4PJOD

Minimal u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
98
Chain Sequence
b'EMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVSKPVNKDRYISKMFLRGDSVIVVLRNPLIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 19
structure length 98
sequence length 107
chains with identical sequence R, d, r
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoD00
4HA8A 5GMKh 4C92A 3JCMX 2YHTA 4M7AE 4N0AC 5LJ3f 4EMHA 5GAMf 2YLCA 4PJOC 2DXTA 2HNIA 2CGHA 4M77E 3L1AA 4J5YA 2VC8A 1B34A 2E1HA 2VXEA 4M75B 3BFMA 2VXFA 4WF2A 4X9DA 4XU1A 3RUXA 4C8QD 4N0AA 2QTXA 2JN0A 3V7CA 4OP0A 4C8QG 5I21A 4M7AC 4C92G 4PJOA 5GMKi 3JCMd 5LJ5e 4M77C 4C92E 3FJPA 2EJ9A 3EFSA 1I4K1 2EJFA 3RKWA 3JCMc 4EMKB 5GANg 1JBMA 4J6XA 4XTUA 4PJOD 2Y90A 5GAOm 4PJOG 4C92C 3JCMV 3BDUA 5GAOq 3HFNA 4F7UB 4HT8A 4PJOE 3RERA 1WPYA 1LJOA 1KQ1A 3RESA 3SWNA 4NOYA 1U1TA 2FB7A 2E41A 1WQ7A 2RA2A 4XU2A 3BW1A 3RKXA 1D3BB 4C8QB 5GANd 3JB9D 4M77D 5LJ5f 1YCYA 2DZCA 4PNOA 5DY9A 4M77G 3RKYA 2DEQA 1MGQA 3JCMg 3JB9G 3GIBA 4J6YA 3FIFA 5CAIA 5GAOp 3JCMJ 1B34B 5LJ5j 1I81A 5LJ3g 3JCMW 2DVEA 3QHSA 5GAMg 4C92D 4XTWA 2E65A 4MMLA 5GMKl 4JRKA 3JB9H 4PJOB 3HFOA 4M7DF 4JRIA 1Y96A 2I2LA 5GAN4 4M78F 3HSBA 1BIAA 4XU0A 4M7AB 4XTZA 3SWNC 5LJ3d 5GAMd 2DTOA 3INZA 4M77B 2FYKA 3JCMP 3V7SA 1TH7A 2YLBA 4F7UF 2DTIA 5LJ5h 4M7AD 4XTYA 4JUVA 3EFRA 4C8QF 4MMKA 4M7DC 1LNXA 4NL2A 4C92B 3BY7A 1WQWA 3V8JA 3JCMe 3JB9I 4HT9A 4M78C 2E64A 3V8KA 4QVCA 4XTVA 3JB9J 4M75F 4NL3A 4M7DA 5GAN8 4Y91A 5GAN2 1WNLA 5GMKm 4M78A 2RD1A 2RB6A 2ZGWA 5GMKe 2DZ9A 5GANj 3JCMh 1BIBA 2E10A 1I5LA 1Y96B 2K57A 1X01A 4V2SA 4M7AF 2DXUA 5GANe 4F7UA 3JCMf 5GAN6 4M7DG 4A53A 1M8VA 4M78D 2EJGA 4XTXA 4M78G 4EMGA 3JB9F 4M7DE 4J6WA 4M75C 4C8QA 1D3BA 2DKGA 1H641 1U1SA 4XU3A 4M78E 5GAN3 5GAOr 1HXDA 5GAOn 3QSUA 3AHUA 3SWNB 3V7RA 4A54A 4F7UG 4M75A 3M4GA 3V8LA 3SB2A 1HK9A 3QO3A 4C92F 1JRIA 4QVDA 5LJ3j 4F7UE 3FB9A 5GAMj 2EWNA 3VU3C 4C8QE 1N9SA 5GMKj 5GANf 4RCCA 5LJ3e 5LJ5g 4M7DB 5GAMe 1M5Q1 4M75D 3JCMb 5GAN5 4M75G 4M78B 4M7AA 1N9RA 2DJZA 2RM4A 4PJOF 3L2ZA 4JLIA 4RCBA 4EMKC 4M75E 5GANh 2EAYA 3RIRA 4C8QC 4M77A 5GAN7 3PGGA 5GAOl 1LOJA 4M7DD 3JCMQ 4XQ3A 3QUIA 5LJ5d 1I8FA 2DTHA 5LJ3h 4DQ2A 5GAMh 4X9CA 4EMKA 1KQ2A 4M77F 4M7AG
chains in the Genus database with same CATH superfamily
2RI2A 5GJWB 2PVDB 2P0PA 3TEEA 3CCJT 2DXTA 2CGHA 2DE0X 3LLRA 5I2SA 4C8QG 2YSQA 5KCOA 2FZGB 1N5ZA 3CCSA 1Q7YU 1IGUA 2RHUA 1UGQB 3EFSA 1P92A 4EDUA 1AVZC 4AG1C 2K3XA 1YCSB 1TOVA 2DK3A 2H8HA 5CKFA 4EPCA 4HCZA 1RLPC 3CCVT 1WI7A 4JDSA 2RA2A 1ZBXA 4JJCA 4XU2A 3HHTB 1W6XA 4ZGDB 3A8HB 5CAIA 2XI9A 1KC8C 2ECZA 2MIOA 3I55Q 4F14A 1WLPB 4Y92A 4JRQA 4PJOB 1IB8A 5I11A 2VVKA 1X2QA 3EG9B 1YJNT 4LNPA 1XQHA 5LJ3d 1M90U 3INZA 2KROA 1JXMA 2MWPA 1PD1A 2JTFA 1WXBA 3CD6T 2JTEA 7AT1B 1YN8A 2AKKA 1QLYA 1VQPT 3SDZA 1PSEA 2MCNA 1WIEA 1UUEA 1Q7YC 2CSQA 1QKWA 3CC2T 2XG8D 4OB1B 4M7DG 3KUFA 3O5ZA 1H641 1QVFS 1D1AA 4KUDK 3EGDB 1OQKA 3M0SA 4RTYA 1EZZB 3EGXA 1G8XA 5LJ3j 3I55A 4JRPA 3FB9A 3E9FA 2EWNA 4C8QE 2NUZA 1G3SA 2QEXQ 4Z88A 5GAOl 4D6WA 2DVJA 2NUPA 2DL5A 1I8FA 1M90C 2LMJA 4X9CA 1Y07A 5KYYB 3CC4T 1M1KU 1QCFA 4PFPA 5GAMf 2VB6A 3M0RA 2KSSA 5FU7C 4KGVB 3RUXA 4A63B 3J80E 3H0HA 4C92G 2MI6A 2R5AA 3AT1B 4GLMA 2DFUA 4PJOD 1HYOA 2M0OA 3TSZA 4LDYA 4F7UB 1FMKA 4LDUA 3OYAA 4BD3A 3GIBA 2F2XA 3HPWA 2OTJT 2QYZA 1WXUA 2LNVA 2LCCA 2O01E 3OS5A 3C12A 2QEXA 2EQIA 4AT1B 1QWFA 1IZ6A 2M0YA 5HY6A 2OAWA 1PKSA 4C5HA 1TS9A 1YJWT 2KGTA 1Q86U 3CPWS 1M1KC 2DXBA 4C8QF 3QDRB 4RTXA 2XHCA 3G4ST 4WCIA 1QW1A 3E2UA 4QVCA 2IVWA 1G83A 3DB3A 1I07A 1UGSB 3L2WA 5C0MA 3JRZA 1K73U 2DF6A 1VQ8T 1TU0B 1VIEA 2DRMA 3JCMf 3CEYA 4IUUA 4PKCC 2F69A 4XTXA 3QJ6A 1MNEA 1FWZA 1T3LA 3UPUA 3SWNB 2AKLA 4RTVA 4LN2A 1VQNT 4OMFB 4IUVA 1NBEB 5EC7A 2XICA 1M5Q1 1VUBA 4M78B 2DJZA 5GAN7 3A98A 3OMCA 2LP5A 1UHFA 2X35A 3L2QA 2YHTA 1Q86C 1VOMA 4E47A 3OYBA 1Y71A 2AZVA 5KYXB 1BCMA 4C0FA 2K3YA 2KK4A 3A8LB 3GBQA 4FM4B 4E6RA 4M75B 4LD9K 5ECAA 3GOXA 3FJ5A 1K73C 2EKOA 1YJ9T 2QK0A 1BU1A 1VYUA 5FU6B 3BDUA 3UWNA 4VUBA 4J9BA 3VS2A 2DMOA 3BW1A 1BI3A 5LJ5f 2K6DA 3RKYA 3CCQQ 1K9MR 3OSSC 4OMQA 3CCST 5GAOp 2J6FA 1UJYA 4E7ZA 3H0FA 2RHZA 3JCMW 4KRTA 3RBBB 2XMFA 2HCKA 1QVFA 1AD5A 2I2LA 2BE7D 3NGPA 3META 3S3OA 2FYKA 4ELYC 2KQWA 2XIDA 2DILA 1MV3A 3HRUA 4QVZA 1UDLA 3M58A 1XTDA 2RHXA 2X9HA 4OMNA 3QWYA 3M4YA 2HKQB 3JB9J 3EH1A 4MZTA 2LT1A 2RMOA 2DBKA 5GAN2 1WNLA 4LDVA 5IT9E 4DOVA 4C0GA 5KYUB 1Y96B 1X01A 2GF7A 3KXTA 3CCEQ 2NUTA 4M78D 1XJWB 2JW4A 4BACA 2YUNA 5IAYA 3MEWA 2CUDA 1U5SA 2GCXA 2XDPA 1OX9A 3TU4K 2B86A 3O8VA 3CCMQ 3NHNA 5GMKj 3DLLA 1WX6A 2E3IA 4M75D 3HL8A 2CP6A 3VYHB 3PNWC 1MMNA 3L2ZA 1M3AA 2EW3A 2D0NA 2EAYA 2A3LA 1PRMC 4OB2B 2XU8A 3SHWA 1OX8A 4M77F 3KBGA 2M1HA 5LJ3f 1RAGB 2L3QA 1M9SA 2YRCA 5IXFA 5CVIA 2KRSA 1KFZA 1VQMA 1SSHA 4M7AC 1VA7A 2KXCA 2KAFA 2HDAA 3VRZA 1E6HA 4C0DC 4M77C 2JOYA 2RPNA 2VGMA 2R57A 3CCEA 2YDLA 1UGVA 3X28B 3HRTA 3CPWA 4E7SA 3CPFA 1JBMA 4XTUA 2KNBB 1RL2A 4PJOG 3C94A 3CPWP 2LQKA 3P8BB 5GAOq 2HAXA 4MZPA 1ZLMA 2O88A 3JB9D 2VKNA 3CCMA 3ZBDA 3OS1A 4PJNA 3OYGA 4XK8E 5KYWB 1BCOA 1MMDA 5GAMg 3I56Q 1ARKA 3CCLQ 2FHDA 3RR6A 2COYA 2XDDA 4XTZA 1M2VB 4JPBW 3TCJA 4R56A 1N8RU 2YLBA 5GJVB 1R77A 1YFNA 1KJWA 4C5GA 4C92B 5CIUA 1IRXA 4R55A 2OI3A 4KBMB 1X6OA 4DOWA 4QW2A 1CKBA 2YWWA 1R0CB 1WA7A 2QGFB 2V26A 2DLPA 4L6V5 4EMGA 4C8QA 4KT0E 1YI2A 3BE3A 1PCXA 1K8AC 3QSUA 1SHGA 1VQKT 3I56A 3CMAQ 4LDXA 4CC4B 3CMET 3CCLA 4RCCA 1PC0A 1OU8A 2JNGA 4C5EA 4PJLA 2CP5A 2BZYA 2M02A 5CKHA 4M7DD 2DPPB 1BI1A 3CBOA 3QUIA 2DTHA 5GAMh 1N8RC 2YLCA 3H9NA 1PD0A 1B34A 1U3OA 2FG0A 1X2KA 3PVQA 1X69A 4RTWA 4GLKA 1BB9A 1WHMA 2DL7A 4N4HA 2V8KA 4E7IA 1G3TA 1FXXA 3MP6A 1VQ7T 3VS3A 3UA6A 2VYTA 1AWJA 1BI2A 4RTZA 1NM7A 3JCMV 4RTUA 3SEMA 2JS0A 2LNHB 4HT8A 2DYIA 2D1XA 2E41A 2QDYB 3FIFA 8ATCB 1I81A 2CP0A 5CKEA 4C92D 4XTWA 5GMKl 2EQMA 4ATOA 1EIFA 2BZ8A 2O31A 4OMOA 1BIAA 3A8GB 2DTOA 3G71Q 2ATCB 5IHNA 2DTIA 3EG1A 2JTMA 1I1JA 1ZUKA 2D9TA 1JO8A 2C0OA 1VQOQ 3BY7A 2DD4A 3M53A 1AWXA 1Q82R 3CCUA 4ZTFA 2LQNA 4BDZA 1AWOA 1S72Q 5DM7R 4KGXB 2X4XA 3JCMh 4RG8A 1Z9ZA 2E6NA 3CC7Q 4LUDA 4K11A 1UGRB 2DXUA 3P8DA 3ZFJA 3E1SA 4Y28E 5IH2A 4M78G 4WTOB 2AT1B 1QMCA 3SFMA 3NFCA 3OY9A 2RNAA 1IHVA 4A4KA 1YIJT 2CUBA 3EG2A 4F7UE 6AT1B 1X6BA 3VU3C 1N9SA 2BTTA 3QG1A 3QXEB 4KULA 3LGLA 2NYSA 4BDYA 3MEUA 4M75G 2X51A 4RCBA 4OGCA 3G71A 1RI9A 4HCKA 4J83A 1BI0A 2A08A 4DBHA 5LJ5d 3EHQA 2DXCA 3OSVA 3LWHA 1YP5A 1ZSZB 1VYVA 1VQ5Q 4N0AC 3C0CA 1MMGA 3OYIA 1S72A 2VXEA 3DB4A 1HD3A 3EGXB 2RO0A 5FROA 2M16A 4FT4A 2JS2A 3OYYA 3CC7A 4ZGJB 4LDWA 2ZPBB 3M9QA 3GLXA 2JVVA 2AHJB 2A0FB 2LRQA 3RERA 1YNZA 3EGUA 1VQMT 3OA6A 3DLMA 3JB9G 2H3EB 1MGQA 2DBMA 2DA9A 2PNIA 1R0BG 3JCMJ 5LJ5j 3M59A 5LJ3g 1AHJB 2KYMA 4MMLA 4CC7A 1GBRA 