1I07A

Eps8 sh3 domain intertwined dimer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i07A00
1SHFA 2ROTA 1NG2A 3M0UA 2D8JA 3I35A 2JM8A 5IXFA 2BTTA 1VYTA 1S1NA 1UJYA 4E6RA 2FPFA 2CREA 2HEQA 3O5ZA 1ABOA 5FWCA 2CUDA 1PHTA 1H8KA 3TSWA 1H92A 2LNHB 2KR3A 1I07A 1PKTA 2F2WA 4AG1C 1TUDA 2JMCA 4JZ3A 2EW3A 1YWPA 1LCKA 2RQUA 2EYXA 1E6GA 2F2VA 1M3AA 1U3OA 1JXOA 2JMAA 4X1VA 2B86A 2YUNA 2MOXA 2HDAA 4J9GA 4AFQC 3H0IA 4RTWA 4OMMA 2V1QA 1X2KA 2EBPA 3TVTA 1GL5A 2HBWA 4J9IA 4AFSC 3VS5A 4RTVA 2JM9A 1FYNA 2FO0A 4HXJA 2BZYA 3QWXX 1UHFA 1WYXA 2L3SA 3REBB 1BBZA 4J9DA 1AZEA 4HVVA 3VS2A 4OMLA 1NEBA 3I5SA 2FRYA 1V1CA 2RNAA 1PKSA 1M3BA 2W10A 1AWWA 2KRSA 2KYMA 2YUQA 2FPDA 2EQIA 4IIMA 2DBKA 4RTXA 4IIOA 3THKA 3I5RA 1N5ZA 4CC7A 2I0NA 2ABLA 1WFWA 2DF6A 2YDLA 1X6GA 2HCKA 4RTUA 4HCKA 4OMNA 2BZ8A 2CSQA 2X3WD 1IO6A 3RBBB 2K7AA 1X2QA 2DX1A 2LQWA 2DJQA 1ABQA 5HCKA 1K9AA 1X6BA 4HVWA 2EVRA 4RTZA 3VS7A 1VYVA 1GCPA 1SSHA 2EGCA 2DL4A 2JTEA 1GRIA 2LX7A 2FPEA 2LP5A 2J6FA 4CC3A 2YUOA 1UFFA 2L3PA 2VWFA 3TSZA 2J6OA 1AEYA 5GJVB 1TG0A 2RF0A 3REAB 4CC4B 1I0CA 2K9GA 3EG1A 2A28A 2KROA 1OPLA 3IQLA 2K6DA 3ZL7C 3U23A 5I11A 1UUEA 2LZ6B 5I22A 2GNCA 2CSIA 2KGTA 4F14A 1K0SA 4GLMA 1WLPB 2E5KA 4J9FA 3ULRB 4Z89A 4ORZA 3QWYA 1CKAA 2DL7A 1YN8A 4JJDA 3VS4A 1WX6A 1UGVA 3UA7A 2O2OA 1JQQA 1MV0B 1SRMA 3PE0A 1UE9A 3PVLA 4F17A 2CUBA 3JV3A 2JT4A 1KJWA 2ECZA 2MIOA 3UF4A 1NM7A 2K2MA 4RTYA 2AKLA 1JEGA 1T3LA 4EIKA 5IH2A 3UA6A 5IHKA 2RPNA 1QCFA 1T0JA 2FRWA 4RTTA 4K11A 2C0OA 4GBQA 5FW9A 1QWEA 3M0RA 1B3QA 2SEMA 3VS0A 1J3TA 1ZUUA 1QKWA 2GGRA 1SEMA 2RQVA 3SEMA 1BB9A 2C0IA 2EGAA 1OV3A 1GBRA 2C0TA 2DL5A 3FJ5A 2ED0A 3VS3A 1E7OA 3RNJA 1M8MA 2ESWA 3GBQA 2O9VA 4LN2A 2KBTA 2L3QA 4J9HA 4JJCA 1TUCA 2CT3A 3NHNA 1WDXA 2OI3A 5IHIA 1JU5C 4DEXA 4DEYA 2X3XD 5GJWB 2CH4W 2AK5A 4CC2A 2DNUA 2L2PA 3M0QA 2DMOA 2VVKA 2JS0A 1VYUA 1UHCA 1UTIA 2HSPA 1X43A 1Z9QA 3EHRA 2LMJA 1OPKA 4J9BA 2OJ2A 1WXUA 2YT6A 2AZSA 1B07A 2J06A 2KXCA 5IXBA 2CH4A 1KSWA 2JS2A 1M27C 2J6KA 3EG2A 3EG3A 2RMOA 2QDLA 2ED1A 2EPDA 1H3HA 2ENMA 4QT7A 1SRLA 2DL3A 1NYFA 1BK2A 3VS1A 1JO8A 2AZVA 2GTOA 2RQRA 1WXTA 1UG1A 2K79A 1RI9A 2RQTA 2SRCA 2KT1A 1AVZC 4OMPA 4LUDA 3EHQA 2LCSA 2DE0X 1ZSGA 1UDLA 4R0KA 4J9CA 1WIEA 2XMFA 1W6XA 1Y0MA 1HJDA 1U5SA 1G2BA 1E6HA 4AG2C 2FG0A 4LNPA 2AKKA 2ROLA 1Z9ZA 2KXDA 1YNZA 1A0NB 3H41A 4LE9A 2DM1A 2NUZA 1K4US 1W70A 2LJ0A 1RLQC 4JZ4A 4OMOA 1HD3A 4JJBA 1UECA 1MV3A 3VRYA 1PNJA 4WCIA 1NLOC 4D8KA 2J05A 4ZNXA 1ARKA 1PRLC 2KRNA 2PZ1A 1PWTA 1T0HA 1NLPC 2P4RA 1OEBA 2M51A 1CSKA 1ZUYA 4F16A 2O31A 1Y57A 1ZX6A 2LQNA 1AZGB 3H0HA 3KFVA 1KIKA 2DL8A 2W0ZA 1GBQA 2D0NA 2O88A 3M0TA 4AFUC 3NPFA 3PVQA 1GFCA 1KFZA 2MCNA 3LH5A 2V1RA 3EG0A 2RN8A 2KE9A 1EFNA 4Z8AA 2DBMA 1UJ0A 2G6FX 1BU1A 1NYGA 2FEIA 2M0YA 4A63B 1QLYA 1JXMA 3NMZC 4Y92A 4M4ZA 3M0PA 1YP5A 2KT8A 4D8DA 2CDTA 1MUZA 3I9QA 2J7IA 2DVJA 2A08A 1M30A 2VKNA 2YUPA 3UATA 4OMQA 1G83A 4FSSA 4KRTA 2PNIA 3EGUA 1XOVA 2RQWA 1PRMC 2EKHA 3SHWA 3NGPA 2L0AA 5ECAA 1HSQA 1I1JA 1AWOA 5EC7A 2GQIA 2DA9A 2A36A 3VS6A 1U06A 4JPBW 3A98A 3VRZA 2JW4A 2K3BA 2KNBB 3H0FA 2EGEA 5L23A 1M3CA 4AFZC 1T3SA 1YCSB 1SPKA 1GFDA 5FWBA 1VA7A 1AD5A 2IIMA 2YSQA 2JXBA 1SHGA 1RLPC 1ZBJA 4RUGA 1QWFA 1NEGA 5IHNA 1W1FA 2NWMA 2DILA 2H8HA 1X27A 1WA7A 3CQTA 2DYBA 3R6NA 2A37A 2D8HA 3C0CA 2OAWA 1WXBA 2EYYA 1GCQC 4Z88A 2PTKA 2D1XA 1FMKA 2CT4A 2BZXA 4ESRA 1WI7A 1ZLMA 2KRMA 4LUEA 4HVUA 2O9SA 2DLPA 2F2XA 3M0SA 2KEAA 4J9EA 1K1ZA 2GBQA 2EYWA 2LJ3A 2DRKA 1YWOA 1K0XA 1ZUKA 2EYZA 1K76A 1X69A 1RUWA 2DRMA 1AWJA 1CKBA 1OOTA 1QKXA 1AOJA 1GCQA 2LJ1A 2KYBA 1AWXA 2GTJA
chains in the Genus database with same CATH superfamily
4C0FA 1SHFA 1H641 4FU6A 3BDLA 2JZ2A 1WHLA 3QZ5B 1QVGS 2D8JA 1MMGA 4ANJA 2BTTA 1VQLT 3CC4T 3CCSQ 1ABOA 3FLGA 1PHTA 3TSWA 2IPOB 2LNHB 2HZYA 3MP1A 3A8LB 3PMIA 1TUDA 1Y7XA 2V26A 1OX8A 3JB9I 2EW3A 1LCKA 1RACB 5J26A 2V8JA 4BE1A 1YBYA 2P4TA 1JXOA 4X1VA 5LJ5f 2QEXT 1ZA1B 2YUNA 5I21A 1FXXA 4M7AB 3HKSA 2NUPB 2V1QA 2EBPA 2BUDA 3S3NA 4AFSC 4IURA 3VS5A 4XU1A 2X9HA 2VGNA 2LCLA 1M1FA 2FO0A 1ZBXA 3QWXX 2L3SA 1BBZA 1WGSA 4J9DA 4M78A 4E2FB 3I5SA 1KD1U 3OS1A 2RA2A 1Q81C 2OTJT 2K5IA 1V1CA 3OS5A 1PKSA 2W10A 1AWWA 1NJIR 2Z0WA 5GAN8 1UB4A 4DQ2A 4RTXA 2KK4A 5KYXB 2MWOA 4IIOA 3THKA 3RUXA 5GMKi 3I5RA 5DY9A 2DAQA 2K57A 5FU7B 2ABLA 2DF6A 3UPUA 2BZ8A 1YJNQ 2CSQA 2HD0A 1Q7YU 2WSFE 2AIRB 2DTOA 1IO6A 2E1HA 3H8ZA 2LQWA 1VQ8T 1K9AA 5GANf 5KH6A 1NPPA 2RHYA 2EVRA 1OYXA 2RI5A 5LJ5g 1GCPA 1Q81R 2DL4A 2JTEA 1GRIA 2G3RA 2LX7A 5KE3A 4J7IA 5GAN7 1VQ9A 3TSZA 4M78E 4C5HA 1NBEB 2K9GA 4EMKB 4M75A 2E65A 4J6YA 3G4ST 2X4JA 2FL7A 4C8QB 1WHJA 8ATCB 3OYBA 4KGVB 2RHZA 1UUEA 2CZ1B 2LZ6B 2KGTA 1OX9A 5J3BA 4J9FA 4Z89A 2LX9A 2XKOC 1TTHB 3RKXA 1MV0B 1YITA 1C6VX 2BE7D 3CCST 1UE9A 3HSBA 4F17A 3BW1A 3M54A 4XQ3A 5I2MA 5CCAA 1KJWA 2H3EB 2AHJB 5IT9E 5IH2A 5KYUB 4M77A 2DIQA 1QCFA 4F7UB 2C0OA 4ELZC 4DA4A 4IUTA 3VUZA 3M0RA 3CD6Q 1NZ9A 3PNWC 1VQ5A 2DD4A 3VS0A 5GANg 3ER0A 2M9UA 1ZUUA 6AT1B 2YHTA 2DFUA 2DIGA 3DB3A 1KC8C 4M75E 3DLLA 3G6EQ 1OU8A 2F5KA 2ZPIB 3VS3A 4J7FA 1M8MA 2ESWA 1VQ4Q 2KBTA 5D6YA 1LPLA 4RCBA 2CT3A 5IHIA 1ZSZB 4DEXA 4DEYA 2X3XD 4RG8A 1JRIA 2DNUA 2JNGA 3VU3C 1YCYA 4LDWA 2HSPA 1VIFA 3TQ7P 2HSEB 5KCHA 1YJNT 2LMJA 1OPKA 4J9BA 3URGA 3QPHA 4M77E 2OJ2A 1WXUA 3X24B 2YT6A 2AZSA 3CCJQ 5GAOp 2J06A 5IXBA 1IZ6A 2JS2A 3G7ZA 3JCMh 3MEWA 1N27A 4II1A 3OYLA 1IREB 1KC8R 1M90R 2QDLA 4FIBA 2RK1A 1NE8A 2ENMA 1SF9A 4PJNA 1GXIE 3PIPA 1JO8A 3HRTA 2DEUA 2GTOA 3CCEQ 2EJGA 1R8OB 3NTIA 2RQTA 1BI2A 3JB9J 4LUDA 2DE0X 1UDLA 1WPYA 4R0KA 1XNIA 1YJ9Q 3CCQA 1KHCA 4JJNK 4XU0A 4N4IA 4XAXB 2MI6A 2HL5C 5FU7C 4LE9A 2RJDA 2NUZA 3WVEB 1K4US 1RLQC 4QQGA 3MKDA 4F7UF 4OMOA 4M7DA 3PFSA 1MV3A 1PNJA 5GAMg 5GAN6 3OYKA 1NLOC 3HHTB 2H3JA 5DLQE 1N9SA 3Q1JA 2EKOA 5LL6S 5DM7R 2KRNA 2PZ1A 1PWTA 1T0HA 1NLPC 1OEBA 2MK5A 4PNOA 2CGHA 3CD6T 1RABB 1Q7YC 3ZEHA 2D0NA 3M0TA 3PVQA 2LT1A 2V1RA 3L2WA 2RN8A 3O8VA 1EFNA 1KK7A 4M77G 4Z8AA 2DBMA 1VQMA 4OGEA 2FEIA 2M0YA 3I55Q 4Y92A 4MZPA 1YP5A 4A4KA 1MUZA 2BE9B 1VQ4T 1M30A 2VKNA 2YUPA 3OMCA 3CCVQ 4OMQA 3FC3A 2NLUA 1PRMC 1JJ2S 3MEVA 3NGPA 3OYEA 1QVFA 3C12A 4OMFB 