4QT7A

Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
SHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the c-Src-SH3 domain in complex with a proline-rich motif of NS5A protein from the hepatitis C virus.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase/transferase activator
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4qt7A00
4OMLA 1WXUA 2W10A 2OAWA 2AKLA 2E5KA 1OPKA 2DE0X 2KXCA 3PVLA 2JTEA 4OMQA 1SSHA 2LCSA 1BK2A 1JXMA 1K1ZA 3JV3A 3TVTA 1U5SA 1NLOC 3TSZA 1NLPC 3H0HA 2EYZA 1Y57A 2D8HA 3VS3A 5I11A 2DMOA 4WCIA 2O31A 2OJ2A 1H8KA 4AG2C 1WFWA 2DL8A 1X6BA 3REAB 1GBRA 2M51A 1BB9A 1W1FA 1HJDA 1UHCA 2KBTA 4LNPA 2VKNA 3M0UA 1RLQC 1M3AA 4RTWA 2B86A 2J06A 1GBQA 1QWEA 1GFDA 1OEBA 2HBWA 2V1RA 2YDLA 4LUEA 2IIMA 3UF4A 3QWYA 2K7AA 2EQIA 5FW9A 4F14A 2DYBA 4M4ZA 2AKKA 2MIOA 4HCKA 4J9DA 2FPFA 3A98A 2DL4A 3VS2A 2A08A 1LCKA 1AZGB 1JO8A 1UDLA 1ZX6A 2CUDA 1PRLC 2DF6A 2YT6A 1ZUYA 1BBZA 2ED0A 2ESWA 2JM8A 2OI3A 1A0NB 3NPFA 3PE0A 5FWBA 2CREA 2KRNA 2PTKA 3M0SA 1JU5C 2CH4W 4RTTA 4Y92A 2JMCA 1ZUKA 2EKHA 3I5SA 4D8KA 3H41A 2DJQA 1E6GA 1QKXA 1GCPA 4HVVA 2GNCA 4OMPA 1I07A 3TSWA 2GTOA 2JMAA 4X1VA 4GLMA 1B07A 1ARKA 2D1XA 2RQTA 1PKSA 2CT3A 3C0CA 2A36A 1SRLA 1E6HA 1T0JA 2V1QA 2K3BA 1WLPB 2JT4A 2MOXA 4Z8AA 3VRYA 4F17A 2RQWA 2LJ1A 3PVQA 1WXBA 1MV3A 1OOTA 1AWOA 2BZYA 1YCSB 1X43A 2KE9A 1YWOA 2JW4A 4Z89A 4K11A 2AZSA 2L2PA 3SHWA 2L0AA 2RQVA 1WA7A 2FRYA 2J6FA 1ABQA 2CDTA 3VS4A 3THKA 3EG0A 1M27C 4LN2A 2PZ1A 1AD5A 1WYXA 2HSPA 4CC2A 1K0XA 1NYFA 2DVJA 2LZ6B 3UATA 2FEIA 4HVUA 4JPBW 2KR3A 1ZSGA 4LUDA 2P4RA 3RBBB 1MV0B 2EYWA 2LJ3A 3CQTA 3LH5A 1UFFA 2F2VA 5IHNA 1GCQC 2SEMA 2XMFA 3EGUA 2BZ8A 1MUZA 1WX6A 2KGTA 2RQUA 1HD3A 4OMOA 2NWMA 2W0ZA 3KFVA 4J9IA 3EHQA 5IHIA 1UHFA 2KROA 3I5RA 2ROTA 2RMOA 2K2MA 1AOJA 2J6KA 3EG1A 1EFNA 3R6NA 2H8HA 1JXOA 1M30A 2KNBB 4HXJA 1Z9ZA 1AEYA 1GRIA 1ZBJA 3M0QA 2YSQA 2YUNA 2DM1A 4FSSA 1X2QA 3QWXX 2X3XD 2LP5A 1M8MA 1Y0MA 4LE9A 2M0YA 1G83A 1TG0A 2ABLA 3UA7A 2ED1A 1NEGA 2D8JA 1H92A 2KEAA 2LMJA 4JJBA 1N5ZA 2O88A 2J6OA 4ORZA 2O9VA 1RI9A 5GJWB 5FWCA 1KIKA 2DA9A 2DRKA 1OPLA 5HCKA 2DILA 3UA6A 1K9AA 3I9QA 1PKTA 4CC7A 3VS5A 4DEXA 3GBQA 2CSIA 3M0PA 2JS2A 2HDAA 1RUWA 1H3HA 1ZUUA 1QCFA 3VS1A 2BZXA 2KXDA 2YUQA 2YUOA 1UUEA 2AZVA 1KFZA 2RF0A 1GL5A 3REBB 4Z88A 5IXFA 4KRTA 1UJ0A 4CC4B 5L23A 4ZNXA 2KRSA 1NM7A 2L3PA 3H0FA 1K76A 4R0KA 2LNHB 4J9HA 1M3CA 2ROLA 1J3TA 2DL5A 4J9GA 1SHFA 1CSKA 1K0SA 1W6XA 1UTIA 2SRCA 4F16A 1AVZC 2NUZA 1Z9QA 1OV3A 2C0OA 1PWTA 1UE9A 2O2OA 2FG0A 3EHRA 2EYXA 1X2KA 2C0IA 1AWJA 2EGCA 1TUCA 3NGPA 4D8DA 4JZ4A 1YNZA 2CSQA 1U3OA 1I0CA 4CC3A 1PNJA 2FO0A 1M3BA 1E7OA 2RNAA 2QDLA 5I22A 3IQLA 1X6GA 1X27A 1BU1A 1CKAA 1RLPC 4A63B 1JQQA 1X69A 2HEQA 2EW3A 1T0HA 1AWXA 4JZ3A 2MCNA 2G6FX 2GGRA 2KYMA 4JJDA 2K79A 2J7IA 5ECAA 3VS6A 3VS7A 1QWFA 1UJYA 1T3LA 4QT7A 2RQRA 1NEBA 1SEMA 4RTXA 1SPKA 1FYNA 1SHGA 1NG2A 2D0NA 1T3SA 1V1CA 2O9SA 2FPEA 3ULRB 4J9EA 2FPDA 2PNIA 1VA7A 5IHKA 1NYGA 2DLPA 1AZEA 1YP5A 3VS0A 2DRMA 1ABOA 4IIOA 1I1JA 4EIKA 1AWWA 3EG2A 4JJCA 4AFSC 3H0IA 2A37A 1IO6A 2DX1A 2KRMA 1JEGA 2LQNA 1YWPA 3I35A 1S1NA 1K4US 2BTTA 5IXBA 2EVRA 3SEMA 2J05A 4J9CA 4RTUA 3NMZC 2JXBA 2K9GA 2F2WA 2X3WD 4RTYA 1UECA 1U06A 4J9BA 3M0TA 2DL7A 2EYYA 4RTVA 4GBQA 3NHNA 2YUPA 5GJVB 2EBPA 4HVWA 2VWFA 1VYTA 4AFZC 2JS0A 2K6DA 4RUGA 3M0RA 3ZL7C 4IIMA 4AG1C 2L3SA 2DBKA 2CUBA 2ECZA 2VVKA 3U23A 1ZLMA 1UG1A 1VYUA 2EGEA 2I0NA 2JM9A 2HCKA 2CT4A 4J9FA 2C0TA 4DEYA 4OMMA 1WI7A 2GQIA 1PRMC 1B3QA 2EPDA 1WXTA 2DNUA 2ENMA 1TUDA 3RNJA 1KJWA 2LJ0A 3EG3A 1WIEA 4AFQC 1FMKA 2LQWA 4AFUC 2DBMA 3FJ5A 2LX7A 2KT1A 3VRZA 4OMNA 2FRWA 1KSWA 4RTZA 2L3QA 2DL3A 1SRMA 5EC7A 1XOVA 2GTJA 2KYBA 2KT8A 2GBQA 1UGVA 2F2XA 4ESRA 1W70A 2AK5A 2RPNA 2A28A 2RN8A 2EGAA 1VYVA 5IH2A 1CKBA 1GCQA 1YN8A 2CH4A 1PHTA 1GFCA 1G2BA 1WDXA 1QLYA 3O5ZA 1QKWA 1HSQA 4E6RA
chains in the Genus database with same CATH superfamily
4OMLA 1X6OA 4JRQA 1H3ZA 2W10A 2OAWA 5GAMd 1GXIE 2E5KA 2DE0X 5LJ3e 3QYGB 2R5MA 4BE0A 4PFOA 3CPWP 1KC8C 5LJ5d 1TWBA 3OSSC 2LT4A 2QAZA 2YLBA 3JV3A 4L5GA 3MHXA 4FW1A 3JRZA 2NLUA 3L2QA 4M7DG 1U8RA 4M77A 2D8HA 4M77F 4BE2A 4D6WA 3G4SQ 2VGNA 3LYIA 3JCMg 1LNXA 4DBQA 5GAN4 3QZ5B 1K73C 2XD0A 2OTJQ 4PKCC 1UHCA 2KBTA 5KE2A 1RLQC 3G4ST 2M1HA 3QKJA 4RTWA 1W2BA 5GAN5 5FRNA 4YTLA 4XAXB 2EFIA 3FC3A 1VQ6T 2M16A 3V7RA 3CMEQ 3OA6A 1M90R 2IIMA 2V26A 3UF4A 3A8GB 4M4ZA 4F7UF 1M9SA 4C92C 1KD1C 2DL4A 3VS2A 1Y07A 3P8HA 3MJXA 4J7IA 2CUDA 1Q95G 2QQSA 2CZ1B 5KYUA 1BBZA 1A0NB 5CQXA 4X34A 2PTKA 3M0SA 1VQMT 1VUBA 3G7ZA 1YI2Q 4PJOD 2DJQA 4PLLA 1SF9A 5IAYA 3BDUA 3LX7A 5GAMh 1QKXA 1GCPA 2GNCA 3OS1A 4OMPA 4ELYC 3HTRA 2GFUA 2FYKA 1V29B 2JMAA 1B07A 1ARKA 4R56A 3MCAB 3CBOA 1PC0A 5HK3A 3CEYA 1D09B 3G1JA 2RB6A 1IGUA 3VRYA 1WJSA 2RQWA 1MV3A 2L5QA 4JLIA 3CCQT 2VB6A 3M4GA 3MO8A 1NE8A 1YCSB 1U1TA 2QQ9A 2JW4A 3RDVA 1VQKQ 3HL8A 1WHMA 1TOVA 3AT1B 5A2QE 1SKUB 2L0AA 1WHHA 2KVQG 2DERA 3QSUA 1UGPB 1WA7A 2FRYA 3V8JA 4MZTA 3THKA 3TU4K 2CZ6B 4LN2A 1VOMA 3I55T 1ZA2B 5CCAA 2M0OA 5LL6S 3ZEHA 1IHVA 2LZ6B 2FEIA 1HYOA 4ME7A 2V8KA 2KR3A 1MMDA 3DB3A 4A4EA 1S72Q 5FU7C 2QA4T 2EYWA 2LCLA 5GANj 2E4HA 2LJ3A 3AHUA 2LT1A 1UFFA 3ZBDA 2LC4A 3ME9A 3EGUA 3JCMJ 1VIEA 2GF7A 2RQUA 3GNGA 1MMGA 1HD3A 4OMOA 2X4YA 1IREB 5LJ3g 3VUBA 1MMNA 1AHJB 2JTMA 4E7SA 2K2MA 4X9DA 3E9GA 2ZGWA 4CRIA 4XU3A 3RMQA 3GOXA 5GAMe 3OYGA 1VQLA 3R6NA 2H8HA 1M30A 2KNBB 1AEYA 3BW1A 1W2BP 3X20B 3URGA 5GAOn 1LPLA 2E12A 3M0QA 1KK7A 2BKDN 3TEEA 3EG9B 3NTIA 1M90C 2QA4Q 3OQ5A 1M8MA 3EGDB 2HBPA 5GMKe 1RL2A 2LTOA 3HFNA 3LWHA 3RKYA 3UA7A 2ED1A 2RM4A 5M9OA 2IPOB 5KYWB 2NUTA 3CPWS 1HK9A 2DRKA 3EH1A 4O6JA 5HCKA 3JB9H 1V76A 3S3MA 1B34B 3VS5A 1KQ1A 3GBQA 3KXTA 2CSIA 1VQOT 5CIUA 2HDAA 1RUWA 3VS1A 2KXDA 3INZA 5CKEA 4IKFA 2YUOA 4M7DD 2QTVA 3ASKA 1KFZA 1I4K1 3REBB 3C95A 1YJNT 4Z88A 4CC4B 5L23A 4B9XA 3QBYA 2K5IA 2YXYA 2E41A 2L3PA 3H0FA 2YRCA 2WSCE 1VQLQ 2DK3A 4M75E 2DL5A 3X24B 4NL2A 3LWIA 1W6XA 1EX4A 3EHRA 2JN0A 5LJ3h 3OW2P 1X2KA 2HQEA 1Q86R 3OS2A 3LLRA 1PG5B 3E9FA 2QYZA 1O9SA 3OYDA 3QJYA 2DTHA 3OYNA 4N4IA 2RNAA 1BCOA 3O8VA 3JB9G 1VQPT 5GMKm 2KSSA 4DQ2A 3VS6A 3CXCA 2HQXA 5GAMg 3CCMQ 3J7AF 