1I07A

Eps8 sh3 domain intertwined dimer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i07A00
2DMOA 2H8HA 4Y92A 1MV3A 4AFZC 2FPEA 2EKHA 1OV3A 1W6XA 2YSQA 2DRMA 2F2XA 2OI3A 4K11A 5GJVB 2IIMA 1KIKA 4QT7A 1FMKA 1B07A 4AFUC 1QLYA 1RLPC 2YUPA 4OMMA 2JW4A 4HXJA 4HVVA 3NPFA 1UJ0A 2ED1A 2KNBB 2RQUA 2LCSA 1PWTA 2RNAA 2MCNA 2LJ1A 1YNZA 1AWOA 2EYYA 4LUDA 2L0AA 2ED0A 1WA7A 2D0NA 1OOTA 1S1NA 1VA7A 3PE0A 2YUNA 3NGPA 2LQWA 3RBBB 2J6OA 4LNPA 3TVTA 4IIOA 2EGEA 1AD5A 2K6DA 3QWYA 4AG2C 5EC7A 1T3LA 3VS5A 2J05A 2CH4A 1E6HA 2VVKA 1SRLA 1U3OA 1UTIA 2CUDA 1KFZA 2V1RA 2HDAA 3H0FA 2L2PA 4JZ4A 4AFSC 2EQIA 1H3HA 2V1QA 3VRYA 1UG1A 4R0KA 2DM1A 1NYFA 4J9IA 2K9GA 4HVUA 2GNCA 2O9VA 2CSQA 2F2VA 2KRNA 2GTJA 4WCIA 2HCKA 2C0OA 1QWFA 2D1XA 2LX7A 3JV3A 2D8JA 2NUZA 1WFWA 1Y57A 2LMJA 2DL4A 2LQNA 2KT8A 2JMAA 3M0TA 4DEYA 2JM9A 2J6FA 2LJ0A 2DL7A 3U23A 2CT4A 2X3WD 5FWCA 5I22A 2QDLA 4JPBW 1SEMA 3VS3A 2GBQA 3EG0A 4DEXA 2JXBA 1UUEA 2PTKA 1NLPC 1U5SA 3I5SA 2LJ3A 2ABLA 3H41A 4LUEA 4Z8AA 1HSQA 3TSZA 2DL8A 4JJBA 2A37A 1QKXA 2C0IA 1GFDA 3M0SA 1YWOA 4A63B 1UFFA 3LH5A 3SHWA 1JEGA 3GBQA 1B3QA 1K0SA 4F16A 4KRTA 1I1JA 2L3QA 5IXBA 1KSWA 2LP5A 1GCQA 2D8HA 1AWJA 3TSWA 1CKAA 1M3CA 3ULRB 1CSKA 4AG1C 1ZX6A 2DLPA 1BB9A 1RLQC 4J9FA 4F17A 1LCKA 1SRMA 3EGUA 1FYNA 3I9QA 3RNJA 2CREA 1PNJA 2DVJA 1TG0A 1VYUA 1XOVA 2L3PA 2J7IA 1BK2A 2FPFA 1HJDA 1WXUA 1RUWA 4E6RA 2K3BA 3ZL7C 1H8KA 4OMOA 2W0ZA 3REBB 1UGVA 2YDLA 1AVZC 2ROTA 3H0HA 2MOXA 4RUGA 2KEAA 2EYZA 3I5RA 1NLOC 5HCKA 2KE9A 1G2BA 1PKTA 2VWFA 4OMNA 1K9AA 2F2WA 2DJQA 2RF0A 4J9EA 1T0HA 1BU1A 2KR3A 2PNIA 2O31A 4IIMA 1IO6A 1M3BA 2OAWA 3M0PA 4Z88A 1M8MA 4RTTA 2A08A 4JJDA 1GRIA 2DILA 2RQRA 2KYMA 2P4RA 1UHCA 1YWPA 2RQTA 4JZ3A 4CC2A 2DBKA 2SEMA 2DRKA 2CH4W 2G6FX 2JS0A 1JQQA 1GCQC 4RTYA 2FEIA 1ABQA 1X2QA 1X43A 4RTZA 4RTXA 2CT3A 2KXCA 2CSIA 5IHNA 2HSPA 2DL5A 1N5ZA 1TUDA 2J06A 2ROLA 1JXMA 2JS2A 5I11A 1UECA 2SRCA 4LN2A 1NEGA 2X3XD 1UE9A 1MUZA 1J3TA 2VKNA 2ENMA 1ZUKA 2LNHB 2EW3A 4CC7A 2K2MA 3EHRA 1VYVA 1X27A 2KGTA 1RI9A 1I07A 2I0NA 2AZSA 1NYGA 4J9DA 1AWWA 4HVWA 2EVRA 1T3SA 2FO0A 3EG1A 2BTTA 1ARKA 1NG2A 1EFNA 2DX1A 2FG0A 1A0NB 1YCSB 4OMPA 1GBQA 1WXBA 1GL5A 5FW9A 4J9HA 2AZVA 1JO8A 2KRSA 2CDTA 1M30A 2A28A 1Y0MA 1AZGB 1UJYA 1WDXA 4JJCA 3M0RA 3UA7A 1UHFA 1AWXA 1ZBJA 2JT4A 2O9SA 1Z9QA 2O88A 4ESRA 2C0TA 2DYBA 3UF4A 4X1VA 1QWEA 2YT6A 1UDLA 1ZUYA 2PZ1A 2AKLA 1H92A 3KFVA 1QCFA 1PHTA 5IXFA 2AKKA 2DNUA 4ORZA 2EYXA 2HBWA 1KJWA 1JXOA 5FWBA 2KXDA 2GQIA 3NMZC 2AK5A 2DL3A 1ABOA 3VRZA 3IQLA 5GJWB 3UA6A 2KYBA 2RQWA 5IH2A 4AFQC 4F14A 1K4US 4D8DA 1WI7A 2ECZA 2M0YA 1E7OA 1WLPB 4CC4B 1AEYA 4RTVA 1T0JA 3VS2A 4RTUA 1G83A 4D8KA 1OPLA 1K76A 2DBMA 3QWXX 2LZ6B 4OMLA 2J6KA 1BBZA 3A98A 2B86A 1SPKA 1SHGA 1WIEA 3O5ZA 1VYTA 1I0CA 2E5KA 4Z89A 2M51A 2RQVA 5IHKA 2EPDA 3VS4A 4M4ZA 1V1CA 3VS6A 1TUCA 2K7AA 3M0UA 3C0CA 2RN8A 2EGCA 3EG3A 3H0IA 1ZSGA 4FSSA 1WXTA 2ESWA 2RPNA 1K0XA 1YP5A 2DE0X 4ZNXA 3SEMA 2MIOA 4CC3A 1SHFA 3EHQA 2EGAA 5ECAA 1SSHA 2JMCA 2YUOA 1K1ZA 2OJ2A 2BZXA 2GTOA 2W10A 3I35A 2O2OA 3VS7A 2JM8A 3VS0A 2XMFA 2FPDA 3NHNA 3VS1A 1PKSA 1AOJA 4RTWA 1NM7A 1ZLMA 2KT1A 1HD3A 2A36A 3CQTA 2DF6A 5L23A 2EBPA 1X69A 1YN8A 4GLMA 2NWMA 3UATA 2JTEA 1X6BA 3M0QA 1QKWA 2L3SA 1E6GA 1X6GA 3REAB 2GGRA 4LE9A 1W70A 4J9BA 1GBRA 1Z9ZA 1CKBA 1NEBA 4EIKA 1W1FA 2K79A 1M3AA 2CUBA 1MV0B 3PVLA 2RMOA 3FJ5A 1AZEA 1ZUUA 2BZYA 2EYWA 1PRMC 4OMQA 2HEQA 1M27C 2KBTA 3PVQA 5IHIA 1WX6A 1WYXA 2BZ8A 1OPKA 2KRMA 1GFCA 4J9GA 1JU5C 1GCPA 2FRYA 3R6NA 2YUQA 1PRLC 3THKA 4HCKA 3EG2A 2FRWA 1X2KA 1U06A 2KROA 4GBQA 2DA9A 4J9CA 1OEBA
chains in the Genus database with same CATH superfamily
4M75A 5CQYA 1W4SA 3BW1A 4Y92A 2LCLA 4FYXB 4PJNA 2XHCA 3RUXA 2XDPA 2EKHA 1VQMA 1VQ8Q 3OYHA 3M9QA 1KIKA 1FMKA 1QLYA 1BI2A 4HXJA 5CQXA 1NJIC 1UJ0A 2KNBB 3CCMA 5CKFA 1VQPQ 2LJ1A 3OYAA 2DXBA 2EYYA 1KD1C 2L0AA 1SG5A 1C1AA 4M77F 8ATCB 1VQOQ 1VA7A 3L1AA 2J6OA 2EGEA 3QWYA 4AG2C 3S3MA 5CCAA 1WJQA 3NFCA 1T3LA 2MYSA 2CH4A 3BY7A 1SRLA 1WHGA 2CUDA 3H0FA 4JZ4A 5GAN5 3JB9I 3CCUT 1K9MC 4M7AD 1YJ9T 1VQ4Q 2V1QA 4L59A 2EJGA 4R0KA 2DTIA 2OX7A 3CCUA 2LQ8A 4Y91A 3OYBA 4HVUA 2GNCA 2O9VA 4ELZC 2CSQA 2F2VA 2QASA 2WSCE 2VYTA 3ZEHA 2KVQG 4FSXA 4XU1A 4BI3A 2D8JA 1OU9A 1WFWA 1Y57A 2YXYA 3GNGA 1K9MR 3QSUA 4M7DA 3OW2S 2KT8A 5A0DA 3HP9A 4DBRA 2LJ0A 2EJFA 2RA2A 2QK0A 1ACMB 1YBYA 4QVDA 4J6XA 2CT4A 1ZSZA 2X3WD 3OS5A 3HTRA 2QDLA 3VS3A 1SEMA 4M78D 1RACB 2JXBA 1NLPC 2PTKA 2OTLT 2LJ3A 3H41A 2ZPFB 4F7UG 5FU6C 3TSZA 1I8FA 2ATCB 1FMWA 2GFAA 2OTLA 4A63B 2EWNA 1KQSA 1VQ6T 1K0SA 3P8BB 4F16A 1RI0A 1KD1R 5IXBA 1GCQA 2D8HA 2DK3A 1AWJA 2QGGA 4KH1B 1M3CA 4IUTA 2CP7A 1CSKA 3JSCA 3VV0A 3LWIA 3LYIA 2DLPA 2FB7A 3JCMV 1JJ2A 3MP8A 2DXCA 5KYXA 4J9FA 3EGXA 3JCMJ 2E70A 4F17A 5LJ5e 1FMVA 1XNIA 4C8QC 5GMKe 1VYUA 1XOVA 2L3PA 3QDFA 3QIIA 1AT1B 1HJDA 4TVRA 2K3BA 2M9UA 1H8KA 2O4XA 1LNXA 2CZ6B 3FB9A 2ZPGB 3HHTB 2KEAA 1O75A 4C5EA 1VQ4A 2FZGB 1MNEA 2WACA 1RAAB 5GAN7 1VQOA 2VGMA 3S6WA 1PKTA 1K9AA 2F2WA 2KR3A 1U1SA 4OP0A 3BFMA 2E64A 2LC4A 4IIMA 2B8AA 4X9DA 4EMHA 4PLIA 4C92E 2QAZA 4LD9K 5GMKj 1IHVA 1UHCA 1YWPA 3V8JA 3RESA 3SD4A 3KXTA 4FW1A 2C06A 1MNDA 5LJ5g 1GCQC 1KC8R 2HZYA 4EMGA 4RTXA 2KXCA 5IHNA 3G4SA 2XDBA 2E3IA 1EX4A 5D6YA 3V7RA 1IB8A 2IG0A 5GANg 2XK0A 4BY6C 2SRCA 2EQMA 4LN2A 1PG5B 2BUDA 3G6EA 4M78C 4XTWA 4HCZA 2KAFA 5J26A 3OYFA 1MUZA 1J3TA 4O6JA 5GAN4 3CMAQ 4M77B 1B34B 5DLQE 5CKEA 1AHJB 1VYVA 2JVVA 5GMKi 4HCCA 3L2RA 1I07A 3CPWS 4B9WA 2HQEA 4J5YA 4N0AA 4J9DA 3SWNB 3HSBA 1AWWA 4HVWA 2KK4A 4JRPA 1VQLA 1TOVA 1TS9A 1T3SA 2F69A 2CYZB 1ARKA 3JCMg 2JN0A 1VQ7Q 1OU8A 1OI1A 1GL5A 3M4YA 3JB9D 1Q81U 4FYYB 1M30A 1C6VX 3EG9B 1UJYA 1WDXA 2LT1A 3EH1A 3UA7A 4IUQA 2JT4A 3AHUA 1M90R 3OB9A 2O88A 4M7AA 2H3JA 4BDZA 5AYFA 2KY9A 3UF4A 4X1VA 3FC3A 2DYIA 4LXCA 5CKHA 5HK0A 4MZMA 2PZ1A 4M75E 1EIFA 5IXFA 4VUBA 4C5HA 2HBWA 3O8VA 1KJWA 4BE0A 1OYXA 3PFSA 3IQLA 1RADB 5IH2A 1VQNQ 3P8HA 4M78A 1QCNA 1WI7A 4M78B 1R0CB 4RTVA 2CGHA 1G3WA 3JCMe 3CD6A 3G7ZA 3M5AA 4MZTA 1MMDA 2LZ6B 2JOYA 3BDUA 5KH6A 3NTKA 1WIEA 3E9GA 3MEUA 2RH2A 3JB9F 3SWNC 4ZGDB 2Y90A 5I2SA 1Q7YU 4M4ZA 1V1CA 3VS6A 1TUCA 2RN8A 