4PJOB 4JRIA 2GQIA 3CXCA 5A0DA 3A98A 3OW2P 5KYNA 2K3BA 2K3YA 3H0FA 2EAYA 3HL8A 3VV0A 1VQPQ 2JVVA 5GAOr 3C95A 1LJOA 4CI0C 1QMCA 2DTHA 4P5NA 5IHNA 5LJ5e 2E10A 1WJRA 1QCNA 3CCLQ 2P0PA 4J6WA 4HT9A 1YI2Q 1PSFA 1Q86R 4M7AD 2QQ9A 4Z88A 5LJ5d 1YJ9T 1ZSZC 4LUEA 1QVFS 4HVUA 4PLLA 2KEAA 2NUTB 2D0QB 3QYHB 1I81A 1K0XA 1G3SA 2VASA 1RUWA 2DRMA 3NTHA 4A4EA 3EFOB 2CP0A 4FT4A 1GCQA 2LJ1A 2QA4A 1H3ZA 3BDUA 1TU0B 5CO7A 2DPPB 4A53A 1Q82U 1KQSP 3T9NA 2JTFA 1VYTA 3KBGA 1UJYA 1P92A 4C5IA 2HEQA 3O5ZA 4MDXA 2CUDA 4M7DG 2Y90A 4BDZA 4DOWA 2ZPHB 2JMCA 3SD4A 2IG0A 4JS4A 1VQ6A 3CEYA 1YWPA 2RQUA 2QASA 3UWNA 5A0GA 2QDYB 2OAUA 3I55T 1VQ7A 3JCMb 2QG9B 5GANd 2B86A 3MO8A 2YRCA 1VQKT 2E6NA 1MNEA 4J9IA 3CCVT 4HXJA 2BZYA 4C8QD 3S3OA 5GMKj 1UHFA 1WYXA 1AZEA 2C06A 4Z02A 3VS2A 4J5YA 1WNLA 3AHUA 1G8XA 5CKEA 4BI3A 4C0ZA 5GAMh 4BB7A 2KY9A 3M4GA 1M3BA 3G1JA 5LJ3h 3QZ9B 4NOYA 1VQPT 2R5AA 5LJ5j 2QAZA 3RKYA 2I0NA 3RKWA 1WFWA 2X4WA 2YDLA 1X6GA 4RTUA 2YXYA 4HCKA 2VUBA 2X3WD 3JCMf 3CCLT 3JAME 2HAXA 4C92D 1Y71A 4FYVB 3RBBB 1YI2T 1PC0A 1X2QA 4N0AC 5KYWA 3SWNB 2O01E 1V76A 2O4XA 2RO0A 4PJLA 2CP2A 3LGLA 4HVWA 5GAOm 1AT1B 1OULA 4IUQA 1SSHA 2EGCA 3VYHB 3QDFA 4B6MA 3FRNA 2MYSA 1RAGB 3M59A 1FMWA 5GAN2 3G71A 1TG0A 5FROA 1UGQB 3OYYA 4IUVA 1EIFA 2A28A 4LDUA 3SDZA 3G4SQ 4E7LA 5GAN3 3L2UA 2K6DA 5GAMe 3P8DA 4YTLA 1M1KC 3S3MA 3CC4A 3FB9A 3R6OA 1VQOA 1CKAA 3A8HB 4JJDA 4FYXB 1UGVA 5GANj 2E3HA 3PVLA 2GFUA 2WACA 3TEEA 2JT4A 3LGFA 2MIOA 3EGXB 2JN0A 3LX7A 3DKMA 2EJ9A 2QEXA 2E41A 3QG1A 3JCMg 3OYFA 3NFCA 2EQKA 1T0JA 2FRWA 1BCOA 4K11A 1O9SA 5FW9A 1QWEA 2OTLQ 1B3QA 4XTYA 1Y96A 1WQ7A 1Q95G 3EAEA 1K8AU 2E64A 3EFSA 2RQVA 2Y4XA 2EGAA 2YRVA 1M1KR 2LDMA 1OU9A 1K9MU 2OTJA 1GBRA 8AT1B 4M7AE 5KYYA 3FJ5A 5FU6B 1QVGP 1BIBA 2ED0A 3PTAA 5GAN4 1E7OA 3RNJA 4D6WA 3GIBA 4LN2A 1UGPB 2L3QA 4C0DC 3ZBDA 4OB2B 3M57A 4OGCA 3QHSA 1JU5C 1ZQ1A 1WQWA 2CH4W 4CC2A 2YLCA 3SFMA 2VVKA 2JS0A 1KHIA 3QBYA 2XD0A 1Q82C 3P8BB 3OYHA 3CMEQ 2K5LA 1VQNQ 1VQ8A 1OI1A 3E9GA 2LTOA 5GAOq 4RG2A 2KXCA 3QUIA 1YFNA 4HCBA 3EG3A 2ED1A 2EPDA 5KYUA 4AMCA 3CC2Q 1MMNA 2DL3A 1KQ1A 1NYFA 4E47A 4F7UA 1ZA2B 4FW2A 4FSXA 1S72Q 4E7HA 1AVZC 1HK9A 2PVOB 4J9CA 1MMAA 1BIAA 3QXEB 2X35A 2XMFA 3INZA 5CVIA 3VJPA 2DETA 1HJDA 1U5SA 1E6HA 4AG2C 2GFAA 3OMGA 3M56A 2AKKA 3CCSA 1Z9ZA 2KXDA 1YNZA 4PFPA 1A0NB 3H41A 4PJOD 3JB9H 1W70A 2LJ0A 2YLBA 4C8QE 2LNVA 3A8MB 4RCCA 4M7AF 2QGFB 1KG1A 4BDYA 5D6XA 4ATOA 1ZSZA 3ZFJA 5C0MA 4F04B 5HK0A 1VOMA 3CBOA 4MZMA 2ZCFB 5GAOl 3GNGA 2M51A 4E7JA 4C92B 2OTLT 2FHDA 2F69A 4F16A 2XHCA 2M0OA 1IXDA 2LQNA 1AZGB 3AT1B 3OYMA 3H0HA 3KFVA 1NPRA 1YITT 4V2SA 4F7UE 2PVDB 4AFUC 3NPFA 3JCMc 3M58A 3QYGB 2FYKA 2G6FX 2AT1B 2MMPA 1QLYA 3OB9A 4M4ZA 4C5EA 5KE2A 4MZTA 3I9QA 1UEBA 2WSCE 2J7IA 3EG9A 2DVJA 2A08A 3EGDB 3OYNA 4ZN1A 4FSSA 5A2QE 2A7YA 4VUBA 2JOYA 3P8HA 4KH1B 2ATCB 2DZ9A 1D3BA 2RQWA 4LD9K 3CCRQ 2COYA 3OSSC 1YJNA 5GAMf 2GCXA 1AWOA 5EC7A 5LJ3f 3HPWA 3RESA 2A36A 4M78G 4HT8A 3NTKA 1U06A 2V8IA 3HRSA 3E9FA 4DBFA 3CMET 1VQNT 2I2LA 2KNBB 2XK0A 1B7TA 2DXTA 3SB2A 3BE3A 3ASKA 2A3LA 1T3SA 4M7AC 1VA7A 2YSQA 4M77B 4C8QF 1SHGA 3LH0A 4LDYA 1RLPC 1HYOA 4QVCA 2EJFA 4RUGA 1QWFA 1SSFA 2DD5A 2DILA 4DBRA 3OBWA 3CC2T 1K73U 2COWA 3HFNA 2BIVA 3L2QA 3R6NA 2A37A 1S72T 3CC7A 3C0CA 2OAWA 1WXBA 2EYYA 2DVEA 1YIJQ 3V7RA 3OYJA 2D1XA 1FMKA 2RK2A 3LLRA 1PCXA 2F2XA 1K9MC 2FZKB 2LJ3A 1VUBA 3OW2A 2KDSA 2XDPA 4C92F 1KD1C 4N0AA 2QK0A 4WF2A 1OOTA 1X01A 2MWPA 2HKNA 5CKFA 2KYBA 1AWXA 4M75G 5LJ3g 1TOVA 3M0UA 3CD6A 1R0CB 2E3IA 4XTWA 4XU3A 4KGZB 3JCMe 2Y4YA 5CKDA 1S1NA 4BE0A 4E6RA 1N8RU 2FPFA 2CREA 3TCJA 5FWCA 4XU2A 1H8KA 2KR3A 1PKTA 4EMKC 3JCMd 2F2WA 4KT0E 1K9MR 3G6EA 4JS5A 4BI4A 1OZ2A 4C8QC 4JZ3A 5CR2A 2MF2A 2EYXA 2F2VA 3ME9A 1VQ4A 1M3AA 1KD1R 2QYZA 2R58A 1OQKA 3FJPA 2K2VA 4AFQC 3H0IA 4RTWA 3HFOA 3CPWA 1VQKQ 5C6SA 4OMMA 1X2KA 3TVTA 1GL5A 3FEOA 1M5Q1 4J83A 1M2VA 4Q5WA 4RTVA 2JM9A 3OA6A 5HKCA 2LVMA 3CCRT 2VGMA 1WJQA 1FMVA 4WTOB 3CCJA 1W4SA 3QJYA 4LD6A 2QQRA 1Q7YR 1VQMT 4M7DB 4C92C 2RNAA 1WHGA 1XTDA 2QGGA 3CCMQ 2KYMA 1YJWQ 3H9NA 2EQIA 4IIMA 2DBKA 4ZTFA 4IUPA 3V8JA 7AT1B 1N5ZA 2X4YA 3CCEA 1RI0A 4RMOA 4CC7A 3CPFA 3I56Q 2KQWA 1I8FA 2HCKA 2RHUA 3KUFA 4OP0A 3RDVA 1B34A 1YJ9A 3CPWS 2K7AA 1NJIU 3PT9A 2PQWA 3GLXA 4A4HA 1XQHA 1ABQA 5HCKA 1YIJT 2JJ9A 1X6BA 4DBQA 3VS7A 1JJ2P 1VYVA 2WSEE 3OYGA 1Y07A 2LP5A 4O6JA 1IGQA 2J6FA 4CC3A 3CXCS 2OX7A 2YUOA 4HCCA 1UFFA 2VWFA 4GLKA 2HQXA 1U1TA 2J6OA 5GJVB 3CCUQ 1AEYA 4IKFA 4JLGA 2E12A 4CC4B 1MNDA 2DJZA 2KMTA 2KROA 4O5VA 1OPLA 4TVRA 1W2BA 3CMAQ 3WXMB 3ZL7C 3U23A 4R56A 4KUIA 5I22A 1WHMA 2GNCA 1Q81U 4F14A 1WLPB 2E5KA 4PFZA 3ULRB 3QWYA 2DL7A 4X9DA 4OB0B 1JQQA 4IUUA 3PE0A 3OSVA 3TREA 1ZHIA 3JV3A 4XTZA 4ELYC 2K2MA 1I5OB 5IAYA 4OVAA 2AKLA 2PUKB 3EH2A 3I55A 5CAIA 1QVFP 3UA6A 3L1AA 1XJWB 1D1CA 4PJOF 4QKUA 1PG5B 1K73C 3CCVA 1TWBA 1C1AA 1BCMA 3HP9A 2QQBA 3JB9G 2CP7A 2GGRA 3L42A 3SEMA 1W2BS 1UGSB 2XU8A 4X34A 2COZA 4M78D 1VQPA 2K4YA 3GBQA 2O9VA 3JCMX 3H6ZA 3L2RA 3CCMT 4J9HA 1YJWT 1TUCA 1YHQA 3NHNA 1WDXA 2FB7A 3RERA 5GJWB 3CCLA 3M0QA 2DMOA 3MP6A 1YI2A 1VYUA 1K73R 3QIIA 2LT4A 1UTIA 3I56T 2XDDA 3BY7A 1O75A 3RIRA 1IGUA 4A4GA 1B07A 1G3TA 1QQJA 5IN1A 3EG2A 4PLIA 2DO3A 2E5QA 3JCMQ 1JB0E 2GF7A 4JRKA 2AZVA 3RMQA 4PJOC 2D6FA 2RQRA 1WXTA 2VXFA 2K79A 2XG8D 4MMLA 3CCUT 4QQ6A 2KT1A 2KVQG 4OMPA 2KI7A 4M7AA 2NUPA 1D09B 2LCSA 4RKUE 4UC4A 3CMAT 1WIEA 2VV5A 1W6XA 1Y0MA 1M90U 1G2BA 4EDUA 5LJ3e 2FG0A 3QJ6A 4QVZA 4LNPA 3X25B 4R55A 1VQLA 2DM1A 2R5MA 5CQXA 4XK8E 4HA8A 5GAMd 1IB8A 4GY5A 3QO3A 5LJ3d 4WCIA 1VQ9Q 2FZGB 5CKHA 4OB1B 4KULA 3EFRA 5KYXA 4NS5A 2RI3A 1ARKA 3FIFA 3MHXA 4M77D 2K3XA 2RH2A 2P4RA 2ZGWA 2RI2A 2EFIA 1CSKA 2CYZB 5A0LA 2QTXA 5KYWB 2HNIA 5EG2A 2O31A 1VQOT 1RAHB 1Y57A 1QVPA 1ZX6A 2O4XB 1YITQ 1NJIC 2W0ZA 1FWZA 3JCMJ 4BI8B 2O88A 3VKIA 2RB6A 5D7UA 2MCNA 3EG0A 1PM3A 2M1HA 1NYGA 3GOXA 1JXMA 2ZPEB 3NMZC 1I5LA 2HQHA 4ZGEB 1QP3A 2KT8A 2HKQB 4KUDK 1LOJA 4KH0B 4B9WA 1G83A 4EMKA 1BI3A 1VQ5Q 3M4YA 3EGUA 3V8LA 1XOVA 1FX7A 4C8QA 3SHWA 1UGRB 1LVKA 2L0AA 5GAOn 5ECAA 4JRPA 1I1JA 3MPUB 2NYSA 3BFMA 5L8RE 3VRZA 1M2OA 2JW4A 3V8KA 2A0FB 2EGEA 4ZGDB 1M3CA 