3UWNA 1M2VB 1QWFA 2QEXQ 1NEBA 1QVPA 1SSFA 3LH0A 1SPKA 4HKEA 2XI9A 3JCMh 3JB9J 3OYYA 4M7AG 2HNIA 1G3WA 2VC8A 1Q82C 3RUXA 4PJJA 1VA7A 4OGCA 4C0FA 4HT9A 1AZEA 3VS0A 2VXFA 3OYBA 4NOYA 4IIOA 4EMKB 3CCVT 1Q86U 5KCOA 2A37A 5GANf 1JEGA 2LQNA 1YWPA 4OB3B 3V7SA 3CCMA 2EYQA 3I35A 1S1NA 2BTTA 3SEMA 3CCET 8ATCB 3HRSA 5KYYA 4RTYA 1BI0A 2VASA 4E7HA 1U06A 2F5TX 2DL7A 4RTVA 1VQ8A 4GBQA 3NHNA 4HVWA 1VYTA 1RAEB 1RABB 4J8OA 4AG1C 4Y28E 1VQ6A 3M59A 2VUBA 3OMCA 4FYVB 5KYYB 4M75C 1ZSZA 3EFRA 4KT0E 2KI7A 1WI7A 1H641 2Y4YA 3I55A 4KUIA 3RNJA 3MEWA 4M78C 1PSEA 2MAMA 1M1KU 1FMKA 2F1LA 2LQWA 2QQBA 3CCRA 2KT1A 2MI6A 2L3QA 2DL3A 1SRMA 5EC7A 1XOVA 2EJFA 1RACB 1PSFA 1Y96A 1LJOA 5A0LA 4JLGA 1W70A 3PGGA 3V8KA 2RPNA 2V8IA 4J6WA 2CYZB 2Y4XA 2KAFA 3LGFA 3CC7Q 2CH4A 4N0AA 1GFCA 1WDXA 4FYWB 1QKWA 4C92D 1VQ4A 4NL3A 2I2LA 5AT1B 5IN1A 2PVOB 3BY7A 4LD6A 2KXCA 3PVLA 2FZCB 2JTEA 3EGXA 4M75D 1VQ6Q 1QVFP 2MWOA 4M7AE 3CCUA 3META 1JXMA 1WHGA 3A8HB 1K1ZA 2QA4A 4FM4B 2OTLT 1YJWT 1NLOC 3TSZA 1NLPC 3H0HA 1VQ5Q 2EYZA 4ATOA 3VS3A 2DTIA 1UGRB 4WCIA 2O31A 2OJ2A 5FU6C 4M7AF 4AG2C 1TXQA 1R0BG 1VQNA 1X6BA 2M51A 4EMGA 3CCEQ 3M55A 4M77B 2DD4A 1I81A 3SD4A 2R58A 1M3AA 1YI2T 3GLXA 2J06A 1QVGA 1GBQA 2M9UA 1GFDA 2DZCA 1KQSS 3JAME 1OEBA 3PMIA 2DXBA 2HBWA 1RAAB 2V1RA 4XTWA 1UB4A 4LUEA 3CPWA 4XU0A 2YRVA 4M78G 4FT4A 2EQIA 1JB0E 3OW2S 4F14A 4PJOG 2AKKA 4QQ6A 3A98A 3CCQA 2A08A 1LCKA 1JO8A 1UDLA 4M78E 1ZX6A 3CMAT 3CCJQ 1RI0A 4QQDA 2DF6A 3OBWA 1WQ7A 2ESWA 4DBFA 4C8QD 4KH1B 5FWBA 1YCYA 4FT2A 4C92F 2RJEA 3G71A 1P92A 4RTTA 3OYIA 4RCCA 3CMAQ 5DLQE 1IZ6A 2X51A 3H41A 4EPCA 4KGVB 1XNIA 4C0ZA 2HZYA 4BY6C 1KC8U 3TSWA 2GTOA 2L3RA 4GLMA 4M75A 3HSBA 3MP6A 1RADB 5GAOm 1BI1A 2V1QA 4RG8A 2MOXA 2DJZA 4QW2A 2PVDB 4F17A 2DZ9A 4N4GA 1ZHIA 1AWOA 2BZYA 4M78F 3TREA 5J26A 3OBYA 5GAOr 5GAN6 2MF2A 4F7UE 4Z89A 3PNWC 2L2PA 1NJIR 3OW2A 4RG2A 3PIPA 3CC2T 4MZMA 4XU1A 4FYYB 1ABQA 2CDTA 3QUIA 1D1CA 3SB2A 1M27C 2E10A 4BDZA 1WYXA 1XTDA 2RHXA 3OYKA 2KDSA 2XG8D 2DKGA 3JCMX 4HVUA 1ZSGA 3UPUA 3QJ6A 2LQKA 1MV0B 3E1SA 4LDVA 2DXUA 4M78D 2SEMA 1WNLA 2XMFA 4VUBA 1QP3A 1MUZA 2KGTA 2NWMA 5CAIA 2W0ZA 3KFVA 4J9IA 3EHQA 5IHIA 1NBEB 1UHFA 2KROA 3A1PA 3I5RA 2ROTA 3M58A 2EQUA 4BI4A 2A3LA 2VYTA 5D6WA 3QZ9B 1KG1A 3EG1A 1EFNA 4ZTJA 3MP8A 3CC2Q 4M7AA 3V8LA 1VQ7A 1BI3A 4HXJA 1Z9ZA 1DJ7B 2CP7A 1OI1A 4C0GA 2YSQA 3UDCA 2K4YA 2QXFA 5FLXE 2K57A 1X2QA 3MEAA 3QWXX 3CD6T 2X3XD 2LP5A 3L2VA 1D0YA 5GAMf 5D7UA 4KGXB 3CCST 1PD0A 2DTOA 2D9TA 5CKBA 3WVEB 1EIFA 1NEGA 3H8ZA 2LMJA 1N5ZA 1RI9A 2XKOC 2RK1A 2LX9A 4ZGEB 4PNOA 1K9AA 3E19A 3I9QA 1QVFA 4CC7A 4DEXA 1I5LA 4PL6A 3N5BB 3CC7T 2JS2A 1H3HA 3EGXB 1OU8A 1ZUUA 4IUVA 4QVZA 2YUQA 3S3OA 1YI2A 1JJ2S 4WF2A 1K9MR 3GP8A 2PVGB 3QPHA 1UUEA 4C8QE 2IG0A 3H6ZA 4Z02A 3FDRA 5IXFA 1JBMA 1FMWA 5LJ3d 4MMLA 4B6MA 4E2FB 1BCMA 4ZNXA 1WHKA 4C8QG 1NM7A 3MPUB 3X25B 2ZZDA 1M3CA 3I55Q 1J3TA 3OYJA 2CZ7B 1SHFA 1WGSA 3CC4Q 1UTIA 3CCQQ 4F16A 1AVZC 1UGSB 2E6NA 2NUZA 1UE9A 2FG0A 1M4ZA 2P84A 4JRKA 2CP5A 4QVDA 4GY5A 1TUCA 3NGPA 1Q82U 4FU6A 1VQ7T 2NUPB 1YNZA 1U3OA 1IGQA 2YRDA 1M3BA 1E7OA 3IQLA 3MEVA 4A4KA 1D0XA 1JQQA 1Q86C 4JUVA 3M9QA 3CCEA 2XDBA 4DA4A 3VUZA 4JZ3A 1LOJA 1QCOA 4JJNK 4JJDA 1D1AA 2K79A 2J7IA 3CCRQ 3VS7A 1T3LA 4QT7A 2X35A 2RQRA 1SEMA 2HQHA 2LCCA 5HKCA 1YITA 1SHGA 1NG2A 3CCJT 2D0NA 1Y96B 2HMAA 2O9SA 2FPEA 4J9EA 5I2SA 2FPDA 5IHKA 1NYGA 3CD6A 1M90U 1D1BA 1Q7YR 4M75G 2D6FA 1VQ9A 3EG2A 3SWNA 4Y91A 4EDUA 4ZN1A 4JJCA 2CGHA 5KE3A 4LDWA 3RKXA 5KYWA 1MNEA 2KRMA 4HT8A 1VQ4Q 2CP6A 4HCCA 4DBHA 3VU3C 2KQWA 2AT1B 5IT9E 2PQWA 4C8QC 1M1KC 2X3WD 2QEXT 1N9SA 3EG9A 2EYYA 1QVFS 3HKSA 1ACMB 2EBPA 2RI3A 2JS0A 5EG2A 3L2ZA 5L8RE 4KUDK 2K5FA 3OY9A 2CUBA 5GMKi 1UG1A 1VYUA 2I0NA 2YLCA 2ZPGB 4KBMB 2HCKA 1VQLT 3RKWA 2EAYA 1YHQQ 2CT4A 4J9FA 2XK0A 2C0TA 2EQJA 3CBPA 4DEYA 2GQIA 4C92E 1PRMC 1B3QA 2EPDA 1WXTA 1YIJT 2DNUA 1S72A 4MMKA 3QDRB 4MDWA 4TVRA 5LJ5h 1YHQA 2LJ0A 3EG3A 4AFQC 4KGZB 4OP0A 2DBMA 3FJ5A 2LX7A 3CCLT 5LJ3j 3G6EQ 1YJWQ 2RI5A 2HKQB 2GTJA 3I56A 1UGVA 2F2XA 4FIBA 2RJDA 2XICA 1W4SA 3M57A 4C92B 1QLYA 2QQAA 4XTYA 1BI2A 1Y7XA 1FX7A 2CKKA 2AKLA 1OPKA 2O4XA 3MP1A 4PLIA 1ZQ1A 2GFAA 1N9RA 4OMQA 1SSHA 3JB9D 2CP0A 4C8QB 1B34A 1M5Q1 4J6XA 1BK2A 1TS9A 2MK5A 5GANd 1U5SA 2ZPBB 1QW1A 4PFZA 4M78A 4PJOC 2DETA 4FCYA 1Y57A 2L8DA 2ZPHB 1VQPA 1K9MU 1H8KA 3JCMV 3OYHA 4XQ3A 1BKBA 2DL8A 4BUGA 3REAB 5GANg 4LD9K 1GBRA 1BB9A 5GMKj 2OAUA 1HJDA 4LNPA 2VKNA 3M0UA 5GAN3 4L6V5 3KUFA 4P5NA 1YIJA 1R8OB 1N8RC 1Q7YC 4ELZC 2PUOB 3BFMA 3QHSA 3QIIA 4OGEA 1NPPA 3C12A 3QWYA 2MIOA 4HCKA 2FPFA 2PU9B 1EZZB 3HPWA 1AZGB 5FU6B 5HY6A 1WQWA 3NFCA 1YJ9A 1ZUYA 2ED0A 3OS0A 2JM8A 2DXTA 2OI3A 3PE0A 3FB9A 1PM3A 2KRNA 5CQYA 1OZ3A 4NS5A 3G4SA 2JMCA 1ZUKA 2EKHA 3C4SA 3S6WA 1TH7A 4PJOB 4EMKA 4HVVA 4O5VA 1I07A 4M75F 3LW5E 4X1VA 1WJRA 4Q5WA 1IXDA 1VQ9Q 3A8LB 1N27A 1PKSA 2JNGA 2VXEA 1E6HA 2EJGA 4C5EA 2K3BA 2F69A 1WLPB 2JT4A 4JRIA 3GPLA 3OYLA 3CBMA 1K8AC 3OYAA 2P0KA 3PVQA 1WXBA 1OOTA 1OX9A 1JRIA 2WSFE 2EQMA 2YHTA 2ZCFB 3GF5A 4OMFB 1NJIU 3OYEA 4N0AC 4DBRA 1QQJA 1X43A 1YWOA 4JDSA 4F7UG 2OTLQ 3CPFA 2RQVA 1MHNA 4ANJA 1RAHB 3QO3A 2K2VA 3VS4A 2MPXC 2CS7A 1VQ5A 2QI2A 2RD1A 4PJNA 1KQSA 2EKOA 2PZ1A 2HSPA 4CC2A 4MZPA 4M7DA 1NYFA 2CP3A 3MEUA 3UATA 1YJ9Q 2KK4A 4LUDA 2P4RA 2XDPA 3RBBB 3CCRT 3LGLA 4BI3A 4XK8E 3EFOB 2RHYA 3CQTA 3JCMc 2DPPB 2F2VA 9ATCB 1PCXA 4XU2A 5KCHA 1GCQC 1QVGP 2BZ8A 3EFSA 2JZ2A 3QXEB 1KHCA 2RMOA 3HHTB 5CVIA 1AT1B 4X9CA 2J6KA 2COZA 2IVWA 2QG9B 1Q81R 2RI2A 3CXCP 4M7DC 1WHJA 3E2UA 2RJFA 1U1SA 4FSSA 3PT9A 1M8VA 1YJ9T 4PFPA 1VQKA 2BE9B 2NUTB 2LNVA 1K73U 1QCNA 1G83A 1TG0A 2X4XA 2ABLA 3HP9A 1C0MA 1H92A 3T9NA 3FJPA 2O88A 1WHLA 2J6OA 4ORZA 3OYCA 3CC4T 3SDZA 4M7AC 1KIKA 1OPLA 5KYXB 2DD5A 1TSFA 3UA6A 3WXMB 3UT1A 2L89A 1M1KR 2BZXA 5CKHA 1G3YA 5LJ5e 1BYMA 2AZVA 2RF0A 3WVDB 3JCMb 5CK9A 3L2WA 1I8FA 3CMAA 4KRTA 4C92A 2OTJA 1FMVA 1UJ0A 2DO3A 3QDFA 2DVEA 2V8JA 2HSEB 3G6ET 2XHCA 2H3JA 1K76A 2HAXA 1KC8R 4OB2B 2LNHB 5GAN7 3X26B 2KY9A 5I2MA 2EIFA 1CSKA 1K0SA 2LRQA 4M7AD 2COWA 4ZN3A 3CMET 2SRCA 1OU9A 2JTFA 3QG1A 1PWTA 4ZGJB 3CC4A 1O75A 3PMTA 3G71T 4QQGA 1AWJA 2EGCA 5D6YA 2AIRB 1F1BB 1Y71A 4D8DA 3Q1JA 3PIOA 