3JCMP

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
109
structure length
77
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLQQPTASDNIANTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 7
structure length 77
sequence length 109
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmP00
2QTXA 4C92D 4C92B 4JLIA 4M75C 1YCYA 3JB9I 4M77C 4PNOA 3JB9J 1HXDA 4M78F 4M77A 2YLBA 4J5YA 4XQ3A 4C8QF 4M7AC 2DEQA 4M78G 4JUVA 3SB2A 4M7DC 3JCMe 4M7AA 3BW1A 4NOYA 4Y91A 4C8QG 3RERA 3RESA 4M7DA 1M8VA 1D3BA 2DJZA 4F7UA 1U1SA 2RM4A 4M78D 3FJPA 5GAMf 3V8LA 1MGQA 1WQWA 2FB7A 1B34A 5GAN6 3QSUA 2FYKA 5GMKj 5LJ3f 2YLCA 1BIAA 2DZCA 2EJGA 2ZGWA 3VU3C 5GANd 4PJOC 1N9RA 3FB9A 3V8JA 3GIBA 2CGHA 2E10A 5I21A 1Y96B 3EFSA 4M75F 4XTWA 4XU3A 4M77F 4XTUA 4C92E 5LJ5f 2K57A 3AHUA 3M4GA 4J6YA 2E1HA 4M77G 4M7AF 4M7DF 3SWNC 3QHSA 3SWNA 4F7UF 5GANj 4M7AG 4M7DG 1M5Q1 4M75A 5GANh 3V7SA 3JCMW 4F7UG 4X9DA 4M78E 1TH7A 5GAOr 4C8QE 3JCMd 5GAMd 2JN0A 1KQ1A 5GAN7 2VXFA 1I81A 1D3BB 1N9SA 4V2SA 3JCMf 1I8FA 4PJOF 1HK9A 4M78B 5GAN5 4QVCA 5LJ3d 4C8QD 4HA8A 1WPYA 4C8QB 3L2ZA 1LJOA 2E64A 1U1TA 4EMKB 4HT8A 3PGGA 5GAMj 4RCCA 3RKWA 2DZ9A 2YHTA 4XU2A 2EAYA 3FIFA 3QO3A 3JCMh 5LJ5d 3RKYA 4C92C 5GAMh 1KQ2A 3V7RA 3L1AA 4J6XA 4WF2A 5LJ3j 3JCMP 5CAIA 2VXEA 1JBMA 2DXUA 2DKGA 2E41A 4M75G 4M77E 4NL2A 5LJ3h 5GMKe 1WNLA 1I5LA 2EJ9A 5GAN3 2VC8A 5LJ3g 4M7AE 3JCMV 4M7DE 4M75D 3JCMQ 4M77D 4M75B 2EWNA 4F7UE 5LJ5j 4M77B 2EJFA 5GMKl 5LJ5h 3JCMJ 3BFMA 1LOJA 3JCMb 2RD1A 5GANg 4M7AD 4M7DD 4M7AB 3RUXA 2DTIA 4A54A 4M7DB 4DQ2A 2DTHA 2DVEA 4MMKA 3RKXA 5GMKm 5GAOq 4F7UB 3JCMX 5GANe 5GAOl 3RIRA 4X9CA 4A53A 1B34B 4PJOG 3HSBA 1WQ7A 3INZA 5GAN4 4XU0A 5GAOm 4OP0A 4XTXA 4PJOD 3HFOA 4MMLA 4PJOB 4N0AC 4EMGA 1X01A 3HFNA 4N0AA 5GAOn 4XTZA 2DXTA 4C92A 3JCMg 5GAMg 4J6WA 4M75E 4QVDA 1H641 1LNXA 3JB9F 4XTYA 1BIBA 4RCBA 2HNIA 2RB6A 3SWNB 5GAMe 4NL3A 3JB9G 2I2LA 3BDUA 2DTOA 2E65A 3QUIA 4M78C 5DY9A 3JB9D 1I4K1 4M78A 3V8KA 5LJ3e 4C8QC 3EFRA 2Y90A 5LJ5g 1JRIA 3V7CA 4C8QA 5GAOp 4PJOA 4XU1A 4EMKC 5GMKi 2RA2A 4EMKA 3BY7A 5GMKh 5GAN2 4EMHA 4JRIA 5LJ5e 4PJOE 4C92F 3JCMc 4XTVA 1Y96A 5GAN8 4HT9A 4JRKA 4C92G 3JB9H 5GANf
chains in the Genus database with same CATH superfamily
1NPPA 4BI4A 4C0GA 1RAGB 2LQNA 4D8KA 2ZPBB 3OW2S 1VQ7T 2PTKA 1YHQT 3CD6T 2DMOA 5GMKj 4ZTFA 3OS5A 5KYXB 2V1QA 1G2BA 1GBRA 4EPCA 2LNHB 1X75C 4IUVA 2RK2A 2XDPA 2LX7A 2JS0A 4XU3A 1PRMC 4C92E 4J6YA 1YIJQ 4M77G 2HAXA 1WIEA 3SWNA 1VQNQ 2E70A 2EYXA 1Y57A 3CCRA 3EG2A 5KYWA 2BUDA 2HL5C 3OYBA 5KCOA 4DBQA 2FPFA 2YRDA 4QVCA 4C8QD 4BE1A 1MNEA 1QCFA 2KK4A 1C0MA 3H8ZA 1JQQA 4A4KA 2BTTA 4IUQA 5GAMh 3E2UA 2A37A 1KQSP 3ASKA 4J8OA 4IUPA 4ME7A 4FYYB 4QT7A 3OS1A 3UF4A 5LJ3g 3KXTA 2K5LA 2BIVA 4RTZA 4ATOA 5GANg 4RTTA 1MMAA 3RUXA 3OW2A 2YUOA 4DQ2A 1GFDA 2YXYA 5CKDA 3VJPA 3JCMX 3EGDB 1JB0E 2RQTA 2NUTA 5GAOm 2CP3A 2CP2A 1WDXA 2DPPB 3HFOA 2EVRA 3OMCA 1X01A 1F1BB 1OZ2A 4HCKA 4LXCA 4JPBW 2HNIA 3G71T 2MK5A 3REAB 1IHWA 2PVOB 4M78C 3G6ET 5LJ3e 1MMGA 4C8QC 3CCJQ 4OGEA 4RG8A 2ZAEA 5GJWB 4IKFA 3FJ5A 4F14A 4J9FA 1PHTA 3DB4A 6AT1B 3UPUA 3MEUA 1K4US 3FEOA 1HXDA 5IHIA 4RTUA 4M7AA 1M90C 2A28A 1H92A 1VQLT 4J7FA 1B34A 5FU6B 2LP5A 3DKMA 5J26A 1YITQ 1EFNA 1M90U 2DZCA 2KSSA 1YJNT 3GIBA 1FYNA 3H6ZA 3CC7T 2MI6A 1HJDA 5GANh 3M53A 1Z9ZA 5FU7B 1MMDA 2ESWA 5GAOr 5GAMd 1LPLA 4KH1B 2IG0A 3LW5E 2E3IA 4LDYA 1YP5A 1LJOA 2KRSA 4RMOA 2KE9A 3OSSC 5FWCA 4J9EA 1X2QA 3ZL7C 1W70A 4A4HA 2PU9B 1W1FA 8ATCB 2VYTA 1QWEA 5CAIA 2DXUA 2DKGA 3VS1A 4RTWA 2K4YA 1DJ7B 1QP2A 4M75B 1I1JA 1IXDA 2RD1A 3CCSA 1LVKA 4JJDA 3CCLQ 1HSQA 2E5KA 1R0CB 4HCZA 1YI2Q 3VS4A 5FRNA 2HBWA 4PJOD 4N0AC 2K3BA 3HKSA 1HD3A 4AFQC 4OMOA 3SWNB 2HSEB 5KYWB 1OPLA 3EFRA 3I35A 2Y90A 1ZHIA 4L5GA 5GMKi 2JVVA 2QQBA 4F04B 4CI0C 3CEYA 4C0DB 1YHQQ 1VQ9A 3CD6Q 2KQWA 3X24B 2NUPA 2K2VA 1YCYA 4CC3A 2EKOA 2JTMA 4J5YA 1WFWA 5DLQE 2VWFA 3JRZA 3RERA 2XKOC 1BK2A 1U1SA 3EH1A 1G3YA 5IHNA 5CKEA 2J6FA 1MGQA 1YJWQ 1ZUUA 2AHJB 3QSUA 1VQOQ 5GANd 1K73R 4PJOC 3M0TA 4IIMA 2NUTB 2E6ZA 2EGEA 3MJXA 5D6WA 2RHIA 4B9XA 3JCMW 4JJBA 4J7IA 2CT3A 1WGSA 2KI7A 2QI2A 2H8HA 2DBMA 1VQ8T 2HQXA 1YWPA 1Q82R 2YDLA 1TU0B 1YJ9A 3QJYA 1NYFA 3JCMP 2PUKB 5GMKe 1WNLA 1M2VB 4FL6A 3P8DA 3JSCA 3CC2Q 3BFMA 3CCUT 4M7AB 5GMKm 2X3XD 1OU8A 3G71Q 1CSKA 1OX8A 2HDAA 1TSFA 3G6EQ 1B34B 4MMLA 1Y07A 3M54A 5GAOn 1NZ9A 1N8RC 2DAQA 3M59A 3M4YA 4F17A 3JB9F 3NTKA 2CP7A 3EGXB 1R0BG 1G3TA 2Z0WA 3OBYA 4C5IA 4J9BA 4A4FA 5GMKh 4EMHA 3VV0A 1VQLQ 3NFCA 2YUPA 2JMCA 1PKTA 2CP0A 3CXCP 2PNIA 2OTJT 2HSPA 3CMAT 4BE0A 3DLLA 1YJNQ 4C92B 4FT2A 4VUBA 3JB9J 3CC7Q 1GCQC 2JM9A 5IHKA 5HCKA 4M78G 1D09B 3I55T 4C8QG 2QYZA 4JZ4A 1JJ2P 3EHQA 2ZPFB 3M56A 1AVZC 3LH0A 4RG2A 2HCKA 1K9MC 2KR3A 2DXBA 2ENMA 1ZA2B 1Y96B 4XTWA 1AWOA 5IXBA 2K57A 1NJIC 4M7DF 3GPLA 1QVGS 4EDUA 5DM7R 1VQMA 4F7UG 1VQ5A 1SF9A 3A8LB 2OTLT 1NJIU 3M0UA 3HPWA 3RDVA 1WJRA 1S72Q 1HK9A 2RI5A 3JAME 1ABOA 3ZEHA 1PWTA 1TS9A 2ED0A 4OMNA 3PGGA 4O6JA 3EGUA 1MNDA 2HZYA 4PJOA 1G3WA 3RKYA 7AT1B 1IGUA 2DJQA 4BI8B 2E41A 4M77E 3URGA 3OY9A 1KSWA 4EIKA 3QDFA 4M75D 2EWNA 1K0SA 5FU6C 3UT1A 1BU1A 5GAOq 3E1SA 1K1ZA 1XNIA 2CREA 4QQ6A 5GAN4 3REBB 1VOMA 1VQPA 3QKJA 1VIEA 3PNWC 4J6WA 1H641 1QVGA 5FU7C 2RB6A 3RBBB 3JB9D 2KNBB 3V8KA 2COYA 4C5EA 2K6DA 4ZTJA 5C0MA 2KBTA 3EG9B 3CCRT 4C92F 5GAN8 5M9OA 4A4EA 3MEVA 1TG0A 2WSEE 2DD4A 2JTFA 2DETA 4M75C 2LVMA 4PNOA 3CPWP 2NWMA 2XI9A 1X43A 1M2OA 1NLPC 1Y7XA 5CR2A 4WCIA 1VQKQ 2BZXA 2FVUA 4GY5A 2DL8A 1KC8C 2F69A 3OYEA 4ZN3A 3S3NA 2RNAA 2C0OA 4BD3A 4OB3B 2CZ7B 2E1HA 2QGFB 4J9IA 1KC8U 2JM8A 3SWNC 2KVQG 1NG2A 2FZKB 2OAWA 3CMEA 1PSEA 4X9DA 3CCJT 3VRZA 5J39A 1D0YA 1QKXA 2VXFA 1TUGB 1TXQA 3PVQA 5IH2A 4C0DC 4E7LA 2L3RA 3CCUQ 5I22A 2RQWA 2PVGB 2RJCA 2JOYA 2RPNA 2CH4A 3X28B 3VYGA 1JO8A 4HXJA 1YFNA 2EPDA 5LJ5j 3CCMA 1K8AR 2FZGB 4LDVA 4M7AD 1V1CA 3GOXA 3LWHA 4LDWA 3BE3A 2VB6A 1TOVA 2GQVA 3C12A 3FDRA 3MHXA 1ABQA 1WA7A 1ZSGA 1UFFA 3NGPA 5D6YA 2CKKA 4Z88A 1CKBA 4KULA 2EW3A 4IUUA 4RTXA 1YCSB 2OTJQ 2AK5A 2CDTA 2DL3A 3VS6A 4PJJA 1QMCA 3I9QA 2I2LA 3OA6A 2MWPA 1OPKA 3QJ6A 3I55Q 1R8OB 4JS5A 5GAN2 2CSIA 2MIOA 2DA9A 1SSFA 3CCVA 2RQRA 1VYTA 4C92D 4LN2A 2LTOA 3G4SA 3OYFA 2DX1A 1U8RA 4M7AC 3CC4Q 4BE2A 4DBRA 3TVTA 2K3XA 3M0SA 2DJZA 1EIFA 3CCQA 2CYZB 1B07A 1O9SA 3FB9A 3META 3CCST 4N4HA 1U5SA 3DLMA 5LJ5f 2MOXA 4M75A 1UE9A 5CCAA 1W2BS 2AKKA 4V2SA 1I8FA 1N27A 2ROTA 3G1JA 2XDDA 2O01E 3MP8A 4HVUA 1ZBXA 1U1TA 3EHRA 2D6FA 4C92C 2L3SA 4N4GA 4AFUC 2VXEA 1XOVA 1Q7YR 5FROA 2I0NA 5CO7A 3NHNA 2DNUA 2J06A 1ARKA 3JCMJ 1YJWT 3LH5A 2FZCB 3JCMb 3NMZC 2YUNA 3T9NA 3LWIA 1VQOT 2DTHA 1UGQB 2VGNA 3RNJA 3RIRA 1YBYA 2HKNA 4OP0A 3SD4A 3OW2P 2D1XA 2RI2A 2OI3A 3OYDA 3CCRQ 4XTZA 2O88A 2EYZA 1IHVA 2V8KA 3S3OA 1YN8A 4RCBA 5A0LA 1W2BA 