4QT7A

Crystal structure of the c-src sh3 domain in complex with a peptide from the hepatitis c virus ns5a-protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
SHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structure of the c-Src-SH3 domain in complex with a proline-rich motif of NS5A protein from the hepatitis C virus.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase/transferase activator
total genus 13
structure length 60
sequence length 60
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4qt7A00
1AWJA 2KBTA 2KRNA 4OMLA 1T0JA 1OV3A 4ZNXA 2K3BA 1WIEA 4Z89A 1QKXA 4LUEA 2DL3A 4Z88A 2PTKA 2DBMA 2SRCA 1AWOA 2DLPA 4J9IA 3TSWA 1ABQA 1X27A 4JJDA 1SPKA 5L23A 1UTIA 2DE0X 2YUQA 1BU1A 1QKWA 3H0FA 1KIKA 3THKA 1XOVA 1K1ZA 1QLYA 1AZGB 1S1NA 4AFUC 2KE9A 2RPNA 2OI3A 3EGUA 4JJBA 1M30A 5FWBA 1T3LA 2F2XA 4JZ3A 5GJWB 2DILA 1OPLA 5EC7A 1JO8A 2C0OA 4LN2A 4ESRA 1WA7A 2DRMA 1RLQC 3H0HA 1UE9A 1RUWA 1UJYA 4IIMA 2SEMA 4F17A 2CT4A 2EYYA 4EIKA 2EGCA 2LCSA 1TUDA 4M4ZA 5IXFA 2DL7A 2EGEA 1SRLA 3ZL7C 5I22A 2DRKA 1UECA 2XMFA 2NUZA 2MOXA 3EG0A 4RTXA 1VA7A 4HVVA 2DM1A 1HJDA 2EYWA 1NEGA 2V1RA 1GBRA 1WXTA 3C0CA 1QWEA 2JM9A 2C0IA 3M0SA 1NYFA 2AZVA 4R0KA 2DF6A 1NG2A 1PKSA 2O9SA 1H3HA 2OAWA 3VRYA 2YT6A 4RTVA 2J06A 3RNJA 2F2VA 3M0QA 2M0YA 1M3CA 2CSIA 2BZXA 3VS2A 2CSQA 2RQUA 2ED0A 5IHNA 1GBQA 2KXDA 2FRYA 2JM8A 1X69A 1QWFA 1X2QA 4D8KA 2ROLA 3H41A 3KFVA 5IHIA 2JMCA 3EHQA 1UDLA 2DJQA 3VS4A 3REAB 2LX7A 1GL5A 2ECZA 4HVUA 1W70A 1B3QA 2FPEA 1AWXA 4CC3A 1K9AA 3JV3A 1W6XA 1GCQC 1X6GA 1CSKA 1GFDA 1AOJA 2GGRA 2D8JA 1WDXA 2VKNA 4J9DA 4AFQC 1X43A 1KFZA 1UUEA 1HSQA 1K4US 1MV0B 2CH4W 2V1QA 3VS1A 5FW9A 1A0NB 2LNHB 3NPFA 4LE9A 3VS5A 1T0HA 2LP5A 4J9FA 1AEYA 2CT3A 1U3OA 1I07A 2LZ6B 2DL4A 1NLOC 2EGAA 4LNPA 3M0RA 2D8HA 2LMJA 1NM7A 1Z9QA 3QWXX 1SHFA 1GRIA 1X6BA 4GLMA 2HCKA 1YCSB 3VRZA 1SEMA 3I9QA 3CQTA 2L3SA 1FYNA 1X2KA 3VS6A 4JJCA 1W1FA 4A63B 2KT1A 4RTYA 1RLPC 2J7IA 2M51A 1MUZA 1PWTA 1T3SA 2EYXA 3EHRA 1UHCA 1I1JA 4OMNA 1Y57A 1GCPA 2LQWA 2RF0A 2KRSA 1LCKA 4J9BA 2JS0A 4Z8AA 3UA6A 1UFFA 2ESWA 4X1VA 2A28A 3EG1A 2HEQA 1ZUYA 3M0PA 1G83A 1OEBA 2KR3A 2CUBA 2DBKA 1VYUA 2AK5A 1JU5C 2YDLA 3RBBB 2O9VA 4JPBW 4AG2C 2LJ0A 1ARKA 4RTWA 1OOTA 2DA9A 3NMZC 2VVKA 2J6FA 1YWPA 1PNJA 1U5SA 1GFCA 2CH4A 2DNUA 2C0TA 4RUGA 3R6NA 4GBQA 4D8DA 1M27C 1E7OA 2K6DA 1MV3A 2FPDA 1TG0A 1ZUKA 2VWFA 1G2BA 2GNCA 2KYBA 2DMOA 2PNIA 3EG2A 3ULRB 1AZEA 2A37A 2DL5A 1AVZC 2AZSA 1UHFA 2KRMA 3PVLA 1WI7A 2MCNA 1U06A 1PRLC 4E6RA 4F14A 1WLPB 2W10A 2EYZA 4IIOA 4K11A 1UG1A 4AFSC 4RTUA 1BB9A 3IQLA 1NYGA 2KROA 2F2WA 2DL8A 2KEAA 2FEIA 1YP5A 3O5ZA 2D0NA 1JQQA 1OPKA 1PHTA 2CUDA 2X3WD 3QWYA 1WXUA 2PZ1A 2QDLA 1EFNA 2YUNA 1TUCA 4OMMA 2RQVA 1BBZA 3SEMA 2BZ8A 2JS2A 2I0NA 1JEGA 2H8HA 1ZBJA 2D1XA 2FG0A 2LJ3A 4CC4B 1WFWA 1I0CA 1GCQA 1HD3A 1NLPC 4RTZA 2RN8A 4OMQA 4JZ4A 1ABOA 3GBQA 4F16A 3TSZA 1V1CA 2K79A 4AFZC 2RQRA 2K9GA 2FO0A 2EKHA 3VS7A 1B07A 1FMKA 3M0UA 3UA7A 2GQIA 2B86A 2L3QA 1SSHA 2BZYA 2A08A 2FRWA 4J9GA 4J9CA 1E6GA 1PRMC 2RMOA 1KSWA 1J3TA 2DX1A 1SHGA 3H0IA 1Y0MA 5HCKA 1CKAA 2P4RA 2AKKA 1Z9ZA 2EVRA 4AG1C 2HBWA 1WYXA 2KT8A 2RNAA 2JW4A 2J6KA 4DEYA 4J9HA 1H92A 2KYMA 4OMPA 3FJ5A 5IH2A 2GBQA 1WXBA 2EPDA 4HCKA 2L2PA 3VS3A 1ZSGA 1N5ZA 2O2OA 2HDAA 2KGTA 4HVWA 2OJ2A 5FWCA 2W0ZA 2DYBA 1ZUUA 4HXJA 4CC7A 1QCFA 2CDTA 2ABLA 1NEBA 3VS0A 2K2MA 2X3XD 3I5SA 2KXCA 2IIMA 2JT4A 4RTTA 2DVJA 3PVQA 1SRMA 1K0SA 2MIOA 2ROTA 1ZLMA 3UF4A 2EW3A 1RI9A 2GTJA 1JXMA 3REBB 2J6OA 2AKLA 4ORZA 1CKBA 3NGPA 1M3BA 2KNBB 2GTOA 1M3AA 2L3PA 2YSQA 1UGVA 2CREA 4QT7A 1ZX6A 4J9EA 4OMOA 2O31A 3A98A 2G6FX 2EQIA 2NWMA 1AD5A 1YWOA 2ENMA 2JXBA 2RQWA 2O88A 2YUOA 1E6HA 3SHWA 1K76A 1WX6A 2EBPA 4Y92A 4DEXA 1H8KA 1JXOA 2LJ1A 3UATA 4KRTA 1YNZA 4WCIA 1KJWA 2A36A 2E5KA 2J05A 1UJ0A 5IXBA 2LQNA 1BK2A 3EG3A 5ECAA 1M8MA 2K7AA 2YUPA 1YN8A 3M0TA 1VYTA 2RQTA 2ED1A 1VYVA 5I11A 5IHKA 3I35A 3TVTA 2BTTA 1IO6A 1PKTA 3NHNA 2JTEA 4FSSA 1K0XA 3I5RA 2FPFA 3LH5A 3PE0A 2JMAA 2HSPA 1AWWA 4CC2A 2L0AA 3U23A 4LUDA 5GJVB
chains in the Genus database with same CATH superfamily
1TS9A 4Z89A 1QKXA 4LUEA 1IGQA 4Z88A 3L1AA 3V7RA 2SRCA 2BKDN 5GAMe 1SPKA 3QG1A 4BI4A 1BU1A 1QKWA 2VGNA 1KIKA 1VQOA 2IVWA 4M75E 4J6WA 3HSBA 1N8RR 4AFUC 3EGUA 4JJBA 1VQPQ 4JRIA 3MPUB 1M30A 1SKUB 4MZMA 5GAN3 5FWBA 1PG5B 2VV5A 4JZ3A 2GCXA 2DILA 1VOMA 4FT2A 1WA7A 1Q81R 3JCMf 1G3YA 2SEMA 2CT4A 3BY7A 4II1A 3KBGA 2HZYA 2RB6A 5IXFA 2DL7A 1BIBA 3ZL7C 2XMFA 1MMGA 1W2BA 2NUZA 4PLIA 4BDYA 3NTKA 3QIIA 4RTXA 1VA7A 5GAOp 2D0QB 3JB9J 2EYWA 1NEGA 1XQHA 3VYGA 1BIAA 1K73C 1VQOQ 2CS7A 2C0IA 4ZTFA 4M78B 3JCMb 1PKSA 4M75F 3H8ZA 1H3HA 2OAWA 4BE2A 4C0ZA 1Q7YU 3BE3A 2XDPA 2FB7A 3MO8A 4M7DE 2Y4XA 4C5IA 3PIOA 1I81A 2BZXA 3VS2A 1FXXA 5IHNA 1GBQA 1D1AA 2FRYA 1WHMA 3RDVA 1QWFA 3L2QA 2ROLA 3EGDB 3H41A 1OYXA 3OA6A 1X6OA 2CZ7B 4L5GA 3L2UA 3VS4A 1V76A 4XTYA 3LX7A 2ECZA 2A7YA 1W70A 3A8HB 1AWXA 2JVVA 1YHQA 1W6XA 1GCQC 3C4SA 3GPLA 3J7AF 4M7DA 3CPWP 2ZZDA 2MWOA 2KVQG 3JCMe 4J9DA 3OW2S 1VQ9T 1D3BA 1RI0A 3M4YA 2HBPA 1NPPA 2D9TA 3META 4IUTA 3L2RA 3QJ6A 1UGPB 3AT1B 3P8DA 5GAOq 1MNEA 4M7DF 1K9MC 4J6XA 1YITT 4F7UE 1OZ3A 4J9FA 4EMHA 3CCQA 5J39A 3JB9D 1I07A 2HQXA 4IUPA 1NLOC 1JJ2P 3FIFA 3M57A 1YJ9A 1Z9QA 4GLKA 1SHFA 1X6BA 3JB9I 5GAOr 3VRZA 5KE2A 5LJ5d 3OBYA 1YHQQ 1W1FA 2KT1A 4M77A 3CCMT 1O75A 1VQ6T 1RLPC 2EKOA 4LDWA 2J7IA 4OVAA 4PJOG 2EYXA 4MDXA 4F7UA 2K2VA 1VQ5Q 2E64A 4NL3A 2LQWA 1QVGS 1N8RU 2KRSA 1TU0B 4KGVB 1VQ7A 4Z8AA 5GAOn 2K4YA 2CZ1B 3BFMA 5KCOA 3EG1A 3UDCA 4C92E 2KQWA 3OYGA 3ZFJA 1Q81U 4HT9A 4F7UF 5A0DA 1BI3A 1M1KR 2OX7A 2CUBA 2QYZA 2ZPIB 4B9XA 2XD0A 2YDLA 4TVRA 1QVFP 4E7LA 2LJ0A 2E3HA 3G71Q 3CPFA 1U5SA 3JCMg 3R6NA 3A1PA 2QEXT 1KHIA 2H3EB 1C0MA 2O4XA 5KYXA 2AT1B 4C92A 1G2BA 5LJ3e 4O6JA 3EG2A 2EQUA 3G6EA 2A37A 4LD9K 3MCAB 2QG9B 1WJQA 3CEYA 4WTOB 2XIDA 4M7AD 1YJWQ 2KRMA 1WLPB 4IIOA 1LNXA 4RTUA 4C92F 5GANj 1NYGA 1JQQA 1OPKA 1PHTA 3QWYA 2X3WD 3M54A 2PZ1A 2VXEA 3E9GA 2QDLA 4AT1B 1TUCA 5HK0A 3F70A 2HL5C 2YRCA 2DO3A 2I0NA 2H8HA 5LL6S 3LH0A 2P0QA 4N4HA 1N9SA 2FG0A 2DJZA 5GANd 1I0CA 4C8QA 4OMQA 2JJ9A 1ABOA 4XU1A 1KQSS 3TSZA 4PLLA 5CVIA 3X26B 2EKHA 4ZGDB 4KGXB 1WHLA 