4PJOD

Minimal u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
98
Chain Sequence
EMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVSKPVNKDRYISKMFLRGDSVIVVLRNPLIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 98
sequence length 107
chains with identical sequence R, d, r
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoD00
4M7AG 3JCMd 4C92A 4M75F 4EMKA 3JCMb 1Y96A 3HFOA 3M4GA 4M7AD 5GMKi 2DXTA 4C8QB 4M7DC 1WPYA 2RB6A 3V8JA 3JB9I 4XU0A 5GAN4 5GAOp 5LJ5d 2DVEA 3RKXA 5GMKh 3QUIA 4C92F 4X9CA 5LJ5j 1WNLA 4PJOF 4M75B 4HT9A 3BY7A 3FIFA 5GAMf 1BIBA 3JB9G 1YCYA 5GAMg 4V2SA 4C92G 3SWNC 3JB9D 4M78G 4C8QA 4C92D 4F7UG 4M78D 4N0AC 3V8KA 5GAN3 4NOYA 4M77E 5GAOn 4M75A 4MMLA 4M7DG 2VC8A 2JN0A 4EMGA 3RUXA 4A53A 4M7DD 4PJOC 1D3BA 4M7AE 2I2LA 4JRKA 4OP0A 2Y90A 2DTHA 2VXFA 5GAMd 1LJOA 4XTZA 4XTXA 2DEQA 1M5Q1 4JUVA 5GMKl 2E65A 4XU1A 3JCMV 4QVDA 2EAYA 4HA8A 4C92E 3L1AA 3GIBA 3JCMc 4M78E 4C8QC 3JCMe 2K57A 5GANf 4PJOG 5GANg 4F7UE 3RIRA 4PJOD 3QSUA 4QVCA 4J5YA 5GMKm 5GAMh 4M75C 4RCCA 3RKWA 5LJ5e 4M7DE 3BFMA 5LJ3f 3JCMJ 5LJ3g 2DTOA 2YLCA 1U1SA 4M77B 2YHTA 5GMKj 4XTYA 4C8QG 3L2ZA 5GANd 4C8QD 4M7AB 4X9DA 5GAMj 1I8FA 4J6YA 5GAN5 2HNIA 4M75G 3V7CA 5GMKe 5GAN2 4J6XA 2YLBA 4WF2A 4M77A 4HT8A 4M75D 1N9SA 3JCMf 3JCMg 4NL3A 3EFSA 4RCBA 1LNXA 5LJ3d 4XU2A 4F7UF 4PJOE 1M8VA 2DZCA 2EJ9A 5GAMe 5GAOm 4XTWA 1WQ7A 2ZGWA 3QHSA 3RERA 4M7AA 4MMKA 5LJ5f 3SB2A 5LJ5g 5GAN8 4C92B 4EMKB 5GANh 4M78B 4M77F 1MGQA 3BW1A 4F7UB 3INZA 5GAOr 3RKYA 5GAN7 3V7SA 5GAOl 3QO3A 1X01A 3FJPA 5DY9A 4Y91A 1KQ2A 2EWNA 4M7AF 1HXDA 2VXEA 5LJ3h 2DJZA 3JB9H 4C8QE 4M7DB 3JB9J 4JRIA 4A54A 4M78A 3V7RA 3BDUA 4NL2A 4F7UA 5GAN6 1I5LA 4M75E 2E1HA 2E41A 4M77C 4XTUA 3JCMW 5GANj 4J6WA 4XU3A 3SWNB 2E10A 2EJFA 1B34B 1HK9A 3JCMQ 3JB9F 4M7DA 1H641 2FYKA 2DTIA 2EJGA 2RA2A 1JRIA 2CGHA 1JBMA 2E64A 3EFRA 4M78F 4XQ3A 3JCMX 1D3BB 4M7AC 3PGGA 3JCMh 5LJ3j 1BIAA 5GANe 1LOJA 1N9RA 4EMHA 4PNOA 3VU3C 2DXUA 3RESA 4PJOB 3SWNA 1TH7A 4DQ2A 5I21A 1B34A 5GAOq 4M7DF 1Y96B 4XTVA 3HFNA 3V8LA 1KQ1A 4N0AA 5LJ5h 3JCMP 3FB9A 4M77G 3HSBA 2RM4A 5LJ3e 1I81A 1WQWA 2QTXA 1U1TA 4M77D 4C92C 4C8QF 4JLIA 4EMKC 4M78C 5CAIA 2DKGA 2FB7A 3AHUA 2DZ9A 2RD1A 4PJOA 1I4K1
chains in the Genus database with same CATH superfamily
4EMKA 1QVGA 3KBGA 2WSCE 3C94A 3LGFA 5I11A 1BKBA 4BE1A 5EC7A 4C0DC 4LUEA 1M3BA 1VQKT 2F1LA 3PMTA 1PM3A 2K2VA 4M77E 2HDAA 4QW2A 4M75A 5IHNA 4ZNXA 2JN0A 4J9FA 1VIEA 2JXBA 8ATCB 1NBEB 3EHRA 3VYGA 4KGVB 2DEQA 3G4SQ 3OYLA 1GL5A 2BZ8A 4X1VA 3M55A 1YWOA 2BZYA 4KH0B 1IRXA 2KAFA 2KT8A 3M58A 2OX7A 2CZ6B 3FC3A 5LJ3f 2LNHB 1MV3A 2YLCA 4B6MA 2KE9A 1OZ2A 1Z9ZA 2HCKA 2X3WD 1R0BG 1WJQA 1VQMA 2OTLT 3CXCP 2XKOC 1KHIA 4J9DA 4XU2A 4KUDK 2QEXT 1JB0E 4DEYA 5LJ5g 3I55T 2NYSA 3OYCA 1UECA 2RHIA 2C0OA 5GAOr 2E5KA 3VS4A 5I22A 2XG8D 3LLRA 5FRMA 3CMAA 2H3EB 2DL8A 3GLXA 1FX7A 3CC2Q 1MHNA 2PUKB 4ELZC 3NPFA 3L2RA 1VQ6Q 3TVTA 4C0DB 3RR6A 3QO3A 2A08A 4XQ3A 1ZUUA 2DERA 2E3HA 5LJ3j 1RUWA 4ZGJB 5I21A 1KIKA 2J6OA 1Y96B 4QVZA 4C8QF 3CPWA 2RF0A 4PJOA 4C92A 2QK0A 4XU0A 4IIMA 3G71T 2DVEA 1VQPA 3QWYA 2LRQA 3H6ZA 2A7YA 1J3TA 4M78D 5GAN3 4J7FA 2K6DA 1JJ2A 2K5LA 3CCEA 1AZGB 5D7UA 5CKEA 3SHWA 1D3BA 1YITA 4L6V5 2MMPA 4ATOA 5CKBA 4OMPA 3OQ5A 4CRIA 1LJOA 4XTXA 4CI0C 2BZXA 2OTJQ 1NPPA 1UGPB 1W6XA 4RTYA 1WX6A 1D0YA 2DIQA 3L1AA 3M53A 5GANf 1BI1A 1M1KU 3IQLA 4FW1A 4QVCA 3PMIA 2QQRA 2P0QA 2YUNA 4E7HA 1B7TA 2M1HA 5C6SA 4DBRA 3P8DA 3CCJQ 1WZOA 1I8FA 2F2XA 5GAN2 1YJ9Q 2LZ6B 2RJEA 4ZN3A 3GF5A 5KH6A 2CKKA 4XTWA 1KC8U 3QHSA 2BKDN 3MEWA 1WFWA 1VOMA 1Q86U 3E19A 2V8IA 5FROA 4DBFA 1ZSZA 3FJPA 2FPFA 1HD3A 2VXEA 1SRMA 2DK3A 4JRIA 4A54A 3V7RA 3E9FA 2NUPA 3CCSQ 1UUEA 1MV0B 1SF9A 2O9VA 5GANj 1Q82R 3KXTA 4XU3A 2VGNA 3M59A 5KYUB 4M7DA 2FYKA 1YJNQ 1JRIA 4FSSA 3LWHA 2JS2A 3G4ST 1JQQA 1TH7A 3QG1A 1SRLA 3O5ZA 2RJDA 4EMKC 2GBQA 2HKQB 4AFSC 3PE0A 3EG0A 4M7AD 1HYOA 1WPYA 2AKKA 1QQJA 1V1CA 5GMKh 3QUIA 1K8AR 2O88A 3GNFB 4PJOF 1QVFS 1G3SA 1M3AA 1ZUKA 5IH2A 3ASKA 3L2WA 4E7KA 3MKDA 1W70A 1K9AA 2COZA 2JOYA 3EH1A 3TQ7P 3X28B 1IXDA 2F69A 4AT1B 2DLPA 5A2QE 2D1XA 2EQIA 4J9GA 1YJWA 2Y90A 2JM8A 2L3RA 1WA7A 2VB6A 2CZ0B 2A3LA 2AIRB 2FG0A 3VYHB 2EKOA 4ELYC 1H8KA 2K57A 2CP7A 3CC2T 2KQWA 3RKWA 1VQ6T 3BFMA 2QDLA 2IG0A 2ZPEB 4DBHA 4KGZB 4OMOA 1ZA1B 3NGPA 1O75A 2LP5A 2OI3A 3OYKA 1WGSA 5FU6C 4M75G 1VQ4A 1VQMT 1QW1A 1NJIU 1VQLA 2J6FA 4M77A 4WF2A 2BIVA 4F7UF 1YWPA 2E12A 1W2BP 2ZGWA 5KYYB 1K1ZA 3NMZC 4EMKB 3CBOA 3MEUA 3MHXA 1UHFA 2YRVA 4C8QE 4C0ZA 4OMNA 2QI2A 5CR2A 3LW5E 1YNZA 1I5LA 5A0LA 2LX7A 2HMAA 2YT6A 3WXMB 3JCMQ 2DBMA 3J7AF 4OMQA 2HD0A 3UF4A 2KVQG 4M7DF 1QVFP 1UB4A 4GLMA 3X24B 5GMKm 1QCFA 1ZX6A 2M9UA 4C92C 4RTWA 2LCCA 3G7ZA 3NTIA 1M2VA 1UG1A 3SD4A 1WNLA 2O01E 1AEYA 3CCJT 2CS7A 1PD1A 3QPHA 1YJ9T 1NM7A 3CCET 2PVDB 5FU6B 4ANJA 2LT4A 1YITT 2KBTA 4QT7A 2NWMA 2FZGB 3GOXA 2NUTA 3FDRA 3JSCA 4Q5WA 4QVDA 2EAYA 3M9QA 3EGXA 4PJOG 4R55A 1QMCA 5AT1B 1MMGA 4PJNA 1R0CB 2J7IA 1VQKA 2LJ3A 3CCST 1Q82C 4BD3A 2GFAA 4HVVA 4O5VA 1IHVA 1WHKA 1YJNT 2CSIA 2XIDA 4XTYA 3TEEA 3NHNA 2MIOA 2ED0A 2MAMA 3I56A 4X9DA 4IKFA 1VQNQ 3VRYA 3QJ6A 4FU6A 2DETA 3A1PA 4RCBA 1LNXA 4J9CA 4PFPA 5LJ3d 1E7OA 1G3YA 5LJ5f 4C92B 1WI7A 4M77F 1S1NA 1K8AC 5GAOl 4PLLA 2X4YA 5FLXE 3TREA 3FEOA 3CCMA 1HXDA 2EQJA 2EYWA 2DRKA 2K79A 2RH2A 3SFMA 1SHGA 3DLLA 4J6WA 2OTLA 2RJFA 3TSZA 3EAEA 2M02A 2R5AA 2HQEA 1D3BB 2QEXA 2RQTA 2KXCA 3I55A 2ENMA 3I35A 3REAB 2FPDA 3FB9A 3CCVQ 1WQWA 2EYXA 3EFOB 2FZCB 2JMAA 2JT4A 3UPUA 2DZ9A 3E2UA 5CVIA 5HKCA 2EGAA 2DXTA 2LQ8A 2RB6A 1K73R 1OPKA 4O6JA 5LJ5j 3FIFA 4LN2A 2VUBA 3OA6A 5CIUA 2MI6A 4NOYA 2CP0A 4C5EA 4M7DG 3M56A 1Q7YR 1GCPA 4OP0A 1YJWT 2L3PA 5FWBA 3QWXX 1NYFA 2E65A 1Q95G 3G71A 1BK2A 2RJCA 4PL6A 4M78E 2L8DA 3QZ9B 4F7UE 3HPWA 3RIRA 4FT4A 8AT1B 3QSUA 3CCQQ 4AFZC 2WACA 2D0NA 3A8OB 5LJ5e 3OW2A 4LD6A 1WHMA 2G3RA 3JCMJ 3GPLA 1AWWA 1QP3A 3MP6A 3EGDB 2KROA 5GANd 2YUPA 1MMDA 2MWPA 4L5GA 3V7CA 4J6XA 1ACMB 4D8KA 1QWEA 4KRTA 4LNPA 3ZL7C 1QCOA 1Y71A 1KQSA 2LQWA 1MGQA 1PRLC 1ZA2B 2CUDA 4HVUA 2DYIA 2NLUA 3G1JA 5HCKA 5GAN6 2E1HA 4N4HA 1WHGA 4BI4A 4DOVA 2E10A 1B34B 9ATCB 4KT0E 2IVWA 2EJGA 2DA9A 3L2UA 1BYMA 2NUZA 2A0FB 1EIFA 4EMHA 2K9GA 2HKNA 2X4JA 1TXQA 3ZEHA 4M77G 4IIOA 4A4KA 3MEVA 1OX9A 2AHJB 2LTOA 1UFFA 2EQUA 1JEGA 4DOWA 1R77A 1NPRA 1KD1R 2PU9B 1IHWA 1OU8A 3OYBA 3LH0A 2LNVA 5KYWA 2CP5A 3NTHA 4JRPA 4RG2A 4C8QA 1AVZC 2CUBA 2RQWA 1S72Q 3G4SA 4KULA 3I5SA 2O4XB 1E6HA 1TTHB 4A4GA 1EFNA 1GFCA 3EG1A 1Y57A 1M8MA 2EYZA 1QVPA 2X35A 4M7AE 2V1RA 3J81E 5HY6A 4CC3A 2ROLA 3Q1JA 1FMKA 1EZZB 4OGEA 3ZBDA 4E7IA 1UTIA 4XK8E 2Z0WA 2KYBA 1Q82U 1XJWB 4Z88A 1VQ9Q 1MNEA 4ZN1A 1Z9QA 3L2ZA 3L42A 2SEMA 5GJWB 3A8GB 3I56T 3CCVT 2YLBA 4J83A 1M1FA 3I9QA 1FMWA 3H41A 1VQOQ 5GAMe 3THKA 3OYFA 