4QT7A

Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
SHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase activator
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structure of the c-Src-SH3 domain in complex with a proline-rich motif of NS5A protein from the hepatitis C virus.
pubmed doi rcsb
source organism Gallus gallus
total genus 13
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4qt7A00
1HJDA 1RLPC 1EFNA 4ORZA 3FJ5A 1ZSGA 2ENMA 2KE9A 1CSKA 1M27C 4RTUA 1UUEA 2LCSA 1X69A 4LUEA 1K4US 2KT8A 3VS5A 2DILA 3REBB 4F17A 2ED0A 2LQWA 4AFZC 3M0UA 4J9GA 2CSQA 5FWCA 4OMQA 1UFFA 4EIKA 2CUBA 3H41A 1PRMC 2O9VA 1NYGA 1U5SA 4CC2A 4Z88A 1AD5A 4J9BA 2W0ZA 5IXBA 3KFVA 2MCNA 1SHFA 4RTYA 1NG2A 1WI7A 4GLMA 2DBKA 2EKHA 4JZ3A 1UGVA 3M0TA 2JW4A 2LP5A 3EG1A 3VS1A 2HCKA 1K9AA 2OI3A 2K2MA 4OMOA 1ABQA 1AVZC 2D1XA 2YT6A 2EGCA 3I9QA 2A36A 2H8HA 1OEBA 2L3SA 2FEIA 1VYVA 2AKKA 1W6XA 2LZ6B 2DJQA 1PHTA 1SHGA 2ESWA 3ULRB 2DM1A 3H0IA 3C0CA 1T3SA 2BZXA 3I5SA 2AZVA 1NLOC 1AWJA 4FSSA 2GQIA 2EQIA 1ZUUA 2KGTA 2YSQA 1E6HA 3EHQA 5I11A 1U3OA 4RTWA 1PNJA 2A28A 1SSHA 2RQUA 1UDLA 2JM9A 2DVJA 1KSWA 1MUZA 4AFUC 2BZYA 2KROA 4D8KA 2RQRA 2D0NA 1WDXA 4HVWA 2X3XD 1KIKA 4J9HA 1WIEA 2DNUA 2YUQA 2V1QA 3M0SA 2JTEA 3M0RA 2LMJA 2J7IA 2M51A 2MIOA 2CREA 2KYBA 2RF0A 3GBQA 1QWFA 1X27A 2KYMA 1YP5A 3VS7A 1WA7A 1AZGB 3SHWA 1YWOA 1Z9QA 2KRSA 1Y57A 3TSZA 2NUZA 2YUOA 2SRCA 2DF6A 1J3TA 2YUPA 4IIOA 1GL5A 1M8MA 1UG1A 2LNHB 1KJWA 3R6NA 2FPDA 2K7AA 1RLQC 2X3WD 5FWBA 2GTOA 4J9DA 4R0KA 5IH2A 1T3LA 1G83A 2XMFA 4RTTA 1G2BA 4RTVA 1UTIA 1B3QA 4JJCA 5IHNA 1H3HA 1ARKA 4ZNXA 1M3BA 2DX1A 2L3PA 1FMKA 1B07A 1X6GA 3EG2A 1MV0B 4K11A 2OAWA 1PRLC 2M0YA 1HD3A 1SRLA 2CUDA 2JS0A 4HCKA 2ROLA 4JJDA 1UJYA 3PVQA 1ABOA 1QLYA 1JQQA 2RPNA 1AWWA 2DMOA 1UHCA 1WLPB 3CQTA 1JU5C 2CH4W 1WXTA 1X2QA 3I35A 1Z9ZA 4F14A 2EPDA 2EBPA 3I5RA 2LJ1A 2DL5A 2DL3A 1RUWA 4CC3A 2EVRA 4IIMA 1RI9A 3TVTA 1QWEA 5IHKA 1QKXA 1BU1A 2AKLA 2JT4A 2L2PA 3H0HA 4HVVA 1TG0A 2E5KA 1HSQA 5EC7A 4WCIA 4CC4B 2DYBA 2PZ1A 2F2VA 1TUCA 1OPLA 2KBTA 2BZ8A 2DRKA 3M0PA 2NWMA 1MV3A 1S1NA 4QT7A 1I0CA 2YDLA 2EYWA 4LE9A 1AWXA 3U23A 3RBBB 1H8KA 2O88A 2DA9A 2OJ2A 5FW9A 1GBRA 3NHNA 4LN2A 2RN8A 3PVLA 3VS2A 1A0NB 3NGPA 1JXOA 2JM8A 2JMAA 2MOXA 1Y0MA 2RMOA 3O5ZA 4Z8AA 4JPBW 1BK2A 3SEMA 2CDTA 2K79A 4A63B 3NMZC 4HXJA 1SEMA 2FO0A 1YNZA 2DBMA 2HDAA 3THKA 1W70A 4OMMA 1UECA 2O31A 3EG0A 1AWOA 1OOTA 3UA7A 1X6BA 2K3BA 2KNBB 3VS4A 2C0OA 2VVKA 1OV3A 4ESRA 1IO6A 1VYUA 1K76A 2A37A 5GJVB 3VRZA 2F2XA 2ECZA 1M3CA 1CKAA 2DL4A 2GBQA 1I1JA 1TUDA 2FPEA 2GTJA 3QWXX 1JO8A 2EYYA 4AG1C 2SEMA 4M4ZA 4J9IA 1WFWA 2EGEA 2GNCA 1NEBA 2F2WA 1N5ZA 2EYXA 4LUDA 2HBWA 4J9CA 4OMPA 2RQTA 4Y92A 1CKBA 5GJWB 2K9GA 1UE9A 2DLPA 2ABLA 1M3AA 4F16A 1YN8A 2D8JA 2PNIA 3EHRA 2AK5A 4JZ4A 1UJ0A 1GRIA 3REAB 2D8HA 3VS0A 4CC7A 2B86A 2LJ3A 2KR3A 1YCSB 4DEXA 5I22A 2LQNA 2DE0X 3VS6A 2KEAA 4E6RA 2IIMA 4J9FA 1K0XA 1SPKA 1YWPA 3TSWA 5IHIA 3IQLA 3UF4A 1GFDA 1ZBJA 2KT1A 1NLPC 1PKSA 2DRMA 3VS3A 1T0JA 2JMCA 2K6DA 2DL8A 2W10A 1JXMA 2LJ0A 1V1CA 2RQVA 3M0QA 1QCFA 2KXCA 4OMLA 1WX6A 2CH4A 2PTKA 1X2KA 4HVUA 4OMNA 2ROTA 2EGAA 3VRYA 4D8DA 1WYXA 2EW3A 1T0HA 2QDLA 2VKNA 1GBQA 5HCKA 1NYFA 1FYNA 1X43A 2RQWA 1BBZA 2P4RA 2FRWA 4DEYA 1NEGA 1M30A 1WXUA 2O9SA 2LX7A 2FG0A 1VA7A 1GFCA 2KRNA 3LH5A 1K1ZA 3JV3A 4AFQC 2HSPA 3A98A 3H0FA 3EGUA 2J6KA 3RNJA 2EYZA 1KFZA 4GBQA 1ZX6A 4X1VA 5L23A 2AZSA 1LCKA 5IXFA 1NM7A 2O2OA 1E7OA 1K0SA 2CT4A 2G6FX 1ZUYA 2V1RA 4RTZA 4AG2C 1GCQA 3PE0A 1SRMA 4RTXA 1PWTA 3EG3A 3NPFA 1I07A 1WXBA 2KXDA 2RNAA 4KRTA 2J6OA 1E6GA 2YUNA 1VYTA 2J06A 2J6FA 1PKTA 3QWYA 1OPKA 1QKWA 3ZL7C 4J9EA 1UHFA 2C0IA 3UATA 2CT3A 1AEYA 1JEGA 1BB9A 2JS2A 2J05A 4LNPA 2HEQA 1GCQC 4JJBA 1ZLMA 5ECAA 2A08A 3UA6A 2CSIA 2KRMA 2FRYA 4RUGA 2BTTA 4AFSC 1GCPA 2GGRA 1XOVA 2ED1A 2JXBA 2FPFA 2L0AA 2I0NA 2L3QA 1U06A 2DL7A 1AOJA 4Z89A 2C0TA 1H92A 1ZUKA 2VWFA 1W1FA 1AZEA
chains in the Genus database with same CATH superfamily
1HJDA 1OU8A 4PJOD 4ORZA 3OYNA 1M90R 1PSFA 5GMKh 4M7AD 4RTUA 1C1AA 2RHXA 3EFOA 3OYMA 3CMET 2VASA 4XTXA 1ZA1B 2KT8A 3VS5A 2VC8A 1K73R 4OGEA 4AFZC 1WJQA 3M0UA 4IUVA 4J9GA 4M78E 3I55T 1Q81R 1Q7YU 4C5GA 4XTYA 1UFFA 1MMGA 4DA4A 3T9NA 1EX4A 1U5SA 4CC2A 4Z88A 3VU3C 2DXCA 3KFVA 3V8LA 3ZEHA 3CC4T 4ELYC 3EG1A 4F7UA 3CCRT 2X4XA 2QDYB 3VS1A 4NOYA 1K9AA 3DB4A 4OMOA 5I2MA 5CO7A 5LJ5g 4RG8A 2FEIA 1WQ7A 4X9CA 3JCMh 4J6YA 3JCMc 1TUGB 1SHGA 3HFNA 2DM1A 3C95A 2E65A 3JCMe 2AZVA 1NLOC 1B34A 3CCST 4FSSA 1W2BP 2O4XA 3CCVT 4FCYA 2Y4XA 1LOJA 4ANJA 2XDDA 4NL2A 2BUDA 5I11A 1U3OA 3OQ5A 2LT4A 2R57A 2RQUA 3QG1A 4N4IA 1YHQA 3H9NA 2DJZA 2QYZA 2JM9A 2QTXA 1VIEA 1MUZA 5GANg 1N8RC 4M75E 2ZPGB 1PD1A 2KROA 5LJ3d 2DIQA 1KIKA 5KYYB 2DNUA 2V1QA 1WHGA 3JB9G 2LMJA 2J7IA 3GBQA 2PUOB 2D9TA 1UB4A 5CIUA 1UGSB 2KSSA 1NPPA 1RI0A 1PC0A 4M7DC 2SRCA 2DF6A 2BIVA 2P0QA 4IIOA 3L2QA 3OW2A 3JB9F 4NS5A 1UG1A 1PG5B 3G71A 3RUXA 3M59A 5FWBA 4R0KA 2F5TX 1T3LA 4FM4B 1VQOQ 4CRIA 2CYZB 2XG8D 4BE1A 1ARKA 2WSEE 1R0BG 3PT9A 2ZCFB 3INZA 4ZNXA 3RKWA 3PMIA 4M77E 4ELZC 5GAMf 3DB3A 1N27A 1X6GA 3CCEQ 3C4SA 5FU6B 1W2BS 1PRLC 5KH6A 4LDVA 1HD3A 3DLMA 1QP2A 5CKFA 4JJDA 1QLYA 2F5KA 1SG5A 4M78B 2P0KA 1QMCA 1UHCA 5LJ3g 4XAXB 1VQ4A 2M16A 1JU5C 5KYNA 1WXTA 1IREB 1VQMA 1YHQT 1Z9ZA 1ZHIA 4F14A 2E6NA 3I5RA 2XICA 3M56A 3GLXA 2E5QA 4C0DC 4IIMA 5IT9E 2ZPIB 3SWNA 2H3JA 3TVTA 5KYUB 2XIDA 2AKLA 2L2PA 2ZZDA 2R5AA 1YITQ 2HNIA 1M1FA 4F04B 4CC4B 2PZ1A 2RJCA 2F2VA 4C92C 3CMEQ 1TUCA 1OPLA 3G4SA 3EGDA 3M0PA 2QXFA 1MV3A 5DY9A 4E7JA 1I0CA 4LE9A 4EMKB 3HL8A 3U23A 1IRXA 3I55Q 3WXMB 2O88A 5GAOm 2RHYA 1GBRA 4PJOB 4N0AA 3NHNA 3VUBA 2MPXC 2PQWA 3G71T 3NTHA 1A0NB 3L42A 1JXOA 1MMDA 2JM8A 2DTOA 4IUPA 2RMOA 3L2UA 1NE8A 4JPBW 3SEMA 3CC4Q 2CDTA 4A63B 2YXYA 4PJMA 4C5EA 3CCRQ 2LCCA 5FU7C 3EFRA 3VJPA 4C5IA 2COWA 3QZ9B 2O31A 1BI3A 1OOTA 1X6OA 2M02A 3UA7A 2K3BA 4MDXA 4KGVB 1G3TA 1OU9A 1OV3A 1G3SA 4ESRA 3HP9A 1I81A 2KAFA 5GAN5 2OX7A 3CCSQ 1S72Q 1VQ4T 3CCVQ 2GBQA 2H3EB 3VUZA 2GTJA 4IURA 1VQMT 4AG1C 5FU6C 3MEUA 4J6XA 1VQLA 2EQJA 1M8VA 1PSEA 4O5VA 4Y91A 4J9CA 4OMPA 2RQTA 4M78C 1I4K1 2K9GA 2DLPA 5C6SA 2ABLA 4F16A 4E47A 4PKCC 1YN8A 