1I07A

Eps8 sh3 domain intertwined dimer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i07A00
5FWBA 1OV3A 3I5SA 1UJYA 1WI7A 1WXTA 2W0ZA 2MOXA 1AD5A 1RUWA 2JS2A 1X2QA 2RQWA 3EGUA 1G2BA 3REBB 1U5SA 1BB9A 4J9DA 4LUEA 1UUEA 4LUDA 1UG1A 2LQWA 2L0AA 3EHRA 2ED0A 2DJQA 2YUNA 2JW4A 1QKWA 4HVUA 4J9CA 1PNJA 1TG0A 1M3CA 2F2WA 1UTIA 1AEYA 4X1VA 2GNCA 1WA7A 3VRZA 1M3AA 3EG1A 2L2PA 3NPFA 1JQQA 1ZUKA 3M0UA 2JS0A 2EGCA 4K11A 4AFZC 2EPDA 4Y92A 2ROTA 2O9VA 3A98A 5IXBA 2KXCA 3LH5A 1LCKA 3VS5A 2YUQA 2DRMA 2JT4A 1FMKA 2L3QA 3EHQA 2JTEA 4IIMA 2JMAA 2EYXA 2EBPA 1GL5A 1NM7A 1SRMA 1UECA 1WYXA 2EGEA 3NHNA 1PWTA 4J9IA 4A63B 1K76A 4ESRA 2A36A 2EW3A 2FPEA 2LMJA 2DX1A 1U3OA 1YN8A 2KYMA 2P4RA 2FG0A 1OPLA 3EG3A 2KGTA 2FPDA 1MV3A 2O88A 1E7OA 2K7AA 4D8DA 1IO6A 1OOTA 4HVWA 2D1XA 2DLPA 2HBWA 2F2VA 1ZSGA 2K2MA 1N5ZA 4HCKA 1X6GA 1QLYA 3SHWA 1WXUA 2J6FA 3UA6A 1GCPA 1MUZA 1I0CA 4LNPA 1MV0B 4J9HA 2D8HA 3O5ZA 3VS4A 5IH2A 3QWYA 5GJWB 1JXMA 2D8JA 2LQNA 2LJ0A 1M3BA 1WXBA 1UE9A 4F17A 1KJWA 2ESWA 1AZGB 2E5KA 3EG0A 5IXFA 4WCIA 4Z8AA 3NMZC 2LP5A 1JEGA 1KIKA 2EVRA 1YNZA 2CUDA 1T3SA 4JJBA 1SRLA 1U06A 2KRSA 2M0YA 4E6RA 3U23A 3SEMA 2SEMA 4Z88A 2K9GA 1UGVA 1SHGA 4JPBW 3THKA 2BZXA 1NYFA 4GLMA 5L23A 2PZ1A 1QKXA 4IIOA 1YWPA 1VYVA 2CT4A 2RQUA 2YDLA 1GFCA 2KRNA 1ZLMA 1HJDA 2CREA 2C0IA 2KYBA 3UA7A 1GFDA 1GCQA 4HXJA 2DBMA 2LJ3A 1BBZA 1M8MA 2RPNA 2PTKA 4CC2A 2A37A 1X69A 2A08A 4KRTA 2OAWA 1NLOC 2GBQA 2CH4W 2FEIA 5I22A 1J3TA 1Y0MA 2ENMA 4OMPA 1VYTA 1ZUUA 2OJ2A 2JM8A 2KT1A 2CUBA 2M51A 1S1NA 1EFNA 1KSWA 1V1CA 2JMCA 1X6BA 4RUGA 3C0CA 2FPFA 4JJCA 1WDXA 4RTWA 2W10A 1RLQC 3TSWA 2DL7A 2V1RA 2DF6A 4DEYA 2EYYA 1WLPB 1JO8A 1VYUA 2RNAA 1QWFA 1XOVA 2YUPA 1ZX6A 3TVTA 3M0SA 4AFUC 2CH4A 1UFFA 1I07A 1PKTA 3RBBB 1GBQA 4OMNA 2JM9A 3VS7A 2EYZA 4HVVA 1AWXA 2ABLA 2GTOA 4DEXA 2AK5A 3TSZA 3ZL7C 1TUDA 1Z9ZA 1K0SA 2OI3A 1NLPC 2DNUA 1AWOA 1GBRA 5ECAA 1T3LA 5I11A 1HD3A 2RQTA 1JU5C 1W70A 4AG2C 2B86A 2LJ1A 3I9QA 2GQIA 1SSHA 1AOJA 3H0IA 1ZUYA 2DM1A 2H8HA 4J9BA 2JXBA 3QWXX 1E6GA 2DL4A 4EIKA 3FJ5A 1X27A 1PHTA 1PKSA 2VKNA 2BZ8A 2X3XD 1QCFA 2FO0A 3I5RA 3R6NA 2VWFA 2AKLA 2HEQA 3RNJA 4RTUA 1W1FA 1G83A 2I0NA 1NEBA 2LX7A 2DL8A 1AWJA 3VRYA 1CKBA 4RTVA 3I35A 1FYNA 2HSPA 3VS6A 2KXDA 1SHFA 1X2KA 2K3BA 1K9AA 4JZ4A 4F16A 2CT3A 2LZ6B 1CSKA 2YUOA 2DBKA 2EGAA 3M0PA 3KFVA 4RTYA 3M0TA 2GTJA 1RI9A 4J9GA 2KNBB 2DYBA 3GBQA 4AFSC 1X43A 1UHFA 2DILA 1SPKA 1UHCA 2O9SA 2O2OA 1WFWA 1PRLC 3PVQA 2J6KA 3H0FA 1B07A 4LN2A 1H92A 2DL3A 2C0TA 1NYGA 2DMOA 5IHIA 2BZYA 1AVZC 1JXOA 4D8KA 1YCSB 3PVLA 1ABQA 1M30A 1KFZA 1K0XA 1K4US 1WIEA 2J7IA 2DE0X 2ROLA 4R0KA 1HSQA 2AKKA 4OMLA 4J9EA 1BK2A 2DRKA 1UDLA 2O31A 2DL5A 2G6FX 1OPKA 2MCNA 2KR3A 1H3HA 4QT7A 4RTXA 3VS3A 2EYWA 2FRYA 4GBQA 1Y57A 2IIMA 4M4ZA 1YWOA 2K6DA 1ABOA 2LNHB 3PE0A 1WX6A 2PNIA 2CDTA 1QWEA 3EG2A 4OMOA 2KROA 2CSQA 4CC4B 2KE9A 2SRCA 2J6OA 2RQRA 1UJ0A 2RF0A 2C0OA 3UF4A 2BTTA 2J06A 2L3SA 5HCKA 3VS2A 2YSQA 4FSSA 2RQVA 2V1QA 5IHNA 1OEBA 2X3WD 1M27C 2D0NA 2LCSA 1RLPC 3M0RA 1TUCA 2J05A 3REAB 1YP5A 2CSIA 1ARKA 1H8KA 2EKHA 4Z89A 2DA9A 2KEAA 1W6XA 2HDAA 3IQLA 3CQTA 1ZBJA 4LE9A 1T0HA 2KT8A 1PRMC 2K79A 1SEMA 1I1JA 2AZSA 4OMMA 2ED1A 2F2XA 2FRWA 2GGRA 2KRMA 3H41A 4ORZA 1VA7A 2RN8A 4RTTA 2RMOA 1NEGA 4CC7A 3VS1A 3UATA 2VVKA 4J9FA 2NWMA 1AZEA 3M0QA 2QDLA 3H0HA 4F14A 2NUZA 5FW9A 5IHKA 1K1ZA 4JZ3A 1AWWA 5EC7A 4AG1C 1A0NB 1GRIA 3VS0A 1BU1A 5FWCA 2ECZA 1Z9QA 2YT6A 4AFQC 2EQIA 4OMQA 1B3QA 4CC3A 4RTZA 1GCQC 3ULRB 2AZVA 4JJDA 3JV3A 4ZNXA 1T0JA 2DVJA 2HCKA 2XMFA 3NGPA 1E6HA 2KBTA 2MIOA 1CKAA 1NG2A 5GJVB 2L3PA 2A28A
chains in the Genus database with same CATH superfamily
3I5SA 4RG8A 1Q81U 1VQOQ 4O6JA 1NJIC 2RHZA 4KBMB 1RABB 3REBB 3CCVA 4J9DA 4ANJA 5GMKe 1WJRA 4M7DB 4EMKB 2LQWA 5GAN4 3CMEQ 4X9DA 3OYDA 5GANg 2JW4A 4J9CA 1PNJA 1VQ8A 1X01A 1UTIA 4X1VA 4JS5A 3EG1A 2QQ9A 3RDVA 1N9RA 1PM3A 3E2UA 2VC8A 2EPDA 4Y92A 4XAXB 2ROTA 3CD6Q 4KT0E 4J6XA 2KXCA 5I2MA 3TCJA 1UGRB 4N4IA 3V8KA 5HK3A 2EYXA 2DYIA 3L1AA 2E65A 2BKDN 3NHNA 1BCMA 1TXQA 2ZPEB 1K76A 1WPYA 1N8RU 1B34A 3OYBA 3QZ9B 4XQ3A 2P4RA 2NUPB 5KYYB 3EGXB 1VQLQ 2KQWA 1C6VX 2FG0A 3OYAA 2HQEA 2E1HA 1R0CB 3GIBA 2PQWA 4YTLA 2A0FB 1WHHA 3LX7A 1MV3A 2DZ9A 1E7OA 4GLKA 3BDUA 1KD1C 3E19A 2RD1A 4J7FA 2DLPA 2HBWA 2F2VA 1BKBA 2K2MA 1N5ZA 2RHXA 2DEQA 2ZGWA 4DBFA 2J6FA 3UA6A 1I0CA 3PMTA 3WVEB 2X35A 3CCET 3VV0A 1WJSA 2LC4A 5IH2A 1JXMA 1M1GA 1M3BA 1TUGB 1JRIA 1WQ7A 4BDZA 1AZGB 5IXFA 2DIQA 4C92C 2LP5A 4C0ZA 1KIKA 1MMDA 4F7UB 2EVRA 3TQ7P 1YNZA 2CP6A 4JJBA 1U06A 2KRSA 2M0YA 2RI3A 4XTUA 4E6RA 3CPWS 3CXCA 2R5MA 3U23A 2K5LA 2CP5A 1QQJA 3H9NA 1RAGB 4M75C 3V7CA 2DXBA 2P84A 4PJLA 1KK7A 2ZPGB 3MEUA 4J7IA 2AIRB 2CP2A 3QKJA 4IIOA 1VYVA 2KRNA 2QYZA 1ZLMA 2CREA 2C0IA 1D1CA 4A4KA 1GCQA 2LJ3A 2RPNA 2PTKA 4CRIA 3CCJQ 2MPXC 1QMCA 4OP0A 1X69A 3P8DA 2OAWA 1NLOC 3EG9B 3TREA 3L42A 4PFZA 5LJ3f 4QQGA 1KG1A 1Y0MA 2OAUA 2RM4A 5FU6B 2KT1A 1JJ2P 2CUBA 1O75A 4IKFA 2IPOB 2RH2A 3H6ZA 2GFUA 2FVUA 4KGZB 1BI1A 2JMCA 5LJ3j 4BI8B 1VQOT 2LT1A 4QQDA 2MWOA 1W2BA 2FPFA 1D3BA 4IUQA 4RTWA 4BI4A 3PGGA 3VUBA 4PJNA 3I55T 2V1RA 2V8IA 3EFOA 2DPPB 1VQPQ 3UT1A 4IUVA 1QW1A 3DLMA 2L8DA 5J39A 1VQMT 3G1JA 1Q7YU 1QWFA 1KC8U 3OYEA 4N4HA 1UFFA 2RO0A 1I07A 4PJMA 4OMNA 3QJYA 4KH1B 3VS7A 5GANf 2EYZA 4HVVA 3X25B 1AWXA 3P8BB 2ABLA 4C92F 2QA4Q 5LJ3h 3TSZA 1BIAA 1K73R 4KUIA 1TUDA 2OI3A 2DNUA 2RJDA 3VYHB 1VQ9Q 1KQ2A 5GANj 5I21A 1HD3A 4CI0C 1N6AA 2MAMA 4AG2C 3Q1JA 4M75F 1I4K1 3I9QA 5LJ3d 3H0IA 1ZUYA 1VQKA 1R8OB 1VQLT 1C0MA 3LYIA 2JXBA 3OYJA 3CCQA 1OQKA 1YJ9A 5D6XA 4EIKA 3FJ5A 5CIUA 1OULA 3I56A 2VKNA 4QQ6A 3OYHA 2X3XD 4N0AC 3MKDA 1AT1B 4LDUA 1HXDA 2CYZB 2AKLA 2F69A 3J81E 3CC2A 1NEBA 3HRSA 1JB0E 1AWJA 3M58A 1I8FA 4M7DG 1D1BA 3CPFA 4E7ZA 5GANh 2F5KA 3AT1B 2EYQA 1K9AA 2EIFA 3MEWA 4JZ4A 4C92A 1NJIR 2LZ6B 2YUOA 5DY9A 3OW2S 3M0TA 4J9GA 4M78E 2NYSA 1RI9A 4IURA 3L2RA 2VB6A 3PVQA 1QCNA 3H0FA 3FJPA 4LN2A 5GANd 5KYWB 2C0TA 3CCRT 2DMOA 4M75A 5IHIA 1AVZC 2FZKB 3PVLA 1ABQA 4FM4B 2QAZA 5C0MA 1LNXA 1KFZA 1QP3A 1K0XA 4RKUE 2J7IA 1Q86R 2RA2A 4OMLA 2XICA 3L2VA 2DRKA 3X28B 1QVFA 1YI2Q 3EGDA 3FEOA 4DBQA 2DXUA 1VQ4A 