3C95A 3M0UA 3CEYA 2MYSA 4OB3B 1K73C 3CC2A 2QQAA 1BCMA 3M57A 3QBYA 1VQ6A 2CYZB 1K8AU 2D9TA 2CDTA 2XMFA 3LGLA 3CCMT 2QGFB 2A37A 3NFCA 4XTUA 4E7ZA 2HBWA 4BE2A 4Z02A 4QQDA 1Q7YC 3JB9F 1M3CA 3QJYA 1H641 5CKFA 2DTIA 2EYQA 1ZBJA 1BIAA 2KNBB 2AT1B 3BDLA 2L3QA 3UDCA 1FMVA 2BE7D 4LD9K 4QQGA 1WHLA 1U1TA 2FB7A 1AWOA 3JCMd 1ZHIA 4OGCA 2DL7A 4JJDA 3JB9I 4MZPA 2H8HA 5CK9A 1K9MR 4C92D 4QKUA 4N0AC 3V8KA 4EDUA 2OTJA 2HSPA 2B8AA 4FCYA 2VC8A 2X4WA 4JS5A 1NLPC 1YIJQ 4JDSA 1TU0B 3LH5A 3CCRQ 4JUVA 2B86A 1WLPB 3HHTB 3CC4Q 2DEUA 1JO8A 1TUCA 2CT4A 4FW2A 2QA4Q 4J5YA 5GAMh 3CCJA 3OYIA 1YJ9A 4C0FA 1UGVA 5DM7R 1SSFA 3RMQA 4FL6A 4PJLA 2FO0A 1OU9A 3J80E 2P0PA 4E7LA 5GMKe 2LDMA 1D0XA 5I2SA 4P5NA 2VYTA 4FYXB 3QYGB 3PIPA 1KD1C 1BB9A 2K2MA 3CCSA 1NEGA 3EH2A 1XNIA 2GTOA 2LCSA 2CH4A 2ZPBB 3V7SA 3EG9B 2E5QA 1KJWA 1YJNA 1YI2Q 2CZ1B 4FT2A 4AG2C 3RMSA 3JB9J 1VIFA 2L3SA 4M78A 3VS0A 1S72T 4OB1B 4F7UA 1KQSS 1GCQA 2EJFA 3OMCA 3LYIA 1BI2A 5ECAA 4DA4A 2AZSA 2M0YA 4JS4A 1UE9A 5M9OA 1F1BB 4PNOA 2DXUA 2JVVA 3SWNA 1RAEB 4DQ2A 3QXEB 2HSEB 1D1BA 3A8LB 4F16A 2JNGA 1G3TA 2VWFA 2YRDA 3M4GA 5GMKi 4J9EA 3CCUQ 3CMEQ 3RKXA 4X9CA 2EVRA 3WVEB 1M27C 3JB9G 5GAMg 3OYHA 1I0CA 1ZLMA 2FL7A 3RNJA 4F14A 2XD0A 2K3BA 1PCXA 2QGGA 1QCNA 2AKLA 1VQOT 1BI0A 4CC4B 4JJBA 1PHTA 2MOXA 1N6AA 3WVDB 3GBQA 3MP8A 3S3NA 4PK4A 2RQRA 2GGRA 1TWBA 2COWA 4Z89A 2EGCA 3M0SA 3OBWA 4M75C 2L5QA 2PNIA 1NEBA 4MZTA 1QVGS 3G6EQ 4GLKA 3CD6Q 3HRSA 1RAHB 4C8QG 2CSQA 1U3OA 4D6WA 2P84A 6AT1B 1G2BA 2E3IA 2FHDA 2X4XA 2HL3A 2PZ1A 2ATCB 2X51A 1U06A 4HVWA 1KFZA 2DD5A 3H9NA 2KDSA 4M7AA 4J8OA 3FRNA 3AT1B 3BW1A 1K73U 2RHYA 1WHJA 2ZCFB 1RABB 1PSEA 3VS2A 4FM4B 2KI7A 1K9MC 2LQKA 2C0IA 2DAQA 1Y0MA 4RTUA 2V26A 1NZ9A 1Q7YU 4M78F 1K4US 2E64A 4OMFB 5KYXB 1VYTA 3HL8A 4IUQA 2MF2A 1M2OA 1KQ1A 2RM4A 2MPXC 3ER0A 4X34A 3S3MA 3VUBA 3P8BB 1T0HA 2K5FA 1CKBA 3V8JA 4F17A 2EGEA 4M75B 1C0MA 5FWCA 3I5RA 4OVAA 3M0RA 3MJXA 5GAOn 3DB4A 2OTJT 4PJMA 3OYEA 3QYHB 3RUXA 4PJOC 4CC2A 1PNJA 1GFDA 2ZPFB 4XTZA 2DXCA 2H3JA 2HL5C 1M9SA 2DVJA 3CXCA 1YI2T 4CC7A 2HZYA 1IZ6A 3CPWS 1VQ5Q 5J39A 3ME9A 2OAUA 1VQNA 2HEQA 4ZGDB 4OF1A 2A28A 2JW4A 4FYYB 1ZQ1A 1UGSB 4RMOA 4LE9A 4C5GA 5AYFA 2DBKA 2HBPA 1LCKA 1X43A 1NE8A 4C0GA 5CCAA 4HT8A 2E70A 3P8HA 1JJ2S 1X2QA 1M8VA 3E1SA 1PKSA 1BBZA 4MMKA 3SB2A 3OS5A 1KD1U 3CCLQ 4HCKA 3CCUT 2Y4XA 3D7SB 1LVKA 4VUBA 5GAN7 1GBRA 3MEAA 2EWNA 4M7AF 2O2OA 3TCJA 2DJZA 3S3OA 4ORZA 4EPCA 1YHQQ 4HCZA 4JZ4A 1TG0A 2C0TA 3CBMA 3CCVA 2K3YA 2F5TX 2K5IA 4AMCA 3PGGA 1SG5A 2RI5A 1JXMA 4B9WA 4PJOB 4PLIA 1ZSZC 2M16A 2BUDA 1K0XA 3A8HB 3VS5A 2ZZDA 5D6WA 5CAIA 4BDYA 1YN8A 3T9NA 3H0FA 1Y96A 4M7DC 2YUQA 3SEMA 2XK0A 3CD6T 2CP2A 2MWOA 3JAME 1RAGB 1M90R 1X69A 1VQ7Q 4M78G 2GF7A 1I1JA 4F7UG 2D8JA 4TVRA 2XI9A 5KE3A 1Q81R 4IUPA 1W1FA 1UJ0A 4JRKA 3CCQA 2DTHA 2FPEA 2VASA 1X6GA 2P4RA 2PTKA 1G83A 1NG2A 2BE9B 4IUVA 4BY6C 3CC7Q 4C92E 3OSSC 4A4EA 3HRTA 2YRCA 1AOJA 3M0TA 2XHCA 5A0GA 1JJ2P 4Z8AA 4JJNK 2RHUA 1H3HA 1U1SA 3OYJA 1OULA 1D1AA 1RAFB 1OPLA 2KYMA 2JUFA 2HNIA 2COYA 1I5OB 2HQHA 1VQ8Q 4RKUE 1RI0A 2J6KA 1VYVA 1ZSZB 2JTEA 1TUDA 1Y07A 1XTDA 2ED1A 4J9BA 2CZ7B 3CPFA 5GAN8 1GXIE 4FIBA 4F04B 3OB9A 4XAXB 2ZPHB 2NUPB 1IGQA 2RI3A 3UT1A 2YDLA 3TSWA 4M7DB 4M77C 1IREB 5DLOA 2DRMA 1RLPC 2RA2A 4BACA 2DILA 3JCMh 2K3XA 4ESRA 2SRCA 3SDZA 5KYUA 1B3QA 3HFNA 2V8JA 4WCIA 1ZSGA 4DEXA 4A4FA 2EPDA 2K7AA 2YUOA 4M7AG 4BY6B 2CP6A 1S72A 1MUZA 1OYXA 3JCMb 1QKXA 4LUDA 1VUBA 2G6FX 4L59A 5GAN4 3JRZA 2L2PA 2DIGA 2KY9A 1MMNA 2I0NA 3M0QA 1JXOA 1SSHA 5GAMf 2FEIA 4LDWA 2EQMA 2DFUA 1WIEA 3A8MB 4LXCA 3LWIA 1OEBA 1YFNA 1V76A 2I2LA 3HP9A 1EX4A 1YCSB 5EG2A 3CCLT 2RK2A 1UEBA 1M5Q1 2RQVA 2RN8A 1QKWA 2KSSA 3JCMV 2EYYA 2MCNA 4II1A 1VQ9A 3GIBA 3JCMc 1W2BA 2FVUA 1OZ3A 4FSXA 1YHQT 2QDYB 1HJDA 4RCCA 1VQNT 4JZ3A 4M77B 4QQ6A 1VQOA 2J06A 1FYNA 1RADB 5GAMj 3VS1A 3OY9A 4M75D 3JCMg 3EFSA 3E9GA 4RG8A 1XQHA 2V1QA 4C5HA 2RQUA 3L2QA 2ESWA 2DMOA 1QLYA 3TU4K 1RACB 1QVFA 4GY5A 4Y91A 5FRNA 1M90C 4RTTA 3JB9H 1WHHA 1D1CA 1VQ7T 2GNCA 3BDUA 4LDYA 2ABLA 4NL2A 2F2VA 2XDDA 4HKEA 1Q81C 1TOVA 2A36A 2ZPIB 5DLQE 1MNDA 2EBPA 5IN1A 3CC7T 1M2VB 2LJ0A 1IGUA 1G5VA 1N8RR 2KRNA 2DL5A 3A5ZB 3DB3A 4A63B 1B07A 3LX7A 4BE0A 2DO3A 5GAOp 2JMCA 3RDVA 3DLMA 3A98A 5FW9A 5IHIA 4HCCA 1VYUA 1YIJA 3U23A 2VGMA 3OYDA 3CCRA 1O9SA 2QQBA 1U8RA 3VS3A 2XU8A 4D8DA 2C06A 4MMLA 3CC4A 1VQ8T 2NUTB 4A53A 4R56A 2QA4A 1AWXA 4PFZA 3CBPA 3EGXB 2VXFA 3CCQT 1NJIC 1TUGB 2RO0A 4FYWB 3MP1A 2CT3A 2CP3A 4PJOD 1PRMC 2DTOA 3GNGA 1HSQA 2IPOB 5GMKj 1WJRA 2RHXA 1AWJA 4RTXA 3JV3A 1UJYA 1A0NB 4N4GA 2WSEE 1YI2A 1G8XA 2OAWA 2QQ9A 2F2WA 3VUZA 1RLQC 1U5SA 3OYYA 4M4ZA 2ROTA 3GP8A 1VQMQ 2KK4A 4JPBW 4E6RA 1KQ2A 2FRYA 4PKCC 2KR3A 1E6GA 1AZEA 4BUGA 3N5BB 1XOVA 2CH4W 4K11A 2DX1A 2YXYA 4R0KA 3OW2S 5D6YA 2QG9B 3NTKA 4JLGA 1PWTA 2W0ZA 3CMAQ 3CCUA 1RL2A 3CMEA 4XTVA 5IHKA 3VS7A 2AK5A 1T3LA 2D0QB 4BB7A 5LJ3e 4JLIA 5D6XA 3M54A 2KMTA 4M75F 1RI9A 1KSWA 1ZBXA 3CQTA 3PNWC 4IUTA 5LJ5d 1GBQA 3EFOA 5I2MA 5CKDA 2XDBA 1YCYA 3HRUA 2K4YA 5J26A 3OYNA 2JJ9A 1PC0A 1DJ7B 2QTVA 2V8KA 3META 4EMGA 1VQPQ 1K76A 1I07A 4M7DD 5CQXA 1G3WA 2YWWA 4JJCA 1MMAA 5GMKl 3X26B 3G6EA 2J05A 3CCEQ 3CD6A 3QDRB 1VQ9T 4C8QC 1YITQ 4KGXB 5GJVB 3URGA 1WYXA 3C4SA 3C0CA 2JTFA 1X75C 2L0AA 2D8HA 2VKNA 2YHTA 5IXFA 2OJ2A 1W2BS 3QDFA 4BI8B 3ULRB 5GAN5 4J6YA 2DL4A 3PTAA 1BU1A 1R8OB 1ABOA 5KYNA 1N8RC 3EGDA 2P0KA 4ZGEB 2PVGB 2R57A 1RAIB 2KEAA 3L2VA 3OW2P 5IT9E 1D09B 2E6ZA 2P4TA 1ARKA 2E4HA 2DYBA 1X01A 2E6NA 5LJ3h 1M90U 4E7JA 4UC4A 3H8ZA 3JCMW 4LDUA 1QP2A 1H92A 4PJJA 2LX9A 1Q81U 4C92F 3EFRA 3QZ5B 2X9HA 1YBYA 3KFVA 2EFIA 5GANe 2JS0A 1KQSP 2RI2A 2XICA 2GCXA 5GAOq 1B34A 5LL6S 1OQKA 2DE0X 2QTXA 4M77D 3ZFJA 4EIKA 3AHUA 5KCHA 1JBMA 5KYWB 2RPNA 4J9HA 4OB0B 2HAXA 1M1GA 4C8QB 1WXTA 4ZTJA 1M30A 3HKSA 4N4IA 2LVMA 3VS6A 3C12A 1BIBA 3OYGA 1IO6A 1JU5C 3PFSA 1YIJT 1PSFA 3H0IA 2LCLA 3CCRT 1NLOC 3CC4T 3R6OA 4OB2B 3R6NA 3X20B 2CREA 2FZKB 2GQIA 2QA4T 3OYAA 1VQ5A 2O4XA 5GAMd 3KUFA 4OMLA 4RTVA 3HTRA 4OMMA 2HQXA 2XDPA 1YJWQ 3EG3A 2MK5A 3PVQA 4Y28E 4E7SA 5LJ3g 2KRMA 1SHFA 2RHZA 4J7IA 3CMAT 1TS9A 3CCLA 4FYVB 1QVGP 2DL3A 1WJSA 2QQSA 3JCMf 3M5AA 5J3BA 1FXXA 2DZCA 2GTJA 2JTMA 1YHQA 1KK7A 5GANh 4RTZA 2PVOB 1GRIA 1OI1A 2EIFA 3INZA 1VQ4Q 2AZVA 1VQLQ 1T0JA 2ECZA 1M1KR 3RBBB 5CO7A 4WTOB 1OOTA 2QASA 4M75E 2E41A 3DKMA 1ABQA 2RMOA 1HK9A 1VQPT 1YP5A 3PVLA 1AD5A 4MDXA 2FRWA 1LOJA 1N9RA 1OV3A 1UHCA 5HK0A 3RESA 2DM1A 1LPLA 3CMET 5A0DA 3VV0A 4DBQA 2EW3A 1P92A 1UDLA 4M78C 2DKGA 2DJQA 2LQNA 3QKJA 1VQ7A 1KC8R 2LC4A 2YSQA 1GCQC 1Q86R 4KBMB 3O8VA 3UATA 1RAAB 4BDZA 1KHCA 2QAZA 4V2SA 4C92G 3SWNC 1IB8A 1PKTA 3CC7A 1K0SA 5IAYA 2DD4A 2X3XD 1AT1B 2IIMA 3OS2A 1VA7A 3VKIA 3MO8A 2D6FA 3G6ET 2LJ1A 4PFOA 3VJPA 5L23A 2DPPB 4Y92A 3JCMe 5GANg 