1IXDA 2KEAA 5A0GA 2E6ZA 4JRIA 1SF9A 4B9XA 5GAN4 4XU0A 1Y57A 3VUZA 1NPRA 1EFNA 4A4HA 4A4FA 4BY6C 3G6EQ 1VQ5A 1MHNA 1WGSA 1RAIB 1VQ4A 4O5VA 4F7UF 1T0JA 3VS1A 2DEUA 1VIFA 2LJ0A 3LH5A 1LNXA 2L3PA 1B7TA 1WQWA 1QVPA 3L2UA 2DJQA 1NPPA 3C4SA 2P4RA 2GGRA 1BIBA 2OJ2A 2EGCA 2XKOC 5GANe 2MWOA 3NTIA 1QVGP 1X75C 3QYHB 3VS6A 4N4IA 1QP2A 3QDFA 5GAOn 4QVDA 1JQQA 2X3WD 2JMAA 2GFUA 3VRYA 4JJNK 5HKCA 1ZA1B 4EMKC 3M0UA 2VUBA 1YI2T 4HCBA 3JCMQ 1KHCA 1SKUB 5LJ3h 1KC8R 1OU9A 2KVQG 1OPLA 1WHJA 1A0NB 2E1HA 3GP8A 3BFMA 2EKHA 3RMQA 2RQVA 1LVKA 4OP0A 1VQ6Q 1M27C 2YT6A 3EHRA 1ZBJA 3I5SA 2V8IA 3I9QA 2O4XB 2OTLQ 3WVEB 3C95A 2KMTA 5GAOm 1TUCA 2ZPEB 1B07A 2Y4YA 3VYGA 1WPYA 1KQ1A 2QI2A 3FRNA 4JJDA 1D3BB 4PNOA 1Q7YR 3VUBA 2CH4W 4D8KA 2QA4Q 3TQ7P 4PK4A 1Y7XA 5IN1A 1VQLT 3JB9H 3H8ZA 1WZOA 4HVVA 3MJXA 1YWOA 2C0IA 3OBWA 2LX7A 2RI5A 3JCMP 1XOVA 3M55A 2FRYA 3G1JA 1VQ6A 4IUQA 1E6GA 1OI1A 1X6GA 1KQSP 2GTJA 1M90R 4PFZA 2OTLA 1PSFA 1W1FA 1D0YA 1W2BS 2E10A 3OS2A 2K57A 2COZA 1KG1A 2BZXA 2DO3A 2EQUA 2HQHA 3RMSA 5GAN6 4M7DE 3JB9F 1YITQ 4OB3B 5GAOr 3LGFA 4AMCA 3CCUT 1ZSGA 3M57A 1PHTA 1K9MU 3HP9A 3EH2A 2L3RA 3EG9A 1NJIU 4PL6A 4Z8AA 3JCMb 2HL3A 1KD1U 4RTTA 2PVGB 4OMLA 3RIRA 4C8QC 1LOJA 2GTOA 3A1PA 3UT1A 2XDBA 2P84A 3REAB 3OYLA 1JJ2A 4M7AG 3LW5E 4OF1A 2WSCE 1KIKA 3EFOA 4J9DA 1JJ2P 4OMMA 2JMCA 5I2MA 4N0AA 1K1ZA 4C92E 3FJPA 2EJ9A 1HJDA 4JJBA 4QKUA 1MV0B 1UB4A 3CCRQ 2QQBA 1YITA 2MK5A 2X4JA 2ENMA 2RJDA 3EGDA 3HFNA 1W4SA 4J9IA 2YUPA 3JCMX 1GL5A 2GQVA 5GANd 3M5AA 1YHQQ 2KRMA 1AZGB 4RUGA 3G7ZA 5KCHA 1SEMA 3FC3A 1K9MC 3OMGA 2HMAA 2VV5A 3UF4A 3N5BB 1M1GA 4M7DF 1NJIC 4E7LA 1KD1C 5FU7B 4ESRA 1VQ9T 2EIFA 2BIVA 4FYXB 5KYYA 3ZEHA 3CXCP 1M8MA 4F17A 4ORZA 3J7AF 4JUVA 4M7DC 4J9HA 1DJ7B 2F2VA 4HT9A 1FMWA 5EG2A 2DM1A 3LYIA 1WJSA 1D0XA 3JSCA 3CCRA 5GANj 1WHKA 1PKTA 1Q86R 1VQ4T 1B3QA 3MP8A 4F7UA 3NTHA 4ME7A 1ABQA 4A4GA 5L23A 4PJJA 1YHQA 1AEYA 1GCQC 2HSPA 1K76A 1BK2A 1TG0A 4C92F 3M56A 4AG2C 2JM9A 3KFVA 5IXBA 4AFQC 1M1FA 2ESWA 4KH0B 2G3RA 4J7FA 3WVDB 4EMKA 4HA8A 3CCQA 2VASA 2CZ0B 5GMKh 3JV3A 3QPHA 3QYGB 5HK0A 2HNIA 2RHYA 2VC8A 2VXFA 3ER0A 1SSFA 2QTXA 3OS0A 4AFZC 4BE0A 2ZPGB 4RG2A 4GBQA 2DX1A 3CCJQ 4EIKA 2PU9B 1ACMB 4J6XA 1NZ9A 2FRWA 1YBYA 1D0ZA 4JS5A 1M3CA 4CC3A 1RAHB 2KYBA 3SWNA 1T0HA 4NOYA 2VWFA 3I55T 2DZCA 4LUEA 1W2BA 1NLOC 2GBQA 1M4ZA 3CCVQ 1B34B 1W2BP 1JEGA 1AOJA 3A5ZB 1AZEA 3EG3A 4E2FB 4QQ6A 1K8AU 1WJQA 1YJNQ 2WSEE 2DL8A 3URGA 4DBRA 3V8JA 2L0AA 4C5IA 3CCJA 1Y0MA 4C0ZA 3TREA 3CD6Q 2RN8A 2RD1A 2ZGWA 2CP2A 1TTHB 3QKJA 2CZ1B 1I5LA 2G6FX 2K2MA 1VQPQ 3HTRA 4CRIA 3CC2Q 1M30A 1ZUYA 4ANJA 3OYEA 2E12A 1NYFA 2FZCB 3CCVA 1HSQA 2QEXT 2NLUA 2LDMA 1H3ZA 1MUZA 3FEOA 2EFIA 2QQSA 1WHGA 3LX7A 4KUIA 4X1VA 5AT1B 1PNJA 2AK5A 5D6WA 1QCOA 1G3WA 4AFSC 3OW2A 3EG0A 2J6KA 3OW2P 2V1QA 1G3YA 4BUGA 3A8MB 1SG5A 3CD6A 3CC4Q 2JN0A 1IO6A 5GMKi 2K79A 5KYUA 2CS7A 1VQPA 2RJCA 4J7IA 2K4YA 4LXCA 3CC2A 2A36A 4PJOE 4J9GA 4BE1A 1U1TA 2FPEA 1M2OA 1QVGS 4N4GA 3JCMg 4RMOA 2SEMA 3S3NA 4IURA 1NEBA 2FEIA 2DVEA 2OTJQ 1W70A 2LVMA 4XAXB 4QT7A 1Q81U 3OYJA 4M7AB 4X34A 1AWWA 4ZTJA 4C0DB 4M77B 3CQTA 5A0DA 1K0SA 3EFRA 3CMAA 3CC4A 1UE9A 2ED1A 1YJWQ 2EYZA 2X3XD 4LD6A 4M7DA 4UC4A 5GMKm 3QIIA 1N8RR 3G4SQ 4ZNXA 2ZAEA 3TVTA 5FRNA 4QQGA 1GCPA 2DNUA 5GAN3 2IPOB 2CP3A 3X20B 3AHUA 1OZ2A 1WJRA 1GCQA 3UA7A 3MEAA 2P0QA 1RAAB 3Q1JA 3DKMA 4CC2A 5GANf 4HKEA 5LJ5g 1V1CA 2IIMA 2RK1A 4PLLA 2L2PA 4PJOF 2FPFA 1VQNQ 1M2VA 1Q81C 3X24B 3OYMA 3VV0A 1U8RA 2E70A 3F70A 4C92A 4RKUE 2DL4A 1RACB 4NS5A 4PJOC 2K3BA 2RQTA 3MO8A 1SRLA 2CZ6B 3NPFA 3G4SA 4II1A 3LH0A 2BUDA 2EPDA 3H41A 1I4K1 1PWTA 1KQSS 3IQLA 1RLQC 3CCQT 1BKBA 1QWEA 2MMPA 4M7AD 3RESA 3QZ9B 5CCAA 1VQOA 1YJ9Q 1CKAA 2LQ8A 4M77D 5DY9A 3P8HA 2D8HA 4J6YA 2ROLA 1ZQ1A 5CQXA 1D09B 4F04B 2MYSA 1VQNA 2EYXA 2CH4A 4KGZB 3CCSQ 1G5VA 2FL7A 2QQ9A 3GNFB 5FLXE 1N6AA 4OB0B 1X43A 3E9GA 2NUPB 2DRKA 5LJ5h 2YRVA 2D0QB 3MKDA 3ME9A 2PZ1A 2MPXC 1RAEB 4R0KA 2O9VA 2CDTA 3CCET 1RI0A 1WHHA 1JJ2S 2PQWA 1JB0E 2RB6A 5CQYA 4MDXA 2X4YA 4L59A 4IKFA 4A53A 4GY5A 1Q95G 2EQKA 1YJ9A 2YUOA 4J9CA 1WDXA 1KK7A 4J6WA 2P4TA 4BI3A 2F1LA 3CCMT 4M78E 1HXDA 1X27A 2FVUA 3V8LA 3QO3A 4JZ3A 1O9SA 1TWBA 5CKDA 3NMZC 5KE3A 4M75E 1QVGA 4PFOA 2J7IA 3MCAB 4FSXA 1QKXA 4E7JA 5D7UA 5J26A 4EMHA 4J9FA 2ZZDA 2RK2A 3CXCS 2HKNA 3GF5A 4E7KA 1J3TA 2LCLA 2QGGA 5I21A 3WXMB 2DETA 2CSIA 1H8KA 2KXDA 3A8OB 2QASA 1IHWA 2EBPA 2KI7A 1RAFB 2F2WA 2EJFA 3RKWA 3OYHA 3G6EA 3OBYA 1AT1B 2KY9A 2W0ZA 2JZ2A 3RKXA 3I56T 3EFOB 4DA4A 3PE0A 3NTKA 3CCLT 3QHSA 2EGEA 2E65A 3M0PA 4BI4A 1V29B 2DD5A 3I5RA 4M78F 1TXQA 1UECA 3SWNC 3VJPA 3V7SA 1ZSZA 2WACA 4D8DA 3CBMA 2D6FA 3PFSA 2QG9B 3FDRA 4MMKA 3OYDA 2HBPA 4FSSA 2KT1A 4M78C 2W10A 2XD0A 4M75F 1UGPB 1C0MA 2JJ9A 2O9SA 4OMPA 2DZ9A 5GMKe 4AFUC 1IREB 3QZ5B 1H3HA 2CKKA 3EAEA 5FWCA 1OULA 4M75C 3CMAT 2DKGA 1U1SA 4XU3A 2RJFA 2F5KA 3UATA 2RH2A 2GFAA 4BY6B 1R8OB 3M4GA 1GBQA 5DLQE 1KQSA 2HL5C 4J9EA 3FLGA 1WHLA 1OV3A 4FW1A 5FU6C 1LPLA 3REBB 1VQKQ 2RM4A 3GPLA 4JLIA 2JXBA 2YRDA 3CMEQ 4E7HA 4PLIA 1UTIA 3PGGA 2E4HA 3X26B 2MF2A 5I22A 4IUTA 2GQIA 2QXFA 4XQ3A 2GNCA 4PJMA 4FIBA 5KYNA 4M4ZA 3R6NA 2QA4A 4FL6A 4WF2A 1OPKA 1SRMA 5IHIA 4PJOA 4B6MA 2HSEB 2K7AA 5GANg 2EQJA 1C1AA 1PG5B 4OGEA 1F1BB 2NUTB 3MPUB 1VQ7Q 1LJOA 1WYXA 2JT4A 1WXTA 2FB7A 4EMKB 1WQ7A 3OQ5A 4M77G 2Z0WA 2KDSA 2EVRA 3JAME 1VQKA 2EYYA 1OEBA 1KSWA 4JRKA 3CBPA 1ZUUA 3G71T 3CMEA 9ATCB 2K2VA 4IIMA 4ZN1A 3HSBA 1M1KR 1OZ3A 4DEXA 2L8DA 1VQOT 2M9UA 5FRMA 5HCKA 3RNJA 4ELZC 1TH7A 3PT9A 4XTYA 5FW9A 1RUWA 1S72T 2RJEA 1MMAA 3JB9I 5KH6A 2ZCFB 4L5GA 3CC7T 2QQAA 4NL3A 3L2VA 5GAN8 2OX7A 4Y91A 3OW2S 3PIPA 2LQWA 3L42A 4B9WA 2SRCA 1IGQA 2O4XA 4JZ4A 2A37A 2CREA 3CXCA 1O75A 5LL6S 1VQ7A 1I5OB 4FCYA 1NE8A 4ZGEB 1VYTA 1D3BA 1JXOA 1YWPA 2COWA 2YUQA 2ED0A 3HRSA 2HD0A 4FU6A 4A54A 5GANh 1HK9A 2KR3A 2C0TA 1NYGA 4ZN3A 2RQWA 1YIJQ 1BYMA 1SPKA 5GAMe 2E5QA 1G2BA 2K5FA 1VQ5T 3M0QA 3QBYA 4DQ2A 1GFCA 1TSFA 1UEBA 2I0NA 4M7AE 1C6VX 1FX7A 1NJIR 4M77E 1K73R 4J5YA 1KD1R 4X9DA 4YTLA 3PMIA 3S3MA 2HEQA 4HXJA 2FZKB 1K0XA 3MHXA 3JCMc 1QVFP 4MDWA 2Y90A 4C92C 2JM8A 2DERA 2K5LA 4MZMA 5HK3A 1H92A 4C8QB 5L8RE 1QCNA 2EYQA 1YCYA 2YXYA 4LE9A 2BKDN 1YIJA 1LCKA 2A7YA 2V8JA 1VQMQ 3M54A 3G6ET 2CT3A 2VGNA 3OYNA 3HFOA 3PMTA 2KE9A 4BI8B 5CK9A 2QDLA 3U23A 1N27A 2ABLA 3JCMe 4F16A 2QTVA 5CR2A 4XTVA 2H3JA 4M78A 3UDCA 2E5KA 4QQDA 1OOTA 4M7AF 1M8VA 2D8JA 2RQUA 1UJ0A 5J3BA 5KYXA 5CKBA 4M75A 1WFWA 2ROTA 1JRIA 4TVRA 4FYYB 2LTOA 4O6JA 3VKIA 3J81E 2B8AA 4M7DB 3ASKA 4JS4A 1QP3A 4BB7A 2A28A 1NLPC 1I0CA 2AIRB 2PUOB 2CP7A 1GRIA 1V76A 1VQ6T 2HZYA 4Q5WA 1YI2Q 2NWMA 1OYXA 2J06A 4C8QD 3VS7A 2PUKB 2OTLT 1FMVA 3VS4A 5LJ5e 1NG2A 2LX9A 2RQRA 2FO0A 2ZPFB 4FYWB 4Z89A 1T3SA 2QA4T 1PRLC 1YJNA 2DYBA 4J8OA 3S6WA 1K4US 1ZHIA 