3G4SA 1D0ZA 2OTLQ 3JB9G 3JB9H 1YWOA 4WF2A 1ABOA 5HK0A 2LNHB 4M78G 4JRKA 2RI5A 1WX6A 4OMOA 2QTXA 1MGQA 4MDXA 1M5Q1 4L6V5 2J6OA 3L2ZA 3CC7Q 3CCJT 4M7DF 2C0OA 2BTTA 2J06A 1YIJT 2V1QA 1BI0A 5GAN2 1NPPA 1M27C 2D0NA 3QO3A 2J05A 1NZ9A 3HKSA 3REAB 1H8KA 1UGPB 3MEAA 3NTIA 2KEAA 5FROA 4DBHA 4FCYA 1QVGS 1MMNA 5LJ3e 4M7DD 3CBMA 1I1JA 4OMMA 2ED1A 2FRWA 1KQSS 1VQ6A 3JB9I 2FB7A 3OYMA 4M77A 3MP1A 2RMOA 4DQ2A 3ZFJA 3CCMQ 4MMKA 1VQPT 4LDWA 1YHQA 3UATA 2VVKA 4J9FA 5CQYA 1M90R 3G71T 2YRCA 1AZEA 3MCAB 4DOWA 5GMKj 2QDLA 3H0HA 2HL3A 4F14A 2NUZA 5FU6C 5FW9A 3RIRA 3HL8A 2HSEB 2FZCB 3QYGB 3FIFA 1K1ZA 2HQXA 5GAOm 1UB4A 5EC7A 4LD9K 5HKCA 5FRMA 1P92A 1RAFB 4RG2A 2QA4T 2QK0A 2YT6A 4OGEA 2QQAA 1B3QA 4CC3A 4RTZA 1OZ3A 2AZVA 2ZPBB 3JB9D 3JV3A 1MHNA 4M78D 1YITA 3FDRA 4XTXA 1U1TA 2D0QB 3PNWC 1NG2A 1UUEA 1UJYA 4OVAA 1WI7A 2XG8D 5GMKh 2W0ZA 2MOXA 2JS2A 2OX7A 5A0DA 2LT4A 1BB9A 2K3XA 3F70A 3PIOA 1UG1A 3CC4A 3WVDB 2DVEA 2BE9B 4F7UF 1UGSB 1ACMB 2YUNA 2EKOA 4XTYA 5M9OA 2GNCA 4A4EA 2L2PA 4E7IA 4J8OA 5HY6A 4A4GA 3CCSA 3RERA 3J7AF 3A98A 2DTOA 4KH0B 5IXBA 2CP0A 5KYUB 2YLBA 2EJ9A 2HNIA 2YUQA 3GNFB 1TS9A 1FMKA 3EHQA 2YRDA 1SF9A 2JMAA 3AHUA 3CCEQ 1GL5A 1MNDA 2XD0A 2RK2A 1NM7A 1UECA 2EGEA 3SB2A 2RHIA 2X4WA 2DIGA 4ESRA 3DLLA 3RESA 4FW1A 4RMOA 3OY9A 2DO3A 1U3OA 1YN8A 3RMQA 1YI2T 1IHWA 3CCUA 4F7UA 1UEBA 1M2VB 2OTLT 2RB6A 4WTOB 4FYYB 3EFSA 4C8QE 2K7AA 1Y7XA 3SDZA 3CXCS 2HZYA 3QPHA 1ZSGA 3TEEA 1QLYA 3CC7T 1WXUA 2GF7A 1K73U 1MUZA 4LNPA 3O5ZA 4ZGEB 5GJWB 5CKHA 2D8JA 1VOMA 2LQNA 2NUTB 1UE9A 4F17A 1EX4A 1LVKA 1YJNA 2E5KA 3EG0A 2P0QA 3NMZC 1K8AC 3CMEA 3RKXA 1Q82U 3G6ET 4PJJA 4HT8A 4GY5A 4C8QG 1T3SA 5GAN5 4E7HA 3EG9A 1SRLA 2G3RA 1YJWT 1O9SA 3SEMA 3A5ZB 3ASKA 1SHGA 1B7TA 1NBEB 3JCMc 3CD6A 3WXMB 3CCMT 1PSEA 4PK4A 4D6WA 2RI2A 4GLMA 3INZA 2M1HA 4JUVA 2RQUA 1GFCA 4R56A 1NJIU 1MNEA 3I55Q 2KYBA 1W2BS 1GFDA 4XTWA 1BBZA 1M8MA 2E3IA 1VQMQ 4AT1B 2A37A 2A08A 2E6ZA 2GBQA 2CH4W 4PKCC 5I22A 1WHLA 3NFCA 1WNLA 2BIVA 1D1AA 3CEYA 2PVGB 1ZUUA 1VQ7A 2XI9A 1Q86U 3QXEB 3VYGA 2DD5A 2M51A 1S1NA 1WQWA 3CPWP 1KSWA 4Y91A 2QEXQ 2DD4A 1X6BA 4N4GA 2JOYA 3OMGA 3GNGA 1WDXA 3QDFA 2VASA 3RKYA 1RI0A 4M78B 2O4XB 3A1PA 1S72T 1ZSZC 3PMIA 3QBYA 1WHGA 2FZGB 4C8QD 1N8RC 4AFUC 2AT1B 2L5QA 3RBBB 2ATCB 5CVIA 2XK0A 1U8RA 2MF2A 2GTOA 5AT1B 4A4FA 2AK5A 1KD1U 3HFOA 4LDVA 1K9MC 1FMVA 1Z9ZA 2X4YA 3RR6A 2JTMA 5D6YA 5GAN6 1JU5C 1W70A 4NS5A 1D0XA 5LL6S 3JCMg 4EDUA 2K5FA 4BD3A 1AOJA 1PC0A 3SWNB 4KULA 3CCRQ 1M90U 3GF5A 3JCMJ 3QWXX 1G8XA 4R55A 5CKFA 5J3BA 1G3WA 5GAOl 2E64A 3R6NA 2QDYB 2VWFA 2DEUA 2HEQA 4RTUA 3O8VA 2NLUA 5D7UA 1CKBA 4MZTA 4RTVA 3I35A 1FYNA 3OS2A 5DLQE 1VQNT 5LJ5f 3KUFA 3JCMW 3SFMA 1QVFS 5CCAA 4F16A 2E5QA 2JUFA 2EGAA 3M0PA 3KFVA 4V2SA 4AFSC 1SPKA 1UHCA 2O9SA 3RUXA 1B07A 3GP8A 1RACB 1H92A 1YIJQ 4FW2A 2BZYA 3PT9A 1JXOA 3OYFA 3V8LA 2IG0A 1WIEA 4R0KA 2DE0X 2KAFA 2AKKA 2Y90A 4JRIA 4J9EA 2O31A 2DL5A 3A8LB 2CZ0B 2RK1A 3S3NA 1H3HA 3BE3A 3VS3A 2E70A 2FRYA 2LDMA 2MMPA 1V29B 2ZCFB 3PE0A 2PNIA 2KROA 4CC4B 2KE9A 4X9CA 3HSBA 1TTHB 1VQ9A 1OU8A 5LJ5h 3C94A 3G71Q 3OW2P 2RF0A 1XTDA 2YXYA 4C0DB 1VQ5A 3UF4A 2HKNA 3CMAT 3JCMP 2VGNA 2LCSA 2KDSA 4FIBA 1TUCA 4O5VA 5GMKm 1YP5A 2EAYA 1NPRA 1OX9A 2B8AA 2EKHA 5LJ5d 1KC8C 2M9UA 3CCLA 3G7ZA 4M7DC 4EMKC 1LJOA 1ZBJA 2FYKA 2QEXT 1BYMA 1G3TA 2ZZDA 2KT8A 1PRMC 2O01E 1YFNA 1EIFA 2F2XA 2KRMA 3H41A 4M77E 4ORZA 1VA7A 1ZSZA 3EAEA 2RN8A 2DTHA 5KE3A 1NEGA 3JCMb 3VS1A 3CCVT 3QUIA 1Q82R 4ELYC 5IHKA 4XTVA 4FL6A 3J80E 1VQ8T 1IB8A 2DK3A 1B34B 4QVCA 3KBGA 3OMCA 1BU1A 5CKDA 4M7AE 2XIDA 4KUDK 2JVVA 5DLOA 1IRXA 1VIFA 1XJWB 4M78C 4ZNXA 1QVGP 2PU9B 2HCKA 4C8QB 4ME7A 5KYUA 4HT9A 1E6HA 2KBTA 1CKAA 3QSUA 4JRQA 1M8VA 5GJVB 1OV3A 3A8MB 2XDBA 1WXTA 1KQSP 1I5LA 2QI2A 3OS5A 3SD4A 1RUWA 1X2QA 2RQWA 3EGUA 2L89A 1G2BA 1U5SA 4PJOE 4A54A 2WACA 4LUDA 2E41A 1IREB 1VQKQ 4BB7A 4BACA 3ME9A 3JCMf 1C1AA 6AT1B 4M7AG 4J6YA 2MWPA 3EHRA 4E7SA 2DJQA 1YJ9Q 1RAAB 1TG0A 4TVRA 1AEYA 3VJPA 1WA7A 1JQQA 2X9HA 1BIBA 2LX9A 4JJNK 3M0UA 2EGCA 4AFZC 4JLIA 2ZPFB 4FT4A 2EJFA 1XQHA 3LH5A 3SWNC 3VS5A 3QJ6A 2JT4A 2DAQA 4IIMA 1JBMA 5LJ5e 4E47A 4HCBA 5CAIA 1WYXA 1F1BB 1WHKA 1N9SA 4RCCA 2OTJA 4J9IA 2EW3A 2NUTA 2F5TX 2E12A 2DX1A 1KD1R 2KYMA 1QVPA 2YWWA 2DERA 1WZOA 4PNOA 3G6EQ 4NOYA 2LNVA 2L3RA 3JCMh 2KGTA 5GAN8 2FPDA 3META 1YJWQ 1U1SA 2O88A 2D9TA 3OQ5A 1IO6A 4HVWA 2X4JA 3MHXA 4MDWA 1X6GA 3OSVA 1M2OA 5J26A 3V7RA 3JCMd 1GCPA 2GQVA 3V7SA 3JB9F 4Q5WA 1D3BB 3QDRB 4P5NA 1MV0B 4M78F 1HK9A 4J9HA 1OYXA 3QWYA 4M7DA 4EMKA 1UGQB 2LJ0A 1G3YA 1WXBA 2CZ1B 3HHTB 2KMTA 4M7AD 3JAME 4Z02A 1KJWA 2ESWA 4Z8AA 4QKUA 2K3YA 5GMKi 2JN0A 4BE0A 2DXTA 2SEMA 4Z88A 3M53A 2P0PA 4JPBW 2D6FA 3THKA 2COWA 4N0AA 1NYFA 4XU0A 4IUTA 3CXCP 1KQ1A 1LOJA 1D0YA 5DM7R 1YWPA 2JNGA 2YDLA 3ER0A 1HJDA 5I2SA 2VXEA 1PG5B 3CCEA 1XNIA 3UA7A 5L8RE 4M78A 2M02A 3BDLA 2O4XA 5CK9A 1JJ2A 1S72Q 1PD1A 3MP6A 2NUPA 2YLCA 3EGXA 4KRTA 5KYYA 4HA8A 3UWNA 4HCCA 4PFOA 2AHJB 1H3ZA 2ENMA 5GAOr 3M5AA 2CS7A 1VYTA 1ZA1B 2YHTA 2BUDA 3L2QA 3QHSA 2OJ2A 2RHYA 3DB3A 3OSSC 3S6WA 4E7LA 1DJ7B 5IT9E 3C0CA 4JJCA 1G5VA 3TSWA 4BUGA 3MO8A 3M9QA 2DL7A 1BCOA 3FC3A 1VQKT 5CO7A 2QGFB 2QQSA 3CCQT 1YJ9T 2KK4A 1MMAA 1KHCA 4MZMA 1W2BP 3I56T 4B9WA 3URGA 2RNAA 4JDSA 4C8QC 5A0LA 1XOVA 2PVDB 1IGUA 2R57A 1N27A 3M0SA 5LJ5g 1YCYA 1PKTA 1VUBA 3JCMe 4LD6A 3CC2T 2JM9A 2R58A 4C5HA 2RJFA 2DTIA 5GMKl 3GPLA 5KCHA 3EGDB 3LW5E 1H641 3JCMQ 4C5IA 1NLPC 4XK8E 1AWOA 1VQNQ 3PTAA 2LRQA 1GBRA 2Y4XA 1VQOA 2GFAA 2RQTA 2EFIA 2R5AA 1WGSA 2B86A 2LJ1A 1K73C 2GQIA 2WSEE 1SKUB 4OF1A 3I55A 2H8HA 1WHMA 3DB4A 2LCCA 3VUZA 2DL4A 1K8AU 4FYWB 1VQMA 1PHTA 1TOVA 2BZ8A 1QCFA 1VQ4T 2JTFA 1M1KC 3G4ST 2V26A 1G83A 5KYNA 2LX7A 4ZN3A 2DL8A 3VS6A 2KXDA 1X2KA 2K3BA 4FYXB 2ZPIB 3C95A 2VV5A 2CT3A 2H3EB 1CSKA 4OB2B 4M77B 4E7JA 1Q81C 1D09B 1ZA2B 1TH7A 2KNBB 3GBQA 1Y96B 2FHDA 1X43A 2DILA 4OB0B 5C6SA 1PRLC 2J6KA 3CMAQ 2OTJT 2A7YA 1M1FA 1NYGA 1WHJA 2P4TA 2PUKB 1YJNQ 2ZPHB 4VUBA 1M30A 1M4ZA 3OA6A 1VQLA 5KYXB 2ROLA 1HSQA 5GAMg 1X75C 1W4SA 1BK2A 4X34A 1ZBXA 2G6FX 4M7AB 1OPKA 3M57A 2MCNA 4ZGDB 3HPWA 1VIEA 3R6OA 4QT7A 4C8QF 1VQ6T 3OS1A 1Y57A 2IIMA 1Q86C 