2JZ2A 1WXUA 4A4HA 1M4ZA 5FU7C 1N27A 2KGTA 2O31A 1VQ8A 1OX8A 2DF6A 1QWFA 2F5KA 3CPWP 1KG1A 5CQYA 4C5IA 1VQKQ 2M0OA 3FLGA 4HCBA 2RK1A 2VV5A 1N9SA 4PJOE 1C6VX 4NS5A 2EJ9A 1N8RU 5IXBA 3RERA 1WQ7A 1H3ZA 3MCAB 4M78B 3I56Q 4AG1C 4F7UB 4BI3A 2PUOB 1N5ZA 1NYGA 4MZMA 1CKAA 3UWNA 3MPUB 2L89A 3BE3A 3PIOA 2BTTA 4ZTFA 3EG9A 7AT1B 3SWNB 4GBQA 1FWZA 1PD0A 3CCMQ 4M7AC 2LMJA 1X6OA 3EHQA 2W10A 3VU3C 3V8LA 1Y7XA 4N0AA 1NJIR 2OTLQ 3HSBA 1X2KA 3OS1A 2ZPGB 3OYMA 2QEXQ 1I4K1 4MDWA 1K9MU 3HFOA 2GFUA 3I55Q 1PG5B 1ZUYA 2PQWA 4JRQA 2QXFA 4KUIA 2R58A 4HT9A 3BY7A 3QIIA 5FU7B 1SPKA 1X6BA 1W4SA 1X27A 2EQKA 3JB9D 2O9SA 3OBYA 2DNUA 3UA7A 4IUUA 3PT9A 4YTLA 3H0HA 4LDXA 2QYZA 4AFUC 5CKHA 1AHJB 2JM9A 1UGRB 1TSFA 3OSVA 3UA6A 3S6WA 1VQ5T 3VRZA 1V29B 1VQ4T 1VQLT 4XU1A 4KH1B 4HA8A 4ME7A 4B9XA 2KRSA 1M1KC 5L8RE 1BI3A 2KXDA 4J9IA 3FJ5A 5HK3A 4M7DE 1SKUB 3G71Q 1D0ZA 3EGUA 1SEMA 2Y4YA 4RUGA 2LT1A 4C8QD 4M7AB 4LDVA 5KCOA 4AFQC 4E2FB 2VVKA 4NL3A 1BCOA 3M0PA 2GQVA 3REBB 1KC8C 5GAOm 1WXBA 4IURA 1Q86C 4E47A 1C1AA 1UGQB 3RKYA 2M51A 3OMGA 5DY9A 5KE2A 2RNAA 3EG2A 3CXCS 2ZAEA 5C0MA 2EKHA 1T3SA 3M4YA 2CGHA 3JCMX 4HXJA 2R5MA 1CSKA 3OS0A 3F70A 1WDXA 5LJ5h 3JCMP 2KT1A 2DXBA 1I81A 2WSFE 5KYXA 3X25B 5KYYA 2RD1A
chains in the Genus database with same CATH topology
3P8BB 5CVIA 5HKCA 2K5FA 4M75F 4EMKA 1QVGA 2DXTA 2LQ8A 3KBGA 2WSCE 2RB6A 3V8JA 1ZBXA 3C94A 3LGFA 3PNWC 4IUTA 1BKBA 4O6JA 5LJ5d 5I2MA 5LJ5j 5CKDA 4M75B 4BE1A 3FIFA 2XDBA 1YCYA 2VUBA 4OVAA 3HRUA 2K4YA 4C0DC 3OA6A 5CIUA 1VQKT 2MI6A 3PMTA 5J26A 5GAOn 3DB4A 2K2VA 4M77E 4NOYA 4QW2A 4C5EA 3OYNA 1DJ7B 2V8KA 3META 4M75A 4M7DG 2OTJT 3M56A 3OYEA 3QYHB 2JN0A 4EMGA 3RUXA 4M7DD 4PJOC 5CQXA 1VIEA 4OP0A 1G3WA 2ZPFB 1YJWT 3VYGA 4XTZA 2DEQA 2DXCA 5GMKl 2E65A 2H3JA 3X26B 3OYLA 1M9SA 3G6EA 3G71A 3CD6A 3QDRB 3M55A 3CXCA 1YI2T 1VQ9T 2RJCA 4PL6A 4M78E 4C8QC 2L8DA 1IZ6A 3QZ9B 1VQ4A 4F7UE 3HPWA 3RIRA 2KAFA 4FT4A 3CPWS 3QSUA 3M58A 2WACA 5J39A 3URGA 3ME9A 3A8OB 2OAUA 1VQNA 4ZGDB 5LJ5e 2CZ6B 3C4SA 3OW2A 3FC3A 4LD6A 2G3RA 5LJ3f 4OF1A 3JCMJ 2JTFA 3GPLA 1X75C 2YLCA 1ZQ1A 2YHTA 1UGSB 4RMOA 1QP3A 3MP6A 4C5GA 1W2BS 1OZ2A 5AYFA 4BI8B 2HBPA 5GANd 2MWPA 5GAN5 1NE8A 4J6YA 4C0GA 3PTAA 1WJQA 1VQMA 5CCAA 4L5GA 3V7CA 2OTLT 4J6XA 4HT8A 1R8OB 2E70A 3P8HA 2XKOC 1JJ2S 1KHIA 1M8VA 4XU2A 1N8RC 2P0KA 4KUDK 4ZGEB 2QEXT 3E1SA 2PVGB 2R57A 1JB0E 4MMKA 1Y71A 3SB2A 3OS5A 5LJ5g 3I55T 1KD1U 1KQSA 3L2VA 3OYCA 1MGQA 3CCUT 2Y4XA 2RHIA 5IT9E 2E6ZA 4VUBA 2P4TA 5GAOr 5GAN7 3MEAA 1X01A 2E6NA 2EWNA 2XG8D 3LLRA 5LJ3h 3TCJA 2DJZA 5FRMA 3CMAA 4M7AF 1M90U 2NLUA 3S3OA 4E7JA 4EPCA 3GLXA 4UC4A 1FX7A 4HCZA 5GAN6 3H8ZA 2E1HA 1MHNA 4LDUA 1QP2A 4N4HA 3JCMW 2PUKB 4BI4A 4DOVA 4ELZC 3L2RA 3CBMA 2E10A 1B34B 4C0DB 3CCVA 2LX9A 4KT0E 1Q81U 3M54A 2IVWA 2K3YA 3QO3A 4C92F 2EJGA 3EFRA 3QZ5B 4XQ3A 2F5TX 2K5IA 3L2UA 1BYMA 1YBYA 3PGGA 5LJ3j 2EFIA 2RI5A 5GANe 1EIFA 4B9WA 4EMHA 2RI2A 2XICA 4ZGJB 4PJOB 4PLIA 2GCXA 5I21A 1B34A 2M16A 2X4JA 5GAOq 1Y96B 2BUDA 5LL6S 3ZEHA 4M77G 3A8HB 4A4KA 2QTXA 2ZZDA 4M77D 3MEVA 4QVZA 5D6WA 3ZFJA 4C8QF 2AHJB 5CAIA 4BDYA 1GXIE 3CPWA 3AHUA 2LTOA 1JBMA 5KCHA 4PJOA 2EQUA 3T9NA 4C92A 4DOWA 1NPRA 1Y96A 4OB0B 2HAXA 1M1GA 2PU9B 4C8QB 4M7DC 4ZTJA 4XU0A 2XK0A 3HKSA 4N4IA 3G71T 2DVEA 3OYBA 3LH0A 3CD6T 1VQPA 2LNVA 2LVMA 3C12A 3NTHA 1BIBA 2MWOA 3JAME 3OYGA 2LRQA 4JRPA 4M78G 2GF7A 4RG2A 3H6ZA 4C8QA 2A7YA 3PFSA 4F7UG 4M78D 1YIJT 3G4SA 1PSFA 4KULA 2LCLA 2O4XB 5GAN3 4J7FA 4A4GA 3CCRT 4TVRA 1JJ2A 2XI9A 2K5LA 3CCEA 5KE3A 3CC4T 3R6OA 4OB2B 3X20B 5CKEA 4IUPA 1D3BA 1QVPA 2X35A 4JRKA 1YITA 4M7AE 4L6V5 2MMPA 2QA4T 4ATOA 5CKBA 3OYAA 3J81E 2O4XA 2DTHA 3OQ5A 3KUFA 4CRIA 5GAMd 1LJOA 3CCQA 4XTXA 4CI0C 5HY6A 1NPPA 1UGPB 3Q1JA 4BY6C 4IUVA 2DIQA 3M53A 3L1AA 3OSSC 2HQXA 4A4EA 4C92E 4OGEA 1BI1A 5GANf 3ZBDA 1M1KU 4E7IA 2XDPA 3HRTA 4QVCA 3PMIA 2QQRA 2P0QA 4E7HA 4XK8E 2XHCA 5A0GA 1Q82U 4Y28E 4JJNK 2RHUA 5LJ3g 2M1HA 5C6SA 1U1SA 2RHZA 4ZN1A 3OYJA 3P8DA 4J7IA 3CMAT 3L2ZA 3CCLA 3L42A 1I8FA 3A8GB 2JUFA 2HNIA 3I56T 5GAN2 3CCVT 2YLBA 1WJSA 2QQSA 1M1FA 2RJEA 4J83A 3JCMf 3M5AA 4ZN3A 3GF5A 1RI0A 4RKUE 5KH6A 5J3BA 1FXXA 2DZCA 1Y07A 2CKKA 1XTDA 5GAMe 4XTWA 1KC8U 3QHSA 2JTMA 3OYFA 2BKDN 2CZ7B 3C95A 3CPFA 5GAN8 3CEYA 3MEWA 4FIBA 5GANh 4OB3B 2PVOB 1YHQA 2QQAA 3E19A 1Q86U 3OB9A 2V8IA 4XAXB 3M57A 1OI1A 2EIFA 2ZPHB 3INZA 3QBYA 5FROA 1VQ6A 2CYZB 1K8AU 2D9TA 2RI3A 3FJPA 3UT1A 4M7DB 2VXEA 3LGLA 3CCMT 5CO7A 2DK3A 4JRIA 4A54A 3V7RA 3E9FA 3NFCA 4M75E 2E41A 4M77C 1IREB 3DKMA 4XTUA 5GANj 3KXTA 4XU3A 4BE2A 2VGNA 3M59A 4QQDA 4Z02A 5DLOA 1Q7YC 1HK9A 3JB9F 1VQPT 4M7DA 3QJYA 1H641 2FYKA 2DTIA 2RA2A 5CKFA 1JRIA 4BACA 2EYQA 3JCMh 2K3XA 3LWHA 4MDXA 1BIAA 1LOJA 1N9RA 5HK0A 3RESA 3G4ST 1TH7A 3SDZA 3QG1A 3BDLA 3HFNA 2V8JA 3X25B 3CMET 1K73C 3UDCA 5A0DA 3VV0A 4LD9K 4QQGA 1U1TA 4EMKC 2RJDA 1P92A 4A4FA 4M78C 2DKGA 2FB7A 3QKJA 1VQ7A 4M7AG 3JCMd 4BY6B 1ZHIA 1S72A 4OGCA 1OYXA 2LC4A 3JCMb 4M7AD 4KBMB 1WPYA 1VUBA 3JB9I 4L59A 5GAN4 3JRZA 3O8VA 2DIGA 4MZPA 5GMKh 2KY9A 3QUIA 4BDZA 3GNFB 4PJOF 1QVFS 1G3SA 1KHCA 5GAMf 5CK9A 4E7KA 3ASKA 3L2WA 4V2SA 4C92G 3SWNC 4LDWA 4C92D 2EQMA 4N0AC 3V8KA 4EDUA 2JOYA 2OTJA 3A8MB 2B8AA 3X28B 2VC8A 2F69A 3LWIA 3CC7A 5IAYA 5A2QE 2DD4A 2X4WA 2I2LA 3HP9A 4JS5A 1YJWA 2Y90A 5EG2A 3CCLT 4JDSA 2L3RA 2RK2A 3OS2A 1UEBA 1M5Q1 4JUVA 2CZ0B 2A3LA 2KSSA 3VKIA 3MO8A 3JCMV 2D6FA 3HHTB 3G6ET 4II1A 3VJPA 1VQ9A 2DPPB 3VYHB 2EKOA 4ELYC 3GIBA 3JCMc 3JCMe 1W2BA 2K57A 2FVUA 5GANg 1OZ3A 4FSXA 4J5YA 5GAMh 3CCJA 1YHQT 2JZ2A 2QDYB 3OYIA 3CC2T 2KQWA 4RCCA 4A4HA 1M4ZA 5FU7C 3RKWA 1N27A 1YJ9A 4C0FA 1VQ6T 1VQNT 3BFMA 5DM7R 2IG0A 1VQ8A 3CC2A 1SSFA 2ZPEB 3RMQA 4FL6A 4M77B 2F5KA 4QQ6A 1VQOA 1KG1A 5CQYA 4C5IA 1O75A 3J80E 2M0OA 5GAMj 2P0PA 3OYKA 3FLGA 1WGSA 5FU6C 4E7LA 4HCBA 4M75G 5GMKe 3OY9A 1QW1A 1VQMT 2LDMA 2RK1A 2VV5A 4M77A 4WF2A 4M75D 1N9SA 5I2SA 3JCMg 2BIVA 4P5NA 3EFSA 2VYTA 4PJOE 4F7UF 2E12A 4NS5A 3E9GA 2EJ9A 1XQHA 3QYGB 4RG8A 4C5HA 1WQ7A 2ZGWA 3PIPA 1N8RU 1KD1C 3MCAB 3RERA 1H3ZA 3L2QA 4EMKB 4M78B 3CBOA 3CCSA 3MEUA 4F7UB 3TU4K 1XNIA 1QVFA 4GY5A 2ZPBB 3MHXA 3V7SA 4BI3A 2E5QA 2PUOB 4Y91A 1YJNA 1VQ5A 5FRNA 1M90C 2CZ1B 2YRVA 4FT2A 3JB9H 4C8QE 4MZMA 3RMSA 3JB9J 1VQ7T 3UWNA 4C0ZA 2QI2A 1VIFA 5CR2A 4M78A 1S72T 3BDUA 2L89A 4LDYA 4NL2A 3LW5E 3PIOA 4OB1B 4F7UA 4ZTFA 2XDDA 1I5LA 5A0LA 1KQSS 4HKEA 3SWNB 1Q81C 2EJFA 3OMCA 3WXMB 3JCMQ 1FWZA 3LYIA 4M7AC 1BI2A 4DA4A 1X6OA 2ZPIB 3J7AF 5DLQE 4JS4A 2HD0A 5M9OA 4PNOA 3VU3C 2DXUA 5IN1A 2JVVA 2KVQG 3SWNA 4DQ2A 4M7DF 3QXEB 3V8LA 1Y7XA 4N0AA 3HSBA 3A8LB 1UB4A 3CC7T 3X24B 2ZPGB 2M9UA 4C92C 5GMKm 3OS1A 3OYMA 1G5VA 2JNGA 2LCCA 1G3TA 1I4K1 4MDWA 3G7ZA 3A5ZB 3DB3A 1K9MU 3HFOA 2GFUA 3M4GA 3NTIA 5GMKi 3LX7A 4BE0A 2PQWA 2DO3A 4JRQA 3SD4A 5GAOp 3RKXA 2QXFA 