1ZX6A 2DEQA 3H6ZA 2DAQA 2Y4XA 2CZ7B 3I35A 1Q82U 1Y96A 2HQEA 5GAMd 4HCCA 2L5QA 1VQLQ 4HVUA 2L3SA 3H0IA 2ZPHB 1FYNA 4JLGA 4CI0C 5D6XA 4NL2A 4V2SA 1NEGA 2L89A 3V8KA 2E64A 1EX4A 2E3HA 4DBFA 1SHFA 3QJYA 3HKSA 3ULRB 1YITT 3D7SB 3OB9A 1RADB 1UG1A 4FW2A 1K8AR 1ZSZC 3VS5A 2RHIA 2JUFA 2CT4A 2AZSA 1MNDA 3ZL7C 1M3BA 3V7RA 4F7UG 1KHIA 1BBZA 3SB2A 4DBQA 1E7OA 5GAMj 4FT2A 2P0KA 4OVAA 2LJ1A 5LJ3e 3CCUQ 2BE9B 5GAN5 4FYVB 1Q82C 1VQLA 3L2RA 3GNGA 3E19A 3MEVA 3OYFA 2LT4A 2QQRA 2XK0A 4DEYA 1KQ2A 1U06A 1UFFA 1VQ8Q 2KT8A 2O2OA 3BDLA 2X4WA 1QQJA 5KYWA 3L1AA 5FWBA 2RI3A 3PTAA 2OTJA 1ZA2B 4XU1A 1UHCA 3V7CA 3CCRT 1TUGB 5A0LA 3JCMd 1XNIA 2MAMA 2FPDA 5AYFA 1YHQT 2ZPIB 3VS0A 2LC4A 1PM3A 2PTKA 8AT1B 1YJWA 3TSWA 2DL3A 2CYZB 3LWIA 2MOXA 2M51A 3PIOA 2V1RA 2WSFE 4IIOA 4HVWA 3RDVA 2LZ6B 2QAZA 3THKA 1TUDA 1VQ8A 5CO7A 2EGAA 5C6SA 1VQ9Q 3OYKA 1CSKA 1S1NA 3M0TA 2KBTA 2LJ3A 3QWXX 3OYCA 1Z9QA 1Q81R 3R6OA 3X25B 1GFDA 5A2QE 2K5IA 5KE2A 2K9GA 5IHKA 3SD4A 1ABOA 2EJGA 4IUPA 2DIQA 2R58A 2EYWA 3PVLA 2OAUA 1VQ4Q 1GXIE 1JU5C 2F5TX 1KC8U 4KH1B 2HQXA 5D6YA 1K9AA 4Z02A 2HBWA 3MP1A 2DIGA 1D1CA 5M9OA 5DLOA 4M7AA 1N9RA 4BE2A 2R5MA 5J39A 2IG0A 1RABB 2J05A 2PVOB 2C06A 4A4EA 4P5NA 4M77A 2RF0A 1VQ9A 2KRNA 3T9NA 2LCSA 2J6OA 1D1BA
chains in the Genus database with same CATH topology
2RI2A 4HA8A 3CCQA 2CZ0B 5GMKh 2PVDB 2P0PA 3QPHA 3QYGB 3TEEA 3CCJT 2QA4A 2YLCA 5HK0A 2DXTA 2HNIA 2CGHA 2RHYA 1B34A 2VC8A 3LLRA 4FL6A 4WF2A 2VXFA 3ER0A 1SSFA 5I2SA 2QTXA 4GLKA 4C8QG 3OS0A 2ZPGB 4BE0A 4RG2A 5KCOA 4PJOA 4N4HA 2V8KA 3CCSA 4E7IA 1Q7YU 1G3TA 1FXXA 2RHUA 3MP6A 1UGQB 1VQ7T 2PU9B 3EFSA 1P92A 4EDUA 2K3XA 2EQJA 5GANg 2VYTA 4J6XA 1BI2A 1NZ9A 4OGEA 1YBYA 2DK3A 3JCMV 5CKFA 4EPCA 4JS5A 4HT8A 4HCZA 1LJOA 3SWNA 3CCVT 4NOYA 4EMKB 2FB7A 2E41A 1WQ7A 1ZBXA 2RA2A 4JDSA 4XU2A 3OQ5A 3HHTB 2QDYB 3I55T 2DZCA 4M77G 1W2BA 2KDSA 3FIFA 4ZGDB 3A8HB 5CAIA 2XI9A 3JAME 1KC8C 1M4ZA 1B34B 1VQKA 1I81A 5CKEA 4C92D 4XTWA 5GMKl 4JRKA 3CBPA 3G71T 3CMEA 2EQMA 4JRQA 4PJOB 4ATOA 2K2VA 1EIFA 4ZN1A 3A5ZB 3HSBA 1BIAA 1YJNT 1OZ3A 1XQHA 5LJ3d 1M90U 2L8DA 3A8GB 1VQOT 2DTOA 2M9UA 3INZA 5FRMA 4ELZC 1TH7A 2DTIA 4QQ6A 1K8AU 2JTMA 1WJQA 3PT9A 2MWPA 4XTYA 2JTFA 2D9TA 1S72T 2RJEA 2WSEE 3CD6T 3URGA 3BY7A 3JB9I 3V8JA 2DD4A 5KH6A 3M53A 4C5IA 2ZCFB 3CCJA 4L5GA 3CC7T 2QQAA 3CCUA 4ZTFA 4NL3A 3L2VA 4C0ZA 5GAN8 4Y91A 3TREA 4BDZA 3PIPA 3OW2S 3SDZA 5DM7R 1PSEA 3L42A 2X4XA 4B9WA 2RD1A 2ZGWA 1Q7YC 2O4XA 3JCMh 4RG8A 3QKJA 3CC2T 2CZ1B 2E6NA 1I5LA 2XG8D 3CXCA 4OB1B 1O75A 1UGRB 2DXUA 5LL6S 3P8DA 1VQ7A 4M7DG 3ZFJA 3E1SA 4Y28E 1NE8A 3KUFA 4M78G 4ZGEB 1D3BA 1H641 4CRIA 1QVFS 4KUDK 3SFMA 3OYEA 3NFCA 3OY9A 4A4KA 2E12A 1YIJT 3HRSA 2HD0A 4FU6A 4A54A 3CCVA 2QEXT 5GANh 1HK9A 5LJ3j 4F7UE 4ZN3A 3I55A 3FB9A 4JRPA 2NLUA 3E9FA 2EWNA 3VU3C 4C8QE 1N9SA 2LDMA 3QG1A 3QXEB 4KULA 1BYMA 1H3ZA 1G3SA 3LGLA 3FEOA 5GAMe 4BDYA 2EFIA 2QQSA 3MEUA 4M75G 2E5QA 3LX7A 4KUIA 2K5FA 4RCBA 4OGCA 3G71A 1VQ5T 5D6WA 5GAOl 4J83A 4D6WA 1BI0A 3QBYA 1I8FA 5LJ5d 4DQ2A 1G3WA 1M90C 4X9CA 2DXCA 1Y07A 3OW2A 3OSVA 3LWHA 3CC4T 1M1KU 1UEBA 4M7AE 4N0AC 5GAMf 1FX7A 3OYIA 1G3YA 4M77E 4J5YA 3A8MB 2KSSA 4BUGA 2VXEA 1S72A 3DB4A 4X9DA 5FU7C 3CD6A 3RUXA 4YTLA 3PMIA 2RO0A 2JN0A 5FROA 2M16A 3J80E 4C92G 3S3MA 5GMKi 2MI6A 4FT4A 3OYYA 3CC7A 2R5AA 2CS7A 4ZGJB 1VQPA 4LDWA 3MHXA 2ZPBB 3M9QA 3GLXA 3JCMc 2JVVA 4MDWA 2RJCA 4J7IA 2K4YA 3CC2A 2M0OA 2Y90A 4PJOD 2AHJB 4C92C 2K5LA 4LDYA 4F7UB 2LRQA 4LDUA 3OYAA 4MZMA 3RERA 4PJOE 4BD3A 5HK3A 4BE1A 1U1TA 3GIBA 3HPWA 4C8QB 1VQMT 5L8RE 3OA6A 1QVGS 2OTJT 4N4GA 2EYQA 1YCYA 3DLMA 3JCMg 3JB9G 1MGQA 2BKDN 4RMOA 2LNVA 2LCCA 3S3NA 2O01E 1YIJA 3OS5A 3C12A 2A7YA 3JCMJ 4IURA 5LJ5j 2QEXA 3M59A 5LJ3g 1AHJB 2DVEA 2V8JA 1IZ6A 3M54A 3G6ET 4MMLA 2LVMA 2VGNA 5A0GA 3OYNA 2E6ZA 3HFOA 4JRIA 4XAXB 4B9XA 5HY6A 3PMTA 1Q81U 5GAN4 3OYJA 4XU0A 4M7AB 3VUZA 4X34A 4BI8B 1NPRA 4ZTJA 4A4HA 4A4FA 4BY6C 4C0DB 4C5HA 4M77B 1YJWT 1MHNA 1WGSA 5CK9A 1VQ5A 1VQ4A 4O5VA 4F7UF 5A0DA 1Q86U 1N27A 3CPWS 1M1KC 2DXBA 1VIFA 3EFRA 4C8QF 3CMAA 1LNXA 3JCMe 3QDRB 3CC4A 1WQWA 2XHCA 1QVPA 3G4ST 1QW1A 4QVCA 2IVWA 5CR2A 3DB3A 4XTVA 4LD6A 1UGSB 4M7DA 2H3JA 3L2WA 5C0MA 4UC4A 3JRZA 3L2UA 5GMKm 3QIIA 4M78A 1NPPA 3C4SA 1K73U 3UDCA 4QQDA 1BIBA 1VQ8T 2XKOC 5FRNA 1VIEA 4M7AF 4QQGA 5GANe 2MWOA 3JCMf 3NTIA 1M8VA 3CEYA 4IUUA 4PKCC 2F69A 4XTXA 1X75C 3QYHB 3QJ6A 5GAN3 4N4IA 1FWZA 5J3BA 1QP2A 5GAOn 3UPUA 3X20B 3AHUA 3SWNB 5CKBA 1OZ2A 4M75A 4QVDA 1JRIA 1WJRA 4TVRA 1VQNT 4OMFB 3MEAA 2LTOA 2P0QA 3Q1JA 4IUVA 4O6JA 3DKMA 2GFUA 5GANf 3VKIA 3J81E 4JJNK 4HKEA 5HKCA 2B8AA 2XICA 4M7DB 5LJ5g 1M5Q1 2RK1A 1VUBA 3ASKA 4M78B 4PLLA 2DJZA 4PJOF 4JS4A 4EMKC 1QP3A 1Q81C 2VUBA 5GAN7 1YI2T 4HCBA 3OMCA 3X24B 3JCMQ 4BB7A 1KHCA 3OYMA 5LJ3h 2X35A 3VV0A 1U8RA 2PUOB 2E70A 3F70A 2KVQG 4C92A 4RKUE 3L2QA 2YHTA 1VQ6T 1Q86C 4Q5WA 4E47A 4NS5A 3OYBA 1Y71A 4PJOC 4C0FA 1OYXA 2K3YA 2KK4A 3A8LB 4FM4B 3MO8A 4M75B 2E1HA 3GP8A 3BFMA 4C8QD 3RMQA 4LD9K 2CZ6B 2PUKB 4OP0A 3G4SA 2OTLT 4II1A 5LJ5e 3GOXA 3LH0A 2LX9A 1K73C 2BUDA 2V8IA 1I4K1 2EKOA 1YJ9T 1KQSS 2O4XB 2ZPFB 3WVEB 3C95A 3CCQT 2KMTA 5GAOm 5FU6B 2ZPEB 3BDUA 3UWNA 4VUBA 1BKBA 2Y4YA 3VYGA 1YJNA 2QA4T 2MMPA 1WPYA 4J8OA 1KQ1A 3RESA 4M7AD 3QZ9B 2QI2A 5CCAA 3FRNA 1VQOA 3BW1A 1D3BB 3S6WA 2LQ8A 1BI3A 4M77D 4PNOA 5DY9A 3RKYA 1ZHIA 3P8HA 3OSSC 2DEQA 5LJ5f 3VUBA 3H6ZA 4J6YA 2DAQA 3CCST 1ZQ1A 5CQXA 5GAOp 2Y4XA 2RHZA 3JCMW 1VQNA 2CZ7B 1Y7XA 5IN1A 1VQLT 3JB9H 3H8ZA 1QVFA 1Q82U 1Y96A 2I2LA 2HQEA 1G5VA 2FL7A 2QQ9A 3OBWA 3META 5GAMd 3GNFB 3S3OA 4HCCA 2L5QA 2RI5A 5FLXE 2FYKA 3JCMP 1N6AA 4OB0B 1XOVA 2KQWA 2XIDA 3E9GA 4ELYC 5LJ5h 2ZPHB 3M55A 4JLGA 3HRUA 2YRVA 3M58A 4QVZA 1XTDA 4NL2A 2D0QB 5D6XA 4CI0C 2L89A 2RHXA 3ME9A 1VQPT 4V2SA 3V8KA 2E64A 4IUQA 1VQ6A 3M4YA 3JB9J 3QJYA 3CCET 1OI1A 2LT1A 1RI0A 4MZTA 1JJ2S 3HKSA 2PQWA 5GAN2 1WNLA 1JB0E 4LDVA 5IT9E 2RB6A 5CQYA 1PSFA 4DOVA 1YITT 2OTLA 2X4YA 4MDXA 3OB9A 4C0GA 1W2BS 4L59A 2E10A 3OS2A 1Y96B 2K57A 1X01A 2GF7A 3KXTA 1KG1A 2RHIA 2DO3A 2EQUA 3RMSA 4IKFA 5GAN6 4A53A 4GY5A 2EQKA 4M78D 1YJ9A 4M7DE 3JB9F 2JUFA 4J6WA 2P4TA 4OB3B 4BI3A 5IAYA 3CCMT 4BACA 5GAOr 4M78E 3LGFA 3MEWA 1HXDA 2GCXA 2FVUA 2XDPA 3V7RA 3CCUT 4F7UG 1KHIA 3TU4K 3V8LA 3SB2A 3QO3A 1O9SA 3M57A 3O8VA 5GAMj 4FT2A 1K9MU 2P0KA 4OVAA 3HP9A 5GMKj 3DLLA 2L3RA 5LJ3e 1NJIU 4PL6A 3JCMb 4M75D 5GAN5 1KD1U 3HL8A 2PVGB 3VYHB 5CKDA 3PNWC 3L2ZA 1Q82C 5KE3A 1QVGA 4M75E 1VQLA 2EAYA 3RIRA 4C8QC 2A3LA 4OB2B 1LOJA 3MCAB 3L2RA 4FSXA 3UT1A 2XU8A 3GNGA 2XDBA 3E19A 3MEVA 3OYFA 2LT4A 4E7JA 2QQRA 3OYLA 2XK0A 4M77F 1JJ2A 1KQ2A 4M7AG 5J26A 3LW5E 4OF1A 2WSCE 3KBGA 2M1HA 5LJ3f 4EMHA 1M9SA 2ZZDA 3BDLA 2RK2A 2X4WA 3CXCS 5CVIA 3L1AA 3GF5A 2RI3A 3PTAA 1VQMA 4E7KA 2OTJA 4XU1A 2LCLA 5I2MA 4N0AA 5I21A 3V7CA 