4QT7A

Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'SHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structure of the c-Src-SH3 domain in complex with a proline-rich motif of NS5A protein from the hepatitis C virus.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase/transferase activator
total genus 13
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4qt7A00
4HVVA 3H41A 1SSHA 3REAB 1NLPC 2KNBB 2HEQA 1X69A 1LCKA 1RI9A 2RQUA 2JW4A 4J9DA 3RBBB 3VS0A 1AZEA 2FPFA 4AFSC 5FW9A 4WCIA 2KT1A 2DJQA 2CSIA 3M0RA 4EIKA 2J7IA 1UFFA 1MV3A 2KRNA 2L2PA 5HCKA 1B3QA 1I07A 4X1VA 2ROTA 1T3SA 3A98A 2EYYA 2GQIA 1MUZA 1S1NA 5FWCA 2K6DA 1CKBA 5L23A 2F2VA 2RQVA 4J9CA 1ARKA 3EG2A 4ESRA 2J05A 4RTYA 2ROLA 3VS1A 1UTIA 2M0YA 1W70A 3I9QA 1WXBA 1GCQC 4AG1C 3NMZC 1EFNA 4HCKA 2IIMA 2KXCA 4E6RA 2X3WD 4OMPA 4AFUC 1OV3A 3JV3A 1XOVA 1JO8A 5I22A 1I0CA 1NLOC 2K79A 3TVTA 3M0PA 1SHGA 4J9GA 5GJVB 2QDLA 1AOJA 1X2QA 2C0IA 3KFVA 2AKLA 1KFZA 1TUDA 3QWYA 4QT7A 2YUQA 1K1ZA 1SRMA 2KYBA 4HVUA 3M0UA 2GNCA 2EPDA 1IO6A 2SRCA 4JZ3A 1RUWA 4CC7A 2K7AA 1AWWA 3UATA 1JXMA 2EGAA 2SEMA 5IHKA 4RTZA 1HJDA 2A36A 4J9EA 1QKXA 1NM7A 1X2KA 3UA6A 1MV0B 2P4RA 1PKSA 1AVZC 2LZ6B 1I1JA 1A0NB 1JXOA 4LUEA 1RLPC 1WDXA 3LH5A 1JEGA 2EYZA 1VYUA 1Z9QA 2EVRA 3U23A 4IIMA 2KBTA 2CDTA 2DF6A 1ZBJA 1Y0MA 2KYMA 1AEYA 1BBZA 4GLMA 1ZUYA 4K11A 2CSQA 1WIEA 2K2MA 2AK5A 1GFCA 2OI3A 2GTJA 2RQWA 3NHNA 2DBKA 3M0TA 1CKAA 1WXTA 2W0ZA 1PRLC 1BU1A 1AD5A 2VVKA 3EGUA 3I35A 3M0SA 4AG2C 1Y57A 2LQWA 1HD3A 2L3PA 1UE9A 2ENMA 3EG1A 1GBQA 2KGTA 2FRYA 3IQLA 3H0FA 1WLPB 1UGVA 2NWMA 3UA7A 2DX1A 2W10A 1YNZA 2KXDA 2DL7A 4HXJA 4OMMA 2RQTA 1K9AA 2CH4A 2KT8A 2A08A 1SHFA 2DM1A 1WX6A 2LJ1A 2RQRA 2O31A 4JJBA 1QWEA 2DRMA 2O9VA 4ZNXA 1GCQA 2O9SA 1K76A 2DL4A 2ESWA 2J6OA 2L0AA 2CREA 1PWTA 3PVQA 1E7OA 1U5SA 2L3SA 2LMJA 2RMOA 2RPNA 1V1CA 2KROA 2RNAA 4LE9A 2O88A 2DL5A 2G6FX 1T0JA 2DILA 1UDLA 4LUDA 1AZGB 2DVJA 2CT4A 1B07A 4Z8AA 1WI7A 2JS2A 1ZSGA 1Z9ZA 1KIKA 2D1XA 3NGPA 2HSPA 1UECA 1U06A 1QKWA 2CH4W 2J06A 2VKNA 4JZ4A 1M3AA 2RF0A 2FO0A 2FG0A 3VRYA 3VS5A 2YDLA 4R0KA 2CT3A 1OOTA 1ZLMA 2EYXA 3SEMA 1PNJA 2AKKA 1YCSB 3RNJA 2JTEA 1SEMA 3SHWA 1OPKA 1RLQC 1ZX6A 2HDAA 2EBPA 1VYVA 2BZXA 1U3OA 1YP5A 2DNUA 1GL5A 2BTTA 3PE0A 4KRTA 4OMNA 1ZUKA 4RTWA 1VYTA 3VS3A 1AWOA 2GBQA 2EKHA 4OMQA 1OEBA 1X6GA 2LP5A 2DL8A 4HVWA 2JMCA 1BB9A 1W1FA 1M8MA 1X27A 3O5ZA 4F14A 4J9FA 4J9IA 1OPLA 2KRSA 3PVLA 2JM9A 2DE0X 1M27C 3GBQA 3ZL7C 4AFZC 1G83A 3VRZA 3VS7A 2I0NA 4JJDA 3TSZA 2A37A 1WA7A 2ED1A 1SRLA 3VS6A 3M0QA 4IIOA 1NYFA 1WXUA 2YUNA 2D8JA 1W6XA 2O2OA 3ULRB 4OMLA 1PKTA 2KRMA 2PTKA 5I11A 2FPEA 1GRIA 2GTOA 5IHNA 1NYGA 2V1QA 4ORZA 3QWXX 1JU5C 1KJWA 4D8DA 1FMKA 1BK2A 2K3BA 1UHCA 3UF4A 2LQNA 3I5RA 2DLPA 3EHQA 4RTXA 4GBQA 4CC4B 2EW3A 1M30A 4J9HA 3NPFA 2CUDA 2EQIA 2H8HA 3EHRA 4JJCA 1UG1A 1ABOA 4Y92A 2FRWA 1NEBA 2RN8A 4F16A 3EG0A 2J6KA 1WFWA 5IXFA 1NEGA 2DRKA 1CSKA 1TUCA 1QLYA 2K9GA 4Z88A 2DYBA 3VS4A 1PRMC 2OAWA 5IH2A 3REBB 1T0HA 2YT6A 2JT4A 2J6FA 1UUEA 2LNHB 2BZYA 2PZ1A 1G2BA 2DBMA 5FWBA 2JS0A 2VWFA 4DEYA 2MCNA 2EYWA 2D8HA 3EG3A 2B86A 5EC7A 1TG0A 1HSQA 4OMOA 2FEIA 1K0XA 5IHIA 4FSSA 1YWPA 1E6HA 2XMFA 1H92A 1X6BA 1M3BA 2HCKA 2X3XD 2EGCA 2HBWA 1KSWA 1NG2A 4D8KA 1UHFA 2YUPA 1N5ZA 2F2WA 1AWJA 4M4ZA 2ECZA 4AFQC 1YN8A 2BZ8A 1E6GA 4RTVA 4JPBW 2F2XA 1K0SA 2LJ3A 3THKA 1QCFA 3TSWA 2GGRA 1H8KA 2L3QA 1PHTA 2OJ2A 4J9BA 2YUOA 2DL3A 2MOXA 1GCPA 2DMOA 3I5SA 1SPKA 2C0OA 3H0IA 2A28A 1YWOA 4CC3A 2E5KA 2PNIA 1FYNA 3C0CA 1JQQA 3H0HA 4RTTA 4F17A 4LNPA 1H3HA 1T3LA 2AZVA 2JMAA 1ZUUA 5GJWB 2KEAA 2M51A 2NUZA 3CQTA 2LCSA 1WYXA 2LJ0A 2KE9A 2C0TA 4RTUA 2LX7A 4DEXA 1VA7A 1M3CA 2ABLA 2EGEA 1UJ0A 4A63B 2JM8A 1ABQA 1UJYA 4RUGA 2JXBA 1QWFA 2AZSA 1GBRA 1GFDA 1J3TA 5ECAA 3R6NA 1AWXA 2KR3A 3FJ5A 1K4US 4Z89A 2MIOA 5IXBA 2V1RA 3VS2A 4CC2A 2D0NA 4LN2A 2ED0A 1X43A 2DA9A 2FPDA 2YSQA 2CUBA
chains in the Genus database with same CATH superfamily
4QVZA 3RMQA 3H41A 1NLPC 2L5QA 2KNBB 2HEQA 5CKBA 3CMEA 1LCKA 2JJ9A 3EG9A 3AT1B 2XU8A 3E2UA 3VS0A 1AZEA 2FPFA 5EG2A 5LJ3g 3TEEA 3G6ET 4WCIA 2DTOA 1OU8A 2X4YA 2J7IA 4II1A 2BUDA 1MV3A 2L2PA 3I56T 4X1VA 3PIOA 2AHJB 3OYDA 1WJSA 3H8ZA 3CD6T 5L23A 2F2VA 2RQVA 4ESRA 2J05A 4XU2A 3CMAT 3L1AA 2E70A 3VS1A 1QP3A 4J5YA 3I9QA 2X35A 3NMZC 1JB0E 2OTLQ 3WVDB 3OYFA 2LRQA 1H641 2DD4A 1VQ5A 4JJNK 1VQKQ 1VQLQ 3DB4A 2KXCA 4E6RA 3OYEA 2NLUA 4JDSA 3MHXA 4OMPA 3BW1A 4X9CA 1MMNA 1OV3A 2RA2A 2XKOC 4GY5A 4LD6A 3CCLT 5I22A 1M2VB 1NLOC 3RIRA 3QBYA 2EQUA 4J9GA 2RJCA 1QVGP 5CKDA 2DJZA 2DTHA 1X2QA 2AKLA 3JCMd 3S3OA 4HVUA 2DIQA 1BI2A 2SRCA 2CZ7B 1VQOQ 2RHZA 2OTJT 4XK8E 1JJ2S 4RMOA 4RG8A 1NPPA 1KC8C 4XAXB 3T9NA 2LX9A 2CP6A 2AT1B 2HQHA 2M1HA 2P4RA 5GMKe 3L2WA 1A0NB 1JXOA 1WQ7A 2DZ9A 4LUEA 4XU1A 1WDXA 1EIFA 3LH5A 1MHNA 2A7YA 1Z9QA 2EVRA 4E7IA 4ANJA 2M0OA 4IIMA 1ZBJA 3Q1JA 3CPFA 4ZN1A 3CCRA 2VASA 1WIEA 4M78F 3CC7T 4JRPA 1YIJT 3NHNA 3G1JA 3CCMA 1TXQA 1M1KC 3JCMf 1VQ8Q 3G71T 1RAEB 4J6WA 1KQSA 3I35A 2VVKA 3EGUA 4FIBA 2ENMA 4C8QB 4N0AC 1R0BG 2D6FA 1VUBA 1D1CA 3V8LA 1WLPB 1SSFA 1UGVA 4XTWA 5D6WA 1Y96B 2E5QA 1X6OA 4M78C 3OYIA 2KI7A 1NJIU 1K9AA 2KT8A 2E41A 4IUQA 3QO3A 2EKOA 4EMGA 3QJYA 2RQRA 1K73U 1BKBA 1KK7A 1I5LA 3MPUB 2O9VA 4ZNXA 1VQ7A 3JSCA 1YBYA 3LWIA 2ESWA 3CPWS 4LD9K 3JCMh 5LJ3j 2LMJA 1YI2A 3P8DA 4A4EA 1PM3A 3CBPA 2RMOA 4C5GA 3QZ5B 1HK9A 2DL5A 3BY7A 4KGZB 1NE8A 1AZGB 2CT4A 5D6YA 1B07A 4Z8AA 4WTOB 2VUBA 3CCVQ 3MP1A 2J06A 2VKNA 1M3AA 2FO0A 2E3IA 2KQWA 1Q95G 1C1AA 4DBHA 1S72Q 1OOTA 3QZ9B 1AHJB 3OBYA 2AKKA 1GXIE 2MWPA 3RNJA 2JTEA 3EAEA 4XTUA 1ZX6A 4M75A 4XU3A 2EBPA 4OGCA 2BTTA 4EMKC 1D0YA 1PD0A 3PE0A 4M7AA 2YLCA 4C5EA 1VYTA 3QPHA 4HT9A 3CCUT 3V7RA 4PFOA 1BIAA 4JRKA 3G6EQ 4J9IA 1OPLA 2CZ6B 4C5IA 1ZQ1A 1KHCA 2QGGA 3PMTA 3I56Q 5LJ5d 4ZGDB 1VQMT 1M27C 1G83A 2I0NA 2QI2A 4R56A 5FU7B 5LL6S 2E12A 1ZSZA 1OU9A 2YUNA 2K57A 3HSBA 5KYWB 1PKTA 2KRMA 5IT9E 1GRIA 5IHNA 2EFIA 1QVGA 1OZ2A 3QWXX 4ORZA 4C0DB 3CCST 2GCXA 1BK2A 3HRUA 5GAOl 3LW5E 4RTXA 5CVIA 4GBQA 4OB1B 3CCLQ 4HKEA 4MDWA 4QQGA 4F7UA 1NZ9A 2DEQA 3NPFA 2CUDA 2EQIA 2H8HA 3EHRA 5GMKh 2RJFA 1N8RU 5GANd 4PJOB 5LJ5f 3OSSC 2RN8A 1RABB 1VQ4A 3EG0A 