3JCMP

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
109
structure length
77
Chain Sequence
b'MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLQQPTASDNIANTIRQIILPDSLNLDSLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 7
structure length 77
sequence length 109
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmP00
5GANj 3JB9D 2YLCA 5GMKe 4V2SA 4M7AF 3L2ZA 4M7AG 5GANh 4EMKB 1M8VA 4XU1A 3RKXA 3QO3A 4M7DE 3RKWA 4C92F 4C92G 4XQ3A 1U1SA 1I81A 2E1HA 4M7AB 5LJ3j 2FB7A 3JCMJ 4XU3A 5LJ3h 2DVEA 4PNOA 4XTYA 1Y96B 5GMKj 5GANe 4EMKA 4F7UE 1MGQA 5GMKh 4C92B 2DTOA 2YLBA 2DEQA 1B34B 1YCYA 2Y90A 1N9SA 2RB6A 1WNLA 2RM4A 4RCBA 3JCMg 4NL2A 3V8LA 5LJ5f 4M7AA 4M75E 3HFNA 2VC8A 4M7DF 4M7DG 5GAMg 2FYKA 4XU2A 5LJ5e 5GMKi 5GAN4 3JCMd 2VXFA 4HA8A 1Y96A 1H641 4M7AC 4C92A 5GAMd 1BIAA 3AHUA 1KQ2A 2DZ9A 4XU0A 1B34A 4F7UF 4F7UG 4C8QE 3JCMQ 4C92C 1M5Q1 1HXDA 2E10A 3M4GA 5GAN5 3JCMW 4M75C 3JCMc 4Y91A 3HSBA 4M7AD 5LJ5j 4M75F 4JRKA 4M75G 4XTXA 5LJ5h 4J6YA 4J5YA 3JCMX 1I8FA 2DZCA 4XTUA 4C92D 4JRIA 2DTIA 4C8QC 5CAIA 4M75B 4M75D 5DY9A 3JCMV 5LJ3g 4C8QF 4C8QG 1JBMA 3BW1A 4X9CA 4A54A 5GAMf 3JB9I 3JCMP 4M7DC 2DTHA 2I2LA 3QUIA 4N0AA 2DKGA 4XTVA 5GAMe 4M78F 5LJ3d 5GAN8 4A53A 3SWNB 5GMKm 4HT8A 3QSUA 4PJOE 5GAN6 3HFOA 3V7SA 4MMKA 2RA2A 2CGHA 4N0AC 4C8QB 4C8QD 5GAN7 4JLIA 2VXEA 3PGGA 3RUXA 3GIBA 4OP0A 4M75A 5GAN3 3BY7A 1WPYA 2HNIA 2JN0A 3FJPA 4M7DD 4X9DA 4J6XA 3JB9H 3RERA 4M7DB 1KQ1A 4M77E 4J6WA 4WF2A 4M78E 2E65A 2DXTA 3SWNA 5GAMj 4PJOC 5GANg 4NL3A 4XTZA 5GAMh 4JUVA 3VU3C 4F7UB 1D3BB 4PJOF 4PJOG 3V7RA 4QVCA 4C8QA 5GAOm 2EJ9A 5I21A 4EMHA 1HK9A 3SWNC 1X01A 5GANd 3RESA 3JB9G 3JB9F 3FB9A 4NOYA 3V8JA 5GAOn 4RCCA 4M7DA 3JCMf 1TH7A 3V8KA 4QVDA 3EFSA 5GAN2 3BDUA 4M77C 5LJ5g 3JCMe 3JB9J 4PJOB 4PJOD 1BIBA 3L1AA 4M78C 3FIFA 4M77F 4M77G 2E64A 5GMKl 1LNXA 1JRIA 4F7UA 2EJFA 1D3BA 2RD1A 3BFMA 4M78G 5LJ5d 1LJOA 1U1TA 1WQ7A 3JCMb 3INZA 4M77D 1LOJA 2ZGWA 4M77B 2E41A 4M78D 3QHSA 4M78B 4PJOA 3RIRA 5GANf 3JCMh 4XTWA 4M7AE 5GAOl 5GAOr 5GAOp 2YHTA 4HT9A 3SB2A 2K57A 1WQWA 4EMKC 4C92E 2EWNA 4M77A 2EJGA 5LJ3f 4M78A 2DXUA 4MMLA 3RKYA 4EMGA 5GAOq 1N9RA 2EAYA 5LJ3e 1I5LA 1I4K1 2QTXA 2DJZA 3V7CA 4DQ2A 3EFRA
chains in the Genus database with same CATH superfamily
1VQ8A 4EMKB 4OB0B 1Q82C 1NJIC 2XU8A 2B86A 3CD6A 1VQ8Q 1X75C 2DXCA 3CCVQ 4JJNK 4F7UE 2PUKB 2DO3A 1BCMA 2O88A 5LJ5f 1AT1B 4M7DF 2J7IA 1T3LA 4Y92A 5GJWB 1S72A 2COZA 4BB7A 2J6KA 3AHUA 3HTRA 1YI2T 1AWWA 1QMCA 5IN1A 3JCMQ 2A3LA 2IVWA 2K5FA 4VUBA 3G71Q 2XD0A 1QCNA 3C94A 2OTJT 1YJNA 1V29B 2KE9A 3VYHB 4C8QC 1YCSB 1WHKA 4C8QF 4RG8A 2MWOA 2I2LA 3QYGB 5GAMe 5LJ3d 2VB6A 1YHQT 3OSVA 2VUBA 2KT1A 2CGHA 4F17A 4JLIA 3UA7A 1VOMA 2HNIA 1R77A 4J6WA 5A0GA 1YJ9A 2FZCB 1H8KA 1UHCA 1BK2A 1PCXA 5CQYA 1ZLMA 1RLQC 2ED1A 3QXEB 2QQAA 3E19A 1PG5B 2DL7A 3A5ZB 4HVWA 1VQ7A 3M0SA 2YWWA 2CP3A 2IPOB 3VS7A 5FW9A 2VKNA 5CKHA 1YITT 3L2WA 1Q86U 2EKOA 3CCLT 1WFWA 2ENMA 3TVTA 2RI3A 4JZ4A 1V76A 1Q81R 4PFZA 2JTMA 2OTJQ 2E12A 2DM1A 4JS5A 2L0AA 4F14A 3EG9A 2JXBA 3OW2P 3CC4A 1I4K1 1YHQQ 2DJZA 1ACMB 2KAFA 2HDAA 4E7SA 2QEXA 3I9QA 1G5VA 3RKXA 4O6JA 3FJ5A 4M7DE 4C92G 4LDYA 3JCMJ 3E1SA 1ZBXA 1QQJA 2O4XB 1W70A 2MMPA 1B34B 4OB3B 3L2QA 2YRVA 4IIOA 1QLYA 1SSFA 1Y7XA 3DLLA 4J83A 3CCLQ 4C8QE 2FL7A 5J39A 4Z02A 1VQLA 2M0OA 3JCMX 2KMTA 2K4YA 2DA9A 4PLLA 2AKLA 3LX7A 1JXMA 3GPLA 5DM7R 3OYBA 2GFAA 4XAXB 1MNEA 1VQNA 4M75A 1TUGB 4PJLA 4BI8B 4X9DA 4FYVB 1TU0B 5KYXA 1S1NA 4RG2A 2C0IA 1K1ZA 5KCOA 1YIJA 1FWZA 2VYTA 4N4IA 3LWIA 3V8KA 1Z9ZA 3BDUA 1NEBA 3JB9J 2LRQA 5GMKl 1VQ6Q 3A8HB 2HD0A 3OYGA 1KSWA 2PTKA 2WACA 3INZA 3CCET 2CH4A 1G8XA 3J81E 1JQQA 2LJ0A 1M90C 3OYFA 3JCMh 1NPPA 5GAOr 1MV0B 4CC7A 2M51A 4JJCA 3VS4A 3BDLA 3ZBDA 4ZN3A 4J9FA 3S3NA 2KQWA 1K9MR 1BB9A 2KRMA 1G3WA 2CSQA 2NYSA 4BI4A 1I81A 1U5SA 2FRYA 2XMFA 2EW3A 1OI1A 2JJ9A 2DEQA 4L5GA 3ZFJA 1YCYA 2Y90A 1N9SA 1KHIA 1M9SA 1K8AC 1GXIE 2HKNA 2ABLA 2XIDA 2K5LA 5GAMg 2D8HA 4HKEA 1E6HA 2J6FA 3CCEQ 1M27C 2BUDA 3CCST 4FT2A 3EFOA 1BBZA 2ZCFB 3UPUA 4M7AD 1K0XA 3NFCA 2XDBA 1NZ9A 4DBFA 3H0IA 2D9TA 4HCCA 4OF1A 1MV3A 1WX6A 3OS2A 2R5MA 4FIBA 2K3XA 1O9SA 4JJBA 1GL5A 2KRNA 3SWNB 4RTZA 2OAUA 3CC2A 1QCFA 1VIFA 2NUTB 3PIOA 3WXMB 4QQDA 1VA7A 2RHUA 4A63B 4E7IA 1X69A 1BYMA 1UFFA 1KD1R 3QYHB 1PNJA 4PJOB 1IREB 4ZGJB 1NYGA 4J7FA 3CCSQ 1PRMC 1WHMA 1JO8A 3I55T 2ZGWA 4N4GA 4M78B 2QQ9A 4XK8E 2HCKA 2PNIA 5GANf 4J9IA 3M54A 3PMIA 1VQ5T 5GAOl 1E6GA 3HL8A 1YWPA 2GF7A 1LCKA 3RNJA 3TEEA 2HQHA 4M77A 1AZGB 5LJ3f 1BCOA 1SRMA 4M7AF 3NMZC 2EKHA 4HVUA 1Q82U 1NJIU 2F2XA 1UDLA 2O9VA 4J9HA 1U1SA 2E1HA 2F2WA 1NLPC 2EQKA 2M16A 3OY9A 3CPWP 1HD3A 5KYWA 5GANe 2LDMA 5GMKj 2LQ8A 1QP3A 3VJPA 2DK3A 4DBQA 2RM4A 3PFSA 3JCMg 4RMOA 5IAYA 2QQBA 3OYIA 1H641 3M0QA 1ZSZA 2DZ9A 2WSEE 2O01E 1WHJA 2MYSA 2CZ6B 1ZSZC 2DD4A 3CCJA 1C0MA 4KUIA 4D8KA 4C0GA 1VQ5Q 2PZ1A 2HZYA 3QKJA 1WZOA 1SG5A 2DL8A 3CCJQ 3S3OA 1M1FA 2A28A 3QWXX 3D7SB 3HP9A 1RAEB 4A4KA 4XTVA 2ATCB 3LYIA 3CCMT 2L3RA 2RA2A 3CQTA 2QA4A 3CMAT 1PSEA 4E7KA 3OA6A 5KE3A 2KYMA 4JRQA 3FJPA 2LMJA 7AT1B 2L3PA 4JUVA 2L8DA 2G3RA 1ZA1B 5EG2A 3BE3A 2DX1A 3G6ET 3EGDA 4PJOD 3MPUB 3E9FA 2ZPHB 1OQKA 3H0HA 3HRUA 2D0QB 3BFMA 3META 3JCMb 3CC7A 2EQJA 5KYYA 3QZ5B 3FEOA 4M78D 2YUOA 1EFNA 3QIIA 2LT1A 8AT1B 3CC7Q 4M7AE 4R0KA 1X27A 2D0NA 1ZUYA 4NS5A 2A37A 1I5LA 5GAOq 2CUBA 1ZBJA 2QTXA 2LTOA 4DQ2A 3EFRA 1N6AA 3CCMQ 3H6ZA 3CMAQ 3VRYA 3CXCS 2HBPA 4PKCC 3EG2A 4Z8AA 4E7LA 1OZ2A 4XQ3A 2K3BA 1VQOT 1SSHA 1VQKA 5FWBA 2DVEA 1KG1A 3CMEA 1GFDA 3CCQT 5GMKh 3QPHA 1BI0A 5I2MA 3OYLA 1RAIB 1H3ZA 2ECZA 1OX8A 2CREA 2P84A 5GMKi 1KK7A 1RABB 1VQMQ 1AVZC 3I56A 1Q86R 3PT9A 1RAHB 2FPFA 1B7TA 2AHJB 1B07A 2CP2A 1QKWA 2KSSA 5KCHA 1D1AA 3JCMc 1M8MA 2I0NA 2EQUA 1V1CA 3EH1A 4EDUA 4PL6A 2LQWA 1XQHA 1WXBA 3JCMV 3J80E 1Q95G 2CUDA 4M78F 2MWPA 5CKEA 5D6WA 1FYNA 2JOYA 2JS0A 1WHHA 1D09B 5KYNA 4JDSA 2RK1A 1KQ1A 2AK5A 4A4GA 3CCQQ 3OYYA 4PJOG 1W4SA 1HK9A 5IHIA 3V8JA 5CR2A 3TCJA 1HJDA 1BIBA 2DMOA 3CCUT 2DL3A 1CKBA 4M78G 1YJWT 3GP8A 2DIGA 3DB4A 1K4US 1ZA2B 1C1AA 2GQVA 1M90U 3EG9B 3UDCA 1SEMA 3UT1A 1ZQ1A 2A36A 3M58A 2X4YA 1I0CA 5AT1B 1PC0A 4X1VA 4DOVA 4OMQA 4Z89A 3TSWA 3Q1JA 2KROA 5ECAA 3CXCA 2HQXA 2X4XA 3M57A 4EMGA 2KNBB 1UEBA 2HQEA 2LCCA 2QASA 2M9UA 1ZUKA 5I11A 1N8RR 4ZN1A 2V1QA 4JJDA 1Q81C 2IIMA 1AWJA 3WVEB 5I2SA 4DOWA 3CCUQ 1RADB 4M4ZA 1Y57A 3OBWA 2L5QA 3VRZA 4JRPA 2GGRA 1KJWA 1WA7A 3CCVA 3VYGA 3VUZA 2DNUA 5HK0A 5LJ5j 4HCKA 1I8FA 2QQRA 3P8HA 2F5KA 4C92D 3MEUA 2DTIA 3LW5E 4OMLA 2QGGA 4M75B 5DY9A 1GBQA 3BW1A 5GAMf 4M7DC 4PFPA 4LD6A 4HT8A 5GMKm 2DL5A 1VIEA 2GTOA 5KYXB 1H3HA 3G71A 4OP0A 2JN0A 4FCYA 2DEUA 2QDYB 3VU3C 3RBBB 1TS9A 3CPFA 4C8QA 3VV0A 3MEVA 5GANd 3TREA 4RCCA 5A2QE 4C5IA 3QJ6A 5IXFA 2KDSA 1JRIA 1D3BA 2V8KA 