77 A;  4B9X A;  1I5L A;  3OYM A;  1YCY A;  3M9Q A;  4J9H A;  2LQW A;  2O9S A;  3OYD A;  1YP5 A;  4M77 F;  2BZX A;  3A98 A;  2A08 A;  2OAW A;  3LGL A;  3CC4 Q;  2FYK A;  3EHQ A;  2KBT A;  2YUO A;  4C92 C;  3A8O B;  3RMS A;  1QVF A;  4J5Y A;  2V8I A;  3RKY A;  3E1S A;  2CSI A;  3DKM A;  2D0N A;  3VS0 A;  2G3R A;  4JDS A;  5FRN A;  4M7A C;  1X01 A;  1VYT A;  5CKF A;  4M78 B;  1FX7 A;  3TSZ A;  1IO6 A;  2CP3 A;  2CT4 A;  1KD1 U;  1Y7X A;  1BIB A;  2RQV A;  4M75 F;  2HQE A;  4GLM A;  1D0Z A;  2MPX C;  4A4E A;  3S3O A;  1N8R R;  4C5I A;  2F5K A;  2DA9 A;  4M78 G;  1NEG A;  2LCS A;  1AWX A;  3HTR A;  1PSF A;  4HA8 A;  4C5E A;  2K4Y A;  1QVG P;  2ZPB B;  2X4W A;  2ESW A;  3I55 T;  1RI0 A;  4JS5 A;  3REB B;  2JMA A;  2KSS A;  1VIF A;  4PJO C;  2HKQ B;  1VQO A;  5GMK l;  2CYZ B;  3OYE A;  4M78 E;  4HVV A;  2DXU A;  3ZL7 C;  2DIQ A;  4QQG A;  1ABQ A;  1M9S A;  3NTI A;  4XU3 A;  2MWO A;  3GBQ A;  1I0C A;  1IHW A;  2EAY A;  5FWB A;  2RO0 A;  1Z9Z A;  2O01 E;  1Q95 G;  3EG3 A;  5CKB A;  3G4S A;  3SDZ A;  3CCM Q;  3CC2 T;  2E3H A;  4ANJ A;  3OYC A;  2BZY A;  2O31 A;  3OS0 A;  3U23 A;  3C12 A;  5CKH A;  1QW1 A;  2W0Z A;  3H6Z A;  5HKC A;  3JCM e;  2MOX A;  5LJ5 g;  4A4G A;  2D8J A;  5LJ5 e;  1YIT A;  2JTE A;  1YJW T;  1KQS P;  1JQQ A;  1PG5 B;  1K9M C;  2EGA A;  4BI3 A;  1M3A A;  2DTI A;  1T3L A;  1VA7 A;  4EMK B;  2LQN A;  4ZGJ B;  3L2Q A;  2P4R A;  4V2S A;  2EYY A;  4RTY A;  4XTW A;  1K8A U;  3I55 Q;  2IG0 A;  1K0X A;  4E7I A;  1SG5 A;  2EWN A;  4RCC A;  2G6F X;  2KR3 A;  3M55 A;  2ECZ A;  2KEA A;  1BCM A;  1VQ7 A;  3V8J A;  1UE9 A;  3OYH A;  1IRX A;  2DPP B;  1RUW A;  2LCC A;  1Q86 U;  4PJM A;  2VGM A;  2BIV A;  3RNJ A;  1TUC A;  3G71 T;  3BDU A;  3CC2 Q;  3EG1 A;  1PD1 A;  1OPL A;  4M77 B;  4QVD A;  1AEY A;  2CP0 A;  2DJZ A;  3M0T A;  4C0G A;  3CCM A;  4DQ2 A;  1WHJ A;  3EH2 A;  1BK2 A;  2MWP A;  2BKD N;  5GAN g;  4R0K A;  1GFC A;  5GAN e;  4IKF A;  3P8H A;  1Q82 U;  3FEO A;  3CCJ T;  2JS2 A;  1VQ4 A;  1YJW Q;  3MKD A;  3KFV A;  3QSU A;  1NYF A;  2FEI A;  2VVK A;  5GAN 4;  5AYF A;  4OVA A;  2BE9 B;  2PUK B;  5KYU