1I07A

Eps8 sh3 domain intertwined dimer
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i07A00
2D1XA 2LQWA 1RLQC 2OAWA 4RUGA 2G6FX 3REAB 4IIOA 1AEYA 2KT8A 2ENMA 1X69A 2D0NA 3EG0A 2LNHB 3PVLA 4JPBW 1SRMA 2RQRA 1AVZC 4M4ZA 1N5ZA 1WI7A 3M0TA 2KXCA 2L0AA 2XMFA 1PKSA 2MCNA 5HCKA 2EYXA 2ED1A 1E6GA 2FRWA 2DBKA 1Y0MA 4J9HA 1OOTA 1OPKA 2HDAA 1UECA 2RQTA 2GBQA 3NPFA 2DRKA 1IO6A 3PVQA 2K7AA 2PNIA 2O2OA 1WXBA 3R6NA 1NG2A 2K2MA 1ZUYA 2FRYA 5I11A 4A63B 2EGEA 1JXMA 3EHRA 2GQIA 2JXBA 2VKNA 1SPKA 2K9GA 1I1JA 1T0JA 2I0NA 4RTZA 2L3PA 4ESRA 1TUDA 1UTIA 1QKWA 1YN8A 2W0ZA 2PTKA 3O5ZA 2C0OA 3PE0A 1GRIA 3THKA 1GCQC 3REBB 3ZL7C 1JEGA 3JV3A 2LQNA 1G83A 1JQQA 5GJWB 1EFNA 2A36A 3H41A 1UG1A 1HSQA 2KGTA 2O9VA 5IXFA 2EVRA 5FWBA 1K1ZA 1T3SA 2AK5A 4J9DA 2EYYA 4AG1C 1ZBJA 1PRMC 4JZ3A 2RPNA 2X3XD 3SHWA 2HCKA 1CKBA 1ZLMA 2FPFA 3VS1A 1J3TA 2GTJA 3VS0A 2LJ0A 2DE0X 1RI9A 4DEYA 4CC3A 4J9BA 3M0UA 1PHTA 2CH4A 1NEBA 1E7OA 2X3WD 2CH4W 4AFZC 2DL5A 1QKXA 2EYZA 4J9EA 2KNBB 3LH5A 2SRCA 2JT4A 4J9CA 1X43A 1WDXA 3RNJA 5IHKA 2W10A 2K79A 2CSIA 4LN2A 2JMCA 5I22A 1OPLA 4J9IA 4CC4B 1KSWA 1BU1A 2B86A 2GTOA 2JMAA 2CDTA 2DBMA 4Z8AA 2EGCA 1AWOA 1ZUUA 1NYGA 2CSQA 2DL3A 4LUEA 2JW4A 2P4RA 2YDLA 5IH2A 4AFSC 1JU5C 2NWMA 1LCKA 1M3CA 1NLOC 3EGUA 4E6RA 3GBQA 2D8HA 2KT1A 1YWPA 3QWYA 2DL8A 2LJ1A 5FWCA 5IXBA 3EG1A 1NYFA 1JXOA 2IIMA 2DVJA 3M0SA 1GCQA 1M8MA 4R0KA 4JJBA 4HCKA 2DF6A 2FG0A 2RQUA 2DA9A 4RTVA 4F17A 2KE9A 4J9GA 2CUDA 2DNUA 1ZX6A 2KR3A 1NEGA 1K76A 1X2QA 2V1RA 2KYMA 2MOXA 3H0HA 2H8HA 2AZSA 1YCSB 4ZNXA 2J06A 2FPEA 2CUBA 2VVKA 2L3SA 3H0IA 4KRTA 1UJ0A 2ABLA 1VYVA 1RUWA 1JO8A 1WYXA 2ED0A 4GBQA 1WIEA 1VYUA 3EHQA 1Y57A 2JS2A 2JTEA 1K0SA 4JZ4A 1CSKA 1GBRA 2A08A 1QWFA 2DLPA 2NUZA 2A37A 3VRYA 2BZXA 1H92A 2QDLA 2YT6A 3NGPA 1XOVA 1VYTA 1SEMA 2YUPA 2V1QA 4HVVA 2KRMA 3QWXX 3TSWA 1K9AA 1M3AA 4JJDA 2LCSA 1Z9QA 2EW3A 4OMMA 2FPDA 1VA7A 2RNAA 1GBQA 2RMOA 2VWFA 2KBTA 2KROA 3A98A 1UE9A 4OMPA 2BTTA 1FMKA 4HVUA 1AWJA 2ESWA 1WA7A 1WLPB 1RLPC 1MV0B 2L2PA 2D8JA 4WCIA 1CKAA 2DM1A 2KRSA 2L3QA 3CQTA 4GLMA 1WXTA 2J7IA 1YNZA 2HSPA 1B07A 1ARKA 4Z88A 2YSQA 3EG3A 2K6DA 1X6GA 3I35A 2EQIA 1Z9ZA 2DRMA 1AWWA 3UATA 2DX1A 2RF0A 5ECAA 4RTUA 2YUQA 2C0TA 1GFCA 4F16A 4AFUC 4D8KA 1W70A 3I9QA 2EPDA 2SEMA 4Z89A 3M0QA 2FEIA 2YUNA 3VS2A 2A28A 4JJCA 5GJVB 1A0NB 4QT7A 1B3QA 1AZGB 2BZ8A 1HD3A 2J6OA 1UGVA 4OMNA 2GGRA 4K11A 1PNJA 3SEMA 5FW9A 4RTYA 3VS6A 2J6FA 1GL5A 4CC7A 5IHIA 3M0RA 1AZEA 1WX6A 2M0YA 1ZUKA 1QLYA 2DYBA 3TSZA 1KJWA 2PZ1A 4J9FA 1AWXA 4FSSA 4CC2A 3KFVA 2AZVA 1T3LA 4DEXA 4RTWA 2HBWA 1UUEA 1GFDA 1U5SA 2YUOA 3VS7A 2RQVA 1OEBA 1I0CA 4LUDA 2JM8A 2LMJA 4AG2C 1PWTA 3TVTA 1V1CA 1I07A 1UFFA 2AKLA 4OMOA 3C0CA 2DJQA 5IHNA 4ORZA 3VRZA 4F14A 2DMOA 1SHGA 2EKHA 1BK2A 1SSHA 1UHCA 1UJYA 2RQWA 1NM7A 2F2WA 3VS4A 1NLPC 1BB9A 1FYNA 2RN8A 4AFQC 1K4US 1PKTA 1KIKA 2LJ3A 3ULRB 2JM9A 4IIMA 4X1VA 1UHFA 1WXUA 1M27C 3FJ5A 2CREA 1ZSGA 2DL4A 4RTTA 1X6BA 1YP5A 2JS0A 1G2BA 3NMZC 2LX7A 1KFZA 2F2XA 3M0PA 2M51A 1X2KA 1MV3A 2HEQA 2MIOA 2ROTA 2KYBA 1SRLA 1H3HA 3RBBB 1SHFA 1UDLA 3NHNA 4HVWA 3UA6A 1MUZA 1E6HA 2J6KA 2C0IA 3VS3A 3H0FA 2ECZA 2LP5A 2LZ6B 2KRNA 1M3BA 1AOJA 1TUCA 2KEAA 1QCFA 2DL7A 2O9SA 3UF4A 3U23A 2GNCA 4OMLA 3IQLA 1QWEA 2DILA 1OV3A 4LE9A 2EYWA 3I5SA 4HXJA 3UA7A 1AD5A 4D8DA 5L23A 5EC7A 2J05A 2K3BA 2EBPA 2O31A 4RTXA 2BZYA 2CT3A 1HJDA 1BBZA 1U06A 1YWOA 3EG2A 2KXDA 1T0HA 1PRLC 1ABQA 1TG0A 1U3OA 2F2VA 2E5KA 3VS5A 4EIKA 1GCPA 2EGAA 2CT4A 2OI3A 1K0XA 1X27A 1WFWA 1W1FA 4LNPA 2FO0A 2AKKA 2OJ2A 1W6XA 1H8KA 2ROLA 1ABOA 1M30A 3I5RA 4Y92A 1S1NA 4OMQA 2O88A
chains in the Genus database with same CATH superfamily
1IHVA 3V8JA 4IIOA 1VQMA 1X69A 3X25B 3P8BB 2LNHB 3J7AF 4JPBW 5I2SA 2OTLA 5L8RE 1WI7A 4PJOC 2MCNA 2DETA 3M53A 2ED1A 1E6GA 4LDWA 1YHQT 3X20B 3OBYA 3I56A 1OOTA 4JJNK 4PJJA 2JTFA 1WHMA 2AIRB 3NTHA 1WHHA 2RQTA 4BD3A 1IO6A 2PNIA 4XU1A 1ZUYA 3OW2A 3CCST 3M4YA 1EX4A 1NBEB 5HY6A 4A63B 1DJ7B 5IT9E 2E65A 4OVAA 1FXXA 4M78E 1M1KR 3G6EA 4IUUA 5CKBA 2VKNA 3UT1A 1SPKA 2I0NA 4PNOA 4M75B 1TUDA 3LWIA 1YN8A 2PTKA 5LJ5j 1VUBA 3O5ZA 3CCSQ 4ZGEB 2E70A 3OYHA 2HKQB 1RL2A 1G83A 2M1HA 4B9XA 2XK0A 5GJWB 5LJ5g 1VQ6Q 1HSQA 2KGTA 5IXFA 2EQMA 2K5IA 3CCQQ 1T3SA 2QEXT 2EYYA 2C06A 1ZBJA 3TU4K 1PRMC 1MNDA 2RPNA 4EMKB 1WJQA 5IN1A 1PM3A 2GTJA 1MMNA 4DEYA 3VUBA 2ZPIB 2D9TA 2CH4A 4MDXA 2X3WD 1M8VA 1QKXA 2E3HA 2EYZA 2KNBB 1VQ4A 1IRXA 3LH5A 2SRCA 4EMKC 3CCLT 2O88A 4D6WA 3RNJA 1YCYA 2W10A 3JCMc 4C0FA 1FWZA 4JDSA 3CC7T 1UEBA 1OPLA 5KCOA 1KSWA 1BU1A 3G7ZA 1VQLA 5CK9A 4N0AC 4Z8AA 4LUEA 2JW4A 4LDYA 2NWMA 4BI3A 1LCKA 4E6RA 4M77F 4A53A 4FCYA 1IXDA 1YWPA 2DTHA 3I55T 1K8AC 3G71Q 5KCHA 3ER0A 2KSSA 1VQKA 1WHKA 4R0KA 4F7UA 4HCKA 5DM7R 2RJCA 2MPXC 2KR3A 3H0HA 1X2QA 1M1KC 2MOXA 3JCMJ 1WJRA 1R77A 4X34A 4E7HA 2AT1B 4JLIA 4QVCA 4N4IA 1VQKT 5M9OA 2J06A 2FPEA 1M90C 3NTKA 4KRTA 2ABLA 2RJFA 2YRVA 3OQ5A 1YJ9Q 1TSFA 5HK3A 2QQBA 4DBHA 3R6OA 3A8GB 5GAN5 2R5AA 1NPPA 3SB2A 1Q81U 4OB0B 1CSKA 1GBRA 2R58A 2GCXA 2XDBA 2CP5A 2QA4Q 3CD6T 2BZXA 5FU6B 2YT6A 4A54A 2XDDA 2V1QA 2KRMA 3TSWA 1K9AA 2DXBA 4HT9A 1YJNQ 4FU6A 1Z9QA 1M2VA 1XNIA 2DEQA 3CXCP 5CCAA 1K9MC 2IG0A 4B9WA 2RNAA 1GBQA 1N8RU 4FYXB 5KE2A 9ATCB 2V8IA 2DD4A 1BCOA 3H6ZA 1YIJQ 5GAOp 1AWJA 1PC0A 1RACB 1RLPC 3OYMA 2D8JA 2DM1A 3EFSA 2JUFA 1UGQB 1VQ6A 1S72A 4Z88A 5GMKj 1Q86C 2VV5A 4X9CA 3MEVA 3V8KA 2VXEA 1Z9ZA 1AWWA 4M7DE 2GFAA 3JB9F 2RF0A 3RMQA 3X28B 4RTUA 2YUQA 1IZ6A 4F16A 1U8RA 3O8VA 4D8KA 4A4GA 2COWA 3I9QA 2DK3A 4M77D 4Z89A 3M0QA 1LVKA 5LJ3f 2VB6A 1NJIU 2A28A 4JJCA 5GJVB 3RR6A 2FZKB 2CYZB 3EAEA 3RKXA 2GF7A 1VQLT 1AZGB 1H3ZA 4KH0B 1BI2A 3M58A 3X24B 2J6OA 4DBQA 2XI9A 1VQNT 4RTYA 1PSEA 2J6FA 2MWPA 5IHIA 1AZEA 1N27A 1Q95G 2DXTA 3E9GA 2FZCB 1VQ7A 3CCJA 4FSSA 4M7AE 1VQMT 3KFVA 2AZVA 4DEXA 3G71A 5IAYA 1UUEA 1OQKA 3HTRA 5GMKl 3VS7A 5GMKi 5CQYA 