1YJNA 2QQRA 4CC3A 1PNJA 4EMHA 4DOWA 1K8AU 2QDLA 1X6GA 1YJNQ 1X27A 1BU1A 1RLPC 4A63B 4J83A 2EW3A 1AWXA 1Q81C 1XJWB 2G6FX 2ZAEA 2E65A 4FL6A 2DAQA 2FHDA 1UJYA 2RA2A 1W2BS 5GAN2 1RAIB 4M77D 4LDXA 4BDYA 5CKDA 3J80E 1V1CA 1NZ9A 2X9HA 8AT1B 1YP5A 3L1AA 1ABOA 3CCJA 2JOYA 1N6AA 1I1JA 4EIKA 3EFOA 1VQMQ 1VQ5T 2A7YA 3GNFB 2AHJB 4PJLA 3SWNC 3JCMQ 1Q82R 2F5KA 1QVGS 4BY6B 4M7AB 4A54A 3VKIA 4LDUA 4WTOB 5IXBA 1VQOQ 2J05A 2OX7A 4RTUA 3NMZC 2JXBA 2K9GA 4M77G 4A4HA 2OTJT 4IURA 2DEUA 1UECA 1YFNA 2MYSA 4KH0B 3M0TA 2LDMA 4J6YA 4LXCA 3F70A 1N8RR 2YUPA 3EAEA 2VWFA 4AFZC 3RIRA 4RUGA 3ZL7C 2OTLA 4JS5A 2L3SA 5FU7B 1KD1U 4A4FA 2JM9A 2R5AA 3SFMA 4BI8B 5C0MA 3CCVQ 1G8XA 3OS5A 3VYHB 4PJMA 1I5OB 1Q7YU 1KJWA 2EJ9A 4B9WA 2EWNA 1WIEA 4AFUC 1VQ4T 2RHZA 1UEBA 4FYXB 3RMSA 1NPRA 2QGGA 2HL3A 3G71Q 2FRWA 3RERA 1KSWA 1VQNQ 2O01E 2KYBA 2KT8A 5DLOA 5CO7A 4ESRA 4IUTA 4M77E 3JB9I 5GAOp 2RN8A 2X4JA 6AT1B 1WJQA 1VQPQ 2XU8A 1G2BA 1VQNT 1K9MC 3V7CA 3QYHB 4JS4A 4C8QA 4C0DC 2COYA 2CP2A 3MKDA 2FZKB 1WXUA 4PJOF 5A0DA 4IUPA 3VYGA 4M75B 3GIBA 1R77A 3KBGA 3PTAA 2LCSA 4M78B 2E70A 3M5AA 2CZ0B 2DXCA 3TVTA 2QASA 1IB8A 2QK0A 2R57A 3BDLA 4BE1A 2JVVA 5I11A 2HKNA 2DMOA 2XIDA 1SG5A 1WFWA 2DIGA 4OB1B 2ZPEB 2RH2A 3BE3A 1W1FA 4RCBA 4N4HA 3HRUA 4M7DE 4M7DF 1YJWA 2B86A 2BUDA 5FROA 2BE7D 1QWEA 3JSCA 4HCBA 2K5LA 3HRTA 1IHWA 3VJPA 3JCMf 1RAFB 2YDLA 4A4GA 4FW2A 2KMTA 2K7AA 5CR2A 5FW9A 2GCXA 2DYBA 4J9DA 3JCMP 3DLLA 2P0PA 1VQ7Q 4J5YA 1PRLC 5LJ5j 1UGQB 2YT6A 3DLMA 5GMKl 1M2VA 3NPFA 2CREA 2QGFB 2X4WA 1JU5C 2CH4W 2DEQA 3CCMT 3CCSQ 4Y92A 5KYUB 3OYFA 5DY9A 1YITT 3I5SA 4D8KA 5D6XA 2E5QA 1KQSP 1E6GA 3JCMW 3SWNB 3D7SB 3PFSA 3L42A 3H9NA 1D0ZA 1LVKA 1ZSZC 2D1XA 4C5HA 2RQTA 4MDXA 2ZPFB 4JRPA 2CT3A 4FSXA 3P8BB 3C0CA 5LJ3f 2A36A 1SRLA 3OMGA 3A5ZB 5LJ5f 1T0JA 2EQKA 4L59A 2VGMA 4QVCA 5I21A 4DOVA 4Z8AA 4OVAA 4XTUA 1JJ2P 2LJ1A 2QTXA 4BD3A 4R55A 3X28B 3JB9F 2RK2A 1M1FA 2KE9A 3CCSA 5GANe 2WSEE 4K11A 2AZSA 3VV0A 3SHWA 2MMPA 1K8AR 4BB7A 2E3IA 2J6FA 2HL5C 3OYMA 1YIJQ 4LDYA 2LQ8A 3EG0A 2K3XA 2GQVA 4RKUE 1AD5A 5GANh 1K0XA 3DKMA 2DVJA 5AYFA 7AT1B 3M53A 2HD0A 1K73R 4E7LA 3L2UA 4JPBW 4ZTFA 1D3BA 2E1HA 4BACA 4IUUA 3CCVA 5GAOq 4PJOA 1OULA 3LH5A 1JJ2A 1YHQT 5IHNA 3TQ7P 2NYSA 1WX6A 5KH6A 1OX8A 2ATCB 2H3EB 1XQHA 1MGQA 1Q81U 1VQKT 1OQKA 3I56Q 1AOJA 5J39A 2QDYB 1JXOA 4E7ZA 1WZOA 4XTZA 1GRIA 2O4XB 1ZBJA 5J3BA 2PUKB 3A8OB 5CKFA 4PJOE 3I56T 2YUNA 2DM1A 1FXXA 4HCZA 3L2RA 2A0FB 1B7TA 1MNDA 4E7IA 1Y0MA 4LE9A 3FEOA 2M0YA 4RMOA 3J81E 1VQMA 2D8JA 2FZGB 2KEAA 4JJBA 1NJIC 2O9VA 5GJWB 4C5GA 5FWCA 2MWPA 2DA9A 2DILA 2E64A 2C06A 1PKTA 4M77C 1M1GA 3M0PA 5A0GA 4PK4A 4OB0B 1QCFA 2RHUA 4UC4A 1TUGB 3NTKA 4M7DB 1C1AA 3CC7A 1GL5A 2QEXA 2RHIA 2DFUA 2KRSA 3M56A 1OYXA 3CD6Q 1IRXA 4OF1A 2G3RA 4R0KA 4J9HA 2B8AA 4C5IA 2ROLA 1G3SA 3HFOA 1X01A 4J9GA 2P4TA 2M02A 3EH2A 3CCUT 1Z9QA 5KYXA 1OV3A 2C0OA 3CXCS 2O2OA 1R0CB 2FL7A 2EYXA 2C0IA 3S3NA 2JUFA 2K3YA 4JZ4A 5GMKh 5LJ5g 3CCUQ 2CSQA 1VQ9T 1I0CA 2FO0A 2ZPIB 5I22A 2WACA 3RR6A 1CKAA 1BIBA 1QMCA 3FRNA 1X69A 4F7UB 2HEQA 4II1A 1VQ8Q 1T0HA 2YWWA 2XDDA 2MCNA 2GGRA 2KYMA 5ECAA 1YITQ 2RJCA 1N8RU 4AT1B 3M4YA 1M2OA 4QKUA 5KYNA 1ZA1B 1FWZA 4A53A 2DIQA 1ZSZB 3CMEA 4V2SA 4RTXA 1FYNA 1ZBXA 1RAGB 1T3SA 4C8QF 4F04B 2BIVA 1G3TA 3ULRB 2VV5A 3OB9A 4XTVA 2PNIA 2DLPA 2DRMA 1AWWA 3ER0A 4AFSC 1TU0B 1D3BB 3H0IA 1S72T 1IO6A 2DX1A 4C92G 5GAMj 4EMKC 2Y90A 1K4US 4GLKA 1VQ8T 3EGDA 2EVRA 4E47A 2FB7A 4J9CA 5FRMA 3TCJA 3CCLA 4HA8A 2F2WA 2Z0WA 4KULA 1BIAA 4XTXA 4J9BA 4E7JA 3OSVA 3RESA 4AMCA 5HK0A 5GJVB 5GAN8 5GAOl 3A8MB 1PD1A 3R6OA 1X75C 2K6DA 1KQ2A 3M0RA 4IIMA 3P8DA 2E6ZA 2DBKA 2ECZA 2VVKA 3U23A 1ZLMA 3M54A 2EGEA 2RO0A 3DB4A 3ZFJA 1HXDA 4OMMA 3JCMd 4C0DB 4IUQA 1KD1R 2FVUA 2ENMA 3FIFA 1TUDA 3C94A 4J7FA 2JJ9A 2D0QB 4F7UA 3JCMe 1MMAA 2E3HA 1G5VA 2LVMA 3CC2A 2P0QA 5DM7R 3VRZA 4OMNA 5C6SA 4RTZA 2NUPA 2GBQA 4CI0C 3NTHA 2AK5A 1TTHB 3G6EA 2A28A 1OZ2A 4E7KA 2EGAA 3FLGA 1VIFA 1VYVA 5IH2A 3CCLQ 1CKBA 1GCQA 1KHIA 1YBYA 1YN8A 1QP2A 1PHTA 4ZGDB 1VQOA 1WPYA 2DYIA 3O5ZA 1C6VX 1HSQA 4E6RA
chains in the Genus database with same CATH topology
4OMLA 1WXUA 2W10A 2OAWA 2AKLA 2E5KA 1OPKA 2DE0X 2KXCA 3PVLA 2JTEA 4OMQA 1SSHA 2LCSA 1BK2A 1JXMA 1K1ZA 3JV3A 3TVTA 1U5SA 1NLOC 3TSZA 1NLPC 3H0HA 2EYZA 1Y57A 2D8HA 3VS3A 5I11A 2DMOA 4WCIA 2O31A 2OJ2A 1H8KA 4AG2C 1WFWA 2DL8A 1X6BA 3REAB 1GBRA 2M51A 1BB9A 1W1FA 1HJDA 1UHCA 2KBTA 4LNPA 2VKNA 3M0UA 1RLQC 1M3AA 4RTWA 2B86A 2J06A 1GBQA 1QWEA 1GFDA 1OEBA 2HBWA 2V1RA 2YDLA 4LUEA 2IIMA 3UF4A 3QWYA 2K7AA 2EQIA 5FW9A 4F14A 2DYBA 4M4ZA 2AKKA 2MIOA 4HCKA 4J9DA 2FPFA 3A98A 2DL4A 3VS2A 2A08A 1LCKA 1AZGB 1JO8A 1UDLA 1ZX6A 2CUDA 1PRLC 2DF6A 2YT6A 1ZUYA 1BBZA 2ED0A 2ESWA 2JM8A 2OI3A 1A0NB 3NPFA 3PE0A 5FWBA 2CREA 2KRNA 2PTKA 3M0SA 1JU5C 2CH4W 4RTTA 4Y92A 2JMCA 1ZUKA 2EKHA 3I5SA 4D8KA 3H41A 2DJQA 1E6GA 1QKXA 1GCPA 4HVVA 2GNCA 4OMPA 1I07A 3TSWA 2GTOA 2JMAA 4X1VA 4GLMA 1B07A 1ARKA 2D1XA 2RQTA 1PKSA 2CT3A 3C0CA 2A36A 1SRLA 1E6HA 1T0JA 2V1QA 2K3BA 1WLPB 2JT4A 2MOXA 4Z8AA 3VRYA 4F17A 2RQWA 2LJ1A 3PVQA 1WXBA 1MV3A 1OOTA 1AWOA 2BZYA 1YCSB 1X43A 2KE9A 1YWOA 2JW4A 4Z89A 4K11A 2AZSA 2L2PA 3SHWA 2L0AA 2RQVA 1WA7A 2FRYA 2J6FA 1ABQA 2CDTA 3VS4A 3THKA 3EG0A 1M27C 4LN2A 2PZ1A 1AD5A 1WYXA 2HSPA 4CC2A 1K0XA 1NYFA 2DVJA 2LZ6B 3UATA 2FEIA 4HVUA 4JPBW 2KR3A 1ZSGA 4LUDA 2P4RA 3RBBB 1MV0B 2EYWA 2LJ3A 3CQTA 3LH5A 1UFFA 2F2VA 5IHNA 1GCQC 2SEMA 2XMFA 3EGUA 2BZ8A 1MUZA 1WX6A 2KGTA 2RQUA 1HD3A 4OMOA 2NWMA 2W0ZA 3KFVA 4J9IA 3EHQA 5IHIA 1UHFA 2KROA 3I5RA 2ROTA 2RMOA 2K2MA 1AOJA 2J6KA 3EG1A 1EFNA 3R6NA 2H8HA 1JXOA 1M30A 2KNBB 4HXJA 1Z9ZA 1AEYA 1GRIA 1ZBJA 3M0QA 2YSQA 2YUNA 2DM1A 4FSSA 1X2QA 3QWXX 2X3XD 2LP5A 1M8MA 1Y0MA 4LE9A 2M0YA 1G83A 1TG0A 2ABLA 3UA7A 2ED1A 1NEGA 2D8JA 1H92A 2KEAA 2LMJA 4JJBA 1N5ZA 2O88A 2J6OA 4ORZA 2O9VA 1RI9A 5GJWB 5FWCA 1KIKA 2DA9A 2DRKA 1OPLA 5HCKA 2DILA 3UA6A 1K9AA 3I9QA 1PKTA 4CC7A 3VS5A 4DEXA 3GBQA 2CSIA 3M0PA 2JS2A 2HDAA 1RUWA 1H3HA 1ZUUA 1QCFA 3VS1A 2BZXA 2KXDA 2YUQA 2YUOA 1UUEA 2AZVA 1KFZA 2RF0A 1GL5A 3REBB 4Z88A 5IXFA 4KRTA 1UJ0A 4CC4B 5L23A 4ZNXA 2KRSA 1NM7A 2L3PA 3H0FA 1K76A 4R0KA 2LNHB 4J9HA 1M3CA 2ROLA 1J3TA 