B;  4M77 G;  5KE3 A;  4OB2 B;  1MMG A;  4R56 A;  2H3E B;  2PVG B;  1JXM A;  2FG0 A;  1WYX A;  5A2Q E;  2HEQ A;  4M75 B;  5LJ3 e;  2KE9 A;  3CME A;  1OUL A;  4NOY A;  2ZAE A;  3EGU A;  2K3X A;  4M77 E;  1PCX A;  4BAC A;  1LJO A;  1M90 U;  1VQ9 T;  4FYV B;  1IGQ A;  3UWN A;  4LUD A;  3UPU A;  3FIF A;  2KMT A;  3TCJ A;  3MEV A;  3G71 Q;  2E1H A;  3MJX A;  2NUT B;  3QWY A;  5CO7 A;  3GP8 A;  4II1 A;  4M75 G;  1TU0 B;  2CRE A;  2L3Q A;  1VQK T;  2QDY B;  3D7S B;  4ZN3 A;  2DTH A;  2EBP A;  4C0Z A;  1X75 C;  5GAM d;  2GTJ A;  2HDA A;  2CS7 A;  4AFU C;  1KD1 R;  3CCJ Q;  2YUP A;  1W70 A;  4KT0 E;  1YJ9 A;  2HL3 A;  1M30 A;  1RAA B;  2RHU A;  2AIR B;  1OI1 A;  2HMA A;  4M75 E;  2GFA A;  1M3C A;  2LJ3 A;  1WNL A;  2M9U A;  2X3X D;  2DYI A;  4XK8 E;  4EMG A;  3HSB A;  2A28 A;  2C0I A;  1MV3 A;  2XD0 A;  1E6G A;  3VS1 A;  2CZ6 B;  2DZ9 A;  4FT4 A;  2RI3 A;  2CZ7 B;  1JO8 A;  1ZUU A;  2KQW A;  2CUD A;  2LVM A;  5A0G A;  5GJV B;  1BI0 A;  2KNB B;  3M0S A;  3JB9 I;  4JZ3 A;  2MMP A;  1EX4 A;  3S6W A;  1VQ9 Q;  4M7D B;  3NHN A;  5A0L A;  1TOV A;  4M78 A;  1I81 A;  1HK9 A;  3RER A;  3QWX X;  1GBR A;  4LD9 K;  3KBG A;  4O5V A;  4RTU A;  2OTJ T;  1IB8 A;  3LWI A;  1GL5 A;  4M78 C;  4CC4 B;  2ZZD A;  3M4Y A;  5CAI A;  1VQK Q;  4XU1 A;  2RA2 A;  2RM4 A;  4JJB A;  4QKU A;  1K1Z A;  1HD3 A;  2F69 A;  3TEE A;  3JCM W;  2NUP B;  3MCA B;  3FB9 A;  3I9Q A;  1KC8 C;  4M7D G;  1VUB A;  1WQW A;  4NL3 A;  1UEB A;  1K9M U;  2DO3 A;  1NZ9 A;  2K79 A;  2PVO B;  1YCS B;  1QVG A;  1OU8 A;  1HJD A;  1MHN A;  3O8V A;  2J6K A;  2CH4 W;  1X2Q A;  4E2F B;  4MDX A;  3H0H A;  4WCI A;  2K2M A;  3JCM f;  3LW5 E;  3C0C A;  2VYT A;  1DJ7 B;  4LE9 A;  3ZEH A;  3QJ6 A;  1BI2 A;  3JCM P;  1R8O B;  1W1F A;  1T0H A;  5KYN A;  6AT1 B;  1YBY A;  3VRY A;  1ZA1 B;  1RL2 A;  2YRD A;  3QKJ A;  2DE0 X;  2HSP A;  4C8Q D;  1B34 A;  2QQ9 A;  2F2W A;  2PU9 B;  3CEY A;  3CCL A;  3S3N A;  2QAZ A;  4F7U A;  3E19 A;  4MZM A;  2OTJ Q;  1F1B B;  4XQ3 A;  1Q7Y C;  2ABL A;  3M58 A;  2FZK B;  3OA6 A;  1KQS A;  2E12 A;  2EGE A;  2IVW A;  4JRI A;  1M2V A;  1Q82 R;  3IQL