2CGHA 2X4JA 2EJGA 2JM8A 4M7AA 1VQ5T 4AG2C 4UC4A 3VJPA 3OB9A 3DB4A 3TVTA 1AHJB 1VQMQ 4OMOA 3VRZA 2DMOA 2VGMA 2EIFA 2QXFA 5FROA 3CC7Q 3L2UA 1PD0A 1BK2A 1SSHA 3OYCA 3OYAA 1FMVA 2RQWA 4PLLA 1QVPA 3TREA 4IUPA 3GOXA 4C8QG 1FYNA 2V8JA 3QYGB 2IVWA 4NOYA 5CR2A 1KG1A 4BI4A 4IIMA 4PJOG 2BIVA 3J80E 2RI2A 4M7AB 5A0DA 1G3TA 4DOVA 1YP5A 4M7DF 3NMZC 2OTLQ 2LX7A 3I55A 1X2KA 2M51A 3LYIA 4O5VA 4GY5A 2KYBA 3CCMA 3OMCA 4HT8A 1H3HA 1UGPB 3RBBB 4KBMB 4FW1A 1UDLA 2CZ6B 2PU9B 2EAYA 2EWNA 3CC2A 2J6KA 2LT1A 1OU8A 4ZN1A 4C0DC 3HRUA 2O9SA 2DL7A 2E10A 2O4XB 3RKWA 1JB0E 1TOVA 2R57A 1D0XA 1R0BG 3FLGA 3RUXA 2DILA 4LE9A 2HSEB 4D8DA 1D3BA 4HXJA 5GAOr 2K3BA 1QP3A 3H9NA 5A0LA 1SSFA 5AYFA 2KXDA 3CBOA 3JCMh 5FU7B 3DKMA 1LPLA 1U3OA 2F2VA 3CMEQ 2FL7A 1VQ8T 5LJ3d 4KUIA 2RD1A 3L2RA 1WFWA 1W1FA 4N0AA 3LGLA 4DBFA 2LRQA 1D09B 1ZA2B 2NYSA 4M77E 4IURA 5LJ3h 2XD0A 1ABOA 4VUBA 2RK1A 3SWNC 2XG8D 4Y92A 2D1XA 4FYWB 1VQ8Q 1KHCA 1RLQC 2G6FX 3ZFJA 2KY9A 3CD6A 1AEYA 2P84A 1M1GA 3BFMA 3EG0A 3P8HA 3HHTB 1AVZC 2VASA 1N5ZA 3SWNB 2F5KA 3OSVA 4FT2A 2XMFA 1PKSA 2K3YA 3S3MA 5HCKA 2CP6A 3ZBDA 3QDRB 1OPKA 3OA6A 2HDAA 2HKNA 4XQ3A 4XTVA 4MMLA 2DO3A 2O2OA 1WXBA 3R6NA 1VQ7Q 1BIAA 1NG2A 5KYUB 1ZSZA 2K2MA 3G71T 2EFIA 5I11A 4BI8B 2OTJA 3EHRA 3QZ5B 2GQIA 1MMDA 2JXBA 2K9GA 4C92B 1I1JA 5J3BA 1HYOA 1BYMA 4OGCA 3QHSA 2QGFB 4M75F 1UTIA 1Y96B 2K5LA 2W0ZA 1VQ7T 2COYA 5KYXA 2KAFA 1D3BB 2R5MA 3ZEHA 2AHJB 2C0OA 1GCQC 3ZL7C 1Q82C 2RI5A 4PFZA 1F1BB 1JEGA 5KH6A 3CCEA 4M77G 2EJFA 5DY9A 1EFNA 4F7UF 1OYXA 2KI7A 3OW2S 4PLIA 2EVRA 5GAOl 1KHIA 4AG1C 4M7AD 4LDXA 2QA4A 4XTUA 3CCUA 3CC4Q 4XTWA 2YXYA 3SHWA 2HCKA 1CKBA 1ZLMA 2FPFA 4CC3A 5AT1B 3FB9A 3I55Q 4J9EA 2EQJA 4DBRA 1PG5B 4M7DC 4J9CA 4Y28E 1X43A 1R8OB 3BY7A 3A8HB 4BE2A 4EMHA 3VYHB 4HA8A 2A7YA 5KYWB 4M75D 3DLMA 1ZUUA 2DL3A 2ZPHB 3RIRA 5LJ5f 3CXCA 5IH2A 5GAN3 4AFSC 1JU5C 2LT4A 4J6YA 4M7DA 2MWOA 4XTZA 2VYTA 2KT1A 2E4HA 5GAN4 3QWYA 2LJ1A 3CMEA 1YITT 2RH2A 5D6YA 4PJNA 3EG9A 2IIMA 2ZPEB 1M8MA 1BIBA 3SFMA 2RQUA 4OMFB 3MHXA 4J9GA 3JB9H 2CUDA 4F7UB 1M90R 3OYJA 3CMAQ 2QG9B 4HKEA 1M1FA 3C94A 4MZPA 4XU3A 3CD6Q 2AZSA 3URGA 2H3EB 2E5QA 3AT1B 2YLBA 4QVDA 1UB4A 3QKJA 3CCET 2X4WA 3GIBA 2DPPB 5D6XA 3JCMd 1UJ0A 3HPWA 1RUWA 3QO3A 2CP2A 3EG9B 2ED0A 3MKDA 4RKUE 1B34A 4HCBA 2JTEA 2M9UA 4JZ4A 3CC2T 1W2BA 2KMTA 2A37A 1TS9A 3VRYA 2RJDA 1H92A 5FRNA 3WVEB 4A4FA 4A4HA 1WGSA 1SEMA 2BE7D 3INZA 3QWXX 1GXIE 1M3AA 5EG2A 4IUTA 2E1HA 1VQPA 4Z02A 2E12A 4FT4A 2ZGWA 3JB9I 1W2BP 2LCLA 4KGVB 2RMOA 1TH7A 2VWFA 2KROA 1YBYA 2ESWA 1WA7A 1WQWA 1WLPB 1MV0B 4WCIA 1LOJA 2L3QA 1YNZA 4M7DG 1ARKA 4JS4A 1BI1A 2KDSA 1K73R 3I35A 2DRMA 2V8KA 3EGXA 2DKGA 4M77B 3UATA 2Y90A 4OP0A 5ECAA 1I5LA 1I5OB 2YWWA 3HL8A 4ZGJB 4AFUC 2OTJT 4TVRA 4A4KA 2SEMA 2MYSA 4JRIA 1YJWT 3M54A 2FEIA 4RMOA 5LJ3e 4M7DD 2HNIA 3OS5A 3L1AA 3VS2A 1VQ4T 2QK0A 1Q82U 1A0NB 1XTDA 2I2LA 4QQ6A 2P0PA 3MEWA 1OU9A 1X6OA 3EGXB 3L2WA 1PCXA 5C6SA 1KC8U 4LD9K 1LNXA 3OMGA 4RCCA 2CP7A 5CVIA 1VQ5Q 1KD1R 3M0RA 2NLUA 1N8RR 3QIIA 3CCQT 5GAMj 3TSZA 1KJWA 2PZ1A 4PJOF 3CMET 1AWXA 1YITA 3CPFA 3E19A 5A0GA 3G1JA 2V26A 4C92E 1U5SA 3OS1A 1GFDA 2RQVA 1I0CA 4M7AF 1C6VX 5GAMg 2CZ0B 3L42A 2XDPA 2ZCFB 2VXFA 4F04B 3MJXA 1PWTA 4B6MA 2QYZA 3CPWP 2RJEA 1VQ8A 2DJQA 2MI6A 4RG8A 2RHIA 2Y4XA 5GAOq 4LD6A 2YHTA 1G8XA 2OTLT 2EKHA 1X75C 2P0KA 3JCMV 4F7UG 1FMWA 4IUQA 1NM7A 3VS4A 1BB9A 2RN8A 1K4US 1PKTA 3C12A 4FSXA 2VGNA 2LJ3A 3ULRB 3MP1A 4BACA 2QQSA 1UHFA 3FJ5A 1M27C 4J5YA 1Y96A 2PUKB 4M77A 1G2BA 1RADB 2F2XA 1JJ2A 1IGUA 1Q86R 1W4SA 2M0OA 2ROTA 4GLKA 1ACMB 5J39A 2OTJQ 1SRLA 1IB8A 4J7IA 1M90U 3NHNA 3G4ST 1E6HA 2C0IA 4F7UE 2LP5A 2KRNA 4PJMA 4J6WA 1M3BA 5HKCA 2ZPGB 2BE9B 4M75A 1VQ9A 3C4SA 3CC4T 2EYWA 3PNWC 5L23A 5EC7A 1VIFA 5CKHA 4RTXA 2B8AA 5GAMf 2CT3A 2Y4YA 3EG2A 5C0MA 1PRLC 1D0ZA 1TG0A 1M4ZA 1KD1C 5GMKh 4XU2A 2PQWA 2H3JA 4M75C 3JCMW 1X27A 4LNPA 2MK5A 4PKCC 2CKKA 3I56Q 3EH2A 1H8KA 3HFNA 4C8QD 4M7DB 2COZA 1M30A 1S72T 1QCNA 1VQLQ 3AHUA 1VQPT 4C5HA 6AT1B 1K8AU 2L8DA 2OAWA 2DZ9A 3REAB 2A0FB 2KT8A 2DFUA 2ATCB 2JNGA 3S6WA 3S3NA 2D0NA 3KXTA 4C0DB 4EMGA 3L2QA 4FW2A 4HCCA 1SRMA 2RQRA 2CZ7B 1C0MA 4KT0E 2L0AA 1V76A 3SWNA 2EYXA 3M59A 1O75A 2FRWA 2LCCA 3TEEA 4J7FA 3CCLA 2DBKA 3L2ZA 3OYEA 4J9HA 1UECA 4XK8E 4C0ZA 3NPFA 2WSCE 4RCBA 3OYBA 1G3YA 1OI1A 4M78B 2FRYA 1B34B 3KBGA 1JXMA 2HL3A 1OX9A 1V29B 5HK0A 3A8OB 3CBPA 3MEUA 1RAFB 3GNGA 4RTZA 3P8DA 1VOMA 4ESRA 1QKWA 3QUIA 1N9RA 3MP8A 2RB6A 1GRIA 2LNVA 4PFPA 5GANj 3NTIA 2L3RA 3REBB 5LJ5h 2JTMA 2XKOC 3JV3A 2Z0WA 4IKFA 2LQNA 1RAAB 3GF5A 2GFUA 1MNEA 3H41A 3LH0A 2O9VA 3T9NA 3VYGA 5GANg 2AK5A 3A1PA 1RAGB 4C8QA 2RHZA 4E7JA 4JZ3A 2PUOB 3EFOA 3CC2Q 4QVZA 1RAHB 4KUDK 5I2MA 4C5IA 2DIQA 3VS0A 2DE0X 1RI9A 4HCZA 3M0UA 4C8QE 4PK4A 5FU6C 5CO7A 3PIPA 4ZTFA 5GAMd 2XU8A 1WDXA 4M78F 4M77C 3CCUT 5IHKA 3HFOA 1OZ3A 2FZGB 3N5BB 1M2VB 2JMCA 3GPLA 1WHLA 3EFOB 2JMAA 2CDTA 2DBMA 1VQOA 4QQGA 1VQ9T 2CSQA 1BCMA 2QDYB 3MP6A 5LJ5e 2YDLA 1IGQA 1TU0B 4CRIA 3A8LB 3GNFB 1M3CA 2VUBA 2D8HA 2DL8A 5FWCA 3CCJT 4C92F 2ZPBB 3EG1A 5D6WA 1VQ4Q 3CC4A 2DF6A 4RTVA 3CXCS 4PFOA 2E64A 1XQHA 2EYQA 1NEGA 1K76A 4MMKA 1IHWA 5GANf 2H8HA 4BE1A 3RMSA 4PJOB 2L89A 4ZNXA 8ATCB 4M7AG 4KGXB 2KK4A 1PSFA 2L3SA 3BE3A 1VYVA 1ZBXA 2O01E 2NUPA 4M78D 2HD0A 4GBQA 3EHQA 1VYUA 1TTHB 4N4GA 2WACA 2A3LA 2E6ZA 2JS2A 4ATOA 3CCRQ 3META 1N9SA 1NZ9A 2BKDN 2LDMA 4EMKA 2RHUA 4C92A 4OGEA 2M02A 1SG5A 2PVGB 1YIJA 2QQRA 4QKUA 1NJIC 1WPYA 5FRMA 3NGPA 1XOVA 1S72Q 4DOWA 3VUZA 2NUPB 4JJDA 3I56T 4RG2A 2K3XA 4C92D 3JB9J 1G3WA 1NJIR 4R55A 3GP8A 2L5QA 3CMAA 4FYVB 2D6FA 3QSUA 2P4TA 2QA4T 5KE3A 3BDLA 1LJOA 2KVQG 3E9FA 4JRPA 1QVGP 1ZSZC 1WZOA 4KH1B 2BTTA 3HP9A 4HVUA 3L2VA 1RAIB 3CPWA 3WVDB 1P92A 2L2PA 1UGRB 3G4SA 1CKAA 4M75G 2RM4A 3CQTA 4L59A 3FJPA 4XTXA 2J7IA 1YI2A 1NE8A 1OULA 4BY6C 1N8RC 4MZTA 2GQVA 1YJWA 2F5TX 2QQAA 3EG3A 1YJNT 