4M75B 3CMEA 3LW5E 3CCLT 2XU8A 3OS1A 3UA7A 1S72T 2L3QA 1SSHA 2FL7A 4C8QF 2A08A 1NJIR 1ZSZC 2IG0A 4FU6A 2DX1A 1WNLA 4ZN3A 1Y0MA 3LWHA 2P4RA 3J80E 2HBWA 2RNAA 3JCMP 4XU3A 2J6KA 2KYMA 3INZA 4X34A 3FJ5A 1UB4A 4GY5A 4C5GA 1B34A 2DXBA 2K57A 3VS3A 2ATCB 3CPWA 3HFOA 4RKUE 2O2OA 4ZGEB 4LDYA 1BCMA 1QQJA 4HVWA 2F69A 2EQMA 4BD3A 2FZGB 3T9NA 4HXJA 4P5NA 3DB4A 3OYAA 3QBYA 2P84A 2M1HA 3RR6A 2K2MA 5GAN4 4HA8A 1PSFA 2CP0A 1PM3A 4PL6A 3V8LA 1C1AA 3CD6T 2DVJA 7AT1B 2ROTA 5LJ5h 1JJ2A 2GTJA 4M7DB 3REBB 2RJDA 2J6OA 1CKBA 1M1KU 4PKCC 2L3PA 2K5LA 1WHJA 2YSQA 3QHSA 4FYXB 3MKDA 2EQIA 2NWMA 5CCAA 4J5YA 1VQ6A 2R57A 2ENMA 2RQWA 1H641 1JB0E 4JRKA 1RAFB 1C6VX 1MMAA 1VQ9Q 1E6HA 4DA4A 4Y28E 1K73R 1YNZA 1ZA2B 2JUFA 2V26A 1YITQ 2K3XA 3VYHB 4XTZA 4A4EA 4KUDK 3MP1A 1YIJT 2MPXC 4C0GA 2LQNA 1G3WA 1YI2A 4J7IA 3CCST 1M8MA 1M2VA 2E12A 1QVFA 2RQTA 4M78A 3C12A 4A4GA 1YJNA 4F7UB 4BE0A 3CCMQ 3JB9G 1VQ6Q 4FSSA 2QEXA 1Q82C 2HQEA 1WJRA 2QA4T 1X01A 4N4GA 4ELYC 3CCVA 2G3RA 5FRNA 2HSPA 1W2BP 4LUDA 2EIFA 5GJVB 3JCMJ 2XDDA 1PCXA 1AWJA 2KRNA 4FM4B 4ZNXA 2K3BA 5FRMA 3SWNB 2ZAEA 2X4WA 2DLPA 1X27A 4PJMA 2RJFA 1OQKA 1UTIA 2DE0X 2VUBA 3TCJA 3H0FA 3THKA 4LXCA 1QLYA 2RJEA 1AZGB 1K9MR 1G8XA 1NJIU 2COZA 2RPNA 2EJ9A 1RACB 2Y4YA 2Y90A 2O4XB 2QTVA 3VUBA 4C92B 4XU2A 3MHXA 1OPLA 1LVKA 2DRMA 2QEXQ 1UE9A 1UJYA 4IIMA 2E3IA 3CCVQ 3CC2A 2EYYA 4EIKA 2EGCA 2LCSA 2GF7A 4PJNA 1TUDA 4M4ZA 4A4HA 2E10A 1SRLA 1SG5A 5I22A 3CPWS 4PJOA 4E7KA 1UEBA 1S72A 4B9WA 4IUVA 3EG0A 4HVVA 1HJDA 3GIBA 1IHVA 2V1RA 1IGUA 1WXTA 1MGQA 5FU7B 2AZVA 2CGHA 4OF1A 5CKHA 2DF6A 1NG2A 1QCOA 3L42A 3S6WA 4PJOF 4FW2A 2DERA 1PC0A 4RTVA 2LT1A 2J06A 3RNJA 3SDZA 2AHJB 2FZCB 2F2VA 3M0QA 1JJ2S 1M3CA 2VXFA 3OYEA 2NUPA 2RK1A 3FB9A 1VQLT 4RCBA 2LRQA 3OS0A 4QW2A 3EHQA 1PD1A 1UDLA 3CCLQ 3JRZA 1S72Q 1IXDA 2JTMA 1K73U 2HL3A 3CD6A 3CC7T 1FX7A 1VQPA 2V8JA 4KBMB 3CC4T 3JV3A 3OYFA 2M0OA 3JAME 2VYTA 4RG2A 4A4KA 4ANJA 1B7TA 2DETA 2WSEE 1WDXA 2VKNA 4FL6A 1KFZA 3RKXA 1MMNA 4RMOA 1K4US 4OGEA 1FWZA 2V1QA 1OZ2A 5FW9A 3EH1A 1A0NB 2PQWA 1QVFS 4FYYB 1T0HA 2LP5A 3QXEB 4NS5A 2WSCE 1M2OA 2M16A 4L59A 1ZA1B 3BDLA 2LZ6B 2DKGA 5CKFA 3LYIA 3QWXX 4MDWA 5D6YA 1GRIA 4GLMA 4A4FA 3CD6Q 2HCKA 2P4TA 3I9QA 8ATCB 1FYNA 2R5MA 1V29B 4JJCA 4X9CA 4RTYA 2M51A 3QDRB 3EFRA 2QK0A 2DXTA 5KYYA 4FSXA 3OS5A 1UHCA 5DLQE 1DJ7B 1QP3A 1K9MU 1Y57A 1GCPA 2I2LA 2QQRA 4J9BA 2JS0A 1UFFA 2LVMA 2QA4A 2ZPFB 3EAEA 5GMKe 1KHCA 5A2QE 2EJGA 1M9SA 4M75A 2HEQA 3M0PA 1IRXA 2WACA 4WF2A 2KR3A 4LDVA 1VYUA 1M2VB 2DXCA 1M8VA 3RBBB 4KH1B 1M90C 4AG2C 3JCMX 3QYGB 1ARKA 4RTWA 1KQ1A 1YIJQ 1ZHIA 3CCSQ 1GFCA 4RUGA 2C0TA 4D8DA 1D0XA 2CP7A 5D6XA 2F5KA 1ZUKA 3OYJA 1LPLA 4UC4A 2GNCA 2DMOA 1G3SA 3P8BB 1I8FA 4RCCA 1KD1C 2QA4Q 3HHTB 2AZSA 1MNDA 1U06A 2DZ9A 3HRSA 1KC8R 2QAZA 4BUGA 3DLMA 3OMGA 2F2WA 4ELZC 2KEAA 2FEIA 2RHZA 3PGGA 2K5IA 2MWPA 4OB1B 3V8KA 3CMAT 4OMMA 3SEMA 3QZ5B 3FLGA 3TU4K 1TH7A 2HNIA 4JRPA 2RM4A 1VQ5A 2LJ3A 1WFWA 2CP5A 1GCQA 5LJ5j 5M9OA 1NLPC 4C0DB 2DFUA 4JZ4A 4JS4A 5KCHA 5LJ5f 3TREA 3A8GB 2K79A 2CZ0B 2JTFA 2FO0A 3LGLA 2KK4A 3VS7A 1B07A 4PJOB 2COYA 5GAMh 2XDBA 2QTXA 5CKDA 1VQLA 2GQIA 1BYMA 5CKBA 2LQKA 4J9GA 4J9CA 3FDRA 1E6GA 1Q82R 3G71A 1G5VA 4R56A 4M77C 3CC7A 2C06A 1WYXA 2KT8A 1VQ4T 3FJPA 2X4JA 3CCET 1RAHB 4M77D 1WXBA 2DTIA 1QP2A 4XTWA 4HCKA 3JB9F 3EG9A 2HDAA 2QQSA 2NUPB 1LJOA 1M4ZA 1YJWA 3UWNA 5FWCA 2W0ZA 1VIFA 4EMKC 2RHUA 1RL2A 5AT1B 2BE7D 2LNVA 4QQDA 4A54A 3SFMA 2ABLA 3X20B 1XNIA 4F04B 3SWNA 2BUDA 3PTAA 1VQLQ 4RTTA 4OB2B 1SRMA 1K0SA 1M1GA 1ZLMA 2EW3A 1RI9A 3A8MB 3CCRT 2JZ2A 4IUUA 5AYFA 1JXMA 4M7AE 3NGPA 2E1HA 1M3BA 3CC7Q 3FC3A 1UGVA 1W2BS 3CC4Q 3WVEB 3HP9A 2E41A 5FROA 2P0KA 1OX9A 1XJWB 1R77A 1YWOA 4BY6B 4M7AC 2O88A 3SHWA 1K76A 3G1JA 2LJ1A 3UATA 1WPYA 4WCIA 3V7SA 5HK3A 2A36A 5GANf 3QPHA 2LTOA 3ZBDA 5CQXA 4A53A 1NBEB 2MAMA 2LC4A 3EFSA 1BK2A 1BI2A 1KC8U 1ZBXA 3EG3A 2EWNA 2YUPA 2VGMA 2DZCA 2ZPGB 3JCMh 5A0LA 1VYVA 2O01E 5IHKA 5KYYB 3I35A 1M5Q1 2YRDA 1PKTA 2JTEA 1K0XA 4C8QD 2FPFA 3SD4A 4OGCA 4C5EA 3PE0A 2DEQA 1OI1A 1WZOA 3KUFA 2L0AA 3U23A 3UT1A 1Y96A 4OMLA 2HKQB 1WQ7A 4JLGA 2OTJT 1OV3A 2BE9B 1WIEA 3OYKA 1OULA 2PTKA 1I5LA 1RAAB 2CP2A 4JJDA 1IZ6A 3C95A 4E7IA 1WJSA 2ZCFB 4N4IA 1XOVA 3URGA 3MEUA 2DD4A 2KE9A 4NOYA 2OI3A 5LJ5g 1KQ2A 3ER0A 1Q82U 1VQ9A 1T3LA 1P92A 4J7FA 5D6WA 2RHXA 1R0BG 4PFPA 5A0GA 3QDFA 3VUZA 2DVEA 2B8AA 4LN2A 2GFUA 4LDUA 3H0HA 5IT9E 1RUWA 4PJJA 2E5QA 5I21A 5KYNA 1H3ZA 5GANe 1YITA 2L89A 1FMWA 3OSVA 2CZ6B 9ATCB 2EGEA 2QQBA 4C0FA 2DRKA 2X35A 2KDSA 3RERA 1QCNA 1KC8C 3RMSA 1GBRA 3C0CA 4EPCA 3X25B 3CCMA 2JM9A 3CMAQ 4R0KA 2O9SA 2X9HA 2COWA 5C0MA 2EFIA 5LJ3h 3JSCA 2XKOC 5D7UA 2DIQA 3BDUA 1F1BB 3D7SB 3PFSA 4HCZA 1M90R 4X9DA 3RKWA 2EQJA 2PUKB 2RQUA 2XK0A 2JM8A 1LOJA 1X2QA 3QZ9B 3KFVA 3QYHB 4JUVA 3CCUT 5IHIA 3GF5A 4XAXB 3VKIA 3E19A 3REAB 1GL5A 4HVUA 1B3QA 1QVGP 1WHKA 2A3LA 4CC3A 3CCRA 2QQ9A 1X6GA 1CSKA 1KD1R 1GFDA 1QVPA 4M78D 5FU6C 4PJLA 5DM7R 4BE1A 2GGRA 1TWBA 3EG9B 4Y91A 1VQ4Q 2D8JA 3CBOA 4Q5WA 5KE3A 4FW1A 3G7ZA 3MP6A 2VC8A 3CCEQ 1UGRB 2LCLA 1X43A 1HSQA 2XICA 4E7JA 4XU0A 5DLOA 5GANg 2PVOB 3CBMA 3A5ZB 3S3MA 1N9RA 2PVDB 2HAXA 3GP8A 2LNHB 2K5FA 3L2ZA 3VS5A 1VQ8T 5CR2A 4IUQA 2CT3A 3QO3A 4O5VA 1U3OA 2VASA 4M77G 3JCMc 2CKKA 3L2WA 2DL4A 3MJXA 2D8HA 1NM7A 4QVDA 2M02A 1YCSB 1SEMA 3WVDB 3CCRQ 3VS6A 3OY9A 3OYIA 5GAN2 2KSSA 4QVZA 2KAFA 4MMLA 2KI7A 3OSSC 1T3SA 3EHRA 2DD5A 4OMNA 2ZGWA 1YFNA 4BI3A 4B6MA 2ESWA 2RHYA 4ME7A 2A28A 1JRIA 2RI2A 3CCLA 4EDUA 1O9SA 2OTJA 4PJOD 1D0YA 2L5QA 4N0AC 4JPBW 4QQ6A 4M7AG 3I56T 1YWPA 1D09B 5GAN8 2F1LA 1HXDA 1PNJA 2F5TX 5J26A 2X4XA 5GAMj 1YBYA 2DNUA 5GAMf 1VQKT 1E7OA 2ZPHB 1MV3A 2FPDA 1VQNT 2LT4A 2VWFA 4J83A 2E6NA 5I2SA 2PNIA 1Y96B 1K8AC 4DOVA 2DL5A 2XHCA 4KUIA 4BDZA 1VQMT 1Q86U 1AVZC 1GXIE 3PVLA 3HL8A 2QDYB 1PRLC 5GAMd 2W10A 2EYZA 3N5BB 2KY9A 3CCQT 3RESA 5HY6A 1M90U 2OTJQ 3O5ZA 3FEOA 3E9FA 5C6SA 2CUDA 5IAYA 1YJ9T 1ZSZB 4C8QG 2RQVA 2BZ8A 2JS2A 2FZKB 1JEGA 2RI5A 3JB9H 2RH2A 1RAIB 3OYDA 1PSEA 3PMIA 2E70A 4CC4B 3LWIA 3A8LB 2A0FB 2KMTA 2RN8A 3ASKA 2YLBA 1KD1U 4LD6A 3GBQA 4F16A 1V1CA 2K3YA 1VQ7T 2RQRA 3M5AA 5J3BA 3OYNA 3VJPA 1FMKA 4NL2A 2QXFA 2B86A 3X28B 3EFOB 5CQYA 1U1TA 1YIJA 4E47A 1PRMC 