4QT7A

Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
SHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structure of the c-Src-SH3 domain in complex with a proline-rich motif of NS5A protein from the hepatitis C virus.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase/transferase activator
total genus 13
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4qt7A00
1UJYA 1WDXA 2YSQA 3VS0A 3R6NA 4RTUA 2DRKA 3M0TA 2YUNA 5EC7A 1X2QA 1VYVA 2A28A 2KT8A 4RTVA 1E7OA 3NMZC 2E5KA 1TUCA 2SEMA 3M0QA 3PVQA 1OPKA 2JM9A 3EG0A 5IXFA 2EGAA 2OAWA 4GBQA 2M51A 4J9HA 5FWCA 1KIKA 2JW4A 1QLYA 1GRIA 2EBPA 2DBMA 2VVKA 2RPNA 1PRMC 3UATA 1AEYA 4JJDA 1JQQA 3M0RA 2PZ1A 4QT7A 3LH5A 2FO0A 3H0FA 3TSZA 4HVVA 1K76A 3REBB 1M3CA 2ROLA 1WI7A 5FWBA 1YWPA 3C0CA 1YP5A 4RTTA 4F14A 2YUQA 5IHIA 4A63B 1I07A 1UGVA 2FPFA 2VKNA 3H41A 1HD3A 1ARKA 4K11A 2DE0X 1SRMA 1WLPB 1V1CA 1E6HA 2CSQA 2CUBA 3H0HA 4JZ3A 1MV0B 2LX7A 4M4ZA 4AG1C 2KXDA 4OMQA 1KSWA 3VS6A 2AK5A 3NHNA 2LQNA 4OMMA 2J05A 3RNJA 2B86A 2V1RA 1UUEA 1JO8A 3O5ZA 1S1NA 1UECA 3NPFA 1W6XA 1U5SA 2VWFA 1KFZA 1K9AA 2KGTA 3VS7A 2EPDA 1AZEA 1ABQA 2K9GA 2SRCA 2ABLA 2X3WD 4ORZA 1YCSB 3PE0A 1K0SA 3VS2A 2DMOA 2C0IA 2DLPA 2KXCA 2D1XA 1Z9ZA 2JS0A 1TUDA 1NM7A 1QKXA 1X2KA 2DJQA 1TG0A 1NYFA 3VS1A 3M0SA 2KBTA 1CKAA 1KJWA 1JU5C 2EYYA 1AWJA 1LCKA 2O88A 2W0ZA 2MIOA 5IH2A 2K2MA 1BB9A 4LE9A 1WXTA 2DA9A 4WCIA 2GNCA 2RNAA 3VS4A 2EW3A 4OMOA 3EHRA 1NEBA 3I35A 2GTJA 1WIEA 2J6KA 2YDLA 2DL4A 5HCKA 1X43A 1K0XA 1BK2A 2KRNA 4LNPA 1OOTA 1SEMA 2GTOA 1VYTA 3REAB 4CC4B 1MUZA 2BZXA 2ENMA 2L3QA 3THKA 1AZGB 1QCFA 1WYXA 2M0YA 3UA6A 3EG3A 3VS5A 3UF4A 3VRZA 2D8JA 1B07A 1UDLA 2BZ8A 1H3HA 1M8MA 2C0TA 4GLMA 4AFUC 5IXBA 2F2XA 1J3TA 4JPBW 3I5RA 1GFDA 3IQLA 2J6OA 2KEAA 2CT4A 3VS3A 1G83A 1BU1A 5ECAA 2LMJA 3GBQA 2KRSA 2CT3A 2HDAA 1MV3A 4ZNXA 2F2VA 1VA7A 1W1FA 2AZVA 1T0JA 2D0NA 2EGCA 2DL7A 4LN2A 5GJWB 4IIMA 3EG2A 1GCQC 4HCKA 4OMNA 4J9GA 2KT1A 2H8HA 2W10A 3QWXX 3M0PA 2OI3A 4J9DA 4F16A 1FYNA 1T3LA 2O31A 2P4RA 1QKWA 2JMCA 1WFWA 4KRTA 2GGRA 2DL5A 4CC2A 2A36A 1K1ZA 1RI9A 2O2OA 4Y92A 1UE9A 1IO6A 4HXJA 2DRMA 2KYBA 4E6RA 4Z88A 3TSWA 2HEQA 4J9FA 1X6BA 2YT6A 2O9VA 2RQRA 1SHFA 1M3AA 4OMPA 2RQUA 1M27C 2GQIA 2RN8A 1OPLA 1ABOA 4AG2C 3EG1A 1UJ0A 1E6GA 4F17A 3FJ5A 1PKSA 2HSPA 2G6FX 4J9BA 1AOJA 4AFZC 1EFNA 2L2PA 4FSSA 1A0NB 3VRYA 2DF6A 1HJDA 2PNIA 4R0KA 2CH4A 4HVUA 5FW9A 4RTYA 2BTTA 2LJ1A 2X3XD 1OV3A 2YUPA 1NLOC 2C0OA 2V1QA 1RLPC 2EKHA 2A37A 2I0NA 4D8DA 1OEBA 3SHWA 2K7AA 2RMOA 2O9SA 2ROTA 4DEXA 1SSHA 1AWOA 2LP5A 3SEMA 4RUGA 4D8KA 4RTZA 1UHFA 1H8KA 2ESWA 2FEIA 1ZSGA 2J7IA 2LJ0A 2ECZA 3H0IA 2CUDA 1YNZA 1UFFA 1GCQA 1JXMA 2JMAA 2FG0A 2JM8A 2JXBA 1SRLA 1X6GA 2DBKA 3JV3A 2DL3A 3I5SA 1FMKA 2K6DA 1CKBA 1PRLC 1JEGA 1T3SA 5IHKA 4DEYA 1M3BA 3A98A 1BBZA 2FRYA 5I11A 2DVJA 4RTWA 3EGUA 2RQWA 3EHQA 1ZUYA 5GJVB 2RQVA 1RUWA 2DM1A 1T0HA 2KNBB 2DYBA 1G2BA 1AD5A 2BZYA 2YUOA 1X27A 1NEGA 1UG1A 2PTKA 2AKLA 2KRMA 1RLQC 2D8HA 3NGPA 1PHTA 2F2WA 1YWOA 2DX1A 1HSQA 2NUZA 1CSKA 1M30A 2J6FA 1SHGA 3TVTA 4EIKA 2KROA 2RF0A 4AFQC 2AZSA 1X69A 2CSIA 1GL5A 1PKTA 2L3PA 1AWWA 3QWYA 4AFSC 3CQTA 4HVWA 2KYMA 2MOXA 3PVLA 1H92A 1PWTA 2KR3A 4LUEA 1NG2A 1UTIA 2J06A 1PNJA 1K4US 5I22A 2OJ2A 5IHNA 1I0CA 2LJ3A 1QWFA 1AVZC 4LUDA 2EQIA 1ZUKA 2AKKA 2LQWA 2LCSA 3ZL7C 1AWXA 2CREA 2DL8A 2L0AA 1ZX6A 1Z9QA 1GCPA 1ZUUA 4OMLA 4CC3A 2EYWA 2RQTA 4CC7A 2HCKA 1ZBJA 1N5ZA 1NLPC 2ED1A 2FPEA 3U23A 1WA7A 2IIMA 4IIOA 1SPKA 1W70A 2QDLA 1XOVA 2CH4W 4X1VA 4J9EA 4ESRA 2K3BA 2EGEA 2JT4A 4RTXA 2ED0A 2JTEA 1ZLMA 4J9CA 3RBBB 2LZ6B 2EYXA 4Z89A 2A08A 2GBQA 1B3QA 3I9QA 4JJBA 1VYUA 1GBQA 4JZ4A 1U06A 5L23A 2DILA 3M0UA 1WXBA 4J9IA 1U3OA 2LNHB 2EYZA 1Y0MA 1JXOA 2L3SA 1GBRA 4JJCA 2HBWA 3KFVA 3ULRB 2JS2A 2K79A 1QWEA 2XMFA 1WXUA 2CDTA 2MCNA 2NWMA 1GFCA 2DNUA 1UHCA 1I1JA 2FPDA 1WX6A 2FRWA 1NYGA 2EVRA 2KE9A 1YN8A 1Y57A 3UA7A 4Z8AA
chains in the Genus database with same CATH superfamily
4DBQA 1VQKA 1WDXA 2V26A 1UGPB 2DRKA 3M0TA 2YUNA 1B7TA 4JRQA 2A28A 3CCST 3OYGA 2XI9A 3JCMe 1E7OA 3NMZC 3PVQA 1IHWA 2JM9A 3CCSA 5IXFA 2LRQA 4XTZA 3CCRQ 3CCMT 2HNIA 3CCQQ 5A0LA 1PRMC 3LYIA 3JB9D 2E6ZA 4HKEA 3CCMA 2PZ1A 4QT7A 4M75C 3N5BB 2IVWA 1QVFP 1S72T 4WTOB 2DZ9A 2QDYB 3OBYA 3RMSA 3QUIA 1M3CA 3REBB 2CP6A 5IT9E 4DBHA 2JTFA 3JB9F 3SD4A 1O9SA 3OYFA 2RHZA 1OI1A 1VQOT 4A63B 3P8HA 5KYYA 3TEEA 1SRMA 1QVFS 4QQDA 1I5LA 4MZTA 3FDRA 3MP1A 4JZ3A 1MV0B 1G8XA 4AG1C 2YLBA 3CBMA 1KSWA 2RD1A 3JAME 1K9MC 1G3SA 3G4SA 1Q81R 4M78D 1YIJT 2B86A 1JO8A 3M58A 3NPFA 2DO3A 1YIJA 3CCEQ 9ATCB 1BI2A 2SRCA 4A4GA 3VS2A 1NPPA 2DMOA 5J3BA 2DLPA 3G6ET 2JS0A 4DOWA 1NM7A 1QKXA 1W2BP 5I21A 2AHJB 2EQKA 4M7AC 1YCYA 4M78B 5I2SA 2CZ1B 1LCKA 2MIOA 2ZPFB 1KHCA 1M5Q1 2GNCA 4VUBA 4NOYA 1OYXA 2GF7A 3V8LA 1WHJA 5HCKA 4M77E 4OB1B 4OB2B 1W2BS 3OS1A 1VQ6Q 2VGMA 2QQRA 1OX9A 1IZ6A 3REAB 1AZGB 3QHSA 1QCFA 3UA6A 1N6AA 4O6JA 3OYLA 4C92E 4FYWB 4IUPA 4C5HA 2BIVA 1ZSZB 2CZ0B 2DZCA 3GP8A 3FJPA 1M8MA 5IXBA 1JB0E 3M54A 1SSFA 5GAOl 2J6OA 5GAN8 4XU3A 3E2UA 2D6FA 2FZKB 2F2VA 2AZVA 2DL7A 5GJWB 1QCOA 4OMNA 4Y28E 3CMET 2H8HA 3QWXX 3M0PA 1FYNA 1HYOA 3JSCA 2P4RA 2JMCA 1MMDA 1WFWA 3E9FA 3CMEA 2GGRA 3EH2A 3QYHB 4C0ZA 1XNIA 2A36A 4JRIA 2FL7A 3OS2A 3QG1A 1IO6A 4OB0B 4B9XA 4QVDA 2CS7A 4Z88A 3RR6A 4FM4B 2HEQA 4V2SA 1X6BA 1VQ8A 2YT6A 4FL6A 3QJYA 2MMPA 2K4YA 3CD6T 1ZA2B 1VQ4T 3A8HB 3I55Q 5CCAA 4PFZA 1SG5A 4AG2C 4KH1B 1RAAB 4HCCA 1UJ0A 4C8QG 1YHQT 2G6FX 1AOJA 2L2PA 3HSBA 2DF6A 3H6ZA 1YHQA 1NZ9A 2OTJT 2PNIA 3RMQA 4HVUA 5FW9A 1RADB 2QTVA 2RI3A 1OX8A 2OTJA 1BI3A 2YUPA 3C4SA 3SWNA 1NLOC 2RO0A 2NUTA 4HCBA 4XTVA 1RLPC 2EKHA 5EG2A 4OF1A 4BE0A 1OEBA 3FRNA 2K7AA 3SWNB 1JRIA 1AWOA 2LP5A 1G3TA 3OYBA 4C0DB 2LT4A 5DLQE 1B34B 4RTZA 2QA4Q 4E2FB 5LJ5e 3P8DA 4M77D 2J7IA 4KH0B 4NL2A 2X4WA 2DXBA 1UFFA 1GCQA 1JXMA 1TXQA 1VIEA 2JMAA 4BI4A 4M77F 1SRLA 4M77A 4YTLA 2O01E 4M75E 4PLIA 1ZA1B 1K9MU 4C92D 3OQ5A 5KYXA 3M57A 6AT1B 1CKBA 1N8RC 4M77B 5IHKA 3GIBA 2YLCA 2Y90A 2LC4A 1M3BA 3A98A 1BBZA 2QQAA 1VQPQ 4DQ2A 1I5OB 4C92F 4C92A 2FZGB 2RQVA 2LCLA 1ZSZC 2DM1A 2OTLT 2KNBB 2K5LA 1PD0A 3X26B 3M4GA 3FB9A 4EMKA 4FYYB 2OTLA 1MMNA 2MAMA 3SFMA 3HRUA 3JCMf 