3WXMB 3CCRT 4M7AC 2KAFA 5A0LA 3A8OB 3JCMd 1XNIA 4C0DC 2MAMA 4M77C 2JOYA 4C92E 2VGMA 2R57A 3FJPA 2EJ9A 3CCEA 3X28B 3HRTA 3CPWA 2EJFA 1UB4A 3CPFA 3RKWA 3OYHA 3G6EA 1JBMA 2QQBA 5AYFA 4XTUA 1YITA 1YHQT 2ZPIB 1RL2A 3OBYA 3C94A 4PJOG 2LQKA 2X4JA 2KY9A 3P8BB 5GAOq 2RJDA 3HFNA 2HAXA 4MZPA 1W4SA 3JCMX 2JZ2A 3RKXA 2GQVA 2LC4A 3I56T 5GANd 1YJWA 3JB9D 3M5AA 3CCMA 3ZBDA 3OS1A 3OYGA 4XK8E 3G7ZA 4DA4A 3CCLT 3NTKA 2CYZB 5KCHA 3LWIA 3FC3A 3QHSA 5GAMg 3PIOA 2WSFE 1K9MC 3OMGA 2E65A 2VV5A 4BI4A 3N5BB 1M1GA 1V29B 4M7DF 1NJIC 2DD5A 4E7LA 1KD1C 5FU7B 2FHDA 4M78F 1VQ9T 2EIFA 2XDDA 4XTZA 3SWNC 2BIVA 3VJPA 3TCJA 4R56A 1VQ8A 5CO7A 1N8RU 3ZEHA 3V7SA 2YLBA 2WACA 3CBMA 2D6FA 5C6SA 3J7AF 3OYKA 3PFSA 4JUVA 3FDRA 4C5GA 4MMKA 4M7DC 3OYDA 1DJ7B 2HBPA 4C92B 5CIUA 4HT9A 4R55A 4M78C 5EG2A 4KBMB 1X6OA 3OYCA 2XD0A 3R6OA 4M75F 4DOWA 3LYIA 4QW2A 3X25B 1WJSA 5A2QE 2K5IA 3JSCA 1UGPB 3CCRA 5GMKe 2DZ9A 5GANj 5KE2A 1IREB 3QZ5B 1VQ4T 3SD4A 3MP8A 4F7UA 2CKKA 3NTHA 4ME7A 2EJGA 4L6V5 3EAEA 4A4GA 4EMGA 4IUPA 4M75C 2DIQA 4C8QA 2R58A 2DKGA 1U1SA 4KT0E 4XU3A 1YI2A 1YHQA 3CMAT 1K8AC 2RJFA 3QSUA 2F5KA 2OAUA 2RH2A 1GXIE 2GFAA 2F5TX 4BY6B 1R8OB 1VQKT 3M4GA 1KC8U 4C92F 3I56A 3M56A 2HQXA 5DLQE 5D6YA 1KQSA 4LDXA 4Z02A 3FLGA 3CMET 3CCLA 3MP1A 2DIGA 4RCCA 5FU6C 2JNGA 4C5EA 5M9OA 1M1FA 5DLOA 4M7AA 1N9RA 2RM4A 2R5MA 5J39A 3GPLA 4BE2A 2IG0A 4JLIA 2PVOB 2C06A 5CKHA 4A4EA 4P5NA 4M77A 2G3RA 3PGGA 4PLIA 3X26B 4E7HA 2MF2A 4M7DD 4IUTA 2DPPB 1BI1A 2QXFA 4XQ3A 3CBOA 3QUIA 1VQ9A 2DTHA 4J7FA 3WVDB 5GAMh 3T9NA 4EMKA 1N8RC 4FIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HA8 A;  5GMK h;  4C92 A;  3JCM X;  2YHT A;  4M7A E;  4N0A C;  5LJ3 f;  4EMH A;  5GAM f;  2YLC A;  4PJO C;  2DXT A;  2HNI A;  2CGH A;  4M77 E;  3L1A A;  4J5Y A;  2VC8 A;  1B34 A;  2E1H A;  2VXE A;  4M75 B;  3BFM A;  2VXF A;  4WF2 A;  4X9D A;  4XU1 A;  3RUX A;  4C8Q D;  4N0A A;  2QTX A;  2JN0 A;  3V7C A;  4OP0 A;  4C8Q G;  5I21 A;  4M7A C;  4C92 G;  4PJO A;  5GMK i;  3JCM d;  5LJ5 e;  4M77 C;  4C92 E;  3FJP A;  2EJ9 A;  3EFS A;  1I4K 1;  2EJF A;  3RKW A;  3JCM c;  4EMK B;  5GAN g;  1JBM A;  4J6X A;  4XTU A;  4PJO D;  2Y90 A;  5GAO m;  4PJO G;  4C92 C;  3JCM V;  3BDU A;  5GAO q;  3HFN A;  4F7U B;  4HT8 A;  4PJO E;  3RER A;  1WPY A;  1LJO A;  1KQ1 A;  3RES A;  3SWN A;  4NOY A;  1U1T A;  2FB7 A;  2E41 A;  1WQ7 A;  2RA2 A;  4XU2 A;  3BW1 A;  3RKX A;  1D3B B;  4C8Q B;  5GAN d;  3JB9 D;  4M77 D;  5LJ5 f;  1YCY A;  2DZC A;  4PNO A;  5DY9 A;  4M77 G;  3RKY A;  2DEQ A;  1MGQ A;  3JCM g;  3JB9 G;  3GIB A;  4J6Y A;  3FIF A;  5CAI A;  5GAO p;  3JCM J;  1B34 B;  5LJ5 j;  1I81 A;  5LJ3 g;  3JCM W;  2DVE A;  3QHS A;  5GAM g;  4C92 D;  4XTW A;  2E65 A;  4MML A;  5GMK l;  4JRK A;  3JB9 H;  4PJO B;  3HFO A;  4M7D F;  4JRI A;  1Y96 A;  2I2L A;  5GAN 4;  4M78 F;  3HSB A;  1BIA A;  4XU0 A;  4M7A B;  4XTZ A;  3SWN C;  5LJ3 d;  5GAM d;  2DTO A;  3INZ A;  4M77 B;  2FYK A;  3JCM P;  3V7S A;  1TH7 A;  2YLB A;  4F7U F;  2DTI A;  5LJ5 h;  4M7A D;  4XTY A;  4JUV A;  3EFR A;  4C8Q F;  4MMK A;  4M7D C;  1LNX A;  4NL2 A;  4C92 B;  3BY7 A;  1WQW A;  3V8J A;  3JCM e;  3JB9 I;  4HT9 A;  4M78 C;  2E64 A;  3V8K A;  4QVC A;  4XTV A;  3JB9 J;  4M75 F;  4NL3 A;  4M7D A;  5GAN 8;  4Y91 A;  5GAN 2;  1WNL A;  5GMK m;  4M78 A;  2RD1 A;  2RB6 A;  2ZGW A;  5GMK e;  2DZ9 A;  5GAN j;  3JCM h;  1BIB A;  2E10 A;  1I5L A;  1Y96 B;  2K57 A;  1X01 A;  4V2S A;  4M7A F;  2DXU A;  5GAN e;  4F7U A;  3JCM f;  5GAN 6;  4M7D G;  4A53 A;  1M8V A;  4M78 D;  2EJG A;  4XTX A;  4M78 G;  4EMG A;  3JB9 F;  4M7D E;  4J6W A;  4M75 C;  4C8Q A;  1D3B A;  2DKG A;  1H64 1;  1U1S A;  4XU3 A;  4M78 E;  5GAN 3;  5GAO r;  1HXD A;  5GAO n;  3QSU A;  3AHU A;  3SWN B;  3V7R A;  4A54 A;  4F7U G;  4M75 A;  3M4G A;  3V8L A;  3SB2 A;  1HK9 A;  3QO3 A;  4C92 F;  1JRI A;  4QVD A;  5LJ3 j;  4F7U E;  3FB9 A;  5GAM j;  2EWN A;  3VU3 C;  4C8Q E;  1N9S A;  5GMK j;  5GAN f;  4RCC A;  5LJ3 e;  5LJ5 g;  4M7D B;  5GAM e;  1M5Q 1;  4M75 D;  3JCM b;  5GAN 5;  4M75 G;  4M78 B;  4M7A A;  1N9R A;  2DJZ A;  2RM4 A;  4PJO F;  3L2Z A;  4JLI A;  4RCB A;  4EMK C;  4M75 E;  5GAN h;  2EAY A;  3RIR A;  4C8Q C;  4M77 A;  5GAN 7;  3PGG A;  5GAO l;  1LOJ A;  4M7D D;  3JCM Q;  4XQ3 A;  3QUI A;  5LJ5 d;  1I8F A;  2DTH A;  5LJ3 h;  4DQ2 A;  5GAM h;  4X9C A;  4EMK A;  1KQ2 A;  4M77 F;  4M7A G; 
#chains in the Genus database with same CATH topology
 2RI2 A;  5GJW B;  2PVD B;  2P0P A;  3TEE A;  3CCJ T;  2DXT A;  2CGH A;  2DE0 X;  3LLR A;  5I2S A;  4C8Q G;  2YSQ A;  5KCO A;  2FZG B;  1N5Z A;  3CCS A;  1Q7Y U;  1IGU A;  2RHU A;  1UGQ B;  3EFS A;  1P92 A;  4EDU A;  1AVZ C;  4AG1 C;  2K3X A;  1YCS B;  1TOV A;  2DK3 A;  2H8H A;  5CKF A;  4EPC A;  4HCZ A;  1RLP C;  3CCV T;  1WI7 A;  4JDS A;  2RA2 A;  1ZBX A;  4JJC A;  4XU2 A;  3HHT B;  1W6X A;  4ZGD B;  3A8H B;  5CAI A;  2XI9 A;  1KC8 C;  2ECZ A;  2MIO A;  3I55 Q;  4F14 A;  1WLP B;  4Y92 A;  4JRQ A;  4PJO B;  1IB8 A;  5I11 A;  2VVK A;  1X2Q A;  3EG9 B;  1YJN T;  4LNP A;  1XQH A;  5LJ3 d;  1M90 U;  3INZ A;  2KRO A;  1JXM A;  2MWP A;  1PD1 A;  2JTF A;  1WXB A;  3CD6 T;  2JTE A;  7AT1 B;  1YN8 A;  2AKK A;  1QLY A;  1VQP T;  3SDZ A;  1PSE A;  2MCN A;  1WIE A;  1UUE A;  1Q7Y C;  2CSQ A;  1QKW A;  3CC2 T;  2XG8 D;  4OB1 B;  4M7D G;  3KUF A;  3O5Z A;  1H64 1;  1QVF S;  1D1A A;  4KUD K;  3EGD B;  1OQK A;  3M0S A;  4RTY A;  1EZZ B;  3EGX A;  1G8X A;  5LJ3 j;  3I55 A;  4JRP A;  3FB9 A;  3E9F A;  2EWN A;  4C8Q E;  2NUZ A;  1G3S A;  2QEX Q;  4Z88 A;  5GAO l;  4D6W A;  2DVJ A;  2NUP A;  2DL5 A;  1I8F A;  1M90 C;  2LMJ A;  4X9C A;  1Y07 A;  5KYY B;  3CC4 T;  1M1K U;  1QCF A;  4PFP A;  5GAM f;  2VB6 A;  3M0R A;  2KSS A;  5FU7 C;  4KGV B;  3RUX A;  4A63 B;  3J80 E;  3H0H A;  4C92 G;  2MI6 A;  2R5A A;  3AT1 B;  4GLM A;  2DFU A;  4PJO D;  1HYO A;  2M0O A;  3TSZ A;  4LDY A;  4F7U B;  1FMK A;  4LDU A;  3OYA A;  4BD3 A;  3GIB A;  2F2X A;  3HPW A;  2OTJ T;  2QYZ A;  1WXU A;  2LNV A;  2LCC A;  2O01 E;  3OS5 A;  3C12 A;  2QEX A;  2EQI A;  4AT1 B;  1QWF A;  1IZ6 A;  2M0Y A;  5HY6 A;  2OAW A;  1PKS A;  4C5H A;  1TS9 A;  1YJW T;  2KGT A;  1Q86 U;  3CPW S;  1M1K C;  2DXB A;  4C8Q F;  3QDR B;  4RTX A;  2XHC A;  3G4S T;  4WCI A;  1QW1 A;  3E2U A;  4QVC A;  2IVW A;  1G83 A;  3DB3 A;  1I07 A;  1UGS B;  3L2W A;  5C0M A;  3JRZ A;  1K73 U;  2DF6 A;  1VQ8 T;  1TU0 B;  1VIE A;  2DRM A;  3JCM f;  3CEY A;  4IUU A;  4PKC C;  2F69 A;  4XTX A;  3QJ6 A;  1MNE A;  1FWZ A;  1T3L A;  3UPU A;  3SWN B;  2AKL A;  4RTV A;  4LN2 A;  1VQN T;  4OMF B;  4IUV A;  1NBE B;  5EC7 A;  2XIC A;  1M5Q 1;  1VUB A;  4M78 B;  2DJZ A;  5GAN 7;  3A98 A;  3OMC A;  2LP5 A;  1UHF