3JCMP

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
109
structure length
77
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLQQPTASDNIANTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 7
structure length 77
sequence length 109
chains with identical sequence T
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmP00
3RERA 2RB6A 2YLBA 4NOYA 1WPYA 3JCMg 2HNIA 5GAN6 4XQ3A 4M78C 5GANf 2EAYA 3FB9A 2FB7A 2QTXA 1I81A 3QUIA 3SWNB 1M8VA 3RUXA 4F7UF 1U1SA 4HA8A 3SWNA 4M78E 3JB9G 3JB9J 4M77G 3JB9H 4M7AG 4M75D 4N0AC 1LJOA 2JN0A 5LJ3d 4J5YA 4M7DD 3JCMQ 1WQ7A 4XTVA 5GAMj 5GAMd 2EJGA 5GMKi 4M75E 4M7DE 5GAN3 3JCMe 4M7AB 4M78G 4C8QD 2EJ9A 3VU3C 3V7CA 4M77D 3V8JA 4C92A 5GAOn 4M7AA 2RA2A 4QVCA 2DZCA 1JRIA 3QHSA 2YHTA 4C8QE 4HT8A 4PJOC 5GAN2 4M75G 4M7DG 5I21A 5GANh 4A53A 3QO3A 4M78D 3AHUA 4J6YA 1MGQA 4MMKA 2E1HA 2VXFA 3RESA 5GAOm 4EMKB 4M75B 4J6WA 3JCMd 4C8QG 4M7DB 4C92F 2E64A 5GANe 5GMKl 4EMHA 1KQ2A 5GAOp 2Y90A 4M7DA 2VXEA 3FJPA 3BFMA 1KQ1A 5LJ5h 2ZGWA 2I2LA 2YLCA 4C92C 4NL3A 5LJ5f 4C8QB 4JRIA 5GAN5 1Y96B 3JCMb 3JCMP 4M77B 4A54A 2E41A 4C8QA 1Y96A 5GMKh 5GANg 1I8FA 3EFRA 2DTIA 4M77A 4M7AE 1BIAA 2CGHA 2DEQA 2E10A 3RIRA 4PJOD 4XTYA 4M7DF 2E65A 3M4GA 5GANj 5GANd 2DXTA 4M78B 3FIFA 2RM4A 1H641 4XU2A 3SWNC 5GMKe 1TH7A 3PGGA 4M78A 4PJOE 1B34B 4RCBA 4JUVA 4WF2A 3JCMc 5LJ3h 1YCYA 5LJ5g 4HT9A 1I4K1 4C8QF 2DVEA 3JB9F 4XTUA 1WNLA 1M5Q1 4M77F 3V8LA 4EMGA 4M7AF 5LJ3f 4EMKA 1I5LA 2DTOA 4M75A 1N9RA 2VC8A 4N0AA 5LJ5j 5GAMf 3JCMJ 1HXDA 5GAOr 4V2SA 1LOJA 4PJOG 1LNXA 2DJZA 3EFSA 3V7RA 3BDUA 4JRKA 3V7SA 4M7AC 2K57A 4J6XA 4Y91A 4DQ2A 5GAOl 4M78F 4QVDA 4F7UE 3HFNA 4OP0A 2RD1A 4NL2A 5GMKj 4JLIA 5GAN4 4C92E 3BW1A 1X01A 5LJ5e 4PNOA 4XU0A 5CAIA 4PJOB 2DKGA 4X9DA 4M75F 4PJOA 3QSUA 5GAOq 3GIBA 5LJ3g 5GAN7 3HSBA 5GAN8 3SB2A 1N9SA 5GAMg 4F7UG 1BIBA 4RCCA 3JCMh 2EWNA 1D3BB 1U1TA 4C92G 4EMKC 3V8KA 5LJ3j 4M75C 4M7DC 2DXUA 4MMLA 3JCMf 1D3BA 1B34A 2DZ9A 4XU1A 1HK9A 1WQWA 3INZA 3RKXA 1JBMA 3RKWA 3JCMV 5GAMh 3JCMW 3HFOA 4F7UB 3BY7A 2FYKA 5LJ5d 4C92B 2DTHA 4PJOF 3L2ZA 3JCMX 4F7UA 4XU3A 4C8QC 3JB9D 4XTZA 4C92D 5LJ3e 4M7AD 4M77C 3JB9I 2EJFA 3RKYA 5GAMe 4XTXA 4XTWA 5GMKm 5DY9A 3L1AA 4X9CA 4M77E
chains in the Genus database with same CATH superfamily
4L5GA 2COYA 2CUBA 3BE3A 2DBMA 2JJ9A 4D8KA 2FB7A 3SWNB 2A08A 1YBYA 1IXDA 4QQDA 3JB9G 1WJQA 1YCSB 3I35A 1S72T 1PHTA 4LXCA 2D9TA 2E5KA 1FWZA 3VYGA 1D09B 2GBQA 5FRMA 3UA7A 4GLKA 4AFZC 5GAOn 3CCLQ 2BZYA 3EHRA 2F2VA 3J80E 2LJ1A 2A3LA 1M90U 1VQMQ 2XI9A 1VQLQ 2VYTA 4JLGA 2RHUA 4FYXB 4C92C 1Y96B 3JCMb 4C0GA 4K11A 1K0SA 2QGFB 1KHCA 5DLQE 2D0NA 4FYVB 1X75C 1QVGS 3FIFA 4BE2A 1YJNT 1Q95G 2HMAA 1KC8C 1PCXA 4RCBA 3C12A 4JUVA 2YUOA 1I1JA 4C8QF 1G8XA 1VQKT 1TS9A 1ABOA 1I5LA 1JQQA 2YUNA 3CMET 5KYUA 1LOJA 2VGNA 1VOMA 3MP6A 3HFNA 3H41A 1ZHIA 1K0XA 3TVTA 2EQJA 2RMOA 4FSXA 3UDCA 5GAN7 3FDRA 1IB8A 2DVJA 3EGDB 3X25B 2E3IA 4FT2A 2FPFA 4DBHA 3MJXA 1W2BA 4XU1A 3LGLA 3RKWA 3VS5A 4HXJA 1UEBA 1S72A 3L2ZA 2ED0A 1C0MA 3H0FA 3G6EQ 4M77C 1HSQA 4LDXA 2LQKA 2D0QB 2YLBA 4NOYA 4E7ZA 3MHXA 2LVMA 2M0YA 2M16A 3JB9H 4RMOA 1LJOA 5KYYA 3JCMQ 2DL5A 3QZ5B 1RADB 4CI0C 4BI8B 3ME9A 1CKAA 4M7AB 4D6WA 1VQ9Q 2A0FB 1Q82R 1VQNT 1SPKA 2A37A 3QHSA 2YHTA 4BI3A 4M75G 5I21A 2RHIA 1YWOA 4EPCA 3TEEA 5FWCA 2RQVA 4ZGEB 2RK2A 3I56Q 1VQ4T 1YJNA 4AG1C 4J6WA 4C8QG 2JM8A 6AT1B 1WI7A 3HKSA 2Y90A 3CXCS 2GF7A 1VQKA 2DX1A 2JMAA 1X6OA 1YITQ 3UATA 3CMEA 2E6ZA 4C8QA 4FM4B 4RTWA 4OMFB 1X27A 3M0QA 2EYXA 2BIVA 4PJOD 1W4SA 2X3XD 2PU9B 4LUEA 2ABLA 1W1FA 1N8RU 1LCKA 1PD0A 2VB6A 3CCRQ 2H3JA 2VWFA 1KJWA 4J7IA 1NJIC 2ED1A 1B7TA 4C0ZA 1QCFA 1LNXA 1VQ6T 1YI2Q 1KQSS 1D0XA 2HSEB 3R6NA 2K57A 4OP0A 2EBPA 3ASKA 1NPRA 3O8VA 3CCQA 1YJWT 3ZBDA 2K3XA 1K9MR 1N9SA 4OVAA 4BDYA 3OYAA 3GNFB 1UECA 2VVKA 3M59A 4MMLA 1M90C 2G6FX 2AZVA 3HPWA 3OYMA 3RBBB 2DL4A 1A0NB 2MPXC 4RTXA 4JPBW 2DXBA 5KYXB 1BK2A 1KK7A 1VQNA 4DEYA 2RB6A 3CQTA 2HKQB 4LE9A 5EG2A 4XQ3A 1E7OA 3A8LB 3PIPA 2CT3A 3CC4A 3IQLA 1RLPC 1VQ4A 2JN0A 2DIQA 4XTVA 1QP2A 2EJGA 4M7DE 3OB9A 2P84A 3SDZA 5HK3A 2MMPA 4BACA 5KYWA 4IUVA 4M78D 3CPWP 3OYJA 2HEQA 3KBGA 2Z0WA 5FU6B 4A4EA 3CCLT 2CZ0B 2HQHA 3VYHB 3ZL7C 1QVFP 4JJBA 3CCJQ 1IO6A 1OV3A 1K8AR 1VQ6A 4KGVB 3QJ6A 1U3OA 5GMKh 1VQMT 4QQ6A 2FHDA 5CQXA 2M0OA 2FO0A 2DYBA 2DXTA 2K5FA 2CZ7B 3REBB 1YJWA 2AZSA 3CCST 2LZ6B 4N4GA 1FYNA 4J8OA 2P0PA 5LJ5j 5IAYA 1UE9A 2HL5C 4PLIA 3A8GB 3EH2A 2KSSA 3VRYA 4MDXA 3SD4A 1X01A 2RK1A 3JV3A 2MAMA 1RAHB 2ROLA 2NUPA 2NUTB 2SEMA 2HL3A 1D3BA 2ZPEB 2JTMA 1PNJA 1TTHB 3HFOA 2HDAA 2BZXA 3OQ5A 2YDLA 4C92D 5GAMe 4OMMA 3E1SA 3I5SA 1TUCA 3M4GA 5C6SA 1R0BG 2EPDA 2EGEA 1WPYA 2DRKA 1ZX6A 4QQGA 1OEBA 3M0SA 1TUDA 4A4HA 4CRIA 5GANf 1XQHA 3NHNA 3RUXA 2F2WA 1ZSZA 4M78E 4IKFA 2SRCA 4FW2A 4LD6A 1N8RC 4HCBA 2X4JA 3HRTA 2B86A 3CCLA 1PSFA 1NEBA 2XIDA 2FZCB 1NBEB 2XKOC 1H3HA 5FW9A 3V7CA 4DOWA 1VQMA 4L59A 1Y7XA 1S72Q 1U06A 4A4KA 3EAEA 1QCNA 2FPEA 2VXFA 3FLGA 3QIIA 2F2XA 5GAOm 2QQAA 4GY5A 4M7DB 2LCLA 5FRNA 3G1JA 2HBPA 4EMHA 2RQRA 3CCSA 3FJPA 1NZ9A 4LN2A 2ATCB 3EG1A 1GBRA 4JRIA 2K3YA 3I56T 2IVWA 2XU8A 4M7AE 3RR6A 4MZMA 4Q5WA 4O5VA 1NEGA 1QVGP 3PGGA 1B34B 1ZA1B 2O88A 3JCMc 2LQWA 4J9FA 1G3SA 2M1HA 2L5QA 3M55A 1LPLA 3OSSC 2JXBA 3GOXA 4RKUE 1M30A 4QW2A 1GL5A 4C92E 1TUGB 5AT1B 1VQKQ 2V1QA 3GIBA 2LT4A 4F17A 1QKXA 5KH6A 3CMEQ 4GBQA 3WVDB 4O6JA 2QDYB 1MMNA 2DBKA 1OPKA 2CREA 2JS2A 3JB9D 1UGVA 5LJ3e 3CC7Q 4J7FA 3J7AF 2IIMA 1KHIA 3M0UA 5GMKm 1V29B 1ZQ1A 3CCVT 2LQ8A 1IREB 4ZNXA 2K6DA 2QEXQ 2LNVA 5KE3A 1BB9A 5J39A 4J5YA 3CCQQ 1WQ7A 2E12A 5GAMj 4JRQA 1K9AA 3M56A 3MKDA 1BI1A 3QYGB 4VUBA 3I56A 1NYGA 3R6OA 1AVZC 4PJOC 5L8RE 4II1A 2HBWA 1NLPC 1H3ZA 3LH5A 1ZSZC 4KGZB 1GCQC 2E1HA 4KH0B 1UGQB 4ESRA 1VQNQ 1OU9A 1QCOA 1KQ2A 2O4XA 3CXCP 2ZGWA 1AEYA 2I0NA 3MEVA 3EG3A 2GFAA 4TVRA 3CC4Q 4AFQC 1AT1B 2GTOA 1IRXA 1VQ4Q 3QZ9B 2IG0A 2KMTA 4OMPA 1AWOA 2C0OA 3CCJT 1W2BS 1TH7A 5CK9A 2K2VA 4ZN1A 3P8DA 2D8HA 3JB9F 1G83A 1T3LA 1M5Q1 4D8DA 2O01E 4PJMA 2QTVA 2M9UA 1HXDA 2W0ZA 3CEYA 3X28B 2DJZA 1KQSP 3V7SA 3NFCA 4DQ2A 4JJDA 4JLIA 2NWMA 1MNDA 1D1CA 2V8IA 1LVKA 1Q7YR 1Q86U 1TXQA 1HYOA 5GAOq 3H0HA 3CCVA 1WXBA 3TSWA 3A1PA 1YHQQ 1KD1R 4B6MA 1H92A 3VV0A 4BDZA 2DIGA 2VUBA 3BDLA 2DRMA 4C92B 1QWEA 1YJWQ 3P8BB 2CDTA 5I2SA 1JEGA 1IGQA 2L89A 3HRSA 3G4ST 2AKKA 2O2OA 3RKYA 3LWHA 3M0TA 1OU8A 2PVDB 3E9GA 3HRUA 2JVVA 2HNIA 5GAN6 3O5ZA 4M78C 1OX8A 2COWA 3SWNA 1X43A 1OX9A 4M77G 4M75D 1WFWA 2O9VA 2DEUA 4X1VA 5CKEA 4ELZC 3JCMe 4LD9K 4C8QD 1WYXA 4FW1A 2ENMA 1X69A 3PIOA 2DLPA 5GAN2 1WA7A 5IHIA 5GANh 3OYEA 1WHMA 4LDVA 1JXMA 3ULRB 5CCAA 3CCJA 1Q81R 1OPLA 3THKA 1NJIU 5GAOp 5CQYA 2OX7A 3OBYA 1XNIA 3TQ7P 2DFUA 5C0MA 2HSPA 4NL3A 3JCMP 3CD6T 2K5LA 4M77B 4RTYA 1Y96A 2K79A 2CUDA 2DAQA 1WHGA 1N8RR 