4KH1B 2AK5A 4JZ4A 1UJ0A 3M55A 1GXIE 2DO3A 3VS0A 3JB9I 4BACA 3G4ST 3BY7A 1YCSB 4DEXA 4PLLA 4PFZA 4KH0B 1M2VA 2LDMA 1RAGB 3OYYA 4E6RA 1TWBA 4J9FA 1BIBA 5L8RE 3IQLA 3M4GA 3VS3A 1D1CA 4XTVA 3ZBDA 2L8DA 3UT1A 2LVMA 2FHDA 4J83A 1V1CA 2RQVA 2EFIA 2E41A 3S3NA 1B7TA 2KXCA 3QPHA 5C0MA 2QK0A 3CCLA 1N9SA 1WPYA 3VRYA 1WYXA 4R55A 2LCLA 3GOXA 2L5QA 3JCMf 3JCMd 2FZGB 4Z02A 1BBZA 2P4RA 3JCMX 3I56A 2FRWA 2K3XA 4MDWA 1WXUA 2O9SA 2F69A 1Q81C 2LX7A 2FG0A 4M7DD 4M75C 2JZ2A 3LH5A 1K1ZA 4AFQC 3MP1A 3A98A 4C0ZA 3EGUA 2J6KA 2NLUA 3FJPA 4C92G 4IKFA 1ZX6A 3P8HA 8ATCB 1VQLT 1YHQQ 4YTLA 1NPRA 3CCJA 4TVRA 1TTHB 5GAOl 1LJOA 4A4HA 1G5VA 4RTZA 4UC4A 1GCQA 3TQ7P 2RHUA 2LT1A 2Y4YA 3P8DA 2ZPHB 3CC2A 2KMTA 2RNAA 4KRTA 2J6OA 1E6GA 2YUNA 3H8ZA 4II1A 1PKTA 3QIIA 1TXQA 3OYCA 3HHTB 4MMKA 5KCHA 5A0LA 1AEYA 1MMNA 5GAN4 3OW2P 2EKOA 2FVUA 5ECAA 1D0XA 4M77C 3RKYA 3G71Q 2WACA 4RUGA 3JCMW 1GCPA 2GGRA 1XOVA 2I0NA 1U06A 2DD4A 2DL7A 1VQ5A 1KHIA 2HL3A 5J39A 1IGQA 3Q1JA 5GAN2 3M57A 2V8IA 1RLPC 2KE9A 4C92D 2HMAA 3E9FA 1EIFA 4E7LA 5GAMe 4LUEA 2LTOA 1K4US 3UWNA 1ACMB 4F17A 2ZGWA 3CPWA 2EJFA 2DERA 4M78G 2HSEB 2CSQA 3G6EA 1VIFA 2RJFA 2CP0A 1VQ4Q 3QJ6A 2JN0A 1PRMC 2CZ7B 2O9VA 1NYGA 1VQMQ 2JTMA 2RK1A 2G3RA 4PLIA 2LX9A 1SHFA 3EH1A 3CCJT 4NL3A 4LD9K 1H641 1Y96B 2KDSA 1PM3A 1NG2A 4M78F 1UGQB 1QQJA 3QZ5B 2I2LA 2E12A 1UGVA 2LP5A 2MI6A 1K9MU 2EIFA 2HCKA 3L2WA 3OMGA 4FL6A 2EGCA 5KYYA 1JRIA 3G4SQ 2DETA 2QTVA 2L3SA 3OW2S 2DJQA 1YIJT 3L2VA 2ESWA 3MCAB 3CMAA 2QQAA 2X35A 2P4TA 3H0IA 3C0CA 3QYHB 1T3SA 3I5SA 1MNEA 3OYDA 2HZYA 2PVOB 4JRIA 4JLIA 2KGTA 2HQXA 4AMCA 1YJWA 1PNJA 2GFAA 2XK0A 5CQYA 1ZBXA 4C8QE 4HCCA 2E70A 1SSHA 4PJOF 3DLLA 1VQ5T 2A7YA 2AT1B 2DVJA 4M7AF 4QQGA 4AFUC 4D8KA 2KVQG 2X3XD 5FRMA 2QEXA 3C12A 2FB7A 1Y07A 3G7ZA 7AT1B 5HKCA 2CREA 2KYBA 2C06A 1N9RA 4KBMB 3G6ET 1WA7A 3SHWA 1Z9QA 5GAN8 4LXCA 2KRSA 1Q82U 1Q95G 2NUZA 2XDBA 1J3TA 3CD6A 5A0GA 1GL5A 4M78A 1K8AR 2LNHB 1KJWA 1VQLQ 2VGNA 3GNGA 2K7AA 1HK9A 4PL6A 2GTOA 5LJ5f 4HA8A 3L2ZA 2EWNA 4HT9A 5GAMj 4DBRA 4RTTA 5LL6S 1G2BA 4M7DB 2R5MA 4RTVA 1B3QA 1WHJA 4M77G 1M90U 1H3HA 1OI1A 1MGQA 3M5AA 3BFMA 1FMKA 5KYUA 5GMKe 3URGA 3QO3A 2V8KA 4A54A 1K73U 5D7UA 2JTFA 3CMAT 1RABB 1WGSA 1FMVA 1SRLA 2CUDA 1D1BA 4M75D 1M1KR 2RA2A 3PVQA 4EMKA 4LDYA 1JQQA 1OX8A 1RADB 3SDZA 2DMOA 1D0YA 5GANf 5D6WA 4IUQA 5GAN3 4PJOA 1YJWT 3CQTA 2CH4W 1Q7YR 4M7AA 3I35A 4XQ3A 3CCLQ 2EBPA 2LJ1A 2DL3A 1M9SA 4FYXB 1M4ZA 1MHNA 5IN1A 2M0OA 1BI2A 4B6MA 2QEXT 2HQHA 2JT4A 1NZ9A 2VXFA 5CR2A 2E5KA 1VQ9A 2FZCB 1VQKT 2E3IA 2BZ8A 3I56Q 1FXXA 4C0DB 2QI2A 2DXTA 2CP6A 2EYWA 2YDLA 2X4JA 2K5LA 2COYA 3RBBB 3BDLA 4FT2A 4M77D 2OJ2A 5FW9A 3CD6T 4IUUA 1VQ6T 3HPWA 2RN8A 4C92B 3PVLA 2K57A 2E4HA 2JMAA 4FT4A 2ZPBB 2K5IA 4DOWA 3BDUA 3O5ZA 4Z8AA 1BK2A 2RK2A 4IUTA 1WQWA 2DXUA 2MYSA 3MEAA 3M9QA 4F7UE 2DTIA 2FO0A 3A8HB 1YNZA 1C0MA 5KE3A 3CC2Q 1SF9A 1BI0A 1R0CB 3CPFA 3FDRA 1UECA 1PD0A 1AWOA 4LDWA 3EFSA 4BDYA 1IO6A 3ME9A 3VRZA 1V76A 2F2XA 2ECZA 3CCQA 1M3CA 5FU7B 3EH2A 1I1JA 3MP8A 2EYYA 5I2SA 5KYXB 2GNCA 2QQSA 2F2WA 3LX7A 1VQ8A 1VQ5Q 5GMKj 2EYXA 1QP3A 4FIBA 4LUDA 3DKMA 4N4HA 2HBWA 2K4YA 3QJYA 1CKBA 5GAN7 5GAMd 4BI3A 1M3AA 1O9SA 1QVGA 2PNIA 1VQ9T 2PUKB 1RAHB 2D8HA 3REAB 2LJ3A 1ZSZC 4DOVA 4PFPA 5I22A 3CPWP 2QAZA 3VS6A 3OYIA 2KEAA 3JCMV 1OQKA 2IIMA 3EG9B 3G6EQ 1SPKA 5J26A 5IHIA 3UF4A 1KC8U 2KT1A 2DRMA 3PNWC 1Q86C 2XHCA 4GLKA 2BE9B 1NJIC 2K6DA 1LPLA 2W10A 3FRNA 4J8OA 2JJ9A 1KG1A 2VUBA 2VGMA 3M0QA 3OYEA 1QCFA 3OS1A 3E1SA 1WX6A 2CH4A 3M53A 4OMNA 2EGAA 1I5LA 2VV5A 1X75C 1WNLA 2EW3A 3V8JA 2QDLA 3NTIA 4MMLA 3AHUA 1GBQA 2DIGA 1NBEB 1FYNA 1X43A 1RAEB 2RQWA 3CMAQ 3CBOA 4C8QC 3PIPA 4PK4A 4AT1B 4DEYA 3CCQT 1KQSA 1QW1A 2YHTA 4HCZA 1WJRA 4OGCA 5GAMg 1YJWQ 3RNJA 1KFZA 2RD1A 2X9HA 4GBQA 5AYFA 2K5FA 4X1VA 5L23A 4RMOA 1LCKA 3HRSA 3OS2A 1VQ8T 1AHJB 4A4GA 5IXFA 2O2OA 2CT4A 3OYAA 4M75B 3RDVA 2G6FX 1ZUYA 4QQDA 2RM4A 4EMHA 4OB1B 3CPWS 2GQVA 1D3BB 2QEXQ 3PE0A 1TSFA 3RIRA 3JAME 4ME7A 2OAUA 3OS0A 1I07A 1WHHA 5HK3A 1IHVA 2KXDA 1VYTA 2J06A 3A8LB 1U1TA 3QWYA 1KD1C 3ZL7C 4QVCA 3PGGA 4BI4A 2GF7A 4DBQA 3CD6Q 1MNDA 1ZLMA 4PJJA 1YI2A 4LDUA 1XQHA 4LD6A 2JNGA 2O4XB 2BTTA 1XJWB 4EMGA 3JCMP 1Y71A 5LJ5h 3JCMQ 4M7DG 2L0AA 2ZAEA 2L3QA 2JVVA 1Y96A 4JRPA 2C0TA 3C94A 5LJ5e 4M77B 1EFNA 3FJ5A 1ZSGA 1RL2A 2ENMA 4XU1A 1YJ9A 4ZGEB 4M7DF 2JOYA 2ED0A 2LQWA 3E2UA 2YLCA 1D0ZA 2LC4A 5FWCA 1FMWA 4OMQA 5GANh 4EIKA 2CUBA 2E6ZA 3OMCA 1K8AC 3H41A 4ZTJA 2PU9B 5J3BA 4J9BA 2W0ZA 2MCNA 5GANe 1QCOA 1TS9A 1N8RU 1WI7A 5DLOA 2DBKA 3CBPA 4JZ3A 3M0TA 1JBMA 4HCBA 2OI3A 1IGUA 1V29B 1AVZC 2D1XA 2RJEA 2YT6A 3I9QA 3PFSA 2H8HA 1VYVA 3QYGB 1W6XA 2LZ6B 1QVPA 1M1KC 1OZ3A 1PHTA 4A4KA 4A4FA 3A5ZB 2FYKA 1YI2T 2GQIA 1Q7YC 3VYHB 4XU2A 5M9OA 1SKUB 2F1LA 4RTWA 3OBWA 2A28A 1C6VX 2HKNA 4C92F 2XD0A 2BZYA 4N4GA 2RQRA 2CP3A 3SD4A 4M7DA 1WDXA 4HVWA 1W4SA 4ZGDB 4J9HA 1YJ9T 2RB6A 4MZMA 5LJ3h 2EYQA 1YIJA 2QQ9A 4BB7A 4J7IA 3ZFJA 1X27A 2KYMA 1YP5A 3CCQQ 2QGFB 4JDSA 1YWOA 1Q86R 1MMAA 1Y57A 1NJIR 2DPPB 4JLGA 3QSUA 4BUGA 3JCMg 5GAOp 2NUPB 3R6NA 1HXDA 3X20B 1RLQC 4J9DA 5IH2A 3CEYA 1G83A 2EQMA 3V8KA 2XMFA 1JB0E 2MMPA 9ATCB 1QVGP 4KULA 3LWIA 1M3BA 2DX1A 2LRQA 2L3PA 5KCOA 2IVWA 1IHWA 3EG2A 4C8QD 1MV0B 3VV0A 4K11A 1G3WA 2EQUA 2OAWA 1LVKA 1YFNA 3FC3A 2ROLA 1UJYA 1ABOA 3OYLA 5FLXE 1WJSA 1YJNA 1RACB 3MPUB 4RCBA 2LNVA 1D1AA 4WF2A 4C92A 5A2QE 1X2QA 5D6XA 2CGHA 4L5GA 4PJLA 3NTKA 4J5YA 3HRTA 3S6WA 1RUWA 2K3YA 1QVFA 3OB9A 5I21A 1RI9A 5KYWB 4QKUA 3GPLA 5IHKA 2EJ9A 1WHMA 2E3HA 1TG0A 5EC7A 2PVDB 4WCIA 2X4WA 1KD1R 2KBTA 2BE7D 3MKDA 2DRKA 3PMTA 1VUBA 3HRUA 3G1JA 1S1NA 2RO0A 4QT7A 1KQSP 4ZN3A 4X9DA 1H8KA 2NUTB 3P8BB 3TREA 2DA9A 3AT1B 2V26A 3EGXB 4LN2A 2EAYA 1F1BB 1IB8A 3NGPA 1M5Q1 1QVGS 3CCMA 2R58A 2OTJA 4M75G 1Y0MA 5KYXA 4P5NA 3CXCP 2K79A 3NMZC 4RG2A 1BCMA 1SEMA 2CS7A 2DBMA 4N0AC 2HDAA 4JJNK 3VYGA 1VQKA 4M75F 1W70A 1X6BA 5CKEA 1Y7XA 3A8MB 4QVZA 4E7SA 3VS4A 1BCOA 2VVKA 3CCET 4FW2A 2QASA 3FLGA 4BD3A 2ATCB 3EG9A 4MZPA 5GJVB 1VQ6A 1YI2Q 2DL4A 1CKAA 1YJNT 4XTZA 2QGGA 1LNXA 3QWXX 4CI0C 3RERA 4JUVA 2RI2A 4O6JA 2SEMA 1BKBA 4M4ZA 4J9IA 2KK4A 5LJ5d 2BKDN 1N5ZA 3SFMA 1QCNA 3JSCA 4FSXA 4D6WA 4PJNA 1R77A 3CC7A 1TU0B 