1IREB 1YJNA 3VV0A 2EQIA 3MPUB 2WSFE 4J83A 4C5EA 1GFCA 4LDVA 1W70A 5KYWA 4XTYA 1G5VA 2EPDA 5CAIA 3OYDA 1VQKQ 1UGSB 1YIJT 1QMCA 3NFCA 2P0QA 2F1LA 1YJ9T 2BZ8A 1VQPQ 1HD3A 3CCRT 2GGRA 2QGGA 4K11A 1PNJA 3PIOA 5FW9A 4C8QF 1JRIA 1GL5A 1KQ2A 4CC7A 3X26B 3CC7A 4C92G 3ME9A 2M0YA 3CCEQ 1QLYA 2DYBA 5GANd 4JRQA 4RTWA 2HBWA 5GAN6 2DIGA 2YUOA 2FB7A 4LUDA 3RDVA 2BUDA 5CKFA 1D1AA 4KGZB 1Q7YU 3LLRA 3CCUQ 7AT1B 4V2SA 4C92C 1I07A 2XHCA 3A5ZB 3C0CA 5IHNA 4OB1B 3QJYA 2DVEA 2LQ8A 4M78A 1SHGA 3E2UA 1X01A 1VQNQ 4PJOE 4FL6A 5GAMh 3RERA 3DLLA 1R0CB 4LDUA 1VQNA 1UJYA 3OBWA 3V7CA 1KK7A 2JJ9A 2F2WA 1NLPC 4E7LA 1VQ5A 2JM9A 3PFSA 1HK9A 2YRDA 2CREA 1ZSGA 2O4XA 1KQSS 2JS0A 4PJOD 5KYYB 1BI3A 3M0PA 1U1SA 4M78C 1MV3A 2HEQA 2MIOA 2MMPA 3PTAA 1KD1U 1QVGS 4OB3B 1SHFA 1EZZB 2XIDA 4HVWA 1MUZA 3E1SA 1QW1A 2ECZA 3SD4A 3V8LA 1D0YA 2CP0A 1AOJA 4L5GA 1TUCA 3D7SB 1WHGA 2KEAA 3UF4A 3V7RA 5GAOn 3JCMP 1ZQ1A 2QAZA 2GNCA 3U23A 1H641 5LJ3j 3IQLA 5J26A 3I5SA 3UA7A 1AD5A 1I4K1 3PT9A 2WSEE 3JCMe 5GAMe 1HJDA 1Q81R 1U06A 1QVGA 1VQ6T 5CQXA 5LJ3g 2HZYA 3QBYA 4AT1B 3OYYA 3OYGA 2CT4A 3OSSC 2DD5A 2OI3A 1K0XA 1K9MU 2OAUA 4OB2B 1QQJA 3G6EQ 4Y91A 2OJ2A 1ZHIA 1W6XA 2ROLA 4ANJA 3CCJQ 1S1NA 2LQWA 4RUGA 3EGDB 1KC8R 2ENMA 3LX7A 2HMAA 1TWBA 2RI3A 2QTVA 3PVLA 1Q82R 1B7TA 4M4ZA 1M9SA 2MAMA 3M0TA 2KXCA 3OYLA 1QVFS 3GLXA 1Y0MA 4NL2A 8AT1B 3M4GA 1WNLA 2GBQA 2EKOA 3ASKA 3FRNA 3EGDA 2DRKA 3PVQA 2K7AA 5GAN2 1QVFP 1K73U 2JZ2A 4L6V5 3JSCA 2EGEA 1G3SA 2M16A 1YHQQ 1QP2A 2E3IA 1T0JA 4YTLA 2ZZDA 2L3PA 1NPRA 4ME7A 5LL6S 4E47A 4II1A 3PMIA 3PE0A 3THKA 2KQWA 2X4XA 2YLCA 1KQSP 4BDZA 1N6AA 4KULA 2ZAEA 2DYIA 5KYUA 1JQQA 3PMTA 4ZGDB 3CCRA 2A36A 2DERA 1UG1A 3JCMX 4AMCA 5FWBA 1K1ZA 4J9DA 4ELYC 1Q7YC 1M5Q1 4O6JA 3CBMA 1U1TA 1WHJA 2QTXA 2X3XD 3VS1A 3JAME 1J3TA 2MF2A 3WXMB 2QI2A 4C8QB 2LJ0A 1AT1B 4J9BA 1PHTA 4QQDA 4M75E 2PVDB 1NEBA 1E7OA 1WQ7A 5GANh 2CH4W 4AFZC 2DL5A 5GAN8 3CCVT 3OYFA 1YI2T 2JT4A 1TUGB 4E7IA 1K9MR 4LN2A 2K79A 2CSIA 3BDUA 3M57A 1M1KU 4C8QC 3HSBA 2QEXA 4EPCA 5I22A 3PGGA 4J9IA 1WJSA 5D7UA 3QPHA 3UWNA 4CC4B 5FLXE 2B86A 2GTOA 2LC4A 2LTOA 3M9QA 4IUVA 2EGCA 1AWOA 1NYGA 2DZCA 2P4RA 3TQ7P 3FDRA 1YI2Q 4Q5WA 1EIFA 3EGUA 1NLOC 1SF9A 3GBQA 4JRKA 3CCVA 4J6XA 2RK2A 3JCMQ 5IXBA 1NYFA 1JXOA 2DVJA 3BW1A 3M0SA 1GCQA 3MCAB 4MDWA 4JJBA 3MO8A 4CI0C 2QQ9A 2FG0A 1VQOT 4FIBA 3TCJA 2DA9A 2QASA 4F17A 2KE9A 4E7SA 2DNUA 1JJ2P 1ZX6A 4PJOA 1QVFA 1I81A 2V1RA 2KYMA 4FM4B 5KYXB 1MMGA 3FEOA 5GANe 2EQKA 1W2BS 4PL6A 1YCSB 2G3RA 3M56A 3LWHA 2CUBA 2VVKA 3CCLQ 1VQOQ 3H0IA 3CCSA 3CCMT 2DEUA 2DAQA 4NS5A 1JO8A 1WYXA 1XJWB 3EH1A 3OS2A 1WIEA 4BB7A 1Y57A 2X9HA 1K0SA 2A08A 2RA2A 1FX7A 1QWFA 1K73C 2DLPA 2NUZA 1RI0A 3V7SA 2CZ1B 5A2QE 3OYKA 2QDLA 2NUTB 5FU7C 3UDCA 1YFNA 1VYTA 1VIEA 2YUPA 4HVVA 2LCSA 2RHXA 2HBPA 3M55A 2HQHA 1OZ2A 2RO0A 3OS0A 1MMAA 5DLOA 2EW3A 4A4EA 4XU0A 4FYYB 4OMMA 1M2OA 2FPDA 1VA7A 2DTIA 4BY6B 5CKEA 2YRCA 2KBTA 2LQKA 3A98A 3M5AA 1UE9A 4OMPA 3A8MB 3Q1JA 2JOYA 4E7KA 1FMKA 3LW5E 2NUTA 4C0GA 2CP3A 4GLMA 2KRSA 5GAOm 1WXTA 2HSPA 4ELZC 1B07A 3HRTA 2JVVA 3VKIA 2YSQA 4JUVA 2K6DA 1X6GA 1KQ1A 5GMKe 2E6NA 2DX1A 4X9DA 1TXQA 3OW2P 2X51A 2C0TA 2K5FA 3CPWS 1ZA1B 2HAXA 1BKBA 3JB9D 3KUFA 5CIUA 4JS5A 2YUNA 2IPOB 4J8OA 4QT7A 2JN0A 1Y71A 1B3QA 2K2VA 2K4YA 1KC8C 1YJ9A 1D1BA 2EQUA 3F70A 1JJ2S 3DB3A 1UGVA 4OMNA 4E7ZA 3HKSA 4BE0A 4M7AC 3G6ET 3LGFA 4M78G 3SEMA 2D0QB 3VS6A 2QEXQ 4ZN3A 3SDZA 3QXEB 5I21A 1O9SA 1WX6A 2FHDA 1ZUKA 3CEYA 4J9FA 1YJWQ 4C5GA 3QDFA 2ZPFB 3CCMQ 4CC2A 3G4SQ 5GAN7 3QYHB 1T3LA 3JCMb 2DJZA 1I8FA 1OEBA 3CCVQ 1KQSA 1Y07A 2LMJA 3FC3A 3QJ6A 1JBMA 2HL5C 1V1CA 1UFFA 2AKLA 2XICA 4ORZA 1ZSZB 4F14A 2RHYA 3UPUA 4EDUA 3CCQA 2X35A 1UHCA 2OX7A 3JB9G 2EJ9A 4AFQC 3OY9A 1Q81C 3QG1A 1KIKA 3OYNA 1D1CA 4E2FB 4X1VA 4ZTJA 1WXUA 5KYYA 5LJ5d 2DL4A 4RTTA 1X6BA 4OF1A 4WF2A 4DQ2A 1KFZA 3RKYA 4QW2A 4BDYA 5KYNA 2FYKA 3JRZA 1Q7YR 2K57A 3VU3C 2FVUA 4XAXB 3H8ZA 4DA4A 1SKUB 4P5NA 3UA6A 3VS3A 1Y7XA 2VC8A 3RESA 3H0FA 5GMKm 1YHQA 3HRSA 1RABB 2LZ6B 1BI0A 3CMAT 1RAEB 1MGQA 1QCFA 4JLGA 4BUGA 1OX8A 5DLQE 4OMLA 2HQXA 1HXDA 4N4HA 1QWEA 3C95A 3S3OA 1OV3A 2DXCA 2DXUA 2LX9A 3FIFA 2J05A 2EBPA 3JCMf 1QCOA 2O31A 2BZYA 3J81E 1BBZA 2PVOB 1YWOA 1T0HA 2DTOA 4NL3A 2F69A 1ABQA 3OYIA 2X4YA 4LXCA 5CKDA 2E5KA 3VS5A 2E41A 2CS7A 1GCPA 3JCMg 4EIKA 2EGAA 3EFRA 4MZMA 1C1AA 4WTOB 2FO0A 2AKKA 1K8AR 3QZ9B 1MHNA 2HQEA 1VQ9Q 4PJLA 4R56A 1Q86U 1YITQ 2LVMA 3I5RA 3MEAA 4OMQA 1PD1A
chains in the Genus database with same CATH topology
2D1XA 2LQWA 1RLQC 2OAWA 4RUGA 2G6FX 3REAB 4IIOA 1AEYA 2KT8A 2ENMA 1X69A 2D0NA 3EG0A 2LNHB 3PVLA 4JPBW 1SRMA 2RQRA 1AVZC 4M4ZA 1N5ZA 1WI7A 3M0TA 2KXCA 2L0AA 2XMFA 1PKSA 2MCNA 5HCKA 2EYXA 2ED1A 1E6GA 2FRWA 2DBKA 1Y0MA 4J9HA 1OOTA 1OPKA 2HDAA 1UECA 2RQTA 2GBQA 3NPFA 2DRKA 1IO6A 3PVQA 2K7AA 2PNIA 2O2OA 1WXBA 3R6NA 1NG2A 2K2MA 1ZUYA 2FRYA 5I11A 4A63B 2EGEA 1JXMA 3EHRA 2GQIA 2JXBA 2VKNA 1SPKA 2K9GA 1I1JA 1T0JA 2I0NA 4RTZA 2L3PA 4ESRA 1TUDA 1UTIA 1QKWA 1YN8A 2W0ZA 2PTKA 3O5ZA 2C0OA 3PE0A 1GRIA 3THKA 1GCQC 3REBB 3ZL7C 1JEGA 3JV3A 2LQNA 1G83A 1JQQA 5GJWB 1EFNA 2A36A 3H41A 1UG1A 1HSQA 2KGTA 2O9VA 5IXFA 2EVRA 5FWBA 1K1ZA 1T3SA 2AK5A 4J9DA 2EYYA 4AG1C 1ZBJA 1PRMC 4JZ3A 2RPNA 2X3XD 3SHWA 2HCKA 1CKBA 1ZLMA 2FPFA 3VS1A 1J3TA 2GTJA 3VS0A 2LJ0A 2DE0X 1RI9A 4DEYA 4CC3A 4J9BA 3M0UA 1PHTA 2CH4A 1NEBA 1E7OA 2X3WD 2CH4W 4AFZC 2DL5A 1QKXA 2EYZA 4J9EA 2KNBB 3LH5A 2SRCA 2JT4A 4J9CA 1X43A 1WDXA 3RNJA 5IHKA 2W10A 2K79A 2CSIA 4LN2A 2JMCA 5I22A 1OPLA 4J9IA 4CC4B 1KSWA 1BU1A 2B86A 2GTOA 2JMAA 2CDTA 2DBMA 4Z8AA 2EGCA 1AWOA 1ZUUA 1NYGA 2CSQA 2DL3A 4LUEA 2JW4A 2P4RA 2YDLA 5IH2A 4AFSC 1JU5C 2NWMA 1LCKA 1M3CA 1NLOC 3EGUA 4E6RA 3GBQA 2D8HA 2KT1A 1YWPA 3QWYA 2DL8A 2LJ1A 5FWCA 5IXBA 3EG1A 1NYFA 1JXOA 2IIMA 2DVJA 3M0SA 1GCQA 1M8MA 4R0KA 4JJBA 4HCKA 2DF6A 2FG0A 2RQUA 2DA9A 4RTVA 4F17A 2KE9A 