4P5NA 3OA6A 3AT1B 4XU2A 3QWXX 2RHYA 2WSCE 1VQPQ 1YCYA 2XDPA 3VS1A 4EMKA 4BE1A 1PD1A 4AT1B 2EKOA 3EFSA 4JRKA 2QI2A 2RPNA 1PKTA 2VV5A 4F7UE 3G4SA 1SRMA 3CCSQ 4RUGA 4E2FB 1M1KU 4FT4A 4M75F 4DBQA 2JM9A 1QVPA 2R5AA 2FEIA 5CKBA 2DILA 4B9XA 4JDSA 3OYLA 1M1FA 2L8DA 2DXUA 1RAAB 3EGDA 2PVOB 1M9SA 2QYZA 2DTHA 5A2QE 4XU3A 2Y4XA 5HCKA 3WXMB 4MZPA 1RI0A 2ZPGB 1U1SA 5GJWB 3CC7T 1RAIB 4M7AG 3KXTA 2C06A 5GAMd 1PG5B 2DL3A 2QEXT 4EDUA 1YNZA 2RI3A 1SHGA 3VU3C 4PFPA 3CD6A 4M7AA 3PFSA 3VKIA 2C0IA 4C5HA 3CCQT 1UJ0A 1UB4A 1Q86C 1MGQA 2EYQA 2HCKA 3PE0A 4A4FA 3S6WA 3SHWA 4Y92A 1UHFA 3PMTA 5FLXE 4QKUA 2EQMA 1JB0E 4LDYA 1M8MA 2XG8D 4JJNK 4R56A 1FXXA 5DLOA 2E10A 3SFMA 3GLXA 4J9HA 5CKFA 1GBQA 2FZGB 3NGPA 5I2MA 3CC4T 2YUPA 1M1GA 1WNLA 1ZBXA 2BUDA 4M75A 3CCUT 1QKWA 1R8OB 5M9OA 2RJDA 3BDUA 1JJ2A 2X51A 2RNAA 2V1RA 2E3HA 1OQKA 2YRCA 2RD1A 4ANJA 2RN8A 5LJ5e 2MWPA 1YFNA 2V26A 3EGXB 2HQXA 4R0KA 1PSEA 1FMKA 5KYYB 4X34A 5FWBA 4IURA 4EMKC 3CC7A 1VIFA 4RG2A 2LDMA 3SEMA 2NUZA 3A5ZB 3S3NA 4RTTA 4F7UB 2FYKA 1YHQT 4ZN3A 2QEXA 4XTXA 1VQ7T 2PZ1A 1VQOA 1D0ZA 5GJVB 1M8VA 1GRIA 2RHXA 2DE0X 3EG9B 4KULA 5LJ3d 4BE0A 2JS0A 3CCVQ 4LUDA 5KCHA 3CCMQ 3D7SB 2DETA 3J81E 2GFUA 2YXYA 2LJ3A 3I9QA 3UWNA 1M1KC 2DPPB 2YSQA 2NLUA 4J6YA 2F5TX 1SKUB 3QYHB 4ZGJB 4C5GA 4PJNA 3L2RA 1KQ1A 2RQWA 3CC2T 2QAZA 2CT4A 3CCUA 3M53A 2CP3A 3QXEB 2HZYA 1W6XA 3S3MA 4OGCA 4M4ZA 3RIRA 1Y57A 3FEOA 4M7DF 2W10A 1UHCA 4C0DC 3UF4A 1W2BP 4PJOE 3NMZC 2DF6A 5LJ3h 4OMOA 2OTLA 1K73R 2QASA 2P4RA 5HY6A 2RO0A 3OYNA 4N0AA 1ZLMA 1WXUA 4E7IA 5GAOr 3VS3A 3X24B 3E2UA 4IUTA 1VQPT 2DM1A 1YHQA 4QVDA 2A28A 4BI4A 1VQ7A 1RLQC 1T0JA 4C0FA 4WTOB 2YT6A 1GXIE 3NPFA 1RUWA 2ZPBB 4M75C 1BI3A 2AK5A 4PJJA 3LGFA 1YN8A 2D8JA 2EFIA 1E6GA 4PK4A 2WSEE 4C8QC 2RF0A 1X6BA 4J9CA 2PVGB 2R5MA 2EJFA 2XHCA 1VQ8A 5HK0A 1VUBA 3RERA 1Q82U 2HAXA 2NYSA 1Y07A 2WSFE 2EVRA 2QK0A 4J83A 3C95A 1X6GA 3G4SQ 3DLLA 1XJWB 2CH4W 3OW2A 3MEUA 3MEWA 2J6OA 3PVLA 5GMKi 1SEMA 2LP5A 5KCOA 1V76A 3CC2A 8ATCB 4HCCA 3V8JA 1M3CA 4CC4B 3JAME 2CKKA 3QKJA 5FROA 1EX4A 3EH1A 4AFSC 1KC8R 4CC2A 4M7DG 4KH1B 3C4SA 4PFZA 1TWBA 3LH0A 3OYKA 3RESA 2JOYA 5KYNA 1EIFA 3DKMA 3JCMd 3WVEB 4JZ4A 1ABQA 2J06A 4M7DA 2VXEA 2XK0A 1BYMA 1IHVA 4E7KA 4ATOA 1N6AA 1QW1A 5J26A 1PM3A 5GANg 1VQPA 1ZSGA 1RI9A 4BUGA 2OAWA 3RMSA 1M2VA 2NUPB 4RG8A 2RM4A 3I55Q 3QDFA 3E9FA 3CD6Q 4JZ3A 1K9MU 1SRLA 3L2VA 1SSHA 5CKDA 4PL6A 3LW5E 3V7RA 1QLYA 3I5RA 1WZOA 1ARKA 3EFOB 4J9DA 1AOJA 1TG0A 2QQSA 4PJOB 3OYIA 9ATCB 1O9SA 1UTIA 1ZSZB 3JCMh 3M5AA 2DZ9A 3HP9A 3MEAA 5FU7C 3LLRA 1R77A 1M2OA 2MYSA 1EFNA 4Z89A 4RTVA 2L3PA 3H6ZA 2MF2A 3H8ZA 2FL7A 2DYIA 2BTTA 1WXTA 3MCAB 2QDLA 1RACB 1AWXA 4KT0E 2F1LA 2FVUA 2KROA 5IT9E 2O31A 4N4HA 4M78G 2E70A 2AT1B 2FRYA 2LJ0A 4FSSA 3VRZA 1K8AU 1VQ5A 2EYZA 1D1BA 2KBTA 4A53A 1M3BA 1IGUA 1PC0A 1M27C 3CCMT 4MMKA 1NJIR 1BCMA 1CKBA 3VS0A 2OI3A 1MMGA 1R0CB 3CMAQ 4OB1B 1VQOQ 1VIEA 3VUBA 2K5IA 4OMLA 2ZPIB 3EFRA 5CKHA 1BBZA 3FJ5A 1BCOA 3LWIA 1SG5A 1M90R 4M78B 1Q82C 5GMKe 2KT8A 3GPLA 4XTUA 3A8OB 1YWPA 4M77F 5GAMf 3OBWA 1BKBA 1NLOC 2DL7A 3OMGA 3META 4KUIA 2LCSA 3T9NA 2K2MA 2KGTA 3HL8A 5L23A 5CAIA 3CCEQ 1JO8A 2EYYA 4IUQA 3OYDA 3CCUQ 4JS4A 5GAN8 3P8HA 5GAMg 4C92G 4FYWB 2XICA 4E47A 1HK9A 4FIBA 2ZPFB 1HD3A 5LJ5d 4AMCA 5CVIA 2RJEA 4BY6C 4M7AD 2YRVA 2OTLQ 2A36A 2GQVA 1I0CA 3FRNA 1J3TA 4OB3B 1TOVA 1MMAA 3A8HB 2YRDA 3MP8A 3PT9A 1I81A 2RQUA 1MMDA 3CCMA 5A0LA 2E4HA 1UGPB 1K9MC 4LDUA 1VQ7Q 2O9SA 2AKLA 3UPUA 2FG0A 3CPFA 2EGCA 3VS6A 1WHLA 1I5OB 2K4YA 1JRIA 4ME7A 1VYVA 2JUFA 4RTUA 4E6RA 3OS0A 3QO3A 2VKNA 1VQ8Q 2XMFA 2K3BA 3OY9A 1JJ2S 5HKCA 2DNUA 1MV3A 3BFMA 3H9NA 5LJ5h 2GQIA 2QQBA 3DB3A 1G3YA 2Y4YA 2L2PA 1UUEA 4E7HA 1U5SA 4M77A 2RJFA 1UDLA 3UA6A 3CC2Q 2CP5A 3RDVA 1Z9ZA 2CP7A 5D6YA 2XDBA 1I4K1 2B8AA 2DK3A 4M7AF 3DB4A 5LJ3f 3F70A 3MPUB 1H8KA 3I55T 1RAFB 5GAOl 1AHJB 2QG9B 4NL2A 2RH2A 4OB0B 4F16A 5GMKj 2RJCA 3A8MB 1WX6A 2KDSA 1K8AC 2HQEA 3U23A 5LJ3g 1NM7A 3PMIA 4RCCA 1U1TA 2LC4A 1EZZB 4LDWA 2COZA 2DD4A 2DJQA 4Z8AA 3EG0A 4HVUA 5J3BA 1K76A 2K7AA 2PUOB 3OS5A 2IPOB 2V8JA 4PLLA 5CIUA 1OI1A 3L2QA 1T3SA 4J9GA 3LX7A 3FB9A 1MUZA 5I22A 4F7UF 1D1AA 2KAFA 4E7SA 3JRZA 5D6XA 2BE9B 1BU1A 3C94A 1NG2A 4M75E 1YJ9T 4ZTFA 2YWWA 2PUKB 3KFVA 1BI2A 4UC4A 4C8QE 4HT8A 3ZEHA 4RTZA 3OYFA 3MP1A 4LNPA 5AYFA 3AHUA 2MIOA 4EMKB 3QPHA 1K4US 2H8HA 2PNIA 2RI5A 1ZBJA 2ECZA 3HTRA 5GMKl 1RAGB 2EGAA 4JJCA 2YLCA 1P92A 4B9WA 5DM7R 2HKNA 3I55A 1UFFA 4IUUA 2R57A 2M02A 3REAB 2KYBA 3OYGA 1UJYA 4HCZA 3M54A 2CGHA 3CMAT 3L42A 1VYUA 1VQOT 5ECAA 2KRNA 3X26B 3SWNC 4JRPA 1Q7YU 1FMVA 4DBRA 4WF2A 2OAUA 1VQ5Q 1KD1U 3CPWA 4EMGA 1YP5A 5KYUB 5I11A 3LYIA 1PRMC 2L0AA 2VC8A 1KIKA 1F1BB 4V2SA 2QXFA 1VYTA 1FX7A 4J6XA 3GBQA 4AFUC 2CSIA 2LCCA 1QVFA 2P0KA 4F14A 1B07A 4IUPA 2DXCA 2DKGA 4ZGDB 4FYYB 4OGEA 2DD5A 3OW2S 3EGXA 4F7UG 3X20B 2LTOA 3TREA 4DBFA 3JCMf 3OYBA 2X4XA 2DL8A 5GAMh 5A0DA 3CCET 1MV0B 2OTJQ 5EC7A 4J9EA 4F7UA 1YJ9A 3QBYA 3QWYA 1WHHA 2JZ2A 3GF5A 3JCMg 3UT1A 3URGA 4C0DB 3OSVA 2OJ2A 2QTXA 3QUIA 1GFDA 2CS7A 2KT1A 5CR2A 2CP0A 4HA8A 2OTLT 2QA4T 1OZ3A 2K9GA 4M7DD 2BKDN 1ZA2B 2KE9A 1Q81U 3EG9A 2J6KA 3EGUA 1QP3A 4QT7A 2GGRA 2AHJB 5GAN3 2XD0A 2XDDA 4QVZA 1AZGB 2KYMA 5KYXA 3PVQA 4DEXA 3QG1A 3CMAA 3L2WA 2PTKA 3KUFA 3E19A 1AZEA 3OS1A 2FRWA 4BD3A 2MK5A 4M75B 1SF9A 4ELYC 5GANe 1WJSA 1CSKA 2RQTA 4OF1A 3VUZA 4C8QB 5GAN5 1KFZA 4Y28E 1VQ8T 4A54A 3G71T 4J9BA 4KBMB 4E7JA 3EG2A 1YIJT 2QQ9A 1QMCA 1KG1A 2D6FA 1H641 4FL6A 3M0PA 4WCIA 2ZAEA 1WHKA 2BE7D 1OZ2A 2DVEA 3TSZA 1AWWA 2GTJA 3JCMJ 3CCEA 1JU5C 2LT1A 4M7AC 2ROTA 4Y91A 5LL6S 5GAN4 3PTAA 4PNOA 1PWTA 4X9DA 2X4YA 4R55A 4IIOA 2YUQA 2GCXA 2L3RA 4BB7A 2EKHA 2RHZA 3S3OA 1QVGA 2QA4A 3CBPA 3INZA 3JCMW 1JBMA 2JW4A 2JTEA 4PJOF 3JCMX 2LNHB 4DA4A 2DERA 2VGMA 2PQWA 5DY9A 3VJPA 4X9CA 2J05A 4YTLA 1W70A 4EIKA 2LQNA 1GCPA 2EAYA 3GNGA 3RNJA 5IXFA 2KRSA 1Q7YC 2QQRA 2P0QA 2ZZDA 2NUTA 1KD1C 2GNCA 2DO3A 2LMJA 4KUDK 1SSFA 2RA2A 3N5BB 2KI7A 5KYWB 1VQLT 3G71A 2EQKA 5CO7A 1WJRA 1AD5A 5IH2A 1TU0B 1YIJA 3OMCA 2F5KA 5D6WA 1U8RA 2MI6A 4CC3A 2F69A 1JJ2P 5FU7B 4NS5A 4XAXB 5LJ5f 4KGXB 2V8KA 2DTIA 1BIAA 2MOXA 4MDWA 5GANj 1G3WA 2D1XA 3TCJA 2H3EB 2X3WD 4Z88A 1WLPB 2X35A 5LJ5g 1OYXA 1XOVA 4C5EA 4A63B 1I07A 1AWJA 2DTOA 2C0TA 1Q81C 2MCNA 4PJOG 1JXOA 3ER0A 3G7ZA 3CXCA 2KNBB 1Y71A 1WHJA 2CZ6B 4M78F 5KE2A 1VQ5T 4XU0A 3EFOA 2EYWA 4XK8E 4PJOA 3G6ET 3SB2A 3NTKA 1BIBA 1Y0MA 1D3BB 1ZUUA 4FU6A 3V8KA 1GCQA 1IHWA 2L3SA 1B34A 2VASA 1O75A 5FU6C 2J6FA 1UG1A 3JCMV 4A4GA 4GLMA 5IN1A 2AIRB 3BY7A 3M57A 1Z9QA 1RAEB 4IIMA 1NYFA 4N4IA 2FPDA 3VS7A 3OYHA 1S1NA 1Q86R 2QGGA 3L1AA 1IZ6A 1KQSA 1VQLA 5A0GA 2HD0A 3CBMA 2OTJT 1VQ9T 3FC3A 4FCYA 2KK4A 4HVWA 3JB9J 4N0AC 2WACA 2X9HA 1DJ7B 3ZFJA 2KXCA 1RABB 4M77D 4JS5A 2P4TA 2JMCA 4QVCA 2DZCA 