4X9CA 4KUIA 1WNLA 2O01E 2R58A 4HT9A 3BY7A 3QIIA 5FU7B 3WVEB 3JB9G 5GAMg 3DLMA 3OYHA 1W4SA 2EQKA 2FL7A 3JB9D 2XD0A 4HCCA 1YIJA 3CCJT 2VGMA 3OBYA 3OYDA 3CCRA 1O9SA 2QQBA 1U8RA 2CS7A 3QPHA 2XU8A 4IUUA 3PT9A 1YJ9T 4YTLA 4MMLA 2C06A 1VQ8T 3CC4A 4LDXA 3CCET 5CKHA 4A53A 2PVDB 4R56A 1AHJB 5FU6B 2QA4A 1VQOT 1UGRB 2LT4A 1YITT 1BI0A 3CBPA 3OSVA 2VXFA 3S6WA 1VQ5T 3CCQT 1NJIC 1N6AA 3WVDB 3GOXA 2RO0A 1V29B 1VQ4T 1VQLT 4XU1A 3FDRA 3JSCA 4Q5WA 4QVDA 2EAYA 3MP8A 3S3NA 4HA8A 4ME7A 4B9XA 1M1KC 5L8RE 1BI3A 3M9QA 3MP1A 4PJOG 1VQLA 4R55A 4PJOD 3OBWA 1VQKA 4M75C 3CCST 1Q82C 2L5QA 4BD3A 5HK3A 4M7DE 2GFAA 4MZTA 1QVGS 4O5VA 2DTOA 4GLKA 3GNGA 1YJNT 3HRSA 2XIDA 5GMKj 4XTYA 3TEEA 1WJRA 4C8QG 2Y4YA 2RHXA 2LT1A 2MAMA 4C8QD 4M7AB 4D6WA 4X9DA 3I56A 4LDVA 5KCOA 4IKFA 2X4XA 2FHDA 3QJ6A 4FU6A 4NL3A 4N4GA 2WSEE 1YI2A 4RCBA 1LNXA 2DD5A 2QQ9A 5LJ3d 2GQVA 1KC8C 5GAOm 1G3YA 2KDSA 3VUZA 4J8OA 4IURA 5LJ5f 4M7AA 1Q86C 4E47A 4C92B 3OYYA 3FRNA 4M77F 3BW1A 1K73U 3GP8A 1UGQB 2RHYA 1K8AC 3RKYA 5GAOl 2KK4A 2ZCFB 3OMGA 2X4YA 4PLLA 5FLXE 3TREA 5DY9A 5KE2A 3FEOA 1KQ2A 3CCMA 1PSEA 1HXDA 4FM4B 2EQJA 4PKCC 3CXCS 1K9MC 2LQKA 2DAQA 3N5BB 4BUGA 1XOVA 2RH2A 3SFMA 5C0MA 3DLLA 1NZ9A 4J6WA 3M4YA 2OTLA 2RJFA 3EAEA 3OW2S 5D6YA 1Q7YU 3NTKA 2R5AA 2CGHA 4JLGA 4M78F 2E64A 3JCMX 1NJIU 2HQEA 1D3BB 2QEXA 4OMFB 2R5MA 3I55A 3HL8A 4IUQA 3OS0A 3CCUA 2MF2A 1RL2A 3F70A 3CMEA 4XTVA 5LJ5h 3JCMP 1KQ1A 3FB9A 2DXBA 4BB7A 2D0QB 2RM4A 5LJ3e 1I81A 3ER0A 1WQWA 2WSFE 4JLIA 4X34A 5D6XA 3S3MA 3UPUA 3VUBA 2DZ9A 2RD1A 2KMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A G;  3JCM d;  4C92 A;  4M75 F;  4EMK A;  3JCM b;  1Y96 A;  3HFO A;  3M4G A;  4M7A D;  5GMK i;  2DXT A;  4C8Q B;  4M7D C;  1WPY A;  2RB6 A;  3V8J A;  3JB9 I;  4XU0 A;  5GAN 4;  5GAO p;  5LJ5 d;  2DVE A;  3RKX A;  5GMK h;  3QUI A;  4C92 F;  4X9C A;  5LJ5 j;  1WNL A;  4PJO F;  4M75 B;  4HT9 A;  3BY7 A;  3FIF A;  5GAM f;  1BIB A;  3JB9 G;  1YCY A;  5GAM g;  4V2S A;  4C92 G;  3SWN C;  3JB9 D;  4M78 G;  4C8Q A;  4C92 D;  4F7U G;  4M78 D;  4N0A C;  3V8K A;  5GAN 3;  4NOY A;  4M77 E;  5GAO n;  4M75 A;  4MML A;  4M7D G;  2VC8 A;  2JN0 A;  4EMG A;  3RUX A;  4A53 A;  4M7D D;  4PJO C;  1D3B A;  4M7A E;  2I2L A;  4JRK A;  4OP0 A;  2Y90 A;  2DTH A;  2VXF A;  5GAM d;  1LJO A;  4XTZ A;  4XTX A;  2DEQ A;  1M5Q 1;  4JUV A;  5GMK l;  2E65 A;  4XU1 A;  3JCM V;  4QVD A;  2EAY A;  4HA8 A;  4C92 E;  3L1A A;  3GIB A;  3JCM c;  4M78 E;  4C8Q C;  3JCM e;  2K57 A;  5GAN f;  4PJO G;  5GAN g;  4F7U E;  3RIR A;  4PJO D;  3QSU A;  4QVC A;  4J5Y A;  5GMK m;  5GAM h;  4M75 C;  4RCC A;  3RKW A;  5LJ5 e;  4M7D E;  3BFM A;  5LJ3 f;  3JCM J;  5LJ3 g;  2DTO A;  2YLC A;  1U1S A;  4M77 B;  2YHT A;  5GMK j;  4XTY A;  4C8Q G;  3L2Z A;  5GAN d;  4C8Q D;  4M7A B;  4X9D A;  5GAM j;  1I8F A;  4J6Y A;  5GAN 5;  2HNI A;  4M75 G;  3V7C A;  5GMK e;  5GAN 2;  4J6X A;  2YLB A;  4WF2 A;  4M77 A;  4HT8 A;  4M75 D;  1N9S A;  3JCM f;  3JCM g;  4NL3 A;  3EFS A;  4RCB A;  1LNX A;  5LJ3 d;  4XU2 A;  4F7U F;  4PJO E;  1M8V A;  2DZC A;  2EJ9 A;  5GAM e;  5GAO m;  4XTW A;  1WQ7 A;  2ZGW A;  3QHS A;  3RER A;  4M7A A;  4MMK A;  5LJ5 f;  3SB2 A;  5LJ5 g;  5GAN 8;  4C92 B;  4EMK B;  5GAN h;  4M78 B;  4M77 F;  1MGQ A;  3BW1 A;  4F7U B;  3INZ A;  5GAO r;  3RKY A;  5GAN 7;  3V7S A;  5GAO l;  3QO3 A;  1X01 A;  3FJP A;  5DY9 A;  4Y91 A;  1KQ2 A;  2EWN A;  4M7A F;  1HXD A;  2VXE A;  5LJ3 h;  2DJZ A;  3JB9 H;  4C8Q E;  4M7D B;  3JB9 J;  4JRI A;  4A54 A;  4M78 A;  3V7R A;  3BDU A;  4NL2 A;  4F7U A;  5GAN 6;  1I5L A;  4M75 E;  2E1H A;  2E41 A;  4M77 C;  4XTU A;  3JCM W;  5GAN j;  4J6W A;  4XU3 A;  3SWN B;  2E10 A;  2EJF A;  1B34 B;  1HK9 A;  3JCM Q;  3JB9 F;  4M7D A;  1H64 1;  2FYK A;  2DTI A;  2EJG A;  2RA2 A;  1JRI A;  2CGH A;  1JBM A;  2E64 A;  3EFR A;  4M78 F;  4XQ3 A;  3JCM X;  1D3B B;  4M7A C;  3PGG A;  3JCM h;  5LJ3 j;  1BIA A;  5GAN e;  1LOJ A;  1N9R A;  4EMH A;  4PNO A;  3VU3 C;  2DXU A;  3RES A;  4PJO B;  3SWN A;  1TH7 A;  4DQ2 A;  5I21 A;  1B34 A;  5GAO q;  4M7D F;  1Y96 B;  4XTV A;  3HFN A;  3V8L A;  1KQ1 A;  4N0A A;  5LJ5 h;  3JCM P;  3FB9 A;  4M77 G;  3HSB A;  2RM4 A;  5LJ3 e;  1I81 A;  1WQW A;  2QTX A;  1U1T A;  4M77 D;  4C92 C;  4C8Q F;  4JLI A;  4EMK C;  4M78 C;  5CAI A;  2DKG A;  2FB7 A;  3AHU A;  2DZ9 A;  2RD1 A;  4PJO A;  1I4K 1; 
#chains in the Genus database with same CATH topology
 4EMK A;  1QVG A;  3KBG A;  2WSC E;  3C94 A;  3LGF A;  5I11 A;  1BKB A;  4BE1 A;  5EC7 A;  4C0D C;  4LUE A;  1M3B A;  1VQK T;  2F1L A;  3PMT A;  1PM3 A;  2K2V A;  4M77 E;  2HDA A;  4QW2 A;  4M75 A;  5IHN A;  4ZNX A;  2JN0 A;  4J9F A;  1VIE A;  2JXB A;  8ATC B;  1NBE B;  3EHR A;  3VYG A;  4KGV B;  2DEQ A;  3G4S Q;  3OYL A;  1GL5 A;  2BZ8 A;  4X1V A;  3M55 A;  1YWO A;  2BZY A;  4KH0 B;  1IRX A;  2KAF A;  2KT8 A;  3M58 A;  2OX7 A;  2CZ6 B;  3FC3 A;  5LJ3 f;  2LNH B;  1MV3 A;  2YLC A;  4B6M A;  2KE9 A;  1OZ2 A;  1Z9Z A;  2HCK A;  2X3W D;  1R0B G;  1WJQ A;  1VQM A;  2OTL T;  3CXC P;  2XKO C;  1KHI A;  4J9D A;  4XU2 A;  4KUD K;  2QEX T;  1JB0 E;  4DEY A;  5LJ5 g;  3I55 T;  2NYS A;  3OYC A;  1UEC A;  2RHI A;  2C0O A;  5GAO r;  2E5K A;  3VS4 A;  5I22 A;  2XG8 D;  3LLR A;  5FRM A;  3CMA A;  2H3E B;  2DL8 A;  3GLX A;  1FX7 A;  3CC2 Q;  1MHN A;  2PUK B;  4ELZ C;  3NPF A;  3L2R A;  1VQ6 Q;  3TVT A;  4C0D B;  3RR6 A;  3QO3 A;  2A08 A;  4XQ3 A;  1ZUU A;  2DER A;  2E3H A;  5LJ3 j;  1RUW A;  4ZGJ B;  5I21 A;  1KIK A;  2J6O A;  1Y96 B;  4QVZ A;  4C8Q F;  3CPW A;  2RF0 A;  4PJO A;  4C92 A;  2QK0 A;  4XU0 A;  4IIM A;  3G71 T;  2DVE A;  1VQP A;  3QWY A;  2LRQ A;  3H6Z A;  2A7Y A;  1J3T A;  4M78 D;  5GAN 3;  4J7F A;  2K6D A;  1JJ2 A;  2K5L A;  3CCE A;  1AZG B;  5D7U A;  5CKE A;  3SHW A;  1D3B A;  1YIT A;  4L6V 5;  2MMP A;  4ATO A;  5CKB A;  4OMP A;  3OQ5 A;  4CRI A;  1LJO A;  4XTX A;  4CI0 C;  2BZX A;  2OTJ Q;  1NPP A;  1UGP B;  1W6X A;  4RTY A;  1WX6 A;  1D0Y A;  2DIQ A;  3L1A A;  3M53 A;  5GAN f;  1BI1 A;  1M1K U;  3IQL A;  4FW1 A;  4QVC A;  3PMI A;  2QQR A;  2P0Q A;  2YUN A;  4E7H A;  1B7T A;  2M1H A;  5C6S A;  4DBR A;  3P8D A;  3CCJ Q;  1WZO A;  1I8F A;  2F2X A;  5GAN 2;  1YJ9 Q;  2LZ6 B;  2RJE A;  4ZN3 A;  3GF5 A;  5KH6 A;  2CKK A;  4XTW A;  1KC8 U;  3QHS A;  2BKD N;  3MEW A;  1WFW A;  1VOM A;  1Q86 U;  3E19 A;  2V8I A;  5FRO A;  4DBF A;  1ZSZ A;  3FJP A;  2FPF A;  1HD3 A;  2VXE A;  1SRM A;  2DK3 A;  4JRI A;  4A54 A;  3V7R A;  3E9F A;  2NUP A;  3CCS Q;  1UUE A;  1MV0 B;  1SF9 A;  2O9V A;  5GAN j;  1Q82 R;  3KXT A;  4XU3 A;  2VGN A;  3M59 A;  5KYU B;  4M7D A;  2FYK A;  1YJN Q;  1JRI A;  4FSS A;  3LWH A;  2JS2 A;  3G4S T;  1JQQ A;  1TH7 