3JCMP

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
109
structure length
77
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLQQPTASDNIANTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 7
structure length 77
sequence length 109
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmP00
3V8LA 3RKYA 3V7RA 2DXUA 4XU1A 4N0AC 3V7SA 4XQ3A 4M77A 5GMKj 5GMKm 4C92D 4M75G 2DZCA 5GAN4 4M7DF 4WF2A 1U1SA 4C8QC 1JBMA 3JCMh 3EFRA 4PJOB 1D3BA 2FYKA 5GANj 1WNLA 1I4K1 4XTZA 4M7DE 2EJ9A 4JLIA 3JB9I 5GAN3 2DEQA 2RA2A 4M78A 5LJ5j 4M7DC 4M77G 5GANh 2YLCA 4NL3A 2FB7A 1HXDA 3QO3A 2E41A 2EJGA 3JB9G 1I81A 3FIFA 5GAMf 5LJ3d 2DTHA 2YHTA 4PJOE 1D3BB 4XU2A 4RCCA 1KQ1A 2RB6A 4M75B 4X9DA 1B34B 3SWNB 4EMKB 5GMKe 4M7DB 5GAN2 1M8VA 5GAOq 4M77C 3RKWA 3JB9D 4M7AC 2DKGA 3FJPA 4M78F 5GANd 4J6YA 4M78C 5GAOp 5GAN6 1BIBA 4F7UF 3QSUA 3BY7A 3V8KA 3JCMf 4C92C 3QUIA 4QVDA 5GMKi 2DJZA 4M77F 3INZA 2CGHA 3BDUA 4JUVA 4C92F 4M75E 5CAIA 2E10A 4MMKA 4XU0A 3JCMP 4F7UE 4C8QE 4XTYA 4JRKA 1LJOA 4NL2A 3HFOA 3SB2A 3RUXA 1I8FA 2DZ9A 4MMLA 4C92E 5LJ3j 5GAOn 1H641 4M78E 3HSBA 3JCMb 1N9SA 5LJ5g 5GANe 1Y96A 5LJ3h 3JCMW 3RERA 3PGGA 4A54A 4M77E 2EWNA 5GAMe 1BIAA 5LJ5h 1MGQA 4C8QG 4PJOF 1WQ7A 5LJ3g 4F7UB 5GAMg 4C8QB 5GAMd 5GAOl 2K57A 4PJOC 2DXTA 5GMKh 1B34A 5DY9A 4C92B 4DQ2A 2DTOA 2RM4A 1Y96B 4PJOD 2VC8A 4J5YA 2E65A 2EAYA 4M75C 3RKXA 3SWNC 3L1AA 4EMKC 4XTXA 3JB9J 3JCMc 2E64A 5GAN7 4HT8A 4QVCA 4J6XA 3JCMe 1WPYA 4OP0A 4M7AA 1LOJA 3V7CA 2RD1A 3JB9H 4M7DG 3JCMg 5GAN5 1JRIA 2JN0A 5LJ3f 4M77D 2DTIA 4JRIA 4EMGA 3BW1A 5LJ5d 4M7AF 2ZGWA 1HK9A 4J6WA 5GAMh 4N0AA 1WQWA 4M78D 4M78G 3V8JA 4M7DA 2I2LA 4Y91A 3RIRA 4M7AD 2E1HA 3AHUA 4C8QA 4NOYA 4XU3A 5GANf 1KQ2A 1I5LA 3L2ZA 1N9RA 1YCYA 5I21A 5GAOr 2VXEA 3EFSA 3M4GA 4XTWA 3VU3C 5GAN8 4PJOA 4X9CA 5GANg 4HT9A 4M75D 2VXFA 5GMKl 5LJ5f 4C8QD 3JCMd 4RCBA 4M7AB 3JCMQ 1U1TA 1X01A 4M75F 4F7UG 4M7DD 3FB9A 4XTVA 3JCMJ 4M78B 4M7AG 5GAMj 2DVEA 2QTXA 3QHSA 4C92G 2YLBA 4XTUA 4A53A 4C8QF 5GAOm 4PJOG 3BFMA 2EJFA 3JCMV 4HA8A 5LJ3e 4M77B 3GIBA 5LJ5e 2HNIA 1M5Q1 3HFNA 4M75A 1LNXA 3SWNA 4EMKA 4EMHA 3JCMX 4F7UA 4V2SA 4M7AE 3JB9F 1TH7A 4C92A 4PNOA 2Y90A 3RESA
chains in the Genus database with same CATH superfamily
2DFUA 1UHFA 3NHNA 4E7IA 2SRCA 3KFVA 3QIIA 3OYJA 2F2VA 3FLGA 2HEQA 4C5GA 1BI1A 2DEQA 2CH4A 1S72A 2YLCA 4ESRA 2EJGA 2HZYA 2XG8D 1E6HA 5GMKe 4KBMB 1YITT 1FWZA 3EGDB 2JUFA 1NZ9A 3Q1JA 4E47A 3QZ5B 3OB9A 1NJIU 4FM4B 2X3WD 1JXOA 2KT8A 1ZSZA 4FYYB 3VJPA 1UGVA 2YWWA 3VV0A 2QQSA 1AD5A 1N6AA 2L5QA 1V29B 1QVFA 1BIAA 4N4HA 2MIOA 1GL5A 2F2XA 4WCIA 4KGXB 3PNWC 3TSZA 3CCLT 3SWNC 4LUEA 2QA4Q 3I35A 2DD5A 4IUTA 1GRIA 3AT1B 4ANJA 2O01E 1EIFA 3GBQA 5I22A 4ATOA 3CBOA 3EGXA 3CCRQ 3NTKA 3CCUT 4ZTJA 5AYFA 4M7DA 2KYBA 2LMJA 3EG3A 3L2ZA 5I21A 1G5VA 1M3AA 2O31A 4X9CA 4FW1A 1M1GA 1OPKA 2V1QA 4HVUA 1G3SA 4MDXA 2JW4A 4M7AG 4BY6C 2RHZA 4F14A 2F5KA 4A53A 2CP2A 2YDLA 1YBYA 4C0DB 2YXYA 4EMKA 4EMHA 1OX9A 3N5BB 4C92A 2JXBA 5GAMg 2YUQA 3RKYA 3BE3A 2PTKA 1SRLA 4BB7A 2KEAA 3CCVA 4J9GA 3D7SB 2KK4A 4C0FA 3MP1A 3EFRA 2EQJA 1XTDA 1AT1B 2M02A 2X4JA 2XDBA 3VKIA 3VRYA 5C0MA 2HSPA 1BCOA 3FIFA 2KGTA 1WI7A 2KBTA 4PFOA 2YHTA 2B8AA 1KD1U 2GFAA 4EMKB 2AHJB 5GAOq 2FVUA 3FRNA 2H3EB 3VS1A 5GMKi 1OI1A 4RUGA 2ED0A 4OMOA 5LJ3j 1YI2A 1YIJT 3CCMA 3HSBA 1MNDA 1ZX6A 3MP8A 1YITA 1WHHA 1K8AC 3CPWA 5CIUA 2HDAA 4C8QB 3R6OA 4L59A 4ELYC 1NE8A 3REBB 2OAUA 1UE9A 1Q82C 2EFIA 1WYXA 4D8DA 1QW1A 2F5TX 1U3OA 2D8HA 2GTOA 3OYGA 2ZPFB 4OGCA 1RAEB 3F70A 2O88A 3LYIA 3MEUA 4EMGA 2BTTA 4DOWA 4JDSA 5C6SA 1WQWA 3M0QA 3V8JA 4NOYA 4X1VA 3CXCP 1N9RA 2CSIA 4A4HA 3MHXA 5GAN8 3SEMA 4Y28E 2VXFA 1NG2A 3VYHB 1WXBA 5KCHA 2ZZDA 3KBGA 2YUNA 3JCMQ 4TVRA 3VS0A 3UATA 2HAXA 1Y71A 4ORZA 3PMIA 1GFCA 4M7AE 1VQOT 5FROA 3THKA 3I56A 2Y90A 3V8LA 2XK0A 2CP0A 1OX8A 1OOTA 5HK0A 3OYAA 2J6KA 1SG5A 1KD1C 1VQ5Q 2RA2A 2J7IA 5GANh 5CO7A 3CC7A 5IT9E 2DD4A 4Z89A 3JB9G 2YRDA 2NUTA 2RMOA 2EYQA 1OQKA 1WZOA 3JB9D 2J05A 4M7AC 2O2OA 2IIMA 3M0PA 1UEBA 4A4KA 2OTLQ 3EHQA 3CMAQ 3VS6A 2LDMA 1KHCA 4RTWA 2DAQA 4J8OA 1KK7A 2AKLA 3QJ6A 1H641 4PKCC 2KQWA 2ZCFB 1N9SA 1Y07A 1Y96A 2DYBA 2ZPIB 2RO0A 3RERA 2QK0A 2VGMA 1NPRA 2R57A 4BDZA 4QQ6A 1OULA 3OYKA 4F7UB 4AG2C 3G7ZA 3I55A 1YFNA 2JJ9A 3EG1A 2RI2A 3FEOA 3CCJT 4XTXA 4GLKA 1CKBA 1WPYA 2LC4A 3V7CA 1MMDA 1KSWA 1MV3A 2LX9A 4HKEA 2F1LA 3BDLA 2W0ZA 5LJ5d 1QVGS 1HK9A 1UGPB 2RK2A 4Y91A 2OTJQ 3KUFA 1XOVA 2KSSA 3OYMA 1WHLA 4LN2A 1U1TA 3C95A 4FU6A 2A28A 3E19A 5IXBA 3HPWA 2HBWA 2AT1B 1IZ6A 2ZPBB 4Z8AA 4R56A 4JRPA 2KY9A 3SDZA 1W2BA 2KR3A 5M9OA 2GTJA 4OB0B 2J06A 2X35A 5CKDA 1W70A 1Q7YU 2VASA 3CMEQ 5KCOA 3OQ5A 4M75G 5GAN4 2VWFA 5CKEA 4PJOB 3C0CA 2L3QA 1KQSA 2LNHB 2JTMA 1X2KA 4LXCA 2RJDA 1N27A 5GAMf 3EFOA 2CYZB 1D3BB 2EQIA 1ACMB 1MUZA 1ZA1B 2DERA 1VQPQ 1K73U 1TOVA 3QZ9B 1WX6A 1YI2Q 4M4ZA 3QSUA 2HCKA 1FMKA 2L8DA 2JS2A 2M0YA 3NFCA 3JCMP 1RAHB 5D6YA 3A8LB 3RUXA 3X24B 3OYHA 3G71T 5KYXB 2XKOC 3J7AF 3CCRA 4Q5WA 2BE7D 2WACA 1J3TA 1JU5C 4OMFB 3M5AA 1NBEB 4E7LA 4AFZC 4PJOD 2E65A 4EMKC 1D09B 1C1AA 1SKUB 1VQNT 5HKCA 2ENMA 2X4XA 1T3LA 1QQJA 2DJQA 2QQ9A 2E70A 1IGQA 4C0GA 2EQKA 1A0NB 2L2PA 1G83A 4A63B 1V1CA 1M1FA 3MP6A 2QASA 1E7OA 3GLXA 2ESWA 3VS7A 2BIVA 4LDVA 3CXCA 1ZUKA 3FB9A 4MDWA 2VKNA 3S3NA 1RI9A 4MZPA 4PJOG 1ZHIA 4BD3A 5LJ3e 3NTIA 1PD0A 4M75A 2JS0A 2ZPHB 2QQAA 3HFNA 4J9IA 2FPEA 4XTZA 3E2UA 1W6XA 4XU1A 2K9GA 2DZCA 2PVOB 2M16A 1VQ7A 1ZUUA 2EBPA 3JB9I 3CBPA 5LJ5j 1KJWA 2QXFA 2FB7A 1HXDA 4PJLA 5KE2A 2LX7A 2CZ1B 4X9DA 1MV0B 2EKHA 1BU1A 2P0KA 1BI3A 2KMTA 1OEBA 1VQ4T 2JNGA 3INZA 4JUVA 2QI2A 2XDPA 1I8FA 1G3YA 1H92A 3OYIA 2GBQA 1E6GA 4QVZA 1PCXA 1I07A 3HRTA 1QKWA 2COWA 4FT2A 4J5YA 1VQ9A 1QKXA 1M27C 3CXCS 4QVCA 2CP6A 5A2QE 4M7AA 2KRNA 3L2RA 1YWPA 7AT1B 3JB9H 2M0OA 1GCPA 5KYWB 3CCUQ 1SHGA 3H0FA 3VS5A 4F04B 2DVJA 1MMNA 3HP9A 1EFNA 1JJ2P 3E1SA 3G6ET 4BI3A 2EQUA 2NWMA 1YP5A 4FIBA 5GANf 4QW2A 3ZBDA 1ZA2B 4IKFA 2CUDA 2EYZA 3A98A 1VIFA 4J9CA 4PJOA 2D0NA 5IH2A 3GP8A 1VQ8Q 1QP3A 1ABOA 1TU0B 4C92G 3O8VA 1YHQT 2Z0WA 1Y57A 1OZ3A 4WTOB 3UF4A 2OX7A 5KYYA 3JB9F 4XAXB 2YRCA 4M78A 3H8ZA 1WLPB 3TREA 1MNEA 2GF7A 3P8HA 3EG9A 2DL8A 1ZLMA 3PIOA 3A8OB 1NEBA 2L3RA 2EJ9A 3M57A 4JLIA 3CCVT 2FZGB 2C0OA 1OYXA 3JV3A 5LJ3d 2K2VA 1MMGA 1VQLA 2RI3A 4K11A 4J6YA 3JSCA 3H41A 2RQRA 3BY7A 3S3MA 3QUIA 6AT1B 1RLPC 2E12A 4JRKA 2DA9A 2P4RA 4E2FB 3EGDA 1ZBJA 2DLPA 3H6ZA 4CC7A 2NUZA 3CMAT 4PFPA 2V1RA 1HD3A 4FCYA 3M59A 4PL6A 3I5SA 4AMCA 2CS7A 4FYVB 3L1AA 1G3TA 1S72T 4J9BA 2MOXA 5HY6A 2CH4W 4FSSA 4LDXA 1X27A 4CC4B 2KDSA 2PU9B 2CKKA 1KC8U 2KNBB 2FRYA 1M3BA 1AVZC 2QA4A 1Q81U 2BKDN 4PJJA 4P5NA 1KQ2A 1I5LA 2M9UA 4DEYA 1PG5B 5A0DA 2X9HA 1X43A 2RH2A 5D6WA 1X01A 1WIEA 4F7UG 5GAMj 2E6NA 3BFMA 2EJFA 2K3YA 2RQWA 3JCMV 4J83A 