2EW3A 2J7IA 1M2VB 2MWOA 2ZPHB 1TSFA 1YITT 1E6HA 2JT4A 5IHKA 3CBOA 1YJ9Q 3C0CA 1HJDA 4C92F 2E64A 1V1CA 3H0IA 4ORZA 3L2UA 1K73U 2I2LA 3RMQA 1M3AA 1YJNQ 4BY6B 3CCRT 1I8FA 1OULA 4OMQA 2DEQA 4PJLA 4XTYA 1SHFA 1M4ZA 2KVQG 4OB2B 1YI2T 2KQWA 1GFCA 1VA7A 3OYCA 4ZTJA 2M51A 4M78A 3G6EA 1PRLC 2ZCFB 4HT9A 3TU4K 1C6VX 1N9RA 3OS2A 2CSQA 1ZUYA 4PKCC 1KSWA 3DLMA 3BW1A 1K1ZA 1MHNA 1N27A 2CZ1B 4CC7A 1X2KA 3HSBA 4AG2C 2KEAA 3OW2P 4PFOA 2OTJA 1QQJA 4C5IA 1VQ9A 4E7LA 4M7DC 3M9QA 1WQWA 3RKXA 2DMOA 2L3QA 5D7UA 1M1KR 3NTIA 2G3RA 3OYYA 2EQUA 2R58A 2X4WA 4Z02A 4M77E 4J9IA 3QJYA 1KC8U 2CP2A 1YITA 3QDRB 4L6V5 1D0YA 1PKSA 1NE8A 2LX9A 2KR3A 3VS4A 2CYZB 2JTFA 2EJ9A 3HHTB 4C92A 2QA4Q 1UGRB 3CCRA 2CH4A 3M58A 1WIEA 4OMNA 1G2BA 1ACMB 2DA9A 3CPWS 1YI2A 3NTHA 2O4XB 3A98A 1NPPA 2A7YA 5IHNA 1T0HA 2KXDA 1UGSB 1QVFS 1WGSA 3VS2A 3JSCA 2E41A 4HVVA 1B3QA 1C1AA 3M4YA 2LRQA 2E65A 3GP8A 5GANd 2E6NA 7AT1B 3Q1JA 4KRTA 1VQ6Q 2ESWA 8AT1B 2LX7A 1OOTA 2FZKB 3G71Q 3V8LA 1YIJQ 3MO8A 1ZUKA 1BI0A 4HKEA 1X2QA 1MNEA 1G5VA 1FMWA 1XTDA 2E5QA 2JNGA 3QSUA 3EHQA 1WDXA 4HCKA 3M0RA 1G3TA 2RI2A 4DOVA 2EWNA 2BZ8A 5LJ3j 4MZTA 4F04B 2EIFA 1N5ZA 1QWFA 2KY9A 1K73C 3PNWC 4XTZA 3JB9I 1RL2A 4XTWA 2EQIA 5IXBA 2CP6A 2KRMA
chains in the Genus database with same CATH topology
4L5GA 3RERA 1Q82U 2HAXA 3GF5A 1ZQ1A 3CCVT 1Y07A 3JCMg 3UT1A 2LQ8A 3URGA 4C0DB 1IREB 3OSVA 2FB7A 2QTXA 2WSFE 1YBYA 3QUIA 3SWNB 2CS7A 4J83A 5CR2A 2LNVA 3C95A 4HA8A 2OTLT 4QQDA 5KE3A 1WJQA 1OZ3A 2QA4T 3JB9G 3DLLA 4M7DD 5J39A 3OW2A 2BKDN 4J5YA 3MEUA 3MEWA 1WQ7A 1S72T 2E12A 5GAMj 1Q81U 5GMKi 1QP3A 5KCOA 2AHJB 5GAN3 4JRQA 3CC2A 2XD0A 2D9TA 1FWZA 3M56A 3VYGA 1BI1A 2XDDA 4HCCA 3QYGB 4GLKA 4QVZA 3V8JA 5GAOn 4VUBA 5FRMA 3I56A 3JAME 2CKKA 3R6OA 3QKJA 5FROA 4PJOC 3QG1A 5L8RE 4M7DG 4II1A 3CMAA 3L2WA 1H3ZA 3KUFA 3C4SA 3E19A 3J80E 3LH0A 3OS1A 3OYKA 2E1HA 2A3LA 3RESA 4BD3A 1M90U 2JOYA 4M75B 1EIFA 3DKMA 3JCMd 1UGQB 2XI9A 4ELYC 1WJSA 3WVEB 5GANe 1KQ2A 2O4XA 4M7DA 2VXEA 2XK0A 2VYTA 1BYMA 2ZGWA 4OF1A 3VUZA 4JLGA 2RHUA 4C92C 3MEVA 4C8QB 5GAN5 4E7KA 1Y96B 3JCMb 4ATOA 4C0GA 2GFAA 4TVRA 4Y28E 1N6AA 1VQ8T 1QW1A 4A54A 5J26A 1KHCA 5DLQE 3G71T 5GANg 1VQPA 3QZ9B 4KBMB 4E7JA 2IG0A 2KMTA 1YIJT 2QQ9A 4BUGA 3RMSA 1KG1A 1X75C 1QVGS 3FIFA 4RG8A 2RM4A 2D6FA 4BE2A 1H641 3CCJT 1YJNT 1W2BS 4FL6A 1TH7A 1KC8C 5CK9A 4RCBA 3C12A 2K2VA 3E9FA 4JUVA 4ZN1A 1K9MU 3P8DA 4C8QF 1OZ2A 2DVEA 3L2VA 3JB9F 1VQKT 1M5Q1 5CKDA 2O01E 4PL6A 1I5LA 3JCMJ 2M9UA 3CMET 1HXDA 3CCEA 3CEYA 2LT1A 1LOJA 2VGNA 2DJZA 3LW5E 3X28B 3V7RA 3V7SA 4M7AC 3NFCA 4Y91A 3MP6A 4DQ2A 5LL6S 3HFNA 5GAN4 1ZHIA 4JLIA 3PTAA 2QQSA 4PNOA 4PJOB 2EQJA 4X9DA 2V8IA 4FSXA 3OYIA 2X4YA 4R55A 1Q86U 3UDCA 1O9SA 5GAOq 5GAN7 3FDRA 3CCVA 2GCXA 2L3RA 3JCMh 4BB7A 2RHZA 3X25B 3M5AA 3S3OA 1QVGA 4FT2A 2QA4A 3VV0A 4BDZA 2DZ9A 3LGLA 3CBPA 3HP9A 3INZA 4XU1A 1JBMA 2DIGA 3MEAA 5FU7C 2VUBA 3JCMW 1UEBA 3LLRA 1S72A 3BDLA 4C92B 4PJOF 3L2ZA 3JCMX 3P8BB 5I2SA 2L89A 3HRSA 4M77C 4DA4A 2VGMA 3G4ST 3RKYA 4LDXA 3LWHA 2LQKA 2PQWA 5DY9A 3VJPA 4X9CA 2PVDB 2D0QB 3E9GA 4YTLA 3HRUA 2JVVA 3H6ZA 2MF2A 2YLBA 4NOYA 2HNIA 5GAN6 3H8ZA 2FL7A 4M78C 2EAYA 3GNGA 3MCAB 3MHXA 2LVMA 2M16A 3SWNA 1Q7YC 4M77G 3JB9H 2QQRA 2P0QA 4M75D 1LJOA 4KT0E 4RMOA 2ZZDA 3JCMQ 2FVUA 1KD1C 3QZ5B 5CKEA 4ELZC 4BI8B 4CI0C 2DO3A 3ME9A 5IT9E 3JCMe 4LD9K 4M7AB 4N4HA 4D6WA 4M78G 4KUDK 2E70A 4C8QD 1SSFA 1VQNT 2RA2A 3N5BB 1VQLT 3QHSA 3G71A 2YHTA 4BI3A 1K8AU 1VQ5A 3PIOA 2EQKA 5CO7A 5GAN2 4M75G 1WJRA 5I21A 5GANh 4A53A 2RHIA 3OYEA 1YIJA 3OMCA 4EPCA 2F5KA 3TEEA 4LDVA 3CCMT 4MMKA 4ZGEB 2RK2A 5CCAA 3CCJA 1VQ4T 1YJNA 5D6WA 1U8RA 4J6WA 2MI6A 4C8QG 2F69A 3HKSA 1NJIU 5GAOp 5CQYA 2Y90A 3CXCS 4OB1B 5FU7B 2GF7A 4NS5A 1VQKA 3OBYA 1XNIA 1X6OA 4XAXB 5C0MA 5LJ5f 1VIEA 4NL3A 3CMEA 3J7AF 3JCMP 3CD6T 2K5LA 4M77B 2E6ZA 3VUBA 2V8KA 4C8QA 2K5IA 4FM4B 1Y96A 2ZPIB 2DTIA 3EFRA 4OMFB 1BIAA 2DAQA 5CKHA 4MDWA 2BIVA 4PJOD 3LWIA 1W4SA 5GANj 4P5NA 1G3WA 4M78B 2PU9B 1Q82C 3TCJA 3OA6A 4XU2A 5GMKe 2RHYA 2WSCE 1N8RU 2X35A 5LJ5g 1YCYA 1OYXA 1XOVA 2XDPA 4XTUA 3GPLA 4C5EA 3A8OB 4M77F 2H3JA 4J7IA 4EMKA 1NJIC 2DTOA 4BE1A 5GAMf 3OBWA 2EKOA 1BKBA 4C0ZA 1Q81C 4PJOG 1LNXA 3EFSA 3OMGA 3META 1VQ6T 4JRKA 1KQSS 3ER0A 2K57A 3G7ZA 4KUIA 3CXCA 2QI2A 1Y71A 2CZ6B 4M78F 4F7UE 2VV5A 4OP0A 3T9NA 3ASKA 5KE2A 1VQ5T 3G4SA 3HL8A 1NPRA 4XU0A 3O8VA 5CAIA 4FT4A 3CCQA 4XK8E 1M1KU 4M75F 1YJWT 4IUQA 3ZBDA 3OYDA 2K3XA 4JS4A 4PJOA 5GAN8 3G6ET 3P8HA 3SB2A 1N9SA 1QVPA 3NTKA 4OVAA 1BIBA 2R5AA 5GAMg 5CKBA 1D3BB 4B9XA 4BDYA 4JDSA 4C92G 3GNFB 1M1FA 2L8DA 4FU6A 3V8KA 3M59A 3OYAA 3OYLA 2DXUA 2XICA 4MMLA 1M90C 1B34A 4E47A 1O75A 1HK9A 4FIBA 3HPWA 5FU6C 3JCMV 4A4GA 2ZPFB 3OYMA 5IN1A 2PVOB 3BY7A 1M9SA 3M57A 5LJ5d 2DTHA 2DXBA 5CVIA 2RJEA 2Y4XA 4XU3A 5A2QE 4BY6C 4M7AD 4N4IA 2YRVA 3WXMB 3OYHA 1VQNA 3L1AA 1IZ6A 1KQSA 1VQLA 2GQVA 3FRNA 2HD0A 2RB6A 5A0GA 4OB3B 5EG2A 3CBMA 3A8HB 2OTJT 4XQ3A 4MZPA 3MP8A 3PT9A 1VQ9T 3A8LB 1I81A 1RI0A 3PIPA 2ZPGB 1U1SA 3FC3A 3CCMA 3CC4A 3CC7T 1VQ4A 2KK4A 3JB9J 5A0LA 4M7AG 4N0AC 1UGPB 2JN0A 3KXTA 1K9MC 4LDUA 2C06A 2DIQA 4XTVA 5GAMd 1QP2A 2EJGA 2WACA 4M7DE 3OB9A 3UPUA 3CPFA 3SDZA 1DJ7B 2QEXT 4EDUA 2RI3A 3ZFJA 3VU3C 4M77D 4JS5A 5HK3A 3CD6A 4M7AA 2P4TA 2MMPA 3PFSA 3VKIA 2DZCA 1JRIA 2K4YA 4ME7A 4QVCA 4BACA 4C5HA 3CCQT 2JUFA 2MWOA 2ZPHB 1YITT 1UB4A 3OS0A 3QO3A 4IUVA 4M78D 1Q86C 1MGQA 2EYQA 3CBOA 4A4FA 3S6WA 3OYJA 4C92F 3KBGA 2E64A 3OY9A 1JJ2S 5FU6B 4A4EA 5HKCA 3CCLT 3BFMA 3PMTA 5LJ5h 2CZ0B 3L2UA 3DB3A 2QQBA 2I2LA 1K73U 3VYHB 3RMQA 5FLXE 2EQMA 1G3YA 1JB0E 4BY6B 2Y4YA 4LDYA 1VQ6A 4E7HA 2XG8D 3QJ6A 5GMKh 3CCRT 1I8FA 4JJNK 1VQMT 4M77A 4QQ6A 4R56A 2FHDA 1FXXA 2RJFA 5CQXA 5DLOA 2M0OA 2DEQA 2E10A 4XTYA 3SFMA 1M4ZA 2KVQG 3GLXA 4OB2B 2DXTA 2KQWA 1YI2T 3OYCA 2K5FA 5CKFA 2CZ7B 4ZTJA 1YJWA 5I2MA 4M78A 3CC4T 3G6EA 2ZCFB 5D6YA 4HT9A 2XDBA 1I4K1 3CCST 1M1GA 2B8AA 2DK3A 3TU4K 1WNLA 1ZBXA 4N4GA 4M7AF 3DB4A 5LJ3f 4J8OA 2BUDA 4M75A 1N9RA 2P0PA 5LJ5j 3CCUT 1R8OB 3F70A 5IAYA 5M9OA 3OS2A 4PLIA 2RJDA 3I55T 3BDUA 1JJ2A 3A8GB 2KSSA 5GAOl 1AHJB 4PKCC 2RD1A 4MDXA 4NL2A 2RH2A 3DLMA 4OB0B 5GMKj 3BW1A 2RJCA 3SD4A 1X01A 5LJ5e 1MHNA 1N27A 3A8MB 2KDSA 2MWPA 1K8AC 2HQEA 2RK1A 2CZ1B 2HQXA 5LJ3g 3HSBA 1PSEA 2OTJA 4C5IA 2MAMA 3PMIA 4RCCA 4X34A 1VQ9A 1U1TA 4E7LA 2LC4A 4IURA 4EMKC 3CC7A 1VIFA 3M9QA 4RG2A 4M7DC 1D3BA 2ZPEB 2JTMA 2LDMA 1WQWA 4LDWA 3RKXA 3A5ZB 2DD4A 3S3NA 3HFOA 4F7UB 3OQ5A 2FYKA 5J3BA 1YHQT 4ZN3A 4C92D 2QEXA 3NTIA 2PUOB 5GAMe 2G3RA 4XTXA 3OYYA 2EQUA 3E1SA 2R58A 2X4WA 3M4GA 3OS5A 4Z02A 2V8JA 5C6SA 4M77E 4PLLA 5CIUA 1VQ7T 1WPYA 1OI1A 3L2QA 1VQOA 3QJYA 4QQGA 1KC8U 5GANf 4A4HA 3LX7A 3FB9A 4CRIA 1YITA 1XQHA 3QDRB 4L6V5 1M8VA 3RUXA 2RHXA 1NE8A 4F7UF 4M78E 2LX9A 2KAFA 4IKFA 3JRZA 4LD6A 5D6XA 1N8RC 