1KC8R 1X2QA 3H0FA 4CC4B 1AOJA 3CEYA 4JPBW 4BDYA 3M53A 3SD4A 2JZ2A 2E5QA 4EPCA 2X3WD 2A0FB 2RI5A 3X28B 2CP5A 4FSSA 1YI2A 2LCSA 1AHJB 5CO7A 1KHCA 2EAYA 4OMFB 2LJ3A 1YI2Q 1M1GA 4OB1B 1OV3A 1M8VA 5M9OA 1WLPB 2OTJA 3LH5A 4HVVA 3KFVA 4C92F 3AT1B 1Z9QA 2KI7A 2FB7A 2QEXT 4IUTA 2MF2A 4KRTA 3OB9A 2GBQA 2W10A 1YHQA 1IZ6A 3M9QA 1QVFS 1AZEA 3FDRA 1MMDA 2EBPA 3EFOB 1M4ZA 4KBMB 2E6NA 1ZX6A 1BI3A 1MMGA 2K79A 4AFUC 2CP0A 2L3QA 5GAN5 1K9MC 4QQ6A 2JW4A 2DERA 2IG0A 1EZZB 4ESRA 5LJ5h 5LL6S 4XTUA 2LZ6B 3OYAA 1K73R 4OB2B 4M75D 3L2RA 1YITA 2L89A 1VQLT 4FW1A 1GBRA 2LX7A 3CCLA 2DKGA 4GLMA 1Q82R 3I5SA 1YITQ 2O9SA 2VXEA 3RUXA 5EC7A 1WPYA 4A4EA 1HSQA 4PJJA 5A0DA 3CBOA 2HL5C 4QQGA 4LD9K 4IUUA 1D0ZA 5GAOm 3M59A 1VQPT 2EGEA 3JB9G 3JCMe 2YRCA 1EIFA 1T0HA 2YUNA 2LQNA 1PRLC 4ORZA 4M77B 3F70A 4GY5A 2YHTA 2E6ZA 1UECA 2C0TA 4HXJA 4EMKC 4C92E 5C6SA 1VQ6A 3G4ST 3VS5A 3X20B 1KD1C 5IH2A 3QDRB 3QWYA 3GOXA 5KYWB 3U23A 4ZGEB 2NWMA 3C12A 2OAWA 1QVFA 3ZEHA 2OTLT 3A1PA 2AZVA 1VQPQ 3OMCA 1IHVA 2DVJA 1RLPC 1ZSZB 4FW2A 4AT1B 1NLOC 4EIKA 2RB6A 2E70A 4MDXA 4HA8A 3LH0A 2CP6A 2RJDA 2KEAA 3VKIA 2DETA 1W6XA 2DE0X 2MCNA 3M4GA 2JM8A 3HSBA 2CZ7B 2QAZA 4M75G 2ROLA 1UJYA 3G4SQ 3EAEA 3NTKA 1MUZA 2VVKA 3EHQA 2JMCA 2QQSA 3KUFA 3OYNA 3CCEA 3P8DA 3VS3A 4F16A 2DRKA 3GIBA 2HAXA 1GCPA 1K76A 1TXQA 2EGCA 4RTUA 2OTLQ 2RHZA 3H41A 3EGDB 4B9XA 2DXTA 2DXBA 4FL6A 2Z0WA 4JZ3A 3PIPA 1XOVA 4BE0A 5KYYB 4J9DA 1WXUA 2EPDA 5LJ5g 2DYIA 2ZPFB 2GTJA 3EG0A 2BZ8A 2CZ0B 2EJFA 3PE0A 1OU8A 2X35A 4JLGA 4M77D 1Q7YC 2DLPA 4CC3A 3ME9A 4OVAA 5IXBA 2X9HA 2P0PA 5GAOp 2CT3A 4J8OA 3M56A 3LWHA 2FZKB 2K9GA 3CCSA 1SHFA 1ZSGA 2F5TX 1VQ9T 3HPWA 4KH0B 5GANj 4V2SA 1E7OA 3A8LB 3JV3A 2PU9B 2RQVA 2CS7A 2LJ1A 3EGUA 5HK3A 2AKKA 3KXTA 1G3SA 1VQ4T 4BY6B 2GNCA 2LNHB 5LJ3j 1OZ3A 1X6OA 4RUGA 4PK4A 1PHTA 2DTOA 4X34A 1BI1A 1RL2A 2H3JA 4M7AA 1M1KC 3HFNA 2JS2A 4M7AC 3UWNA 1BU1A 5GAMd 2X3XD 4ELYC 1M90R 2VGMA 1TWBA 2JUFA 2M1HA 2RF0A 4BD3A 1TUDA 4MDWA 3GNGA 5FRNA 1A0NB 4C5GA 2R5AA 3EG3A 5CKBA 4FT4A 4C0ZA 2RJEA 4X9CA 2EGAA 3OYDA 1C6VX 5GAN8 3SDZA 1RAGB 3V7SA 1NYFA 4GBQA 1VQ5A 3PGGA 4OMPA 4QVZA 3I55Q 1VQ4Q 2XDPA 1F1BB 1Q86C 1G83A 3DB3A 2KXDA 3PVLA 3MKDA 1YP5A 3JB9I 1AWXA 1D0YA 2NUPA 1R0CB 1K9AA 3FB9A 3NTIA 4LXCA 4ZTJA 4J9CA 4M77G 5IT9E 2RD1A 5CVIA 2QGFB 1R0BG 1WQ7A 3A8GB 4DEYA 3OQ5A 3JRZA 2YSQA 2XHCA 3GBQA 2O2OA 1QKXA 3MP1A 4QT7A 4DBHA 5FU6C 1G3TA 3OYJA 2ZZDA 3GLXA 1WQWA 4C0DB 2RI2A 1IB8A 3P8BB 2F2VA 5GMKe 1YBYA 1OPKA 5GANh 5FU7C 3E2UA 1UB4A 1ZHIA 2QG9B 5D6YA 1D1CA 1UG1A 2GFUA 4XU3A 3MCAB 5LJ3h 3OS0A 4R55A 1TTHB 2V8IA 4AFQC 3TQ7P 4AFZC 3CCMA 2DBKA 1KFZA 1VYVA 3CMAA 4RCBA 5DLQE 3T9NA 3HKSA 3JCMd 1Y96A 1QP2A 4LNPA 3S3MA 2KT8A 2F69A 2DL4A 5CQXA 4PJNA 3I56T 3OMGA 4JRKA 1N8RC 2E3IA 4J6YA 4J5YA 3OYKA 1RI9A 2ZPGB 3G6EQ 1RUWA 3MEWA 3CBMA 1VQMA 1RAAB 1UE9A 3QSUA 1QWEA 4MMKA 3ULRB 2G6FX 4C8QB 2RHIA 1D0XA 1OULA 2RH2A 4LUEA 2J6OA 3UF4A 3PVQA 2FPEA 3VS2A 2YXYA 3REAB 1QWFA 4PJOC 1ABOA 2PUOB 4XTZA 1WJQA 1D3BB 4PJOF 1OU9A 3EG1A 3A8OB 2RN8A 1GCQC 1WHGA 2CKKA 2E5KA 2P4TA 4M78C 2VGNA 3WVDB 1VQOA 4F7UA 2QTVA 2RQRA 1U1TA 1W2BS 4DBRA 1NPRA 3QZ9B 3CCQA 2DD5A 4ANJA 1VQOQ 3M0UA 4HCBA 2BZYA 1IO6A 2HSPA 1VUBA 3A8MB 1W1FA 3CXCP 5KYUA 2CSIA 2DXUA 1N9RA 1N5ZA 1CSKA 2RQUA 2VC8A 3V7CA 2EQMA 2RPNA 3A98A 3CCRT 2YLCA 1WI7A 2KYBA 1WIEA 1KC8C 2JMAA 3QO3A 2Y4YA 1BI2A 1UGRB 4FYYB 3KBGA 1QVPA 4E6RA 3VS1A 1UGPB 4OMMA 3PMTA 2H8HA 1UTIA 1OOTA 4DEXA 2KY9A 2MK5A 2ED0A 4F7UG 1M5Q1 2R57A 1VQ8T 1JJ2S 2PVDB 3CCUA 2K6DA 1KIKA 1FMKA 1GFCA 3GNFB 3CD6T 5LJ3g 1K8AU 2EVRA 1OEBA 3CCRQ 2COYA 3JCMP 1XTDA 5DLOA 1YJWQ 4PJOE 5GAN6 3HFOA 4C8QD 2KK4A 2YUPA 9ATCB 1WGSA 1FMWA 5GAN3 1UGSB 2OI3A 1S72T 4D6WA 4M78E 5GAMj 4CRIA 4FYXB 3UA6A 1WJSA 3ZL7C 1JXOA 2EJ9A 5I21A 2P0KA 5GAOn 4M7DA 2KRSA 2KGTA 1W2BA 2QXFA 1YN8A 2HEQA 4O5VA 1K0SA 3FLGA 1K73C 3FIFA 1I5OB 3GF5A 1YJNT 2X51A 2E4HA 2BKDN 1AWOA 2RQTA 1QVGS 1Q7YU 3N5BB 1NM7A 2D8JA 2OJ2A 4B9WA 1PD1A 3EGXA 5J3BA 4IUQA 4BE1A 3G7ZA 2CT4A 2Y4XA 3CD6Q 1X2KA 3IQLA 3VS0A 3VS6A 1YJ9T 2EYZA 1JJ2P 3JB9D 1MMNA 4JS4A 2ROTA 4J9GA 3L2ZA 2X4WA 3ER0A 2F1LA 4RTWA 1O75A 2W0ZA 1VQ7T 1S72Q 3OW2S 1QCOA 1NG2A 1SKUB 2JNGA 5L8RE 3MJXA 3MO8A 2DAQA 3NPFA 1M1KU 1WNLA 2DRMA 4AG1C 2A7YA 4M7DG 2VV5A 1YJNQ 5LJ5e 5GAN4 2QYZA 2JM9A 2JT4A 4E47A 4C92A 3O8VA 3SFMA 1JJ2A 3M0RA 3MP6A 3CC4T 3RMQA 4C92C 1AD5A 1U06A 2O31A 2KXCA 3RMSA 1QW1A 1X6BA 2QDLA 4RTVA 2C06A 2K7AA 3RR6A 1QVGP 1SRLA 2MI6A 1YJ9Q 1MNDA 4BACA 4C8QG 2FVUA 2DF6A 4A53A 3SEMA 4GLKA 1VQ7Q 2EQIA 4KGVB 4FU6A 4BI3A 3RERA 3MHXA 5AYFA 4LDXA 4WF2A 2E65A 2C0OA 4YTLA 2ESWA 5GAMh 4C0FA 3TU4K 3JB9F 2RNAA 4NOYA 2D1XA 3JCMf 5GAN2 4D8DA 1QVGA 1TSFA 2K2VA 3QBYA 3MEAA 4OGCA 2E64A 4IUPA 5C0MA 1NJIR 1VYUA 2A08A 1XNIA 5CIUA 3CC4Q 2FG0A 4R56A 1NE8A 3M0TA 2QEXQ 4KGXB 2YDLA 3MP8A 3DKMA 2L3SA 1M2VA 1VQNT 2PVGB 5A0LA 2V8JA 4A4FA 4J9EA 4QW2A 3OW2A 1UUEA 3TSZA 2FHDA 2PVOB 1YIJT 1VQ6T 1MMAA 1WDXA 3M5AA 4LE9A 3URGA 1QVFP 5CK9A 1D1BA 1WHLA 4M7AB 5KH6A 2QK0A 1OYXA 4XTYA 4EMKA 5IHKA 1MGQA 2M02A 4WTOB 1VQLQ 3I5RA 4P5NA 4IURA 3OYEA 1SHGA 5CKFA 4B6MA 1I1JA 2DPPB 1I07A 2SRCA 1KQ2A 1EX4A 1VQPA 2E10A 3H9NA 4BE2A 4M75C 1N8RU 4Y91A 2R58A 4M75F 4XTXA 1VQNQ 2ZPBB 1WJRA 4Y28E 1T0JA 2DZCA 4KH1B 4JRIA 2XKOC 5CAIA 2MIOA 4CC2A 4LUDA 4A54A 1YIJQ 2V1RA 1PKTA 3OYCA 1YWOA 2NUPB 2BZXA 4BUGA 2J05A 4UC4A 3G4SA 2SEMA 2LCLA 2X4JA 1M3CA 1U8RA 2MPXC 1WYXA 2HKQB 4RTYA 2PQWA 4L6V5 1TH7A 5FU6B 3EFSA 3X24B 1LNXA 2OTLA 2CZ1B 1R8OB 3EHRA 1JU5C 3H8ZA 1WXTA 2DYBA 1TG0A 3OBYA 5FU7B 4LN2A 2LC4A 4PFOA 4FYWB 2HSEB 3G1JA 2XI9A 2MAMA 4RTXA 3CC2T 1YFNA 3L42A 3DLMA 2ZPEB 3S6WA 4OMNA 2FEIA 3L2UA 1KC8U 1TUCA 3HHTB 3FRNA 1RI0A 2XK0A 1Y96B 2XICA 4E7ZA 1OPLA 3OSSC 3NGPA 3RDVA 4M75E 4IUVA 1FXXA 3CPWS 3SHWA 1ARKA 2O4XA 1MHNA 1B34A 1ABQA 2BIVA 4TVRA 2HL3A 5FROA 1FX7A 8ATCB 4II1A 3QJYA 3QDFA 2BE7D 1Q81U 2RQWA 1IGQA 4AMCA 4LDWA 1YNZA 3CC2Q 3O5ZA 5FLXE 4J7IA 4C5EA 3QUIA 4N0AA 4F04B 4ZTFA 1H92A 5FWCA 2LQKA 2JTEA 1FMVA 1UGQB 4N0AC 3I35A 2FZGB 2V26A 3BY7A 2AZSA 3JB9H 4KUDK 3HRTA 3CBPA 3REBB 4F7UB 1VQ9A 3M4YA 1VYTA 1ZUUA 3CCJT 1X43A 3E9GA 5I22A 1IGUA 1TOVA 1K73U 3JSCA 4M77C 4C5HA 1VQ9Q 3I55A 3L1AA 4M77F 1VQ4A 3NHNA 5LJ5d 2K5IA 1LJOA 1RACB 5KYUB 2CYZB 3M0PA 1G3YA 3RIRA 3ASKA 1CKAA 5IHNA 4MZPA 1M2OA 2LVMA 2H3EB 2QA4T 4J9BA 3SB2A 1G2BA 2K57A 1M3BA 1K8AR 2GQIA 2EWNA 2VASA 2EJGA 1LVKA 2CP7A 5LJ3e 2B8AA 4CI0C 2RHYA 4M7AG 2KVQG 4XU1A 4ZGDB 4FSXA 2MOXA 5L23A 1PM3A 2E3HA 3CC7T 3CPWA 2YLBA 3R6OA 2NUZA 1RAFB 4NL2A 1SF9A 4KULA 5FRMA 2RJCA 4ELZC 2FYKA 1U3OA 1JEGA 1Q7YR 1BIAA 1JB0E 4AFSC 5D6XA 3C95A 4XU0A 5J26A 3JAME 1P92A 4N4HA 4PLIA 5KE2A 1HXDA 1PKSA 3HRSA 4E2FB 3JCMW 2ZAEA 2QA4Q 5D7UA 3R6NA 1KQSS 1Y71A 3VUBA 4RTTA 3X26B 1UHFA 2KR3A 1VQKT 2VWFA 2JVVA 