1XQHA 2LRQA 4L6V5 4FCYA 3J81E 2KI7A 4LDYA 1VQLQ 1D1AA 1VQ9T 3SEMA 1Q86C 3CBOA 3MEVA 1VQPT 5D6XA 2E5QA 2X4XA 5ECAA 1SSHA 2YUOA 3EG9A 2OTJT 4J6WA 3JCMh 3RR6A 2P0PA 3M59A 2BZXA 4C8QB 4DOVA 1K73R 1TSFA 2O2OA 2JM8A 1YHQA 3M57A 5J39A 2K4YA 2RHXA 3JCMc 3OYDA 4II1A 4C0DC 3CMEQ 1KQ1A 1YITT 1ZQ1A 5LJ5d 1XTDA 3OYLA 4PJJA 3PIPA 3M56A 1YITA 1TUGB 1X6GA 3MHXA 3INZA 4J9BA 3PTAA 5GAOm 1YFNA 1K8AC 1CKBA 4XTVA 2LX9A 1W1FA 1WHMA 3M55A 2ZPHB 3PVLA 2RMOA 1YI2A 2G3RA 3EFRA 3I55A 5C6SA 2KBTA 3PVQA 1BIAA 4E2FB 3UT1A 5GANd 2KRMA 1M2VB 4J9GA 1JU5C 1XJWB 3R6NA 2CZ0B 4OF1A 1X2KA 1VUBA 1U06A 1SSFA 4GBQA 5KCOA 3V8LA 4A4EA 2QEXQ 5GANe 3RMQA 1RL2A 2IVWA 1Q81C 2FPEA 1W6XA 2YSQA 2DRMA 4K11A 4JUVA 3E1SA 2IIMA 2RJCA 4QT7A 4HA8A 3KUFA 3LX7A 3CCLT 2I2LA 1Q81R 1X6OA 2HBPA 1M1KC 3LGFA 2HL5C 3CCQQ 1G5VA 1PWTA 5KYWA 2RNAA 2MCNA 3QBYA 3VU3C 3AT1B 1WA7A 2D0NA 1S1NA 4FYWB 5CAIA 3HL8A 4RCCA 3NGPA 3GOXA 3PGGA 3LW5E 3RBBB 4IIOA 2ZPBB 2EQKA 2X35A 2K6DA 1M2VA 1JBMA 5EC7A 3VS5A 2MAMA 3QYGB 4KT0E 1E6HA 2VVKA 1K8AR 2KDSA 3CC2Q 1M9SA 2YLBA 5GAMf 2L2PA 4AFSC 2EQIA 2RD1A 4Z02A 3VRYA 1VQMQ 3CXCA 1W2BA 2L8DA 2DM1A 3CMAA 2QQSA 1NYFA 4QW2A 1YIJT 4C92B 2A3LA 2HCKA 2C0OA 2D1XA 3EGDB 2LX7A 3JV3A 3MKDA 1BKBA 4ME7A 4P5NA 3DKMA 4UC4A 2LMJA 2JMAA 2JM9A 1M8VA 3U23A 3CC4T 1OZ3A 5KE3A 3EG0A 4PNOA 4M78G 3CCUQ 1VQKA 3JCMX 1OX9A 2ABLA 3X28B 3CC4A 1VQ6A 4A4KA 4LDVA 1G3YA 4N4IA 2K57A 2DL8A 4JJBA 2A37A 1QKXA 3SHWA 1K9MU 3GBQA 3CCVA 3OY9A 1I1JA 2L3QA 2XKOC 2L5QA 1S72T 2QTVA 1ZX6A 5D6WA 1IGUA 4M7AE 1RLQC 5KYUA 1M1GA 1LPLA 1D3BA 1SRMA 3JAME 3CCJQ 3OYKA 8AT1B 3EGUA 3I9QA 1BK2A 2FPFA 3WVEB 2HD0A 5GAOr 1RUWA 2PU9B 4B6MA 5GMKm 4OMOA 4ZGEB 2ZPIB 4A4GA 1WHHA 3MP1A 3REBB 3L2VA 3CCRQ 2ROTA 3H0HA 3ASKA 3FEOA 5CKDA 1G8XA 1WHLA 3I5RA 2MWOA 4EMKA 1KQSS 1NLOC 2RK2A 1IGQA 2DIGA 2YRVA 2KE9A 2VWFA 1G3TA 1YJNA 3VJPA 2DJQA 4GY5A 4Y28E 6AT1B 2PNIA 4M77D 2O31A 1IO6A 2OAWA 4PLLA 1H641 3I56Q 1M8MA 4RTTA 5LJ3d 1VIFA 3G6EQ 1D1CA 2XIDA 4J8OA 3OMCA 4NL3A 4F7UF 2RQTA 2RHIA 4PJOA 4XU2A 2R5AA 2DRKA 1D0XA 1MMAA 2JS0A 1JQQA 2HMAA 1IZ6A 4E47A 4RTYA 3CC7T 4OB0B 3L2ZA 1M1KR 3SWNA 5J3BA 2QG9B 3G6ET 2HSPA 5IAYA 4QQDA 5KYXB 2JS2A 1JXMA 5DM7R 4WF2A 5I11A 5GAMj 2X3XD 3E9FA 1KK7A 4C0GA 2HAXA 1ZUKA 3JB9H 1Q86U 3MJXA 3EHRA 1X27A 2KGTA 3HFNA 2DETA 4M75C 1VQ9Q 5CIUA 2YWWA 3C12A 5CVIA 2EVRA 2AHJB 2FO0A 3EG1A 1WJRA 1R8OB 2RJEA 3LH0A 1EFNA 2FG0A 3GF5A 4Q5WA 1N8RU 1NPPA 1YCSB 1A0NB 1GBQA 4MDXA 1WXBA 2K5FA 5FW9A 3OYGA 1KC8U 4XTZA 4FM4B 5HK3A 2A28A 2QQ9A 3CCEA 1AZGB 2DZCA 1BCMA 2Y4XA 1YJ9A 1YJNQ 4JJCA 2MF2A 3M0RA 3HFOA 1FXXA 1ZBJA 4ZTJA 4IUVA 5LJ5f 4C8QD 3OW2A 2DYBA 3HRTA 1QWEA 5A2QE 2AKLA 3ZFJA 1H92A 1VQ8T 1KQ2A 4EMKC 2EFIA 3QG1A 1UGPB 5GANf 4ORZA 2EYXA 2QA4T 3JCMd 3CPFA 5KYNA 2DL3A 1K73C 4E7IA 4M75B 4JRIA 1ABOA 2DD5A 3OYIA 1D1BA 2EQUA 3CD6T 3QZ5B 1YJWA 2M0YA 3T9NA 2DZ9A 1WLPB 4F7UB 1AEYA 3JCMQ 1QVFA 3QWXX 4OMLA 1HXDA 3M58A 3GNFB 3JCMb 1VQ7A 1SHGA 1Q82C 3H9NA 2HSEB 1R0BG 3J80E 4J7FA 2M51A 2EPDA 3EGDA 1VQ9A 2WSEE 3PMIA 3H0IA 3I56T 5GMKl 2K5IA 4FSSA 4JS5A 4PJOB 2RPNA 1K0XA 2JTMA 4J83A 2FVUA 3I56A 1SHFA 2JMCA 3MPUB 2OJ2A 3E2UA 4C92F 2VXFA 4M7AC 2GTOA 2M02A 2F1LA 3I35A 3GIBA 2RJDA 2XMFA 4ZN1A 2P0QA 2XICA 5LJ3f 4O5VA 4BB7A 4LDUA 1AOJA 4RTWA 1NM7A 2LCCA 3CMET 4MMKA 2X4JA 5L23A 2KSSA 1X69A 2ZAEA 1JRIA 4BE2A 4C8QG 3M0QA 5I2MA 1TTHB 2E6NA 1WPYA 2MMPA 2XDDA 3L2WA 3OYNA 1X75C 3HPWA 1NEBA 4EIKA 1M1KU 4E7SA 1I5LA 3FJ5A 2DIQA 2EAYA 2VUBA 5LJ5h 1PM3A 4J6YA 2AT1B 4FL6A 5KYUB 2BZYA 1LOJA 2EYWA 3G71A 4OMQA 3RERA 2HEQA 2BZ8A 1WYXA 4FU6A 3QXEB 1GFCA 5LJ5j 2YUQA 1PRLC 3JB9G 1Q86R 4HCKA 3EG2A 2FRWA 2VC8A 3TCJA 3M4GA 1BYMA 1OEBA 2MPXC 2DMOA 2H8HA 1YJ9Q 1MV3A 3OS0A 2CP2A 3BE3A 2F2XA 1QVGA 4AFUC 2CP6A 2GFUA 3MO8A 1RLPC 2YUPA 4OMMA 4HVVA 1PC0A 2ED1A 2LNVA 4XK8E 4MZPA 3UPUA 5CO7A 3A8OB 1YNZA 3CC2A 3F70A 4M7DG 1OOTA 2VV5A 3E19A 3QUIA 4XQ3A 4R56A 1IHWA 4JRKA 3PE0A 5AT1B 2DEUA 2YUNA 2XI9A 3CCSA 3CPWP 2LQWA 4LNPA 3R6OA 1N9RA 2CKKA 1VQLT 4XU3A 3CCST 5GMKh 1VQ6Q 1ZA1B 4J7IA 2V8IA 2OTJQ 3TU4K 4FW2A 1U3OA 1UTIA 1KFZA 3MEAA 2HDAA 1ZSZB 2QA4Q 2FHDA 4C8QA 1NPRA 3QYHB 1YIJA 3CXCP 1W2BP 4RMOA 1Q82U 3H8ZA 7AT1B 4ELYC 3GLXA 1WNLA 1Q7YR 1BCOA 4J9IA 1RABB 3GP8A 4C8QF 2KRNA 4BI4A 4M77A 1Q7YC 2DXUA 1QWFA 1Y96B 1EZZB 2NUZA 4KBMB 4JLIA 2E3HA 3OSSC 1WHKA 4A4HA 4PKCC 4DEYA 2J6FA 1TU0B 3FLGA 3OYYA 2BIVA 1WHJA 2E4HA 4DBQA 4DEXA 5GAOq 3CCLQ 4QKUA 1UUEA 5DY9A 2DVEA 2O4XB 1U5SA 3I5SA 3PIOA 4BUGA 4LUEA 1HSQA 3CCVT 4LDXA 2C0IA 1GFDA 3EH2A 3M0SA 4M77E 4B9XA 1UGQB 5GAMe 1S72A 5DLOA 2KMTA 1N8RC 2LT4A 1B3QA 3QZ9B 4KRTA 2LP5A 3RKYA 3EGXB 2LDMA 3TSWA 1CKAA 2JTFA 1VQPA 2BKDN 3D7SB 2VXEA 1JJ2P 4HKEA 1BB9A 5FU6B 1KC8C 2YLCA 3M53A 2L3RA 2EJ9A 4FT2A 1LCKA 5I21A 3CC4Q 1FYNA 2CREA 1PNJA 4C92A 4M7AB 1D09B 4ANJA 4KUIA 5CK9A 2NUPB 3RIRA 1WXUA 2OTJA 3X24B 2W0ZA 3J7AF 2EQJA 1VQ5T 3HRUA 1UGVA 3L2QA 1AVZC 3MEWA 2MWPA 4RUGA 4PFPA 3CC7Q 1V29B 2DFUA 2EYZA 9ATCB 4OVAA 1KG1A 1PD1A 2OTLQ 1G2BA 2K5LA 4PJOD 1QVFS 1VQ5Q 4IUPA 2RF0A 3HRSA 4J9EA 4KULA 4NOYA 1T0HA 1BU1A 3A8GB 4CI0C 1M3BA 1QVFP 4M77G 4Z88A 2A0FB 4M78F 1GRIA 4NL2A 2NLUA 2O01E 1BI0A 2RQRA 2KYMA 1KQSP 3QO3A 2P4RA 1MMNA 4PJOF 2HQXA 3JRZA 4JZ3A 4XTXA 3CC7A 2FYKA 1WZOA 2CH4W 2DKGA 4DBHA 5GAOn 1OULA 2EIFA 3G4SQ 2X51A 4E7ZA 3VYHB 2FEIA 1ABQA 1X43A 3FRNA 1VQMT 2CT3A 2CSIA 5FRNA 3CXCS 1W2BS 1TUDA 2ROLA 1ZBXA 1Y7XA 2DPPB 2VB6A 1NEGA 2DTOA 3MCAB 4E7KA 1UE9A 4E7LA 4KGVB 5LJ3e 1UGRB 3RMSA 5GAN8 1M4ZA 1UB4A 3CCQT 3CCLA 2AIRB 1RI9A 1MMGA 1BI1A 2I0NA 5FU7B 1NYGA 1OQKA 2XU8A 1PD0A 3G71Q 3CCQA 2BTTA 3VYGA 2VGNA 2M16A 4OMPA 1D0ZA 2K3YA 2LTOA 1QQJA 3G1JA 4DA4A 2K2VA 1JO8A 2CDTA 4RCBA 4M78E 1Y0MA 4KGXB 3I55Q 5HKCA 2JJ9A 4IUUA 1ZSZC 3VUZA 1Z9QA 3URGA 4BY6B 1VQ8A 1VQNA 4ESRA 2ZGWA 4JJNK 2YT6A 5D7UA 4C92G 2QA4A 3A1PA 1VQNT 1QCFA 5KE2A 2AKKA 3WVDB 2DNUA 3A8MB 4CRIA 2XD0A 2COWA 2AK5A 3DLMA 2RI3A 5A0GA 1I4K1 4M7DD 5GJWB 3SFMA 1KHCA 1N8RR 2KYBA 2RO0A 2RQWA 1MGQA 1VQKT 4F14A 1K4US 4D8DA 2PQWA 2COZA 5L8RE 3JCMW 3QDRB 2VASA 1E7OA 1VQ7T 4CC4B 2RHZA 3PNWC 1T0JA 3VS2A 2QXFA 4M75G 4D8KA 1OPLA 1K76A 2J6KA 1BBZA 4FYVB 1PSFA 3A98A 2B86A 