4KULA 5LJ3d 4BE0A 4HCBA 3C94A 2X4JA 3HRTA 3CCLA 2CYZB 4M75E 2JTFA 1PSFA 1YJ9T 2XIDA 4ZTFA 5KCHA 2XKOC 2PUKB 2EJ9A 3V7CA 3HHTB 4C92A 1BI2A 3J81E 4DOWA 1UGRB 4UC4A 4C8QE 3CCRA 1VQMA 4HT8A 2GFUA 4L59A 3M58A 3ZEHA 1Y7XA 3UWNA 1M1KC 2DPPB 4A4KA 3OYFA 3EAEA 3MP1A 2NLUA 5AYFA 3CPWS 4J6YA 1YI2A 3AHUA 2VXFA 3QIIA 3FLGA 5GAOm 3NTHA 2F5TX 4EMKB 2O4XB 2QQAA 3QPHA 1NPPA 2A7YA 4GY5A 4M7DB 2LCLA 2RI5A 1W2BA 3QYHB 2HBPA 4EMHA 5GMKl 3RKWA 5FRNA 4ZGJB 3CCSA 4C5GA 3FJPA 3L2RA 1KQ1A 1NZ9A 1UGSB 3CC2T 2YLCA 1QVFS 3CCUA 1P92A 4JRIA 1WGSA 4B9WA 5DM7R 2K3YA 3JSCA 3M53A 3I55A 3I56T 3QXEB 4IUUA 2E41A 2R57A 2IVWA 2XU8A 3OYGA 4HCZA 4MZMA 4OGCA 3M54A 2CGHA 3S3MA 3CMAT 3M4YA 2LRQA 3L42A 3RIRA 3FEOA 4Q5WA 1VQOT 2E65A 4O5VA 4M7DF 3GP8A 5GANd 2E6NA 3Q1JA 4C0DC 3X26B 3SWNC 4PJOE 3PGGA 4JRPA 1Q7YU 1B34B 4WF2A 3JCMc 5LJ3h 2OAUA 2OTLA 1KD1U 3CPWA 5HY6A 3V8LA 4EMGA 1G3SA 2RO0A 3LYIA 4N0AA 3OYNA 2VC8A 4E7IA 5GAOr 4V2SA 2QXFA 2M1HA 1FX7A 2L5QA 3X24B 3M55A 3OSSC 3MO8A 3GOXA 4RKUE 4IUTA 4J6XA 4QW2A 1VQPT 1BI0A 1YHQA 4QVDA 4HKEA 2LCCA 1QVFA 2P0KA 4C92E 4IUPA 2DXCA 1G5VA 2DKGA 4ZGDB 4BI4A 1XTDA 2E5QA 1VQ7A 4C0FA 2JNGA 3QSUA 3GIBA 4OGEA 2LT4A 2DD5A 5KH6A 3OW2S 1G3TA 1GXIE 2RI2A 3WVDB 4DOVA 4F7UG 3X20B 2EWNA 2LTOA 2ZPBB 4O6JA 2QDYB 3TREA 5LJ3j 4M75C 4MZTA 1BI3A 3JCMf 3OYBA 2X4XA 5GAMh 5A0DA 2EIFA 3CCET 3LGFA 2EFIA 2KY9A 1K73C 2WSEE 4F7UA 4C8QC 3PNWC 3JB9D 1YJ9A 4XTZA 5LJ3e 3QBYA 4J7FA 3JB9I 2PVGB 2R5MA 2EJFA 1RL2A 2XHCA 1KHIA 1VQ8A 4XTWA 5HK0A 2JZ2A 5GMKm 1V29B 1VUBA 4M7AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RER A;  2RB6 A;  2YLB A;  4NOY A;  1WPY A;  3JCM g;  2HNI A;  5GAN 6;  4XQ3 A;  4M78 C;  5GAN f;  2EAY A;  3FB9 A;  2FB7 A;  2QTX A;  1I81 A;  3QUI A;  3SWN B;  1M8V A;  3RUX A;  4F7U F;  1U1S A;  4HA8 A;  3SWN A;  4M78 E;  3JB9 G;  3JB9 J;  4M77 G;  3JB9 H;  4M7A G;  4M75 D;  4N0A C;  1LJO A;  2JN0 A;  5LJ3 d;  4J5Y A;  4M7D D;  3JCM Q;  1WQ7 A;  4XTV A;  5GAM j;  5GAM d;  2EJG A;  5GMK i;  4M75 E;  4M7D E;  5GAN 3;  3JCM e;  4M7A B;  4M78 G;  4C8Q D;  2EJ9 A;  3VU3 C;  3V7C A;  4M77 D;  3V8J A;  4C92 A;  5GAO n;  4M7A A;  2RA2 A;  4QVC A;  2DZC A;  1JRI A;  3QHS A;  2YHT A;  4C8Q E;  4HT8 A;  4PJO C;  5GAN 2;  4M75 G;  4M7D G;  5I21 A;  5GAN h;  4A53 A;  3QO3 A;  4M78 D;  3AHU A;  4J6Y A;  1MGQ A;  4MMK A;  2E1H A;  2VXF A;  3RES A;  5GAO m;  4EMK B;  4M75 B;  4J6W A;  3JCM d;  4C8Q G;  4M7D B;  4C92 F;  2E64 A;  5GAN e;  5GMK l;  4EMH A;  1KQ2 A;  5GAO p;  2Y90 A;  4M7D A;  2VXE A;  3FJP A;  3BFM A;  1KQ1 A;  5LJ5 h;  2ZGW A;  2I2L A;  2YLC A;  4C92 C;  4NL3 A;  5LJ5 f;  4C8Q B;  4JRI A;  5GAN 5;  1Y96 B;  3JCM b;  3JCM P;  4M77 B;  4A54 A;  2E41 A;  4C8Q A;  1Y96 A;  5GMK h;  5GAN g;  1I8F A;  3EFR A;  2DTI A;  4M77 A;  4M7A E;  1BIA A;  2CGH A;  2DEQ A;  2E10 A;  3RIR A;  4PJO D;  4XTY A;  4M7D F;  2E65 A;  3M4G A;  5GAN j;  5GAN d;  2DXT A;  4M78 B;  3FIF A;  2RM4 A;  1H64 1;  4XU2 A;  3SWN C;  5GMK e;  1TH7 A;  3PGG A;  4M78 A;  4PJO E;  1B34 B;  4RCB A;  4JUV A;  4WF2 A;  3JCM c;  5LJ3 h;  1YCY A;  5LJ5 g;  4HT9 A;  1I4K 1;  4C8Q F;  2DVE A;  3JB9 F;  4XTU A;  1WNL A;  1M5Q 1;  4M77 F;  3V8L A;  4EMG A;  4M7A F;  5LJ3 f;  4EMK A;  1I5L A;  2DTO A;  4M75 A;  1N9R A;  2VC8 A;  4N0A A;  5LJ5 j;  5GAM f;  3JCM J;  1HXD A;  5GAO r;  4V2S A;  1LOJ A;  4PJO G;  1LNX A;  2DJZ A;  3EFS A;  3V7R A;  3BDU A;  4JRK A;  3V7S A;  4M7A C;  2K57 A;  4J6X A;  4Y91 A;  4DQ2 A;  5GAO l;  4M78 F;  4QVD A;  4F7U E;  3HFN A;  4OP0 A;  2RD1 A;  4NL2 A;  5GMK j;  4JLI A;  5GAN 4;  4C92 E;  3BW1 A;  1X01 A;  5LJ5 e;  4PNO A;  4XU0 A;  5CAI A;  4PJO B;  2DKG A;  4X9D A;  4M75 F;  4PJO A;  3QSU A;  5GAO q;  3GIB A;  5LJ3 g;  5GAN 7;  3HSB A;  5GAN 8;  3SB2 A;  1N9S A;  5GAM g;  4F7U G;  1BIB A;  4RCC A;  3JCM h;  2EWN A;  1D3B B;  1U1T A;  4C92 G;  4EMK C;  3V8K A;  5LJ3 j;  4M75 C;  4M7D C;  2DXU A;  4MML A;  3JCM f;  1D3B A;  1B34 A;  2DZ9 A;  4XU1 A;  1HK9 A;  1WQW A;  3INZ A;  3RKX A;  1JBM A;  3RKW A;  3JCM V;  5GAM h;  3JCM W;  3HFO A;  4F7U B;  3BY7 A;  2FYK A;  5LJ5 d;  4C92 B;  2DTH A;  4PJO F;  3L2Z A;  3JCM X;  4F7U A;  4XU3 A;  4C8Q C;  3JB9 D;  4XTZ A;  4C92 D;  5LJ3 e;  4M7A D;  4M77 C;  3JB9 I;  2EJF A;  3RKY A;  5GAM e;  4XTX A;  4XTW A;  5GMK m;  5DY9 A;  3L1A A;  4X9C A;  4M77 E; 
#chains in the Genus database with same CATH topology
 4L5G A;  2COY A;  2CUB A;  3BE3 A;  2DBM A;  2JJ9 A;  4D8K A;  2FB7 A;  3SWN B;  2A08 A;  1YBY A;  1IXD A;  4QQD A;  3JB9 G;  1WJQ A;  1YCS B;  3I35 A;  1S72 T;  1PHT A;  4LXC A;  2D9T A;  2E5K A;  1FWZ A;  3VYG A;  1D09 B;  2GBQ A;  5FRM A;  3UA7 A;  4GLK A;  4AFZ C;  5GAO n;  3CCL Q;  2BZY A;  3EHR A;  2F2V A;  3J80 E;  2LJ1 A;  2A3L A;  1M90 U;  1VQM Q;  2XI9 A;  1VQL Q;  2VYT A;  4JLG A;  2RHU A;  4FYX B;  4C92 C;  1Y96 B;  3JCM b;  4C0G A;  4K11 A;  1K0S A;  2QGF B;  1KHC A;  5DLQ E;  2D0N A;  4FYV B;  1X75 C;  1QVG S;  3FIF A;  4BE2 A;  1YJN T;  1Q95 G;  2HMA A;  1KC8 C;  1PCX A;  4RCB A;  3C12 A;  4JUV A;  2YUO A;  1I1J A;  4C8Q F;  1G8X A;  1VQK T;  1TS9 A;  1ABO A;  1I5L A;  1JQQ A;  2YUN A;  3CME T;  5KYU A;  1LOJ A;  2VGN A;  1VOM A;  3MP6 A;  3HFN A;  3H41 A;  1ZHI A;  1K0X A;  3TVT A;  2EQJ A;  2RMO A;  4FSX A;  3UDC A;  5GAN 7;  3FDR A;  1IB8 A;  2DVJ A;  3EGD B;  3X25 B;  2E3I A;  4FT2 A;  2FPF A;  4DBH A;  3MJX A;  1W2B A;  4XU1 A;  3LGL A;  3RKW A;  3VS5 A;  4HXJ A;  1UEB A;  1S72 A;  3L2Z A;  2ED0 A;  1C0M A;  3H0F A;  3G6E Q;  4M77 C;  1HSQ A;  4LDX A;  2LQK A;  2D0Q B;  2YLB A;  4NOY A;  4E7Z A;  3MHX A;  2LVM A;  2M0Y A;  2M16 A;  3JB9 H;  4RMO A;  1LJO A;  5KYY A;  3JCM Q;  2DL5 A;  3QZ5 B;  1RAD B;  4CI0 C;  4BI8 B;  3ME9 A;  1CKA A;  4M7A B;  4D6W A;  1VQ9 Q;  2A0F B;  1Q82 R;  1VQN T;  1SPK A;  2A37 A;  3QHS A;  2YHT A;  4BI3 A;  4M75 G;  5I21 A;  2RHI A;  1YWO A;  4EPC A;  3TEE A;  5FWC A;  2RQV A;  4ZGE B;  2RK2 A;  3I56 Q;  1VQ4 T;  1YJN A;  4AG1 C;  4J6W A;  4C8Q G;  2JM8 A;  6AT1 B;  1WI7 A;  3HKS A;  2Y90 A;  3CXC S;  2GF7 A;  1VQK A;  2DX1 A;  2JMA A;  1X6O A;  1YIT Q;  3UAT A;  3CME A;  2E6Z A;  4C8Q A;  4FM4 B;  4RTW A;  4OMF B;  1X27 A;  3M0Q A;  2EYX A;  2BIV A;  4PJO D;  1W4S A;  2X3X D;  2PU9 B;  4LUE A;  2ABL A;  1W1F A;  1N8R U;  1LCK A;  1PD0 A;  2VB6 A;  3CCR Q;  2H3J A;  2VWF A;  1KJW A;  4J7I A;  1NJI C;  2ED1 A;  1B7T A;  4C0Z A;  1QCF A;  1LNX A;  1VQ6 T;  1YI2 Q;  1KQS S;  1D0X A;  2HSE B;  3R6N A;  2K57 A;  4OP0 A;  2EBP A;  3ASK A;  1NPR A;  3O8V A;  3CCQ A;  1YJW T;  3ZBD A;  2K3X A;  1K9M R;  1N9S A;  4OVA A;  4BDY A;  3OYA A;  3GNF B;  1UEC A;  2VVK A;  3M59 A;  4MML A;  