1IHVA 2E5KA 2LZ6B 2V8IA 4JRIA 2RJEA 3RESA 3V7RA 2L89A 2EYYA 5FRNA 2RI5A 2ZAEA 4RTVA 2DBMA 4M7DF 1U8RA 2RHIA 2FYKA 1VQKT 2LQWA 4CC3A 4M7DE 1BYMA 3I5RA 3G1JA 1VYTA 2KROA 1VQOA 3M53A 2YRVA 2YT6A 2L3PA 4PJOE 4XU2A 3JAME 3SWNB 2JVVA 1B7TA 5GANd 2O4XA 2QDLA 1K8AR 4D6WA 2RHXA 4KGZB 3M54A 3VYGA 3BDUA 4MMKA 5J3BA 3WXMB 1ARKA 1G8XA 1AWJA 4C92E 1AZEA 1GBRA 3CMAA 4PK4A 5ECAA 2DRMA 4F16A 1YIJQ 1VQPA 4A54A 1ZUYA 3UDCA 5CKHA 3OYEA 1MGQA 1G2BA 2KYMA 1VQ6T 4A4FA 5DY9A 1M1KU 1QCOA 4II1A 2DTOA 1WXUA 1IHWA 1QCFA 5GAN7 4RG2A 4J9EA 3RR6A 3M9QA 3GOXA 3SFMA 3DLMA 2CT4A 3OS5A 4OVAA 2FEIA 5IXFA 1JRIA 1M2VB 4KULA 1JQQA 3NGPA 1EX4A 2XICA 1SRMA 3BW1A 2CREA 2HMAA 2ZGWA 3VUBA 3I9QA 2DX1A 3CC2Q 3EH2A 1KFZA 3I55Q 4AFSC 2K4YA 4XTWA 2BZYA 2EGAA 3EG9B 2LJ0A 4AFUC 1ZSZB 2BUDA 5LJ5f 1D0ZA 2BZXA 1W4SA 3G6EQ 3JCMJ 1AEYA 4LD9K 4PFZA 1ZBXA 3MEAA 5KYNA 3LGLA 2COZA 1JO8A 2K5LA 3RMQA 3C4SA 2CZ0B 4PJMA 1I1JA 2H8HA 3OBYA 3QKJA 1M9SA 1TXQA 3CC7Q 3TCJA 3A5ZB 1X6GA 1WJRA 5HK3A 2FO0A 2E41A 2HQXA 3G71A 3UA6A 2L0AA 4ME7A 2GQIA 5IN1A 2C0TA 1D0XA 4M78C 2R5AA 1QP2A 3MO8A 3CD6A 3TVTA 4KRTA 1VQ4Q 2EPDA 4M77F 2K3XA 4FSXA 1LJOA 2RJFA 3HFOA 4MMLA 5FWCA 1VQLQ 3JCMb 2BE9B 3IQLA 1BK2A 1QMCA 3M55A 2DILA 2EWNA 1PSEA 3EHRA 1VUBA 5GAOl 2F69A 3PT9A 3T9NA 3QXEB 1OV3A 3M0RA 2DL5A 1VQMT 1WHKA 1VQ9Q 1K73R 3HTRA 3EAEA 2KRMA 2LT4A 4J6XA 3OBWA 3ZEHA 4RMOA 1IB8A 3H9NA 4M7DG 3CCRT 3HL8A 1JXMA 2QYZA 3R6NA 4DA4A 1LCKA 1M1KR 2OTJT 5GAMh 2D9TA 3RIRA 4M7AD 3AHUA 1K9AA 5FU7B 1AWXA 1D1BA 2YSQA 2RN8A 3VU3C 3I55T 1Q7YR 1T0JA 4N4IA 1PRMC 5KYYB 2PUKB 3REAB 4EIKA 5CR2A 3QHSA 3TEEA 5LL6S 1RADB 1KG1A 1IRXA 2LCCA 2RQTA 3CC4T 8ATCB 3A8HB 2KE9A 1K0SA 3SWNA 1B3QA 4RTYA 1WFWA 3QYHB 1D0YA 4RTTA 4N0AC 1R8OB 5GMKm 1U1SA 4X34A 2K79A 3CCLA 1D3BA 2BZ8A 1K73C 2M1HA 3CCST 1GCQC 2NUPB 4M77G 2G3RA 3OS1A 2OTLT 3QO3A 2AZVA 1UGQB 1NM7A 5CVIA 4JLGA 1Q82R 4M77C 1YJWQ 2NYSA 2PVGB 2LNVA 1BIBA 5GJWB 3DLLA 1VYUA 3JCMf 1HYOA 2EQMA 2E10A 2OJ2A 2HD0A 1VQPT 1KC8C 4QQDA 4J9HA 2QA4T 1PM3A 2IG0A 5GAMe 5IAYA 2QEXA 1Q81R 4PJOC 4OMPA 1VQMQ 1QLYA 1Y96B 4IUQA 1QVFP 3RKXA 1KIKA 2DF6A 2RF0A 1IXDA 1BCMA 5HCKA 4PLLA 2DTIA 4J9DA 4J6WA 5CQYA 1BB9A 4RTUA 3KXTA 3FJ5A 2OAWA 1UGRB 3PVLA 3OYDA 1OU8A 1YCYA 3CC4Q 2DEUA 1I0CA 4HT9A 3UA7A 2MPXC 2HKQB 3CCQQ 4C5IA 1UDLA 3TSWA 4OGEA 5FU7C 3CC4A 4Z88A 1NPPA 2QTXA 5GAOm 1LPLA 4JZ3A 3META 3TQ7P 4C5HA 2XD0A 1RABB 1VQOQ 3CCMT 3GIBA 3CBMA 3LWIA 1M90C 1VQKQ 4R55A 4ZGEB 2JM9A 2EYXA 5I2MA 2VVKA 2XHCA 4CRIA 1VOMA 4FYXB 4LUDA 2E4HA 3I56T 1JJ2S 1OU9A 3OSSC 1WNLA 3O5ZA 3M0SA 4ZGDB 2FPFA 4MZMA 2AIRB 1WJQA 4NL3A 3C12A 5FWBA 3OSVA 1JJ2A 4LDYA 1AZGB 1YWOA 1M8VA 2E3HA 1PRLC 3CD6T 2YUOA 2D1XA 3FDRA 4M78F 5FU6C 1TS9A 4E7ZA 2A7YA 3V8KA 2JM8A 4C92F 3NPFA 1VQLT 4BE2A 4XU0A 5KYUB 4F7UE 2OTJA 2MAMA 3CCJQ 9ATCB 2O4XB 5GANe 3CD6Q 1R77A 3GNFB 1UUEA 4JJNK 4M77E 2DL3A 1VQ8A 1EZZB 2JMAA 3PTAA 4DQ2A 4C92B 2QEXT 1S72Q 3G71Q 2DRKA 2FZCB 1VQ6Q 1LOJA 3G4SQ 3L2VA 2RD1A 3CCUA 3VS4A 3CMEA 1YJ9Q 2J6FA 3M0TA 4QQGA 4M7AF 2LT1A 2DL4A 4HCBA 3RMSA 1OZ2A 1FMWA 3EH1A 2E1HA 2Y4XA 3MPUB 2WSFE 5KYWA 4FYWB 3EFSA 4HVWA 2ATCB 5GANg 5L8RE 2KI7A 2RHYA 1MHNA 2A37A 3SD4A 4M7DD 4M78B 3WVEB 2DVEA 4QT7A 2D0QB 4QKUA 1H3ZA 4LDUA 2IPOB 2X4WA 2DK3A 2MI6A 2JMCA 2GNCA 2E3IA 4J9FA 1H8KA 2A0FB 1ZQ1A 3WVDB 5GMKj 4JJCA 2HL3A 3CCSA 3J80E 3EG0A 2FL7A 1I4K1 3I56Q 3OYNA 1TUCA 4HVVA 2PZ1A 1AHJB 2V8JA 8AT1B 1CKAA 1RLQC 2P0QA 5FLXE 4RCCA 2QGGA 2LQNA 3E9FA 2RB6A 4M75B 4KGVB 5GAN2 1UTIA 2NLUA 2QQRA 1W1FA 4KUIA 1K0XA 4FT4A 3CPWP 3X26B 1IO6A 1G3WA 4E7SA 4LE9A 5FW9A 1YIJA 4QVDA 1Q82U 1YHQA 1HSQA 1RACB 1VQ4A 1UFFA 2X51A 4E7HA 2DM1A 2V26A 4M78E 1YCSB 2QDYB 2VV5A 2ABLA 1GCQA 3PGGA 2MYSA 1Y7XA 3M4YA 1TSFA 1T0HA 4C8QG 1BKBA 3URGA 5GAMd 3GNGA 4HCZA 4F17A 1X6BA 2D6FA 2QG9B 3E9GA 5EG2A 1NJIR 2COYA 4XK8E 3X25B 5GJVB 2R5MA 1VQ6A 3QBYA 2E5QA 2DBKA 3L42A 2MMPA 4BE1A 5I11A 3DKMA 4RTXA 3M0UA 3L2QA 2FPDA 2XU8A 3CCJA 4M78D 2M51A 2D8JA 3L2UA 1P92A 3QJYA 3L2WA 4LDWA 3CEYA 3G6EA 1K1ZA 3LH5A 2B86A 4OF1A 4JJBA 5AT1B 2EVRA 4IUPA 5J39A 5GMKl 4C8QD 3LGFA 4XTVA 2DO3A 1NLOC 2DMOA 4XTUA 2AK5A 2A36A 3VUZA 4LNPA 2YUPA 4V2SA 2RQUA 2KVQG 2SEMA 2MCNA 1YJNA 3GF5A 2DXUA 2X3XD 1SEMA 4XQ3A 3DB4A 2CP5A 2CUBA 1WJSA 5KE3A 3UWNA 3JCMh 3CC7T 4EPCA 1K76A 1WHMA 4MZTA 1M4ZA 1TTHB 2GGRA 3VRZA 4OMMA 4KH1B 1XJWB 3NMZC 4GLMA 1YJNT 1I81A 2DIQA 3LH0A 3PIPA 1WGSA 2DTHA 2ED1A 1SSHA 1UHCA 2EW3A 2R58A 3RKWA 3LW5E 5GAOp 3UT1A 2GQVA 4OB3B 2G6FX 1FXXA 4IIMA 1Q95G 3LWHA 3P8DA 1WXTA 2GCXA 3QPHA 5GAOn 1LVKA 3A8GB 1YJWT 3DB3A 3X28B 4CC2A 4BE0A 4PLIA 1YNZA 3CCET 1RAIB 4BI8B 2RM4A 2PUOB 1Z9ZA 2QAZA 2LRQA 2RQVA 2FG0A 1QCNA 1UECA 3S3OA 4HXJA 2QEXQ 1BI2A 3EFOB 3EGUA 1ZSGA 4N0AA 5IHIA 3OW2A 2P4TA 1Y0MA 1M2VA 1RL2A 2DNUA 3ULRB 2VB6A 3OS2A 3ME9A 3MEVA 3CCQT 3VS3A 3JCMd 1YJWA 4Z02A 3OY9A 4KT0E 2KRSA 3LX7A 4UC4A 5KYXA 2CZ6B 5DM7R 2AKKA 2DIGA 3OW2S 3JRZA 1GXIE 1K9MR 1M5Q1 2NUTB 2OTLA 2XMFA 4F7UA 1YN8A 1BBZA 1SF9A 2LJ3A 2NUPA 1X2QA 2I0NA 4M77A 1U06A 4KH0B 4C92D 1M2OA 3HRUA 3CMET 4WF2A 4C8QC 2P0PA 5I2SA 1N8RR 1YJNQ 3ER0A 2V8KA 3QDFA 1VIEA 2J6OA 4L5GA 4IUUA 2PQWA 5KYUA 1ZSZC 4CI0C 1CSKA 3OS0A 2DKGA 4N4GA 3FJPA 1AOJA 1K8AU 1VA7A 1WHJA 4BACA 3HKSA 4F7UF 4R0KA 2DJZA 2EGCA 2JTEA 3MJXA 2LP5A 4ZGJB 3ASKA 5LJ3h 3CPWS 4NS5A 3OYFA 2CT3A 1QWEA 2LCLA 5LJ3g 3GPLA 1XQHA 5GMKh 4B9XA 2HL5C 1F1BB 2IVWA 2VYTA 3RDVA 1AWOA 2XIDA 4M75C 1M1KC 3G4ST 3EGXB 2FRWA 3CCLQ 1NLPC 1TUGB 2AZSA 4O6JA 4L6V5 3QWXX 3QDRB 2OI3A 4FL6A 4DOVA 4M77D 4JRQA 2PVDB 4JJDA 4BY6B 3OYLA 2HQEA 2I2LA 2MK5A 2LTOA 1RAFB 3PFSA 4DBFA 4DBHA 5GAOr 3M4GA 1PWTA 1R0CB 1RAGB 5CK9A 2DPPB 4O5VA 4M7AB 2QQBA 3CCMQ 1PD1A 1UG1A 1NYGA 1PC0A 2YLBA 3QG1A 2C06A 1KC8R 4B9WA 2GFUA 1MMAA 2LVMA 1U5SA 1LNXA 3JCMX 2JTFA 1M8MA 1TH7A 1QVGA 1Q81C 1UJ0A 4YTLA 1I5OB 2EIFA 1R0BG 5EC7A 3V7SA 3CQTA 5CQXA 3CCSQ 1JBMA 1SSFA 1WA7A 1FMVA 5IHNA 4JS4A 4JPBW 4E7KA 2CZ7B 4IIOA 3FC3A 4OB1B 4DBRA 4EDUA 1D1AA 2JZ2A 2FHDA 3M58A 1TWBA 4AG1C 4C92C 4C0ZA 2CGHA 4M75E 2DE0X 4XTYA 3SB2A 4HCCA 2ZPEB 4GY5A 5LJ5g 4ZN3A 4E7JA 1RUWA 2K7AA 1T3SA 2EYWA 1VQNQ 2ECZA 1B07A 5LJ5h 5FU6B 1N5ZA 2WSEE 4ZNXA 3JB9J 3RNJA 2EGEA 2E64A 1IGUA 2A3LA 4HT8A 1Z9QA 3JCMe 4OP0A 1X75C 4BUGA 1VQ9T 2K5IA 1JB0E 2RNAA 1UJYA 1O75A 2HBPA 1KHIA 3A1PA 5D7UA 1DJ7B 2MWOA 1VQ7T 2JOYA 1IREB 2A08A 2QGFB 4RCBA 4DBQA 1PKTA 2DXCA 4M75F 3S6WA 1HJDA 1BI0A 1AWWA 3CC2A 1NYFA 1W2BS 4M77B 5LJ5e 5J26A 2O9SA 4D8KA 1S1NA 2VUBA 1KD1R 4DEXA 3OW2P 3NTHA 1UGSB 2QTVA 3CCVQ 4A4GA 1GBQA 4C5EA 2K5FA 5GANj 2O9VA 4ZN1A 2MWPA 5GAN3 5KH6A 4M7DC 2EKOA 5L23A 4ELZC 2WSCE 2H3JA 3OMCA 3VS2A 1KQ1A 1ABQA 4ZTFA 2K6DA 4BI4A 3MKDA 2P84A 1VQNA 2RPNA 3PVQA 1Q86U 5GAN6 2HSEB 1SPKA 5IHKA 4JZ4A 2MF2A 3J81E 4C8QE 3LLRA 2DZ9A 3RBBB 1KQSP 3U23A 1UB4A 