1JBMA 2DTHA 4PJMA 3CMET 1VQMT 2RHXA 5CCAA 4M7DB 4J6XA 1K9MU 4M77E 4ME7A 2HBWA 4RKUE 4Z88A 3PTAA 3G6EA 3SWNA 3OYMA 4NL3A 3C4SA 3SWNC 4IIMA 4BDZA 1M1KR 1HYOA 1NBEB 1Y07A 2P4RA 4IKFA 2NUTA 5GJVB 3EGXB 3OS1A 2QI2A 1Y0MA 4MZMA 4Q5WA 1IRXA 2AIRB 4PJOA 4LDUA 4K11A 2FRWA 1GCQA 5CKDA 2ZPIB 1VQKQ 1IHWA 4E7JA 3L2VA 2RJFA 4MZTA 3X25B 2LP5A 3OS5A 4M78A 3CMEQ 3RKYA 4QKUA 2LX9A 4BY6C 5HCKA 2FPDA 2JTFA 1KQSP 2CDTA 2WSFE 1NEGA 2DFUA 2XG8D 3M55A 1UJ0A 1XJWB 1B3QA 2D6FA 3RKWA 3I56Q 1T3SA 2WSCE 4ZNXA 4PNOA 2DILA 3J7AF 2RK2A 3EH2A 2EYYA 4C92B 3UATA 2KBTA 3V8LA 1KD1U 4XU2A 3FC3A 2VXFA 1M30A 1X6GA 2OX7A 2LT4A 4F7UF 1KQSA 1SPKA 2DBMA 2BTTA 2BE9B 4FM4B 3LGLA 2YT6A 2EYXA 2K2MA 4DA4A 5HKCA 2NLUA 1J3TA 2EIFA 2FO0A 1PSFA 2RMOA 1N27A 3NTHA 4A4HA 2RO0A 4ATOA 5GAN7 4HCZA 2YUQA 3LGFA 4M7DD 4E7HA 3OYHA 2DJQA 2J06A 2K3YA 5GANg 1OX9A 4QVCA 3V7RA 3CCRA 4EMHA 1AEYA 3CCVT 1X01A 3RESA 1YJWA 2XDDA 1W2BP 2EYQA 1PD0A 2EFIA 3THKA 1GRIA 2YRDA 4QVDA 2AT1B 4OMOA 4OGEA 2L2PA 4KT0E 1BKBA 3LLRA 3C0CA 1DJ7B 1M2VB 4KGZB 2LNVA 2P0QA 2EYWA 2M0YA 4WCIA 6AT1B 1M3AA 4C0DC 1LOJA 2E41A 2DIQA 3QHSA 2GCXA 4XTWA 5HY6A 3G71T 4HT9A 4L59A 1IXDA 2COWA 2CH4W 1UGVA 3QG1A 2HMAA 1PWTA 4MMLA 4AG2C 1LPLA 4LDVA 3PNWC
chains in the Genus database with same CATH topology
3HPWA 2FHDA 2PVOB 3H6ZA 5GANj 1YIJT 3A8LB 3CXCS 1VQ6T 1VQ8A 4V2SA 2PU9B 4EMKB 2HBPA 2CS7A 4OB0B 4PKCC 5HK3A 1Q82C 3M5AA 1NJIC 3URGA 3KXTA 4E7LA 5CK9A 2XU8A 1OZ2A 1G3SA 4XQ3A 1VQ4T 4BY6B 1VQOT 4M7AB 5LJ3j 1X75C 5KH6A 1VQKA 3CD6A 1OYXA 1OZ3A 2DVEA 2DXCA 1KG1A 1X6OA 4XTYA 4JJNK 3CMEA 4EMKA 4F7UE 1MGQA 3CCQT 5GMKh 2PUKB 2DO3A 2DTOA 3QPHA 1BI1A 4X34A 1BI0A 1RL2A 5I2MA 4P5NA 3OYLA 1H3ZA 2H3JA 4IURA 5LJ5f 4M7AA 1M1KC 3HFNA 4M7DF 3OYEA 5CKFA 5GMKi 1S72A 4M7AC 2DPPB 3UWNA 4BB7A 3I56A 5GAMd 1YI2T 3AHUA 1KQ2A 4ELYC 3PT9A 2VGMA 1VQPA 5IN1A 3JCMQ 2JUFA 2AHJB 2A3LA 2E10A 2IVWA 2M1HA 4BD3A 4BE2A 2KSSA 4M75C 5KCHA 3JCMc 2K5FA 4Y91A 1N8RU 2EQUA 2R58A 4M75F 4MDWA 3GNGA 4VUBA 4XTXA 5FRNA 2ZPBB 1WJRA 2XD0A 4C5GA 4Y28E 2DZCA 3C94A 2R5AA 4EDUA 1V29B 4PL6A 1YJNA 2OTJT 4JRIA 1XQHA 3VYHB 2XKOC 5CKBA 4FT4A 4C0ZA 2RJEA 4C8QC 5CAIA 3JCMV 4C8QF 4RG8A 3J80E 4X9CA 4A54A 3OYDA 2MWOA 2I2LA 5GAN8 3QYGB 5GAMe 4M78F 5LJ3d 2MWPA 5CKEA 5D6WA 1YHQT 3SDZA 3OSVA 2JOYA 2VUBA 3V7SA 3OYCA 2CGHA 1VQ5A 4JLIA 3PGGA 4QVZA 2XDPA 4BUGA 2HNIA 1Q86C 4JDSA 2RK1A 1KQ1A 4UC4A 3DB3A 4J6WA 4A4GA 5A0GA 3G4SA 3EFRA 2LCLA 1YJ9A 2X4JA 3OYYA 3JB9I 1U8RA 4PJOG 1W4SA 5CQYA 1HK9A 3QXEB 2QQAA 3E19A 3FB9A 3V8JA 2PQWA 5CR2A 3TCJA 4L6V5 1TH7A 3A5ZB 3NTIA 3EFSA 5FU6B 1VQ7A 3X24B 1BIBA 4ZTJA 3CCUT 4M77G 5IT9E 1LNXA 2RD1A 2OTLA 4M78G 1YJWT 3GP8A 2CZ1B 5CVIA 2DIGA 1R8OB 1WQ7A 3A8GB 3DB4A 5CKHA 3H8ZA 1YITT 3L2WA 3OQ5A 1Q86U 2EKOA 3JRZA 2GQVA 3CCLT 1M90U 2XHCA 3OBYA 3MP1A 2RI3A 3UDCA 5FU7B 5FU6C 1G3TA 1ZQ1A 2JTMA 3UT1A 3OYJA 2E12A 2LC4A 3M58A 2X4YA 2ZZDA 3GLXA 4LDVA 4JS5A 2XI9A 4DOVA 1WQWA 4C0DB 2RI2A 2MAMA 3Q1JA 3CXCA 2HQXA 3CC2T 2X4XA 3L42A 3M57A 4EMGA 3CC4A 3DLMA 1I4K1 3P8BB 2DJZA 1UEBA 2KAFA 2ZPEB 3S6WA 2HQEA 2LCCA 5GMKe 1YBYA 2QEXA 5GANh 5FU7C 3L2UA 1KC8U 1UB4A 1ZHIA 1G5VA 2M9UA 5D6YA 3RKXA 4O6JA 3HHTB 4M7DE 4C92G 4LDYA 2GFUA 4ZN1A 3FRNA 1RI0A 3JCMJ 4XU3A 3MCAB 5LJ3h 2XK0A 1ZBXA 3E1SA 4R55A 3OS0A 1Y96B 1Q81C 2V8IA 2XICA 2O4XB 1GXIE 3WVEB 5I2SA 2MMPA 3CCMA 1B34B 4OB3B 4DOWA 3OSSC 3L2QA 4RCBA 5DLQE 3T9NA 3CMAA 2YRVA 4M75E 4IUVA 1FXXA 3HKSA 3CPWS 3OBWA 3JCMd 1Y96A 2L5QA 1QP2A 2O4XA 1MHNA 4JRPA 1SSFA 1Y7XA 3DLLA 1B34A 4J83A 2BIVA 4TVRA 3S3MA 4C8QE 2FL7A 5FROA 3CCVA 3VYGA 1FX7A 2F69A 3VUZA 5J39A 5CQXA 4Z02A 4II1A 3I56T 3QJYA 5HK0A 3OMGA 1VQLA 5LJ5j 2M0OA 4JRKA 1N8RC 1Q81U 4J6YA 4J5YA 3JCMX 1I8FA 2QQRA 2KMTA 3OYKA 3P8HA 4LDWA 2K4YA 2ZPGB 4PLLA 2F5KA 4C92D 3MEUA 2DTIA 3LW5E 3MEWA 3CBMA 1VQMA 4M75B 5DY9A 3LX7A 5FLXE 3BW1A 5GAMf 4M7DC 3GPLA 4J7IA 4C5EA 3QUIA 4N0AA 5DM7R 4ZTFA 4LD6A 4HT8A 3OYBA 2LQKA 5GMKm 3QSUA 2GFAA 4XAXB 1VIEA 1UGQB 4MMKA 4N0AC 4C8QB 2RHIA 3G71A 4OP0A 1VQNA 2RH2A 4M75A 3BY7A 2JN0A 4BI8B 4X9DA 3JB9H 4KUDK 3HRTA 3CBPA 4PJOC 4XTZA 2PUOB 2QDYB 3VU3C 4F7UB 1D3BB 1WJQA 4PJOF 3CPFA 1VQ9A 3M4YA 4C8QA 4RG2A 3CCJT 3A8OB 3VV0A 3MEVA 5KCOA 5GANd 1FWZA 1YIJA 4ATOA 3TREA 3E9GA 2VYTA 4RCCA 5A2QE 2CKKA 4N4IA 3LWIA 1K73U 3JSCA 3V8KA 4C5IA 2P4TA 3BDUA 4M77C 4C5HA 3QJ6A 3JB9J 3I55A 3L1AA 4M78C 2LRQA 4M77F 2VGNA 5GMKl 3WVDB 1VQ4A 2KDSA 1JRIA 4F7UA 1VQOA 1D3BA 2V8KA 5LJ5d 3A8HB 2HD0A 2K5IA 3OYGA 1LJOA 1U1TA 1W2BS 1NPRA 2WACA 3QZ9B 3CCQA 3INZA 3CCET 2CYZB 2DD5A 3CEYA 3J81E 4BDYA 1G3YA 4HCBA 3M53A 3RIRA 3OYFA 1M90C 3ASKA 3SD4A 2JZ2A 2E5QA 4MZPA 1NPPA 3JCMh 4EPCA 2LVMA 2RI5A 1VUBA 2QA4T 5GAOr 3A8MB 3X28B 3SB2A 2K57A 1YI2A 2EWNA 1AHJB 2EJGA 5CO7A 1KHCA 2DXUA 3BDLA 1N9RA 2EAYA 5LJ3e 3ZBDA 2VC8A 4ZN3A 3V7CA 4OMFB 2B8AA 2EQMA 3CCRT 4CI0C 1M1GA 2RHYA 2KQWA 2YLCA 4OB1B 3S3NA 4M7AG 1M8VA 2KVQG 5M9OA 4XU1A 1KC8C 4ZGDB 3QO3A 2OTJA 4FSXA 4C92F 1G3WA 4BI4A 1I81A 2Y4YA 2QEXT 2FB7A 4IUTA 1BI2A 2MF2A 3CC7T 1UGRB 3OB9A 3CPWA 3KBGA 1OI1A 1QVPA 2YLBA 1IZ6A 2DEQA 3M9QA 3R6OA 1YCYA 2Y90A 4L5GA 1N9SA 3ZFJA 1UGPB 3FDRA 1QVFS 1KHIA 1M4ZA 1M9SA 4KBMB 4NL2A 1K8AC 2E6NA 2XIDA 3PMTA 2K5LA 4KULA 2RJCA 5FRMA 4ELZC 2FYKA 5GAMg 4HKEA 1BI3A 2KY9A 1BIAA 1JB0E 5D6XA 3C95A 4XU0A 4F7UG 2BUDA 3CCST 4FT2A 5J26A 3JAME 1P92A 4N4HA 4PLIA 1M5Q1 5KE2A 1HXDA 5GAN5 2ZCFB 3HRSA 3JCMW 3UPUA 1K9MC 2R57A 4QQ6A 4M7AD 2IG0A 1VQ8T 3NFCA 2XDBA 1JJ2S 2PVDB 5LJ5h 1KQSS 1Y71A 3VUBA 3CCUA 1NZ9A 5LL6S 2D9TA 4XTUA 4HCCA 4OF1A 3OYAA 3GNFB 3X26B 1VQLT 4OB2B 4M75D 3L2RA 5LJ3g 2L89A 3OS2A 2JVVA 1YITA 1K8AU 1JBMA 2R5MA 4FIBA 2K3XA 3JCMP 1O9SA 2DTHA 3CCLA 3CMET 2DKGA 1XTDA 5DLOA 4PJOE 3SWNB 5GAN6 3HFOA 1VQMT 4C8QD 2KK4A 2RHXA 2VXEA 3RUXA 5CCAA 1WGSA 5GAN3 1WPYA 4A4EA 4M7DB 1UGSB 2OAUA 4J6XA 1K9MU 4M77E 4ME7A 1S72T 3CC2A 4D6WA 4RKUE 4M78E 3PTAA 5A0DA 3CBOA 1VIFA 3SWNA 4CRIA 5GAMj 4NL3A 3OYMA 4QQGA 3PIOA 3WXMB 4LD9K 4IUUA 3C4SA 4QQDA 5GAOm 3M59A 1WJSA 1VQPT 2EJ9A 2RHUA 5I21A 3SWNC 4BDZA 3JB9G 4E7IA 1BYMA 2P0KA 1Y07A 5GAOn 4M7DA 3JB9F 1W2BA 2QXFA 3QYHB 4O5VA 3JCMe 4PJOB 3FLGA 1IREB 1K73C 4IKFA 3FIFA 4ZGJB 1EIFA 3GF5A 4J7FA 1YJNT 3OS1A 2QI2A 2BKDN 1QVGS 1Q7YU 3N5BB 4B9WA 4MZMA 4Q5WA 3I55T 4M77B 2ZGWA 4N4GA 4M78B 4PJOA 2QQ9A 4XK8E 4LDUA 5GANf 3M54A 3PMIA 1VQ5T 5GAOl 5J3BA 3F70A 4IUQA 4BE1A 4GY5A 2YHTA 3G7ZA 2ZPIB 5CKDA 3HL8A 2E6ZA 2Y4XA 2GF7A 3TEEA 4EMKC 4C92E 5C6SA 4M77A 4E7JA 1VQ6A 3L2VA 2RJFA 4MZTA 5LJ3f 3X25B 3OS5A 4M78A 3G4ST 3RKYA 1YJ9T 3X20B 2LX9A 1KD1C 4BY6C 3QDRB 2JTFA 3JB9D 4JS4A 3GOXA 4M7AF 3L2ZA 2WSFE 1Q82U 1NJIU 2X4WA 3ER0A 4ZGEB 3M55A 1O75A 2XG8D 1VQ7T 3C12A 3OW2S 2D6FA 3RKWA 1U1SA 2E1HA 1QVFA 3ZEHA 2OTLT 2WSCE 2EQKA 2M16A 4PNOA 3OY9A 3OMCA 2JNGA 3J7AF 5L8RE 5GANe 2LDMA 