3CCUA 3CCSA 1SHGA 3E1SA 4JRQA 2EVRA 5GMKm 2E6ZA 3ME9A 3G4ST 1QVGA 2JW4A 4DEYA 1OU8A 4J9HA 1H92A 2L8DA 4OMPA 5IH2A 2GBQA 2L2PA 1N5ZA 4MZTA 2KGTA 2OJ2A 1PD0A 4DBFA 2H3JA 2JOYA 4M75C 1QCFA 3G6ET 4XTXA 1Q86C 3HPWA 3CBPA 1NEBA 3OYCA 3NTIA 1RAEB 4M75D 4CI0C 1VQ8A 2DK3A 3PNWC 2IIMA 2JT4A 4VUBA 3P8HA 2EYQA 4XTUA 2HD0A 5GMKl 4KH0B 3CCUQ 3HTRA 3KXTA 5I2MA 3JCMd 2KNBB 2HQHA 2P0PA 2GTOA 2L3RA 3QJYA 1UGSB 2CREA 3C94A 1ZX6A 4J9EA 4OMOA 4QT7A 5GMKi 2O31A 2NLUA 2RO0A 3RUXA 2JXBA 3OYBA 2NYSA 2YUOA 4ZGJB 5FU6B 4FIBA 3OBWA 4PFOA 3HFNA 2EBPA 4Y92A 4DEXA 1Q95G 1JXOA 4D6WA 2YXYA 2BIVA 4M78G 8AT1B 3CCJT 3M55A 2EJFA 2E5KA 2HSEB 3CMET 1VQ8Q 2J05A 3MEVA 1D1BA 2QASA 5IXBA 2E65A 3PT9A 3OB9A 3LGFA 1G3TA 2R5AA 4M7DC 3TEEA 2LX9A 3S3OA 1NE8A 5GAMg 4QQGA 4R55A 4M7DD 5ECAA 1BKBA 3M0TA 3HRTA 1TXQA 3NFCA 2NUTA 2ED1A 3I56A 2ZPBB 3BW1A 1KQSA 2V8KA 3TVTA 2XI9A 4V2SA 4QKUA 1IO6A 3NHNA 1VQKA 1VQNA 2HMAA 4BI8B 2MYSA 4CC2A 4KT0E 4M77E 2KBTA 3VU3C 1T0JA 1VQMA 5LJ3j 1TSFA 2MI6A 2DL3A 5LJ3f 2DBMA 1BI0A 1AWOA 3MP8A 3Q1JA 4J9IA 4MZPA 3TSWA 1ABQA 5L23A 2YUQA 3CC4A 2FVUA 5CK9A 1R0CB 1K1ZA 3EGXA 5KYWA 1S1NA 3I56Q 2QGGA 5L8RE 5LJ3d 4L6V5 2F2XA 5GJWB 4DQ2A 5EC7A 1BCOA 1JO8A 2C0OA 5GMKh 3CXCP 4ESRA 1RLQC 1VQKQ 3OYHA 1Q7YC 2E4HA 1VQNQ 1TOVA 4F17A 4HT8A 1ZQ1A 3SWNC 4M77F 1RAGB 4EMKA 1VQMQ 1UECA 4ZTJA 3LLRA 1N27A 4Z02A 3I55T 2MOXA 1MMDA 3A8OB 3M4GA 4J8OA 3CCQQ 5GAOm 2YRVA 2DM1A 2OTLT 3JCMV 1X75C 1YI2T 5LJ5e 1Y71A 1QWEA 3S3NA 1YJ9Q 3M0SA 3GOXA 1NYFA 4C92C 3WXMB 3G4SA 1YJNT 3TQ7P 4JJNK 4EMGA 3UPUA 4C92D 3VRYA 3H9NA 4PNOA 2YT6A 3X24B 4OB3B 1AHJB 2M0YA 1QW1A 2CSIA 3PMTA 4FYWB 3CCVT 2CSQA 2ZPEB 4OMFB 4M7AA 2ED0A 4FT4A 4DOWA 2KXDA 1VQ7Q 3M58A 1X69A 4D8KA 4C8QE 2JMCA 5GAOl 2WSFE 3RIRA 2DJQA 1KG1A 2LX7A 2FPEA 5FU7C 1IB8A 4M7AF 1FMVA 4OP0A 1K9AA 4DBHA 1K8AR 2QI2A 4C8QC 2D6FA 1AOJA 3V7CA 1AT1B 3G4SQ 4BB7A 4AFQC 1XTDA 1UUEA 3L2VA 1WQWA 2IPOB 4HCBA 5GAN6 2OAUA 2YHTA 1MV0B 2CH4W 4KULA 3VS1A 3QUIA 4PK4A 3NPFA 1HK9A 5KYUA 1U8RA 1N8RC 4LE9A 3CC2T 1M1FA 2DTHA 2FYKA 1RABB 3G6EQ 1AEYA 3CCJA 2EGAA 4LNPA 4E2FB 3M0RA 2LMJA 1Q81C 1UGQB 3CMAA 4XQ3A 1ZSZA 3HRUA 4CRIA 3CQTA 1U1SA 2GQVA 2L3SA 1X2KA 4A63B 4MMKA 3RMQA 1OU9A 4M75G 2RD1A 1MUZA 2DPPB 1PWTA 2X51A 1RADB 1I1JA 2DEUA 4DBQA 2RF0A 1LCKA 1OX8A 3UA6A 5LJ3g 2CYZB 4X1VA 4JDSA 4JLIA 2MF2A 4XK8E 1ZUYA 3OW2P 4J6YA 1G83A 1OEBA 3PIPA 3EFOA 2DBKA 2GFAA 2DTOA 3CCJQ 2AK5A 1JU5C 2M9UA 3CMEQ 1W4SA 1R8OB 2O9VA 2NUTB 1VQ4A 1OOTA 1VQPT 3OS2A 2DA9A 3NMZC 4IKFA 2VVKA 1I4K1 2J6FA 4YTLA 5HKCA 3CCEA 3V8JA 3OYYA 1Y7XA 1Q86R 4E7SA 1VUBA 2MMPA 2CH4A 1NPRA 4GBQA 3AHUA 4DBRA 1M27C 2K6DA 2LQ8A 1D3BB 1TG0A 3OQ5A 3M59A 2CP6A 3GLXA 2KYBA 3GNGA 4RG8A 3ULRB 4M78E 3CXCA 2XG8D 3DLLA 1AZEA 2RJCA 4M7DG 1TTHB 1UHFA 2PVGB 1WI7A 2MCNA 4E6RA 4F14A 6AT1B 4K11A 4AFSC 1UG1A 1BB9A 3IQLA 5FLXE 2KROA 4M78C 2DL8A 1YP5A 2D0NA 1VQOT 4LDXA 3I55A 1WXUA 2YUNA 1EFNA 3EGXB 5KYWB 1BBZA 5CKEA 2OTLA 3M53A 1ZBJA 2D1XA 4M77B 4OB0B 1N6AA 3OMCA 1VIEA 2V8IA 2X4YA 1YCYA 2JNGA 1HD3A 4RTZA 1K8AU 1HYOA 3DB3A 5IN1A 2RK2A 4JS5A 2PUOB 4AFZC 2Z0WA 3JCMW 2K9GA 4EMKB 1D1CA 1SSFA 4M78F 4XTVA 5EG2A 4ZN1A 3M0UA 2FHDA 4F7UG 2BZYA 3QSUA 1WHHA 2FRWA 2RMOA 3EGDA 1KSWA 1NZ9A 1J3TA 3H0IA 5HCKA 3I55Q 1CKAA 2AKKA 1Z9ZA 4AG1C 1D0ZA 1KK7A 3M56A 2OTLQ 1YI2Q 3O8VA 1M1KC 2R58A 2EPDA 4PJOE 4C0DC 3GNFB 2YWWA 1ZSGA 5GAN5 5GANh 1YJNQ 5KYXB 2DYBA 1ZUUA 4M7AB 5KH6A 4CC7A 4PJOC 2CDTA 4ATOA 2YLCA 3FRNA 3VS0A 3DKMA 3RKYA 2X3XD 4PFZA 3H6ZA 3I5SA 2KXCA 2JN0A 3SB2A 1SF9A 4C92G 2EAYA 2RA2A 3PVQA 1KQSP 2MIOA 2QGFB 3UF4A 5CAIA 1YHQT 1EX4A 2LCCA 1Y07A 1EIFA 2AKLA 4ORZA 1Q7YR 4QVCA 5CO7A 2EQKA 1M3AA 2MK5A 4N0AA 2HKNA 3OYLA 3A98A 2G6FX 1VQ5T 4IURA 1AD5A 1I5OB 3E2UA 1WGSA 1TUGB 4KGZB 4C8QB 4E7HA 4HKEA 5KYUB 2AIRB 1WX6A 3VV0A 4FYVB 2DAQA 5GAN7 1H8KA 3NTHA 2DIGA 4KRTA 2LDMA 4C5HA 2DXUA 1KJWA 1MHNA 1ACMB 1JBMA 2RHIA 3ZEHA 2DYIA 1QMCA 3CC2Q 1UJ0A 4FCYA 3OW2A 1EZZB 2PU9B 5GMKj 3HKSA 5DY9A 3QKJA 3MEWA 1BI1A 2RI3A 3G71T 3J81E 2K7AA 1YN8A 3CXCS 4E7ZA 1VYTA 1WHGA 3EH2A 3R6OA 5I11A 3MEAA 2CP3A 4BY6C 4HCCA 1IREB 4AMCA 2BTTA 3M9QA 1NJIC 1B34B 4BACA 2VB6A 3I5RA 3JCMQ 1IHWA 3LH5A 3OYMA 2JMAA 1YJWT 1AWWA 2QQAA 5CIUA
chains in the Genus database with same CATH topology
1AWJA 2KBTA 2KRNA 4OMLA 1T0JA 1OV3A 4ZNXA 2K3BA 1WIEA 4Z89A 1QKXA 4LUEA 2DL3A 4Z88A 2PTKA 2DBMA 2SRCA 1AWOA 2DLPA 4J9IA 3TSWA 1ABQA 1X27A 4JJDA 1SPKA 5L23A 1UTIA 2DE0X 2YUQA 1BU1A 1QKWA 3H0FA 1KIKA 3THKA 1XOVA 1K1ZA 1QLYA 1AZGB 1S1NA 4AFUC 2KE9A 2RPNA 2OI3A 3EGUA 4JJBA 1M30A 5FWBA 1T3LA 2F2XA 4JZ3A 5GJWB 2DILA 1OPLA 5EC7A 1JO8A 2C0OA 4LN2A 4ESRA 1WA7A 2DRMA 1RLQC 3H0HA 1UE9A 1RUWA 1UJYA 4IIMA 2SEMA 4F17A 2CT4A 2EYYA 4EIKA 2EGCA 2LCSA 1TUDA 4M4ZA 5IXFA 2DL7A 2EGEA 1SRLA 3ZL7C 5I22A 2DRKA 1UECA 2XMFA 2NUZA 2MOXA 3EG0A 4RTXA 1VA7A 4HVVA 2DM1A 1HJDA 2EYWA 1NEGA 2V1RA 1GBRA 1WXTA 3C0CA 1QWEA 2JM9A 2C0IA 3M0SA 1NYFA 2AZVA 4R0KA 2DF6A 1NG2A 1PKSA 2O9SA 1H3HA 2OAWA 3VRYA 2YT6A 4RTVA 2J06A 3RNJA 2F2VA 3M0QA 2M0YA 1M3CA 2CSIA 2BZXA 3VS2A 2CSQA 2RQUA 2ED0A 5IHNA 1GBQA 2KXDA 2FRYA 2JM8A 1X69A 1QWFA 1X2QA 4D8KA 2ROLA 3H41A 3KFVA 5IHIA 2JMCA 3EHQA 1UDLA 2DJQA 3VS4A 3REAB 2LX7A 1GL5A 2ECZA 4HVUA 1W70A 1B3QA 2FPEA 1AWXA 4CC3A 1K9AA 3JV3A 1W6XA 1GCQC 1X6GA 1CSKA 1GFDA 1AOJA 2GGRA 2D8JA 1WDXA 2VKNA 4J9DA 4AFQC 1X43A 1KFZA 1UUEA 1HSQA 1K4US 1MV0B 2CH4W 2V1QA 3VS1A 5FW9A 1A0NB 2LNHB 3NPFA 4LE9A 3VS5A 1T0HA 2LP5A 4J9FA 1AEYA 2CT3A 1U3OA 1I07A 2LZ6B 2DL4A 1NLOC 2EGAA 4LNPA 3M0RA 2D8HA 2LMJA 1NM7A 1Z9QA 3QWXX 1SHFA 1GRIA 1X6BA 4GLMA 2HCKA 1YCSB 3VRZA 1SEMA 3I9QA 3CQTA 2L3SA 1FYNA 1X2KA 3VS6A 4JJCA 1W1FA 4A63B 2KT1A 4RTYA 1RLPC 2J7IA 2M51A 1MUZA 1PWTA 1T3SA 2EYXA 3EHRA 1UHCA 1I1JA 4OMNA 1Y57A 1GCPA 2LQWA 2RF0A 2KRSA 1LCKA 4J9BA 2JS0A 4Z8AA 3UA6A 1UFFA 2ESWA 4X1VA 2A28A 3EG1A 2HEQA 1ZUYA 3M0PA 1G83A 1OEBA 2KR3A 2CUBA 2DBKA 1VYUA 2AK5A 1JU5C 2YDLA 3RBBB 2O9VA 4JPBW 4AG2C 2LJ0A 1ARKA 4RTWA 1OOTA 2DA9A 3NMZC 2VVKA 2J6FA 1YWPA 1PNJA 1U5SA 1GFCA 2CH4A 2DNUA 2C0TA 4RUGA 3R6NA 4GBQA 4D8DA 1M27C 1E7OA 2K6DA 1MV3A 2FPDA 1TG0A 1ZUKA 2VWFA 1G2BA 2GNCA 2KYBA 2DMOA 2PNIA 3EG2A 3ULRB 1AZEA 2A37A 2DL5A 1AVZC 2AZSA 1UHFA 2KRMA 