2VXEA 3RR6A 4AFZC 5L23A 1YCSB 2DXBA 3UT1A 2EQMA 1RAIB 3L2ZA 4CRIA 2IIMA 2JXBA 1G3WA 1NEGA 3TU4K 1W1FA 2NWMA 2H8HA 1BI0A 2L8DA 3GF5A 4AT1B 3VYGA 1X27A 1N9RA 1Y96B 5D6WA 4C92A 3G4SA 2DTIA 1RAAB 5GAMj 2D8HA 2GQVA 4QVDA 2CZ7B 5LJ3j 4JRQA 1GCQC 1TS9A 5CK9A 2M16A 3PIOA 2RJCA 2PTKA 4ESRA 2BZXA 2JUFA 3V7CA 1WI7A 5KYYB 1V29B 4M78B 2O9SA 2DLPA 3M0SA 1Q82R 4A4FA 1ZUKA 1D0XA 4XTUA 2EYZA 1K76A 1X69A 1Q86U 4M7DD 3MEUA 4FT2A 1M1GA 3EGDA 4M7AG 1VQ9T 2DKGA 2EQJA 2GTJA 4E7SA 3CC7Q 3SWNC 2ROTA 3V7SA 2OTLA 1NG2A 4ZGJB 3QKJA 1RL2A 3M9QA 5FLXE 3CCQQ 3I35A 2JM8A 2MPXC 2QXFA 5IXFA 1HXDA 4ME7A 2RHXA 3JB9D 1RAFB 2DEQA 3A8GB 3A5ZB 5CQYA 4NL2A 1RADB 1H92A 1IHWA 1R0BG 4PK4A 1I07A 2DYIA 2QI2A 1WHHA 2PUOB 4AG1C 4C92E 1SG5A 2LQ8A 3JCMP 2E6ZA 1EX4A 2PU9B 4FYWB 1E6GA 2KSSA 2ZPFB 3KXTA 1U3OA 2ZZDA 2VC8A 1G3YA 2JMAA 4HCZA 2MOXA 3M55A 2RHIA 2HDAA 4J9GA 3RMSA 5CKBA 1M8VA 4M75B 1TXQA 2HBWA 5GMKm 2XDBA 1FYNA 1VQ5T 4E7KA 2RD1A 3QSUA 3E1SA 3CMEA 3REBB 1VQNA 5KCOA 1QW1A 1M90C 4HVVA 3QDRB 3F70A 4OMLA 1NEBA 2FRYA 5J39A 4A54A 3GPLA 1PSEA 2HQEA 1VQMQ 3OS0A 4BACA 3CBMA 2BKDN 3OYCA 2KRSA 2YUQA 2FPDA 2RJEA 3M53A 3EH1A 3L2VA 1PD1A 3CC2A 3C94A 3X28B 3A1PA 3JSCA 4BY6B 3M5AA 2QQAA 4C8QG 1X6OA 4M78F 3META 1I4K1 5CIUA 3N5BB 1S72A 2EQUA 4J6XA 2F1LA 3S6WA 4OMNA 5FU6C 4L6V5 3FDRA 2DX1A 3X26B 2DJQA 3J80E 1K8AC 2YWWA 4RTZA 3OS2A 3D7SB 2ZAEA 2FPEA 4JUVA 1D0YA 2QTVA 2L3PA 1G5VA 2ZPBB 3LWHA 2QQSA 4F7UG 4C92G 1M4ZA 2L5QA 3EG9B 2RF0A 3LYIA 3JCMV 3REAB 3DLMA 1I0CA 2YRDA 3EG1A 4DBHA 3IQLA 1D3BB 3WVDB 5I11A 2CKKA 3CC7T 2HL3A 2CSIA 2DK3A 4C5GA 4PJOA 1K0SA 4GLMA 4ORZA 3CCQT 3VS4A 1YN8A 2HMAA 1WX6A 3UA7A 1D1AA 2O2OA 2P84A 1SRMA 1JBMA 1OZ3A 4PKCC 5GAN5 2EYQA 4ZN3A 2CUBA 1K8AR 4M75F 2ECZA 3UF4A 1NM7A 2EWNA 4BUGA 4RTYA 1JJ2A 4MDWA 3E19A 1JEGA 1T3LA 5GMKh 2E4HA 2CS7A 4EIKA 2XIDA 4N4GA 3LWIA 5IHKA 4EMHA 2QA4Q 1BKBA 2RPNA 4M78C 4RTTA 2XICA 2MAMA 4GBQA 3OW2S 5HK3A 2SEMA 1VIEA 1J3TA 1QKWA 3CCRA 1SEMA 4LDXA 1BB9A 2C0IA 1OV3A 5LJ5h 9ATCB 3DB4A 4HKEA 2C0TA 1KQSA 2DL5A 4M77F 3MEAA 2EIFA 5AYFA 3JCMW 2NUTA 3G6ET 2CP6A 4X9CA 1VQ6Q 1WJSA 4E7IA 1TH7A 3JRZA 5FRMA 2DXCA 3OYAA 1VQ7Q 4PJOE 3EFOA 4PFOA 1Q86C 4JJCA 4DOVA 2OI3A 1M1KU 1WHKA 2L89A 3MJXA 2AK5A 4M7DE 2L2PA 1PD0A 4FM4B 1UHCA 3OBYA 5GMKe 1LNXA 2CZ6B 1X43A 1Z9QA 3EHRA 2CP3A 2DZCA 4XTVA 1YIJA 3J81E 2FZCB 5FRNA 3CCJT 2F5TX 1TSFA 2CH4A 4E7ZA 1KSWA 4M75C 1IHVA 5GMKl 1RAEB 1M27C 2J6KA 4N4HA 1QP2A 2RMOA 1YHQQ 1H3HA 1KQSS 4QT7A 4FW1A 1SRLA 1BK2A 3VS1A 1QCOA 3CCET 5GANh 1UG1A 1RI9A 2SRCA 1M2VB 3EHQA 1IRXA 2DXUA 3VUBA 1ZSGA 4J8OA 4ZTJA 1AHJB 4EMGA 1KQ2A 3J7AF 2ROLA 4M77C 4BY6C 2R57A 1U1SA 4JZ4A 1MMDA 1BYMA 1HD3A 4JJBA 1UECA 2ZPGB 3CPWP 3VRYA 3G71Q 5I2SA 2P0KA 3E2UA 4Y91A 2PVGB 4D8KA 2J05A 3C4SA 4ZNXA 2KAFA 2LQKA 4BE2A 4BD3A 1PRLC 2RJFA 2FVUA 4OB3B 2QA4T 1VQKA 4QQDA 2L3RA 3OYIA 1ZUYA 4PJOG 2X4XA 1D0ZA 2VB6A 1VQLQ 3CC4Q 4C0DB 4JDSA 1B34B 3CXCP 1SKUB 1VQOQ 4M7DF 4C0GA 4PJMA 5GANe 2LC4A 1KIKA 3SWNA 1C0MA 2DL8A 4Y28E 1GBQA 4B9XA 1M9SA 1GFCA 1KFZA 3LH5A 4FCYA 2KE9A 1R77A 1UJ0A 4NL3A 4EPCA 1BU1A 4A63B 3HTRA 3CCMA 1YJWA 2QEXQ 3M0PA 1VQ6T 1DJ7B 1N6AA 4D8DA 2HBPA 3JB9F 2CDTA 2K5FA 3A8OB 2CP5A 2V8KA 3UATA 1VQ7T 4KRTA 2PNIA 4KGXB 3PMTA 3I56A 2X51A 2VYTA 2EKHA 1TUGB 4L5GA 1HSQA 2IVWA 3GP8A 2DA9A 5DLOA 3VS6A 2OTJQ 4PJJA 4JPBW 2P0QA 3CBPA 4QW2A 4L59A 2LCCA 2B8AA 3GNFB 1N8RC 1MHNA 1WZOA 3OQ5A 3X20B 1SPKA 3OYDA 1GFDA 4JLIA 5HY6A 2E70A 3EGXA 5FWBA 1W2BP 1AD5A 5M9OA 3HRUA 1ZBJA 1YHQT 2XI9A 1QVGA 4LDVA 1ACMB 2M02A 3CCUA 2LRQA 4LXCA 4OF1A 4KBMB 1WA7A 1MGQA 3CQTA 3CMAA 2DYBA 2RM4A 1EZZB 1X75C 4M7DC 1VQ8Q 1F1BB 4M75D 1D1BA 3OY9A 2DERA 2CT4A 5AT1B 1ZLMA 2KRMA 1U8RA 1KC8U 2CZ0B 4J9EA 1K1ZA 2GBQA 2EYWA 3PGGA 2DRKA 1YWOA 3MP8A 4MMKA 4XTXA 3UDCA 1BI1A 1N8RR 2JTMA 1AWJA 3LW5E 4FL6A 4FYYB 3MCAB 1CKBA 1QKXA 2D9TA 4PL6A 1AOJA 3G71T
chains in the Genus database with same CATH topology
1SHFA 2ROTA 1NG2A 3M0UA 2D8JA 3I35A 2JM8A 5IXFA 2BTTA 1VYTA 1S1NA 1UJYA 4E6RA 2FPFA 2CREA 2HEQA 3O5ZA 1ABOA 5FWCA 2CUDA 1PHTA 1H8KA 3TSWA 1H92A 2LNHB 2KR3A 1I07A 1PKTA 2F2WA 4AG1C 1TUDA 2JMCA 4JZ3A 2EW3A 1YWPA 1LCKA 2RQUA 2EYXA 1E6GA 2F2VA 1M3AA 1U3OA 1JXOA 2JMAA 4X1VA 2B86A 2YUNA 2MOXA 2HDAA 4J9GA 4AFQC 3H0IA 4RTWA 4OMMA 2V1QA 1X2KA 2EBPA 3TVTA 1GL5A 2HBWA 4J9IA 4AFSC 3VS5A 4RTVA 2JM9A 1FYNA 2FO0A 4HXJA 2BZYA 3QWXX 1UHFA 1WYXA 2L3SA 3REBB 1BBZA 4J9DA 1AZEA 4HVVA 3VS2A 4OMLA 1NEBA 3I5SA 2FRYA 1V1CA 2RNAA 1PKSA 1M3BA 2W10A 1AWWA 2KRSA 2KYMA 2YUQA 2FPDA 2EQIA 4IIMA 2DBKA 4RTXA 4IIOA 3THKA 3I5RA 1N5ZA 4CC7A 2I0NA 2ABLA 1WFWA 2DF6A 2YDLA 1X6GA 2HCKA 4RTUA 4HCKA 4OMNA 2BZ8A 2CSQA 2X3WD 1IO6A 3RBBB 2K7AA 1X2QA 2DX1A 2LQWA 2DJQA 1ABQA 5HCKA 1K9AA 1X6BA 4HVWA 2EVRA 4RTZA 3VS7A 1VYVA 1GCPA 1SSHA 2EGCA 2DL4A 2JTEA 1GRIA 2LX7A 2FPEA 2LP5A 2J6FA 4CC3A 2YUOA 1UFFA 2L3PA 2VWFA 3TSZA 2J6OA 1AEYA 5GJVB 1TG0A 2RF0A 3REAB 4CC4B 1I0CA 2K9GA 3EG1A 2A28A 2KROA 1OPLA 3IQLA 2K6DA 3ZL7C 3U23A 5I11A 1UUEA 2LZ6B 5I22A 2GNCA 2CSIA 2KGTA 4F14A 1K0SA 4GLMA 1WLPB 2E5KA 4J9FA 3ULRB 4Z89A 4ORZA 3QWYA 1CKAA 2DL7A 1YN8A 4JJDA 3VS4A 1WX6A 1UGVA 3UA7A 2O2OA 1JQQA 1MV0B 1SRMA 3PE0A 1UE9A 3PVLA 4F17A 2CUBA 3JV3A 2JT4A 1KJWA 2ECZA 2MIOA 3UF4A 1NM7A 2K2MA 4RTYA 2AKLA 1JEGA 1T3LA 4EIKA 5IH2A 3UA6A 5IHKA 2RPNA 1QCFA 1T0JA 2FRWA 4RTTA 4K11A 2C0OA 4GBQA 5FW9A 1QWEA 3M0RA 1B3QA 2SEMA 3VS0A 1J3TA 1ZUUA 1QKWA 2GGRA 1SEMA 2RQVA 3SEMA 1BB9A 2C0IA 2EGAA 1OV3A 1GBRA 2C0TA 2DL5A 3FJ5A 2ED0A 3VS3A 1E7OA 3RNJA 1M8MA 2ESWA 3GBQA 2O9VA 4LN2A 2KBTA 2L3QA 4J9HA 4JJCA 1TUCA 2CT3A 3NHNA 1WDXA 2OI3A 5IHIA 1JU5C 4DEXA 4DEYA 2X3XD 5GJWB 2CH4W 2AK5A 4CC2A 2DNUA 2L2PA 3M0QA 2DMOA 2VVKA 2JS0A 1VYUA 1UHCA 1UTIA 2HSPA 1X43A 1Z9QA 3EHRA 2LMJA 1OPKA 4J9BA 2OJ2A 1WXUA 2YT6A 2AZSA 1B07A 2J06A 2KXCA 5IXBA 2CH4A 1KSWA 2JS2A 1M27C 2J6KA 3EG2A 3EG3A 2RMOA 2QDLA 2ED1A 2EPDA 1H3HA 2ENMA 4QT7A 1SRLA 2DL3A 1NYFA 1BK2A 3VS1A 1JO8A 2AZVA 2GTOA 2RQRA 1WXTA 1UG1A 2K79A 1RI9A 2RQTA 2SRCA 2KT1A 1AVZC 4OMPA 4LUDA 3EHQA 2LCSA 2DE0X 1ZSGA 1UDLA 4R0KA 4J9CA 1WIEA 2XMFA 1W6XA 1Y0MA 1HJDA 1U5SA 1G2BA 1E6HA 4AG2C 2FG0A 4LNPA 2AKKA 2ROLA 1Z9ZA 