3DLLA 2M02A 3CBOA 1HSQA 1X01A 1CSKA 5LJ3f 3VUZA 1SHGA 3TVTA 3VUBA 4EIKA 4WF2A 2AZSA 3H8ZA 3CQTA 5GAOq 1BCMA 2KYMA 1H92A 4B9WA 4LUEA 1NG2A 2E3HA 5HKCA 3JCMQ 1M1KR 2VC8A 4E7IA 4PLLA 1TU0B 4M7AE 2LJ3A 1QW1A 4N0AC 1HXDA 4F7UB 4J6YA 2DFUA 3EH1A 2RM4A 1VUBA 4LDVA 4ELZC 3BDUA 3BY7A 4XAXB 2RA2A 1XJWB 1I4K1 3NTKA 4KULA 4QQGA 2ED1A 3EGDA 2FPEA 5GAMe 3PIPA 3QBYA 2RHIA 1KC8R 4MZMA 4J83A 2VUBA 1W70A 4RG8A 3OS5A 2QDLA 1Q7YC 4PKCC 2E6NA 2ED0A 1VQ9Q 1RAIB 3RBBB 2QI2A 4HT8A 4OMFB 1S72Q 1K73R 4PJMA 1GBQA 5C0MA 4JZ4A 2JVVA 2HQXA 4L5GA 1WPYA 1YJWQ 1WXBA 1VQMT 2LDMA 1Y0MA 4MZPA 1VQOQ 4NS5A 4XK8E 4ATOA 1GBRA 1IREB 4RG2A 2CP7A 1VQMA 2GFUA 3HRSA 2JS2A 1MMGA 2RH2A 4KGVB 4ZGDB 1Q95G 1QMCA 1UHCA 2HL3A 4M75D 2FPDA 1WX6A 2YRVA 3OY9A 4BE2A 5HY6A 2CZ7B 2EVRA 2KE9A 4L59A 1NJIU 4BDZA 1Y57A 2XU8A 5FROA 4DA4A 4LD9K 1RI0A 4M75F 4M75A 2M0OA 3QZ5B 5IN1A 3RIRA 4C0FA 3OYJA 1X2QA 3JCMP 4F04B 2KT8A 3JCMW 2C06A 3GPLA 2P0KA 2GQVA 5HK0A 2SEMA 3M0QA 1Q86C 1OPKA 3G6EQ 1AT1B 2EGAA 3G71T 4LXCA 4GBQA 2WACA 2LQKA 3CC7Q 1QLYA 2XICA 4OVAA 1GRIA 2EBPA 2KY9A 5CAIA 1AEYA 1O75A 2RHYA 3G71A 3J80E 3CCLQ 4M7DC 1RAEB 2MYSA 1UGQB 2CYZB 3LH5A 2E12A 2FO0A 2DIQA 4B6MA 3H0FA 1K76A 4N4GA 5LJ3h 2ROLA 1D0XA 5FWBA 4QQ6A 3HL8A 3HTRA 4QW2A 1YP5A 2RJFA 2F5KA 2QAZA 2FYKA 4BI8B 1HD3A 1ARKA 1EX4A 4M7AD 4L6V5 4XU0A 2CSQA 5GAN4 3JCMg 2COYA 1FX7A 4IUQA 2LX9A 2RK2A 5LJ3g 4M7AF 5GAN2 4X9DA 3VU3C 5CKFA 2H3EB 1KG1A 2LQNA 1FMWA 3NTIA 1G5VA 1KQSP 1KD1R 8ATCB 2V1RA 1UUEA 2VWFA 4M7AB 3CCUT 4ZN1A 2EPDA 1IHVA 4FT2A 5D6XA 3OYDA 1AZEA 2O4XA 1ABQA 1D0ZA 3A8OB 5GANh 3HFOA 5LJ5j 4A54A 1KQSS 3OW2P 2D1XA 1NE8A 3T9NA 2O4XB 2DJQA 1UEBA 3M0SA 1PCXA 1Q81C 1WNLA 3CBPA 1KJWA 1TTHB 4EPCA 1JBMA 1EIFA 4KGZB 2W0ZA 7AT1B 2DA9A 4WCIA 3I35A 2GTJA 3OW2S 2J6KA 2YDLA 3KBGA 2EQUA 3JB9G 2D0QB 1BK2A 2LVMA 3X24B 5CKDA 3QJ6A 2HMAA 1N9RA 1YI2T 1BKBA 3J7AF 3L2WA 5LJ5f 2GTOA 1VQKT 1PSFA 1WJRA 4IUUA 1VQ4Q 1MUZA 2BZXA 3G7ZA 3CD6Q 4HT9A 1YI2A 1V76A 5CK9A 2M0YA 3EG3A 2E3IA 1I81A 3LLRA 3CMAQ 4EDUA 4BB7A 2BZ8A 2C0TA 3OMGA 4X34A 1J3TA 3I5RA 4JJNK 1RL2A 2QG9B 3QIIA 2PUKB 4BY6B 2VB6A 1YJNA 3LH0A 5LJ5d 1X6OA 3AT1B 2FZCB 1VA7A 4M78G 1DJ7B 1Y71A 2RK1A 1TWBA 1T0JA 2D0NA 1Q7YU 4LN2A 3EG2A 3MEAA 4HCKA 4E47A 2R5AA 4PNOA 1D0YA 2KT1A 2W10A 2PQWA 4JDSA 1KHIA 1QP3A 1TSFA 3OB9A 1VQNT 3AHUA 3JB9J 4OGEA 2DL5A 2EFIA 2R58A 2JUFA 4X9CA 1YITT 1VQNA 2XIDA 1RI9A 2EWNA 1FXXA 5DLOA 1YITA 3X20B 2DRMA 2KYBA 4Z02A 4XTUA 3TSWA 3EG9B 2VXFA 3JCMc 3G4ST 1M2OA 1WHGA 3I56A 5GAN7 2KI7A 2L8DA 5GAMj 5GMKh 3EFRA 2RN8A 1VQ7T 3P8BB 1ABOA 1E6GA 4LDXA 3FJ5A 1PKSA 1W4SA 3MCAB 2LCCA 1VQ7A 3L2UA 4FSSA 1VQ5T 3VRYA 3NTHA 2CH4A 4M78F 1VQLQ 4M78A 3SDZA 1WHKA 1Q86U 1OZ3A 5GAOm 1VQ5A 2LJ1A 2X3XD 3PGGA 2DD4A 2E64A 3TU4K 2V1QA 5D7UA 2A37A 3JB9I 2K2VA 4JS4A 4D8DA 1KQ1A 2O9SA 2ROTA 1IB8A 2D9TA 1BIBA 2K3XA 3META 1YBYA 1KQ2A 4RUGA 2JN0A 1H8KA 2X4JA 2FEIA 3UWNA 4J6WA 2ECZA 2DTHA 1ZSZA 3H0IA 2CUDA 4ANJA 2EJGA 2FB7A 4MMLA 5GAMd 2L5QA 2JM8A 4M7DE 2EQJA 1FMVA 2F1LA 3OYEA 4PJOC 3DB4A 2DBKA 1OZ2A 1IGQA 4XTXA 5CO7A 4P5NA 1OQKA 5KH6A 3I5SA 4PJLA 2DVEA 2DAQA 2RJEA 1PRLC 3QSUA 1WQWA 2BE7D 3CC2T 3SB2A 4DEYA 5FU6B 2FRYA 5I11A 4RTWA 1ZHIA 1U8RA 3QKJA 3EHQA 1D1CA 2P0QA 3CC2A 2BUDA 5GJVB 4GLKA 3EFOB 5A0GA 3A1PA 4BI3A 5KYNA 4FW2A 2KK4A 2KRMA 1Y96B 2D8HA 1Q81U 4BY6C 1QVFA 3ZFJA 2ZPHB 4J6XA 4F7UE 1JJ2P 3VKIA 2PU9B 2NUZA 2KAFA 2COWA 2J6FA 3CPWP 3OS0A 4AFQC 4PJJA 1VQ8T 1PKTA 4FU6A 3QWYA 4OB3B 2RHUA 4AFSC 2HZYA 4HVWA 1PM3A 3A8MB 3OYAA 1PWTA 4XU1A 5J39A 2HD0A 3S6WA 1M90R 1UTIA 4J7FA 2DYIA 3QDFA 4NL3A 1PNJA 3PMIA 3OBWA 3CPWS 4A4KA 2H3JA 1I0CA 1LPLA 2ZGWA 2OX7A 1FWZA 4R56A 3MEVA 4A4HA 4M77G 3MEWA 2QK0A 2X9HA 2LNVA 2LQWA 1D1BA 1NJIC 2QEXQ 1XTDA 5M9OA 2CKKA 4PFOA 4CC7A 3INZA 3J81E 1D09B 4KUIA 4C92G 1NLPC 4KBMB 3LW5E 2M9UA 4A53A 1G3WA 2V8KA 4IIOA 4A4EA 1W2BA 4XQ3A 3URGA 1B34A 4PJNA 1U1SA 1XOVA 3C95A 4J9EA 3QO3A 4ESRA 2EGEA 4AMCA 2VASA 2A08A 3CCRT 3CCQT 2DXTA 5KYWA 2COZA 3G1JA 3CCRA 3FEOA 1U3OA 2LNHB 3CCQA 2EYZA 3CC4Q 4N4HA 1P92A 4JJCA 5KYWB 1LJOA 2DIGA 2DTOA 1Q82R 3CCVQ 4M7DD 3PFSA 1OULA 2DNUA 3RKXA 2XDBA 2MPXC 1PC0A 1NYGA 5DM7R 4Z8AA 5FU7C 1UJYA 3BE3A 5GMKi 2YSQA 2YXYA 1YJ9Q 3CCUQ 4JRPA 3JCMV 1VYVA 4M7DB 3V7CA 4RTVA 3MPUB 2E5KA 1TUCA 3E19A 5CKBA 5FU6C 4J5YA 4C8QB 2LT1A 2RJCA 3EG0A 1X75C 4D6WA 3CCET 2ZCFB 2JW4A 2WSFE 2DBMA 2VVKA 1M9SA 2ZPBB 3UATA 3ER0A 3CCEA 2M1HA 1WHHA 4F7UF 1RAHB 4F7UA 4HVVA 2DXUA 4ZTFA 2NYSA 1WI7A 2MK5A 3HPWA 1YWPA 3C0CA 4DBRA 4F14A 1BI0A 2YUQA 4C5IA 3L1AA 1UGVA 2FPFA 3H41A 1VQKQ 3CXCP 2DE0X 2RI2A 3M59A 3H0HA 1VQ6T 2LX7A 4E7SA 2KXDA 2E5QA 5AYFA 2CGHA 2AK5A 1VQ6A 4OMMA 3CCSQ 4M75G 1SKUB 4E7ZA 3BW1A 3CXCS 3CCJT 3RNJA 5D6WA 4C5EA 1R0CB 1S1NA 1UECA 1W6XA 1U5SA 2KGTA 3X28B 1Q82U 3CCJA 3CCMQ 4PJOE 3S3OA 1YCSB 2CP3A 3PE0A 1K0SA 2A0FB 4CI0C 3OA6A 4E7LA 1Z9ZA 4C5GA 1TUDA 3EGXA 1TG0A 3VS1A 2DEQA 5FRMA 1KD1C 1CKAA 2VV5A 5CIUA 1JU5C 2EYYA 1AWJA 2EAYA 1WJSA 2K2MA 4LE9A 1RAFB 1WXTA 3VS4A 1D3BB 2EW3A 3EGXB 4OMOA 1NEBA 4A4FA 3MP6A 8AT1B 1X43A 2KRNA 4LNPA 3G4SQ 3RKWA 1OOTA 1UGRB 4CRIA 2ENMA 1YFNA 2NUPB 1WYXA 3GNFB 1YIJQ 3ZEHA 3HFNA 3VS5A 3UF4A 2WSEE 4M7AG 3OYYA 2PUOB 4GLMA 1M1KU 4BACA 3I55T 4JPBW 2QYZA 2CT4A 3VS3A 3I55A 2DERA 3GBQA 2KRSA 2HDAA 1W1FA 2EGCA 4IIMA 1GCQC 4J9GA 1TH7A 1I8FA 3JCMh 2BE9B 2RB6A 1QKWA 3GLXA 4C8QC 4ME7A 1Y7XA 1IXDA 4BDYA 4CC2A 1U1TA 1KC8U 4DOVA 2KDSA 2HBPA 3L2QA 2O2OA 4Y92A 1UE9A 4HXJA 2QA4T 2K5IA 2K5FA 3ASKA 2BKDN 4RCCA 1K73U 1IRXA 1M3AA 4OMPA 2QA4A 2RQUA 4E7KA 4M7AA 2GQIA 4LDYA 5L8RE 1OPLA 2X4YA 3A5ZB 4KT0E 2JZ2A 4F17A 4J9BA 2IG0A 4AFZC 3A8LB 4HCZA 2EIFA 1A0NB 3LGLA 4PJOD 4RTYA 3M4YA 2BTTA 3CMEQ 1OV3A 3RESA 4TVRA 1WHMA 4FIBA 3V8JA 4PL6A 2X51A 2I0NA 1VQPA 3ZBDA 2QQ9A 3L2VA 1VIFA 2RMOA 2EKOA 3V7SA 2XDPA 1VQ8Q 1LOJA 1RAGB 4PJOB 2M16A 4MMKA 3VYHB 2EJFA 4FCYA 2ESWA 1ZSGA 2LJ0A 2E41A 4FYXB 5GAN3 4BE1A 3JCMb 2JXBA 1BI1A 1YHQQ 4IUTA 1X6GA 5AT1B 4ZGJB 3JV3A 4XU2A 1LNXA 3H9NA 2AIRB 3UT1A 2K57A 2DL3A 1WGSA 2OTJQ 3FC3A 4C0GA 1YJNT 2K6DA 2MWOA 1T3SA 1QVPA 2DVJA 3EGUA 3QPHA 2FHDA 1M2VB 1RUWA 1G3YA 3QDRB 3VYGA 2A7YA 2BZYA 1MNEA 2YRDA 5GAOn 3M56A 4QKUA 1VOMA 3PT9A 2PTKA 2AKLA 4E7HA 