A;  5GMK j;  1NPR A;  1VQ8 T;  3R6N A;  3CMA T;  2D8H A;  3LGF A;  2O4X A;  1PNJ A;  3NTK A;  1VQ5 A;  5FU6 C;  2KGT A;  2XDP A;  3A8G B;  2ROL A;  2KRS A;  4J9G A;  2OTL A;  3J81 E;  4LNP A;  2KY9 A;  2YHT A;  1AT1 B;  1NLP C;  1U06 A;  5GAM j;  3UA6 A;  1JRI A;  1E7O A;  2JM9 A;  4E6R A;  4JZ4 A;  4LDX A;  1IGU A;  5J39 A;  5GAM h;  1D0X A;  1AOJ A;  1X2K A;  4HCZ A;  2DXC A;  1HSQ A;  4LDV A;  3RDV A;  5I21 A;  1QVF S;  4LDW A;  2E6Z A;  4RG2 A;  3M0P A;  1PM3 A;  3VV0 A;  1KFZ A;  2WAC A;  5AT1 B;  2K7A A;  1I07 A;  2VKN A;  1Y57 A;  2RQW A;  2HL5 C;  3M0U A;  1QP2 A;  3SWN A;  1K76 A;  1NJI U;  5GAN 5;  4OMP A;  1RAD B;  5LJ3 f;  1ZX6 A;  2M16 A;  3THK A;  1TSF A;  1YJN A;  2QEX T;  3SWN C;  3EHR A;  4BI4 A;  1UGQ B;  5CIU A;  1QP3 A;  4A4K A;  4J83 A;  3VKI A;  2RJC A;  1VQ8 Q;  5GAO r;  2DVE A;  3VYG A;  3CMA Q;  1WHM A;  1M2O A;  5KYX A;  4IIM A;  4DBQ A;  5DLQ E;  3MET A;  2J05 A;  5FU7 B;  2RQU A;  3GOX A;  2GGR A;  1K8A C;  3CPW P;  2YUN A;  1S72 A;  3OYJ A;  4QW2 A;  1VQO T;  4VUB A;  2RHY A;  1SSH A;  4F14 A;  1S1N A;  5KE2 A;  1AWJ A;  5I11 A;  3OYL A;  5ECA A;  3VJP A;  1G3T A;  4PKC C;  2ZPF B;  1ARK A;  3CBO A;  2CGH A;  4MMK A;  3G4S T;  4EIK A;  3LYI A;  3OW2 P;  5GMK m;  2K5I A;  3CCV A;  3L2V A;  2AKL A;  4KUI A;  1MND A;  2V26 A;  3PMT A;  2RHX A;  2QEX Q;  1WJR A;  1AZG B;  2VAS A;  1R0B G;  2GBQ A;  1AWO A;  3LH5 A;  1YIT T;  1FWZ A;  4J9C A;  2EYZ A;  1VQ6 A;  2K3Y A;  1TUD A;  3X25 B;  1KC8 U;  3L2W A;  1SRL A;  2QK0 A;  3VUZ A;  2EYX A;  1N9R A;  5D6W A;  1WZO A;  3PT9 A;  3J7A F;  5D6X A;  3H8Z A;  1SRM A;  4RTW A;  2JTF A;  9ATC B;  3OYN A;  2JS0 A;  2RF0 A;  2DJQ A;  4AT1 B;  2DRK A;  4X9C A;  3X26 B;  2QTV A;  2KAF A;  1Q81 C;  4C92 A;  1VQO Q;  1VQ7 T;  2LJ1 A;  1ZQ1 A;  4QQD A;  2HBW A;  3PFS A;  4P5N A;  1AWW A;  1MV0 B;  4IIO A;  1RAB B;  1VQM A;  2DIG A;  4M7A A;  3VRZ A;  1M90 C;  1PSE A;  4FU6 A;  3G4S Q;  1KIK A;  1YWP A;  2A7Y A;  2HBP A;  3G6E A;  4LXC A;  2DK3 A;  3E9G A;  3QUI A;  4C5H A;  3A1P A;  2QYZ A;  2B8A A;  3RKW A;  3CCM T;  3CXC A;  3PGG A;  2JXB A;  3A8H B;  1N6A A;  1X6B A;  3QZ5 B;  1D3B B;  1Q7Y U;  3L1A A;  2DVJ A;  1VQ4 T;  2HD0 A;  2K3B A;  1YIT Q;  3EG9 A;  4C5G A;  2ATC B;  2QQA A;  1FMW A;  2KRM A;  4IUV A;  1LCK A;  2QEX A; 