A;  2X35 A;  3L2Q A;  2YHT A;  1Q86 C;  1VOM A;  4E47 A;  3OYB A;  1Y71 A;  2AZV A;  5KYX B;  1BCM A;  4C0F A;  2K3Y A;  2KK4 A;  3A8L B;  3GBQ A;  4FM4 B;  4E6R A;  4M75 B;  4LD9 K;  5ECA A;  3GOX A;  3FJ5 A;  1K73 C;  2EKO A;  1YJ9 T;  2QK0 A;  1BU1 A;  1VYU A;  5FU6 B;  3BDU A;  3UWN A;  4VUB A;  4J9B A;  3VS2 A;  2DMO A;  3BW1 A;  1BI3 A;  5LJ5 f;  2K6D A;  3RKY A;  3CCQ Q;  1K9M R;  3OSS C;  4OMQ A;  3CCS T;  5GAO p;  2J6F A;  1UJY A;  4E7Z A;  3H0F A;  2RHZ A;  3JCM W;  4KRT A;  3RBB B;  2XMF A;  2HCK A;  1QVF A;  1AD5 A;  2I2L A;  2BE7 D;  3NGP A;  3MET A;  3S3O A;  2FYK A;  4ELY C;  2KQW A;  2XID A;  2DIL A;  1MV3 A;  3HRU A;  4QVZ A;  1UDL A;  3M58 A;  1XTD A;  2RHX A;  2X9H A;  4OMN A;  3QWY A;  3M4Y A;  2HKQ B;  3JB9 J;  3EH1 A;  4MZT A;  2LT1 A;  2RMO A;  2DBK A;  5GAN 2;  1WNL A;  4LDV A;  5IT9 E;  4DOV A;  4C0G A;  5KYU B;  1Y96 B;  1X01 A;  2GF7 A;  3KXT A;  3CCE Q;  2NUT A;  4M78 D;  1XJW B;  2JW4 A;  4BAC A;  2YUN A;  5IAY A;  3MEW A;  2CUD A;  1U5S A;  2GCX A;  2XDP A;  1OX9 A;  3TU4 K;  2B86 A;  3O8V A;  3CCM Q;  3NHN A;  5GMK j;  3DLL A;  1WX6 A;  2E3I A;  4M75 D;  3HL8 A;  2CP6 A;  3VYH B;  3PNW C;  1MMN A;  3L2Z A;  1M3A A;  2EW3 A;  2D0N A;  2EAY A;  2A3L A;  1PRM C;  4OB2 B;  2XU8 A;  3SHW A;  1OX8 A;  4M77 F;  3KBG A;  2M1H A;  5LJ3 f;  1RAG B;  2L3Q A;  1M9S A;  2YRC A;  5IXF A;  5CVI A;  2KRS A;  1KFZ A;  1VQM A;  1SSH A;  4M7A C;  1VA7 A;  2KXC A;  2KAF A;  2HDA A;  3VRZ A;  1E6H A;  4C0D C;  4M77 C;  2JOY A;  2RPN A;  2VGM A;  2R57 A;  3CCE A;  2YDL A;  1UGV A;  3X28 B;  3HRT A;  3CPW A;  4E7S A;  3CPF A;  1JBM A;  4XTU A;  2KNB B;  1RL2 A;  4PJO G;  3C94 A;  3CPW P;  2LQK A;  3P8B B;  5GAO q;  2HAX A;  4MZP A;  1ZLM A;  2O88 A;  3JB9 D;  2VKN A;  3CCM A;  3ZBD A;  3OS1 A;  4PJN A;  3OYG A;  4XK8 E;  5KYW B;  1BCO A;  1MMD A;  5GAM g;  3I56 Q;  1ARK A;  3CCL Q;  2FHD A;  3RR6 A;  2COY A;  2XDD A;  4XTZ A;  1M2V B;  4JPB W;  3TCJ A;  4R56 A;  1N8R U;  2YLB A;  5GJV B;  1R77 A;  1YFN A;  1KJW A;  4C5G A;  4C92 B;  5CIU A;  1IRX A;  4R55 A;  2OI3 A;  4KBM B;  1X6O A;  4DOW A;  4QW2 A;  1CKB A;  2YWW A;  1R0C B;  1WA7 A;  2QGF B;  2V26 A;  2DLP A;  4L6V 5;  4EMG A;  4C8Q A;  4KT0 E;  1YI2 A;  3BE3 A;  1PCX A;  1K8A C;  3QSU A;  1SHG A;  1VQK T;  3I56 A;  3CMA Q;  4LDX A;  4CC4 B;  3CME T;  3CCL A;  4RCC A;  1PC0 A;  1OU8 A;  2JNG A;  4C5E A;  4PJL A;  2CP5 A;  2BZY A;  2M02 A;  5CKH A;  4M7D D;  2DPP B;  1BI1 A;  3CBO A;  3QUI A;  2DTH A;  5GAM h;  1N8R C;  2YLC A;  3H9N A;  1PD0 A;  1B34 A;  1U3O A;  2FG0 A;  1X2K A;  3PVQ A;  1X69 A;  4RTW A;  4GLK A;  1BB9 A;  1WHM A;  2DL7 A;  4N4H A;  2V8K A;  4E7I A;  1G3T A;  1FXX A;  3MP6 A;  1VQ7 T;  3VS3 A;  3UA6 A;  2VYT A;  1AWJ A;  1BI2 A;  4RTZ A;  1NM7 A;  3JCM V;  4RTU A;  3SEM A;  2JS0 A;  2LNH B;  4HT8 A;  2DYI A;  2D1X A;  2E41 A;  2QDY B;  3FIF A;  8ATC B;  1I81 A;  2CP0 A;  5CKE A;  4C92 D;  4XTW A;  5GMK l;  2EQM A;  4ATO A;  1EIF A;  2BZ8 A;  2O31 A;  4OMO A;  1BIA A;  3A8G B;  2DTO A;  3G71 Q;  2ATC B;  5IHN A;  2DTI A;  3EG1 A;  2JTM A;  1I1J A;  1ZUK A;  2D9T A;  1JO8 A;  2C0O A;  1VQO Q;  3BY7 A;  2DD4 A;  3M53 A;  1AWX A;  1Q82 R;  3CCU A;  4ZTF A;  2LQN A;  4BDZ A;  1AWO A;  1S72 Q;  5DM7 R;  4KGX B;  2X4X A;  3JCM h;  4RG8 A;  1Z9Z A;  2E6N A;  3CC7 Q;  4LUD A;  4K11 A;  1UGR B;  2DXU A;  3P8D A;  3ZFJ A;  3E1S A;  4Y28 E;  5IH2 A;  4M78 G;  4WTO B;  2AT1 B;  1QMC A;  3SFM A;  3NFC A;  3OY9 A;  2RNA A;  1IHV A;  4A4K A;  1YIJ T;  2CUB A;  3EG2 A;  4F7U E;  6AT1 B;  1X6B A;  3VU3 C;  1N9S A;  2BTT A;  3QG1 A;  3QXE B;  4KUL A;  3LGL A;  2NYS A;  4BDY A;  3MEU A;  4M75 G;  2X51 A;  4RCB A;  4OGC A;  3G71 A;  1RI9 A;  4HCK A;  4J83 A;  1BI0 A;  2A08 A;  4DBH A;  5LJ5 d;  3EHQ A;  2DXC A;  3OSV A;  3LWH A;  1YP5 A;  1ZSZ B;  1VYV A;  1VQ5 Q;  4N0A C;  3C0C A;  1MMG A;  3OYI A;  1S72 A;  2VXE A;  3DB4 A;  1HD3 A;  3EGX B;  2RO0 A;  5FRO A;  2M16 A;  4FT4 A;  2JS2 A;  3OYY A;  3CC7 A;  4ZGJ B;  4LDW A;  2ZPB B;  3M9Q A;  3GLX A;  2JVV A;  2AHJ B;  2A0F B;  2LRQ A;  3RER A;  1YNZ A;  3EGU A;  1VQM T;  3OA6 A;  3DLM A;  3JB9 G;  2H3E B;  1MGQ A;  2DBM A;  2DA9 A;  2PNI A;  1R0B G;  3JCM J;  5LJ5 j;  3M59 A;  5LJ3 g;  1AHJ B;  2KYM A;  4MML A;  4CC7 A;  1GBR A;  1IXD A;  2KEA A;  5A0G A;  2E6Z A;  4JRI A;  1SF9 A;  4B9X A;  5GAN 4;  4XU0 A;  1Y57 A;  3VUZ A;  1NPR A;  1EFN A;  4A4H A;  4A4F A;  4BY6 C;  3G6E Q;  1VQ5 A;  1MHN A;  1WGS A;  1RAI B;  1VQ4 A;  4O5V A;  4F7U F;  1T0J A;  3VS1 A;  2DEU A;  1VIF A;  2LJ0 A;  3LH5 A;  1LNX A;  2L3P A;  1B7T A;  1WQW A;  1QVP A;  3L2U A;  2DJQ A;  1NPP A;  3C4S A;  2P4R A;  2GGR A;  1BIB A;  2OJ2 A;  2EGC A;  2XKO C;  5GAN e;  2MWO A;  3NTI A;  1QVG P;  1X75 C;  3QYH B;  3VS6 A;  4N4I A;  1QP2 A;  3QDF A;  5GAO n;  4QVD A;  1JQQ A;  2X3W D;  2JMA A;  2GFU A;  3VRY A;  4JJN K;  5HKC A;  1ZA1 B;  4EMK C;  3M0U A;  2VUB A;  1YI2 T;  4HCB A;  3JCM Q;  1KHC A;  1SKU B;  5LJ3 h;  1KC8 R;  1OU9 A;  2KVQ G;  1OPL A;  1WHJ A;  1A0N B;  2E1H A;  3GP8 A;  3BFM A;  2EKH A;  3RMQ A;  2RQV A;  1LVK A;  4OP0 A;  1VQ6 Q;  1M27 C;  2YT6 A;  3EHR A;  1ZBJ A;  3I5S A;  2V8I A;  3I9Q A;  2O4X B;  2OTL Q;  3WVE B;  3C95 A;  2KMT A;  5GAO m;  1TUC A;  2ZPE B;  1B07 A;  2Y4Y A;  3VYG A;  1WPY A;  1KQ1 A;  2QI2 A;  3FRN A;  4JJD A;  1D3B B;  4PNO A;  1Q7Y R;  3VUB A;  2CH4 W;  4D8K A;  2QA4 Q;  3TQ7 P;  4PK4 A;  1Y7X A;  5IN1 A;  1VQL T;  3JB9 H;  3H8Z A;  1WZO A;  4HVV A;  3MJX A;  1YWO A;  2C0I A;  3OBW A;  2LX7 A;  2RI5 A;  3JCM P;  1XOV A;  3M55 A;  2FRY A;  3G1J A;  1VQ6 A;  4IUQ A;  1E6G A;  1OI1 A;  1X6G A;  1KQS P;  2GTJ A;  1M90 R;  4PFZ A;  2OTL A;  1PSF A;  1W1F A;  1D0Y A;  1W2B S;  2E10 A;  3OS2 A;  2K57 A;  2COZ A;  1KG1 A;  2BZX A;  2DO3 A;  2EQU A;  2HQH A;  3RMS A;  5GAN 6;  4M7D E;  3JB9 F;  1YIT Q;  4OB3 B;  5GAO r;  3LGF A;  4AMC A;  3CCU T;  1ZSG A;  3M57 A;  1PHT A;  1K9M U;  3HP9 A;  3EH2 A;  2L3R A;  3EG9 A;  1NJI U;  4PL6 A;  4Z8A A;  3JCM b;  2HL3 A;  1KD1 U;  4RTT A;  2PVG B;  4OML A;  3RIR A;  4C8Q C;  1LOJ A;  2GTO A;  3A1P A;  3UT1 A;  2XDB A;  2P84 A;  3REA B;  3OYL A;  1JJ2 A;  4M7A G;  3LW5 E;  4OF1 A;  2WSC E;  1KIK A;  3EFO A;  4J9D A;  1JJ2 P;  4OMM A;  2JMC A;  5I2M A;  4N0A A;  1K1Z A;  4C92 E;  3FJP A;  2EJ9 A;  1HJD A;  4JJB A;  4QKU A;  1MV0 B;  1UB4 A;  3CCR Q;  2QQB A;  1YIT A;  2MK5 A;  2X4J A;  2ENM A;  2RJD A;  3EGD A;  3HFN A;  1W4S A;  4J9I A;  2YUP A;  3JCM X;  1GL5 A;  2GQV A;  5GAN d;  3M5A A;  1YHQ Q;  2KRM A;  1AZG B;  4RUG A;  3G7Z A;  5KCH A;  1SEM A;  3FC3 A;  1K9M C;  3OMG A;  