4J9GA 2CUDA 2DNUA 1ZX6A 2KR3A 1NEGA 1K76A 1X2QA 2V1RA 2KYMA 2MOXA 3H0HA 2H8HA 2AZSA 1YCSB 4ZNXA 2J06A 2FPEA 2CUBA 2VVKA 2L3SA 3H0IA 4KRTA 1UJ0A 2ABLA 1VYVA 1RUWA 1JO8A 1WYXA 2ED0A 4GBQA 1WIEA 1VYUA 3EHQA 1Y57A 2JS2A 2JTEA 1K0SA 4JZ4A 1CSKA 1GBRA 2A08A 1QWFA 2DLPA 2NUZA 2A37A 3VRYA 2BZXA 1H92A 2QDLA 2YT6A 3NGPA 1XOVA 1VYTA 1SEMA 2YUPA 2V1QA 4HVVA 2KRMA 3QWXX 3TSWA 1K9AA 1M3AA 4JJDA 2LCSA 1Z9QA 2EW3A 4OMMA 2FPDA 1VA7A 2RNAA 1GBQA 2RMOA 2VWFA 2KBTA 2KROA 3A98A 1UE9A 4OMPA 2BTTA 1FMKA 4HVUA 1AWJA 2ESWA 1WA7A 1WLPB 1RLPC 1MV0B 2L2PA 2D8JA 4WCIA 1CKAA 2DM1A 2KRSA 2L3QA 3CQTA 4GLMA 1WXTA 2J7IA 1YNZA 2HSPA 1B07A 1ARKA 4Z88A 2YSQA 3EG3A 2K6DA 1X6GA 3I35A 2EQIA 1Z9ZA 2DRMA 1AWWA 3UATA 2DX1A 2RF0A 5ECAA 4RTUA 2YUQA 2C0TA 1GFCA 4F16A 4AFUC 4D8KA 1W70A 3I9QA 2EPDA 2SEMA 4Z89A 3M0QA 2FEIA 2YUNA 3VS2A 2A28A 4JJCA 5GJVB 1A0NB 4QT7A 1B3QA 1AZGB 2BZ8A 1HD3A 2J6OA 1UGVA 4OMNA 2GGRA 4K11A 1PNJA 3SEMA 5FW9A 4RTYA 3VS6A 2J6FA 1GL5A 4CC7A 5IHIA 3M0RA 1AZEA 1WX6A 2M0YA 1ZUKA 1QLYA 2DYBA 3TSZA 1KJWA 2PZ1A 4J9FA 1AWXA 4FSSA 4CC2A 3KFVA 2AZVA 1T3LA 4DEXA 4RTWA 2HBWA 1UUEA 1GFDA 1U5SA 2YUOA 3VS7A 2RQVA 1OEBA 1I0CA 4LUDA 2JM8A 2LMJA 4AG2C 1PWTA 3TVTA 1V1CA 1I07A 1UFFA 2AKLA 4OMOA 3C0CA 2DJQA 5IHNA 4ORZA 3VRZA 4F14A 2DMOA 1SHGA 2EKHA 1BK2A 1SSHA 1UHCA 1UJYA 2RQWA 1NM7A 2F2WA 3VS4A 1NLPC 1BB9A 1FYNA 2RN8A 4AFQC 1K4US 1PKTA 1KIKA 2LJ3A 3ULRB 2JM9A 4IIMA 4X1VA 1UHFA 1WXUA 1M27C 3FJ5A 2CREA 1ZSGA 2DL4A 4RTTA 1X6BA 1YP5A 2JS0A 1G2BA 3NMZC 2LX7A 1KFZA 2F2XA 3M0PA 2M51A 1X2KA 1MV3A 2HEQA 2MIOA 2ROTA 2KYBA 1SRLA 1H3HA 3RBBB 1SHFA 1UDLA 3NHNA 4HVWA 3UA6A 1MUZA 1E6HA 2J6KA 2C0IA 3VS3A 3H0FA 2ECZA 2LP5A 2LZ6B 2KRNA 1M3BA 1AOJA 1TUCA 2KEAA 1QCFA 2DL7A 2O9SA 3UF4A 3U23A 2GNCA 4OMLA 3IQLA 1QWEA 2DILA 1OV3A 4LE9A 2EYWA 3I5SA 4HXJA 3UA7A 1AD5A 4D8DA 5L23A 5EC7A 2J05A 2K3BA 2EBPA 2O31A 4RTXA 2BZYA 2CT3A 1HJDA 1BBZA 1U06A 1YWOA 3EG2A 2KXDA 1T0HA 1PRLC 1ABQA 1TG0A 1U3OA 2F2VA 2E5KA 3VS5A 4EIKA 1GCPA 2EGAA 2CT4A 2OI3A 1K0XA 1X27A 1WFWA 1W1FA 4LNPA 2FO0A 2AKKA 2OJ2A 1W6XA 1H8KA 2ROLA 1ABOA 1M30A 3I5RA 4Y92A 1S1NA 4OMQA 2O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1X A;  2LQW A;  1RLQ C;  2OAW A;  4RUG A;  2G6F X;  3REA B;  4IIO A;  1AEY A;  2KT8 A;  2ENM A;  1X69 A;  2D0N A;  3EG0 A;  2LNH B;  3PVL A;  4JPB W;  1SRM A;  2RQR A;  1AVZ C;  4M4Z A;  1N5Z A;  1WI7 A;  3M0T A;  2KXC A;  2L0A A;  2XMF A;  1PKS A;  2MCN A;  5HCK A;  2EYX A;  2ED1 A;  1E6G A;  2FRW A;  2DBK A;  1Y0M A;  4J9H A;  1OOT A;  1OPK A;  2HDA A;  1UEC A;  2RQT A;  2GBQ A;  3NPF A;  2DRK A;  1IO6 A;  3PVQ A;  2K7A A;  2PNI A;  2O2O A;  1WXB A;  3R6N A;  1NG2 A;  2K2M A;  1ZUY A;  2FRY A;  5I11 A;  4A63 B;  2EGE A;  1JXM A;  3EHR A;  2GQI A;  2JXB A;  2VKN A;  1SPK A;  2K9G A;  1I1J A;  1T0J A;  2I0N A;  4RTZ A;  2L3P A;  4ESR A;  1TUD A;  1UTI A;  1QKW A;  1YN8 A;  2W0Z A;  2PTK A;  3O5Z A;  2C0O A;  3PE0 A;  1GRI A;  3THK A;  1GCQ C;  3REB B;  3ZL7 C;  1JEG A;  3JV3 A;  2LQN A;  1G83 A;  1JQQ A;  5GJW B;  1EFN A;  2A36 A;  3H41 A;  1UG1 A;  1HSQ A;  2KGT A;  2O9V A;  5IXF A;  2EVR A;  5FWB A;  1K1Z A;  1T3S A;  2AK5 A;  4J9D A;  2EYY A;  4AG1 C;  1ZBJ A;  1PRM C;  4JZ3 A;  2RPN A;  2X3X D;  3SHW A;  2HCK A;  1CKB A;  1ZLM A;  2FPF A;  3VS1 A;  1J3T A;  2GTJ A;  3VS0 A;  2LJ0 A;  2DE0 X;  1RI9 A;  4DEY A;  4CC3 A;  4J9B A;  3M0U A;  1PHT A;  2CH4 A;  1NEB A;  1E7O A;  2X3W D;  2CH4 W;  4AFZ C;  2DL5 A;  1QKX A;  2EYZ A;  4J9E A;  2KNB B;  3LH5 A;  2SRC A;  2JT4 A;  4J9C A;  1X43 A;  1WDX A;  3RNJ A;  5IHK A;  2W10 A;  2K79 A;  2CSI A;  4LN2 A;  2JMC A;  5I22 A;  1OPL A;  4J9I A;  4CC4 B;  1KSW A;  1BU1 A;  2B86 A;  2GTO A;  2JMA A;  2CDT A;  2DBM A;  4Z8A A;  2EGC A;  1AWO A;  1ZUU A;  1NYG A;  2CSQ A;  2DL3 A;  4LUE A;  2JW4 A;  2P4R A;  2YDL A;  5IH2 A;  4AFS C;  1JU5 C;  2NWM A;  1LCK A;  1M3C A;  1NLO C;  3EGU A;  4E6R A;  3GBQ A;  2D8H A;  2KT1 A;  1YWP A;  3QWY A;  2DL8 A;  2LJ1 A;  5FWC A;  5IXB A;  3EG1 A;  1NYF A;  1JXO A;  2IIM A;  2DVJ A;  3M0S A;  1GCQ A;  1M8M A;  4R0K A;  4JJB A;  4HCK A;  2DF6 A;  2FG0 A;  2RQU A;  2DA9 A;  4RTV A;  4F17 A;  2KE9 A;  4J9G A;  2CUD A;  2DNU A;  1ZX6 A;  2KR3 A;  1NEG A;  1K76 A;  1X2Q A;  2V1R A;  2KYM A;  2MOX A;  3H0H A;  2H8H A;  2AZS A;  1YCS B;  4ZNX A;  2J06 A;  2FPE A;  2CUB A;  2VVK A;  2L3S A;  3H0I A;  4KRT A;  1UJ0 A;  2ABL A;  1VYV A;  1RUW A;  1JO8 A;  1WYX A;  2ED0 A;  4GBQ A;  1WIE A;  1VYU A;  3EHQ A;  1Y57 A;  2JS2 A;  2JTE A;  1K0S A;  4JZ4 A;  1CSK A;  1GBR A;  2A08 A;  1QWF A;  2DLP A;  2NUZ A;  2A37 A;  3VRY A;  2BZX A;  1H92 A;  2QDL A;  2YT6 A;  3NGP A;  1XOV A;  1VYT A;  1SEM A;  2YUP A;  2V1Q A;  4HVV A;  2KRM A;  3QWX X;  3TSW A;  1K9A A;  1M3A A;  4JJD A;  2LCS A;  1Z9Q A;  2EW3 A;  4OMM A;  2FPD A;  1VA7 A;  2RNA A;  1GBQ A;  2RMO A;  2VWF A;  2KBT A;  2KRO A;  3A98 A;  1UE9 A;  4OMP A;  2BTT A;  1FMK A;  4HVU A;  1AWJ A;  2ESW A;  1WA7 A;  1WLP B;  1RLP C;  1MV0 B;  2L2P A;  2D8J A;  4WCI A;  1CKA A;  2DM1 A;  2KRS A;  2L3Q A;  3CQT A;  4GLM A;  1WXT A;  2J7I A;  1YNZ A;  2HSP A;  1B07 A;  1ARK A;  4Z88 A;  2YSQ A;  3EG3 A;  2K6D A;  1X6G A;  3I35 A;  2EQI A;  1Z9Z A;  2DRM A;  1AWW A;  3UAT A;  2DX1 A;  2RF0 A;  5ECA A;  4RTU A;  2YUQ A;  2C0T A;  1GFC A;  4F16 A;  4AFU C;  4D8K A;  1W70 A;  3I9Q A;  2EPD A;  2SEM A;  4Z89 A;  3M0Q A;  2FEI A;  2YUN A;  3VS2 A;  2A28 A;  4JJC A;  5GJV B;  1A0N B;  4QT7 A;  1B3Q A;  1AZG B;  2BZ8 A;  1HD3 A;  2J6O A;  1UGV A;  4OMN A;  2GGR A;  4K11 A;  1PNJ A;  3SEM A;  5FW9 A;  4RTY A;  3VS6 A;  2J6F A;  1GL5 A;  4CC7 A;  5IHI A;  3M0R A;  1AZE A;  1WX6 A;  2M0Y A;  1ZUK A;  1QLY A;  2DYB A;  3TSZ A;  1KJW A;  2PZ1 A;  4J9F A;  1AWX A;  4FSS A;  4CC2 