#chains in the Genus database with same CATH homology
 5GAN g;  1YIJ A;  1ZHI A;  5GAN e;  3FLG A;  2QI2 A;  2RJF A;  3ER0 A;  2D0Q B;  3P8H A;  1Q82 U;  4IKF A;  3FEO A;  4DOW A;  2VC8 A;  3EAE A;  3CCJ T;  1VQ4 A;  3CPW S;  3MHX A;  2RJE A;  1O9S A;  2ZPG B;  1YI2 A;  4L6V 5;  1M1G A;  3CCS A;  4MZT A;  3OB9 A;  3QSU A;  2VGN A;  3OSS C;  2L5Q A;  3OYG A;  4C8Q F;  4M7A G;  5GAN 4;  3GNG A;  4L5G A;  4M75 A;  5AYF A;  4OVA A;  4PJO A;  3DB4 A;  2DXT A;  4C92 E;  3AHU A;  2PUK B;  3CME T;  4M77 G;  1WQ7 A;  5KE3 A;  5GAN h;  2XHC A;  2LX9 A;  4OB2 B;  5CCA A;  4R56 A;  3OYA A;  3CCJ A;  2PVG B;  2RHI A;  3F70 A;  3T9N A;  5FLX E;  4X9D A;  4OP0 A;  5D6Y A;  2LCL A;  4N4I A;  4M75 C;  2F5T X;  4CI0 C;  5LJ3 h;  2C06 A;  2Y90 A;  5A2Q E;  4HCC A;  3OS1 A;  2QA4 T;  4PLI A;  4M75 B;  5LJ3 e;  2P0P A;  3RES A;  4J8O A;  4M7A E;  4PJO B;  3CME A;  2GFU A;  3QYG B;  3JCM J;  4NOY A;  4M75 D;  2K3X A;  3CBP A;  3MP1 A;  4M77 E;  5FRM A;  4PJO D;  4BAC A;  2PVD B;  3RUX A;  5GAN 3;  2HAX A;  1LJO A;  3V7C A;  4QVC A;  1OZ3 A;  4N0A A;  2LC4 A;  5GAO l;  5DY9 A;  2QEX A;  1VQ9 T;  1M90 U;  1WGS A;  1WJS A;  4BD3 A;  4F7U F;  1XOV A;  4MZP A;  4EPC A;  4R55 A;  3JCM c;  3C4S A;  2DZC A;  3EFR A;  3UWN A;  3JCM d;  4HCB A;  3UPU A;  3FIF A;  2KMT A;  3TCJ A;  3V7R A;  2LNV A;  4BDZ A;  3BDL A;  3MEV A;  3HFN A;  2R5M A;  2E1H A;  2E6N A;  5J3B A;  4N0A C;  5LJ5 d;  3MP8 A;  3E9F A;  5CO7 A;  3OMG A;  1VQ9 A;  1YHQ T;  3GP8 A;  3VUB A;  3CCR T;  4II1 A;  2XKO C;  4XAX B;  3I56 T;  2P0Q A;  4M75 G;  1YJ9 T;  3FJP A;  4PJO G;  1VQK T;  1N9S A;  2DTO A;  2OAU A;  2QDY B;  2WSF E;  1JJ2 S;  4HT9 A;  1KQ2 A;  1UGS B;  3X20 B;  4BUG A;  2E10 A;  3RIR A;  1M4Z A;  1VIE A;  2FL7 A;  5KH6 A;  5IN1 A;  3PNW C;  2DEQ A;  2DTH A;  4ZN3 A;  3J80 E;  4C0Z A;  1X75 C;  2MF2 A;  5GAM d;  2CS7 A;  1YHQ A;  4XU2 A;  3CCR A;  1JJ2 A;  4NS5 