1M90 C;  2G6F X;  2AZV A;  3HPW A;  3OYM A;  3RBB B;  2DL4 A;  1A0N B;  2MPX C;  4RTX A;  4JPB W;  2DXB A;  5KYX B;  1BK2 A;  1KK7 A;  1VQN A;  4DEY A;  2RB6 A;  3CQT A;  2HKQ B;  4LE9 A;  5EG2 A;  4XQ3 A;  1E7O A;  3A8L B;  3PIP A;  2CT3 A;  3CC4 A;  3IQL A;  1RLP C;  1VQ4 A;  2JN0 A;  2DIQ A;  4XTV A;  1QP2 A;  2EJG A;  4M7D E;  3OB9 A;  2P84 A;  3SDZ A;  5HK3 A;  2MMP A;  4BAC A;  5KYW A;  4IUV A;  4M78 D;  3CPW P;  3OYJ A;  2HEQ A;  3KBG A;  2Z0W A;  5FU6 B;  4A4E A;  3CCL T;  2CZ0 B;  2HQH A;  3VYH B;  3ZL7 C;  1QVF P;  4JJB A;  3CCJ Q;  1IO6 A;  1OV3 A;  1K8A R;  1VQ6 A;  4KGV B;  3QJ6 A;  1U3O A;  5GMK h;  1VQM T;  4QQ6 A;  2FHD A;  5CQX A;  2M0O A;  2FO0 A;  2DYB A;  2DXT A;  2K5F A;  2CZ7 B;  3REB B;  1YJW A;  2AZS A;  3CCS T;  2LZ6 B;  4N4G A;  1FYN A;  4J8O A;  2P0P A;  5LJ5 j;  5IAY A;  1UE9 A;  2HL5 C;  4PLI A;  3A8G B;  3EH2 A;  2KSS A;  3VRY A;  4MDX A;  3SD4 A;  1X01 A;  2RK1 A;  3JV3 A;  2MAM A;  1RAH B;  2ROL A;  2NUP A;  2NUT B;  2SEM A;  2HL3 A;  1D3B A;  2ZPE B;  2JTM A;  1PNJ A;  1TTH B;  3HFO A;  2HDA A;  2BZX A;  3OQ5 A;  2YDL A;  4C92 D;  5GAM e;  4OMM A;  3E1S A;  3I5S A;  1TUC A;  3M4G A;  5C6S A;  1R0B G;  2EPD A;  2EGE A;  1WPY A;  2DRK A;  1ZX6 A;  4QQG A;  1OEB A;  3M0S A;  1TUD A;  4A4H A;  4CRI A;  5GAN f;  1XQH A;  3NHN A;  3RUX A;  2F2W A;  1ZSZ A;  4M78 E;  4IKF A;  2SRC A;  4FW2 A;  4LD6 A;  1N8R C;  4HCB A;  2X4J A;  3HRT A;  2B86 A;  3CCL A;  1PSF A;  1NEB A;  2XID A;  2FZC B;  1NBE B;  2XKO C;  1H3H A;  5FW9 A;  3V7C A;  4DOW A;  1VQM A;  4L59 A;  1Y7X A;  1S72 Q;  1U06 A;  4A4K A;  3EAE A;  1QCN A;  2FPE A;  2VXF A;  3FLG A;  3QII A;  2F2X A;  5GAO m;  2QQA A;  4GY5 A;  4M7D B;  2LCL A;  5FRN A;  3G1J A;  2HBP A;  4EMH A;  2RQR A;  3CCS A;  3FJP A;  1NZ9 A;  4LN2 A;  2ATC B;  3EG1 A;  1GBR A;  4JRI A;  2K3Y A;  3I56 T;  2IVW A;  2XU8 A;  4M7A E;  3RR6 A;  4MZM A;  4Q5W A;  4O5V A;  1NEG A;  1QVG P;  3PGG A;  1B34 B;  1ZA1 B;  2O88 A;  3JCM c;  2LQW A;  4J9F A;  1G3S A;  2M1H A;  2L5Q A;  3M55 A;  1LPL A;  3OSS C;  2JXB A;  3GOX A;  4RKU E;  1M30 A;  4QW2 A;  1GL5 A;  4C92 E;  1TUG B;  5AT1 B;  1VQK Q;  2V1Q A;  3GIB A;  2LT4 A;  4F17 A;  1QKX A;  5KH6 A;  3CME Q;  4GBQ A;  3WVD B;  4O6J A;  2QDY B;  1MMN A;  2DBK A;  1OPK A;  2CRE A;  2JS2 A;  3JB9 D;  1UGV A;  5LJ3 e;  3CC7 Q;  4J7F A;  3J7A F;  2IIM A;  1KHI A;  3M0U A;  5GMK m;  1V29 B;  1ZQ1 A;  3CCV T;  2LQ8 A;  1IRE B;  4ZNX A;  2K6D A;  2QEX Q;  2LNV A;  5KE3 A;  1BB9 A;  5J39 A;  4J5Y A;  3CCQ Q;  1WQ7 A;  2E12 A;  5GAM j;  4JRQ A;  1K9A A;  3M56 A;  3MKD A;  1BI1 A;  3QYG B;  4VUB A;  3I56 A;  1NYG A;  3R6O A;  1AVZ C;  4PJO C;  5L8R E;  4II1 A;  2HBW A;  1NLP C;  1H3Z A;  3LH5 A;  1ZSZ C;  4KGZ B;  1GCQ C;  2E1H A;  4KH0 B;  1UGQ B;  4ESR A;  1VQN Q;  1OU9 A;  1QCO A;  1KQ2 A;  2O4X A;  3CXC P;  2ZGW A;  1AEY A;  2I0N A;  3MEV A;  3EG3 A;  2GFA A;  4TVR A;  3CC4 Q;  4AFQ C;  1AT1 B;  2GTO A;  1IRX A;  1VQ4 Q;  3QZ9 B;  2IG0 A;  2KMT A;  4OMP A;  1AWO A;  2C0O A;  3CCJ T;  1W2B S;  1TH7 A;  5CK9 A;  2K2V A;  4ZN1 A;  3P8D A;  2D8H A;  3JB9 F;  1G83 A;  1T3L A;  1M5Q 1;  4D8D A;  2O01 E;  4PJM A;  2QTV A;  2M9U A;  1HXD A;  2W0Z A;  3CEY A;  3X28 B;  2DJZ A;  1KQS P;  3V7S A;  3NFC A;  4DQ2 A;  4JJD A;  4JLI A;  2NWM A;  1MND A;  1D1C A;  2V8I A;  1LVK A;  1Q7Y R;  1Q86 U;  1TXQ A;  1HYO A;  5GAO q;  3H0H A;  3CCV A;  1WXB A;  3TSW A;  3A1P A;  1YHQ Q;  1KD1 R;  4B6M A;  1H92 A;  3VV0 A;  4BDZ A;  2DIG A;  2VUB A;  3BDL A;  2DRM A;  4C92 B;  1QWE A;  1YJW Q;  3P8B B;  2CDT A;  5I2S A;  1JEG A;  1IGQ A;  2L89 A;  3HRS A;  3G4S T;  2AKK A;  2O2O A;  3RKY A;  3LWH A;  3M0T A;  1OU8 A;  2PVD B;  3E9G A;  3HRU A;  2JVV A;  2HNI A;  5GAN 6;  3O5Z A;  4M78 C;  1OX8 A;  2COW A;  3SWN A;  1X43 A;  1OX9 A;  4M77 G;  4M75 D;  1WFW A;  2O9V A;  2DEU A;  4X1V A;  5CKE A;  4ELZ C;  3JCM e;  4LD9 K;  4C8Q D;  1WYX A;  4FW1 A;  2ENM A;  1X69 A;  3PIO A;  2DLP A;  5GAN 2;  1WA7 A;  5IHI A;  5GAN h;  3OYE A;  1WHM A;  4LDV A;  1JXM A;  3ULR B;  5CCA A;  3CCJ A;  1Q81 R;  1OPL A;  3THK A;  1NJI U;  5GAO p;  5CQY A;  2OX7 A;  3OBY A;  1XNI A;  3TQ7 P;  2DFU A;  5C0M A;  2HSP A;  4NL3 A;  3JCM P;  3CD6 T;  2K5L A;  4M77 B;  4RTY A;  1Y96 A;  2K79 A;  2CUD A;  2DAQ A;  1WHG A;  1N8R R;  4P5N A;  3OA6 A;  3AT1 B;  4XU2 A;  3QWX X;  2RHY A;  2WSC E;  1VQP Q;  1YCY A;  2XDP A;  3VS1 A;  4EMK A;  4BE1 A;  1PD1 A;  4AT1 B;  2EKO A;  3EFS A;  4JRK A;  2QI2 A;  2RPN A;  1PKT A;  2VV5 A;  4F7U E;  3G4S A;  1SRM A;  3CCS Q;  4RUG A;  4E2F B;  1M1K U;  4FT4 A;  4M75 F;  4DBQ A;  2JM9 A;  1QVP A;  2R5A A;  2FEI A;  5CKB A;  2DIL A;  4B9X A;  4JDS A;  3OYL A;  1M1F A;  2L8D A;  2DXU A;  1RAA B;  3EGD A;  2PVO B;  1M9S A;  2QYZ A;  2DTH A;  5A2Q E;  4XU3 A;  2Y4X A;  5HCK A;  3WXM B;  4MZP A;  1RI0 A;  2ZPG B;  1U1S A;  5GJW B;  3CC7 T;  1RAI B;  4M7A G;  3KXT A;  2C06 A;  5GAM d;  1PG5 B;  2DL3 A;  2QEX T;  4EDU A;  1YNZ A;  2RI3 A;  1SHG A;  3VU3 C;  4PFP A;  3CD6 A;  4M7A A;  3PFS A;  3VKI A;  2C0I A;  4C5H A;  3CCQ T;  1UJ0 A;  1UB4 A;  1Q86 C;  1MGQ A;  2EYQ A;  2HCK A;  3PE0 A;  4A4F A;  3S6W A;  3SHW A;  4Y92 A;  1UHF A;  3PMT A;  5FLX E;  4QKU A;  2EQM A;  1JB0 E;  4LDY A;  1M8M A;  2XG8 D;  4JJN K;  4R56 A;  1FXX A;  5DLO A;  2E10 A;  3SFM A;  3GLX A;  4J9H A;  5CKF A;  1GBQ A;  2FZG B;  3NGP A;  5I2M A;  3CC4 T;  2YUP A;  1M1G A;  1WNL A;  1ZBX A;  2BUD A;  4M75 A;  3CCU T;  1QKW A;  1R8O B;  5M9O A;  2RJD A;  3BDU A;  1JJ2 A;  2X51 A;  2RNA A;  2V1R A;  2E3H A;  1OQK A;  2YRC A;  2RD1 A;  4ANJ A;  2RN8 A;  5LJ5 e;  2MWP A;  1YFN A;  2V26 A;  3EGX B;  2HQX A;  4R0K A;  1PSE A;  1FMK A;  5KYY B;  4X34 A;  5FWB A;  4IUR A;  4EMK C;  3CC7 A;  1VIF A;  4RG2 A;  2LDM A;  3SEM A;  2NUZ A;  3A5Z B;  3S3N A;  4RTT A;  4F7U B;  2FYK A;  1YHQ T;  4ZN3 A;  2QEX A;  4XTX A;  1VQ7 T;  2PZ1 A;  1VQO A;  1D0Z A;  5GJV B;  1M8V A;  1GRI A;  2RHX A;  2DE0 X;  3EG9 B;  4KUL A;  5LJ3 d;  4BE0 A;  2JS0 A;  3CCV Q;  4LUD A;  5KCH A;  3CCM Q;  3D7S B;  2DET A;  3J81 E;  2GFU A;  2YXY A;  2LJ3 A;  3I9Q A;  3UWN A;  1M1K C;  2DPP B;  2YSQ A;  2NLU A;  4J6Y A;  2F5T X;  1SKU B;  3QYH B;  4ZGJ B;  4C5G A;  4PJN A;  3L2R A;  1KQ1 A;  2RQW A;  3CC2 T;  2QAZ A;  2CT4 A;  3CCU A;  3M53 A;  2CP3 A;  3QXE B;  2HZY A;  1W6X A;  3S3M A;  4OGC A;  4M4Z A;  3RIR A;  1Y57 A;  3FEO A;  4M7D F;  2W10 A;  1UHC A;  4C0D C;  3UF4 A;  1W2B P;  4PJO E;  3NMZ C;  2DF6 A;  5LJ3 h;  4OMO A;  2OTL A;  1K73 R;  2QAS A;  2P4R A;  5HY6 A;  2RO0 A;  3OYN A;  4N0A A;  1ZLM A;  1WXU A;  4E7I A;  5GAO r;  