3E1SA 2EJFA 1NEGA 3NTIA 2DRKA 1CSKA 4HCZA 3FJPA 2OTJQ 3CCET 2DYBA 2K5IA 4XU0A 3KUFA 4KT0E 2DETA 2DEUA 1U1TA 2YT6A 3CC2T 5M9OA 8AT1B 3GOXA 1WHKA 3EGDB 5GAMg 4OF1A 1M5Q1 3TU4K 2YLBA 1YJ9T 2EYWA 4N4IA 3VYGA 3CC7Q 2IPOB 2CP2A 3ZFJA 5GANf 3JCMW 3S6WA 2COZA 4C92A 3PFSA 3G71Q 3FC3A 2EGCA 3GPLA 1OZ3A 4D8KA 1R8OB 4QQDA 4M75G 2FZGB 1XQHA 2COWA 4M4ZA 2ECZA 2E65A 1E6GA 5GAN3 4M7AG 2F2XA 3R6OA 2XD0A 2HZYA 2LJ3A 2ZPGB 3M54A 4A4FA 2LTOA 4ELZC 1H8KA 1RAAB 2HKQB 3SD4A 1PHTA 2OJ2A 2D0QB 2YUOA 1Q7YR 5GAOp 2KDSA 2DL3A 4E2FB 1GCPA 2DMOA 3I5SA 2C0OA 2A28A 2RHUA 2DXUA 4CC3A 3NTKA 8ATCB 3D7SB 3C0CA 3CBOA 3JAME 1K8AC 1G3TA 3OB9A 3LX7A 4LNPA 5J39A 1D3BB 4XTYA 5DM7R 1G8XA 1VQKT 1BCOA 4Z02A 2M51A 4KULA 2LJ0A 1MNDA 4DEXA 3CXCS 3V8KA 1X01A 1OI1A 1M90R 2IVWA 2MAMA 1Y7XA 3G4SA 2M9UA 5A0GA 2PUKB 2FYKA 1GFDA 1J3TA 3R6NA 1VQNQ 5FU6C 4Z89A 1WJRA 5CKFA 1I81A 4BB7A 2RO0A 4JUVA 2V1RA 3OYBA 4CC2A 4F7UG 3GNFB 1ZBXA 2XK0A 4RCCA 1WZOA 1VQOT 2FPDA 3HKSA 2YSQA 2CUBA 3MO8A 4BE2A 3REAB 3H6ZA 5GAN5 3X24B 1RI9A 4L5GA 4X34A 1BI0A 2RQUA 4BE1A 2RK1A 1W2BP 2EQJA 5LJ3e 5LJ5j 4AFSC 2H3EB 2DJQA 3M0RA 2F5TX 2PVGB 3I55Q 1VOMA 4CRIA 2VXEA 5HCKA 3CCUQ 3CCJA 1OYXA 1B3QA 1M2VA 1I07A 1OULA 4A53A 4ATOA 3URGA 2QDYB 5FRMA 3A98A 4IUUA 4OVAA 1QQJA 4JRIA 4D6WA 2GQIA 1MUZA 1G3WA 5KH6A 3AHUA 2QEXT 3OW2S 1JJ2P 4RTYA 2EWNA 2ROLA 3QYHB 1Q82R 1VQMQ 2XIDA 1W70A 1TUGB 4M7DB 2KY9A 4BD3A 1WXBA 1N9SA 4ZN3A 4C92G 5GAMj 1EFNA 4HA8A 3RKXA 3RKWA 4B9XA 5GANj 1XOVA 1JO8A 1I0CA 4MZTA 4E7LA 3QDRB 5GJVB 5CKHA 2C0IA 2CS7A 3CCSQ 2Y4XA 4PLLA 1TUDA 4QT7A 4A4HA 2EPDA 1IO6A 4CC7A 4BDYA 3UATA 2GQVA 3X25B 4X9DA 2V8JA 2SEMA 3EH2A 5IHKA 4RTZA 5KCOA 1YCYA 2FVUA 3C4SA 1Y71A 1X2KA 1VQ7Q 2K3XA 3GNGA 4C8QA 2BE9B 3MCAB 1N8RR 2LZ6B 1I1JA 5C6SA 3QKJA 1YJWA 3CCVT 3OYGA 2HAXA 3U23A 2KBTA 3JCMe 1Y96A 2DF6A 2E3HA 5LJ3d 1AEYA 1BBZA 2ZGWA 3CC4A 4M77A 1M1FA 3JCMJ 4RG2A 2DBKA 3OYMA 1YJ9Q 3CPWP 4J6YA 1VQ9A 1PRLC 1KG1A 4XTXA 2QYZA 3M0SA 1AD5A 4AG2C 1Y57A 1HD3A 3LH0A 2RI2A 4QKUA 4M77D 1GBQA 1R77A 4FT4A 4QVCA 3BDLA 1QCOA 2DX1A 3QHSA 2W10A 5CQXA 1WHGA 1YNZA 4FYWB 2DL7A 1TWBA 2CH4A 3A8GB 1SHFA 2NUTB 1RADB 3LLRA 1B34B 2DM1A 5LJ3f 2D9TA 5CK9A 1GCQA 1NPRA 2DL4A 3L2RA 2O01E 1PWTA 3PVQA 2HD0A 3OBWA 3EGXB 1YHQA 3M59A 1M2OA 2XDBA 2JTMA 4PJLA 2K5FA 2RPNA 2RNAA 4OGEA 4LE9A 2ZPFB 3OYLA 1XTDA 1UDLA 2DVJA 3GIBA 5KE3A 1V76A 2D1XA 3NGPA 4HT8A 2V26A 4JZ4A 3X28B 3VRYA 5KCHA 4MMKA 1QVFS 3CCQA 2YDLA 4DBQA 2MMPA 3NFCA 4O5VA 3OYNA 4E7ZA 2RK2A 4BI3A 4OB0B 4DA4A 1ZLMA 5LJ3h 2C06A 2RJEA 1V29B 3GP8A 2HNIA 5A0DA 4RKUE 3CEYA 3SHWA 1W2BA 2X51A 3L2QA 2JVVA 1VYVA 2BZXA 2COYA 4ZTFA 1GL5A 1NBEB 1K9MU 1ZUKA 4RTWA 3VJPA 1YITA 4OMQA 2LP5A 5KYWA 4C8QG 4HVWA 2RI3A 2JMCA 2X4XA 4VUBA 4N4GA 1MNEA 1F1BB 4PJMA 1X27A 3VUBA 3O5ZA 4J9FA 1VQ6A 3MEWA 1M1KR 2KRSA 2GFAA 2QXFA 3PVLA 1JJ2A 2JN0A 1MMAA 3MKDA 5CKEA 1KD1C 4M77G 4BUGA 3ZL7C 5KYXB 3VRZA 4FT2A 3VS7A 3J81E 4PJOA 3TSZA 4DBFA 4M77F 1WA7A 2E10A 2P4TA 2QEXQ 1QVPA 2D8JA 2O2OA 1C0MA 4ELYC 1IHWA 4BE0A 1IZ6A 3TQ7P 2FPEA 2DXTA 1Q7YU 1NYGA 1RL2A 3CMET 3FB9A 4D8DA 1FMKA 3HP9A 2LQNA 3EFRA 2ZPEB 3FEOA 3EGDA 5LJ5e 1QP2A 3RMSA 2EW3A 3UWNA 2VXFA 2QA4A 4FYXB 4JJCA 3P8BB 4XTVA 4IKFA 4Y92A 1NEBA 2R58A 4F16A 5CO7A 3M9QA 2O4XB 2J6KA 5IXFA 3EH1A 2V8KA 3SWNC 2HBPA 3MEVA 4M78B 1M90U 3V8JA 3VS4A 1ZHIA 2OAWA 4ZGEB 6AT1B 7AT1B 1IRXA 1T0HA 1EX4A 2CP3A 2LNHB 5GAMe 4A4GA 1VQ5T 2P0QA 1G2BA 2DBMA 4FYVB 1VQNT 3VUZA 3CPWA 4DEYA 1VQPA 1OX9A 1Q86U 2GFUA 5AT1B 2D8HA 3EG3A 5GANe 1TG0A 3G4SQ 3OYKA 5KYYB 1IXDA 3CC2A 2XMFA 2RHXA 3VU3C 4FCYA 2CP7A 2HCKA 2X3XD 3N5BB 1PC0A 1KSWA 4DBRA 5GMKm 1D3BA 3QSUA 1AWJA 2LDMA 2MYSA 4JRQA 3CXCP 1YJNA 2DXCA 1K0SA 3THKA 4LDWA 4CI0C 3I55T 4BI4A 2GGRA 3GLXA 2L3QA 4IUTA 1ZA1B 3JCMQ 2Y4YA 2YRDA 3INZA 3LGFA 3OS1A 3DKMA 4M75D 3RUXA 1Q82U 4EMKB 1SPKA 4M7AD 2DTIA 2EJGA 3H0IA 4FSXA 3LGLA 4PNOA 3CCRT 3OY9A 4OP0A 1XNIA 3H0HA 2MF2A 3M5AA 4PJOG 3CCMT 1BCMA 2JMAA 2DYIA 4C0ZA 3BFMA 1WYXA 5DLOA 4TVRA 3L2VA 3A8MB 2LX7A 3OSVA 1VA7A 2EGEA 4A63B 4J8OA 1ABQA 3HTRA 2CKKA 1QWFA 2AZSA 1GBRA 2EIFA 3J80E 2L3RA 2KR3A 2OTLA 2BKDN 1SF9A 1WHLA 1VQLA 3E9GA 1OQKA 5IXBA 2R5MA 3HFNA 5GAMd 1X43A 2KVQG 4F7UE 1Q81C 3OW2P 1RAHB 4EMHA 4HVVA 5DY9A 1SSHA 3TCJA 1VQ7T 1FMVA 1X69A 5CQYA 4M7DA 2RD1A 2X4WA 4J9DA 2A0FB 2GF7A 2CP0A 1YI2T 1QCNA 1BIBA 2KT1A 3JB9D 1VQOA 4EIKA 1UFFA 2ZPBB 2JOYA 2KRNA 3F70A 1K9MR 2ROTA 1T3SA 2XHCA 3X26B 1YJWQ 1S1NA 4AMCA 2K6DA 4J9CA 1ARKA 1SKUB 3EFSA 2MPXC 4QQ6A 3TREA 5GAMf 3CC4Q 3QIIA 5LJ5h 4FYYB 1KQ1A 2X3WD 1HYOA 1VQ8A 3HPWA 2K79A 3TVTA 4M75F 4QVDA 1SHGA 2XG8D 5GAN4 4NOYA 3CMEQ 2QASA 2QDLA 3KFVA 4C92D 1QW1A 4M7AF 3QWYA 1SRMA 2KYBA 1R0CB 1C6VX 2HQEA 4FW1A 1K8AR 2L8DA 4JZ3A 1RUWA 1AWWA 3RESA 2QAZA 1G3YA 2EGAA 2WSFE 2QQRA 2A36A 5GAMh 1QKXA 2YRCA 1PKSA 1AVZC 2JUFA 2HSEB 5GANh 4M75C 2IG0A 3LWHA 2VGMA 3HRSA 1VYUA 4M7AC 1KC8U 3JB9J 1D09B 3C95A 4GLMA 2LNVA 1ZUYA 4K11A 2WSEE 2NUTA 1GFCA 2YHTA 1VQ5Q 1B34A 2GTJA 3VKIA 3ER0A 1CKAA 3CBMA 5HKCA 4JS5A 3RERA 2WACA 2W0ZA 4KH1B 3CCVA 1BU1A 2LQWA 4AT1B 1NJIC 3JB9G 3CXCA 2L3PA 1Q86R 4E7JA 3EGXA 2P0PA 1KD1U 3EG1A 4FL6A 4F7UF 1K73C 5FU6B 3QDFA 5J3BA 2ZPIB 1S72A 2XDDA 3JB9F 4M7DG 1M1KU 1ZSZC 2KK4A 3GF5A 2KXDA 1IGQA 4OMMA 3UT1A 2A08A 4J7FA 3JRZA 1D1AA 5A0LA 2DXBA 1QVFP 1N27A 3OYAA 4JJBA 1QWEA 2O9SA 1K76A 2J6OA 2KMTA 2CREA 4EPCA 1G5VA 4Y91A 1LPLA 1U5SA 3ZBDA 3G6EA 2WSCE 4PL6A 2M02A 2MI6A 5I2MA 3CCRQ 4KBMB 2KROA 3M55A 4A54A 5GAN6 1D0ZA 4P5NA 2QTVA 3I56A 2G6FX 1T0JA 4BI8B 3CCMQ 4LUDA 2P0KA 1WI7A 1ZSGA 3CD6A 1Z9ZA 1KIKA 2HSPA 1UECA 1U06A 1QKWA 2CH4W 4C92F 3CMAA 2FG0A 2KAFA 3ZEHA 4ZGJB 1TOVA 3OW2A 3VS5A 5KYNA 4R0KA 1X75C 2CT3A 3E19A 1PNJA 1D0XA 1VIEA 1WJQA 2LQ8A 3WXMB 2K5LA 1SEMA 5KYXA 2AIRB 2VB6A 1RLQC 4PLIA 2HDAA 1FWZA 4OMFB 1YP5A 3JCMc 3CCLA 2F5KA 2LVMA 3VS3A 1UEBA 4A4KA 1RI0A 2LCLA 3WVEB 1I5OB 2RJDA 4PFZA 1JBMA 4C92C 2DAQA 4C8QE 4KGXB 4BY6C 1VIFA 4KUIA 1BB9A 1YI2Q 1M8MA 2OTJA 3G4ST 3QYGB 2JM9A 3GBQA 4M77E 4N0AA 4Q5WA 3UDCA 4C8QD 1MGQA 1PSFA 1TU0B 1U8RA 4JJDA 1BI3A 3OS5A 2ED1A 3M58A 2O4XA 3JB9I 4PKCC 4IIOA 1NYFA 1WXUA 1W6XA 5GAOq 4M78A 4LDYA 1UGRB 2FHDA 3DLMA 4EDUA 2RB6A 1N8RC 3CC7A 2V1QA 2ZPHB 