5AT1B 1I4K1 1N6AA 2DYIA 3PTAA 4BI3A 4PJNA 4XU1A 4ELYC 4BY6B 3D7SB 1OOTA 2DM1A 2M1HA 2F2WA 4XTVA 2G6FX 2F5KA 2QQAA 2X9HA 2V8IA 3LGFA 1PNJA 3QIIA 2RJFA 1ZX6A 1RAIB 4FYXB 3CC2T 2RF0A 1PKSA 2DEQA 1PG5B 1TUDA 4M7DA 5HK3A 3RESA 1M8VA 1WLPB 4FT4A 3V8LA 1WQWA 2XK0A 1KQSA 1OYXA 4E7IA 4C5GA 3N5BB 1UJ0A 1G5VA 3FC3A 2DEUA 3TSZA 4II1A 1VQ4A 4HKEA 1M2VA 2J6OA 2L5QA 3UATA 2LJ1A 4JZ3A 4M78E 3H9NA 3EFOB 2A7YA 3H41A 4C8QE 3VS3A 2HQEA 2RQVA 1VYVA 3LYIA 2L0AA 2XICA 1WHGA 1KD1C 2D9TA 4XAXB 4XU2A 1JBMA 4GLMA 5LJ3h 2COZA 4CRIA 1KD1U 2HBPA 2RMOA 3EGXA 4F7UE 2L89A 4C0FA 1NYGA 3M58A 2DVEA 4N4IA 1C6VX 2LCCA 1M1KC 1V29B 2X35A 3PFSA 1SSHA 3QG1A 2QXFA 4C92A 1UB4A 1M1KU 4FU6A 2M02A 3TU4K 3MEWA 1BIBA 4NL3A 4TVRA 3CCEA 2YT6A 2QDLA 1S72T 1X6OA 4E7HA 1Y71A 2DERA 2P84A 1HYOA 1VQ5T 5LJ5e 1Q86R 1Y96A 2W0ZA 1XQHA 4JRKA 3CCLA 2M0OA 4LDXA 2J05A 3CCSQ 1ZUYA 2QAZA 2F1LA 1OEBA 2MYSA 2YLBA 2GCXA 2X4WA 2BZ8A 1UTIA 3FLGA 5DLOA 2EQKA 1MHNA 3CBMA 3MKDA 2QTVA 1WJSA 1Q81R 4P5NA 4M77F 3I5SA 2Y4YA 3S3MA 5FLXE 3AHUA 2LNVA 3VUBA 1VQ7A 1GBQA 4M7AG 3CPFA 2QQRA 3EG1A 1VQPT 2VUBA 2IVWA 2B86A 1VQ9Q 5GAN5 2QA4A 1UGVA 5CQXA 5LJ3d 2F2XA 1OU9A 3ER0A 1PC0A 1BBZA 1G3SA 1I5LA 2DLPA 1SRLA 2EJ9A 4F16A 4LE9A 3EG3A 1RI9A 2K79A 1VQKT 3ULRB 1QKWA 4LUEA 4M7DB 1LCKA 1KHIA 2DIQA 4MMKA 2O9SA 1ZSZB 2WSFE 4PJMA 1BI0A 3EG9A 3HSBA 3TCJA 2GBQA 2GQIA 3L2VA 4QW2A 4QVDA 2EYWA 1PM3A 4X1VA 8AT1B 2DYBA 1KIKA 2E12A 2MPXC 1V76A 4KUDK 4LD9K 1AWXA 2QGGA 4RTVA 2GFUA 2FL7A 1YJ9Q 2LT1A 3C0CA 4FYVB 3R6NA 2EYQA 1OZ3A 3E9GA 2O4XA 3MEAA 3GP8A 3NPFA 1D1BA 2VGMA 1QVFS 4JJNK 2XG8D 3HP9A 3BDLA 3H0IA 1KK7A 1T3LA 2A3LA 2M9UA 2RM4A 2FB7A 2QEXA 3VS0A 3A8GB 3M5AA 3VU3C 4NS5A 2E4HA 2CUBA 5I21A 3VS7A 4JDSA 1UGRB 1RAHB 4QQDA 1FX7A 2JXBA 2K7AA 2COWA 1SEMA 1QCOA 5CKBA 1YJNA 2FHDA 1I81A 1N9SA 1PRLC 3CC7A 2EGCA 4BY6C 2JUFA 4KRTA 4OMPA 2KXCA 1H8KA 4C0ZA 2DRMA 4C5HA 5GAMj 1TTHB 1KQ2A 4FW2A 3HL8A 3QYHB 1FXXA 4WF2A 3CC4T 1QVFA 3J81E 2O31A 1I07A 2FO0A 1IGQA 3CCVT 1W4SA 1X69A 2CSQA 2RI3A 1KHCA 5GAOl 1O75A 3INZA 1M3CA 4XTXA 4PL6A 5KYYA 1VQ5Q 3VKIA 2Y4XA 2ZPHB 5CK9A 2CZ6B 3CCQT 1D0ZA 3QZ9B 5KE3A 3KBGA 3LX7A 2A36A 4L6V5 1EZZB 1MV0B 1QVGP 2D8HA 3QWYA 3BY7A 2QK0A 2FG0A 3GLXA 4FIBA 2KGTA 2EKHA 3A8OB 3X25B 3DB3A 2AKLA 2WSCE 4JLIA 1M4ZA 4KT0E 3L42A 5L23A 2MAMA 3QXEB 2PVDB 1R77A 2E3HA 1I0CA 5GAMf 3HRSA 1H3ZA 1BCOA 2D0NA 4A63B 1VQPQ 1VQ6A 4E2FB 4OMLA 4RUGA 5CKFA 3GF5A 4D8DA 2LMJA 1RI0A 3M4GA 4JRPA 4MDXA 2ED1A 2DFUA 2JTEA 5IN1A 5GANj 4ESRA 2GTJA 2DVJA 1Q81U 1GCPA 1BYMA 1J3TA 1KQ1A 2CH4W 5C6SA 3HRTA 4K11A 4HA8A 5LL6S 2V1RA 4HT8A 3ME9A 5KE2A 2AZSA 3EG0A 1M3AA 1QWFA 5HY6A 2EAYA 3FIFA 2O4XB 1K73C 2L3PA 3V7RA 5I11A 3VS2A 4R56A 4FSSA 1VQ8A 2MWOA 2YRCA 1K73U 2JZ2A 3WXMB 4M7DD 2X4YA 2XDBA 1UUEA 4PJOG 1SHFA 2LDMA 1ZA1B 1RLPC 1Q82C 2EIFA 2GTOA 3CCUA 1WXUA 3CMEQ 3PMTA 2CP6A 3HFNA 2DL4A 5CIUA 1B7TA 1M90R 1PD0A 1UHCA 2DL7A 1Q82U 3VUZA 1VQ4T 2DTOA 4KBMB 5D7UA 1OI1A 1UJYA 4KGXB 3X26B 5GAOp 3OYAA 3Q1JA 2FRYA 1OULA 3I5RA 2V8JA 4ANJA 9ATCB 4DBFA 2K9GA 5FRMA 3MCAB 3CCMQ 2R58A 2LJ0A 4JS4A 3E19A 4R55A 1MMNA 4M78F 5L8RE 2H3EB 4M77A 4LUDA 4C8QF 2C0TA 3EFOA 4M7DC 3OYMA 3CMAA 4FW1A 4CC7A 2EQIA 3PE0A 2MMPA 1NLOC 1W6XA 5A2QE 1G83A 2ZGWA 2KT1A 2HEQA 2RHXA 2RJDA 1I5OB 2ZPGB 1CKAA 4QKUA 5KYYB 2QQ9A 2RHYA 4F7UF 2CUDA 1MV3A 1SHGA 1ZQ1A 3H0FA 4UC4A 2EFIA 3HHTB 2LQWA 3CCVQ 2K5FA 3J80E 1RABB 5KYUA 3M0QA 3I56A 4PLIA 2RHZA 2KT8A 3G4SQ 2A08A 2MCNA 3OBWA 2OTLA 1VA7A 2DL5A 2DO3A 4IUTA 4XK8E 3GNFB 4M7AE 2DE0X 2X4XA 5GMKl 3CCQQ 4OVAA 1LOJA 1VIFA 2HD0A 1UEBA 4A54A 4X34A 3OYLA 4E6RA 4A4GA 3HTRA 4X9CA 4OMFB 2K5IA 2L3QA 1AWJA 4OB0B 1IB8A 1U3OA 2KXDA 1LNXA 4IURA 2HL3A 2YRVA 5GAMe 4DEXA 1IRXA 1BCMA 1YIJA 2XU8A 1VQ9T 3QUIA 5DY9A 3RMQA 1D1AA 1VQNA 1KQSS 5HK0A 4EMKA 1QVPA 1T3SA 3VYHB 4O5VA 1W2BP 2RH2A 2LX9A 3JB9H 2QA4T 3NTIA 5HKCA 1FMKA 3LGLA 4J9GA 3TQ7P 3EH2A 4WTOB 3KUFA 4M78D 2RO0A 3FJPA 3AT1B 5CKHA 1BIAA 5IAYA 2EJGA 4HCBA 2CGHA 3EFSA 4GLKA 1JU5C 4OGCA 2CP5A 2KYBA 3CQTA 2LT4A 3SDZA 1VYUA 1JXOA 3U23A 1AWWA 3ZBDA 2VVKA 2ZCFB 1YJ9T 1U06A 2JN0A 3OYIA 1D3BB 1ZSZA 4PJOF 4R0KA 1WHJA 2E64A 2EBPA 4DA4A 3CCJA 2KEAA 4FM4B 1N8RR 1Q95G 2K3YA 3L1AA 2L8DA 2OX7A 4M75G 4NL2A 4BDYA 3OYKA 2CZ1B 2GFAA 1M9SA 5GAN3 2GF7A 3A8MB 4M77B 2EJFA 1GL5A 3JV3A 5GJVB 2M16A 4KUIA 2SEMA 5GANe 2HKQB 1VQ4Q 2ATCB 2M0YA 2GNCA 2IIMA 4EMGA 1YITA 2MF2A 2XIDA 3VS5A 2QEXT 1PSFA 3P8BB 2C06A 1T0JA 2KRMA 3JB9G 3P8HA 2E65A 2NYSA 2DRKA 1K8AC 1K9MR 5LJ5g 1NEBA 2ZPEB 2BKDN 2JJ9A 1H3HA 2ECZA 4JRIA 1BI2A 1K8AU 3R6OA 5KYUB 3PVLA 1NJIR 2FRWA 1K9AA 4ELZC 4ORZA 3OYGA 2QTXA 1D1CA 1S1NA 4XQ3A 3J7AF 4JUVA 4Y91A 1AOJA 1WXTA 1QP3A 1GFCA 1X6BA 2KRNA 3L2UA 5CVIA 3ZFJA 3QYGB 2FYKA 3OS2A 1VQMT 1N9RA 1X27A 4BUGA 2SRCA 2E10A 3O5ZA 5KH6A 3L2RA 4XTUA 2KROA 3CCEQ 1C1AA 1YI2A 4OMMA 1WHLA 2VKNA 4JLGA 4YTLA 4M7DG 2OAUA 3V7SA 1RADB 3H0HA 4KGZB 1TH7A 1T0HA 4JJCA 2PZ1A 2BE7D 3JCMf 2F2VA 1AEYA 4EMKB 1B3QA 2AIRB 2VASA 4FSXA 4FYWB 1YHQA 2HQHA 3SEMA 3CD6A 2VC8A 3JCMV 4MDWA 5LJ5h 3M9QA 3RMSA 5J3BA 1UECA 4AG1C 3OS0A 1VQ7Q 4XU0A 1KJWA 1OV3A 1YJWA 4KH0B 2RN8A 1VQOA 4PKCC 4OF1A 2DXTA 5KYNA 1Z9QA 1VQ6T 5CQYA 2LC4A 2QQSA 2RQUA 3PIOA 1Q7YC 2QA4Q 1JXMA 1QQJA 4M78A 5AYFA 4BDZA 1JRIA 3V7CA 4C8QA 1KC8R 4D6WA 1Q7YU 3RR6A 2RA2A 4DEYA 2P0QA 4GBQA 4PJOE 2RJEA 1BI3A 2DK3A 4C92G 1QLYA 4L59A 1WHKA 4E47A 1D0XA 2IPOB 2J6KA 1RL2A 1A0NB 2R5AA 3KFVA 4DOVA 2P4RA 4F7UA 1AZGB 3CC2A 3CMET 1TWBA 1AT1B 1UG1A 4AFSC 4M75F 3G71A 1BI1A 3G6EA 2DD5A 3TSWA 3SFMA 3S6WA 3UWNA 4M4ZA 5A0DA 1FMWA 1WX6A 1K76A 3CXCS 5GAN7 4CC2A 3VRYA 1WXBA 3L2ZA 2LQ8A 5EG2A 1M30A 3CCMT 1PCXA 4RCCA 2M51A 2DZ9A 2YHTA 5LJ5d 1AHJB 2X51A 1K0XA 1JJ2S 1VQLA 1UGPB 1KFZA 2BZYA 4PK4A 3QBYA 1WJQA 4ZGJB 2E6NA 3JCMQ 4M77D 4BACA 4RTYA 2QEXQ 2X3WD 3MPUB 1NBEB 1N8RU 2YSQA 3CBPA 1QVFP 1NE8A 4AG2C 5FW9A 4Y28E 1SKUB 4A53A 1IO6A 4DOWA 1X2KA 2W10A 4ZN1A 2CZ0B 4HCCA 1ZBJA 4N0AA 1KG1A 3JCMg 1FWZA 2CT4A 4Z02A 2X4JA 1JEGA 2L2PA 4XTYA 3THKA 3F70A 3BDUA 3UDCA 2DILA 2K2MA 3O8VA 3CXCA 1M1FA 4MZPA 2YWWA 2LRQA 1NEGA 2FEIA 4FCYA 4RKUE 3EAEA 3G4ST 3QDRB 5D6XA 2DIGA 3OSVA 1NM7A 1S72A 2LCLA 1SPKA 1MUZA 2EQUA 1K9MU 2AT1B 1VQMQ 4QQGA 1JJ2A 2XHCA 4M77C 1EX4A 3QWXX 2ABLA 2G3RA 4PFZA 3I56T 1E6HA 3JCMe 3BW1A 2PQWA 1WZOA 4AFZC 4PLLA 5GAN6 2YLCA 2ZZDA 1M27C 4Z89A 3WVEB 3V8JA 4J9CA 2ZPIB 5KCHA 1Q86C 2A0FB 3IQLA 4B9WA 4MZTA 3OYYA 1FMVA 5IXFA 4M7AF 2NUPB 1QCNA 2DBKA 2P0KA 4HVVA 2KY9A 1RAAB 2JW4A 2EQJA 5EC7A 5A0GA 1Q86U 2DXCA 4KGVB 2R57A 1N5ZA 2FPDA 2RK1A 3M0PA 4M78B 2D8JA 4C8QB 3GBQA 3NTHA 4J9DA 1YIJT 3CPWS 4HVWA 3QO3A 3JCMh 1VQNT 1Q81C 2O2OA 3A98A 1SG5A 3C4SA 4J6XA 1OQKA 2JT4A 2XMFA 2QDYB 5LJ3j 3OYHA 1AD5A 2HMAA 1M8MA 3SHWA 3OYJA 3GNGA 1YWOA 2VV5A 2EYYA 1WYXA 4B6MA 5ECAA 3OB9A 3QPHA 