3PVLA 1WI7A 2MCNA 1U06A 1PRLC 4E6RA 4F14A 1WLPB 2W10A 2EYZA 4IIOA 4K11A 1UG1A 4AFSC 4RTUA 1BB9A 3IQLA 1NYGA 2KROA 2F2WA 2DL8A 2KEAA 2FEIA 1YP5A 3O5ZA 2D0NA 1JQQA 1OPKA 1PHTA 2CUDA 2X3WD 3QWYA 1WXUA 2PZ1A 2QDLA 1EFNA 2YUNA 1TUCA 4OMMA 2RQVA 1BBZA 3SEMA 2BZ8A 2JS2A 2I0NA 1JEGA 2H8HA 1ZBJA 2D1XA 2FG0A 2LJ3A 4CC4B 1WFWA 1I0CA 1GCQA 1HD3A 1NLPC 4RTZA 2RN8A 4OMQA 4JZ4A 1ABOA 3GBQA 4F16A 3TSZA 1V1CA 2K79A 4AFZC 2RQRA 2K9GA 2FO0A 2EKHA 3VS7A 1B07A 1FMKA 3M0UA 3UA7A 2GQIA 2B86A 2L3QA 1SSHA 2BZYA 2A08A 2FRWA 4J9GA 4J9CA 1E6GA 1PRMC 2RMOA 1KSWA 1J3TA 2DX1A 1SHGA 3H0IA 1Y0MA 5HCKA 1CKAA 2P4RA 2AKKA 1Z9ZA 2EVRA 4AG1C 2HBWA 1WYXA 2KT8A 2RNAA 2JW4A 2J6KA 4DEYA 4J9HA 1H92A 2KYMA 4OMPA 3FJ5A 5IH2A 2GBQA 1WXBA 2EPDA 4HCKA 2L2PA 3VS3A 1ZSGA 1N5ZA 2O2OA 2HDAA 2KGTA 4HVWA 2OJ2A 5FWCA 2W0ZA 2DYBA 1ZUUA 4HXJA 4CC7A 1QCFA 2CDTA 2ABLA 1NEBA 3VS0A 2K2MA 2X3XD 3I5SA 2KXCA 2IIMA 2JT4A 4RTTA 2DVJA 3PVQA 1SRMA 1K0SA 2MIOA 2ROTA 1ZLMA 3UF4A 2EW3A 1RI9A 2GTJA 1JXMA 3REBB 2J6OA 2AKLA 4ORZA 1CKBA 3NGPA 1M3BA 2KNBB 2GTOA 1M3AA 2L3PA 2YSQA 1UGVA 2CREA 4QT7A 1ZX6A 4J9EA 4OMOA 2O31A 3A98A 2G6FX 2EQIA 2NWMA 1AD5A 1YWOA 2ENMA 2JXBA 2RQWA 2O88A 2YUOA 1E6HA 3SHWA 1K76A 1WX6A 2EBPA 4Y92A 4DEXA 1H8KA 1JXOA 2LJ1A 3UATA 4KRTA 1YNZA 4WCIA 1KJWA 2A36A 2E5KA 2J05A 1UJ0A 5IXBA 2LQNA 1BK2A 3EG3A 5ECAA 1M8MA 2K7AA 2YUPA 1YN8A 3M0TA 1VYTA 2RQTA 2ED1A 1VYVA 5I11A 5IHKA 3I35A 3TVTA 2BTTA 1IO6A 1PKTA 3NHNA 2JTEA 4FSSA 1K0XA 3I5RA 2FPFA 3LH5A 3PE0A 2JMAA 2HSPA 1AWWA 4CC2A 2L0AA 3U23A 4LUDA 5GJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWJ A;  2KBT A;  2KRN A;  4OML A;  1T0J A;  1OV3 A;  4ZNX A;  2K3B A;  1WIE A;  4Z89 A;  1QKX A;  4LUE A;  2DL3 A;  4Z88 A;  2PTK A;  2DBM A;  2SRC A;  1AWO A;  2DLP A;  4J9I A;  3TSW A;  1ABQ A;  1X27 A;  4JJD A;  1SPK A;  5L23 A;  1UTI A;  2DE0 X;  2YUQ A;  1BU1 A;  1QKW A;  3H0F A;  1KIK A;  3THK A;  1XOV A;  1K1Z A;  1QLY A;  1AZG B;  1S1N A;  4AFU C;  2KE9 A;  2RPN A;  2OI3 A;  3EGU A;  4JJB A;  1M30 A;  5FWB A;  1T3L A;  2F2X A;  4JZ3 A;  5GJW B;  2DIL A;  1OPL A;  5EC7 A;  1JO8 A;  2C0O A;  4LN2 A;  4ESR A;  1WA7 A;  2DRM A;  1RLQ C;  3H0H A;  1UE9 A;  1RUW A;  1UJY A;  4IIM A;  2SEM A;  4F17 A;  2CT4 A;  2EYY A;  4EIK A;  2EGC A;  2LCS A;  1TUD A;  4M4Z A;  5IXF A;  2DL7 A;  2EGE A;  1SRL A;  3ZL7 C;  5I22 A;  2DRK A;  1UEC A;  2XMF A;  2NUZ A;  2MOX A;  3EG0 A;  4RTX A;  1VA7 A;  4HVV A;  2DM1 A;  1HJD A;  2EYW A;  1NEG A;  2V1R A;  1GBR A;  1WXT A;  3C0C A;  1QWE A;  2JM9 A;  2C0I A;  3M0S A;  1NYF A;  2AZV A;  4R0K A;  2DF6 A;  1NG2 A;  1PKS A;  2O9S A;  1H3H A;  2OAW A;  3VRY A;  2YT6 A;  4RTV A;  2J06 A;  3RNJ A;  2F2V A;  3M0Q A;  2M0Y A;  1M3C A;  2CSI A;  2BZX A;  3VS2 A;  2CSQ A;  2RQU A;  2ED0 A;  5IHN A;  1GBQ A;  2KXD A;  2FRY A;  2JM8 A;  1X69 A;  1QWF A;  1X2Q A;  4D8K A;  2ROL A;  3H41 A;  3KFV A;  5IHI A;  2JMC A;  3EHQ A;  1UDL A;  2DJQ A;  3VS4 A;  3REA B;  2LX7 A;  1GL5 A;  2ECZ A;  4HVU A;  1W70 A;  1B3Q A;  2FPE A;  1AWX A;  4CC3 A;  1K9A A;  3JV3 A;  1W6X A;  1GCQ C;  1X6G A;  1CSK A;  1GFD A;  1AOJ A;  2GGR A;  2D8J A;  1WDX A;  2VKN A;  4J9D A;  4AFQ C;  1X43 A;  1KFZ A;  1UUE A;  1HSQ A;  1K4U S;  1MV0 B;  2CH4 W;  2V1Q A;  3VS1 A;  5FW9 A;  1A0N B;  2LNH B;  3NPF A;  4LE9 A;  3VS5 A;  1T0H A;  2LP5 A;  4J9F A;  1AEY A;  2CT3 A;  1U3O A;  1I07 A;  2LZ6 B;  2DL4 A;  1NLO C;  2EGA A;  4LNP A;  3M0R A;  2D8H A;  2LMJ A;  1NM7 A;  1Z9Q A;  3QWX X;  1SHF A;  1GRI A;  1X6B A;  4GLM A;  2HCK A;  1YCS B;  3VRZ A;  1SEM A;  3I9Q A;  3CQT A;  2L3S A;  1FYN A;  1X2K A;  3VS6 A;  4JJC A;  1W1F A;  4A63 B;  2KT1 A;  4RTY A;  1RLP C;  2J7I A;  2M51 A;  1MUZ A;  1PWT A;  1T3S A;  2EYX A;  3EHR A;  1UHC A;  1I1J A;  4OMN A;  1Y57 A;  1GCP A;  2LQW A;  2RF0 A;  2KRS A;  1LCK A;  4J9B A;  2JS0 A;  4Z8A A;  3UA6 A;  1UFF A;  2ESW A;  4X1V A;  2A28 A;  3EG1 A;  2HEQ A;  1ZUY A;  3M0P A;  1G83 A;  1OEB A;  2KR3 A;  2CUB A;  2DBK A;  1VYU A;  2AK5 A;  1JU5 C;  2YDL A;  3RBB B;  2O9V A;  4JPB W;  4AG2 C;  2LJ0 A;  1ARK A;  4RTW A;  1OOT A;  2DA9 A;  3NMZ C;  2VVK A;  2J6F A;  1YWP A;  1PNJ A;  1U5S A;  1GFC A;  2CH4 A;  2DNU A;  2C0T A;  4RUG A;  3R6N A;  4GBQ A;  4D8D A;  1M27 C;  1E7O A;  2K6D A;  1MV3 A;  2FPD A;  1TG0 A;  1ZUK A;  2VWF A;  1G2B A;  2GNC A;  2KYB A;  2DMO A;  2PNI A;  3EG2 A;  3ULR B;  1AZE A;  2A37 A;  2DL5 A;  1AVZ C;  2AZS A;  1UHF A;  2KRM A;  3PVL A;  1WI7 A;  2MCN A;  1U06 A;  1PRL C;  4E6R A;  4F14 A;  1WLP B;  2W10 A;  2EYZ A;  4IIO A;  4K11 A;  1UG1 A;  4AFS C;  4RTU A;  1BB9 A;  3IQL A;  1NYG A;  2KRO A;  2F2W A;  2DL8 A;  2KEA A;  2FEI A;  1YP5 A;  3O5Z A;  2D0N A;  1JQQ A;  1OPK A;  1PHT A;  2CUD A;  2X3W D;  3QWY A;  1WXU A;  2PZ1 A;  2QDL A;  1EFN A;  2YUN A;  1TUC A;  4OMM A;  2RQV A;  1BBZ A;  3SEM A;  2BZ8 A;  2JS2 A;  2I0N A;  1JEG A;  2H8H A;  1ZBJ A;  2D1X A;  2FG0 A;  2LJ3 A;  4CC4 B;  1WFW A;  1I0C A;  1GCQ A;  1HD3 A;  1NLP C;  4RTZ A;  2RN8 A;  4OMQ A;  4JZ4 A;  1ABO A;  3GBQ A;  4F16 A;  3TSZ A;  1V1C A;  2K79 A;  4AFZ C;  2RQR A;  2K9G A;  2FO0 A;  2EKH A;  3VS7 A;  1B07 A;  1FMK A;  3M0U A;  3UA7 A;  2GQI A;  2B86 A;  2L3Q A;  1SSH A;  2BZY A;  2A08 A;  2FRW A;  4J9G A;  4J9C A;  1E6G A;  1PRM C;  2RMO A;  1KSW A;  1J3T A;  2DX1 A;  1SHG A;  3H0I A;  1Y0M A;  5HCK A;  1CKA A;  2P4R A;  2AKK A;  1Z9Z A;  2EVR A;  4AG1 C;  2HBW A;  1WYX A;  2KT8 A;  2RNA A;  2JW4 A;  2J6K A;  4DEY A;  4J9H A;  1H92 A;  2KYM A;  4OMP A;  3FJ5 A;  5IH2 A;  2GBQ A;  1WXB A;  2EPD A;  4HCK A;  2L2P A;  3VS3 A;  1ZSG A;  1N5Z A;  2O2O A;  2HDA A;  2KGT A;  4HVW A;  2OJ2 A;  5FWC A;  2W0Z A;  2DYB A;  1ZUU A;  4HXJ A;  4CC7 A;  1QCF A;  2CDT A;  2ABL A;  1NEB A;  3VS0 A;  2K2M A;  2X3X D;  3I5S A;  2KXC A;  2IIM A;  2JT4 A;  4RTT A;  2DVJ A;  3PVQ A;  1SRM A;  1K0S A;  2MIO A;  2ROT A;  1ZLM A;  3UF4 A;  2EW3 A;  1RI9 A;  2GTJ A;  1JXM A;  3REB B;  2J6O A;  2AKL A;  4ORZ A;  1CKB A;  3NGP A;  1M3B A;  2KNB B;  2GTO A;  1M3A A;  2L3P A;  2YSQ A;  1UGV A;  2CRE A;  4QT7 A;  1ZX6 A;  4J9E A;  4OMO A;  2O31 A;  3A98 A;  2G6F X;  2EQI A;  2NWM A;  1AD5 A;  1YWO A;  2ENM A;  2JXB A;  2RQW A;  2O88 A;  2YUO A;  1E6H A;  3SHW A;  1K76 A;  1WX6 A;  2EBP A;  4Y92 A;  4DEX A;  1H8K A;  1JXO A;  2LJ1 A;  3UAT A;  4KRT A;  1YNZ A;  4WCI A;  1KJW A;  2A36 A;  2E5K A;  2J05 A;  1UJ0 A;  5IXB A;  2LQN A;  1BK2 A;  3EG3 A;  5ECA A;  1M8M A;  2K7A A;  2YUP A;  1YN8 A;  3M0T A;  1VYT A;  2RQT A;  2ED1 A;  1VYV A;  5I11 A;  5IHK A;  3I35 A;  3TVT A;  2BTT A;  1IO6 A;  1PKT A;  3NHN A;  2JTE A;  4FSS A;  1K0X A;  3I5R A;  2FPF A;  3LH5 A;  3PE0 A;  2JMA A;  2HSP A;  1AWW A;  4CC2 A;  2L0A A;  3U23 A;  4LUD A;  5GJV B; 