1M30A 1RAAB 3HRSA 4KUDK 2RK1A 2PNIA 1WQ7A 2DL7A 2K57A 2DXTA 3QWYA 4HCKA 4BDYA 2EAYA 5D6XA 2E6ZA 2XDDA 1XNIA 3JCMc 5A0GA 1V76A 2ROLA 3ZL7C 1VQMA 5GAN5 3PE0A 5LJ3f 2ZPGB 2LJ1A 5A0LA 4RTZA 1GFDA 1N8RU 1QVGP 3X20B 4XU3A 1N8RC 4E6RA 2CP3A 3ZFJA 4OB2B 1W2BP 3H0HA 3CCEA 4M75D 3C94A 2LQKA 4J7FA 3PMTA 5DLQE 1K9MU 3QYGB 1VQ8T 1SHFA 1K9MC 4C8QF 3OYBA 1FX7A 1PHTA 2K2MA 2KXDA 1D1CA 1YHQQ 2CP7A 2DXBA 4PNOA 2ROTA 1QVFS 1PKSA 1VQ5T 1C0MA 4OMNA 4AFQC 1OPLA 3OA6A 3G4SA 2W10A 3UPUA 3TU4K 3HHTB 1X69A 1PSFA 4VUBA 4M7DB 1B34B 1VYVA 1TUDA 1O9SA 3M56A 1YITQ 1M3CA 1M90U 2Y4YA 3OYCA 3EG2A 4J7IA 3OYYA 1Q7YC 5FRMA 5CAIA 4NL2A 1NJIC 1WHGA 1JEGA 2CDTA 2CSQA 5CKFA 2F2WA 1WDXA 3JCMW 2FZKB 2XI9A 1YI2T 4A4EA 2LCSA 4GBQA 2C0IA 3CCEQ 2RJCA 1FYNA 4PJOF 3MEWA 1B34A 2HKNA 2K3BA 3SHWA 2VC8A 1VQ5A 2DYIA 3CPFA 5CCAA 2LQ8A 4RKUE 4JS5A 1QVPA 2KXCA 2KAFA 1KQSS 2RHUA 1RI0A 5CKBA 3CC2T 1TG0A 3OMGA 4OMQA 1YJ9A 1NEGA 1VQ7Q 3JCMg 2JN0A 4OMLA 4PJNA 2X4YA 4Y92A 4M78G 2L3SA 4IURA 4C8QA 1VQKA 1H3HA 2VXEA 1YJ9T 2JT4A 2DETA 3MCAB 4B6MA 4C0DC 1Q86C 2KT1A 1C6VX 1PNJA 3CCQA 5DLOA 1M90R 3P8BB 1Q86R 3H0IA 4HA8A 4IUVA 1X6OA 3A8MB 2HQHA 4AT1B 2HNIA 1QWFA 4FW2A 4RG8A 1K4US 2VGNA 4LD6A
chains in the Genus database with same CATH topology
4E7IA 4XU1A 4N0AC 1R8OB 4M77A 5GMKm 4C92D 3QIIA 2DZCA 3OYJA 3HRUA 2PVOB 4WF2A 1U1SA 3FLGA 4C8QC 3CMET 2P0PA 4X34A 3CCLA 1D3BA 1K73C 2M16A 5I2SA 1VQ7A 2M1HA 4C5GA 3CCST 1BI1A 3JB9I 2DEQA 3CBPA 3ER0A 5LJ5j 1S72A 2V8KA 2QXFA 2YLCA 4M77G 2FB7A 2G3RA 1HXDA 3OS1A 2OTLT 3QO3A 1VIEA 2EJGA 4L5GA 4IUUA 5KE2A 2PQWA 2XG8D 1UGQB 2CZ1B 4X9DA 5GMKe 4KBMB 1YITT 5CVIA 4JLGA 2P0KA 1FWZA 4M77C 1BI3A 2KMTA 4CI0C 3OS0A 2DKGA 4N4GA 3FJPA 2PVGB 1VQ4T 1K8AU 2JUFA 1NZ9A 3Q1JA 2LNVA 3QZ5B 3OB9A 4E47A 4BACA 4FM4B 1BIBA 3DLLA 3HKSA 4F7UF 3JCMf 2DJZA 2JNGA 3INZA 4JUVA 2QI2A 3VJPA 2EQMA 2XDPA 2E10A 3VV0A 2HD0A 1VQPT 4ZGJB 1I8FA 2QQSA 1KC8C 3ASKA 4QQDA 1G3YA 3OYIA 1N6AA 2QA4T 5LJ3h 2L5QA 3CPWS 1V29B 2IG0A 4NS5A 3OYFA 5GAMe 2LCLA 1BIAA 4N4HA 1QVFA 5IAYA 2QEXA 5LJ3g 4QVZA 1XQHA 3GPLA 4PJOC 5GMKh 4B9XA 2IVWA 3HRTA 3PNWC 2VYTA 1Y96B 4IUQA 3CCLT 4FT2A 2XIDA 4J5YA 4M75C 3RKXA 3SWNC 1M1KC 3G4ST 1VQ9A 3CXCS 2DD5A 4IUTA 4QVCA 5A2QE 4O6JA 4L6V5 4M7AA 3QDRB 3L2RA 3JB9H 2O01E 1EIFA 2M0OA 4FL6A 4PLLA 4ATOA 3CBOA 4DOVA 4M77D 2DTIA 4JRQA 2PVDB 3NTKA 3CCUT 4BY6B 3HP9A 4J6WA 4ZTJA 3OYLA 5CQYA 5AYFA 2HQEA 2I2LA 3E1SA 3KXTA 4M7DA 2LTOA 3G6ET 4BI3A 2EQUA 4FIBA 5GANf 1UGRB 3OYDA 3PFSA 4QW2A 3ZBDA 1G5VA 3L2ZA 1YCYA 5I21A 5GAOr 4IKFA 3M4GA 1VIFA 4PJOA 4X9CA 3GP8A 1M1GA 4HT9A 1QP3A 5CK9A 2DPPB 4O5VA 4C5IA 1G3SA 4OGEA 5FU7C 4M7AB 3CC4A 4MDXA 4M7AG 4BY6C 2QQBA 1NPPA 2QTXA 2RHZA 5GAOm 4C92G 2F5KA 2YLBA 3O8VA 3META 3QG1A 4A53A 2GFUA 4B9WA 4C5HA 1YHQT 2C06A 1YBYA 2XD0A 1OZ3A 2LVMA 4C0DB 3CCMT 3GIBA 3CBMA 3LWIA 1M90C 4EMKA 1LNXA 3JCMX 2JTFA 4EMHA 4R55A 4ZGEB 3N5BB 3JB9F 1TH7A 4XAXB 4C92A 5GAMg 4M78A 1QVGA 3H8ZA 1Q81C 3RKYA 5I2MA 4YTLA 2EIFA 3TREA 4BB7A 3V7SA 2XHCA 3CCVA 4CRIA 2GF7A 5CQXA 2KK4A 4C0FA 3I56T 1JBMA 1SSFA 3EFRA 2EQJA 3MP1A 3P8HA 1JJ2S 1XTDA 3OSSC 3PIOA 1WNLA 3A8OB 4JS4A 2X4JA 4ZGDB 2XDBA 2L3RA 2EJ9A 3M57A 4JLIA 3VKIA 3CCVT 4E7KA 4MZMA 2CZ7B 3FC3A 1WJQA 4OB1B 5C0MA 4NL3A 4EDUA 1OYXA 3C12A 3OSVA 1JJ2A 3FIFA 5LJ3d 2YHTA 2B8AA 2JZ2A 4LDYA 1KD1U 2GFAA 2K2VA 4EMKB 1M8VA 2AHJB 5GAOq 2FVUA 3CD6T 1VQLA 2FHDA 3FDRA 4M78F 5FU6C 2RI3A 3M58A 3FRNA 4J6YA 3JSCA 2A7YA 3BY7A 3V8KA 4C92C 5GMKi 3QUIA 4C0ZA 3S3MA 1OI1A 4C92F 2CGHA 1VQLT 4M75E 4BE2A 2E12A 4XU0A 4F7UE 4XTYA 4JRKA 3SB2A 5LJ3j 2OTJA 2MAMA 1YI2A 1YIJT 3CCMA 3HSBA 4HCCA 2ZPEB 4GY5A 2O4XB 5LJ5g 5GANe 3GNFB 4JJNK 4ZN3A 4E7JA 3H6ZA 3MP8A 4M77E 1YITA 1K8AC 1VQ8A 3CPWA 5LJ5h 5FU6B 3CMAT 5CIUA 4C8QB 3M59A 2WSEE 3PTAA 4DQ2A 4C92B 3R6OA 4L59A 4ELYC 2QEXT 1NE8A 4PL6A 2OAUA 1Q82C 2EFIA 3JB9J 2CS7A 3L1AA 1G3TA 2E64A 1QW1A 2A3LA 1S72T 5HY6A 4HT8A 2F5TX 3JCMe 4OP0A 1LOJA 1X75C 4BUGA 3L2VA 1VQ9T 3OYGA 4LDXA 2RD1A 2K5IA 2ZPFB 4OGCA 2KDSA 3CCUA 3F70A 2PU9B 3CMEA 2CKKA 3LYIA 3MEUA 1KC8U 1JB0E 4EMGA 4QQGA 4M7AF 2LT1A 1O75A 4DOWA 4HCBA 2HBPA 4JDSA 3RMSA 5C6SA 1WQWA 2QA4A 1Q81U 1KHIA 1OZ2A 3V8JA 2BKDN 2E1HA 2Y4XA 4P5NA 4NOYA 2WSFE 1KQ2A 1DJ7B 2MWOA 1I5LA 2M9UA 1VQ7T 2JOYA 1N9RA 1IREB 3EFSA 5A0DA 4A4HA 5GAN8 3MHXA 5GANg 5L8RE 2RHYA 1MHNA 4Y28E 2VXFA 3VYHB 2RH2A 4RCBA 5KCHA 2ZZDA 3KBGA 5D6WA 1X01A 2DXCA 4M75F 3SD4A 4F7UG 3JCMQ 4M7DD 4M78B 4TVRA 3S6WA 2DVEA 3WVEB 5GAMj 1BI0A 2E6NA 2HAXA 2D0QB 3BFMA 2EJFA 2K3YA 1H3ZA 1Y71A 3JCMV 3CC2A 4J83A 4LDUA 2X4WA 1W2BS 2DK3A 4M77B 2MI6A 3PMIA 5J26A 5LJ5e 2VUBA 4M7AE 1VQOT 5FROA 2V8IA 3I56A 2Y90A 2RJEA 4JRIA 3RESA 3V8LA 3V7RA 3NTHA 1ZQ1A 2L89A 3WVDB 5GMKj 1UGSB 5FRNA 2RI5A 3CCSA 4M7DF 4A4GA 3J80E 2XK0A 1U8RA 2RHIA 2FL7A 2K5FA 2FYKA 4C5EA 5GANj 1VQKT 1I4K1 3OYAA 5HK0A 1BYMA 4M7DE 4ZN1A 3OYNA 2MWPA 1KD1C 5GAN3 5KH6A 2RA2A 4M7DC 5GANh 5CO7A 3CC7A 5IT9E 2DD4A 2EKOA 3JB9G 1AHJB 2V8JA 1VQOA 3M53A 2WSCE 2YRVA 4ELZC 2H3JA 3OMCA 4PJOE 4XU2A 2P0QA 5FLXE 4RCCA 1KQ1A 3JAME 3E9FA 2RB6A 2JVVA 4M75B 3SWNB 4ZTFA 4BI4A 5GAN2 2NLUA 2QQRA 2EYQA 4KUIA 3JB9D 4FT4A 4M7AC 5GANd 3X26B 2O4XA 1G3WA 1VQNA 4D6WA 1Q86U 5GAN6 1YIJA 4A4KA 1UEBA 2RHXA 3M54A 3VYGA 4QVDA 1Q82U 1YHQA 1VQ4A 3BDUA 2LDMA 2MF2A 1KHCA 4MMKA 5J3BA 2DAQA 3WXMB 4C8QE 3J81E 4E7HA 4J8OA 3LLRA 2DZ9A 4C92E 3QJ6A 1H641 2QDYB 4M78E 2KQWA 4PKCC 3CMAA 1N9SA 1UB4A 2VV5A 2ZCFB 1NJIU 1Y07A 1Y96A 2ZPIB 2RO0A 3RERA 1VQPA 3PGGA 4A54A 2VGMA 1NPRA 1Y7XA 3UDCA 3M4YA 5CKHA 3HRSA 2R57A 3OYEA 4BDZA 2RK1A 4KUDK 4QQ6A 1MGQA 4C8QG 1BKBA 3OYKA 1WQ7A 4F7UB 3URGA 5GAMd 2K57A 3GNGA 2DXTA 4HCZA 1VQ6T 3G7ZA 4A4FA 5DY9A 1M1KU 2D6FA 3I55A 4II1A 2DTOA 3E9GA 5EG2A 2RI2A 3FEOA 4BDYA 4XK8E 3CCJT 2EAYA 5D6XA 2E6ZA 2XDDA 3X25B 4XTXA 2R5MA 4GLKA 1XNIA 3JCMc 5GAN7 1VQ6A 3QBYA 4RG2A 2E5QA 5A0GA 1WPYA 2LC4A 3L42A 2MMPA 3M9QA 3V7CA 1VQMA 2LX9A 3GOXA 3SFMA 3DLMA 3OS5A 4OVAA 3DKMA 5GAN5 4BE1A 1JRIA 4KULA 4HKEA 3L2QA 5LJ3f 3BDLA 2XICA 2ZPGB 3BW1A 5LJ5d 5A0LA 2XU8A 2ZGWA 3VUBA 1HK9A 1QVGS 3CCJA 1N8RU 4M78D 1UGPB 2RK2A 4Y91A 3X20B 3L2UA 1P92A 3KUFA 3QJYA 4XU3A 1XOVA 2KSSA 1N8RC 3OYMA 3ZFJA 3L2WA 4OB2B 4LDWA 2K4YA 3CEYA 3G6EA 4XTWA 4OF1A 3CCEA 4M75D 2BUDA 3C94A 4IUPA 2LQKA 5J39A 4J7FA 5GMKl 4C8QD 5LJ5f 3PMTA 5DLQE 1K9MU 3LGFA 3QYGB 1U1TA 3C95A 1W4SA 1VQ8T 4XTVA 3JCMJ 4FU6A 2DO3A 1K9MC 4XTUA 4C8QF 4LD9K 3OYBA 1FX7A 3E19A 1ZBXA 3MEAA 3VUZA 3HPWA 4R56A 4JRPA 1IZ6A 2ZPBB 2KY9A 3SDZA 1W2BA 4V2SA 3LGLA 5M9OA 4OB0B 2KVQG 1YJNA 2X35A 5CKDA 2DXBA 4PNOA 1Q7YU 3GF5A 2K5LA 3RMQA 2DXUA 3C4SA 2CZ0B 5KCOA 4XQ3A 3DB4A 3OBYA 1QVFS 3OQ5A 4M75G 5GAN4 5CKEA 1WJSA 5KE3A 3UWNA 3JCMh 3QKJA 3CC7T 1VQ5T 4EPCA 4PJOB 1M9SA 4MZTA 1M4ZA 1KQSA 3TCJA 3OA6A 3G4SA 3A5ZB 2JTMA 1WJRA 