2DL5A 4J9GA 1SHFA 1CSKA 1K0SA 1W6XA 1UTIA 2SRCA 4F16A 1AVZC 2NUZA 1Z9QA 1OV3A 2C0OA 1PWTA 1UE9A 2O2OA 2FG0A 3EHRA 2EYXA 1X2KA 2C0IA 1AWJA 2EGCA 1TUCA 3NGPA 4D8DA 4JZ4A 1YNZA 2CSQA 1U3OA 1I0CA 4CC3A 1PNJA 2FO0A 1M3BA 1E7OA 2RNAA 2QDLA 5I22A 3IQLA 1X6GA 1X27A 1BU1A 1CKAA 1RLPC 4A63B 1JQQA 1X69A 2HEQA 2EW3A 1T0HA 1AWXA 4JZ3A 2MCNA 2G6FX 2GGRA 2KYMA 4JJDA 2K79A 2J7IA 5ECAA 3VS6A 3VS7A 1QWFA 1UJYA 1T3LA 4QT7A 2RQRA 1NEBA 1SEMA 4RTXA 1SPKA 1FYNA 1SHGA 1NG2A 2D0NA 1T3SA 1V1CA 2O9SA 2FPEA 3ULRB 4J9EA 2FPDA 2PNIA 1VA7A 5IHKA 1NYGA 2DLPA 1AZEA 1YP5A 3VS0A 2DRMA 1ABOA 4IIOA 1I1JA 4EIKA 1AWWA 3EG2A 4JJCA 4AFSC 3H0IA 2A37A 1IO6A 2DX1A 2KRMA 1JEGA 2LQNA 1YWPA 3I35A 1S1NA 1K4US 2BTTA 5IXBA 2EVRA 3SEMA 2J05A 4J9CA 4RTUA 3NMZC 2JXBA 2K9GA 2F2WA 2X3WD 4RTYA 1UECA 1U06A 4J9BA 3M0TA 2DL7A 2EYYA 4RTVA 4GBQA 3NHNA 2YUPA 5GJVB 2EBPA 4HVWA 2VWFA 1VYTA 4AFZC 2JS0A 2K6DA 4RUGA 3M0RA 3ZL7C 4IIMA 4AG1C 2L3SA 2DBKA 2CUBA 2ECZA 2VVKA 3U23A 1ZLMA 1UG1A 1VYUA 2EGEA 2I0NA 2JM9A 2HCKA 2CT4A 4J9FA 2C0TA 4DEYA 4OMMA 1WI7A 2GQIA 1PRMC 1B3QA 2EPDA 1WXTA 2DNUA 2ENMA 1TUDA 3RNJA 1KJWA 2LJ0A 3EG3A 1WIEA 4AFQC 1FMKA 2LQWA 4AFUC 2DBMA 3FJ5A 2LX7A 2KT1A 3VRZA 4OMNA 2FRWA 1KSWA 4RTZA 2L3QA 2DL3A 1SRMA 5EC7A 1XOVA 2GTJA 2KYBA 2KT8A 2GBQA 1UGVA 2F2XA 4ESRA 1W70A 2AK5A 2RPNA 2A28A 2RN8A 2EGAA 1VYVA 5IH2A 1CKBA 1GCQA 1YN8A 2CH4A 1PHTA 1GFCA 1G2BA 1WDXA 1QLYA 3O5ZA 1QKWA 1HSQA 4E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OML A;  1WXU A;  2W10 A;  2OAW A;  2AKL A;  2E5K A;  1OPK A;  2DE0 X;  2KXC A;  3PVL A;  2JTE A;  4OMQ A;  1SSH A;  2LCS A;  1BK2 A;  1JXM A;  1K1Z A;  3JV3 A;  3TVT A;  1U5S A;  1NLO C;  3TSZ A;  1NLP C;  3H0H A;  2EYZ A;  1Y57 A;  2D8H A;  3VS3 A;  5I11 A;  2DMO A;  4WCI A;  2O31 A;  2OJ2 A;  1H8K A;  4AG2 C;  1WFW A;  2DL8 A;  1X6B A;  3REA B;  1GBR A;  2M51 A;  1BB9 A;  1W1F A;  1HJD A;  1UHC A;  2KBT A;  4LNP A;  2VKN A;  3M0U A;  1RLQ C;  1M3A A;  4RTW A;  2B86 A;  2J06 A;  1GBQ A;  1QWE A;  1GFD A;  1OEB A;  2HBW A;  2V1R A;  2YDL A;  4LUE A;  2IIM A;  3UF4 A;  3QWY A;  2K7A A;  2EQI A;  5FW9 A;  4F14 A;  2DYB A;  4M4Z A;  2AKK A;  2MIO A;  4HCK A;  4J9D A;  2FPF A;  3A98 A;  2DL4 A;  3VS2 A;  2A08 A;  1LCK A;  1AZG B;  1JO8 A;  1UDL A;  1ZX6 A;  2CUD A;  1PRL C;  2DF6 A;  2YT6 A;  1ZUY A;  1BBZ A;  2ED0 A;  2ESW A;  2JM8 A;  2OI3 A;  1A0N B;  3NPF A;  3PE0 A;  5FWB A;  2CRE A;  2KRN A;  2PTK A;  3M0S A;  1JU5 C;  2CH4 W;  4RTT A;  4Y92 A;  2JMC A;  1ZUK A;  2EKH A;  3I5S A;  4D8K A;  3H41 A;  2DJQ A;  1E6G A;  1QKX A;  1GCP A;  4HVV A;  2GNC A;  4OMP A;  1I07 A;  3TSW A;  2GTO A;  2JMA A;  4X1V A;  4GLM A;  1B07 A;  1ARK A;  2D1X A;  2RQT A;  1PKS A;  2CT3 A;  3C0C A;  2A36 A;  1SRL A;  1E6H A;  1T0J A;  2V1Q A;  2K3B A;  1WLP B;  2JT4 A;  2MOX A;  4Z8A A;  3VRY A;  4F17 A;  2RQW A;  2LJ1 A;  3PVQ A;  1WXB A;  1MV3 A;  1OOT A;  1AWO A;  2BZY A;  1YCS B;  1X43 A;  2KE9 A;  1YWO A;  2JW4 A;  4Z89 A;  4K11 A;  2AZS A;  2L2P A;  3SHW A;  2L0A A;  2RQV A;  1WA7 A;  2FRY A;  2J6F A;  1ABQ A;  2CDT A;  3VS4 A;  3THK A;  3EG0 A;  1M27 C;  4LN2 A;  2PZ1 A;  1AD5 A;  1WYX A;  2HSP A;  4CC2 A;  1K0X A;  1NYF A;  2DVJ A;  2LZ6 B;  3UAT A;  2FEI A;  4HVU A;  4JPB W;  2KR3 A;  1ZSG A;  4LUD A;  2P4R A;  3RBB B;  1MV0 B;  2EYW A;  2LJ3 A;  3CQT A;  3LH5 A;  1UFF A;  2F2V A;  5IHN A;  1GCQ C;  2SEM A;  2XMF A;  3EGU A;  2BZ8 A;  1MUZ A;  1WX6 A;  2KGT A;  2RQU A;  1HD3 A;  4OMO A;  2NWM A;  2W0Z A;  3KFV A;  4J9I A;  3EHQ A;  5IHI A;  1UHF A;  2KRO A;  3I5R A;  2ROT A;  2RMO A;  2K2M A;  1AOJ A;  2J6K A;  3EG1 A;  1EFN A;  3R6N A;  2H8H A;  1JXO A;  1M30 A;  2KNB B;  4HXJ A;  1Z9Z A;  1AEY A;  1GRI A;  1ZBJ A;  3M0Q A;  2YSQ A;  2YUN A;  2DM1 A;  4FSS A;  1X2Q A;  3QWX X;  2X3X D;  2LP5 A;  1M8M A;  1Y0M A;  4LE9 A;  2M0Y A;  1G83 A;  1TG0 A;  2ABL A;  3UA7 A;  2ED1 A;  1NEG A;  2D8J A;  1H92 A;  2KEA A;  2LMJ A;  4JJB A;  1N5Z A;  2O88 A;  2J6O A;  4ORZ A;  2O9V A;  1RI9 A;  5GJW B;  5FWC A;  1KIK A;  2DA9 A;  2DRK A;  1OPL A;  5HCK A;  2DIL A;  3UA6 A;  1K9A A;  3I9Q A;  1PKT A;  4CC7 A;  3VS5 A;  4DEX A;  3GBQ A;  2CSI A;  3M0P A;  2JS2 A;  2HDA A;  1RUW A;  1H3H A;  1ZUU A;  1QCF A;  3VS1 A;  2BZX A;  2KXD A;  2YUQ A;  2YUO A;  1UUE A;  2AZV A;  1KFZ A;  2RF0 A;  1GL5 A;  3REB B;  4Z88 A;  5IXF A;  4KRT A;  1UJ0 A;  4CC4 B;  5L23 A;  4ZNX A;  2KRS A;  1NM7 A;  2L3P A;  3H0F A;  1K76 A;  4R0K A;  2LNH B;  4J9H A;  1M3C A;  2ROL A;  1J3T A;  2DL5 A;  4J9G A;  1SHF A;  1CSK A;  1K0S A;  1W6X A;  1UTI A;  2SRC A;  4F16 A;  1AVZ C;  2NUZ A;  1Z9Q A;  1OV3 A;  2C0O A;  1PWT A;  1UE9 A;  2O2O A;  2FG0 A;  3EHR A;  2EYX A;  1X2K A;  2C0I A;  1AWJ A;  2EGC A;  1TUC A;  3NGP A;  4D8D A;  4JZ4 A;  1YNZ A;  2CSQ A;  1U3O A;  1I0C A;  4CC3 A;  1PNJ A;  2FO0 A;  1M3B A;  1E7O A;  2RNA A;  2QDL A;  5I22 A;  3IQL A;  1X6G A;  1X27 A;  1BU1 A;  1CKA A;  1RLP C;  4A63 B;  1JQQ A;  1X69 A;  2HEQ A;  2EW3 A;  1T0H A;  1AWX A;  4JZ3 A;  2MCN A;  2G6F X;  2GGR A;  2KYM A;  4JJD A;  2K79 A;  2J7I A;  5ECA A;  3VS6 A;  3VS7 A;  1QWF A;  1UJY A;  1T3L A;  4QT7 A;  2RQR A;  1NEB A;  1SEM A;  4RTX A;  1SPK A;  1FYN A;  1SHG A;  1NG2 A;  2D0N A;  1T3S A;  1V1C A;  2O9S A;  2FPE A;  3ULR B;  4J9E A;  2FPD A;  2PNI A;  1VA7 A;  5IHK A;  1NYG A;  2DLP A;  1AZE A;  1YP5 A;  3VS0 A;  2DRM A;  1ABO A;  4IIO A;  1I1J A;  4EIK A;  1AWW A;  3EG2 A;  4JJC A;  4AFS C;  3H0I A;  2A37 A;  1IO6 A;  2DX1 A;  2KRM A;  1JEG A;  2LQN A;  1YWP A;  3I35 A;  1S1N A;  1K4U S;  2BTT A;  5IXB A;  2EVR A;  3SEM A;  2J05 A;  4J9C A;  4RTU A;  3NMZ C;  2JXB A;  2K9G A;  2F2W A;  2X3W D;  4RTY A;  1UEC A;  1U06 A;  4J9B A;  3M0T A;  2DL7 A;  2EYY A;  4RTV A;  4GBQ A;  3NHN A;  2YUP A;  5GJV B;  2EBP A;  4HVW A;  2VWF A;  1VYT A;  4AFZ C;  2JS0 A;  2K6D A;  4RUG A;  3M0R A;  3ZL7 C;  4IIM A;  4AG1 C;  2L3S A;  2DBK A;  2CUB A;  2ECZ A;  2VVK A;  3U23 A;  1ZLM A;  1UG1 A;  1VYU A;  2EGE A;  2I0N A;  2JM9 A;  2HCK A;  2CT4 A;  4J9F A;  2C0T A;  4DEY A;  4OMM A;  1WI7 A;  2GQI A;  1PRM C;  1B3Q A;  2EPD A;  1WXT A;  2DNU A;  2ENM A;  1TUD A;  3RNJ A;  1KJW A;  2LJ0 A;  3EG3 A;  1WIE A;  4AFQ C;  1FMK A;  2LQW A;  4AFU C;  2DBM A;  3FJ5 A;  2LX7 A;  2KT1 A;  3VRZ A;  4OMN A;  2FRW A;  1KSW A;  4RTZ A;  2L3Q A;  2DL3 A;  1SRM A;  5EC7 A;  1XOV A;  2GTJ A;  2KYB A;  2KT8 A;  2GBQ A;  1UGV A;  2F2X A;  4ESR A;  1W70 A;  2AK5 A;  2RPN A;  2A28 A;  2RN8 A;  2EGA A;  1VYV A;  5IH2 A;  1CKB A;  1GCQ A;  1YN8 A;  2CH4 A;  1PHT A;  1GFC A;  1G2B A;  1WDX A;  1QLY A;  3O5Z A;  1QKW A;  1HSQ A;  4E6R A; 