1XTDA 1VQ6Q 2QG9B 2DTIA 2LCSA 5KYXA 4Y92A 4F7UB 1OX9A 3OQ5A 4E7SA 4ZGDB 2H3JA 2JS2A 4OMQA 4QVZA 1VQKA 1M3BA 3A5ZB 2OJ2A 1X6GA 4ZGEB 4M75E 4Q5WA 1UDLA 1AZEA 1VUBA 3C94A 3PMIA 3UA7A 1G8XA 4J9HA 4LNPA 3WVDB 4PFPA 2V26A 1P92A 4EMKC 2YUQA 2B8AA 2DF6A 3A1PA 1ZUKA 3JCMc 1BKBA 3CPWA 1VQ8Q 4LDUA 4DBHA 2P0PA 3OMGA 1E7OA 3JB9I 2KYMA 3M55A 4OB2B 4ZNXA 1Y0MA 1GCQA 3SB2A 1TUCA 2XD0A 4NOYA 4E7KA 4CC4B 1D3BA 4AT1B 2J7IA 3EGDA 2LJ3A 5LJ3f 4MZMA 1KD1R 2F5TX 3MP6A 5GANf 4LD6A 1RAFB 2WACA 3MO8A 1NPRA 2GGRA 3MP1A 2ROLA 3QHSA 1YNZA 3LLRA 4IIOA 4E7ZA 1M5Q1 1GXIE 2C0IA 1IZ6A 3TREA 4J83A 1YITT 3JCMd 2OTJA 2RHUA 1ZSZC 1RLQC 1M1KR 2KDSA 1WPYA 1QW1A 2FPEA 3PIPA 2EQMA 2PUOB 1PD1A 1UHFA 3PT9A 3E9FA 2E5QA 3RKWA 4Z8AA 3I55A 3L2QA 5IT9E 4JRQA 2AZVA 2R5MA 3CMAQ 5I2SA 1WHHA 4M7DE 2BE9B 2JMAA 1IREB 1RAEB 1ACMB 3UA6A 5FWBA 4PFOA 3RKXA 2EGAA 3CC4A 2QASA 3X20B 1WI7A 2P4TA 1WQ7A 1RACB 1E6GA 3M0RA 3CCET 3TEEA 3OYCA 1ZLMA 4PJLA 3M57A 1UGSB 1XJWB 4PJOB 3A8HB 3FRNA 4E7JA 2NLUA 3HRUA 1RUWA 3G7ZA 3OYNA 2JNGA 3QZ5B 5GAMg 3C95A 1M1GA 2NUZA 3CCLT 1SRMA 1YI2T 3I56Q 2D0QB 3L2WA 2LQKA 2OTLQ 1GRIA 1BB9A 2KMTA 3CBOA 2LZ6B 2O9VA 4OB1B 5I2MA 4BB7A 4HT9A 2CS7A 1WHMA 2KAFA 4AMCA
chains in the Genus database with same CATH topology
2QTXA 2VGMA 1QVFS 2JTFA 4M75C 1NPPA 2LVMA 4PNOA 4BI4A 4C0GA 4JJNK 4XQ3A 2XI9A 3J7AF 4JUVA 2XG8D 2ZPBB 3HP9A 4Y91A 3BDLA 1Y7XA 5CR2A 1QP3A 2A3LA 2M9UA 3OW2S 2RM4A 3L2UA 1VQ7T 2FB7A 5CVIA 3ZFJA 1YHQT 3CD6T 3QYGB 2FYKA 2QEXA 5GMKj 4ZTFA 3A8GB 2FVUA 3OS5A 4GY5A 3M5AA 1KC8C 3OS2A 2F69A 3VU3C 4NS5A 1VQMT 4EPCA 1X75C 4IUVA 2RK2A 1N9RA 4BUGA 4ZN3A 3OYEA 2XDPA 2E10A 5I21A 3S3NA 4XU3A 4C92E 5KH6A 3L2RA 4XTUA 4BD3A 4JDSA 4J6YA 4OB3B 2CZ7B 2E1HA 1UGRB 4M77G 1KC8U 4QQDA 1FX7A 3SWNC 1YI2A 4JLGA 2HAXA 4YTLA 3SWNA 2KVQG 4M7DG 2OAUA 2E70A 3V7SA 3CMEA 1PSEA 4X9DA 5CKBA 3CCRA 3CCJT 1TH7A 1YJNA 2FHDA 2BUDA 5J39A 3OYBA 2VXFA 1I81A 1N9SA 3CC7A 4BY6C 3JCMf 5KCOA 4C0DC 2JUFA 2L3RA 4QVCA 4E7LA 4C8QD 4BE1A 2KK4A 2PVGB 2RJCA 3H8ZA 2JOYA 4A4KA 4C0ZA 4EMKB 4C5HA 5GAMj 4IUQA 5GAMh 3X28B 1KQ2A 3VYGA 3HL8A 3QYHB 1FXXA 3ASKA 4J8OA 4IUPA 4WF2A 4FSXA 4ME7A 3CC4T 1QVFA 3J81E 1YHQA 3CD6A 3OS1A 2VC8A 5LJ3g 3JCMV 3KXTA 5LJ5j 3CCMA 4MDWA 2K5LA 5LJ5h 3M9QA 2BIVA 1W4SA 3RMSA 4LDVA 3CCVT 5GANg 4ATOA 2RI3A 4M7AD 3RUXA 1KHCA 3OW2A 5J3BA 4DQ2A 5CKDA 3GOXA 3LWHA 3VJPA 4LDWA 3JCMX 5GAOl 1O75A 1JB0E 2GQVA 3C12A 3OS0A 3INZA 4XU0A 3FDRA 5GAOm 4XTXA 1YJWA 3MHXA 4PL6A 2DPPB 3HFOA 5D6YA 2CKKA 3OMCA 1VQOA 1X01A 3VKIA 4PKCC 2Y4XA 4KULA 2DXTA 4OF1A 4IUUA 2ZPHB 5CK9A 2CZ6B 3CCQT 1VQ6T 5CQYA 1OZ2A 2LC4A 2QQSA 3PIOA 1Q7YC 2HNIA 4ELZC 3QZ9B 2I2LA 5KE3A 3OA6A 3G71T 2PVOB 3KBGA 3LX7A 4M78C 3G6ET 2MWPA 5AYFA 4M78A 4L6V5 5LJ3e 4C8QC 4BDZA 1JRIA 3V7CA 4C8QA 3QJ6A 4OGEA 1R8OB 4D6WA 1Q7YU 4JS5A 2RA2A 3BY7A 5GAN2 4RG8A 2P0QA 3GLXA 4PJOE 4IKFA 2RJEA 1BI3A 2DK3A 4FIBA 4C92G 4L59A 1SSFA 3CCVA 3A8OB 3DB4A 3X25B 3DB3A 4C92D 3UPUA 4E47A 2WSCE 3MEUA 4JLIA 2LTOA 3FEOA 1HXDA 3G4SA 3OYFA 1RL2A 1M4ZA 2R5AA 4KT0E 1U8RA 4M7AC 3L42A 4BE2A 4M7AA 4DOVA 1M90C 2MAMA 3QXEB 2K3XA 2PVDB 2DJZA 1VQLT 4F7UA 1EIFA 5GAMf 3HRSA 1H3ZA 4J7FA 1B34A 5FU6B 3DKMA 5J26A 1VQ6A 3CCQA 2CYZB 3CC2A 1O9SA 2DZCA 2KSSA 3CMET 1M90U 1YJNT 3FB9A 3META 5CKFA 3CCST 3GF5A 4N4HA 3GIBA 4M75F 3G71A 3DLMA 3H6ZA 5LJ5f 1BI1A 3CC7T 3G6EA 2DD5A 1RI0A 3M4GA 4JRPA 4MDXA 2MI6A 3SFMA 5IN1A 3S6WA 3UWNA 5GANj 5A0DA 5GANh 4M75A 3M53A 1Q81U 5FU7B 5CCAA 5GAOr 1W2BS 3CXCS 5GAMd 1BYMA 5GAN7 1KQ1A 2IG0A 5C6SA 4V2SA 3HRTA 1I8FA 1N27A 3LW5E 2XDDA 4HA8A 4LDYA 2O01E 3GP8A 3MP8A 3L2ZA 1LJOA 1ZBXA 5LL6S 2LQ8A 1U1TA 4RMOA 5EG2A 3ME9A 4HT8A 2D6FA 5KE2A 3CCMT 4RCCA 2DZ9A 2YHTA 3OSSC 2EAYA 1AHJB 2O4XB 3FIFA 5HY6A 5LJ5d 4C92C 1K73C 4N4GA 4A4HA 2PU9B 3V7RA 1JJ2S 1VQLA 2VYTA 5CAIA 1UGPB 2VXEA 2DXUA 1XOVA 2DKGA 4R56A 5FROA 2K4YA 1VQ8A 2MWOA 1DJ7B 1WJQA 3QBYA 5CO7A 4ZGJB 2E6NA 1QP2A 3JCMQ 1K73U 4M77D 4M75B 4BACA 3JCMJ 2JZ2A 1YJWT 3JCMb 3WXMB 2RD1A 3CCSA 1N8RU 3T9NA 3LWIA 3CBPA 2X4YA 4M7DD 1VQOT 1NE8A 2DTHA 1UGQB 2VGNA 2XDBA 2QEXT 4Y28E 3RIRA 1YBYA 4A53A 4PJOG 4HCZA 4DOWA 2LDMA 5FRNA 4OP0A 3SD4A 1Q82C 2EIFA 4PJOD 3CCUA 2RI2A 4N0AC 3PMTA 4ZN1A 2CZ0B 3OYDA 4HCCA 3HFNA 3HKSA 4N0AA 4XTZA 1KG1A 3JCMg 1FWZA 2V8KA 2X4JA 5CIUA 4Z02A 3S3OA 4XTYA 1Q82U 4RCBA 3SWNB 3F70A 5A0LA 3BDUA 3UDCA 3VUZA 1VQ4T 2DTOA 4KBMB 1W2BA 3O8VA 3CXCA 1M1FA 1I4K1 1N6AA 1OI1A 4MZPA 3PTAA 2LRQA 3EFRA 2Y90A 1ZHIA 4L5GA 4BI3A 3X26B 5GAOp 3OYAA 3Q1JA 4XU1A 5GMKi 2JVVA 3EAEA 4RKUE 2QQBA 4ELYC 4CI0C 2V8JA 3CEYA 4BY6B 3G4ST 4C0DB 3QDRB 5D6XA 2DIGA 2M1HA 3OSVA 4XTVA 2F5KA 1S72A 1VQ9A 2LCLA 2QQAA 2KQWA 2V8IA 3LGFA 3X24B 2EQUA 1K9MU 3MCAB 5FRMA 1JJ2A 3QIIA 4QQGA 2RJFA 2R58A 4JS4A 2XHCA 3E19A 2K2VA 1YCYA 4M77C 4R55A 3CC2T 4M78F 5L8RE 4M77A 2EKOA 2JTMA 4J5YA 2G3RA 4C8QF 5DLQE 3I56T 2DEQA 4M7DC 3JCMe 3BW1A 2PQWA 4M7DA 5HK3A 3JRZA 3RESA 3RERA 1M8VA 2XKOC 3OYMA 1U1SA 4PLLA 1G3YA 3CMAA 5CKEA 4FT4A 3V8LA 1MGQA 1WQWA 2XK0A 1KQSA 1OYXA 4E7IA 2MMPA 4C5GA 3N5BB 5GAN6 2AHJB 5A2QE 3QSUA 2YLCA 2ZZDA 2ZGWA 5GANd 4PJOC 1G5VA 2RHXA 2RJDA 3V8JA 3WVEB 3FC3A 2ZPIB 2ZPGB 5KCHA 4II1A 2E6ZA 1Q86C 1VQ4A 4B9WA 4MZTA 3OYYA 4M7AF 4HKEA 5D6WA 2QQ9A 2RHYA 2RHIA 2P0KA 4F7UF 2L5QA 2KY9A 4B9XA 2EQJA 3JCMW 5A0GA 4J7IA 1Q86U 4M78E 2DXCA 1ZQ1A 1WGSA 2A7YA 4UC4A 4C8QE 2R57A 2EFIA 2QI2A 2HQEA 2RK1A 3HHTB 4M78B 3LYIA 2K5FA 4C8QB 1VQ8T 3AHUA 2HQXA 3NTHA 3J80E 2XICA 1YIJT 3CPWS 1KD1C 3I56A 2D9TA 4PLIA 2RHZA 4XAXB 3QO3A 4XU2A 3JCMh 1YJ9A 1VQNT 3OBWA 3QJYA 1Q81C 2OTLA 3C4SA 4J6XA 3OYHA 5LJ3j 2PUKB 2QDYB 1JBMA 3JCMP 5LJ3h 5GMKe 2DO3A 1WNLA 4IUTA 4XK8E 3OYJA 3GNGA 4CRIA 3GNFB 2VV5A 1KD1U 4M7AE 2HBPA 4FL6A 3P8DA 3OB9A 4F7UE 2X4XA 3QPHA 2L89A 5GMKl 1XTDA 3JSCA 3BFMA 1LOJA 4OVAA 3CCUT 4C0FA 1VIFA 4M7AB 2HD0A 2DTIA 3M58A 1UEBA 4A54A 4X34A 2DVEA 5GMKm 4N4IA 4F7UB 3OYLA 3OQ5A 4A4GA 2LCCA 4X9CA 4OMFB 1M1KC 1B34B 1V29B 2X35A 4ZGDB 2H3JA 3PFSA 2K5IA 4QVZA 1VQKA 4MMLA 3A5ZB 1Y07A 4OB0B 3QG1A 2QXFA 3M54A 5GAOn 4C92A 1UB4A 1NZ9A 1N8RC 4ZGEB 1M1KU 2DAQA 3M59A 4M75E 1LNXA 3M4YA 4Q5WA 4IURA 3JB9F 1VUBA 3C94A 4FU6A 3TU4K 3PMIA 3MEWA 3NTKA 1BIBA 4NL3A 2YRVA 4TVRA 5GAMe 3CCEA 1YIJA 2XU8A 1VQ9T 1S72T 3QUIA 3WVDB 5DY9A 3RMQA 1X6OA 4E7HA 1G3TA 1Y71A 3OBYA 1VQNA 4C5IA 1P92A 4EMKC 1KQSS 5HK0A 4EMKA 4A4FA 5GMKh 2B8AA 4EMHA 3VV0A 1QVPA 1VQ5T 3NFCA 3VYHB 4O5VA 5LJ5e 3JCMc 1BKBA 2RH2A 2LX9A 3CPWA 1Y96A 1XQHA 4JRKA 2OTJT 4LDUA 3CCLA 3JB9H 3CMAT 4BE0A 2QA4T 2M0OA 3DLLA 2P0PA 3OMGA 3NTIA 5HKCA 4LDXA 3LGLA 4C92B 3JB9I 3M55A 4FT2A 4OB2B 4VUBA 3JB9J 2YLBA 2GCXA 2X4WA 4M78G 3SB2A 2XD0A 3I55T 4NOYA 4C8QG 4E7KA 3FLGA 1D3BA 3KUFA 5DLOA 2ZPFB 2EQKA 2RO0A 1MHNA 3CBMA 3FJPA 3LH0A 3M56A 4M78D 4RG2A 1K9MC 5LJ3f 2DXBA 4MZMA 1WJSA 