3UPUA 5HK3A 3TU4K 2RJDA 1YJNT 1N27A 2E41A 3HHTB 1I81A 2HQXA 2DIQA 3LH0A 5GAMf 3PIPA 1WGSA 2DTHA 3G71A 1PSFA 2CYZB 4VUBA 1D3BB 4M7DB 1B34B 4ME7A 2R58A 5IN1A 1K73U 3RKWA 3QZ9B 1O9SA 3M56A 1M90U 4M78C 3LW5E 5GAOp 3UT1A 2GQVA 4OB3B 2R5AA 2Y4YA 1QP2A 3MO8A 3QSUA 1FXXA 3CD6A 2L8DA 3LWHA 4M77F 3NFCA 2K3XA 4J7IA 3OYYA 3P8DA 3OYCA 1Q7YC 5FRMA 5CAIA 3JCMP 3QPHA 2GCXA 5D6YA 4FSXA 1LJOA 2RJFA 3HFOA 3A8LB 4NL2A 4MMLA 3RUXA 5GAOn 1NJIC 3X24B 3OYHA 5CKFA 3G71T 3JCMb 1YJWT 3A8GB 3DB3A 3X28B 2XKOC 2XI9A 3JCMW 1YI2T 3J7AF 3M55A 4Q5WA 2EWNA 3CCRA 1PSEA 4A4EA 2RJCA 2WACA 4BE0A 4PJOF 4OMFB 1VUBA 4PLIA 5GAOl 2F69A 3PT9A 3M5AA 1B34A 3MEWA 3CCET 4BI8B 4E7LA 3T9NA 2RM4A 3QXEB 2PUOB 2VC8A 4PJOD 1VQ5A 2LRQA 2E65A 4EMKC 1VQMT 3CPFA 5CCAA 2LQ8A 4RKUE 4JS5A 1QVPA 3EAEA 2KAFA 2LT4A 1KQSS 4J6XA 5HKCA 3OBWA 1VQNT 2RHUA 1RI0A 5CKBA 3ZEHA 3CC2T 3OMGA 4RMOA 3S3OA 1YJ9A 2X4XA 4M7DG 3JCMg 3CCRT 3HL8A 2JN0A 2QQ9A 2E70A 4DA4A 1BI2A 4C0GA 2OTJT 2EQKA 2X4YA 5GAMh 4N0AA 4M78G 2D9TA 3RIRA 3OW2A 3AHUA 2P4TA 4IURA 4C8QA 1M1FA 4M7AD 1RL2A 5FU7B 1VQKA 3MP6A 2VXEA 3OS2A 1YJ9T 3ME9A 3MEVA 3VU3C 3CCQT 3I55T 3GLXA 3MCAB 2BIVA 4C0DC 1Q86C 4N4IA 3JCMd 4LDVA 1YJWA 4Z02A 3CXCA 3OY9A 2PUKB 4KT0E 3CCQA 3FB9A 3LX7A 4UC4A 5DLOA 4MDWA 5CR2A 3QHSA 3S3NA 3P8BB 3TEEA 4MZPA 5LL6S 2CZ6B 4PJOG 1KG1A 5DM7R 1ZHIA 4BD3A 2LCCA 4HA8A 5LJ3e 2DIGA 3NTIA 1X6OA 3A8MB 4IUVA 3CC4T 3JRZA 3A8HB 3OW2S 1GXIE 2HNIA 1M5Q1 2ZPHB 3HFNA 4M75A 2QQAA 3SWNA 2OTLA 4F7UA 4RG8A 3QYHB 2VGNA 4XTZA 4LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8L A;  3RKY A;  3V7R A;  2DXU A;  4XU1 A;  4N0A C;  3V7S A;  4XQ3 A;  4M77 A;  5GMK j;  5GMK m;  4C92 D;  4M75 G;  2DZC A;  5GAN 4;  4M7D F;  4WF2 A;  1U1S A;  4C8Q C;  1JBM A;  3JCM h;  3EFR A;  4PJO B;  1D3B A;  2FYK A;  5GAN j;  1WNL A;  1I4K 1;  4XTZ A;  4M7D E;  2EJ9 A;  4JLI A;  3JB9 I;  5GAN 3;  2DEQ A;  2RA2 A;  4M78 A;  5LJ5 j;  4M7D C;  4M77 G;  5GAN h;  2YLC A;  4NL3 A;  2FB7 A;  1HXD A;  3QO3 A;  2E41 A;  2EJG A;  3JB9 G;  1I81 A;  3FIF A;  5GAM f;  5LJ3 d;  2DTH A;  2YHT A;  4PJO E;  1D3B B;  4XU2 A;  4RCC A;  1KQ1 A;  2RB6 A;  4M75 B;  4X9D A;  1B34 B;  3SWN B;  4EMK B;  5GMK e;  4M7D B;  5GAN 2;  1M8V A;  5GAO q;  4M77 C;  3RKW A;  3JB9 D;  4M7A C;  2DKG A;  3FJP A;  4M78 F;  5GAN d;  4J6Y A;  4M78 C;  5GAO p;  5GAN 6;  1BIB A;  4F7U F;  3QSU A;  3BY7 A;  3V8K A;  3JCM f;  4C92 C;  3QUI A;  4QVD A;  5GMK i;  2DJZ A;  4M77 F;  3INZ A;  2CGH A;  3BDU A;  4JUV A;  4C92 F;  4M75 E;  5CAI A;  2E10 A;  4MMK A;  4XU0 A;  3JCM P;  4F7U E;  4C8Q E;  4XTY A;  4JRK A;  1LJO A;  4NL2 A;  3HFO A;  3SB2 A;  3RUX A;  1I8F A;  2DZ9 A;  4MML A;  4C92 E;  5LJ3 j;  5GAO n;  1H64 1;  4M78 E;  3HSB A;  3JCM b;  1N9S A;  5LJ5 g;  5GAN e;  1Y96 A;  5LJ3 h;  3JCM W;  3RER A;  3PGG A;  4A54 A;  4M77 E;  2EWN A;  5GAM e;  1BIA A;  5LJ5 h;  1MGQ A;  4C8Q G;  4PJO F;  1WQ7 A;  5LJ3 g;  4F7U B;  5GAM g;  4C8Q B;  5GAM d;  5GAO l;  2K57 A;  4PJO C;  2DXT A;  5GMK h;  1B34 A;  5DY9 A;  4C92 B;  4DQ2 A;  2DTO A;  2RM4 A;  1Y96 B;  4PJO D;  2VC8 A;  4J5Y A;  2E65 A;  2EAY A;  4M75 C;  3RKX A;  3SWN C;  3L1A A;  4EMK C;  4XTX A;  3JB9 J;  3JCM c;  2E64 A;  5GAN 7;  4HT8 A;  4QVC A;  4J6X A;  3JCM e;  1WPY A;  4OP0 A;  4M7A A;  1LOJ A;  3V7C A;  2RD1 A;  3JB9 H;  4M7D G;  3JCM g;  5GAN 5;  1JRI A;  2JN0 A;  5LJ3 f;  4M77 D;  2DTI A;  4JRI A;  4EMG A;  3BW1 A;  5LJ5 d;  4M7A F;  2ZGW A;  1HK9 A;  4J6W A;  5GAM h;  4N0A A;  1WQW A;  4M78 D;  4M78 G;  3V8J A;  4M7D A;  2I2L A;  4Y91 A;  3RIR A;  4M7A D;  2E1H A;  3AHU A;  4C8Q A;  4NOY A;  4XU3 A;  5GAN f;  1KQ2 A;  1I5L A;  3L2Z A;  1N9R A;  1YCY A;  5I21 A;  5GAO r;  2VXE A;  3EFS A;  3M4G A;  4XTW A;  3VU3 C;  5GAN 8;  4PJO A;  4X9C A;  5GAN g;  4HT9 A;  4M75 D;  2VXF A;  5GMK l;  5LJ5 f;  4C8Q D;  3JCM d;  4RCB A;  4M7A B;  3JCM Q;  1U1T A;  1X01 A;  4M75 F;  4F7U G;  4M7D D;  3FB9 A;  4XTV A;  3JCM J;  4M78 B;  4M7A G;  5GAM j;  2DVE A;  2QTX A;  3QHS A;  4C92 G;  2YLB A;  4XTU A;  4A53 A;  4C8Q F;  5GAO m;  4PJO G;  3BFM A;  2EJF A;  3JCM V;  4HA8 A;  5LJ3 e;  4M77 B;  3GIB A;  5LJ5 e;  2HNI A;  1M5Q 1;  3HFN A;  4M75 A;  1LNX A;  3SWN A;  4EMK A;  4EMH A;  3JCM X;  4F7U A;  4V2S A;  4M7A E;  3JB9 F;  1TH7 A;  4C92 A;  4PNO A;  2Y90 A;  3RES A; 
#chains in the Genus database with same CATH topology
 2DFU A;  1UHF A;  3NHN A;  4E7I A;  2SRC A;  3KFV A;  3QII A;  3OYJ A;  2F2V A;  3FLG A;  2HEQ A;  4C5G A;  1BI1 A;  2DEQ A;  2CH4 A;  1S72 A;  2YLC A;  4ESR A;  2EJG A;  2HZY A;  2XG8 D;  1E6H A;  5GMK e;  4KBM B;  1YIT T;  1FWZ A;  3EGD B;  2JUF A;  1NZ9 A;  3Q1J A;  4E47 A;  3QZ5 B;  3OB9 A;  1NJI U;  4FM4 B;  2X3W D;  1JXO A;  2KT8 A;  1ZSZ A;  4FYY B;  3VJP A;  1UGV A;  2YWW A;  3VV0 A;  2QQS A;  1AD5 A;  1N6A A;  2L5Q A;  1V29 B;  1QVF A;  1BIA A;  4N4H A;  2MIO A;  1GL5 A;  2F2X A;  4WCI A;  4KGX B;  3PNW C;  3TSZ A;  3CCL T;  3SWN C;  4LUE A;  2QA4 Q;  3I35 A;  2DD5 A;  4IUT A;  1GRI A;  3AT1 B;  4ANJ A;  2O01 E;  1EIF A;  3GBQ A;  5I22 A;  4ATO A;  3CBO A;  3EGX A;  3CCR Q;  3NTK A;  3CCU T;  4ZTJ A;  5AYF A;  4M7D A;  2KYB A;  2LMJ A;  3EG3 A;  3L2Z A;  5I21 A;  1G5V A;  1M3A A;  2O31 A;  4X9C A;  4FW1 A;  1M1G A;  1OPK A;  2V1Q A;  4HVU A;  1G3S A;  4MDX A;  2JW4 A;  4M7A G;  4BY6 C;  2RHZ A;  4F14 A;  2F5K A;  4A53 A;  2CP2 A;  2YDL A;  1YBY A;  4C0D B;  2YXY A;  4EMK A;  4EMH A;  1OX9 A;  3N5B B;  4C92 A;  2JXB A;  5GAM g;  2YUQ A;  3RKY A;  3BE3 A;  2PTK A;  1SRL A;  4BB7 A;  2KEA A;  3CCV A;  4J9G A;  3D7S B;  2KK4 A;  4C0F A;  3MP1 A;  3EFR A;  2EQJ A;  1XTD A;  1AT1 B;  2M02 A;  2X4J A;  2XDB A;  3VKI A;  3VRY A;  5C0M A;  2HSP A;  1BCO A;  3FIF A;  2KGT A;  1WI7 A;  2KBT A;  4PFO A;  2YHT A;  2B8A A;  1KD1 U;  2GFA A;  4EMK B;  2AHJ B;  5GAO q;  2FVU A;  3FRN A;  2H3E B;  3VS1 A;  5GMK i;  1OI1 A;  4RUG A;  2ED0 A;  4OMO A;  5LJ3 j;  1YI2 A;  1YIJ T;  3CCM A;  3HSB A;  1MND A;  1ZX6 A;  3MP8 A;  1YIT A;  1WHH A;  1K8A C;  3CPW A;  5CIU A;  2HDA A;  4C8Q B;  3R6O A;  4L59 A;  4ELY C;  1NE8 A;  3REB B;  2OAU A;  1UE9 A;  1Q82 C;  2EFI A;  1WYX A;  4D8D A;  1QW1 A;  2F5T X;  1U3O A;  2D8H A;  2GTO A;  3OYG A;  2ZPF B;  4OGC A;  1RAE B;  3F70 A;  2O88 A;  3LYI A;  3MEU A;  4EMG A;  2BTT A;  4DOW A;  4JDS A;  5C6S A;  1WQW A;  3M0Q A;  3V8J A;  4NOY A;  4X1V A;  3CXC P;  1N9R A;  2CSI A;  4A4H A;  3MHX A;  5GAN 8;  3SEM A;  4Y28 E;  2VXF A;  1NG2 A;  3VYH B;  1WXB A;  5KCH A;  2ZZD A;  3KBG A;  2YUN A;  3JCM Q;  4TVR A;  3VS0 A;  3UAT A;  2HAX A;  1Y71 A;  4ORZ A;  3PMI A;  1GFC A;  4M7A E;  1VQO T;  5FRO A;  3THK A;  3I56 A;  