3KXTA 2CDTA 1YHQT 1QWEA 3EG2A 4LXCA 2X51A 2CSQA 3VU3C 1QVFP 3CCVQ 2C06A 1ZQ1A 2RQRA 1FXXA 3LGLA 4BY6B 2L3SA 4AMCA 4RCBA 4PJOB 5IHNA 1OEBA 1VQ8Q 4FT2A 1RLPC 3M0RA 4C0GA 3HRTA 3CCRA 2CSIA 1ARKA 4Z89A 2EQUA 2HDAA 4ZTFA 3IQLA 3MPUB 1VQ7Q 8AT1B 1YITT 5CKBA 4LE9A 3JB9J 3JCMV 1K9MU 3D7SB 2K79A 3OBWA 1WJQA 4C8QA 2HL5C 3LGFA 4KGVB 3T9NA 4OMFB 1FX7A 1PCXA 4CC7A 4QVDA 2A3LA 4NL3A 3CC4T 1Y71A 1RAHB 5KYWA 5GAN3 2KY9A 2DFUA 2F1LA 3CCJA 1G3SA 4JZ3A 1YIJA 4AG1C 1M90C 7AT1B 3TU4K 2WSFE 2KVQG 2EQKA 2KI7A 5FWCA 2ECZA 3LH0A 3CCST 1Z9QA 2HAXA 2V8JA 4OMQA 4C92E 2RJEA 3ULRB 2HMAA 4JJDA 9ATCB 1T0JA 3OYNA 2XMFA 4A4HA 2MI6A 1LPLA 3M55A 4ELZC 2A28A 5FWBA 3M4YA 4FSXA 5LJ5j 1AD5A 3A8OB 4E2FB 3DKMA 4M75E 1VQPA 5GAOq 4LUEA 3ZBDA 3G71A 3OB9A 2L0AA 3CCUT 2ED0A 1QKWA 4HVUA 2DKGA 2XKOC 1M3CA 2F2WA 4C92G 3VRZA 4UC4A 1M3AA 3NPFA 3M56A 1ZUKA 3EH1A 4L5GA 2JS0A 4BI3A 4K11A 1BI3A 2QASA 2QA4A 2O9VA 2QQRA 3OBYA 1YBYA 2DXCA 1IZ6A 5AYFA 4ATOA 2COZA 1LCKA 2HD0A 2DRMA 4M75G 4JRPA 2LQKA 1HYOA 1RL2A 1M9SA 3PIPA 4ZTJA 2L3QA 2JTEA 4C0FA 2EBPA 5FU7B 1EZZB 1SRMA 2QQBA 2H3JA 1YJNT 4BE2A 1PWTA 3OS0A 4A63B 2A36A 4XU3A 3CMET 2FPEA 2DJZA 2LMJA 1Q7YC 2EWNA 3M59A 3QYHB 1OPLA 3EFRA 4M77C 4NL2A 3EG3A 3HFNA 2FL7A 5GAMf 1SSFA 5KH6A 2QTVA 3X20B 2CP7A 3CD6T 3V8JA 5A0GA 4MZPA 3HTRA 1Q95G 4D8DA 1OOTA 2D1XA 4EPCA 3HRUA 4HCKA 3SHWA 3E9GA 4IUPA 5GAMj 3JRZA 1K8AR 5EG2A 3E9FA 1MMGA 2D8HA 3VS4A 4M7DE 4F04B 4Y28E 2PVOB 3C12A 1VQ5Q 4M7AC 2YRVA 3M54A 2X4XA 2XDDA 4LDXA 1SG5A 4WCIA 4LDYA 1M1KR 1JEGA 3PFSA 4C92D 2HQHA 2CUDA 4M77G 3RMSA 1VQ7T 1JJ2S 5GAOp 1YI2A 3RKWA 3CCLQ 8ATCB 1OU9A 2K9GA 2EJGA 2QG9B 2OTLA 1UGVA 3N5BB 4BY6C 3MP8A 2BZXA 1Q81R 3FB9A 4M75D 4PJOC 2VUBA 3LWHA 2XDPA 5GAMh 3A8HB 2JJ9A 3JCMX 2V8KA 5L23A 2PZ1A 5KE2A 2JZ2A 2QXFA 1QKXA 4XU1A 2CT4A 3CC7A 2M16A 5FLXE 1FMWA 3GOXA 3FRNA 2E10A 4PLLA 3CCQQ 4HXJA 2DBMA 5KCOA 5GAMd 3I56Q 4CC2A 3CPWA 4JS4A 2FEIA 5CKEA 2ZAEA 4DBRA 1M2VA 3UDCA 1J3TA 2E3HA 3CC2Q 4OMPA 5GAOn 3G6EA 2DETA 2GCXA 3E1SA 2JM8A 1OX8A 4OGCA 1YJWA 1EFNA 4PJOG 1IXDA 2VGMA 3UPUA 5GAN7 4M77F 1V1CA 2LQ8A 4RUGA 4BDYA 1AHJB 4L59A 3OYCA 3NTKA 3L2UA 3CCMA 2W10A 1RLQC 3OYLA 1V76A 4J6WA 5IN1A 4EMHA 4II1A 2IVWA 4DOVA 4PLIA 1N8RR 2CKKA 2DF6A 2COYA 4DEYA 2EYYA 1WLPB 4E7KA 4A53A 4J83A 4QVZA 4F7UE 1JO8A 1VYUA 2YUPA 1K9MR 1ZX6A 3P8HA 1IGQA 3TVTA 2XHCA 4M77D 4C5GA 2CH4A 1Y07A 3ZEHA 4M7AF 1GBQA 1VQ4Q 3BFMA 1TWBA 2PUOB 3G4SQ 1GXIE 3X26B 4DEXA 3C4SA 4C5EA 4ZN1A 3ZL7C 1K0SA 2WSCE 4ZGJB 2CGHA 4FU6A 5ECAA 1T3LA 5I11A 3HP9A 4JLGA 2E4HA 3S3MA 3EFOB 2RJCA 4F7UG 1Y96A 1SSHA 4FYVB 4PJOF 2Z0WA 1TSFA 2DM1A 2XU8A 4J9BA 3LWIA 2OTJQ 1OZ2A 2K5IA 1BI2A 1RAIB 2QGGA 1E6GA 3QG1A 4XU2A 1X27A 4MMLA 1PKSA 1S72A 5CR2A 1TU0B 3H8ZA 5KYXA 3I5RA 2FO0A 4C0DC 4OB1B 2I2LA 1QCOA 1KHIA 3RNJA 5FU7C 1W1FA 4M7AA 2I0NA 3L2WA 1VQ6Q 4PJOD 3VRYA 3LLRA 4PL6A 2CP3A 2HSPA 1SHFA 5GAMe 1VQ9T 1YHQQ 2P0KA 1ZSZB 5GANe 2DBKA 1PSFA 1VQ5T 4RTYA 4OB3B 3OYYA 2GTJA 2DYBA 1UHFA 1ZHIA 2O2OA 1WFWA 2VYTA 5A2QE 1RAEB 2LVMA 3OYKA 2DL3A 2MYSA 2VXFA 4PFPA 4D8KA 1YCSB 3GLXA 2HKQB 4PJOA 4KGXB 1K4US 2RHUA 3JSCA 3CCLT 2CZ7B 1FWZA 2K4YA 4BE1A 1UDLA 2LTOA 2KR3A 3CBOA 2KSSA 4RTXA 1YITQ 2EYWA 5D6WA 3OW2A 4DA4A 4GBQA 4M4ZA 4C92B 2K6DA 3M4GA 3X24B 2LCLA 1VQNA 4EMGA 3QIIA 1R0BG 2SRCA 1UJ0A 3CC4Q 1R77A 2K2VA 3OYIA 2BE7D 4QW2A 2Y4YA 3SWNA 1Q7YR 1NE8A 1PD0A 1KC8R 4M75B 1X6OA 5HCKA 3VS2A 1OI1A 4B9XA 2YSQA 4FSSA 2RQVA 2X3WD 4XTZA 4IUUA 3S3OA 3EH2A 3CCSQ 2DA9A 4HCZA 1W6XA 3NTHA 1QP2A 2K57A 3CQTA 1T0HA 1SEMA 2AZSA 2EQJA 5CQXA 4J5YA 2GGRA 3A8GB 3BW1A 1I5OB 2M0OA 4RTTA 1I81A 2E6NA 3FLGA 1RADB 5FRNA 2NWMA 3M0QA 4B6MA 3VKIA 5LJ3g 3MEVA 3CMAA 3CCUQ 3CBPA 1AWWA 5IAYA 1QVGA 1A0NB 2EQMA 1Q82C 1GRIA 3VS0A 1M1KU 4AFQC 2EQIA 3OYGA 1IHVA 1KQSA 4HKEA 1GCQC 3MJXA 3QZ5B 2DVJA 2HBPA 2MK5A 2QEXA 3NGPA 2MIOA 2CZ6B 2DZCA 3BY7A 2L3PA
chains in the Genus database with same CATH topology
5FWBA 1OV3A 3I5SA 1UJYA 1WI7A 1WXTA 2W0ZA 2MOXA 1AD5A 1RUWA 2JS2A 1X2QA 2RQWA 3EGUA 1G2BA 3REBB 1U5SA 1BB9A 4J9DA 4LUEA 1UUEA 4LUDA 1UG1A 2LQWA 2L0AA 3EHRA 2ED0A 2DJQA 2YUNA 2JW4A 1QKWA 4HVUA 4J9CA 1PNJA 1TG0A 1M3CA 2F2WA 1UTIA 1AEYA 4X1VA 2GNCA 1WA7A 3VRZA 1M3AA 3EG1A 2L2PA 3NPFA 1JQQA 1ZUKA 3M0UA 2JS0A 2EGCA 4K11A 4AFZC 2EPDA 4Y92A 2ROTA 2O9VA 3A98A 5IXBA 2KXCA 3LH5A 1LCKA 3VS5A 2YUQA 2DRMA 2JT4A 1FMKA 2L3QA 3EHQA 2JTEA 4IIMA 2JMAA 2EYXA 2EBPA 1GL5A 1NM7A 1SRMA 1UECA 1WYXA 2EGEA 3NHNA 1PWTA 4J9IA 4A63B 1K76A 4ESRA 2A36A 2EW3A 2FPEA 2LMJA 2DX1A 1U3OA 1YN8A 2KYMA 2P4RA 2FG0A 1OPLA 3EG3A 2KGTA 2FPDA 1MV3A 2O88A 1E7OA 2K7AA 4D8DA 1IO6A 1OOTA 4HVWA 2D1XA 2DLPA 2HBWA 2F2VA 1ZSGA 2K2MA 1N5ZA 4HCKA 1X6GA 1QLYA 3SHWA 1WXUA 2J6FA 3UA6A 1GCPA 1MUZA 1I0CA 4LNPA 1MV0B 4J9HA 2D8HA 3O5ZA 3VS4A 5IH2A 3QWYA 5GJWB 1JXMA 2D8JA 2LQNA 2LJ0A 1M3BA 1WXBA 1UE9A 4F17A 1KJWA 2ESWA 1AZGB 2E5KA 3EG0A 5IXFA 4WCIA 4Z8AA 3NMZC 2LP5A 1JEGA 1KIKA 2EVRA 1YNZA 2CUDA 1T3SA 4JJBA 1SRLA 1U06A 2KRSA 2M0YA 4E6RA 3U23A 3SEMA 2SEMA 4Z88A 2K9GA 1UGVA 1SHGA 4JPBW 3THKA 2BZXA 1NYFA 4GLMA 5L23A 2PZ1A 1QKXA 4IIOA 1YWPA 1VYVA 2CT4A 2RQUA 2YDLA 1GFCA 2KRNA 1ZLMA 1HJDA 2CREA 2C0IA 2KYBA 3UA7A 1GFDA 1GCQA 4HXJA 2DBMA 2LJ3A 1BBZA 1M8MA 2RPNA 2PTKA 4CC2A 2A37A 1X69A 2A08A 4KRTA 2OAWA 1NLOC 2GBQA 2CH4W 2FEIA 5I22A 1J3TA 1Y0MA 2ENMA 4OMPA 1VYTA 1ZUUA 2OJ2A 2JM8A 2KT1A 2CUBA 2M51A 1S1NA 1EFNA 1KSWA 1V1CA 2JMCA 1X6BA 4RUGA 3C0CA 2FPFA 4JJCA 1WDXA 4RTWA 2W10A 1RLQC 3TSWA 2DL7A 2V1RA 2DF6A 4DEYA 2EYYA 1WLPB 1JO8A 1VYUA 2RNAA 1QWFA 1XOVA 2YUPA 1ZX6A 3TVTA 3M0SA 4AFUC 2CH4A 1UFFA 1I07A 1PKTA 3RBBB 1GBQA 4OMNA 2JM9A 3VS7A 2EYZA 4HVVA 1AWXA 2ABLA 2GTOA 4DEXA 2AK5A 3TSZA 3ZL7C 1TUDA 1Z9ZA 1K0SA 2OI3A 1NLPC 2DNUA 1AWOA 1GBRA 5ECAA 1T3LA 5I11A 1HD3A 2RQTA 1JU5C 1W70A 4AG2C 2B86A 2LJ1A 3I9QA 2GQIA 1SSHA 1AOJA 3H0IA 1ZUYA 2DM1A 2H8HA 4J9BA 2JXBA 3QWXX 1E6GA 2DL4A 4EIKA 3FJ5A 1X27A 1PHTA 1PKSA 2VKNA 2BZ8A 2X3XD 1QCFA 2FO0A 3I5RA 3R6NA 2VWFA 2AKLA 2HEQA 3RNJA 4RTUA 1W1FA 1G83A 2I0NA 1NEBA 2LX7A 2DL8A 1AWJA 3VRYA 1CKBA 4RTVA 3I35A 1FYNA 2HSPA 3VS6A 2KXDA 1SHFA 1X2KA 2K3BA 1K9AA 4JZ4A 4F16A 2CT3A 2LZ6B 1CSKA 2YUOA 2DBKA 