5CKHA 1BIAA 5IAYA 2EJGA 4HCBA 2F5TX 4P5NA 2CGHA 3MP6A 5GANf 1Y96B 3EFSA 4GLKA 4LD6A 4XTWA 4M77F 4OGCA 2K57A 2Y4YA 2WACA 3MO8A 3SDZA 2LT4A 2LNVA 3VUBA 1NPRA 5FLXE 3S3MA 1NJIC 1VQ7A 3MP1A 4M7DF 3GPLA 3QHSA 1QVGS 4M7AG 3LLRA 4EDUA 1M5Q1 3CPFA 5DM7R 1VQMA 1GXIE 4F7UG 1IZ6A 1VQ5A 2QQRA 3TREA 4J83A 3ZBDA 2ZCFB 3A8LB 1YJ9T 1VQPT 2VUBA 1YITT 3JCMd 2JN0A 2IVWA 3OYIA 1NJIU 2RHUA 2OTLT 1D3BB 2OTJA 3HPWA 1WJRA 4PJOF 1HK9A 2RI5A 5GAN5 3JAME 2QA4A 5LJ3d 5CQXA 2KDSA 1WPYA 1QW1A 3ZEHA 2E64A 3PIPA 3ER0A 2EQMA 2PUOB 3PGGA 3PT9A 3E9FA 4O6JA 4DA4A 3CCJA 2E5QA 3RKWA 4PJOA 4FM4B 3I55A 3L2QA 1G3SA 1G3WA 3RKYA 5IT9E 2K3YA 3L1AA 4BI8B 4JRQA 2E41A 2L8DA 4M75G 4M77E 4NL2A 3URGA 3OY9A 4BDYA 2R5MA 1I5LA 2EJ9A 5I2SA 3OYKA 2CZ1B 2GFAA 1M9SA 5GAN3 2GF7A 4M7DE 4M75D 2EWNA 3A8MB 4M77B 2EJFA 1IREB 1VQKT 5FU6C 3UT1A 2M16A 4M7DB 4KUIA 5GAOq 1KHIA 2DIQA 4MMKA 3E1SA 3RKXA 2WSFE 3CC4A 5GANe 1BI0A 1XNIA 3X20B 2P4TA 4QQ6A 3HSBA 1WQ7A 5GAN4 3CCET 3TCJA 3TEEA 3OYCA 3M57A 1UGSB 4PJOB 4EMGA 3A8HB 1VQPA 3QKJA 3FRNA 2MF2A 3L2VA 2XIDA 2NLUA 3HRUA 4E7JA 1YITA 3G7ZA 3OYNA 1VIEA 2JNGA 3PNWC 3QZ5B 3C95A 4J6WA 1PSFA 4QW2A 4QVDA 1H641 5GAMg 1QVGA 3P8BB 5FU7C 2C06A 1M1GA 3JB9G 2RB6A 3P8HA 2E12A 3CCLT 2E65A 4KUDK 3JB9D 4LD9K 3V8KA 1K8AC 1YI2T 5LJ5g 2ZPEB 2GFUA 4C5EA 2FL7A 4ZTJA 2BKDN 2D0QB 2LT1A 5C0MA 3L2WA 2EYQA 2LQKA 4JRIA 3CCRT 1OZ3A 2KMTA 3CBOA 2O4XA 3E9GA 3MEAA 4OB1B 5I2MA 4C92F 1BI2A 4BB7A 5GAN8 5M9OA 4A4EA 2CS7A 3MEVA 1K8AU 4HT9A 3R6OA 2KAFA 2WSEE 2DD4A 3OYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTX A;  4C92 D;  4C92 B;  4JLI A;  4M75 C;  1YCY A;  3JB9 I;  4M77 C;  4PNO A;  3JB9 J;  1HXD A;  4M78 F;  4M77 A;  2YLB A;  4J5Y A;  4XQ3 A;  4C8Q F;  4M7A C;  2DEQ A;  4M78 G;  4JUV A;  3SB2 A;  4M7D C;  3JCM e;  4M7A A;  3BW1 A;  4NOY A;  4Y91 A;  4C8Q G;  3RER A;  3RES A;  4M7D A;  1M8V A;  1D3B A;  2DJZ A;  4F7U A;  1U1S A;  2RM4 A;  4M78 D;  3FJP A;  5GAM f;  3V8L A;  1MGQ A;  1WQW A;  2FB7 A;  1B34 A;  5GAN 6;  3QSU A;  2FYK A;  5GMK j;  5LJ3 f;  2YLC A;  1BIA A;  2DZC A;  2EJG A;  2ZGW A;  3VU3 C;  5GAN d;  4PJO C;  1N9R A;  3FB9 A;  3V8J A;  3GIB A;  2CGH A;  2E10 A;  5I21 A;  1Y96 B;  3EFS A;  4M75 F;  4XTW A;  4XU3 A;  4M77 F;  4XTU A;  4C92 E;  5LJ5 f;  2K57 A;  3AHU A;  3M4G A;  4J6Y A;  2E1H A;  4M77 G;  4M7A F;  4M7D F;  3SWN C;  3QHS A;  3SWN A;  4F7U F;  5GAN j;  4M7A G;  4M7D G;  1M5Q 1;  4M75 A;  5GAN h;  3V7S A;  3JCM W;  4F7U G;  4X9D A;  4M78 E;  1TH7 A;  5GAO r;  4C8Q E;  3JCM d;  5GAM d;  2JN0 A;  1KQ1 A;  5GAN 7;  2VXF A;  1I81 A;  1D3B B;  1N9S A;  4V2S A;  3JCM f;  1I8F A;  4PJO F;  1HK9 A;  4M78 B;  5GAN 5;  4QVC A;  5LJ3 d;  4C8Q D;  4HA8 A;  1WPY A;  4C8Q B;  3L2Z A;  1LJO A;  2E64 A;  1U1T A;  4EMK B;  4HT8 A;  3PGG A;  5GAM j;  4RCC A;  3RKW A;  2DZ9 A;  2YHT A;  4XU2 A;  2EAY A;  3FIF A;  3QO3 A;  3JCM h;  5LJ5 d;  3RKY A;  4C92 C;  5GAM h;  1KQ2 A;  3V7R A;  3L1A A;  4J6X A;  4WF2 A;  5LJ3 j;  3JCM P;  5CAI A;  2VXE A;  1JBM A;  2DXU A;  2DKG A;  2E41 A;  4M75 G;  4M77 E;  4NL2 A;  5LJ3 h;  5GMK e;  1WNL A;  1I5L A;  2EJ9 A;  5GAN 3;  2VC8 A;  5LJ3 g;  4M7A E;  3JCM V;  4M7D E;  4M75 D;  3JCM Q;  4M77 D;  4M75 B;  2EWN A;  4F7U E;  5LJ5 j;  4M77 B;  2EJF A;  5GMK l;  5LJ5 h;  3JCM J;  3BFM A;  1LOJ A;  3JCM b;  2RD1 A;  5GAN g;  4M7A D;  4M7D D;  4M7A B;  3RUX A;  2DTI A;  4A54 A;  4M7D B;  4DQ2 A;  2DTH A;  2DVE A;  4MMK A;  3RKX A;  5GMK m;  5GAO q;  4F7U B;  3JCM X;  5GAN e;  5GAO l;  3RIR A;  4X9C A;  4A53 A;  1B34 B;  4PJO G;  3HSB A;  1WQ7 A;  3INZ A;  5GAN 4;  4XU0 A;  5GAO m;  4OP0 A;  4XTX A;  4PJO D;  3HFO A;  4MML A;  4PJO B;  4N0A C;  4EMG A;  1X01 A;  3HFN A;  4N0A A;  5GAO n;  4XTZ A;  2DXT A;  4C92 A;  3JCM g;  5GAM g;  4J6W A;  4M75 E;  4QVD A;  1H64 1;  1LNX A;  3JB9 F;  4XTY A;  1BIB A;  4RCB A;  2HNI A;  2RB6 A;  3SWN B;  5GAM e;  4NL3 A;  3JB9 G;  2I2L A;  3BDU A;  2DTO A;  2E65 A;  3QUI A;  4M78 C;  5DY9 A;  3JB9 D;  1I4K 1;  4M78 A;  3V8K A;  5LJ3 e;  4C8Q C;  3EFR A;  2Y90 A;  5LJ5 g;  1JRI A;  3V7C A;  4C8Q A;  5GAO p;  4PJO A;  4XU1 A;  4EMK C;  5GMK i;  2RA2 A;  4EMK A;  3BY7 A;  5GMK h;  5GAN 2;  4EMH A;  4JRI A;  5LJ5 e;  4PJO E;  4C92 F;  3JCM c;  4XTV A;  1Y96 A;  5GAN 8;  4HT9 A;  4JRK A;  4C92 G;  3JB9 H;  5GAN f; 
#chains in the Genus database with same CATH topology
 1NPP A;  4BI4 A;  4C0G A;  1RAG B;  2LQN A;  4D8K A;  2ZPB B;  3OW2 S;  1VQ7 T;  2PTK A;  1YHQ T;  3CD6 T;  2DMO A;  5GMK j;  4ZTF A;  3OS5 A;  5KYX B;  2V1Q A;  1G2B A;  1GBR A;  4EPC A;  2LNH B;  1X75 C;  4IUV A;  2RK2 A;  2XDP A;  2LX7 A;  2JS0 A;  4XU3 A;  1PRM C;  4C92 E;  4J6Y A;  1YIJ Q;  4M77 G;  2HAX A;  1WIE A;  3SWN A;  1VQN Q;  2E70 A;  2EYX A;  1Y57 A;  3CCR A;  3EG2 A;  5KYW A;  2BUD A;  2HL5 C;  3OYB A;  5KCO A;  4DBQ A;  2FPF A;  2YRD A;  4QVC A;  4C8Q D;  4BE1 A;  1MNE A;  1QCF A;  2KK4 A;  1C0M A;  3H8Z A;  1JQQ A;  4A4K A;  2BTT A;  4IUQ A;  5GAM h;  3E2U A;  2A37 A;  1KQS P;  3ASK A;  4J8O A;  4IUP A;  4ME7 A;  4FYY B;  4QT7 A;  3OS1 A;  3UF4 A;  5LJ3 g;  3KXT A;  2K5L A;  2BIV A;  4RTZ A;  4ATO A;  5GAN g;  4RTT A;  1MMA A;  3RUX A;  3OW2 A;  2YUO A;  4DQ2 A;  1GFD A;  2YXY A;  5CKD A;  3VJP A;  3JCM X;  3EGD B;  1JB0 E;  2RQT A;  2NUT A;  5GAO m;  2CP3 A;  2CP2 A;  1WDX A;  2DPP B;  3HFO A;  2EVR A;  3OMC A;  1X01 A;  1F1B B;  1OZ2 A;  4HCK A;  4LXC A;  4JPB W;  2HNI A;  3G71 T;  2MK5 A;  3REA B;  1IHW A;  2PVO B;  4M78 C;  3G6E T;  5LJ3 e;  1MMG A;  4C8Q C;  3CCJ Q;  4OGE A;  4RG8 A;  2ZAE A;  5GJW B;  4IKF A;  3FJ5 A;  4F14 A;  4J9F A;  1PHT A;  3DB4 A;  6AT1 B;  3UPU A;  3MEU A;  1K4U S;  3FEO A;  1HXD A;  5IHI A;  4RTU A;  4M7A A;  1M90 C;  2A28 A;  1H92 A;  1VQL T;  4J7F A;  1B34 A;  5FU6 B;  2LP5 A;  3DKM A;  5J26 A;  1YIT Q;  1EFN A;  1M90 U;  2DZC A;  2KSS A;  1YJN T;  3GIB A;  1FYN A;  3H6Z A;  3CC7 T;  2MI6 A;  1HJD A;  5GAN h;  3M53 A;  1Z9Z A;  5FU7 B;  1MMD A;  2ESW A;  5GAO r;  5GAM d;  1LPL A;  4KH1 B;  2IG0 A;  3LW5 E;  2E3I A;  4LDY A;  1YP5 A;  1LJO A;  2KRS A;  4RMO A;  2KE9 A;  3OSS C;  5FWC A;  4J9E A;  1X2Q A;  3ZL7 C;  1W70 A;  4A4H A;  2PU9 B;  1W1F A;  8ATC B;  2VYT A;  1QWE A;  5CAI A;  2DXU A;  2DKG A;  3VS1 A;  4RTW A;  2K4Y A;  1DJ7 B;  1QP2 A;  4M75 B;  1I1J A;  1IXD A;  2RD1 A;  3CCS A;  1LVK A;  4JJD A;  3CCL Q;  1HSQ A;  2E5K A;  1R0C B;  4HCZ A;  1YI2 Q;  3VS4 A;  5FRN A;  2HBW A;  4PJO D;  4N0A C;  2K3B A;  3HKS A;  1HD3 A;  4AFQ C;  4OMO A;  3SWN B;  2HSE B;  5KYW B;  1OPL A;  3EFR A;  3I35 A;  2Y90 A;  1ZHI A;  4L5G A;  5GMK i;  2JVV A;  2QQB A;  4F04 B;  4CI0 C;  3CEY A;  4C0D B;  