2Y90 A;  3V8L A;  2XK0 A;  2CP0 A;  1OX8 A;  1OOT A;  5HK0 A;  3OYA A;  2J6K A;  1SG5 A;  1KD1 C;  1VQ5 Q;  2RA2 A;  2J7I A;  5GAN h;  5CO7 A;  3CC7 A;  5IT9 E;  2DD4 A;  4Z89 A;  3JB9 G;  2YRD A;  2NUT A;  2RMO A;  2EYQ A;  1OQK A;  1WZO A;  3JB9 D;  2J05 A;  4M7A C;  2O2O A;  2IIM A;  3M0P A;  1UEB A;  4A4K A;  2OTL Q;  3EHQ A;  3CMA Q;  3VS6 A;  2LDM A;  1KHC A;  4RTW A;  2DAQ A;  4J8O A;  1KK7 A;  2AKL A;  3QJ6 A;  1H64 1;  4PKC C;  2KQW A;  2ZCF B;  1N9S A;  1Y07 A;  1Y96 A;  2DYB A;  2ZPI B;  2RO0 A;  3RER A;  2QK0 A;  2VGM A;  1NPR A;  2R57 A;  4BDZ A;  4QQ6 A;  1OUL A;  3OYK A;  4F7U B;  4AG2 C;  3G7Z A;  3I55 A;  1YFN A;  2JJ9 A;  3EG1 A;  2RI2 A;  3FEO A;  3CCJ T;  4XTX A;  4GLK A;  1CKB A;  1WPY A;  2LC4 A;  3V7C A;  1MMD A;  1KSW A;  1MV3 A;  2LX9 A;  4HKE A;  2F1L A;  3BDL A;  2W0Z A;  5LJ5 d;  1QVG S;  1HK9 A;  1UGP B;  2RK2 A;  4Y91 A;  2OTJ Q;  3KUF A;  1XOV A;  2KSS A;  3OYM A;  1WHL A;  4LN2 A;  1U1T A;  3C95 A;  4FU6 A;  2A28 A;  3E19 A;  5IXB A;  3HPW A;  2HBW A;  2AT1 B;  1IZ6 A;  2ZPB B;  4Z8A A;  4R56 A;  4JRP A;  2KY9 A;  3SDZ A;  1W2B A;  2KR3 A;  5M9O A;  2GTJ A;  4OB0 B;  2J06 A;  2X35 A;  5CKD A;  1W70 A;  1Q7Y U;  2VAS A;  3CME Q;  5KCO A;  3OQ5 A;  4M75 G;  5GAN 4;  2VWF A;  5CKE A;  4PJO B;  3C0C A;  2L3Q A;  1KQS A;  2LNH B;  2JTM A;  1X2K A;  4LXC A;  2RJD A;  1N27 A;  5GAM f;  3EFO A;  2CYZ B;  1D3B B;  2EQI A;  1ACM B;  1MUZ A;  1ZA1 B;  2DER A;  1VQP Q;  1K73 U;  1TOV A;  3QZ9 B;  1WX6 A;  1YI2 Q;  4M4Z A;  3QSU A;  2HCK A;  1FMK A;  2L8D A;  2JS2 A;  2M0Y A;  3NFC A;  3JCM P;  1RAH B;  5D6Y A;  3A8L B;  3RUX A;  3X24 B;  3OYH A;  3G71 T;  5KYX B;  2XKO C;  3J7A F;  3CCR A;  4Q5W A;  2BE7 D;  2WAC A;  1J3T A;  1JU5 C;  4OMF B;  3M5A A;  1NBE B;  4E7L A;  4AFZ C;  4PJO D;  2E65 A;  4EMK C;  1D09 B;  1C1A A;  1SKU B;  1VQN T;  5HKC A;  2ENM A;  2X4X A;  1T3L A;  1QQJ A;  2DJQ A;  2QQ9 A;  2E70 A;  1IGQ A;  4C0G A;  2EQK A;  1A0N B;  2L2P A;  1G83 A;  4A63 B;  1V1C A;  1M1F A;  3MP6 A;  2QAS A;  1E7O A;  3GLX A;  2ESW A;  3VS7 A;  2BIV A;  4LDV A;  3CXC A;  1ZUK A;  3FB9 A;  4MDW A;  2VKN A;  3S3N A;  1RI9 A;  4MZP A;  4PJO G;  1ZHI A;  4BD3 A;  5LJ3 e;  3NTI A;  1PD0 A;  4M75 A;  2JS0 A;  2ZPH B;  2QQA A;  3HFN A;  4J9I A;  2FPE A;  4XTZ A;  3E2U A;  1W6X A;  4XU1 A;  2K9G A;  2DZC A;  2PVO B;  2M16 A;  1VQ7 A;  1ZUU A;  2EBP A;  3JB9 I;  3CBP A;  5LJ5 j;  1KJW A;  2QXF A;  2FB7 A;  1HXD A;  4PJL A;  5KE2 A;  2LX7 A;  2CZ1 B;  4X9D A;  1MV0 B;  2EKH A;  1BU1 A;  2P0K A;  1BI3 A;  2KMT A;  1OEB A;  1VQ4 T;  2JNG A;  3INZ A;  4JUV A;  2QI2 A;  2XDP A;  1I8F A;  1G3Y A;  1H92 A;  3OYI A;  2GBQ A;  1E6G A;  4QVZ A;  1PCX A;  1I07 A;  3HRT A;  1QKW A;  2COW A;  4FT2 A;  4J5Y A;  1VQ9 A;  1QKX A;  1M27 C;  3CXC S;  4QVC A;  2CP6 A;  5A2Q E;  4M7A A;  2KRN A;  3L2R A;  1YWP A;  7AT1 B;  3JB9 H;  2M0O A;  1GCP A;  5KYW B;  3CCU Q;  1SHG A;  3H0F A;  3VS5 A;  4F04 B;  2DVJ A;  1MMN A;  3HP9 A;  1EFN A;  1JJ2 P;  3E1S A;  3G6E T;  4BI3 A;  2EQU A;  2NWM A;  1YP5 A;  4FIB A;  5GAN f;  4QW2 A;  3ZBD A;  1ZA2 B;  4IKF A;  2CUD A;  2EYZ A;  3A98 A;  1VIF A;  4J9C A;  4PJO A;  2D0N A;  5IH2 A;  3GP8 A;  1VQ8 Q;  1QP3 A;  1ABO A;  1TU0 B;  4C92 G;  3O8V A;  1YHQ T;  2Z0W A;  1Y57 A;  1OZ3 A;  4WTO B;  3UF4 A;  2OX7 A;  5KYY A;  3JB9 F;  4XAX B;  2YRC A;  4M78 A;  3H8Z A;  1WLP B;  3TRE A;  1MNE A;  2GF7 A;  3P8H A;  3EG9 A;  2DL8 A;  1ZLM A;  3PIO A;  3A8O B;  1NEB A;  2L3R A;  2EJ9 A;  3M57 A;  4JLI A;  3CCV T;  2FZG B;  2C0O A;  1OYX A;  3JV3 A;  5LJ3 d;  2K2V A;  1MMG A;  1VQL A;  2RI3 A;  4K11 A;  4J6Y A;  3JSC A;  3H41 A;  2RQR A;  3BY7 A;  3S3M A;  3QUI A;  6AT1 B;  1RLP C;  2E12 A;  4JRK A;  2DA9 A;  2P4R A;  4E2F B;  3EGD A;  1ZBJ A;  2DLP A;  3H6Z A;  4CC7 A;  2NUZ A;  3CMA T;  4PFP A;  2V1R A;  1HD3 A;  4FCY A;  3M59 A;  4PL6 A;  3I5S A;  4AMC A;  2CS7 A;  4FYV B;  3L1A A;  1G3T A;  1S72 T;  4J9B A;  2MOX A;  5HY6 A;  2CH4 W;  4FSS A;  4LDX A;  1X27 A;  4CC4 B;  2KDS A;  2PU9 B;  2CKK A;  1KC8 U;  2KNB B;  2FRY A;  1M3B A;  1AVZ C;  2QA4 A;  1Q81 U;  2BKD N;  4PJJ A;  4P5N A;  1KQ2 A;  1I5L A;  2M9U A;  4DEY A;  1PG5 B;  5A0D A;  2X9H A;  1X43 A;  2RH2 A;  5D6W A;  1X01 A;  1WIE A;  4F7U G;  5GAM j;  2E6N A;  3BFM A;  2EJF A;  2K3Y A;  2RQW A;  3JCM V;  4J83 A;  1IHV A;  2E5K A;  2LZ6 B;  2V8I A;  4JRI A;  2RJE A;  3RES A;  3V7R A;  2L89 A;  2EYY A;  5FRN A;  2RI5 A;  2ZAE A;  4RTV A;  2DBM A;  4M7D F;  1U8R A;  2RHI A;  2FYK A;  1VQK T;  2LQW A;  4CC3 A;  4M7D E;  1BYM A;  3I5R A;  3G1J A;  1VYT A;  2KRO A;  1VQO A;  3M53 A;  2YRV A;  2YT6 A;  2L3P A;  4PJO E;  4XU2 A;  3JAM E;  3SWN B;  2JVV A;  1B7T A;  5GAN d;  2O4X A;  2QDL A;  1K8A R;  4D6W A;  2RHX A;  4KGZ B;  3M54 A;  3VYG A;  3BDU A;  4MMK A;  5J3B A;  3WXM B;  1ARK A;  1G8X A;  1AWJ A;  4C92 E;  1AZE A;  1GBR A;  3CMA A;  4PK4 A;  5ECA A;  2DRM A;  4F16 A;  1YIJ Q;  1VQP A;  4A54 A;  1ZUY A;  3UDC A;  5CKH A;  3OYE A;  1MGQ A;  1G2B A;  2KYM A;  1VQ6 T;  4A4F A;  5DY9 A;  1M1K U;  1QCO A;  4II1 A;  2DTO A;  1WXU A;  1IHW A;  1QCF A;  5GAN 7;  4RG2 A;  4J9E A;  3RR6 A;  3M9Q A;  3GOX A;  3SFM A;  3DLM A;  2CT4 A;  3OS5 A;  4OVA A;  2FEI A;  5IXF A;  1JRI A;  1M2V B;  4KUL A;  1JQQ A;  3NGP A;  1EX4 A;  2XIC A;  1SRM A;  3BW1 A;  2CRE A;  2HMA A;  2ZGW A;  3VUB A;  3I9Q A;  2DX1 A;  3CC2 Q;  3EH2 A;  1KFZ A;  3I55 Q;  4AFS C;  2K4Y A;  4XTW A;  2BZY A;  2EGA A;  3EG9 B;  2LJ0 A;  4AFU C;  1ZSZ B;  2BUD A;  5LJ5 f;  1D0Z A;  2BZX A;  1W4S A;  3G6E Q;  3JCM J;  1AEY A;  4LD9 K;  4PFZ A;  1ZBX A;  3MEA A;  5KYN A;  3LGL A;  2COZ A;  1JO8 A;  2K5L A;  3RMQ A;  3C4S A;  2CZ0 B;  4PJM A;  1I1J A;  2H8H A;  3OBY A;  3QKJ A;  1M9S A;  1TXQ A;  3CC7 Q;  3TCJ A;  3A5Z B;  1X6G A;  1WJR A;  5HK3 A;  2FO0 A;  2E41 A;  2HQX A;  3G71 A;  3UA6 A;  2L0A A;  4ME7 A;  2GQI A;  5IN1 A;  2C0T A;  1D0X A;  4M78 C;  2R5A A;  1QP2 A;  3MO8 A;  3CD6 A;  3TVT A;  4KRT A;  1VQ4 Q;  2EPD A;  4M77 F;  2K3X A;  4FSX A;  1LJO A;  2RJF A;  3HFO A;  4MML A;  5FWC A;  1VQL Q;  3JCM b;  2BE9 B;  3IQL A;  1BK2 A;  1QMC A;  3M55 A;  2DIL A;  2EWN A;  1PSE A;  3EHR A;  1VUB A;  5GAO l;  2F69 A;  3PT9 A;  3T9N A;  3QXE B;  1OV3 A;  3M0R A;  2DL5 A;  1VQM T;  1WHK A;  1VQ9 Q;  1K73 R;  3HTR A;  3EAE A;  2KRM A;  2LT4 A;  4J6X A;  3OBW A;  3ZEH A;  4RMO A;  1IB8 A;  3H9N A;  4M7D G;  3CCR T;  3HL8 A;  1JXM A;  2QYZ A;  3R6N A;  4DA4 A;  1LCK A;  1M1K R;  2OTJ T;  5GAM h;  2D9T A;  3RIR A;  4M7A D;  3AHU A;  1K9A A;  5FU7 B;  1AWX A;  1D1B A;  2YSQ A;  2RN8 A;  3VU3 C;  3I55 