3EFOB 1JU5C 1YIJA 3DB3A 1RAGB 4E7KA 2K3BA 2QTXA 3OYJA 3G71A 3L2UA 4CC4B 4PK4A 2HMAA 4FW2A 1P92A 1M30A 3P8HA 4J9HA 4BDZA 2KSSA 4B9WA 4O6JA 1WHHA 5KYUB 1BI1A 3CCJT 1UG1A 1ABOA 2FRWA 1XJWB 9ATCB 1TH7A 4OB3B 5KYYA 3PT9A 1WFWA 4KH0B 2VC8A 3OYHA 3HL8A 2PQWA 3OS0A 2NUPB 1PRMC 1Q81U 3OS2A 4ZTJA 3UPUA 3A8HB 2J6FA 3V7SA 2BZYA 3JCMV 3MEUA 2PVDB 4HCCA 2PZ1A 2F1LA 2XI9A 2JS0A 2VWFA 2MCNA 2QQAA 4F04B 2B86A 1PG5B 5EC7A 1HSQA 4OMOA 2FEIA 4EMKA 1K0XA 5IHIA 4HCBA 4FSSA 1YWPA 4JLGA 2FB7A 2K2VA 1KC8R 1E6HA 4PJNA 3SDZA 2HBWA 1W2BS 1NG2A 2DPPB 1VQNA 2YUPA 2YXYA 1N5ZA 2CZ1B 2F2WA 2CGHA 2QQ9A 3QXEB 1YN8A 4AFQC 5FLXE 1TTHB 2DIGA 4JPBW 1N6AA 5HY6A 4UC4A 1QVFA 2XICA 4J83A 1VQ4Q 1LOJA 3C94A 2FZCB 1KD1R 1TSFA 4J9BA 5GAOr 5IN1A 1YJWT 2F69A 4OB2B 4C8QF 1DJ7B 1ZA2B 1YFNA 1YWOA 3PMIA 1UB4A 2PNIA 2QGFB 3I55A 3CC4T 3OYYA 4IURA 1JQQA 4L6V5 4RTTA 4F17A 3CCUA 1T3LA 4PJOE 3KBGA 5GJWB 2KEAA 1KQSS 1VQ9T 3CQTA 1PD1A 1FX7A 2KE9A 4M78G 3PTAA 2QG9B 4Y28E 5HK3A 3JCMg 1K8AU 4RUGA 1VQMA 3QUIA 4C8QC 2E64A 4PJOD 5GAOn 3FJ5A 3JCMX 4FM4B 2EJ9A 2RHIA 4NL3A 4IUVA 2CYZB 3VS2A 5CR2A 2BIVA 2Y90A 5A2QE 2R5AA 2H3JA 1W4SA 5CIUA 4M77C 2RI5A 4E7SA 3NTHA 4B6MA 1UGSB 3CCSA 2JW4A 2EQMA 3RBBB 1MMGA 1HXDA 3O8VA 2DO3A 1YHQT 3E9FA 5FW9A 2CSIA 1MMDA 1D1BA 4M77B 5GAN7 2FL7A 3SWNB 2EYYA 1LVKA 5FWCA 3VV0A 4MMLA 1CKBA 2OAUA 2P84A 3EG2A 3PGGA 3CCEA 4XTZA 5D6XA 3A8OB 3MEAA 4KGVB 3X20B 4J6XA 3CCQT 4JS4A 3G7ZA 1RAIB 1UTIA 2M0YA 3HRTA 3EG9B 4DQ2A 5GMKi 1GCQC 4AG1C 4HCKA 5AYFA 5L8RE 2IIMA 5I21A 1YJ9A 3META 4M75E 4E7HA 2JZ2A 4AFUC 3JV3A 2DERA 4ME7A 4J7IA 1H3ZA 3L2ZA 4M7AE 1M1GA 2V8IA 3M0PA 2EQKA 2CP5A 1YITT 1AOJA 1IREB 1KFZA 5KE2A 2YUQA 1K1ZA 3M0UA 2GNCA 2K7AA 3MP6A 1JXMA 4NL2A 3QG1A 1SG5A 5DLQE 1VQ6T 3J7AF 1HJDA 2DVEA 4R55A 4J9EA 3CCJQ 4L59A 1NM7A 3UA6A 5GMKl 1MV0B 2HL5C 4RCBA 3JCMP 2YRVA 3M53A 1PCXA 5FU7C 1RLPC 2ZZDA 1JEGA 2EYZA 4PJOF 2EYQA 1IHVA 2QQSA 5GAOm 2DFUA 2CDTA 3M4YA 1Y0MA 2KYMA 2K3YA 1QVGS 5CCAA 2RM4A 1Q81R 1WHJA 2CSQA 3KXTA 2K2MA 2AK5A 2OI3A 4XQ3A 2R57A 2RQWA 3M0TA 3CD6Q 4FU6A 4C0DC 1WXTA 1VQKA 1UGPB 4KUDK 3CMAQ 2LT4A 4DOVA 2NYSA 4C0GA 3FIFA 4PFPA 2QA4T 1UE9A 2E4HA 4LXCA 2RH2A 4MZPA 5C0MA 3OQ5A 4PJOC 2KGTA 2FRYA 4M7DE 3IQLA 3H0FA 2NWMA 3HFOA 3UA7A 4HXJA 2RQTA 2JNGA 2XDPA 5LJ5g 2MK5A 2B8AA 2VYTA 2QK0A 2E1HA 4MDXA 1WX6A 2LJ1A 2Z0WA 2O31A 1RAFB 2DRMA 4M7DD 2DK3A 2L0AA 1FXXA 2ZAEA 1VQPT 1E7OA 2L3SA 1WHMA 2A3LA 1V1CA 3BE3A 2O88A 3QJ6A 2DILA 2MWOA 2QQBA 4LDVA 4C92E 1VQ9Q 3OMGA 2JS2A 2QEXA 2RF0A 1FMWA 1YJNT 5GANg 1K9MC 1QMCA 3VYHB 3HHTB 1U1SA 2LC4A 1KHIA 1BYMA 2EYXA 1I8FA 1YIJQ 3V7CA 3SEMA 3PNWC 1YCSB 2X4JA 2E6NA 1OPKA 4JLIA 2CZ0B 4N4HA 2DNUA 1U3OA 2PUOB 4KRTA 4OMNA 1AWOA 2GBQA 1RACB 1ACMB 2EKHA 1OEBA 1X6GA 2X9HA 2DL8A 3OA6A 2LCCA 5GAN8 3EFOA 1EZZB 1W1FA 3L42A 3FLGA 1YHQQ 2LT1A 4F14A 1LJOA 1WPYA 1JRIA 3A1PA 2DZCA 3BDUA 1NJIR 2DE0X 3A8LB 4AFZC 3RR6A 1Q7YC 2RHYA 2DKGA 2HKNA 5KYUA 3M56A 4M75B 2OTLT 5GMKj 5HK0A 4MZMA 1K73R 1VQLT 1TS9A 2A37A 1SRLA 3VS6A 4M7AB 3M0QA 5I2SA 2E6ZA 3OMCA 3ULRB 3CCQQ 4OMLA 1O9SA 2NUPA 3OYCA 2PTKA 3S3MA 5I11A 2GTOA 1KQ2A 4YTLA 3RDVA 1KJWA 1VQ4T 3ME9A 1M8VA 4WF2A 1OX8A 1UHCA 3UF4A 2EAYA 3I5RA 2DLPA 3EHQA 1M90C 4M7DF 3PIPA 4C0FA 2LQKA 1YITQ 2I2LA 1N9RA 4C5HA 1ZSZB 3JCMb 2OX7A 1VQ6Q 1TUCA 1G3SA 1QLYA 1Q86C 2K9GA 4Z88A 1M4ZA 3ASKA 1M9SA 5IH2A 3REBB 3MP8A 2YWWA 3JB9H 2JT4A 5FROA 1UUEA 2L89A 2JTFA 4M7DC 2M16A 3DLLA 1AT1B 4F7UB 4BACA 5FWBA 1VQ8T 3SFMA 1B7TA 2PVOB 1PSEA 5FRNA 2VGNA 1H92A 3H9NA 1X6BA 1M3BA 3M4GA 4PJJA 1UHFA 1KQSP 3FDRA 4NS5A 3S3NA 2BE7D 1Q82C 1O75A 2BZ8A 1IGUA 4RTVA 2QA4Q 1Y07A 3RKYA 2ZCFB 3A5ZB 1QCFA 3TSWA 2FZKB 3LYIA 5GAN2 2ATCB 3C12A 2MOXA 1I4K1 1WNLA 1IB8A 4DOWA 4E47A 3SB2A 2E5KA 5J26A 5IAYA 1UGQB 1FYNA 4C92B 4V2SA 4BY6B 1WGSA 4LDXA 1H3HA 2AZVA 1ZUUA 1VQPQ 3CCEQ 2NUZA 3M57A 2K4YA 1WQWA 4LDUA 2LCSA 2C0TA 4RTUA 2PU9B 4M78E 3FRNA 1M3CA 2ABLA 1UJ0A 2JM8A 2HQXA 3CC2Q 2G3RA 1UJYA 1LNXA 2HL3A 2JXBA 4QW2A 3MJXA 4GLKA 1S72T 2DD5A 5ECAA 1AWXA 4IUPA 5D7UA 1K4US 2MIOA 3SWNA 5CAIA 4M78D 2D0NA 2ED0A 4LN2A 1YJNQ 2VV5A 2DA9A
chains in the Genus database with same CATH topology
4HVVA 3H41A 1SSHA 3REAB 1NLPC 2KNBB 2HEQA 1X69A 1LCKA 1RI9A 2RQUA 2JW4A 4J9DA 3RBBB 3VS0A 1AZEA 2FPFA 4AFSC 5FW9A 4WCIA 2KT1A 2DJQA 2CSIA 3M0RA 4EIKA 2J7IA 1UFFA 1MV3A 2KRNA 2L2PA 5HCKA 1B3QA 1I07A 4X1VA 2ROTA 1T3SA 3A98A 2EYYA 2GQIA 1MUZA 1S1NA 5FWCA 2K6DA 1CKBA 5L23A 2F2VA 2RQVA 4J9CA 1ARKA 3EG2A 4ESRA 2J05A 4RTYA 2ROLA 3VS1A 1UTIA 2M0YA 1W70A 3I9QA 1WXBA 1GCQC 4AG1C 3NMZC 1EFNA 4HCKA 2IIMA 2KXCA 4E6RA 2X3WD 4OMPA 4AFUC 1OV3A 3JV3A 1XOVA 1JO8A 5I22A 1I0CA 1NLOC 2K79A 3TVTA 3M0PA 1SHGA 4J9GA 5GJVB 2QDLA 1AOJA 1X2QA 2C0IA 3KFVA 2AKLA 1KFZA 1TUDA 3QWYA 4QT7A 2YUQA 1K1ZA 1SRMA 2KYBA 4HVUA 3M0UA 2GNCA 2EPDA 1IO6A 2SRCA 4JZ3A 1RUWA 4CC7A 2K7AA 1AWWA 3UATA 1JXMA 2EGAA 2SEMA 5IHKA 4RTZA 1HJDA 2A36A 4J9EA 1QKXA 1NM7A 1X2KA 3UA6A 1MV0B 2P4RA 1PKSA 1AVZC 2LZ6B 1I1JA 1A0NB 1JXOA 4LUEA 1RLPC 1WDXA 3LH5A 1JEGA 2EYZA 1VYUA 1Z9QA 2EVRA 3U23A 4IIMA 2KBTA 2CDTA 2DF6A 1ZBJA 1Y0MA 2KYMA 1AEYA 1BBZA 4GLMA 1ZUYA 4K11A 2CSQA 1WIEA 2K2MA 2AK5A 1GFCA 2OI3A 2GTJA 2RQWA 3NHNA 2DBKA 3M0TA 1CKAA 1WXTA 2W0ZA 1PRLC 1BU1A 1AD5A 2VVKA 3EGUA 3I35A 3M0SA 4AG2C 1Y57A 2LQWA 1HD3A 2L3PA 1UE9A 2ENMA 3EG1A 1GBQA 2KGTA 2FRYA 3IQLA 3H0FA 1WLPB 1UGVA 2NWMA 3UA7A 2DX1A 2W10A 1YNZA 2KXDA 2DL7A 4HXJA 4OMMA 2RQTA 1K9AA 2CH4A 2KT8A 2A08A 1SHFA 2DM1A 1WX6A 2LJ1A 2RQRA 2O31A 4JJBA 1QWEA 2DRMA 2O9VA 4ZNXA 1GCQA 2O9SA 1K76A 2DL4A 2ESWA 2J6OA 2L0AA 2CREA 1PWTA 3PVQA 1E7OA 1U5SA 2L3SA 2LMJA 2RMOA 2RPNA 1V1CA 2KROA 2RNAA 4LE9A 2O88A 2DL5A 2G6FX 1T0JA 2DILA 1UDLA 4LUDA 1AZGB 2DVJA 2CT4A 1B07A 4Z8AA 1WI7A 2JS2A 1ZSGA 1Z9ZA 1KIKA 2D1XA 3NGPA 2HSPA 1UECA 1U06A 1QKWA 2CH4W 2J06A 2VKNA 4JZ4A 1M3AA 2RF0A 2FO0A 2FG0A 3VRYA 3VS5A 2YDLA 4R0KA 2CT3A 1OOTA 1ZLMA 2EYXA 3SEMA 1PNJA 2AKKA 1YCSB 3RNJA 2JTEA 1SEMA 3SHWA 1OPKA 1RLQC 1ZX6A 2HDAA 2EBPA 1VYVA 2BZXA 1U3OA 1YP5A 2DNUA 1GL5A 2BTTA 3PE0A 4KRTA 4OMNA 1ZUKA 4RTWA 1VYTA 3VS3A 1AWOA 2GBQA 2EKHA 4OMQA 1OEBA 1X6GA 2LP5A 2DL8A 4HVWA 2JMCA 1BB9A 1W1FA 1M8MA 1X27A 3O5ZA 4F14A 4J9FA 4J9IA 1OPLA 