2NYSA 1SPKA 2E10A 3O5ZA 3QJYA 1I0CA 1ZHIA 4Z89A 2RQVA 5IHKA 4DQ2A 1YHQQ 1RAFB 2K7AA 3M0UA 3C0CA 2EGCA 2L89A 3EG3A 2DEQA 1ZSGA 1WXTA 2ESWA 2PUOB 2PVGB 2ZPEB 4F7UA 1YP5A 4C8QE 2EKOA 4CC3A 4C0DB 1C0MA 4A53A 3EHQA 2MK5A 4NS5A 3CD6Q 5KYWB 1SF9A 3OYMA 4AT1B 3VS7A 1QVPA 2FPDA 5FLXE 2DD4A 2E41A 3VS1A 1PKSA 2K3XA 2DAQA 1QP2A 5KCHA 2F5KA 4RG8A 1VQOT 2KT1A 2DF6A 3SDZA 2Z0WA 4GLMA 3UATA 2JTEA 3CCRA 1I5OB 1X6BA 1QKWA 2IPOB 3JB9J 1S72Q 2COYA 1KD1U 3REAB 2DERA 3CPWA 2GGRA 4C5GA 4LE9A 1VQ4T 1W70A 3S3OA 3CCRT 4GLKA 1ZA2B 1M3AA 2CUBA 5KYYA 3A5ZB 2R58A 3C4SA 1NE8A 3G71T 4PJOG 2RM4A 2RI5A 3CCJA 1AZEA 3MP6A 3QPHA 2M1HA 1U1TA 1TWBA 1JB0E 1B34A 5IHIA 2EYQA 1WX6A 1OPKA 3CCJT 1QVGP 2A7YA 2GF7A 2FRYA 2R5MA 3G4ST 3KBGA 2RK1A 4JRQA 2KROA 3EFOA 2XG8D 3PMTA 2KQWA 4A54A 5CKBA 1HYOA 4AFZC 2FZKB 3OW2P 4RG2A 1OV3A 4C0ZA 2OI3A 1OX8A 5GJVB 2E1HA 4ZGJB 1B07A 2DTHA 4QVZA 2F5TX 2JW4A 1BI3A 3V7SA 3NPFA 3CC2T 2RQUA 5GAMg 2LCSA 3V7CA 2D9TA 2M0OA 1M5Q1 3X20B 1AWOA 4LUDA 5GAOp 4ZN3A 2ED0A 3CCMT 1N9SA 2ZCFB 2RB6A 1P92A 4A4FA 3TVTA 1AD5A 3CCET 3Q1JA 1RAEB 2J05A 1B7TA 1YJWQ 1UEBA 3ZBDA 2V8JA 2PVOB 2HKQB 2V1RA 4R55A 3C95A 3V8KA 2QEXT 3NTHA 1H3HA 1QVGS 1FWZA 5LJ3h 4KUDK 3FDRA 2PUKB 1Y71A 3P8DA 1QP3A 1UG1A 4V2SA 2BE7D 5GAN6 2QEXA 2QYZA 2K9GA 2ZZDA 3VUBA 4EPCA 1BIBA 2GTJA 4WCIA 3WXMB 1DJ7B 4DOWA 3GPLA 2DL4A 2LQNA 1YJWT 4HT8A 3M0TA 1RAGB 2DL7A 1Q82R 5FWCA 5I22A 4JPBW 4WTOB 2GBQA 4X34A 4YTLA 3OS2A 3UDCA 4EDUA 1IXDA 4BE1A 2GCXA 1NJIR 4Z8AA 3EAEA 5LJ3j 4HT9A 3CCVQ 4N4HA 3HKSA 1YITQ 1LJOA 1SKUB 1YWOA 3M54A 1UFFA 3LH5A 1JEGA 2X4WA 1D0YA 3C94A 1M2OA 4C92D 5A0LA 3VKIA 1KSWA 5GANj 3BDLA 3LGLA 4C92C 3ULRB 4AG1C 5FROA 5LL6S 1GXIE 1N6AA 3OBWA 4XTUA 5C0MA 5GAN2 3RNJA 2RHYA 2DVJA 1TG0A 2J7IA 2X4YA 3LLRA 3SB2A 1VQ5A 4KGZB 3X26B 4C0FA 3L42A 2NUPA 1N27A 2YHTA 5CR2A 5GAOl 4E6RA 3QJ6A 3ZL7C 1JJ2S 4ZTFA 4LD6A 2YDLA 1YHQT 1VOMA 2MOXA 2V8KA 4M7AG 4EMKB 3CMEA 5GANh 1HK9A 5HCKA 2FZCB 2HL3A 4IURA 4OMNA 4M75F 3I55T 3TQ7P 3JCMP 3JCMf 4M7DB 4JS4A 2DJZA 3RKXA 3M0PA 4QQ6A 2A08A 4JJDA 1WQWA 2JNGA 2LQKA 2DILA 1LVKA 2RJFA 1YI2T 1QMCA 1VIEA 5IT9E 4PFOA 4CC2A 4MMLA 2QDYB 4F7UE 2DBKA 2SEMA 4JDSA 3UWNA 2G6FX 4BACA 1PCXA 3DLLA 1X2QA 4RTZA 5FU7C 3RDVA 1Y96A 2DL5A 4M75D 1H3ZA 1WGSA 3QKJA 5GAN3 1N5ZA 1IRXA 2J06A 3LWHA 3N5BB 1UECA 3CCMQ 1M90U 3DB3A 4E7JA 2VKNA 2ENMA 1TXQA 4M7DE 2LNHB 2CZ1B 1YI2Q 3OYEA 3CCEQ 2EW3A 4CC7A 5GAMd 2K2MA 4M7DC 4LDWA 4F04B 2NUTB 4PJOE 2AZSA 4PJOC 2E12A 1G3SA 3L2UA 3TEEA 2E65A 1NG2A 2DX1A 2R57A 1M90C 1V76A 4QVCA 1D3BB 4ATOA 4J9HA 2AZVA 1R77A 2KRSA 3CBPA 4BD3A 1VQKQ 4OGCA 2PVDB 2X9HA 3CCSQ 2HNIA 4C5IA 4OB1B 3TREA 2RI2A 3RKWA 4FT4A 1Y07A 1QCOA 1UHFA 1AWXA 2O9SA 4JLGA 3CMAT 1WJSA 2C0TA 3ER0A 2BE9B 3OYCA 4BDYA 1UDLA 1IREB 1ZUYA 3KFVA 2P84A 1PHTA 1YCYA 5KYYB 2RHUA 1WQ7A 1NJIU 4M7AF 2HKNA 2QGFB 2CP3A 5FWBA 1JXOA 2KXDA 2GQIA 3NMZC 1X01A 3META 2JUFA 1O9SA 2NUTA 3VRZA 3UA6A 1RAHB 4M7DF 2D0QB 4PL6A 4AFQC 2OAUA 4OGEA 2ECZA 1K73U 4HCBA 1NBEB 3EFSA 2D6FA 4BI8B 2QQBA 1K8AU 2DXTA 2WSFE 3DB4A 4RTUA 4RKUE 1G83A 3NTIA 1I81A 2DBMA 2DO3A 5HY6A 3X25B 1VYTA 1Q95G 3OBYA 5LJ3g 4N0AC 2E5KA 3FJPA 3A8LB 3VS4A 1F1BB 1U8RA 2JZ2A 5EG2A 3CBMA 1KHIA 4OB3B 2QQAA 4E7HA 2LVMA 2P0KA 2GQVA 2CP5A 4KH0B 2DE0X 4ZNXA 2MIOA 2MI6A 1TH7A 2EGAA 2QQRA 3FIFA 1OZ2A 3ME9A 1K1ZA 3S3NA 3OMGA 2CS7A 2W10A 1RAIB 3VS0A 2H3EB 2P4TA 1UGSB 4PK4A 3NHNA 5GAMh 4PFZA 1ZLMA 4XU0A 2YRDA 4IKFA 1HD3A 2A36A 3CQTA 5FRMA 4OB2B 2EBPA 3OA6A 1YN8A 1YJNT 2NWMA 2FL7A 5M9OA 2L3SA 4X9CA 4MDWA 1E6GA 3OS1A 4PJMA 4XTYA 3CEYA 1QW1A 1GBRA 2Y4YA 4N4GA 1Z9ZA 1NZ9A 4M77C 4L5GA 3OSVA 2K79A 1MV0B 1YIJQ 2YRCA 4FIBA 4DBFA 5IN1A 2E6ZA 3QHSA 4PJLA 1MHNA 1ZUUA 4XAXB 2QTXA 4QQGA 1PRMC 2HQHA 1M27C 2CP0A 3PT9A 4AMCA 3OYJA 4D6WA 3A8HB 1GCPA 4OMFB 2QI2A 3OQ5A 3H6ZA 3THKA 2V26A 1M1FA 2CZ7B 3EFOB 2DA9A 4J9CA 1FX7A 1PSEA
chains in the Genus database with same CATH topology
2DMOA 2H8HA 4Y92A 1MV3A 4AFZC 2FPEA 2EKHA 1OV3A 1W6XA 2YSQA 2DRMA 2F2XA 2OI3A 4K11A 5GJVB 2IIMA 1KIKA 4QT7A 1FMKA 1B07A 4AFUC 1QLYA 1RLPC 2YUPA 4OMMA 2JW4A 4HXJA 4HVVA 3NPFA 1UJ0A 2ED1A 2KNBB 2RQUA 2LCSA 1PWTA 2RNAA 2MCNA 2LJ1A 1YNZA 1AWOA 2EYYA 4LUDA 2L0AA 2ED0A 1WA7A 2D0NA 1OOTA 1S1NA 1VA7A 3PE0A 2YUNA 3NGPA 2LQWA 3RBBB 2J6OA 4LNPA 3TVTA 4IIOA 2EGEA 1AD5A 2K6DA 3QWYA 4AG2C 5EC7A 1T3LA 3VS5A 2J05A 2CH4A 1E6HA 2VVKA 1SRLA 1U3OA 1UTIA 2CUDA 1KFZA 2V1RA 2HDAA 3H0FA 2L2PA 4JZ4A 4AFSC 2EQIA 1H3HA 2V1QA 3VRYA 1UG1A 4R0KA 2DM1A 1NYFA 4J9IA 2K9GA 4HVUA 2GNCA 2O9VA 2CSQA 2F2VA 2KRNA 2GTJA 4WCIA 2HCKA 2C0OA 1QWFA 2D1XA 2LX7A 3JV3A 2D8JA 2NUZA 1WFWA 1Y57A 2LMJA 2DL4A 2LQNA 2KT8A 2JMAA 3M0TA 4DEYA 2JM9A 2J6FA 2LJ0A 2DL7A 3U23A 2CT4A 2X3WD 5FWCA 5I22A 2QDLA 4JPBW 1SEMA 3VS3A 2GBQA 3EG0A 4DEXA 2JXBA 1UUEA 2PTKA 1NLPC 1U5SA 3I5SA 2LJ3A 2ABLA 3H41A 4LUEA 4Z8AA 1HSQA 3TSZA 2DL8A 4JJBA 2A37A 1QKXA 2C0IA 1GFDA 3M0SA 1YWOA 4A63B 1UFFA 3LH5A 3SHWA 1JEGA 3GBQA 1B3QA 1K0SA 4F16A 4KRTA 1I1JA 2L3QA 5IXBA 1KSWA 2LP5A 1GCQA 2D8HA 1AWJA 3TSWA 1CKAA 1M3CA 3ULRB 1CSKA 4AG1C 1ZX6A 2DLPA 1BB9A 1RLQC 4J9FA 4F17A 1LCKA 1SRMA 3EGUA 1FYNA 3I9QA 3RNJA 2CREA 1PNJA 2DVJA 1TG0A 1VYUA 1XOVA 2L3PA 2J7IA 1BK2A 2FPFA 1HJDA 1WXUA 1RUWA 4E6RA 2K3BA 3ZL7C 1H8KA 4OMOA 2W0ZA 3REBB 1UGVA 2YDLA 1AVZC 2ROTA 3H0HA 2MOXA 4RUGA 2KEAA 2EYZA 3I5RA 1NLOC 5HCKA 2KE9A 1G2BA 1PKTA 2VWFA 4OMNA 1K9AA 2F2WA 2DJQA 2RF0A 4J9EA 1T0HA 1BU1A 2KR3A 2PNIA 2O31A 4IIMA 1IO6A 1M3BA 2OAWA 3M0PA 4Z88A 1M8MA 4RTTA 2A08A 4JJDA 1GRIA 2DILA 2RQRA 2KYMA 2P4RA 1UHCA 1YWPA 2RQTA 4JZ3A 4CC2A 2DBKA 2SEMA 2DRKA 2CH4W 2G6FX 2JS0A 1JQQA 1GCQC 4RTYA 2FEIA 1ABQA 1X2QA 1X43A 4RTZA 4RTXA 2CT3A 2KXCA 2CSIA 5IHNA 2HSPA 2DL5A 1N5ZA 1TUDA 2J06A 2ROLA 1JXMA 2JS2A 5I11A 1UECA 2SRCA 4LN2A 1NEGA 2X3XD 1UE9A 1MUZA 1J3TA 2VKNA 2ENMA 1ZUKA 2LNHB 2EW3A 4CC7A 2K2MA 3EHRA 1VYVA 1X27A 2KGTA 1RI9A 1I07A 2I0NA 2AZSA 1NYGA 4J9DA 1AWWA 4HVWA 2EVRA 1T3SA 2FO0A 3EG1A 2BTTA 1ARKA 1NG2A 1EFNA 2DX1A 2FG0A 1A0NB 1YCSB 4OMPA 1GBQA 1WXBA 1GL5A 5FW9A 4J9HA 2AZVA 1JO8A 2KRSA 2CDTA 1M30A 2A28A 1Y0MA 1AZGB 1UJYA 1WDXA 4JJCA 3M0RA 3UA7A 1UHFA 1AWXA 1ZBJA 2JT4A 2O9SA 1Z9QA 