A;  3QG1 A;  1SRL A;  3O5Z A;  2RJD A;  4EMK C;  2GBQ A;  2HKQ B;  4AFS C;  3PE0 A;  3EG0 A;  4M7A D;  1HYO A;  1WPY A;  2AKK A;  1QQJ A;  1V1C A;  5GMK h;  3QUI A;  1K8A R;  2O88 A;  3GNF B;  4PJO F;  1QVF S;  1G3S A;  1M3A A;  1ZUK A;  5IH2 A;  3ASK A;  3L2W A;  4E7K A;  3MKD A;  1W70 A;  1K9A A;  2COZ A;  2JOY A;  3EH1 A;  3TQ7 P;  3X28 B;  1IXD A;  2F69 A;  4AT1 B;  2DLP A;  5A2Q E;  2D1X A;  2EQI A;  4J9G A;  1YJW A;  2Y90 A;  2JM8 A;  2L3R A;  1WA7 A;  2VB6 A;  2CZ0 B;  2A3L A;  2AIR B;  2FG0 A;  3VYH B;  2EKO A;  4ELY C;  1H8K A;  2K57 A;  2CP7 A;  3CC2 T;  2KQW A;  3RKW A;  1VQ6 T;  3BFM A;  2QDL A;  2IG0 A;  2ZPE B;  4DBH A;  4KGZ B;  4OMO A;  1ZA1 B;  3NGP A;  1O75 A;  2LP5 A;  2OI3 A;  3OYK A;  1WGS A;  5FU6 C;  4M75 G;  1VQ4 A;  1VQM T;  1QW1 A;  1NJI U;  1VQL A;  2J6F A;  4M77 A;  4WF2 A;  2BIV A;  4F7U F;  1YWP A;  2E12 A;  1W2B P;  2ZGW A;  5KYY B;  1K1Z A;  3NMZ C;  4EMK B;  3CBO A;  3MEU A;  3MHX A;  1UHF A;  2YRV A;  4C8Q E;  4C0Z A;  4OMN A;  2QI2 A;  5CR2 A;  3LW5 E;  1YNZ A;  1I5L A;  5A0L A;  2LX7 A;  2HMA A;  2YT6 A;  3WXM B;  3JCM Q;  2DBM A;  3J7A F;  4OMQ A;  2HD0 A;  3UF4 A;  2KVQ G;  4M7D F;  1QVF P;  1UB4 A;  4GLM A;  3X24 B;  5GMK m;  1QCF A;  1ZX6 A;  2M9U A;  4C92 C;  4RTW A;  2LCC A;  3G7Z A;  3NTI A;  1M2V A;  1UG1 A;  3SD4 A;  1WNL A;  2O01 E;  1AEY A;  3CCJ T;  2CS7 A;  1PD1 A;  3QPH A;  1YJ9 T;  1NM7 A;  3CCE T;  2PVD B;  5FU6 B;  4ANJ A;  2LT4 A;  1YIT T;  2KBT A;  4QT7 A;  2NWM A;  2FZG B;  3GOX A;  2NUT A;  3FDR A;  3JSC A;  4Q5W A;  4QVD A;  2EAY A;  3M9Q A;  3EGX A;  4PJO G;  4R55 A;  1QMC A;  5AT1 B;  1MMG A;  4PJN A;  1R0C B;  2J7I A;  1VQK A;  2LJ3 A;  3CCS T;  1Q82 C;  4BD3 A;  2GFA A;  4HVV A;  4O5V A;  1IHV A;  1WHK A;  1YJN T;  2CSI A;  2XID A;  4XTY A;  3TEE A;  3NHN A;  2MIO A;  2ED0 A;  2MAM A;  3I56 A;  4X9D A;  4IKF A;  1VQN Q;  3VRY A;  3QJ6 A;  4FU6 A;  2DET A;  3A1P A;  4RCB A;  1LNX A;  4J9C A;  4PFP A;  5LJ3 d;  1E7O A;  1G3Y A;  5LJ5 f;  4C92 B;  1WI7 A;  4M77 F;  1S1N A;  1K8A C;  5GAO l;  4PLL A;  2X4Y A;  5FLX E;  3TRE A;  3FEO A;  3CCM A;  1HXD A;  2EQJ A;  2EYW A;  2DRK A;  2K79 A;  2RH2 A;  3SFM A;  1SHG A;  3DLL A;  4J6W A;  2OTL A;  2RJF A;  3TSZ A;  3EAE A;  2M02 A;  2R5A A;  2HQE A;  1D3B B;  2QEX A;  2RQT A;  2KXC A;  3I55 A;  2ENM A;  3I35 A;  3REA B;  2FPD A;  3FB9 A;  3CCV Q;  1WQW A;  2EYX A;  3EFO B;  2FZC B;  2JMA A;  2JT4 A;  3UPU A;  2DZ9 A;  3E2U A;  5CVI A;  5HKC A;  2EGA A;  2DXT A;  2LQ8 A;  2RB6 A;  1K73 R;  1OPK A;  4O6J A;  5LJ5 j;  3FIF A;  4LN2 A;  2VUB A;  3OA6 A;  5CIU A;  2MI6 A;  4NOY A;  2CP0 A;  4C5E A;  4M7D G;  3M56 A;  1Q7Y R;  1GCP A;  4OP0 A;  1YJW T;  2L3P A;  5FWB A;  3QWX X;  1NYF A;  2E65 A;  1Q95 G;  3G71 A;  1BK2 A;  2RJC A;  4PL6 A;  4M78 E;  2L8D A;  3QZ9 B;  4F7U E;  3HPW A;  3RIR A;  4FT4 A;  8AT1 B;  3QSU A;  3CCQ Q;  4AFZ C;  2WAC A;  2D0N A;  3A8O B;  5LJ5 e;  3OW2 A;  4LD6 A;  1WHM A;  2G3R A;  3JCM J;  3GPL A;  1AWW A;  1QP3 A;  3MP6 A;  3EGD B;  2KRO A;  5GAN d;  2YUP A;  1MMD A;  2MWP A;  4L5G A;  3V7C A;  4J6X A;  1ACM B;  4D8K A;  1QWE A;  4KRT A;  4LNP A;  3ZL7 C;  1QCO A;  1Y71 A;  1KQS A;  2LQW A;  1MGQ A;  1PRL C;  1ZA2 B;  2CUD A;  4HVU A;  2DYI A;  2NLU A;  3G1J A;  5HCK A;  5GAN 6;  2E1H A;  4N4H A;  1WHG A;  4BI4 A;  4DOV A;  2E10 A;  1B34 B;  9ATC B;  4KT0 E;  2IVW A;  2EJG A;  2DA9 A;  3L2U A;  1BYM A;  2NUZ A;  2A0F B;  1EIF A;  4EMH A;  2K9G A;  2HKN A;  2X4J A;  1TXQ A;  3ZEH A;  4M77 G;  4IIO A;  4A4K A;  3MEV A;  1OX9 A;  2AHJ B;  2LTO A;  1UFF A;  2EQU A;  1JEG A;  4DOW A;  1R77 A;  1NPR A;  1KD1 R;  2PU9 B;  1IHW A;  1OU8 A;  3OYB A;  3LH0 A;  2LNV A;  5KYW A;  2CP5 A;  3NTH A;  4JRP A;  4RG2 A;  4C8Q A;  1AVZ C;  2CUB A;  2RQW A;  1S72 Q;  3G4S A;  4KUL A;  3I5S A;  2O4X B;  1E6H A;  1TTH B;  4A4G A;  1EFN A;  1GFC A;  3EG1 A;  1Y57 A;  1M8M A;  2EYZ A;  1QVP A;  2X35 A;  4M7A E;  2V1R A;  3J81 E;  5HY6 A;  4CC3 A;  2ROL A;  3Q1J A;  1FMK A;  1EZZ B;  4OGE A;  3ZBD A;  4E7I A;  1UTI A;  4XK8 E;  2Z0W A;  2KYB A;  1Q82 U;  1XJW B;  4Z88 A;  1VQ9 Q;  1MNE A;  4ZN1 A;  1Z9Q A;  3L2Z A;  3L42 A;  2SEM A;  5GJW B;  3A8G B;  3I56 T;  3CCV T;  2YLB A;  4J83 A;  1M1F A;  3I9Q A;  1FMW A;  3H41 A;  1VQO Q;  5GAM e;  3THK A;  3OYF A;  3C95 A;  3M0U A;  3CEY A;  2MYS A;  4OB3 B;  1K73 C;  3CC2 A;  2QQA A;  1BCM A;  3M57 A;  3QBY A;  1VQ6 A;  2CYZ B;  1K8A U;  2D9T A;  2CDT A;  2XMF A;  3LGL A;  3CCM T;  2QGF B;  2A37 A;  3NFC A;  4XTU A;  4E7Z A;  2HBW A;  4BE2 A;  4Z02 A;  4QQD A;  1Q7Y C;  3JB9 F;  1M3C A;  3QJY A;  1H64 1;  5CKF A;  2DTI A;  2EYQ A;  1ZBJ A;  1BIA A;  2KNB B;  2AT1 B;  3BDL A;  2L3Q A;  3UDC A;  1FMV A;  2BE7 D;  4LD9 K;  4QQG A;  1WHL A;  1U1T A;  2FB7 A;  1AWO A;  3JCM d;  1ZHI A;  4OGC A;  2DL7 A;  4JJD A;  3JB9 I;  4MZP A;  2H8H A;  5CK9 A;  1K9M R;  4C92 D;  4QKU A;  4N0A C;  3V8K A;  4EDU A;  2OTJ A;  2HSP A;  2B8A A;  4FCY A;  2VC8 A;  2X4W A;  4JS5 A;  1NLP C;  1YIJ Q;  4JDS A;  1TU0 B;  3LH5 A;  3CCR Q;  4JUV A;  2B86 A;  1WLP B;  3HHT B;  3CC4 Q;  2DEU A;  1JO8 A;  1TUC A;  2CT4 A;  4FW2 A;  2QA4 Q;  4J5Y A;  5GAM h;  3CCJ A;  3OYI A;  1YJ9 A;  4C0F A;  1UGV A;  5DM7 R;  1SSF A;  3RMQ A;  4FL6 A;  4PJL A;  2FO0 A;  1OU9 A;  3J80 E;  2P0P A;  4E7L A;  5GMK e;  2LDM A;  1D0X A;  5I2S A;  4P5N A;  2VYT A;  4FYX B;  3QYG B;  3PIP A;  1KD1 C;  1BB9 A;  2K2M A;  3CCS A;  1NEG A;  3EH2 A;  1XNI A;  2GTO A;  2LCS A;  2CH4 A;  2ZPB B;  3V7S A;  3EG9 B;  2E5Q A;  1KJW A;  1YJN A;  1YI2 Q;  2CZ1 B;  4FT2 A;  4AG2 C;  3RMS A;  3JB9 J;  1VIF A;  2L3S A;  4M78 A;  3VS0 A;  1S72 T;  4OB1 B;  4F7U A;  1KQS S;  1GCQ A;  2EJF A;  3OMC A;  3LYI A;  1BI2 A;  5ECA A;  4DA4 A;  2AZS A;  2M0Y A;  4JS4 A;  1UE9 A;  5M9O A;  1F1B B;  4PNO A;  2DXU A;  2JVV A;  3SWN A;  1RAE B;  4DQ2 A;  3QXE B;  2HSE B;  1D1B A;  3A8L B;  4F16 A;  2JNG A;  1G3T A;  2VWF A;  2YRD A;  3M4G A;  5GMK i;  4J9E A;  3CCU Q;  3CME Q;  3RKX A;  4X9C A;  2EVR A;  3WVE B;  1M27 C;  3JB9 G;  5GAM g;  3OYH A;  1I0C A;  1ZLM A;  2FL7 A;  3RNJ A;  4F14 A;  2XD0 A;  2K3B A;  1PCX A;  2QGG A;  1QCN A;  2AKL A;  1VQO T;  1BI0 A;  4CC4 B;  4JJB A;  1PHT A;  2MOX A;  1N6A A;  3WVD B;  3GBQ A;  3MP8 A;  3S3N A;  4PK4 A;  2RQR A;  2GGR A;  1TWB A;  2COW A;  4Z89 A;  2EGC A;  3M0S A;  3OBW A;  4M75 C;  2L5Q A;  2PNI A;  1NEB A;  4MZT A;  1QVG S;  3G6E Q;  4GLK A;  3CD6 Q;  3HRS A;  1RAH B;  4C8Q G;  2CSQ A;  1U3O A;  4D6W A;  2P84 A;  6AT1 B;  1G2B A;  2E3I A;  2FHD A;  2X4X A;  2HL3 A;  2PZ1 A;  2ATC B;  2X51 A;  1U06 A;  4HVW A;  1KFZ A;  