1YHQ Q;  1VQ9 A;  3CD6 Q;  2KQW A;  3X24 B;  2NUP A;  2K2V A;  1YCY A;  4CC3 A;  2EKO A;  2JTM A;  4J5Y A;  1WFW A;  5DLQ E;  2VWF A;  3JRZ A;  3RER A;  2XKO C;  1BK2 A;  1U1S A;  3EH1 A;  1G3Y A;  5IHN A;  5CKE A;  2J6F A;  1MGQ A;  1YJW Q;  1ZUU A;  2AHJ B;  3QSU A;  1VQO Q;  5GAN d;  1K73 R;  4PJO C;  3M0T A;  4IIM A;  2NUT B;  2E6Z A;  2EGE A;  3MJX A;  5D6W A;  2RHI A;  4B9X A;  3JCM W;  4JJB A;  4J7I A;  2CT3 A;  1WGS A;  2KI7 A;  2QI2 A;  2H8H A;  2DBM A;  1VQ8 T;  2HQX A;  1YWP A;  1Q82 R;  2YDL A;  1TU0 B;  1YJ9 A;  3QJY A;  1NYF A;  3JCM P;  2PUK B;  5GMK e;  1WNL A;  1M2V B;  4FL6 A;  3P8D A;  3JSC A;  3CC2 Q;  3BFM A;  3CCU T;  4M7A B;  5GMK m;  2X3X D;  1OU8 A;  3G71 Q;  1CSK A;  1OX8 A;  2HDA A;  1TSF A;  3G6E Q;  1B34 B;  4MML A;  1Y07 A;  3M54 A;  5GAO n;  1NZ9 A;  1N8R C;  2DAQ A;  3M59 A;  3M4Y A;  4F17 A;  3JB9 F;  3NTK A;  2CP7 A;  3EGX B;  1R0B G;  1G3T A;  2Z0W A;  3OBY A;  4C5I A;  4J9B A;  4A4F A;  5GMK h;  4EMH A;  3VV0 A;  1VQL Q;  3NFC A;  2YUP A;  2JMC A;  1PKT A;  2CP0 A;  3CXC P;  2PNI A;  2OTJ T;  2HSP A;  3CMA T;  4BE0 A;  3DLL A;  1YJN Q;  4C92 B;  4FT2 A;  4VUB A;  3JB9 J;  3CC7 Q;  1GCQ C;  2JM9 A;  5IHK A;  5HCK A;  4M78 G;  1D09 B;  3I55 T;  4C8Q G;  2QYZ A;  4JZ4 A;  1JJ2 P;  3EHQ A;  2ZPF B;  3M56 A;  1AVZ C;  3LH0 A;  4RG2 A;  2HCK A;  1K9M C;  2KR3 A;  2DXB A;  2ENM A;  1ZA2 B;  1Y96 B;  4XTW A;  1AWO A;  5IXB A;  2K57 A;  1NJI C;  4M7D F;  3GPL A;  1QVG S;  4EDU A;  5DM7 R;  1VQM A;  4F7U G;  1VQ5 A;  1SF9 A;  3A8L B;  2OTL T;  1NJI U;  3M0U A;  3HPW A;  3RDV A;  1WJR A;  1S72 Q;  1HK9 A;  2RI5 A;  3JAM E;  1ABO A;  3ZEH A;  1PWT A;  1TS9 A;  2ED0 A;  4OMN A;  3PGG A;  4O6J A;  3EGU A;  1MND A;  2HZY A;  4PJO A;  1G3W A;  3RKY A;  7AT1 B;  1IGU A;  2DJQ A;  4BI8 B;  2E41 A;  4M77 E;  3URG A;  3OY9 A;  1KSW A;  4EIK A;  3QDF A;  4M75 D;  2EWN A;  1K0S A;  5FU6 C;  3UT1 A;  1BU1 A;  5GAO q;  3E1S A;  1K1Z A;  1XNI A;  2CRE A;  4QQ6 A;  5GAN 4;  3REB B;  1VOM A;  1VQP A;  3QKJ A;  1VIE A;  3PNW C;  4J6W A;  1H64 1;  1QVG A;  5FU7 C;  2RB6 A;  3RBB B;  3JB9 D;  2KNB B;  3V8K A;  2COY A;  4C5E A;  2K6D A;  4ZTJ A;  5C0M A;  2KBT A;  3EG9 B;  3CCR T;  4C92 F;  5GAN 8;  5M9O A;  4A4E A;  3MEV A;  1TG0 A;  2WSE E;  2DD4 A;  2JTF A;  2DET A;  4M75 C;  2LVM A;  4PNO A;  3CPW P;  2NWM A;  2XI9 A;  1X43 A;  1M2O A;  1NLP C;  1Y7X A;  5CR2 A;  4WCI A;  1VQK Q;  2BZX A;  2FVU A;  4GY5 A;  2DL8 A;  1KC8 C;  2F69 A;  3OYE A;  4ZN3 A;  3S3N A;  2RNA A;  2C0O A;  4BD3 A;  4OB3 B;  2CZ7 B;  2E1H A;  2QGF B;  4J9I A;  1KC8 U;  2JM8 A;  3SWN C;  2KVQ G;  1NG2 A;  2FZK B;  2OAW A;  3CME A;  1PSE A;  4X9D A;  3CCJ T;  3VRZ A;  5J39 A;  1D0Y A;  1QKX A;  2VXF A;  1TUG B;  1TXQ A;  3PVQ A;  5IH2 A;  4C0D C;  4E7L A;  2L3R A;  3CCU Q;  5I22 A;  2RQW A;  2PVG B;  2RJC A;  2JOY A;  2RPN A;  2CH4 A;  3X28 B;  3VYG A;  1JO8 A;  4HXJ A;  1YFN A;  2EPD A;  5LJ5 j;  3CCM A;  1K8A R;  2FZG B;  4LDV A;  4M7A D;  1V1C A;  3GOX A;  3LWH A;  4LDW A;  3BE3 A;  2VB6 A;  1TOV A;  2GQV A;  3C12 A;  3FDR A;  3MHX A;  1ABQ A;  1WA7 A;  1ZSG A;  1UFF A;  3NGP A;  5D6Y A;  2CKK A;  4Z88 A;  1CKB A;  4KUL A;  2EW3 A;  4IUU A;  4RTX A;  1YCS B;  2OTJ Q;  2AK5 A;  2CDT A;  2DL3 A;  3VS6 A;  4PJJ A;  1QMC A;  3I9Q A;  2I2L A;  3OA6 A;  2MWP A;  1OPK A;  3QJ6 A;  3I55 Q;  1R8O B;  4JS5 A;  5GAN 2;  2CSI A;  2MIO A;  2DA9 A;  1SSF A;  3CCV A;  2RQR A;  1VYT A;  4C92 D;  4LN2 A;  2LTO A;  3G4S A;  3OYF A;  2DX1 A;  1U8R A;  4M7A C;  3CC4 Q;  4BE2 A;  4DBR A;  3TVT A;  2K3X A;  3M0S A;  2DJZ A;  1EIF A;  3CCQ A;  2CYZ B;  1B07 A;  1O9S A;  3FB9 A;  3MET A;  3CCS T;  4N4H A;  1U5S A;  3DLM A;  5LJ5 f;  2MOX A;  4M75 A;  1UE9 A;  5CCA A;  1W2B S;  2AKK A;  4V2S A;  1I8F A;  1N27 A;  2ROT A;  3G1J A;  2XDD A;  2O01 E;  3MP8 A;  4HVU A;  1ZBX A;  1U1T A;  3EHR A;  2D6F A;  4C92 C;  2L3S A;  4N4G A;  4AFU C;  2VXE A;  1XOV A;  1Q7Y R;  5FRO A;  2I0N A;  5CO7 A;  3NHN A;  2DNU A;  2J06 A;  1ARK A;  3JCM J;  1YJW T;  3LH5 A;  2FZC B;  3JCM b;  3NMZ C;  2YUN A;  3T9N A;  3LWI A;  1VQO T;  2DTH A;  1UGQ B;  2VGN A;  3RNJ A;  3RIR A;  1YBY A;  2HKN A;  4OP0 A;  3SD4 A;  3OW2 P;  2D1X A;  2RI2 A;  2OI3 A;  3OYD A;  3CCR Q;  4XTZ A;  2O88 A;  2EYZ A;  1IHV A;  2V8K A;  3S3O A;  1YN8 A;  4RCB A;  5A0L A;  1W2B A;  5AT1 B;  1I4K 1;  1N6A A;  2DYI A;  3PTA A;  4BI3 A;  4PJN A;  4XU1 A;  4ELY C;  4BY6 B;  3D7S B;  1OOT A;  2DM1 A;  2M1H A;  2F2W A;  4XTV A;  2G6F X;  2F5K A;  2QQA A;  2X9H A;  2V8I A;  3LGF A;  1PNJ A;  3QII A;  2RJF A;  1ZX6 A;  1RAI B;  4FYX B;  3CC2 T;  2RF0 A;  1PKS A;  2DEQ A;  1PG5 B;  1TUD A;  4M7D A;  5HK3 A;  3RES A;  1M8V A;  1WLP B;  4FT4 A;  3V8L A;  1WQW A;  2XK0 A;  1KQS A;  1OYX A;  4E7I A;  4C5G A;  3N5B B;  1UJ0 A;  1G5V A;  3FC3 A;  2DEU A;  3TSZ A;  4II1 A;  1VQ4 A;  4HKE A;  1M2V A;  2J6O A;  2L5Q A;  3UAT A;  2LJ1 A;  4JZ3 A;  4M78 E;  3H9N A;  3EFO B;  2A7Y A;  3H41 A;  4C8Q E;  3VS3 A;  2HQE A;  2RQV A;  1VYV A;  3LYI A;  2L0A A;  2XIC A;  1WHG A;  1KD1 C;  2D9T A;  4XAX B;  4XU2 A;  1JBM A;  4GLM A;  5LJ3 h;  2COZ A;  4CRI A;  1KD1 U;  2HBP A;  2RMO A;  3EGX A;  4F7U E;  2L89 A;  4C0F A;  1NYG A;  3M58 A;  2DVE A;  4N4I A;  1C6V X;  2LCC A;  1M1K C;  1V29 B;  2X35 A;  3PFS A;  1SSH A;  3QG1 A;  2QXF A;  4C92 A;  1UB4 A;  1M1K U;  4FU6 A;  2M02 A;  3TU4 K;  3MEW A;  1BIB A;  4NL3 A;  4TVR A;  3CCE A;  2YT6 A;  2QDL A;  1S72 T;  1X6O A;  4E7H A;  1Y71 A;  2DER A;  2P84 A;  1HYO A;  1VQ5 T;  5LJ5 e;  1Q86 R;  1Y96 A;  2W0Z A;  1XQH A;  4JRK A;  3CCL A;  2M0O A;  4LDX A;  2J05 A;  3CCS Q;  1ZUY A;  2QAZ A;  2F1L A;  1OEB A;  2MYS A;  2YLB A;  2GCX A;  2X4W A;  2BZ8 A;  1UTI A;  3FLG A;  5DLO A;  2EQK A;  1MHN A;  3CBM A;  3MKD A;  2QTV A;  1WJS A;  1Q81 R;  4P5N A;  4M77 F;  3I5S A;  2Y4Y A;  3S3M A;  5FLX E;  3AHU A;  2LNV A;  3VUB A;  1VQ7 A;  1GBQ A;  4M7A G;  3CPF A;  2QQR A;  3EG1 A;  1VQP T;  2VUB A;  2IVW A;  2B86 A;  1VQ9 Q;  5GAN 5;  2QA4 A;  1UGV A;  5CQX A;  5LJ3 d;  2F2X A;  1OU9 A;  3ER0 A;  1PC0 A;  1BBZ A;  1G3S A;  1I5L A;  2DLP A;  1SRL A;  2EJ9 A;  4F16 A;  4LE9 A;  3EG3 A;  1RI9 A;  2K79 A;  1VQK T;  3ULR B;  1QKW A;  4LUE A;  4M7D B;  1LCK A;  1KHI A;  2DIQ A;  4MMK A;  2O9S A;  1ZSZ B;  2WSF E;  4PJM A;  1BI0 A;  3EG9 A;  3HSB A;  3TCJ A;  2GBQ A;  2GQI A;  3L2V A;  4QW2 A;  4QVD A;  2EYW A;  1PM3 A;  4X1V A;  8AT1 B;  2DYB A;  1KIK A;  2E12 A;  2MPX C;  1V76 A;  4KUD K;  4LD9 K;  1AWX A;  2QGG A;  4RTV A;  2GFU A;  2FL7 A;  1YJ9 Q;  2LT1 A;  3C0C A;  4FYV B;  3R6N A;  2EYQ A;  1OZ3 A;  3E9G