A;  3URG A;  4MDW A;  3QHS A;  3JCM Q;  4KT0 E;  2VXF A;  1YJ9 A;  4IUR A;  4JRP A;  1KD1 C;  3MEA A;  3UDC A;  1VQK A;  2RHU A;  1HXD A;  1OI1 A;  4M75 E;  2D6F A;  1IZ6 A;  3A8M B;  1O75 A;  4M7D F;  4PJO E;  2GFA A;  2L3R A;  1VQP T;  3HPW A;  2V8J A;  3LLR A;  4BE2 A;  1WNL A;  2M9U A;  4JLI A;  3TRE A;  1BI3 A;  4XK8 E;  4BDY A;  4EMG A;  3HSB A;  1K73 C;  4E7J A;  1KHC A;  3JCM X;  2X4J A;  2EJ9 A;  2XD0 A;  4KUD K;  5CKD A;  2K5F A;  4HT8 A;  4ME7 A;  2LT1 A;  1WJQ A;  2CZ6 B;  2DZ9 A;  4FT4 A;  3BY7 A;  4BE0 A;  1FXX A;  2RI3 A;  2CZ7 B;  4BY6 C;  1VQP A;  1VQL T;  4M7D A;  2Y4X A;  2FHD A;  2KQW A;  4J6X A;  4BY6 B;  2LVM A;  5A0G A;  3CCE T;  3L42 A;  3OS2 A;  1P92 A;  3PIO A;  3JB9 D;  1BI0 A;  3OYK A;  4ATO A;  2RK2 A;  4M78 F;  4ZGE B;  3QYH B;  4OB0 B;  3QG1 A;  4L59 A;  3DB3 A;  4OB3 B;  3JB9 I;  4M7D C;  4WF2 A;  5C6S A;  2MMP A;  4LDY A;  3S6W A;  3V7S A;  2EJG A;  1W4S A;  4M7D B;  3P8D A;  5J26 A;  3CPF A;  2LTO A;  5GAN 7;  5A0L A;  1KQ1 A;  3CCE A;  3OY9 A;  2H3J A;  4C0D C;  4M7D D;  1U1T A;  3OQ5 A;  2KK4 A;  4E7H A;  3QDR B;  5GAN d;  4M78 A;  3X28 B;  3FC3 A;  3KXT A;  1I81 A;  3CCQ T;  1ZBX A;  1HK9 A;  3RER A;  2FVU A;  3ASK A;  1Y96 A;  4ZN1 A;  4LD9 K;  2CKK A;  3KBG A;  3JRZ A;  4LDU A;  4O5V A;  3JB9 G;  3DLM A;  2OTJ T;  2XID A;  4O6J A;  2ZCF B;  3LWI A;  2XDB A;  1M1K U;  2EJF A;  4C0F A;  4M78 C;  5CAI A;  2ZZD A;  3M4Y A;  2M0O A;  4XU1 A;  2RA2 A;  3V8L A;  2RM4 A;  5KCO A;  1I4K 1;  2F69 A;  1BKB A;  2QQB A;  3TEE A;  3JCM W;  2MI6 A;  3CCQ A;  3N5B B;  3MCA B;  3FB9 A;  3HRT A;  1Y96 B;  4M78 D;  1KC8 C;  4M7D G;  1QVG S;  4Y91 A;  2OTJ A;  1VUB A;  1WQW A;  5GAN 2;  4N4G A;  4NL3 A;  2WSC E;  1UEB A;  4FL6 A;  1K9M U;  1SSF A;  1I8F A;  3CPW A;  4E7K A;  5LJ3 d;  3GIB A;  2NLU A;  1GXI E;  3VU3 C;  4OMF B;  3RMQ A;  2DO3 A;  3OYI A;  1NE8 A;  1NZ9 A;  1QVG A;  2PVO B;  3M59 A;  4A4H A;  2L8D A;  4XTY A;  3P8B B;  3EFS A;  1MHN A;  3M56 A;  3O8V A;  3JB9 H;  2A3L A;  5I2M A;  1Q81 U;  3OYB A;  1U8R A;  3ZBD A;  4C8Q A;  5FRO A;  3OW2 S;  4MDX A;  3QZ9 B;  2K57 