2KXDA 1YNZA 1A0NB 3H41A 4LE9A 2DM1A 2NUZA 1K4US 1W70A 2LJ0A 1RLQC 4JZ4A 4OMOA 1HD3A 4JJBA 1UECA 1MV3A 3VRYA 1PNJA 4WCIA 1NLOC 4D8KA 2J05A 4ZNXA 1ARKA 1PRLC 2KRNA 2PZ1A 1PWTA 1T0HA 1NLPC 2P4RA 1OEBA 2M51A 1CSKA 1ZUYA 4F16A 2O31A 1Y57A 1ZX6A 2LQNA 1AZGB 3H0HA 3KFVA 1KIKA 2DL8A 2W0ZA 1GBQA 2D0NA 2O88A 3M0TA 4AFUC 3NPFA 3PVQA 1GFCA 1KFZA 2MCNA 3LH5A 2V1RA 3EG0A 2RN8A 2KE9A 1EFNA 4Z8AA 2DBMA 1UJ0A 2G6FX 1BU1A 1NYGA 2FEIA 2M0YA 4A63B 1QLYA 1JXMA 3NMZC 4Y92A 4M4ZA 3M0PA 1YP5A 2KT8A 4D8DA 2CDTA 1MUZA 3I9QA 2J7IA 2DVJA 2A08A 1M30A 2VKNA 2YUPA 3UATA 4OMQA 1G83A 4FSSA 4KRTA 2PNIA 3EGUA 1XOVA 2RQWA 1PRMC 2EKHA 3SHWA 3NGPA 2L0AA 5ECAA 1HSQA 1I1JA 1AWOA 5EC7A 2GQIA 2DA9A 2A36A 3VS6A 1U06A 4JPBW 3A98A 3VRZA 2JW4A 2K3BA 2KNBB 3H0FA 2EGEA 5L23A 1M3CA 4AFZC 1T3SA 1YCSB 1SPKA 1GFDA 5FWBA 1VA7A 1AD5A 2IIMA 2YSQA 2JXBA 1SHGA 1RLPC 1ZBJA 4RUGA 1QWFA 1NEGA 5IHNA 1W1FA 2NWMA 2DILA 2H8HA 1X27A 1WA7A 3CQTA 2DYBA 3R6NA 2A37A 2D8HA 3C0CA 2OAWA 1WXBA 2EYYA 1GCQC 4Z88A 2PTKA 2D1XA 1FMKA 2CT4A 2BZXA 4ESRA 1WI7A 1ZLMA 2KRMA 4LUEA 4HVUA 2O9SA 2DLPA 2F2XA 3M0SA 2KEAA 4J9EA 1K1ZA 2GBQA 2EYWA 2LJ3A 2DRKA 1YWOA 1K0XA 1ZUKA 2EYZA 1K76A 1X69A 1RUWA 2DRMA 1AWJA 1CKBA 1OOTA 1QKXA 1AOJA 1GCQA 2LJ1A 2KYBA 1AWXA 2GTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHF A;  2ROT A;  1NG2 A;  3M0U A;  2D8J A;  3I35 A;  2JM8 A;  5IXF A;  2BTT A;  1VYT A;  1S1N A;  1UJY A;  4E6R A;  2FPF A;  2CRE A;  2HEQ A;  3O5Z A;  1ABO A;  5FWC A;  2CUD A;  1PHT A;  1H8K A;  3TSW A;  1H92 A;  2LNH B;  2KR3 A;  1I07 A;  1PKT A;  2F2W A;  4AG1 C;  1TUD A;  2JMC A;  4JZ3 A;  2EW3 A;  1YWP A;  1LCK A;  2RQU A;  2EYX A;  1E6G A;  2F2V A;  1M3A A;  1U3O A;  1JXO A;  2JMA A;  4X1V A;  2B86 A;  2YUN A;  2MOX A;  2HDA A;  4J9G A;  4AFQ C;  3H0I A;  4RTW A;  4OMM A;  2V1Q A;  1X2K A;  2EBP A;  3TVT A;  1GL5 A;  2HBW A;  4J9I A;  4AFS C;  3VS5 A;  4RTV A;  2JM9 A;  1FYN A;  2FO0 A;  4HXJ A;  2BZY A;  3QWX X;  1UHF A;  1WYX A;  2L3S A;  3REB B;  1BBZ A;  4J9D A;  1AZE A;  4HVV A;  3VS2 A;  4OML A;  1NEB A;  3I5S A;  2FRY A;  1V1C A;  2RNA A;  1PKS A;  1M3B A;  2W10 A;  1AWW A;  2KRS A;  2KYM A;  2YUQ A;  2FPD A;  2EQI A;  4IIM A;  2DBK A;  4RTX A;  4IIO A;  3THK A;  3I5R A;  1N5Z A;  4CC7 A;  2I0N A;  2ABL A;  1WFW A;  2DF6 A;  2YDL A;  1X6G A;  2HCK A;  4RTU A;  4HCK A;  4OMN A;  2BZ8 A;  2CSQ A;  2X3W D;  1IO6 A;  3RBB B;  2K7A A;  1X2Q A;  2DX1 A;  2LQW A;  2DJQ A;  1ABQ A;  5HCK A;  1K9A A;  1X6B A;  4HVW A;  2EVR A;  4RTZ A;  3VS7 A;  1VYV A;  1GCP A;  1SSH A;  2EGC A;  2DL4 A;  2JTE A;  1GRI A;  2LX7 A;  2FPE A;  2LP5 A;  2J6F A;  4CC3 A;  2YUO A;  1UFF A;  2L3P A;  2VWF A;  3TSZ A;  2J6O A;  1AEY A;  5GJV B;  1TG0 A;  2RF0 A;  3REA B;  4CC4 B;  1I0C A;  2K9G A;  3EG1 A;  2A28 A;  2KRO A;  1OPL A;  3IQL A;  2K6D A;  3ZL7 C;  3U23 A;  5I11 A;  1UUE A;  2LZ6 B;  5I22 A;  2GNC A;  2CSI A;  2KGT A;  4F14 A;  1K0S A;  4GLM A;  1WLP B;  2E5K A;  4J9F A;  3ULR B;  4Z89 A;  4ORZ A;  3QWY A;  1CKA A;  2DL7 A;  1YN8 A;  4JJD A;  3VS4 A;  1WX6 A;  1UGV A;  3UA7 A;  2O2O A;  1JQQ A;  1MV0 B;  1SRM A;  3PE0 A;  1UE9 A;  3PVL A;  4F17 A;  2CUB A;  3JV3 A;  2JT4 A;  1KJW A;  2ECZ A;  2MIO A;  3UF4 A;  1NM7 A;  2K2M A;  4RTY A;  2AKL A;  1JEG A;  1T3L A;  4EIK A;  5IH2 A;  3UA6 A;  5IHK A;  2RPN A;  1QCF A;  1T0J A;  2FRW A;  4RTT A;  4K11 A;  2C0O A;  4GBQ A;  5FW9 A;  1QWE A;  3M0R A;  1B3Q A;  2SEM A;  3VS0 A;  1J3T A;  1ZUU A;  1QKW A;  2GGR A;  1SEM A;  2RQV A;  3SEM A;  1BB9 A;  2C0I A;  2EGA A;  1OV3 A;  1GBR A;  2C0T A;  2DL5 A;  3FJ5 A;  2ED0 A;  3VS3 A;  1E7O A;  3RNJ A;  1M8M A;  2ESW A;  3GBQ A;  2O9V A;  4LN2 A;  2KBT A;  2L3Q A;  4J9H A;  4JJC A;  1TUC A;  2CT3 A;  3NHN A;  1WDX A;  2OI3 A;  5IHI A;  1JU5 C;  4DEX A;  4DEY A;  2X3X D;  5GJW B;  2CH4 W;  2AK5 A;  4CC2 A;  2DNU A;  2L2P A;  3M0Q A;  2DMO A;  2VVK A;  2JS0 A;  1VYU A;  1UHC A;  1UTI A;  2HSP A;  1X43 A;  1Z9Q A;  3EHR A;  2LMJ A;  1OPK A;  4J9B A;  2OJ2 A;  1WXU A;  2YT6 A;  2AZS A;  1B07 A;  2J06 A;  2KXC A;  5IXB A;  2CH4 A;  1KSW A;  2JS2 A;  1M27 C;  2J6K A;  3EG2 A;  3EG3 A;  2RMO A;  2QDL A;  2ED1 A;  2EPD A;  1H3H A;  2ENM A;  4QT7 A;  1SRL A;  2DL3 A;  1NYF A;  1BK2 A;  3VS1 A;  1JO8 A;  2AZV A;  2GTO A;  2RQR A;  1WXT A;  1UG1 A;  2K79 A;  1RI9 A;  2RQT A;  2SRC A;  2KT1 A;  1AVZ C;  4OMP A;  4LUD A;  3EHQ A;  2LCS A;  2DE0 X;  1ZSG A;  1UDL A;  4R0K A;  4J9C A;  1WIE A;  2XMF A;  1W6X A;  1Y0M A;  1HJD A;  1U5S A;  1G2B A;  1E6H A;  4AG2 C;  2FG0 A;  4LNP A;  2AKK A;  2ROL A;  1Z9Z A;  2KXD A;  1YNZ A;  1A0N B;  3H41 A;  4LE9 A;  2DM1 A;  2NUZ A;  1K4U S;  1W70 A;  2LJ0 A;  1RLQ C;  4JZ4 A;  4OMO A;  1HD3 A;  4JJB A;  1UEC A;  1MV3 A;  3VRY A;  1PNJ A;  4WCI A;  1NLO C;  4D8K A;  2J05 A;  4ZNX A;  1ARK A;  1PRL C;  2KRN A;  2PZ1 A;  1PWT A;  1T0H A;  1NLP C;  2P4R A;  1OEB A;  2M51 A;  1CSK A;  1ZUY A;  4F16 A;  2O31 A;  1Y57 A;  1ZX6 A;  2LQN A;  1AZG B;  3H0H A;  3KFV A;  1KIK A;  2DL8 A;  2W0Z A;  1GBQ A;  2D0N A;  2O88 A;  3M0T A;  4AFU C;  3NPF A;  3PVQ A;  1GFC A;  1KFZ A;  2MCN A;  3LH5 A;  2V1R A;  3EG0 A;  2RN8 A;  2KE9 A;  1EFN A;  4Z8A A;  2DBM A;  1UJ0 A;  2G6F X;  1BU1 A;  1NYG A;  2FEI A;  2M0Y A;  4A63 B;  1QLY A;  1JXM A;  3NMZ C;  4Y92 A;  4M4Z A;  3M0P A;  1YP5 A;  2KT8 A;  4D8D A;  2CDT A;  1MUZ A;  3I9Q A;  2J7I A;  2DVJ A;  2A08 A;  1M30 A;  2VKN A;  2YUP A;  3UAT A;  4OMQ A;  1G83 A;  4FSS A;  4KRT A;  2PNI A;  3EGU A;  1XOV A;  2RQW A;  1PRM C;  2EKH A;  3SHW A;  3NGP A;  2L0A A;  5ECA A;  1HSQ A;  1I1J A;  1AWO A;  5EC7 A;  2GQI A;  2DA9 A;  2A36 A;  3VS6 A;  1U06 A;  4JPB W;  3A98 A;  3VRZ A;  2JW4 A;  2K3B A;  2KNB B;  3H0F A;  2EGE A;  5L23 A;  1M3C A;  4AFZ C;  1T3S A;  1YCS B;  1SPK A;  1GFD A;  5FWB A;  1VA7 A;  1AD5 A;  2IIM A;  2YSQ A;  2JXB A;  1SHG A;  1RLP C;  1ZBJ A;  4RUG A;  1QWF A;  1NEG A;  5IHN A;  1W1F A;  2NWM A;  2DIL A;  2H8H A;  1X27 A;  1WA7 A;  3CQT A;  2DYB A;  3R6N A;  2A37 A;  2D8H A;  3C0C A;  2OAW A;  1WXB A;  2EYY A;  1GCQ C;  4Z88 A;  2PTK A;  2D1X A;  1FMK A;  2CT4 A;  2BZX A;  4ESR A;  1WI7 A;  1ZLM A;  2KRM A;  4LUE A;  4HVU A;  2O9S A;  2DLP A;  2F2X A;  3M0S A;  2KEA A;  4J9E A;  1K1Z A;  2GBQ A;  2EYW A;  2LJ3 A;  2DRK A;  1YWO A;  1K0X A;  1ZUK A;  2EYZ A;  1K76 A;  1X69 A;  1RUW A;  2DRM A;  1AWJ A;  1CKB A;  1OOT A;  1QKX A;  1AOJ A;  1GCQ A;  2LJ1 A;  2KYB A;  1AWX A;  2GTJ A; 