2O88A 4ESRA 2C0TA 2DYBA 3UF4A 4X1VA 1QWEA 2YT6A 1UDLA 1ZUYA 2PZ1A 2AKLA 1H92A 3KFVA 1QCFA 1PHTA 5IXFA 2AKKA 2DNUA 4ORZA 2EYXA 2HBWA 1KJWA 1JXOA 5FWBA 2KXDA 2GQIA 3NMZC 2AK5A 2DL3A 1ABOA 3VRZA 3IQLA 5GJWB 3UA6A 2KYBA 2RQWA 5IH2A 4AFQC 4F14A 1K4US 4D8DA 1WI7A 2ECZA 2M0YA 1E7OA 1WLPB 4CC4B 1AEYA 4RTVA 1T0JA 3VS2A 4RTUA 1G83A 4D8KA 1OPLA 1K76A 2DBMA 3QWXX 2LZ6B 4OMLA 2J6KA 1BBZA 3A98A 2B86A 1SPKA 1SHGA 1WIEA 3O5ZA 1VYTA 1I0CA 2E5KA 4Z89A 2M51A 2RQVA 5IHKA 2EPDA 3VS4A 4M4ZA 1V1CA 3VS6A 1TUCA 2K7AA 3M0UA 3C0CA 2RN8A 2EGCA 3EG3A 3H0IA 1ZSGA 4FSSA 1WXTA 2ESWA 2RPNA 1K0XA 1YP5A 2DE0X 4ZNXA 3SEMA 2MIOA 4CC3A 1SHFA 3EHQA 2EGAA 5ECAA 1SSHA 2JMCA 2YUOA 1K1ZA 2OJ2A 2BZXA 2GTOA 2W10A 3I35A 2O2OA 3VS7A 2JM8A 3VS0A 2XMFA 2FPDA 3NHNA 3VS1A 1PKSA 1AOJA 4RTWA 1NM7A 1ZLMA 2KT1A 1HD3A 2A36A 3CQTA 2DF6A 5L23A 2EBPA 1X69A 1YN8A 4GLMA 2NWMA 3UATA 2JTEA 1X6BA 3M0QA 1QKWA 2L3SA 1E6GA 1X6GA 3REAB 2GGRA 4LE9A 1W70A 4J9BA 1GBRA 1Z9ZA 1CKBA 1NEBA 4EIKA 1W1FA 2K79A 1M3AA 2CUBA 1MV0B 3PVLA 2RMOA 3FJ5A 1AZEA 1ZUUA 2BZYA 2EYWA 1PRMC 4OMQA 2HEQA 1M27C 2KBTA 3PVQA 5IHIA 1WX6A 1WYXA 2BZ8A 1OPKA 2KRMA 1GFCA 4J9GA 1JU5C 1GCPA 2FRYA 3R6NA 2YUQA 1PRLC 3THKA 4HCKA 3EG2A 2FRWA 1X2KA 1U06A 2KROA 4GBQA 2DA9A 4J9CA 1OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMO A;  2H8H A;  4Y92 A;  1MV3 A;  4AFZ C;  2FPE A;  2EKH A;  1OV3 A;  1W6X A;  2YSQ A;  2DRM A;  2F2X A;  2OI3 A;  4K11 A;  5GJV B;  2IIM A;  1KIK A;  4QT7 A;  1FMK A;  1B07 A;  4AFU C;  1QLY A;  1RLP C;  2YUP A;  4OMM A;  2JW4 A;  4HXJ A;  4HVV A;  3NPF A;  1UJ0 A;  2ED1 A;  2KNB B;  2RQU A;  2LCS A;  1PWT A;  2RNA A;  2MCN A;  2LJ1 A;  1YNZ A;  1AWO A;  2EYY A;  4LUD A;  2L0A A;  2ED0 A;  1WA7 A;  2D0N A;  1OOT A;  1S1N A;  1VA7 A;  3PE0 A;  2YUN A;  3NGP A;  2LQW A;  3RBB B;  2J6O A;  4LNP A;  3TVT A;  4IIO A;  2EGE A;  1AD5 A;  2K6D A;  3QWY A;  4AG2 C;  5EC7 A;  1T3L A;  3VS5 A;  2J05 A;  2CH4 A;  1E6H A;  2VVK A;  1SRL A;  1U3O A;  1UTI A;  2CUD A;  1KFZ A;  2V1R A;  2HDA A;  3H0F A;  2L2P A;  4JZ4 A;  4AFS C;  2EQI A;  1H3H A;  2V1Q A;  3VRY A;  1UG1 A;  4R0K A;  2DM1 A;  1NYF A;  4J9I A;  2K9G A;  4HVU A;  2GNC A;  2O9V A;  2CSQ A;  2F2V A;  2KRN A;  2GTJ A;  4WCI A;  2HCK A;  2C0O A;  1QWF A;  2D1X A;  2LX7 A;  3JV3 A;  2D8J A;  2NUZ A;  1WFW A;  1Y57 A;  2LMJ A;  2DL4 A;  2LQN A;  2KT8 A;  2JMA A;  3M0T A;  4DEY A;  2JM9 A;  2J6F A;  2LJ0 A;  2DL7 A;  3U23 A;  2CT4 A;  2X3W D;  5FWC A;  5I22 A;  2QDL A;  4JPB W;  1SEM A;  3VS3 A;  2GBQ A;  3EG0 A;  4DEX A;  2JXB A;  1UUE A;  2PTK A;  1NLP C;  1U5S A;  3I5S A;  2LJ3 A;  2ABL A;  3H41 A;  4LUE A;  4Z8A A;  1HSQ A;  3TSZ A;  2DL8 A;  4JJB A;  2A37 A;  1QKX A;  2C0I A;  1GFD A;  3M0S A;  1YWO A;  4A63 B;  1UFF A;  3LH5 A;  3SHW A;  1JEG A;  3GBQ A;  1B3Q A;  1K0S A;  4F16 A;  4KRT A;  1I1J A;  2L3Q A;  5IXB A;  1KSW A;  2LP5 A;  1GCQ A;  2D8H A;  1AWJ A;  3TSW A;  1CKA A;  1M3C A;  3ULR B;  1CSK A;  4AG1 C;  1ZX6 A;  2DLP A;  1BB9 A;  1RLQ C;  4J9F A;  4F17 A;  1LCK A;  1SRM A;  3EGU A;  1FYN A;  3I9Q A;  3RNJ A;  2CRE A;  1PNJ A;  2DVJ A;  1TG0 A;  1VYU A;  1XOV A;  2L3P A;  2J7I A;  1BK2 A;  2FPF A;  1HJD A;  1WXU A;  1RUW A;  4E6R A;  2K3B A;  3ZL7 C;  1H8K A;  4OMO A;  2W0Z A;  3REB B;  1UGV A;  2YDL A;  1AVZ C;  2ROT A;  3H0H A;  2MOX A;  4RUG A;  2KEA A;  2EYZ A;  3I5R A;  1NLO C;  5HCK A;  2KE9 A;  1G2B A;  1PKT A;  2VWF A;  4OMN A;  1K9A A;  2F2W A;  2DJQ A;  2RF0 A;  4J9E A;  1T0H A;  1BU1 A;  2KR3 A;  2PNI A;  2O31 A;  4IIM A;  1IO6 A;  1M3B A;  2OAW A;  3M0P A;  4Z88 A;  1M8M A;  4RTT A;  2A08 A;  4JJD A;  1GRI A;  2DIL A;  2RQR A;  2KYM A;  2P4R A;  1UHC A;  1YWP A;  2RQT A;  4JZ3 A;  4CC2 A;  2DBK A;  2SEM A;  2DRK A;  2CH4 W;  2G6F X;  2JS0 A;  1JQQ A;  1GCQ C;  4RTY A;  2FEI A;  1ABQ A;  1X2Q A;  1X43 A;  4RTZ A;  4RTX A;  2CT3 A;  2KXC A;  2CSI A;  5IHN A;  2HSP A;  2DL5 A;  1N5Z A;  1TUD A;  2J06 A;  2ROL A;  1JXM A;  2JS2 A;  5I11 A;  1UEC A;  2SRC A;  4LN2 A;  1NEG A;  2X3X D;  1UE9 A;  1MUZ A;  1J3T A;  2VKN A;  2ENM A;  1ZUK A;  2LNH B;  2EW3 A;  4CC7 A;  2K2M A;  3EHR A;  1VYV A;  1X27 A;  2KGT A;  1RI9 A;  1I07 A;  2I0N A;  2AZS A;  1NYG A;  4J9D A;  1AWW A;  4HVW A;  2EVR A;  1T3S A;  2FO0 A;  3EG1 A;  2BTT A;  1ARK A;  1NG2 A;  1EFN A;  2DX1 A;  2FG0 A;  1A0N B;  1YCS B;  4OMP A;  1GBQ A;  1WXB A;  1GL5 A;  5FW9 A;  4J9H A;  2AZV A;  1JO8 A;  2KRS A;  2CDT A;  1M30 A;  2A28 A;  1Y0M A;  1AZG B;  1UJY A;  1WDX A;  4JJC A;  3M0R A;  3UA7 A;  1UHF A;  1AWX A;  1ZBJ A;  2JT4 A;  2O9S A;  1Z9Q A;  2O88 A;  4ESR A;  2C0T A;  2DYB A;  3UF4 A;  4X1V A;  1QWE A;  2YT6 A;  1UDL A;  1ZUY A;  2PZ1 A;  2AKL A;  1H92 A;  3KFV A;  1QCF A;  1PHT A;  5IXF A;  2AKK A;  2DNU A;  4ORZ A;  2EYX A;  2HBW A;  1KJW A;  1JXO A;  5FWB A;  2KXD A;  2GQI A;  3NMZ C;  2AK5 A;  2DL3 A;  1ABO A;  3VRZ A;  3IQL A;  5GJW B;  3UA6 A;  2KYB A;  2RQW A;  5IH2 A;  4AFQ C;  4F14 A;  1K4U S;  4D8D A;  1WI7 A;  2ECZ A;  2M0Y A;  1E7O A;  1WLP B;  4CC4 B;  1AEY A;  4RTV A;  1T0J A;  3VS2 A;  4RTU A;  1G83 A;  4D8K A;  1OPL A;  1K76 A;  2DBM A;  3QWX X;  2LZ6 B;  4OML A;  2J6K A;  1BBZ A;  3A98 A;  2B86 A;  1SPK A;  1SHG A;  1WIE A;  3O5Z A;  1VYT A;  1I0C A;  2E5K A;  4Z89 A;  2M51 A;  2RQV A;  5IHK A;  2EPD A;  3VS4 A;  4M4Z A;  1V1C A;  3VS6 A;  1TUC A;  2K7A A;  3M0U A;  3C0C A;  2RN8 A;  2EGC A;  3EG3 A;  3H0I A;  1ZSG A;  4FSS A;  1WXT A;  2ESW A;  2RPN A;  1K0X A;  1YP5 A;  2DE0 X;  4ZNX A;  3SEM A;  2MIO A;  4CC3 A;  1SHF A;  3EHQ A;  2EGA A;  5ECA A;  1SSH A;  2JMC A;  2YUO A;  1K1Z A;  2OJ2 A;  2BZX A;  2GTO A;  2W10 A;  3I35 A;  2O2O A;  3VS7 A;  2JM8 A;  3VS0 A;  2XMF A;  2FPD A;  3NHN A;  3VS1 A;  1PKS A;  1AOJ A;  4RTW A;  1NM7 A;  1ZLM A;  2KT1 A;  1HD3 A;  2A36 A;  3CQT A;  2DF6 A;  5L23 A;  2EBP A;  1X69 A;  1YN8 A;  4GLM A;  2NWM A;  3UAT A;  2JTE A;  1X6B A;  3M0Q A;  1QKW A;  2L3S A;  1E6G A;  1X6G A;  3REA B;  2GGR A;  4LE9 A;  1W70 A;  4J9B A;  1GBR A;  1Z9Z A;  1CKB A;  1NEB A;  4EIK A;  1W1F A;  2K79 A;  1M3A A;  2CUB A;  1MV0 B;  3PVL A;  2RMO A;  3FJ5 A;  1AZE A;  1ZUU A;  2BZY A;  2EYW A;  1PRM C;  4OMQ A;  2HEQ A;  1M27 C;  2KBT A;  3PVQ A;  5IHI A;  1WX6 A;  1WYX A;  2BZ8 A;  1OPK A;  2KRM A;  1GFC A;  4J9G A;  1JU5 C;  1GCP A;  2FRY A;  3R6N A;  2YUQ A;  1PRL C;  3THK A;  4HCK A;  3EG2 A;  2FRW A;  1X2K A;  1U06 A;  2KRO A;  4GBQ A;  2DA9 A;  4J9C A;  1OEB A; 