2DD5 A;  3H9N A;  2KDS A;  4M7A A;  4J8O A;  3FRN A;  3AT1 B;  3BW1 A;  1K73 U;  2RHY A;  1WHJ A;  2ZCF B;  1RAB B;  1PSE A;  3VS2 A;  4FM4 B;  2KI7 A;  1K9M C;  2LQK A;  2C0I A;  2DAQ A;  1Y0M A;  4RTU A;  2V26 A;  1NZ9 A;  1Q7Y U;  4M78 F;  1K4U S;  2E64 A;  4OMF B;  5KYX B;  1VYT A;  3HL8 A;  4IUQ A;  2MF2 A;  1M2O A;  1KQ1 A;  2RM4 A;  2MPX C;  3ER0 A;  4X34 A;  3S3M A;  3VUB A;  3P8B B;  1T0H A;  2K5F A;  1CKB A;  3V8J A;  4F17 A;  2EGE A;  4M75 B;  1C0M A;  5FWC A;  3I5R A;  4OVA A;  3M0R A;  3MJX A;  5GAO n;  3DB4 A;  2OTJ T;  4PJM A;  3OYE A;  3QYH B;  3RUX A;  4PJO C;  4CC2 A;  1PNJ A;  1GFD A;  2ZPF B;  4XTZ A;  2DXC A;  2H3J A;  2HL5 C;  1M9S A;  2DVJ A;  3CXC A;  1YI2 T;  4CC7 A;  2HZY A;  1IZ6 A;  3CPW S;  1VQ5 Q;  5J39 A;  3ME9 A;  2OAU A;  1VQN A;  2HEQ A;  4ZGD B;  4OF1 A;  2A28 A;  2JW4 A;  4FYY B;  1ZQ1 A;  1UGS B;  4RMO A;  4LE9 A;  4C5G A;  5AYF A;  2DBK A;  2HBP A;  1LCK A;  1X43 A;  1NE8 A;  4C0G A;  5CCA A;  4HT8 A;  2E70 A;  3P8H A;  1JJ2 S;  1X2Q A;  1M8V A;  3E1S A;  1PKS A;  1BBZ A;  4MMK A;  3SB2 A;  3OS5 A;  1KD1 U;  3CCL Q;  4HCK A;  3CCU T;  2Y4X A;  3D7S B;  1LVK A;  4VUB A;  5GAN 7;  1GBR A;  3MEA A;  2EWN A;  4M7A F;  2O2O A;  3TCJ A;  2DJZ A;  3S3O A;  4ORZ A;  4EPC A;  1YHQ Q;  4HCZ A;  4JZ4 A;  1TG0 A;  2C0T A;  3CBM A;  3CCV A;  2K3Y A;  2F5T X;  2K5I A;  4AMC A;  3PGG A;  1SG5 A;  2RI5 A;  1JXM A;  4B9W A;  4PJO B;  4PLI A;  1ZSZ C;  2M16 A;  2BUD A;  1K0X A;  3A8H B;  3VS5 A;  2ZZD A;  5D6W A;  5CAI A;  4BDY A;  1YN8 A;  3T9N A;  3H0F A;  1Y96 A;  4M7D C;  2YUQ A;  3SEM A;  2XK0 A;  3CD6 T;  2CP2 A;  2MWO A;  3JAM E;  1RAG B;  1M90 R;  1X69 A;  1VQ7 Q;  4M78 G;  2GF7 A;  1I1J A;  4F7U G;  2D8J A;  4TVR A;  2XI9 A;  5KE3 A;  1Q81 R;  4IUP A;  1W1F A;  1UJ0 A;  4JRK A;  3CCQ A;  2DTH A;  2FPE A;  2VAS A;  1X6G A;  2P4R A;  2PTK A;  1G83 A;  1NG2 A;  2BE9 B;  4IUV A;  4BY6 C;  3CC7 Q;  4C92 E;  3OSS C;  4A4E A;  3HRT A;  2YRC A;  1AOJ A;  3M0T A;  2XHC A;  5A0G A;  1JJ2 P;  4Z8A A;  4JJN K;  2RHU A;  1H3H A;  1U1S A;  3OYJ A;  1OUL A;  1D1A A;  1RAF B;  1OPL A;  2KYM A;  2JUF A;  2HNI A;  2COY A;  1I5O B;  2HQH A;  1VQ8 Q;  4RKU E;  1RI0 A;  2J6K A;  1VYV A;  1ZSZ B;  2JTE A;  1TUD A;  1Y07 A;  1XTD A;  2ED1 A;  4J9B A;  2CZ7 B;  3CPF A;  5GAN 8;  1GXI E;  4FIB A;  4F04 B;  3OB9 A;  4XAX B;  2ZPH B;  2NUP B;  1IGQ A;  2RI3 A;  3UT1 A;  2YDL A;  3TSW A;  4M7D B;  4M77 C;  1IRE B;  5DLO A;  2DRM A;  1RLP C;  2RA2 A;  4BAC A;  2DIL A;  3JCM h;  2K3X A;  4ESR A;  2SRC A;  3SDZ A;  5KYU A;  1B3Q A;  3HFN A;  2V8J A;  4WCI A;  1ZSG A;  4DEX A;  4A4F A;  2EPD A;  2K7A A;  2YUO A;  4M7A G;  4BY6 B;  2CP6 A;  1S72 A;  1MUZ A;  1OYX A;  3JCM b;  1QKX A;  4LUD A;  1VUB A;  2G6F X;  4L59 A;  5GAN 4;  3JRZ A;  2L2P A;  2DIG A;  2KY9 A;  1MMN A;  2I0N A;  3M0Q A;  1JXO A;  1SSH A;  5GAM f;  2FEI A;  4LDW A;  2EQM A;  2DFU A;  1WIE A;  3A8M B;  4LXC A;  3LWI A;  1OEB A;  1YFN A;  1V76 A;  2I2L A;  3HP9 A;  1EX4 A;  1YCS B;  5EG2 A;  3CCL T;  2RK2 A;  1UEB A;  1M5Q 1;  2RQV A;  2RN8 A;  1QKW A;  2KSS A;  3JCM V;  2EYY A;  2MCN A;  4II1 A;  1VQ9 A;  3GIB A;  3JCM c;  1W2B A;  2FVU A;  1OZ3 A;  4FSX A;  1YHQ T;  2QDY B;  1HJD A;  4RCC A;  1VQN T;  4JZ3 A;  4M77 B;  4QQ6 A;  1VQO A;  2J06 A;  1FYN A;  1RAD B;  5GAM j;  3VS1 A;  3OY9 A;  4M75 D;  3JCM g;  3EFS A;  3E9G A;  4RG8 A;  1XQH A;  2V1Q A;  4C5H A;  2RQU A;  3L2Q A;  2ESW A;  2DMO A;  1QLY A;  3TU4 K;  1RAC B;  1QVF A;  4GY5 A;  4Y91 A;  5FRN A;  1M90 C;  4RTT A;  3JB9 H;  1WHH A;  1D1C A;  1VQ7 T;  2GNC A;  3BDU A;  4LDY A;  2ABL A;  4NL2 A;  2F2V A;  2XDD A;  4HKE A;  1Q81 C;  1TOV A;  2A36 A;  2ZPI B;  5DLQ E;  1MND A;  2EBP A;  5IN1 A;  3CC7 T;  1M2V B;  2LJ0 A;  1IGU A;  1G5V A;  1N8R R;  2KRN A;  2DL5 A;  3A5Z B;  3DB3 A;  4A63 B;  1B07 A;  3LX7 A;  4BE0 A;  2DO3 A;  5GAO p;  2JMC A;  3RDV A;  3DLM A;  3A98 A;  5FW9 A;  5IHI A;  4HCC A;  1VYU A;  1YIJ A;  3U23 A;  2VGM A;  3OYD A;  3CCR A;  1O9S A;  2QQB A;  1U8R A;  3VS3 A;  2XU8 A;  4D8D A;  2C06 A;  4MML A;  3CC4 A;  1VQ8 T;  2NUT B;  4A53 A;  4R56 A;  2QA4 A;  1AWX A;  4PFZ A;  3CBP A;  3EGX B;  2VXF A;  3CCQ T;  1NJI C;  1TUG B;  2RO0 A;  4FYW B;  3MP1 A;  2CT3 A;  2CP3 A;  4PJO D;  1PRM C;  2DTO A;  3GNG A;  1HSQ A;  2IPO B;  5GMK j;  1WJR A;  2RHX A;  1AWJ A;  4RTX A;  3JV3 A;  1UJY A;  1A0N B;  4N4G A;  2WSE E;  1YI2 A;  1G8X A;  2OAW A;  2QQ9 A;  2F2W A;  3VUZ A;  1RLQ C;  1U5S A;  3OYY A;  4M4Z A;  2ROT A;  3GP8 A;  1VQM Q;  2KK4 A;  4JPB W;  4E6R A;  1KQ2 A;  2FRY A;  4PKC C;  2KR3 A;  1E6G A;  1AZE A;  4BUG A;  3N5B B;  1XOV A;  2CH4 W;  4K11 A;  2DX1 A;  2YXY A;  4R0K A;  3OW2 S;  5D6Y A;  2QG9 B;  3NTK A;  4JLG A;  1PWT A;  2W0Z A;  3CMA Q;  3CCU A;  1RL2 A;  3CME A;  4XTV A;  5IHK A;  3VS7 A;  2AK5 A;  1T3L A;  2D0Q B;  4BB7 A;  5LJ3 e;  4JLI A;  5D6X A;  3M54 A;  2KMT A;  4M75 F;  1RI9 A;  1KSW A;  1ZBX A;  3CQT A;  3PNW C;  4IUT A;  5LJ5 d;  1GBQ A;  3EFO A;  5I2M A;  5CKD A;  2XDB A;  1YCY A;  3HRU A;  2K4Y A;  5J26 A;  3OYN A;  2JJ9 A;  1PC0 A;  1DJ7 B;  2QTV A;  2V8K A;  3MET A;  4EMG A;  1VQP Q;  1K76 A;  1I07 A;  4M7D D;  5CQX A;  1G3W A;  2YWW A;  4JJC A;  1MMA A;  5GMK l;  3X26 B;  3G6E A;  2J05 A;  3CCE Q;  3CD6 A;  3QDR B;  1VQ9 T;  4C8Q C;  1YIT Q;  4KGX B;  5GJV B;  3URG A;  1WYX A;  3C4S A;  3C0C A;  2JTF A;  1X75 C;  2L0A A;  2D8H A;  2VKN A;  2YHT A;  5IXF A;  2OJ2 A;  1W2B S;  3QDF A;  4BI8 B;  3ULR B;  5GAN 5;  4J6Y A;  2DL4 A;  3PTA A;  1BU1 A;  1R8O B;  1ABO A;  5KYN A;  1N8R C;  3EGD A;  2P0K A;  4ZGE B;  2PVG B;  2R57 A;  1RAI B;  2KEA A;  3L2V A;  3OW2 P;  5IT9 E;  1D09 B;  2E6Z A;  2P4T A;  1ARK A;  2E4H A;  2DYB A;  1X01 A;  2E6N A;  5LJ3 h;  1M90 U;  4E7J A;  4UC4 A;  3H8Z A;  3JCM W;  4LDU A;  1QP2 A;  1H92 A;  4PJJ A;  2LX9 A;  1Q81 U;  4C92 F;  3EFR A;  3QZ5 B;  2X9H A;  1YBY A;  3KFV A;  2EFI A;  5GAN e;  2JS0 A;  1KQS P;  2RI2 A;  2XIC A;  2GCX A;  5GAO q;  1B34 A;  5LL6 S;  1OQK A;  2DE0 X;  2QTX A;  4M77 D;  3ZFJ A;  4EIK A;  3AHU A;  5KCH A;  1JBM A;  5KYW B;  2RPN A;  4J9H A;  4OB0 B;  2HAX A;  1M1G A;  4C8Q B;  1WXT A;  4ZTJ A;  1M30 A;  3HKS A;  4N4I A;  2LVM A;  3VS6 A;  3C12 A;  1BIB A;  3OYG A;  1IO6 A;  1JU5 C;  3PFS A;  1YIJ T;  1PSF A;  3H0I A;  2LCL A;  3CCR T;  1NLO C;  3CC4 T;  3R6O A;  4OB2 B;  3R6N A;  3X20 B;  2CRE A;  2FZK B;  2GQI A;  2QA4 T;  3OYA A;  1VQ5 A;  2O4X A;  5GAM d;  3KUF A;  4OML A;  4RTV A;  3HTR A;  4OMM A;  2HQX A;  2XDP A;  1YJW Q;  3EG3 A;  2MK5 A;  3PVQ A;  4Y28 E;  4E7S A;  5LJ3 g;  2KRM A;  1SHF A;  2RHZ A;  