2EGAA 3M0PA 3KFVA 4RTYA 3M0TA 2GTJA 1RI9A 4J9GA 2KNBB 2DYBA 3GBQA 4AFSC 1X43A 1UHFA 2DILA 1SPKA 1UHCA 2O9SA 2O2OA 1WFWA 1PRLC 3PVQA 2J6KA 3H0FA 1B07A 4LN2A 1H92A 2DL3A 2C0TA 1NYGA 2DMOA 5IHIA 2BZYA 1AVZC 1JXOA 4D8KA 1YCSB 3PVLA 1ABQA 1M30A 1KFZA 1K0XA 1K4US 1WIEA 2J7IA 2DE0X 2ROLA 4R0KA 1HSQA 2AKKA 4OMLA 4J9EA 1BK2A 2DRKA 1UDLA 2O31A 2DL5A 2G6FX 1OPKA 2MCNA 2KR3A 1H3HA 4QT7A 4RTXA 3VS3A 2EYWA 2FRYA 4GBQA 1Y57A 2IIMA 4M4ZA 1YWOA 2K6DA 1ABOA 2LNHB 3PE0A 1WX6A 2PNIA 2CDTA 1QWEA 3EG2A 4OMOA 2KROA 2CSQA 4CC4B 2KE9A 2SRCA 2J6OA 2RQRA 1UJ0A 2RF0A 2C0OA 3UF4A 2BTTA 2J06A 2L3SA 5HCKA 3VS2A 2YSQA 4FSSA 2RQVA 2V1QA 5IHNA 1OEBA 2X3WD 1M27C 2D0NA 2LCSA 1RLPC 3M0RA 1TUCA 2J05A 3REAB 1YP5A 2CSIA 1ARKA 1H8KA 2EKHA 4Z89A 2DA9A 2KEAA 1W6XA 2HDAA 3IQLA 3CQTA 1ZBJA 4LE9A 1T0HA 2KT8A 1PRMC 2K79A 1SEMA 1I1JA 2AZSA 4OMMA 2ED1A 2F2XA 2FRWA 2GGRA 2KRMA 3H41A 4ORZA 1VA7A 2RN8A 4RTTA 2RMOA 1NEGA 4CC7A 3VS1A 3UATA 2VVKA 4J9FA 2NWMA 1AZEA 3M0QA 2QDLA 3H0HA 4F14A 2NUZA 5FW9A 5IHKA 1K1ZA 4JZ3A 1AWWA 5EC7A 4AG1C 1A0NB 1GRIA 3VS0A 1BU1A 5FWCA 2ECZA 1Z9QA 2YT6A 4AFQC 2EQIA 4OMQA 1B3QA 4CC3A 4RTZA 1GCQC 3ULRB 2AZVA 4JJDA 3JV3A 4ZNXA 1T0JA 2DVJA 2HCKA 2XMFA 3NGPA 1E6HA 2KBTA 2MIOA 1CKAA 1NG2A 5GJVB 2L3PA 2A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWB A;  1OV3 A;  3I5S A;  1UJY A;  1WI7 A;  1WXT A;  2W0Z A;  2MOX A;  1AD5 A;  1RUW A;  2JS2 A;  1X2Q A;  2RQW A;  3EGU A;  1G2B A;  3REB B;  1U5S A;  1BB9 A;  4J9D A;  4LUE A;  1UUE A;  4LUD A;  1UG1 A;  2LQW A;  2L0A A;  3EHR A;  2ED0 A;  2DJQ A;  2YUN A;  2JW4 A;  1QKW A;  4HVU A;  4J9C A;  1PNJ A;  1TG0 A;  1M3C A;  2F2W A;  1UTI A;  1AEY A;  4X1V A;  2GNC A;  1WA7 A;  3VRZ A;  1M3A A;  3EG1 A;  2L2P A;  3NPF A;  1JQQ A;  1ZUK A;  3M0U A;  2JS0 A;  2EGC A;  4K11 A;  4AFZ C;  2EPD A;  4Y92 A;  2ROT A;  2O9V A;  3A98 A;  5IXB A;  2KXC A;  3LH5 A;  1LCK A;  3VS5 A;  2YUQ A;  2DRM A;  2JT4 A;  1FMK A;  2L3Q A;  3EHQ A;  2JTE A;  4IIM A;  2JMA A;  2EYX A;  2EBP A;  1GL5 A;  1NM7 A;  1SRM A;  1UEC A;  1WYX A;  2EGE A;  3NHN A;  1PWT A;  4J9I A;  4A63 B;  1K76 A;  4ESR A;  2A36 A;  2EW3 A;  2FPE A;  2LMJ A;  2DX1 A;  1U3O A;  1YN8 A;  2KYM A;  2P4R A;  2FG0 A;  1OPL A;  3EG3 A;  2KGT A;  2FPD A;  1MV3 A;  2O88 A;  1E7O A;  2K7A A;  4D8D A;  1IO6 A;  1OOT A;  4HVW A;  2D1X A;  2DLP A;  2HBW A;  2F2V A;  1ZSG A;  2K2M A;  1N5Z A;  4HCK A;  1X6G A;  1QLY A;  3SHW A;  1WXU A;  2J6F A;  3UA6 A;  1GCP A;  1MUZ A;  1I0C A;  4LNP A;  1MV0 B;  4J9H A;  2D8H A;  3O5Z A;  3VS4 A;  5IH2 A;  3QWY A;  5GJW B;  1JXM A;  2D8J A;  2LQN A;  2LJ0 A;  1M3B A;  1WXB A;  1UE9 A;  4F17 A;  1KJW A;  2ESW A;  1AZG B;  2E5K A;  3EG0 A;  5IXF A;  4WCI A;  4Z8A A;  3NMZ C;  2LP5 A;  1JEG A;  1KIK A;  2EVR A;  1YNZ A;  2CUD A;  1T3S A;  4JJB A;  1SRL A;  1U06 A;  2KRS A;  2M0Y A;  4E6R A;  3U23 A;  3SEM A;  2SEM A;  4Z88 A;  2K9G A;  1UGV A;  1SHG A;  4JPB W;  3THK A;  2BZX A;  1NYF A;  4GLM A;  5L23 A;  2PZ1 A;  1QKX A;  4IIO A;  1YWP A;  1VYV A;  2CT4 A;  2RQU A;  2YDL A;  1GFC A;  2KRN A;  1ZLM A;  1HJD A;  2CRE A;  2C0I A;  2KYB A;  3UA7 A;  1GFD A;  1GCQ A;  4HXJ A;  2DBM A;  2LJ3 A;  1BBZ A;  1M8M A;  2RPN A;  2PTK A;  4CC2 A;  2A37 A;  1X69 A;  2A08 A;  4KRT A;  2OAW A;  1NLO C;  2GBQ A;  2CH4 W;  2FEI A;  5I22 A;  1J3T A;  1Y0M A;  2ENM A;  4OMP A;  1VYT A;  1ZUU A;  2OJ2 A;  2JM8 A;  2KT1 A;  2CUB A;  2M51 A;  1S1N A;  1EFN A;  1KSW A;  1V1C A;  2JMC A;  1X6B A;  4RUG A;  3C0C A;  2FPF A;  4JJC A;  1WDX A;  4RTW A;  2W10 A;  1RLQ C;  3TSW A;  2DL7 A;  2V1R A;  2DF6 A;  4DEY A;  2EYY A;  1WLP B;  1JO8 A;  1VYU A;  2RNA A;  1QWF A;  1XOV A;  2YUP A;  1ZX6 A;  3TVT A;  3M0S A;  4AFU C;  2CH4 A;  1UFF A;  1I07 A;  1PKT A;  3RBB B;  1GBQ A;  4OMN A;  2JM9 A;  3VS7 A;  2EYZ A;  4HVV A;  1AWX A;  2ABL A;  2GTO A;  4DEX A;  2AK5 A;  3TSZ A;  3ZL7 C;  1TUD A;  1Z9Z A;  1K0S A;  2OI3 A;  1NLP C;  2DNU A;  1AWO A;  1GBR A;  5ECA A;  1T3L A;  5I11 A;  1HD3 A;  2RQT A;  1JU5 C;  1W70 A;  4AG2 C;  2B86 A;  2LJ1 A;  3I9Q A;  2GQI A;  1SSH A;  1AOJ A;  3H0I A;  1ZUY A;  2DM1 A;  2H8H A;  4J9B A;  2JXB A;  3QWX X;  1E6G A;  2DL4 A;  4EIK A;  3FJ5 A;  1X27 A;  1PHT A;  1PKS A;  2VKN A;  2BZ8 A;  2X3X D;  1QCF A;  2FO0 A;  3I5R A;  3R6N A;  2VWF A;  2AKL A;  2HEQ A;  3RNJ A;  4RTU A;  1W1F A;  1G83 A;  2I0N A;  1NEB A;  2LX7 A;  2DL8 A;  1AWJ A;  3VRY A;  1CKB A;  4RTV A;  3I35 A;  1FYN A;  2HSP A;  3VS6 A;  2KXD A;  1SHF A;  1X2K A;  2K3B A;  1K9A A;  4JZ4 A;  4F16 A;  2CT3 A;  2LZ6 B;  1CSK A;  2YUO A;  2DBK A;  2EGA A;  3M0P A;  3KFV A;  4RTY A;  3M0T A;  2GTJ A;  1RI9 A;  4J9G A;  2KNB B;  2DYB A;  3GBQ A;  4AFS C;  1X43 A;  1UHF A;  2DIL A;  1SPK A;  1UHC A;  2O9S A;  2O2O A;  1WFW A;  1PRL C;  3PVQ A;  2J6K A;  3H0F A;  1B07 A;  4LN2 A;  1H92 A;  2DL3 A;  2C0T A;  1NYG A;  2DMO A;  5IHI A;  2BZY A;  1AVZ C;  1JXO A;  4D8K A;  1YCS B;  3PVL A;  1ABQ A;  1M30 A;  1KFZ A;  1K0X A;  1K4U S;  1WIE A;  2J7I A;  2DE0 X;  2ROL A;  4R0K A;  1HSQ A;  2AKK A;  4OML A;  4J9E A;  1BK2 A;  2DRK A;  1UDL A;  2O31 A;  2DL5 A;  2G6F X;  1OPK A;  2MCN A;  2KR3 A;  1H3H A;  4QT7 A;  4RTX A;  3VS3 A;  2EYW A;  2FRY A;  4GBQ A;  1Y57 A;  2IIM A;  4M4Z A;  1YWO A;  2K6D A;  1ABO A;  2LNH B;  3PE0 A;  1WX6 A;  2PNI A;  2CDT A;  1QWE A;  3EG2 A;  4OMO A;  2KRO A;  2CSQ A;  4CC4 B;  2KE9 A;  2SRC A;  2J6O A;  2RQR A;  1UJ0 A;  2RF0 A;  2C0O A;  3UF4 A;  2BTT A;  2J06 A;  2L3S A;  5HCK A;  3VS2 A;  2YSQ A;  4FSS A;  2RQV A;  2V1Q A;  5IHN A;  1OEB A;  2X3W D;  1M27 C;  2D0N A;  2LCS A;  1RLP C;  3M0R A;  1TUC A;  2J05 A;  3REA B;  1YP5 A;  2CSI A;  1ARK A;  1H8K A;  2EKH A;  4Z89 A;  2DA9 A;  2KEA A;  1W6X A;  2HDA A;  3IQL A;  3CQT A;  1ZBJ A;  4LE9 A;  1T0H A;  2KT8 A;  1PRM C;  2K79 A;  1SEM A;  1I1J A;  2AZS A;  4OMM A;  2ED1 A;  2F2X A;  2FRW A;  2GGR A;  2KRM A;  3H41 A;  4ORZ A;  1VA7 A;  2RN8 A;  4RTT A;  2RMO A;  1NEG A;  4CC7 A;  3VS1 A;  3UAT A;  2VVK A;  4J9F A;  2NWM A;  1AZE A;  3M0Q A;  2QDL A;  3H0H A;  4F14 A;  2NUZ A;  5FW9 A;  5IHK A;  1K1Z A;  4JZ3 A;  1AWW A;  5EC7 A;  4AG1 C;  1A0N B;  1GRI A;  3VS0 A;  1BU1 A;  5FWC A;  2ECZ A;  1Z9Q A;  2YT6 A;  4AFQ C;  2EQI A;  4OMQ A;  1B3Q A;  4CC3 A;  4RTZ A;  1GCQ C;  3ULR B;  2AZV A;  4JJD A;  3JV3 A;  4ZNX A;  1T0J A;  2DVJ A;  2HCK A;  2XMF A;  3NGP A;  1E6H A;  2KBT A;  2MIO A;  1CKA A;  1NG2 A;  5GJV B;  2L3P A;  2A28 A; 