2KRSA 3PVLA 2JM9A 2DE0X 1M27C 3GBQA 3ZL7C 4AFZC 1G83A 3VRZA 3VS7A 2I0NA 4JJDA 3TSZA 2A37A 1WA7A 2ED1A 1SRLA 3VS6A 3M0QA 4IIOA 1NYFA 1WXUA 2YUNA 2D8JA 1W6XA 2O2OA 3ULRB 4OMLA 1PKTA 2KRMA 2PTKA 5I11A 2FPEA 1GRIA 2GTOA 5IHNA 1NYGA 2V1QA 4ORZA 3QWXX 1JU5C 1KJWA 4D8DA 1FMKA 1BK2A 2K3BA 1UHCA 3UF4A 2LQNA 3I5RA 2DLPA 3EHQA 4RTXA 4GBQA 4CC4B 2EW3A 1M30A 4J9HA 3NPFA 2CUDA 2EQIA 2H8HA 3EHRA 4JJCA 1UG1A 1ABOA 4Y92A 2FRWA 1NEBA 2RN8A 4F16A 3EG0A 2J6KA 1WFWA 5IXFA 1NEGA 2DRKA 1CSKA 1TUCA 1QLYA 2K9GA 4Z88A 2DYBA 3VS4A 1PRMC 2OAWA 5IH2A 3REBB 1T0HA 2YT6A 2JT4A 2J6FA 1UUEA 2LNHB 2BZYA 2PZ1A 1G2BA 2DBMA 5FWBA 2JS0A 2VWFA 4DEYA 2MCNA 2EYWA 2D8HA 3EG3A 2B86A 5EC7A 1TG0A 1HSQA 4OMOA 2FEIA 1K0XA 5IHIA 4FSSA 1YWPA 1E6HA 2XMFA 1H92A 1X6BA 1M3BA 2HCKA 2X3XD 2EGCA 2HBWA 1KSWA 1NG2A 4D8KA 1UHFA 2YUPA 1N5ZA 2F2WA 1AWJA 4M4ZA 2ECZA 4AFQC 1YN8A 2BZ8A 1E6GA 4RTVA 4JPBW 2F2XA 1K0SA 2LJ3A 3THKA 1QCFA 3TSWA 2GGRA 1H8KA 2L3QA 1PHTA 2OJ2A 4J9BA 2YUOA 2DL3A 2MOXA 1GCPA 2DMOA 3I5SA 1SPKA 2C0OA 3H0IA 2A28A 1YWOA 4CC3A 2E5KA 2PNIA 1FYNA 3C0CA 1JQQA 3H0HA 4RTTA 4F17A 4LNPA 1H3HA 1T3LA 2AZVA 2JMAA 1ZUUA 5GJWB 2KEAA 2M51A 2NUZA 3CQTA 2LCSA 1WYXA 2LJ0A 2KE9A 2C0TA 4RTUA 2LX7A 4DEXA 1VA7A 1M3CA 2ABLA 2EGEA 1UJ0A 4A63B 2JM8A 1ABQA 1UJYA 4RUGA 2JXBA 1QWFA 2AZSA 1GBRA 1GFDA 1J3TA 5ECAA 3R6NA 1AWXA 2KR3A 3FJ5A 1K4US 4Z89A 2MIOA 5IXBA 2V1RA 3VS2A 4CC2A 2D0NA 4LN2A 2ED0A 1X43A 2DA9A 2FPDA 2YSQA 2CUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  3H41 A;  1SSH A;  3REA B;  1NLP C;  2KNB B;  2HEQ A;  1X69 A;  1LCK A;  1RI9 A;  2RQU A;  2JW4 A;  4J9D A;  3RBB B;  3VS0 A;  1AZE A;  2FPF A;  4AFS C;  5FW9 A;  4WCI A;  2KT1 A;  2DJQ A;  2CSI A;  3M0R A;  4EIK A;  2J7I A;  1UFF A;  1MV3 A;  2KRN A;  2L2P A;  5HCK A;  1B3Q A;  1I07 A;  4X1V A;  2ROT A;  1T3S A;  3A98 A;  2EYY A;  2GQI A;  1MUZ A;  1S1N A;  5FWC A;  2K6D A;  1CKB A;  5L23 A;  2F2V A;  2RQV A;  4J9C A;  1ARK A;  3EG2 A;  4ESR A;  2J05 A;  4RTY A;  2ROL A;  3VS1 A;  1UTI A;  2M0Y A;  1W70 A;  3I9Q A;  1WXB A;  1GCQ C;  4AG1 C;  3NMZ C;  1EFN A;  4HCK A;  2IIM A;  2KXC A;  4E6R A;  2X3W D;  4OMP A;  4AFU C;  1OV3 A;  3JV3 A;  1XOV A;  1JO8 A;  5I22 A;  1I0C A;  1NLO C;  2K79 A;  3TVT A;  3M0P A;  1SHG A;  4J9G A;  5GJV B;  2QDL A;  1AOJ A;  1X2Q A;  2C0I A;  3KFV A;  2AKL A;  1KFZ A;  1TUD A;  3QWY A;  4QT7 A;  2YUQ A;  1K1Z A;  1SRM A;  2KYB A;  4HVU A;  3M0U A;  2GNC A;  2EPD A;  1IO6 A;  2SRC A;  4JZ3 A;  1RUW A;  4CC7 A;  2K7A A;  1AWW A;  3UAT A;  1JXM A;  2EGA A;  2SEM A;  5IHK A;  4RTZ A;  1HJD A;  2A36 A;  4J9E A;  1QKX A;  1NM7 A;  1X2K A;  3UA6 A;  1MV0 B;  2P4R A;  1PKS A;  1AVZ C;  2LZ6 B;  1I1J A;  1A0N B;  1JXO A;  4LUE A;  1RLP C;  1WDX A;  3LH5 A;  1JEG A;  2EYZ A;  1VYU A;  1Z9Q A;  2EVR A;  3U23 A;  4IIM A;  2KBT A;  2CDT A;  2DF6 A;  1ZBJ A;  1Y0M A;  2KYM A;  1AEY A;  1BBZ A;  4GLM A;  1ZUY A;  4K11 A;  2CSQ A;  1WIE A;  2K2M A;  2AK5 A;  1GFC A;  2OI3 A;  2GTJ A;  2RQW A;  3NHN A;  2DBK A;  3M0T A;  1CKA A;  1WXT A;  2W0Z A;  1PRL C;  1BU1 A;  1AD5 A;  2VVK A;  3EGU A;  3I35 A;  3M0S A;  4AG2 C;  1Y57 A;  2LQW A;  1HD3 A;  2L3P A;  1UE9 A;  2ENM A;  3EG1 A;  1GBQ A;  2KGT A;  2FRY A;  3IQL A;  3H0F A;  1WLP B;  1UGV A;  2NWM A;  3UA7 A;  2DX1 A;  2W10 A;  1YNZ A;  2KXD A;  2DL7 A;  4HXJ A;  4OMM A;  2RQT A;  1K9A A;  2CH4 A;  2KT8 A;  2A08 A;  1SHF A;  2DM1 A;  1WX6 A;  2LJ1 A;  2RQR A;  2O31 A;  4JJB A;  1QWE A;  2DRM A;  2O9V A;  4ZNX A;  1GCQ A;  2O9S A;  1K76 A;  2DL4 A;  2ESW A;  2J6O A;  2L0A A;  2CRE A;  1PWT A;  3PVQ A;  1E7O A;  1U5S A;  2L3S A;  2LMJ A;  2RMO A;  2RPN A;  1V1C A;  2KRO A;  2RNA A;  4LE9 A;  2O88 A;  2DL5 A;  2G6F X;  1T0J A;  2DIL A;  1UDL A;  4LUD A;  1AZG B;  2DVJ A;  2CT4 A;  1B07 A;  4Z8A A;  1WI7 A;  2JS2 A;  1ZSG A;  1Z9Z A;  1KIK A;  2D1X A;  3NGP A;  2HSP A;  1UEC A;  1U06 A;  1QKW A;  2CH4 W;  2J06 A;  2VKN A;  4JZ4 A;  1M3A A;  2RF0 A;  2FO0 A;  2FG0 A;  3VRY A;  3VS5 A;  2YDL A;  4R0K A;  2CT3 A;  1OOT A;  1ZLM A;  2EYX A;  3SEM A;  1PNJ A;  2AKK A;  1YCS B;  3RNJ A;  2JTE A;  1SEM A;  3SHW A;  1OPK A;  1RLQ C;  1ZX6 A;  2HDA A;  2EBP A;  1VYV A;  2BZX A;  1U3O A;  1YP5 A;  2DNU A;  1GL5 A;  2BTT A;  3PE0 A;  4KRT A;  4OMN A;  1ZUK A;  4RTW A;  1VYT A;  3VS3 A;  1AWO A;  2GBQ A;  2EKH A;  4OMQ A;  1OEB A;  1X6G A;  2LP5 A;  2DL8 A;  4HVW A;  2JMC A;  1BB9 A;  1W1F A;  1M8M A;  1X27 A;  3O5Z A;  4F14 A;  4J9F A;  4J9I A;  1OPL A;  2KRS A;  3PVL A;  2JM9 A;  2DE0 X;  1M27 C;  3GBQ A;  3ZL7 C;  4AFZ C;  1G83 A;  3VRZ A;  3VS7 A;  2I0N A;  4JJD A;  3TSZ A;  2A37 A;  1WA7 A;  2ED1 A;  1SRL A;  3VS6 A;  3M0Q A;  4IIO A;  1NYF A;  1WXU A;  2YUN A;  2D8J A;  1W6X A;  2O2O A;  3ULR B;  4OML A;  1PKT A;  2KRM A;  2PTK A;  5I11 A;  2FPE A;  1GRI A;  2GTO A;  5IHN A;  1NYG A;  2V1Q A;  4ORZ A;  3QWX X;  1JU5 C;  1KJW A;  4D8D A;  1FMK A;  1BK2 A;  2K3B A;  1UHC A;  3UF4 A;  2LQN A;  3I5R A;  2DLP A;  3EHQ A;  4RTX A;  4GBQ A;  4CC4 B;  2EW3 A;  1M30 A;  4J9H A;  3NPF A;  2CUD A;  2EQI A;  2H8H A;  3EHR A;  4JJC A;  1UG1 A;  1ABO A;  4Y92 A;  2FRW A;  1NEB A;  2RN8 A;  4F16 A;  3EG0 A;  2J6K A;  1WFW A;  5IXF A;  1NEG A;  2DRK A;  1CSK A;  1TUC A;  1QLY A;  2K9G A;  4Z88 A;  2DYB A;  3VS4 A;  1PRM C;  2OAW A;  5IH2 A;  3REB B;  1T0H A;  2YT6 A;  2JT4 A;  2J6F A;  1UUE A;  2LNH B;  2BZY A;  2PZ1 A;  1G2B A;  2DBM A;  5FWB A;  2JS0 A;  2VWF A;  4DEY A;  2MCN A;  2EYW A;  2D8H A;  3EG3 A;  2B86 A;  5EC7 A;  1TG0 A;  1HSQ A;  4OMO A;  2FEI A;  1K0X A;  5IHI A;  4FSS A;  1YWP A;  1E6H A;  2XMF A;  1H92 A;  1X6B A;  1M3B A;  2HCK A;  2X3X D;  2EGC A;  2HBW A;  1KSW A;  1NG2 A;  4D8K A;  1UHF A;  2YUP A;  1N5Z A;  2F2W A;  1AWJ A;  4M4Z A;  2ECZ A;  4AFQ C;  1YN8 A;  2BZ8 A;  1E6G A;  4RTV A;  4JPB W;  2F2X A;  1K0S A;  2LJ3 A;  3THK A;  1QCF A;  3TSW A;  2GGR A;  1H8K A;  2L3Q A;  1PHT A;  2OJ2 A;  4J9B A;  2YUO A;  2DL3 A;  2MOX A;  1GCP A;  2DMO A;  3I5S A;  1SPK A;  2C0O A;  3H0I A;  2A28 A;  1YWO A;  4CC3 A;  2E5K A;  2PNI A;  1FYN A;  3C0C A;  1JQQ A;  3H0H A;  4RTT A;  4F17 A;  4LNP A;  1H3H A;  1T3L A;  2AZV A;  2JMA A;  1ZUU A;  5GJW B;  2KEA A;  2M51 A;  2NUZ A;  3CQT A;  2LCS A;  1WYX A;  2LJ0 A;  2KE9 A;  2C0T A;  4RTU A;  2LX7 A;  4DEX A;  1VA7 A;  1M3C A;  2ABL A;  2EGE A;  1UJ0 A;  4A63 B;  2JM8 A;  1ABQ A;  1UJY A;  4RUG A;  2JXB A;  1QWF A;  2AZS A;  1GBR A;  1GFD A;  1J3T A;  5ECA A;  3R6N A;  1AWX A;  2KR3 A;  3FJ5 A;  1K4U S;  4Z89 A;  2MIO A;  5IXB A;  2V1R A;  3VS2 A;  4CC2 A;  2D0N A;  4LN2 A;  2ED0 A;  1X43 A;  2DA9 A;  2FPD A;  2YSQ A;  2CUB A; 