5GMKj 2LQ8A 2RK2A 4C92B 1QP3A 3MO8A 3VJPA 2DK3A 2DAQA 2RB6A 1M1KU 1WNLA 2E70A 2RM4A 3PFSA 3JCMg 4RMOA 2A7YA 3V8LA 5IAYA 4MDXA 2QQBA 1KD1U 4M7DG 2VV5A 4XU2A 5LJ5e 5GAN4 3FC3A 2VXFA 4HA8A 3OYIA 3LH0A 1H641 4E47A 4C92A 3O8VA 2DZ9A 2RJDA 2WSEE 2LT4A 2O01E 3SFMA 4F7UF 1KQSA 1JJ2A 2CZ6B 2DD4A 3CCJA 3MP6A 3VKIA 3RMQA 4C92C 3CC4T 4KUIA 3M4GA 4C0GA 3RMSA 3HSBA 1QW1A 2CZ7B 3QKJA 4M75G 4FM4B 3LGLA 2C06A 3S3OA 1M1FA 4DA4A 5HKCA 3EAEA 2NLUA 3NTKA 2MI6A 3HP9A 2EIFA 4BACA 4C8QG 1PSFA 2QQSA 3KUFA 3OYNA 3CCEA 2FVUA 3P8DA 4A4KA 4XTVA 4A53A 1N27A 3LYIA 3G6EA 3NTHA 4A4HA 4GLKA 2L3RA 2RA2A 2RO0A 3CCMT 1YHQA 5GAN7 3GIBA 2QA4A 4HCZA 1PSEA 4E7KA 2HAXA 3OA6A 3CMAT 3LGFA 4FU6A 5KE3A 4BI3A 3CD6T 4M7DD 4JRQA 4E7HA 3FJPA 3OYHA 3RERA 2RHZA 3MHXA 5AYFA 4B9XA 4WF2A 4LDXA 2E65A 2DXTA 4YTLA 2K3YA 5GANg 5GAMh 4JUVA 4QVCA 4C0FA 2L8DA 3V7RA 2DXBA 2G3RA 4FL6A 4EMHA 5EG2A 3CCRA 1X01A 3CCVT 3RESA 3PIPA 1XOVA 4BE0A 3TU4K 1YJWA 2XDDA 1VQKT 4NOYA 2EYQA 2EFIA 3G6ET 3JCMf 4QVDA 5GAN2 1QVGA 5LJ5g 2K2VA 4PJOD 2ZPFB 3E9FA 2ZPHB 3QBYA 3HRUA 3MEAA 4OGCA 2E64A 4OGEA 2CZ0B 2D0QB 2EJFA 4IUPA 3BFMA 4KT0E 5C0MA 1BKBA 3LLRA 3META 1XNIA 1DJ7B 2X35A 5CIUA 2EQJA 4JLGA 3JCMb 3CC7A 2LNVA 2P0QA 4R56A 3QZ5B 1NE8A 4C0DC 4M77D 1LOJA 1Q7YC 2E41A 2DIQA 3FEOA 4M78D 3QHSA 3ME9A 4OVAA 2GCXA 3QIIA 2LT1A 4XTWA 5HY6A 4M7AE 2P0PA 3MP8A 5GAOp 3DKMA 3G71T 4J8OA 4HT9A 1VQNT 3M56A 4L59A 2PVGB 5A0LA 3LWHA 2V8JA 4A4FA 3QG1A 4NS5A 3CCSA 1I5LA 4MMLA 5GAOq 2F5TX 4QW2A 2QTXA 3PNWC 3OW2A 2LTOA 1VQ9T 4DQ2A 1N6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN j;  3JB9 D;  2YLC A;  5GMK e;  4V2S A;  4M7A F;  3L2Z A;  4M7A G;  5GAN h;  4EMK B;  1M8V A;  4XU1 A;  3RKX A;  3QO3 A;  4M7D E;  3RKW A;  4C92 F;  4C92 G;  4XQ3 A;  1U1S A;  1I81 A;  2E1H A;  4M7A B;  5LJ3 j;  2FB7 A;  3JCM J;  4XU3 A;  5LJ3 h;  2DVE A;  4PNO A;  4XTY A;  1Y96 B;  5GMK j;  5GAN e;  4EMK A;  4F7U E;  1MGQ A;  5GMK h;  4C92 B;  2DTO A;  2YLB A;  2DEQ A;  1B34 B;  1YCY A;  2Y90 A;  1N9S A;  2RB6 A;  1WNL A;  2RM4 A;  4RCB A;  3JCM g;  4NL2 A;  3V8L A;  5LJ5 f;  4M7A A;  4M75 E;  3HFN A;  2VC8 A;  4M7D F;  4M7D G;  5GAM g;  2FYK A;  4XU2 A;  5LJ5 e;  5GMK i;  5GAN 4;  3JCM d;  2VXF A;  4HA8 A;  1Y96 A;  1H64 1;  4M7A C;  4C92 A;  5GAM d;  1BIA A;  3AHU A;  1KQ2 A;  2DZ9 A;  4XU0 A;  1B34 A;  4F7U F;  4F7U G;  4C8Q E;  3JCM Q;  4C92 C;  1M5Q 1;  1HXD A;  2E10 A;  3M4G A;  5GAN 5;  3JCM W;  4M75 C;  3JCM c;  4Y91 A;  3HSB A;  4M7A D;  5LJ5 j;  4M75 F;  4JRK A;  4M75 G;  4XTX A;  5LJ5 h;  4J6Y A;  4J5Y A;  3JCM X;  1I8F A;  2DZC A;  4XTU A;  4C92 D;  4JRI A;  2DTI A;  4C8Q C;  5CAI A;  4M75 B;  4M75 D;  5DY9 A;  3JCM V;  5LJ3 g;  4C8Q F;  4C8Q G;  1JBM A;  3BW1 A;  4X9C A;  4A54 A;  5GAM f;  3JB9 I;  3JCM P;  4M7D C;  2DTH A;  2I2L A;  3QUI A;  4N0A A;  2DKG A;  4XTV A;  5GAM e;  4M78 F;  5LJ3 d;  5GAN 8;  4A53 A;  3SWN B;  5GMK m;  4HT8 A;  3QSU A;  4PJO E;  5GAN 6;  3HFO A;  3V7S A;  4MMK A;  2RA2 A;  2CGH A;  4N0A C;  4C8Q B;  4C8Q D;  5GAN 7;  4JLI A;  2VXE A;  3PGG A;  3RUX A;  3GIB A;  4OP0 A;  4M75 A;  5GAN 3;  3BY7 A;  1WPY A;  2HNI A;  2JN0 A;  3FJP A;  4M7D D;  4X9D A;  4J6X A;  3JB9 H;  3RER A;  4M7D B;  1KQ1 A;  4M77 E;  4J6W A;  4WF2 A;  4M78 E;  2E65 A;  2DXT A;  3SWN A;  5GAM j;  4PJO C;  5GAN g;  4NL3 A;  4XTZ A;  5GAM h;  4JUV A;  3VU3 C;  4F7U B;  1D3B B;  4PJO F;  4PJO G;  3V7R A;  4QVC A;  4C8Q A;  5GAO m;  2EJ9 A;  5I21 A;  4EMH A;  1HK9 A;  3SWN C;  1X01 A;  5GAN d;  3RES A;  3JB9 G;  3JB9 F;  3FB9 A;  4NOY A;  3V8J A;  5GAO n;  4RCC A;  4M7D A;  3JCM f;  1TH7 A;  3V8K A;  4QVD A;  3EFS A;  5GAN 2;  3BDU A;  4M77 C;  5LJ5 g;  3JCM e;  3JB9 J;  4PJO B;  4PJO D;  1BIB A;  3L1A A;  4M78 C;  3FIF A;  4M77 F;  4M77 G;  2E64 A;  5GMK l;  1LNX A;  1JRI A;  4F7U A;  2EJF A;  1D3B A;  2RD1 A;  3BFM A;  4M78 G;  5LJ5 d;  1LJO A;  1U1T A;  1WQ7 A;  3JCM b;  3INZ A;  4M77 D;  1LOJ A;  2ZGW A;  4M77 B;  2E41 A;  4M78 D;  3QHS A;  4M78 B;  4PJO A;  3RIR A;  5GAN f;  3JCM h;  4XTW A;  4M7A E;  5GAO l;  5GAO r;  5GAO p;  2YHT A;  4HT9 A;  3SB2 A;  2K57 A;  1WQW A;  4EMK C;  4C92 E;  2EWN A;  4M77 A;  2EJG A;  5LJ3 f;  4M78 A;  2DXU A;  4MML A;  3RKY A;  4EMG A;  5GAO q;  1N9R A;  2EAY A;  5LJ3 e;  1I5L A;  1I4K 1;  2QTX A;  2DJZ A;  3V7C A;  4DQ2 A;  3EFR A; 
#chains in the Genus database with same CATH topology
 1VQ8 A;  4EMK B;  4OB0 B;  1Q82 C;  1NJI C;  2XU8 A;  2B86 A;  3CD6 A;  1VQ8 Q;  1X75 C;  2DXC A;  3CCV Q;  4JJN K;  4F7U E;  2PUK B;  2DO3 A;  1BCM A;  2O88 A;  5LJ5 f;  1AT1 B;  4M7D F;  2J7I A;  1T3L A;  4Y92 A;  5GJW B;  1S72 A;  2COZ A;  4BB7 A;  2J6K A;  3AHU A;  3HTR A;  1YI2 T;  1AWW A;  1QMC A;  5IN1 A;  3JCM Q;  2A3L A;  2IVW A;  2K5F A;  4VUB A;  3G71 Q;  2XD0 A;  1QCN A;  3C94 A;  2OTJ T;  1YJN A;  1V29 B;  2KE9 A;  3VYH B;  4C8Q C;  1YCS B;  1WHK A;  4C8Q F;  4RG8 A;  2MWO A;  2I2L A;  3QYG B;  5GAM e;  5LJ3 d;  2VB6 A;  1YHQ T;  3OSV A;  2VUB A;  2KT1 A;  2CGH A;  4F17 A;  4JLI A;  3UA7 A;  1VOM A;  2HNI A;  1R77 A;  4J6W A;  5A0G A;  1YJ9 A;  2FZC B;  1H8K A;  1UHC A;  1BK2 A;  1PCX A;  5CQY A;  1ZLM A;  1RLQ C;  2ED1 A;  3QXE B;  2QQA A;  3E19 A;  1PG5 B;  2DL7 A;  3A5Z B;  4HVW A;  1VQ7 A;  3M0S A;  2YWW A;  2CP3 A;  2IPO B;  3VS7 A;  5FW9 A;  2VKN A;  5CKH A;  1YIT T;  3L2W A;  1Q86 U;  2EKO A;  3CCL T;  1WFW A;  2ENM A;  3TVT A;  2RI3 A;  4JZ4 A;  1V76 A;  1Q81 R;  4PFZ A;  2JTM A;  2OTJ Q;  2E12 A;  2DM1 A;  4JS5 A;  2L0A A;  4F14 A;  3EG9 A;  2JXB A;  3OW2 P;  3CC4 A;  1I4K 1;  1YHQ Q;  2DJZ A;  1ACM B;  2KAF A;  2HDA A;  4E7S A;  2QEX A;  3I9Q A;  1G5V A;  3RKX A;  4O6J A;  3FJ5 A;  4M7D E;  4C92 G;  4LDY A;  3JCM J;  3E1S A;  1ZBX A;  1QQJ A;  2O4X B;  1W70 A;  2MMP A;  1B34 B;  4OB3 B;  3L2Q A;  2YRV A;  4IIO A;  1QLY A;  1SSF A;  1Y7X A;  3DLL A;  4J83 A;  3CCL Q;  4C8Q E;  2FL7 A;  5J39 A;  4Z02 A;  1VQL A;  2M0O A;  3JCM X;  2KMT A;  2K4Y A;  2DA9 A;  4PLL A;  2AKL A;  3LX7 A;  1JXM A;  3GPL A;  5DM7 R;  3OYB A;  2GFA A;  4XAX B;  1MNE A;  1VQN A;  4M75 A;  1TUG B;  4PJL A;  4BI8 B;  4X9D A;  4FYV B;  1TU0 B;  5KYX A;  1S1N A;  4RG2 A;  2C0I A;  1K1Z A;  5KCO A;  1YIJ A;  1FWZ A;  2VYT A;  4N4I A;  3LWI A;  3V8K A;  1Z9Z A;  3BDU A;  1NEB A;  3JB9 J;  2LRQ A;  5GMK l;  1VQ6 Q;  3A8H B;  2HD0 A;  3OYG A;  1KSW A;  2PTK A;  2WAC A;  3INZ A;  3CCE T;  2CH4 A;  1G8X A;  3J81 E;  1JQQ A;  2LJ0 A;  1M90 C;  3OYF A;  3JCM h;  1NPP A;  5GAO r;  1MV0 B;  4CC7 A;  2M51 A;  4JJC A;  3VS4 A;  3BDL A;  3ZBD A;  4ZN3 A;  4J9F A;  3S3N A;  2KQW A;  1K9M R;  1BB9 A;  2KRM A;  1G3W A;  2CSQ A;  2NYS A;  4BI4 A;  