A;  2O4X A;  3MEA A;  3GP8 A;  3NPF A;  1D1B A;  2VGM A;  1QVF S;  4JJN K;  2XG8 D;  3HP9 A;  3BDL A;  3H0I A;  1KK7 A;  1T3L A;  2A3L A;  2M9U A;  2RM4 A;  2FB7 A;  2QEX A;  3VS0 A;  3A8G B;  3M5A A;  3VU3 C;  4NS5 A;  2E4H A;  2CUB A;  5I21 A;  3VS7 A;  4JDS A;  1UGR B;  1RAH B;  4QQD A;  1FX7 A;  2JXB A;  2K7A A;  2COW A;  1SEM A;  1QCO A;  5CKB A;  1YJN A;  2FHD A;  1I81 A;  1N9S A;  1PRL C;  3CC7 A;  2EGC A;  4BY6 C;  2JUF A;  4KRT A;  4OMP A;  2KXC A;  1H8K A;  4C0Z A;  2DRM A;  4C5H A;  5GAM j;  1TTH B;  1KQ2 A;  4FW2 A;  3HL8 A;  3QYH B;  1FXX A;  4WF2 A;  3CC4 T;  1QVF A;  3J81 E;  2O31 A;  1I07 A;  2FO0 A;  1IGQ A;  3CCV T;  1W4S A;  1X69 A;  2CSQ A;  2RI3 A;  1KHC A;  5GAO l;  1O75 A;  3INZ A;  1M3C A;  4XTX A;  4PL6 A;  5KYY A;  1VQ5 Q;  3VKI A;  2Y4X A;  2ZPH B;  5CK9 A;  2CZ6 B;  3CCQ T;  1D0Z A;  3QZ9 B;  5KE3 A;  3KBG A;  3LX7 A;  2A36 A;  4L6V 5;  1EZZ B;  1MV0 B;  1QVG P;  2D8H A;  3QWY A;  3BY7 A;  2QK0 A;  2FG0 A;  3GLX A;  4FIB A;  2KGT A;  2EKH A;  3A8O B;  3X25 B;  3DB3 A;  2AKL A;  2WSC E;  4JLI A;  1M4Z A;  4KT0 E;  3L42 A;  5L23 A;  2MAM A;  3QXE B;  2PVD B;  1R77 A;  2E3H A;  1I0C A;  5GAM f;  3HRS A;  1H3Z A;  1BCO A;  2D0N A;  4A63 B;  1VQP Q;  1VQ6 A;  4E2F B;  4OML A;  4RUG A;  5CKF A;  3GF5 A;  4D8D A;  2LMJ A;  1RI0 A;  3M4G A;  4JRP A;  4MDX A;  2ED1 A;  2DFU A;  2JTE A;  5IN1 A;  5GAN j;  4ESR A;  2GTJ A;  2DVJ A;  1Q81 U;  1GCP A;  1BYM A;  1J3T A;  1KQ1 A;  2CH4 W;  5C6S A;  3HRT A;  4K11 A;  4HA8 A;  5LL6 S;  2V1R A;  4HT8 A;  3ME9 A;  5KE2 A;  2AZS A;  3EG0 A;  1M3A A;  1QWF A;  5HY6 A;  2EAY A;  3FIF A;  2O4X B;  1K73 C;  2L3P A;  3V7R A;  5I11 A;  3VS2 A;  4R56 A;  4FSS A;  1VQ8 A;  2MWO A;  2YRC A;  1K73 U;  2JZ2 A;  3WXM B;  4M7D D;  2X4Y A;  2XDB A;  1UUE A;  4PJO G;  1SHF A;  2LDM A;  1ZA1 B;  1RLP C;  1Q82 C;  2EIF A;  2GTO A;  3CCU A;  1WXU A;  3CME Q;  3PMT A;  2CP6 A;  3HFN A;  2DL4 A;  5CIU A;  1B7T A;  1M90 R;  1PD0 A;  1UHC A;  2DL7 A;  1Q82 U;  3VUZ A;  1VQ4 T;  2DTO A;  4KBM B;  5D7U A;  1OI1 A;  1UJY A;  4KGX B;  3X26 B;  5GAO p;  3OYA A;  3Q1J A;  2FRY A;  1OUL A;  3I5R A;  2V8J A;  4ANJ A;  9ATC B;  4DBF A;  2K9G A;  5FRM A;  3MCA B;  3CCM Q;  2R58 A;  2LJ0 A;  4JS4 A;  3E19 A;  4R55 A;  1MMN A;  4M78 F;  5L8R E;  2H3E B;  4M77 A;  4LUD A;  4C8Q F;  2C0T A;  3EFO A;  4M7D C;  3OYM A;  3CMA A;  4FW1 A;  4CC7 A;  2EQI A;  3PE0 A;  2MMP A;  1NLO C;  1W6X A;  5A2Q E;  1G83 A;  2ZGW A;  2KT1 A;  2HEQ A;  2RHX A;  2RJD A;  1I5O B;  2ZPG B;  1CKA A;  4QKU A;  5KYY B;  2QQ9 A;  2RHY A;  4F7U F;  2CUD A;  1MV3 A;  1SHG A;  1ZQ1 A;  3H0F A;  4UC4 A;  2EFI A;  3HHT B;  2LQW A;  3CCV Q;  2K5F A;  3J80 E;  1RAB B;  5KYU A;  3M0Q A;  3I56 A;  4PLI A;  2RHZ A;  2KT8 A;  3G4S Q;  2A08 A;  2MCN A;  3OBW A;  2OTL A;  1VA7 A;  2DL5 A;  2DO3 A;  4IUT A;  4XK8 E;  3GNF B;  4M7A E;  2DE0 X;  2X4X A;  5GMK l;  3CCQ Q;  4OVA A;  1LOJ A;  1VIF A;  2HD0 A;  1UEB A;  4A54 A;  4X34 A;  3OYL A;  4E6R A;  4A4G A;  3HTR A;  4X9C A;  4OMF B;  2K5I A;  2L3Q A;  1AWJ A;  4OB0 B;  1IB8 A;  1U3O A;  2KXD A;  1LNX A;  4IUR A;  2HL3 A;  2YRV A;  5GAM e;  4DEX A;  1IRX A;  1BCM A;  1YIJ A;  2XU8 A;  1VQ9 T;  3QUI A;  5DY9 A;  3RMQ A;  1D1A A;  1VQN A;  1KQS S;  5HK0 A;  4EMK A;  1QVP A;  1T3S A;  3VYH B;  4O5V A;  1W2B P;  2RH2 A;  2LX9 A;  3JB9 H;  2QA4 T;  3NTI A;  5HKC A;  1FMK A;  3LGL A;  4J9G A;  3TQ7 P;  3EH2 A;  4WTO B;  3KUF A;  4M78 D;  2RO0 A;  3FJP A;  3AT1 B;  5CKH A;  1BIA A;  5IAY A;  2EJG A;  4HCB A;  2CGH A;  3EFS A;  4GLK A;  1JU5 C;  4OGC A;  2CP5 A;  2KYB A;  3CQT A;  2LT4 A;  3SDZ A;  1VYU A;  1JXO A;  3U23 A;  1AWW A;  3ZBD A;  2VVK A;  2ZCF B;  1YJ9 T;  1U06 A;  2JN0 A;  3OYI A;  1D3B B;  1ZSZ A;  4PJO F;  4R0K A;  1WHJ A;  2E64 A;  2EBP A;  4DA4 A;  3CCJ A;  2KEA A;  4FM4 B;  1N8R R;  1Q95 G;  2K3Y A;  3L1A A;  2L8D A;  2OX7 A;  4M75 G;  4NL2 A;  4BDY A;  3OYK A;  2CZ1 B;  2GFA A;  1M9S A;  5GAN 3;  2GF7 A;  3A8M B;  4M77 B;  2EJF A;  1GL5 A;  3JV3 A;  5GJV B;  2M16 A;  4KUI A;  2SEM A;  5GAN e;  2HKQ B;  1VQ4 Q;  2ATC B;  2M0Y A;  2GNC A;  2IIM A;  4EMG A;  1YIT A;  2MF2 A;  2XID A;  3VS5 A;  2QEX T;  1PSF A;  3P8B B;  2C06 A;  1T0J A;  2KRM A;  3JB9 G;  3P8H A;  2E65 A;  2NYS A;  2DRK A;  1K8A C;  1K9M R;  5LJ5 g;  1NEB A;  2ZPE B;  2BKD N;  2JJ9 A;  1H3H A;  2ECZ A;  4JRI A;  1BI2 A;  1K8A U;  3R6O A;  5KYU B;  3PVL A;  1NJI R;  2FRW A;  1K9A A;  4ELZ C;  4ORZ A;  3OYG A;  2QTX A;  1D1C A;  1S1N A;  4XQ3 A;  3J7A F;  4JUV A;  4Y91 A;  1AOJ A;  1WXT A;  1QP3 A;  1GFC A;  1X6B A;  2KRN A;  3L2U A;  5CVI A;  3ZFJ A;  3QYG B;  2FYK A;  3OS2 A;  1VQM T;  1N9R A;  1X27 A;  4BUG A;  2SRC A;  2E10 A;  3O5Z A;  5KH6 A;  3L2R A;  4XTU A;  2KRO A;  3CCE Q;  1C1A A;  1YI2 A;  4OMM A;  1WHL A;  2VKN A;  4JLG A;  4YTL A;  4M7D G;  2OAU A;  3V7S A;  1RAD B;  3H0H A;  4KGZ B;  1TH7 A;  1T0H A;  4JJC A;  2PZ1 A;  2BE7 D;  3JCM f;  2F2V A;  1AEY A;  4EMK B;  1B3Q A;  2AIR B;  2VAS A;  4FSX A;  4FYW B;  1YHQ A;  2HQH A;  3SEM A;  3CD6 A;  2VC8 A;  3JCM V;  4MDW A;  5LJ5 h;  3M9Q A;  3RMS A;  5J3B A;  1UEC A;  4AG1 C;  3OS0 A;  1VQ7 Q;  4XU0 A;  1KJW A;  1OV3 A;  1YJW A;  4KH0 B;  2RN8 A;  1VQO A;  4PKC C;  4OF1 A;  2DXT A;  5KYN A;  1Z9Q A;  1VQ6 T;  5CQY A;  2LC4 A;  2QQS A;  2RQU A;  3PIO A;  1Q7Y C;  2QA4 Q;  1JXM A;  1QQJ A;  4M78 A;  5AYF A;  4BDZ A;  1JRI A;  3V7C A;  4C8Q A;  1KC8 R;  4D6W A;  1Q7Y U;  3RR6 A;  2RA2 A;  4DEY A;  2P0Q A;  4GBQ A;  4PJO E;  2RJE A;  1BI3 A;  2DK3 A;  4C92 G;  1QLY A;  4L59 A;  1WHK A;  4E47 A;  1D0X A;  2IPO B;  2J6K A;  1RL2 A;  1A0N B;  2R5A A;  3KFV A;  4DOV A;  2P4R A;  4F7U A;  1AZG B;  3CC2 A;  3CME T;  1TWB A;  1AT1 B;  1UG1 A;  4AFS C;  4M75 F;  3G71 A;  1BI1 A;  3G6E A;  2DD5 A;  3TSW A;  3SFM A;  3S6W A;  3UWN A;  4M4Z A;  5A0D A;  1FMW A;  1WX6 A;  1K76 A;  3CXC S;  5GAN 7;  4CC2 A;  3VRY A;  1WXB A;  3L2Z A;  2LQ8 A;  5EG2 A;  1M30 A;  3CCM T;  1PCX A;  4RCC A;  2M51 A;  2DZ9 A;  2YHT A;  5LJ5 d;  1AHJ B;  2X51 A;  1K0X A;  1JJ2 S;  1VQL A;  1UGP B;  1KFZ A;  2BZY A;  4PK4 A;  3QBY A;  1WJQ A;  4ZGJ B;  2E6N A;  3JCM Q;  4M77 D;  4BAC A;  4RTY A;  2QEX Q;  2X3W D;  3MPU B;  1NBE B;  1N8R U;  2YSQ A;  3CBP A;  1QVF P;  1NE8 A;  4AG2 C;  5FW9 A;  4Y28 E;  1SKU B;  4A53 A;  1IO6 A;  4DOW A;  1X2K A;  2W10 A;  4ZN1 A;  2CZ0 B;  4HCC A;  1ZBJ A;  4N0A A;  1KG1 A;  3JCM g;  1FWZ A;  2CT4 A;  4Z02 A;  2X4J A;  1JEG A;  2L2P A;  4XTY A;  3THK A;  3F70 A;  3BDU A;  3UDC A;  2DIL A;  2K2M A;  3O8V A;  3CXC A;  1M1F A;  4MZP A;  2YWW A;  2LRQ A;  1NEG A;  2FEI