#chains in the Genus database with same CATH topology
 3I5S A;  4RG8 A;  1Q81 U;  1VQO Q;  4O6J A;  1NJI C;  2RHZ A;  4KBM B;  1RAB B;  3REB B;  3CCV A;  4J9D A;  4ANJ A;  5GMK e;  1WJR A;  4M7D B;  4EMK B;  2LQW A;  5GAN 4;  3CME Q;  4X9D A;  3OYD A;  5GAN g;  2JW4 A;  4J9C A;  1PNJ A;  1VQ8 A;  1X01 A;  1UTI A;  4X1V A;  4JS5 A;  3EG1 A;  2QQ9 A;  3RDV A;  1N9R A;  1PM3 A;  3E2U A;  2VC8 A;  2EPD A;  4Y92 A;  4XAX B;  2ROT A;  3CD6 Q;  4KT0 E;  4J6X A;  2KXC A;  5I2M A;  3TCJ A;  1UGR B;  4N4I A;  3V8K A;  5HK3 A;  2EYX A;  2DYI A;  3L1A A;  2E65 A;  2BKD N;  3NHN A;  1BCM A;  1TXQ A;  2ZPE B;  1K76 A;  1WPY A;  1N8R U;  1B34 A;  3OYB A;  3QZ9 B;  4XQ3 A;  2P4R A;  2NUP B;  5KYY B;  3EGX B;  1VQL Q;  2KQW A;  1C6V X;  2FG0 A;  3OYA A;  2HQE A;  2E1H A;  1R0C B;  3GIB A;  2PQW A;  4YTL A;  2A0F B;  1WHH A;  3LX7 A;  1MV3 A;  2DZ9 A;  1E7O A;  4GLK A;  3BDU A;  1KD1 C;  3E19 A;  2RD1 A;  4J7F A;  2DLP A;  2HBW A;  2F2V A;  1BKB A;  2K2M A;  1N5Z A;  2RHX A;  2DEQ A;  2ZGW A;  4DBF A;  2J6F A;  3UA6 A;  1I0C A;  3PMT A;  3WVE B;  2X35 A;  3CCE T;  3VV0 A;  1WJS A;  2LC4 A;  5IH2 A;  1JXM A;  1M1G A;  1M3B A;  1TUG B;  1JRI A;  1WQ7 A;  4BDZ A;  1AZG B;  5IXF A;  2DIQ A;  4C92 C;  2LP5 A;  4C0Z A;  1KIK A;  1MMD A;  4F7U B;  2EVR A;  3TQ7 P;  1YNZ A;  2CP6 A;  4JJB A;  1U06 A;  2KRS A;  2M0Y A;  2RI3 A;  4XTU A;  4E6R A;  3CPW S;  3CXC A;  2R5M A;  3U23 A;  2K5L A;  2CP5 A;  1QQJ A;  3H9N A;  1RAG B;  4M75 C;  3V7C A;  2DXB A;  2P84 A;  4PJL A;  1KK7 A;  2ZPG B;  3MEU A;  4J7I A;  2AIR B;  2CP2 A;  3QKJ A;  4IIO A;  1VYV A;  2KRN A;  2QYZ A;  1ZLM A;  2CRE A;  2C0I A;  1D1C A;  4A4K A;  1GCQ A;  2LJ3 A;  2RPN A;  2PTK A;  4CRI A;  3CCJ Q;  2MPX C;  1QMC A;  4OP0 A;  1X69 A;  3P8D A;  2OAW A;  1NLO C;  3EG9 B;  3TRE A;  3L42 A;  4PFZ A;  5LJ3 f;  4QQG A;  1KG1 A;  1Y0M A;  2OAU A;  2RM4 A;  5FU6 B;  2KT1 A;  1JJ2 P;  2CUB A;  1O75 A;  4IKF A;  2IPO B;  2RH2 A;  3H6Z A;  2GFU A;  2FVU A;  4KGZ B;  1BI1 A;  2JMC A;  5LJ3 j;  4BI8 B;  1VQO T;  2LT1 A;  4QQD A;  2MWO A;  1W2B A;  2FPF A;  1D3B A;  4IUQ A;  4RTW A;  4BI4 A;  3PGG A;  3VUB A;  4PJN A;  3I55 T;  2V1R A;  2V8I A;  3EFO A;  2DPP B;  1VQP Q;  3UT1 A;  4IUV A;  1QW1 A;  3DLM A;  2L8D A;  5J39 A;  1VQM T;  3G1J A;  1Q7Y U;  1QWF A;  1KC8 U;  3OYE A;  4N4H A;  1UFF A;  2RO0 A;  1I07 A;  4PJM A;  4OMN A;  3QJY A;  4KH1 B;  3VS7 A;  5GAN f;  2EYZ A;  4HVV A;  3X25 B;  1AWX A;  3P8B B;  2ABL A;  4C92 F;  2QA4 Q;  5LJ3 h;  3TSZ A;  1BIA A;  1K73 R;  4KUI A;  1TUD A;  2OI3 A;  2DNU A;  2RJD A;  3VYH B;  1VQ9 Q;  1KQ2 A;  5GAN j;  5I21 A;  1HD3 A;  4CI0 C;  1N6A A;  2MAM A;  4AG2 C;  3Q1J A;  4M75 F;  1I4K 1;  3I9Q A;  5LJ3 d;  3H0I A;  1ZUY A;  1VQK A;  1R8O B;  1VQL T;  1C0M A;  3LYI A;  2JXB A;  3OYJ A;  3CCQ A;  1OQK A;  1YJ9 A;  5D6X A;  4EIK A;  3FJ5 A;  5CIU A;  1OUL A;  3I56 A;  2VKN A;  4QQ6 A;  3OYH A;  2X3X D;  4N0A C;  3MKD A;  1AT1 B;  4LDU A;  1HXD A;  2CYZ B;  2AKL A;  2F69 A;  3J81 E;  3CC2 A;  1NEB A;  3HRS A;  1JB0 E;  1AWJ A;  3M58 A;  1I8F A;  4M7D G;  1D1B A;  3CPF A;  4E7Z A;  5GAN h;  2F5K A;  3AT1 B;  2EYQ A;  1K9A A;  2EIF A;  3MEW A;  4JZ4 A;  4C92 A;  1NJI R;  2LZ6 B;  2YUO A;  5DY9 A;  3OW2 S;  3M0T A;  4J9G A;  4M78 E;  2NYS A;  1RI9 A;  4IUR A;  3L2R A;  2VB6 A;  3PVQ A;  1QCN A;  3H0F A;  3FJP A;  4LN2 A;  5GAN d;  5KYW B;  2C0T A;  3CCR T;  2DMO A;  4M75 A;  5IHI A;  1AVZ C;  2FZK B;  3PVL A;  1ABQ A;  4FM4 B;  2QAZ A;  5C0M A;  1LNX A;  1KFZ A;  1QP3 A;  1K0X A;  4RKU E;  2J7I A;  1Q86 R;  2RA2 A;  4OML A;  2XIC A;  3L2V A;  2DRK A;  3X28 B;  1QVF A;  1YI2 Q;  3EGD A;  3FEO A;  4DBQ A;  2DXU A;  1VQ4 A;  3G4S A;  1D0Z A;  2OTL Q;  3JB9 G;  3JB9 H;  1YWO A;  4WF2 A;  1ABO A;  5HK0 A;  2LNH B;  4M78 G;  4JRK A;  2RI5 A;  1WX6 A;  4OMO A;  2QTX A;  1MGQ A;  4MDX A;  1M5Q 1;  4L6V 5;  2J6O A;  3L2Z A;  3CC7 Q;  3CCJ T;  4M7D F;  2C0O A;  2BTT A;  2J06 A;  1YIJ T;  2V1Q A;  1BI0 A;  5GAN 2;  1NPP A;  1M27 C;  2D0N A;  3QO3 A;  2J05 A;  1NZ9 A;  3HKS A;  3REA B;  1H8K A;  1UGP B;  3MEA A;  3NTI A;  2KEA A;  5FRO A;  4DBH A;  4FCY A;  1QVG S;  1MMN A;  5LJ3 e;  4M7D D;  3CBM A;  1I1J A;  4OMM A;  2ED1 A;  2FRW A;  1KQS S;  1VQ6 A;  3JB9 I;  2FB7 A;  3OYM A;  4M77 A;  3MP1 A;  2RMO A;  4DQ2 A;  3ZFJ A;  3CCM Q;  4MMK A;  1VQP T;  4LDW A;  1YHQ A;  3UAT A;  2VVK A;  4J9F A;  5CQY A;  1M90 R;  3G71 T;  2YRC A;  1AZE A;  3MCA B;  4DOW A;  5GMK j;  2QDL A;  3H0H A;  2HL3 A;  4F14 A;  2NUZ A;  5FU6 C;  5FW9 A;  3RIR A;  3HL8 A;  2HSE B;  2FZC B;  3QYG B;  3FIF A;  1K1Z A;  2HQX A;  5GAO m;  1UB4 A;  5EC7 A;  4LD9 K;  5HKC A;  5FRM A;  1P92 A;  1RAF B;  4RG2 A;  2QA4 T;  2QK0 A;  2YT6 A;  4OGE A;  2QQA A;  1B3Q A;  4CC3 A;  4RTZ A;  1OZ3 A;  2AZV A;  2ZPB B;  3JB9 D;  3JV3 A;  1MHN A;  4M78 D;  1YIT A;  3FDR A;  4XTX A;  1U1T A;  2D0Q B;  3PNW C;  1NG2 A;  1UUE A;  1UJY A;  4OVA A;  1WI7 A;  2XG8 D;  5GMK h;  2W0Z A;  2MOX A;  2JS2 A;  2OX7 A;  5A0D A;  2LT4 A;  1BB9 A;  2K3X A;  3F70 A;  3PIO A;  1UG1 A;  3CC4 A;  3WVD B;  2DVE A;  2BE9 B;  4F7U F;  1UGS B;  1ACM B;  2YUN A;  2EKO A;  4XTY A;  5M9O A;  2GNC A;  4A4E A;  2L2P A;  4E7I A;  4J8O A;  5HY6 A;  4A4G A;  3CCS A;  3RER A;  3J7A F;  3A98 A;  2DTO A;  4KH0 B;  5IXB A;  2CP0 A;  5KYU B;  2YLB A;  2EJ9 A;  2HNI A;  2YUQ A;  3GNF B;  1TS9 A;  1FMK A;  3EHQ A;  2YRD A;  1SF9 A;  2JMA A;  3AHU A;  3CCE Q;  1GL5 A;  1MND A;  2XD0 A;  2RK2 A;  1NM7 A;  1UEC A;  2EGE A;  3SB2 A;  2RHI A;  2X4W A;  2DIG A;  4ESR A;  3DLL A;  3RES A;  4FW1 A;  4RMO