A;  3KFV A;  2AZV A;  1T3L A;  4DEX A;  4RTW A;  2HBW A;  1UUE A;  1GFD A;  1U5S A;  2YUO A;  3VS7 A;  2RQV A;  1OEB A;  1I0C A;  4LUD A;  2JM8 A;  2LMJ A;  4AG2 C;  1PWT A;  3TVT A;  1V1C A;  1I07 A;  1UFF A;  2AKL A;  4OMO A;  3C0C A;  2DJQ A;  5IHN A;  4ORZ A;  3VRZ A;  4F14 A;  2DMO A;  1SHG A;  2EKH A;  1BK2 A;  1SSH A;  1UHC A;  1UJY A;  2RQW A;  1NM7 A;  2F2W A;  3VS4 A;  1NLP C;  1BB9 A;  1FYN A;  2RN8 A;  4AFQ C;  1K4U S;  1PKT A;  1KIK A;  2LJ3 A;  3ULR B;  2JM9 A;  4IIM A;  4X1V A;  1UHF A;  1WXU A;  1M27 C;  3FJ5 A;  2CRE A;  1ZSG A;  2DL4 A;  4RTT A;  1X6B A;  1YP5 A;  2JS0 A;  1G2B A;  3NMZ C;  2LX7 A;  1KFZ A;  2F2X A;  3M0P A;  2M51 A;  1X2K A;  1MV3 A;  2HEQ A;  2MIO A;  2ROT A;  2KYB A;  1SRL A;  1H3H A;  3RBB B;  1SHF A;  1UDL A;  3NHN A;  4HVW A;  3UA6 A;  1MUZ A;  1E6H A;  2J6K A;  2C0I A;  3VS3 A;  3H0F A;  2ECZ A;  2LP5 A;  2LZ6 B;  2KRN A;  1M3B A;  1AOJ A;  1TUC A;  2KEA A;  1QCF A;  2DL7 A;  2O9S A;  3UF4 A;  3U23 A;  2GNC A;  4OML A;  3IQL A;  1QWE A;  2DIL A;  1OV3 A;  4LE9 A;  2EYW A;  3I5S A;  4HXJ A;  3UA7 A;  1AD5 A;  4D8D A;  5L23 A;  5EC7 A;  2J05 A;  2K3B A;  2EBP A;  2O31 A;  4RTX A;  2BZY A;  2CT3 A;  1HJD A;  1BBZ A;  1U06 A;  1YWO A;  3EG2 A;  2KXD A;  1T0H A;  1PRL C;  1ABQ A;  1TG0 A;  1U3O A;  2F2V A;  2E5K A;  3VS5 A;  4EIK A;  1GCP A;  2EGA A;  2CT4 A;  2OI3 A;  1K0X A;  1X27 A;  1WFW A;  1W1F A;  4LNP A;  2FO0 A;  2AKK A;  2OJ2 A;  1W6X A;  1H8K A;  2ROL A;  1ABO A;  1M30 A;  3I5R A;  4Y92 A;  1S1N A;  4OMQ A;  2O88 A; 
#chains in the Genus database with same CATH topology
 1IHV A;  3V8J A;  4IIO A;  1VQM A;  1X69 A;  3X25 B;  3P8B B;  2LNH B;  3J7A F;  4JPB W;  5I2S A;  2OTL A;  5L8R E;  1WI7 A;  4PJO C;  2MCN A;  2DET A;  3M53 A;  2ED1 A;  1E6G A;  4LDW A;  1YHQ T;  3X20 B;  3OBY A;  3I56 A;  1OOT A;  4JJN K;  4PJJ A;  2JTF A;  1WHM A;  2AIR B;  3NTH A;  1WHH A;  2RQT A;  4BD3 A;  1IO6 A;  2PNI A;  4XU1 A;  1ZUY A;  3OW2 A;  3CCS T;  3M4Y A;  1EX4 A;  1NBE B;  5HY6 A;  4A63 B;  1DJ7 B;  5IT9 E;  2E65 A;  4OVA A;  1FXX A;  4M78 E;  1M1K R;  3G6E A;  4IUU A;  5CKB A;  2VKN A;  3UT1 A;  1SPK A;  2I0N A;  4PNO A;  4M75 B;  1TUD A;  3LWI A;  1YN8 A;  2PTK A;  5LJ5 j;  1VUB A;  3O5Z A;  3CCS Q;  4ZGE B;  2E70 A;  3OYH A;  2HKQ B;  1RL2 A;  1G83 A;  2M1H A;  4B9X A;  2XK0 A;  5GJW B;  5LJ5 g;  1VQ6 Q;  1HSQ A;  2KGT A;  5IXF A;  2EQM A;  2K5I A;  3CCQ Q;  1T3S A;  2QEX T;  2EYY A;  2C06 A;  1ZBJ A;  3TU4 K;  1PRM C;  1MND A;  2RPN A;  4EMK B;  1WJQ A;  5IN1 A;  1PM3 A;  2GTJ A;  1MMN A;  4DEY A;  3VUB A;  2ZPI B;  2D9T A;  2CH4 A;  4MDX A;  2X3W D;  1M8V A;  1QKX A;  2E3H A;  2EYZ A;  2KNB B;  1VQ4 A;  1IRX A;  3LH5 A;  2SRC A;  4EMK C;  3CCL T;  2O88 A;  4D6W A;  3RNJ A;  1YCY A;  2W10 A;  3JCM c;  4C0F A;  1FWZ A;  4JDS A;  3CC7 T;  1UEB A;  1OPL A;  5KCO A;  1KSW A;  1BU1 A;  3G7Z A;  1VQL A;  5CK9 A;  4N0A C;  4Z8A A;  4LUE A;  2JW4 A;  4LDY A;  2NWM A;  4BI3 A;  1LCK A;  4E6R A;  4M77 F;  4A53 A;  4FCY A;  1IXD A;  1YWP A;  2DTH A;  3I55 T;  1K8A C;  3G71 Q;  5KCH A;  3ER0 A;  2KSS A;  1VQK A;  1WHK A;  4R0K A;  4F7U A;  4HCK A;  5DM7 R;  2RJC A;  2MPX C;  2KR3 A;  3H0H A;  1X2Q A;  1M1K C;  2MOX A;  3JCM J;  1WJR A;  1R77 A;  4X34 A;  4E7H A;  2AT1 B;  4JLI A;  4QVC A;  4N4I A;  1VQK T;  5M9O A;  2J06 A;  2FPE A;  1M90 C;  3NTK A;  4KRT A;  2ABL A;  2RJF A;  2YRV A;  3OQ5 A;  1YJ9 Q;  1TSF A;  5HK3 A;  2QQB A;  4DBH A;  3R6O A;  3A8G B;  5GAN 5;  2R5A A;  1NPP A;  3SB2 A;  1Q81 U;  4OB0 B;  1CSK A;  1GBR A;  2R58 A;  2GCX A;  2XDB A;  2CP5 A;  2QA4 Q;  3CD6 T;  2BZX A;  5FU6 B;  2YT6 A;  4A54 A;  2XDD A;  2V1Q A;  2KRM A;  3TSW A;  1K9A A;  2DXB A;  4HT9 A;  1YJN Q;  4FU6 A;  1Z9Q A;  1M2V A;  1XNI A;  2DEQ A;  3CXC P;  5CCA A;  1K9M C;  2IG0 A;  4B9W A;  2RNA A;  1GBQ A;  1N8R U;  4FYX B;  5KE2 A;  9ATC B;  2V8I A;  2DD4 A;  1BCO A;  3H6Z A;  1YIJ Q;  5GAO p;  1AWJ A;  1PC0 A;  1RAC B;  1RLP C;  3OYM A;  2D8J A;  2DM1 A;  3EFS A;  2JUF A;  1UGQ B;  1VQ6 A;  1S72 A;  4Z88 A;  5GMK j;  1Q86 C;  2VV5 A;  4X9C A;  3MEV A;  3V8K A;  2VXE A;  1Z9Z A;  1AWW A;  4M7D E;  2GFA A;  3JB9 F;  2RF0 A;  3RMQ A;  3X28 B;  4RTU A;  2YUQ A;  1IZ6 A;  4F16 A;  1U8R A;  3O8V A;  4D8K A;  4A4G A;  2COW A;  3I9Q A;  2DK3 A;  4M77 D;  4Z89 A;  3M0Q A;  1LVK A;  5LJ3 f;  2VB6 A;  1NJI U;  2A28 A;  4JJC A;  5GJV B;  3RR6 A;  2FZK B;  2CYZ B;  3EAE A;  3RKX A;  2GF7 A;  1VQL T;  1AZG B;  1H3Z A;  4KH0 B;  1BI2 A;  3M58 A;  3X24 B;  2J6O A;  4DBQ A;  2XI9 A;  1VQN T;  4RTY A;  1PSE A;  2J6F A;  2MWP A;  5IHI A;  1AZE A;  1N27 A;  1Q95 G;  2DXT A;  3E9G A;  2FZC B;  1VQ7 A;  3CCJ A;  4FSS A;  4M7A E;  1VQM T;  3KFV A;  2AZV A;  4DEX A;  3G71 A;  5IAY A;  1UUE A;  1OQK A;  3HTR A;  5GMK l;  3VS7 A;  5GMK i;  5CQY A;  2CGH A;  2X4J A;  2EJG A;  2JM8 A;  4M7A A;  1VQ5 T;  4AG2 C;  4UC4 A;  3VJP A;  3OB9 A;  3DB4 A;  3TVT A;  1AHJ B;  1VQM Q;  4OMO A;  3VRZ A;  2DMO A;  2VGM A;  2EIF A;  2QXF A;  5FRO A;  3CC7 Q;  3L2U A;  1PD0 A;  1BK2 A;  1SSH A;  3OYC A;  3OYA A;  1FMV A;  2RQW A;  4PLL A;  1QVP A;  3TRE A;  4IUP A;  3GOX A;  4C8Q G;  1FYN A;  2V8J A;  3QYG B;  2IVW A;  4NOY A;  5CR2 A;  1KG1 A;  4BI4 A;  4IIM A;  4PJO G;  2BIV A;  3J80 E;  2RI2 A;  4M7A B;  5A0D A;  1G3T A;  4DOV A;  1YP5 A;  4M7D F;  3NMZ C;  2OTL Q;  2LX7 A;  3I55 A;  1X2K A;  2M51 A;  3LYI A;  4O5V A;  4GY5 A;  2KYB A;  3CCM A;  3OMC A;  4HT8 A;  1H3H A;  1UGP B;  3RBB B;  4KBM B;  4FW1 A;  1UDL A;  2CZ6 B;  2PU9 B;  2EAY A;  2EWN A;  3CC2 A;  2J6K A;  2LT1 A;  1OU8 A;  4ZN1 A;  4C0D C;  3HRU A;  2O9S A;  2DL7 A;  2E10 A;  2O4X B;  3RKW A;  1JB0 E;  1TOV A;  2R57 A;  1D0X A;  1R0B G;  3FLG A;  3RUX