#chains in the Genus database with same CATH topology
 4C0F A;  1SHF A;  1H64 1;  4FU6 A;  3BDL A;  2JZ2 A;  1WHL A;  3QZ5 B;  1QVG S;  2D8J A;  1MMG A;  4ANJ A;  2BTT A;  1VQL T;  3CC4 T;  3CCS Q;  1ABO A;  3FLG A;  1PHT A;  3TSW A;  2IPO B;  2LNH B;  2HZY A;  3MP1 A;  3A8L B;  3PMI A;  1TUD A;  1Y7X A;  2V26 A;  1OX8 A;  3JB9 I;  2EW3 A;  1LCK A;  1RAC B;  5J26 A;  2V8J A;  4BE1 A;  1YBY A;  2P4T A;  1JXO A;  4X1V A;  5LJ5 f;  2QEX T;  1ZA1 B;  2YUN A;  5I21 A;  1FXX A;  4M7A B;  3HKS A;  2NUP B;  2V1Q A;  2EBP A;  2BUD A;  3S3N A;  4AFS C;  4IUR A;  3VS5 A;  4XU1 A;  2X9H A;  2VGN A;  2LCL A;  1M1F A;  2FO0 A;  1ZBX A;  3QWX X;  2L3S A;  1BBZ A;  1WGS A;  4J9D A;  4M78 A;  4E2F B;  3I5S A;  1KD1 U;  3OS1 A;  2RA2 A;  1Q81 C;  2OTJ T;  2K5I A;  1V1C A;  3OS5 A;  1PKS A;  2W10 A;  1AWW A;  1NJI R;  2Z0W A;  5GAN 8;  1UB4 A;  4DQ2 A;  4RTX A;  2KK4 A;  5KYX B;  2MWO A;  4IIO A;  3THK A;  3RUX A;  5GMK i;  3I5R A;  5DY9 A;  2DAQ A;  2K57 A;  5FU7 B;  2ABL A;  2DF6 A;  3UPU A;  2BZ8 A;  1YJN Q;  2CSQ A;  2HD0 A;  1Q7Y U;  2WSF E;  2AIR B;  2DTO A;  1IO6 A;  2E1H A;  3H8Z A;  2LQW A;  1VQ8 T;  1K9A A;  5GAN f;  5KH6 A;  1NPP A;  2RHY A;  2EVR A;  1OYX A;  2RI5 A;  5LJ5 g;  1GCP A;  1Q81 R;  2DL4 A;  2JTE A;  1GRI A;  2G3R A;  2LX7 A;  5KE3 A;  4J7I A;  5GAN 7;  1VQ9 A;  3TSZ A;  4M78 E;  4C5H A;  1NBE B;  2K9G A;  4EMK B;  4M75 A;  2E65 A;  4J6Y A;  3G4S T;  2X4J A;  2FL7 A;  4C8Q B;  1WHJ A;  8ATC B;  3OYB A;  4KGV B;  2RHZ A;  1UUE A;  2CZ1 B;  2LZ6 B;  2KGT A;  1OX9 A;  5J3B A;  4J9F A;  4Z89 A;  2LX9 A;  2XKO C;  1TTH B;  3RKX A;  1MV0 B;  1YIT A;  1C6V X;  2BE7 D;  3CCS T;  1UE9 A;  3HSB A;  4F17 A;  3BW1 A;  3M54 A;  4XQ3 A;  5I2M A;  5CCA A;  1KJW A;  2H3E B;  2AHJ B;  5IT9 E;  5IH2 A;  5KYU B;  4M77 A;  2DIQ A;  1QCF A;  4F7U B;  2C0O A;  4ELZ C;  4DA4 A;  4IUT A;  3VUZ A;  3M0R A;  3CD6 Q;  1NZ9 A;  3PNW C;  1VQ5 A;  2DD4 A;  3VS0 A;  5GAN g;  3ER0 A;  2M9U A;  1ZUU A;  6AT1 B;  2YHT A;  2DFU A;  2DIG A;  3DB3 A;  1KC8 C;  4M75 E;  3DLL A;  3G6E Q;  1OU8 A;  2F5K A;  2ZPI B;  3VS3 A;  4J7F A;  1M8M A;  2ESW A;  1VQ4 Q;  2KBT A;  5D6Y A;  1LPL A;  4RCB A;  2CT3 A;  5IHI A;  1ZSZ B;  4DEX A;  4DEY A;  2X3X D;  4RG8 A;  1JRI A;  2DNU A;  2JNG A;  3VU3 C;  1YCY A;  4LDW A;  2HSP A;  1VIF A;  3TQ7 P;  2HSE B;  5KCH A;  1YJN T;  2LMJ A;  1OPK A;  4J9B A;  3URG A;  3QPH A;  4M77 E;  2OJ2 A;  1WXU A;  3X24 B;  2YT6 A;  2AZS A;  3CCJ Q;  5GAO p;  2J06 A;  5IXB A;  1IZ6 A;  2JS2 A;  3G7Z A;  3JCM h;  3MEW A;  1N27 A;  4II1 A;  3OYL A;  1IRE B;  1KC8 R;  1M90 R;  2QDL A;  4FIB A;  2RK1 A;  1NE8 A;  2ENM A;  1SF9 A;  4PJN A;  1GXI E;  3PIP A;  1JO8 A;  3HRT A;  2DEU A;  2GTO A;  3CCE Q;  2EJG A;  1R8O B;  3NTI A;  2RQT A;  1BI2 A;  3JB9 J;  4LUD A;  2DE0 X;  1UDL A;  1WPY A;  4R0K A;  1XNI A;  1YJ9 Q;  3CCQ A;  1KHC A;  4JJN K;  4XU0 A;  4N4I A;  4XAX B;  2MI6 A;  2HL5 C;  5FU7 C;  4LE9 A;  2RJD A;  2NUZ A;  3WVE B;  1K4U S;  1RLQ C;  4QQG A;  3MKD A;  4F7U F;  4OMO A;  4M7D A;  3PFS A;  1MV3 A;  1PNJ A;  5GAM g;  5GAN 6;  3OYK A;  1NLO C;  3HHT B;  2H3J A;  5DLQ E;  1N9S A;  3Q1J A;  2EKO A;  5LL6 S;  5DM7 R;  2KRN A;  2PZ1 A;  1PWT A;  1T0H A;  1NLP C;  1OEB A;  2MK5 A;  4PNO A;  2CGH A;  3CD6 T;  1RAB B;  1Q7Y C;  3ZEH A;  2D0N A;  3M0T A;  3PVQ A;  2LT1 A;  2V1R A;  3L2W A;  2RN8 A;  3O8V A;  1EFN A;  1KK7 A;  4M77 G;  4Z8A A;  2DBM A;  1VQM A;  4OGE A;  2FEI A;  2M0Y A;  3I55 Q;  4Y92 A;  4MZP A;  1YP5 A;  4A4K A;  1MUZ A;  2BE9 B;  1VQ4 T;  1M30 A;  2VKN A;  2YUP A;  3OMC A;  3CCV Q;  4OMQ A;  3FC3 A;  2NLU A;  1PRM C;  1JJ2 S;  3MEV A;  3NGP A;  3OYE A;  1QVF A;  3C12 A;  4OMF B;  4PJO B;  4JRI A;  2GQI A;  3CXC A;  5A0D A;  3A98 A;  3OW2 P;  5KYN A;  2K3B A;  2K3Y A;  3H0F A;  2EAY A;  3HL8 A;  3VV0 A;  1VQP Q;  2JVV A;  5GAO r;  3C95 A;  1LJO A;  4CI0 C;  1QMC A;  2DTH A;  4P5N A;  5IHN A;  5LJ5 e;  2E10 A;  1WJR A;  1QCN A;  3CCL Q;  2P0P A;  4J6W A;  4HT9 A;  1YI2 Q;  1PSF A;  1Q86 R;  4M7A D;  2QQ9 A;  4Z88 A;  5LJ5 d;  1YJ9 T;  1ZSZ C;  4LUE A;  1QVF S;  4HVU A;  4PLL A;  2KEA A;  2NUT B;  2D0Q B;  3QYH B;  1I81 A;  1K0X A;  1G3S A;  2VAS A;  1RUW A;  2DRM A;  3NTH A;  4A4E A;  3EFO B;  2CP0 A;  4FT4 A;  1GCQ A;  2LJ1 A;  2QA4 A;  1H3Z A;  3BDU A;  1TU0 B;  5CO7 A;  2DPP B;  4A53 A;  1Q82 U;  1KQS P;  3T9N A;  2JTF A;  1VYT A;  3KBG A;  1UJY A;  1P92 A;  4C5I A;  2HEQ A;  3O5Z A;  4MDX A;  2CUD A;  4M7D G;  2Y90 A;  4BDZ A;  4DOW A;  2ZPH B;  2JMC A;  3SD4 A;  2IG0 A;  4JS4 A;  1VQ6 A;  3CEY A;  1YWP A;  2RQU A;  2QAS A;  3UWN A;  5A0G A;  2QDY B;  2OAU A;  3I55 T;  1VQ7 A;  3JCM b;  2QG9 B;  5GAN d;  2B86 A;  3MO8 A;  2YRC A;  1VQK T;  2E6N A;  1MNE A;  4J9I A;  3CCV T;  4HXJ A;  2BZY A;  4C8Q D;  3S3O A;  5GMK j;  1UHF A;  1WYX A;  1AZE A;  2C06 A;  4Z02 A;  3VS2 A;  4J5Y A;  1WNL A;  3AHU A;  1G8X A;  5CKE A;  4BI3 A;  4C0Z A;  5GAM h;  4BB7 A;  2KY9 A;  3M4G A;  1M3B A;  3G1J A;  5LJ3 h;  3QZ9 B;  4NOY A;  1VQP T;  2R5A A;  5LJ5 j;  2QAZ A;  3RKY A;  2I0N A;  3RKW A;  1WFW A;  2X4W A;  2YDL A;  1X6G A;  4RTU A;  2YXY A;  4HCK A;  2VUB A;  2X3W D;  3JCM f;  3CCL T;  3JAM E;  2HAX A;  4C92 D;  1Y71 A;  4FYV B;  3RBB B;  1YI2 T;  1PC0 A;  1X2Q A;  4N0A C;  5KYW A;  3SWN B;  2O01 E;  1V76 A;  2O4X A;  2RO0 A;  4PJL A;  2CP2 A;  3LGL A;  4HVW A;  5GAO m;  1AT1 B;  1OUL A;  4IUQ A;  1SSH A;  2EGC A;  3VYH B;  3QDF A;  4B6M A;  3FRN A;  2MYS A;  1RAG B;  3M59 A;  1FMW A;  5GAN 2;  3G71 A;  1TG0 A;  5FRO A;  1UGQ B;  3OYY A;  4IUV A;  1EIF A;  2A28 A;  4LDU