#chains in the Genus database with same CATH topology
 4OML A;  1X6O A;  4JRQ A;  1H3Z A;  2W10 A;  2OAW A;  5GAM d;  1GXI E;  2E5K A;  2DE0 X;  5LJ3 e;  3QYG B;  2R5M A;  4BE0 A;  4PFO A;  3CPW P;  1KC8 C;  5LJ5 d;  1TWB A;  3OSS C;  2LT4 A;  2QAZ A;  2YLB A;  3JV3 A;  4L5G A;  3MHX A;  4FW1 A;  3JRZ A;  2NLU A;  3L2Q A;  4M7D G;  1U8R A;  4M77 A;  2D8H A;  4M77 F;  4BE2 A;  4D6W A;  3G4S Q;  2VGN A;  3LYI A;  3JCM g;  1LNX A;  4DBQ A;  5GAN 4;  3QZ5 B;  1K73 C;  2XD0 A;  2OTJ Q;  4PKC C;  1UHC A;  2KBT A;  5KE2 A;  1RLQ C;  3G4S T;  2M1H A;  3QKJ A;  4RTW A;  1W2B A;  5GAN 5;  5FRN A;  4YTL A;  4XAX B;  2EFI A;  3FC3 A;  1VQ6 T;  2M16 A;  3V7R A;  3CME Q;  3OA6 A;  1M90 R;  2IIM A;  2V26 A;  3UF4 A;  3A8G B;  4M4Z A;  4F7U F;  1M9S A;  4C92 C;  1KD1 C;  2DL4 A;  3VS2 A;  1Y07 A;  3P8H A;  3MJX A;  4J7I A;  2CUD A;  1Q95 G;  2QQS A;  2CZ1 B;  5KYU A;  1BBZ A;  1A0N B;  5CQX A;  4X34 A;  2PTK A;  3M0S A;  1VQM T;  1VUB A;  3G7Z A;  1YI2 Q;  4PJO D;  2DJQ A;  4PLL A;  1SF9 A;  5IAY A;  3BDU A;  3LX7 A;  5GAM h;  1QKX A;  1GCP A;  2GNC A;  3OS1 A;  4OMP A;  4ELY C;  3HTR A;  2GFU A;  2FYK A;  1V29 B;  2JMA A;  1B07 A;  1ARK A;  4R56 A;  3MCA B;  3CBO A;  1PC0 A;  5HK3 A;  3CEY A;  1D09 B;  3G1J A;  2RB6 A;  1IGU A;  3VRY A;  1WJS A;  2RQW A;  1MV3 A;  2L5Q A;  4JLI A;  3CCQ T;  2VB6 A;  3M4G A;  3MO8 A;  1NE8 A;  1YCS B;  1U1T A;  2QQ9 A;  2JW4 A;  3RDV A;  1VQK Q;  3HL8 A;  1WHM A;  1TOV A;  3AT1 B;  5A2Q E;  1SKU B;  2L0A A;  1WHH A;  2KVQ G;  2DER A;  3QSU A;  1UGP B;  1WA7 A;  2FRY A;  3V8J A;  4MZT A;  3THK A;  3TU4 K;  2CZ6 B;  4LN2 A;  1VOM A;  3I55 T;  1ZA2 B;  5CCA A;  2M0O A;  5LL6 S;  3ZEH A;  1IHV A;  2LZ6 B;  2FEI A;  1HYO A;  4ME7 A;  2V8K A;  2KR3 A;  1MMD A;  3DB3 A;  4A4E A;  1S72 Q;  5FU7 C;  2QA4 T;  2EYW A;  2LCL A;  5GAN j;  2E4H A;  2LJ3 A;  3AHU A;  2LT1 A;  1UFF A;  3ZBD A;  2LC4 A;  3ME9 A;  3EGU A;  3JCM J;  1VIE A;  2GF7 A;  2RQU A;  3GNG A;  1MMG A;  1HD3 A;  4OMO A;  2X4Y A;  1IRE B;  5LJ3 g;  3VUB A;  1MMN A;  1AHJ B;  2JTM A;  4E7S A;  2K2M A;  4X9D A;  3E9G A;  2ZGW A;  4CRI A;  4XU3 A;  3RMQ A;  3GOX A;  5GAM e;  3OYG A;  1VQL A;  3R6N A;  2H8H A;  1M30 A;  2KNB B;  1AEY A;  3BW1 A;  1W2B P;  3X20 B;  3URG A;  5GAO n;  1LPL A;  2E12 A;  3M0Q A;  1KK7 A;  2BKD N;  3TEE A;  3EG9 B;  3NTI A;  1M90 C;  2QA4 Q;  3OQ5 A;  1M8M A;  3EGD B;  2HBP A;  5GMK e;  1RL2 A;  2LTO A;  3HFN A;  3LWH A;  3RKY A;  3UA7 A;  2ED1 A;  2RM4 A;  5M9O A;  2IPO B;  5KYW B;  2NUT A;  3CPW S;  1HK9 A;  2DRK A;  3EH1 A;  4O6J A;  5HCK A;  3JB9 H;  1V76 A;  3S3M A;  1B34 B;  3VS5 A;  1KQ1 A;  3GBQ A;  3KXT A;  2CSI A;  1VQO T;  5CIU A;  2HDA A;  1RUW A;  3VS1 A;  2KXD A;  3INZ A;  5CKE A;  4IKF A;  2YUO A;  4M7D D;  2QTV A;  3ASK A;  1KFZ A;  1I4K 1;  3REB B;  3C95 A;  1YJN T;  4Z88 A;  4CC4 B;  5L23 A;  4B9X A;  3QBY A;  2K5I A;  2YXY A;  2E41 A;  2L3P A;  3H0F A;  2YRC A;  2WSC E;  1VQL Q;  2DK3 A;  4M75 E;  2DL5 A;  3X24 B;  4NL2 A;  3LWI A;  1W6X A;  1EX4 A;  3EHR A;  2JN0 A;  5LJ3 h;  3OW2 P;  1X2K A;  2HQE A;  1Q86 R;  3OS2 A;  3LLR A;  1PG5 B;  3E9F A;  2QYZ A;  1O9S A;  3OYD A;  3QJY A;  2DTH A;  3OYN A;  4N4I A;  2RNA A;  1BCO A;  3O8V A;  3JB9 G;  1VQP T;  5GMK m;  2KSS A;  4DQ2 A;  3VS6 A;  3CXC A;  2HQX A;  5GAM g;  3CCM Q;  3J7A F;  3UWN A;  1M2V B;  1QWF A;  2QEX Q;  1NEB A;  1QVP A;  1SSF A;  3LH0 A;  1SPK A;  4HKE A;  2XI9 A;  3JCM h;  3JB9 J;  3OYY A;  4M7A G;  2HNI A;  1G3W A;  2VC8 A;  1Q82 C;  3RUX A;  4PJJ A;  1VA7 A;  4OGC A;  4C0F A;  4HT9 A;  1AZE A;  3VS0 A;  2VXF A;  3OYB A;  4NOY A;  4IIO A;  4EMK B;  3CCV T;  1Q86 U;  5KCO A;  2A37 A;  5GAN f;  1JEG A;  2LQN A;  1YWP A;  4OB3 B;  3V7S A;  3CCM A;  2EYQ A;  3I35 A;  1S1N A;  2BTT A;  3SEM A;  3CCE T;  8ATC B;  3HRS A;  5KYY A;  4RTY A;  1BI0 A;  2VAS A;  4E7H A;  1U06 A;  2F5T X;  2DL7 A;  4RTV A;  1VQ8 A;  4GBQ A;  3NHN A;  4HVW A;  1VYT A;  1RAE B;  1RAB B;  4J8O A;  4AG1 C;  4Y28 E;  1VQ6 A;  3M59 A;  2VUB A;  3OMC A;  4FYV B;  5KYY B;  4M75 C;  1ZSZ A;  3EFR A;  4KT0 E;  2KI7 A;  1WI7 A;  1H64 1;  2Y4Y A;  3I55 A;  4KUI A;  3RNJ A;  3MEW A;  4M78 C;  1PSE A;  2MAM A;  1M1K U;  1FMK A;  2F1L A;  2LQW A;  2QQB A;  3CCR A;  2KT1 A;  2MI6 A;  2L3Q A;  2DL3 A;  1SRM A;  5EC7 A;  1XOV A;  2EJF A;  1RAC B;  1PSF A;  1Y96 A;  1LJO A;  5A0L A;  4JLG A;  1W70 A;  3PGG A;  3V8K A;  2RPN A;  2V8I A;  4J6W A;  2CYZ B;  2Y4X A;  2KAF A;  3LGF A;  3CC7 Q;  2CH4 A;  4N0A A;  1GFC A;  1WDX A;  4FYW B;  1QKW A;  4C92 D;  1VQ4 A;  4NL3 A;  2I2L A;  5AT1 B;  5IN1 A;  2PVO B;  3BY7 A;  4LD6 A;  2KXC A;  3PVL A;  2FZC B;  2JTE A;  3EGX A;  4M75 D;  1VQ6 Q;  1QVF P;  2MWO A;  4M7A E;  3CCU A;  3MET A;  1JXM A;  1WHG A;  3A8H B;  1K1Z A;  2QA4 A;  4FM4 B;  2OTL T;  1YJW T;  1NLO C;  3TSZ A;  1NLP C;  3H0H A;  1VQ5 Q;  2EYZ A;  4ATO A;  3VS3 A;  2DTI A;  1UGR B;  4WCI A;  2O31 A;  2OJ2 A;  5FU6 C;  4M7A F;  4AG2 C;  1TXQ A;  1R0B G;  1VQN A;  1X6B A;  2M51 A;  4EMG A;  3CCE Q;  3M55 A;  4M77 B;  2DD4 A;  1I81 A;  3SD4 A;  2R58 A;  1M3A A;  1YI2 T;  3GLX A;  2J06 A;  1QVG A;  1GBQ A;  2M9U A;  1GFD A;  2DZC A;  1KQS S;  3JAM E;  1OEB A;  3PMI A;  2DXB A;  2HBW A;  1RAA B;  2V1R A;  4XTW A;  1UB4 A;  4LUE A;  3CPW A;  4XU0 A;  2YRV A;  4M78 G;  4FT4 A;  2EQI A;  1JB0 E;  3OW2 S;  4F14 A;  4PJO G;  2AKK A;  4QQ6 A;  3A98 A;  3CCQ A;  2A08 A;  1LCK A;  1JO8 A;  1UDL A;  4M78 E;  1ZX6 A;  3CMA T;  3CCJ Q;  1RI0 