4J7I A;  3CMA T;  1TS9 A;  3CCL A;  4FYV B;  1QVG P;  2DL3 A;  1WJS A;  2QQS A;  3JCM f;  3M5A A;  5J3B A;  1FXX A;  2DZC A;  2GTJ A;  2JTM A;  1YHQ A;  1KK7 A;  5GAN h;  4RTZ A;  2PVO B;  1GRI A;  1OI1 A;  2EIF A;  3INZ A;  1VQ4 Q;  2AZV A;  1VQL Q;  1T0J A;  2ECZ A;  1M1K R;  3RBB B;  5CO7 A;  4WTO B;  1OOT A;  2QAS A;  4M75 E;  2E41 A;  3DKM A;  1ABQ A;  2RMO A;  1HK9 A;  1VQP T;  1YP5 A;  3PVL A;  1AD5 A;  4MDX A;  2FRW A;  1LOJ A;  1N9R A;  1OV3 A;  1UHC A;  5HK0 A;  3RES A;  2DM1 A;  1LPL A;  3CME T;  5A0D A;  3VV0 A;  4DBQ A;  2EW3 A;  1P92 A;  1UDL A;  4M78 C;  2DKG A;  2DJQ A;  2LQN A;  3QKJ A;  1VQ7 A;  1KC8 R;  2LC4 A;  2YSQ A;  1GCQ C;  1Q86 R;  4KBM B;  3O8V A;  3UAT A;  1RAA B;  4BDZ A;  1KHC A;  2QAZ A;  4V2S A;  4C92 G;  3SWN C;  1IB8 A;  1PKT A;  3CC7 A;  1K0S A;  5IAY A;  2DD4 A;  2X3X D;  1AT1 B;  2IIM A;  3OS2 A;  1VA7 A;  3VKI A;  3MO8 A;  2D6F A;  3G6E T;  2LJ1 A;  4PFO A;  3VJP A;  5L23 A;  2DPP B;  4Y92 A;  3JCM e;  5GAN g;  2JZ2 A;  1WXU A;  4A4H A;  1M4Z A;  5FU7 C;  1N27 A;  2KGT A;  2O31 A;  1VQ8 A;  1OX8 A;  2DF6 A;  1QWF A;  2F5K A;  3CPW P;  1KG1 A;  5CQY A;  4C5I A;  1VQK Q;  2M0O A;  3FLG A;  4HCB A;  2RK1 A;  2VV5 A;  1N9S A;  4PJO E;  1C6V X;  4NS5 A;  2EJ9 A;  1N8R U;  5IXB A;  3RER A;  1WQ7 A;  1H3Z A;  3MCA B;  4M78 B;  3I56 Q;  4AG1 C;  4F7U B;  4BI3 A;  2PUO B;  1N5Z A;  1NYG A;  4MZM A;  1CKA A;  3UWN A;  3MPU B;  2L89 A;  3BE3 A;  3PIO A;  2BTT A;  4ZTF A;  3EG9 A;  7AT1 B;  3SWN B;  4GBQ A;  1FWZ A;  1PD0 A;  3CCM Q;  4M7A C;  2LMJ A;  1X6O A;  3EHQ A;  2W10 A;  3VU3 C;  3V8L A;  1Y7X A;  4N0A A;  1NJI R;  2OTL Q;  3HSB A;  1X2K A;  3OS1 A;  2ZPG B;  3OYM A;  2QEX Q;  1I4K 1;  4MDW A;  1K9M U;  3HFO A;  2GFU A;  3I55 Q;  1PG5 B;  1ZUY A;  2PQW A;  4JRQ A;  2QXF A;  4KUI A;  2R58 A;  4HT9 A;  3BY7 A;  3QII A;  5FU7 B;  1SPK A;  1X6B A;  1W4S A;  1X27 A;  2EQK A;  3JB9 D;  2O9S A;  3OBY A;  2DNU A;  3UA7 A;  4IUU A;  3PT9 A;  4YTL A;  3H0H A;  4LDX A;  2QYZ A;  4AFU C;  5CKH A;  1AHJ B;  2JM9 A;  1UGR B;  1TSF A;  3OSV A;  3UA6 A;  3S6W A;  1VQ5 T;  3VRZ A;  1V29 B;  1VQ4 T;  1VQL T;  4XU1 A;  4KH1 B;  4HA8 A;  4ME7 A;  4B9X A;  2KRS A;  1M1K C;  5L8R E;  1BI3 A;  2KXD A;  4J9I A;  3FJ5 A;  5HK3 A;  4M7D E;  1SKU B;  3G71 Q;  1D0Z A;  3EGU A;  1SEM A;  2Y4Y A;  4RUG A;  2LT1 A;  4C8Q D;  4M7A B;  4LDV A;  5KCO A;  4AFQ C;  4E2F B;  2VVK A;  4NL3 A;  1BCO A;  3M0P A;  2GQV A;  3REB B;  1KC8 C;  5GAO m;  1WXB A;  4IUR A;  1Q86 C;  4E47 A;  1C1A A;  1UGQ B;  3RKY A;  2M51 A;  3OMG A;  5DY9 A;  5KE2 A;  2RNA A;  3EG2 A;  3CXC S;  2ZAE A;  5C0M A;  2EKH A;  1T3S A;  3M4Y A;  2CGH A;  3JCM X;  4HXJ A;  2R5M A;  1CSK A;  3OS0 A;  3F70 A;  1WDX A;  5LJ5 h;  3JCM P;  2KT1 A;  2DXB A;  1I81 A;  2WSF E;  5KYX A;  3X25 B;  5KYY A;  2RD1 A; 
#chains in the Genus database with same CATH homology
 3P8B B;  5CVI A;  5HKC A;  2K5F A;  4M75 F;  4EMK A;  1QVG A;  2DXT A;  2LQ8 A;  3KBG A;  2WSC E;  2RB6 A;  3V8J A;  1ZBX A;  3C94 A;  3LGF A;  3PNW C;  4IUT A;  1BKB A;  4O6J A;  5LJ5 d;  5I2M A;  5LJ5 j;  5CKD A;  4M75 B;  4BE1 A;  3FIF A;  2XDB A;  1YCY A;  2VUB A;  4OVA A;  3HRU A;  2K4Y A;  4C0D C;  3OA6 A;  5CIU A;  1VQK T;  2MI6 A;  3PMT A;  5J26 A;  5GAO n;  3DB4 A;  2K2V A;  4M77 E;  4NOY A;  4QW2 A;  4C5E A;  3OYN A;  1DJ7 B;  2V8K A;  3MET A;  4M75 A;  4M7D G;  2OTJ T;  3M56 A;  3OYE A;  3QYH B;  2JN0 A;  4EMG A;  3RUX A;  4M7D D;  4PJO C;  5CQX A;  1VIE A;  4OP0 A;  1G3W A;  2ZPF B;  1YJW T;  3VYG A;  4XTZ A;  2DEQ A;  2DXC A;  5GMK l;  2E65 A;  2H3J A;  3X26 B;  3OYL A;  1M9S A;  3G6E A;  3G71 A;  3CD6 A;  3QDR B;  3M55 A;  3CXC A;  1YI2 T;  1VQ9 T;  2RJC A;  4PL6 A;  4M78 E;  4C8Q C;  2L8D A;  1IZ6 A;  3QZ9 B;  1VQ4 A;  4F7U E;  3HPW A;  3RIR A;  2KAF A;  4FT4 A;  3CPW S;  3QSU A;  3M58 A;  2WAC A;  5J39 A;  3URG A;  3ME9 A;  3A8O B;  2OAU A;  1VQN A;  4ZGD B;  5LJ5 e;  2CZ6 B;  3C4S A;  3OW2 A;  3FC3 A;  4LD6 A;  2G3R A;  5LJ3 f;  4OF1 A;  3JCM J;  2JTF A;  3GPL A;  1X75 C;  2YLC A;  1ZQ1 A;  2YHT A;  1UGS B;  4RMO A;  1QP3 A;  3MP6 A;  4C5G A;  1W2B S;  1OZ2 A;  5AYF A;  4BI8 B;  2HBP A;  5GAN d;  2MWP A;  5GAN 5;  1NE8 A;  4J6Y A;  4C0G A;  3PTA A;  1WJQ A;  1VQM A;  5CCA A;  4L5G A;  3V7C A;  2OTL T;  4J6X A;  4HT8 A;  1R8O B;  2E70 A;  3P8H A;  2XKO C;  1JJ2 S;  1KHI A;  1M8V A;  4XU2 A;  1N8R C;  2P0K A;  4KUD K;  4ZGE B;  2QEX T;  3E1S A;  2PVG B;  2R57 A;  1JB0 E;  4MMK A;  1Y71 A;  3SB2 A;  3OS5 A;  5LJ5 g;  3I55 T;  1KD1 U;  1KQS A;  3L2V A;  3OYC A;  1MGQ A;  3CCU T;  2Y4X A;  2RHI A;  5IT9 E;  2E6Z A;  4VUB A;  2P4T A;  5GAO r;  5GAN 7;  3MEA A;  1X01 A;  2E6N A;  2EWN A;  2XG8 D;  3LLR A;  5LJ3 h;  3TCJ A;  2DJZ A;  5FRM A;  3CMA A;  4M7A F;  1M90 U;  2NLU A;  3S3O A;  4E7J A;  4EPC A;  3GLX A;  4UC4 A;  1FX7 A;  4HCZ A;  5GAN 6;  3H8Z A;  2E1H A;  1MHN A;  4LDU A;  1QP2 A;  4N4H A;  3JCM W;  2PUK B;  4BI4 A;  4DOV A;  4ELZ C;  3L2R A;  3CBM A;  2E10 A;  1B34 B;  4C0D B;  3CCV A;  2LX9 A;  4KT0 E;  1Q81 U;  3M54 A;  2IVW A;  2K3Y A;  3QO3 A;  4C92 F;  2EJG A;  3EFR A;  3QZ5 B;  4XQ3 A;  2F5T X;  2K5I A;  3L2U A;  1BYM A;  1YBY A;  3PGG A;  5LJ3 j;  2EFI A;  2RI5 A;  5GAN e;  1EIF A;  4B9W A;  4EMH A;  2RI2 A;  2XIC A;  4ZGJ B;  4PJO B;  4PLI A;  2GCX A;  5I21 A;  1B34 A;  2M16 A;  2X4J A;  5GAO q;  1Y96 B;  2BUD A;  5LL6 S;  3ZEH A;  4M77 G;  3A8H B;  4A4K A;  2QTX A;  2ZZD A;  4M77 D;  3MEV A;  4QVZ A;  5D6W A;  3ZFJ A;  4C8Q F;  2AHJ B;  5CAI A;  4BDY A;  1GXI E;  3CPW A;  3AHU A;  2LTO A;  1JBM A;  5KCH A;  4PJO A;  2EQU A;  3T9N A;  4C92 A;  4DOW A;  1NPR A;  1Y96 A;  4OB0 B;  2HAX A;  1M1G A;  2PU9 B;  4C8Q B;  4M7D C;  4ZTJ A;  4XU0 A;  2XK0 A;  3HKS A;  4N4I A;  3G71 T;  2DVE A;  3OYB A;  3LH0 A;  3CD6 T;  1VQP A;  2LNV A;  2LVM A;  3C12 A;  3NTH A;  1BIB A;  2MWO A;  3JAM E;  3OYG A;  2LRQ A;  4JRP A;  4M78 G;  2GF7 A;  4RG2 A;  3H6Z A;  4C8Q A;  2A7Y A;  3PFS A;  4F7U G;  4M78 D;  1YIJ T;  3G4S A;  1PSF A;  4KUL A;  2LCL A;  2O4X B;  5GAN 3;  4J7F A;  4A4G A;  3CCR T;  4TVR A;  1JJ2 A;  2XI9 A;  2K5L A;  3CCE A;  5KE3 A;  3CC4 T;  3R6O A;  4OB2 B;  3X20 B;  5CKE A;  4IUP A;  1D3B A;  1QVP A;  2X35 A;  4JRK A;  1YIT A;  4M7A E;  4L6V 5;  2MMP A;  2QA4 T;  4ATO A;  5CKB A;  3OYA A;  3J81 E;  2O4X A;  2DTH A;  3OQ5 A;  3KUF A;  4CRI A;  5GAM d;  1LJO A;  3CCQ A;  4XTX A;  4CI0 C;  5HY6 A;  1NPP A;  1UGP B;  3Q1J A;  4BY6 C;  4IUV A;  2DIQ A;  3M53 A;  3L1A A;  3OSS C;  2HQX A;  4A4E A;  4C92 E;  4OGE A;  1BI1 A;  5GAN f;  3ZBD A;  1M1K U;  4E7I A;  2XDP A;  3HRT A;  4QVC A;  3PMI