A;  3SDZ A;  3G4S Q;  4E7L A;  5GAN 3;  3L2U A;  2K6D A;  5GAM e;  3P8D A;  4YTL A;  1M1K C;  3S3M A;  3CC4 A;  3FB9 A;  3R6O A;  1VQO A;  1CKA A;  3A8H B;  4JJD A;  4FYX B;  1UGV A;  5GAN j;  2E3H A;  3PVL A;  2GFU A;  2WAC A;  3TEE A;  2JT4 A;  3LGF A;  2MIO A;  3EGX B;  2JN0 A;  3LX7 A;  3DKM A;  2EJ9 A;  2QEX A;  2E41 A;  3QG1 A;  3JCM g;  3OYF A;  3NFC A;  2EQK A;  1T0J A;  2FRW A;  1BCO A;  4K11 A;  1O9S A;  5FW9 A;  1QWE A;  2OTL Q;  1B3Q A;  4XTY A;  1Y96 A;  1WQ7 A;  1Q95 G;  3EAE A;  1K8A U;  2E64 A;  3EFS A;  2RQV A;  2Y4X A;  2EGA A;  2YRV A;  1M1K R;  2LDM A;  1OU9 A;  1K9M U;  2OTJ A;  1GBR A;  8AT1 B;  4M7A E;  5KYY A;  3FJ5 A;  5FU6 B;  1QVG P;  1BIB A;  2ED0 A;  3PTA A;  5GAN 4;  1E7O A;  3RNJ A;  4D6W A;  3GIB A;  4LN2 A;  1UGP B;  2L3Q A;  4C0D C;  3ZBD A;  4OB2 B;  3M57 A;  4OGC A;  3QHS A;  1JU5 C;  1ZQ1 A;  1WQW A;  2CH4 W;  4CC2 A;  2YLC A;  3SFM A;  2VVK A;  2JS0 A;  1KHI A;  3QBY A;  2XD0 A;  1Q82 C;  3P8B B;  3OYH A;  3CME Q;  2K5L A;  1VQN Q;  1VQ8 A;  1OI1 A;  3E9G A;  2LTO A;  5GAO q;  4RG2 A;  2KXC A;  3QUI A;  1YFN A;  4HCB A;  3EG3 A;  2ED1 A;  2EPD A;  5KYU A;  4AMC A;  3CC2 Q;  1MMN A;  2DL3 A;  1KQ1 A;  1NYF A;  4E47 A;  4F7U A;  1ZA2 B;  4FW2 A;  4FSX A;  1S72 Q;  4E7H A;  1AVZ C;  1HK9 A;  2PVO B;  4J9C A;  1MMA A;  1BIA A;  3QXE B;  2X35 A;  2XMF A;  3INZ A;  5CVI A;  3VJP A;  2DET A;  1HJD A;  1U5S A;  1E6H A;  4AG2 C;  2GFA A;  3OMG A;  3M56 A;  2AKK A;  3CCS A;  1Z9Z A;  2KXD A;  1YNZ A;  4PFP A;  1A0N B;  3H41 A;  4PJO D;  3JB9 H;  1W70 A;  2LJ0 A;  2YLB A;  4C8Q E;  2LNV A;  3A8M B;  4RCC A;  4M7A F;  2QGF B;  1KG1 A;  4BDY A;  5D6X A;  4ATO A;  1ZSZ A;  3ZFJ A;  5C0M A;  4F04 B;  5HK0 A;  1VOM A;  3CBO A;  4MZM A;  2ZCF B;  5GAO l;  3GNG A;  2M51 A;  4E7J A;  4C92 B;  2OTL T;  2FHD A;  2F69 A;  4F16 A;  2XHC A;  2M0O A;  1IXD A;  2LQN A;  1AZG B;  3AT1 B;  3OYM A;  3H0H A;  3KFV A;  1NPR A;  1YIT T;  4V2S A;  4F7U E;  2PVD B;  4AFU C;  3NPF A;  3JCM c;  3M58 A;  3QYG B;  2FYK A;  2G6F X;  2AT1 B;  2MMP A;  1QLY A;  3OB9 A;  4M4Z A;  4C5E A;  5KE2 A;  4MZT A;  3I9Q A;  1UEB A;  2WSC E;  2J7I A;  3EG9 A;  2DVJ A;  2A08 A;  3EGD B;  3OYN A;  4ZN1 A;  4FSS A;  5A2Q E;  2A7Y A;  4VUB A;  2JOY A;  3P8H A;  4KH1 B;  2ATC B;  2DZ9 A;  1D3B A;  2RQW A;  4LD9 K;  3CCR Q;  2COY A;  3OSS C;  1YJN A;  5GAM f;  2GCX A;  1AWO A;  5EC7 A;  5LJ3 f;  3HPW A;  3RES A;  2A36 A;  4M78 G;  4HT8 A;  3NTK A;  1U06 A;  2V8I A;  3HRS A;  3E9F A;  4DBF A;  3CME T;  1VQN T;  2I2L A;  2KNB B;  2XK0 A;  1B7T A;  2DXT A;  3SB2 A;  3BE3 A;  3ASK A;  2A3L A;  1T3S A;  4M7A C;  1VA7 A;  2YSQ A;  4M77 B;  4C8Q F;  1SHG A;  3LH0 A;  4LDY A;  1RLP C;  1HYO A;  4QVC A;  2EJF A;  4RUG A;  1QWF A;  1SSF A;  2DD5 A;  2DIL A;  4DBR A;  3OBW A;  3CC2 T;  1K73 U;  2COW A;  3HFN A;  2BIV A;  3L2Q A;  3R6N A;  2A37 A;  1S72 T;  3CC7 A;  3C0C A;  2OAW A;  1WXB A;  2EYY A;  2DVE A;  1YIJ Q;  3V7R A;  3OYJ A;  2D1X A;  1FMK A;  2RK2 A;  3LLR A;  1PCX A;  2F2X A;  1K9M C;  2FZK B;  2LJ3 A;  1VUB A;  3OW2 A;  2KDS A;  2XDP A;  4C92 F;  1KD1 C;  4N0A A;  2QK0 A;  4WF2 A;  1OOT A;  1X01 A;  2MWP A;  2HKN A;  5CKF A;  2KYB A;  1AWX A;  4M75 G;  5LJ3 g;  1TOV A;  3M0U A;  3CD6 A;  1R0C B;  2E3I A;  4XTW A;  4XU3 A;  4KGZ B;  3JCM e;  2Y4Y A;  5CKD A;  1S1N A;  4BE0 A;  4E6R A;  1N8R U;  2FPF A;  2CRE A;  3TCJ A;  5FWC A;  4XU2 A;  1H8K A;  2KR3 A;  1PKT A;  4EMK C;  3JCM d;  2F2W A;  4KT0 E;  1K9M R;  3G6E A;  4JS5 A;  4BI4 A;  1OZ2 A;  4C8Q C;  4JZ3 A;  5CR2 A;  2MF2 A;  2EYX A;  2F2V A;  3ME9 A;  1VQ4 A;  1M3A A;  1KD1 R;  2QYZ A;  2R58 A;  1OQK A;  3FJP A;  2K2V A;  4AFQ C;  3H0I A;  4RTW A;  3HFO A;  3CPW A;  1VQK Q;  5C6S A;  4OMM A;  1X2K A;  3TVT A;  1GL5 A;  3FEO A;  1M5Q 1;  4J83 A;  1M2V A;  4Q5W A;  4RTV A;  2JM9 A;  3OA6 A;  5HKC A;  2LVM A;  3CCR T;  2VGM A;  1WJQ A;  1FMV A;  4WTO B;  3CCJ A;  1W4S A;  3QJY A;  4LD6 A;  2QQR A;  1Q7Y R;  1VQM T;  4M7D B;  4C92 C;  2RNA A;  1WHG A;  1XTD A;  2QGG A;  3CCM Q;  2KYM A;  1YJW Q;  3H9N A;  2EQI A;  4IIM A;  2DBK A;  4ZTF A;  4IUP A;  3V8J A;  7AT1 B;  1N5Z A;  2X4Y A;  3CCE A;  1RI0 A;  4RMO A;  4CC7 A;  3CPF A;  3I56 Q;  2KQW A;  1I8F A;  2HCK A;  2RHU A;  3KUF A;  4OP0 A;  3RDV A;  1B34 A;  1YJ9 A;  3CPW S;  2K7A A;  1NJI U;  3PT9 A;  2PQW A;  3GLX A;  4A4H A;  1XQH A;  1ABQ A;  5HCK A;  1YIJ T;  2JJ9 A;  1X6B A;  4DBQ A;  3VS7 A;  1JJ2 P;  1VYV A;  2WSE E;  3OYG A;  1Y07 A;  2LP5 A;  4O6J A;  1IGQ A;  2J6F A;  4CC3 A;  3CXC S;  2OX7 A;  2YUO A;  4HCC A;  1UFF A;  2VWF A;  4GLK A;  2HQX A;  1U1T A;  2J6O A;  5GJV B;  3CCU Q;  1AEY A;  4IKF A;  4JLG A;  2E12 A;  4CC4 B;  1MND A;  2DJZ A;  2KMT A;  2KRO A;  4O5V A;  1OPL A;  4TVR A;  1W2B A;  3CMA Q;  3WXM B;  3ZL7 C;  3U23 A;  4R56 A;  4KUI A;  5I22 A;  1WHM A;  2GNC A;  1Q81 U;  4F14 A;  1WLP B;  2E5K A;  4PFZ A;  3ULR B;  3QWY A;  2DL7 A;  4X9D A;  4OB0 B;  1JQQ A;  4IUU A;  3PE0 A;  3OSV A;  3TRE A;  1ZHI A;  3JV3 A;  4XTZ A;  4ELY C;  2K2M A;  1I5O B;  5IAY A;  4OVA A;  2AKL A;  2PUK B;  3EH2 A;  3I55 A;  5CAI A;  1QVF P;  3UA6 A;  3L1A A;  1XJW B;  1D1C A;  4PJO F;  4QKU A;  1PG5 B;  1K73 C;  3CCV A;  1TWB A;  1C1A A;  1BCM A;  3HP9 A;  2QQB A;  3JB9 G;  2CP7 A;  2GGR A;  3L42 A;  3SEM A;  1W2B S;  1UGS B;  2XU8 A;  4X34 A;  2COZ A;  4M78 D;  1VQP A;  2K4Y A;  3GBQ A;  2O9V A;  3JCM X;  3H6Z A;  3L2R A;  3CCM T;  4J9H A;  1YJW T;  1TUC A;  1YHQ A;  3NHN A;  1WDX A;  2FB7 A;  3RER A;  5GJW B;  3CCL A;  3M0Q A;  2DMO A;  3MP6 A;  1YI2 A;  1VYU A;  1K73 R;  3QII A;  2LT4 A;  1UTI A;  3I56 T;  2XDD A;  3BY7 A;  1O75 A;  3RIR A;  1IGU A;  4A4G A;  1B07 A;  1G3T A;  1QQJ A;  5IN1 A;  3EG2 A;  4PLI A;  2DO3 A;  2E5Q A;  3JCM Q;  1JB0 E;  2GF7 A;  4JRK A;  2AZV A;  3RMQ A;  4PJO C;  2D6F A;  2RQR A;  1WXT A;  2VXF A;  2K79 A;  2XG8 D;  4MML A;  3CCU T;  4QQ6 A;  2KT1 A;  2KVQ G;  4OMP A;  2KI7 A;  4M7A A;  2NUP A;  1D09 B;  2LCS A;  4RKU E;  4UC4 A;  3CMA T;  