1I81 A;  1U5S A;  2FRY A;  2XMF A;  2EW3 A;  1OI1 A;  2JJ9 A;  2DEQ A;  4L5G A;  3ZFJ A;  1YCY A;  2Y90 A;  1N9S A;  1KHI A;  1M9S A;  1K8A C;  1GXI E;  2HKN A;  2ABL A;  2XID A;  2K5L A;  5GAM g;  2D8H A;  4HKE A;  1E6H A;  2J6F A;  3CCE Q;  1M27 C;  2BUD A;  3CCS T;  4FT2 A;  3EFO A;  1BBZ A;  2ZCF B;  3UPU A;  4M7A D;  1K0X A;  3NFC A;  2XDB A;  1NZ9 A;  4DBF A;  3H0I A;  2D9T A;  4HCC A;  4OF1 A;  1MV3 A;  1WX6 A;  3OS2 A;  2R5M A;  4FIB A;  2K3X A;  1O9S A;  4JJB A;  1GL5 A;  2KRN A;  3SWN B;  4RTZ A;  2OAU A;  3CC2 A;  1QCF A;  1VIF A;  2NUT B;  3PIO A;  3WXM B;  4QQD A;  1VA7 A;  2RHU A;  4A63 B;  4E7I A;  1X69 A;  1BYM A;  1UFF A;  1KD1 R;  3QYH B;  1PNJ A;  4PJO B;  1IRE B;  4ZGJ B;  1NYG A;  4J7F A;  3CCS Q;  1PRM C;  1WHM A;  1JO8 A;  3I55 T;  2ZGW A;  4N4G A;  4M78 B;  2QQ9 A;  4XK8 E;  2HCK A;  2PNI A;  5GAN f;  4J9I A;  3M54 A;  3PMI A;  1VQ5 T;  5GAO l;  1E6G A;  3HL8 A;  1YWP A;  2GF7 A;  1LCK A;  3RNJ A;  3TEE A;  2HQH A;  4M77 A;  1AZG B;  5LJ3 f;  1BCO A;  1SRM A;  4M7A F;  3NMZ C;  2EKH A;  4HVU A;  1Q82 U;  1NJI U;  2F2X A;  1UDL A;  2O9V A;  4J9H A;  1U1S A;  2E1H A;  2F2W A;  1NLP C;  2EQK A;  2M16 A;  3OY9 A;  3CPW P;  1HD3 A;  5KYW A;  5GAN e;  2LDM A;  5GMK j;  2LQ8 A;  1QP3 A;  3VJP A;  2DK3 A;  4DBQ A;  2RM4 A;  3PFS A;  3JCM g;  4RMO A;  5IAY A;  2QQB A;  3OYI A;  1H64 1;  3M0Q A;  1ZSZ A;  2DZ9 A;  2WSE E;  2O01 E;  1WHJ A;  2MYS A;  2CZ6 B;  1ZSZ C;  2DD4 A;  3CCJ A;  1C0M A;  4KUI A;  4D8K A;  4C0G A;  1VQ5 Q;  2PZ1 A;  2HZY A;  3QKJ A;  1WZO A;  1SG5 A;  2DL8 A;  3CCJ Q;  3S3O A;  1M1F A;  2A28 A;  3QWX X;  3D7S B;  3HP9 A;  1RAE B;  4A4K A;  4XTV A;  2ATC B;  3LYI A;  3CCM T;  2L3R A;  2RA2 A;  3CQT A;  2QA4 A;  3CMA T;  1PSE A;  4E7K A;  3OA6 A;  5KE3 A;  2KYM A;  4JRQ A;  3FJP A;  2LMJ A;  7AT1 B;  2L3P A;  4JUV A;  2L8D A;  2G3R A;  1ZA1 B;  5EG2 A;  3BE3 A;  2DX1 A;  3G6E T;  3EGD A;  4PJO D;  3MPU B;  3E9F A;  2ZPH B;  1OQK A;  3H0H A;  3HRU A;  2D0Q B;  3BFM A;  3MET A;  3JCM b;  3CC7 A;  2EQJ A;  5KYY A;  3QZ5 B;  3FEO A;  4M78 D;  2YUO A;  1EFN A;  3QII A;  2LT1 A;  8AT1 B;  3CC7 Q;  4M7A E;  4R0K A;  1X27 A;  2D0N A;  1ZUY A;  4NS5 A;  2A37 A;  1I5L A;  5GAO q;  2CUB A;  1ZBJ A;  2QTX A;  2LTO A;  4DQ2 A;  3EFR A;  1N6A A;  3CCM Q;  3H6Z A;  3CMA Q;  3VRY A;  3CXC S;  2HBP A;  4PKC C;  3EG2 A;  4Z8A A;  4E7L A;  1OZ2 A;  4XQ3 A;  2K3B A;  1VQO T;  1SSH A;  1VQK A;  5FWB A;  2DVE A;  1KG1 A;  3CME A;  1GFD A;  3CCQ T;  5GMK h;  3QPH A;  1BI0 A;  5I2M A;  3OYL A;  1RAI B;  1H3Z A;  2ECZ A;  1OX8 A;  2CRE A;  2P84 A;  5GMK i;  1KK7 A;  1RAB B;  1VQM Q;  1AVZ C;  3I56 A;  1Q86 R;  3PT9 A;  1RAH B;  2FPF A;  1B7T A;  2AHJ B;  1B07 A;  2CP2 A;  1QKW A;  2KSS A;  5KCH A;  1D1A A;  3JCM c;  1M8M A;  2I0N A;  2EQU A;  1V1C A;  3EH1 A;  4EDU A;  4PL6 A;  2LQW A;  1XQH A;  1WXB A;  3JCM V;  3J80 E;  1Q95 G;  2CUD A;  4M78 F;  2MWP A;  5CKE A;  5D6W A;  1FYN A;  2JOY A;  2JS0 A;  1WHH A;  1D09 B;  5KYN A;  4JDS A;  2RK1 A;  1KQ1 A;  2AK5 A;  4A4G A;  3CCQ Q;  3OYY A;  4PJO G;  1W4S A;  1HK9 A;  5IHI A;  3V8J A;  5CR2 A;  3TCJ A;  1HJD A;  1BIB A;  2DMO A;  3CCU T;  2DL3 A;  1CKB A;  4M78 G;  1YJW T;  3GP8 A;  2DIG A;  3DB4 A;  1K4U S;  1ZA2 B;  1C1A A;  2GQV A;  1M90 U;  3EG9 B;  3UDC A;  1SEM A;  3UT1 A;  1ZQ1 A;  2A36 A;  3M58 A;  2X4Y A;  1I0C A;  5AT1 B;  1PC0 A;  4X1V A;  4DOV A;  4OMQ A;  4Z89 A;  3TSW A;  3Q1J A;  2KRO A;  5ECA A;  3CXC A;  2HQX A;  2X4X A;  3M57 A;  4EMG A;  2KNB B;  1UEB A;  2HQE A;  2LCC A;  2QAS A;  2M9U A;  1ZUK A;  5I11 A;  1N8R R;  4ZN1 A;  2V1Q A;  4JJD A;  1Q81 C;  2IIM A;  1AWJ A;  3WVE B;  5I2S A;  4DOW A;  3CCU Q;  1RAD B;  4M4Z A;  1Y57 A;  3OBW A;  2L5Q A;  3VRZ A;  4JRP A;  2GGR A;  1KJW A;  1WA7 A;  3CCV A;  3VYG A;  3VUZ A;  2DNU A;  5HK0 A;  5LJ5 j;  4HCK A;  1I8F A;  2QQR A;  3P8H A;  2F5K A;  4C92 D;  3MEU A;  2DTI A;  3LW5 E;  4OML A;  2QGG A;  4M75 B;  5DY9 A;  1GBQ A;  3BW1 A;  5GAM f;  4M7D C;  4PFP A;  4LD6 A;  4HT8 A;  5GMK m;  2DL5 A;  1VIE A;  2GTO A;  5KYX B;  1H3H A;  3G71 A;  4OP0 A;  2JN0 A;  4FCY A;  2DEU A;  2QDY B;  3VU3 C;  3RBB B;  1TS9 A;  3CPF A;  4C8Q A;  3VV0 A;  3MEV A;  5GAN d;  3TRE A;  4RCC A;  5A2Q E;  4C5I A;  3QJ6 A;  5IXF A;  2KDS A;  1JRI A;  1D3B A;  2V8K A;  1KC8 R;  1X2Q A;  3H0F A;  4CC4 B;  1AOJ A;  3CEY A;  4JPB W;  4BDY A;  3M53 A;  3SD4 A;  2JZ2 A;  2E5Q A;  4EPC A;  2X3W D;  2A0F B;  2RI5 A;  3X28 B;  2CP5 A;  4FSS A;  1YI2 A;  2LCS A;  1AHJ B;  5CO7 A;  1KHC A;  2EAY A;  4OMF B;  2LJ3 A;  1YI2 Q;  1M1G A;  4OB1 B;  1OV3 A;  1M8V A;  5M9O A;  1WLP B;  2OTJ A;  3LH5 A;  4HVV A;  3KFV A;  4C92 F;  3AT1 B;  1Z9Q A;  2KI7 A;  2FB7 A;  2QEX T;  4IUT A;  2MF2 A;  4KRT A;  3OB9 A;  2GBQ A;  2W10 A;  1YHQ A;  1IZ6 A;  3M9Q A;  1QVF S;  1AZE A;  3FDR A;  1MMD A;  2EBP A;  3EFO B;  1M4Z A;  4KBM B;  2E6N A;  1ZX6 A;  1BI3 A;  1MMG A;  2K79 A;  4AFU C;  2CP0 A;  2L3Q A;  5GAN 5;  1K9M C;  4QQ6 A;  2JW4 A;  2DER A;  2IG0 A;  1EZZ B;  4ESR A;  5LJ5 h;  5LL6 S;  4XTU A;  2LZ6 B;  3OYA A;  1K73 R;  4OB2 B;  4M75 D;  3L2R A;  1YIT A;  2L89 A;  1VQL T;  4FW1 A;  1GBR A;  2LX7 A;  3CCL A;  2DKG A;  4GLM A;  1Q82 R;  3I5S A;  1YIT Q;  2O9S A;  2VXE A;  3RUX A;  5EC7 A;  1WPY A;  4A4E A;  1HSQ A;  4PJJ A;  5A0D A;  3CBO A;  2HL5 C;  4QQG A;  4LD9 K;  4IUU A;  1D0Z A;  5GAO m;  3M59 A;  1VQP T;  2EGE A;  3JB9 G;  3JCM e;  2YRC A;  1EIF A;  1T0H A;  2YUN A;  2LQN A;  1PRL C;  4ORZ A;  4M77 B;  3F70 A;  4GY5 A;  2YHT A;  2E6Z A;  1UEC A;  2C0T A;  4HXJ A;  4EMK C;  4C92 E;  5C6S A;  1VQ6 A;  3G4S T;  3VS5 A;  3X20 B;  1KD1 C;  5IH2 A;  3QDR B;  3QWY A;  3GOX A;  5KYW B;  3U23 A;  4ZGE B;  2NWM A;  3C12 A;  2OAW A;  1QVF A;  3ZEH A;  2OTL T;  3A1P A;  2AZV A;  1VQP Q;  3OMC A;  1IHV A;  2DVJ A;  1RLP C;  1ZSZ B;  4FW2 A;  4AT1 B;  1NLO C;  4EIK A;  2RB6 A;  2E70 A;  4MDX A;  4HA8 A;  3LH0 A;  2CP6 A;  2RJD A;  2KEA A;  3VKI A;  2DET A;  1W6X A;  2DE0 X;  2MCN A;  3M4G A;  2JM8 A;  3HSB A;  2CZ7 B;  2QAZ A;  4M75 G;  2ROL A;  1UJY A;  3G4S Q;  3EAE A;  3NTK A;  1MUZ A;  2VVK A;  3EHQ A;  2JMC A;  2QQS A;  3KUF A;  3OYN A;  3CCE A;  3P8D A;  3VS3 A;  4F16 A;  2DRK A;  3GIB A;  2HAX A;  1GCP A;  1K76 A;  1TXQ A;  2EGC A;  4RTU A;  2OTL Q;  2RHZ A;  3H41 A;  3EGD B;  4B9X A;  2DXT A;  2DXB A;  4FL6 A;  2Z0W A;  4JZ3 A;  3PIP A;  1XOV A;  4BE0 A;  5KYY B;  4J9D A;  1WXU A;  2EPD A;  5LJ5 g;  2DYI A;  2ZPF B;  2GTJ A;  3EG0 A;  2BZ8 A;  2CZ0 B;  2EJF A;  3PE0 A;  1OU8 A;  2X35 A;  4JLG A;  4M77 D;  1Q7Y C;  2DLP A;  4CC3 A;  3ME9 A;  4OVA A;  5IXB