A;  2DIL A;  4LE9 A;  2HSE B;  4D8D A;  1D3B A;  4HXJ A;  5GAO r;  2K3B A;  1QP3 A;  3H9N A;  5A0L A;  1SSF A;  5AYF A;  2KXD A;  3CBO A;  3JCM h;  5FU7 B;  3DKM A;  1LPL A;  1U3O A;  2F2V A;  3CME Q;  2FL7 A;  1VQ8 T;  5LJ3 d;  4KUI A;  2RD1 A;  3L2R A;  1WFW A;  1W1F A;  4N0A A;  3LGL A;  4DBF A;  2LRQ A;  1D09 B;  1ZA2 B;  2NYS A;  4M77 E;  4IUR A;  5LJ3 h;  2XD0 A;  1ABO A;  4VUB A;  2RK1 A;  3SWN C;  2XG8 D;  4Y92 A;  2D1X A;  4FYW B;  1VQ8 Q;  1KHC A;  1RLQ C;  2G6F X;  3ZFJ A;  2KY9 A;  3CD6 A;  1AEY A;  2P84 A;  1M1G A;  3BFM A;  3EG0 A;  3P8H A;  3HHT B;  1AVZ C;  2VAS A;  1N5Z A;  3SWN B;  2F5K A;  3OSV A;  4FT2 A;  2XMF A;  1PKS A;  2K3Y A;  3S3M A;  5HCK A;  2CP6 A;  3ZBD A;  3QDR B;  1OPK A;  3OA6 A;  2HDA A;  2HKN A;  4XQ3 A;  4XTV A;  4MML A;  2DO3 A;  2O2O A;  1WXB A;  3R6N A;  1VQ7 Q;  1BIA A;  1NG2 A;  5KYU B;  1ZSZ A;  2K2M A;  3G71 T;  2EFI A;  5I11 A;  4BI8 B;  2OTJ A;  3EHR A;  3QZ5 B;  2GQI A;  1MMD A;  2JXB A;  2K9G A;  4C92 B;  1I1J A;  5J3B A;  1HYO A;  1BYM A;  4OGC A;  3QHS A;  2QGF B;  4M75 F;  1UTI A;  1Y96 B;  2K5L A;  2W0Z A;  1VQ7 T;  2COY A;  5KYX A;  2KAF A;  1D3B B;  2R5M A;  3ZEH A;  2AHJ B;  2C0O A;  1GCQ C;  3ZL7 C;  1Q82 C;  2RI5 A;  4PFZ A;  1F1B B;  1JEG A;  5KH6 A;  3CCE A;  4M77 G;  2EJF A;  5DY9 A;  1EFN A;  4F7U F;  1OYX A;  2KI7 A;  3OW2 S;  4PLI A;  2EVR A;  5GAO l;  1KHI A;  4AG1 C;  4M7A D;  4LDX A;  2QA4 A;  4XTU A;  3CCU A;  3CC4 Q;  4XTW A;  2YXY A;  3SHW A;  2HCK A;  1CKB A;  1ZLM A;  2FPF A;  4CC3 A;  5AT1 B;  3FB9 A;  3I55 Q;  4J9E A;  2EQJ A;  4DBR A;  1PG5 B;  4M7D C;  4J9C A;  4Y28 E;  1X43 A;  1R8O B;  3BY7 A;  3A8H B;  4BE2 A;  4EMH A;  3VYH B;  4HA8 A;  2A7Y A;  5KYW B;  4M75 D;  3DLM A;  1ZUU A;  2DL3 A;  2ZPH B;  3RIR A;  5LJ5 f;  3CXC A;  5IH2 A;  5GAN 3;  4AFS C;  1JU5 C;  2LT4 A;  4J6Y A;  4M7D A;  2MWO A;  4XTZ A;  2VYT A;  2KT1 A;  2E4H A;  5GAN 4;  3QWY A;  2LJ1 A;  3CME A;  1YIT T;  2RH2 A;  5D6Y A;  4PJN A;  3EG9 A;  2IIM A;  2ZPE B;  1M8M A;  1BIB A;  3SFM A;  2RQU A;  4OMF B;  3MHX A;  4J9G A;  3JB9 H;  2CUD A;  4F7U B;  1M90 R;  3OYJ A;  3CMA Q;  2QG9 B;  4HKE A;  1M1F A;  3C94 A;  4MZP A;  4XU3 A;  3CD6 Q;  2AZS A;  3URG A;  2H3E B;  2E5Q A;  3AT1 B;  2YLB A;  4QVD A;  1UB4 A;  3QKJ A;  3CCE T;  2X4W A;  3GIB A;  2DPP B;  5D6X A;  3JCM d;  1UJ0 A;  3HPW A;  1RUW A;  3QO3 A;  2CP2 A;  3EG9 B;  2ED0 A;  3MKD A;  4RKU E;  1B34 A;  4HCB A;  2JTE A;  2M9U A;  4JZ4 A;  3CC2 T;  1W2B A;  2KMT A;  2A37 A;  1TS9 A;  3VRY A;  2RJD A;  1H92 A;  5FRN A;  3WVE B;  4A4F A;  4A4H A;  1WGS A;  1SEM A;  2BE7 D;  3INZ A;  3QWX X;  1GXI E;  1M3A A;  5EG2 A;  4IUT A;  2E1H A;  1VQP A;  4Z02 A;  2E12 A;  4FT4 A;  2ZGW A;  3JB9 I;  1W2B P;  2LCL A;  4KGV B;  2RMO A;  1TH7 A;  2VWF A;  2KRO A;  1YBY A;  2ESW A;  1WA7 A;  1WQW A;  1WLP B;  1MV0 B;  4WCI A;  1LOJ A;  2L3Q A;  1YNZ A;  4M7D G;  1ARK A;  4JS4 A;  1BI1 A;  2KDS A;  1K73 R;  3I35 A;  2DRM A;  2V8K A;  3EGX A;  2DKG A;  4M77 B;  3UAT A;  2Y90 A;  4OP0 A;  5ECA A;  1I5L A;  1I5O B;  2YWW A;  3HL8 A;  4ZGJ B;  4AFU C;  2OTJ T;  4TVR A;  4A4K A;  2SEM A;  2MYS A;  4JRI A;  1YJW T;  3M54 A;  2FEI A;  4RMO A;  5LJ3 e;  4M7D D;  2HNI A;  3OS5 A;  3L1A A;  3VS2 A;  1VQ4 T;  2QK0 A;  1Q82 U;  1A0N B;  1XTD A;  2I2L A;  4QQ6 A;  2P0P A;  3MEW A;  1OU9 A;  1X6O A;  3EGX B;  3L2W A;  1PCX A;  5C6S A;  1KC8 U;  4LD9 K;  1LNX A;  3OMG A;  4RCC A;  2CP7 A;  5CVI A;  1VQ5 Q;  1KD1 R;  3M0R A;  2NLU A;  1N8R R;  3QII A;  3CCQ T;  5GAM j;  3TSZ A;  1KJW A;  2PZ1 A;  4PJO F;  3CME T;  1AWX A;  1YIT A;  3CPF A;  3E19 A;  5A0G A;  3G1J A;  2V26 A;  4C92 E;  1U5S A;  3OS1 A;  1GFD A;  2RQV A;  1I0C A;  4M7A F;  1C6V X;  5GAM g;  2CZ0 B;  3L42 A;  2XDP A;  2ZCF B;  2VXF A;  4F04 B;  3MJX A;  1PWT A;  4B6M A;  2QYZ A;  3CPW P;  2RJE A;  1VQ8 A;  2DJQ A;  2MI6 A;  4RG8 A;  2RHI A;  2Y4X A;  5GAO q;  4LD6 A;  2YHT A;  1G8X A;  2OTL T;  2EKH A;  1X75 C;  2P0K A;  3JCM V;  4F7U G;  1FMW A;  4IUQ A;  1NM7 A;  3VS4 A;  1BB9 A;  2RN8 A;  1K4U S;  1PKT A;  3C12 A;  4FSX A;  2VGN A;  2LJ3 A;  3ULR B;  3MP1 A;  4BAC A;  2QQS A;  1UHF A;  3FJ5 A;  1M27 C;  4J5Y A;  1Y96 A;  2PUK B;  4M77 A;  1G2B A;  1RAD B;  2F2X A;  1JJ2 A;  1IGU A;  1Q86 R;  1W4S A;  2M0O A;  2ROT A;  4GLK A;  1ACM B;  5J39 A;  2OTJ Q;  1SRL A;  1IB8 A;  4J7I A;  1M90 U;  3NHN A;  3G4S T;  1E6H A;  2C0I A;  4F7U E;  2LP5 A;  2KRN A;  4PJM A;  4J6W A;  1M3B A;  5HKC A;  2ZPG B;  2BE9 B;  4M75 A;  1VQ9 A;  3C4S A;  3CC4 T;  2EYW A;  3PNW C;  5L23 A;  5EC7 A;  1VIF A;  5CKH A;  4RTX A;  2B8A A;  5GAM f;  2CT3 A;  2Y4Y A;  3EG2 A;  5C0M A;  1PRL C;  1D0Z A;  1TG0 A;  1M4Z A;  1KD1 C;  5GMK h;  4XU2 A;  2PQW A;  2H3J A;  4M75 C;  3JCM W;  1X27 A;  4LNP A;  2MK5 A;  4PKC C;  2CKK A;  3I56 Q;  3EH2 A;  1H8K A;  3HFN A;  4C8Q D;  4M7D B;  2COZ A;  1M30 A;  1S72 T;  1QCN A;  1VQL Q;  3AHU A;  1VQP T;  4C5H A;  6AT1 B;  1K8A U;  2L8D A;  2OAW A;  2DZ9 A;  3REA B;  2A0F B;  2KT8 A;  2DFU A;  2ATC B;  2JNG A;  3S6W A;  3S3N A;  2D0N A;  3KXT A;  4C0D B;  4EMG A;  3L2Q A;  4FW2 A;  4HCC A;  1SRM A;  2RQR A;  2CZ7 B;  1C0M A;  4KT0 E;  2L0A A;  1V76 A;  3SWN A;  2EYX A;  3M59 A;  1O75 A;  2FRW A;  2LCC A;  3TEE A;  4J7F A;  3CCL A;  2DBK A;  3L2Z A;  3OYE A;  4J9H A;  1UEC A;  4XK8 E;  4C0Z A;  3NPF A;  2WSC E;  4RCB A;  3OYB A;  1G3Y A;  1OI1 A;  4M78 B;  2FRY A;  1B34 B;  3KBG A;  1JXM A;  2HL3 A;  1OX9 A;  1V29 B;  5HK0 A;  3A8O B;  3CBP A;  3MEU A;  1RAF B;  3GNG A;  4RTZ A;  3P8D A;  1VOM A;  4ESR A;  1QKW A;  3QUI A;  1N9R A;  3MP8 A;  2RB6 A;  1GRI A;  2LNV A;  4PFP A;  5GAN j;  3NTI A;  2L3R A;  3REB B;  5LJ5 h;  2JTM A;  2XKO C;  3JV3 A;  2Z0W