#chains in the Genus database with same CATH topology
 4M75 A;  5CQY A;  1W4S A;  3BW1 A;  4Y92 A;  2LCL A;  4FYX B;  4PJN A;  2XHC A;  3RUX A;  2XDP A;  2EKH A;  1VQM A;  1VQ8 Q;  3OYH A;  3M9Q A;  1KIK A;  1FMK A;  1QLY A;  1BI2 A;  4HXJ A;  5CQX A;  1NJI C;  1UJ0 A;  2KNB B;  3CCM A;  5CKF A;  1VQP Q;  2LJ1 A;  3OYA A;  2DXB A;  2EYY A;  1KD1 C;  2L0A A;  1SG5 A;  1C1A A;  4M77 F;  8ATC B;  1VQO Q;  1VA7 A;  3L1A A;  2J6O A;  2EGE A;  3QWY A;  4AG2 C;  3S3M A;  5CCA A;  1WJQ A;  3NFC A;  1T3L A;  2MYS A;  2CH4 A;  3BY7 A;  1SRL A;  1WHG A;  2CUD A;  3H0F A;  4JZ4 A;  5GAN 5;  3JB9 I;  3CCU T;  1K9M C;  4M7A D;  1YJ9 T;  1VQ4 Q;  2V1Q A;  4L59 A;  2EJG A;  4R0K A;  2DTI A;  2OX7 A;  3CCU A;  2LQ8 A;  4Y91 A;  3OYB A;  4HVU A;  2GNC A;  2O9V A;  4ELZ C;  2CSQ A;  2F2V A;  2QAS A;  2WSC E;  2VYT A;  3ZEH A;  2KVQ G;  4FSX A;  4XU1 A;  4BI3 A;  2D8J A;  1OU9 A;  1WFW A;  1Y57 A;  2YXY A;  3GNG A;  1K9M R;  3QSU A;  4M7D A;  3OW2 S;  2KT8 A;  5A0D A;  3HP9 A;  4DBR A;  2LJ0 A;  2EJF A;  2RA2 A;  2QK0 A;  1ACM B;  1YBY A;  4QVD A;  4J6X A;  2CT4 A;  1ZSZ A;  2X3W D;  3OS5 A;  3HTR A;  2QDL A;  3VS3 A;  1SEM A;  4M78 D;  1RAC B;  2JXB A;  1NLP C;  2PTK A;  2OTL T;  2LJ3 A;  3H41 A;  2ZPF B;  4F7U G;  5FU6 C;  3TSZ A;  1I8F A;  2ATC B;  1FMW A;  2GFA A;  2OTL A;  4A63 B;  2EWN A;  1KQS A;  1VQ6 T;  1K0S A;  3P8B B;  4F16 A;  1RI0 A;  1KD1 R;  5IXB A;  1GCQ A;  2D8H A;  2DK3 A;  1AWJ A;  2QGG A;  4KH1 B;  1M3C A;  4IUT A;  2CP7 A;  1CSK A;  3JSC A;  3VV0 A;  3LWI A;  3LYI A;  2DLP A;  2FB7 A;  3JCM V;  1JJ2 A;  3MP8 A;  2DXC A;  5KYX A;  4J9F A;  3EGX A;  3JCM J;  2E70 A;  4F17 A;  5LJ5 e;  1FMV A;  1XNI A;  4C8Q C;  5GMK e;  1VYU A;  1XOV A;  2L3P A;  3QDF A;  3QII A;  1AT1 B;  1HJD A;  4TVR A;  2K3B A;  2M9U A;  1H8K A;  2O4X A;  1LNX A;  2CZ6 B;  3FB9 A;  2ZPG B;  3HHT B;  2KEA A;  1O75 A;  4C5E A;  1VQ4 A;  2FZG B;  1MNE A;  2WAC A;  1RAA B;  5GAN 7;  1VQO A;  2VGM A;  3S6W A;  1PKT A;  1K9A A;  2F2W A;  2KR3 A;  1U1S A;  4OP0 A;  3BFM A;  2E64 A;  2LC4 A;  4IIM A;  2B8A A;  4X9D A;  4EMH A;  4PLI A;  4C92 E;  2QAZ A;  4LD9 K;  5GMK j;  1IHV A;  1UHC A;  1YWP A;  3V8J A;  3RES A;  3SD4 A;  3KXT A;  4FW1 A;  2C06 A;  1MND A;  5LJ5 g;  1GCQ C;  1KC8 R;  2HZY A;  4EMG A;  4RTX A;  2KXC A;  5IHN A;  3G4S A;  2XDB A;  2E3I A;  1EX4 A;  5D6Y A;  3V7R A;  1IB8 A;  2IG0 A;  5GAN g;  2XK0 A;  4BY6 C;  2SRC A;  2EQM A;  4LN2 A;  1PG5 B;  2BUD A;  3G6E A;  4M78 C;  4XTW A;  4HCZ A;  2KAF A;  5J26 A;  3OYF A;  1MUZ A;  1J3T A;  4O6J A;  5GAN 4;  3CMA Q;  4M77 B;  1B34 B;  5DLQ E;  5CKE A;  1AHJ B;  1VYV A;  2JVV A;  5GMK i;  4HCC A;  3L2R A;  1I07 A;  3CPW S;  4B9W A;  2HQE A;  4J5Y A;  4N0A A;  4J9D A;  3SWN B;  3HSB A;  1AWW A;  4HVW A;  2KK4 A;  4JRP A;  1VQL A;  1TOV A;  1TS9 A;  1T3S A;  2F69 A;  2CYZ B;  1ARK A;  3JCM g;  2JN0 A;  1VQ7 Q;  1OU8 A;  1OI1 A;  1GL5 A;  3M4Y A;  3JB9 D;  1Q81 U;  4FYY B;  1M30 A;  1C6V X;  3EG9 B;  1UJY A;  1WDX A;  2LT1 A;  3EH1 A;  3UA7 A;  4IUQ A;  2JT4 A;  3AHU A;  1M90 R;  3OB9 A;  2O88 A;  4M7A A;  2H3J A;  4BDZ A;  5AYF A;  2KY9 A;  3UF4 A;  4X1V A;  3FC3 A;  2DYI A;  4LXC A;  5CKH A;  5HK0 A;  4MZM A;  2PZ1 A;  4M75 E;  1EIF A;  5IXF A;  4VUB A;  4C5H A;  2HBW A;  3O8V A;  1KJW A;  4BE0 A;  1OYX A;  3PFS A;  3IQL A;  1RAD B;  5IH2 A;  1VQN Q;  3P8H A;  4M78 A;  1QCN A;  1WI7 A;  4M78 B;  1R0C B;  4RTV A;  2CGH A;  1G3W A;  3JCM e;  3CD6 A;  3G7Z A;  3M5A A;  4MZT A;  1MMD A;  2LZ6 B;  2JOY A;  3BDU A;  5KH6 A;  3NTK A;  1WIE A;  3E9G A;  3MEU A;  2RH2 A;  3JB9 F;  3SWN C;  4ZGD B;  2Y90 A;  5I2S A;  1Q7Y U;  4M4Z A;  1V1C A;  3VS6 A;  1TUC A;  2RN8 A;  1XQH A;  2LRQ A;  4L6V 5;  4FCY A;  3J81 E;  2KI7 A;  4LDY A;  1VQL Q;  1D1A A;  1VQ9 T;  3SEM A;  1Q86 C;  3CBO A;  3MEV A;  1VQP T;  5D6X A;  2E5Q A;  2X4X A;  5ECA A;  1SSH A;  2YUO A;  3EG9 A;  2OTJ T;  4J6W A;  3JCM h;  3RR6 A;  2P0P A;  3M59 A;  2BZX A;  4C8Q B;  4DOV A;  1K73 R;  1TSF A;  2O2O A;  2JM8 A;  1YHQ A;  3M57 A;  5J39 A;  2K4Y A;  2RHX A;  3JCM c;  3OYD A;  4II1 A;  4C0D C;  3CME Q;  1KQ1 A;  1YIT T;  1ZQ1 A;  5LJ5 d;  1XTD A;  3OYL A;  4PJJ A;  3PIP A;  3M56 A;  1YIT A;  1TUG B;  1X6G A;  3MHX A;  3INZ A;  4J9B A;  3PTA A;  5GAO m;  1YFN A;  1K8A C;  1CKB A;  4XTV A;  2LX9 A;  1W1F A;  1WHM A;  3M55 A;  2ZPH B;  3PVL A;  2RMO A;  1YI2 A;  2G3R A;  3EFR A;  3I55 A;  5C6S A;  2KBT A;  3PVQ A;  1BIA A;  4E2F B;  3UT1 A;  5GAN d;  2KRM A;  1M2V B;  4J9G A;  1JU5 C;  1XJW B;  3R6N A;  2CZ0 B;  4OF1 A;  1X2K A;  1VUB A;  1U06 A;  1SSF A;  4GBQ A;  5KCO A;  3V8L A;  4A4E A;  2QEX Q;  5GAN e;  3RMQ A;  1RL2 A;  2IVW A;  1Q81 C;  2FPE A;  1W6X A;  2YSQ A;  2DRM A;  4K11 A;  4JUV A;  3E1S A;  2IIM A;  2RJC A;  4QT7 A;  4HA8 A;  3KUF A;  3LX7 A;  3CCL T;  2I2L A;  1Q81 R;  1X6O A;  2HBP A;  1M1K C;  3LGF A;  2HL5 C;  3CCQ Q;  1G5V A;  1PWT A;  5KYW A;  2RNA A;  2MCN A;  3QBY A;  3VU3 C;  3AT1 B;  1WA7 A;  2D0N A;  1S1N A;  4FYW B;  5CAI A;  3HL8 A;  4RCC A;  3NGP A;  3GOX A;  3PGG A;  3LW5 E;  3RBB B;  4IIO A;  2ZPB B;  2EQK A;  2X35 A;  2K6D A;  1M2V A;  1JBM A;  5EC7 A;  3VS5 A;  2MAM A;  3QYG B;  4KT0 E;  1E6H A;  2VVK A;  1K8A R;  2KDS A;  3CC2 Q;  1M9S A;  2YLB A;  5GAM f;  2L2P A;  4AFS C;  2EQI A;  2RD1 A;  4Z02 A;  3VRY A;  1VQM Q;  3CXC A;  1W2B A;  2L8D A;  2DM1 A;  3CMA A;  2QQS A;  1NYF A;  4QW2 A;  1YIJ T;  4C92 B;  2A3L A;  2HCK A;  2C0O A;  2D1X A;  3EGD B;  2LX7 A;  3JV3 A;  3MKD A;  1BKB A;  4ME7 A;  4P5N A;  3DKM A;  4UC4 A;  2LMJ A;  2JMA A;  2JM9 A;  1M8V