A;  3OY9 A;  2DO3 A;  1U3O A;  1YN8 A;  3RMQ A;  1YI2 T;  1IHW A;  3CCU A;  4F7U A;  1UEB A;  1M2V B;  2OTL T;  2RB6 A;  4WTO B;  4FYY B;  3EFS A;  4C8Q E;  2K7A A;  1Y7X A;  3SDZ A;  3CXC S;  2HZY A;  3QPH A;  1ZSG A;  3TEE A;  1QLY A;  3CC7 T;  1WXU A;  2GF7 A;  1K73 U;  1MUZ A;  4LNP A;  3O5Z A;  4ZGE B;  5GJW B;  5CKH A;  2D8J A;  1VOM A;  2LQN A;  2NUT B;  1UE9 A;  4F17 A;  1EX4 A;  1LVK A;  1YJN A;  2E5K A;  3EG0 A;  2P0Q A;  3NMZ C;  1K8A C;  3CME A;  3RKX A;  1Q82 U;  3G6E T;  4PJJ A;  4HT8 A;  4GY5 A;  4C8Q G;  1T3S A;  5GAN 5;  4E7H A;  3EG9 A;  1SRL A;  2G3R A;  1YJW T;  1O9S A;  3SEM A;  3A5Z B;  3ASK A;  1SHG A;  1B7T A;  1NBE B;  3JCM c;  3CD6 A;  3WXM B;  3CCM T;  1PSE A;  4PK4 A;  4D6W A;  2RI2 A;  4GLM A;  3INZ A;  2M1H A;  4JUV A;  2RQU A;  1GFC A;  4R56 A;  1NJI U;  1MNE A;  3I55 Q;  2KYB A;  1W2B S;  1GFD A;  4XTW A;  1BBZ A;  1M8M A;  2E3I A;  1VQM Q;  4AT1 B;  2A37 A;  2A08 A;  2E6Z A;  2GBQ A;  2CH4 W;  4PKC C;  5I22 A;  1WHL A;  3NFC A;  1WNL A;  2BIV A;  1D1A A;  3CEY A;  2PVG B;  1ZUU A;  1VQ7 A;  2XI9 A;  1Q86 U;  3QXE B;  3VYG A;  2DD5 A;  2M51 A;  1S1N A;  1WQW A;  3CPW P;  1KSW A;  4Y91 A;  2QEX Q;  2DD4 A;  1X6B A;  4N4G A;  2JOY A;  3OMG A;  3GNG A;  1WDX A;  3QDF A;  2VAS A;  3RKY A;  1RI0 A;  4M78 B;  2O4X B;  3A1P A;  1S72 T;  1ZSZ C;  3PMI A;  3QBY A;  1WHG A;  2FZG B;  4C8Q D;  1N8R C;  4AFU C;  2AT1 B;  2L5Q A;  3RBB B;  2ATC B;  5CVI A;  2XK0 A;  1U8R A;  2MF2 A;  2GTO A;  5AT1 B;  4A4F A;  2AK5 A;  1KD1 U;  3HFO A;  4LDV A;  1K9M C;  1FMV A;  1Z9Z A;  2X4Y A;  3RR6 A;  2JTM A;  5D6Y A;  5GAN 6;  1JU5 C;  1W70 A;  4NS5 A;  1D0X A;  5LL6 S;  3JCM g;  4EDU A;  2K5F A;  4BD3 A;  1AOJ A;  1PC0 A;  3SWN B;  4KUL A;  3CCR Q;  1M90 U;  3GF5 A;  3JCM J;  3QWX X;  1G8X A;  4R55 A;  5CKF A;  5J3B A;  1G3W A;  5GAO l;  2E64 A;  3R6N A;  2QDY B;  2VWF A;  2DEU A;  2HEQ A;  4RTU A;  3O8V A;  2NLU A;  5D7U A;  1CKB A;  4MZT A;  4RTV A;  3I35 A;  1FYN A;  3OS2 A;  5DLQ E;  1VQN T;  5LJ5 f;  3KUF A;  3JCM W;  3SFM A;  1QVF S;  5CCA A;  4F16 A;  2E5Q A;  2JUF A;  2EGA A;  3M0P A;  3KFV A;  4V2S A;  4AFS C;  1SPK A;  1UHC A;  2O9S A;  3RUX A;  1B07 A;  3GP8 A;  1RAC B;  1H92 A;  1YIJ Q;  4FW2 A;  2BZY A;  3PT9 A;  1JXO A;  3OYF A;  3V8L A;  2IG0 A;  1WIE A;  4R0K A;  2DE0 X;  2KAF A;  2AKK A;  2Y90 A;  4JRI A;  4J9E A;  2O31 A;  2DL5 A;  3A8L B;  2CZ0 B;  2RK1 A;  3S3N A;  1H3H A;  3BE3 A;  3VS3 A;  2E70 A;  2FRY A;  2LDM A;  2MMP A;  1V29 B;  2ZCF B;  3PE0 A;  2PNI A;  2KRO A;  4CC4 B;  2KE9 A;  4X9C A;  3HSB A;  1TTH B;  1VQ9 A;  1OU8 A;  5LJ5 h;  3C94 A;  3G71 Q;  3OW2 P;  2RF0 A;  1XTD A;  2YXY A;  4C0D B;  1VQ5 A;  3UF4 A;  2HKN A;  3CMA T;  3JCM P;  2VGN A;  2LCS A;  2KDS A;  4FIB A;  1TUC A;  4O5V A;  5GMK m;  1YP5 A;  2EAY A;  1NPR A;  1OX9 A;  2B8A A;  2EKH A;  5LJ5 d;  1KC8 C;  2M9U A;  3CCL A;  3G7Z A;  4M7D C;  4EMK C;  1LJO A;  1ZBJ A;  2FYK A;  2QEX T;  1BYM A;  1G3T A;  2ZZD A;  2KT8 A;  1PRM C;  2O01 E;  1YFN A;  1EIF A;  2F2X A;  2KRM A;  3H41 A;  4M77 E;  4ORZ A;  1VA7 A;  1ZSZ A;  3EAE A;  2RN8 A;  2DTH A;  5KE3 A;  1NEG A;  3JCM b;  3VS1 A;  3CCV T;  3QUI A;  1Q82 R;  4ELY C;  5IHK A;  4XTV A;  4FL6 A;  3J80 E;  1VQ8 T;  1IB8 A;  2DK3 A;  1B34 B;  4QVC A;  3KBG A;  3OMC A;  1BU1 A;  5CKD A;  4M7A E;  2XID A;  4KUD K;  2JVV A;  5DLO A;  1IRX A;  1VIF A;  1XJW B;  4M78 C;  4ZNX A;  1QVG P;  2PU9 B;  2HCK A;  4C8Q B;  4ME7 A;  5KYU A;  4HT9 A;  1E6H A;  2KBT A;  1CKA A;  3QSU A;  4JRQ A;  1M8V A;  5GJV B;  1OV3 A;  3A8M B;  2XDB A;  1WXT A;  1KQS P;  1I5L A;  2QI2 A;  3OS5 A;  3SD4 A;  1RUW A;  1X2Q A;  2RQW A;  3EGU A;  2L89 A;  1G2B A;  1U5S A;  4PJO E;  4A54 A;  2WAC A;  4LUD A;  2E41 A;  1IRE B;  1VQK Q;  4BB7 A;  4BAC A;  3ME9 A;  3JCM f;  1C1A A;  6AT1 B;  4M7A G;  4J6Y A;  2MWP A;  3EHR A;  4E7S A;  2DJQ A;  1YJ9 Q;  1RAA B;  1TG0 A;  4TVR A;  1AEY A;  3VJP A;  1WA7 A;  1JQQ A;  2X9H A;  1BIB A;  2LX9 A;  4JJN K;  3M0U A;  2EGC A;  4AFZ C;  4JLI A;  2ZPF B;  4FT4 A;  2EJF A;  1XQH A;  3LH5 A;  3SWN C;  3VS5 A;  3QJ6 A;  2JT4 A;  2DAQ A;  4IIM A;  1JBM A;  5LJ5 e;  4E47 A;  4HCB A;  5CAI A;  1WYX A;  1F1B B;  1WHK A;  1N9S A;  4RCC A;  2OTJ A;  4J9I A;  2EW3 A;  2NUT A;  2F5T X;  2E12 A;  2DX1 A;  1KD1 R;  2KYM A;  1QVP A;  2YWW A;  2DER A;  1WZO A;  4PNO A;  3G6E Q;  4NOY A;  2LNV A;  2L3R A;  3JCM h;  2KGT A;  5GAN 8;  2FPD A;  3MET A;  1YJW Q;  1U1S A;  2O88 A;  2D9T A;  3OQ5 A;  1IO6 A;  4HVW A;  2X4J A;  3MHX A;  4MDW A;  1X6G A;  3OSV A;  1M2O A;  5J26 A;  3V7R A;  3JCM d;  1GCP A;  2GQV A;  3V7S A;  3JB9 F;  4Q5W A;  1D3B B;  3QDR B;  4P5N A;  1MV0 B;  4M78 F;  1HK9 A;  4J9H A;  1OYX A;  3QWY A;  4M7D A;  4EMK A;  1UGQ B;  2LJ0 A;  1G3Y A;  1WXB A;  2CZ1 B;  3HHT B;  2KMT A;  4M7A D;  3JAM E;  4Z02 A;  1KJW A;  2ESW A;  4Z8A A;  4QKU A;  2K3Y A;  5GMK i;  2JN0 A;  4BE0 A;  2DXT A;  2SEM A;  4Z88 A;  3M53 A;  2P0P A;  4JPB W;  2D6F A;  3THK A;  2COW A;  4N0A A;  1NYF A;  4XU0 A;  4IUT A;  3CXC P;  1KQ1 A;  1LOJ A;  1D0Y A;  5DM7 R;  1YWP A;  2JNG A;  2YDL A;  3ER0 A;  1HJD A;  5I2S A;  2VXE A;  1PG5 B;  3CCE A;  1XNI A;  3UA7 A;  5L8R E;  4M78 A;  2M02 A;  3BDL A;  2O4X A;  5CK9 A;  1JJ2 A;  1S72 Q;  1PD1 A;  3MP6 A;  2NUP A;  2YLC A;  3EGX A;  4KRT A;  5KYY A;  4HA8 A;  3UWN A;  4HCC A;  4PFO A;  2AHJ B;  1H3Z A;  2ENM A;  5GAO r;  3M5A A;  2CS7 A;  1VYT A;  1ZA1 B;  2YHT A;  2BUD A;  3L2Q A;  3QHS A;  2OJ2 A;  2RHY A;  3DB3 A;  3OSS C;  3S6W A;  4E7L A;  1DJ7 B;  5IT9 E;  3C0C A;  4JJC A;  1G5V A;  3TSW A;  4BUG A;  3MO8 A;  3M9Q A;  2DL7 A;  1BCO A;  3FC3 A;  1VQK T;  5CO7 A;  2QGF B;  2QQS A;  3CCQ T;  1YJ9 T;  2KK4 A;  1MMA A;  1KHC A;  4MZM A;  1W2B P;  3I56 T;  4B9W A;  3URG A;  2RNA A;  4JDS A;  4C8Q C;  5A0L A;  1XOV A;  2PVD B;  1IGU A;  2R57 A;  1N27 A;  3M0S A;  5LJ5 g;  1YCY A;  1PKT A;  1VUB A;  3JCM e;  4LD6 A;  3CC2 T;  2JM9 A;  2R58 A;  4C5H A;  2RJF A;  2DTI A;  5GMK l;  3GPL A;  5KCH A;  