A;  4FCY A;  4RKU E;  3EAE A;  3G4S T;  3QDR B;  5D6X A;  2DIG A;  3OSV A;  1NM7 A;  1S72 A;  2LCL A;  1SPK A;  1MUZ A;  2EQU A;  1K9M U;  2AT1 B;  1VQM Q;  4QQG A;  1JJ2 A;  2XHC A;  4M77 C;  1EX4 A;  3QWX X;  2ABL A;  2G3R A;  4PFZ A;  3I56 T;  1E6H A;  3JCM e;  3BW1 A;  2PQW A;  1WZO A;  4AFZ C;  4PLL A;  5GAN 6;  2YLC A;  2ZZD A;  1M27 C;  4Z89 A;  3WVE B;  3V8J A;  4J9C A;  2ZPI B;  5KCH A;  1Q86 C;  2A0F B;  3IQL A;  4B9W A;  4MZT A;  3OYY A;  1FMV A;  5IXF A;  4M7A F;  2NUP B;  1QCN A;  2DBK A;  2P0K A;  4HVV A;  2KY9 A;  1RAA B;  2JW4 A;  2EQJ A;  5EC7 A;  5A0G A;  1Q86 U;  2DXC A;  4KGV B;  2R57 A;  1N5Z A;  2FPD A;  2RK1 A;  3M0P A;  4M78 B;  2D8J A;  4C8Q B;  3GBQ A;  3NTH A;  4J9D A;  1YIJ T;  3CPW S;  4HVW A;  3QO3 A;  3JCM h;  1VQN T;  1Q81 C;  2O2O A;  3A98 A;  1SG5 A;  3C4S A;  4J6X A;  1OQK A;  2JT4 A;  2XMF A;  2QDY B;  5LJ3 j;  3OYH A;  1AD5 A;  2HMA A;  1M8M A;  3SHW A;  3OYJ A;  3GNG A;  1YWO A;  2VV5 A;  2EYY A;  1WYX A;  4B6M A;  5ECA A;  3OB9 A;  3QPH A;  1XTD A;  1VQ6 Q;  2QG9 B;  2DTI A;  2LCS A;  5KYX A;  4Y92 A;  4F7U B;  1OX9 A;  3OQ5 A;  4E7S A;  4ZGD B;  2H3J A;  2JS2 A;  4OMQ A;  4QVZ A;  1VQK A;  1M3B A;  3A5Z B;  2OJ2 A;  1X6G A;  4ZGE B;  4M75 E;  4Q5W A;  1UDL A;  1AZE A;  1VUB A;  3C94 A;  3PMI A;  3UA7 A;  1G8X A;  4J9H A;  4LNP A;  3WVD B;  4PFP A;  2V26 A;  1P92 A;  4EMK C;  2YUQ A;  2B8A A;  2DF6 A;  3A1P A;  1ZUK A;  3JCM c;  1BKB A;  3CPW A;  1VQ8 Q;  4LDU A;  4DBH A;  2P0P A;  3OMG A;  1E7O A;  3JB9 I;  2KYM A;  3M55 A;  4OB2 B;  4ZNX A;  1Y0M A;  1GCQ A;  3SB2 A;  1TUC A;  2XD0 A;  4NOY A;  4E7K A;  4CC4 B;  1D3B A;  4AT1 B;  2J7I A;  3EGD A;  2LJ3 A;  5LJ3 f;  4MZM A;  1KD1 R;  2F5T X;  3MP6 A;  5GAN f;  4LD6 A;  1RAF B;  2WAC A;  3MO8 A;  1NPR A;  2GGR A;  3MP1 A;  2ROL A;  3QHS A;  1YNZ A;  3LLR A;  4IIO A;  4E7Z A;  1M5Q 1;  1GXI E;  2C0I A;  1IZ6 A;  3TRE A;  4J83 A;  1YIT T;  3JCM d;  2OTJ A;  2RHU A;  1ZSZ C;  1RLQ C;  1M1K R;  2KDS A;  1WPY A;  1QW1 A;  2FPE A;  3PIP A;  2EQM A;  2PUO B;  1PD1 A;  1UHF A;  3PT9 A;  3E9F A;  2E5Q A;  3RKW A;  4Z8A A;  3I55 A;  3L2Q A;  5IT9 E;  4JRQ A;  2AZV A;  2R5M A;  3CMA Q;  5I2S A;  1WHH A;  4M7D E;  2BE9 B;  2JMA A;  1IRE B;  1RAE B;  1ACM B;  3UA6 A;  5FWB A;  4PFO A;  3RKX A;  2EGA A;  3CC4 A;  2QAS A;  3X20 B;  1WI7 A;  2P4T A;  1WQ7 A;  1RAC B;  1E6G A;  3M0R A;  3CCE T;  3TEE A;  3OYC A;  1ZLM A;  4PJL A;  3M57 A;  1UGS B;  1XJW B;  4PJO B;  3A8H B;  3FRN A;  4E7J A;  2NLU A;  3HRU A;  1RUW A;  3G7Z A;  3OYN A;  2JNG A;  3QZ5 B;  5GAM g;  3C95 A;  1M1G A;  2NUZ A;  3CCL T;  1SRM A;  1YI2 T;  3I56 Q;  2D0Q B;  3L2W A;  2LQK A;  2OTL Q;  1GRI A;  1BB9 A;  2KMT A;  3CBO A;  2LZ6 B;  2O9V A;  4OB1 B;  5I2M A;  4BB7 A;  4HT9 A;  2CS7 A;  1WHM A;  2KAF A;  4AMC A; 
#chains in the Genus database with same CATH homology
 2QTX A;  2VGM A;  1QVF S;  2JTF A;  4M75 C;  1NPP A;  2LVM A;  4PNO A;  4BI4 A;  4C0G A;  4JJN K;  4XQ3 A;  2XI9 A;  3J7A F;  4JUV A;  2XG8 D;  2ZPB B;  3HP9 A;  4Y91 A;  3BDL A;  1Y7X A;  5CR2 A;  1QP3 A;  2A3L A;  2M9U A;  3OW2 S;  2RM4 A;  3L2U A;  1VQ7 T;  2FB7 A;  5CVI A;  3ZFJ A;  1YHQ T;  3CD6 T;  3QYG B;  2FYK A;  2QEX A;  5GMK j;  4ZTF A;  3A8G B;  2FVU A;  3OS5 A;  4GY5 A;  3M5A A;  1KC8 C;  3OS2 A;  2F69 A;  3VU3 C;  4NS5 A;  1VQM T;  4EPC A;  1X75 C;  4IUV A;  2RK2 A;  1N9R A;  4BUG A;  4ZN3 A;  3OYE A;  2XDP A;  2E10 A;  5I21 A;  3S3N A;  4XU3 A;  4C92 E;  5KH6 A;  3L2R A;  4XTU A;  4BD3 A;  4JDS A;  4J6Y A;  4OB3 B;  2CZ7 B;  2E1H A;  1UGR B;  4M77 G;  1KC8 U;  4QQD A;  1FX7 A;  3SWN C;  1YI2 A;  4JLG A;  2HAX A;  4YTL A;  3SWN A;  2KVQ G;  4M7D G;  2OAU A;  2E70 A;  3V7S A;  3CME A;  1PSE A;  4X9D A;  5CKB A;  3CCR A;  3CCJ T;  1TH7 A;  1YJN A;  2FHD A;  2BUD A;  5J39 A;  3OYB A;  2VXF A;  1I81 A;  1N9S A;  3CC7 A;  4BY6 C;  3JCM f;  5KCO A;  4C0D C;  2JUF A;  2L3R A;  4QVC A;  4E7L A;  4C8Q D;  4BE1 A;  2KK4 A;  2PVG B;  2RJC A;  3H8Z A;  2JOY A;  4A4K A;  4C0Z A;  4EMK B;  4C5H A;  5GAM j;  4IUQ A;  5GAM h;  3X28 B;  1KQ2 A;  3VYG A;  3HL8 A;  3QYH B;  1FXX A;  3ASK A;  4J8O A;  4IUP A;  4WF2 A;  4FSX A;  4ME7 A;  3CC4 T;  1QVF A;  3J81 E;  1YHQ A;  3CD6 A;  3OS1 A;  2VC8 A;  5LJ3 g;  3JCM V;  3KXT A;  5LJ5 j;  3CCM A;  4MDW A;  2K5L A;  5LJ5 h;  3M9Q A;  2BIV A;  1W4S A;  3RMS A;  4LDV A;  3CCV T;  5GAN g;  4ATO A;  2RI3 A;  4M7A D;  3RUX A;  1KHC A;  3OW2 A;  5J3B A;  4DQ2 A;  5CKD A;  3GOX A;  3LWH A;  3VJP A;  4LDW A;  3JCM X;  5GAO l;  1O75 A;  1JB0 E;  2GQV A;  3C12 A;  3OS0 A;  3INZ A;  4XU0 A;  3FDR A;  5GAO m;  4XTX A;  1YJW A;  3MHX A;  4PL6 A;  2DPP B;  3HFO A;  5D6Y A;  2CKK A;  3OMC A;  1VQO A;  1X01 A;  3VKI A;  4PKC C;  2Y4X A;  4KUL A;  2DXT A;  4OF1 A;  4IUU A;  2ZPH B;  5CK9 A;  2CZ6 B;  3CCQ T;  1VQ6 T;  5CQY A;  1OZ2 A;  2LC4 A;  2QQS A;  3PIO A;  1Q7Y C;  2HNI A;  4ELZ C;  3QZ9 B;  2I2L A;  5KE3 A;  3OA6 A;  3G71 T;  2PVO B;  3KBG A;  3LX7 A;  4M78 C;  3G6E T;  2MWP A;  5AYF A;  4M78 A;  4L6V 5;  5LJ3 e;  4C8Q C;  4BDZ A;  1JRI A;  3V7C A;  4C8Q A;  3QJ6 A;  4OGE A;  1R8O B;  4D6W A;  1Q7Y U;  4JS5 A;  2RA2 A;  3BY7 A;  5GAN 2;  4RG8 A;  2P0Q A;  3GLX A;  4PJO E;  4IKF A;  2RJE A;  1BI3 A;  2DK3 A;  4FIB A;  4C92 G;  4L59 A;  1SSF A;  3CCV A;  3A8O B;  3DB4 A;  3X25 B;  3DB3 A;  4C92 D;  3UPU A;  4E47 A;  2WSC E;  3MEU A;  4JLI A;  2LTO A;  3FEO A;  1HXD A;  3G4S A;  3OYF A;  1RL2 A;  1M4Z A;  2R5A A;  4KT0 E;  1U8R A;  4M7A C;  3L42 A;  4BE2 A;  4M7A A;  4DOV A;  1M90 C;  2MAM A;  3QXE B;  2K3X A;  2PVD B;  2DJZ A;  1VQL T;  4F7U A;  1EIF A;  5GAM f;  3HRS A;  1H3Z A;  4J7F A;  1B34 A;  5FU6 B;  3DKM A;  5J26 A;  1VQ6 A;  3CCQ A;  2CYZ B;  3CC2 A;  1O9S A;  2DZC A;  2KSS A;  3CME T;  1M90 U;  1YJN T;  3FB9 A;  3MET A;  5CKF A;  3CCS T;  3GF5 A;  4N4H A;  3GIB A;  4M75 F;  3G71 A;  3DLM A;  3H6Z A;  5LJ5 f;  1BI1 A;  3CC7 T;  3G6E A;  2DD5 A;  1RI0 A;  3M4G A;  4JRP A;  4MDX A;  2MI6 A;  3SFM A;  5IN1 A;  3S6W A;  3UWN A;  5GAN j;  5A0D A;  5GAN h;  4M75 A;  3M53 A;  1Q81 U;  5FU7 B;  5CCA A;  5GAO r;  1W2B S;  3CXC S;  5GAM d;  1BYM A;  5GAN 7;  1KQ1 A;  2IG0 A;  5C6S A;  4V2S A;  3HRT A;  1I8F A;  1N27 A;  3LW5 E;  2XDD A;  4HA8 A;  4LDY A;  2O01 E;  3GP8 A;  3MP8 A;  3L2Z A;  1LJO A;  1ZBX A;  5LL6 S;  2LQ8 A;  1U1T A;  4RMO A;  5EG2 A;  3ME9 A;  4HT8 A;  2D6F A;  5KE2 A;  3CCM T;  4RCC A;  2DZ9 A;  2YHT A;  3OSS C;  2EAY A;  1AHJ B;  2O4X B;  3FIF A;  5HY6 A;  5LJ5 d;  4C92 C;  1K73 C;  4N4G A;  4A4H A;  2PU9 B;  3V7R A;  1JJ2 S;  1VQL A;  2VYT A;  5CAI A;  1UGP B;  2VXE A;  