#chains in the Genus database with same CATH topology
 4QVZ A;  3RMQ A;  3H41 A;  1NLP C;  2L5Q A;  2KNB B;  2HEQ A;  5CKB A;  3CME A;  1LCK A;  2JJ9 A;  3EG9 A;  3AT1 B;  2XU8 A;  3E2U A;  3VS0 A;  1AZE A;  2FPF A;  5EG2 A;  5LJ3 g;  3TEE A;  3G6E T;  4WCI A;  2DTO A;  1OU8 A;  2X4Y A;  2J7I A;  4II1 A;  2BUD A;  1MV3 A;  2L2P A;  3I56 T;  4X1V A;  3PIO A;  2AHJ B;  3OYD A;  1WJS A;  3H8Z A;  3CD6 T;  5L23 A;  2F2V A;  2RQV A;  4ESR A;  2J05 A;  4XU2 A;  3CMA T;  3L1A A;  2E70 A;  3VS1 A;  1QP3 A;  4J5Y A;  3I9Q A;  2X35 A;  3NMZ C;  1JB0 E;  2OTL Q;  3WVD B;  3OYF A;  2LRQ A;  1H64 1;  2DD4 A;  1VQ5 A;  4JJN K;  1VQK Q;  1VQL Q;  3DB4 A;  2KXC A;  4E6R A;  3OYE A;  2NLU A;  4JDS A;  3MHX A;  4OMP A;  3BW1 A;  4X9C A;  1MMN A;  1OV3 A;  2RA2 A;  2XKO C;  4GY5 A;  4LD6 A;  3CCL T;  5I22 A;  1M2V B;  1NLO C;  3RIR A;  3QBY A;  2EQU A;  4J9G A;  2RJC A;  1QVG P;  5CKD A;  2DJZ A;  2DTH A;  1X2Q A;  2AKL A;  3JCM d;  3S3O A;  4HVU A;  2DIQ A;  1BI2 A;  2SRC A;  2CZ7 B;  1VQO Q;  2RHZ A;  2OTJ T;  4XK8 E;  1JJ2 S;  4RMO A;  4RG8 A;  1NPP A;  1KC8 C;  4XAX B;  3T9N A;  2LX9 A;  2CP6 A;  2AT1 B;  2HQH A;  2M1H A;  2P4R A;  5GMK e;  3L2W A;  1A0N B;  1JXO A;  1WQ7 A;  2DZ9 A;  4LUE A;  4XU1 A;  1WDX A;  1EIF A;  3LH5 A;  1MHN A;  2A7Y A;  1Z9Q A;  2EVR A;  4E7I A;  4ANJ A;  2M0O A;  4IIM A;  1ZBJ A;  3Q1J A;  3CPF A;  4ZN1 A;  3CCR A;  2VAS A;  1WIE A;  4M78 F;  3CC7 T;  4JRP A;  1YIJ T;  3NHN A;  3G1J A;  3CCM A;  1TXQ A;  1M1K C;  3JCM f;  1VQ8 Q;  3G71 T;  1RAE B;  4J6W A;  1KQS A;  3I35 A;  2VVK A;  3EGU A;  4FIB A;  2ENM A;  4C8Q B;  4N0A C;  1R0B G;  2D6F A;  1VUB A;  1D1C A;  3V8L A;  1WLP B;  1SSF A;  1UGV A;  4XTW A;  5D6W A;  1Y96 B;  2E5Q A;  1X6O A;  4M78 C;  3OYI A;  2KI7 A;  1NJI U;  1K9A A;  2KT8 A;  2E41 A;  4IUQ A;  3QO3 A;  2EKO A;  4EMG A;  3QJY A;  2RQR A;  1K73 U;  1BKB A;  1KK7 A;  1I5L A;  3MPU B;  2O9V A;  4ZNX A;  1VQ7 A;  3JSC A;  1YBY A;  3LWI A;  2ESW A;  3CPW S;  4LD9 K;  3JCM h;  5LJ3 j;  2LMJ A;  1YI2 A;  3P8D A;  4A4E A;  1PM3 A;  3CBP A;  2RMO A;  4C5G A;  3QZ5 B;  1HK9 A;  2DL5 A;  3BY7 A;  4KGZ B;  1NE8 A;  1AZG B;  2CT4 A;  5D6Y A;  1B07 A;  4Z8A A;  4WTO B;  2VUB A;  3CCV Q;  3MP1 A;  2J06 A;  2VKN A;  1M3A A;  2FO0 A;  2E3I A;  2KQW A;  1Q95 G;  1C1A A;  4DBH A;  1S72 Q;  1OOT A;  3QZ9 B;  1AHJ B;  3OBY A;  2AKK A;  1GXI E;  2MWP A;  3RNJ A;  2JTE A;  3EAE A;  4XTU A;  1ZX6 A;  4M75 A;  4XU3 A;  2EBP A;  4OGC A;  2BTT A;  4EMK C;  1D0Y A;  1PD0 A;  3PE0 A;  4M7A A;  2YLC A;  4C5E A;  1VYT A;  3QPH A;  4HT9 A;  3CCU T;  3V7R A;  4PFO A;  1BIA A;  4JRK A;  3G6E Q;  4J9I A;  1OPL A;  2CZ6 B;  4C5I A;  1ZQ1 A;  1KHC A;  2QGG A;  3PMT A;  3I56 Q;  5LJ5 d;  4ZGD B;  1VQM T;  1M27 C;  1G83 A;  2I0N A;  2QI2 A;  4R56 A;  5FU7 B;  5LL6 S;  2E12 A;  1ZSZ A;  1OU9 A;  2YUN A;  2K57 A;  3HSB A;  5KYW B;  1PKT A;  2KRM A;  5IT9 E;  1GRI A;  5IHN A;  2EFI A;  1QVG A;  1OZ2 A;  3QWX X;  4ORZ A;  4C0D B;  3CCS T;  2GCX A;  1BK2 A;  3HRU A;  5GAO l;  3LW5 E;  4RTX A;  5CVI A;  4GBQ A;  4OB1 B;  3CCL Q;  4HKE A;  4MDW A;  4QQG A;  4F7U A;  1NZ9 A;  2DEQ A;  3NPF A;  2CUD A;  2EQI A;  2H8H A;  3EHR A;  5GMK h;  2RJF A;  1N8R U;  5GAN d;  4PJO B;  5LJ5 f;  3OSS C;  2RN8 A;  1RAB B;  1VQ4 A;  3EG0 A;  3E1S A;  2EJF A;  1NEG A;  3NTI A;  2DRK A;  1CSK A;  4HCZ A;  3FJP A;  2OTJ Q;  3CCE T;  2DYB A;  2K5I A;  4XU0 A;  3KUF A;  4KT0 E;  2DET A;  2DEU A;  1U1T A;  2YT6 A;  3CC2 T;  5M9O A;  8AT1 B;  3GOX A;  1WHK A;  3EGD B;  5GAM g;  4OF1 A;  1M5Q 1;  3TU4 K;  2YLB A;  1YJ9 T;  2EYW A;  4N4I A;  3VYG A;  3CC7 Q;  2IPO B;  2CP2 A;  3ZFJ A;  5GAN f;  3JCM W;  3S6W A;  2COZ A;  4C92 A;  3PFS A;  3G71 Q;  3FC3 A;  2EGC A;  3GPL A;  1OZ3 A;  4D8K A;  1R8O B;  4QQD A;  4M75 G;  2FZG B;  1XQH A;  2COW A;  4M4Z A;  2ECZ A;  2E65 A;  1E6G A;  5GAN 3;  4M7A G;  2F2X A;  3R6O A;  2XD0 A;  2HZY A;  2LJ3 A;  2ZPG B;  3M54 A;  4A4F A;  2LTO A;  4ELZ C;  1H8K A;  1RAA B;  2HKQ B;  3SD4 A;  1PHT A;  2OJ2 A;  2D0Q B;  2YUO A;  1Q7Y R;  5GAO p;  2KDS A;  2DL3 A;  4E2F B;  1GCP A;  2DMO A;  3I5S A;  2C0O A;  2A28 A;  2RHU A;  2DXU A;  4CC3 A;  3NTK A;  8ATC B;  3D7S B;  3C0C A;  3CBO A;  3JAM E;  1K8A C;  1G3T A;  3OB9 A;  3LX7 A;  4LNP A;  5J39 A;  1D3B B;  4XTY A;  5DM7 R;  1G8X A;  1VQK T;  1BCO A;  4Z02 A;  2M51 A;  4KUL A;  2LJ0 A;  1MND A;  4DEX A;  3CXC S;  3V8K A;  1X01 A;  1OI1 A;  1M90 R;  2IVW A;  2MAM A;  1Y7X A;  3G4S A;  2M9U A;  5A0G A;  2PUK B;  2FYK A;  1GFD A;  1J3T A;  3R6N A;  1VQN Q;  5FU6 C;  4Z89 A;  1WJR A;  5CKF A;  1I81 A;  4BB7 A;  2RO0 A;  4JUV A;  2V1R A;  3OYB A;  4CC2 A;  4F7U G;  3GNF B;  1ZBX A;  2XK0 A;  4RCC A;  1WZO A;  1VQO T;  2FPD A;  3HKS A;  2YSQ A;  2CUB A;  3MO8 A;  4BE2 A;  3REA B;  3H6Z A;  5GAN 5;  3X24 B;  1RI9 A;  4L5G A;  4X34 A;  1BI0 A;  2RQU A;  4BE1 A;  2RK1 A;  1W2B P;  2EQJ A;  5LJ3 e;  5LJ5 j;  4AFS C;  2H3E B;  2DJQ A;  3M0R A;  2F5T X;  2PVG B;  3I55 Q;  1VOM A;  4CRI A;  2VXE A;  5HCK A;  3CCU Q;  3CCJ A;  1OYX A;  1B3Q A;  1M2V A;  1I07 A;  1OUL A;  4A53 A;  4ATO A;  3URG A;  2QDY B;  5FRM A;  3A98 A;  4IUU A;  4OVA A;  1QQJ A;  4JRI A;  4D6W A;  2GQI A;  1MUZ A;  1G3W A;  5KH6 A;  3AHU A;  2QEX T;  3OW2 S;  1JJ2 P;  4RTY A;  2EWN A;  2ROL A;  3QYH B;  1Q82 R;  1VQM Q;  2XID A;  1W70 A;  1TUG B;  4M7D B;  2KY9 A;  4BD3 A;  1WXB A;  1N9S A;  4ZN3 A;  4C92 G;  5GAM j;  1EFN A;  4HA8 A;  3RKX A;  3RKW A;  4B9X A;  