1KD1U 2WSCE 2XKOC 5LJ3e 1PHTA 2F2WA 2HL5C 5J26A 2DX1A 1M30A 3EG9A 2JNGA 2R57A 4O5VA 2KROA 1GL5A 2L3PA 1VQ9T 1WJQA 2P0PA 5GMKl 3I56T 3JRZA 2DETA 1VQ9A 2HQEA 2J06A 3M55A 1YJWT 1S72A 5I22A 4FW1A 5IHNA 4EMGA 1K8AR 4IKFA 3RKYA 1AVZC 3BDLA 4LUDA 1YJWA 1KQSA 1QP2A 1ZUKA 1BCOA 1VQOA 4JRKA 3ZL7C 2CREA 3F70A 3PTAA 2L0AA 3M53A 3E9GA 1ZUUA 2P84A 4OMLA 3UPUA 1M90C 2OTLQ 5KYYB 3V7RA 4OGCA 3S3MA 2HCKA 5GANe 1ZBJA 1N5ZA 2QGFB 2ZAEA 3OSVA 4QVCA 3VV0A 2JJ9A 3OW2A 1C0MA 2DPPB 3U23A 1PSEA 4RKUE 4IUVA 5GAMf 2IIMA 3OYHA 1SPKA 3TCJA 2P4TA 2A3LA 5DY9A 2RI5A 5KYUA 2JTEA 4ZTJA 4J9CA 3CPFA 5GAOr 3QZ9B 2EYXA 4Z89A 3EFSA 3I9QA 3CC7T 1VYUA 1QCNA 3G6EA 3PMTA 1TOVA 2ZPIB 3CEYA 4DBFA 5L23A 3M0UA 5KYUB 3RDVA 3CCLT 2FVUA 3CC7A 4OP0A 4PFPA 2KMTA 1JXOA 5FU7B 5KE2A 3HRTA 5GAN5 3CCLA 1QVGP 3KFVA 3WVEB 2K79A 2XMFA 2CDTA 2V8JA 2NWMA 3MJXA 3OMCA 1GFCA 5A0DA 2K3YA 4C8QE 5LJ5h 1I1JA 2LQ8A 1N27A 2E65A 2FRWA 3MEUA 4QVZA 3EFOA 3EAEA 3L2RA 1QVGS 3CCJQ 3VS0A 2HQHA 1Y96A 4RTUA 3R6NA 1OU8A 3M5AA 2LTOA 4FYVB 5EC7A 1Q82C 4R55A 2E4HA 5GAN6 4BD3A 2XK0A 5LJ5g 1K8AU 1KK7A 4N0AA 2PVDB 2XD0A 2OAWA 4J9HA 2M51A 5FWCA 1KIKA 2DD5A 5CKHA 3L2ZA 2RPNA 3PNWC 4JJDA 1JQQA 3M0RA 1VQMQ 1M8VA 1NBEB 1MMAA 2AT1B 1MNDA 2CP2A 2KVQG 3LWHA 3TSZA 1JJ2S 1NPRA 3D7SB 1K9MR 4RTTA 5GMKe 3Q1JA 5IHIA 1I07A 2VKNA 4K11A 1BIAA 1LVKA 3TQ7P 1WLPB 1V1CA 1M1GA 1E6HA 2CUBA 2HAXA 4M4ZA 4JUVA 3FLGA 3GOXA 2DEUA 4OMQA 5D6YA 4KUDK 4M7DG 3VS6A 4LDUA 3NHNA 2XG8D 1M1KC 2J05A 4GY5A 3CD6A 1VQ4A 4N4IA 3O5ZA 1RABB 1TS9A 3CMAT 5I2MA 1KFZA 1K9AA 3VS7A 4AT1B 3G71Q 2L3RA 1HK9A 2CZ6B 2K9GA 4JLIA 4ORZA 2ABLA 2X3WD 3KXTA 3CMAA 2QQBA 2C0IA 2IPOB 2KXCA 5A2QE 3L42A 1H3ZA 1QQJA 5GAMh 1X2KA 1NYFA 1R8OB 2KBTA 1UGSB 3M9QA 2O88A 1WQ7A 5IH2A 1BB9A 2ZPGB 1KC8C 2NUTB 4RCBA 4F7UG 2RNAA 3EHRA 4XTWA 1WIEA 2DL4A 3DKMA 1SF9A 3MHXA 1K0XA 3A8GB 2JTMA 5CVIA 1QVGA 2MF2A 2HKNA 2XHCA 2JOYA 3LX7A 3MO8A 4M78C 2Z0WA 5GAMg 1K73C 4C8QD 1SEMA 1VYTA 4CC4B 5HK3A 2L3QA 3THKA 5CKEA 4M7DF 4M7DA 5FRNA 4UC4A 4ZN3A 2YRCA 1XQHA 1ACMB 3VRZA 2D8JA 4C8QF 1B07A 4C8QA 2EQMA 4JS5A 1UDLA 1M90U 1H3HA 4AFUC 3PIOA 5LJ3j 2F2XA 2DK3A 1PG5B 1GFDA 2GFAA 3IQLA 1TUGB 2KEAA 1EZZB 4IURA 4Y91A 1G83A 1BU1A 5ECAA 2LMJA 2CT3A 3OYMA 1MV3A 1V29B 1JJ2A 4ZNXA 5KYXB 3UDCA 2DKGA 3HP9A 1VQLT 2MWPA 3CPWA 2E70A 2YWWA 3C12A 3QXEB 3LGFA 2G3RA 1BYMA 3WVDB 3OYIA 4J9DA 2OI3A 2YHTA 4F16A 4C92B 1VQLA 1T3LA 2O31A 4KRTA 2EJ9A 1C6VX 2L89A 2QXFA 4EMKB 5IAYA 4E7JA 1YI2Q 1K1ZA 3LWIA 1NJIR 1RACB 5CQXA 1GXIE 4EMHA 3S3NA 4E6RA 4XTYA 5GANj 1C1AA 2CP5A 4J9FA 2O9VA 2RQRA 1SHFA 3MKDA 4ZGEB 4ELYC 2KSSA 1M27C 1M1FA 2RHXA 3DLMA 3JCMd 2Y4XA 1YJNQ 3EG1A 5LL6S 5LJ3d 2HSPA 1EFNA 2ZZDA 3NFCA 4J8OA 1IGUA 1HJDA 3OSSC 4R0KA 1AHJB 1ZBXA 4MDWA 5GANf 2C0OA 2RJDA 1D3BA 2PVOB 1VQNQ 3SHWA 3DB3A 1YITQ 3EGDB 4DEXA 2MI6A 1SSHA 2EYQA 3SEMA 1WZOA 3I56Q 2NUPA 2I2LA 4D8KA 2PVGB 3VJPA 1UHFA 3R6OA 2KQWA 4J7IA 1N8RR 3O8VA 5GANd 4KGXB 3SWNC 2GCXA 2QTXA 2VYTA 1YNZA 4Q5WA 2F5TX 1VQ7Q 2FG0A 1H641 3HHTB 4C0DC 2QASA 4PK4A 3JB9H 1VQ5Q 5FLXE 3RERA 1FMKA 2X35A 1JEGA 1F1BB 1PD1A 4LDWA 2RQWA 4LD6A 4RMOA 2QEXT 1ZUYA 2DXCA 5C6SA 1T0HA 1N9SA 2DYBA 1G2BA 1AD5A 2QEXA 2YUOA 1X27A 1NEGA 1UG1A 1Y07A 2B8AA 4M77C 3RUXA 4M75B 5GMKj 1RLQC 4PJOG 1OU9A 3NGPA 3GNGA 3MP8A 5CQYA 1YWOA 2VXEA 2ZPEB 3KUFA 3TREA 2HSEB 2RF0A 4MDXA 1X69A 2CSIA 2ATCB 1AWWA 4C92C 5CR2A 3X25B 3CXCA 2MOXA 3PVLA 2HKQB 1R0BG 2KR3A 2E1HA 2Y4YA 4EMKC 1K4US 5KE3A 2OJ2A 1QWFA 3CC4T 2NLUA 3CC2Q 2EQIA 2AKKA 2OAUA 2F69A 2LCSA 3CCVT 1AWXA 3CC4A 2DL8A 1ZX6A 1Z9QA 1GCPA 1Q7YR 4CC3A 3HKSA 3FIFA 2EYWA 2QGGA 3BFMA 3CCVA 1D1AA 2RQTA 1N8RU 2DJZA 4M78E 1VQPT 1K8AC 5GAOp 3E1SA 3OYNA 2CP0A 4HA8A 4PJOF 1WA7A 1YJ9T 4PJOA 5KCHA 1MGQA 1UB4A 2V8IA 3OYCA 2CH4W 4X1VA 2DTIA 2K3BA 1YJ9A 2JT4A 2VGNA 3CCUA 4RTXA 1MHNA 3C94A 1ZLMA 2LZ6B 4FSXA 2GBQA 1B3QA 3V8KA 1M4ZA 4JJBA 2X4XA 3WXMB 1U06A 2DILA 5KCOA 3GF5A 4J9IA 1ZQ1A 4II1A 5GMKm 4BUGA 2E10A 2L3SA 3ME9A 2HBWA 3ULRB 1WHLA 1QWEA 5GANg 1WXUA 4FT4A 2MCNA 1R77A 3JCMJ 2XDDA 1M2VA 2R5MA 1Q86R 3OYKA 2QQSA 1YN8A 3UA7A 3JCMX 3QYGB 4JLGA
chains in the Genus database with same CATH topology
1UJYA 1WDXA 2YSQA 3VS0A 3R6NA 4RTUA 2DRKA 3M0TA 2YUNA 5EC7A 1X2QA 1VYVA 2A28A 2KT8A 4RTVA 1E7OA 3NMZC 2E5KA 1TUCA 2SEMA 3M0QA 3PVQA 1OPKA 2JM9A 3EG0A 5IXFA 2EGAA 2OAWA 4GBQA 2M51A 4J9HA 5FWCA 1KIKA 2JW4A 1QLYA 1GRIA 2EBPA 2DBMA 2VVKA 2RPNA 1PRMC 3UATA 1AEYA 4JJDA 1JQQA 3M0RA 2PZ1A 4QT7A 3LH5A 2FO0A 3H0FA 3TSZA 4HVVA 1K76A 3REBB 1M3CA 2ROLA 1WI7A 5FWBA 1YWPA 3C0CA 1YP5A 4RTTA 4F14A 2YUQA 5IHIA 4A63B 1I07A 1UGVA 2FPFA 2VKNA 3H41A 1HD3A 1ARKA 4K11A 2DE0X 1SRMA 1WLPB 1V1CA 1E6HA 2CSQA 2CUBA 3H0HA 4JZ3A 1MV0B 2LX7A 4M4ZA 4AG1C 2KXDA 4OMQA 1KSWA 3VS6A 2AK5A 3NHNA 2LQNA 4OMMA 2J05A 3RNJA 2B86A 2V1RA 1UUEA 1JO8A 3O5ZA 1S1NA 1UECA 3NPFA 1W6XA 1U5SA 2VWFA 1KFZA 1K9AA 2KGTA 3VS7A 2EPDA 1AZEA 1ABQA 2K9GA 2SRCA 2ABLA 2X3WD 4ORZA 1YCSB 3PE0A 1K0SA 3VS2A 2DMOA 2C0IA 2DLPA 2KXCA 2D1XA 1Z9ZA 2JS0A 1TUDA 1NM7A 1QKXA 1X2KA 2DJQA 1TG0A 1NYFA 3VS1A 3M0SA 2KBTA 1CKAA 1KJWA 1JU5C 2EYYA 1AWJA 1LCKA 2O88A 2W0ZA 2MIOA 5IH2A 2K2MA 1BB9A 4LE9A 1WXTA 2DA9A 4WCIA 2GNCA 2RNAA 3VS4A 2EW3A 4OMOA 3EHRA 1NEBA 3I35A 2GTJA 1WIEA 2J6KA 2YDLA 2DL4A 5HCKA 1X43A 1K0XA 1BK2A 2KRNA 4LNPA 1OOTA 1SEMA 2GTOA 1VYTA 3REAB 4CC4B 1MUZA 2BZXA 2ENMA 2L3QA 3THKA 1AZGB 1QCFA 1WYXA 2M0YA 3UA6A 3EG3A 3VS5A 3UF4A 3VRZA 2D8JA 1B07A 1UDLA 2BZ8A 1H3HA 1M8MA 2C0TA 4GLMA 4AFUC 5IXBA 2F2XA 1J3TA 4JPBW 3I5RA 1GFDA 3IQLA 2J6OA 2KEAA 2CT4A 3VS3A 1G83A 1BU1A 5ECAA 2LMJA 3GBQA 2KRSA 2CT3A 2HDAA 1MV3A 4ZNXA 2F2VA 1VA7A 1W1FA 2AZVA 1T0JA 2D0NA 2EGCA 2DL7A 4LN2A 5GJWB 4IIMA 3EG2A 1GCQC 4HCKA 4OMNA 4J9GA 2KT1A 2H8HA 2W10A 3QWXX 3M0PA 2OI3A 4J9DA 4F16A 1FYNA 1T3LA 2O31A 2P4RA 1QKWA 2JMCA 1WFWA 4KRTA 2GGRA 2DL5A 4CC2A 2A36A 1K1ZA 1RI9A 2O2OA 4Y92A 1UE9A 1IO6A 4HXJA 2DRMA 2KYBA 4E6RA 4Z88A 3TSWA 2HEQA 4J9FA 1X6BA 2YT6A 2O9VA 2RQRA 1SHFA 1M3AA 4OMPA 2RQUA 1M27C 2GQIA 2RN8A 1OPLA 1ABOA 4AG2C 3EG1A 1UJ0A 1E6GA 4F17A 3FJ5A 1PKSA 2HSPA 2G6FX 4J9BA 1AOJA 4AFZC 1EFNA 2L2PA 4FSSA 1A0NB 3VRYA 2DF6A 1HJDA 2PNIA 4R0KA 2CH4A 4HVUA 5FW9A 4RTYA 2BTTA 2LJ1A 2X3XD 