3EGD B;  3LW5 E;  1H64 1;  3JCM Q;  4C5I A;  1NLP C;  4XK8 E;  1AWO A;  1VQN Q;  3PTA A;  2LRQ A;  1GBR A;  2Y4X A;  1VQO A;  2GFA A;  2RQT A;  2EFI A;  2R5A A;  1WGS A;  2B86 A;  2LJ1 A;  1K73 C;  2GQI A;  2WSE E;  1SKU B;  4OF1 A;  3I55 A;  2H8H A;  1WHM A;  3DB4 A;  2LCC A;  3VUZ A;  2DL4 A;  1K8A U;  4FYW B;  1VQM A;  1PHT A;  1TOV A;  2BZ8 A;  1QCF A;  1VQ4 T;  2JTF A;  1M1K C;  3G4S T;  2V26 A;  1G83 A;  5KYN A;  2LX7 A;  4ZN3 A;  2DL8 A;  3VS6 A;  2KXD A;  1X2K A;  2K3B A;  4FYX B;  2ZPI B;  3C95 A;  2VV5 A;  2CT3 A;  2H3E B;  1CSK A;  4OB2 B;  4M77 B;  4E7J A;  1Q81 C;  1D09 B;  1ZA2 B;  1TH7 A;  2KNB B;  3GBQ A;  1Y96 B;  2FHD A;  1X43 A;  2DIL A;  4OB0 B;  5C6S A;  1PRL C;  2J6K A;  3CMA Q;  2OTJ T;  2A7Y A;  1M1F A;  1NYG A;  1WHJ A;  2P4T A;  2PUK B;  1YJN Q;  2ZPH B;  4VUB A;  1M30 A;  1M4Z A;  3OA6 A;  1VQL A;  5KYX B;  2ROL A;  1HSQ A;  5GAM g;  1X75 C;  1W4S A;  1BK2 A;  4X34 A;  1ZBX A;  2G6F X;  4M7A B;  1OPK A;  3M57 A;  2MCN A;  4ZGD B;  3HPW A;  1VIE A;  3R6O A;  4QT7 A;  4C8Q F;  1VQ6 T;  3OS1 A;  1Y57 A;  2IIM A;  1Q86 C;  3KXT A;  2CDT A;  1YHQ T;  1QWE A;  3EG2 A;  4LXC A;  2X51 A;  2CSQ A;  3VU3 C;  1QVF P;  3CCV Q;  2C06 A;  1ZQ1 A;  2RQR A;  1FXX A;  3LGL A;  4BY6 B;  2L3S A;  4AMC A;  4RCB A;  4PJO B;  5IHN A;  1OEB A;  1VQ8 Q;  4FT2 A;  1RLP C;  3M0R A;  4C0G A;  3HRT A;  3CCR A;  2CSI A;  1ARK A;  4Z89 A;  2EQU A;  2HDA A;  4ZTF A;  3IQL A;  3MPU B;  1VQ7 Q;  8AT1 B;  1YIT T;  5CKB A;  4LE9 A;  3JB9 J;  3JCM V;  1K9M U;  3D7S B;  2K79 A;  3OBW A;  1WJQ A;  4C8Q A;  2HL5 C;  3LGF A;  4KGV B;  3T9N A;  4OMF B;  1FX7 A;  1PCX A;  4CC7 A;  4QVD A;  2A3L A;  4NL3 A;  3CC4 T;  1Y71 A;  1RAH B;  5KYW A;  5GAN 3;  2KY9 A;  2DFU A;  2F1L A;  3CCJ A;  1G3S A;  4JZ3 A;  1YIJ A;  4AG1 C;  1M90 C;  7AT1 B;  3TU4 K;  2WSF E;  2KVQ G;  2EQK A;  2KI7 A;  5FWC A;  2ECZ A;  3LH0 A;  3CCS T;  1Z9Q A;  2HAX A;  2V8J A;  4OMQ A;  4C92 E;  2RJE A;  3ULR B;  2HMA A;  4JJD A;  9ATC B;  1T0J A;  3OYN A;  2XMF A;  4A4H A;  2MI6 A;  1LPL A;  3M55 A;  4ELZ C;  2A28 A;  5FWB A;  3M4Y A;  4FSX A;  5LJ5 j;  1AD5 A;  3A8O B;  4E2F B;  3DKM A;  4M75 E;  1VQP A;  5GAO q;  4LUE A;  3ZBD A;  3G71 A;  3OB9 A;  2L0A A;  3CCU T;  2ED0 A;  1QKW A;  4HVU A;  2DKG A;  2XKO C;  1M3C A;  2F2W A;  4C92 G;  3VRZ A;  4UC4 A;  1M3A A;  3NPF A;  3M56 A;  1ZUK A;  3EH1 A;  4L5G A;  2JS0 A;  4BI3 A;  4K11 A;  1BI3 A;  2QAS A;  2QA4 A;  2O9V A;  2QQR A;  3OBY A;  1YBY A;  2DXC A;  1IZ6 A;  5AYF A;  4ATO A;  2COZ A;  1LCK A;  2HD0 A;  2DRM A;  4M75 G;  4JRP A;  2LQK A;  1HYO A;  1RL2 A;  1M9S A;  3PIP A;  4ZTJ A;  2L3Q A;  2JTE A;  4C0F A;  2EBP A;  5FU7 B;  1EZZ B;  1SRM A;  2QQB A;  2H3J A;  1YJN T;  4BE2 A;  1PWT A;  3OS0 A;  4A63 B;  2A36 A;  4XU3 A;  3CME T;  2FPE A;  2DJZ A;  2LMJ A;  1Q7Y C;  2EWN A;  3M59 A;  3QYH B;  1OPL A;  3EFR A;  4M77 C;  4NL2 A;  3EG3 A;  3HFN A;  2FL7 A;  5GAM f;  1SSF A;  5KH6 A;  2QTV A;  3X20 B;  2CP7 A;  3CD6 T;  3V8J A;  5A0G A;  4MZP A;  3HTR A;  1Q95 G;  4D8D A;  1OOT A;  2D1X A;  4EPC A;  3HRU A;  4HCK A;  3SHW A;  3E9G A;  4IUP A;  5GAM j;  3JRZ A;  1K8A R;  5EG2 A;  3E9F A;  1MMG A;  2D8H A;  3VS4 A;  4M7D E;  4F04 B;  4Y28 E;  2PVO B;  3C12 A;  1VQ5 Q;  4M7A C;  2YRV A;  3M54 A;  2X4X A;  2XDD A;  4LDX A;  1SG5 A;  4WCI A;  4LDY A;  1M1K R;  1JEG A;  3PFS A;  4C92 D;  2HQH A;  2CUD A;  4M77 G;  3RMS A;  1VQ7 T;  1JJ2 S;  5GAO p;  1YI2 A;  3RKW A;  3CCL Q;  8ATC B;  1OU9 A;  2K9G A;  2EJG A;  2QG9 B;  2OTL A;  1UGV A;  3N5B B;  4BY6 C;  3MP8 A;  2BZX A;  1Q81 R;  3FB9 A;  4M75 D;  4PJO C;  2VUB A;  3LWH A;  2XDP A;  5GAM h;  3A8H B;  2JJ9 A;  3JCM X;  2V8K A;  5L23 A;  2PZ1 A;  5KE2 A;  2JZ2 A;  2QXF A;  1QKX A;  4XU1 A;  2CT4 A;  3CC7 A;  2M16 A;  5FLX E;  1FMW A;  3GOX A;  3FRN A;  2E10 A;  4PLL A;  3CCQ Q;  4HXJ A;  2DBM A;  5KCO A;  5GAM d;  3I56 Q;  4CC2 A;  3CPW A;  4JS4 A;  2FEI A;  5CKE A;  2ZAE A;  4DBR A;  1M2V A;  3UDC A;  1J3T A;  2E3H A;  3CC2 Q;  4OMP A;  5GAO n;  3G6E A;  2DET A;  2GCX A;  3E1S A;  2JM8 A;  1OX8 A;  4OGC A;  1YJW A;  1EFN A;  4PJO G;  1IXD A;  2VGM A;  3UPU A;  5GAN 7;  4M77 F;  1V1C A;  2LQ8 A;  4RUG A;  4BDY A;  1AHJ B;  4L59 A;  3OYC A;  3NTK A;  3L2U A;  3CCM A;  2W10 A;  1RLQ C;  3OYL A;  1V76 A;  4J6W A;  5IN1 A;  4EMH A;  4II1 A;  2IVW A;  4DOV A;  4PLI A;  1N8R R;  2CKK A;  2DF6 A;  2COY A;  4DEY A;  2EYY A;  1WLP B;  4E7K A;  4A53 A;  4J83 A;  4QVZ A;  4F7U E;  1JO8 A;  1VYU A;  2YUP A;  1K9M R;  1ZX6 A;  3P8H A;  1IGQ A;  3TVT A;  2XHC A;  4M77 D;  4C5G A;  2CH4 A;  1Y07 A;  3ZEH A;  4M7A F;  1GBQ A;  1VQ4 Q;  3BFM A;  1TWB A;  2PUO B;  3G4S Q;  1GXI E;  3X26 B;  4DEX A;  3C4S A;  4C5E A;  4ZN1 A;  3ZL7 C;  1K0S A;  2WSC E;  4ZGJ B;  2CGH A;  4FU6 A;  5ECA A;  1T3L A;  5I11 A;  3HP9 A;  4JLG A;  2E4H A;  3S3M A;  3EFO B;  2RJC A;  4F7U G;  1Y96 A;  1SSH A;  4FYV B;  4PJO F;  2Z0W A;  1TSF A;  2DM1 A;  2XU8 A;  4J9B A;  3LWI A;  2OTJ Q;  1OZ2 A;  2K5I A;  1BI2 A;  1RAI B;  2QGG A;  1E6G A;  3QG1 A;  4XU2 A;  1X27 A;  4MML A;  1PKS A;  1S72 A;  5CR2 A;  1TU0 B;  3H8Z A;  5KYX A;  3I5R A;  2FO0 A;  4C0D C;  4OB1 B;  2I2L A;  1QCO A;  1KHI A;  3RNJ A;  5FU7 C;  1W1F A;  4M7A A;  2I0N A;  3L2W A;  1VQ6 Q;  4PJO D;  3VRY A;  3LLR A;  4PL6 A;  2CP3 A;  2HSP A;  1SHF A;  5GAM e;  1VQ9 T;  1YHQ Q;  2P0K A;  1ZSZ B;  5GAN e;  2DBK A;  1PSF A;  1VQ5 T;  4RTY A;  4OB3 B;  3OYY A;  2GTJ A;  2DYB A;  1UHF A;  1ZHI A;  2O2O A;  1WFW A;  2VYT A;  5A2Q E;  1RAE B;  2LVM A;  3OYK A;  2DL3 A;  2MYS A;  2VXF A;  4PFP A;  4D8K A;  1YCS B;  3GLX A;  2HKQ B;  4PJO A;  4KGX B;  1K4U S;  2RHU A;  3JSC A;  3CCL T;  2CZ7 B;  1FWZ A;  2K4Y A;  4BE1 A;  1UDL A;  2LTO A;  2KR3 A;  3CBO A;  2KSS A;  4RTX A;  1YIT Q;  2EYW A;  5D6W A;  3OW2 A;  4DA4 A;  4GBQ A;  4M4Z A;  4C92 B;  2K6D A;  3M4G A;  3X24 B;  2LCL A;  1VQN A;  4EMG A;  3QII A;  1R0B G;  2SRC A;  1UJ0 A;  3CC4 Q;  1R77 A;  2K2V A;  3OYI A;  2BE7 D;  4QW2 A;  2Y4Y A;  3SWN A;  1Q7Y R;  1NE8 A;  1PD0 A;  1KC8 R;  4M75 B;  1X6O A;  5HCK A;  3VS2 A;  1OI1 A;  4B9X A;  2YSQ A;  4FSS A;  2RQV A;  2X3W D;  4XTZ A;  4IUU A;  3S3O A;  3EH2 A;  3CCS Q;  2DA9 A;  4HCZ A;  1W6X A;  3NTH A;  1QP2 A;  2K57 A;  3CQT A;  1T0H A;  1SEM A;  2AZS A;  2EQJ A;  5CQX A;  4J5Y A;  2GGR A;  3A8G B;  3BW1 A;  1I5O B;  2M0O A;  4RTT A;  1I81 A;  2E6N A;  3FLG A;  1RAD B;  5FRN A;  2NWM A;  3M0Q A;  4B6M A;  3VKI A;  5LJ3 g;  3MEV A;  3CMA A;  3CCU Q;  3CBP A;  1AWW A;  5IAY A;  1QVG A;  1A0N B;  2EQM A;  1Q82 C;  1GRI A;  3VS0 A;  1M1K U;  4AFQ C;  2EQI A;  3OYG A;  1IHV A;  1KQS A;  4HKE A;  1GCQ C;  3MJX A;  3QZ5 B;  2DVJ A;  2HBP A;  2MK5 A;  2QEX A;  3NGP A;  2MIO A;  2CZ6 B;  2DZC A;  3BY7 A;  2L3P A; 