#chains in the Genus database with same CATH topology
 1TS9 A;  4Z89 A;  1QKX A;  4LUE A;  1IGQ A;  4Z88 A;  3L1A A;  3V7R A;  2SRC A;  2BKD N;  5GAM e;  1SPK A;  3QG1 A;  4BI4 A;  1BU1 A;  1QKW A;  2VGN A;  1KIK A;  1VQO A;  2IVW A;  4M75 E;  4J6W A;  3HSB A;  1N8R R;  4AFU C;  3EGU A;  4JJB A;  1VQP Q;  4JRI A;  3MPU B;  1M30 A;  1SKU B;  4MZM A;  5GAN 3;  5FWB A;  1PG5 B;  2VV5 A;  4JZ3 A;  2GCX A;  2DIL A;  1VOM A;  4FT2 A;  1WA7 A;  1Q81 R;  3JCM f;  1G3Y A;  2SEM A;  2CT4 A;  3BY7 A;  4II1 A;  3KBG A;  2HZY A;  2RB6 A;  5IXF A;  2DL7 A;  1BIB A;  3ZL7 C;  2XMF A;  1MMG A;  1W2B A;  2NUZ A;  4PLI A;  4BDY A;  3NTK A;  3QII A;  4RTX A;  1VA7 A;  5GAO p;  2D0Q B;  3JB9 J;  2EYW A;  1NEG A;  1XQH A;  3VYG A;  1BIA A;  1K73 C;  1VQO Q;  2CS7 A;  2C0I A;  4ZTF A;  4M78 B;  3JCM b;  1PKS A;  4M75 F;  3H8Z A;  1H3H A;  2OAW A;  4BE2 A;  4C0Z A;  1Q7Y U;  3BE3 A;  2XDP A;  2FB7 A;  3MO8 A;  4M7D E;  2Y4X A;  4C5I A;  3PIO A;  1I81 A;  2BZX A;  3VS2 A;  1FXX A;  5IHN A;  1GBQ A;  1D1A A;  2FRY A;  1WHM A;  3RDV A;  1QWF A;  3L2Q A;  2ROL A;  3EGD B;  3H41 A;  1OYX A;  3OA6 A;  1X6O A;  2CZ7 B;  4L5G A;  3L2U A;  3VS4 A;  1V76 A;  4XTY A;  3LX7 A;  2ECZ A;  2A7Y A;  1W70 A;  3A8H B;  1AWX A;  2JVV A;  1YHQ A;  1W6X A;  1GCQ C;  3C4S A;  3GPL A;  3J7A F;  4M7D A;  3CPW P;  2ZZD A;  2MWO A;  2KVQ G;  3JCM e;  4J9D A;  3OW2 S;  1VQ9 T;  1D3B A;  1RI0 A;  3M4Y A;  2HBP A;  1NPP A;  2D9T A;  3MET A;  4IUT A;  3L2R A;  3QJ6 A;  1UGP B;  3AT1 B;  3P8D A;  5GAO q;  1MNE A;  4M7D F;  1K9M C;  4J6X A;  1YIT T;  4F7U E;  1OZ3 A;  4J9F A;  4EMH A;  3CCQ A;  5J39 A;  3JB9 D;  1I07 A;  2HQX A;  4IUP A;  1NLO C;  1JJ2 P;  3FIF A;  3M57 A;  1YJ9 A;  1Z9Q A;  4GLK A;  1SHF A;  1X6B A;  3JB9 I;  5GAO r;  3VRZ A;  5KE2 A;  5LJ5 d;  3OBY A;  1YHQ Q;  1W1F A;  2KT1 A;  4M77 A;  3CCM T;  1O75 A;  1VQ6 T;  1RLP C;  2EKO A;  4LDW A;  2J7I A;  4OVA A;  4PJO G;  2EYX A;  4MDX A;  4F7U A;  2K2V A;  1VQ5 Q;  2E64 A;  4NL3 A;  2LQW A;  1QVG S;  1N8R U;  2KRS A;  1TU0 B;  4KGV B;  1VQ7 A;  4Z8A A;  5GAO n;  2K4Y A;  2CZ1 B;  3BFM A;  5KCO A;  3EG1 A;  3UDC A;  4C92 E;  2KQW A;  3OYG A;  3ZFJ A;  1Q81 U;  4HT9 A;  4F7U F;  5A0D A;  1BI3 A;  1M1K R;  2OX7 A;  2CUB A;  2QYZ A;  2ZPI B;  4B9X A;  2XD0 A;  2YDL A;  4TVR A;  1QVF P;  4E7L A;  2LJ0 A;  2E3H A;  3G71 Q;  3CPF A;  1U5S A;  3JCM g;  3R6N A;  3A1P A;  2QEX T;  1KHI A;  2H3E B;  1C0M A;  2O4X A;  5KYX A;  2AT1 B;  4C92 A;  1G2B A;  5LJ3 e;  4O6J A;  3EG2 A;  2EQU A;  3G6E A;  2A37 A;  4LD9 K;  3MCA B;  2QG9 B;  1WJQ A;  3CEY A;  4WTO B;  2XID A;  4M7A D;  1YJW Q;  2KRM A;  1WLP B;  4IIO A;  1LNX A;  4RTU A;  4C92 F;  5GAN j;  1NYG A;  1JQQ A;  1OPK A;  1PHT A;  3QWY A;  2X3W D;  3M54 A;  2PZ1 A;  2VXE A;  3E9G A;  2QDL A;  4AT1 B;  1TUC A;  5HK0 A;  3F70 A;  2HL5 C;  2YRC A;  2DO3 A;  2I0N A;  2H8H A;  5LL6 S;  3LH0 A;  2P0Q A;  4N4H A;  1N9S A;  2FG0 A;  2DJZ A;  5GAN d;  1I0C A;  4C8Q A;  4OMQ A;  2JJ9 A;  1ABO A;  4XU1 A;  1KQS S;  3TSZ A;  4PLL A;  5CVI A;  3X26 B;  2EKH A;  4ZGD B;  4KGX B;  1WHL A;  4M75 B;  3CME A;  3LW5 E;  3CCL T;  2XU8 A;  3OS1 A;  3UA7 A;  1S72 T;  2L3Q A;  1SSH A;  2FL7 A;  4C8Q F;  2A08 A;  1NJI R;  1ZSZ C;  2IG0 A;  4FU6 A;  2DX1 A;  1WNL A;  4ZN3 A;  1Y0M A;  3LWH A;  2P4R A;  3J80 E;  2HBW A;  2RNA A;  3JCM P;  4XU3 A;  2J6K A;  2KYM A;  3INZ A;  4X34 A;  3FJ5 A;  1UB4 A;  4GY5 A;  4C5G A;  1B34 A;  2DXB A;  2K57 A;  3VS3 A;  2ATC B;  3CPW A;  3HFO A;  4RKU E;  2O2O A;  4ZGE B;  4LDY A;  1BCM A;  1QQJ A;  4HVW A;  2F69 A;  2EQM A;  4BD3 A;  2FZG B;  3T9N A;  4HXJ A;  4P5N A;  3DB4 A;  3OYA A;  3QBY A;  2P84 A;  2M1H A;  3RR6 A;  2K2M A;  5GAN 4;  4HA8 A;  1PSF A;  2CP0 A;  1PM3 A;  4PL6 A;  3V8L A;  1C1A A;  3CD6 T;  2DVJ A;  7AT1 B;  2ROT A;  5LJ5 h;  1JJ2 A;  2GTJ A;  4M7D B;  3REB B;  2RJD A;  2J6O A;  1CKB A;  1M1K U;  4PKC C;  2L3P A;  2K5L A;  1WHJ A;  2YSQ A;  3QHS A;  4FYX B;  3MKD A;  2EQI A;  2NWM A;  5CCA A;  4J5Y A;  1VQ6 A;  2R57 A;  2ENM A;  2RQW A;  1H64 1;  1JB0 E;  4JRK A;  1RAF B;  1C6V X;  1MMA A;  1VQ9 Q;  1E6H A;  4DA4 A;  4Y28 E;  1K73 R;  1YNZ A;  1ZA2 B;  2JUF A;  2V26 A;  1YIT Q;  2K3X A;  3VYH B;  4XTZ A;  4A4E A;  4KUD K;  3MP1 A;  1YIJ T;  2MPX C;  4C0G A;  2LQN A;  1G3W A;  1YI2 A;  4J7I A;  3CCS T;  1M8M A;  1M2V A;  2E12 A;  1QVF A;  2RQT A;  4M78 A;  3C12 A;  4A4G A;  1YJN A;  4F7U B;  4BE0 A;  3CCM Q;  3JB9 G;  1VQ6 Q;  4FSS A;  2QEX A;  1Q82 C;  2HQE A;  1WJR A;  2QA4 T;  1X01 A;  4N4G A;  4ELY C;  3CCV A;  2G3R A;  5FRN A;  2HSP A;  1W2B P;  4LUD A;  2EIF A;  5GJV B;  3JCM J;  2XDD A;  1PCX A;  1AWJ A;  2KRN A;  4FM4 B;  4ZNX A;  2K3B A;  5FRM A;  3SWN B;  2ZAE A;  2X4W A;  2DLP A;  1X27 A;  4PJM A;  2RJF A;  1OQK A;  1UTI A;  2DE0 X;  2VUB A;  3TCJ A;  3H0F A;  3THK A;  4LXC A;  1QLY A;  2RJE A;  1AZG B;  1K9M R;  1G8X A;  1NJI U;  2COZ A;  2RPN A;  2EJ9 A;  1RAC B;  2Y4Y A;  2Y90 A;  2O4X B;  2QTV A;  3VUB A;  4C92 B;  4XU2 A;  3MHX A;  1OPL A;  1LVK A;  2DRM A;  2QEX Q;  1UE9 A;  1UJY A;  4IIM A;  2E3I A;  3CCV Q;  3CC2 A;  2EYY A;  4EIK A;  2EGC A;  2LCS A;  2GF7 A;  4PJN A;  1TUD A;  4M4Z A;  4A4H A;  2E10 A;  1SRL A;  1SG5 A;  5I22 A;  3CPW S;  4PJO A;  4E7K A;  1UEB A;  1S72 A;  4B9W A;  4IUV A;  3EG0 A;  4HVV A;  1HJD A;  3GIB A;  1IHV A;  2V1R A;  1IGU A;  1WXT A;  1MGQ A;  5FU7 B;  2AZV A;  2CGH A;  4OF1 