1OV3A 2YUPA 1NLOC 2C0OA 2V1QA 1RLPC 2EKHA 2A37A 2I0NA 4D8DA 1OEBA 3SHWA 2K7AA 2RMOA 2O9SA 2ROTA 4DEXA 1SSHA 1AWOA 2LP5A 3SEMA 4RUGA 4D8KA 4RTZA 1UHFA 1H8KA 2ESWA 2FEIA 1ZSGA 2J7IA 2LJ0A 2ECZA 3H0IA 2CUDA 1YNZA 1UFFA 1GCQA 1JXMA 2JMAA 2FG0A 2JM8A 2JXBA 1SRLA 1X6GA 2DBKA 3JV3A 2DL3A 3I5SA 1FMKA 2K6DA 1CKBA 1PRLC 1JEGA 1T3SA 5IHKA 4DEYA 1M3BA 3A98A 1BBZA 2FRYA 5I11A 2DVJA 4RTWA 3EGUA 2RQWA 3EHQA 1ZUYA 5GJVB 2RQVA 1RUWA 2DM1A 1T0HA 2KNBB 2DYBA 1G2BA 1AD5A 2BZYA 2YUOA 1X27A 1NEGA 1UG1A 2PTKA 2AKLA 2KRMA 1RLQC 2D8HA 3NGPA 1PHTA 2F2WA 1YWOA 2DX1A 1HSQA 2NUZA 1CSKA 1M30A 2J6FA 1SHGA 3TVTA 4EIKA 2KROA 2RF0A 4AFQC 2AZSA 1X69A 2CSIA 1GL5A 1PKTA 2L3PA 1AWWA 3QWYA 4AFSC 3CQTA 4HVWA 2KYMA 2MOXA 3PVLA 1H92A 1PWTA 2KR3A 4LUEA 1NG2A 1UTIA 2J06A 1PNJA 1K4US 5I22A 2OJ2A 5IHNA 1I0CA 2LJ3A 1QWFA 1AVZC 4LUDA 2EQIA 1ZUKA 2AKKA 2LQWA 2LCSA 3ZL7C 1AWXA 2CREA 2DL8A 2L0AA 1ZX6A 1Z9QA 1GCPA 1ZUUA 4OMLA 4CC3A 2EYWA 2RQTA 4CC7A 2HCKA 1ZBJA 1N5ZA 1NLPC 2ED1A 2FPEA 3U23A 1WA7A 2IIMA 4IIOA 1SPKA 1W70A 2QDLA 1XOVA 2CH4W 4X1VA 4J9EA 4ESRA 2K3BA 2EGEA 2JT4A 4RTXA 2ED0A 2JTEA 1ZLMA 4J9CA 3RBBB 2LZ6B 2EYXA 4Z89A 2A08A 2GBQA 1B3QA 3I9QA 4JJBA 1VYUA 1GBQA 4JZ4A 1U06A 5L23A 2DILA 3M0UA 1WXBA 4J9IA 1U3OA 2LNHB 2EYZA 1Y0MA 1JXOA 2L3SA 1GBRA 4JJCA 2HBWA 3KFVA 3ULRB 2JS2A 2K79A 1QWEA 2XMFA 1WXUA 2CDTA 2MCNA 2NWMA 1GFCA 2DNUA 1UHCA 1I1JA 2FPDA 1WX6A 2FRWA 1NYGA 2EVRA 2KE9A 1YN8A 1Y57A 3UA7A 4Z8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJY A;  1WDX A;  2YSQ A;  3VS0 A;  3R6N A;  4RTU A;  2DRK A;  3M0T A;  2YUN A;  5EC7 A;  1X2Q A;  1VYV A;  2A28 A;  2KT8 A;  4RTV A;  1E7O A;  3NMZ C;  2E5K A;  1TUC A;  2SEM A;  3M0Q A;  3PVQ A;  1OPK A;  2JM9 A;  3EG0 A;  5IXF A;  2EGA A;  2OAW A;  4GBQ A;  2M51 A;  4J9H A;  5FWC A;  1KIK A;  2JW4 A;  1QLY A;  1GRI A;  2EBP A;  2DBM A;  2VVK A;  2RPN A;  1PRM C;  3UAT A;  1AEY A;  4JJD A;  1JQQ A;  3M0R A;  2PZ1 A;  4QT7 A;  3LH5 A;  2FO0 A;  3H0F A;  3TSZ A;  4HVV A;  1K76 A;  3REB B;  1M3C A;  2ROL A;  1WI7 A;  5FWB A;  1YWP A;  3C0C A;  1YP5 A;  4RTT A;  4F14 A;  2YUQ A;  5IHI A;  4A63 B;  1I07 A;  1UGV A;  2FPF A;  2VKN A;  3H41 A;  1HD3 A;  1ARK A;  4K11 A;  2DE0 X;  1SRM A;  1WLP B;  1V1C A;  1E6H A;  2CSQ A;  2CUB A;  3H0H A;  4JZ3 A;  1MV0 B;  2LX7 A;  4M4Z A;  4AG1 C;  2KXD A;  4OMQ A;  1KSW A;  3VS6 A;  2AK5 A;  3NHN A;  2LQN A;  4OMM A;  2J05 A;  3RNJ A;  2B86 A;  2V1R A;  1UUE A;  1JO8 A;  3O5Z A;  1S1N A;  1UEC A;  3NPF A;  1W6X A;  1U5S A;  2VWF A;  1KFZ A;  1K9A A;  2KGT A;  3VS7 A;  2EPD A;  1AZE A;  1ABQ A;  2K9G A;  2SRC A;  2ABL A;  2X3W D;  4ORZ A;  1YCS B;  3PE0 A;  1K0S A;  3VS2 A;  2DMO A;  2C0I A;  2DLP A;  2KXC A;  2D1X A;  1Z9Z A;  2JS0 A;  1TUD A;  1NM7 A;  1QKX A;  1X2K A;  2DJQ A;  1TG0 A;  1NYF A;  3VS1 A;  3M0S A;  2KBT A;  1CKA A;  1KJW A;  1JU5 C;  2EYY A;  1AWJ A;  1LCK A;  2O88 A;  2W0Z A;  2MIO A;  5IH2 A;  2K2M A;  1BB9 A;  4LE9 A;  1WXT A;  2DA9 A;  4WCI A;  2GNC A;  2RNA A;  3VS4 A;  2EW3 A;  4OMO A;  3EHR A;  1NEB A;  3I35 A;  2GTJ A;  1WIE A;  2J6K A;  2YDL A;  2DL4 A;  5HCK A;  1X43 A;  1K0X A;  1BK2 A;  2KRN A;  4LNP A;  1OOT A;  1SEM A;  2GTO A;  1VYT A;  3REA B;  4CC4 B;  1MUZ A;  2BZX A;  2ENM A;  2L3Q A;  3THK A;  1AZG B;  1QCF A;  1WYX A;  2M0Y A;  3UA6 A;  3EG3 A;  3VS5 A;  3UF4 A;  3VRZ A;  2D8J A;  1B07 A;  1UDL A;  2BZ8 A;  1H3H A;  1M8M A;  2C0T A;  4GLM A;  4AFU C;  5IXB A;  2F2X A;  1J3T A;  4JPB W;  3I5R A;  1GFD A;  3IQL A;  2J6O A;  2KEA A;  2CT4 A;  3VS3 A;  1G83 A;  1BU1 A;  5ECA A;  2LMJ A;  3GBQ A;  2KRS A;  2CT3 A;  2HDA A;  1MV3 A;  4ZNX A;  2F2V A;  1VA7 A;  1W1F A;  2AZV A;  1T0J A;  2D0N A;  2EGC A;  2DL7 A;  4LN2 A;  5GJW B;  4IIM A;  3EG2 A;  1GCQ C;  4HCK A;  4OMN A;  4J9G A;  2KT1 A;  2H8H A;  2W10 A;  3QWX X;  3M0P A;  2OI3 A;  4J9D A;  4F16 A;  1FYN A;  1T3L A;  2O31 A;  2P4R A;  1QKW A;  2JMC A;  1WFW A;  4KRT A;  2GGR A;  2DL5 A;  4CC2 A;  2A36 A;  1K1Z A;  1RI9 A;  2O2O A;  4Y92 A;  1UE9 A;  1IO6 A;  4HXJ A;  2DRM A;  2KYB A;  4E6R A;  4Z88 A;  3TSW A;  2HEQ A;  4J9F A;  1X6B A;  2YT6 A;  2O9V A;  2RQR A;  1SHF A;  1M3A A;  4OMP A;  2RQU A;  1M27 C;  2GQI A;  2RN8 A;  1OPL A;  1ABO A;  4AG2 C;  3EG1 A;  1UJ0 A;  1E6G A;  4F17 A;  3FJ5 A;  1PKS A;  2HSP A;  2G6F X;  4J9B A;  1AOJ A;  4AFZ C;  1EFN A;  2L2P A;  4FSS A;  1A0N B;  3VRY A;  2DF6 A;  1HJD A;  2PNI A;  4R0K A;  2CH4 A;  4HVU A;  5FW9 A;  4RTY A;  2BTT A;  2LJ1 A;  2X3X D;  1OV3 A;  2YUP A;  1NLO C;  2C0O A;  2V1Q A;  1RLP C;  2EKH A;  2A37 A;  2I0N A;  4D8D A;  1OEB A;  3SHW A;  2K7A A;  2RMO A;  2O9S A;  2ROT A;  4DEX A;  1SSH A;  1AWO A;  2LP5 A;  3SEM A;  4RUG A;  4D8K A;  4RTZ A;  1UHF A;  1H8K A;  2ESW A;  2FEI A;  1ZSG A;  2J7I A;  2LJ0 A;  2ECZ A;  3H0I A;  2CUD A;  1YNZ A;  1UFF A;  1GCQ A;  1JXM A;  2JMA A;  2FG0 A;  2JM8 A;  2JXB A;  1SRL A;  1X6G A;  2DBK A;  3JV3 A;  2DL3 A;  3I5S A;  1FMK A;  2K6D A;  1CKB A;  1PRL C;  1JEG A;  1T3S A;  5IHK A;  4DEY A;  1M3B A;  3A98 A;  1BBZ A;  2FRY A;  5I11 A;  2DVJ A;  4RTW A;  3EGU A;  2RQW A;  3EHQ A;  1ZUY A;  5GJV B;  2RQV A;  1RUW A;  2DM1 A;  1T0H A;  2KNB B;  2DYB A;  1G2B A;  1AD5 A;  2BZY A;  2YUO A;  1X27 A;  1NEG A;  1UG1 A;  2PTK A;  2AKL A;  2KRM A;  1RLQ C;  2D8H A;  3NGP A;  1PHT A;  2F2W A;  1YWO A;  2DX1 A;  1HSQ A;  2NUZ A;  1CSK A;  1M30 A;  2J6F A;  1SHG A;  3TVT A;  4EIK A;  2KRO A;  2RF0 A;  4AFQ C;  2AZS A;  1X69 A;  2CSI A;  1GL5 A;  1PKT A;  2L3P A;  1AWW A;  3QWY A;  4AFS C;  3CQT A;  4HVW A;  2KYM A;  2MOX A;  3PVL A;  1H92 A;  1PWT A;  2KR3 A;  4LUE A;  1NG2 A;  1UTI A;  2J06 A;  1PNJ A;  1K4U S;  5I22 A;  2OJ2 A;  5IHN A;  1I0C A;  2LJ3 A;  1QWF A;  1AVZ C;  4LUD A;  2EQI A;  1ZUK A;  2AKK A;  2LQW A;  2LCS A;  3ZL7 C;  1AWX A;  2CRE A;  2DL8 A;  2L0A A;  1ZX6 A;  1Z9Q A;  1GCP A;  1ZUU A;  4OML A;  4CC3 A;  2EYW A;  2RQT A;  4CC7 A;  2HCK A;  1ZBJ A;  1N5Z A;  1NLP C;  2ED1 A;  2FPE A;  3U23 A;  1WA7 A;  2IIM A;  4IIO A;  1SPK A;  1W70 A;  2QDL A;  1XOV A;  2CH4 W;  4X1V A;  4J9E A;  4ESR A;  2K3B A;  2EGE A;  2JT4 A;  4RTX A;  2ED0 A;  2JTE A;  1ZLM A;  4J9C A;  3RBB B;  2LZ6 B;  2EYX A;  4Z89 A;  2A08 A;  2GBQ A;  1B3Q A;  3I9Q A;  4JJB A;  1VYU A;  1GBQ A;  4JZ4 A;  1U06 A;  5L23 A;  2DIL A;  3M0U A;  1WXB A;  4J9I A;  1U3O A;  2LNH B;  2EYZ A;  1Y0M A;  1JXO A;  2L3S A;  1GBR A;  4JJC A;  2HBW A;  3KFV A;  3ULR B;  2JS2 A;  2K79 A;  1QWE A;  2XMF A;  1WXU A;  2CDT A;  2MCN A;  2NWM A;  1GFC A;  2DNU A;  1UHC A;  1I1J A;  2FPD A;  1WX6 A;  2FRW A;  1NYG A;  2EVR A;  2KE9 A;  1YN8 A;  1Y57 A;  3UA7 A;  4Z8A A; 