A;  2X9H A;  2P0P A;  5GAO p;  2CT3 A;  4J8O A;  3M56 A;  3LWH A;  2FZK B;  2K9G A;  3CCS A;  1SHF A;  1ZSG A;  2F5T X;  1VQ9 T;  3HPW A;  4KH0 B;  5GAN j;  4V2S A;  1E7O A;  3A8L B;  3JV3 A;  2PU9 B;  2RQV A;  2CS7 A;  2LJ1 A;  3EGU A;  5HK3 A;  2AKK A;  3KXT A;  1G3S A;  1VQ4 T;  4BY6 B;  2GNC A;  2LNH B;  5LJ3 j;  1OZ3 A;  1X6O A;  4RUG A;  4PK4 A;  1PHT A;  2DTO A;  4X34 A;  1BI1 A;  1RL2 A;  2H3J A;  4M7A A;  1M1K C;  3HFN A;  2JS2 A;  4M7A C;  3UWN A;  1BU1 A;  5GAM d;  2X3X D;  4ELY C;  1M90 R;  2VGM A;  1TWB A;  2JUF A;  2M1H A;  2RF0 A;  4BD3 A;  1TUD A;  4MDW A;  3GNG A;  5FRN A;  1A0N B;  4C5G A;  2R5A A;  3EG3 A;  5CKB A;  4FT4 A;  4C0Z A;  2RJE A;  4X9C A;  2EGA A;  3OYD A;  1C6V X;  5GAN 8;  3SDZ A;  1RAG B;  3V7S A;  1NYF A;  4GBQ A;  1VQ5 A;  3PGG A;  4OMP A;  4QVZ A;  3I55 Q;  1VQ4 Q;  2XDP A;  1F1B B;  1Q86 C;  1G83 A;  3DB3 A;  2KXD A;  3PVL A;  3MKD A;  1YP5 A;  3JB9 I;  1AWX A;  1D0Y A;  2NUP A;  1R0C B;  1K9A A;  3FB9 A;  3NTI A;  4LXC A;  4ZTJ A;  4J9C A;  4M77 G;  5IT9 E;  2RD1 A;  5CVI A;  2QGF B;  1R0B G;  1WQ7 A;  3A8G B;  4DEY A;  3OQ5 A;  3JRZ A;  2YSQ A;  2XHC A;  3GBQ A;  2O2O A;  1QKX A;  3MP1 A;  4QT7 A;  4DBH A;  5FU6 C;  1G3T A;  3OYJ A;  2ZZD A;  3GLX A;  1WQW A;  4C0D B;  2RI2 A;  1IB8 A;  3P8B B;  2F2V A;  5GMK e;  1YBY A;  1OPK A;  5GAN h;  5FU7 C;  3E2U A;  1UB4 A;  1ZHI A;  2QG9 B;  5D6Y A;  1D1C A;  1UG1 A;  2GFU A;  4XU3 A;  3MCA B;  5LJ3 h;  3OS0 A;  4R55 A;  1TTH B;  2V8I A;  4AFQ C;  3TQ7 P;  4AFZ C;  3CCM A;  2DBK A;  1KFZ A;  1VYV A;  3CMA A;  4RCB A;  5DLQ E;  3T9N A;  3HKS A;  3JCM d;  1Y96 A;  1QP2 A;  4LNP A;  3S3M A;  2KT8 A;  2F69 A;  2DL4 A;  5CQX A;  4PJN A;  3I56 T;  3OMG A;  4JRK A;  1N8R C;  2E3I A;  4J6Y A;  4J5Y A;  3OYK A;  1RI9 A;  2ZPG B;  3G6E Q;  1RUW A;  3MEW A;  3CBM A;  1VQM A;  1RAA B;  1UE9 A;  3QSU A;  1QWE A;  4MMK A;  3ULR B;  2G6F X;  4C8Q B;  2RHI A;  1D0X A;  1OUL A;  2RH2 A;  4LUE A;  2J6O A;  3UF4 A;  3PVQ A;  2FPE A;  3VS2 A;  2YXY A;  3REA B;  1QWF A;  4PJO C;  1ABO A;  2PUO B;  4XTZ A;  1WJQ A;  1D3B B;  4PJO F;  1OU9 A;  3EG1 A;  3A8O B;  2RN8 A;  1GCQ C;  1WHG A;  2CKK A;  2E5K A;  2P4T A;  4M78 C;  2VGN A;  3WVD B;  1VQO A;  4F7U A;  2QTV A;  2RQR A;  1U1T A;  1W2B S;  4DBR A;  1NPR A;  3QZ9 B;  3CCQ A;  2DD5 A;  4ANJ A;  1VQO Q;  3M0U A;  4HCB A;  2BZY A;  1IO6 A;  2HSP A;  1VUB A;  3A8M B;  1W1F A;  3CXC P;  5KYU A;  2CSI A;  2DXU A;  1N9R A;  1N5Z A;  1CSK A;  2RQU A;  2VC8 A;  3V7C A;  2EQM A;  2RPN A;  3A98 A;  3CCR T;  2YLC A;  1WI7 A;  2KYB A;  1WIE A;  1KC8 C;  2JMA A;  3QO3 A;  2Y4Y A;  1BI2 A;  1UGR B;  4FYY B;  3KBG A;  1QVP A;  4E6R A;  3VS1 A;  1UGP B;  4OMM A;  3PMT A;  2H8H A;  1UTI A;  1OOT A;  4DEX A;  2KY9 A;  2MK5 A;  2ED0 A;  4F7U G;  1M5Q 1;  2R57 A;  1VQ8 T;  1JJ2 S;  2PVD B;  3CCU A;  2K6D A;  1KIK A;  1FMK A;  1GFC A;  3GNF B;  3CD6 T;  5LJ3 g;  1K8A U;  2EVR A;  1OEB A;  3CCR Q;  2COY A;  3JCM P;  1XTD A;  5DLO A;  1YJW Q;  4PJO E;  5GAN 6;  3HFO A;  4C8Q D;  2KK4 A;  2YUP A;  9ATC B;  1WGS A;  1FMW A;  5GAN 3;  1UGS B;  2OI3 A;  1S72 T;  4D6W A;  4M78 E;  5GAM j;  4CRI A;  4FYX B;  3UA6 A;  1WJS A;  3ZL7 C;  1JXO A;  2EJ9 A;  5I21 A;  2P0K A;  5GAO n;  4M7D A;  2KRS A;  2KGT A;  1W2B A;  2QXF A;  1YN8 A;  2HEQ A;  4O5V A;  1K0S A;  3FLG A;  1K73 C;  3FIF A;  1I5O B;  3GF5 A;  1YJN T;  2X51 A;  2E4H A;  2BKD N;  1AWO A;  2RQT A;  1QVG S;  1Q7Y U;  3N5B B;  1NM7 A;  2D8J A;  2OJ2 A;  4B9W A;  1PD1 A;  3EGX A;  5J3B A;  4IUQ A;  4BE1 A;  3G7Z A;  2CT4 A;  2Y4X A;  3CD6 Q;  1X2K A;  3IQL A;  3VS0 A;  3VS6 A;  1YJ9 T;  2EYZ A;  1JJ2 P;  3JB9 D;  1MMN A;  4JS4 A;  2ROT A;  4J9G A;  3L2Z A;  2X4W A;  3ER0 A;  2F1L A;  4RTW A;  1O75 A;  2W0Z A;  1VQ7 T;  1S72 Q;  3OW2 S;  1QCO A;  1NG2 A;  1SKU B;  2JNG A;  5L8R E;  3MJX A;  3MO8 A;  2DAQ A;  3NPF A;  1M1K U;  1WNL A;  2DRM A;  4AG1 C;  2A7Y A;  4M7D G;  2VV5 A;  1YJN Q;  5LJ5 e;  5GAN 4;  2QYZ A;  2JM9 A;  2JT4 A;  4E47 A;  4C92 A;  3O8V A;  3SFM A;  1JJ2 A;  3M0R A;  3MP6 A;  3CC4 T;  3RMQ A;  4C92 C;  1AD5 A;  1U06 A;  2O31 A;  2KXC A;  3RMS A;  1QW1 A;  1X6B A;  2QDL A;  4RTV A;  2C06 A;  2K7A A;  3RR6 A;  1QVG P;  1SRL A;  2MI6 A;  1YJ9 Q;  1MND A;  4BAC A;  4C8Q G;  2FVU A;  2DF6 A;  4A53 A;  3SEM A;  4GLK A;  1VQ7 Q;  2EQI A;  4KGV B;  4FU6 A;  4BI3 A;  3RER A;  3MHX A;  5AYF A;  4LDX A;  4WF2 A;  2E65 A;  2C0O A;  4YTL A;  2ESW A;  5GAM h;  4C0F A;  3TU4 K;  3JB9 F;  2RNA A;  4NOY A;  2D1X A;  3JCM f;  5GAN 2;  4D8D A;  1QVG A;  1TSF A;  2K2V A;  3QBY A;  3MEA A;  4OGC A;  2E64 A;  4IUP A;  5C0M A;  1NJI R;  1VYU A;  2A08 A;  1XNI A;  5CIU A;  3CC4 Q;  2FG0 A;  4R56 A;  1NE8 A;  3M0T A;  2QEX Q;  4KGX B;  2YDL A;  3MP8 A;  3DKM A;  2L3S A;  1M2V A;  1VQN T;  2PVG B;  5A0L A;  2V8J A;  4A4F A;  4J9E A;  4QW2 A;  3OW2 A;  1UUE A;  3TSZ A;  2FHD A;  2PVO B;  1YIJ T;  1VQ6 T;  1MMA A;  1WDX A;  3M5A A;  4LE9 A;  3URG A;  1QVF P;  5CK9 A;  1D1B A;  1WHL A;  4M7A B;  5KH6 A;  2QK0 A;  1OYX A;  4XTY A;  4EMK A;  5IHK A;  1MGQ A;  2M02 A;  4WTO B;  1VQL Q;  3I5R A;  4P5N A;  4IUR A;  3OYE A;  1SHG A;  5CKF A;  4B6M A;  1I1J A;  2DPP B;  1I07 A;  2SRC A;  1KQ2 A;  1EX4 A;  1VQP A;  2E10 A;  3H9N A;  4BE2 A;  4M75 C;  1N8R U;  4Y91 A;  2R58 A;  4M75 F;  4XTX A;  1VQN Q;  2ZPB B;  1WJR A;  4Y28 E;  1T0J A;  2DZC A;  4KH1 B;  4JRI A;  2XKO C;  5CAI A;  2MIO A;  4CC2 A;  4LUD A;  4A54 A;  1YIJ Q;  2V1R A;  1PKT A;  3OYC A;  1YWO A;  2NUP B;  2BZX A;  4BUG A;  2J05 A;  4UC4 A;  3G4S A;  2SEM A;  2LCL A;  2X4J A;  1M3C A;  1U8R A;  2MPX C;  1WYX A;  2HKQ B;  4RTY A;  2PQW A;  4L6V 5;  1TH7 A;  5FU6 B;  3EFS A;  3X24 B;  1LNX A;  2OTL A;  2CZ1 B;  1R8O B;  3EHR A;  1JU5 C;  3H8Z A;  1WXT A;  2DYB A;  1TG0 A;  3OBY A;  5FU7 B;  4LN2 A;  2LC4 A;  4PFO A;  4FYW B;  2HSE B;  3G1J A;  2XI9 A;  2MAM A;  4RTX A;  3CC2 T;  1YFN A;  3L42 A;  3DLM A;  2ZPE B;  3S6W A;  4OMN A;  2FEI A;  3L2U A;  1KC8 U;  1TUC A;  3HHT B;  3FRN A;  1RI0 A;  2XK0 A;  1Y96 B;  2XIC A;  4E7Z A;  1OPL A;  3OSS C;  3NGP A;  3RDV A;  4M75 E;  4IUV A;  1FXX A;  3CPW S;  3SHW A;  1ARK A;  2O4X A;  1MHN A;  1B34 A;  1ABQ A;  2BIV A;  4TVR A;  2HL3 A;  5FRO A;  1FX7 A;  8ATC B;  4II1 A;  3QJY A;  3QDF A;  2BE7 D;  1Q81 U;  2RQW A;  1IGQ A;  4AMC A;  4LDW A;  1YNZ A;  3CC2 Q;  3O5Z A;  5FLX E;  4J7I A;  4C5E A;  3QUI A;  4N0A A;  4F04 B;  4ZTF A;  1H92 A;  5FWC A;  2LQK A;  2JTE A;  1FMV A;  1UGQ B;  4N0A C;  3I35 A;  2FZG B;  2V26 A;  3BY7 A;  2AZS A;  3JB9 H;  4KUD K;  3HRT A;  3CBP A;  3REB B;  4F7U B;  1VQ9 A;  3M4Y