A;  4QQD A;  2DF6 A;  3OBW A;  1WQ7 A;  2ESW A;  4DBF A;  4C8Q D;  4KH1 B;  5FWB A;  1YCY A;  4FT2 A;  4C92 F;  2RJE A;  3G71 A;  1P92 A;  4RTT A;  3OYI A;  4RCC A;  3CMA Q;  5DLQ E;  1IZ6 A;  2X51 A;  3H41 A;  4EPC A;  4KGV B;  1XNI A;  4C0Z A;  2HZY A;  4BY6 C;  1KC8 U;  3TSW A;  2GTO A;  2L3R A;  4GLM A;  4M75 A;  3HSB A;  3MP6 A;  1RAD B;  5GAO m;  1BI1 A;  2V1Q A;  4RG8 A;  2MOX A;  2DJZ A;  4QW2 A;  2PVD B;  4F17 A;  2DZ9 A;  4N4G A;  1ZHI A;  1AWO A;  2BZY A;  4M78 F;  3TRE A;  5J26 A;  3OBY A;  5GAO r;  5GAN 6;  2MF2 A;  4F7U E;  4Z89 A;  3PNW C;  2L2P A;  1NJI R;  3OW2 A;  4RG2 A;  3PIP A;  3CC2 T;  4MZM A;  4XU1 A;  4FYY B;  1ABQ A;  2CDT A;  3QUI A;  1D1C A;  3SB2 A;  1M27 C;  2E10 A;  4BDZ A;  1WYX A;  1XTD A;  2RHX A;  3OYK A;  2KDS A;  2XG8 D;  2DKG A;  3JCM X;  4HVU A;  1ZSG A;  3UPU A;  3QJ6 A;  2LQK A;  1MV0 B;  3E1S A;  4LDV A;  2DXU A;  4M78 D;  2SEM A;  1WNL A;  2XMF A;  4VUB A;  1QP3 A;  1MUZ A;  2KGT A;  2NWM A;  5CAI A;  2W0Z A;  3KFV A;  4J9I A;  3EHQ A;  5IHI A;  1NBE B;  1UHF A;  2KRO A;  3A1P A;  3I5R A;  2ROT A;  3M58 A;  2EQU A;  4BI4 A;  2A3L A;  2VYT A;  5D6W A;  3QZ9 B;  1KG1 A;  3EG1 A;  1EFN A;  4ZTJ A;  3MP8 A;  3CC2 Q;  4M7A A;  3V8L A;  1VQ7 A;  1BI3 A;  4HXJ A;  1Z9Z A;  1DJ7 B;  2CP7 A;  1OI1 A;  4C0G A;  2YSQ A;  3UDC A;  2K4Y A;  2QXF A;  5FLX E;  2K57 A;  1X2Q A;  3MEA A;  3QWX X;  3CD6 T;  2X3X D;  2LP5 A;  3L2V A;  1D0Y A;  5GAM f;  5D7U A;  4KGX B;  3CCS T;  1PD0 A;  2DTO A;  2D9T A;  5CKB A;  3WVE B;  1EIF A;  1NEG A;  3H8Z A;  2LMJ A;  1N5Z A;  1RI9 A;  2XKO C;  2RK1 A;  2LX9 A;  4ZGE B;  4PNO A;  1K9A A;  3E19 A;  3I9Q A;  1QVF A;  4CC7 A;  4DEX A;  1I5L A;  4PL6 A;  3N5B B;  3CC7 T;  2JS2 A;  1H3H A;  3EGX B;  1OU8 A;  1ZUU A;  4IUV A;  4QVZ A;  2YUQ A;  3S3O A;  1YI2 A;  1JJ2 S;  4WF2 A;  1K9M R;  3GP8 A;  2PVG B;  3QPH A;  1UUE A;  4C8Q E;  2IG0 A;  3H6Z A;  4Z02 A;  3FDR A;  5IXF A;  1JBM A;  1FMW A;  5LJ3 d;  4MML A;  4B6M A;  4E2F B;  1BCM A;  4ZNX A;  1WHK A;  4C8Q G;  1NM7 A;  3MPU B;  3X25 B;  2ZZD A;  1M3C A;  3I55 Q;  1J3T A;  3OYJ A;  2CZ7 B;  1SHF A;  1WGS A;  3CC4 Q;  1UTI A;  3CCQ Q;  4F16 A;  1AVZ C;  1UGS B;  2E6N A;  2NUZ A;  1UE9 A;  2FG0 A;  1M4Z A;  2P84 A;  4JRK A;  2CP5 A;  4QVD A;  4GY5 A;  1TUC A;  3NGP A;  1Q82 U;  4FU6 A;  1VQ7 T;  2NUP B;  1YNZ A;  1U3O A;  1IGQ A;  2YRD A;  1M3B A;  1E7O A;  3IQL A;  3MEV A;  4A4K A;  1D0X A;  1JQQ A;  1Q86 C;  4JUV A;  3M9Q A;  3CCE A;  2XDB A;  4DA4 A;  3VUZ A;  4JZ3 A;  1LOJ A;  1QCO A;  4JJN K;  4JJD A;  1D1A A;  2K79 A;  2J7I A;  3CCR Q;  3VS7 A;  1T3L A;  4QT7 A;  2X35 A;  2RQR A;  1SEM A;  2HQH A;  2LCC A;  5HKC A;  1YIT A;  1SHG A;  1NG2 A;  3CCJ T;  2D0N A;  1Y96 B;  2HMA A;  2O9S A;  2FPE A;  4J9E A;  5I2S A;  2FPD A;  5IHK A;  1NYG A;  3CD6 A;  1M90 U;  1D1B A;  1Q7Y R;  4M75 G;  2D6F A;  1VQ9 A;  3EG2 A;  3SWN A;  4Y91 A;  4EDU A;  4ZN1 A;  4JJC A;  2CGH A;  5KE3 A;  4LDW A;  3RKX A;  5KYW A;  1MNE A;  2KRM A;  4HT8 A;  1VQ4 Q;  2CP6 A;  4HCC A;  4DBH A;  3VU3 C;  2KQW A;  2AT1 B;  5IT9 E;  2PQW A;  4C8Q C;  1M1K C;  2X3W D;  2QEX T;  1N9S A;  3EG9 A;  2EYY A;  1QVF S;  3HKS A;  1ACM B;  2EBP A;  2RI3 A;  2JS0 A;  5EG2 A;  3L2Z A;  5L8R E;  4KUD K;  2K5F A;  3OY9 A;  2CUB A;  5GMK i;  1UG1 A;  1VYU A;  2I0N A;  2YLC A;  2ZPG B;  4KBM B;  2HCK A;  1VQL T;  3RKW A;  2EAY A;  1YHQ Q;  2CT4 A;  4J9F A;  2XK0 A;  2C0T A;  2EQJ A;  3CBP A;  4DEY A;  2GQI A;  4C92 E;  1PRM C;  1B3Q A;  2EPD A;  1WXT A;  1YIJ T;  2DNU A;  1S72 A;  4MMK A;  3QDR B;  4MDW A;  4TVR A;  5LJ5 h;  1YHQ A;  2LJ0 A;  3EG3 A;  4AFQ C;  4KGZ B;  4OP0 A;  2DBM A;  3FJ5 A;  2LX7 A;  3CCL T;  5LJ3 j;  3G6E Q;  1YJW Q;  2RI5 A;  2HKQ B;  2GTJ A;  3I56 A;  1UGV A;  2F2X A;  4FIB A;  2RJD A;  2XIC A;  1W4S A;  3M57 A;  4C92 B;  1QLY A;  2QQA A;  4XTY A;  1BI2 A;  1Y7X A;  1FX7 A;  2CKK A;  2AKL A;  1OPK A;  2O4X A;  3MP1 A;  4PLI A;  1ZQ1 A;  2GFA A;  1N9R A;  4OMQ A;  1SSH A;  3JB9 D;  2CP0 A;  4C8Q B;  1B34 A;  1M5Q 1;  4J6X A;  1BK2 A;  1TS9 A;  2MK5 A;  5GAN d;  1U5S A;  2ZPB B;  1QW1 A;  4PFZ A;  4M78 A;  4PJO C;  2DET A;  4FCY A;  1Y57 A;  2L8D A;  2ZPH B;  1VQP A;  1K9M U;  1H8K A;  3JCM V;  3OYH A;  4XQ3 A;  1BKB A;  2DL8 A;  4BUG A;  3REA B;  5GAN g;  4LD9 K;  1GBR A;  1BB9 A;  5GMK j;  2OAU A;  1HJD A;  4LNP A;  2VKN A;  3M0U A;  5GAN 3;  4L6V 5;  3KUF A;  4P5N A;  1YIJ A;  1R8O B;  1N8R C;  1Q7Y C;  4ELZ C;  2PUO B;  3BFM A;  3QHS A;  3QII A;  4OGE A;  1NPP A;  3C12 A;  3QWY A;  2MIO A;  4HCK A;  2FPF A;  2PU9 B;  1EZZ B;  3HPW A;  1AZG B;  5FU6 B;  5HY6 A;  1WQW A;  3NFC A;  1YJ9 A;  1ZUY A;  2ED0 A;  3OS0 A;  2JM8 A;  2DXT A;  2OI3 A;  3PE0 A;  3FB9 A;  1PM3 A;  2KRN A;  5CQY A;  1OZ3 A;  4NS5 A;  3G4S A;  2JMC A;  1ZUK A;  2EKH A;  3C4S A;  3S6W A;  1TH7 A;  4PJO B;  4EMK A;  4HVV A;  4O5V A;  1I07 A;  4M75 F;  3LW5 E;  4X1V A;  1WJR A;  4Q5W A;  1IXD A;  1VQ9 Q;  3A8L B;  1N27 A;  1PKS A;  2JNG A;  2VXE A;  1E6H A;  2EJG A;  4C5E A;  2K3B A;  2F69 A;  1WLP B;  2JT4 A;  4JRI A;  3GPL A;  3OYL A;  3CBM A;  1K8A C;  3OYA A;  2P0K A;  3PVQ A;  1WXB A;  1OOT A;  1OX9 A;  1JRI A;  2WSF E;  2EQM A;  2YHT A;  2ZCF B;  3GF5 A;  4OMF B;  1NJI U;  3OYE A;  4N0A C;  4DBR A;  1QQJ A;  1X43 A;  1YWO A;  4JDS A;  4F7U G;  2OTL Q;  3CPF A;  2RQV A;  1MHN A;  4ANJ A;  1RAH B;  3QO3 A;  2K2V A;  3VS4 A;  2MPX C;  2CS7 A;  1VQ5 A;  2QI2 A;  2RD1 A;  4PJN A;  1KQS A;  2EKO A;  2PZ1 A;  2HSP A;  4CC2 A;  4MZP A;  4M7D A;  1NYF A;  2CP3 A;  3MEU A;  3UAT A;  1YJ9 Q;  2KK4 A;  4LUD A;  2P4R A;  2XDP A;  3RBB B;  3CCR T;  3LGL A;  4BI3 A;  4XK8 E;  3EFO B;  2RHY A;  3CQT A;  3JCM c;  2DPP B;  2F2V A;  9ATC B;  1PCX A;  4XU2 A;  5KCH A;  1GCQ C;  1QVG P;  2BZ8 A;  3EFS A;  2JZ2 A;  3QXE B;  1KHC A;  2RMO A;  3HHT B;  5CVI A;  1AT1 B;  4X9C A;  2J6K A;  2COZ A;  2IVW A;  2QG9 B;  1Q81 R;  2RI2 A;  3CXC P;  4M7D C;  1WHJ A;  3E2U A;  2RJF A;  1U1S A;  4FSS A;  3PT9 A;  1M8V A;  1YJ9 T;  4PFP A;  1VQK A;  2BE9 B;  2NUT