5GAN j;  1XOV A;  1JO8 A;  1I0C A;  4MZT A;  4E7L A;  3QDR B;  5GJV B;  5CKH A;  2C0I A;  2CS7 A;  3CCS Q;  2Y4X A;  4PLL A;  1TUD A;  4QT7 A;  4A4H A;  2EPD A;  1IO6 A;  4CC7 A;  4BDY A;  3UAT A;  2GQV A;  3X25 B;  4X9D A;  2V8J A;  2SEM A;  3EH2 A;  5IHK A;  4RTZ A;  5KCO A;  1YCY A;  2FVU A;  3C4S A;  1Y71 A;  1X2K A;  1VQ7 Q;  2K3X A;  3GNG A;  4C8Q A;  2BE9 B;  3MCA B;  1N8R R;  2LZ6 B;  1I1J A;  5C6S A;  3QKJ A;  1YJW A;  3CCV T;  3OYG A;  2HAX A;  3U23 A;  2KBT A;  3JCM e;  1Y96 A;  2DF6 A;  2E3H A;  5LJ3 d;  1AEY A;  1BBZ A;  2ZGW A;  3CC4 A;  4M77 A;  1M1F A;  3JCM J;  4RG2 A;  2DBK A;  3OYM A;  1YJ9 Q;  3CPW P;  4J6Y A;  1VQ9 A;  1PRL C;  1KG1 A;  4XTX A;  2QYZ A;  3M0S A;  1AD5 A;  4AG2 C;  1Y57 A;  1HD3 A;  3LH0 A;  2RI2 A;  4QKU A;  4M77 D;  1GBQ A;  1R77 A;  4FT4 A;  4QVC A;  3BDL A;  1QCO A;  2DX1 A;  3QHS A;  2W10 A;  5CQX A;  1WHG A;  1YNZ A;  4FYW B;  2DL7 A;  1TWB A;  2CH4 A;  3A8G B;  1SHF A;  2NUT B;  1RAD B;  3LLR A;  1B34 B;  2DM1 A;  5LJ3 f;  2D9T A;  5CK9 A;  1GCQ A;  1NPR A;  2DL4 A;  3L2R A;  2O01 E;  1PWT A;  3PVQ A;  2HD0 A;  3OBW A;  3EGX B;  1YHQ A;  3M59 A;  1M2O A;  2XDB A;  2JTM A;  4PJL A;  2K5F A;  2RPN A;  2RNA A;  4OGE A;  4LE9 A;  2ZPF B;  3OYL A;  1XTD A;  1UDL A;  2DVJ A;  3GIB A;  5KE3 A;  1V76 A;  2D1X A;  3NGP A;  4HT8 A;  2V26 A;  4JZ4 A;  3X28 B;  3VRY A;  5KCH A;  4MMK A;  1QVF S;  3CCQ A;  2YDL A;  4DBQ A;  2MMP A;  3NFC A;  4O5V A;  3OYN A;  4E7Z A;  2RK2 A;  4BI3 A;  4OB0 B;  4DA4 A;  1ZLM A;  5LJ3 h;  2C06 A;  2RJE A;  1V29 B;  3GP8 A;  2HNI A;  5A0D A;  4RKU E;  3CEY A;  3SHW A;  1W2B A;  2X51 A;  3L2Q A;  2JVV A;  1VYV A;  2BZX A;  2COY A;  4ZTF A;  1GL5 A;  1NBE B;  1K9M U;  1ZUK A;  4RTW A;  3VJP A;  1YIT A;  4OMQ A;  2LP5 A;  5KYW A;  4C8Q G;  4HVW A;  2RI3 A;  2JMC A;  2X4X A;  4VUB A;  4N4G A;  1MNE A;  1F1B B;  4PJM A;  1X27 A;  3VUB A;  3O5Z A;  4J9F A;  1VQ6 A;  3MEW A;  1M1K R;  2KRS A;  2GFA A;  2QXF A;  3PVL A;  1JJ2 A;  2JN0 A;  1MMA A;  3MKD A;  5CKE A;  1KD1 C;  4M77 G;  4BUG A;  3ZL7 C;  5KYX B;  3VRZ A;  4FT2 A;  3VS7 A;  3J81 E;  4PJO A;  3TSZ A;  4DBF A;  4M77 F;  1WA7 A;  2E10 A;  2P4T A;  2QEX Q;  1QVP A;  2D8J A;  2O2O A;  1C0M A;  4ELY C;  1IHW A;  4BE0 A;  1IZ6 A;  3TQ7 P;  2FPE A;  2DXT A;  1Q7Y U;  1NYG A;  1RL2 A;  3CME T;  3FB9 A;  4D8D A;  1FMK A;  3HP9 A;  2LQN A;  3EFR A;  2ZPE B;  3FEO A;  3EGD A;  5LJ5 e;  1QP2 A;  3RMS A;  2EW3 A;  3UWN A;  2VXF A;  2QA4 A;  4FYX B;  4JJC A;  3P8B B;  4XTV A;  4IKF A;  4Y92 A;  1NEB A;  2R58 A;  4F16 A;  5CO7 A;  3M9Q A;  2O4X B;  2J6K A;  5IXF A;  3EH1 A;  2V8K A;  3SWN C;  2HBP A;  3MEV A;  4M78 B;  1M90 U;  3V8J A;  3VS4 A;  1ZHI A;  2OAW A;  4ZGE B;  6AT1 B;  7AT1 B;  1IRX A;  1T0H A;  1EX4 A;  2CP3 A;  2LNH B;  5GAM e;  4A4G A;  1VQ5 T;  2P0Q A;  1G2B A;  2DBM A;  4FYV B;  1VQN T;  3VUZ A;  3CPW A;  4DEY A;  1VQP A;  1OX9 A;  1Q86 U;  2GFU A;  5AT1 B;  2D8H A;  3EG3 A;  5GAN e;  1TG0 A;  3G4S Q;  3OYK A;  5KYY B;  1IXD A;  3CC2 A;  2XMF A;  2RHX A;  3VU3 C;  4FCY A;  2CP7 A;  2HCK A;  2X3X D;  3N5B B;  1PC0 A;  1KSW A;  4DBR A;  5GMK m;  1D3B A;  3QSU A;  1AWJ A;  2LDM A;  2MYS A;  4JRQ A;  3CXC P;  1YJN A;  2DXC A;  1K0S A;  3THK A;  4LDW A;  4CI0 C;  3I55 T;  4BI4 A;  2GGR A;  3GLX A;  2L3Q A;  4IUT A;  1ZA1 B;  3JCM Q;  2Y4Y A;  2YRD A;  3INZ A;  3LGF A;  3OS1 A;  3DKM A;  4M75 D;  3RUX A;  1Q82 U;  4EMK B;  1SPK A;  4M7A D;  2DTI A;  2EJG A;  3H0I A;  4FSX A;  3LGL A;  4PNO A;  3CCR T;  3OY9 A;  4OP0 A;  1XNI A;  3H0H A;  2MF2 A;  3M5A A;  4PJO G;  3CCM T;  1BCM A;  2JMA A;  2DYI A;  4C0Z A;  3BFM A;  1WYX A;  5DLO A;  4TVR A;  3L2V A;  3A8M B;  2LX7 A;  3OSV A;  1VA7 A;  2EGE A;  4A63 B;  4J8O A;  1ABQ A;  3HTR A;  2CKK A;  1QWF A;  2AZS A;  1GBR A;  2EIF A;  3J80 E;  2L3R A;  2KR3 A;  2OTL A;  2BKD N;  1SF9 A;  1WHL A;  1VQL A;  3E9G A;  1OQK A;  5IXB A;  2R5M A;  3HFN A;  5GAM d;  1X43 A;  2KVQ G;  4F7U E;  1Q81 C;  3OW2 P;  1RAH B;  4EMH A;  4HVV A;  5DY9 A;  1SSH A;  3TCJ A;  1VQ7 T;  1FMV A;  1X69 A;  5CQY A;  4M7D A;  2RD1 A;  2X4W A;  4J9D A;  2A0F B;  2GF7 A;  2CP0 A;  1YI2 T;  1QCN A;  1BIB A;  2KT1 A;  3JB9 D;  1VQO A;  4EIK A;  1UFF A;  2ZPB B;  2JOY A;  2KRN A;  3F70 A;  1K9M R;  2ROT A;  1T3S A;  2XHC A;  3X26 B;  1YJW Q;  1S1N A;  4AMC A;  2K6D A;  4J9C A;  1ARK A;  1SKU B;  3EFS A;  2MPX C;  4QQ6 A;  3TRE A;  5GAM f;  3CC4 Q;  3QII A;  5LJ5 h;  4FYY B;  1KQ1 A;  2X3W D;  1HYO A;  1VQ8 A;  3HPW A;  2K79 A;  3TVT A;  4M75 F;  4QVD A;  1SHG A;  2XG8 D;  5GAN 4;  4NOY A;  3CME Q;  2QAS A;  2QDL A;  3KFV A;  4C92 D;  1QW1 A;  4M7A F;  3QWY A;  1SRM A;  2KYB A;  1R0C B;  1C6V X;  2HQE A;  4FW1 A;  1K8A R;  2L8D A;  4JZ3 A;  1RUW A;  1AWW A;  3RES A;  2QAZ A;  1G3Y A;  2EGA A;  2WSF E;  2QQR A;  2A36 A;  5GAM h;  1QKX A;  2YRC A;  1PKS A;  1AVZ C;  2JUF A;  2HSE B;  5GAN h;  4M75 C;  2IG0 A;  3LWH A;  2VGM A;  3HRS A;  1VYU A;  4M7A C;  1KC8 U;  3JB9 J;  1D09 B;  3C95 A;  4GLM A;  2LNV A;  1ZUY A;  4K11 A;  2WSE E;  2NUT A;  1GFC A;  2YHT A;  1VQ5 Q;  1B34 A;  2GTJ A;  3VKI A;  3ER0 A;  1CKA A;  3CBM A;  5HKC A;  4JS5 A;  3RER A;  2WAC A;  2W0Z A;  4KH1 B;  3CCV A;  1BU1 A;  2LQW A;  4AT1 B;  1NJI C;  3JB9 G;  3CXC A;  2L3P A;  1Q86 R;  4E7J A;  3EGX A;  2P0P A;  1KD1 U;  3EG1 A;  4FL6 A;  4F7U F;  1K73 C;  5FU6 B;  3QDF A;  5J3B A;  2ZPI B;  1S72 A;  2XDD A;  3JB9 F;  4M7D G;  1M1K U;  1ZSZ C;  2KK4 A;  3GF5 A;  2KXD A;  1IGQ A;  4OMM A;  3UT1 A;  2A08 A;  4J7F A;  3JRZ A;  1D1A A;  5A0L A;  2DXB A;  1QVF P;  1N27 A;  3OYA A;  4JJB A;  1QWE A;  2O9S A;  1K76 A;  2J6O A;  2KMT A;  2CRE A;  4EPC A;  1G5V A;  4Y91 A;  1LPL A;  1U5S A;  3ZBD A;  3G6E A;  2WSC E;  4PL6 A;  2M02 A;  2MI6 A;  5I2M A;  3CCR Q;  4KBM B;  2KRO A;  3M55 A;  4A54 A;  5GAN 6;  1D0Z A;  4P5N A;  2QTV A;  3I56 A;  2G6F X;  1T0J A;  4BI8 B;  3CCM Q;  4LUD A;  2P0K A;  1WI7 A;  1ZSG A;  3CD6 A;  1Z9Z A;  1KIK A;  2HSP A;  1UEC A;  1U06 A;  1QKW A;  2CH4 W;  4C92 F;  3CMA A;  2FG0 A;  