A;  1VYT A;  1ZUU A;  3CCJ T;  1X43 A;  3E9G A;  5I22 A;  1IGU A;  1TOV A;  1K73 U;  3JSC A;  4M77 C;  4C5H A;  1VQ9 Q;  3I55 A;  3L1A A;  4M77 F;  1VQ4 A;  3NHN A;  5LJ5 d;  2K5I A;  1LJO A;  1RAC B;  5KYU B;  2CYZ B;  3M0P A;  1G3Y A;  3RIR A;  3ASK A;  1CKA A;  5IHN A;  4MZP A;  1M2O A;  2LVM A;  2H3E B;  2QA4 T;  4J9B A;  3SB2 A;  1G2B A;  2K57 A;  1M3B A;  1K8A R;  2GQI A;  2EWN A;  2VAS A;  2EJG A;  1LVK A;  2CP7 A;  5LJ3 e;  2B8A A;  4CI0 C;  2RHY A;  4M7A G;  2KVQ G;  4XU1 A;  4ZGD B;  4FSX A;  2MOX A;  5L23 A;  1PM3 A;  2E3H A;  3CC7 T;  3CPW A;  2YLB A;  3R6O A;  2NUZ A;  1RAF B;  4NL2 A;  1SF9 A;  4KUL A;  5FRM A;  2RJC A;  4ELZ C;  2FYK A;  1U3O A;  1JEG A;  1Q7Y R;  1BIA A;  1JB0 E;  4AFS C;  5D6X A;  3C95 A;  4XU0 A;  5J26 A;  3JAM E;  1P92 A;  4N4H A;  4PLI A;  5KE2 A;  1HXD A;  1PKS A;  3HRS A;  4E2F B;  3JCM W;  2ZAE A;  2QA4 Q;  5D7U A;  3R6N A;  1KQS S;  1Y71 A;  3VUB A;  4RTT A;  3X26 B;  1UHF A;  2KR3 A;  1VQK T;  2VWF A;  2JVV A;  1JBM A;  2DTH A;  4PJM A;  3CME T;  1VQM T;  2RHX A;  5CCA A;  4M7D B;  4J6X A;  1K9M U;  4M77 E;  4ME7 A;  2HBW A;  4RKU E;  4Z88 A;  3PTA A;  3G6E A;  3SWN A;  3OYM A;  4NL3 A;  3C4S A;  3SWN C;  4IIM A;  4BDZ A;  1M1K R;  1HYO A;  1NBE B;  1Y07 A;  2P4R A;  4IKF A;  2NUT A;  5GJV B;  3EGX B;  3OS1 A;  2QI2 A;  1Y0M A;  4MZM A;  4Q5W A;  1IRX A;  2AIR B;  4PJO A;  4LDU A;  4K11 A;  2FRW A;  1GCQ A;  5CKD A;  2ZPI B;  1VQK Q;  1IHW A;  4E7J A;  3L2V A;  2RJF A;  4MZT A;  3X25 B;  2LP5 A;  3OS5 A;  4M78 A;  3CME Q;  3RKY A;  4QKU A;  2LX9 A;  4BY6 C;  5HCK A;  2FPD A;  2JTF A;  1KQS P;  2CDT A;  2WSF E;  1NEG A;  2DFU A;  2XG8 D;  3M55 A;  1UJ0 A;  1XJW B;  1B3Q A;  2D6F A;  3RKW A;  3I56 Q;  1T3S A;  2WSC E;  4ZNX A;  4PNO A;  2DIL A;  3J7A F;  2RK2 A;  3EH2 A;  2EYY A;  4C92 B;  3UAT A;  2KBT A;  3V8L A;  1KD1 U;  4XU2 A;  3FC3 A;  2VXF A;  1M30 A;  1X6G A;  2OX7 A;  2LT4 A;  4F7U F;  1KQS A;  1SPK A;  2DBM A;  2BTT A;  2BE9 B;  4FM4 B;  3LGL A;  2YT6 A;  2EYX A;  2K2M A;  4DA4 A;  5HKC A;  2NLU A;  1J3T A;  2EIF A;  2FO0 A;  1PSF A;  2RMO A;  1N27 A;  3NTH A;  4A4H A;  2RO0 A;  4ATO A;  5GAN 7;  4HCZ A;  2YUQ A;  3LGF A;  4M7D D;  4E7H A;  3OYH A;  2DJQ A;  2J06 A;  2K3Y A;  5GAN g;  1OX9 A;  4QVC A;  3V7R A;  3CCR A;  4EMH A;  1AEY A;  3CCV T;  1X01 A;  3RES A;  1YJW A;  2XDD A;  1W2B P;  2EYQ A;  1PD0 A;  2EFI A;  3THK A;  1GRI A;  2YRD A;  4QVD A;  2AT1 B;  4OMO A;  4OGE A;  2L2P A;  4KT0 E;  1BKB A;  3LLR A;  3C0C A;  1DJ7 B;  1M2V B;  4KGZ B;  2LNV A;  2P0Q A;  2EYW A;  2M0Y A;  4WCI A;  6AT1 B;  1M3A A;  4C0D C;  1LOJ A;  2E41 A;  2DIQ A;  3QHS A;  2GCX A;  4XTW A;  5HY6 A;  3G71 T;  4HT9 A;  4L59 A;  1IXD A;  2COW A;  2CH4 W;  1UGV A;  3QG1 A;  2HMA A;  1PWT A;  4MML A;  4AG2 C;  1LPL A;  4LDV A;  3PNW C; 
#chains in the Genus database with same CATH homology
 3HPW A;  2FHD A;  2PVO B;  3H6Z A;  5GAN j;  1YIJ T;  3A8L B;  3CXC S;  1VQ6 T;  1VQ8 A;  4V2S A;  2PU9 B;  4EMK B;  2HBP A;  2CS7 A;  4OB0 B;  4PKC C;  5HK3 A;  1Q82 C;  3M5A A;  1NJI C;  3URG A;  3KXT A;  4E7L A;  5CK9 A;  2XU8 A;  1OZ2 A;  1G3S A;  4XQ3 A;  1VQ4 T;  4BY6 B;  1VQO T;  4M7A B;  5LJ3 j;  1X75 C;  5KH6 A;  1VQK A;  3CD6 A;  1OYX A;  1OZ3 A;  2DVE A;  2DXC A;  1KG1 A;  1X6O A;  4XTY A;  4JJN K;  3CME A;  4EMK A;  4F7U E;  1MGQ A;  3CCQ T;  5GMK h;  2PUK B;  2DO3 A;  2DTO A;  3QPH A;  1BI1 A;  4X34 A;  1BI0 A;  1RL2 A;  5I2M A;  4P5N A;  3OYL A;  1H3Z A;  2H3J A;  4IUR A;  5LJ5 f;  4M7A A;  1M1K C;  3HFN A;  4M7D F;  3OYE A;  5CKF A;  5GMK i;  1S72 A;  4M7A C;  2DPP B;  3UWN A;  4BB7 A;  3I56 A;  5GAM d;  1YI2 T;  3AHU A;  1KQ2 A;  4ELY C;  3PT9 A;  2VGM A;  1VQP A;  5IN1 A;  3JCM Q;  2JUF A;  2AHJ B;  2A3L A;  2E10 A;  2IVW A;  2M1H A;  4BD3 A;  4BE2 A;  2KSS A;  4M75 C;  5KCH A;  3JCM c;  2K5F A;  4Y91 A;  1N8R U;  2EQU A;  2R58 A;  4M75 F;  4MDW A;  3GNG A;  4VUB A;  4XTX A;  5FRN A;  2ZPB B;  1WJR A;  2XD0 A;  4C5G A;  4Y28 E;  2DZC A;  3C94 A;  2R5A A;  4EDU A;  1V29 B;  4PL6 A;  1YJN A;  2OTJ T;  4JRI A;  1XQH A;  3VYH B;  2XKO C;  5CKB A;  4FT4 A;  4C0Z A;  2RJE A;  4C8Q C;  5CAI A;  3JCM V;  4C8Q F;  4RG8 A;  3J80 E;  4X9C A;  4A54 A;  3OYD A;  2MWO A;  2I2L A;  5GAN 8;  3QYG B;  5GAM e;  4M78 F;  5LJ3 d;  2MWP A;  5CKE A;  5D6W A;  1YHQ T;  3SDZ A;  3OSV A;  2JOY A;  2VUB A;  3V7S A;  3OYC A;  2CGH A;  1VQ5 A;  4JLI A;  3PGG A;  4QVZ A;  2XDP A;  4BUG A;  2HNI A;  1Q86 C;  4JDS A;  2RK1 A;  1KQ1 A;  4UC4 A;  3DB3 A;  4J6W A;  4A4G A;  5A0G A;  3G4S A;  3EFR A;  2LCL A;  1YJ9 A;  2X4J A;  3OYY A;  3JB9 I;  1U8R A;  4PJO G;  1W4S A;  5CQY A;  1HK9 A;  3QXE B;  2QQA A;  3E19 A;  3FB9 A;  3V8J A;  2PQW A;  5CR2 A;  3TCJ A;  4L6V 5;  1TH7 A;  3A5Z B;  3NTI A;  3EFS A;  5FU6 B;  1VQ7 A;  3X24 B;  1BIB A;  4ZTJ A;  3CCU T;  4M77 G;  5IT9 E;  1LNX A;  2RD1 A;  2OTL A;  4M78 G;  1YJW T;  3GP8 A;  2CZ1 B;  5CVI A;  2DIG A;  1R8O B;  1WQ7 A;  3A8G B;  3DB4 A;  5CKH A;  3H8Z A;  1YIT T;  3L2W A;  3OQ5 A;  1Q86 U;  2EKO A;  3JRZ A;  2GQV A;  3CCL T;  1M90 U;  2XHC A;  3OBY A;  3MP1 A;  2RI3 A;  3UDC A;  5FU7 B;  5FU6 C;  1G3T A;  1ZQ1 A;  2JTM A;  3UT1 A;  3OYJ A;  2E12 A;  2LC4 A;  3M58 A;  2X4Y A;  2ZZD A;  3GLX A;  4LDV A;  4JS5 A;  2XI9 A;  4DOV A;  1WQW A;  4C0D B;  2RI2 A;  2MAM A;  3Q1J A;  3CXC A;  2HQX A;  3CC2 T;  2X4X A;  3L42 A;  3M57 A;  4EMG A;  3CC4 A;  3DLM A;  1I4K 1;  3P8B B;  2DJZ A;  1UEB A;  2KAF A;  2ZPE B;  3S6W A;  2HQE A;  2LCC A;  5GMK e;  1YBY A;  2QEX A;  5GAN h;  5FU7 C;  3L2U A;  1KC8 U;  1UB4 A;  1ZHI A;  1G5V A;  2M9U A;  5D6Y A;  3RKX A;  4O6J A;  3HHT B;  4M7D E;  4C92 G;  4LDY A;  2GFU A;  4ZN1 A;  3FRN A;  1RI0 A;  3JCM J;  4XU3 A;  3MCA B;  5LJ3 h;  2XK0 A;  1ZBX A;  3E1S A;  4R55 A;  3OS0 A;  1Y96 B;  1Q81 C;  2V8I A;  2XIC A;  2O4X B;  1GXI E;  3WVE B;  5I2S A;  2MMP A;  3CCM A;  1B34 B;  4OB3 B;  4DOW A;  3OSS C;  3L2Q A;  4RCB A;  5DLQ E;  3T9N A;  3CMA A;  2YRV A;  4M75 E;  4IUV A;  1FXX A;  3HKS A;  3CPW S;  3OBW A;  3JCM d;  1Y96 A;  2L5Q A;  1QP2 A;  2O4X A;  1MHN A;  4JRP A;  1SSF A;  1Y7X A;  3DLL A;  1B34 A;  4J83 A;  2BIV A;  4TVR A;  3S3M A;  4C8Q E;  2FL7 A;  5FRO A;  3CCV A;  3VYG A;  1FX7 A;  2F69 A;  3VUZ A;  5J39 A;  5CQX A;  4Z02 A;  4II1 A;  3I56 T;  3QJY A;  5HK0 A;  3OMG A;  1VQL A;  5LJ5 j;  2M0O A;  4JRK A;  1N8R C;  1Q81 U;  4J6Y A;  4J5Y A;  3JCM X;  1I8F A;  2QQR A;  2KMT A;  3OYK A;  3P8H A;  4LDW A;  2K4Y A;  2ZPG B;  4PLL A;  2F5K A;  4C92 D;  3MEU A;  2DTI A;  3LW5 E;  3MEW A;  3CBM A;  1VQM A;  4M75 B;  5DY9 A;  3LX7 A;  5FLX E;  3BW1 