A;  1N8R C;  2WSE E;  3JCM f;  3LW5 E;  5IAY A;  1VQN T;  2MAM A;  1DJ7 B;  2VYT A;  4XTV A;  4X34 A;  3ZEH A;  2R57 A;  3QJY A;  3X24 B;  4Q5W A;  1XQH A;  5HY6 A;  3QJ6 A;  3OW2 A;  3A8L B;  2VUB A;  4C8Q C;  2BUD A;  1BI2 A;  1UGR B;  2YLC A;  3SFM A;  3JCM P;  1R8O B;  3NTH A;  1X6O A;  4B9W A;  4C8Q B;  5CR2 A;  3CC4 T;  2QA4 A;  1YBY A;  5L8R E;  3CCL T;  3LWH A;  2DKG A;  1RL2 A;  3QKJ A;  1VQN A;  5GAO m;  2PUO B;  2CZ1 B;  2JUF A;  1B34 A;  2QQ9 A;  4C8Q D;  2E5Q A;  2P4T A;  5GAN 8;  1Q86 C;  2YRV A;  3HRU A;  4JS4 A;  2PU9 B;  4XTX A;  2AHJ B;  3CEY A;  4QVZ A;  1NJI C;  3MEU A;  5GAM f;  1M5Q 1;  4UC4 A;  3CC4 A;  4J6W A;  4IUU A;  3CCL A;  2EYQ A;  4ZGD B;  3S3N A;  4FIB A;  4F7U A;  4QQ6 A;  3E19 A;  3C95 A;  3CD6 T;  4GLK A;  4ZTF A;  1B34 B;  1KQS S;  4MZM A;  2QQS A;  3HRS A;  4JLG A;  3RKX A;  4XQ3 A;  1Q7Y C;  5HK0 A;  2I2L A;  2JOY A;  2LDM A;  3FRN A;  3M58 A;  3OS5 A;  4MML A;  1VQ5 T;  4C8Q G;  1XNI A;  3OA6 A;  2VXE A;  2RK1 A;  3I56 A;  2IVW A;  2E12 A;  2DD5 A;  1KQS A;  1BYM A;  1H3Z A;  3GNF B;  3QPH A;  4JRI A;  4F7U B;  2OTL T;  5HK3 A;  3JCM h;  5LJ5 j;  5GMK j;  5GAO n;  1NPR A;  1VQ8 T;  2K5L A;  5CVI A;  3JCM V;  2GF7 A;  2R5A A;  1G3S A;  3JCM g;  1Q82 C;  2R58 A;  2X4Y A;  3CMA T;  5GMK i;  3LGF A;  2KDS A;  2O4X A;  5CKE A;  2D9T A;  1VQ5 A;  3NTK A;  2XK0 A;  4OGC A;  5FU6 C;  1Y07 A;  4DA4 A;  4JUV A;  1V29 B;  4J6Y A;  2XDP A;  4A4F A;  3A8G B;  4RKU E;  1H64 1;  4C92 F;  3BW1 A;  5FU6 B;  2OTL A;  3J81 E;  4C8Q E;  3JB9 J;  3JAM E;  2GQV A;  3PIP A;  2KY9 A;  4OF1 A;  1M1F A;  1VQ8 A;  2YHT A;  3C94 A;  5GAM j;  1JRI A;  3CMA A;  4PNO A;  1G3Y A;  5M9O A;  2O4X B;  1QVP A;  3LH0 A;  4LDX A;  4B9X A;  5J39 A;  5GAM h;  4RMO A;  1I5L A;  2V8K A;  5GAM g;  4HCZ A;  4M7A F;  2DXC A;  3OYM A;  3OYF A;  1YCY A;  3M9Q A;  4DOV A;  4F7U G;  4LDV A;  3INZ A;  2ZPH B;  4FT2 A;  5I21 A;  3OYD A;  1QVF S;  2JZ2 A;  4LDW A;  4M77 F;  2E6Z A;  1VQL A;  3LGL A;  4IUP A;  2FYK A;  4RG2 A;  2QQR A;  3HHT B;  3Q1J A;  2JNG A;  3VV0 A;  4BB7 A;  3MO8 A;  4C92 C;  5GAN 6;  3A8O