5GJWB 1KQSS 1YJ9Q 4CC7A 2X4YA 2B86A 3OYKA 3CBMA 1KQ1A 6AT1B 2LQNA 1SSFA 2DE0X 2O01E 1YITT 4M77F 1Q81U 3LW5E 3OY9A 1M1KU 4FYYB 3TSWA 1ZBJA 5GANd 2B8AA 4J6WA 1T0JA 4XTWA 2DFUA 1JJ2P 4OB3B 1ZSZB 3V7RA 5EG2A 3CXCS 3CCMT 4ATOA 2OTJT 1M1GA 2RHZA 2ZPEB 2P0PA 4C0GA 1XNIA 4KGXB 2XI9A 1X2KA 4HVUA 4M75A 4D8DA 1BI1A 1T0HA 4DBHA 1D3BA 2VKNA 3OYGA 5HCKA 3LGFA 3X24B 4JS5A 3RMSA 3ER0A 2V8JA 1NEGA 5CK9A 1M30A 1VQ7A 1VA7A 4RKUE 1GFCA 3JV3A 4KGZB 3CCJQ 2HSPA 1FX7A 2DZCA 3HKSA 4PJOE 2EYZA 2ZPFB 4LDXA 1S72T 4M7AE 4C8QB 2KY9A 4Y28E 1NM7A 3MEWA 1E7OA 1K0SA 3CC7T 3EAEA 1UEBA 5A0DA 1BIAA 4AG2C 2YRCA 8AT1B 1WZOA 1SRMA 4L6V5 5LJ3f 1PWTA 4M77A 3EG3A 1YIJQ 1X01A 1WXBA 2HAXA 3H6ZA 4XU0A 3OYFA 4ZN1A 3HTRA 1OPKA 1JJ2S 5D6YA 2C0IA 3UATA 2CT3A 5KE2A 3L2RA 1JEGA 2JS2A 5CKDA 3HSBA 3FB9A 2FZKB 1UGPB 2HEQA 1GCQC 4EDUA 4JJBA 2D0QB 1EZZB 2A08A 3UA6A 2RI5A 2KRMA 4AFSC 2JUFA 3X26B 3J80E 1VOMA 3QDRB 2JXBA 2FPFA 2MWOA 4B9WA 2CZ6B 2XU8A 1ZUKA 2VWFA 4FW1A 3BE3A 4KT0E 2DK3A 1CSKA 4Q5WA 4RCCA 1IXDA 2QA4A 3MHXA 1M27C 2CP5A 3TU4K 1UUEA 1XTDA 2LCSA 5FROA 3V7CA 1X69A 3HFOA 2DEUA 4FU6A 3JB9J 5CKBA 2DILA 3REBB 1RAAB 1VQPA 1D09B 4EPCA 3GP8A 1VQ7T 3NFCA 2L3RA 4JRKA 1YJNQ 4E7ZA 3LYIA 2YRDA 3SB2A 3KBGA 1RAFB 1KC8R 1VQNA 1AD5A 5IXBA 2YLBA 3CCUA 4RTYA 1KHCA 1R8OB 1QVFP 4GLMA 3JB9D 3OSVA 3MO8A 2EKHA 2JW4A 3BW1A 2XDPA 1P92A 2RHIA 3ASKA 3A8OB 5CCAA 2K2MA 3EFOB 3M58A 1ABQA 5DM7R 2HKQB 5GAN6 2CP2A 2A36A 3RMQA 1OEBA 2RH2A 2AKKA 1G8XA 2CZ1B 3ULRB 3TEEA 2BZXA 4BE2A 2HQEA 2VB6A 1AWJA 4XK8E 2EQIA 1ZUUA 3N5BB 3A1PA 3CCMQ 2OTJQ 1WHKA 2YSQA 1N6AA 2KI7A 3D7SB 1E6HA 3EHQA 3GNFB 5GAOn 4JRQA 4KUIA 2NUPA 4M7AB 3OBYA 1UDLA 1TH7A 3CXCA 4F7UB 1KSWA 4HT8A 2OTLA 4B9XA 1G3YA 2D0NA 1VQKQ 2DKGA 3OYBA 2QA4T 2GCXA 4MZTA 1K9MC 1WIEA 3L1AA 2YUQA 3F70A 3M0SA 2JTEA 3M0RA 4XTUA 2P84A 1VQPT 2VXEA 1OYXA 2M51A 2MIOA 2RF0A 1QWFA 3VS7A 1VQ6Q 5HY6A 1AZGB 4BDZA 1B34B 4PNOA 2D6FA 3TSZA 2YUOA 1QVFS 4KUDK 2NYSA 2YUPA 1VQNT 4OB2B 1M8MA 3CCUT 2IG0A 4R56A 2FPDA 2X3WD 4QVDA 5CKHA 3CC7Q 2MWPA 3QDFA 4FYWB 2RI3A 4DBFA 1UTIA 5CQXA 4JJCA 5IHNA 2VYTA 5KYWA 1B07A 4OMFB 4OB0B 2K2VA 3MJXA 3KXTA 4E7HA 2M0YA 5FRNA 5GAOq 2JS0A 4HCKA 5IAYA 2RPNA 2QG9B 1AWWA 2NUTA 1JJ2A 2KQWA 3J81E 1Q82C 1WLPB 3QUIA 2MF2A 3EGXA 2CZ0B 1IZ6A 4PFOA 4OVAA 2GFUA 5AT1B 3S3MA 2DZ9A 2EPDA 2DL5A 2OTLT 4C0FA 4CC3A 3OA6A 1VQ9Q 1WHLA 2EVRA 3UPUA 4EMKC 2A3LA 1O75A 1N8RR 2MK5A 1QWEA 4OF1A 3LH0A 1QKXA 1BU1A 3H0HA 4HVVA 3V7SA 1HSQA 5CVIA 1M90C 4PJOC 2DYBA 3QXEB 4M7AC 5GMKi 2LQ8A 3JCMb 2HD0A 2Y90A 2E1HA 3KUFA 2NWMA 1VQ7Q 3LWHA 3JB9H 2IPOB 1K73C 4FYVB 1AWXA 3RKXA 5GMKm 3E9GA 2HBPA 4C8QG 2EJGA 4E7IA 3VS2A 1W2BA 5HK0A 2MOXA 3X28B 4DQ2A 4BE0A 3SWNB 2AHJB 4HXJA 4C8QF 4ZGJB 1OZ2A 4V2SA 2A0FB 3THKA 3M54A 2DXBA 4OMMA 2YRVA 3EGDB 3EG0A 5LJ3e 2KNBB 2PVGB 2C0OA 2DVEA 2HL5C 2CKKA 1FWZA 3A8GB 1VYUA 2CP7A 2COZA 1K76A 2A37A 1Q86U 1NJIU 5LJ5j 1VQ8Q 1H3ZA 1TUDA 2FPEA 1JO8A 1ZSZA 1WFWA 2EGEA 2XKOC 1NEBA 2E64A 1BYMA 2RJDA 1U8RA 3WVDB 3X25B 2DYIA 3TCJA 1TOVA 4BI8B 4Y92A 1VQOA 3CCLT 1UE9A 4M7DE 3WVEB 4WTOB 2M1HA 2QA4Q 2D8JA 4L59A 3EHRA 1OX9A 1YBYA 1GRIA 3UDCA 3LGLA 5GAMh 2KR3A 1KK7A 2EQKA 1I8FA 4OP0A 1VQPQ 3CCEA 4A4EA 5GANj 4BY6B 1I5OB 2Z0WA 2WSCE 3PTAA 1K0XA 1YWPA 4VUBA 3I56T 1GFDA 1NLPC 1PKSA 2LQKA 2FL7A 2JMCA 3OS5A 1VQNQ 2DL8A 1ZA2B 3MP6A 3CCUQ 1JXMA 4JS4A 2LJ0A 4C8QA 1U1SA 4OMLA 2PTKA 2ROTA 1M2OA 3S3OA 1K9MR 1HYOA 4QW2A 4C5HA 3R6OA 3FEOA 1YITA 1KD1U 1NYFA 3M4YA 1M2VB 3META 3CC2T 3CMEA 1DJ7B 3SWNC 2YWWA 3RR6A 3GF5A 2KRNA 4E7KA 3OSSC 5CAIA 3I55A 4PJOG 1KC8C 2L89A 3H0FA 3PIOA 4HKEA 1YCYA 3RESA 4ZTFA 4M7AG 4C92E 2AZSA 4X34A 3JCMJ 4F7UG 5GMKl 2DEQA 2OTLQ 2X51A 4XU3A 2V1RA 5LJ3j 3OYHA 1VQOT 3LLRA 3JRZA 3CC4A 4E2FB 1ZQ1A 2AIRB 4M78D 3CCRA 4RTXA 1RAIB 3J7AF 2M9UA 4GY5A 3NPFA 4F7UF 4J7FA 2J6FA 1QKWA 3QBYA 4J9EA 1UHFA 3O8VA 1BB9A 5DLQE 2WSFE 1K8AU 2J05A 4LNPA 3VKIA 1AT1B 3QHSA 5GAOr 2E10A 3QKJA 1Q82R 3GIBA 4A53A 3CCSA 2CSIA 3FIFA 1S72A 3CCVA 2FRYA 4QQ6A 3OYJA 1PCXA 2DD5A 2DAQA 4BY6C 2QQBA 1KQ2A 3MEVA 2ED1A 2MAMA 1OULA 1AOJA 4Z89A 1H92A 3E19A 1UGRB 2QQRA 1W1FA 2DTHA 1AZEA
chains in the Genus database with same CATH topology
1HJDA 1RLPC 1EFNA 4ORZA 3FJ5A 1ZSGA 2ENMA 2KE9A 1CSKA 1M27C 4RTUA 1UUEA 2LCSA 1X69A 4LUEA 1K4US 2KT8A 3VS5A 2DILA 3REBB 4F17A 2ED0A 2LQWA 4AFZC 3M0UA 4J9GA 2CSQA 5FWCA 4OMQA 1UFFA 4EIKA 2CUBA 3H41A 1PRMC 2O9VA 1NYGA 1U5SA 4CC2A 4Z88A 1AD5A 4J9BA 2W0ZA 5IXBA 3KFVA 2MCNA 1SHFA 4RTYA 1NG2A 1WI7A 4GLMA 2DBKA 2EKHA 4JZ3A 1UGVA 3M0TA 2JW4A 2LP5A 3EG1A 3VS1A 2HCKA 1K9AA 2OI3A 2K2MA 4OMOA 1ABQA 1AVZC 2D1XA 2YT6A 2EGCA 3I9QA 2A36A 2H8HA 1OEBA 2L3SA 2FEIA 1VYVA 2AKKA 1W6XA 2LZ6B 2DJQA 1PHTA 1SHGA 2ESWA 3ULRB 2DM1A 3H0IA 3C0CA 1T3SA 2BZXA 3I5SA 2AZVA 1NLOC 1AWJA 4FSSA 2GQIA 2EQIA 1ZUUA 2KGTA 2YSQA 1E6HA 3EHQA 5I11A 1U3OA 4RTWA 1PNJA 2A28A 1SSHA 2RQUA 1UDLA 2JM9A 2DVJA 1KSWA 1MUZA 4AFUC 2BZYA 2KROA 4D8KA 2RQRA 2D0NA 1WDXA 4HVWA 2X3XD 1KIKA 4J9HA 1WIEA 2DNUA 2YUQA 2V1QA 3M0SA 2JTEA 3M0RA 2LMJA 2J7IA 2M51A 2MIOA 2CREA 2KYBA 2RF0A 3GBQA 1QWFA 1X27A 2KYMA 1YP5A 3VS7A 1WA7A 1AZGB 3SHWA 1YWOA 1Z9QA 2KRSA 1Y57A 3TSZA 2NUZA 2YUOA 2SRCA 2DF6A 1J3TA 2YUPA 4IIOA 1GL5A 1M8MA 1UG1A 2LNHB 1KJWA 3R6NA 2FPDA 2K7AA 1RLQC 2X3WD 5FWBA 2GTOA 4J9DA 4R0KA 5IH2A 1T3LA 1G83A 2XMFA 4RTTA 1G2BA 4RTVA 1UTIA 1B3QA 4JJCA 5IHNA 1H3HA 1ARKA 4ZNXA 1M3BA 2DX1A 2L3PA 1FMKA 1B07A 1X6GA 3EG2A 1MV0B 4K11A 2OAWA 1PRLC 2M0YA 1HD3A 1SRLA 2CUDA 2JS0A 4HCKA 2ROLA 4JJDA 1UJYA 3PVQA 1ABOA 1QLYA 1JQQA 2RPNA 1AWWA 2DMOA 1UHCA 1WLPB 3CQTA 1JU5C 2CH4W 1WXTA 1X2QA 3I35A 1Z9ZA 4F14A 2EPDA 2EBPA 3I5RA 2LJ1A 2DL5A 2DL3A 1RUWA 4CC3A 2EVRA 4IIMA 1RI9A 3TVTA 1QWEA 5IHKA 1QKXA 1BU1A 2AKLA 2JT4A 2L2PA 3H0HA 4HVVA 1TG0A 2E5KA 1HSQA 5EC7A 4WCIA 4CC4B 2DYBA 2PZ1A 2F2VA 1TUCA 1OPLA 2KBTA 2BZ8A 2DRKA 3M0PA 2NWMA 1MV3A 1S1NA 4QT7A 1I0CA 2YDLA 2EYWA 4LE9A 1AWXA 3U23A 3RBBB 1H8KA 2O88A 2DA9A 2OJ2A 5FW9A 1GBRA 3NHNA 4LN2A 2RN8A 3PVLA 3VS2A 1A0NB 3NGPA 1JXOA 2JM8A 2JMAA 2MOXA 1Y0MA 2RMOA 3O5ZA 4Z8AA 4JPBW 1BK2A 3SEMA 2CDTA 2K79A 4A63B 3NMZC 4HXJA 1SEMA 2FO0A 1YNZA 2DBMA 2HDAA 3THKA 1W70A 4OMMA 1UECA 2O31A 3EG0A 1AWOA 1OOTA 3UA7A 1X6BA 