A;  5GAM f;  4M7D C;  3GPL A;  4J7I A;  4C5E A;  3QUI A;  4N0A A;  5DM7 R;  4ZTF A;  4LD6 A;  4HT8 A;  3OYB A;  2LQK A;  5GMK m;  3QSU A;  2GFA A;  4XAX B;  1VIE A;  1UGQ B;  4MMK A;  4N0A C;  4C8Q B;  2RHI A;  3G71 A;  4OP0 A;  1VQN A;  2RH2 A;  4M75 A;  3BY7 A;  2JN0 A;  4BI8 B;  4X9D A;  3JB9 H;  4KUD K;  3HRT A;  3CBP A;  4PJO C;  4XTZ A;  2PUO B;  2QDY B;  3VU3 C;  4F7U B;  1D3B B;  1WJQ A;  4PJO F;  3CPF A;  1VQ9 A;  3M4Y A;  4C8Q A;  4RG2 A;  3CCJ T;  3A8O B;  3VV0 A;  3MEV A;  5KCO A;  5GAN d;  1FWZ A;  1YIJ A;  4ATO A;  3TRE A;  3E9G A;  2VYT A;  4RCC A;  5A2Q E;  2CKK A;  4N4I A;  3LWI A;  1K73 U;  3JSC A;  3V8K A;  4C5I A;  2P4T A;  3BDU A;  4M77 C;  4C5H A;  3QJ6 A;  3JB9 J;  3I55 A;  3L1A A;  4M78 C;  2LRQ A;  4M77 F;  2VGN A;  5GMK l;  3WVD B;  1VQ4 A;  2KDS A;  1JRI A;  4F7U A;  1VQO A;  1D3B A;  2V8K A;  5LJ5 d;  3A8H B;  2HD0 A;  2K5I A;  3OYG A;  1LJO A;  1U1T A;  1W2B S;  1NPR A;  2WAC A;  3QZ9 B;  3CCQ A;  3INZ A;  3CCE T;  2CYZ B;  2DD5 A;  3CEY A;  3J81 E;  4BDY A;  1G3Y A;  4HCB A;  3M53 A;  3RIR A;  3OYF A;  1M90 C;  3ASK A;  3SD4 A;  2JZ2 A;  2E5Q A;  4MZP A;  1NPP A;  3JCM h;  4EPC A;  2LVM A;  2RI5 A;  1VUB A;  2QA4 T;  5GAO r;  3A8M B;  3X28 B;  3SB2 A;  2K57 A;  1YI2 A;  2EWN A;  1AHJ B;  2EJG A;  5CO7 A;  1KHC A;  2DXU A;  3BDL A;  1N9R A;  2EAY A;  5LJ3 e;  3ZBD A;  2VC8 A;  4ZN3 A;  3V7C A;  4OMF B;  2B8A A;  2EQM A;  3CCR T;  4CI0 C;  1M1G A;  2RHY A;  2KQW A;  2YLC A;  4OB1 B;  3S3N A;  4M7A G;  1M8V A;  2KVQ G;  5M9O A;  4XU1 A;  1KC8 C;  4ZGD B;  3QO3 A;  2OTJ A;  4FSX A;  4C92 F;  1G3W A;  4BI4 A;  1I81 A;  2Y4Y A;  2QEX T;  2FB7 A;  4IUT A;  1BI2 A;  2MF2 A;  3CC7 T;  1UGR B;  3OB9 A;  3CPW A;  3KBG A;  1OI1 A;  1QVP A;  2YLB A;  1IZ6 A;  2DEQ A;  3M9Q A;  3R6O A;  1YCY A;  2Y90 A;  4L5G A;  1N9S A;  3ZFJ A;  1UGP B;  3FDR A;  1QVF S;  1KHI A;  1M4Z A;  1M9S A;  4KBM B;  4NL2 A;  1K8A C;  2E6N A;  2XID A;  3PMT A;  2K5L A;  4KUL A;  2RJC A;  5FRM A;  4ELZ C;  2FYK A;  5GAM g;  4HKE A;  1BI3 A;  2KY9 A;  1BIA A;  1JB0 E;  5D6X A;  3C95 A;  4XU0 A;  4F7U G;  2BUD A;  3CCS T;  4FT2 A;  5J26 A;  3JAM E;  1P92 A;  4N4H A;  4PLI A;  1M5Q 1;  5KE2 A;  1HXD A;  5GAN 5;  2ZCF B;  3HRS A;  3JCM W;  3UPU A;  1K9M C;  2R57 A;  4QQ6 A;  4M7A D;  2IG0 A;  1VQ8 T;  3NFC A;  2XDB A;  1JJ2 S;  2PVD B;  5LJ5 h;  1KQS S;  1Y71 A;  3VUB A;  3CCU A;  1NZ9 A;  5LL6 S;  2D9T A;  4XTU A;  4HCC A;  4OF1 A;  3OYA A;  3GNF B;  3X26 B;  1VQL T;  4OB2 B;  4M75 D;  3L2R A;  5LJ3 g;  2L89 A;  3OS2 A;  2JVV A;  1YIT A;  1K8A U;  1JBM A;  2R5M A;  4FIB A;  2K3X A;  3JCM P;  1O9S A;  2DTH A;  3CCL A;  3CME T;  2DKG A;  1XTD A;  5DLO A;  4PJO E;  3SWN B;  5GAN 6;  3HFO A;  1VQM T;  4C8Q D;  2KK4 A;  2RHX A;  2VXE A;  3RUX A;  5CCA A;  1WGS A;  5GAN 3;  1WPY A;  4A4E A;  4M7D B;  1UGS B;  2OAU A;  4J6X A;  1K9M U;  4M77 E;  4ME7 A;  1S72 T;  3CC2 A;  4D6W A;  4RKU E;  4M78 E;  3PTA A;  5A0D A;  3CBO A;  1VIF A;  3SWN A;  4CRI A;  5GAM j;  4NL3 A;  3OYM A;  4QQG A;  3PIO A;  3WXM B;  4LD9 K;  4IUU A;  3C4S A;  4QQD A;  5GAO m;  3M59 A;  1WJS A;  1VQP T;  2EJ9 A;  2RHU A;  5I21 A;  3SWN C;  4BDZ A;  3JB9 G;  4E7I A;  1BYM A;  2P0K A;  1Y07 A;  5GAO n;  4M7D A;  3JB9 F;  1W2B A;  2QXF A;  3QYH B;  4O5V A;  3JCM e;  4PJO B;  3FLG A;  1IRE B;  1K73 C;  4IKF A;  3FIF A;  4ZGJ B;  1EIF A;  3GF5 A;  4J7F A;  1YJN T;  3OS1 A;  2QI2 A;  2BKD N;  1QVG S;  1Q7Y U;  3N5B B;  4B9W A;  4MZM A;  4Q5W A;  3I55 T;  4M77 B;  2ZGW A;  4N4G A;  4M78 B;  4PJO A;  2QQ9 A;  4XK8 E;  4LDU A;  5GAN f;  3M54 A;  3PMI A;  1VQ5 T;  5GAO l;  5J3B A;  3F70 A;  4IUQ A;  4BE1 A;  4GY5 A;  2YHT A;  3G7Z A;  2ZPI B;  5CKD A;  3HL8 A;  2E6Z A;  2Y4X A;  2GF7 A;  3TEE A;  4EMK C;  4C92 E;  5C6S A;  4M77 A;  4E7J A;  1VQ6 A;  3L2V A;  2RJF A;  4MZT A;  5LJ3 f;  3X25 B;  3OS5 A;  4M78 A;  3G4S T;  3RKY A;  1YJ9 T;  3X20 B;  2LX9 A;  1KD1 C;  4BY6 C;  3QDR B;  2JTF A;  3JB9 D;  4JS4 A;  3GOX A;  4M7A F;  3L2Z A;  2WSF E;  1Q82 U;  1NJI U;  2X4W A;  3ER0 A;  4ZGE B;  3M55 A;  1O75 A;  2XG8 D;  1VQ7 T;  3C12 A;  3OW2 S;  2D6F A;  3RKW A;  1U1S A;  2E1H A;  1QVF A;  3ZEH A;  2OTL T;  2WSC E;  2EQK A;  2M16 A;  4PNO A;  3OY9 A;  3OMC A;  2JNG A;  3J7A F;  5L8R E;  5GAN e;  2LDM A;  5GMK j;  2LQ8 A;  2RK2 A;  4C92 B;  1QP3 A;  3MO8 A;  3VJP A;  2DK3 A;  2DAQ A;  2RB6 A;  1M1K U;  1WNL A;  2E70 A;  2RM4 A;  3PFS A;  3JCM g;  4RMO A;  2A7Y A;  3V8L A;  5IAY A;  4MDX A;  2QQB A;  1KD1 U;  4M7D G;  2VV5 A;  4XU2 A;  5LJ5 e;  5GAN 4;  3FC3 A;  2VXF A;  4HA8 A;  3OYI A;  3LH0 A;  1H64 1;  4E47 A;  4C92 A;  3O8V A;  2DZ9 A;  2RJD A;  2WSE E;  2LT4 A;  2O01 E;  3SFM A;  4F7U F;  1KQS A;  1JJ2 A;  2CZ6 B;  2DD4 A;  3CCJ A;  3MP6 A;  3VKI A;  3RMQ A;  4C92 C;  3CC4 T;  4KUI A;  3M4G A;  4C0G A;  3RMS A;  3HSB A;  1QW1 A;  2CZ7 B;  3QKJ A;  4M75 G;  4FM4 B;  3LGL A;  2C06 A;  3S3O A;  1M1F A;  4DA4 A;  5HKC A;  3EAE A;  2NLU A;  3NTK A;  2MI6 A;  3HP9 A;  2EIF A;  4BAC A;  4C8Q G;  1PSF A;  2QQS A;  3KUF A;  3OYN A;  3CCE A;  2FVU A;  3P8D A;  4A4K A;  4XTV A;  4A53 A;  1N27 A;  3LYI A;  3G6E A;  3NTH A;  4A4H A;  4GLK A;  2L3R A;  2RA2 A;  2RO0 A;  3CCM T;  1YHQ A;  5GAN 7;  3GIB A;  2QA4 A;  4HCZ A;  1PSE A;  4E7K A;  2HAX A;  3OA6 A;  3CMA T;  3LGF A;  4FU6 A;  5KE3 A;  4BI3 A;  3CD6 T;  4M7D D;  4JRQ A;  4E7H A;  3FJP A;  3OYH A;  3RER A;  2RHZ A;  3MHX A;  5AYF A;  4B9X A;  4WF2 A;  4LDX A;  2E65 A;  2DXT A;  4YTL A;  2K3Y A;  5GAN g;  5GAM h;  4JUV A;  4QVC A;  4C0F A;  2L8D A;  3V7R A;  2DXB A;  2G3R A;  4FL6 A;  4EMH A;  5EG2 A;  3CCR A;  1X01 A;  3CCV T;  3RES A;  3PIP A;  1XOV A;  4BE0 A;  3TU4 K;  1YJW A;  2XDD A;  1VQK T;  4NOY A;  2EYQ A;  2EFI A;  3G6E T;  3JCM f;  4QVD A;  5GAN 2;  1QVG A;  5LJ5 g;  2K2V A;  4PJO D;  2ZPF B;  3E9F A;  2ZPH B;  3QBY A;  3HRU A;  3MEA A;  4OGC A;  2E64 A;  4OGE A;  2CZ0 B;  2D0Q B;  2EJF A;  4IUP A;  3BFM A;  4KT0 E;  5C0M A;  1BKB A;  3LLR A;  3MET A;  1XNI A;  1DJ7 B;  2X35 A;  5CIU A;  2EQJ A;  4JLG A;  3JCM b;  3CC7 A;  2LNV A;  2P0Q A;  4R56 A;  3QZ5 B;  1NE8 A;  4C0D C;  4M77 D;  1LOJ A;  1Q7Y C;  2E41 A;  2DIQ A;  3FEO A;  4M78 D;  3QHS A;  3ME9 A;  4OVA A;  2GCX A;  3QII A;  2LT1 A;  4XTW A;  5HY6 A;  4M7A E;  2P0P A;  3MP8 A;  5GAO p;  3DKM A;  3G71 T;  4J8O A;  4HT9 A;  1VQN T;  3M56 A;  4L59 A;  2PVG B;  5A0L A;  3LWH A;  2V8J A;  4A4F A;  3QG1 A;  4NS5 A;  3CCS A;  1I5L A;  4MML A;  5GAO q;  2F5T X;  4QW2 A;  2QTX A;  3PNW C;  3OW2 A;  2LTO A;  1VQ9 T;  4DQ2 A;  1N6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...