A;  5CKH A;  2DF6 A;  1NG2 A;  1QCO A;  3L42 A;  3S6W A;  4PJO F;  4FW2 A;  2DER A;  1PC0 A;  4RTV A;  2LT1 A;  2J06 A;  3RNJ A;  3SDZ A;  2AHJ B;  2FZC B;  2F2V A;  3M0Q A;  1JJ2 S;  1M3C A;  2VXF A;  3OYE A;  2NUP A;  2RK1 A;  3FB9 A;  1VQL T;  4RCB A;  2LRQ A;  3OS0 A;  4QW2 A;  3EHQ A;  1PD1 A;  1UDL A;  3CCL Q;  3JRZ A;  1S72 Q;  1IXD A;  2JTM A;  1K73 U;  2HL3 A;  3CD6 A;  3CC7 T;  1FX7 A;  1VQP A;  2V8J A;  4KBM B;  3CC4 T;  3JV3 A;  3OYF A;  2M0O A;  3JAM E;  2VYT A;  4RG2 A;  4A4K A;  4ANJ A;  1B7T A;  2DET A;  2WSE E;  1WDX A;  2VKN A;  4FL6 A;  1KFZ A;  3RKX A;  1MMN A;  4RMO A;  1K4U S;  4OGE A;  1FWZ A;  2V1Q A;  1OZ2 A;  5FW9 A;  3EH1 A;  1A0N B;  2PQW A;  1QVF S;  4FYY B;  1T0H A;  2LP5 A;  3QXE B;  4NS5 A;  2WSC E;  1M2O A;  2M16 A;  4L59 A;  1ZA1 B;  3BDL A;  2LZ6 B;  2DKG A;  5CKF A;  3LYI A;  3QWX X;  4MDW A;  5D6Y A;  1GRI A;  4GLM A;  4A4F A;  3CD6 Q;  2HCK A;  2P4T A;  3I9Q A;  8ATC B;  1FYN A;  2R5M A;  1V29 B;  4JJC A;  4X9C A;  4RTY A;  2M51 A;  3QDR B;  3EFR A;  2QK0 A;  2DXT A;  5KYY A;  4FSX A;  3OS5 A;  1UHC A;  5DLQ E;  1DJ7 B;  1QP3 A;  1K9M U;  1Y57 A;  1GCP A;  2I2L A;  2QQR A;  4J9B A;  2JS0 A;  1UFF A;  2LVM A;  2QA4 A;  2ZPF B;  3EAE A;  5GMK e;  1KHC A;  5A2Q E;  2EJG A;  1M9S A;  4M75 A;  2HEQ A;  3M0P A;  1IRX A;  2WAC A;  4WF2 A;  2KR3 A;  4LDV A;  1VYU A;  1M2V B;  2DXC A;  1M8V A;  3RBB B;  4KH1 B;  1M90 C;  4AG2 C;  3JCM X;  3QYG B;  1ARK A;  4RTW A;  1KQ1 A;  1YIJ Q;  1ZHI A;  3CCS Q;  1GFC A;  4RUG A;  2C0T A;  4D8D A;  1D0X A;  2CP7 A;  5D6X A;  2F5K A;  1ZUK A;  3OYJ A;  1LPL A;  4UC4 A;  2GNC A;  2DMO A;  1G3S A;  3P8B B;  1I8F A;  4RCC A;  1KD1 C;  2QA4 Q;  3HHT B;  2AZS A;  1MND A;  1U06 A;  2DZ9 A;  3HRS A;  1KC8 R;  2QAZ A;  4BUG A;  3DLM A;  3OMG A;  2F2W A;  4ELZ C;  2KEA A;  2FEI A;  2RHZ A;  3PGG A;  2K5I A;  2MWP A;  4OB1 B;  3V8K A;  3CMA T;  4OMM A;  3SEM A;  3QZ5 B;  3FLG A;  3TU4 K;  1TH7 A;  2HNI A;  4JRP A;  2RM4 A;  1VQ5 A;  2LJ3 A;  1WFW A;  2CP5 A;  1GCQ A;  5LJ5 j;  5M9O A;  1NLP C;  4C0D B;  2DFU A;  4JZ4 A;  4JS4 A;  5KCH A;  5LJ5 f;  3TRE A;  3A8G B;  2K79 A;  2CZ0 B;  2JTF A;  2FO0 A;  3LGL A;  2KK4 A;  3VS7 A;  1B07 A;  4PJO B;  2COY A;  5GAM h;  2XDB A;  2QTX A;  5CKD A;  1VQL A;  2GQI A;  1BYM A;  5CKB A;  2LQK A;  4J9G A;  4J9C A;  3FDR A;  1E6G A;  1Q82 R;  3G71 A;  1G5V A;  4R56 A;  4M77 C;  3CC7 A;  2C06 A;  1WYX A;  2KT8 A;  1VQ4 T;  3FJP A;  2X4J A;  3CCE T;  1RAH B;  4M77 D;  1WXB A;  2DTI A;  1QP2 A;  4XTW A;  4HCK A;  3JB9 F;  3EG9 A;  2HDA A;  2QQS A;  2NUP B;  1LJO A;  1M4Z A;  1YJW A;  3UWN A;  5FWC A;  2W0Z A;  1VIF A;  4EMK C;  2RHU A;  1RL2 A;  5AT1 B;  2BE7 D;  2LNV A;  4QQD A;  4A54 A;  3SFM A;  2ABL A;  3X20 B;  1XNI A;  4F04 B;  3SWN A;  2BUD A;  3PTA A;  1VQL Q;  4RTT A;  4OB2 B;  1SRM A;  1K0S A;  1M1G A;  1ZLM A;  2EW3 A;  1RI9 A;  3A8M B;  3CCR T;  2JZ2 A;  4IUU A;  5AYF A;  1JXM A;  4M7A E;  3NGP A;  2E1H A;  1M3B A;  3CC7 Q;  3FC3 A;  1UGV A;  1W2B S;  3CC4 Q;  3WVE B;  3HP9 A;  2E41 A;  5FRO A;  2P0K A;  1OX9 A;  1XJW B;  1R77 A;  1YWO A;  4BY6 B;  4M7A C;  2O88 A;  3SHW A;  1K76 A;  3G1J A;  2LJ1 A;  3UAT A;  1WPY A;  4WCI A;  3V7S A;  5HK3 A;  2A36 A;  5GAN f;  3QPH A;  2LTO A;  3ZBD A;  5CQX A;  4A53 A;  1NBE B;  2MAM A;  2LC4 A;  3EFS A;  1BK2 A;  1BI2 A;  1KC8 U;  1ZBX A;  3EG3 A;  2EWN A;  2YUP A;  2VGM A;  2DZC A;  2ZPG B;  3JCM h;  5A0L A;  1VYV A;  2O01 E;  5IHK A;  5KYY B;  3I35 A;  1M5Q 1;  2YRD A;  1PKT A;  2JTE A;  1K0X A;  4C8Q D;  2FPF A;  3SD4 A;  4OGC A;  4C5E A;  3PE0 A;  2DEQ A;  1OI1 A;  1WZO A;  3KUF A;  2L0A A;  3U23 A;  3UT1 A;  1Y96 A;  4OML A;  2HKQ B;  1WQ7 A;  4JLG A;  2OTJ T;  1OV3 A;  2BE9 B;  1WIE A;  3OYK A;  1OUL A;  2PTK A;  1I5L A;  1RAA B;  2CP2 A;  4JJD A;  1IZ6 A;  3C95 A;  4E7I A;  1WJS A;  2ZCF B;  4N4I A;  1XOV A;  3URG A;  3MEU A;  2DD4 A;  2KE9 A;  4NOY A;  2OI3 A;  5LJ5 g;  1KQ2 A;  3ER0 A;  1Q82 U;  1VQ9 A;  1T3L A;  1P92 A;  4J7F A;  5D6W A;  2RHX A;  1R0B G;  4PFP A;  5A0G A;  3QDF A;  3VUZ A;  2DVE A;  2B8A A;  4LN2 A;  2GFU A;  4LDU A;  3H0H A;  5IT9 E;  1RUW A;  4PJJ A;  2E5Q A;  5I21 A;  5KYN A;  1H3Z A;  5GAN e;  1YIT A;  2L89 A;  1FMW A;  3OSV A;  2CZ6 B;  9ATC B;  2EGE A;  2QQB A;  4C0F A;  2DRK A;  2X35 A;  2KDS A;  3RER A;  1QCN A;  1KC8 C;  3RMS A;  1GBR A;  3C0C A;  4EPC A;  3X25 B;  3CCM A;  2JM9 A;  3CMA Q;  4R0K A;  2O9S A;  2X9H A;  2COW A;  5C0M A;  2EFI A;  5LJ3 h;  3JSC A;  2XKO C;  5D7U A;  2DIQ A;  3BDU A;  1F1B B;  3D7S B;  3PFS A;  4HCZ A;  1M90 R;  4X9D A;  3RKW A;  2EQJ A;  2PUK B;  2RQU A;  2XK0 A;  2JM8 A;  1LOJ A;  1X2Q A;  3QZ9 B;  3KFV A;  3QYH B;  4JUV A;  3CCU T;  5IHI A;  3GF5 A;  4XAX B;  3VKI A;  3E19 A;  3REA B;  1GL5 A;  4HVU A;  1B3Q A;  1QVG P;  1WHK A;  2A3L A;  4CC3 A;  3CCR A;  2QQ9 A;  1X6G A;  1CSK A;  1KD1 R;  1GFD A;  1QVP A;  4M78 D;  5FU6 C;  4PJL A;  5DM7 R;  4BE1 A;  2GGR A;  1TWB A;  3EG9 B;  4Y91 A;  1VQ4 Q;  2D8J A;  3CBO A;  4Q5W A;  5KE3 A;  4FW1 A;  3G7Z A;  3MP6 A;  2VC8 A;  3CCE Q;  1UGR B;  2LCL A;  1X43 A;  1HSQ A;  2XIC A;  4E7J A;  4XU0 A;  5DLO A;  5GAN g;  2PVO B;  3CBM A;  3A5Z B;  3S3M A;  1N9R A;  2PVD B;  2HAX A;  3GP8 A;  2LNH B;  2K5F A;  3L2Z A;  3VS5 A;  1VQ8 T;  5CR2 A;  4IUQ A;  2CT3 A;  3QO3 A;  4O5V A;  1U3O A;  2VAS A;  4M77 G;  3JCM c;  2CKK A;  3L2W A;  2DL4 A;  3MJX A;  2D8H A;  1NM7 A;  4QVD A;  2M02 A;  1YCS B;  1SEM A;  3WVD B;  3CCR Q;  3VS6 A;  3OY9 A;  3OYI A;  5GAN 2;  2KSS A;  4QVZ A;  2KAF A;  4MML A;  2KI7 A;  3OSS C;  1T3S A;  3EHR A;  2DD5 A;  4OMN A;  2ZGW A;  1YFN A;  4BI3 A;  4B6M A;  2ESW A;  2RHY A;  4ME7 A;  2A28 A;  1JRI A;  2RI2 A;  3CCL A;  4EDU A;  1O9S A;  2OTJ A;  4PJO D;  1D0Y A;  2L5Q A;  4N0A C;  4JPB W;  4QQ6 A;  4M7A G;  3I56 T;  1YWP A;  1D09 B;  5GAN 8;  2F1L A;  1HXD A;  1PNJ A;  2F5T X;  5J26 A;  2X4X A;  5GAM j;  1YBY A;  2DNU A;  5GAM f;  1VQK T;  1E7O A;  2ZPH B;  1MV3 A;  2FPD A;  1VQN T;  2LT4 A;  2VWF A;  4J83 A;  2E6N A;  5I2S A;  2PNI A;  1Y96 B;  