2KAF A;  3ZEH A;  4ZGJ B;  1TOV A;  3OW2 A;  3VS5 A;  5KYN A;  4R0K A;  1X75 C;  2CT3 A;  3E19 A;  1PNJ A;  1D0X A;  1VIE A;  1WJQ A;  2LQ8 A;  3WXM B;  2K5L A;  1SEM A;  5KYX A;  2AIR B;  2VB6 A;  1RLQ C;  4PLI A;  2HDA A;  1FWZ A;  4OMF B;  1YP5 A;  3JCM c;  3CCL A;  2F5K A;  2LVM A;  3VS3 A;  1UEB A;  4A4K A;  1RI0 A;  2LCL A;  3WVE B;  1I5O B;  2RJD A;  4PFZ A;  1JBM A;  4C92 C;  2DAQ A;  4C8Q E;  4KGX B;  4BY6 C;  1VIF A;  4KUI A;  1BB9 A;  1YI2 Q;  1M8M A;  2OTJ A;  3G4S T;  3QYG B;  2JM9 A;  3GBQ A;  4M77 E;  4N0A A;  4Q5W A;  3UDC A;  4C8Q D;  1MGQ A;  1PSF A;  1TU0 B;  1U8R A;  4JJD A;  1BI3 A;  3OS5 A;  2ED1 A;  3M58 A;  2O4X A;  3JB9 I;  4PKC C;  4IIO A;  1NYF A;  1WXU A;  1W6X A;  5GAO q;  4M78 A;  4LDY A;  1UGR B;  2FHD A;  3DLM A;  4EDU A;  2RB6 A;  1N8R C;  3CC7 A;  2V1Q A;  2ZPH B;  3EFO B;  1JU5 C;  1YIJ A;  3DB3 A;  1RAG B;  4E7K A;  2K3B A;  2QTX A;  3OYJ A;  3G71 A;  3L2U A;  4CC4 B;  4PK4 A;  2HMA A;  4FW2 A;  1P92 A;  1M30 A;  3P8H A;  4J9H A;  4BDZ A;  2KSS A;  4B9W A;  4O6J A;  1WHH A;  5KYU B;  1BI1 A;  3CCJ T;  1UG1 A;  1ABO A;  2FRW A;  1XJW B;  9ATC B;  1TH7 A;  4OB3 B;  5KYY A;  3PT9 A;  1WFW A;  4KH0 B;  2VC8 A;  3OYH A;  3HL8 A;  2PQW A;  3OS0 A;  2NUP B;  1PRM C;  1Q81 U;  3OS2 A;  4ZTJ A;  3UPU A;  3A8H B;  2J6F A;  3V7S A;  2BZY A;  3JCM V;  3MEU A;  2PVD B;  4HCC A;  2PZ1 A;  2F1L A;  2XI9 A;  2JS0 A;  2VWF A;  2MCN A;  2QQA A;  4F04 B;  2B86 A;  1PG5 B;  5EC7 A;  1HSQ A;  4OMO A;  2FEI A;  4EMK A;  1K0X A;  5IHI A;  4HCB A;  4FSS A;  1YWP A;  4JLG A;  2FB7 A;  2K2V A;  1KC8 R;  1E6H A;  4PJN A;  3SDZ A;  2HBW A;  1W2B S;  1NG2 A;  2DPP B;  1VQN A;  2YUP A;  2YXY A;  1N5Z A;  2CZ1 B;  2F2W A;  2CGH A;  2QQ9 A;  3QXE B;  1YN8 A;  4AFQ C;  5FLX E;  1TTH B;  2DIG A;  4JPB W;  1N6A A;  5HY6 A;  4UC4 A;  1QVF A;  2XIC A;  4J83 A;  1VQ4 Q;  1LOJ A;  3C94 A;  2FZC B;  1KD1 R;  1TSF A;  4J9B A;  5GAO r;  5IN1 A;  1YJW T;  2F69 A;  4OB2 B;  4C8Q F;  1DJ7 B;  1ZA2 B;  1YFN A;  1YWO A;  3PMI A;  1UB4 A;  2PNI A;  2QGF B;  3I55 A;  3CC4 T;  3OYY A;  4IUR A;  1JQQ A;  4L6V 5;  4RTT A;  4F17 A;  3CCU A;  1T3L A;  4PJO E;  3KBG A;  5GJW B;  2KEA A;  1KQS S;  1VQ9 T;  3CQT A;  1PD1 A;  1FX7 A;  2KE9 A;  4M78 G;  3PTA A;  2QG9 B;  4Y28 E;  5HK3 A;  3JCM g;  1K8A U;  4RUG A;  1VQM A;  3QUI A;  4C8Q C;  2E64 A;  4PJO D;  5GAO n;  3FJ5 A;  3JCM X;  4FM4 B;  2EJ9 A;  2RHI A;  4NL3 A;  4IUV A;  2CYZ B;  3VS2 A;  5CR2 A;  2BIV A;  2Y90 A;  5A2Q E;  2R5A A;  2H3J A;  1W4S A;  5CIU A;  4M77 C;  2RI5 A;  4E7S A;  3NTH A;  4B6M A;  1UGS B;  3CCS A;  2JW4 A;  2EQM A;  3RBB B;  1MMG A;  1HXD A;  3O8V A;  2DO3 A;  1YHQ T;  3E9F A;  5FW9 A;  2CSI A;  1MMD A;  1D1B A;  4M77 B;  5GAN 7;  2FL7 A;  3SWN B;  2EYY A;  1LVK A;  5FWC A;  3VV0 A;  4MML A;  1CKB A;  2OAU A;  2P84 A;  3EG2 A;  3PGG A;  3CCE A;  4XTZ A;  5D6X A;  3A8O B;  3MEA A;  4KGV B;  3X20 B;  4J6X A;  3CCQ T;  4JS4 A;  3G7Z A;  1RAI B;  1UTI A;  2M0Y A;  3HRT A;  3EG9 B;  4DQ2 A;  5GMK i;  1GCQ C;  4AG1 C;  4HCK A;  5AYF A;  5L8R E;  2IIM A;  5I21 A;  1YJ9 A;  3MET A;  4M75 E;  4E7H A;  2JZ2 A;  4AFU C;  3JV3 A;  2DER A;  4ME7 A;  4J7I A;  1H3Z A;  3L2Z A;  4M7A E;  1M1G A;  2V8I A;  3M0P A;  2EQK A;  2CP5 A;  1YIT T;  1AOJ A;  1IRE B;  1KFZ A;  5KE2 A;  2YUQ A;  1K1Z A;  3M0U A;  2GNC A;  2K7A A;  3MP6 A;  1JXM A;  4NL2 A;  3QG1 A;  1SG5 A;  5DLQ E;  1VQ6 T;  3J7A F;  1HJD A;  2DVE A;  4R55 A;  4J9E A;  3CCJ Q;  4L59 A;  1NM7 A;  3UA6 A;  5GMK l;  1MV0 B;  2HL5 C;  4RCB A;  3JCM P;  2YRV A;  3M53 A;  1PCX A;  5FU7 C;  1RLP C;  2ZZD A;  1JEG A;  2EYZ A;  4PJO F;  2EYQ A;  1IHV A;  2QQS A;  5GAO m;  2DFU A;  2CDT A;  3M4Y A;  1Y0M A;  2KYM A;  2K3Y A;  1QVG S;  5CCA A;  2RM4 A;  1Q81 R;  1WHJ A;  2CSQ A;  3KXT A;  2K2M A;  2AK5 A;  2OI3 A;  4XQ3 A;  2R57 A;  2RQW A;  3M0T A;  3CD6 Q;  4FU6 A;  4C0D C;  1WXT A;  1VQK A;  1UGP B;  4KUD K;  3CMA Q;  2LT4 A;  4DOV A;  2NYS A;  4C0G A;  3FIF A;  4PFP A;  2QA4 T;  1UE9 A;  2E4H A;  4LXC A;  2RH2 A;  4MZP A;  5C0M A;  3OQ5 A;  4PJO C;  2KGT A;  2FRY A;  4M7D E;  3IQL A;  3H0F A;  2NWM A;  3HFO A;  3UA7 A;  4HXJ A;  2RQT A;  2JNG A;  2XDP A;  5LJ5 g;  2MK5 A;  2B8A A;  2VYT A;  2QK0 A;  2E1H A;  4MDX A;  1WX6 A;  2LJ1 A;  2Z0W A;  2O31 A;  1RAF B;  2DRM A;  4M7D D;  2DK3 A;  2L0A A;  1FXX A;  2ZAE A;  1VQP T;  1E7O A;  2L3S A;  1WHM A;  2A3L A;  1V1C A;  3BE3 A;  2O88 A;  3QJ6 A;  2DIL A;  2MWO A;  2QQB A;  4LDV A;  4C92 E;  1VQ9 Q;  3OMG A;  2JS2 A;  2QEX A;  2RF0 A;  1FMW A;  1YJN T;  5GAN g;  1K9M C;  1QMC A;  3VYH B;  3HHT B;  1U1S A;  2LC4 A;  1KHI A;  1BYM A;  2EYX A;  1I8F A;  1YIJ Q;  3V7C A;  3SEM A;  3PNW C;  1YCS B;  2X4J A;  2E6N A;  1OPK A;  4JLI A;  2CZ0 B;  4N4H A;  2DNU A;  1U3O A;  2PUO B;  4KRT A;  4OMN A;  1AWO A;  2GBQ A;  1RAC B;  1ACM B;  2EKH A;  1OEB A;  1X6G A;  2X9H A;  2DL8 A;  3OA6 A;  2LCC A;  5GAN 8;  3EFO A;  1EZZ B;  1W1F A;  3L42 A;  3FLG A;  1YHQ Q;  2LT1 A;  4F14 A;  1LJO A;  1WPY A;  1JRI A;  3A1P A;  2DZC A;  3BDU A;  1NJI R;  2DE0 X;  3A8L B;  4AFZ C;  3RR6 A;  1Q7Y C;  2RHY A;  2DKG A;  2HKN A;  5KYU A;  3M56 A;  4M75 B;  2OTL T;  5GMK j;  5HK0 A;  4MZM A;  1K73 R;  1VQL T;  1TS9 A;  2A37 A;  1SRL A;  3VS6 A;  4M7A B;  3M0Q A;  5I2S A;  2E6Z A;  3OMC A;  3ULR B;  3CCQ Q;  4OML A;  1O9S A;  2NUP A;  3OYC A;  2PTK A;  3S3M A;  5I11 A;  2GTO A;  1KQ2 A;  4YTL A;  3RDV A;  1KJW A;  1VQ4 T;  3ME9 A;  1M8V A;  4WF2 A;  1OX8 A;  1UHC A;  3UF4 A;  2EAY A;  3I5R A;  2DLP A;  3EHQ A;  1M90 C;  4M7D F;  3PIP A;  4C0F A;  2LQK A;  1YIT Q;  2I2L A;  1N9R A;  4C5H A;  1ZSZ B;  3JCM b;  2OX7 A;  1VQ6 Q;  1TUC A;  1G3S A;  1QLY A;  1Q86 C;  2K9G A;  4Z88 A;  1M4Z A;  3ASK A;  1M9S A;  5IH2 A;  3REB B;  3MP8 A;  2YWW A;  3JB9 H;  2JT4 A;  5FRO A;  1UUE A;  2L89 A;  2JTF A;  4M7D C;  2M16 A;  3DLL A;  1AT1 B;  4F7U B;  4BAC A;  5FWB A;  1VQ8 T;  3SFM A;  1B7T A;  2PVO B;  1PSE A;  5FRN A;  2VGN A;  1H92 A;  3H9N A;  1X6B A;  1M3B A;  3M4G A;  4PJJ A;  1UHF A;  1KQS P;  3FDR A;  4NS5 A;  3S3N A;  2BE7 D;  1Q82 C;  1O75 A;  2BZ8 A;  1IGU A;  4RTV A;  2QA4 Q;  1Y07 A;  3RKY A;  2ZCF B;  3A5Z B;  1QCF A;  3TSW A;  2FZK B;  3LYI A;  5GAN 2;  2ATC B;  3C12 A;  2MOX A;  1I4K 1;  1WNL A;  1IB8 A;  4DOW A;  4E47 A;  3SB2 A;  2E5K A;  5J26 A;  5IAY A;  1UGQ B;  1FYN A;  4C92 B;  4V2S A;  4BY6 B;  1WGS A;  4LDX A;  1H3H A;  2AZV A;  1ZUU A;  1VQP Q;  3CCE Q;  2NUZ A;  3M57 A;  2K4Y A;  1WQW A;  4LDU A;  2LCS A;  2C0T A;  4RTU A;  2PU9 B;  4M78 E;  3FRN A;  1M3C A;  2ABL A;  1UJ0 A;  2JM8 A;  2HQX A;  3CC2 Q;  2G3R A;  1UJY A;  1LNX A;  2HL3 A;  2JXB A;  4QW2 A;  3MJX A;  4GLK A;  1S72 T;  2DD5 A;  5ECA A;  1AWX A;  4IUP A;  5D7U A;  1K4U S;  2MIO A;  3SWN A;  5CAI A;  4M78 D;  2D0N A;  2ED0 A;  4LN2 A;  1YJN Q;  2VV5 A;  2DA9 A; 