A;  3U23 A;  3CC4 T;  1OZ3 A;  5KE3 A;  3EG0 A;  4PNO A;  4M78 G;  3CCU Q;  1VQK A;  3JCM X;  1OX9 A;  2ABL A;  3X28 B;  3CC4 A;  1VQ6 A;  4A4K A;  4LDV A;  1G3Y A;  4N4I A;  2K57 A;  2DL8 A;  4JJB A;  2A37 A;  1QKX A;  3SHW A;  1K9M U;  3GBQ A;  3CCV A;  3OY9 A;  1I1J A;  2L3Q A;  2XKO C;  2L5Q A;  1S72 T;  2QTV A;  1ZX6 A;  5D6W A;  1IGU A;  4M7A E;  1RLQ C;  5KYU A;  1M1G A;  1LPL A;  1D3B A;  1SRM A;  3JAM E;  3CCJ Q;  3OYK A;  8AT1 B;  3EGU A;  3I9Q A;  1BK2 A;  2FPF A;  3WVE B;  2HD0 A;  5GAO r;  1RUW A;  2PU9 B;  4B6M A;  5GMK m;  4OMO A;  4ZGE B;  2ZPI B;  4A4G A;  1WHH A;  3MP1 A;  3REB B;  3L2V A;  3CCR Q;  2ROT A;  3H0H A;  3ASK A;  3FEO A;  5CKD A;  1G8X A;  1WHL A;  3I5R A;  2MWO A;  4EMK A;  1KQS S;  1NLO C;  2RK2 A;  1IGQ A;  2DIG A;  2YRV A;  2KE9 A;  2VWF A;  1G3T A;  1YJN A;  3VJP A;  2DJQ A;  4GY5 A;  4Y28 E;  6AT1 B;  2PNI A;  4M77 D;  2O31 A;  1IO6 A;  2OAW A;  4PLL A;  1H64 1;  3I56 Q;  1M8M A;  4RTT A;  5LJ3 d;  1VIF A;  3G6E Q;  1D1C A;  2XID A;  4J8O A;  3OMC A;  4NL3 A;  4F7U F;  2RQT A;  2RHI A;  4PJO A;  4XU2 A;  2R5A A;  2DRK A;  1D0X A;  1MMA A;  2JS0 A;  1JQQ A;  2HMA A;  1IZ6 A;  4E47 A;  4RTY A;  3CC7 T;  4OB0 B;  3L2Z A;  1M1K R;  3SWN A;  5J3B A;  2QG9 B;  3G6E T;  2HSP A;  5IAY A;  4QQD A;  5KYX B;  2JS2 A;  1JXM A;  5DM7 R;  4WF2 A;  5I11 A;  5GAM j;  2X3X D;  3E9F A;  1KK7 A;  4C0G A;  2HAX A;  1ZUK A;  3JB9 H;  1Q86 U;  3MJX A;  3EHR A;  1X27 A;  2KGT A;  3HFN A;  2DET A;  4M75 C;  1VQ9 Q;  5CIU A;  2YWW A;  3C12 A;  5CVI A;  2EVR A;  2AHJ B;  2FO0 A;  3EG1 A;  1WJR A;  1R8O B;  2RJE A;  3LH0 A;  1EFN A;  2FG0 A;  3GF5 A;  4Q5W A;  1N8R U;  1NPP A;  1YCS B;  1A0N B;  1GBQ A;  4MDX A;  1WXB A;  2K5F A;  5FW9 A;  3OYG A;  1KC8 U;  4XTZ A;  4FM4 B;  5HK3 A;  2A28 A;  2QQ9 A;  3CCE A;  1AZG B;  2DZC A;  1BCM A;  2Y4X A;  1YJ9 A;  1YJN Q;  4JJC A;  2MF2 A;  3M0R A;  3HFO A;  1FXX A;  1ZBJ A;  4ZTJ A;  4IUV A;  5LJ5 f;  4C8Q D;  3OW2 A;  2DYB A;  3HRT A;  1QWE A;  5A2Q E;  2AKL A;  3ZFJ A;  1H92 A;  1VQ8 T;  1KQ2 A;  4EMK C;  2EFI A;  3QG1 A;  1UGP B;  5GAN f;  4ORZ A;  2EYX A;  2QA4 T;  3JCM d;  3CPF A;  5KYN A;  2DL3 A;  1K73 C;  4E7I A;  4M75 B;  4JRI A;  1ABO A;  2DD5 A;  3OYI A;  1D1B A;  2EQU A;  3CD6 T;  3QZ5 B;  1YJW A;  2M0Y A;  3T9N A;  2DZ9 A;  1WLP B;  4F7U B;  1AEY A;  3JCM Q;  1QVF A;  3QWX X;  4OML A;  1HXD A;  3M58 A;  3GNF B;  3JCM b;  1VQ7 A;  1SHG A;  1Q82 C;  3H9N A;  2HSE B;  1R0B G;  3J80 E;  4J7F A;  2M51 A;  2EPD A;  3EGD A;  1VQ9 A;  2WSE E;  3PMI A;  3H0I A;  3I56 T;  5GMK l;  2K5I A;  4FSS A;  4JS5 A;  4PJO B;  2RPN A;  1K0X A;  2JTM A;  4J83 A;  2FVU A;  3I56 A;  1SHF A;  2JMC A;  3MPU B;  2OJ2 A;  3E2U A;  4C92 F;  2VXF A;  4M7A C;  2GTO A;  2M02 A;  2F1L A;  3I35 A;  3GIB A;  2RJD A;  2XMF A;  4ZN1 A;  2P0Q A;  2XIC A;  5LJ3 f;  4O5V A;  4BB7 A;  4LDU A;  1AOJ A;  4RTW A;  1NM7 A;  2LCC A;  3CME T;  4MMK A;  2X4J A;  5L23 A;  2KSS A;  1X69 A;  2ZAE A;  1JRI A;  4BE2 A;  4C8Q G;  3M0Q A;  5I2M A;  1TTH B;  2E6N A;  1WPY A;  2MMP A;  2XDD A;  3L2W A;  3OYN A;  1X75 C;  3HPW A;  1NEB A;  4EIK A;  1M1K U;  4E7S A;  1I5L A;  3FJ5 A;  2DIQ A;  2EAY A;  2VUB A;  5LJ5 h;  1PM3 A;  4J6Y A;  2AT1 B;  4FL6 A;  5KYU B;  2BZY A;  1LOJ A;  2EYW A;  3G71 A;  4OMQ A;  3RER A;  2HEQ A;  2BZ8 A;  1WYX A;  4FU6 A;  3QXE B;  1GFC A;  5LJ5 j;  2YUQ A;  1PRL C;  3JB9 G;  1Q86 R;  4HCK A;  3EG2 A;  2FRW A;  2VC8 A;  3TCJ A;  3M4G A;  1BYM A;  1OEB A;  2MPX C;  2DMO A;  2H8H A;  1YJ9 Q;  1MV3 A;  3OS0 A;  2CP2 A;  3BE3 A;  2F2X A;  1QVG A;  4AFU C;  2CP6 A;  2GFU A;  3MO8 A;  1RLP C;  2YUP A;  4OMM A;  4HVV A;  1PC0 A;  2ED1 A;  2LNV A;  4XK8 E;  4MZP A;  3UPU A;  5CO7 A;  3A8O B;  1YNZ A;  3CC2 A;  3F70 A;  4M7D G;  1OOT A;  2VV5 A;  3E19 A;  3QUI A;  4XQ3 A;  4R56 A;  1IHW A;  4JRK A;  3PE0 A;  5AT1 B;  2DEU A;  2YUN A;  2XI9 A;  3CCS A;  3CPW P;  2LQW A;  4LNP A;  3R6O A;  1N9R A;  2CKK A;  1VQL T;  4XU3 A;  3CCS T;  5GMK h;  1VQ6 Q;  1ZA1 B;  4J7I A;  2V8I A;  2OTJ Q;  3TU4 K;  4FW2 A;  1U3O A;  1UTI A;  1KFZ A;  3MEA A;  2HDA A;  1ZSZ B;  2QA4 Q;  2FHD A;  4C8Q A;  1NPR A;  3QYH B;  1YIJ A;  3CXC P;  1W2B P;  4RMO A;  1Q82 U;  3H8Z A;  7AT1 B;  4ELY C;  3GLX A;  1WNL A;  1Q7Y R;  1BCO A;  4J9I A;  1RAB B;  3GP8 A;  4C8Q F;  2KRN A;  4BI4 A;  4M77 A;  1Q7Y C;  2DXU A;  1QWF A;  1Y96 B;  1EZZ B;  2NUZ A;  4KBM B;  4JLI A;  2E3H A;  3OSS C;  1WHK A;  4A4H A;  4PKC C;  4DEY A;  2J6F A;  1TU0 B;  3FLG A;  3OYY A;  2BIV A;  1WHJ A;  2E4H A;  4DBQ A;  4DEX A;  5GAO q;  3CCL Q;  4QKU A;  1UUE A;  5DY9 A;  2DVE A;  2O4X B;  1U5S A;  3I5S A;  3PIO A;  4BUG A;  4LUE A;  1HSQ A;  3CCV T;  4LDX A;  2C0I A;  1GFD A;  3EH2 A;  3M0S A;  4M77 E;  4B9X A;  1UGQ B;  5GAM e;  1S72 A;  5DLO A;  2KMT A;  1N8R C;  2LT4 A;  1B3Q A;  3QZ9 B;  4KRT A;  2LP5 A;  3RKY A;  3EGX B;  2LDM A;  3TSW A;  1CKA A;  2JTF A;  1VQP A;  2BKD N;  3D7S B;  2VXE A;  1JJ2 P;  4HKE A;  1BB9 A;  5FU6 B;  1KC8 C;  2YLC A;  3M53 A;  2L3R A;  2EJ9 A;  4FT2 A;  1LCK A;  5I21 A;  3CC4 Q;  1FYN A;  2CRE A;  1PNJ A;  4C92 A;  4M7A B;  1D09 B;  4ANJ A;  4KUI A;  5CK9 A;  2NUP B;  3RIR A;  1WXU A;  2OTJ A;  3X24 B;  2W0Z A;  3J7A F;  2EQJ A;  1VQ5 T;  3HRU A;  1UGV A;  3L2Q A;  1AVZ C;  3MEW A;  2MWP A;  4RUG A;  4PFP A;  3CC7 Q;  1V29 B;  2DFU A;  2EYZ A;  9ATC B;  4OVA A;  1KG1 A;  1PD1 A;  2OTL Q;  1G2B A;  2K5L A;  4PJO D;  1QVF S;  1VQ5 Q;  4IUP A;  2RF0 A;  3HRS A;  4J9E A;  4KUL A;  4NOY A;  1T0H A;  1BU1 A;  3A8G B;  4CI0 C;  1M3B A;  1QVF P;  4M77 G;  4Z88 A;  2A0F B;  4M78 F;  1GRI A;  4NL2 A;  2NLU A;  2O01 E;  1BI0 A;  2RQR A;  2KYM A;  1KQS P;  3QO3 A;  2P4R A;  1MMN A;  4PJO F;  2HQX A;  3JRZ A;  4JZ3 A;  4XTX A;  3CC7 A;  2FYK A;  1WZO A;  2CH4 W;  2DKG A;  4DBH A;  5GAO n;  1OUL A;  2EIF A;  3G4S Q;  2X51 A;  4E7Z A;  3VYH B;  2FEI A;  1ABQ A;  1X43 A;  3FRN A;  1VQM T;  2CT3 A;  2CSI A;  5FRN A;  3CXC S;  1W2B S;  1TUD A;  2ROL A;  1ZBX A;  1Y7X A;  