1K8A C;  4DOV A;  2DL5 A;  2XHC A;  4KUI A;  4BDZ A;  1VQM T;  1Q86 U;  1AVZ C;  1GXI E;  3PVL A;  3HL8 A;  2QDY B;  1PRL C;  5GAM d;  2W10 A;  2EYZ A;  3N5B B;  2KY9 A;  3CCQ T;  3RES A;  5HY6 A;  1M90 U;  2OTJ Q;  3O5Z A;  3FEO A;  3E9F A;  5C6S A;  2CUD A;  5IAY A;  1YJ9 T;  1ZSZ B;  4C8Q G;  2RQV A;  2BZ8 A;  2JS2 A;  2FZK B;  1JEG A;  2RI5 A;  3JB9 H;  2RH2 A;  1RAI B;  3OYD A;  1PSE A;  3PMI A;  2E70 A;  4CC4 B;  3LWI A;  3A8L B;  2A0F B;  2KMT A;  2RN8 A;  3ASK A;  2YLB A;  1KD1 U;  4LD6 A;  3GBQ A;  4F16 A;  1V1C A;  2K3Y A;  1VQ7 T;  2RQR A;  3M5A A;  5J3B A;  3OYN A;  3VJP A;  1FMK A;  4NL2 A;  2QXF A;  2B86 A;  3X28 B;  3EFO B;  5CQY A;  1U1T A;  1YIJ A;  4E47 A;  1PRM C;  3CCU A;  3CCS A;  1SHG A;  3E1S A;  4JRQ A;  2EVR A;  5GMK m;  2E6Z A;  3ME9 A;  3G4S T;  1QVG A;  2JW4 A;  4DEY A;  1OU8 A;  4J9H A;  1H92 A;  2L8D A;  4OMP A;  5IH2 A;  2GBQ A;  2L2P A;  1N5Z A;  4MZT A;  2KGT A;  2OJ2 A;  1PD0 A;  4DBF A;  2H3J A;  2JOY A;  4M75 C;  1QCF A;  3G6E T;  4XTX A;  1Q86 C;  3HPW A;  3CBP A;  1NEB A;  3OYC A;  3NTI A;  1RAE B;  4M75 D;  4CI0 C;  1VQ8 A;  2DK3 A;  3PNW C;  2IIM A;  2JT4 A;  4VUB A;  3P8H A;  2EYQ A;  4XTU A;  2HD0 A;  5GMK l;  4KH0 B;  3CCU Q;  3HTR A;  3KXT A;  5I2M A;  3JCM d;  2KNB B;  2HQH A;  2P0P A;  2GTO A;  2L3R A;  3QJY A;  1UGS B;  2CRE A;  3C94 A;  1ZX6 A;  4J9E A;  4OMO A;  4QT7 A;  5GMK i;  2O31 A;  2NLU A;  2RO0 A;  3RUX A;  2JXB A;  3OYB A;  2NYS A;  2YUO A;  4ZGJ B;  5FU6 B;  4FIB A;  3OBW A;  4PFO A;  3HFN A;  2EBP A;  4Y92 A;  4DEX A;  1Q95 G;  1JXO A;  4D6W A;  2YXY A;  2BIV A;  4M78 G;  8AT1 B;  3CCJ T;  3M55 A;  2EJF A;  2E5K A;  2HSE B;  3CME T;  1VQ8 Q;  2J05 A;  3MEV A;  1D1B A;  2QAS A;  5IXB A;  2E65 A;  3PT9 A;  3OB9 A;  3LGF A;  1G3T A;  2R5A A;  4M7D C;  3TEE A;  2LX9 A;  3S3O A;  1NE8 A;  5GAM g;  4QQG A;  4R55 A;  4M7D D;  5ECA A;  1BKB A;  3M0T A;  3HRT A;  1TXQ A;  3NFC A;  2NUT A;  2ED1 A;  3I56 A;  2ZPB B;  3BW1 A;  1KQS A;  2V8K A;  3TVT A;  2XI9 A;  4V2S A;  4QKU A;  1IO6 A;  3NHN A;  1VQK A;  1VQN A;  2HMA A;  4BI8 B;  2MYS A;  4CC2 A;  4KT0 E;  4M77 E;  2KBT A;  3VU3 C;  1T0J A;  1VQM A;  5LJ3 j;  1TSF A;  2MI6 A;  2DL3 A;  5LJ3 f;  2DBM A;  1BI0 A;  1AWO A;  3MP8 A;  3Q1J A;  4J9I A;  4MZP A;  3TSW A;  1ABQ A;  5L23 A;  2YUQ A;  3CC4 A;  2FVU A;  5CK9 A;  1R0C B;  1K1Z A;  3EGX A;  5KYW A;  1S1N A;  3I56 Q;  2QGG A;  5L8R E;  5LJ3 d;  4L6V 5;  2F2X A;  5GJW B;  4DQ2 A;  5EC7 A;  1BCO A;  1JO8 A;  2C0O A;  5GMK h;  3CXC P;  4ESR A;  1RLQ C;  1VQK Q;  3OYH A;  1Q7Y C;  2E4H A;  1VQN Q;  1TOV A;  4F17 A;  4HT8 A;  1ZQ1 A;  3SWN C;  4M77 F;  1RAG B;  4EMK A;  1VQM Q;  1UEC A;  4ZTJ A;  3LLR A;  1N27 A;  4Z02 A;  3I55 T;  2MOX A;  1MMD A;  3A8O B;  3M4G A;  4J8O A;  3CCQ Q;  5GAO m;  2YRV A;  2DM1 A;  2OTL T;  3JCM V;  1X75 C;  1YI2 T;  5LJ5 e;  1Y71 A;  1QWE A;  3S3N A;  1YJ9 Q;  3M0S A;  3GOX A;  1NYF A;  4C92 C;  3WXM B;  3G4S A;  1YJN T;  3TQ7 P;  4JJN K;  4EMG A;  3UPU A;  4C92 D;  3VRY A;  3H9N A;  4PNO A;  2YT6 A;  3X24 B;  4OB3 B;  1AHJ B;  2M0Y A;  1QW1 A;  2CSI A;  3PMT A;  4FYW B;  3CCV T;  2CSQ A;  2ZPE B;  4OMF B;  4M7A A;  2ED0 A;  4FT4 A;  4DOW A;  2KXD A;  1VQ7 Q;  3M58 A;  1X69 A;  4D8K A;  4C8Q E;  2JMC A;  5GAO l;  2WSF E;  3RIR A;  2DJQ A;  1KG1 A;  2LX7 A;  2FPE A;  5FU7 C;  1IB8 A;  4M7A F;  1FMV A;  4OP0 A;  1K9A A;  4DBH A;  1K8A R;  2QI2 A;  4C8Q C;  2D6F A;  1AOJ A;  3V7C A;  1AT1 B;  3G4S Q;  4BB7 A;  4AFQ C;  1XTD A;  1UUE A;  3L2V A;  1WQW A;  2IPO B;  4HCB A;  5GAN 6;  2OAU A;  2YHT A;  1MV0 B;  2CH4 W;  4KUL A;  3VS1 A;  3QUI A;  4PK4 A;  3NPF A;  1HK9 A;  5KYU A;  1U8R A;  1N8R C;  4LE9 A;  3CC2 T;  1M1F A;  2DTH A;  2FYK A;  1RAB B;  3G6E Q;  1AEY A;  3CCJ A;  2EGA A;  4LNP A;  4E2F B;  3M0R A;  2LMJ A;  1Q81 C;  1UGQ B;  3CMA A;  4XQ3 A;  1ZSZ A;  3HRU A;  4CRI A;  3CQT A;  1U1S A;  2GQV A;  2L3S A;  1X2K A;  4A63 B;  4MMK A;  3RMQ A;  1OU9 A;  4M75 G;  2RD1 A;  1MUZ A;  2DPP B;  1PWT A;  2X51 A;  1RAD B;  1I1J A;  2DEU A;  4DBQ A;  2RF0 A;  1LCK A;  1OX8 A;  3UA6 A;  5LJ3 g;  2CYZ B;  4X1V A;  4JDS A;  4JLI A;  2MF2 A;  4XK8 E;  1ZUY A;  3OW2 P;  4J6Y A;  1G83 A;  1OEB A;  3PIP A;  3EFO A;  2DBK A;  2GFA A;  2DTO A;  3CCJ Q;  2AK5 A;  1JU5 C;  2M9U A;  3CME Q;  1W4S A;  1R8O B;  2O9V A;  2NUT B;  1VQ4 A;  1OOT A;  1VQP T;  3OS2 A;  2DA9 A;  3NMZ C;  4IKF A;  2VVK A;  1I4K 1;  2J6F A;  4YTL A;  5HKC A;  3CCE A;  3V8J A;  3OYY A;  1Y7X A;  1Q86 R;  4E7S A;  1VUB A;  2MMP A;  2CH4 A;  1NPR A;  4GBQ A;  3AHU A;  4DBR A;  1M27 C;  2K6D A;  2LQ8 A;  1D3B B;  1TG0 A;  3OQ5 A;  3M59 A;  2CP6 A;  3GLX A;  2KYB A;  3GNG A;  4RG8 A;  3ULR B;  4M78 E;  3CXC A;  2XG8 D;  3DLL A;  1AZE A;  2RJC A;  4M7D G;  1TTH B;  1UHF A;  2PVG B;  1WI7 A;  2MCN A;  4E6R A;  4F14 A;  6AT1 B;  4K11 A;  4AFS C;  1UG1 A;  1BB9 A;  3IQL A;  5FLX E;  2KRO A;  4M78 C;  2DL8 A;  1YP5 A;  2D0N A;  1VQO T;  4LDX A;  3I55 A;  1WXU A;  2YUN A;  1EFN A;  3EGX B;  5KYW B;  1BBZ A;  5CKE A;  2OTL A;  3M53 A;  1ZBJ A;  2D1X A;  4M77 B;  4OB0 B;  1N6A A;  3OMC A;  1VIE A;  2V8I A;  2X4Y A;  1YCY A;  2JNG A;  1HD3 A;  4RTZ A;  1K8A U;  1HYO A;  3DB3 A;  5IN1 A;  2RK2 A;  4JS5 A;  2PUO B;  4AFZ C;  2Z0W A;  3JCM W;  2K9G A;  4EMK B;  1D1C A;  1SSF A;  4M78 F;  4XTV A;  5EG2 A;  4ZN1 A;  3M0U A;  2FHD A;  4F7U G;  2BZY A;  3QSU A;  1WHH A;  2FRW A;  2RMO A;  3EGD A;  1KSW A;  1NZ9 A;  1J3T A;  3H0I A;  5HCK A;  3I55 Q;  1CKA A;  2AKK A;  1Z9Z A;  4AG1 C;  1D0Z A;  1KK7 A;  3M56 A;  2OTL Q;  1YI2 Q;  3O8V A;  1M1K C;  2R58 A;  2EPD A;  4PJO E;  4C0D C;  3GNF B;  2YWW A;  1ZSG A;  5GAN 5;  5GAN h;  1YJN Q;  5KYX B;  2DYB A;  1ZUU A;  4M7A B;  5KH6 A;  4CC7 A;  4PJO C;  2CDT A;  4ATO A;  2YLC A;  3FRN A;  3VS0 A;  3DKM A;  3RKY A;  2X3X D;  4PFZ A;  3H6Z A;  3I5S A;  2KXC A;  2JN0 A;  3SB2 A;  1SF9 A;  4C92 G;  2EAY A;  2RA2 A;  3PVQ A;  1KQS P;  2MIO A;  2QGF B;  3UF4 A;  5CAI A;  1YHQ T;  1EX4 A;  2LCC A;  1Y07 A;  1EIF A;  2AKL A;  4ORZ A;  1Q7Y R;  4QVC A;  5CO7 A;  2EQK A;  1M3A A;  2MK5 A;  4N0A A;  2HKN A;  3OYL A;  3A98 A;  2G6F X;  1VQ5 T;  4IUR A;  1AD5 A;  1I5O B;  3E2U A;  1WGS A;  1TUG B;  4KGZ B;  4C8Q B;  4E7H A;  4HKE A;  5KYU B;  2AIR B;  1WX6 A;  3VV0 A;  4FYV B;  2DAQ A;  5GAN 7;  1H8K A;  3NTH A;  2DIG A;  4KRT A;  2LDM A;  4C5H A;  2DXU A;  1KJW A;  1MHN A;  1ACM B;  1JBM A;  2RHI A;  3ZEH A;  2DYI A;  1QMC A;  3CC2 Q;  1UJ0 A;  4FCY A;  3OW2 A;  1EZZ B;  2PU9 B;  5GMK j;  3HKS A;  5DY9 A;  3QKJ A;  3MEW A;  1BI1 A;  2RI3 A;  3G71 T;  3J81 E;  2K7A A;  1YN8 A;  3CXC S;  4E7Z A;  1VYT A;  1WHG A;  3EH2 A;  3R6O A;  5I11 A;  3MEA A;  2CP3 A;  4BY6 C;  4HCC A;  1IRE B;  4AMC A;  2BTT A;  3M9Q A;  1NJI C;  1B34 B;  4BAC A;  2VB6 A;  3I5R A;  3JCM Q;  1IHW A;  3LH5 A;  3OYM A;  2JMA A;  1YJW T;  1AWW A;  2QQA A;  5CIU A; 