2HMA A;  2VV5 A;  3UF4 A;  3N5B B;  1M1G A;  4M7D F;  1NJI C;  4E7L A;  1KD1 C;  5FU7 B;  4ESR A;  1VQ9 T;  2EIF A;  2BIV A;  4FYX B;  5KYY A;  3ZEH A;  3CXC P;  1M8M A;  4F17 A;  4ORZ A;  3J7A F;  4JUV A;  4M7D C;  4J9H A;  1DJ7 B;  2F2V A;  4HT9 A;  1FMW A;  5EG2 A;  2DM1 A;  3LYI A;  1WJS A;  1D0X A;  3JSC A;  3CCR A;  5GAN j;  1WHK A;  1PKT A;  1Q86 R;  1VQ4 T;  1B3Q A;  3MP8 A;  4F7U A;  3NTH A;  4ME7 A;  1ABQ A;  4A4G A;  5L23 A;  4PJJ A;  1YHQ A;  1AEY A;  1GCQ C;  2HSP A;  1K76 A;  1BK2 A;  1TG0 A;  4C92 F;  3M56 A;  4AG2 C;  2JM9 A;  3KFV A;  5IXB A;  4AFQ C;  1M1F A;  2ESW A;  4KH0 B;  2G3R A;  4J7F A;  3WVD B;  4EMK A;  4HA8 A;  3CCQ A;  2VAS A;  2CZ0 B;  5GMK h;  3JV3 A;  3QPH A;  3QYG B;  5HK0 A;  2HNI A;  2RHY A;  2VC8 A;  2VXF A;  3ER0 A;  1SSF A;  2QTX A;  3OS0 A;  4AFZ C;  4BE0 A;  2ZPG B;  4RG2 A;  4GBQ A;  2DX1 A;  3CCJ Q;  4EIK A;  2PU9 B;  1ACM B;  4J6X A;  1NZ9 A;  2FRW A;  1YBY A;  1D0Z A;  4JS5 A;  1M3C A;  4CC3 A;  1RAH B;  2KYB A;  3SWN A;  1T0H A;  4NOY A;  2VWF A;  3I55 T;  2DZC A;  4LUE A;  1W2B A;  1NLO C;  2GBQ A;  1M4Z A;  3CCV Q;  1B34 B;  1W2B P;  1JEG A;  1AOJ A;  3A5Z B;  1AZE A;  3EG3 A;  4E2F B;  4QQ6 A;  1K8A U;  1WJQ A;  1YJN Q;  2WSE E;  2DL8 A;  3URG A;  4DBR A;  3V8J A;  2L0A A;  4C5I A;  3CCJ A;  1Y0M A;  4C0Z A;  3TRE A;  3CD6 Q;  2RN8 A;  2RD1 A;  2ZGW A;  2CP2 A;  1TTH B;  3QKJ A;  2CZ1 B;  1I5L A;  2G6F X;  2K2M A;  1VQP Q;  3HTR A;  4CRI A;  3CC2 Q;  1M30 A;  1ZUY A;  4ANJ A;  3OYE A;  2E12 A;  1NYF A;  2FZC B;  3CCV A;  1HSQ A;  2QEX T;  2NLU A;  2LDM A;  1H3Z A;  1MUZ A;  3FEO A;  2EFI A;  2QQS A;  1WHG A;  3LX7 A;  4KUI A;  4X1V A;  5AT1 B;  1PNJ A;  2AK5 A;  5D6W A;  1QCO A;  1G3W A;  4AFS C;  3OW2 A;  3EG0 A;  2J6K A;  3OW2 P;  2V1Q A;  1G3Y A;  4BUG A;  3A8M B;  1SG5 A;  3CD6 A;  3CC4 Q;  2JN0 A;  1IO6 A;  5GMK i;  2K79 A;  5KYU A;  2CS7 A;  1VQP A;  2RJC A;  4J7I A;  2K4Y A;  4LXC A;  3CC2 A;  2A36 A;  4PJO E;  4J9G A;  4BE1 A;  1U1T A;  2FPE A;  1M2O A;  1QVG S;  4N4G A;  3JCM g;  4RMO A;  2SEM A;  3S3N A;  4IUR A;  1NEB A;  2FEI A;  2DVE A;  2OTJ Q;  1W70 A;  2LVM A;  4XAX B;  4QT7 A;  1Q81 U;  3OYJ A;  4M7A B;  4X34 A;  1AWW A;  4ZTJ A;  4C0D B;  4M77 B;  3CQT A;  5A0D A;  1K0S A;  3EFR A;  3CMA A;  3CC4 A;  1UE9 A;  2ED1 A;  1YJW Q;  2EYZ A;  2X3X D;  4LD6 A;  4M7D A;  4UC4 A;  5GMK m;  3QII A;  1N8R R;  3G4S Q;  4ZNX A;  2ZAE A;  3TVT A;  5FRN A;  4QQG A;  1GCP A;  2DNU A;  5GAN 3;  2IPO B;  2CP3 A;  3X20 B;  3AHU A;  1OZ2 A;  1WJR A;  1GCQ A;  3UA7 A;  3MEA A;  2P0Q A;  1RAA B;  3Q1J A;  3DKM A;  4CC2 A;  5GAN f;  4HKE A;  5LJ5 g;  1V1C A;  2IIM A;  2RK1 A;  4PLL A;  2L2P A;  4PJO F;  2FPF A;  1VQN Q;  1M2V A;  1Q81 C;  3X24 B;  3OYM A;  3VV0 A;  1U8R A;  2E70 A;  3F70 A;  4C92 A;  4RKU E;  2DL4 A;  1RAC B;  4NS5 A;  4PJO C;  2K3B A;  2RQT A;  3MO8 A;  1SRL A;  2CZ6 B;  3NPF A;  3G4S A;  4II1 A;  3LH0 A;  2BUD A;  2EPD A;  3H41 A;  1I4K 1;  1PWT A;  1KQS S;  3IQL A;  1RLQ C;  3CCQ T;  1BKB A;  1QWE A;  2MMP A;  4M7A D;  3RES A;  3QZ9 B;  5CCA A;  1VQO A;  1YJ9 Q;  1CKA A;  2LQ8 A;  4M77 D;  5DY9 A;  3P8H A;  2D8H A;  4J6Y A;  2ROL A;  1ZQ1 A;  5CQX A;  1D09 B;  4F04 B;  2MYS A;  1VQN A;  2EYX A;  2CH4 A;  4KGZ B;  3CCS Q;  1G5V A;  2FL7 A;  2QQ9 A;  3GNF B;  5FLX E;  1N6A A;  4OB0 B;  1X43 A;  3E9G A;  2NUP B;  2DRK A;  5LJ5 h;  2YRV A;  2D0Q B;  3MKD A;  3ME9 A;  2PZ1 A;  2MPX C;  1RAE B;  4R0K A;  2O9V A;  2CDT A;  3CCE T;  1RI0 A;  1WHH A;  1JJ2 S;  2PQW A;  1JB0 E;  2RB6 A;  5CQY A;  4MDX A;  2X4Y A;  4L59 A;  4IKF A;  4A53 A;  4GY5 A;  1Q95 G;  2EQK A;  1YJ9 A;  2YUO A;  4J9C A;  1WDX A;  1KK7 A;  4J6W A;  2P4T A;  4BI3 A;  2F1L A;  3CCM T;  4M78 E;  1HXD A;  1X27 A;  2FVU A;  3V8L A;  3QO3 A;  4JZ3 A;  1O9S A;  1TWB A;  5CKD A;  3NMZ C;  5KE3 A;  4M75 E;  1QVG A;  4PFO A;  2J7I A;  3MCA B;  4FSX A;  1QKX A;  4E7J A;  5D7U A;  5J26 A;  4EMH A;  4J9F A;  2ZZD A;  2RK2 A;  3CXC S;  2HKN A;  3GF5 A;  4E7K A;  1J3T A;  2LCL A;  2QGG A;  5I21 A;  3WXM B;  2DET A;  2CSI A;  1H8K A;  2KXD A;  3A8O B;  2QAS A;  1IHW A;  2EBP A;  2KI7 A;  1RAF B;  2F2W A;  2EJF A;  3RKW A;  3OYH A;  3G6E A;  3OBY A;  1AT1 B;  2KY9 A;  2W0Z A;  2JZ2 A;  3RKX A;  3I56 T;  3EFO B;  4DA4 A;  3PE0 A;  3NTK A;  3CCL T;  3QHS A;  2EGE A;  2E65 A;  3M0P A;  4BI4 A;  1V29 B;  2DD5 A;  3I5R A;  4M78 F;  1TXQ A;  1UEC A;  3SWN C;  3VJP A;  3V7S A;  1ZSZ A;  2WAC A;  4D8D A;  3CBM A;  2D6F A;  3PFS A;  2QG9 B;  3FDR A;  4MMK A;  3OYD A;  2HBP A;  4FSS A;  2KT1 A;  4M78 C;  2W10 A;  2XD0 A;  4M75 F;  1UGP B;  1C0M A;  2JJ9 A;  2O9S A;  4OMP A;  2DZ9 A;  5GMK e;  4AFU C;  1IRE B;  3QZ5 B;  1H3H A;  2CKK A;  3EAE A;  5FWC A;  1OUL A;  4M75 C;  3CMA T;  2DKG A;  1U1S A;  4XU3 A;  2RJF A;  2F5K A;  3UAT A;  2RH2 A;  2GFA A;  4BY6 B;  1R8O B;  3M4G A;  1GBQ A;  5DLQ E;  1KQS A;  2HL5 C;  4J9E A;  3FLG A;  1WHL A;  1OV3 A;  4FW1 A;  5FU6 C;  1LPL A;  3REB B;  1VQK Q;  2RM4 A;  3GPL A;  4JLI A;  2JXB A;  2YRD A;  3CME Q;  4E7H A;  4PLI A;  1UTI A;  3PGG A;  2E4H A;  3X26 B;  2MF2 A;  5I22 A;  4IUT A;  2GQI A;  2QXF A;  4XQ3 A;  2GNC A;  4PJM A;  4FIB A;  5KYN A;  4M4Z A;  3R6N A;  2QA4 A;  4FL6 A;  4WF2 A;  1OPK A;  1SRM A;  5IHI A;  4PJO A;  4B6M A;  2HSE B;  2K7A A;  5GAN g;  2EQJ A;  1C1A A;  1PG5 B;  4OGE A;  1F1B B;  2NUT B;  3MPU B;  1VQ7 Q;  1LJO A;  1WYX A;  2JT4 A;  1WXT A;  2FB7 A;  4EMK B;  1WQ7 A;  3OQ5 A;  4M77 G;  2Z0W A;  2KDS A;  2EVR A;  3JAM E;  1VQK A;  2EYY A;  1OEB A;  1KSW A;  4JRK A;  3CBP A;  1ZUU A;  3G71 T;  3CME A;  9ATC B;  2K2V A;  4IIM A;  4ZN1 A;  3HSB A;  1M1K R;  1OZ3 A;  4DEX A;  2L8D A;  1VQO T;  2M9U A;  5FRM A;  5HCK A;  3RNJ A;  4ELZ C;  1TH7 A;  3PT9 A;  4XTY A;  5FW9 A;  1RUW A;  1S72 T;  2RJE A;  1MMA A;  3JB9 I;  5KH6 A;  2ZCF B;  4L5G A;  3CC7 T;  2QQA A;  4NL3 A;  3L2V A;  5GAN 8;  2OX7 A;  4Y91 A;  3OW2 S;  3PIP A;  2LQW A;  3L42 A;  4B9W A;  2SRC A;  1IGQ A;  2O4X A;  4JZ4 A;  2A37 A;  2CRE A;  3CXC A;  1O75 A;  5LL6 S;  1VQ7 A;  1I5O B;  4FCY A;  1NE8 A;  4ZGE B;  1VYT A;  1D3B A;  1JXO A;  1YWP A;  2COW A;  2YUQ A;  2ED0 A;  3HRS A;  2HD0 A;  4FU6 A;  4A54 A;  5GAN h;  1HK9 A;  2KR3 A;  2C0T A;  1NYG A;  4ZN3 A;  2RQW A;  1YIJ Q;  1BYM A;  1SPK A;  5GAM e;  2E5Q A;  1G2B A;  2K5F A;  1VQ5 T;  3M0Q A;  3QBY A;  4DQ2 A;  1GFC A;  1TSF A;  1UEB A;  2I0N A;  4M7A E;  1C6V X;  1FX7 A;  1NJI R;  4M77 E;  1K73 R;  4J5Y A;  1KD1 R;  4X9D A;  4YTL A;  3PMI A;  3S3M A;  2HEQ A;  4HXJ A;  2FZK B;  1K0X A;  3MHX A;  3JCM c;  1QVF P;  4MDW A;  2Y90 A;  4C92 C;  2JM8 A;  2DER