A;  4IKF A;  2LQN A;  1RAA B;  3GF5 A;  2GFU A;  1MNE A;  3H41 A;  3LH0 A;  2O9V A;  3T9N A;  3VYG A;  5GAN g;  2AK5 A;  3A1P A;  1RAG B;  4C8Q A;  2RHZ A;  4E7J A;  4JZ3 A;  2PUO B;  3EFO A;  3CC2 Q;  4QVZ A;  1RAH B;  4KUD K;  5I2M A;  4C5I A;  2DIQ A;  3VS0 A;  2DE0 X;  1RI9 A;  4HCZ A;  3M0U A;  4C8Q E;  4PK4 A;  5FU6 C;  5CO7 A;  3PIP A;  4ZTF A;  5GAM d;  2XU8 A;  1WDX A;  4M78 F;  4M77 C;  3CCU T;  5IHK A;  3HFO A;  1OZ3 A;  2FZG B;  3N5B B;  1M2V B;  2JMC A;  3GPL A;  1WHL A;  3EFO B;  2JMA A;  2CDT A;  2DBM A;  1VQO A;  4QQG A;  1VQ9 T;  2CSQ A;  1BCM A;  2QDY B;  3MP6 A;  5LJ5 e;  2YDL A;  1IGQ A;  1TU0 B;  4CRI A;  3A8L B;  3GNF B;  1M3C A;  2VUB A;  2D8H A;  2DL8 A;  5FWC A;  3CCJ T;  4C92 F;  2ZPB B;  3EG1 A;  5D6W A;  1VQ4 Q;  3CC4 A;  2DF6 A;  4RTV A;  3CXC S;  4PFO A;  2E64 A;  1XQH A;  2EYQ A;  1NEG A;  1K76 A;  4MMK A;  1IHW A;  5GAN f;  2H8H A;  4BE1 A;  3RMS A;  4PJO B;  2L89 A;  4ZNX A;  8ATC B;  4M7A G;  4KGX B;  2KK4 A;  1PSF A;  2L3S A;  3BE3 A;  1VYV A;  1ZBX A;  2O01 E;  2NUP A;  4M78 D;  2HD0 A;  4GBQ A;  3EHQ A;  1VYU A;  1TTH B;  4N4G A;  2WAC A;  2A3L A;  2E6Z A;  2JS2 A;  4ATO A;  3CCR Q;  3MET A;  1N9S A;  1NZ9 A;  2BKD N;  2LDM A;  4EMK A;  2RHU A;  4C92 A;  4OGE A;  2M02 A;  1SG5 A;  2PVG B;  1YIJ A;  2QQR A;  4QKU A;  1NJI C;  1WPY A;  5FRM A;  3NGP A;  1XOV A;  1S72 Q;  4DOW A;  3VUZ A;  2NUP B;  4JJD A;  3I56 T;  4RG2 A;  2K3X A;  4C92 D;  3JB9 J;  1G3W A;  1NJI R;  4R55 A;  3GP8 A;  2L5Q A;  3CMA A;  4FYV B;  2D6F A;  3QSU A;  2P4T A;  2QA4 T;  5KE3 A;  3BDL A;  1LJO A;  2KVQ G;  3E9F A;  4JRP A;  1QVG P;  1ZSZ C;  1WZO A;  4KH1 B;  2BTT A;  3HP9 A;  4HVU A;  3L2V A;  1RAI B;  3CPW A;  3WVD B;  1P92 A;  2L2P A;  1UGR B;  3G4S A;  1CKA A;  4M75 G;  2RM4 A;  3CQT A;  4L59 A;  3FJP A;  4XTX A;  2J7I A;  1YI2 A;  1NE8 A;  1OUL A;  4BY6 C;  1N8R C;  4MZT A;  2GQV A;  1YJW A;  2F5T X;  2QQA A;  3EG3 A;  1YJN T;  1IRE B;  1YJN A;  3VV0 A;  2EQI A;  3MPU B;  2WSF E;  4J83 A;  4C5E A;  1GFC A;  4LDV A;  1W70 A;  5KYW A;  4XTY A;  1G5V A;  2EPD A;  5CAI A;  3OYD A;  1VQK Q;  1UGS B;  1YIJ T;  1QMC A;  3NFC A;  2P0Q A;  2F1L A;  1YJ9 T;  2BZ8 A;  1VQP Q;  1HD3 A;  3CCR T;  2GGR A;  2QGG A;  4K11 A;  1PNJ A;  3PIO A;  5FW9 A;  4C8Q F;  1JRI A;  1GL5 A;  1KQ2 A;  4CC7 A;  3X26 B;  3CC7 A;  4C92 G;  3ME9 A;  2M0Y A;  3CCE Q;  1QLY A;  2DYB A;  5GAN d;  4JRQ A;  4RTW A;  2HBW A;  5GAN 6;  2DIG A;  2YUO A;  2FB7 A;  4LUD A;  3RDV A;  2BUD A;  5CKF A;  1D1A A;  4KGZ B;  1Q7Y U;  3LLR A;  3CCU Q;  7AT1 B;  4V2S A;  4C92 C;  1I07 A;  2XHC A;  3A5Z B;  3C0C A;  5IHN A;  4OB1 B;  3QJY A;  2DVE A;  2LQ8 A;  4M78 A;  1SHG A;  3E2U A;  1X01 A;  1VQN Q;  4PJO E;  4FL6 A;  5GAM h;  3RER A;  3DLL A;  1R0C B;  4LDU A;  1VQN A;  1UJY A;  3OBW A;  3V7C A;  1KK7 A;  2JJ9 A;  2F2W A;  1NLP C;  4E7L A;  1VQ5 A;  2JM9 A;  3PFS A;  1HK9 A;  2YRD A;  2CRE A;  1ZSG A;  2O4X A;  1KQS S;  2JS0 A;  4PJO D;  5KYY B;  1BI3 A;  3M0P A;  1U1S A;  4M78 C;  1MV3 A;  2HEQ A;  2MIO A;  2MMP A;  3PTA A;  1KD1 U;  1QVG S;  4OB3 B;  1SHF A;  1EZZ B;  2XID A;  4HVW A;  1MUZ A;  3E1S A;  1QW1 A;  2ECZ A;  3SD4 A;  3V8L A;  1D0Y A;  2CP0 A;  1AOJ A;  4L5G A;  1TUC A;  3D7S B;  1WHG A;  2KEA A;  3UF4 A;  3V7R A;  5GAO n;  3JCM P;  1ZQ1 A;  2QAZ A;  2GNC A;  3U23 A;  1H64 1;  5LJ3 j;  3IQL A;  5J26 A;  3I5S A;  3UA7 A;  1AD5 A;  1I4K 1;  3PT9 A;  2WSE E;  3JCM e;  5GAM e;  1HJD A;  1Q81 R;  1U06 A;  1QVG A;  1VQ6 T;  5CQX A;  5LJ3 g;  2HZY A;  3QBY A;  4AT1 B;  3OYY A;  3OYG A;  2CT4 A;  3OSS C;  2DD5 A;  2OI3 A;  1K0X A;  1K9M U;  2OAU A;  4OB2 B;  1QQJ A;  3G6E Q;  4Y91 A;  2OJ2 A;  1ZHI A;  1W6X A;  2ROL A;  4ANJ A;  3CCJ Q;  1S1N A;  2LQW A;  4RUG A;  3EGD B;  1KC8 R;  2ENM A;  3LX7 A;  2HMA A;  1TWB A;  2RI3 A;  2QTV A;  3PVL A;  1Q82 R;  1B7T A;  4M4Z A;  1M9S A;  2MAM A;  3M0T A;  2KXC A;  3OYL A;  1QVF S;  3GLX A;  1Y0M A;  4NL2 A;  8AT1 B;  3M4G A;  1WNL A;  2GBQ A;  2EKO A;  3ASK A;  3FRN A;  3EGD A;  2DRK A;  3PVQ A;  2K7A A;  5GAN 2;  1QVF P;  1K73 U;  2JZ2 A;  4L6V 5;  3JSC A;  2EGE A;  1G3S A;  2M16 A;  1YHQ Q;  1QP2 A;  2E3I A;  1T0J A;  4YTL A;  2ZZD A;  2L3P A;  1NPR A;  4ME7 A;  5LL6 S;  4E47 A;  4II1 A;  3PMI A;  3PE0 A;  3THK A;  2KQW A;  2X4X A;  2YLC A;  1KQS P;  4BDZ A;  1N6A A;  4KUL A;  2ZAE A;  2DYI A;  5KYU A;  1JQQ A;  3PMT A;  4ZGD B;  3CCR A;  2A36 A;  2DER A;  1UG1 A;  3JCM X;  4AMC A;  5FWB A;  1K1Z A;  4J9D A;  4ELY C;  1Q7Y C;  1M5Q 1;  4O6J A;  3CBM A;  1U1T A;  1WHJ A;  2QTX A;  2X3X D;  3VS1 A;  3JAM E;  1J3T A;  2MF2 A;  3WXM B;  2QI2 A;  4C8Q B;  2LJ0 A;  1AT1 B;  4J9B A;  1PHT A;  4QQD A;  4M75 E;  2PVD B;  1NEB A;  1E7O A;  1WQ7 A;  5GAN h;  2CH4 W;  4AFZ C;  2DL5 A;  5GAN 8;  3CCV T;  3OYF A;  1YI2 T;  2JT4 A;  1TUG B;  4E7I A;  1K9M R;  4LN2 A;  2K79 A;  2CSI A;  3BDU A;  3M57 A;  1M1K U;  4C8Q C;  3HSB A;  2QEX A;  4EPC A;  5I22 A;  3PGG A;  4J9I A;  1WJS A;  5D7U A;  3QPH A;  3UWN A;  4CC4 B;  5FLX E;  2B86 A;  2GTO A;  2LC4 A;  2LTO A;  3M9Q A;  4IUV A;  2EGC A;  1AWO A;  1NYG A;  2DZC A;  2P4R A;  3TQ7 P;  3FDR A;  1YI2 Q;  4Q5W A;  1EIF A;  3EGU A;  1NLO C;  1SF9 A;  3GBQ A;  4JRK A;  3CCV A;  4J6X A;  2RK2 A;  3JCM Q;  5IXB A;  1NYF A;  1JXO A;  2DVJ A;  3BW1 A;  3M0S A;  1GCQ A;  3MCA B;  4MDW A;  4JJB A;  3MO8 A;  4CI0 C;  2QQ9 A;  2FG0 A;  1VQO T;  4FIB A;  3TCJ A;  2DA9 A;  2QAS A;  4F17 A;  2KE9 A;  4E7S A;  2DNU A;  1JJ2 P;  1ZX6 A;  4PJO A;  1QVF A;  1I81 A;  2V1R A;  2KYM A;  4FM4 B;  5KYX B;  1MMG A;  3FEO A;  5GAN e;  2EQK A;  1W2B S;  4PL6 A;  1YCS B;  2G3R A;  3M56 A;  3LWH A;  2CUB A;  2VVK A;  3CCL Q;  1VQO Q;  3H0I A;  3CCS A;  3CCM T;  2DEU A;  