1WIE A;  2VV5 A;  1W6X A;  1Y0M A;  1M90 U;  1G2B A;  4EDU A;  5LJ3 e;  2FG0 A;  3QJ6 A;  4QVZ A;  4LNP A;  3X25 B;  4R55 A;  1VQL A;  2DM1 A;  2R5M A;  5CQX A;  4XK8 E;  4HA8 A;  5GAM d;  1IB8 A;  4GY5 A;  3QO3 A;  5LJ3 d;  4WCI A;  1VQ9 Q;  2FZG B;  5CKH A;  4OB1 B;  4KUL A;  3EFR A;  5KYX A;  4NS5 A;  2RI3 A;  1ARK A;  3FIF A;  3MHX A;  4M77 D;  2K3X A;  2RH2 A;  2P4R A;  2ZGW A;  2RI2 A;  2EFI A;  1CSK A;  2CYZ B;  5A0L A;  2QTX A;  5KYW B;  2HNI A;  5EG2 A;  2O31 A;  1VQO T;  1RAH B;  1Y57 A;  1QVP A;  1ZX6 A;  2O4X B;  1YIT Q;  1NJI C;  2W0Z A;  1FWZ A;  3JCM J;  4BI8 B;  2O88 A;  3VKI A;  2RB6 A;  5D7U A;  2MCN A;  3EG0 A;  1PM3 A;  2M1H A;  1NYG A;  3GOX A;  1JXM A;  2ZPE B;  3NMZ C;  1I5L A;  2HQH A;  4ZGE B;  1QP3 A;  2KT8 A;  2HKQ B;  4KUD K;  1LOJ A;  4KH0 B;  4B9W A;  1G83 A;  4EMK A;  1BI3 A;  1VQ5 Q;  3M4Y A;  3EGU A;  3V8L A;  1XOV A;  1FX7 A;  4C8Q A;  3SHW A;  1UGR B;  1LVK A;  2L0A A;  5GAO n;  5ECA A;  4JRP A;  1I1J A;  3MPU B;  2NYS A;  3BFM A;  5L8R E;  3VRZ A;  1M2O A;  2JW4 A;  3V8K A;  2A0F B;  2EGE A;  4ZGD B;  1M3C A;  2VXE A;  3RR6 A;  4AFZ C;  5L23 A;  1YCS B;  2DXB A;  3UT1 A;  2EQM A;  1RAI B;  3L2Z A;  4CRI A;  2IIM A;  2JXB A;  1G3W A;  1NEG A;  3TU4 K;  1W1F A;  2NWM A;  2H8H A;  1BI0 A;  2L8D A;  3GF5 A;  4AT1 B;  3VYG A;  1X27 A;  1N9R A;  1Y96 B;  5D6W A;  4C92 A;  3G4S A;  2DTI A;  1RAA B;  5GAM j;  2D8H A;  2GQV A;  4QVD A;  2CZ7 B;  5LJ3 j;  4JRQ A;  1GCQ C;  1TS9 A;  5CK9 A;  2M16 A;  3PIO A;  2RJC A;  2PTK A;  4ESR A;  2BZX A;  2JUF A;  3V7C A;  1WI7 A;  5KYY B;  1V29 B;  4M78 B;  2O9S A;  2DLP A;  3M0S A;  1Q82 R;  4A4F A;  1ZUK A;  1D0X A;  4XTU A;  2EYZ A;  1K76 A;  1X69 A;  1Q86 U;  4M7D D;  3MEU A;  4FT2 A;  1M1G A;  3EGD A;  4M7A G;  1VQ9 T;  2DKG A;  2EQJ A;  2GTJ A;  4E7S A;  3CC7 Q;  3SWN C;  2ROT A;  3V7S A;  2OTL A;  1NG2 A;  4ZGJ B;  3QKJ A;  1RL2 A;  3M9Q A;  5FLX E;  3CCQ Q;  3I35 A;  2JM8 A;  2MPX C;  2QXF A;  5IXF A;  1HXD A;  4ME7 A;  2RHX A;  3JB9 D;  1RAF B;  2DEQ A;  3A8G B;  3A5Z B;  5CQY A;  4NL2 A;  1RAD B;  1H92 A;  1IHW A;  1R0B G;  4PK4 A;  1I07 A;  2DYI A;  2QI2 A;  1WHH A;  2PUO B;  4AG1 C;  4C92 E;  1SG5 A;  2LQ8 A;  3JCM P;  2E6Z A;  1EX4 A;  2PU9 B;  4FYW B;  1E6G A;  2KSS A;  2ZPF B;  3KXT A;  1U3O A;  2ZZD A;  2VC8 A;  1G3Y A;  2JMA A;  4HCZ A;  2MOX A;  3M55 A;  2RHI A;  2HDA A;  4J9G A;  3RMS A;  5CKB A;  1M8V A;  4M75 B;  1TXQ A;  2HBW A;  5GMK m;  2XDB A;  1FYN A;  1VQ5 T;  4E7K A;  2RD1 A;  3QSU A;  3E1S A;  3CME A;  3REB B;  1VQN A;  5KCO A;  1QW1 A;  1M90 C;  4HVV A;  3QDR B;  3F70 A;  4OML A;  1NEB A;  2FRY A;  5J39 A;  4A54 A;  3GPL A;  1PSE A;  2HQE A;  1VQM Q;  3OS0 A;  4BAC A;  3CBM A;  2BKD N;  3OYC A;  2KRS A;  2YUQ A;  2FPD A;  2RJE A;  3M53 A;  3EH1 A;  3L2V A;  1PD1 A;  3CC2 A;  3C94 A;  3X28 B;  3A1P A;  3JSC A;  4BY6 B;  3M5A A;  2QQA A;  4C8Q G;  1X6O A;  4M78 F;  3MET A;  1I4K 1;  5CIU A;  3N5B B;  1S72 A;  2EQU A;  4J6X A;  2F1L A;  3S6W A;  4OMN A;  5FU6 C;  4L6V 5;  3FDR A;  2DX1 A;  3X26 B;  2DJQ A;  3J80 E;  1K8A C;  2YWW A;  4RTZ A;  3OS2 A;  3D7S B;  2ZAE A;  2FPE A;  4JUV A;  1D0Y A;  2QTV A;  2L3P A;  1G5V A;  2ZPB B;  3LWH A;  2QQS A;  4F7U G;  4C92 G;  1M4Z A;  2L5Q A;  3EG9 B;  2RF0 A;  3LYI A;  3JCM V;  3REA B;  3DLM A;  1I0C A;  2YRD A;  3EG1 A;  4DBH A;  3IQL A;  1D3B B;  3WVD B;  5I11 A;  2CKK A;  3CC7 T;  2HL3 A;  2CSI A;  2DK3 A;  4C5G A;  4PJO A;  1K0S A;  4GLM A;  4ORZ A;  3CCQ T;  3VS4 A;  1YN8 A;  2HMA A;  1WX6 A;  3UA7 A;  1D1A A;  2O2O A;  2P84 A;  1SRM A;  1JBM A;  1OZ3 A;  4PKC C;  5GAN 5;  2EYQ A;  4ZN3 A;  2CUB A;  1K8A R;  4M75 F;  2ECZ A;  3UF4 A;  1NM7 A;  2EWN A;  4BUG A;  4RTY A;  1JJ2 A;  4MDW A;  3E19 A;  1JEG A;  1T3L A;  5GMK h;  2E4H A;  2CS7 A;  4EIK A;  2XID A;  4N4G A;  3LWI A;  5IHK A;  4EMH A;  2QA4 Q;  1BKB A;  2RPN A;  4M78 C;  4RTT A;  2XIC A;  2MAM A;  4GBQ A;  3OW2 S;  5HK3 A;  2SEM A;  1VIE A;  1J3T A;  1QKW A;  3CCR A;  1SEM A;  4LDX A;  1BB9 A;  2C0I A;  1OV3 A;  5LJ5 h;  9ATC B;  3DB4 A;  4HKE A;  2C0T A;  1KQS A;  2DL5 A;  4M77 F;  3MEA A;  2EIF A;  5AYF A;  3JCM W;  2NUT A;  3G6E T;  2CP6 A;  4X9C A;  1VQ6 Q;  1WJS A;  4E7I A;  1TH7 A;  3JRZ A;  5FRM A;  2DXC A;  3OYA A;  1VQ7 Q;  4PJO E;  3EFO A;  4PFO A;  1Q86 C;  4JJC A;  4DOV A;  2OI3 A;  1M1K U;  1WHK A;  2L89 A;  3MJX A;  2AK5 A;  4M7D E;  2L2P A;  1PD0 A;  4FM4 B;  1UHC A;  3OBY A;  5GMK e;  1LNX A;  2CZ6 B;  1X43 A;  1Z9Q A;  3EHR A;  2CP3 A;  2DZC A;  4XTV A;  1YIJ A;  3J81 E;  2FZC B;  5FRN A;  3CCJ T;  2F5T X;  1TSF A;  2CH4 A;  4E7Z A;  1KSW A;  4M75 C;  1IHV A;  5GMK l;  1RAE B;  1M27 C;  2J6K A;  4N4H A;  1QP2 A;  2RMO A;  1YHQ Q;  1H3H A;  1KQS S;  4QT7 A;  4FW1 A;  1SRL A;  1BK2 A;  3VS1 A;  1QCO A;  3CCE T;  5GAN h;  1UG1 A;  1RI9 A;  2SRC A;  1M2V B;  3EHQ A;  1IRX A;  2DXU A;  3VUB A;  1ZSG A;  4J8O A;  4ZTJ A;  1AHJ B;  4EMG A;  1KQ2 A;  3J7A F;  2ROL A;  4M77 C;  4BY6 C;  2R57 A;  1U1S A;  4JZ4 A;  1MMD A;  1BYM A;  1HD3 A;  4JJB A;  1UEC A;  2ZPG B;  3CPW P;  3VRY A;  3G71 Q;  5I2S A;  2P0K A;  3E2U A;  4Y91 A;  2PVG B;  4D8K A;  2J05 A;  3C4S A;  4ZNX A;  2KAF A;  2LQK A;  4BE2 A;  4BD3 A;  1PRL C;  2RJF A;  2FVU A;  4OB3 B;  2QA4 T;  1VQK A;  4QQD A;  2L3R A;  3OYI A;  1ZUY A;  4PJO G;  2X4X A;  1D0Z A;  2VB6 A;  1VQL Q;  3CC4 Q;  4C0D B;  4JDS A;  1B34 B;  3CXC P;  1SKU B;  1VQO Q;  4M7D F;  4C0G A;  4PJM A;  5GAN e;  2LC4 A;  1KIK A;  3SWN A;  1C0M A;  2DL8 A;  4Y28 E;  1GBQ A;  4B9X A;  1M9S A;  1GFC A;  1KFZ A;  3LH5 A;  4FCY A;  2KE9 A;  1R77 A;  1UJ0 A;  4NL3 A;  4EPC A;  1BU1 A;  4A63 B;  3HTR A;  3CCM A;  1YJW A;  2QEX Q;  3M0P A;  1VQ6 T;  1DJ7 B;  1N6A A;  4D8D A;  2HBP A;  3JB9 F;  2CDT A;  2K5F A;  3A8O B;  2CP5 A;  2V8K A;  3UAT A;  1VQ7 T;  4KRT A;  2PNI A;  4KGX B;  3PMT A;  3I56 A;  2X51 A;  2VYT A;  2EKH A;  1TUG B;  4L5G A;  1HSQ A;  2IVW A;  3GP8 A;  2DA9 A;  5DLO A;  3VS6 A;  2OTJ Q;  4PJJ A;  4JPB W;  2P0Q A;  3CBP A;  4QW2 A;  4L59 A;  2LCC A;  2B8A A;  3GNF B;  1N8R C;  1MHN A;  1WZO A;  3OQ5 A;  3X20 B;  1SPK A;  3OYD A;  1GFD A;  4JLI A;  5HY6 A;  2E70 A;  3EGX A;  5FWB A;  1W2B P;  1AD5 A;  5M9O A;  3HRU A;  1ZBJ A;  1YHQ T;  2XI9 A;  1QVG A;  4LDV A;  1ACM B;  2M02 A;  3CCU A;  2LRQ A;  4LXC A;  4OF1 A;  4KBM B;  1WA7 A;  1MGQ A;  3CQT A;  3CMA A;  2DYB A;  2RM4 A;  1EZZ B;  1X75 C;  4M7D C;  1VQ8 Q;  1F1B B;  4M75 D;  1D1B A;  3OY9 A;  2DER A;  2CT4 A;  5AT1 B;  1ZLM A;  2KRM A;  1U8R A;  1KC8 U;  2CZ0 B;  4J9E A;  1K1Z A;  2GBQ A;  2EYW A;  3PGG A;  2DRK A;  1YWO A;  3MP8 A;  4MMK A;  4XTX A;  3UDC A;  1BI1 A;  1N8R R;  2JTM A;  1AWJ A;  3LW5 E;  4FL6 A;  4FYY B;  3MCA B;  1CKB A;  1QKX A;  2D9T A;  4PL6 A;  1AOJ A;  3G71 T; 