A;  2K5L A;  4MZM A;  5HK3 A;  1H92 A;  4C8Q B;  5L8R E;  1QCN A;  2EYQ A;  1YCY A;  2YXY A;  4LE9 A;  2BKD N;  1YIJ A;  1LCK A;  2A7Y A;  2V8J A;  1VQM Q;  3M54 A;  3G6E T;  2CT3 A;  2VGN A;  3OYN A;  3HFO A;  3PMT A;  2KE9 A;  4BI8 B;  5CK9 A;  2QDL A;  3U23 A;  1N27 A;  2ABL A;  3JCM e;  4F16 A;  2QTV A;  5CR2 A;  4XTV A;  2H3J A;  4M78 A;  3UDC A;  2E5K A;  4QQD A;  1OOT A;  4M7A F;  1M8V A;  2D8J A;  2RQU A;  1UJ0 A;  5J3B A;  5KYX A;  5CKB A;  4M75 A;  1WFW A;  2ROT A;  1JRI A;  4TVR A;  4FYY B;  2LTO A;  4O6J A;  3VKI A;  3J81 E;  2B8A A;  4M7D B;  3ASK A;  4JS4 A;  1QP3 A;  4BB7 A;  2A28 A;  1NLP C;  1I0C A;  2AIR B;  2PUO B;  2CP7 A;  1GRI A;  1V76 A;  1VQ6 T;  2HZY A;  4Q5W A;  1YI2 Q;  2NWM A;  1OYX A;  2J06 A;  4C8Q D;  3VS7 A;  2PUK B;  2OTL T;  1FMV A;  3VS4 A;  5LJ5 e;  1NG2 A;  2LX9 A;  2RQR A;  2FO0 A;  2ZPF B;  4FYW B;  4Z89 A;  1T3S A;  2QA4 T;  1PRL C;  1YJN A;  2DYB A;  4J8O A;  3S6W A;  1K4U S;  1ZHI A;  1ZX6 A;  2DEQ A;  3H6Z A;  2DAQ A;  2Y4X A;  2CZ7 B;  3I35 A;  1Q82 U;  1Y96 A;  2HQE A;  5GAM d;  4HCC A;  2L5Q A;  1VQL Q;  4HVU A;  2L3S A;  3H0I A;  2ZPH B;  1FYN A;  4JLG A;  4CI0 C;  5D6X A;  4NL2 A;  4V2S A;  1NEG A;  2L89 A;  3V8K A;  2E64 A;  1EX4 A;  2E3H A;  4DBF A;  1SHF A;  3QJY A;  3HKS A;  3ULR B;  1YIT T;  3D7S B;  3OB9 A;  1RAD B;  1UG1 A;  4FW2 A;  1K8A R;  1ZSZ C;  3VS5 A;  2RHI A;  2JUF A;  2CT4 A;  2AZS A;  1MND A;  3ZL7 C;  1M3B A;  3V7R A;  4F7U G;  1KHI A;  1BBZ A;  3SB2 A;  4DBQ A;  1E7O A;  5GAM j;  4FT2 A;  2P0K A;  4OVA A;  2LJ1 A;  5LJ3 e;  3CCU Q;  2BE9 B;  5GAN 5;  4FYV B;  1Q82 C;  1VQL A;  3L2R A;  3GNG A;  3E19 A;  3MEV A;  3OYF A;  2LT4 A;  2QQR A;  2XK0 A;  4DEY A;  1KQ2 A;  1U06 A;  1UFF A;  1VQ8 Q;  2KT8 A;  2O2O A;  3BDL A;  2X4W A;  1QQJ A;  5KYW A;  3L1A A;  5FWB A;  2RI3 A;  3PTA A;  2OTJ A;  1ZA2 B;  4XU1 A;  1UHC A;  3V7C A;  3CCR T;  1TUG B;  5A0L A;  3JCM d;  1XNI A;  2MAM A;  2FPD A;  5AYF A;  1YHQ T;  2ZPI B;  3VS0 A;  2LC4 A;  1PM3 A;  2PTK A;  8AT1 B;  1YJW A;  3TSW A;  2DL3 A;  2CYZ B;  3LWI A;  2MOX A;  2M51 A;  3PIO A;  2V1R A;  2WSF E;  4IIO A;  4HVW A;  3RDV A;  2LZ6 B;  2QAZ A;  3THK A;  1TUD A;  1VQ8 A;  5CO7 A;  2EGA A;  5C6S A;  1VQ9 Q;  3OYK A;  1CSK A;  1S1N A;  3M0T A;  2KBT A;  2LJ3 A;  3QWX X;  3OYC A;  1Z9Q A;  1Q81 R;  3R6O A;  3X25 B;  1GFD A;  5A2Q E;  2K5I A;  5KE2 A;  2K9G A;  5IHK A;  3SD4 A;  1ABO A;  2EJG A;  4IUP A;  2DIQ A;  2R58 A;  2EYW A;  3PVL A;  2OAU A;  1VQ4 Q;  1GXI E;  1JU5 C;  2F5T X;  1KC8 U;  4KH1 B;  2HQX A;  5D6Y A;  1K9A A;  4Z02 A;  2HBW A;  3MP1 A;  2DIG A;  1D1C A;  5M9O A;  5DLO A;  4M7A A;  1N9R A;  4BE2 A;  2R5M A;  5J39 A;  2IG0 A;  1RAB B;  2J05 A;  2PVO B;  2C06 A;  4A4E A;  4P5N A;  4M77 A;  2RF0 A;  1VQ9 A;  2KRN A;  3T9N A;  2LCS A;  2J6O A;  1D1B A; 
#chains in the Genus database with same CATH homology
 2RI2 A;  4HA8 A;  3CCQ A;  2CZ0 B;  5GMK h;  2PVD B;  2P0P A;  3QPH A;  3QYG B;  3TEE A;  3CCJ T;  2QA4 A;  2YLC A;  5HK0 A;  2DXT A;  2HNI A;  2CGH A;  2RHY A;  1B34 A;  2VC8 A;  3LLR A;  4FL6 A;  4WF2 A;  2VXF A;  3ER0 A;  1SSF A;  5I2S A;  2QTX A;  4GLK A;  4C8Q G;  3OS0 A;  2ZPG B;  4BE0 A;  4RG2 A;  5KCO A;  4PJO A;  4N4H A;  2V8K A;  3CCS A;  4E7I A;  1Q7Y U;  1G3T A;  1FXX A;  2RHU A;  3MP6 A;  1UGQ B;  1VQ7 T;  2PU9 B;  3EFS A;  1P92 A;  4EDU A;  2K3X A;  2EQJ A;  5GAN g;  2VYT A;  4J6X A;  1BI2 A;  1NZ9 A;  4OGE A;  1YBY A;  2DK3 A;  3JCM V;  5CKF A;  4EPC A;  4JS5 A;  4HT8 A;  4HCZ A;  1LJO A;  3SWN A;  3CCV T;  4NOY A;  4EMK B;  2FB7 A;  2E41 A;  1WQ7 A;  1ZBX A;  2RA2 A;  4JDS A;  4XU2 A;  3OQ5 A;  3HHT B;  2QDY B;  3I55 T;  2DZC A;  4M77 G;  1W2B A;  2KDS A;  3FIF A;  4ZGD B;  3A8H B;  5CAI A;  2XI9 A;  3JAM E;  1KC8 C;  1M4Z A;  1B34 B;  1VQK A;  1I81 A;  5CKE A;  4C92 D;  4XTW A;  5GMK l;  4JRK A;  3CBP A;  3G71 T;  3CME A;  2EQM A;  4JRQ A;  4PJO B;  4ATO A;  2K2V A;  1EIF A;  4ZN1 A;  3A5Z B;  3HSB A;  1BIA A;  1YJN T;  1OZ3 A;  1XQH A;  5LJ3 d;  1M90 U;  2L8D A;  3A8G B;  1VQO T;  2DTO A;  2M9U A;  3INZ A;  5FRM A;  4ELZ C;  1TH7 A;  2DTI A;  4QQ6 A;  1K8A U;  2JTM A;  1WJQ A;  3PT9 A;  2MWP A;  4XTY A;  2JTF A;  2D9T A;  1S72 T;  2RJE A;  2WSE E;  3CD6 T;  3URG A;  3BY7 A;  3JB9 I;  3V8J A;  2DD4 A;  5KH6 A;  3M53 A;  4C5I A;  2ZCF B;  3CCJ A;  4L5G A;  3CC7 T;  2QQA A;  3CCU A;  4ZTF A;  4NL3 A;  3L2V A;  4C0Z A;  5GAN 8;  4Y91 A;  3TRE A;  4BDZ A;  3PIP A;  3OW2 S;  3SDZ A;  5DM7 R;  1PSE A;  3L42 A;  2X4X A;  4B9W A;  2RD1 A;  2ZGW A;  1Q7Y C;  2O4X A;  3JCM h;  4RG8 A;  3QKJ A;  3CC2 T;  2CZ1 B;  2E6N A;  1I5L A;  2XG8 D;  3CXC A;  4OB1 B;  1O75 A;  1UGR B;  2DXU A;  5LL6 S;  3P8D A;  1VQ7 A;  4M7D G;  3ZFJ A;  3E1S A;  4Y28 E;  1NE8 A;  3KUF A;  4M78 G;  4ZGE B;  1D3B A;  1H64 1;  4CRI A;  1QVF S;  4KUD K;  3SFM A;  3OYE A;  3NFC A;  3OY9 A;  4A4K A;  2E12 A;  1YIJ T;  3HRS A;  2HD0 A;  4FU6 A;  4A54 A;  3CCV A;  2QEX T;  5GAN h;  1HK9 A;  5LJ3 j;  4F7U E;  4ZN3 A;  3I55 A;  3FB9 A;  4JRP A;  2NLU A;  3E9F A;  2EWN A;  3VU3 C;  4C8Q E;  1N9S A;  2LDM A;  3QG1 A;  3QXE B;  4KUL A;  1BYM A;  1H3Z A;  1G3S A;  3LGL A;  3FEO A;  5GAM e;  4BDY A;  2EFI A;  2QQS A;  3MEU A;  4M75 G;  2E5Q A;  3LX7 A;  4KUI A;  2K5F A;  4RCB A;  4OGC A;  3G71 A;  1VQ5 T;  5D6W A;  5GAO l;  4J83 A;  4D6W A;  1BI0 A;  3QBY A;  1I8F A;  5LJ5 d;  4DQ2 A;  1G3W A;  1M90 C;  4X9C A;  2DXC A;  1Y07 A;  3OW2 A;  3OSV A;  3LWH A;  3CC4 T;  1M1K U;  1UEB A;  4M7A E;  4N0A C;  5GAM f;  1FX7 A;  3OYI A;  1G3Y A;  4M77 E;  4J5Y A;  3A8M B;  2KSS A;  4BUG A;  2VXE A;  1S72 A;  3DB4 A;  4X9D A;  5FU7 C;  3CD6 A;  3RUX A;  4YTL A;  3PMI A;  2RO0 A;  2JN0 A;  5FRO A;  2M16 A;  3J80 E;  4C92 G;  3S3M A;  5GMK i;  2MI6 A;  4FT4 A;  3OYY A;  3CC7 A;  2R5A A;  2CS7 A;  4ZGJ B;  1VQP A;  4LDW A;  3MHX A;  2ZPB B;  3M9Q A;  3GLX A;  3JCM c;  2JVV A;  4MDW A;  2RJC A;  4J7I A;  2K4Y A;  3CC2 A;  2M0O A;  2Y90 A;  4PJO D;  2AHJ B;  4C92 C;  2K5L A;  4LDY A;  4F7U B;  2LRQ A;  4LDU A;  3OYA A;  4MZM A;  3RER A;  4PJO E;  4BD3 A;  5HK3 A;  4BE1 A;  1U1T A;  3GIB A;  3HPW A;  4C8Q B;  1VQM T;  5L8R E;  3OA6 A;  1QVG S;  2OTJ T;  4N4G A;  2EYQ A;  1YCY A;  3DLM A;  3JCM g;  3JB9 G;  1MGQ A;  2BKD N;  4RMO A;  2LNV A;  2LCC A;  3S3N A;  2O01 E;  1YIJ A;  3OS5 A;  3C12 A;  2A7Y A;  3JCM J;  4IUR A;  5LJ5 j;  2QEX A;  3M59 A;  5LJ3 g;  1AHJ B;  2DVE A;  2V8J A;  1IZ6 A;  3M54 A;  3G6E T;  4MML A;  2LVM A;  2VGN A;  5A0G A;  3OYN A;  2E6Z A;  3HFO A;  4JRI A;  4XAX B;  4B9X A;  5HY6 A;  3PMT A;  1Q81 U;  5GAN 4;  3OYJ A;  4XU0 A;  4M7A B;  