#chains in the Genus database with same CATH homology
 1AWJ A;  2KBT A;  2KRN A;  4OML A;  1T0J A;  1OV3 A;  4ZNX A;  2K3B A;  1WIE A;  4Z89 A;  1QKX A;  4LUE A;  2DL3 A;  4Z88 A;  2PTK A;  2DBM A;  2SRC A;  1AWO A;  2DLP A;  4J9I A;  3TSW A;  1ABQ A;  1X27 A;  4JJD A;  1SPK A;  5L23 A;  1UTI A;  2DE0 X;  2YUQ A;  1BU1 A;  1QKW A;  3H0F A;  1KIK A;  3THK A;  1XOV A;  1K1Z A;  1QLY A;  1AZG B;  1S1N A;  4AFU C;  2KE9 A;  2RPN A;  2OI3 A;  3EGU A;  4JJB A;  1M30 A;  5FWB A;  1T3L A;  2F2X A;  4JZ3 A;  5GJW B;  2DIL A;  1OPL A;  5EC7 A;  1JO8 A;  2C0O A;  4LN2 A;  4ESR A;  1WA7 A;  2DRM A;  1RLQ C;  3H0H A;  1UE9 A;  1RUW A;  1UJY A;  4IIM A;  2SEM A;  4F17 A;  2CT4 A;  2EYY A;  4EIK A;  2EGC A;  2LCS A;  1TUD A;  4M4Z A;  5IXF A;  2DL7 A;  2EGE A;  1SRL A;  3ZL7 C;  5I22 A;  2DRK A;  1UEC A;  2XMF A;  2NUZ A;  2MOX A;  3EG0 A;  4RTX A;  1VA7 A;  4HVV A;  2DM1 A;  1HJD A;  2EYW A;  1NEG A;  2V1R A;  1GBR A;  1WXT A;  3C0C A;  1QWE A;  2JM9 A;  2C0I A;  3M0S A;  1NYF A;  2AZV A;  4R0K A;  2DF6 A;  1NG2 A;  1PKS A;  2O9S A;  1H3H A;  2OAW A;  3VRY A;  2YT6 A;  4RTV A;  2J06 A;  3RNJ A;  2F2V A;  3M0Q A;  2M0Y A;  1M3C A;  2CSI A;  2BZX A;  3VS2 A;  2CSQ A;  2RQU A;  2ED0 A;  5IHN A;  1GBQ A;  2KXD A;  2FRY A;  2JM8 A;  1X69 A;  1QWF A;  1X2Q A;  4D8K A;  2ROL A;  3H41 A;  3KFV A;  5IHI A;  2JMC A;  3EHQ A;  1UDL A;  2DJQ A;  3VS4 A;  3REA B;  2LX7 A;  1GL5 A;  2ECZ A;  4HVU A;  1W70 A;  1B3Q A;  2FPE A;  1AWX A;  4CC3 A;  1K9A A;  3JV3 A;  1W6X A;  1GCQ C;  1X6G A;  1CSK A;  1GFD A;  1AOJ A;  2GGR A;  2D8J A;  1WDX A;  2VKN A;  4J9D A;  4AFQ C;  1X43 A;  1KFZ A;  1UUE A;  1HSQ A;  1K4U S;  1MV0 B;  2CH4 W;  2V1Q A;  3VS1 A;  5FW9 A;  1A0N B;  2LNH B;  3NPF A;  4LE9 A;  3VS5 A;  1T0H A;  2LP5 A;  4J9F A;  1AEY A;  2CT3 A;  1U3O A;  1I07 A;  2LZ6 B;  2DL4 A;  1NLO C;  2EGA A;  4LNP A;  3M0R A;  2D8H A;  2LMJ A;  1NM7 A;  1Z9Q A;  3QWX X;  1SHF A;  1GRI A;  1X6B A;  4GLM A;  2HCK A;  1YCS B;  3VRZ A;  1SEM A;  3I9Q A;  3CQT A;  2L3S A;  1FYN A;  1X2K A;  3VS6 A;  4JJC A;  1W1F A;  4A63 B;  2KT1 A;  4RTY A;  1RLP C;  2J7I A;  2M51 A;  1MUZ A;  1PWT A;  1T3S A;  2EYX A;  3EHR A;  1UHC A;  1I1J A;  4OMN A;  1Y57 A;  1GCP A;  2LQW A;  2RF0 A;  2KRS A;  1LCK A;  4J9B A;  2JS0 A;  4Z8A A;  3UA6 A;  1UFF A;  2ESW A;  4X1V A;  2A28 A;  3EG1 A;  2HEQ A;  1ZUY A;  3M0P A;  1G83 A;  1OEB A;  2KR3 A;  2CUB A;  2DBK A;  1VYU A;  2AK5 A;  1JU5 C;  2YDL A;  3RBB B;  2O9V A;  4JPB W;  4AG2 C;  2LJ0 A;  1ARK A;  4RTW A;  1OOT A;  2DA9 A;  3NMZ C;  2VVK A;  2J6F A;  1YWP A;  1PNJ A;  1U5S A;  1GFC A;  2CH4 A;  2DNU A;  2C0T A;  4RUG A;  3R6N A;  4GBQ A;  4D8D A;  1M27 C;  1E7O A;  2K6D A;  1MV3 A;  2FPD A;  1TG0 A;  1ZUK A;  2VWF A;  1G2B A;  2GNC A;  2KYB A;  2DMO A;  2PNI A;  3EG2 A;  3ULR B;  1AZE A;  2A37 A;  2DL5 A;  1AVZ C;  2AZS A;  1UHF A;  2KRM A;  3PVL A;  1WI7 A;  2MCN A;  1U06 A;  1PRL C;  4E6R A;  4F14 A;  1WLP B;  2W10 A;  2EYZ A;  4IIO A;  4K11 A;  1UG1 A;  4AFS C;  4RTU A;  1BB9 A;  3IQL A;  1NYG A;  2KRO A;  2F2W A;  2DL8 A;  2KEA A;  2FEI A;  1YP5 A;  3O5Z A;  2D0N A;  1JQQ A;  1OPK A;  1PHT A;  2CUD A;  2X3W D;  3QWY A;  1WXU A;  2PZ1 A;  2QDL A;  1EFN A;  2YUN A;  1TUC A;  4OMM A;  2RQV A;  1BBZ A;  3SEM A;  2BZ8 A;  2JS2 A;  2I0N A;  1JEG A;  2H8H A;  1ZBJ A;  2D1X A;  2FG0 A;  2LJ3 A;  4CC4 B;  1WFW A;  1I0C A;  1GCQ A;  1HD3 A;  1NLP C;  4RTZ A;  2RN8 A;  4OMQ A;  4JZ4 A;  1ABO A;  3GBQ A;  4F16 A;  3TSZ A;  1V1C A;  2K79 A;  4AFZ C;  2RQR A;  2K9G A;  2FO0 A;  2EKH A;  3VS7 A;  1B07 A;  1FMK A;  3M0U A;  3UA7 A;  2GQI A;  2B86 A;  2L3Q A;  1SSH A;  2BZY A;  2A08 A;  2FRW A;  4J9G A;  4J9C A;  1E6G A;  1PRM C;  2RMO A;  1KSW A;  1J3T A;  2DX1 A;  1SHG A;  3H0I A;  1Y0M A;  5HCK A;  1CKA A;  2P4R A;  2AKK A;  1Z9Z A;  2EVR A;  4AG1 C;  2HBW A;  1WYX A;  2KT8 A;  2RNA A;  2JW4 A;  2J6K A;  4DEY A;  4J9H A;  1H92 A;  2KYM A;  4OMP A;  3FJ5 A;  5IH2 A;  2GBQ A;  1WXB A;  2EPD A;  4HCK A;  2L2P A;  3VS3 A;  1ZSG A;  1N5Z A;  2O2O A;  2HDA A;  2KGT A;  4HVW A;  2OJ2 A;  5FWC A;  2W0Z A;  2DYB A;  1ZUU A;  4HXJ A;  4CC7 A;  1QCF A;  2CDT A;  2ABL A;  1NEB A;  3VS0 A;  2K2M A;  2X3X D;  3I5S A;  2KXC A;  2IIM A;  2JT4 A;  4RTT A;  2DVJ A;  3PVQ A;  1SRM A;  1K0S A;  2MIO A;  2ROT A;  1ZLM A;  3UF4 A;  2EW3 A;  1RI9 A;  2GTJ A;  1JXM A;  3REB B;  2J6O A;  2AKL A;  4ORZ A;  1CKB A;  3NGP A;  1M3B A;  2KNB B;  2GTO A;  1M3A A;  2L3P A;  2YSQ A;  1UGV A;  2CRE A;  4QT7 A;  1ZX6 A;  4J9E A;  4OMO A;  2O31 A;  3A98 A;  2G6F X;  2EQI A;  2NWM A;  1AD5 A;  1YWO A;  2ENM A;  2JXB A;  2RQW A;  2O88 A;  2YUO A;  1E6H A;  3SHW A;  1K76 A;  1WX6 A;  2EBP A;  4Y92 A;  4DEX A;  1H8K A;  1JXO A;  2LJ1 A;  3UAT A;  4KRT A;  1YNZ A;  4WCI A;  1KJW A;  2A36 A;  2E5K A;  2J05 A;  1UJ0 A;  5IXB A;  2LQN A;  1BK2 A;  3EG3 A;  5ECA A;  1M8M A;  2K7A A;  2YUP A;  1YN8 A;  3M0T A;  1VYT A;  2RQT A;  2ED1 A;  1VYV A;  5I11 A;  5IHK A;  3I35 A;  3TVT A;  2BTT A;  1IO6 A;  1PKT A;  3NHN A;  2JTE A;  4FSS A;  1K0X A;  3I5R A;  2FPF A;  3LH5 A;  3PE0 A;  2JMA A;  2HSP A;  1AWW A;  4CC2 A;  2L0A A;  3U23 A;  4LUD A;  5GJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...