B;  2LNV A;  1K73 U;  1QCN A;  1G83 A;  1TG0 A;  2X4X A;  2ABL A;  3HP9 A;  1C0M A;  1H92 A;  3T9N A;  3FJP A;  2O88 A;  1WHL A;  2J6O A;  4ORZ A;  3OYC A;  3CC4 T;  3SDZ A;  4M7A C;  1KIK A;  1OPL A;  5KYX B;  2DD5 A;  1TSF A;  3UA6 A;  3WXM B;  3UT1 A;  2L89 A;  1M1K R;  2BZX A;  5CKH A;  1G3Y A;  5LJ5 e;  1BYM A;  2AZV A;  2RF0 A;  3WVD B;  3JCM b;  5CK9 A;  3L2W A;  1I8F A;  3CMA A;  4KRT A;  4C92 A;  2OTJ A;  1FMV A;  1UJ0 A;  2DO3 A;  3QDF A;  2DVE A;  2V8J A;  2HSE B;  3G6E T;  2XHC A;  2H3J A;  1K76 A;  2HAX A;  1KC8 R;  4OB2 B;  2LNH B;  5GAN 7;  3X26 B;  2KY9 A;  5I2M A;  2EIF A;  1CSK A;  1K0S A;  2LRQ A;  4M7A D;  2COW A;  4ZN3 A;  3CME T;  2SRC A;  1OU9 A;  2JTF A;  3QG1 A;  1PWT A;  4ZGJ B;  3CC4 A;  1O75 A;  3PMT A;  3G71 T;  4QQG A;  1AWJ A;  2EGC A;  5D6Y A;  2AIR B;  1F1B B;  1Y71 A;  4D8D A;  3Q1J A;  3PIO A;  1YJN A;  2QQR A;  4CC3 A;  1PNJ A;  4EMH A;  4DOW A;  1K8A U;  2QDL A;  1X6G A;  1YJN Q;  1X27 A;  1BU1 A;  1RLP C;  4A63 B;  4J83 A;  2EW3 A;  1AWX A;  1Q81 C;  1XJW B;  2G6F X;  2ZAE A;  2E65 A;  4FL6 A;  2DAQ A;  2FHD A;  1UJY A;  2RA2 A;  1W2B S;  5GAN 2;  1RAI B;  4M77 D;  4LDX A;  4BDY A;  5CKD A;  3J80 E;  1V1C A;  1NZ9 A;  2X9H A;  8AT1 B;  1YP5 A;  3L1A A;  1ABO A;  3CCJ A;  2JOY A;  1N6A A;  1I1J A;  4EIK A;  3EFO A;  1VQM Q;  1VQ5 T;  2A7Y A;  3GNF B;  2AHJ B;  4PJL A;  3SWN C;  3JCM Q;  1Q82 R;  2F5K A;  1QVG S;  4BY6 B;  4M7A B;  4A54 A;  3VKI A;  4LDU A;  4WTO B;  5IXB A;  1VQO Q;  2J05 A;  2OX7 A;  4RTU A;  3NMZ C;  2JXB A;  2K9G A;  4M77 G;  4A4H A;  2OTJ T;  4IUR A;  2DEU A;  1UEC A;  1YFN A;  2MYS A;  4KH0 B;  3M0T A;  2LDM A;  4J6Y A;  4LXC A;  3F70 A;  1N8R R;  2YUP A;  3EAE A;  2VWF A;  4AFZ C;  3RIR A;  4RUG A;  3ZL7 C;  2OTL A;  4JS5 A;  2L3S A;  5FU7 B;  1KD1 U;  4A4F A;  2JM9 A;  2R5A A;  3SFM A;  4BI8 B;  5C0M A;  3CCV Q;  1G8X A;  3OS5 A;  3VYH B;  4PJM A;  1I5O B;  1Q7Y U;  1KJW A;  2EJ9 A;  4B9W A;  2EWN A;  1WIE A;  4AFU C;  1VQ4 T;  2RHZ A;  1UEB A;  4FYX B;  3RMS A;  1NPR A;  2QGG A;  2HL3 A;  3G71 Q;  2FRW A;  3RER A;  1KSW A;  1VQN Q;  2O01 E;  2KYB A;  2KT8 A;  5DLO A;  5CO7 A;  4ESR A;  4IUT A;  4M77 E;  3JB9 I;  5GAO p;  2RN8 A;  2X4J A;  6AT1 B;  1WJQ A;  1VQP Q;  2XU8 A;  1G2B A;  1VQN T;  1K9M C;  3V7C A;  3QYH B;  4JS4 A;  4C8Q A;  4C0D C;  2COY A;  2CP2 A;  3MKD A;  2FZK B;  1WXU A;  4PJO F;  5A0D A;  4IUP A;  3VYG A;  4M75 B;  3GIB A;  1R77 A;  3KBG A;  3PTA A;  2LCS A;  4M78 B;  2E70 A;  3M5A A;  2CZ0 B;  2DXC A;  3TVT A;  2QAS A;  1IB8 A;  2QK0 A;  2R57 A;  3BDL A;  4BE1 A;  2JVV A;  5I11 A;  2HKN A;  2DMO A;  2XID A;  1SG5 A;  1WFW A;  2DIG A;  4OB1 B;  2ZPE B;  2RH2 A;  3BE3 A;  1W1F A;  4RCB A;  4N4H A;  3HRU A;  4M7D E;  4M7D F;  1YJW A;  2B86 A;  2BUD A;  5FRO A;  2BE7 D;  1QWE A;  3JSC A;  4HCB A;  2K5L A;  3HRT A;  1IHW A;  3VJP A;  3JCM f;  1RAF B;  2YDL A;  4A4G A;  4FW2 A;  2KMT A;  2K7A A;  5CR2 A;  5FW9 A;  2GCX A;  2DYB A;  4J9D A;  3JCM P;  3DLL A;  2P0P A;  1VQ7 Q;  4J5Y A;  1PRL C;  5LJ5 j;  1UGQ B;  2YT6 A;  3DLM A;  5GMK l;  1M2V A;  3NPF A;  2CRE A;  2QGF B;  2X4W A;  1JU5 C;  2CH4 W;  2DEQ A;  3CCM T;  3CCS Q;  4Y92 A;  5KYU B;  3OYF A;  5DY9 A;  1YIT T;  3I5S A;  4D8K A;  5D6X A;  2E5Q A;  1KQS P;  1E6G A;  3JCM W;  3SWN B;  3D7S B;  3PFS A;  3L42 A;  3H9N A;  1D0Z A;  1LVK A;  1ZSZ C;  2D1X A;  4C5H A;  2RQT A;  4MDX A;  2ZPF B;  4JRP A;  2CT3 A;  4FSX A;  3P8B B;  3C0C A;  5LJ3 f;  2A36 A;  1SRL A;  3OMG A;  3A5Z B;  5LJ5 f;  1T0J A;  2EQK A;  4L59 A;  2VGM A;  4QVC A;  5I21 A;  4DOV A;  4Z8A A;  4OVA A;  4XTU A;  1JJ2 P;  2LJ1 A;  2QTX A;  4BD3 A;  4R55 A;  3X28 B;  3JB9 F;  2RK2 A;  1M1F A;  2KE9 A;  3CCS A;  5GAN e;  2WSE E;  4K11 A;  2AZS A;  3VV0 A;  3SHW A;  2MMP A;  1K8A R;  4BB7 A;  2E3I A;  2J6F A;  2HL5 C;  3OYM A;  1YIJ Q;  4LDY A;  2LQ8 A;  3EG0 A;  2K3X A;  2GQV A;  4RKU E;  1AD5 A;  5GAN h;  1K0X A;  3DKM A;  2DVJ A;  5AYF A;  7AT1 B;  3M53 A;  2HD0 A;  1K73 R;  4E7L A;  3L2U A;  4JPB W;  4ZTF A;  1D3B A;  2E1H A;  4BAC A;  4IUU A;  3CCV A;  5GAO q;  4PJO A;  1OUL A;  3LH5 A;  1JJ2 A;  1YHQ T;  5IHN A;  3TQ7 P;  2NYS A;  1WX6 A;  5KH6 A;  1OX8 A;  2ATC B;  2H3E B;  1XQH A;  1MGQ A;  1Q81 U;  1VQK T;  1OQK A;  3I56 Q;  1AOJ A;  5J39 A;  2QDY B;  1JXO A;  4E7Z A;  1WZO A;  4XTZ A;  1GRI A;  2O4X B;  1ZBJ A;  5J3B A;  2PUK B;  3A8O B;  5CKF A;  4PJO E;  3I56 T;  2YUN A;  2DM1 A;  1FXX A;  4HCZ A;  3L2R A;  2A0F B;  1B7T A;  1MND A;  4E7I A;  1Y0M A;  4LE9 A;  3FEO A;  2M0Y A;  4RMO A;  3J81 E;  1VQM A;  2D8J A;  2FZG B;  2KEA A;  4JJB A;  1NJI C;  2O9V A;  5GJW B;  4C5G A;  5FWC A;  2MWP A;  2DA9 A;  2DIL A;  2E64 A;  2C06 A;  1PKT A;  4M77 C;  1M1G A;  3M0P A;  5A0G A;  4PK4 A;  4OB0 B;  1QCF A;  2RHU A;  4UC4 A;  1TUG B;  3NTK A;  4M7D B;  1C1A A;  3CC7 A;  1GL5 A;  2QEX A;  2RHI A;  2DFU A;  2KRS A;  3M56 A;  1OYX A;  3CD6 Q;  1IRX A;  4OF1 A;  2G3R A;  4R0K A;  4J9H A;  2B8A A;  4C5I A;  2ROL A;  1G3S A;  3HFO A;  1X01 A;  4J9G A;  2P4T A;  2M02 A;  3EH2 A;  3CCU T;  1Z9Q A;  5KYX A;  1OV3 A;  2C0O A;  3CXC S;  2O2O A;  1R0C B;  2FL7 A;  2EYX A;  2C0I A;  3S3N A;  2JUF A;  2K3Y A;  4JZ4 A;  5GMK h;  5LJ5 g;  3CCU Q;  2CSQ A;  1VQ9 T;  1I0C A;  2FO0 A;  2ZPI B;  5I22 A;  2WAC A;  3RR6 A;  1CKA A;  1BIB A;  1QMC A;  3FRN A;  1X69 A;  4F7U B;  2HEQ A;  4II1 A;  1VQ8 Q;  1T0H A;  2YWW A;  2XDD A;  2MCN A;  2GGR A;  2KYM A;  5ECA A;  1YIT Q;  2RJC A;  1N8R U;  4AT1 B;  3M4Y A;  1M2O A;  4QKU A;  5KYN A;  1ZA1 B;  1FWZ A;  4A53 A;  2DIQ A;  1ZSZ B;  3CME A;  4V2S A;  4RTX A;  1FYN A;  1ZBX A;  1RAG B;  1T3S A;  4C8Q F;  4F04 B;  2BIV A;  1G3T A;  3ULR B;  2VV5 A;  3OB9 A;  4XTV A;  2PNI A;  2DLP A;  2DRM A;  1AWW A;  3ER0 A;  4AFS C;  1TU0 B;  1D3B B;  3H0I A;  1S72 T;  1IO6 A;  2DX1 A;  4C92 G;  5GAM j;  4EMK C;  2Y90 A;  1K4U S;  4GLK A;  1VQ8 T;  3EGD A;  2EVR A;  4E47 A;  2FB7 A;  4J9C A;  5FRM A;  3TCJ A;  3CCL A;  4HA8 A;  2F2W A;  2Z0W A;  4KUL A;  1BIA A;  4XTX A;  4J9B A;  4E7J A;  3OSV A;  3RES A;  4AMC A;  5HK0 A;  5GJV B;  5GAN 8;  5GAO l;  3A8M B;  1PD1 A;  3R6O A;  1X75 C;  2K6D A;  1KQ2 A;  3M0R A;  4IIM A;  3P8D A;  2E6Z A;  2DBK A;  2ECZ A;  2VVK A;  3U23 A;  1ZLM A;  3M54 A;  2EGE A;  2RO0 A;  3DB4 A;  3ZFJ A;  1HXD A;  4OMM A;  3JCM d;  4C0D B;  4IUQ A;  1KD1 R;  2FVU A;  2ENM A;  3FIF A;  1TUD A;  3C94 A;  4J7F A;  2JJ9 A;  2D0Q B;  4F7U A;  3JCM e;  1MMA A;  2E3H A;  1G5V A;  2LVM A;  3CC2 A;  2P0Q A;  5DM7 R;  3VRZ A;  4OMN A;  5C6S A;  4RTZ A;  2NUP A;  2GBQ A;  4CI0 C;  3NTH A;  2AK5 A;  1TTH B;  3G6E A;  2A28 A;  1OZ2 A;  4E7K A;  2EGA A;  3FLG A;  1VIF A;  1VYV A;  5IH2 A;  3CCL Q;  1CKB A;  1GCQ A;  1KHI A;  1YBY A;  1YN8 A;  1QP2 A;  1PHT A;  4ZGD B;  1VQO A;  1WPY A;  2DYI A;  3O5Z A;  1C6V X;  1HSQ A;  4E6R A; 