#chains in the Genus database with same CATH topology
 4DBQ A;  1VQK A;  1WDX A;  2V26 A;  1UGP B;  2DRK A;  3M0T A;  2YUN A;  1B7T A;  4JRQ A;  2A28 A;  3CCS T;  3OYG A;  2XI9 A;  3JCM e;  1E7O A;  3NMZ C;  3PVQ A;  1IHW A;  2JM9 A;  3CCS A;  5IXF A;  2LRQ A;  4XTZ A;  3CCR Q;  3CCM T;  2HNI A;  3CCQ Q;  5A0L A;  1PRM C;  3LYI A;  3JB9 D;  2E6Z A;  4HKE A;  3CCM A;  2PZ1 A;  4QT7 A;  4M75 C;  3N5B B;  2IVW A;  1QVF P;  1S72 T;  4WTO B;  2DZ9 A;  2QDY B;  3OBY A;  3RMS A;  3QUI A;  1M3C A;  3REB B;  2CP6 A;  5IT9 E;  4DBH A;  2JTF A;  3JB9 F;  3SD4 A;  1O9S A;  3OYF A;  2RHZ A;  1OI1 A;  1VQO T;  4A63 B;  3P8H A;  5KYY A;  3TEE A;  1SRM A;  1QVF S;  4QQD A;  1I5L A;  4MZT A;  3FDR A;  3MP1 A;  4JZ3 A;  1MV0 B;  1G8X A;  4AG1 C;  2YLB A;  3CBM A;  1KSW A;  2RD1 A;  3JAM E;  1K9M C;  1G3S A;  3G4S A;  1Q81 R;  4M78 D;  1YIJ T;  2B86 A;  1JO8 A;  3M58 A;  3NPF A;  2DO3 A;  1YIJ A;  3CCE Q;  9ATC B;  1BI2 A;  2SRC A;  4A4G A;  3VS2 A;  1NPP A;  2DMO A;  5J3B A;  2DLP A;  3G6E T;  2JS0 A;  4DOW A;  1NM7 A;  1QKX A;  1W2B P;  5I21 A;  2AHJ B;  2EQK A;  4M7A C;  1YCY A;  4M78 B;  5I2S A;  2CZ1 B;  1LCK A;  2MIO A;  2ZPF B;  1KHC A;  1M5Q 1;  2GNC A;  4VUB A;  4NOY A;  1OYX A;  2GF7 A;  3V8L A;  1WHJ A;  5HCK A;  4M77 E;  4OB1 B;  4OB2 B;  1W2B S;  3OS1 A;  1VQ6 Q;  2VGM A;  2QQR A;  1OX9 A;  1IZ6 A;  3REA B;  1AZG B;  3QHS A;  1QCF A;  3UA6 A;  1N6A A;  4O6J A;  3OYL A;  4C92 E;  4FYW B;  4IUP A;  4C5H A;  2BIV A;  1ZSZ B;  2CZ0 B;  2DZC A;  3GP8 A;  3FJP A;  1M8M A;  5IXB A;  1JB0 E;  3M54 A;  1SSF A;  5GAO l;  2J6O A;  5GAN 8;  4XU3 A;  3E2U A;  2D6F A;  2FZK B;  2F2V A;  2AZV A;  2DL7 A;  5GJW B;  1QCO A;  4OMN A;  4Y28 E;  3CME T;  2H8H A;  3QWX X;  3M0P A;  1FYN A;  1HYO A;  3JSC A;  2P4R A;  2JMC A;  1MMD A;  1WFW A;  3E9F A;  3CME A;  2GGR A;  3EH2 A;  3QYH B;  4C0Z A;  1XNI A;  2A36 A;  4JRI A;  2FL7 A;  3OS2 A;  3QG1 A;  1IO6 A;  4OB0 B;  4B9X A;  4QVD A;  2CS7 A;  4Z88 A;  3RR6 A;  4FM4 B;  2HEQ A;  4V2S A;  1X6B A;  1VQ8 A;  2YT6 A;  4FL6 A;  3QJY A;  2MMP A;  2K4Y A;  3CD6 T;  1ZA2 B;  1VQ4 T;  3A8H B;  3I55 Q;  5CCA A;  4PFZ A;  1SG5 A;  4AG2 C;  4KH1 B;  1RAA B;  4HCC A;  1UJ0 A;  4C8Q G;  1YHQ T;  2G6F X;  1AOJ A;  2L2P A;  3HSB A;  2DF6 A;  3H6Z A;  1YHQ A;  1NZ9 A;  2OTJ T;  2PNI A;  3RMQ A;  4HVU A;  5FW9 A;  1RAD B;  2QTV A;  2RI3 A;  1OX8 A;  2OTJ A;  1BI3 A;  2YUP A;  3C4S A;  3SWN A;  1NLO C;  2RO0 A;  2NUT A;  4HCB A;  4XTV A;  1RLP C;  2EKH A;  5EG2 A;  4OF1 A;  4BE0 A;  1OEB A;  3FRN A;  2K7A A;  3SWN B;  1JRI A;  1AWO A;  2LP5 A;  1G3T A;  3OYB A;  4C0D B;  2LT4 A;  5DLQ E;  1B34 B;  4RTZ A;  2QA4 Q;  4E2F B;  5LJ5 e;  3P8D A;  4M77 D;  2J7I A;  4KH0 B;  4NL2 A;  2X4W A;  2DXB A;  1UFF A;  1GCQ A;  1JXM A;  1TXQ A;  1VIE A;  2JMA A;  4BI4 A;  4M77 F;  1SRL A;  4M77 A;  4YTL A;  2O01 E;  4M75 E;  4PLI A;  1ZA1 B;  1K9M U;  4C92 D;  3OQ5 A;  5KYX A;  3M57 A;  6AT1 B;  1CKB A;  1N8R C;  4M77 B;  5IHK A;  3GIB A;  2YLC A;  2Y90 A;  2LC4 A;  1M3B A;  3A98 A;  1BBZ A;  2QQA A;  1VQP Q;  4DQ2 A;  1I5O B;  4C92 F;  4C92 A;  2FZG B;  2RQV A;  2LCL A;  1ZSZ C;  2DM1 A;  2OTL T;  2KNB B;  2K5L A;  1PD0 A;  3X26 B;  3M4G A;  3FB9 A;  4EMK A;  4FYY B;  2OTL A;  1MMN A;  2MAM A;  3SFM A;  3HRU A;  3JCM f;  3DLL A;  2M02 A;  3CBO A;  1HSQ A;  1X01 A;  1CSK A;  5LJ3 f;  3VUZ A;  1SHG A;  3TVT A;  3VUB A;  4EIK A;  4WF2 A;  2AZS A;  3H8Z A;  3CQT A;  5GAO q;  1BCM A;  2KYM A;  1H92 A;  4B9W A;  4LUE A;  1NG2 A;  2E3H A;  5HKC A;  3JCM Q;  1M1K R;  2VC8 A;  4E7I A;  4PLL A;  1TU0 B;  4M7A E;  2LJ3 A;  1QW1 A;  4N0A C;  1HXD A;  4F7U B;  4J6Y A;  2DFU A;  3EH1 A;  2RM4 A;  1VUB A;  4LDV A;  4ELZ C;  3BDU A;  3BY7 A;  4XAX B;  2RA2 A;  1XJW B;  1I4K 1;  3NTK A;  4KUL A;  4QQG A;  2ED1 A;  3EGD A;  2FPE A;  5GAM e;  3PIP A;  3QBY A;  2RHI A;  1KC8 R;  4MZM A;  4J83 A;  2VUB A;  1W70 A;  4RG8 A;  3OS5 A;  2QDL A;  1Q7Y C;  4PKC C;  2E6N A;  2ED0 A;  1VQ9 Q;  1RAI B;  3RBB B;  2QI2 A;  4HT8 A;  4OMF B;  1S72 Q;  1K73 R;  4PJM A;  1GBQ A;  5C0M A;  4JZ4 A;  2JVV A;  2HQX A;  4L5G A;  1WPY A;  1YJW Q;  1WXB A;  1VQM T;  2LDM A;  1Y0M A;  4MZP A;  1VQO Q;  4NS5 A;  4XK8 E;  4ATO A;  1GBR A;  1IRE B;  4RG2 A;  2CP7 A;  1VQM A;  2GFU A;  3HRS A;  2JS2 A;  1MMG A;  2RH2 A;  4KGV B;  4ZGD B;  1Q95 G;  1QMC A;  1UHC A;  2HL3 A;  4M75 D;  2FPD A;  1WX6 A;  2YRV A;  3OY9 A;  4BE2 A;  5HY6 A;  2CZ7 B;  2EVR A;  2KE9 A;  4L59 A;  1NJI U;  4BDZ A;  1Y57 A;  2XU8 A;  5FRO A;  4DA4 A;  4LD9 K;  1RI0 A;  4M75 F;  4M75 A;  2M0O A;  3QZ5 B;  5IN1 A;  3RIR A;  4C0F A;  3OYJ A;  1X2Q A;  3JCM P;  4F04 B;  2KT8 A;  3JCM W;  2C06 A;  3GPL A;  2P0K A;  2GQV A;  5HK0 A;  2SEM A;  3M0Q A;  1Q86 C;  1OPK A;  3G6E Q;  1AT1 B;  2EGA A;  3G71 T;  4LXC A;  4GBQ A;  2WAC A;  2LQK A;  3CC7 Q;  1QLY A;  2XIC A;  4OVA A;  1GRI A;  2EBP A;  2KY9 A;  5CAI A;  1AEY A;  1O75 A;  2RHY A;  3G71 A;  3J80 E;  3CCL Q;  4M7D C;  1RAE B;  2MYS A;  1UGQ B;  2CYZ B;  3LH5 A;  2E12 A;  2FO0 A;  2DIQ A;  4B6M A;  3H0F A;  1K76 A;  4N4G A;  5LJ3 h;  2ROL A;  1D0X A;  5FWB A;  4QQ6 A;  3HL8 A;  3HTR A;  4QW2 A;  1YP5 A;  2RJF A;  2F5K A;  2QAZ A;  2FYK A;  4BI8 B;  1HD3 A;  1ARK A;  1EX4 A;  4M7A D;  4L6V 5;  4XU0 A;  2CSQ A;  5GAN 4;  3JCM g;  2COY A;  1FX7 A;  4IUQ A;  2LX9 A;  2RK2 A;  5LJ3 g;  4M7A F;  5GAN 2;  4X9D A;  3VU3 C;  5CKF A;  2H3E B;  1KG1 A;  2LQN A;  1FMW A;  3NTI A;  1G5V A;  1KQS P;  1KD1 