2DPP B;  2VB6 A;  1NEG A;  2DTO A;  3MCA B;  4E7K A;  1UE9 A;  4E7L A;  4KGV B;  5LJ3 e;  1UGR B;  3RMS A;  5GAN 8;  1M4Z A;  1UB4 A;  3CCQ T;  3CCL A;  2AIR B;  1RI9 A;  1MMG A;  1BI1 A;  2I0N A;  5FU7 B;  1NYG A;  1OQK A;  2XU8 A;  1PD0 A;  3G71 Q;  3CCQ A;  2BTT A;  3VYG A;  2VGN A;  2M16 A;  4OMP A;  1D0Z A;  2K3Y A;  2LTO A;  1QQJ A;  3G1J A;  4DA4 A;  2K2V A;  1JO8 A;  2CDT A;  4RCB A;  4M78 E;  1Y0M A;  4KGX B;  3I55 Q;  5HKC A;  2JJ9 A;  4IUU A;  1ZSZ C;  3VUZ A;  1Z9Q A;  3URG A;  4BY6 B;  1VQ8 A;  1VQN A;  4ESR A;  2ZGW A;  4JJN K;  2YT6 A;  5D7U A;  4C92 G;  2QA4 A;  3A1P A;  1VQN T;  1QCF A;  5KE2 A;  2AKK A;  3WVD B;  2DNU A;  3A8M B;  4CRI A;  2XD0 A;  2COW A;  2AK5 A;  3DLM A;  2RI3 A;  5A0G A;  1I4K 1;  4M7D D;  5GJW B;  3SFM A;  1KHC A;  1N8R R;  2KYB A;  2RO0 A;  2RQW A;  1MGQ A;  1VQK T;  4F14 A;  1K4U S;  4D8D A;  2PQW A;  2COZ A;  5L8R E;  3JCM W;  3QDR B;  2VAS A;  1E7O A;  1VQ7 T;  4CC4 B;  2RHZ A;  3PNW C;  1T0J A;  3VS2 A;  2QXF A;  4M75 G;  4D8K A;  1OPL A;  1K76 A;  2J6K A;  1BBZ A;  4FYV B;  1PSF A;  3A98 A;  2B86 A;  2NYS A;  1SPK A;  2E10 A;  3O5Z A;  3QJY A;  1I0C A;  1ZHI A;  4Z89 A;  2RQV A;  5IHK A;  4DQ2 A;  1YHQ Q;  1RAF B;  2K7A A;  3M0U A;  3C0C A;  2EGC A;  2L89 A;  3EG3 A;  2DEQ A;  1ZSG A;  1WXT A;  2ESW A;  2PUO B;  2PVG B;  2ZPE B;  4F7U A;  1YP5 A;  4C8Q E;  2EKO A;  4CC3 A;  4C0D B;  1C0M A;  4A53 A;  3EHQ A;  2MK5 A;  4NS5 A;  3CD6 Q;  5KYW B;  1SF9 A;  3OYM A;  4AT1 B;  3VS7 A;  1QVP A;  2FPD A;  5FLX E;  2DD4 A;  2E41 A;  3VS1 A;  1PKS A;  2K3X A;  2DAQ A;  1QP2 A;  5KCH A;  2F5K A;  4RG8 A;  1VQO T;  2KT1 A;  2DF6 A;  3SDZ A;  2Z0W A;  4GLM A;  3UAT A;  2JTE A;  3CCR A;  1I5O B;  1X6B A;  1QKW A;  2IPO B;  3JB9 J;  1S72 Q;  2COY A;  1KD1 U;  3REA B;  2DER A;  3CPW A;  2GGR A;  4C5G A;  4LE9 A;  1VQ4 T;  1W70 A;  3S3O A;  3CCR T;  4GLK A;  1ZA2 B;  1M3A A;  2CUB A;  5KYY A;  3A5Z B;  2R58 A;  3C4S A;  1NE8 A;  3G71 T;  4PJO G;  2RM4 A;  2RI5 A;  3CCJ A;  1AZE A;  3MP6 A;  3QPH A;  2M1H A;  1U1T A;  1TWB A;  1JB0 E;  1B34 A;  5IHI A;  2EYQ A;  1WX6 A;  1OPK A;  3CCJ T;  1QVG P;  2A7Y A;  2GF7 A;  2FRY A;  2R5M A;  3G4S T;  3KBG A;  2RK1 A;  4JRQ A;  2KRO A;  3EFO A;  2XG8 D;  3PMT A;  2KQW A;  4A54 A;  5CKB A;  1HYO A;  4AFZ C;  2FZK B;  3OW2 P;  4RG2 A;  1OV3 A;  4C0Z A;  2OI3 A;  1OX8 A;  5GJV B;  2E1H A;  4ZGJ B;  1B07 A;  2DTH A;  4QVZ A;  2F5T X;  2JW4 A;  1BI3 A;  3V7S A;  3NPF A;  3CC2 T;  2RQU A;  5GAM g;  2LCS A;  3V7C A;  2D9T A;  2M0O A;  1M5Q 1;  3X20 B;  1AWO A;  4LUD A;  5GAO p;  4ZN3 A;  2ED0 A;  3CCM T;  1N9S A;  2ZCF B;  2RB6 A;  1P92 A;  4A4F A;  3TVT A;  1AD5 A;  3CCE T;  3Q1J A;  1RAE B;  2J05 A;  1B7T A;  1YJW Q;  1UEB A;  3ZBD A;  2V8J A;  2PVO B;  2HKQ B;  2V1R A;  4R55 A;  3C95 A;  3V8K A;  2QEX T;  3NTH A;  1H3H A;  1QVG S;  1FWZ A;  5LJ3 h;  4KUD K;  3FDR A;  2PUK B;  1Y71 A;  3P8D A;  1QP3 A;  1UG1 A;  4V2S A;  2BE7 D;  5GAN 6;  2QEX A;  2QYZ A;  2K9G A;  2ZZD A;  3VUB A;  4EPC A;  1BIB A;  2GTJ A;  4WCI A;  3WXM B;  1DJ7 B;  4DOW A;  3GPL A;  2DL4 A;  2LQN A;  1YJW T;  4HT8 A;  3M0T A;  1RAG B;  2DL7 A;  1Q82 R;  5FWC A;  5I22 A;  4JPB W;  4WTO B;  2GBQ A;  4X34 A;  4YTL A;  3OS2 A;  3UDC A;  4EDU A;  1IXD A;  4BE1 A;  2GCX A;  1NJI R;  4Z8A A;  3EAE A;  5LJ3 j;  4HT9 A;  3CCV Q;  4N4H A;  3HKS A;  1YIT Q;  1LJO A;  1SKU B;  1YWO A;  3M54 A;  1UFF A;  3LH5 A;  1JEG A;  2X4W A;  1D0Y A;  3C94 A;  1M2O A;  4C92 D;  5A0L A;  3VKI A;  1KSW A;  5GAN j;  3BDL A;  3LGL A;  4C92 C;  3ULR B;  4AG1 C;  5FRO A;  5LL6 S;  1GXI E;  1N6A A;  3OBW A;  4XTU A;  5C0M A;  5GAN 2;  3RNJ A;  2RHY A;  2DVJ A;  1TG0 A;  2J7I A;  2X4Y A;  3LLR A;  3SB2 A;  1VQ5 A;  4KGZ B;  3X26 B;  4C0F A;  3L42 A;  2NUP A;  1N27 A;  2YHT A;  5CR2 A;  5GAO l;  4E6R A;  3QJ6 A;  3ZL7 C;  1JJ2 S;  4ZTF A;  4LD6 A;  2YDL A;  1YHQ T;  1VOM A;  2MOX A;  2V8K A;  4M7A G;  4EMK B;  3CME A;  5GAN h;  1HK9 A;  5HCK A;  2FZC B;  2HL3 A;  4IUR A;  4OMN A;  4M75 F;  3I55 T;  3TQ7 P;  3JCM P;  3JCM f;  4M7D B;  4JS4 A;  2DJZ A;  3RKX A;  3M0P A;  4QQ6 A;  2A08 A;  4JJD A;  1WQW A;  2JNG A;  2LQK A;  2DIL A;  1LVK A;  2RJF A;  1YI2 T;  1QMC A;  1VIE A;  5IT9 E;  4PFO A;  4CC2 A;  4MML A;  2QDY B;  4F7U E;  2DBK A;  2SEM A;  4JDS A;  3UWN A;  2G6F X;  4BAC A;  1PCX A;  3DLL A;  1X2Q A;  4RTZ A;  5FU7 C;  3RDV A;  1Y96 A;  2DL5 A;  4M75 D;  1H3Z A;  1WGS A;  3QKJ A;  5GAN 3;  1N5Z A;  1IRX A;  2J06 A;  3LWH A;  3N5B B;  1UEC A;  3CCM Q;  1M90 U;  3DB3 A;  4E7J A;  2VKN A;  2ENM A;  1TXQ A;  4M7D E;  2LNH B;  2CZ1 B;  1YI2 Q;  3OYE A;  3CCE Q;  2EW3 A;  4CC7 A;  5GAM d;  2K2M A;  4M7D C;  4LDW A;  4F04 B;  2NUT B;  4PJO E;  2AZS A;  4PJO C;  2E12 A;  1G3S A;  3L2U A;  3TEE A;  2E65 A;  1NG2 A;  2DX1 A;  2R57 A;  1M90 C;  1V76 A;  4QVC A;  1D3B B;  4ATO A;  4J9H A;  2AZV A;  1R77 A;  2KRS A;  3CBP A;  4BD3 A;  1VQK Q;  4OGC A;  2PVD B;  2X9H A;  3CCS Q;  2HNI A;  4C5I A;  4OB1 B;  3TRE A;  2RI2 A;  3RKW A;  4FT4 A;  1Y07 A;  1QCO A;  1UHF A;  1AWX A;  2O9S A;  4JLG A;  3CMA T;  1WJS A;  2C0T A;  3ER0 A;  2BE9 B;  3OYC A;  4BDY A;  1UDL A;  1IRE B;  1ZUY A;  3KFV A;  2P84 A;  1PHT A;  1YCY A;  5KYY B;  2RHU A;  1WQ7 A;  1NJI U;  4M7A F;  2HKN A;  2QGF B;  2CP3 A;  5FWB A;  1JXO A;  2KXD A;  2GQI A;  3NMZ C;  1X01 A;  3MET A;  2JUF A;  1O9S A;  2NUT A;  3VRZ A;  3UA6 A;  1RAH B;  4M7D F;  2D0Q B;  4PL6 A;  4AFQ C;  2OAU A;  4OGE A;  2ECZ A;  1K73 U;  4HCB A;  1NBE B;  3EFS A;  2D6F A;  4BI8 B;  2QQB A;  1K8A U;  2DXT A;  2WSF E;  3DB4 A;  4RTU A;  4RKU E;  1G83 A;  3NTI A;  1I81 A;  2DBM A;  2DO3 A;  5HY6 A;  3X25 B;  1VYT A;  1Q95 G;  3OBY A;  5LJ3 g;  4N0A C;  2E5K A;  3FJP A;  3A8L B;  3VS4 A;  1F1B B;  1U8R A;  2JZ2 A;  5EG2 A;  3CBM A;  1KHI A;  4OB3 B;  2QQA A;  4E7H A;  2LVM A;  2P0K A;  2GQV A;  2CP5 A;  4KH0 B;  2DE0 X;  4ZNX A;  2MIO A;  2MI6 A;  1TH7 A;  2EGA A;  2QQR A;  3FIF A;  1OZ2 A;  3ME9 A;  1K1Z A;  3S3N A;  3OMG A;  2CS7 A;  2W10 A;  1RAI B;  3VS0 A;  2H3E B;  2P4T A;  1UGS B;  4PK4 A;  3NHN A;  5GAM h;  4PFZ A;  1ZLM A;  4XU0 A;  2YRD A;  4IKF A;  1HD3 A;  2A36 A;  3CQT A;  5FRM A;  4OB2 B;  2EBP A;  3OA6 A;  1YN8 A;  1YJN T;  2NWM A;  2FL7 A;  5M9O A;  2L3S A;  4X9C A;  4MDW A;  1E6G A;  3OS1 A;  4PJM A;  4XTY A;  3CEY A;  1QW1 A;  1GBR A;  2Y4Y A;  4N4G A;  1Z9Z A;  1NZ9 A;  4M77 C;  4L5G A;  3OSV A;  2K79 A;  1MV0 B;  1YIJ Q;  2YRC A;  4FIB A;  4DBF A;  5IN1 A;  2E6Z A;  3QHS A;  4PJL A;  1MHN A;  1ZUU A;  4XAX B;  2QTX A;  4QQG A;  1PRM C;  2HQH A;  1M27 C;  2CP0 A;  3PT9 A;  4AMC A;  3OYJ A;  4D6W A;  3A8H B;  1GCP A;  4OMF B;  2QI2 A;  3OQ5 A;  3H6Z A;  3THK A;  2V26 A;  1M1F A;  2CZ7 B;  3EFO B;  2DA9 A;  4J9C A;  1FX7 A;  1PSE A; 