2K3BA 2KNBB 3VS4A 2C0OA 2VVKA 1OV3A 4ESRA 1IO6A 1VYUA 1K76A 2A37A 5GJVB 3VRZA 2F2XA 2ECZA 1M3CA 1CKAA 2DL4A 2GBQA 1I1JA 1TUDA 2FPEA 2GTJA 3QWXX 1JO8A 2EYYA 4AG1C 2SEMA 4M4ZA 4J9IA 1WFWA 2EGEA 2GNCA 1NEBA 2F2WA 1N5ZA 2EYXA 4LUDA 2HBWA 4J9CA 4OMPA 2RQTA 4Y92A 1CKBA 5GJWB 2K9GA 1UE9A 2DLPA 2ABLA 1M3AA 4F16A 1YN8A 2D8JA 2PNIA 3EHRA 2AK5A 4JZ4A 1UJ0A 1GRIA 3REAB 2D8HA 3VS0A 4CC7A 2B86A 2LJ3A 2KR3A 1YCSB 4DEXA 5I22A 2LQNA 2DE0X 3VS6A 2KEAA 4E6RA 2IIMA 4J9FA 1K0XA 1SPKA 1YWPA 3TSWA 5IHIA 3IQLA 3UF4A 1GFDA 1ZBJA 2KT1A 1NLPC 1PKSA 2DRMA 3VS3A 1T0JA 2JMCA 2K6DA 2DL8A 2W10A 1JXMA 2LJ0A 1V1CA 2RQVA 3M0QA 1QCFA 2KXCA 4OMLA 1WX6A 2CH4A 2PTKA 1X2KA 4HVUA 4OMNA 2ROTA 2EGAA 3VRYA 4D8DA 1WYXA 2EW3A 1T0HA 2QDLA 2VKNA 1GBQA 5HCKA 1NYFA 1FYNA 1X43A 2RQWA 1BBZA 2P4RA 2FRWA 4DEYA 1NEGA 1M30A 1WXUA 2O9SA 2LX7A 2FG0A 1VA7A 1GFCA 2KRNA 3LH5A 1K1ZA 3JV3A 4AFQC 2HSPA 3A98A 3H0FA 3EGUA 2J6KA 3RNJA 2EYZA 1KFZA 4GBQA 1ZX6A 4X1VA 5L23A 2AZSA 1LCKA 5IXFA 1NM7A 2O2OA 1E7OA 1K0SA 2CT4A 2G6FX 1ZUYA 2V1RA 4RTZA 4AG2C 1GCQA 3PE0A 1SRMA 4RTXA 1PWTA 3EG3A 3NPFA 1I07A 1WXBA 2KXDA 2RNAA 4KRTA 2J6OA 1E6GA 2YUNA 1VYTA 2J06A 2J6FA 1PKTA 3QWYA 1OPKA 1QKWA 3ZL7C 4J9EA 1UHFA 2C0IA 3UATA 2CT3A 1AEYA 1JEGA 1BB9A 2JS2A 2J05A 4LNPA 2HEQA 1GCQC 4JJBA 1ZLMA 5ECAA 2A08A 3UA6A 2CSIA 2KRMA 2FRYA 4RUGA 2BTTA 4AFSC 1GCPA 2GGRA 1XOVA 2ED1A 2JXBA 2FPFA 2L0AA 2I0NA 2L3QA 1U06A 2DL7A 1AOJA 4Z89A 2C0TA 1H92A 1ZUKA 2VWFA 1W1FA 1AZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJD A;  1RLP C;  1EFN A;  4ORZ A;  3FJ5 A;  1ZSG A;  2ENM A;  2KE9 A;  1CSK A;  1M27 C;  4RTU A;  1UUE A;  2LCS A;  1X69 A;  4LUE A;  1K4U S;  2KT8 A;  3VS5 A;  2DIL A;  3REB B;  4F17 A;  2ED0 A;  2LQW A;  4AFZ C;  3M0U A;  4J9G A;  2CSQ A;  5FWC A;  4OMQ A;  1UFF A;  4EIK A;  2CUB A;  3H41 A;  1PRM C;  2O9V A;  1NYG A;  1U5S A;  4CC2 A;  4Z88 A;  1AD5 A;  4J9B A;  2W0Z A;  5IXB A;  3KFV A;  2MCN A;  1SHF A;  4RTY A;  1NG2 A;  1WI7 A;  4GLM A;  2DBK A;  2EKH A;  4JZ3 A;  1UGV A;  3M0T A;  2JW4 A;  2LP5 A;  3EG1 A;  3VS1 A;  2HCK A;  1K9A A;  2OI3 A;  2K2M A;  4OMO A;  1ABQ A;  1AVZ C;  2D1X A;  2YT6 A;  2EGC A;  3I9Q A;  2A36 A;  2H8H A;  1OEB A;  2L3S A;  2FEI A;  1VYV A;  2AKK A;  1W6X A;  2LZ6 B;  2DJQ A;  1PHT A;  1SHG A;  2ESW A;  3ULR B;  2DM1 A;  3H0I A;  3C0C A;  1T3S A;  2BZX A;  3I5S A;  2AZV A;  1NLO C;  1AWJ A;  4FSS A;  2GQI A;  2EQI A;  1ZUU A;  2KGT A;  2YSQ A;  1E6H A;  3EHQ A;  5I11 A;  1U3O A;  4RTW A;  1PNJ A;  2A28 A;  1SSH A;  2RQU A;  1UDL A;  2JM9 A;  2DVJ A;  1KSW A;  1MUZ A;  4AFU C;  2BZY A;  2KRO A;  4D8K A;  2RQR A;  2D0N A;  1WDX A;  4HVW A;  2X3X D;  1KIK A;  4J9H A;  1WIE A;  2DNU A;  2YUQ A;  2V1Q A;  3M0S A;  2JTE A;  3M0R A;  2LMJ A;  2J7I A;  2M51 A;  2MIO A;  2CRE A;  2KYB A;  2RF0 A;  3GBQ A;  1QWF A;  1X27 A;  2KYM A;  1YP5 A;  3VS7 A;  1WA7 A;  1AZG B;  3SHW A;  1YWO A;  1Z9Q A;  2KRS A;  1Y57 A;  3TSZ A;  2NUZ A;  2YUO A;  2SRC A;  2DF6 A;  1J3T A;  2YUP A;  4IIO A;  1GL5 A;  1M8M A;  1UG1 A;  2LNH B;  1KJW A;  3R6N A;  2FPD A;  2K7A A;  1RLQ C;  2X3W D;  5FWB A;  2GTO A;  4J9D A;  4R0K A;  5IH2 A;  1T3L A;  1G83 A;  2XMF A;  4RTT A;  1G2B A;  4RTV A;  1UTI A;  1B3Q A;  4JJC A;  5IHN A;  1H3H A;  1ARK A;  4ZNX A;  1M3B A;  2DX1 A;  2L3P A;  1FMK A;  1B07 A;  1X6G A;  3EG2 A;  1MV0 B;  4K11 A;  2OAW A;  1PRL C;  2M0Y A;  1HD3 A;  1SRL A;  2CUD A;  2JS0 A;  4HCK A;  2ROL A;  4JJD A;  1UJY A;  3PVQ A;  1ABO A;  1QLY A;  1JQQ A;  2RPN A;  1AWW A;  2DMO A;  1UHC A;  1WLP B;  3CQT A;  1JU5 C;  2CH4 W;  1WXT A;  1X2Q A;  3I35 A;  1Z9Z A;  4F14 A;  2EPD A;  2EBP A;  3I5R A;  2LJ1 A;  2DL5 A;  2DL3 A;  1RUW A;  4CC3 A;  2EVR A;  4IIM A;  1RI9 A;  3TVT A;  1QWE A;  5IHK A;  1QKX A;  1BU1 A;  2AKL A;  2JT4 A;  2L2P A;  3H0H A;  4HVV A;  1TG0 A;  2E5K A;  1HSQ A;  5EC7 A;  4WCI A;  4CC4 B;  2DYB A;  2PZ1 A;  2F2V A;  1TUC A;  1OPL A;  2KBT A;  2BZ8 A;  2DRK A;  3M0P A;  2NWM A;  1MV3 A;  1S1N A;  4QT7 A;  1I0C A;  2YDL A;  2EYW A;  4LE9 A;  1AWX A;  3U23 A;  3RBB B;  1H8K A;  2O88 A;  2DA9 A;  2OJ2 A;  5FW9 A;  1GBR A;  3NHN A;  4LN2 A;  2RN8 A;  3PVL A;  3VS2 A;  1A0N B;  3NGP A;  1JXO A;  2JM8 A;  2JMA A;  2MOX A;  1Y0M A;  2RMO A;  3O5Z A;  4Z8A A;  4JPB W;  1BK2 A;  3SEM A;  2CDT A;  2K79 A;  4A63 B;  3NMZ C;  4HXJ A;  1SEM A;  2FO0 A;  1YNZ A;  2DBM A;  2HDA A;  3THK A;  1W70 A;  4OMM A;  1UEC A;  2O31 A;  3EG0 A;  1AWO A;  1OOT A;  3UA7 A;  1X6B A;  2K3B A;  2KNB B;  3VS4 A;  2C0O A;  2VVK A;  1OV3 A;  4ESR A;  1IO6 A;  1VYU A;  1K76 A;  2A37 A;  5GJV B;  3VRZ A;  2F2X A;  2ECZ A;  1M3C A;  1CKA A;  2DL4 A;  2GBQ A;  1I1J A;  1TUD A;  2FPE A;  2GTJ A;  3QWX X;  1JO8 A;  2EYY A;  4AG1 C;  2SEM A;  4M4Z A;  4J9I A;  1WFW A;  2EGE A;  2GNC A;  1NEB A;  2F2W A;  1N5Z A;  2EYX A;  4LUD A;  2HBW A;  4J9C A;  4OMP A;  2RQT A;  4Y92 A;  1CKB A;  5GJW B;  2K9G A;  1UE9 A;  2DLP A;  2ABL A;  1M3A A;  4F16 A;  1YN8 A;  2D8J A;  2PNI A;  3EHR A;  2AK5 A;  4JZ4 A;  1UJ0 A;  1GRI A;  3REA B;  2D8H A;  3VS0 A;  4CC7 A;  2B86 A;  2LJ3 A;  2KR3 A;  1YCS B;  4DEX A;  5I22 A;  2LQN A;  2DE0 X;  3VS6 A;  2KEA A;  4E6R A;  2IIM A;  4J9F A;  1K0X A;  1SPK A;  1YWP A;  3TSW A;  5IHI A;  3IQL A;  3UF4 A;  1GFD A;  1ZBJ A;  2KT1 A;  1NLP C;  1PKS A;  2DRM A;  3VS3 A;  1T0J A;  2JMC A;  2K6D A;  2DL8 A;  2W10 A;  1JXM A;  2LJ0 A;  1V1C A;  2RQV A;  3M0Q A;  1QCF A;  2KXC A;  4OML A;  1WX6 A;  2CH4 A;  2PTK A;  1X2K A;  4HVU A;  4OMN A;  2ROT A;  2EGA A;  3VRY A;  4D8D A;  1WYX A;  2EW3 A;  1T0H A;  2QDL A;  2VKN A;  1GBQ A;  5HCK A;  1NYF A;  1FYN A;  1X43 A;  2RQW A;  1BBZ A;  2P4R A;  2FRW A;  4DEY A;  1NEG A;  1M30 A;  1WXU A;  2O9S A;  2LX7 A;  2FG0 A;  1VA7 A;  1GFC A;  2KRN A;  3LH5 A;  1K1Z A;  3JV3 A;  4AFQ C;  2HSP A;  3A98 A;  3H0F A;  3EGU A;  2J6K A;  3RNJ A;  2EYZ A;  1KFZ A;  4GBQ A;  1ZX6 A;  4X1V A;  5L23 A;  2AZS A;  1LCK A;  5IXF A;  1NM7 A;  2O2O A;  1E7O A;  1K0S A;  2CT4 A;  2G6F X;  1ZUY A;  2V1R A;  4RTZ A;  4AG2 C;  1GCQ A;  3PE0 A;  1SRM A;  4RTX A;  1PWT A;  3EG3 A;  3NPF A;  1I07 A;  1WXB A;  2KXD A;  2RNA A;  4KRT A;  2J6O A;  1E6G A;  2YUN A;  1VYT A;  2J06 A;  2J6F A;  1PKT A;  3QWY A;  1OPK A;  1QKW A;  3ZL7 C;  4J9E A;  1UHF A;  2C0I A;  3UAT A;  2CT3 A;  1AEY A;  1JEG A;  1BB9 A;  2JS2 A;  2J05 A;  4LNP A;  2HEQ A;  1GCQ C;  4JJB A;  1ZLM A;  5ECA A;  2A08 A;  3UA6 A;  2CSI A;  2KRM A;  2FRY A;  4RUG A;  2BTT A;  4AFS C;  1GCP A;  2GGR A;  1XOV A;  2ED1 A;  2JXB A;  2FPF A;  2L0A A;  2I0N A;  2L3Q A;  1U06 A;  2DL7 A;  1AOJ A;  4Z89 A;  2C0T A;  1H92 A;  1ZUK A;  2VWF A;  1W1F A;  1AZE A; 