R;  8ATC B;  2V1R A;  1UUE A;  2VWF A;  4M7A B;  3CCU T;  4ZN1 A;  2EPD A;  1IHV A;  4FT2 A;  5D6X A;  3OYD A;  1AZE A;  2O4X A;  1ABQ A;  1D0Z A;  3A8O B;  5GAN h;  3HFO A;  5LJ5 j;  4A54 A;  1KQS S;  3OW2 P;  2D1X A;  1NE8 A;  3T9N A;  2O4X B;  2DJQ A;  1UEB A;  3M0S A;  1PCX A;  1Q81 C;  1WNL A;  3CBP A;  1KJW A;  1TTH B;  4EPC A;  1JBM A;  1EIF A;  4KGZ B;  2W0Z A;  7AT1 B;  2DA9 A;  4WCI A;  3I35 A;  2GTJ A;  3OW2 S;  2J6K A;  2YDL A;  3KBG A;  2EQU A;  3JB9 G;  2D0Q B;  1BK2 A;  2LVM A;  3X24 B;  5CKD A;  3QJ6 A;  2HMA A;  1N9R A;  1YI2 T;  1BKB A;  3J7A F;  3L2W A;  5LJ5 f;  2GTO A;  1VQK T;  1PSF A;  1WJR A;  4IUU A;  1VQ4 Q;  1MUZ A;  2BZX A;  3G7Z A;  3CD6 Q;  4HT9 A;  1YI2 A;  1V76 A;  5CK9 A;  2M0Y A;  3EG3 A;  2E3I A;  1I81 A;  3LLR A;  3CMA Q;  4EDU A;  4BB7 A;  2BZ8 A;  2C0T A;  3OMG A;  4X34 A;  1J3T A;  3I5R A;  4JJN K;  1RL2 A;  2QG9 B;  3QII A;  2PUK B;  4BY6 B;  2VB6 A;  1YJN A;  3LH0 A;  5LJ5 d;  1X6O A;  3AT1 B;  2FZC B;  1VA7 A;  4M78 G;  1DJ7 B;  1Y71 A;  2RK1 A;  1TWB A;  1T0J A;  2D0N A;  1Q7Y U;  4LN2 A;  3EG2 A;  3MEA A;  4HCK A;  4E47 A;  2R5A A;  4PNO A;  1D0Y A;  2KT1 A;  2W10 A;  2PQW A;  4JDS A;  1KHI A;  1QP3 A;  1TSF A;  3OB9 A;  1VQN T;  3AHU A;  3JB9 J;  4OGE A;  2DL5 A;  2EFI A;  2R58 A;  2JUF A;  4X9C A;  1YIT T;  1VQN A;  2XID A;  1RI9 A;  2EWN A;  1FXX A;  5DLO A;  1YIT A;  3X20 B;  2DRM A;  2KYB A;  4Z02 A;  4XTU A;  3TSW A;  3EG9 B;  2VXF A;  3JCM c;  3G4S T;  1M2O A;  1WHG A;  3I56 A;  5GAN 7;  2KI7 A;  2L8D A;  5GAM j;  5GMK h;  3EFR A;  2RN8 A;  1VQ7 T;  3P8B B;  1ABO A;  1E6G A;  4LDX A;  3FJ5 A;  1PKS A;  1W4S A;  3MCA B;  2LCC A;  1VQ7 A;  3L2U A;  4FSS A;  1VQ5 T;  3VRY A;  3NTH A;  2CH4 A;  4M78 F;  1VQL Q;  4M78 A;  3SDZ A;  1WHK A;  1Q86 U;  1OZ3 A;  5GAO m;  1VQ5 A;  2LJ1 A;  2X3X D;  3PGG A;  2DD4 A;  2E64 A;  3TU4 K;  2V1Q A;  5D7U A;  2A37 A;  3JB9 I;  2K2V A;  4JS4 A;  4D8D A;  1KQ1 A;  2O9S A;  2ROT A;  1IB8 A;  2D9T A;  1BIB A;  2K3X A;  3MET A;  1YBY A;  1KQ2 A;  4RUG A;  2JN0 A;  1H8K A;  2X4J A;  2FEI A;  3UWN A;  4J6W A;  2ECZ A;  2DTH A;  1ZSZ A;  3H0I A;  2CUD A;  4ANJ A;  2EJG A;  2FB7 A;  4MML A;  5GAM d;  2L5Q A;  2JM8 A;  4M7D E;  2EQJ A;  1FMV A;  2F1L A;  3OYE A;  4PJO C;  3DB4 A;  2DBK A;  1OZ2 A;  1IGQ A;  4XTX A;  5CO7 A;  4P5N A;  1OQK A;  5KH6 A;  3I5S A;  4PJL A;  2DVE A;  2DAQ A;  2RJE A;  1PRL C;  3QSU A;  1WQW A;  2BE7 D;  3CC2 T;  3SB2 A;  4DEY A;  5FU6 B;  2FRY A;  5I11 A;  4RTW A;  1ZHI A;  1U8R A;  3QKJ A;  3EHQ A;  1D1C A;  2P0Q A;  3CC2 A;  2BUD A;  5GJV B;  4GLK A;  3EFO B;  5A0G A;  3A1P A;  4BI3 A;  5KYN A;  4FW2 A;  2KK4 A;  2KRM A;  1Y96 B;  2D8H A;  1Q81 U;  4BY6 C;  1QVF A;  3ZFJ A;  2ZPH B;  4J6X A;  4F7U E;  1JJ2 P;  3VKI A;  2PU9 B;  2NUZ A;  2KAF A;  2COW A;  2J6F A;  3CPW P;  3OS0 A;  4AFQ C;  4PJJ A;  1VQ8 T;  1PKT A;  4FU6 A;  3QWY A;  4OB3 B;  2RHU A;  4AFS C;  2HZY A;  4HVW A;  1PM3 A;  3A8M B;  3OYA A;  1PWT A;  4XU1 A;  5J39 A;  2HD0 A;  3S6W A;  1M90 R;  1UTI A;  4J7F A;  2DYI A;  3QDF A;  4NL3 A;  1PNJ A;  3PMI A;  3OBW A;  3CPW S;  4A4K A;  2H3J A;  1I0C A;  1LPL A;  2ZGW A;  2OX7 A;  1FWZ A;  4R56 A;  3MEV A;  4A4H A;  4M77 G;  3MEW A;  2QK0 A;  2X9H A;  2LNV A;  2LQW A;  1D1B A;  1NJI C;  2QEX Q;  1XTD A;  5M9O A;  2CKK A;  4PFO A;  4CC7 A;  3INZ A;  3J81 E;  1D09 B;  4KUI A;  4C92 G;  1NLP C;  4KBM B;  3LW5 E;  2M9U A;  4A53 A;  1G3W A;  2V8K A;  4IIO A;  4A4E A;  1W2B A;  4XQ3 A;  3URG A;  1B34 A;  4PJN A;  1U1S A;  1XOV A;  3C95 A;  4J9E A;  3QO3 A;  4ESR A;  2EGE A;  4AMC A;  2VAS A;  2A08 A;  3CCR T;  3CCQ T;  2DXT A;  5KYW A;  2COZ A;  3G1J A;  3CCR A;  3FEO A;  1U3O A;  2LNH B;  3CCQ A;  2EYZ A;  3CC4 Q;  4N4H A;  1P92 A;  4JJC A;  5KYW B;  1LJO A;  2DIG A;  2DTO A;  1Q82 R;  3CCV Q;  4M7D D;  3PFS A;  1OUL A;  2DNU A;  3RKX A;  2XDB A;  2MPX C;  1PC0 A;  1NYG A;  5DM7 R;  4Z8A A;  5FU7 C;  1UJY A;  3BE3 A;  5GMK i;  2YSQ A;  2YXY A;  1YJ9 Q;  3CCU Q;  4JRP A;  3JCM V;  1VYV A;  4M7D B;  3V7C A;  4RTV A;  3MPU B;  2E5K A;  1TUC A;  3E19 A;  5CKB A;  5FU6 C;  4J5Y A;  4C8Q B;  2LT1 A;  2RJC A;  3EG0 A;  1X75 C;  4D6W A;  3CCE T;  2ZCF B;  2JW4 A;  2WSF E;  2DBM A;  2VVK A;  1M9S A;  2ZPB B;  3UAT A;  3ER0 A;  3CCE A;  2M1H A;  1WHH A;  4F7U F;  1RAH B;  4F7U A;  4HVV A;  2DXU A;  4ZTF A;  2NYS A;  1WI7 A;  2MK5 A;  3HPW A;  1YWP A;  3C0C A;  4DBR A;  4F14 A;  1BI0 A;  2YUQ A;  4C5I A;  3L1A A;  1UGV A;  2FPF A;  3H41 A;  1VQK Q;  3CXC P;  2DE0 X;  2RI2 A;  3M59 A;  3H0H A;  1VQ6 T;  2LX7 A;  4E7S A;  2KXD A;  2E5Q A;  5AYF A;  2CGH A;  2AK5 A;  1VQ6 A;  4OMM A;  3CCS Q;  4M75 G;  1SKU B;  4E7Z A;  3BW1 A;  3CXC S;  3CCJ T;  3RNJ A;  5D6W A;  4C5E A;  1R0C B;  1S1N A;  1UEC A;  1W6X A;  1U5S A;  2KGT A;  3X28 B;  1Q82 U;  3CCJ A;  3CCM Q;  4PJO E;  3S3O A;  1YCS B;  2CP3 A;  3PE0 A;  1K0S A;  2A0F B;  4CI0 C;  3OA6 A;  4E7L A;  1Z9Z A;  4C5G A;  1TUD A;  3EGX A;  1TG0 A;  3VS1 A;  2DEQ A;  5FRM A;  1KD1 C;  1CKA A;  2VV5 A;  5CIU A;  1JU5 C;  2EYY A;  1AWJ A;  2EAY A;  1WJS A;  2K2M A;  4LE9 A;  1RAF B;  1WXT A;  3VS4 A;  1D3B B;  2EW3 A;  3EGX B;  4OMO A;  1NEB A;  4A4F A;  3MP6 A;  8AT1 B;  1X43 A;  2KRN A;  4LNP A;  3G4S Q;  3RKW A;  1OOT A;  1UGR B;  4CRI A;  2ENM A;  1YFN A;  2NUP B;  1WYX A;  3GNF B;  1YIJ Q;  3ZEH A;  3HFN A;  3VS5 A;  3UF4 A;  2WSE E;  4M7A G;  3OYY A;  2PUO B;  4GLM A;  1M1K U;  4BAC A;  3I55 T;  4JPB W;  2QYZ A;  2CT4 A;  3VS3 A;  3I55 A;  2DER A;  3GBQ A;  2KRS A;  2HDA A;  1W1F A;  2EGC A;  4IIM A;  1GCQ C;  4J9G A;  1TH7 A;  1I8F A;  3JCM h;  2BE9 B;  2RB6 A;  1QKW A;  3GLX A;  4C8Q C;  4ME7 A;  1Y7X A;  1IXD A;  4BDY A;  4CC2 A;  1U1T A;  1KC8 U;  4DOV A;  2KDS A;  2HBP A;  3L2Q A;  2O2O A;  4Y92 A;  1UE9 A;  4HXJ A;  2QA4 T;  2K5I A;  2K5F A;  3ASK A;  2BKD N;  4RCC A;  1K73 U;  1IRX A;  1M3A A;  4OMP A;  2QA4 A;  2RQU A;  4E7K A;  4M7A A;  2GQI A;  4LDY A;  5L8R E;  1OPL A;  2X4Y A;  3A5Z B;  4KT0 E;  2JZ2 A;  4F17 A;  4J9B A;  2IG0 A;  4AFZ C;  