3VS3 A;  3X24 B;  3E2U A;  4IUT A;  1VQP T;  2DM1 A;  1YHQ A;  4QVD A;  2A28 A;  4BI4 A;  1VQ7 A;  1RLQ C;  1T0J A;  4C0F A;  4WTO B;  2YT6 A;  1GXI E;  3NPF A;  1RUW A;  2ZPB B;  4M75 C;  1BI3 A;  2AK5 A;  4PJJ A;  3LGF A;  1YN8 A;  2D8J A;  2EFI A;  1E6G A;  4PK4 A;  2WSE E;  4C8Q C;  2RF0 A;  1X6B A;  4J9C A;  2PVG B;  2R5M A;  2EJF A;  2XHC A;  1VQ8 A;  5HK0 A;  1VUB A;  3RER A;  1Q82 U;  2HAX A;  2NYS A;  1Y07 A;  2WSF E;  2EVR A;  2QK0 A;  4J83 A;  3C95 A;  1X6G A;  3G4S Q;  3DLL A;  1XJW B;  2CH4 W;  3OW2 A;  3MEU A;  3MEW A;  2J6O A;  3PVL A;  5GMK i;  1SEM A;  2LP5 A;  5KCO A;  1V76 A;  3CC2 A;  8ATC B;  4HCC A;  3V8J A;  1M3C A;  4CC4 B;  3JAM E;  2CKK A;  3QKJ A;  5FRO A;  1EX4 A;  3EH1 A;  4AFS C;  1KC8 R;  4CC2 A;  4M7D G;  4KH1 B;  3C4S A;  4PFZ A;  1TWB A;  3LH0 A;  3OYK A;  3RES A;  2JOY A;  5KYN A;  1EIF A;  3DKM A;  3JCM d;  3WVE B;  4JZ4 A;  1ABQ A;  2J06 A;  4M7D A;  2VXE A;  2XK0 A;  1BYM A;  1IHV A;  4E7K A;  4ATO A;  1N6A A;  1QW1 A;  5J26 A;  1PM3 A;  5GAN g;  1VQP A;  1ZSG A;  1RI9 A;  4BUG A;  2OAW A;  3RMS A;  1M2V A;  2NUP B;  4RG8 A;  2RM4 A;  3I55 Q;  3QDF A;  3E9F A;  3CD6 Q;  4JZ3 A;  1K9M U;  1SRL A;  3L2V A;  1SSH A;  5CKD A;  4PL6 A;  3LW5 E;  3V7R A;  1QLY A;  3I5R A;  1WZO A;  1ARK A;  3EFO B;  4J9D A;  1AOJ A;  1TG0 A;  2QQS A;  4PJO B;  3OYI A;  9ATC B;  1O9S A;  1UTI A;  1ZSZ B;  3JCM h;  3M5A A;  2DZ9 A;  3HP9 A;  3MEA A;  5FU7 C;  3LLR A;  1R77 A;  1M2O A;  2MYS A;  1EFN A;  4Z89 A;  4RTV A;  2L3P A;  3H6Z A;  2MF2 A;  3H8Z A;  2FL7 A;  2DYI A;  2BTT A;  1WXT A;  3MCA B;  2QDL A;  1RAC B;  1AWX A;  4KT0 E;  2F1L A;  2FVU A;  2KRO A;  5IT9 E;  2O31 A;  4N4H A;  4M78 G;  2E70 A;  2AT1 B;  2FRY A;  2LJ0 A;  4FSS A;  3VRZ A;  1K8A U;  1VQ5 A;  2EYZ A;  1D1B A;  2KBT A;  4A53 A;  1M3B A;  1IGU A;  1PC0 A;  1M27 C;  3CCM T;  4MMK A;  1NJI R;  1BCM A;  1CKB A;  3VS0 A;  2OI3 A;  1MMG A;  1R0C B;  3CMA Q;  4OB1 B;  1VQO Q;  1VIE A;  3VUB A;  2K5I A;  4OML A;  2ZPI B;  3EFR A;  5CKH A;  1BBZ A;  3FJ5 A;  1BCO A;  3LWI A;  1SG5 A;  1M90 R;  4M78 B;  1Q82 C;  5GMK e;  2KT8 A;  3GPL A;  4XTU A;  3A8O B;  1YWP A;  4M77 F;  5GAM f;  3OBW A;  1BKB A;  1NLO C;  2DL7 A;  3OMG A;  3MET A;  4KUI A;  2LCS A;  3T9N A;  2K2M A;  2KGT A;  3HL8 A;  5L23 A;  5CAI A;  3CCE Q;  1JO8 A;  2EYY A;  4IUQ A;  3OYD A;  3CCU Q;  4JS4 A;  5GAN 8;  3P8H A;  5GAM g;  4C92 G;  4FYW B;  2XIC A;  4E47 A;  1HK9 A;  4FIB A;  2ZPF B;  1HD3 A;  5LJ5 d;  4AMC A;  5CVI A;  2RJE A;  4BY6 C;  4M7A D;  2YRV A;  2OTL Q;  2A36 A;  2GQV A;  1I0C A;  3FRN A;  1J3T A;  4OB3 B;  1TOV A;  1MMA A;  3A8H B;  2YRD A;  3MP8 A;  3PT9 A;  1I81 A;  2RQU A;  1MMD A;  3CCM A;  5A0L A;  2E4H A;  1UGP B;  1K9M C;  4LDU A;  1VQ7 Q;  2O9S A;  2AKL A;  3UPU A;  2FG0 A;  3CPF A;  2EGC A;  3VS6 A;  1WHL A;  1I5O B;  2K4Y A;  1JRI A;  4ME7 A;  1VYV A;  2JUF A;  4RTU A;  4E6R A;  3OS0 A;  3QO3 A;  2VKN A;  1VQ8 Q;  2XMF A;  2K3B A;  3OY9 A;  1JJ2 S;  5HKC A;  2DNU A;  1MV3 A;  3BFM A;  3H9N A;  5LJ5 h;  2GQI A;  2QQB A;  3DB3 A;  1G3Y A;  2Y4Y A;  2L2P A;  1UUE A;  4E7H A;  1U5S A;  4M77 A;  2RJF A;  1UDL A;  3UA6 A;  3CC2 Q;  2CP5 A;  3RDV A;  1Z9Z A;  2CP7 A;  5D6Y A;  2XDB A;  1I4K 1;  2B8A A;  2DK3 A;  4M7A F;  3DB4 A;  5LJ3 f;  3F70 A;  3MPU B;  1H8K A;  3I55 T;  1RAF B;  5GAO l;  1AHJ B;  2QG9 B;  4NL2 A;  2RH2 A;  4OB0 B;  4F16 A;  5GMK j;  2RJC A;  3A8M B;  1WX6 A;  2KDS A;  1K8A C;  2HQE A;  3U23 A;  5LJ3 g;  1NM7 A;  3PMI A;  4RCC A;  1U1T A;  2LC4 A;  1EZZ B;  4LDW A;  2COZ A;  2DD4 A;  2DJQ A;  4Z8A A;  3EG0 A;  4HVU A;  5J3B A;  1K76 A;  2K7A A;  2PUO B;  3OS5 A;  2IPO B;  2V8J A;  4PLL A;  5CIU A;  1OI1 A;  3L2Q A;  1T3S A;  4J9G A;  3LX7 A;  3FB9 A;  1MUZ A;  5I22 A;  4F7U F;  1D1A A;  2KAF A;  4E7S A;  3JRZ A;  5D6X A;  2BE9 B;  1BU1 A;  3C94 A;  1NG2 A;  4M75 E;  1YJ9 T;  4ZTF A;  2YWW A;  2PUK B;  3KFV A;  1BI2 A;  4UC4 A;  4C8Q E;  4HT8 A;  3ZEH A;  4RTZ A;  3OYF A;  3MP1 A;  4LNP A;  5AYF A;  3AHU A;  2MIO A;  4EMK B;  3QPH A;  1K4U S;  2H8H A;  2PNI A;  2RI5 A;  1ZBJ A;  2ECZ A;  3HTR A;  5GMK l;  1RAG B;  2EGA A;  4JJC A;  2YLC A;  1P92 A;  4B9W A;  5DM7 R;  2HKN A;  3I55 A;  1UFF A;  4IUU A;  2R57 A;  2M02 A;  3REA B;  2KYB A;  3OYG A;  1UJY A;  4HCZ A;  3M54 A;  2CGH A;  3CMA T;  3L42 A;  1VYU A;  1VQO T;  5ECA A;  2KRN A;  3X26 B;  3SWN C;  4JRP A;  1Q7Y U;  1FMV A;  4DBR A;  4WF2 A;  2OAU A;  1VQ5 Q;  1KD1 U;  3CPW A;  4EMG A;  1YP5 A;  5KYU B;  5I11 A;  3LYI A;  1PRM C;  2L0A A;  2VC8 A;  1KIK A;  1F1B B;  4V2S A;  2QXF A;  1VYT A;  1FX7 A;  4J6X A;  3GBQ A;  4AFU C;  2CSI A;  2LCC A;  1QVF A;  2P0K A;  4F14 A;  1B07 A;  4IUP A;  2DXC A;  2DKG A;  4ZGD B;  4FYY B;  4OGE A;  2DD5 A;  3OW2 S;  3EGX A;  4F7U G;  3X20 B;  2LTO A;  3TRE A;  4DBF A;  3JCM f;  3OYB A;  2X4X A;  2DL8 A;  5GAM h;  5A0D A;  3CCE T;  1MV0 B;  2OTJ Q;  5EC7 A;  4J9E A;  4F7U A;  1YJ9 A;  3QBY A;  3QWY A;  1WHH A;  2JZ2 A;  3GF5 A;  3JCM g;  3UT1 A;  3URG A;  4C0D B;  3OSV A;  2OJ2 A;  2QTX A;  3QUI A;  1GFD A;  2CS7 A;  2KT1 A;  5CR2 A;  2CP0 A;  4HA8 A;  2OTL T;  2QA4 T;  1OZ3 A;  2K9G A;  4M7D D;  2BKD N;  1ZA2 B;  2KE9 A;  1Q81 U;  3EG9 A;  2J6K A;  3EGU A;  1QP3 A;  4QT7 A;  2GGR A;  2AHJ B;  5GAN 3;  2XD0 A;  2XDD A;  4QVZ A;  1AZG B;  2KYM A;  5KYX A;  3PVQ A;  4DEX A;  3QG1 A;  3CMA A;  3L2W A;  2PTK A;  3KUF A;  3E19 A;  1AZE A;  3OS1 A;  2FRW A;  4BD3 A;  2MK5 A;  4M75 B;  1SF9 A;  4ELY C;  5GAN e;  1WJS A;  1CSK A;  2RQT A;  4OF1 A;  3VUZ A;  4C8Q B;  5GAN 5;  1KFZ A;  4Y28 E;  1VQ8 T;  4A54 A;  3G71 T;  4J9B A;  4KBM B;  4E7J A;  3EG2 A;  1YIJ T;  2QQ9 A;  1QMC A;  1KG1 A;  2D6F A;  1H64 1;  4FL6 A;  3M0P A;  4WCI A;  2ZAE A;  1WHK A;  2BE7 D;  1OZ2 A;  2DVE A;  3TSZ A;  1AWW A;  2GTJ A;  3JCM J;  3CCE A;  1JU5 C;  2LT1 A;  4M7A C;  2ROT A;  4Y91 A;  5LL6 S;  5GAN 4;  3PTA A;  4PNO A;  1PWT A;  4X9D A;  2X4Y A;  4R55 A;  4IIO A;  2YUQ A;  2GCX A;  2L3R A;  4BB7 A;  2EKH A;  2RHZ A;  3S3O A;  1QVG A;  2QA4 A;  3CBP A;  3INZ A;  3JCM W;  1JBM A;  2JW4 A;  2JTE A;  4PJO F;  3JCM X;  2LNH B;  4DA4 A;  2DER A;  2VGM A;  2PQW A;  5DY9 A;  3VJP A;  4X9C A;  2J05 A;  4YTL A;  1W70 A;  4EIK A;  2LQN A;  1GCP A;  2EAY A;  3GNG A;  3RNJ A;  5IXF A;  2KRS A;  1Q7Y C;  2QQR A;  2P0Q A;  2ZZD A;  2NUT A;  1KD1 C;  2GNC A;  2DO3 A;  2LMJ A;  4KUD K;  1SSF A;  2RA2 A;  3N5B B;  2KI7 A;  5KYW B;  1VQL T;  3G71 A;  2EQK A;  5CO7 A;  1WJR A;  1AD5 A;  5IH2 A;  1TU0 B;  1YIJ A;  3OMC A;  2F5K A;  5D6W A;  1U8R A;  2MI6 A;  4CC3 A;  2F69 A;  1JJ2 P;  5FU7 B;  4NS5 A;  4XAX