#chains in the Genus database with same CATH topology
 1HJD A;  1OU8 A;  4PJO D;  4ORZ A;  3OYN A;  1M90 R;  1PSF A;  5GMK h;  4M7A D;  4RTU A;  1C1A A;  2RHX A;  3EFO A;  3OYM A;  3CME T;  2VAS A;  4XTX A;  1ZA1 B;  2KT8 A;  3VS5 A;  2VC8 A;  1K73 R;  4OGE A;  4AFZ C;  1WJQ A;  3M0U A;  4IUV A;  4J9G A;  4M78 E;  3I55 T;  1Q81 R;  1Q7Y U;  4C5G A;  4XTY A;  1UFF A;  1MMG A;  4DA4 A;  3T9N A;  1EX4 A;  1U5S A;  4CC2 A;  4Z88 A;  3VU3 C;  2DXC A;  3KFV A;  3V8L A;  3ZEH A;  3CC4 T;  4ELY C;  3EG1 A;  4F7U A;  3CCR T;  2X4X A;  2QDY B;  3VS1 A;  4NOY A;  1K9A A;  3DB4 A;  4OMO A;  5I2M A;  5CO7 A;  5LJ5 g;  4RG8 A;  2FEI A;  1WQ7 A;  4X9C A;  3JCM h;  4J6Y A;  3JCM c;  1TUG B;  1SHG A;  3HFN A;  2DM1 A;  3C95 A;  2E65 A;  3JCM e;  2AZV A;  1NLO C;  1B34 A;  3CCS T;  4FSS A;  1W2B P;  2O4X A;  3CCV T;  4FCY A;  2Y4X A;  1LOJ A;  4ANJ A;  2XDD A;  4NL2 A;  2BUD A;  5I11 A;  1U3O A;  3OQ5 A;  2LT4 A;  2R57 A;  2RQU A;  3QG1 A;  4N4I A;  1YHQ A;  3H9N A;  2DJZ A;  2QYZ A;  2JM9 A;  2QTX A;  1VIE A;  1MUZ A;  5GAN g;  1N8R C;  4M75 E;  2ZPG B;  1PD1 A;  2KRO A;  5LJ3 d;  2DIQ A;  1KIK A;  5KYY B;  2DNU A;  2V1Q A;  1WHG A;  3JB9 G;  2LMJ A;  2J7I A;  3GBQ A;  2PUO B;  2D9T A;  1UB4 A;  5CIU A;  1UGS B;  2KSS A;  1NPP A;  1RI0 A;  1PC0 A;  4M7D C;  2SRC A;  2DF6 A;  2BIV A;  2P0Q A;  4IIO A;  3L2Q A;  3OW2 A;  3JB9 F;  4NS5 A;  1UG1 A;  1PG5 B;  3G71 A;  3RUX A;  3M59 A;  5FWB A;  4R0K A;  2F5T X;  1T3L A;  4FM4 B;  1VQO Q;  4CRI A;  2CYZ B;  2XG8 D;  4BE1 A;  1ARK A;  2WSE E;  1R0B G;  3PT9 A;  2ZCF B;  3INZ A;  4ZNX A;  3RKW A;  3PMI A;  4M77 E;  4ELZ C;  5GAM f;  3DB3 A;  1N27 A;  1X6G A;  3CCE Q;  3C4S A;  5FU6 B;  1W2B S;  1PRL C;  5KH6 A;  4LDV A;  1HD3 A;  3DLM A;  1QP2 A;  5CKF A;  4JJD A;  1QLY A;  2F5K A;  1SG5 A;  4M78 B;  2P0K A;  1QMC A;  1UHC A;  5LJ3 g;  4XAX B;  1VQ4 A;  2M16 A;  1JU5 C;  5KYN A;  1WXT A;  1IRE B;  1VQM A;  1YHQ T;  1Z9Z A;  1ZHI A;  4F14 A;  2E6N A;  3I5R A;  2XIC A;  3M56 A;  3GLX A;  2E5Q A;  4C0D C;  4IIM A;  5IT9 E;  2ZPI B;  3SWN A;  2H3J A;  3TVT A;  5KYU B;  2XID A;  2AKL A;  2L2P A;  2ZZD A;  2R5A A;  1YIT Q;  2HNI A;  1M1F A;  4F04 B;  4CC4 B;  2PZ1 A;  2RJC A;  2F2V A;  4C92 C;  3CME Q;  1TUC A;  1OPL A;  3G4S A;  3EGD A;  3M0P A;  2QXF A;  1MV3 A;  5DY9 A;  4E7J A;  1I0C A;  4LE9 A;  4EMK B;  3HL8 A;  3U23 A;  1IRX A;  3I55 Q;  3WXM B;  2O88 A;  5GAO m;  2RHY A;  1GBR A;  4PJO B;  4N0A A;  3NHN A;  3VUB A;  2MPX C;  2PQW A;  3G71 T;  3NTH A;  1A0N B;  3L42 A;  1JXO A;  1MMD A;  2JM8 A;  2DTO A;  4IUP A;  2RMO A;  3L2U A;  1NE8 A;  4JPB W;  3SEM A;  3CC4 Q;  2CDT A;  4A63 B;  2YXY A;  4PJM A;  4C5E A;  3CCR Q;  2LCC A;  5FU7 C;  3EFR A;  3VJP A;  4C5I A;  2COW A;  3QZ9 B;  2O31 A;  1BI3 A;  1OOT A;  1X6O A;  2M02 A;  3UA7 A;  2K3B A;  4MDX A;  4KGV B;  1G3T A;  1OU9 A;  1OV3 A;  1G3S A;  4ESR A;  3HP9 A;  1I81 A;  2KAF A;  5GAN 5;  2OX7 A;  3CCS Q;  1S72 Q;  1VQ4 T;  3CCV Q;  2GBQ A;  2H3E B;  3VUZ A;  2GTJ A;  4IUR A;  1VQM T;  4AG1 C;  5FU6 C;  3MEU A;  4J6X A;  1VQL A;  2EQJ A;  1M8V A;  1PSE A;  4O5V A;  4Y91 A;  4J9C A;  4OMP A;  2RQT A;  4M78 C;  1I4K 1;  2K9G A;  2DLP A;  5C6S A;  2ABL A;  4F16 A;  4E47 A;  4PKC C;  1YN8 A;  4KH1 B;  2AK5 A;  4JZ4 A;  1UJ0 A;  3M55 A;  1GXI E;  2DO3 A;  3VS0 A;  3JB9 I;  4BAC A;  3G4S T;  3BY7 A;  1YCS B;  4DEX A;  4PLL A;  4PFZ A;  4KH0 B;  1M2V A;  2LDM A;  1RAG B;  3OYY A;  4E6R A;  1TWB A;  4J9F A;  1BIB A;  5L8R E;  3IQL A;  3M4G A;  3VS3 A;  1D1C A;  4XTV A;  3ZBD A;  2L8D A;  3UT1 A;  2LVM A;  2FHD A;  4J83 A;  1V1C A;  2RQV A;  2EFI A;  2E41 A;  3S3N A;  1B7T A;  2KXC A;  3QPH A;  5C0M A;  2QK0 A;  3CCL A;  1N9S A;  1WPY A;  3VRY A;  1WYX A;  4R55 A;  2LCL A;  3GOX A;  2L5Q A;  3JCM f;  3JCM d;  2FZG B;  4Z02 A;  1BBZ A;  2P4R A;  3JCM X;  3I56 A;  2FRW A;  2K3X A;  4MDW A;  1WXU A;  2O9S A;  2F69 A;  1Q81 C;  2LX7 A;  2FG0 A;  4M7D D;  4M75 C;  2JZ2 A;  3LH5 A;  1K1Z A;  4AFQ C;  3MP1 A;  3A98 A;  4C0Z A;  3EGU A;  2J6K A;  2NLU A;  3FJP A;  4C92 G;  4IKF A;  1ZX6 A;  3P8H A;  8ATC B;  1VQL T;  1YHQ Q;  4YTL A;  1NPR A;  3CCJ A;  4TVR A;  1TTH B;  5GAO l;  1LJO A;  4A4H A;  1G5V A;  4RTZ A;  4UC4 A;  1GCQ A;  3TQ7 P;  2RHU A;  2LT1 A;  2Y4Y A;  3P8D A;  2ZPH B;  3CC2 A;  2KMT A;  2RNA A;  4KRT A;  2J6O A;  1E6G A;  2YUN A;  3H8Z A;  4II1 A;  1PKT A;  3QII A;  1TXQ A;  3OYC A;  3HHT B;  4MMK A;  5KCH A;  5A0L A;  1AEY A;  1MMN A;  5GAN 4;  3OW2 P;  2EKO A;  2FVU A;  5ECA A;  1D0X A;  4M77 C;  3RKY A;  3G71 Q;  2WAC A;  4RUG A;  3JCM W;  1GCP A;  2GGR A;  1XOV A;  2I0N A;  1U06 A;  2DD4 A;  2DL7 A;  1VQ5 A;  1KHI A;  2HL3 A;  5J39 A;  1IGQ A;  3Q1J A;  5GAN 2;  3M57 A;  2V8I A;  1RLP C;  2KE9 A;  4C92 D;  2HMA A;  3E9F A;  1EIF A;  4E7L A;  5GAM e;  4LUE A;  2LTO A;  1K4U S;  3UWN A;  1ACM B;  4F17 A;  2ZGW A;  3CPW A;  2EJF A;  2DER A;  4M78 G;  2HSE B;  2CSQ A;  3G6E A;  1VIF A;  2RJF A;  2CP0 A;  1VQ4 Q;  3QJ6 A;  2JN0 A;  1PRM C;  2CZ7 B;  2O9V A;  1NYG A;  1VQM Q;  2JTM A;  2RK1 A;  2G3R A;  4PLI A;  2LX9 A;  1SHF A;  3EH1 A;  3CCJ T;  4NL3 A;  4LD9 K;  1H64 1;  1Y96 B;  2KDS A;  1PM3 A;  1NG2 A;  4M78 F;  1UGQ B;  1QQJ A;  3QZ5 B;  2I2L A;  2E12 A;  1UGV A;  2LP5 A;  2MI6 A;  1K9M U;  2EIF A;  2HCK A;  3L2W A;  3OMG A;  4FL6 A;  2EGC A;  5KYY A;  1JRI A;  3G4S Q;  2DET A;  2QTV A;  2L3S A;  3OW2 S;  2DJQ A;  1YIJ T;  3L2V A;  2ESW A;  3MCA B;  3CMA A;  