B;  3A5Z B;  2XI9 A;  3RMS A;  2WAC A;  1QVF A;  4FSX A;  4J5Y A;  2FB7 A;  2EKO A;  2V8I A;  4C0D B;  4BE1 A;  5CQX A;  3RKY A;  3E1S A;  1YJN T;  5DM7 R;  3OYY A;  4XU0 A;  3WVE B;  2XDD A;  2RI2 A;  2LQ8 A;  4JRQ A;  4F7U E;  3DKM A;  1JBM A;  5GAO q;  2EQJ A;  3JSC A;  1QP2 A;  3SWN A;  3MP6 A;  4RG8 A;  1NJI U;  5GAN 5;  2G3R A;  4JDS A;  1G3W A;  3QII A;  5FRN A;  1X01 A;  4M7A C;  5LJ3 f;  2RI5 A;  3PTA A;  2M16 A;  5CKF A;  4XTZ A;  4M78 B;  1FX7 A;  3OBY A;  1G5V A;  3WVD B;  1YJN A;  2QEX T;  2RHZ A;  3M57 A;  3M53 A;  3LX7 A;  3SWN C;  4BI4 A;  1UGQ B;  3GPL A;  5CIU A;  1QP3 A;  3SWN B;  4A4K A;  2JTM A;  4J83 A;  2JVV A;  5GAN j;  3VKI A;  2RJC A;  4A54 A;  2QXF A;  2JN0 A;  1OZ2 A;  4JJN K;  5GAO r;  1KD1 U;  2DVE A;  1Y7X A;  3VYG A;  1S72 T;  1BIB A;  2X35 A;  2ZPE B;  4M75 F;  3MEW A;  5CQY A;  1KG1 A;  1BIA A;  4PJO F;  1UGP B;  2HQE A;  5FU7 C;  3DLL A;  4A4E A;  1NPP A;  5DLQ E;  3S3O A;  4KBM B;  1KHI A;  3MET A;  5FU7 B;  4M7D E;  3CC7 T;  1K73 U;  4C5I A;  2F5K A;  3GOX A;  3BFM A;  1K8A C;  1BI1 A;  4M78 G;  4RCB A;  2ZPI B;  1S72 A;  3OYJ A;  4QW2 A;  1OYX A;  1VQO T;  1M8V A;  1PSF A;  5LJ5 f;  4HA8 A;  4C5E A;  2K4Y A;  3HP9 A;  4OB1 B;  3CCU T;  2ZPB B;  4VUB A;  2X4W A;  2ZGW A;  3I55 T;  2RHY A;  1RI0 A;  5LJ3 j;  4JS5 A;  1LNX A;  3CC7 A;  2KSS A;  3L2Z A;  5KE2 A;  3CCV T;  2LQK A;  3OYL A;  2PQW A;  4HKE A;  4ELY C;  3VYH B;  1Y71 A;  1VIF A;  3VJP A;  1G3T A;  4GY5 A;  2ZPF B;  4PKC C;  4Y28 E;  5LJ3 g;  4PJO C;  1VQO A;  2QTX A;  3ME9 A;  5GMK l;  2CYZ B;  2HNI A;  3CBO A;  2CGH A;  4M78 E;  3OYE A;  4MMK A;  3CCU A;  3G7Z A;  3G4S T;  3I55 A;  3LYI A;  2DXU A;  2EFI A;  2M1H A;  2RB6 A;  3QBY A;  1U1S A;  5GMK m;  1XTD A;  2DIQ A;  2E41 A;  2K5I A;  4QQG A;  1M9S A;  2K2V A;  2LT4 A;  3NTI A;  4XU3 A;  3CCV A;  2MWO A;  3L2V A;  2EAY A;  3QXE B;  2RO0 A;  3L2R A;  4NL2 A;  1N27 A;  2O01 E;  4KUI A;  1VQ6 T;  1UB4 A;  4KUL A;  5CKB A;  3TU4 K;  2DD4 A;  4PLL A;  3SDZ A;  3G4S A;  3CC2 T;  2LRQ A;  3PMT A;  3M4G A;  2RHX A;  4IUQ A;  3UT1 A;  1WJR A;  3OYC A;  3OMC