3A8L B;  4HCZ A;  2EIF A;  1A0N B;  3LGL A;  4PJO D;  4RTY A;  3M4Y A;  2BTT A;  3CME Q;  1OV3 A;  3RES A;  4TVR A;  1WHM A;  4FIB A;  3V8J A;  4PL6 A;  2X51 A;  2I0N A;  1VQP A;  3ZBD A;  2QQ9 A;  3L2V A;  1VIF A;  2RMO A;  2EKO A;  3V7S A;  2XDP A;  1VQ8 Q;  1LOJ A;  1RAG B;  4PJO B;  2M16 A;  4MMK A;  3VYH B;  2EJF A;  4FCY A;  2ESW A;  1ZSG A;  2LJ0 A;  2E41 A;  4FYX B;  5GAN 3;  4BE1 A;  3JCM b;  2JXB A;  1BI1 A;  1YHQ Q;  4IUT A;  1X6G A;  5AT1 B;  4ZGJ B;  3JV3 A;  4XU2 A;  1LNX A;  3H9N A;  2AIR B;  3UT1 A;  2K57 A;  2DL3 A;  1WGS A;  2OTJ Q;  3FC3 A;  4C0G A;  1YJN T;  2K6D A;  2MWO A;  1T3S A;  1QVP A;  2DVJ A;  3EGU A;  3QPH A;  2FHD A;  1M2V B;  1RUW A;  1G3Y A;  3QDR B;  3VYG A;  2A7Y A;  2BZY A;  1MNE A;  2YRD A;  5GAO n;  3M56 A;  4QKU A;  1VOM A;  3PT9 A;  2PTK A;  2AKL A;  4E7H A;  1KD1 U;  2WSC E;  2XKO C;  5LJ3 e;  1PHT A;  2F2W A;  2HL5 C;  5J26 A;  2DX1 A;  1M30 A;  3EG9 A;  2JNG A;  2R57 A;  4O5V A;  2KRO A;  1GL5 A;  2L3P A;  1VQ9 T;  1WJQ A;  2P0P A;  5GMK l;  3I56 T;  3JRZ A;  2DET A;  1VQ9 A;  2HQE A;  2J06 A;  3M55 A;  1YJW T;  1S72 A;  5I22 A;  4FW1 A;  5IHN A;  4EMG A;  1K8A R;  4IKF A;  3RKY A;  1AVZ C;  3BDL A;  4LUD A;  1YJW A;  1KQS A;  1QP2 A;  1ZUK A;  1BCO A;  1VQO A;  4JRK A;  3ZL7 C;  2CRE A;  3F70 A;  3PTA A;  2L0A A;  3M53 A;  3E9G A;  1ZUU A;  2P84 A;  4OML A;  3UPU A;  1M90 C;  2OTL Q;  5KYY B;  3V7R A;  4OGC A;  3S3M A;  2HCK A;  5GAN e;  1ZBJ A;  1N5Z A;  2QGF B;  2ZAE A;  3OSV A;  4QVC A;  3VV0 A;  2JJ9 A;  3OW2 A;  1C0M A;  2DPP B;  3U23 A;  1PSE A;  4RKU E;  4IUV A;  5GAM f;  2IIM A;  3OYH A;  1SPK A;  3TCJ A;  2P4T A;  2A3L A;  5DY9 A;  2RI5 A;  5KYU A;  2JTE A;  4ZTJ A;  4J9C A;  3CPF A;  5GAO r;  3QZ9 B;  2EYX A;  4Z89 A;  3EFS A;  3I9Q A;  3CC7 T;  1VYU A;  1QCN A;  3G6E A;  3PMT A;  1TOV A;  2ZPI B;  3CEY A;  4DBF A;  5L23 A;  3M0U A;  5KYU B;  3RDV A;  3CCL T;  2FVU A;  3CC7 A;  4OP0 A;  4PFP A;  2KMT A;  1JXO A;  5FU7 B;  5KE2 A;  3HRT A;  5GAN 5;  3CCL A;  1QVG P;  3KFV A;  3WVE B;  2K79 A;  2XMF A;  2CDT A;  2V8J A;  2NWM A;  3MJX A;  3OMC A;  1GFC A;  5A0D A;  2K3Y A;  4C8Q E;  5LJ5 h;  1I1J A;  2LQ8 A;  1N27 A;  2E65 A;  2FRW A;  3MEU A;  4QVZ A;  3EFO A;  3EAE A;  3L2R A;  1QVG S;  3CCJ Q;  3VS0 A;  2HQH A;  1Y96 A;  4RTU A;  3R6N A;  1OU8 A;  3M5A A;  2LTO A;  4FYV B;  5EC7 A;  1Q82 C;  4R55 A;  2E4H A;  5GAN 6;  4BD3 A;  2XK0 A;  5LJ5 g;  1K8A U;  1KK7 A;  4N0A A;  2PVD B;  2XD0 A;  2OAW A;  4J9H A;  2M51 A;  5FWC A;  1KIK A;  2DD5 A;  5CKH A;  3L2Z A;  2RPN A;  3PNW C;  4JJD A;  1JQQ A;  3M0R A;  1VQM Q;  1M8V A;  1NBE B;  1MMA A;  2AT1 B;  1MND A;  2CP2 A;  2KVQ G;  3LWH A;  3TSZ A;  1JJ2 S;  1NPR A;  3D7S B;  1K9M R;  4RTT A;  5GMK e;  3Q1J A;  5IHI A;  1I07 A;  2VKN A;  4K11 A;  1BIA A;  1LVK A;  3TQ7 P;  1WLP B;  1V1C A;  1M1G A;  1E6H A;  2CUB A;  2HAX A;  4M4Z A;  4JUV A;  3FLG A;  3GOX A;  2DEU A;  4OMQ A;  5D6Y A;  4KUD K;  4M7D G;  3VS6 A;  4LDU A;  3NHN A;  2XG8 D;  1M1K C;  2J05 A;  4GY5 A;  3CD6 A;  1VQ4 A;  4N4I A;  3O5Z A;  1RAB B;  1TS9 A;  3CMA T;  5I2M A;  1KFZ A;  1K9A A;  3VS7 A;  4AT1 B;  3G71 Q;  2L3R A;  1HK9 A;  2CZ6 B;  2K9G A;  4JLI A;  4ORZ A;  2ABL A;  2X3W D;  3KXT A;  3CMA A;  2QQB A;  2C0I A;  2IPO B;  2KXC A;  5A2Q E;  3L42 A;  1H3Z A;  1QQJ A;  5GAM h;  1X2K A;  1NYF A;  1R8O B;  2KBT A;  1UGS B;  3M9Q A;  2O88 A;  1WQ7 A;  5IH2 A;  1BB9 A;  2ZPG B;  1KC8 C;  2NUT B;  4RCB A;  4F7U G;  2RNA A;  3EHR A;  4XTW A;  1WIE A;  2DL4 A;  3DKM A;  1SF9 A;  3MHX A;  1K0X A;  3A8G B;  2JTM A;  5CVI A;  1QVG A;  2MF2 A;  2HKN A;  2XHC A;  2JOY A;  3LX7 A;  3MO8 A;  4M78 C;  2Z0W A;  5GAM g;  1K73 C;  4C8Q D;  1SEM A;  1VYT A;  4CC4 B;  5HK3 A;  2L3Q A;  3THK A;  5CKE A;  4M7D F;  4M7D A;  5FRN A;  4UC4 A;  4ZN3 A;  2YRC A;  1XQH A;  1ACM B;  3VRZ A;  2D8J A;  4C8Q F;  1B07 A;  4C8Q A;  2EQM A;  4JS5 A;  1UDL A;  1M90 U;  1H3H A;  4AFU C;  3PIO A;  5LJ3 j;  2F2X A;  2DK3 A;  1PG5 B;  1GFD A;  2GFA A;  3IQL A;  1TUG B;  2KEA A;  1EZZ B;  4IUR A;  4Y91 A;  1G83 A;  1BU1 A;  5ECA A;  2LMJ A;  2CT3 A;  3OYM A;  1MV3 A;  1V29 B;  1JJ2 A;  4ZNX A;  5KYX B;  3UDC A;  2DKG A;  3HP9 A;  1VQL T;  2MWP A;  3CPW A;  2E70 A;  2YWW A;  3C12 A;  3QXE B;  3LGF A;  2G3R A;  1BYM A;  3WVD B;  3OYI A;  4J9D A;  2OI3 A;  2YHT A;  4F16 A;  4C92 B;  1VQL A;  1T3L A;  2O31 A;  4KRT A;  2EJ9 A;  1C6V X;  2L89 A;  2QXF A;  4EMK B;  5IAY A;  4E7J A;  1YI2 Q;  1K1Z A;  3LWI A;  1NJI R;  1RAC B;  5CQX A;  1GXI E;  4EMH A;  3S3N A;  4E6R A;  4XTY A;  5GAN j;  1C1A A;  2CP5 A;  4J9F A;  2O9V A;  2RQR A;  1SHF A;  3MKD A;  4ZGE B;  4ELY C;  2KSS A;  1M27 C;  1M1F A;  2RHX A;  3DLM A;  3JCM d;  2Y4X A;  1YJN Q;  3EG1 A;  5LL6 S;  5LJ3 d;  2HSP A;  1EFN A;  2ZZD A;  3NFC A;  4J8O A;  1IGU A;  1HJD A;  3OSS C;  4R0K A;  1AHJ B;  1ZBX A;  4MDW A;  5GAN f;  2C0O A;  2RJD A;  1D3B A;  2PVO B;  1VQN Q;  3SHW A;  3DB3 A;  1YIT Q;  3EGD B;  4DEX A;  2MI6 A;  1SSH A;  2EYQ A;  3SEM A;  1WZO A;  3I56 Q;  2NUP A;  2I2L A;  4D8K A;  2PVG B;  3VJP A;  1UHF A;  3R6O A;  2KQW A;  4J7I A;  1N8R R;  3O8V A;  5GAN d;  4KGX B;  3SWN C;  2GCX A;  2QTX A;  2VYT A;  1YNZ A;  4Q5W A;  2F5T X;  1VQ7 Q;  2FG0 A;  1H64 1;  3HHT B;  4C0D C;  2QAS A;  4PK4 A;  3JB9 H;  1VQ5 Q;  5FLX E;  3RER A;  1FMK A;  2X35 A;  1JEG A;  1F1B B;  1PD1 A;  4LDW A;  2RQW A;  4LD6 A;  4RMO A;  2QEX T;  1ZUY A;  2DXC A;  5C6S A;  1T0H A;  1N9S A;  2DYB A;  1G2B A;  1AD5 A;  2QEX A;  2YUO A;  1X27 A;  1NEG A;  1UG1 A;  1Y07 A;  2B8A A;  4M77 C;  3RUX A;  4M75 B;  5GMK j;  1RLQ C;  4PJO G;  1OU9 A;  3NGP A;  3GNG A;  3MP8 A;  5CQY A;  1YWO A;  2VXE A;  2ZPE B;  3KUF A;  3TRE A;  2HSE B;  2RF0 A;  4MDX A;  1X69 A;  2CSI A;  2ATC B;  1AWW A;  4C92 C;  5CR2 A;  3X25 B;  3CXC A;  2MOX A;  3PVL A;  2HKQ B;  1R0B G;  2KR3 A;  2E1H A;  2Y4Y A;  4EMK C;  1K4U S;  5KE3 A;  2OJ2 A;  1QWF A;  3CC4 T;  2NLU A;  3CC2 Q;  2EQI A;  2AKK A;  2OAU A;  2F69 A;  2LCS A;  3CCV T;  1AWX A;  3CC4 A;  2DL8 A;  1ZX6 A;  1Z9Q A;  1GCP A;  1Q7Y R;  4CC3 A;  3HKS A;  3FIF A;  2EYW A;  2QGG A;  3BFM A;  3CCV A;  1D1A A;  2RQT A;  1N8R U;  2DJZ A;  4M78 E;  1VQP T;  1K8A C;  5GAO p;  3E1S A;  3OYN A;  2CP0 A;  4HA8 A;  4PJO F;  1WA7 A;  1YJ9 T;  4PJO A;  5KCH A;  1MGQ A;  1UB4 A;  2V8I A;  3OYC A;  2CH4 W;  4X1V A;  2DTI A;  2K3B A;  1YJ9 A;  2JT4 A;  2VGN A;  3CCU A;  4RTX A;  1MHN A;  3C94 A;  1ZLM A;  2LZ6 B;  4FSX A;  2GBQ A;  1B3Q A;  3V8K A;  1M4Z A;  4JJB A;  2X4X A;  3WXM B;  1U06 A;  2DIL A;  5KCO A;  3GF5 A;  4J9I A;  1ZQ1 A;  4II1 A;  5GMK m;  4BUG A;  2E10 A;  2L3S A;  3ME9 A;  2HBW A;  3ULR B;  1WHL A;  1QWE A;  5GAN g;  1WXU A;  4FT4 A;  2MCN A;  1R77 A;  3JCM J;  2XDD A;  1M2V A;  2R5M A;  1Q86 R;  3OYK A;  2QQS A;  1YN8 A;  3UA7 A;  3JCM X;  3QYG B;  4JLG A; 