2DXU A;  1XOV A;  2DKG A;  4R56 A;  5FRO A;  2K4Y A;  1VQ8 A;  2MWO A;  1DJ7 B;  1WJQ A;  3QBY A;  5CO7 A;  4ZGJ B;  2E6N A;  1QP2 A;  3JCM Q;  1K73 U;  4M77 D;  4M75 B;  4BAC A;  3JCM J;  2JZ2 A;  1YJW T;  3JCM b;  3WXM B;  2RD1 A;  3CCS A;  1N8R U;  3T9N A;  3LWI A;  3CBP A;  2X4Y A;  4M7D D;  1VQO T;  1NE8 A;  2DTH A;  1UGQ B;  2VGN A;  2XDB A;  2QEX T;  4Y28 E;  3RIR A;  1YBY A;  4A53 A;  4PJO G;  4HCZ A;  4DOW A;  2LDM A;  5FRN A;  4OP0 A;  3SD4 A;  1Q82 C;  2EIF A;  4PJO D;  3CCU A;  2RI2 A;  4N0A C;  3PMT A;  4ZN1 A;  2CZ0 B;  3OYD A;  4HCC A;  3HFN A;  3HKS A;  4N0A A;  4XTZ A;  1KG1 A;  3JCM g;  1FWZ A;  2V8K A;  2X4J A;  5CIU A;  4Z02 A;  3S3O A;  4XTY A;  1Q82 U;  4RCB A;  3SWN B;  3F70 A;  5A0L A;  3BDU A;  3UDC A;  3VUZ A;  1VQ4 T;  2DTO A;  4KBM B;  1W2B A;  3O8V A;  3CXC A;  1M1F A;  1I4K 1;  1N6A A;  1OI1 A;  4MZP A;  3PTA A;  2LRQ A;  3EFR A;  2Y90 A;  1ZHI A;  4L5G A;  4BI3 A;  3X26 B;  5GAO p;  3OYA A;  3Q1J A;  4XU1 A;  5GMK i;  2JVV A;  3EAE A;  4RKU E;  2QQB A;  4ELY C;  4CI0 C;  2V8J A;  3CEY A;  4BY6 B;  3G4S T;  4C0D B;  3QDR B;  5D6X A;  2DIG A;  2M1H A;  3OSV A;  4XTV A;  2F5K A;  1S72 A;  1VQ9 A;  2LCL A;  2QQA A;  2KQW A;  2V8I A;  3LGF A;  3X24 B;  2EQU A;  1K9M U;  3MCA B;  5FRM A;  1JJ2 A;  3QII A;  4QQG A;  2RJF A;  2R58 A;  4JS4 A;  2XHC A;  3E19 A;  2K2V A;  1YCY A;  4M77 C;  4R55 A;  3CC2 T;  4M78 F;  5L8R E;  4M77 A;  2EKO A;  2JTM A;  4J5Y A;  2G3R A;  4C8Q F;  5DLQ E;  3I56 T;  2DEQ A;  4M7D C;  3JCM e;  3BW1 A;  2PQW A;  4M7D A;  5HK3 A;  3JRZ A;  3RES A;  3RER A;  1M8V A;  2XKO C;  3OYM A;  1U1S A;  4PLL A;  1G3Y A;  3CMA A;  5CKE A;  4FT4 A;  3V8L A;  1MGQ A;  1WQW A;  2XK0 A;  1KQS A;  1OYX A;  4E7I A;  2MMP A;  4C5G A;  3N5B B;  5GAN 6;  2AHJ B;  5A2Q E;  3QSU A;  2YLC A;  2ZZD A;  2ZGW A;  5GAN d;  4PJO C;  1G5V A;  2RHX A;  2RJD A;  3V8J A;  3WVE B;  3FC3 A;  2ZPI B;  2ZPG B;  5KCH A;  4II1 A;  2E6Z A;  1Q86 C;  1VQ4 A;  4B9W A;  4MZT A;  3OYY A;  4M7A F;  4HKE A;  5D6W A;  2QQ9 A;  2RHY A;  2RHI A;  2P0K A;  4F7U F;  2L5Q A;  2KY9 A;  4B9X A;  2EQJ A;  3JCM W;  5A0G A;  4J7I A;  1Q86 U;  4M78 E;  2DXC A;  1ZQ1 A;  1WGS A;  2A7Y A;  4UC4 A;  4C8Q E;  2R57 A;  2EFI A;  2QI2 A;  2HQE A;  2RK1 A;  3HHT B;  4M78 B;  3LYI A;  2K5F A;  4C8Q B;  1VQ8 T;  3AHU A;  2HQX A;  3NTH A;  3J80 E;  2XIC A;  1YIJ T;  3CPW S;  1KD1 C;  3I56 A;  2D9T A;  4PLI A;  2RHZ A;  4XAX B;  3QO3 A;  4XU2 A;  3JCM h;  1YJ9 A;  1VQN T;  3OBW A;  3QJY A;  1Q81 C;  2OTL A;  3C4S A;  4J6X A;  3OYH A;  5LJ3 j;  2PUK B;  2QDY B;  1JBM A;  3JCM P;  5LJ3 h;  5GMK e;  2DO3 A;  1WNL A;  4IUT A;  4XK8 E;  3OYJ A;  3GNG A;  4CRI A;  3GNF B;  2VV5 A;  1KD1 U;  4M7A E;  2HBP A;  4FL6 A;  3P8D A;  3OB9 A;  4F7U E;  2X4X A;  3QPH A;  2L89 A;  5GMK l;  1XTD A;  3JSC A;  3BFM A;  1LOJ A;  4OVA A;  3CCU T;  4C0F A;  1VIF A;  4M7A B;  2HD0 A;  2DTI A;  3M58 A;  1UEB A;  4A54 A;  4X34 A;  2DVE A;  5GMK m;  4N4I A;  4F7U B;  3OYL A;  3OQ5 A;  4A4G A;  2LCC A;  4X9C A;  4OMF B;  1M1K C;  1B34 B;  1V29 B;  2X35 A;  4ZGD B;  2H3J A;  3PFS A;  2K5I A;  4QVZ A;  1VQK A;  4MML A;  3A5Z B;  1Y07 A;  4OB0 B;  3QG1 A;  2QXF A;  3M54 A;  5GAO n;  4C92 A;  1UB4 A;  1NZ9 A;  1N8R C;  4ZGE B;  1M1K U;  2DAQ A;  3M59 A;  4M75 E;  1LNX A;  3M4Y A;  4Q5W A;  4IUR A;  3JB9 F;  1VUB A;  3C94 A;  4FU6 A;  3TU4 K;  3PMI A;  3MEW A;  3NTK A;  1BIB A;  4NL3 A;  2YRV A;  4TVR A;  5GAM e;  3CCE A;  1YIJ A;  2XU8 A;  1VQ9 T;  1S72 T;  3QUI A;  3WVD B;  5DY9 A;  3RMQ A;  1X6O A;  4E7H A;  1G3T A;  1Y71 A;  3OBY A;  1VQN A;  4C5I A;  1P92 A;  4EMK C;  1KQS S;  5HK0 A;  4EMK A;  4A4F A;  5GMK h;  2B8A A;  4EMH A;  3VV0 A;  1QVP A;  1VQ5 T;  3NFC A;  3VYH B;  4O5V A;  5LJ5 e;  3JCM c;  1BKB A;  2RH2 A;  2LX9 A;  3CPW A;  1Y96 A;  1XQH A;  4JRK A;  2OTJ T;  4LDU A;  3CCL A;  3JB9 H;  3CMA T;  4BE0 A;  2QA4 T;  2M0O A;  3DLL A;  2P0P A;  3OMG A;  3NTI A;  5HKC A;  4LDX A;  3LGL A;  4C92 B;  3JB9 I;  3M55 A;  4FT2 A;  4OB2 B;  4VUB A;  3JB9 J;  2YLB A;  2GCX A;  2X4W A;  4M78 G;  3SB2 A;  2XD0 A;  3I55 T;  4NOY A;  4C8Q G;  4E7K A;  3FLG A;  1D3B A;  3KUF A;  5DLO A;  2ZPF B;  2EQK A;  2RO0 A;  1MHN A;  3CBM A;  3FJP A;  3LH0 A;  3M56 A;  4M78 D;  4RG2 A;  1K9M C;  5LJ3 f;  2DXB A;  4MZM A;  1WJS A;  5CKH A;  1BIA A;  5IAY A;  2EJG A;  4HCB A;  2F5T X;  4P5N A;  2CGH A;  3MP6 A;  5GAN f;  1Y96 B;  3EFS A;  4GLK A;  4LD6 A;  4XTW A;  4M77 F;  4OGC A;  2K57 A;  2Y4Y A;  2WAC A;  3MO8 A;  3SDZ A;  2LT4 A;  2LNV A;  3VUB A;  1NPR A;  5FLX E;  3S3M A;  1NJI C;  1VQ7 A;  3MP1 A;  4M7D F;  3GPL A;  3QHS A;  1QVG S;  4M7A G;  3LLR A;  4EDU A;  1M5Q 1;  3CPF A;  5DM7 R;  1VQM A;  1GXI E;  4F7U G;  1IZ6 A;  1VQ5 A;  2QQR A;  3TRE A;  4J83 A;  3ZBD A;  2ZCF B;  3A8L B;  1YJ9 T;  1VQP T;  2VUB A;  1YIT T;  3JCM d;  2JN0 A;  2IVW A;  3OYI A;  1NJI U;  2RHU A;  2OTL T;  1D3B B;  2OTJ A;  3HPW A;  1WJR A;  4PJO F;  1HK9 A;  2RI5 A;  5GAN 5;  3JAM E;  2QA4 A;  5LJ3 d;  5CQX A;  2KDS A;  1WPY A;  1QW1 A;  3ZEH A;  2E64 A;  3PIP A;  3ER0 A;  2EQM A;  2PUO B;  3PGG A;  3PT9 A;  3E9F A;  4O6J A;  4DA4 A;  3CCJ A;  2E5Q A;  3RKW A;  4PJO A;  4FM4 B;  3I55 A;  3L2Q A;  1G3S A;  1G3W A;  3RKY A;  5IT9 E;  2K3Y A;  3L1A A;  4BI8 B;  4JRQ A;  2E41 A;  2L8D A;  4M75 G;  4M77 E;  4NL2 A;  3URG A;  3OY9 A;  4BDY A;  2R5M A;  1I5L A;  2EJ9 A;  5I2S A;  3OYK A;  2CZ1 B;  2GFA A;  1M9S A;  5GAN 3;  2GF7 A;  4M7D E;  4M75 D;  2EWN A;  3A8M B;  4M77 B;  2EJF A;  1IRE B;  1VQK T;  5FU6 C;  3UT1 A;  2M16 A;  4M7D B;  4KUI A;  5GAO q;  1KHI A;  2DIQ A;  4MMK A;  3E1S A;  3RKX A;  2WSF E;  3CC4 A;  5GAN e;  1BI0 A;  1XNI A;  3X20 B;  2P4T A;  4QQ6 A;  3HSB A;  1WQ7 A;  5GAN 4;  3CCE T;  3TCJ A;  3TEE A;  3OYC A;  3M57 A;  1UGS B;  4PJO B;  4EMG A;  3A8H B;  1VQP A;  3QKJ A;  3FRN A;  2MF2 A;  3L2V A;  2XID A;  2NLU A;  3HRU A;  4E7J A;  1YIT A;  3G7Z A;  3OYN A;  1VIE A;  2JNG A;  3PNW C;  3QZ5 B;  3C95 A;  4J6W A;  1PSF A;  4QW2 A;  4QVD A;  1H64 1;  5GAM g;  1QVG A;  3P8B B;  5FU7 C;  2C06 A;  1M1G A;  3JB9 G;  2RB6 A;  3P8H A;  2E12 A;  3CCL T;  2E65 A;  4KUD K;  3JB9 D;  4LD9 K;  3V8K A;  1K8A C;  1YI2 T;  5LJ5 g;  2ZPE B;  2GFU A;  4C5E A;  2FL7 A;  4ZTJ A;  2BKD N;  2D0Q B;  2LT1 A;  5C0M A;  3L2W A;  2EYQ A;  2LQK A;  4JRI A;  3CCR T;  1OZ3 A;  2KMT A;  3CBO A;  2O4X A;  3E9G A;  3MEA A;  4OB1 B;  5I2M A;  4C92 F;  1BI2 A;  4BB7 A;  5GAN 8;  5M9O A;  4A4E A;  2CS7 A;  3MEV A;  1K8A U;  4HT9 A;  3R6O A;  2KAF A;  2WSE E;  2DD4 A;  3OYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...