2QQA A;  2X35 A;  2P4T A;  3H0I A;  3C0C A;  3QYH B;  1T3S A;  3I5S A;  1MNE A;  3OYD A;  2HZY A;  2PVO B;  4JRI A;  4JLI A;  2KGT A;  2HQX A;  4AMC A;  1YJW A;  1PNJ A;  2GFA A;  2XK0 A;  5CQY A;  1ZBX A;  4C8Q E;  4HCC A;  2E70 A;  1SSH A;  4PJO F;  3DLL A;  1VQ5 T;  2A7Y A;  2AT1 B;  2DVJ A;  4M7A F;  4QQG A;  4AFU C;  4D8K A;  2KVQ G;  2X3X D;  5FRM A;  2QEX A;  3C12 A;  2FB7 A;  1Y07 A;  3G7Z A;  7AT1 B;  5HKC A;  2CRE A;  2KYB A;  2C06 A;  1N9R A;  4KBM B;  3G6E T;  1WA7 A;  3SHW A;  1Z9Q A;  5GAN 8;  4LXC A;  2KRS A;  1Q82 U;  1Q95 G;  2NUZ A;  2XDB A;  1J3T A;  3CD6 A;  5A0G A;  1GL5 A;  4M78 A;  1K8A R;  2LNH B;  1KJW A;  1VQL Q;  2VGN A;  3GNG A;  2K7A A;  1HK9 A;  4PL6 A;  2GTO A;  5LJ5 f;  4HA8 A;  3L2Z A;  2EWN A;  4HT9 A;  5GAM j;  4DBR A;  4RTT A;  5LL6 S;  1G2B A;  4M7D B;  2R5M A;  4RTV A;  1B3Q A;  1WHJ A;  4M77 G;  1M90 U;  1H3H A;  1OI1 A;  1MGQ A;  3M5A A;  3BFM A;  1FMK A;  5KYU A;  5GMK e;  3URG A;  3QO3 A;  2V8K A;  4A54 A;  1K73 U;  5D7U A;  2JTF A;  3CMA T;  1RAB B;  1WGS A;  1FMV A;  1SRL A;  2CUD A;  1D1B A;  4M75 D;  1M1K R;  2RA2 A;  3PVQ A;  4EMK A;  4LDY A;  1JQQ A;  1OX8 A;  1RAD B;  3SDZ A;  2DMO A;  1D0Y A;  5GAN f;  5D6W A;  4IUQ A;  5GAN 3;  4PJO A;  1YJW T;  3CQT A;  2CH4 W;  1Q7Y R;  4M7A A;  3I35 A;  4XQ3 A;  3CCL Q;  2EBP A;  2LJ1 A;  2DL3 A;  1M9S A;  4FYX B;  1M4Z A;  1MHN A;  5IN1 A;  2M0O A;  1BI2 A;  4B6M A;  2QEX T;  2HQH A;  2JT4 A;  1NZ9 A;  2VXF A;  5CR2 A;  2E5K A;  1VQ9 A;  2FZC B;  1VQK T;  2E3I A;  2BZ8 A;  3I56 Q;  1FXX A;  4C0D B;  2QI2 A;  2DXT A;  2CP6 A;  2EYW A;  2YDL A;  2X4J A;  2K5L A;  2COY A;  3RBB B;  3BDL A;  4FT2 A;  4M77 D;  2OJ2 A;  5FW9 A;  3CD6 T;  4IUU A;  1VQ6 T;  3HPW A;  2RN8 A;  4C92 B;  3PVL A;  2K57 A;  2E4H A;  2JMA A;  4FT4 A;  2ZPB B;  2K5I A;  4DOW A;  3BDU A;  3O5Z A;  4Z8A A;  1BK2 A;  2RK2 A;  4IUT A;  1WQW A;  2DXU A;  2MYS A;  3MEA A;  3M9Q A;  4F7U E;  2DTI A;  2FO0 A;  3A8H B;  1YNZ A;  1C0M A;  5KE3 A;  3CC2 Q;  1SF9 A;  1BI0 A;  1R0C B;  3CPF A;  3FDR A;  1UEC A;  1PD0 A;  1AWO A;  4LDW A;  3EFS A;  4BDY A;  1IO6 A;  3ME9 A;  3VRZ A;  1V76 A;  2F2X A;  2ECZ A;  3CCQ A;  1M3C A;  5FU7 B;  3EH2 A;  1I1J A;  3MP8 A;  2EYY A;  5I2S A;  5KYX B;  2GNC A;  2QQS A;  2F2W A;  3LX7 A;  1VQ8 A;  1VQ5 Q;  5GMK j;  2EYX A;  1QP3 A;  4FIB A;  4LUD A;  3DKM A;  4N4H A;  2HBW A;  2K4Y A;  3QJY A;  1CKB A;  5GAN 7;  5GAM d;  4BI3 A;  1M3A A;  1O9S A;  1QVG A;  2PNI A;  1VQ9 T;  2PUK B;  1RAH B;  2D8H A;  3REA B;  2LJ3 A;  1ZSZ C;  4DOV A;  4PFP A;  5I22 A;  3CPW P;  2QAZ A;  3VS6 A;  3OYI A;  2KEA A;  3JCM V;  1OQK A;  2IIM A;  3EG9 B;  3G6E Q;  1SPK A;  5J26 A;  5IHI A;  3UF4 A;  1KC8 U;  2KT1 A;  2DRM A;  3PNW C;  1Q86 C;  2XHC A;  4GLK A;  2BE9 B;  1NJI C;  2K6D A;  1LPL A;  2W10 A;  3FRN A;  4J8O A;  2JJ9 A;  1KG1 A;  2VUB A;  2VGM A;  3M0Q A;  3OYE A;  1QCF A;  3OS1 A;  3E1S A;  1WX6 A;  2CH4 A;  3M53 A;  4OMN A;  2EGA A;  1I5L A;  2VV5 A;  1X75 C;  1WNL A;  2EW3 A;  3V8J A;  2QDL A;  3NTI A;  4MML A;  3AHU A;  1GBQ A;  2DIG A;  1NBE B;  1FYN A;  1X43 A;  1RAE B;  2RQW A;  3CMA Q;  3CBO A;  4C8Q C;  3PIP A;  4PK4 A;  4AT1 B;  4DEY A;  3CCQ T;  1KQS A;  1QW1 A;  2YHT A;  4HCZ A;  1WJR A;  4OGC A;  5GAM g;  1YJW Q;  3RNJ A;  1KFZ A;  2RD1 A;  2X9H A;  4GBQ A;  5AYF A;  2K5F A;  4X1V A;  5L23 A;  4RMO A;  1LCK A;  3HRS A;  3OS2 A;  1VQ8 T;  1AHJ B;  4A4G A;  5IXF A;  2O2O A;  2CT4 A;  3OYA A;  4M75 B;  3RDV A;  2G6F X;  1ZUY A;  4QQD A;  2RM4 A;  4EMH A;  4OB1 B;  3CPW S;  2GQV A;  1D3B B;  2QEX Q;  3PE0 A;  1TSF A;  3RIR A;  3JAM E;  4ME7 A;  2OAU A;  3OS0 A;  1I07 A;  1WHH A;  5HK3 A;  1IHV A;  2KXD A;  1VYT A;  2J06 A;  3A8L B;  1U1T A;  3QWY A;  1KD1 C;  3ZL7 C;  4QVC A;  3PGG A;  4BI4 A;  2GF7 A;  4DBQ A;  3CD6 Q;  1MND A;  1ZLM A;  4PJJ A;  1YI2 A;  4LDU A;  1XQH A;  4LD6 A;  2JNG A;  2O4X B;  2BTT A;  1XJW B;  4EMG A;  3JCM P;  1Y71 A;  5LJ5 h;  3JCM Q;  4M7D G;  2L0A A;  2ZAE A;  2L3Q A;  2JVV A;  1Y96 A;  4JRP A;  2C0T A;  3C94 A;  5LJ5 e;  4M77 B;  1EFN A;  3FJ5 A;  1ZSG A;  1RL2 A;  2ENM A;  4XU1 A;  1YJ9 A;  4ZGE B;  4M7D F;  2JOY A;  2ED0 A;  2LQW A;  3E2U A;  2YLC A;  1D0Z A;  2LC4 A;  5FWC A;  1FMW A;  4OMQ A;  5GAN h;  4EIK A;  2CUB A;  2E6Z A;  3OMC A;  1K8A C;  3H41 A;  4ZTJ A;  2PU9 B;  5J3B A;  4J9B A;  2W0Z A;  2MCN A;  5GAN e;  1QCO A;  1TS9 A;  1N8R U;  1WI7 A;  5DLO A;  2DBK A;  3CBP A;  4JZ3 A;  3M0T A;  1JBM A;  4HCB A;  2OI3 A;  1IGU A;  1V29 B;  1AVZ C;  2D1X A;  2RJE A;  2YT6 A;  3I9Q A;  3PFS A;  2H8H A;  1VYV A;  3QYG B;  1W6X A;  2LZ6 B;  1QVP A;  1M1K C;  1OZ3 A;  1PHT A;  4A4K A;  4A4F A;  3A5Z B;  2FYK A;  1YI2 T;  2GQI A;  1Q7Y C;  3VYH B;  4XU2 A;  5M9O A;  1SKU B;  2F1L A;  4RTW A;  3OBW A;  2A28 A;  1C6V X;  2HKN A;  4C92 F;  2XD0 A;  2BZY A;  4N4G A;  2RQR A;  2CP3 A;  3SD4 A;  4M7D A;  1WDX A;  4HVW A;  1W4S A;  4ZGD B;  4J9H A;  1YJ9 T;  2RB6 A;  4MZM A;  5LJ3 h;  2EYQ A;  1YIJ A;  2QQ9 A;  4BB7 A;  4J7I A;  3ZFJ A;  1X27 A;  2KYM A;  1YP5 A;  3CCQ Q;  2QGF B;  4JDS A;  1YWO A;  1Q86 R;  1MMA A;  1Y57 A;  1NJI R;  2DPP B;  4JLG A;  3QSU A;  4BUG A;  3JCM g;  5GAO p;  2NUP B;  3R6N A;  1HXD A;  3X20 B;  1RLQ C;  4J9D A;  5IH2 A;  3CEY A;  1G83 A;  2EQM A;  3V8K A;  2XMF A;  1JB0 E;  2MMP A;  9ATC B;  1QVG P;  4KUL A;  3LWI A;  1M3B A;  2DX1 A;  2LRQ A;  2L3P A;  5KCO A;  2IVW A;  1IHW A;  3EG2 A;  4C8Q D;  1MV0 B;  3VV0 A;  4K11 A;  1G3W A;  2EQU A;  2OAW A;  1LVK A;  1YFN A;  3FC3 A;  2ROL A;  1UJY A;  1ABO A;  3OYL A;  5FLX E;  1WJS A;  1YJN A;  1RAC B;  3MPU B;  4RCB A;  2LNV A;  1D1A A;  4WF2 A;  4C92 A;  5A2Q E;  1X2Q A;  5D6X A;  2CGH A;  4L5G A;  4PJL A;  3NTK A;  4J5Y A;  3HRT A;  3S6W A;  1RUW A;  2K3Y A;  1QVF A;  3OB9 A;  5I21 A;  1RI9 A;  5KYW B;  4QKU A;  3GPL A;  5IHK A;  2EJ9 A;  1WHM A;  2E3H A;  1TG0 A;  5EC7 A;  2PVD B;  4WCI A;  2X4W A;  1KD1 R;  2KBT A;  2BE7 D;  3MKD A;  2DRK A;  3PMT A;  1VUB A;  3HRU A;  3G1J A;  1S1N A;  2RO0 A;  4QT7 A;  1KQS P;  4ZN3 A;  