#chains in the Genus database with same CATH homology
 4OML A;  1WXU A;  2W10 A;  2OAW A;  2AKL A;  2E5K A;  1OPK A;  2DE0 X;  2KXC A;  3PVL A;  2JTE A;  4OMQ A;  1SSH A;  2LCS A;  1BK2 A;  1JXM A;  1K1Z A;  3JV3 A;  3TVT A;  1U5S A;  1NLO C;  3TSZ A;  1NLP C;  3H0H A;  2EYZ A;  1Y57 A;  2D8H A;  3VS3 A;  5I11 A;  2DMO A;  4WCI A;  2O31 A;  2OJ2 A;  1H8K A;  4AG2 C;  1WFW A;  2DL8 A;  1X6B A;  3REA B;  1GBR A;  2M51 A;  1BB9 A;  1W1F A;  1HJD A;  1UHC A;  2KBT A;  4LNP A;  2VKN A;  3M0U A;  1RLQ C;  1M3A A;  4RTW A;  2B86 A;  2J06 A;  1GBQ A;  1QWE A;  1GFD A;  1OEB A;  2HBW A;  2V1R A;  2YDL A;  4LUE A;  2IIM A;  3UF4 A;  3QWY A;  2K7A A;  2EQI A;  5FW9 A;  4F14 A;  2DYB A;  4M4Z A;  2AKK A;  2MIO A;  4HCK A;  4J9D A;  2FPF A;  3A98 A;  2DL4 A;  3VS2 A;  2A08 A;  1LCK A;  1AZG B;  1JO8 A;  1UDL A;  1ZX6 A;  2CUD A;  1PRL C;  2DF6 A;  2YT6 A;  1ZUY A;  1BBZ A;  2ED0 A;  2ESW A;  2JM8 A;  2OI3 A;  1A0N B;  3NPF A;  3PE0 A;  5FWB A;  2CRE A;  2KRN A;  2PTK A;  3M0S A;  1JU5 C;  2CH4 W;  4RTT A;  4Y92 A;  2JMC A;  1ZUK A;  2EKH A;  3I5S A;  4D8K A;  3H41 A;  2DJQ A;  1E6G A;  1QKX A;  1GCP A;  4HVV A;  2GNC A;  4OMP A;  1I07 A;  3TSW A;  2GTO A;  2JMA A;  4X1V A;  4GLM A;  1B07 A;  1ARK A;  2D1X A;  2RQT A;  1PKS A;  2CT3 A;  3C0C A;  2A36 A;  1SRL A;  1E6H A;  1T0J A;  2V1Q A;  2K3B A;  1WLP B;  2JT4 A;  2MOX A;  4Z8A A;  3VRY A;  4F17 A;  2RQW A;  2LJ1 A;  3PVQ A;  1WXB A;  1MV3 A;  1OOT A;  1AWO A;  2BZY A;  1YCS B;  1X43 A;  2KE9 A;  1YWO A;  2JW4 A;  4Z89 A;  4K11 A;  2AZS A;  2L2P A;  3SHW A;  2L0A A;  2RQV A;  1WA7 A;  2FRY A;  2J6F A;  1ABQ A;  2CDT A;  3VS4 A;  3THK A;  3EG0 A;  1M27 C;  4LN2 A;  2PZ1 A;  1AD5 A;  1WYX A;  2HSP A;  4CC2 A;  1K0X A;  1NYF A;  2DVJ A;  2LZ6 B;  3UAT A;  2FEI A;  4HVU A;  4JPB W;  2KR3 A;  1ZSG A;  4LUD A;  2P4R A;  3RBB B;  1MV0 B;  2EYW A;  2LJ3 A;  3CQT A;  3LH5 A;  1UFF A;  2F2V A;  5IHN A;  1GCQ C;  2SEM A;  2XMF A;  3EGU A;  2BZ8 A;  1MUZ A;  1WX6 A;  2KGT A;  2RQU A;  1HD3 A;  4OMO A;  2NWM A;  2W0Z A;  3KFV A;  4J9I A;  3EHQ A;  5IHI A;  1UHF A;  2KRO A;  3I5R A;  2ROT A;  2RMO A;  2K2M A;  1AOJ A;  2J6K A;  3EG1 A;  1EFN A;  3R6N A;  2H8H A;  1JXO A;  1M30 A;  2KNB B;  4HXJ A;  1Z9Z A;  1AEY A;  1GRI A;  1ZBJ A;  3M0Q A;  2YSQ A;  2YUN A;  2DM1 A;  4FSS A;  1X2Q A;  3QWX X;  2X3X D;  2LP5 A;  1M8M A;  1Y0M A;  4LE9 A;  2M0Y A;  1G83 A;  1TG0 A;  2ABL A;  3UA7 A;  2ED1 A;  1NEG A;  2D8J A;  1H92 A;  2KEA A;  2LMJ A;  4JJB A;  1N5Z A;  2O88 A;  2J6O A;  4ORZ A;  2O9V A;  1RI9 A;  5GJW B;  5FWC A;  1KIK A;  2DA9 A;  2DRK A;  1OPL A;  5HCK A;  2DIL A;  3UA6 A;  1K9A A;  3I9Q A;  1PKT A;  4CC7 A;  3VS5 A;  4DEX A;  3GBQ A;  2CSI A;  3M0P A;  2JS2 A;  2HDA A;  1RUW A;  1H3H A;  1ZUU A;  1QCF A;  3VS1 A;  2BZX A;  2KXD A;  2YUQ A;  2YUO A;  1UUE A;  2AZV A;  1KFZ A;  2RF0 A;  1GL5 A;  3REB B;  4Z88 A;  5IXF A;  4KRT A;  1UJ0 A;  4CC4 B;  5L23 A;  4ZNX A;  2KRS A;  1NM7 A;  2L3P A;  3H0F A;  1K76 A;  4R0K A;  2LNH B;  4J9H A;  1M3C A;  2ROL A;  1J3T A;  2DL5 A;  4J9G A;  1SHF A;  1CSK A;  1K0S A;  1W6X A;  1UTI A;  2SRC A;  4F16 A;  1AVZ C;  2NUZ A;  1Z9Q A;  1OV3 A;  2C0O A;  1PWT A;  1UE9 A;  2O2O A;  2FG0 A;  3EHR A;  2EYX A;  1X2K A;  2C0I A;  1AWJ A;  2EGC A;  1TUC A;  3NGP A;  4D8D A;  4JZ4 A;  1YNZ A;  2CSQ A;  1U3O A;  1I0C A;  4CC3 A;  1PNJ A;  2FO0 A;  1M3B A;  1E7O A;  2RNA A;  2QDL A;  5I22 A;  3IQL A;  1X6G A;  1X27 A;  1BU1 A;  1CKA A;  1RLP C;  4A63 B;  1JQQ A;  1X69 A;  2HEQ A;  2EW3 A;  1T0H A;  1AWX A;  4JZ3 A;  2MCN A;  2G6F X;  2GGR A;  2KYM A;  4JJD A;  2K79 A;  2J7I A;  5ECA A;  3VS6 A;  3VS7 A;  1QWF A;  1UJY A;  1T3L A;  4QT7 A;  2RQR A;  1NEB A;  1SEM A;  4RTX A;  1SPK A;  1FYN A;  1SHG A;  1NG2 A;  2D0N A;  1T3S A;  1V1C A;  2O9S A;  2FPE A;  3ULR B;  4J9E A;  2FPD A;  2PNI A;  1VA7 A;  5IHK A;  1NYG A;  2DLP A;  1AZE A;  1YP5 A;  3VS0 A;  2DRM A;  1ABO A;  4IIO A;  1I1J A;  4EIK A;  1AWW A;  3EG2 A;  4JJC A;  4AFS C;  3H0I A;  2A37 A;  1IO6 A;  2DX1 A;  2KRM A;  1JEG A;  2LQN A;  1YWP A;  3I35 A;  1S1N A;  1K4U S;  2BTT A;  5IXB A;  2EVR A;  3SEM A;  2J05 A;  4J9C A;  4RTU A;  3NMZ C;  2JXB A;  2K9G A;  2F2W A;  2X3W D;  4RTY A;  1UEC A;  1U06 A;  4J9B A;  3M0T A;  2DL7 A;  2EYY A;  4RTV A;  4GBQ A;  3NHN A;  2YUP A;  5GJV B;  2EBP A;  4HVW A;  2VWF A;  1VYT A;  4AFZ C;  2JS0 A;  2K6D A;  4RUG A;  3M0R A;  3ZL7 C;  4IIM A;  4AG1 C;  2L3S A;  2DBK A;  2CUB A;  2ECZ A;  2VVK A;  3U23 A;  1ZLM A;  1UG1 A;  1VYU A;  2EGE A;  2I0N A;  2JM9 A;  2HCK A;  2CT4 A;  4J9F A;  2C0T A;  4DEY A;  4OMM A;  1WI7 A;  2GQI A;  1PRM C;  1B3Q A;  2EPD A;  1WXT A;  2DNU A;  2ENM A;  1TUD A;  3RNJ A;  1KJW A;  2LJ0 A;  3EG3 A;  1WIE A;  4AFQ C;  1FMK A;  2LQW A;  4AFU C;  2DBM A;  3FJ5 A;  2LX7 A;  2KT1 A;  3VRZ A;  4OMN A;  2FRW A;  1KSW A;  4RTZ A;  2L3Q A;  2DL3 A;  1SRM A;  5EC7 A;  1XOV A;  2GTJ A;  2KYB A;  2KT8 A;  2GBQ A;  1UGV A;  2F2X A;  4ESR A;  1W70 A;  2AK5 A;  2RPN A;  2A28 A;  2RN8 A;  2EGA A;  1VYV A;  5IH2 A;  1CKB A;  1GCQ A;  1YN8 A;  2CH4 A;  1PHT A;  1GFC A;  1G2B A;  1WDX A;  1QLY A;  3O5Z A;  1QKW A;  1HSQ A;  4E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...