T;  1Q7Y R;  1T0J A;  4N4I A;  1PRM C;  5KYY B;  2PUK B;  3REA B;  4EIK A;  5CR2 A;  3QHS A;  3TEE A;  5LL6 S;  1RAD B;  1KG1 A;  1IRX A;  2LCC A;  2RQT A;  3CC4 T;  8ATC B;  3A8H B;  2KE9 A;  1K0S A;  3SWN A;  1B3Q A;  4RTY A;  1WFW A;  3QYH B;  1D0Y A;  4RTT A;  4N0A C;  1R8O B;  5GMK m;  1U1S A;  4X34 A;  2K79 A;  3CCL A;  1D3B A;  2BZ8 A;  1K73 C;  2M1H A;  3CCS T;  1GCQ C;  2NUP B;  4M77 G;  2G3R A;  3OS1 A;  2OTL T;  3QO3 A;  2AZV A;  1UGQ B;  1NM7 A;  5CVI A;  4JLG A;  1Q82 R;  4M77 C;  1YJW Q;  2NYS A;  2PVG B;  2LNV A;  1BIB A;  5GJW B;  3DLL A;  1VYU A;  3JCM f;  1HYO A;  2EQM A;  2E10 A;  2OJ2 A;  2HD0 A;  1VQP T;  1KC8 C;  4QQD A;  4J9H A;  2QA4 T;  1PM3 A;  2IG0 A;  5GAM e;  5IAY A;  2QEX A;  1Q81 R;  4PJO C;  4OMP A;  1VQM Q;  1QLY A;  1Y96 B;  4IUQ A;  1QVF P;  3RKX A;  1KIK A;  2DF6 A;  2RF0 A;  1IXD A;  1BCM A;  5HCK A;  4PLL A;  2DTI A;  4J9D A;  4J6W A;  5CQY A;  1BB9 A;  4RTU A;  3KXT A;  3FJ5 A;  2OAW A;  1UGR B;  3PVL A;  3OYD A;  1OU8 A;  1YCY A;  3CC4 Q;  2DEU A;  1I0C A;  4HT9 A;  3UA7 A;  2MPX C;  2HKQ B;  3CCQ Q;  4C5I A;  1UDL A;  3TSW A;  4OGE A;  5FU7 C;  3CC4 A;  4Z88 A;  1NPP A;  2QTX A;  5GAO m;  1LPL A;  4JZ3 A;  3MET A;  3TQ7 P;  4C5H A;  2XD0 A;  1RAB B;  1VQO Q;  3CCM T;  3GIB A;  3CBM A;  3LWI A;  1M90 C;  1VQK Q;  4R55 A;  4ZGE B;  2JM9 A;  2EYX A;  5I2M A;  2VVK A;  2XHC A;  4CRI A;  1VOM A;  4FYX B;  4LUD A;  2E4H A;  3I56 T;  1JJ2 S;  1OU9 A;  3OSS C;  1WNL A;  3O5Z A;  3M0S A;  4ZGD B;  2FPF A;  4MZM A;  2AIR B;  1WJQ A;  4NL3 A;  3C12 A;  5FWB A;  3OSV A;  1JJ2 A;  4LDY A;  1AZG B;  1YWO A;  1M8V A;  2E3H A;  1PRL C;  3CD6 T;  2YUO A;  2D1X A;  3FDR A;  4M78 F;  5FU6 C;  1TS9 A;  4E7Z A;  2A7Y A;  3V8K A;  2JM8 A;  4C92 F;  3NPF A;  1VQL T;  4BE2 A;  4XU0 A;  5KYU B;  4F7U E;  2OTJ A;  2MAM A;  3CCJ Q;  9ATC B;  2O4X B;  5GAN e;  3CD6 Q;  1R77 A;  3GNF B;  1UUE A;  4JJN K;  4M77 E;  2DL3 A;  1VQ8 A;  1EZZ B;  2JMA A;  3PTA A;  4DQ2 A;  4C92 B;  2QEX T;  1S72 Q;  3G71 Q;  2DRK A;  2FZC B;  1VQ6 Q;  1LOJ A;  3G4S Q;  3L2V A;  2RD1 A;  3CCU A;  3VS4 A;  3CME A;  1YJ9 Q;  2J6F A;  3M0T A;  4QQG A;  4M7A F;  2LT1 A;  2DL4 A;  4HCB A;  3RMS A;  1OZ2 A;  1FMW A;  3EH1 A;  2E1H A;  2Y4X A;  3MPU B;  2WSF E;  5KYW A;  4FYW B;  3EFS A;  4HVW A;  2ATC B;  5GAN g;  5L8R E;  2KI7 A;  2RHY A;  1MHN A;  2A37 A;  3SD4 A;  4M7D D;  4M78 B;  3WVE B;  2DVE A;  4QT7 A;  2D0Q B;  4QKU A;  1H3Z A;  4LDU A;  2IPO B;  2X4W A;  2DK3 A;  2MI6 A;  2JMC A;  2GNC A;  2E3I A;  4J9F A;  1H8K A;  2A0F B;  1ZQ1 A;  3WVD B;  5GMK j;  4JJC A;  2HL3 A;  3CCS A;  3J80 E;  3EG0 A;  2FL7 A;  1I4K 1;  3I56 Q;  3OYN A;  1TUC A;  4HVV A;  2PZ1 A;  1AHJ B;  2V8J A;  8AT1 B;  1CKA A;  1RLQ C;  2P0Q A;  5FLX E;  4RCC A;  2QGG A;  2LQN A;  3E9F A;  2RB6 A;  4M75 B;  4KGV B;  5GAN 2;  1UTI A;  2NLU A;  2QQR A;  1W1F A;  4KUI A;  1K0X A;  4FT4 A;  3CPW P;  3X26 B;  1IO6 A;  1G3W A;  4E7S A;  4LE9 A;  5FW9 A;  1YIJ A;  4QVD A;  1Q82 U;  1YHQ A;  1HSQ A;  1RAC B;  1VQ4 A;  1UFF A;  2X51 A;  4E7H A;  2DM1 A;  2V26 A;  4M78 E;  1YCS B;  2QDY B;  2VV5 A;  2ABL A;  1GCQ A;  3PGG A;  2MYS A;  1Y7X A;  3M4Y A;  1TSF A;  1T0H A;  4C8Q G;  1BKB A;  3URG A;  5GAM d;  3GNG A;  4HCZ A;  4F17 A;  1X6B A;  2D6F A;  2QG9 B;  3E9G A;  5EG2 A;  1NJI R;  2COY A;  4XK8 E;  3X25 B;  5GJV B;  2R5M A;  1VQ6 A;  3QBY A;  2E5Q A;  2DBK A;  3L42 A;  2MMP A;  4BE1 A;  5I11 A;  3DKM A;  4RTX A;  3M0U A;  3L2Q A;  2FPD A;  2XU8 A;  3CCJ A;  4M78 D;  2M51 A;  2D8J A;  3L2U A;  1P92 A;  3QJY A;  3L2W A;  4LDW A;  3CEY A;  3G6E A;  1K1Z A;  3LH5 A;  2B86 A;  4OF1 A;  4JJB A;  5AT1 B;  2EVR A;  4IUP A;  5J39 A;  5GMK l;  4C8Q D;  3LGF A;  4XTV A;  2DO3 A;  1NLO C;  2DMO A;  4XTU A;  2AK5 A;  2A36 A;  3VUZ A;  4LNP A;  2YUP A;  4V2S A;  2RQU A;  2KVQ G;  2SEM A;  2MCN A;  1YJN A;  3GF5 A;  2DXU A;  2X3X D;  1SEM A;  4XQ3 A;  3DB4 A;  2CP5 A;  2CUB A;  1WJS A;  5KE3 A;  3UWN A;  3JCM h;  3CC7 T;  4EPC A;  1K76 A;  1WHM A;  4MZT A;  1M4Z A;  1TTH B;  2GGR A;  3VRZ A;  4OMM A;  4KH1 B;  1XJW B;  3NMZ C;  4GLM A;  1YJN T;  1I81 A;  2DIQ A;  3LH0 A;  3PIP A;  1WGS A;  2DTH A;  2ED1 A;  1SSH A;  1UHC A;  2EW3 A;  2R58 A;  3RKW A;  3LW5 E;  5GAO p;  3UT1 A;  2GQV A;  4OB3 B;  2G6F X;  1FXX A;  4IIM A;  1Q95 G;  3LWH A;  3P8D A;  1WXT A;  2GCX A;  3QPH A;  5GAO n;  1LVK A;  3A8G B;  1YJW T;  3DB3 A;  3X28 B;  4CC2 A;  4BE0 A;  4PLI A;  1YNZ A;  3CCE T;  1RAI B;  4BI8 B;  2RM4 A;  2PUO B;  1Z9Z A;  2QAZ A;  2LRQ A;  2RQV A;  2FG0 A;  1QCN A;  1UEC A;  3S3O A;  4HXJ A;  2QEX Q;  1BI2 A;  3EFO B;  3EGU A;  1ZSG A;  4N0A A;  5IHI A;  3OW2 A;  2P4T A;  1Y0M A;  1M2V A;  1RL2 A;  2DNU A;  3ULR B;  2VB6 A;  3OS2 A;  3ME9 A;  3MEV A;  3CCQ T;  3VS3 A;  3JCM d;  1YJW A;  4Z02 A;  3OY9 A;  4KT0 E;  2KRS A;  3LX7 A;  4UC4 A;  5KYX A;  2CZ6 B;  5DM7 R;  2AKK A;  2DIG A;  3OW2 S;  3JRZ A;  1GXI E;  1K9M R;  1M5Q 1;  2NUT B;  2OTL A;  2XMF A;  4F7U A;  1YN8 A;  1BBZ A;  1SF9 A;  2LJ3 A;  2NUP A;  1X2Q A;  2I0N A;  4M77 A;  1U06 A;  4KH0 B;  4C92 D;  1M2O A;  3HRU A;  3CME T;  4WF2 A;  4C8Q C;  2P0P A;  5I2S A;  1N8R R;  1YJN Q;  3ER0 A;  2V8K A;  3QDF A;  1VIE A;  2J6O A;  4L5G A;  4IUU A;  2PQW A;  5KYU A;  1ZSZ C;  4CI0 C;  1CSK A;  3OS0 A;  2DKG A;  4N4G A;  3FJP A;  1AOJ A;  1K8A U;  1VA7 A;  1WHJ A;  4BAC A;  3HKS A;  4F7U F;  4R0K A;  2DJZ A;  2EGC A;  2JTE A;  3MJX A;  2LP5 A;  4ZGJ B;  3ASK A;  5LJ3 h;  3CPW S;  4NS5 A;  3OYF A;  2CT3 A;  1QWE A;  2LCL A;  5LJ3 g;  3GPL A;  1XQH A;  5GMK h;  4B9X A;  2HL5 C;  1F1B B;  2IVW A;  2VYT A;  3RDV A;  1AWO A;  2XID A;  4M75 C;  1M1K C;  3G4S T;  3EGX B;  2FRW A;  3CCL Q;  1NLP C;  1TUG B;  2AZS A;  4O6J A;  4L6V 5;  3QWX X;  3QDR B;  2OI3 A;  4FL6 A;  4DOV A;  4M77 D;  4JRQ A;  2PVD B;  4JJD A;  4BY6 B;  3OYL A;  2HQE A;  2I2L A;  2MK5 A;  2LTO A;  1RAF B;  3PFS A;  4DBF A;  4DBH A;  5GAO r;  3M4G A;  1PWT A;  1R0C B;  1RAG B;  5CK9 A;  2DPP B;  4O5V A;  4M7A B;  2QQB A;  3CCM Q;  1PD1 A;  1UG1 A;  1NYG A;  1PC0 A;  2YLB A;  3QG1 A;  2C06 A;  1KC8 R;  4B9W A;  2GFU A;  1MMA A;  2LVM A;  1U5S A;  1LNX A;  3JCM X;  2JTF A;  1M8M A;  1TH7 A;  1QVG A;  1Q81 C;  1UJ0 A;  4YTL A;  1I5O B;  2EIF A;  1R0B G;  5EC7 A;  3V7S A;  3CQT A;  5CQX A;  3CCS Q;  1JBM A;  1SSF A;  1WA7 A;  1FMV A;  5IHN A;  4JS4 A;  4JPB W;  4E7K A;  2CZ7 B;  4IIO A;  3FC3 A;  4OB1 B;  4DBR A;  4EDU A;  1D1A A;  2JZ2 A;  2FHD A;  3M58 A;  1TWB A;  4AG1 C;  4C92 C;  4C0Z A;  2CGH A;  4M75 E;  2DE0 X;  4XTY A;  3SB2 A;  4HCC A;  2ZPE B;  4GY5 A;  5LJ5 g;  4ZN3 A;  