4X9D A;  1H8K A;  2NUT B;  3P8B B;  3TRE A;  2DA9 A;  3AT1 B;  2V26 A;  3EGX B;  4LN2 A;  2EAY A;  1F1B B;  1IB8 A;  3NGP A;  1M5Q 1;  1QVG S;  3CCM A;  2R58 A;  2OTJ A;  4M75 G;  1Y0M A;  5KYX A;  4P5N A;  3CXC P;  2K79 A;  3NMZ C;  4RG2 A;  1BCM A;  1SEM A;  2CS7 A;  2DBM A;  4N0A C;  2HDA A;  4JJN K;  3VYG A;  1VQK A;  4M75 F;  1W70 A;  1X6B A;  5CKE A;  1Y7X A;  3A8M B;  4QVZ A;  4E7S A;  3VS4 A;  1BCO A;  2VVK A;  3CCE T;  4FW2 A;  2QAS A;  3FLG A;  4BD3 A;  2ATC B;  3EG9 A;  4MZP A;  5GJV B;  1VQ6 A;  1YI2 Q;  2DL4 A;  1CKA A;  1YJN T;  4XTZ A;  2QGG A;  1LNX A;  3QWX X;  4CI0 C;  3RER A;  4JUV A;  2RI2 A;  4O6J A;  2SEM A;  1BKB A;  4M4Z A;  4J9I A;  2KK4 A;  5LJ5 d;  2BKD N;  1N5Z A;  3SFM A;  1QCN A;  3JSC A;  4FSX A;  4D6W A;  4PJN A;  1R77 A;  3CC7 A;  1TU0 B;  5GJW B;  1KQS S;  1YJ9 Q;  4CC7 A;  2X4Y A;  2B86 A;  3OYK A;  3CBM A;  1KQ1 A;  6AT1 B;  2LQN A;  1SSF A;  2DE0 X;  2O01 E;  1YIT T;  4M77 F;  1Q81 U;  3LW5 E;  3OY9 A;  1M1K U;  4FYY B;  3TSW A;  1ZBJ A;  5GAN d;  2B8A A;  4J6W A;  1T0J A;  4XTW A;  2DFU A;  1JJ2 P;  4OB3 B;  1ZSZ B;  3V7R A;  5EG2 A;  3CXC S;  3CCM T;  4ATO A;  2OTJ T;  1M1G A;  2RHZ A;  2ZPE B;  2P0P A;  4C0G A;  1XNI A;  4KGX B;  2XI9 A;  1X2K A;  4HVU A;  4M75 A;  4D8D A;  1BI1 A;  1T0H A;  4DBH A;  1D3B A;  2VKN A;  3OYG A;  5HCK A;  3LGF A;  3X24 B;  4JS5 A;  3RMS A;  3ER0 A;  2V8J A;  1NEG A;  5CK9 A;  1M30 A;  1VQ7 A;  1VA7 A;  4RKU E;  1GFC A;  3JV3 A;  4KGZ B;  3CCJ Q;  2HSP A;  1FX7 A;  2DZC A;  3HKS A;  4PJO E;  2EYZ A;  2ZPF B;  4LDX A;  1S72 T;  4M7A E;  4C8Q B;  2KY9 A;  4Y28 E;  1NM7 A;  3MEW A;  1E7O A;  1K0S A;  3CC7 T;  3EAE A;  1UEB A;  5A0D A;  1BIA A;  4AG2 C;  2YRC A;  8AT1 B;  1WZO A;  1SRM A;  4L6V 5;  5LJ3 f;  1PWT A;  4M77 A;  3EG3 A;  1YIJ Q;  1X01 A;  1WXB A;  2HAX A;  3H6Z A;  4XU0 A;  3OYF A;  4ZN1 A;  3HTR A;  1OPK A;  1JJ2 S;  5D6Y A;  2C0I A;  3UAT A;  2CT3 A;  5KE2 A;  3L2R A;  1JEG A;  2JS2 A;  5CKD A;  3HSB A;  3FB9 A;  2FZK B;  1UGP B;  2HEQ A;  1GCQ C;  4EDU A;  4JJB A;  2D0Q B;  1EZZ B;  2A08 A;  3UA6 A;  2RI5 A;  2KRM A;  4AFS C;  2JUF A;  3X26 B;  3J80 E;  1VOM A;  3QDR B;  2JXB A;  2FPF A;  2MWO A;  4B9W A;  2CZ6 B;  2XU8 A;  1ZUK A;  2VWF A;  4FW1 A;  3BE3 A;  4KT0 E;  2DK3 A;  1CSK A;  4Q5W A;  4RCC A;  1IXD A;  2QA4 A;  3MHX A;  1M27 C;  2CP5 A;  3TU4 K;  1UUE A;  1XTD A;  2LCS A;  5FRO A;  3V7C A;  1X69 A;  3HFO A;  2DEU A;  4FU6 A;  3JB9 J;  5CKB A;  2DIL A;  3REB B;  1RAA B;  1VQP A;  1D09 B;  4EPC A;  3GP8 A;  1VQ7 T;  3NFC A;  2L3R A;  4JRK A;  1YJN Q;  4E7Z A;  3LYI A;  2YRD A;  3SB2 A;  3KBG A;  1RAF B;  1KC8 R;  1VQN A;  1AD5 A;  5IXB A;  2YLB A;  3CCU A;  4RTY A;  1KHC A;  1R8O B;  1QVF P;  4GLM A;  3JB9 D;  3OSV A;  3MO8 A;  2EKH A;  2JW4 A;  3BW1 A;  2XDP A;  1P92 A;  2RHI A;  3ASK A;  3A8O B;  5CCA A;  2K2M A;  3EFO B;  3M58 A;  1ABQ A;  5DM7 R;  2HKQ B;  5GAN 6;  2CP2 A;  2A36 A;  3RMQ A;  1OEB A;  2RH2 A;  2AKK A;  1G8X A;  2CZ1 B;  3ULR B;  3TEE A;  2BZX A;  4BE2 A;  2HQE A;  2VB6 A;  1AWJ A;  4XK8 E;  2EQI A;  1ZUU A;  3N5B B;  3A1P A;  3CCM Q;  2OTJ Q;  1WHK A;  2YSQ A;  1N6A A;  2KI7 A;  3D7S B;  1E6H A;  3EHQ A;  3GNF B;  5GAO n;  4JRQ A;  4KUI A;  2NUP A;  4M7A B;  3OBY A;  1UDL A;  1TH7 A;  3CXC A;  4F7U B;  1KSW A;  4HT8 A;  2OTL A;  4B9X A;  1G3Y A;  2D0N A;  1VQK Q;  2DKG A;  3OYB A;  2QA4 T;  2GCX A;  4MZT A;  1K9M C;  1WIE A;  3L1A A;  2YUQ A;  3F70 A;  3M0S A;  2JTE A;  3M0R A;  4XTU A;  2P84 A;  1VQP T;  2VXE A;  1OYX A;  2M51 A;  2MIO A;  2RF0 A;  1QWF A;  3VS7 A;  1VQ6 Q;  5HY6 A;  1AZG B;  4BDZ A;  1B34 B;  4PNO A;  2D6F A;  3TSZ A;  2YUO A;  1QVF S;  4KUD K;  2NYS A;  2YUP A;  1VQN T;  4OB2 B;  1M8M A;  3CCU T;  2IG0 A;  4R56 A;  2FPD A;  2X3W D;  4QVD A;  5CKH A;  3CC7 Q;  2MWP A;  3QDF A;  4FYW B;  2RI3 A;  4DBF A;  1UTI A;  5CQX A;  4JJC A;  5IHN A;  2VYT A;  5KYW A;  1B07 A;  4OMF B;  4OB0 B;  2K2V A;  3MJX A;  3KXT A;  4E7H A;  2M0Y A;  5FRN A;  5GAO q;  2JS0 A;  4HCK A;  5IAY A;  2RPN A;  2QG9 B;  1AWW A;  2NUT A;  1JJ2 A;  2KQW A;  3J81 E;  1Q82 C;  1WLP B;  3QUI A;  2MF2 A;  3EGX A;  2CZ0 B;  1IZ6 A;  4PFO A;  4OVA A;  2GFU A;  5AT1 B;  3S3M A;  2DZ9 A;  2EPD A;  2DL5 A;  2OTL T;  4C0F A;  4CC3 A;  3OA6 A;  1VQ9 Q;  1WHL A;  2EVR A;  3UPU A;  4EMK C;  2A3L A;  1O75 A;  1N8R R;  2MK5 A;  1QWE A;  4OF1 A;  3LH0 A;  1QKX A;  1BU1 A;  3H0H A;  4HVV A;  3V7S A;  1HSQ A;  5CVI A;  1M90 C;  4PJO C;  2DYB A;  3QXE B;  4M7A C;  5GMK i;  2LQ8 A;  3JCM b;  2HD0 A;  2Y90 A;  2E1H A;  3KUF A;  2NWM A;  1VQ7 Q;  3LWH A;  3JB9 H;  2IPO B;  1K73 C;  4FYV B;  1AWX A;  3RKX A;  5GMK m;  3E9G A;  2HBP A;  4C8Q G;  2EJG A;  4E7I A;  3VS2 A;  1W2B A;  5HK0 A;  2MOX A;  3X28 B;  4DQ2 A;  4BE0 A;  3SWN B;  2AHJ B;  4HXJ A;  4C8Q F;  4ZGJ B;  1OZ2 A;  4V2S A;  2A0F B;  3THK A;  3M54 A;  2DXB A;  4OMM A;  2YRV A;  3EGD B;  3EG0 A;  5LJ3 e;  2KNB B;  2PVG B;  2C0O A;  2DVE A;  2HL5 C;  2CKK A;  1FWZ A;  3A8G B;  1VYU A;  2CP7 A;  2COZ A;  1K76 A;  2A37 A;  1Q86 U;  1NJI U;  5LJ5 j;  1VQ8 Q;  1H3Z A;  1TUD A;  2FPE A;  1JO8 A;  1ZSZ A;  1WFW A;  2EGE A;  2XKO C;  1NEB A;  2E64 A;  1BYM A;  2RJD A;  1U8R A;  3WVD B;  3X25 B;  2DYI A;  3TCJ A;  1TOV A;  4BI8 B;  4Y92 A;  1VQO A;  3CCL T;  1UE9 A;  4M7D E;  3WVE B;  4WTO B;  2M1H A;  2QA4 Q;  2D8J A;  4L59 A;  3EHR A;  1OX9 A;  1YBY A;  1GRI A;  3UDC A;  3LGL A;  5GAM h;  2KR3 A;  1KK7 A;  2EQK A;  1I8F A;  4OP0 A;  1VQP Q;  3CCE A;  4A4E A;  5GAN j;  4BY6 B;  1I5O B;  2Z0W A;  2WSC E;  3PTA A;  1K0X A;  1YWP A;  4VUB A;  3I56 T;  1GFD A;  1NLP C;  1PKS A;  2LQK A;  2FL7 A;  2JMC A;  3OS5 A;  1VQN Q;  2DL8 A;  1ZA2 B;  3MP6 A;  3CCU Q;  1JXM A;  4JS4 A;  2LJ0 A;  4C8Q A;  1U1S A;  4OML A;  2PTK A;  2ROT A;  1M2O A;  3S3O A;  1K9M R;  1HYO A;  4QW2 A;  4C5H A;  3R6O A;  3FEO A;  1YIT A;  1KD1 U;  1NYF A;  3M4Y A;  1M2V B;  3MET A;  3CC2 T;  3CME A;  1DJ7 B;  3SWN C;  2YWW A;  3RR6 A;  3GF5 A;  2KRN A;  4E7K A;  3OSS C;  5CAI A;  3I55 A;  4PJO G;  1KC8 C;  2L89 A;  3H0F A;  3PIO A;  4HKE A;  1YCY A;  3RES A;  4ZTF A;  4M7A G;  4C92 E;  2AZS A;  4X34 A;  3JCM J;  4F7U G;  5GMK l;  2DEQ A;  2OTL Q;  2X51 A;  4XU3 A;  2V1R A;  5LJ3 j;  3OYH A;  1VQO T;  3LLR A;  3JRZ A;  3CC4 A;  4E2F B;  1ZQ1 A;  2AIR B;  4M78 D;  3CCR A;  4RTX A;  1RAI B;  3J7A F;  2M9U A;  4GY5 A;  3NPF A;  4F7U F;  4J7F A;  2J6F A;  1QKW A;  3QBY A;  4J9E A;  1UHF A;  3O8V A;  1BB9 A;  5DLQ E;  2WSF E;  1K8A U;  2J05 A;  4LNP A;  3VKI A;  1AT1 B;  3QHS A;  5GAO r;  2E10 A;  3QKJ A;  1Q82 R;  3GIB A;  4A53 A;  3CCS A;  2CSI A;  3FIF A;  1S72 A;  3CCV A;  2FRY A;  4QQ6 A;  3OYJ A;  1PCX A;  2DD5 A;  2DAQ A;  4BY6 C;  2QQB A;  1KQ2 A;  3MEV A;  2ED1 A;  2MAM A;  1OUL A;  1AOJ A;  4Z89 A;  1H92 A;  3E19 A;  1UGR B;  2QQR A;  1W1F A;  2DTH A;  1AZE A; 