A;  4ZTJ A;  1YIT T;  3OS0 A;  1M1K C;  3CD6 A;  1FWZ A;  3HKS A;  3C12 A;  5CKH A;  4PL6 A;  1EIF A;  1QW1 A;  5DLO A;  1JB0 E;  2L89 A;  3H6Z A;  5LL6 S;  3SB2 A;  3M5A A;  5HKC A;  3JCM e;  3GLX A;  1VQ6 A;  4EMK A;  2K3Y A;  2E70 A;  3X25 B;  5CK9 A;  1KC8 U;  3R6O A;  3CC2 A;  2Y4Y A;  5LJ5 h;  3QO3 A;  5GMK h;  1MGQ A;  3L2W A;  5LJ5 g;  4A4G A;  2DAQ A;  3JB9 F;  3KUF A;  4J7F A;  5LJ5 e;  5GMK e;  3VUZ A;  3CBM A;  3WXM B;  3ZFJ A;  1N9R A;  4N4H A;  4FM4 B;  5D6W A;  1YIT A;  1YJW T;  2CZ0 B;  2XU8 A;  1K9M C;  3PT9 A;  3J7A F;  5D6X A;  3H8Z A;  3V8K A;  4BI3 A;  4EMK C;  2JTF A;  3S3M A;  3OYN A;  2DTI A;  2E65 A;  2EQK A;  4EMK B;  4LD6 A;  3OBW A;  4EMH A;  3PMI A;  2XIC A;  4ZGJ B;  3L2Q A;  1VQM T;  4X9C A;  3X26 B;  5GAN f;  2XG8 D;  4V2S A;  2KAF A;  1Q81 C;  2HQX A;  4C92 A;  4E47 A;  1N8R U;  1VQ7 T;  1YJW A;  2VV5 A;  1ZQ1 A;  4EDU A;  5GAM e;  1IRE B;  4XTW A;  4QQD A;  1K8A U;  3SD4 A;  3PFS A;  2GCX A;  4P5N A;  2YLB A;  2IG0 A;  5IT9 E;  3G6E T;  4Z02 A;  4E7I A;  2X4X A;  4YTL A;  2EWN A;  1W2B S;  2DXB A;  4RCC A;  3FDR A;  3M55 A;  3L2U A;  1WPY A;  3GF5 A;  1VQM A;  2DIG A;  4OGE A;  3M54 A;  3HL8 A;  1W2B A;  4C92 B;  3V8J A;  1M90 C;  1VQ7 A;  4M7A A;  1PSE A;  3OYH A;  2DPP B;  2EQM A;  4FU6 A;  2A7Y A;  4IUT A;  2HBP A;  2RJD A;  5A0D A;  5I2S A;  2LCC A;  4JRK A;  4M77 A;  3CXC S;  3G6E A;  2DK3 A;  4C92 D;  1Q86 U;  1D3B A;  3E9G A;  3HFO A;  5GAO p;  2EQU A;  3QUI A;  4CRI A;  2VGM A;  4C5H A;  5EG2 A;  2BIV A;  2P0K A;  1LOJ A;  2B8A A;  2RH2 A;  3RKW A;  5C0M A;  3CCM T;  4E7L A;  2RD1 A;  5KCH A;  3CXC A;  4M7A B;  3PGG A;  4M77 C;  3G71 T;  3A8H B;  1N6A A;  3BDU A;  1YIJ T;  2E64 A;  3OSV A;  4BI8 B;  3QZ5 B;  3NFC A;  4M77 B;  4QVD A;  3JCM b;  4M7A D;  1D3B B;  1Q7Y U;  4ELZ C;  3L1A A;  4A53 A;  1VQ4 T;  2EIF A;  2HD0 A;  4C5G A;  2DJZ A;  4M77 D;  4C0G A;  4D6W A;  2QQA A;  3CCM A;  4DQ2 A;  1AHJ B;  3CCS T;  4TVR A;  1YI2 T;  2KVQ G;  4IUV A;  1TH7 A;  2MWP A;  4J7I A;  4XTU A;  4C92 G;  2BKD N;  3G71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...