#chains in the Genus database with same CATH homology
 5FWB A;  1OV3 A;  3I5S A;  1UJY A;  1WI7 A;  1WXT A;  2W0Z A;  2MOX A;  1AD5 A;  1RUW A;  2JS2 A;  1X2Q A;  2RQW A;  3EGU A;  1G2B A;  3REB B;  1U5S A;  1BB9 A;  4J9D A;  4LUE A;  1UUE A;  4LUD A;  1UG1 A;  2LQW A;  2L0A A;  3EHR A;  2ED0 A;  2DJQ A;  2YUN A;  2JW4 A;  1QKW A;  4HVU A;  4J9C A;  1PNJ A;  1TG0 A;  1M3C A;  2F2W A;  1UTI A;  1AEY A;  4X1V A;  2GNC A;  1WA7 A;  3VRZ A;  1M3A A;  3EG1 A;  2L2P A;  3NPF A;  1JQQ A;  1ZUK A;  3M0U A;  2JS0 A;  2EGC A;  4K11 A;  4AFZ C;  2EPD A;  4Y92 A;  2ROT A;  2O9V A;  3A98 A;  5IXB A;  2KXC A;  3LH5 A;  1LCK A;  3VS5 A;  2YUQ A;  2DRM A;  2JT4 A;  1FMK A;  2L3Q A;  3EHQ A;  2JTE A;  4IIM A;  2JMA A;  2EYX A;  2EBP A;  1GL5 A;  1NM7 A;  1SRM A;  1UEC A;  1WYX A;  2EGE A;  3NHN A;  1PWT A;  4J9I A;  4A63 B;  1K76 A;  4ESR A;  2A36 A;  2EW3 A;  2FPE A;  2LMJ A;  2DX1 A;  1U3O A;  1YN8 A;  2KYM A;  2P4R A;  2FG0 A;  1OPL A;  3EG3 A;  2KGT A;  2FPD A;  1MV3 A;  2O88 A;  1E7O A;  2K7A A;  4D8D A;  1IO6 A;  1OOT A;  4HVW A;  2D1X A;  2DLP A;  2HBW A;  2F2V A;  1ZSG A;  2K2M A;  1N5Z A;  4HCK A;  1X6G A;  1QLY A;  3SHW A;  1WXU A;  2J6F A;  3UA6 A;  1GCP A;  1MUZ A;  1I0C A;  4LNP A;  1MV0 B;  4J9H A;  2D8H A;  3O5Z A;  3VS4 A;  5IH2 A;  3QWY A;  5GJW B;  1JXM A;  2D8J A;  2LQN A;  2LJ0 A;  1M3B A;  1WXB A;  1UE9 A;  4F17 A;  1KJW A;  2ESW A;  1AZG B;  2E5K A;  3EG0 A;  5IXF A;  4WCI A;  4Z8A A;  3NMZ C;  2LP5 A;  1JEG A;  1KIK A;  2EVR A;  1YNZ A;  2CUD A;  1T3S A;  4JJB A;  1SRL A;  1U06 A;  2KRS A;  2M0Y A;  4E6R A;  3U23 A;  3SEM A;  2SEM A;  4Z88 A;  2K9G A;  1UGV A;  1SHG A;  4JPB W;  3THK A;  2BZX A;  1NYF A;  4GLM A;  5L23 A;  2PZ1 A;  1QKX A;  4IIO A;  1YWP A;  1VYV A;  2CT4 A;  2RQU A;  2YDL A;  1GFC A;  2KRN A;  1ZLM A;  1HJD A;  2CRE A;  2C0I A;  2KYB A;  3UA7 A;  1GFD A;  1GCQ A;  4HXJ A;  2DBM A;  2LJ3 A;  1BBZ A;  1M8M A;  2RPN A;  2PTK A;  4CC2 A;  2A37 A;  1X69 A;  2A08 A;  4KRT A;  2OAW A;  1NLO C;  2GBQ A;  2CH4 W;  2FEI A;  5I22 A;  1J3T A;  1Y0M A;  2ENM A;  4OMP A;  1VYT A;  1ZUU A;  2OJ2 A;  2JM8 A;  2KT1 A;  2CUB A;  2M51 A;  1S1N A;  1EFN A;  1KSW A;  1V1C A;  2JMC A;  1X6B A;  4RUG A;  3C0C A;  2FPF A;  4JJC A;  1WDX A;  4RTW A;  2W10 A;  1RLQ C;  3TSW A;  2DL7 A;  2V1R A;  2DF6 A;  4DEY A;  2EYY A;  1WLP B;  1JO8 A;  1VYU A;  2RNA A;  1QWF A;  1XOV A;  2YUP A;  1ZX6 A;  3TVT A;  3M0S A;  4AFU C;  2CH4 A;  1UFF A;  1I07 A;  1PKT A;  3RBB B;  1GBQ A;  4OMN A;  2JM9 A;  3VS7 A;  2EYZ A;  4HVV A;  1AWX A;  2ABL A;  2GTO A;  4DEX A;  2AK5 A;  3TSZ A;  3ZL7 C;  1TUD A;  1Z9Z A;  1K0S A;  2OI3 A;  1NLP C;  2DNU A;  1AWO A;  1GBR A;  5ECA A;  1T3L A;  5I11 A;  1HD3 A;  2RQT A;  1JU5 C;  1W70 A;  4AG2 C;  2B86 A;  2LJ1 A;  3I9Q A;  2GQI A;  1SSH A;  1AOJ A;  3H0I A;  1ZUY A;  2DM1 A;  2H8H A;  4J9B A;  2JXB A;  3QWX X;  1E6G A;  2DL4 A;  4EIK A;  3FJ5 A;  1X27 A;  1PHT A;  1PKS A;  2VKN A;  2BZ8 A;  2X3X D;  1QCF A;  2FO0 A;  3I5R A;  3R6N A;  2VWF A;  2AKL A;  2HEQ A;  3RNJ A;  4RTU A;  1W1F A;  1G83 A;  2I0N A;  1NEB A;  2LX7 A;  2DL8 A;  1AWJ A;  3VRY A;  1CKB A;  4RTV A;  3I35 A;  1FYN A;  2HSP A;  3VS6 A;  2KXD A;  1SHF A;  1X2K A;  2K3B A;  1K9A A;  4JZ4 A;  4F16 A;  2CT3 A;  2LZ6 B;  1CSK A;  2YUO A;  2DBK A;  2EGA A;  3M0P A;  3KFV A;  4RTY A;  3M0T A;  2GTJ A;  1RI9 A;  4J9G A;  2KNB B;  2DYB A;  3GBQ A;  4AFS C;  1X43 A;  1UHF A;  2DIL A;  1SPK A;  1UHC A;  2O9S A;  2O2O A;  1WFW A;  1PRL C;  3PVQ A;  2J6K A;  3H0F A;  1B07 A;  4LN2 A;  1H92 A;  2DL3 A;  2C0T A;  1NYG A;  2DMO A;  5IHI A;  2BZY A;  1AVZ C;  1JXO A;  4D8K A;  1YCS B;  3PVL A;  1ABQ A;  1M30 A;  1KFZ A;  1K0X A;  1K4U S;  1WIE A;  2J7I A;  2DE0 X;  2ROL A;  4R0K A;  1HSQ A;  2AKK A;  4OML A;  4J9E A;  1BK2 A;  2DRK A;  1UDL A;  2O31 A;  2DL5 A;  2G6F X;  1OPK A;  2MCN A;  2KR3 A;  1H3H A;  4QT7 A;  4RTX A;  3VS3 A;  2EYW A;  2FRY A;  4GBQ A;  1Y57 A;  2IIM A;  4M4Z A;  1YWO A;  2K6D A;  1ABO A;  2LNH B;  3PE0 A;  1WX6 A;  2PNI A;  2CDT A;  1QWE A;  3EG2 A;  4OMO A;  2KRO A;  2CSQ A;  4CC4 B;  2KE9 A;  2SRC A;  2J6O A;  2RQR A;  1UJ0 A;  2RF0 A;  2C0O A;  3UF4 A;  2BTT A;  2J06 A;  2L3S A;  5HCK A;  3VS2 A;  2YSQ A;  4FSS A;  2RQV A;  2V1Q A;  5IHN A;  1OEB A;  2X3W D;  1M27 C;  2D0N A;  2LCS A;  1RLP C;  3M0R A;  1TUC A;  2J05 A;  3REA B;  1YP5 A;  2CSI A;  1ARK A;  1H8K A;  2EKH A;  4Z89 A;  2DA9 A;  2KEA A;  1W6X A;  2HDA A;  3IQL A;  3CQT A;  1ZBJ A;  4LE9 A;  1T0H A;  2KT8 A;  1PRM C;  2K79 A;  1SEM A;  1I1J A;  2AZS A;  4OMM A;  2ED1 A;  2F2X A;  2FRW A;  2GGR A;  2KRM A;  3H41 A;  4ORZ A;  1VA7 A;  2RN8 A;  4RTT A;  2RMO A;  1NEG A;  4CC7 A;  3VS1 A;  3UAT A;  2VVK A;  4J9F A;  2NWM A;  1AZE A;  3M0Q A;  2QDL A;  3H0H A;  4F14 A;  2NUZ A;  5FW9 A;  5IHK A;  1K1Z A;  4JZ3 A;  1AWW A;  5EC7 A;  4AG1 C;  1A0N B;  1GRI A;  3VS0 A;  1BU1 A;  5FWC A;  2ECZ A;  1Z9Q A;  2YT6 A;  4AFQ C;  2EQI A;  4OMQ A;  1B3Q A;  4CC3 A;  4RTZ A;  1GCQ C;  3ULR B;  2AZV A;  4JJD A;  3JV3 A;  4ZNX A;  1T0J A;  2DVJ A;  2HCK A;  2XMF A;  3NGP A;  1E6H A;  2KBT A;  2MIO A;  1CKA A;  1NG2 A;  5GJV B;  2L3P A;  2A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...