#chains in the Genus database with same CATH homology
 1HJD A;  1RLP C;  1EFN A;  4ORZ A;  3FJ5 A;  1ZSG A;  2ENM A;  2KE9 A;  1CSK A;  1M27 C;  4RTU A;  1UUE A;  2LCS A;  1X69 A;  4LUE A;  1K4U S;  2KT8 A;  3VS5 A;  2DIL A;  3REB B;  4F17 A;  2ED0 A;  2LQW A;  4AFZ C;  3M0U A;  4J9G A;  2CSQ A;  5FWC A;  4OMQ A;  1UFF A;  4EIK A;  2CUB A;  3H41 A;  1PRM C;  2O9V A;  1NYG A;  1U5S A;  4CC2 A;  4Z88 A;  1AD5 A;  4J9B A;  2W0Z A;  5IXB A;  3KFV A;  2MCN A;  1SHF A;  4RTY A;  1NG2 A;  1WI7 A;  4GLM A;  2DBK A;  2EKH A;  4JZ3 A;  1UGV A;  3M0T A;  2JW4 A;  2LP5 A;  3EG1 A;  3VS1 A;  2HCK A;  1K9A A;  2OI3 A;  2K2M A;  4OMO A;  1ABQ A;  1AVZ C;  2D1X A;  2YT6 A;  2EGC A;  3I9Q A;  2A36 A;  2H8H A;  1OEB A;  2L3S A;  2FEI A;  1VYV A;  2AKK A;  1W6X A;  2LZ6 B;  2DJQ A;  1PHT A;  1SHG A;  2ESW A;  3ULR B;  2DM1 A;  3H0I A;  3C0C A;  1T3S A;  2BZX A;  3I5S A;  2AZV A;  1NLO C;  1AWJ A;  4FSS A;  2GQI A;  2EQI A;  1ZUU A;  2KGT A;  2YSQ A;  1E6H A;  3EHQ A;  5I11 A;  1U3O A;  4RTW A;  1PNJ A;  2A28 A;  1SSH A;  2RQU A;  1UDL A;  2JM9 A;  2DVJ A;  1KSW A;  1MUZ A;  4AFU C;  2BZY A;  2KRO A;  4D8K A;  2RQR A;  2D0N A;  1WDX A;  4HVW A;  2X3X D;  1KIK A;  4J9H A;  1WIE A;  2DNU A;  2YUQ A;  2V1Q A;  3M0S A;  2JTE A;  3M0R A;  2LMJ A;  2J7I A;  2M51 A;  2MIO A;  2CRE A;  2KYB A;  2RF0 A;  3GBQ A;  1QWF A;  1X27 A;  2KYM A;  1YP5 A;  3VS7 A;  1WA7 A;  1AZG B;  3SHW A;  1YWO A;  1Z9Q A;  2KRS A;  1Y57 A;  3TSZ A;  2NUZ A;  2YUO A;  2SRC A;  2DF6 A;  1J3T A;  2YUP A;  4IIO A;  1GL5 A;  1M8M A;  1UG1 A;  2LNH B;  1KJW A;  3R6N A;  2FPD A;  2K7A A;  1RLQ C;  2X3W D;  5FWB A;  2GTO A;  4J9D A;  4R0K A;  5IH2 A;  1T3L A;  1G83 A;  2XMF A;  4RTT A;  1G2B A;  4RTV A;  1UTI A;  1B3Q A;  4JJC A;  5IHN A;  1H3H A;  1ARK A;  4ZNX A;  1M3B A;  2DX1 A;  2L3P A;  1FMK A;  1B07 A;  1X6G A;  3EG2 A;  1MV0 B;  4K11 A;  2OAW A;  1PRL C;  2M0Y A;  1HD3 A;  1SRL A;  2CUD A;  2JS0 A;  4HCK A;  2ROL A;  4JJD A;  1UJY A;  3PVQ A;  1ABO A;  1QLY A;  1JQQ A;  2RPN A;  1AWW A;  2DMO A;  1UHC A;  1WLP B;  3CQT A;  1JU5 C;  2CH4 W;  1WXT A;  1X2Q A;  3I35 A;  1Z9Z A;  4F14 A;  2EPD A;  2EBP A;  3I5R A;  2LJ1 A;  2DL5 A;  2DL3 A;  1RUW A;  4CC3 A;  2EVR A;  4IIM A;  1RI9 A;  3TVT A;  1QWE A;  5IHK A;  1QKX A;  1BU1 A;  2AKL A;  2JT4 A;  2L2P A;  3H0H A;  4HVV A;  1TG0 A;  2E5K A;  1HSQ A;  5EC7 A;  4WCI A;  4CC4 B;  2DYB A;  2PZ1 A;  2F2V A;  1TUC A;  1OPL A;  2KBT A;  2BZ8 A;  2DRK A;  3M0P A;  2NWM A;  1MV3 A;  1S1N A;  4QT7 A;  1I0C A;  2YDL A;  2EYW A;  4LE9 A;  1AWX A;  3U23 A;  3RBB B;  1H8K A;  2O88 A;  2DA9 A;  2OJ2 A;  5FW9 A;  1GBR A;  3NHN A;  4LN2 A;  2RN8 A;  3PVL A;  3VS2 A;  1A0N B;  3NGP A;  1JXO A;  2JM8 A;  2JMA A;  2MOX A;  1Y0M A;  2RMO A;  3O5Z A;  4Z8A A;  4JPB W;  1BK2 A;  3SEM A;  2CDT A;  2K79 A;  4A63 B;  3NMZ C;  4HXJ A;  1SEM A;  2FO0 A;  1YNZ A;  2DBM A;  2HDA A;  3THK A;  1W70 A;  4OMM A;  1UEC A;  2O31 A;  3EG0 A;  1AWO A;  1OOT A;  3UA7 A;  1X6B A;  2K3B A;  2KNB B;  3VS4 A;  2C0O A;  2VVK A;  1OV3 A;  4ESR A;  1IO6 A;  1VYU A;  1K76 A;  2A37 A;  5GJV B;  3VRZ A;  2F2X A;  2ECZ A;  1M3C A;  1CKA A;  2DL4 A;  2GBQ A;  1I1J A;  1TUD A;  2FPE A;  2GTJ A;  3QWX X;  1JO8 A;  2EYY A;  4AG1 C;  2SEM A;  4M4Z A;  4J9I A;  1WFW A;  2EGE A;  2GNC A;  1NEB A;  2F2W A;  1N5Z A;  2EYX A;  4LUD A;  2HBW A;  4J9C A;  4OMP A;  2RQT A;  4Y92 A;  1CKB A;  5GJW B;  2K9G A;  1UE9 A;  2DLP A;  2ABL A;  1M3A A;  4F16 A;  1YN8 A;  2D8J A;  2PNI A;  3EHR A;  2AK5 A;  4JZ4 A;  1UJ0 A;  1GRI A;  3REA B;  2D8H A;  3VS0 A;  4CC7 A;  2B86 A;  2LJ3 A;  2KR3 A;  1YCS B;  4DEX A;  5I22 A;  2LQN A;  2DE0 X;  3VS6 A;  2KEA A;  4E6R A;  2IIM A;  4J9F A;  1K0X A;  1SPK A;  1YWP A;  3TSW A;  5IHI A;  3IQL A;  3UF4 A;  1GFD A;  1ZBJ A;  2KT1 A;  1NLP C;  1PKS A;  2DRM A;  3VS3 A;  1T0J A;  2JMC A;  2K6D A;  2DL8 A;  2W10 A;  1JXM A;  2LJ0 A;  1V1C A;  2RQV A;  3M0Q A;  1QCF A;  2KXC A;  4OML A;  1WX6 A;  2CH4 A;  2PTK A;  1X2K A;  4HVU A;  4OMN A;  2ROT A;  2EGA A;  3VRY A;  4D8D A;  1WYX A;  2EW3 A;  1T0H A;  2QDL A;  2VKN A;  1GBQ A;  5HCK A;  1NYF A;  1FYN A;  1X43 A;  2RQW A;  1BBZ A;  2P4R A;  2FRW A;  4DEY A;  1NEG A;  1M30 A;  1WXU A;  2O9S A;  2LX7 A;  2FG0 A;  1VA7 A;  1GFC A;  2KRN A;  3LH5 A;  1K1Z A;  3JV3 A;  4AFQ C;  2HSP A;  3A98 A;  3H0F A;  3EGU A;  2J6K A;  3RNJ A;  2EYZ A;  1KFZ A;  4GBQ A;  1ZX6 A;  4X1V A;  5L23 A;  2AZS A;  1LCK A;  5IXF A;  1NM7 A;  2O2O A;  1E7O A;  1K0S A;  2CT4 A;  2G6F X;  1ZUY A;  2V1R A;  4RTZ A;  4AG2 C;  1GCQ A;  3PE0 A;  1SRM A;  4RTX A;  1PWT A;  3EG3 A;  3NPF A;  1I07 A;  1WXB A;  2KXD A;  2RNA A;  4KRT A;  2J6O A;  1E6G A;  2YUN A;  1VYT A;  2J06 A;  2J6F A;  1PKT A;  3QWY A;  1OPK A;  1QKW A;  3ZL7 C;  4J9E A;  1UHF A;  2C0I A;  3UAT A;  2CT3 A;  1AEY A;  1JEG A;  1BB9 A;  2JS2 A;  2J05 A;  4LNP A;  2HEQ A;  1GCQ C;  4JJB A;  1ZLM A;  5ECA A;  2A08 A;  3UA6 A;  2CSI A;  2KRM A;  2FRY A;  4RUG A;  2BTT A;  4AFS C;  1GCP A;  2GGR A;  1XOV A;  2ED1 A;  2JXB A;  2FPF A;  2L0A A;  2I0N A;  2L3Q A;  1U06 A;  2DL7 A;  1AOJ A;  4Z89 A;  2C0T A;  1H92 A;  1ZUK A;  2VWF A;  1W1F A;  1AZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...