3VUZ A;  4X34 A;  4BI8 B;  1NPR A;  4ZTJ A;  4A4H A;  4A4F A;  4BY6 C;  4C0D B;  4C5H A;  4M77 B;  1YJW T;  1MHN A;  1WGS A;  5CK9 A;  1VQ5 A;  1VQ4 A;  4O5V A;  4F7U F;  5A0D A;  1Q86 U;  1N27 A;  3CPW S;  1M1K C;  2DXB A;  1VIF A;  3EFR A;  4C8Q F;  3CMA A;  1LNX A;  3JCM e;  3QDR B;  3CC4 A;  1WQW A;  2XHC A;  1QVP A;  3G4S T;  1QW1 A;  4QVC A;  2IVW A;  5CR2 A;  3DB3 A;  4XTV A;  4LD6 A;  1UGS B;  4M7D A;  2H3J A;  3L2W A;  5C0M A;  4UC4 A;  3JRZ A;  3L2U A;  5GMK m;  3QII A;  4M78 A;  1NPP A;  3C4S A;  1K73 U;  3UDC A;  4QQD A;  1BIB A;  1VQ8 T;  2XKO C;  5FRN A;  1VIE A;  4M7A F;  4QQG A;  5GAN e;  2MWO A;  3JCM f;  3NTI A;  1M8V A;  3CEY A;  4IUU A;  4PKC C;  2F69 A;  4XTX A;  1X75 C;  3QYH B;  3QJ6 A;  5GAN 3;  4N4I A;  1FWZ A;  5J3B A;  1QP2 A;  5GAO n;  3UPU A;  3X20 B;  3AHU A;  3SWN B;  5CKB A;  1OZ2 A;  4M75 A;  4QVD A;  1JRI A;  1WJR A;  4TVR A;  1VQN T;  4OMF B;  3MEA A;  2LTO A;  2P0Q A;  3Q1J A;  4IUV A;  4O6J A;  3DKM A;  2GFU A;  5GAN f;  3VKI A;  3J81 E;  4JJN K;  4HKE A;  5HKC A;  2B8A A;  2XIC A;  4M7D B;  5LJ5 g;  1M5Q 1;  2RK1 A;  1VUB A;  3ASK A;  4M78 B;  4PLL A;  2DJZ A;  4PJO F;  4JS4 A;  4EMK C;  1QP3 A;  1Q81 C;  2VUB A;  5GAN 7;  1YI2 T;  4HCB A;  3OMC A;  3X24 B;  3JCM Q;  4BB7 A;  1KHC A;  3OYM A;  5LJ3 h;  2X35 A;  3VV0 A;  1U8R A;  2PUO B;  2E70 A;  3F70 A;  2KVQ G;  4C92 A;  4RKU E;  3L2Q A;  2YHT A;  1VQ6 T;  1Q86 C;  4Q5W A;  4E47 A;  4NS5 A;  3OYB A;  1Y71 A;  4PJO C;  4C0F A;  1OYX A;  2K3Y A;  2KK4 A;  3A8L B;  4FM4 B;  3MO8 A;  4M75 B;  2E1H A;  3GP8 A;  3BFM A;  4C8Q D;  3RMQ A;  4LD9 K;  2CZ6 B;  2PUK B;  4OP0 A;  3G4S A;  2OTL T;  4II1 A;  5LJ5 e;  3GOX A;  3LH0 A;  2LX9 A;  1K73 C;  2BUD A;  2V8I A;  1I4K 1;  2EKO A;  1YJ9 T;  1KQS S;  2O4X B;  2ZPF B;  3WVE B;  3C95 A;  3CCQ T;  2KMT A;  5GAO m;  5FU6 B;  2ZPE B;  3BDU A;  3UWN A;  4VUB A;  1BKB A;  2Y4Y A;  3VYG A;  1YJN A;  2QA4 T;  2MMP A;  1WPY A;  4J8O A;  1KQ1 A;  3RES A;  4M7A D;  3QZ9 B;  2QI2 A;  5CCA A;  3FRN A;  1VQO A;  3BW1 A;  1D3B B;  3S6W A;  2LQ8 A;  1BI3 A;  4M77 D;  4PNO A;  5DY9 A;  3RKY A;  1ZHI A;  3P8H A;  3OSS C;  2DEQ A;  5LJ5 f;  3VUB A;  3H6Z A;  4J6Y A;  2DAQ A;  3CCS T;  1ZQ1 A;  5CQX A;  5GAO p;  2Y4X A;  2RHZ A;  3JCM W;  1VQN A;  2CZ7 B;  1Y7X A;  5IN1 A;  1VQL T;  3JB9 H;  3H8Z A;  1QVF A;  1Q82 U;  1Y96 A;  2I2L A;  2HQE A;  1G5V A;  2FL7 A;  2QQ9 A;  3OBW A;  3MET A;  5GAM d;  3GNF B;  3S3O A;  4HCC A;  2L5Q A;  2RI5 A;  5FLX E;  2FYK A;  3JCM P;  1N6A A;  4OB0 B;  1XOV A;  2KQW A;  2XID A;  3E9G A;  4ELY C;  5LJ5 h;  2ZPH B;  3M55 A;  4JLG A;  3HRU A;  2YRV A;  3M58 A;  4QVZ A;  1XTD A;  4NL2 A;  2D0Q B;  5D6X A;  4CI0 C;  2L89 A;  2RHX A;  3ME9 A;  1VQP T;  4V2S A;  3V8K A;  2E64 A;  4IUQ A;  1VQ6 A;  3M4Y A;  3JB9 J;  3QJY A;  3CCE T;  1OI1 A;  2LT1 A;  1RI0 A;  4MZT A;  1JJ2 S;  3HKS A;  2PQW A;  5GAN 2;  1WNL A;  1JB0 E;  4LDV A;  5IT9 E;  2RB6 A;  5CQY A;  1PSF A;  4DOV A;  1YIT T;  2OTL A;  2X4Y A;  4MDX A;  3OB9 A;  4C0G A;  1W2B S;  4L59 A;  2E10 A;  3OS2 A;  1Y96 B;  2K57 A;  1X01 A;  2GF7 A;  3KXT A;  1KG1 A;  2RHI A;  2DO3 A;  2EQU A;  3RMS A;  4IKF A;  5GAN 6;  4A53 A;  4GY5 A;  2EQK A;  4M78 D;  1YJ9 A;  4M7D E;  3JB9 F;  2JUF A;  4J6W A;  2P4T A;  4OB3 B;  4BI3 A;  5IAY A;  3CCM T;  4BAC A;  5GAO r;  4M78 E;  3LGF A;  3MEW A;  1HXD A;  2GCX A;  2FVU A;  2XDP A;  3V7R A;  3CCU T;  4F7U G;  1KHI A;  3TU4 K;  3V8L A;  3SB2 A;  3QO3 A;  1O9S A;  3M57 A;  3O8V A;  5GAM j;  4FT2 A;  1K9M U;  2P0K A;  4OVA A;  3HP9 A;  5GMK j;  3DLL A;  2L3R A;  5LJ3 e;  1NJI U;  4PL6 A;  3JCM b;  4M75 D;  5GAN 5;  1KD1 U;  3HL8 A;  2PVG B;  3VYH B;  5CKD A;  3PNW C;  3L2Z A;  1Q82 C;  5KE3 A;  1QVG A;  4M75 E;  1VQL A;  2EAY A;  3RIR A;  4C8Q C;  2A3L A;  4OB2 B;  1LOJ A;  3MCA B;  3L2R A;  4FSX A;  3UT1 A;  2XU8 A;  3GNG A;  2XDB A;  3E19 A;  3MEV A;  3OYF A;  2LT4 A;  4E7J A;  2QQR A;  3OYL A;  2XK0 A;  4M77 F;  1JJ2 A;  1KQ2 A;  4M7A G;  5J26 A;  3LW5 E;  4OF1 A;  2WSC E;  3KBG A;  2M1H A;  5LJ3 f;  4EMH A;  1M9S A;  2ZZD A;  3BDL A;  2RK2 A;  2X4W A;  3CXC S;  5CVI A;  3L1A A;  3GF5 A;  2RI3 A;  3PTA A;  1VQM A;  4E7K A;  2OTJ A;  4XU1 A;  2LCL A;  5I2M A;  4N0A A;  5I21 A;  3V7C A;  3WXM B;  3CCR T;  4M7A C;  2KAF A;  5A0L A;  3A8O B;  3JCM d;  1XNI A;  4C0D C;  2MAM A;  4M77 C;  2JOY A;  4C92 E;  2VGM A;  2R57 A;  3FJP A;  2EJ9 A;  3CCE A;  3X28 B;  3HRT A;  3CPW A;  2EJF A;  1UB4 A;  3CPF A;  3RKW A;  3OYH A;  3G6E A;  1JBM A;  2QQB A;  5AYF A;  4XTU A;  1YIT A;  1YHQ T;  2ZPI B;  1RL2 A;  3OBY A;  3C94 A;  4PJO G;  2LQK A;  2X4J A;  2KY9 A;  3P8B B;  5GAO q;  2RJD A;  3HFN A;  2HAX A;  4MZP A;  1W4S A;  3JCM X;  2JZ2 A;  3RKX A;  2GQV A;  2LC4 A;  3I56 T;  5GAN d;  1YJW A;  3JB9 D;  3M5A A;  3CCM A;  3ZBD A;  3OS1 A;  3OYG A;  4XK8 E;  3G7Z A;  4DA4 A;  3CCL T;  3NTK A;  2CYZ B;  5KCH A;  3LWI A;  3FC3 A;  3QHS A;  5GAM g;  3PIO A;  2WSF E;  1K9M C;  3OMG A;  2E65 A;  2VV5 A;  4BI4 A;  3N5B B;  1M1G A;  1V29 B;  4M7D F;  1NJI C;  2DD5 A;  4E7L A;  1KD1 C;  5FU7 B;  2FHD A;  4M78 F;  1VQ9 T;  2EIF A;  2XDD A;  4XTZ A;  3SWN C;  2BIV A;  3VJP A;  3TCJ A;  4R56 A;  1VQ8 A;  5CO7 A;  1N8R U;  3ZEH A;  3V7S A;  2YLB A;  2WAC A;  3CBM A;  2D6F A;  5C6S A;  3J7A F;  3OYK A;  3PFS A;  4JUV A;  3FDR A;  4C5G A;  4MMK A;  4M7D C;  3OYD A;  1DJ7 B;  2HBP A;  4C92 B;  5CIU A;  4HT9 A;  4R55 A;  4M78 C;  5EG2 A;  4KBM B;  1X6O A;  3OYC A;  2XD0 A;  3R6O A;  4M75 F;  4DOW A;  3LYI A;  4QW2 A;  3X25 B;  1WJS A;  5A2Q E;  2K5I A;  3JSC A;  1UGP B;  3CCR A;  5GMK e;  2DZ9 A;  5GAN j;  5KE2 A;  1IRE B;  3QZ5 B;  1VQ4 T;  3SD4 A;  3MP8 A;  4F7U A;  2CKK A;  3NTH A;  4ME7 A;  2EJG A;  4L6V 5;  3EAE A;  4A4G A;  4EMG A;  4IUP A;  4M75 C;  2DIQ A;  4C8Q A;  2R58 A;  2DKG A;  1U1S A;  4KT0 E;  4XU3 A;  1YI2 A;  1YHQ A;  3CMA T;  1K8A C;  2RJF A;  3QSU A;  2F5K A;  2OAU A;  2RH2 A;  1GXI E;  2GFA A;  2F5T X;  4BY6 B;  1R8O B;  1VQK T;  3M4G A;  1KC8 U;  4C92 F;  3I56 A;  3M56 A;  2HQX A;  5DLQ E;  5D6Y A;  1KQS A;  4LDX A;  4Z02 A;  3FLG A;  3CME T;  3CCL A;  3MP1 A;  2DIG A;  4RCC A;  5FU6 C;  2JNG A;  4C5E A;  5M9O A;  1M1F A;  5DLO A;  4M7A A;  1N9R A;  2RM4 A;  2R5M A;  5J39 A;  3GPL A;  4BE2 A;  2IG0 A;  4JLI A;  2PVO B;  2C06 A;  5CKH A;  4A4E A;  4P5N A;  4M77 A;  2G3R A;  3PGG A;  4PLI A;  3X26 B;  4E7H A;  2MF2 A;  4M7D D;  4IUT A;  2DPP B;  1BI1 A;  2QXF A;  4XQ3 A;  3CBO A;  3QUI A;  1VQ9 A;  2DTH A;  4J7F A;  3WVD B;  5GAM h;  3T9N A;  4EMK A;  1N8R C;  4FIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...