4E7J A;  1RUW A;  2K7A A;  1T3S A;  2EYW A;  1VQN Q;  2ECZ A;  1B07 A;  5LJ5 h;  5FU6 B;  1N5Z A;  2WSE E;  4ZNX A;  3JB9 J;  3RNJ A;  2EGE A;  2E64 A;  1IGU A;  2A3L A;  4HT8 A;  1Z9Q A;  3JCM e;  4OP0 A;  1X75 C;  4BUG A;  1VQ9 T;  2K5I A;  1JB0 E;  2RNA A;  1UJY A;  1O75 A;  2HBP A;  1KHI A;  3A1P A;  5D7U A;  1DJ7 B;  2MWO A;  1VQ7 T;  2JOY A;  1IRE B;  2A08 A;  2QGF B;  4RCB A;  4DBQ A;  1PKT A;  2DXC A;  4M75 F;  3S6W A;  1HJD A;  1BI0 A;  1AWW A;  3CC2 A;  1NYF A;  1W2B S;  4M77 B;  5LJ5 e;  5J26 A;  2O9S A;  4D8K A;  1S1N A;  2VUB A;  1KD1 R;  4DEX A;  3OW2 P;  3NTH A;  1UGS B;  2QTV A;  3CCV Q;  4A4G A;  1GBQ A;  4C5E A;  2K5F A;  5GAN j;  2O9V A;  4ZN1 A;  2MWP A;  5GAN 3;  5KH6 A;  4M7D C;  2EKO A;  5L23 A;  4ELZ C;  2WSC E;  2H3J A;  3OMC A;  3VS2 A;  1KQ1 A;  1ABQ A;  4ZTF A;  2K6D A;  4BI4 A;  3MKD A;  2P84 A;  1VQN A;  2RPN A;  3PVQ A;  1Q86 U;  5GAN 6;  2HSE B;  1SPK A;  5IHK A;  4JZ4 A;  2MF2 A;  3J81 E;  4C8Q E;  3LLR A;  2DZ9 A;  3RBB B;  1KQS P;  3U23 A;  1UB4 A;  1M30 A;  1RAA B;  3HRS A;  4KUD K;  2RK1 A;  2PNI A;  1WQ7 A;  2DL7 A;  2K57 A;  2DXT A;  3QWY A;  4HCK A;  4BDY A;  2EAY A;  5D6X A;  2E6Z A;  2XDD A;  1XNI A;  3JCM c;  5A0G A;  1V76 A;  2ROL A;  3ZL7 C;  1VQM A;  5GAN 5;  3PE0 A;  5LJ3 f;  2ZPG B;  2LJ1 A;  5A0L A;  4RTZ A;  1GFD A;  1N8R U;  1QVG P;  3X20 B;  4XU3 A;  1N8R C;  4E6R A;  2CP3 A;  3ZFJ A;  4OB2 B;  1W2B P;  3H0H A;  3CCE A;  4M75 D;  3C94 A;  2LQK A;  4J7F A;  3PMT A;  5DLQ E;  1K9M U;  3QYG B;  1VQ8 T;  1SHF A;  1K9M C;  4C8Q F;  3OYB A;  1FX7 A;  1PHT A;  2K2M A;  2KXD A;  1D1C A;  1YHQ Q;  2CP7 A;  2DXB A;  4PNO A;  2ROT A;  1QVF S;  1PKS A;  1VQ5 T;  1C0M A;  4OMN A;  4AFQ C;  1OPL A;  3OA6 A;  3G4S A;  2W10 A;  3UPU A;  3TU4 K;  3HHT B;  1X69 A;  1PSF A;  4VUB A;  4M7D B;  1B34 B;  1VYV A;  1TUD A;  1O9S A;  3M56 A;  1YIT Q;  1M3C A;  1M90 U;  2Y4Y A;  3OYC A;  3EG2 A;  4J7I A;  3OYY A;  1Q7Y C;  5FRM A;  5CAI A;  4NL2 A;  1NJI C;  1WHG A;  1JEG A;  2CDT A;  2CSQ A;  5CKF A;  2F2W A;  1WDX A;  3JCM W;  2FZK B;  2XI9 A;  1YI2 T;  4A4E A;  2LCS A;  4GBQ A;  2C0I A;  3CCE Q;  2RJC A;  1FYN A;  4PJO F;  3MEW A;  1B34 A;  2HKN A;  2K3B A;  3SHW A;  2VC8 A;  1VQ5 A;  2DYI A;  3CPF A;  5CCA A;  2LQ8 A;  4RKU E;  4JS5 A;  1QVP A;  2KXC A;  2KAF A;  1KQS S;  2RHU A;  1RI0 A;  5CKB A;  3CC2 T;  1TG0 A;  3OMG A;  4OMQ A;  1YJ9 A;  1NEG A;  1VQ7 Q;  3JCM g;  2JN0 A;  4OML A;  4PJN A;  2X4Y A;  4Y92 A;  4M78 G;  2L3S A;  4IUR A;  4C8Q A;  1VQK A;  1H3H A;  2VXE A;  1YJ9 T;  2JT4 A;  2DET A;  3MCA B;  4B6M A;  4C0D C;  1Q86 C;  2KT1 A;  1C6V X;  1PNJ A;  3CCQ A;  5DLO A;  1M90 R;  3P8B B;  1Q86 R;  3H0I A;  4HA8 A;  4IUV A;  1X6O A;  3A8M B;  2HQH A;  4AT1 B;  2HNI A;  1QWF A;  4FW2 A;  4RG8 A;  1K4U S;  2VGN A;  4LD6 A; 
#chains in the Genus database with same CATH homology
 4E7I A;  4XU1 A;  4N0A C;  1R8O B;  4M77 A;  5GMK m;  4C92 D;  3QII A;  2DZC A;  3OYJ A;  3HRU A;  2PVO B;  4WF2 A;  1U1S A;  3FLG A;  4C8Q C;  3CME T;  2P0P A;  4X34 A;  3CCL A;  1D3B A;  1K73 C;  2M16 A;  5I2S A;  1VQ7 A;  2M1H A;  4C5G A;  3CCS T;  1BI1 A;  3JB9 I;  2DEQ A;  3CBP A;  3ER0 A;  5LJ5 j;  1S72 A;  2V8K A;  2QXF A;  2YLC A;  4M77 G;  2FB7 A;  2G3R A;  1HXD A;  3OS1 A;  2OTL T;  3QO3 A;  1VIE A;  2EJG A;  4L5G A;  4IUU A;  5KE2 A;  2PQW A;  2XG8 D;  1UGQ B;  2CZ1 B;  4X9D A;  5GMK e;  4KBM B;  1YIT T;  5CVI A;  4JLG A;  2P0K A;  1FWZ A;  4M77 C;  1BI3 A;  2KMT A;  4CI0 C;  3OS0 A;  2DKG A;  4N4G A;  3FJP A;  2PVG B;  1VQ4 T;  1K8A U;  2JUF A;  1NZ9 A;  3Q1J A;  2LNV A;  3QZ5 B;  3OB9 A;  4E47 A;  4BAC A;  4FM4 B;  1BIB A;  3DLL A;  3HKS A;  4F7U F;  3JCM f;  2DJZ A;  2JNG A;  3INZ A;  4JUV A;  2QI2 A;  3VJP A;  2EQM A;  2XDP A;  2E10 A;  3VV0 A;  2HD0 A;  1VQP T;  4ZGJ B;  1I8F A;  2QQS A;  1KC8 C;  3ASK A;  4QQD A;  1G3Y A;  3OYI A;  1N6A A;  2QA4 T;  5LJ3 h;  2L5Q A;  3CPW S;  1V29 B;  2IG0 A;  4NS5 A;  3OYF A;  5GAM e;  2LCL A;  1BIA A;  4N4H A;  1QVF A;  5IAY A;  2QEX A;  5LJ3 g;  4QVZ A;  1XQH A;  3GPL A;  4PJO C;  5GMK h;  4B9X A;  2IVW A;  3HRT A;  3PNW C;  2VYT A;  1Y96 B;  4IUQ A;  3CCL T;  4FT2 A;  2XID A;  4J5Y A;  4M75 C;  3RKX A;  3SWN C;  1M1K C;  3G4S T;  1VQ9 A;  3CXC S;  2DD5 A;  4IUT A;  4QVC A;  5A2Q E;  4O6J A;  4L6V 5;  4M7A A;  3QDR B;  3L2R A;  3JB9 H;  2O01 E;  1EIF A;  2M0O A;  4FL6 A;  4PLL A;  4ATO A;  3CBO A;  4DOV A;  4M77 D;  2DTI A;  4JRQ A;  2PVD B;  3NTK A;  3CCU T;  4BY6 B;  3HP9 A;  4J6W A;  4ZTJ A;  3OYL A;  5CQY A;  5AYF A;  2HQE A;  2I2L A;  3E1S A;  3KXT A;  4M7D A;  2LTO A;  3G6E T;  4BI3 A;  2EQU A;  4FIB A;  5GAN f;  1UGR B;  3OYD A;  3PFS A;  4QW2 A;  3ZBD A;  1G5V A;  3L2Z A;  1YCY A;  5I21 A;  5GAO r;  4IKF A;  3M4G A;  1VIF A;  4PJO A;  4X9C A;  3GP8 A;  1M1G A;  4HT9 A;  1QP3 A;  5CK9 A;  2DPP B;  4O5V A;  4C5I A;  1G3S A;  4OGE A;  5FU7 C;  4M7A B;  3CC4 A;  4MDX A;  4M7A G;  4BY6 C;  2QQB A;  1NPP A;  2QTX A;  2RHZ A;  5GAO m;  4C92 G;  2F5K A;  2YLB A;  3O8V A;  3MET A;  3QG1 A;  4A53 A;  2GFU A;  4B9W A;  4C5H A;  1YHQ T;  2C06 A;  1YBY A;  2XD0 A;  1OZ3 A;  2LVM A;  4C0D B;  3CCM T;  3GIB A;  3CBM A;  3LWI A;  1M90 C;  4EMK A;  1LNX A;  3JCM X;  2JTF A;  4EMH A;  4R55 A;  4ZGE B;  3N5B B;  3JB9 F;  1TH7 A;  4XAX B;  4C92 A;  5GAM g;  4M78 A;  1QVG A;  3H8Z A;  1Q81 C;  3RKY A;  5I2M A;  4YTL A;  2EIF A;  3TRE A;  4BB7 A;  3V7S A;  2XHC A;  3CCV A;  4CRI A;  2GF7 A;  5CQX A;  2KK4 A;  4C0F A;  3I56 T;  1JBM A;  1SSF A;  3EFR A;  2EQJ A;  3MP1 A;  3P8H A;  1JJ2 S;  1XTD A;  3OSS C;  3PIO A;  1WNL A;  3A8O B;  4JS4 A;  2X4J A;  4ZGD B;  2XDB A;  2L3R A;  2EJ9 A;  3M57 A;  4JLI A;  3VKI A;  3CCV T;  4E7K A;  4MZM A;  2CZ7 B;  3FC3 A;  1WJQ A;  4OB1 B;  5C0M A;  4NL3 A;  4EDU A;  1OYX A;  3C12 A;  3OSV A;  1JJ2 A;  3FIF A;  5LJ3 d;  2YHT A;  2B8A A;  2JZ2 A;  4LDY A;  1KD1 U;  2GFA A;  2K2V A;  4EMK B;  1M8V A;  2AHJ B;  5GAO q;  2FVU A;  3CD6 T;  1VQL A;  2FHD A;  3FDR A;  4M78 F;  5FU6 C;  2RI3 A;  3M58 A;  3FRN A;  4J6Y A;  3JSC A;  2A7Y A;  3BY7 A;  3V8K A;  4C92 C;  5GMK i;  3QUI A;  4C0Z A;  3S3M A;  1OI1 A;  4C92 F;  2CGH A;  1VQL T;  4M75 E;  4BE2 A;  2E12 A;  4XU0 A;  4F7U E;  4XTY A;  4JRK A;  3SB2 A;  5LJ3 j;  2OTJ A;  2MAM A;  1YI2 A;  1YIJ T;  3CCM A;  3HSB A;  4HCC A;  2ZPE B;  4GY5 A;  2O4X B;  5LJ5 g;  5GAN e;  3GNF B;  4JJN K;  4ZN3 A;  4E7J A;  3H6Z A;  3MP8 A;  4M77 E;  1YIT A;  1K8A C;  1VQ8 A;  3CPW A;  5LJ5 h;  5FU6 B;  3CMA T;  5CIU A;  4C8Q B;  3M59 A;  2WSE E;  3PTA A;  4DQ2 A;  4C92 B;  3R6O A;  4L59 A;  4ELY C;  2QEX T;  1NE8 A;  