#chains in the Genus database with same CATH homology
 2DMO A;  2H8H A;  4Y92 A;  1MV3 A;  4AFZ C;  2FPE A;  2EKH A;  1OV3 A;  1W6X A;  2YSQ A;  2DRM A;  2F2X A;  2OI3 A;  4K11 A;  5GJV B;  2IIM A;  1KIK A;  4QT7 A;  1FMK A;  1B07 A;  4AFU C;  1QLY A;  1RLP C;  2YUP A;  4OMM A;  2JW4 A;  4HXJ A;  4HVV A;  3NPF A;  1UJ0 A;  2ED1 A;  2KNB B;  2RQU A;  2LCS A;  1PWT A;  2RNA A;  2MCN A;  2LJ1 A;  1YNZ A;  1AWO A;  2EYY A;  4LUD A;  2L0A A;  2ED0 A;  1WA7 A;  2D0N A;  1OOT A;  1S1N A;  1VA7 A;  3PE0 A;  2YUN A;  3NGP A;  2LQW A;  3RBB B;  2J6O A;  4LNP A;  3TVT A;  4IIO A;  2EGE A;  1AD5 A;  2K6D A;  3QWY A;  4AG2 C;  5EC7 A;  1T3L A;  3VS5 A;  2J05 A;  2CH4 A;  1E6H A;  2VVK A;  1SRL A;  1U3O A;  1UTI A;  2CUD A;  1KFZ A;  2V1R A;  2HDA A;  3H0F A;  2L2P A;  4JZ4 A;  4AFS C;  2EQI A;  1H3H A;  2V1Q A;  3VRY A;  1UG1 A;  4R0K A;  2DM1 A;  1NYF A;  4J9I A;  2K9G A;  4HVU A;  2GNC A;  2O9V A;  2CSQ A;  2F2V A;  2KRN A;  2GTJ A;  4WCI A;  2HCK A;  2C0O A;  1QWF A;  2D1X A;  2LX7 A;  3JV3 A;  2D8J A;  2NUZ A;  1WFW A;  1Y57 A;  2LMJ A;  2DL4 A;  2LQN A;  2KT8 A;  2JMA A;  3M0T A;  4DEY A;  2JM9 A;  2J6F A;  2LJ0 A;  2DL7 A;  3U23 A;  2CT4 A;  2X3W D;  5FWC A;  5I22 A;  2QDL A;  4JPB W;  1SEM A;  3VS3 A;  2GBQ A;  3EG0 A;  4DEX A;  2JXB A;  1UUE A;  2PTK A;  1NLP C;  1U5S A;  3I5S A;  2LJ3 A;  2ABL A;  3H41 A;  4LUE A;  4Z8A A;  1HSQ A;  3TSZ A;  2DL8 A;  4JJB A;  2A37 A;  1QKX A;  2C0I A;  1GFD A;  3M0S A;  1YWO A;  4A63 B;  1UFF A;  3LH5 A;  3SHW A;  1JEG A;  3GBQ A;  1B3Q A;  1K0S A;  4F16 A;  4KRT A;  1I1J A;  2L3Q A;  5IXB A;  1KSW A;  2LP5 A;  1GCQ A;  2D8H A;  1AWJ A;  3TSW A;  1CKA A;  1M3C A;  3ULR B;  1CSK A;  4AG1 C;  1ZX6 A;  2DLP A;  1BB9 A;  1RLQ C;  4J9F A;  4F17 A;  1LCK A;  1SRM A;  3EGU A;  1FYN A;  3I9Q A;  3RNJ A;  2CRE A;  1PNJ A;  2DVJ A;  1TG0 A;  1VYU A;  1XOV A;  2L3P A;  2J7I A;  1BK2 A;  2FPF A;  1HJD A;  1WXU A;  1RUW A;  4E6R A;  2K3B A;  3ZL7 C;  1H8K A;  4OMO A;  2W0Z A;  3REB B;  1UGV A;  2YDL A;  1AVZ C;  2ROT A;  3H0H A;  2MOX A;  4RUG A;  2KEA A;  2EYZ A;  3I5R A;  1NLO C;  5HCK A;  2KE9 A;  1G2B A;  1PKT A;  2VWF A;  4OMN A;  1K9A A;  2F2W A;  2DJQ A;  2RF0 A;  4J9E A;  1T0H A;  1BU1 A;  2KR3 A;  2PNI A;  2O31 A;  4IIM A;  1IO6 A;  1M3B A;  2OAW A;  3M0P A;  4Z88 A;  1M8M A;  4RTT A;  2A08 A;  4JJD A;  1GRI A;  2DIL A;  2RQR A;  2KYM A;  2P4R A;  1UHC A;  1YWP A;  2RQT A;  4JZ3 A;  4CC2 A;  2DBK A;  2SEM A;  2DRK A;  2CH4 W;  2G6F X;  2JS0 A;  1JQQ A;  1GCQ C;  4RTY A;  2FEI A;  1ABQ A;  1X2Q A;  1X43 A;  4RTZ A;  4RTX A;  2CT3 A;  2KXC A;  2CSI A;  5IHN A;  2HSP A;  2DL5 A;  1N5Z A;  1TUD A;  2J06 A;  2ROL A;  1JXM A;  2JS2 A;  5I11 A;  1UEC A;  2SRC A;  4LN2 A;  1NEG A;  2X3X D;  1UE9 A;  1MUZ A;  1J3T A;  2VKN A;  2ENM A;  1ZUK A;  2LNH B;  2EW3 A;  4CC7 A;  2K2M A;  3EHR A;  1VYV A;  1X27 A;  2KGT A;  1RI9 A;  1I07 A;  2I0N A;  2AZS A;  1NYG A;  4J9D A;  1AWW A;  4HVW A;  2EVR A;  1T3S A;  2FO0 A;  3EG1 A;  2BTT A;  1ARK A;  1NG2 A;  1EFN A;  2DX1 A;  2FG0 A;  1A0N B;  1YCS B;  4OMP A;  1GBQ A;  1WXB A;  1GL5 A;  5FW9 A;  4J9H A;  2AZV A;  1JO8 A;  2KRS A;  2CDT A;  1M30 A;  2A28 A;  1Y0M A;  1AZG B;  1UJY A;  1WDX A;  4JJC A;  3M0R A;  3UA7 A;  1UHF A;  1AWX A;  1ZBJ A;  2JT4 A;  2O9S A;  1Z9Q A;  2O88 A;  4ESR A;  2C0T A;  2DYB A;  3UF4 A;  4X1V A;  1QWE A;  2YT6 A;  1UDL A;  1ZUY A;  2PZ1 A;  2AKL A;  1H92 A;  3KFV A;  1QCF A;  1PHT A;  5IXF A;  2AKK A;  2DNU A;  4ORZ A;  2EYX A;  2HBW A;  1KJW A;  1JXO A;  5FWB A;  2KXD A;  2GQI A;  3NMZ C;  2AK5 A;  2DL3 A;  1ABO A;  3VRZ A;  3IQL A;  5GJW B;  3UA6 A;  2KYB A;  2RQW A;  5IH2 A;  4AFQ C;  4F14 A;  1K4U S;  4D8D A;  1WI7 A;  2ECZ A;  2M0Y A;  1E7O A;  1WLP B;  4CC4 B;  1AEY A;  4RTV A;  1T0J A;  3VS2 A;  4RTU A;  1G83 A;  4D8K A;  1OPL A;  1K76 A;  2DBM A;  3QWX X;  2LZ6 B;  4OML A;  2J6K A;  1BBZ A;  3A98 A;  2B86 A;  1SPK A;  1SHG A;  1WIE A;  3O5Z A;  1VYT A;  1I0C A;  2E5K A;  4Z89 A;  2M51 A;  2RQV A;  5IHK A;  2EPD A;  3VS4 A;  4M4Z A;  1V1C A;  3VS6 A;  1TUC A;  2K7A A;  3M0U A;  3C0C A;  2RN8 A;  2EGC A;  3EG3 A;  3H0I A;  1ZSG A;  4FSS A;  1WXT A;  2ESW A;  2RPN A;  1K0X A;  1YP5 A;  2DE0 X;  4ZNX A;  3SEM A;  2MIO A;  4CC3 A;  1SHF A;  3EHQ A;  2EGA A;  5ECA A;  1SSH A;  2JMC A;  2YUO A;  1K1Z A;  2OJ2 A;  2BZX A;  2GTO A;  2W10 A;  3I35 A;  2O2O A;  3VS7 A;  2JM8 A;  3VS0 A;  2XMF A;  2FPD A;  3NHN A;  3VS1 A;  1PKS A;  1AOJ A;  4RTW A;  1NM7 A;  1ZLM A;  2KT1 A;  1HD3 A;  2A36 A;  3CQT A;  2DF6 A;  5L23 A;  2EBP A;  1X69 A;  1YN8 A;  4GLM A;  2NWM A;  3UAT A;  2JTE A;  1X6B A;  3M0Q A;  1QKW A;  2L3S A;  1E6G A;  1X6G A;  3REA B;  2GGR A;  4LE9 A;  1W70 A;  4J9B A;  1GBR A;  1Z9Z A;  1CKB A;  1NEB A;  4EIK A;  1W1F A;  2K79 A;  1M3A A;  2CUB A;  1MV0 B;  3PVL A;  2RMO A;  3FJ5 A;  1AZE A;  1ZUU A;  2BZY A;  2EYW A;  1PRM C;  4OMQ A;  2HEQ A;  1M27 C;  2KBT A;  3PVQ A;  5IHI A;  1WX6 A;  1WYX A;  2BZ8 A;  1OPK A;  2KRM A;  1GFC A;  4J9G A;  1JU5 C;  1GCP A;  2FRY A;  3R6N A;  2YUQ A;  1PRL C;  3THK A;  4HCK A;  3EG2 A;  2FRW A;  1X2K A;  1U06 A;  2KRO A;  4GBQ A;  2DA9 A;  4J9C A;  1OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...