A;  2QQR A;  2P0Q A;  4E7H A;  4XK8 E;  2XHC A;  5A0G A;  1Q82 U;  4Y28 E;  4JJN K;  2RHU A;  5LJ3 g;  2M1H A;  5C6S A;  1U1S A;  2RHZ A;  4ZN1 A;  3OYJ A;  3P8D A;  4J7I A;  3CMA T;  3L2Z A;  3CCL A;  3L42 A;  1I8F A;  3A8G B;  2JUF A;  2HNI A;  3I56 T;  5GAN 2;  3CCV T;  2YLB A;  1WJS A;  2QQS A;  1M1F A;  2RJE A;  4J83 A;  3JCM f;  3M5A A;  4ZN3 A;  3GF5 A;  1RI0 A;  4RKU E;  5KH6 A;  5J3B A;  1FXX A;  2DZC A;  1Y07 A;  2CKK A;  1XTD A;  5GAM e;  4XTW A;  1KC8 U;  3QHS A;  2JTM A;  3OYF A;  2BKD N;  2CZ7 B;  3C95 A;  3CPF A;  5GAN 8;  3CEY A;  3MEW A;  4FIB A;  5GAN h;  4OB3 B;  2PVO B;  1YHQ A;  2QQA A;  3E19 A;  1Q86 U;  3OB9 A;  2V8I A;  4XAX B;  3M57 A;  1OI1 A;  2EIF A;  2ZPH B;  3INZ A;  3QBY A;  5FRO A;  1VQ6 A;  2CYZ B;  1K8A U;  2D9T A;  2RI3 A;  3FJP A;  3UT1 A;  4M7D B;  2VXE A;  3LGL A;  3CCM T;  5CO7 A;  2DK3 A;  4JRI A;  4A54 A;  3V7R A;  3E9F A;  3NFC A;  4M75 E;  2E41 A;  4M77 C;  1IRE B;  3DKM A;  4XTU A;  5GAN j;  3KXT A;  4XU3 A;  4BE2 A;  2VGN A;  3M59 A;  4QQD A;  4Z02 A;  5DLO A;  1Q7Y C;  1HK9 A;  3JB9 F;  1VQP T;  4M7D A;  3QJY A;  1H64 1;  2FYK A;  2DTI A;  2RA2 A;  5CKF A;  1JRI A;  4BAC A;  2EYQ A;  3JCM h;  2K3X A;  3LWH A;  4MDX A;  1BIA A;  1LOJ A;  1N9R A;  5HK0 A;  3RES A;  3G4S T;  1TH7 A;  3SDZ A;  3QG1 A;  3BDL A;  3HFN A;  2V8J A;  3X25 B;  3CME T;  1K73 C;  3UDC A;  5A0D A;  3VV0 A;  4LD9 K;  4QQG A;  1U1T A;  4EMK C;  2RJD A;  1P92 A;  4A4F A;  4M78 C;  2DKG A;  2FB7 A;  3QKJ A;  1VQ7 A;  4M7A G;  3JCM d;  4BY6 B;  1ZHI A;  1S72 A;  4OGC A;  1OYX A;  2LC4 A;  3JCM b;  4M7A D;  4KBM B;  1WPY A;  1VUB A;  3JB9 I;  4L59 A;  5GAN 4;  3JRZ A;  3O8V A;  2DIG A;  4MZP A;  5GMK h;  2KY9 A;  3QUI A;  4BDZ A;  3GNF B;  4PJO F;  1QVF S;  1G3S A;  1KHC A;  5GAM f;  5CK9 A;  4E7K A;  3ASK A;  3L2W A;  4V2S A;  4C92 G;  3SWN C;  4LDW A;  4C92 D;  2EQM A;  4N0A C;  3V8K A;  4EDU A;  2JOY A;  2OTJ A;  3A8M B;  2B8A A;  3X28 B;  2VC8 A;  2F69 A;  3LWI A;  3CC7 A;  5IAY A;  5A2Q E;  2DD4 A;  2X4W A;  2I2L A;  3HP9 A;  4JS5 A;  1YJW A;  2Y90 A;  5EG2 A;  3CCL T;  4JDS A;  2L3R A;  2RK2 A;  3OS2 A;  1UEB A;  1M5Q 1;  4JUV A;  2CZ0 B;  2A3L A;  2KSS A;  3VKI A;  3MO8 A;  3JCM V;  2D6F A;  3HHT B;  3G6E T;  4II1 A;  3VJP A;  1VQ9 A;  2DPP B;  3VYH B;  2EKO A;  4ELY C;  3GIB A;  3JCM c;  3JCM e;  1W2B A;  2K57 A;  2FVU A;  5GAN g;  1OZ3 A;  4FSX A;  4J5Y A;  5GAM h;  3CCJ A;  1YHQ T;  2JZ2 A;  2QDY B;  3OYI A;  3CC2 T;  2KQW A;  4RCC A;  4A4H A;  1M4Z A;  5FU7 C;  3RKW A;  1N27 A;  1YJ9 A;  4C0F A;  1VQ6 T;  1VQN T;  3BFM A;  5DM7 R;  2IG0 A;  1VQ8 A;  3CC2 A;  1SSF A;  2ZPE B;  3RMQ A;  4FL6 A;  4M77 B;  2F5K A;  4QQ6 A;  1VQO A;  1KG1 A;  5CQY A;  4C5I A;  1O75 A;  3J80 E;  2M0O A;  5GAM j;  2P0P A;  3OYK A;  3FLG A;  1WGS A;  5FU6 C;  4E7L A;  4HCB A;  4M75 G;  5GMK e;  3OY9 A;  1QW1 A;  1VQM T;  2LDM A;  2RK1 A;  2VV5 A;  4M77 A;  4WF2 A;  4M75 D;  1N9S A;  5I2S A;  3JCM g;  2BIV A;  4P5N A;  3EFS A;  2VYT A;  4PJO E;  4F7U F;  2E12 A;  4NS5 A;  3E9G A;  2EJ9 A;  1XQH A;  3QYG B;  4RG8 A;  4C5H A;  1WQ7 A;  2ZGW A;  3PIP A;  1N8R U;  1KD1 C;  3MCA B;  3RER A;  1H3Z A;  3L2Q A;  4EMK B;  4M78 B;  3CBO A;  3CCS A;  3MEU A;  4F7U B;  3TU4 K;  1XNI A;  1QVF A;  4GY5 A;  2ZPB B;  3MHX A;  3V7S A;  4BI3 A;  2E5Q A;  2PUO B;  4Y91 A;  1YJN A;  1VQ5 A;  5FRN A;  1M90 C;  2CZ1 B;  2YRV A;  4FT2 A;  3JB9 H;  4C8Q E;  4MZM A;  3RMS A;  3JB9 J;  1VQ7 T;  3UWN A;  4C0Z A;  2QI2 A;  1VIF A;  5CR2 A;  4M78 A;  1S72 T;  3BDU A;  2L89 A;  4LDY A;  4NL2 A;  3LW5 E;  3PIO A;  4OB1 B;  4F7U A;  4ZTF A;  2XDD A;  1I5L A;  5A0L A;  1KQS S;  4HKE A;  3SWN B;  1Q81 C;  2EJF A;  3OMC A;  3WXM B;  3JCM Q;  1FWZ A;  3LYI A;  4M7A C;  1BI2 A;  4DA4 A;  1X6O A;  2ZPI B;  3J7A F;  5DLQ E;  4JS4 A;  2HD0 A;  5M9O A;  4PNO A;  3VU3 C;  2DXU A;  5IN1 A;  2JVV A;  2KVQ G;  3SWN A;  4DQ2 A;  4M7D F;  3QXE B;  3V8L A;  1Y7X A;  4N0A A;  3HSB A;  3A8L B;  1UB4 A;  3CC7 T;  3X24 B;  2ZPG B;  2M9U A;  4C92 C;  5GMK m;  3OS1 A;  3OYM A;  1G5V A;  2JNG A;  2LCC A;  1G3T A;  1I4K 1;  4MDW A;  3G7Z A;  3A5Z B;  3DB3 A;  1K9M U;  3HFO A;  2GFU A;  3M4G A;  3NTI A;  5GMK i;  3LX7 A;  4BE0 A;  2PQW A;  2DO3 A;  4JRQ A;  3SD4 A;  5GAO p;  3RKX A;  2QXF A;  4X9C A;  4KUI A;  1WNL A;  2O01 E;  2R58 A;  4HT9 A;  3BY7 A;  3QII A;  5FU7 B;  3WVE B;  3JB9 G;  5GAM g;  3DLM A;  3OYH A;  1W4S A;  2EQK A;  2FL7 A;  3JB9 D;  2XD0 A;  4HCC A;  1YIJ A;  3CCJ T;  2VGM A;  3OBY A;  3OYD A;  3CCR A;  1O9S A;  2QQB A;  1U8R A;  2CS7 A;  3QPH A;  2XU8 A;  4IUU A;  3PT9 A;  1YJ9 T;  4YTL A;  4MML A;  2C06 A;  1VQ8 T;  3CC4 A;  4LDX A;  3CCE T;  5CKH A;  4A53 A;  2PVD B;  4R56 A;  1AHJ B;  5FU6 B;  2QA4 A;  1VQO T;  1UGR B;  2LT4 A;  1YIT T;  1BI0 A;  3CBP A;  3OSV A;  2VXF A;  3S6W A;  1VQ5 T;  3CCQ T;  1NJI C;  1N6A A;  3WVD B;  3GOX A;  2RO0 A;  1V29 B;  1VQ4 T;  1VQL T;  4XU1 A;  3FDR A;  3JSC A;  4Q5W A;  4QVD A;  2EAY A;  3MP8 A;  3S3N A;  4HA8 A;  4ME7 A;  4B9X A;  1M1K C;  5L8R E;  1BI3 A;  3M9Q A;  3MP1 A;  4PJO G;  1VQL A;  4R55 A;  4PJO D;  3OBW A;  1VQK A;  4M75 C;  3CCS T;  1Q82 C;  2L5Q A;  4BD3 A;  5HK3 A;  4M7D E;  2GFA A;  4MZT A;  1QVG S;  4O5V A;  2DTO A;  4GLK A;  3GNG A;  1YJN T;  3HRS A;  2XID A;  5GMK j;  4XTY A;  3TEE A;  1WJR A;  4C8Q G;  2Y4Y A;  2RHX A;  2LT1 A;  2MAM A;  4C8Q D;  4M7A B;  4D6W A;  4X9D A;  3I56 A;  4LDV A;  5KCO A;  4IKF A;  2X4X A;  2FHD A;  3QJ6 A;  4FU6 A;  4NL3 A;  4N4G A;  2WSE E;  1YI2 A;  4RCB A;  1LNX A;  2DD5 A;  2QQ9 A;  5LJ3 d;  2GQV A;  1KC8 C;  5GAO m;  1G3Y A;  2KDS A;  3VUZ A;  4J8O A;  4IUR A;  5LJ5 f;  4M7A A;  1Q86 C;  4E47 A;  4C92 B;  3OYY A;  3FRN A;  4M77 F;  3BW1 A;  1K73 U;  3GP8 A;  1UGQ B;  2RHY A;  1K8A C;  3RKY A;  5GAO l;  2KK4 A;  2ZCF B;  3OMG A;  2X4Y A;  4PLL A;  5FLX E;  3TRE A;  5DY9 A;  5KE2 A;  3FEO A;  1KQ2 A;  3CCM A;  1PSE A;  1HXD A;  4FM4 B;  2EQJ A;  4PKC C;  3CXC S;  1K9M C;  2LQK A;  2DAQ A;  3N5B B;  4BUG A;  1XOV A;  2RH2 A;  3SFM A;  5C0M A;  3DLL A;  1NZ9 A;  4J6W A;  3M4Y A;  2OTL A;  2RJF A;  3EAE A;  3OW2 S;  5D6Y A;  1Q7Y U;  3NTK A;  2R5A A;  2CGH A;  4JLG A;  4M78 F;  2E64 A;  3JCM X;  1NJI U;  2HQE A;  1D3B B;  2QEX A;  4OMF B;  2R5M A;  3I55 A;  3HL8 A;  4IUQ A;  3OS0 A;  3CCU A;  2MF2 A;  1RL2 A;  3F70 A;  3CME A;  4XTV A;  5LJ5 h;  3JCM P;  1KQ1 A;  3FB9 A;  2DXB A;  4BB7 A;  2D0Q B;  2RM4 A;  5LJ3 e;  1I81 A;  3ER0 A;  1WQW A;  2WSF E;  4JLI A;  4X34 A;  5D6X A;  3S3M A;  3UPU A;  3VUB A;  2DZ9 A;  2RD1 A;  2KMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...