B;  5LJ5 f;  4KGX B;  2V8K A;  2DTI A;  1BIA A;  2MOX A;  4MDW A;  5GAN j;  1G3W A;  2D1X A;  3TCJ A;  2H3E B;  2X3W D;  4Z88 A;  1WLP B;  2X35 A;  5LJ5 g;  1OYX A;  1XOV A;  4C5E A;  4A63 B;  1I07 A;  1AWJ A;  2DTO A;  2C0T A;  1Q81 C;  2MCN A;  4PJO G;  1JXO A;  3ER0 A;  3G7Z A;  3CXC A;  2KNB B;  1Y71 A;  1WHJ A;  2CZ6 B;  4M78 F;  5KE2 A;  1VQ5 T;  4XU0 A;  3EFO A;  2EYW A;  4XK8 E;  4PJO A;  3G6E T;  3SB2 A;  3NTK A;  1BIB A;  1Y0M A;  1D3B B;  1ZUU A;  4FU6 A;  3V8K A;  1GCQ A;  1IHW A;  2L3S A;  1B34 A;  2VAS A;  1O75 A;  5FU6 C;  2J6F A;  1UG1 A;  3JCM V;  4A4G A;  4GLM A;  5IN1 A;  2AIR B;  3BY7 A;  3M57 A;  1Z9Q A;  1RAE B;  4IIM A;  1NYF A;  4N4I A;  2FPD A;  3VS7 A;  3OYH A;  1S1N A;  1Q86 R;  2QGG A;  3L1A A;  1IZ6 A;  1KQS A;  1VQL A;  5A0G A;  2HD0 A;  3CBM A;  2OTJ T;  1VQ9 T;  3FC3 A;  4FCY A;  2KK4 A;  4HVW A;  3JB9 J;  4N0A C;  2WAC A;  2X9H A;  1DJ7 B;  3ZFJ A;  2KXC A;  1RAB B;  4M77 D;  4JS5 A;  2P4T A;  2JMC A;  4QVC A;  2DZC A;  2EW3 A;  2J7I A;  1M2V B;  2MWO A;  2ZPH B;  1TSF A;  1YIT T;  1E6H A;  2JT4 A;  5IHK A;  3CBO A;  1YJ9 Q;  3C0C A;  1HJD A;  4C92 F;  2E64 A;  1V1C A;  3H0I A;  4ORZ A;  3L2U A;  1K73 U;  2I2L A;  3RMQ A;  1M3A A;  1YJN Q;  4BY6 B;  3CCR T;  1I8F A;  1OUL A;  4OMQ A;  2DEQ A;  4PJL A;  4XTY A;  1SHF A;  1M4Z A;  2KVQ G;  4OB2 B;  1YI2 T;  2KQW A;  1GFC A;  1VA7 A;  3OYC A;  4ZTJ A;  2M51 A;  4M78 A;  3G6E A;  1PRL C;  2ZCF B;  4HT9 A;  3TU4 K;  1C6V X;  1N9R A;  3OS2 A;  2CSQ A;  1ZUY A;  4PKC C;  1KSW A;  3DLM A;  3BW1 A;  1K1Z A;  1MHN A;  1N27 A;  2CZ1 B;  4CC7 A;  1X2K A;  3HSB A;  4AG2 C;  2KEA A;  3OW2 P;  4PFO A;  2OTJ A;  1QQJ A;  4C5I A;  1VQ9 A;  4E7L A;  4M7D C;  3M9Q A;  1WQW A;  3RKX A;  2DMO A;  2L3Q A;  5D7U A;  1M1K R;  3NTI A;  2G3R A;  3OYY A;  2EQU A;  2R58 A;  2X4W A;  4Z02 A;  4M77 E;  4J9I A;  3QJY A;  1KC8 U;  2CP2 A;  1YIT A;  3QDR B;  4L6V 5;  1D0Y A;  1PKS A;  1NE8 A;  2LX9 A;  2KR3 A;  3VS4 A;  2CYZ B;  2JTF A;  2EJ9 A;  3HHT B;  4C92 A;  2QA4 Q;  1UGR B;  3CCR A;  2CH4 A;  3M58 A;  1WIE A;  4OMN A;  1G2B A;  1ACM B;  2DA9 A;  3CPW S;  1YI2 A;  3NTH A;  2O4X B;  3A98 A;  1NPP A;  2A7Y A;  5IHN A;  1T0H A;  2KXD A;  1UGS B;  1QVF S;  1WGS A;  3VS2 A;  3JSC A;  2E41 A;  4HVV A;  1B3Q A;  1C1A A;  3M4Y A;  2LRQ A;  2E65 A;  3GP8 A;  5GAN d;  2E6N A;  7AT1 B;  3Q1J A;  4KRT A;  1VQ6 Q;  2ESW A;  8AT1 B;  2LX7 A;  1OOT A;  2FZK B;  3G71 Q;  3V8L A;  1YIJ Q;  3MO8 A;  1ZUK A;  1BI0 A;  4HKE A;  1X2Q A;  1MNE A;  1G5V A;  1FMW A;  1XTD A;  2E5Q A;  2JNG A;  3QSU A;  3EHQ A;  1WDX A;  4HCK A;  3M0R A;  1G3T A;  2RI2 A;  4DOV A;  2EWN A;  2BZ8 A;  5LJ3 j;  4MZT A;  4F04 B;  2EIF A;  1N5Z A;  1QWF A;  2KY9 A;  1K73 C;  3PNW C;  4XTZ A;  3JB9 I;  1RL2 A;  4XTW A;  2EQI A;  5IXB A;  2CP6 A;  2KRM A; 
#chains in the Genus database with same CATH homology
 4L5G A;  3RER A;  1Q82 U;  2HAX A;  3GF5 A;  1ZQ1 A;  3CCV T;  1Y07 A;  3JCM g;  3UT1 A;  2LQ8 A;  3URG A;  4C0D B;  1IRE B;  3OSV A;  2FB7 A;  2QTX A;  2WSF E;  1YBY A;  3QUI A;  3SWN B;  2CS7 A;  4J83 A;  5CR2 A;  2LNV A;  3C95 A;  4HA8 A;  2OTL T;  4QQD A;  5KE3 A;  1WJQ A;  1OZ3 A;  2QA4 T;  3JB9 G;  3DLL A;  4M7D D;  5J39 A;  3OW2 A;  2BKD N;  4J5Y A;  3MEU A;  3MEW A;  1WQ7 A;  1S72 T;  2E12 A;  5GAM j;  1Q81 U;  5GMK i;  1QP3 A;  5KCO A;  2AHJ B;  5GAN 3;  4JRQ A;  3CC2 A;  2XD0 A;  2D9T A;  1FWZ A;  3M56 A;  3VYG A;  1BI1 A;  2XDD A;  4HCC A;  3QYG B;  4GLK A;  4QVZ A;  3V8J A;  5GAO n;  4VUB A;  5FRM A;  3I56 A;  3JAM E;  2CKK A;  3R6O A;  3QKJ A;  5FRO A;  4PJO C;  3QG1 A;  5L8R E;  4M7D G;  4II1 A;  3CMA A;  3L2W A;  1H3Z A;  3KUF A;  3C4S A;  3E19 A;  3J80 E;  3LH0 A;  3OS1 A;  3OYK A;  2E1H A;  2A3L A;  3RES A;  4BD3 A;  1M90 U;  2JOY A;  4M75 B;  1EIF A;  3DKM A;  3JCM d;  1UGQ B;  2XI9 A;  4ELY C;  1WJS A;  3WVE B;  5GAN e;  1KQ2 A;  2O4X A;  4M7D A;  2VXE A;  2XK0 A;  2VYT A;  1BYM A;  2ZGW A;  4OF1 A;  3VUZ A;  4JLG A;  2RHU A;  4C92 C;  3MEV A;  4C8Q B;  5GAN 5;  4E7K A;  1Y96 B;  3JCM b;  4ATO A;  4C0G A;  2GFA A;  4TVR A;  4Y28 E;  1N6A A;  1VQ8 T;  1QW1 A;  4A54 A;  5J26 A;  1KHC A;  5DLQ E;  3G71 T;  5GAN g;  1VQP A;  3QZ9 B;  4KBM B;  4E7J A;  2IG0 A;  2KMT A;  1YIJ T;  2QQ9 A;  4BUG A;  3RMS A;  1KG1 A;  1X75 C;  1QVG S;  3FIF A;  4RG8 A;  2RM4 A;  2D6F A;  4BE2 A;  1H64 1;  3CCJ T;  1YJN T;  1W2B S;  4FL6 A;  1TH7 A;  1KC8 C;  5CK9 A;  4RCB A;  3C12 A;  2K2V A;  3E9F A;  4JUV A;  4ZN1 A;  1K9M U;  3P8D A;  4C8Q F;  1OZ2 A;  2DVE A;  3L2V A;  3JB9 F;  1VQK T;  1M5Q 1;  5CKD A;  2O01 E;  4PL6 A;  1I5L A;  3JCM J;  2M9U A;  3CME T;  1HXD A;  3CCE A;  3CEY A;  2LT1 A;  1LOJ A;  2VGN A;  2DJZ A;  3LW5 E;  3X28 B;  3V7R A;  3V7S A;  4M7A C;  3NFC A;  4Y91 A;  3MP6 A;  4DQ2 A;  5LL6 S;  3HFN A;  5GAN 4;  1ZHI A;  4JLI A;  3PTA A;  2QQS A;  4PNO A;  4PJO B;  2EQJ A;  4X9D A;  2V8I A;  4FSX A;  3OYI A;  2X4Y A;  4R55 A;  1Q86 U;  3UDC A;  1O9S A;  5GAO q;  5GAN 7;  3FDR A;  3CCV A;  2GCX A;  2L3R A;  3JCM h;  4BB7 A;  2RHZ A;  3X25 B;  3M5A A;  3S3O A;  1QVG A;  4FT2 A;  2QA4 A;  3VV0 A;  4BDZ A;  2DZ9 A;  3LGL A;  3CBP A;  3HP9 A;  3INZ A;  4XU1 A;  1JBM A;  2DIG A;  3MEA A;  5FU7 C;  2VUB A;  3JCM W;  1UEB A;  3LLR A;  1S72 A;  3BDL A;  4C92 B;  4PJO F;  3L2Z A;  3JCM X;  3P8B B;  5I2S A;  2L89 A;  3HRS A;  4M77 C;  4DA4 A;  2VGM A;  3G4S T;  3RKY A;  4LDX A;  3LWH A;  2LQK A;  2PQW A;  5DY9 A;  3VJP A;  4X9C A;  2PVD B;  2D0Q B;  3E9G A;  4YTL A;  3HRU A;  2JVV A;  3H6Z A;  2MF2 A;  2YLB A;  4NOY A;  2HNI A;  5GAN 6;  3H8Z A;  2FL7 A;  4M78 C;  2EAY A;  3GNG A;  3MCA B;  3MHX A;  2LVM A;  2M16 A;  3SWN A;  1Q7Y C;  4M77 G;  3JB9 H;  2QQR A;  2P0Q A;  4M75 D;  1LJO A;  4KT0 E;  4RMO A;  2ZZD A;  3JCM Q;  2FVU A;  1KD1 C;  3QZ5 B;  5CKE A;  4ELZ C;  4BI8 B;  4CI0 C;  2DO3 A;  3ME9 A;  5IT9 E;  3JCM e;  4LD9 K;  4M7A B;  4N4H A;  4D6W A;  4M78 G;  4KUD K;  2E70 A;  4C8Q D;  1SSF A;  1VQN T;  2RA2 A;  3N5B B;  1VQL T;  3QHS A;  3G71 A;  2YHT A;  4BI3 A;  1K8A U;  1VQ5 A;  3PIO A;  2EQK A;  5CO7 A;  5GAN 2;  4M75 G;  1WJR A;  5I21 A;  5GAN h;  4A53 A;  2RHI A;  3OYE A;  1YIJ A;  3OMC A;  4EPC A;  2F5K A;  3TEE A;  4LDV A;  3CCM T;  4MMK A;  4ZGE B;  2RK2 A;  5CCA A;  3CCJ A;  1VQ4 T;  1YJN A;  5D6W A;  1U8R A;  4J6W A;  2MI6 A;  4C8Q G;  2F69 A;  3HKS A;  1NJI U;  5GAO p;  5CQY A;  2Y90 A;  3CXC S;  4OB1 B;  5FU7 B;  2GF7 A;  4NS5 A;  1VQK A;  3OBY A;  1XNI A;  1X6O A;  4XAX B;  5C0M A;  5LJ5 f;  1VIE A;  4NL3 A;  3CME A;  3J7A F;  3JCM P;  3CD6 T;  2K5L A;  4M77 B;  2E6Z A;  3VUB A;  2V8K A;  4C8Q