4PL6 A;  2OAU A;  1Q82 C;  2EFI A;  3JB9 J;  2CS7 A;  3L1A A;  1G3T A;  2E64 A;  1QW1 A;  2A3L A;  1S72 T;  5HY6 A;  4HT8 A;  2F5T X;  3JCM e;  4OP0 A;  1LOJ A;  1X75 C;  4BUG A;  3L2V A;  1VQ9 T;  3OYG A;  4LDX A;  2RD1 A;  2K5I A;  2ZPF B;  4OGC A;  2KDS A;  3CCU A;  3F70 A;  2PU9 B;  3CME A;  2CKK A;  3LYI A;  3MEU A;  1KC8 U;  1JB0 E;  4EMG A;  4QQG A;  4M7A F;  2LT1 A;  1O75 A;  4DOW A;  4HCB A;  2HBP A;  4JDS A;  3RMS A;  5C6S A;  1WQW A;  2QA4 A;  1Q81 U;  1KHI A;  1OZ2 A;  3V8J A;  2BKD N;  2E1H A;  2Y4X A;  4P5N A;  4NOY A;  2WSF E;  1KQ2 A;  1DJ7 B;  2MWO A;  1I5L A;  2M9U A;  1VQ7 T;  2JOY A;  1N9R A;  1IRE B;  3EFS A;  5A0D A;  4A4H A;  5GAN 8;  3MHX A;  5GAN g;  5L8R E;  2RHY A;  1MHN A;  4Y28 E;  2VXF A;  3VYH B;  2RH2 A;  4RCB A;  5KCH A;  2ZZD A;  3KBG A;  5D6W A;  1X01 A;  2DXC A;  4M75 F;  3SD4 A;  4F7U G;  3JCM Q;  4M7D D;  4M78 B;  4TVR A;  3S6W A;  2DVE A;  3WVE B;  5GAM j;  1BI0 A;  2E6N A;  2HAX A;  2D0Q B;  3BFM A;  2EJF A;  2K3Y A;  1H3Z A;  1Y71 A;  3JCM V;  3CC2 A;  4J83 A;  4LDU A;  2X4W A;  1W2B S;  2DK3 A;  4M77 B;  2MI6 A;  3PMI A;  5J26 A;  5LJ5 e;  2VUB A;  4M7A E;  1VQO T;  5FRO A;  2V8I A;  3I56 A;  2Y90 A;  2RJE A;  4JRI A;  3RES A;  3V8L A;  3V7R A;  3NTH A;  1ZQ1 A;  2L89 A;  3WVD B;  5GMK j;  1UGS B;  5FRN A;  2RI5 A;  3CCS A;  4M7D F;  4A4G A;  3J80 E;  2XK0 A;  1U8R A;  2RHI A;  2FL7 A;  2K5F A;  2FYK A;  4C5E A;  5GAN j;  1VQK T;  1I4K 1;  3OYA A;  5HK0 A;  1BYM A;  4M7D E;  4ZN1 A;  3OYN A;  2MWP A;  1KD1 C;  5GAN 3;  5KH6 A;  2RA2 A;  4M7D C;  5GAN h;  5CO7 A;  3CC7 A;  5IT9 E;  2DD4 A;  2EKO A;  3JB9 G;  1AHJ B;  2V8J A;  1VQO A;  3M53 A;  2WSC E;  2YRV A;  4ELZ C;  2H3J A;  3OMC A;  4PJO E;  4XU2 A;  2P0Q A;  5FLX E;  4RCC A;  1KQ1 A;  3JAM E;  3E9F A;  2RB6 A;  2JVV A;  4M75 B;  3SWN B;  4ZTF A;  4BI4 A;  5GAN 2;  2NLU A;  2QQR A;  2EYQ A;  4KUI A;  3JB9 D;  4FT4 A;  4M7A C;  5GAN d;  3X26 B;  2O4X A;  1G3W A;  1VQN A;  4D6W A;  1Q86 U;  5GAN 6;  1YIJ A;  4A4K A;  1UEB A;  2RHX A;  3M54 A;  3VYG A;  4QVD A;  1Q82 U;  1YHQ A;  1VQ4 A;  3BDU A;  2LDM A;  2MF2 A;  1KHC A;  4MMK A;  5J3B A;  2DAQ A;  3WXM B;  4C8Q E;  3J81 E;  4E7H A;  4J8O A;  3LLR A;  2DZ9 A;  4C92 E;  3QJ6 A;  1H64 1;  2QDY B;  4M78 E;  2KQW A;  4PKC C;  3CMA A;  1N9S A;  1UB4 A;  2VV5 A;  2ZCF B;  1NJI U;  1Y07 A;  1Y96 A;  2ZPI B;  2RO0 A;  3RER A;  1VQP A;  3PGG A;  4A54 A;  2VGM A;  1NPR A;  1Y7X A;  3UDC A;  3M4Y A;  5CKH A;  3HRS A;  2R57 A;  3OYE A;  4BDZ A;  2RK1 A;  4KUD K;  4QQ6 A;  1MGQ A;  4C8Q G;  1BKB A;  3OYK A;  1WQ7 A;  4F7U B;  3URG A;  5GAM d;  2K57 A;  3GNG A;  2DXT A;  4HCZ A;  1VQ6 T;  3G7Z A;  4A4F A;  5DY9 A;  1M1K U;  2D6F A;  3I55 A;  4II1 A;  2DTO A;  3E9G A;  5EG2 A;  2RI2 A;  3FEO A;  4BDY A;  4XK8 E;  3CCJ T;  2EAY A;  5D6X A;  2E6Z A;  2XDD A;  3X25 B;  4XTX A;  2R5M A;  4GLK A;  1XNI A;  3JCM c;  5GAN 7;  1VQ6 A;  3QBY A;  4RG2 A;  2E5Q A;  5A0G A;  1WPY A;  2LC4 A;  3L42 A;  2MMP A;  3M9Q A;  3V7C A;  1VQM A;  2LX9 A;  3GOX A;  3SFM A;  3DLM A;  3OS5 A;  4OVA A;  3DKM A;  5GAN 5;  4BE1 A;  1JRI A;  4KUL A;  4HKE A;  3L2Q A;  5LJ3 f;  3BDL A;  2XIC A;  2ZPG B;  3BW1 A;  5LJ5 d;  5A0L A;  2XU8 A;  2ZGW A;  3VUB A;  1HK9 A;  1QVG S;  3CCJ A;  1N8R U;  4M78 D;  1UGP B;  2RK2 A;  4Y91 A;  3X20 B;  3L2U A;  1P92 A;  3KUF A;  3QJY A;  4XU3 A;  1XOV A;  2KSS A;  1N8R C;  3OYM A;  3ZFJ A;  3L2W A;  4OB2 B;  4LDW A;  2K4Y A;  3CEY A;  3G6E A;  4XTW A;  4OF1 A;  3CCE A;  4M75 D;  2BUD A;  3C94 A;  4IUP A;  2LQK A;  5J39 A;  4J7F A;  5GMK l;  4C8Q D;  5LJ5 f;  3PMT A;  5DLQ E;  1K9M U;  3LGF A;  3QYG B;  1U1T A;  3C95 A;  1W4S A;  1VQ8 T;  4XTV A;  3JCM J;  4FU6 A;  2DO3 A;  1K9M C;  4XTU A;  4C8Q F;  4LD9 K;  3OYB A;  1FX7 A;  3E19 A;  1ZBX A;  3MEA A;  3VUZ A;  3HPW A;  4R56 A;  4JRP A;  1IZ6 A;  2ZPB B;  2KY9 A;  3SDZ A;  1W2B A;  4V2S A;  3LGL A;  5M9O A;  4OB0 B;  2KVQ G;  1YJN A;  2X35 A;  5CKD A;  2DXB A;  4PNO A;  1Q7Y U;  3GF5 A;  2K5L A;  3RMQ A;  2DXU A;  3C4S A;  2CZ0 B;  5KCO A;  4XQ3 A;  3DB4 A;  3OBY A;  1QVF S;  3OQ5 A;  4M75 G;  5GAN 4;  5CKE A;  1WJS A;  5KE3 A;  3UWN A;  3JCM h;  3QKJ A;  3CC7 T;  1VQ5 T;  4EPC A;  4PJO B;  1M9S A;  4MZT A;  1M4Z A;  1KQS A;  3TCJ A;  3OA6 A;  3G4S A;  3A5Z B;  2JTM A;  1WJR A;  3UPU A;  5HK3 A;  3TU4 K;  2RJD A;  1YJN T;  1N27 A;  2E41 A;  3HHT B;  1I81 A;  2HQX A;  2DIQ A;  3LH0 A;  5GAM f;  3PIP A;  1WGS A;  2DTH A;  3G71 A;  1PSF A;  2CYZ B;  4VUB A;  1D3B B;  4M7D B;  1B34 B;  4ME7 A;  2R58 A;  5IN1 A;  1K73 U;  3RKW A;  3QZ9 B;  1O9S A;  3M56 A;  1M90 U;  4M78 C;  3LW5 E;  5GAO p;  3UT1 A;  2GQV A;  4OB3 B;  2R5A A;  2Y4Y A;  1QP2 A;  3MO8 A;  3QSU A;  1FXX A;  3CD6 A;  2L8D A;  3LWH A;  4M77 F;  3NFC A;  2K3X A;  4J7I A;  3OYY A;  3P8D A;  3OYC A;  1Q7Y C;  5FRM A;  5CAI A;  3JCM P;  3QPH A;  2GCX A;  5D6Y A;  4FSX A;  1LJO A;  2RJF A;  3HFO A;  3A8L B;  4NL2 A;  4MML A;  3RUX A;  5GAO n;  1NJI C;  3X24 B;  3OYH A;  5CKF A;  3G71 T;  3JCM b;  1YJW T;  3A8G B;  3DB3 A;  3X28 B;  2XKO C;  2XI9 A;  3JCM W;  1YI2 T;  3J7A F;  3M55 A;  4Q5W A;  2EWN A;  3CCR A;  1PSE A;  4A4E A;  2RJC A;  2WAC A;  4BE0 A;  4PJO F;  4OMF B;  1VUB A;  4PLI A;  5GAO l;  2F69 A;  3PT9 A;  3M5A A;  1B34 A;  3MEW A;  3CCE T;  4BI8 B;  4E7L A;  3T9N A;  2RM4 A;  3QXE B;  2PUO B;  2VC8 A;  4PJO D;  1VQ5 A;  2LRQ A;  2E65 A;  4EMK C;  1VQM T;  3CPF A;  5CCA A;  2LQ8 A;  4RKU E;  4JS5 A;  1QVP A;  3EAE A;  2KAF A;  2LT4 A;  1KQS S;  4J6X A;  5HKC A;  3OBW A;  1VQN T;  2RHU A;  1RI0 A;  5CKB A;  3ZEH A;  3CC2 T;  3OMG A;  4RMO A;  3S3O A;  1YJ9 A;  2X4X A;  4M7D G;  3JCM g;  3CCR T;  3HL8 A;  2JN0 A;  2QQ9 A;  2E70 A;  4DA4 A;  1BI2 A;  4C0G A;  2OTJ T;  2EQK A;  2X4Y A;  5GAM h;  4N0A A;  4M78 G;  2D9T A;  3RIR A;  3OW2 A;  3AHU A;  2P4T A;  4IUR A;  4C8Q A;  1M1F A;  4M7A D;  1RL2 A;  5FU7 B;  1VQK A;  3MP6 A;  2VXE A;  3OS2 A;  1YJ9 T;  3ME9 A;  3MEV A;  3VU3 C;  3CCQ T;  3I55 T;  3GLX A;  3MCA B;  2BIV A;  4C0D C;  1Q86 C;  4N4I A;  3JCM d;  4LDV A;  1YJW A;  4Z02 A;  3CXC A;  3OY9 A;  2PUK B;  4KT0 E;  3CCQ A;  3FB9 A;  3LX7 A;  4UC4 A;  5DLO A;  4MDW A;  5CR2 A;  3QHS A;  3S3N A;  3P8B B;  3TEE A;  4MZP A;  5LL6 S;  2CZ6 B;  4PJO G;  1KG1 A;  5DM7 R;  1ZHI A;  4BD3 A;  2LCC A;  4HA8 A;  5LJ3 e;  2DIG A;  3NTI A;  1X6O A;  3A8M B;  4IUV A;  3CC4 T;  3JRZ A;  3A8H B;  3OW2 S;  1GXI E;  2HNI A;  1M5Q 1;  2ZPH B;  3HFN A;  4M75 A;  2QQA A;  3SWN A;  2OTL A;  4F7U A;  4RG8 A;  3QYH B;  2VGN A;  4XTZ A;  4LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...