#chains in the Genus database with same CATH homology
 1UJY A;  1WDX A;  2YSQ A;  3VS0 A;  3R6N A;  4RTU A;  2DRK A;  3M0T A;  2YUN A;  5EC7 A;  1X2Q A;  1VYV A;  2A28 A;  2KT8 A;  4RTV A;  1E7O A;  3NMZ C;  2E5K A;  1TUC A;  2SEM A;  3M0Q A;  3PVQ A;  1OPK A;  2JM9 A;  3EG0 A;  5IXF A;  2EGA A;  2OAW A;  4GBQ A;  2M51 A;  4J9H A;  5FWC A;  1KIK A;  2JW4 A;  1QLY A;  1GRI A;  2EBP A;  2DBM A;  2VVK A;  2RPN A;  1PRM C;  3UAT A;  1AEY A;  4JJD A;  1JQQ A;  3M0R A;  2PZ1 A;  4QT7 A;  3LH5 A;  2FO0 A;  3H0F A;  3TSZ A;  4HVV A;  1K76 A;  3REB B;  1M3C A;  2ROL A;  1WI7 A;  5FWB A;  1YWP A;  3C0C A;  1YP5 A;  4RTT A;  4F14 A;  2YUQ A;  5IHI A;  4A63 B;  1I07 A;  1UGV A;  2FPF A;  2VKN A;  3H41 A;  1HD3 A;  1ARK A;  4K11 A;  2DE0 X;  1SRM A;  1WLP B;  1V1C A;  1E6H A;  2CSQ A;  2CUB A;  3H0H A;  4JZ3 A;  1MV0 B;  2LX7 A;  4M4Z A;  4AG1 C;  2KXD A;  4OMQ A;  1KSW A;  3VS6 A;  2AK5 A;  3NHN A;  2LQN A;  4OMM A;  2J05 A;  3RNJ A;  2B86 A;  2V1R A;  1UUE A;  1JO8 A;  3O5Z A;  1S1N A;  1UEC A;  3NPF A;  1W6X A;  1U5S A;  2VWF A;  1KFZ A;  1K9A A;  2KGT A;  3VS7 A;  2EPD A;  1AZE A;  1ABQ A;  2K9G A;  2SRC A;  2ABL A;  2X3W D;  4ORZ A;  1YCS B;  3PE0 A;  1K0S A;  3VS2 A;  2DMO A;  2C0I A;  2DLP A;  2KXC A;  2D1X A;  1Z9Z A;  2JS0 A;  1TUD A;  1NM7 A;  1QKX A;  1X2K A;  2DJQ A;  1TG0 A;  1NYF A;  3VS1 A;  3M0S A;  2KBT A;  1CKA A;  1KJW A;  1JU5 C;  2EYY A;  1AWJ A;  1LCK A;  2O88 A;  2W0Z A;  2MIO A;  5IH2 A;  2K2M A;  1BB9 A;  4LE9 A;  1WXT A;  2DA9 A;  4WCI A;  2GNC A;  2RNA A;  3VS4 A;  2EW3 A;  4OMO A;  3EHR A;  1NEB A;  3I35 A;  2GTJ A;  1WIE A;  2J6K A;  2YDL A;  2DL4 A;  5HCK A;  1X43 A;  1K0X A;  1BK2 A;  2KRN A;  4LNP A;  1OOT A;  1SEM A;  2GTO A;  1VYT A;  3REA B;  4CC4 B;  1MUZ A;  2BZX A;  2ENM A;  2L3Q A;  3THK A;  1AZG B;  1QCF A;  1WYX A;  2M0Y A;  3UA6 A;  3EG3 A;  3VS5 A;  3UF4 A;  3VRZ A;  2D8J A;  1B07 A;  1UDL A;  2BZ8 A;  1H3H A;  1M8M A;  2C0T A;  4GLM A;  4AFU C;  5IXB A;  2F2X A;  1J3T A;  4JPB W;  3I5R A;  1GFD A;  3IQL A;  2J6O A;  2KEA A;  2CT4 A;  3VS3 A;  1G83 A;  1BU1 A;  5ECA A;  2LMJ A;  3GBQ A;  2KRS A;  2CT3 A;  2HDA A;  1MV3 A;  4ZNX A;  2F2V A;  1VA7 A;  1W1F A;  2AZV A;  1T0J A;  2D0N A;  2EGC A;  2DL7 A;  4LN2 A;  5GJW B;  4IIM A;  3EG2 A;  1GCQ C;  4HCK A;  4OMN A;  4J9G A;  2KT1 A;  2H8H A;  2W10 A;  3QWX X;  3M0P A;  2OI3 A;  4J9D A;  4F16 A;  1FYN A;  1T3L A;  2O31 A;  2P4R A;  1QKW A;  2JMC A;  1WFW A;  4KRT A;  2GGR A;  2DL5 A;  4CC2 A;  2A36 A;  1K1Z A;  1RI9 A;  2O2O A;  4Y92 A;  1UE9 A;  1IO6 A;  4HXJ A;  2DRM A;  2KYB A;  4E6R A;  4Z88 A;  3TSW A;  2HEQ A;  4J9F A;  1X6B A;  2YT6 A;  2O9V A;  2RQR A;  1SHF A;  1M3A A;  4OMP A;  2RQU A;  1M27 C;  2GQI A;  2RN8 A;  1OPL A;  1ABO A;  4AG2 C;  3EG1 A;  1UJ0 A;  1E6G A;  4F17 A;  3FJ5 A;  1PKS A;  2HSP A;  2G6F X;  4J9B A;  1AOJ A;  4AFZ C;  1EFN A;  2L2P A;  4FSS A;  1A0N B;  3VRY A;  2DF6 A;  1HJD A;  2PNI A;  4R0K A;  2CH4 A;  4HVU A;  5FW9 A;  4RTY A;  2BTT A;  2LJ1 A;  2X3X D;  1OV3 A;  2YUP A;  1NLO C;  2C0O A;  2V1Q A;  1RLP C;  2EKH A;  2A37 A;  2I0N A;  4D8D A;  1OEB A;  3SHW A;  2K7A A;  2RMO A;  2O9S A;  2ROT A;  4DEX A;  1SSH A;  1AWO A;  2LP5 A;  3SEM A;  4RUG A;  4D8K A;  4RTZ A;  1UHF A;  1H8K A;  2ESW A;  2FEI A;  1ZSG A;  2J7I A;  2LJ0 A;  2ECZ A;  3H0I A;  2CUD A;  1YNZ A;  1UFF A;  1GCQ A;  1JXM A;  2JMA A;  2FG0 A;  2JM8 A;  2JXB A;  1SRL A;  1X6G A;  2DBK A;  3JV3 A;  2DL3 A;  3I5S A;  1FMK A;  2K6D A;  1CKB A;  1PRL C;  1JEG A;  1T3S A;  5IHK A;  4DEY A;  1M3B A;  3A98 A;  1BBZ A;  2FRY A;  5I11 A;  2DVJ A;  4RTW A;  3EGU A;  2RQW A;  3EHQ A;  1ZUY A;  5GJV B;  2RQV A;  1RUW A;  2DM1 A;  1T0H A;  2KNB B;  2DYB A;  1G2B A;  1AD5 A;  2BZY A;  2YUO A;  1X27 A;  1NEG A;  1UG1 A;  2PTK A;  2AKL A;  2KRM A;  1RLQ C;  2D8H A;  3NGP A;  1PHT A;  2F2W A;  1YWO A;  2DX1 A;  1HSQ A;  2NUZ A;  1CSK A;  1M30 A;  2J6F A;  1SHG A;  3TVT A;  4EIK A;  2KRO A;  2RF0 A;  4AFQ C;  2AZS A;  1X69 A;  2CSI A;  1GL5 A;  1PKT A;  2L3P A;  1AWW A;  3QWY A;  4AFS C;  3CQT A;  4HVW A;  2KYM A;  2MOX A;  3PVL A;  1H92 A;  1PWT A;  2KR3 A;  4LUE A;  1NG2 A;  1UTI A;  2J06 A;  1PNJ A;  1K4U S;  5I22 A;  2OJ2 A;  5IHN A;  1I0C A;  2LJ3 A;  1QWF A;  1AVZ C;  4LUD A;  2EQI A;  1ZUK A;  2AKK A;  2LQW A;  2LCS A;  3ZL7 C;  1AWX A;  2CRE A;  2DL8 A;  2L0A A;  1ZX6 A;  1Z9Q A;  1GCP A;  1ZUU A;  4OML A;  4CC3 A;  2EYW A;  2RQT A;  4CC7 A;  2HCK A;  1ZBJ A;  1N5Z A;  1NLP C;  2ED1 A;  2FPE A;  3U23 A;  1WA7 A;  2IIM A;  4IIO A;  1SPK A;  1W70 A;  2QDL A;  1XOV A;  2CH4 W;  4X1V A;  4J9E A;  4ESR A;  2K3B A;  2EGE A;  2JT4 A;  4RTX A;  2ED0 A;  2JTE A;  1ZLM A;  4J9C A;  3RBB B;  2LZ6 B;  2EYX A;  4Z89 A;  2A08 A;  2GBQ A;  1B3Q A;  3I9Q A;  4JJB A;  1VYU A;  1GBQ A;  4JZ4 A;  1U06 A;  5L23 A;  2DIL A;  3M0U A;  1WXB A;  4J9I A;  1U3O A;  2LNH B;  2EYZ A;  1Y0M A;  1JXO A;  2L3S A;  1GBR A;  4JJC A;  2HBW A;  3KFV A;  3ULR B;  2JS2 A;  2K79 A;  1QWE A;  2XMF A;  1WXU A;  2CDT A;  2MCN A;  2NWM A;  1GFC A;  2DNU A;  1UHC A;  1I1J A;  2FPD A;  1WX6 A;  2FRW A;  1NYG A;  2EVR A;  2KE9 A;  1YN8 A;  1Y57 A;  3UA7 A;  4Z8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...