A;  2K5I A;  4FM4 B;  1Y96 A;  2ZPI B;  2DTI A;  3EFR A;  4OMF B;  1BIA A;  2DAQ A;  5CKH A;  4MDW A;  2BIV A;  4PJO D;  3LWI A;  1W4S A;  5GAN j;  4P5N A;  1G3W A;  4M78 B;  2PU9 B;  1Q82 C;  3TCJ A;  3OA6 A;  4XU2 A;  5GMK e;  2RHY A;  2WSC E;  1N8R U;  2X35 A;  5LJ5 g;  1YCY A;  1OYX A;  1XOV A;  2XDP A;  4XTU A;  3GPL A;  4C5E A;  3A8O B;  4M77 F;  2H3J A;  4J7I A;  4EMK A;  1NJI C;  2DTO A;  4BE1 A;  5GAM f;  3OBW A;  2EKO A;  1BKB A;  4C0Z A;  1Q81 C;  4PJO G;  1LNX A;  3EFS A;  3OMG A;  3MET A;  1VQ6 T;  4JRK A;  1KQS S;  3ER0 A;  2K57 A;  3G7Z A;  4KUI A;  3CXC A;  2QI2 A;  1Y71 A;  2CZ6 B;  4M78 F;  4F7U E;  2VV5 A;  4OP0 A;  3T9N A;  3ASK A;  5KE2 A;  1VQ5 T;  3G4S A;  3HL8 A;  1NPR A;  4XU0 A;  3O8V A;  5CAI A;  4FT4 A;  3CCQ A;  4XK8 E;  1M1K U;  4M75 F;  1YJW T;  4IUQ A;  3ZBD A;  3OYD A;  2K3X A;  4JS4 A;  4PJO A;  5GAN 8;  3G6E T;  3P8H A;  3SB2 A;  1N9S A;  1QVP A;  3NTK A;  4OVA A;  1BIB A;  2R5A A;  5GAM g;  5CKB A;  1D3B B;  4B9X A;  4BDY A;  4JDS A;  4C92 G;  3GNF B;  1M1F A;  2L8D A;  4FU6 A;  3V8K A;  3M59 A;  3OYA A;  3OYL A;  2DXU A;  2XIC A;  4MML A;  1M90 C;  1B34 A;  4E47 A;  1O75 A;  1HK9 A;  4FIB A;  3HPW A;  5FU6 C;  3JCM V;  4A4G A;  2ZPF B;  3OYM A;  5IN1 A;  2PVO B;  3BY7 A;  1M9S A;  3M57 A;  5LJ5 d;  2DTH A;  2DXB A;  5CVI A;  2RJE A;  2Y4X A;  4XU3 A;  5A2Q E;  4BY6 C;  4M7A D;  4N4I A;  2YRV A;  3WXM B;  3OYH A;  1VQN A;  3L1A A;  1IZ6 A;  1KQS A;  1VQL A;  2GQV A;  3FRN A;  2HD0 A;  2RB6 A;  5A0G A;  4OB3 B;  5EG2 A;  3CBM A;  3A8H B;  2OTJ T;  4XQ3 A;  4MZP A;  3MP8 A;  3PT9 A;  1VQ9 T;  3A8L B;  1I81 A;  1RI0 A;  3PIP A;  2ZPG B;  1U1S A;  3FC3 A;  3CCM A;  3CC4 A;  3CC7 T;  1VQ4 A;  2KK4 A;  3JB9 J;  5A0L A;  4M7A G;  4N0A C;  1UGP B;  2JN0 A;  3KXT A;  1K9M C;  4LDU A;  2C06 A;  2DIQ A;  4XTV A;  5GAM d;  1QP2 A;  2EJG A;  2WAC A;  4M7D E;  3OB9 A;  3UPU A;  3CPF A;  3SDZ A;  1DJ7 B;  2QEX T;  4EDU A;  2RI3 A;  3ZFJ A;  3VU3 C;  4M77 D;  4JS5 A;  5HK3 A;  3CD6 A;  4M7A A;  2P4T A;  2MMP A;  3PFS A;  3VKI A;  2DZC A;  1JRI A;  2K4Y A;  4ME7 A;  4QVC A;  4BAC A;  4C5H A;  3CCQ T;  2JUF A;  2MWO A;  2ZPH B;  1YIT T;  1UB4 A;  3OS0 A;  3QO3 A;  4IUV A;  4M78 D;  1Q86 C;  1MGQ A;  2EYQ A;  3CBO A;  4A4F A;  3S6W A;  3OYJ A;  4C92 F;  3KBG A;  2E64 A;  3OY9 A;  1JJ2 S;  5FU6 B;  4A4E A;  5HKC A;  3CCL T;  3BFM A;  3PMT A;  5LJ5 h;  2CZ0 B;  3L2U A;  3DB3 A;  2QQB A;  2I2L A;  1K73 U;  3VYH B;  3RMQ A;  5FLX E;  2EQM A;  1G3Y A;  1JB0 E;  4BY6 B;  2Y4Y A;  4LDY A;  1VQ6 A;  4E7H A;  2XG8 D;  3QJ6 A;  5GMK h;  3CCR T;  1I8F A;  4JJN K;  1VQM T;  4M77 A;  4QQ6 A;  4R56 A;  2FHD A;  1FXX A;  2RJF A;  5CQX A;  5DLO A;  2M0O A;  2DEQ A;  2E10 A;  4XTY A;  3SFM A;  1M4Z A;  2KVQ G;  3GLX A;  4OB2 B;  2DXT A;  2KQW A;  1YI2 T;  3OYC A;  2K5F A;  5CKF A;  2CZ7 B;  4ZTJ A;  1YJW A;  5I2M A;  4M78 A;  3CC4 T;  3G6E A;  2ZCF B;  5D6Y A;  4HT9 A;  2XDB A;  1I4K 1;  3CCS T;  1M1G A;  2B8A A;  2DK3 A;  3TU4 K;  1WNL A;  1ZBX A;  4N4G A;  4M7A F;  3DB4 A;  5LJ3 f;  4J8O A;  2BUD A;  4M75 A;  1N9R A;  2P0P A;  5LJ5 j;  3CCU T;  1R8O B;  3F70 A;  5IAY A;  5M9O A;  3OS2 A;  4PLI A;  2RJD A;  3I55 T;  3BDU A;  1JJ2 A;  3A8G B;  2KSS A;  5GAO l;  1AHJ B;  4PKC C;  2RD1 A;  4MDX A;  4NL2 A;  2RH2 A;  3DLM A;  4OB0 B;  5GMK j;  3BW1 A;  2RJC A;  3SD4 A;  1X01 A;  5LJ5 e;  1MHN A;  1N27 A;  3A8M B;  2KDS A;  2MWP A;  1K8A C;  2HQE A;  2RK1 A;  2CZ1 B;  2HQX A;  5LJ3 g;  3HSB A;  1PSE A;  2OTJ A;  4C5I A;  2MAM A;  3PMI A;  4RCC A;  4X34 A;  1VQ9 A;  1U1T A;  4E7L A;  2LC4 A;  4IUR A;  4EMK C;  3CC7 A;  1VIF A;  3M9Q A;  4RG2 A;  4M7D C;  1D3B A;  2ZPE B;  2JTM A;  2LDM A;  1WQW A;  4LDW A;  3RKX A;  3A5Z B;  2DD4 A;  3S3N A;  3HFO A;  4F7U B;  3OQ5 A;  2FYK A;  5J3B A;  1YHQ T;  4ZN3 A;  4C92 D;  2QEX A;  3NTI A;  2PUO B;  5GAM e;  2G3R A;  4XTX A;  3OYY A;  2EQU A;  3E1S A;  2R58 A;  2X4W A;  3M4G A;  3OS5 A;  4Z02 A;  2V8J A;  5C6S A;  4M77 E;  4PLL A;  5CIU A;  1VQ7 T;  1WPY A;  1OI1 A;  3L2Q A;  1VQO A;  3QJY A;  4QQG A;  1KC8 U;  5GAN f;  4A4H A;  3LX7 A;  3FB9 A;  4CRI A;  1YIT A;  1XQH A;  3QDR B;  4L6V 5;  1M8V A;  3RUX A;  2RHX A;  1NE8 A;  4F7U F;  4M78 E;  2LX9 A;  2KAF A;  4IKF A;  3JRZ A;  4LD6 A;  5D6X A;  1N8R C;  4KUL A;  5LJ3 d;  4BE0 A;  4HCB A;  3C94 A;  2X4J A;  3HRT A;  3CCL A;  2CYZ B;  4M75 E;  2JTF A;  1PSF A;  1YJ9 T;  2XID A;  4ZTF A;  5KCH A;  2XKO C;  2PUK B;  2EJ9 A;  3V7C A;  3HHT B;  4C92 A;  1BI2 A;  3J81 E;  4DOW A;  1UGR B;  4UC4 A;  4C8Q E;  3CCR A;  1VQM A;  4HT8 A;  2GFU A;  4L59 A;  3M58 A;  3ZEH A;  1Y7X A;  3UWN A;  1M1K C;  2DPP B;  4A4K A;  3OYF A;  3EAE A;  3MP1 A;  2NLU A;  5AYF A;  3CPW S;  4J6Y A;  1YI2 A;  3AHU A;  2VXF A;  3QII A;  3FLG A;  5GAO m;  3NTH A;  2F5T X;  4EMK B;  2O4X B;  2QQA A;  3QPH A;  1NPP A;  2A7Y A;  4GY5 A;  4M7D B;  2LCL A;  2RI5 A;  1W2B A;  3QYH B;  2HBP A;  4EMH A;  5GMK l;  3RKW A;  5FRN A;  4ZGJ B;  3CCS A;  4C5G A;  3FJP A;  3L2R A;  1KQ1 A;  1NZ9 A;  1UGS B;  3CC2 T;  2YLC A;  1QVF S;  3CCU A;  1P92 A;  4JRI A;  1WGS A;  4B9W A;  5DM7 R;  2K3Y A;  3JSC A;  3M53 A;  3I55 A;  3I56 T;  3QXE B;  4IUU A;  2E41 A;  2R57 A;  2IVW A;  2XU8 A;  3OYG A;  4HCZ A;  4MZM A;  4OGC A;  3M54 A;  2CGH A;  3S3M A;  3CMA T;  3M4Y A;  2LRQ A;  3L42 A;  3RIR A;  3FEO A;  4Q5W A;  1VQO T;  2E65 A;  4O5V A;  4M7D F;  3GP8 A;  5GAN d;  2E6N A;  3Q1J A;  4C0D C;  3X26 B;  3SWN C;  4PJO E;  3PGG A;  4JRP A;  1Q7Y U;  1B34 B;  4WF2 A;  3JCM c;  5LJ3 h;  2OAU A;  2OTL A;  1KD1 U;  3CPW A;  5HY6 A;  3V8L A;  4EMG A;  1G3S A;  2RO0 A;  3LYI A;  4N0A A;  3OYN A;  2VC8 A;  4E7I A;  5GAO r;  4V2S A;  2QXF A;  2M1H A;  1FX7 A;  2L5Q A;  3X24 B;  3M55 A;  3OSS C;  3MO8 A;  3GOX A;  4RKU E;  4IUT A;  4J6X A;  4QW2 A;  1VQP T;  1BI0 A;  1YHQ A;  4QVD A;  4HKE A;  2LCC A;  1QVF A;  2P0K A;  4C92 E;  4IUP A;  2DXC A;  1G5V A;  2DKG A;  4ZGD B;  4BI4 A;  1XTD A;  2E5Q A;  1VQ7 A;  4C0F A;  2JNG A;  3QSU A;  3GIB A;  4OGE A;  2LT4 A;  2DD5 A;  5KH6 A;  3OW2 S;  1G3T A;  1GXI E;  2RI2 A;  3WVD B;  4DOV A;  4F7U G;  3X20 B;  2EWN A;  2LTO A;  2ZPB B;  4O6J A;  2QDY B;  3TRE A;  5LJ3 j;  4M75 C;  4MZT A;  1BI3 A;  3JCM f;  3OYB A;  2X4X A;  5GAM h;  5A0D A;  2EIF A;  3CCE T;  3LGF A;  2EFI A;  2KY9 A;  1K73 C;  2WSE E;  4F7U A;  4C8Q C;  3PNW C;  3JB9 D;  1YJ9 A;  4XTZ A;  5LJ3 e;  3QBY A;  4J7F A;  3JB9 I;  2PVG B;  2R5M A;  2EJF A;  1RL2 A;  2XHC A;  1KHI A;  1VQ8 A;  4XTW A;  5HK0 A;  2JZ2 A;  5GMK m;  1V29 B;  1VUB A;  4M7A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...