#chains in the Genus database with same CATH homology
 1SHF A;  2ROT A;  1NG2 A;  3M0U A;  2D8J A;  3I35 A;  2JM8 A;  5IXF A;  2BTT A;  1VYT A;  1S1N A;  1UJY A;  4E6R A;  2FPF A;  2CRE A;  2HEQ A;  3O5Z A;  1ABO A;  5FWC A;  2CUD A;  1PHT A;  1H8K A;  3TSW A;  1H92 A;  2LNH B;  2KR3 A;  1I07 A;  1PKT A;  2F2W A;  4AG1 C;  1TUD A;  2JMC A;  4JZ3 A;  2EW3 A;  1YWP A;  1LCK A;  2RQU A;  2EYX A;  1E6G A;  2F2V A;  1M3A A;  1U3O A;  1JXO A;  2JMA A;  4X1V A;  2B86 A;  2YUN A;  2MOX A;  2HDA A;  4J9G A;  4AFQ C;  3H0I A;  4RTW A;  4OMM A;  2V1Q A;  1X2K A;  2EBP A;  3TVT A;  1GL5 A;  2HBW A;  4J9I A;  4AFS C;  3VS5 A;  4RTV A;  2JM9 A;  1FYN A;  2FO0 A;  4HXJ A;  2BZY A;  3QWX X;  1UHF A;  1WYX A;  2L3S A;  3REB B;  1BBZ A;  4J9D A;  1AZE A;  4HVV A;  3VS2 A;  4OML A;  1NEB A;  3I5S A;  2FRY A;  1V1C A;  2RNA A;  1PKS A;  1M3B A;  2W10 A;  1AWW A;  2KRS A;  2KYM A;  2YUQ A;  2FPD A;  2EQI A;  4IIM A;  2DBK A;  4RTX A;  4IIO A;  3THK A;  3I5R A;  1N5Z A;  4CC7 A;  2I0N A;  2ABL A;  1WFW A;  2DF6 A;  2YDL A;  1X6G A;  2HCK A;  4RTU A;  4HCK A;  4OMN A;  2BZ8 A;  2CSQ A;  2X3W D;  1IO6 A;  3RBB B;  2K7A A;  1X2Q A;  2DX1 A;  2LQW A;  2DJQ A;  1ABQ A;  5HCK A;  1K9A A;  1X6B A;  4HVW A;  2EVR A;  4RTZ A;  3VS7 A;  1VYV A;  1GCP A;  1SSH A;  2EGC A;  2DL4 A;  2JTE A;  1GRI A;  2LX7 A;  2FPE A;  2LP5 A;  2J6F A;  4CC3 A;  2YUO A;  1UFF A;  2L3P A;  2VWF A;  3TSZ A;  2J6O A;  1AEY A;  5GJV B;  1TG0 A;  2RF0 A;  3REA B;  4CC4 B;  1I0C A;  2K9G A;  3EG1 A;  2A28 A;  2KRO A;  1OPL A;  3IQL A;  2K6D A;  3ZL7 C;  3U23 A;  5I11 A;  1UUE A;  2LZ6 B;  5I22 A;  2GNC A;  2CSI A;  2KGT A;  4F14 A;  1K0S A;  4GLM A;  1WLP B;  2E5K A;  4J9F A;  3ULR B;  4Z89 A;  4ORZ A;  3QWY A;  1CKA A;  2DL7 A;  1YN8 A;  4JJD A;  3VS4 A;  1WX6 A;  1UGV A;  3UA7 A;  2O2O A;  1JQQ A;  1MV0 B;  1SRM A;  3PE0 A;  1UE9 A;  3PVL A;  4F17 A;  2CUB A;  3JV3 A;  2JT4 A;  1KJW A;  2ECZ A;  2MIO A;  3UF4 A;  1NM7 A;  2K2M A;  4RTY A;  2AKL A;  1JEG A;  1T3L A;  4EIK A;  5IH2 A;  3UA6 A;  5IHK A;  2RPN A;  1QCF A;  1T0J A;  2FRW A;  4RTT A;  4K11 A;  2C0O A;  4GBQ A;  5FW9 A;  1QWE A;  3M0R A;  1B3Q A;  2SEM A;  3VS0 A;  1J3T A;  1ZUU A;  1QKW A;  2GGR A;  1SEM A;  2RQV A;  3SEM A;  1BB9 A;  2C0I A;  2EGA A;  1OV3 A;  1GBR A;  2C0T A;  2DL5 A;  3FJ5 A;  2ED0 A;  3VS3 A;  1E7O A;  3RNJ A;  1M8M A;  2ESW A;  3GBQ A;  2O9V A;  4LN2 A;  2KBT A;  2L3Q A;  4J9H A;  4JJC A;  1TUC A;  2CT3 A;  3NHN A;  1WDX A;  2OI3 A;  5IHI A;  1JU5 C;  4DEX A;  4DEY A;  2X3X D;  5GJW B;  2CH4 W;  2AK5 A;  4CC2 A;  2DNU A;  2L2P A;  3M0Q A;  2DMO A;  2VVK A;  2JS0 A;  1VYU A;  1UHC A;  1UTI A;  2HSP A;  1X43 A;  1Z9Q A;  3EHR A;  2LMJ A;  1OPK A;  4J9B A;  2OJ2 A;  1WXU A;  2YT6 A;  2AZS A;  1B07 A;  2J06 A;  2KXC A;  5IXB A;  2CH4 A;  1KSW A;  2JS2 A;  1M27 C;  2J6K A;  3EG2 A;  3EG3 A;  2RMO A;  2QDL A;  2ED1 A;  2EPD A;  1H3H A;  2ENM A;  4QT7 A;  1SRL A;  2DL3 A;  1NYF A;  1BK2 A;  3VS1 A;  1JO8 A;  2AZV A;  2GTO A;  2RQR A;  1WXT A;  1UG1 A;  2K79 A;  1RI9 A;  2RQT A;  2SRC A;  2KT1 A;  1AVZ C;  4OMP A;  4LUD A;  3EHQ A;  2LCS A;  2DE0 X;  1ZSG A;  1UDL A;  4R0K A;  4J9C A;  1WIE A;  2XMF A;  1W6X A;  1Y0M A;  1HJD A;  1U5S A;  1G2B A;  1E6H A;  4AG2 C;  2FG0 A;  4LNP A;  2AKK A;  2ROL A;  1Z9Z A;  2KXD A;  1YNZ A;  1A0N B;  3H41 A;  4LE9 A;  2DM1 A;  2NUZ A;  1K4U S;  1W70 A;  2LJ0 A;  1RLQ C;  4JZ4 A;  4OMO A;  1HD3 A;  4JJB A;  1UEC A;  1MV3 A;  3VRY A;  1PNJ A;  4WCI A;  1NLO C;  4D8K A;  2J05 A;  4ZNX A;  1ARK A;  1PRL C;  2KRN A;  2PZ1 A;  1PWT A;  1T0H A;  1NLP C;  2P4R A;  1OEB A;  2M51 A;  1CSK A;  1ZUY A;  4F16 A;  2O31 A;  1Y57 A;  1ZX6 A;  2LQN A;  1AZG B;  3H0H A;  3KFV A;  1KIK A;  2DL8 A;  2W0Z A;  1GBQ A;  2D0N A;  2O88 A;  3M0T A;  4AFU C;  3NPF A;  3PVQ A;  1GFC A;  1KFZ A;  2MCN A;  3LH5 A;  2V1R A;  3EG0 A;  2RN8 A;  2KE9 A;  1EFN A;  4Z8A A;  2DBM A;  1UJ0 A;  2G6F X;  1BU1 A;  1NYG A;  2FEI A;  2M0Y A;  4A63 B;  1QLY A;  1JXM A;  3NMZ C;  4Y92 A;  4M4Z A;  3M0P A;  1YP5 A;  2KT8 A;  4D8D A;  2CDT A;  1MUZ A;  3I9Q A;  2J7I A;  2DVJ A;  2A08 A;  1M30 A;  2VKN A;  2YUP A;  3UAT A;  4OMQ A;  1G83 A;  4FSS A;  4KRT A;  2PNI A;  3EGU A;  1XOV A;  2RQW A;  1PRM C;  2EKH A;  3SHW A;  3NGP A;  2L0A A;  5ECA A;  1HSQ A;  1I1J A;  1AWO A;  5EC7 A;  2GQI A;  2DA9 A;  2A36 A;  3VS6 A;  1U06 A;  4JPB W;  3A98 A;  3VRZ A;  2JW4 A;  2K3B A;  2KNB B;  3H0F A;  2EGE A;  5L23 A;  1M3C A;  4AFZ C;  1T3S A;  1YCS B;  1SPK A;  1GFD A;  5FWB A;  1VA7 A;  1AD5 A;  2IIM A;  2YSQ A;  2JXB A;  1SHG A;  1RLP C;  1ZBJ A;  4RUG A;  1QWF A;  1NEG A;  5IHN A;  1W1F A;  2NWM A;  2DIL A;  2H8H A;  1X27 A;  1WA7 A;  3CQT A;  2DYB A;  3R6N A;  2A37 A;  2D8H A;  3C0C A;  2OAW A;  1WXB A;  2EYY A;  1GCQ C;  4Z88 A;  2PTK A;  2D1X A;  1FMK A;  2CT4 A;  2BZX A;  4ESR A;  1WI7 A;  1ZLM A;  2KRM A;  4LUE A;  4HVU A;  2O9S A;  2DLP A;  2F2X A;  3M0S A;  2KEA A;  4J9E A;  1K1Z A;  2GBQ A;  2EYW A;  2LJ3 A;  2DRK A;  1YWO A;  1K0X A;  1ZUK A;  2EYZ A;  1K76 A;  1X69 A;  1RUW A;  2DRM A;  1AWJ A;  1CKB A;  1OOT A;  1QKX A;  1AOJ A;  1GCQ A;  2LJ1 A;  2KYB A;  1AWX A;  2GTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...