#chains in the Genus database with same CATH homology
 4HVV A;  3H41 A;  1SSH A;  3REA B;  1NLP C;  2KNB B;  2HEQ A;  1X69 A;  1LCK A;  1RI9 A;  2RQU A;  2JW4 A;  4J9D A;  3RBB B;  3VS0 A;  1AZE A;  2FPF A;  4AFS C;  5FW9 A;  4WCI A;  2KT1 A;  2DJQ A;  2CSI A;  3M0R A;  4EIK A;  2J7I A;  1UFF A;  1MV3 A;  2KRN A;  2L2P A;  5HCK A;  1B3Q A;  1I07 A;  4X1V A;  2ROT A;  1T3S A;  3A98 A;  2EYY A;  2GQI A;  1MUZ A;  1S1N A;  5FWC A;  2K6D A;  1CKB A;  5L23 A;  2F2V A;  2RQV A;  4J9C A;  1ARK A;  3EG2 A;  4ESR A;  2J05 A;  4RTY A;  2ROL A;  3VS1 A;  1UTI A;  2M0Y A;  1W70 A;  3I9Q A;  1WXB A;  1GCQ C;  4AG1 C;  3NMZ C;  1EFN A;  4HCK A;  2IIM A;  2KXC A;  4E6R A;  2X3W D;  4OMP A;  4AFU C;  1OV3 A;  3JV3 A;  1XOV A;  1JO8 A;  5I22 A;  1I0C A;  1NLO C;  2K79 A;  3TVT A;  3M0P A;  1SHG A;  4J9G A;  5GJV B;  2QDL A;  1AOJ A;  1X2Q A;  2C0I A;  3KFV A;  2AKL A;  1KFZ A;  1TUD A;  3QWY A;  4QT7 A;  2YUQ A;  1K1Z A;  1SRM A;  2KYB A;  4HVU A;  3M0U A;  2GNC A;  2EPD A;  1IO6 A;  2SRC A;  4JZ3 A;  1RUW A;  4CC7 A;  2K7A A;  1AWW A;  3UAT A;  1JXM A;  2EGA A;  2SEM A;  5IHK A;  4RTZ A;  1HJD A;  2A36 A;  4J9E A;  1QKX A;  1NM7 A;  1X2K A;  3UA6 A;  1MV0 B;  2P4R A;  1PKS A;  1AVZ C;  2LZ6 B;  1I1J A;  1A0N B;  1JXO A;  4LUE A;  1RLP C;  1WDX A;  3LH5 A;  1JEG A;  2EYZ A;  1VYU A;  1Z9Q A;  2EVR A;  3U23 A;  4IIM A;  2KBT A;  2CDT A;  2DF6 A;  1ZBJ A;  1Y0M A;  2KYM A;  1AEY A;  1BBZ A;  4GLM A;  1ZUY A;  4K11 A;  2CSQ A;  1WIE A;  2K2M A;  2AK5 A;  1GFC A;  2OI3 A;  2GTJ A;  2RQW A;  3NHN A;  2DBK A;  3M0T A;  1CKA A;  1WXT A;  2W0Z A;  1PRL C;  1BU1 A;  1AD5 A;  2VVK A;  3EGU A;  3I35 A;  3M0S A;  4AG2 C;  1Y57 A;  2LQW A;  1HD3 A;  2L3P A;  1UE9 A;  2ENM A;  3EG1 A;  1GBQ A;  2KGT A;  2FRY A;  3IQL A;  3H0F A;  1WLP B;  1UGV A;  2NWM A;  3UA7 A;  2DX1 A;  2W10 A;  1YNZ A;  2KXD A;  2DL7 A;  4HXJ A;  4OMM A;  2RQT A;  1K9A A;  2CH4 A;  2KT8 A;  2A08 A;  1SHF A;  2DM1 A;  1WX6 A;  2LJ1 A;  2RQR A;  2O31 A;  4JJB A;  1QWE A;  2DRM A;  2O9V A;  4ZNX A;  1GCQ A;  2O9S A;  1K76 A;  2DL4 A;  2ESW A;  2J6O A;  2L0A A;  2CRE A;  1PWT A;  3PVQ A;  1E7O A;  1U5S A;  2L3S A;  2LMJ A;  2RMO A;  2RPN A;  1V1C A;  2KRO A;  2RNA A;  4LE9 A;  2O88 A;  2DL5 A;  2G6F X;  1T0J A;  2DIL A;  1UDL A;  4LUD A;  1AZG B;  2DVJ A;  2CT4 A;  1B07 A;  4Z8A A;  1WI7 A;  2JS2 A;  1ZSG A;  1Z9Z A;  1KIK A;  2D1X A;  3NGP A;  2HSP A;  1UEC A;  1U06 A;  1QKW A;  2CH4 W;  2J06 A;  2VKN A;  4JZ4 A;  1M3A A;  2RF0 A;  2FO0 A;  2FG0 A;  3VRY A;  3VS5 A;  2YDL A;  4R0K A;  2CT3 A;  1OOT A;  1ZLM A;  2EYX A;  3SEM A;  1PNJ A;  2AKK A;  1YCS B;  3RNJ A;  2JTE A;  1SEM A;  3SHW A;  1OPK A;  1RLQ C;  1ZX6 A;  2HDA A;  2EBP A;  1VYV A;  2BZX A;  1U3O A;  1YP5 A;  2DNU A;  1GL5 A;  2BTT A;  3PE0 A;  4KRT A;  4OMN A;  1ZUK A;  4RTW A;  1VYT A;  3VS3 A;  1AWO A;  2GBQ A;  2EKH A;  4OMQ A;  1OEB A;  1X6G A;  2LP5 A;  2DL8 A;  4HVW A;  2JMC A;  1BB9 A;  1W1F A;  1M8M A;  1X27 A;  3O5Z A;  4F14 A;  4J9F A;  4J9I A;  1OPL A;  2KRS A;  3PVL A;  2JM9 A;  2DE0 X;  1M27 C;  3GBQ A;  3ZL7 C;  4AFZ C;  1G83 A;  3VRZ A;  3VS7 A;  2I0N A;  4JJD A;  3TSZ A;  2A37 A;  1WA7 A;  2ED1 A;  1SRL A;  3VS6 A;  3M0Q A;  4IIO A;  1NYF A;  1WXU A;  2YUN A;  2D8J A;  1W6X A;  2O2O A;  3ULR B;  4OML A;  1PKT A;  2KRM A;  2PTK A;  5I11 A;  2FPE A;  1GRI A;  2GTO A;  5IHN A;  1NYG A;  2V1Q A;  4ORZ A;  3QWX X;  1JU5 C;  1KJW A;  4D8D A;  1FMK A;  1BK2 A;  2K3B A;  1UHC A;  3UF4 A;  2LQN A;  3I5R A;  2DLP A;  3EHQ A;  4RTX A;  4GBQ A;  4CC4 B;  2EW3 A;  1M30 A;  4J9H A;  3NPF A;  2CUD A;  2EQI A;  2H8H A;  3EHR A;  4JJC A;  1UG1 A;  1ABO A;  4Y92 A;  2FRW A;  1NEB A;  2RN8 A;  4F16 A;  3EG0 A;  2J6K A;  1WFW A;  5IXF A;  1NEG A;  2DRK A;  1CSK A;  1TUC A;  1QLY A;  2K9G A;  4Z88 A;  2DYB A;  3VS4 A;  1PRM C;  2OAW A;  5IH2 A;  3REB B;  1T0H A;  2YT6 A;  2JT4 A;  2J6F A;  1UUE A;  2LNH B;  2BZY A;  2PZ1 A;  1G2B A;  2DBM A;  5FWB A;  2JS0 A;  2VWF A;  4DEY A;  2MCN A;  2EYW A;  2D8H A;  3EG3 A;  2B86 A;  5EC7 A;  1TG0 A;  1HSQ A;  4OMO A;  2FEI A;  1K0X A;  5IHI A;  4FSS A;  1YWP A;  1E6H A;  2XMF A;  1H92 A;  1X6B A;  1M3B A;  2HCK A;  2X3X D;  2EGC A;  2HBW A;  1KSW A;  1NG2 A;  4D8K A;  1UHF A;  2YUP A;  1N5Z A;  2F2W A;  1AWJ A;  4M4Z A;  2ECZ A;  4AFQ C;  1YN8 A;  2BZ8 A;  1E6G A;  4RTV A;  4JPB W;  2F2X A;  1K0S A;  2LJ3 A;  3THK A;  1QCF A;  3TSW A;  2GGR A;  1H8K A;  2L3Q A;  1PHT A;  2OJ2 A;  4J9B A;  2YUO A;  2DL3 A;  2MOX A;  1GCP A;  2DMO A;  3I5S A;  1SPK A;  2C0O A;  3H0I A;  2A28 A;  1YWO A;  4CC3 A;  2E5K A;  2PNI A;  1FYN A;  3C0C A;  1JQQ A;  3H0H A;  4RTT A;  4F17 A;  4LNP A;  1H3H A;  1T3L A;  2AZV A;  2JMA A;  1ZUU A;  5GJW B;  2KEA A;  2M51 A;  2NUZ A;  3CQT A;  2LCS A;  1WYX A;  2LJ0 A;  2KE9 A;  2C0T A;  4RTU A;  2LX7 A;  4DEX A;  1VA7 A;  1M3C A;  2ABL A;  2EGE A;  1UJ0 A;  4A63 B;  2JM8 A;  1ABQ A;  1UJY A;  4RUG A;  2JXB A;  1QWF A;  2AZS A;  1GBR A;  1GFD A;  1J3T A;  5ECA A;  3R6N A;  1AWX A;  2KR3 A;  3FJ5 A;  1K4U S;  4Z89 A;  2MIO A;  5IXB A;  2V1R A;  3VS2 A;  4CC2 A;  2D0N A;  4LN2 A;  2ED0 A;  1X43 A;  2DA9 A;  2FPD A;  2YSQ A;  2CUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...