2DAQ A;  4NS5 A;  1JO8 A;  1WYX A;  1XJW B;  3EH1 A;  3OS2 A;  1WIE A;  4BB7 A;  1Y57 A;  2X9H A;  1K0S A;  2A08 A;  2RA2 A;  1FX7 A;  1QWF A;  1K73 C;  2DLP A;  2NUZ A;  1RI0 A;  3V7S A;  2CZ1 B;  5A2Q E;  3OYK A;  2QDL A;  2NUT B;  5FU7 C;  3UDC A;  1YFN A;  1VYT A;  1VIE A;  2YUP A;  4HVV A;  2LCS A;  2RHX A;  2HBP A;  3M55 A;  2HQH A;  1OZ2 A;  2RO0 A;  3OS0 A;  1MMA A;  5DLO A;  2EW3 A;  4A4E A;  4XU0 A;  4FYY B;  4OMM A;  1M2O A;  2FPD A;  1VA7 A;  2DTI A;  4BY6 B;  5CKE A;  2YRC A;  2KBT A;  2LQK A;  3A98 A;  3M5A A;  1UE9 A;  4OMP A;  3A8M B;  3Q1J A;  2JOY A;  4E7K A;  1FMK A;  3LW5 E;  2NUT A;  4C0G A;  2CP3 A;  4GLM A;  2KRS A;  5GAO m;  1WXT A;  2HSP A;  4ELZ C;  1B07 A;  3HRT A;  2JVV A;  3VKI A;  2YSQ A;  4JUV A;  2K6D A;  1X6G A;  1KQ1 A;  5GMK e;  2E6N A;  2DX1 A;  4X9D A;  1TXQ A;  3OW2 P;  2X51 A;  2C0T A;  2K5F A;  3CPW S;  1ZA1 B;  2HAX A;  1BKB A;  3JB9 D;  3KUF A;  5CIU A;  4JS5 A;  2YUN A;  2IPO B;  4J8O A;  4QT7 A;  2JN0 A;  1Y71 A;  1B3Q A;  2K2V A;  2K4Y A;  1KC8 C;  1YJ9 A;  1D1B A;  2EQU A;  3F70 A;  1JJ2 S;  3DB3 A;  1UGV A;  4OMN A;  4E7Z A;  3HKS A;  4BE0 A;  4M7A C;  3G6E T;  3LGF A;  4M78 G;  3SEM A;  2D0Q B;  3VS6 A;  2QEX Q;  4ZN3 A;  3SDZ A;  3QXE B;  5I21 A;  1O9S A;  1WX6 A;  2FHD A;  1ZUK A;  3CEY A;  4J9F A;  1YJW Q;  4C5G A;  3QDF A;  2ZPF B;  3CCM Q;  4CC2 A;  3G4S Q;  5GAN 7;  3QYH B;  1T3L A;  3JCM b;  2DJZ A;  1I8F A;  1OEB A;  3CCV Q;  1KQS A;  1Y07 A;  2LMJ A;  3FC3 A;  3QJ6 A;  1JBM A;  2HL5 C;  1V1C A;  1UFF A;  2AKL A;  2XIC A;  4ORZ A;  1ZSZ B;  4F14 A;  2RHY A;  3UPU A;  4EDU A;  3CCQ A;  2X35 A;  1UHC A;  2OX7 A;  3JB9 G;  2EJ9 A;  4AFQ C;  3OY9 A;  1Q81 C;  3QG1 A;  1KIK A;  3OYN A;  1D1C A;  4E2F B;  4X1V A;  4ZTJ A;  1WXU A;  5KYY A;  5LJ5 d;  2DL4 A;  4RTT A;  1X6B A;  4OF1 A;  4WF2 A;  4DQ2 A;  1KFZ A;  3RKY A;  4QW2 A;  4BDY A;  5KYN A;  2FYK A;  3JRZ A;  1Q7Y R;  2K57 A;  3VU3 C;  2FVU A;  4XAX B;  3H8Z A;  4DA4 A;  1SKU B;  4P5N A;  3UA6 A;  3VS3 A;  1Y7X A;  2VC8 A;  3RES A;  3H0F A;  5GMK m;  1YHQ A;  3HRS A;  1RAB B;  2LZ6 B;  1BI0 A;  3CMA T;  1RAE B;  1MGQ A;  1QCF A;  4JLG A;  4BUG A;  1OX8 A;  5DLQ E;  4OML A;  2HQX A;  1HXD A;  4N4H A;  1QWE A;  3C95 A;  3S3O A;  1OV3 A;  2DXC A;  2DXU A;  2LX9 A;  3FIF A;  2J05 A;  2EBP A;  3JCM f;  1QCO A;  2O31 A;  2BZY A;  3J81 E;  1BBZ A;  2PVO B;  1YWO A;  1T0H A;  2DTO A;  4NL3 A;  2F69 A;  1ABQ A;  3OYI A;  2X4Y A;  4LXC A;  5CKD A;  2E5K A;  3VS5 A;  2E41 A;  2CS7 A;  1GCP A;  3JCM g;  4EIK A;  2EGA A;  3EFR A;  4MZM A;  1C1A A;  4WTO B;  2FO0 A;  2AKK A;  1K8A R;  3QZ9 B;  1MHN A;  2HQE A;  1VQ9 Q;  4PJL A;  4R56 A;  1Q86 U;  1YIT Q;  2LVM A;  3I5R A;  3MEA A;  4OMQ A;  1PD1 A; 
#chains in the Genus database with same CATH homology
 2D1X A;  2LQW A;  1RLQ C;  2OAW A;  4RUG A;  2G6F X;  3REA B;  4IIO A;  1AEY A;  2KT8 A;  2ENM A;  1X69 A;  2D0N A;  3EG0 A;  2LNH B;  3PVL A;  4JPB W;  1SRM A;  2RQR A;  1AVZ C;  4M4Z A;  1N5Z A;  1WI7 A;  3M0T A;  2KXC A;  2L0A A;  2XMF A;  1PKS A;  2MCN A;  5HCK A;  2EYX A;  2ED1 A;  1E6G A;  2FRW A;  2DBK A;  1Y0M A;  4J9H A;  1OOT A;  1OPK A;  2HDA A;  1UEC A;  2RQT A;  2GBQ A;  3NPF A;  2DRK A;  1IO6 A;  3PVQ A;  2K7A A;  2PNI A;  2O2O A;  1WXB A;  3R6N A;  1NG2 A;  2K2M A;  1ZUY A;  2FRY A;  5I11 A;  4A63 B;  2EGE A;  1JXM A;  3EHR A;  2GQI A;  2JXB A;  2VKN A;  1SPK A;  2K9G A;  1I1J A;  1T0J A;  2I0N A;  4RTZ A;  2L3P A;  4ESR A;  1TUD A;  1UTI A;  1QKW A;  1YN8 A;  2W0Z A;  2PTK A;  3O5Z A;  2C0O A;  3PE0 A;  1GRI A;  3THK A;  1GCQ C;  3REB B;  3ZL7 C;  1JEG A;  3JV3 A;  2LQN A;  1G83 A;  1JQQ A;  5GJW B;  1EFN A;  2A36 A;  3H41 A;  1UG1 A;  1HSQ A;  2KGT A;  2O9V A;  5IXF A;  2EVR A;  5FWB A;  1K1Z A;  1T3S A;  2AK5 A;  4J9D A;  2EYY A;  4AG1 C;  1ZBJ A;  1PRM C;  4JZ3 A;  2RPN A;  2X3X D;  3SHW A;  2HCK A;  1CKB A;  1ZLM A;  2FPF A;  3VS1 A;  1J3T A;  2GTJ A;  3VS0 A;  2LJ0 A;  2DE0 X;  1RI9 A;  4DEY A;  4CC3 A;  4J9B A;  3M0U A;  1PHT A;  2CH4 A;  1NEB A;  1E7O A;  2X3W D;  2CH4 W;  4AFZ C;  2DL5 A;  1QKX A;  2EYZ A;  4J9E A;  2KNB B;  3LH5 A;  2SRC A;  2JT4 A;  4J9C A;  1X43 A;  1WDX A;  3RNJ A;  5IHK A;  2W10 A;  2K79 A;  2CSI A;  4LN2 A;  2JMC A;  5I22 A;  1OPL A;  4J9I A;  4CC4 B;  1KSW A;  1BU1 A;  2B86 A;  2GTO A;  2JMA A;  2CDT A;  2DBM A;  4Z8A A;  2EGC A;  1AWO A;  1ZUU A;  1NYG A;  2CSQ A;  2DL3 A;  4LUE A;  2JW4 A;  2P4R A;  2YDL A;  5IH2 A;  4AFS C;  1JU5 C;  2NWM A;  1LCK A;  1M3C A;  1NLO C;  3EGU A;  4E6R A;  3GBQ A;  2D8H A;  2KT1 A;  1YWP A;  3QWY A;  2DL8 A;  2LJ1 A;  5FWC A;  5IXB A;  3EG1 A;  1NYF A;  1JXO A;  2IIM A;  2DVJ A;  3M0S A;  1GCQ A;  1M8M A;  4R0K A;  4JJB A;  4HCK A;  2DF6 A;  2FG0 A;  2RQU A;  2DA9 A;  4RTV A;  4F17 A;  2KE9 A;  4J9G A;  2CUD A;  2DNU A;  1ZX6 A;  2KR3 A;  1NEG A;  1K76 A;  1X2Q A;  2V1R A;  2KYM A;  2MOX A;  3H0H A;  2H8H A;  2AZS A;  1YCS B;  4ZNX A;  2J06 A;  2FPE A;  2CUB A;  2VVK A;  2L3S A;  3H0I A;  4KRT A;  1UJ0 A;  2ABL A;  1VYV A;  1RUW A;  1JO8 A;  1WYX A;  2ED0 A;  4GBQ A;  1WIE A;  1VYU A;  3EHQ A;  1Y57 A;  2JS2 A;  2JTE A;  1K0S A;  4JZ4 A;  1CSK A;  1GBR A;  2A08 A;  1QWF A;  2DLP A;  2NUZ A;  2A37 A;  3VRY A;  2BZX A;  1H92 A;  2QDL A;  2YT6 A;  3NGP A;  1XOV A;  1VYT A;  1SEM A;  2YUP A;  2V1Q A;  4HVV A;  2KRM A;  3QWX X;  3TSW A;  1K9A A;  1M3A A;  4JJD A;  2LCS A;  1Z9Q A;  2EW3 A;  4OMM A;  2FPD A;  1VA7 A;  2RNA A;  1GBQ A;  2RMO A;  2VWF A;  2KBT A;  2KRO A;  3A98 A;  1UE9 A;  4OMP A;  2BTT A;  1FMK A;  4HVU A;  1AWJ A;  2ESW A;  1WA7 A;  1WLP B;  1RLP C;  1MV0 B;  2L2P A;  2D8J A;  4WCI A;  1CKA A;  2DM1 A;  2KRS A;  2L3Q A;  3CQT A;  4GLM A;  1WXT A;  2J7I A;  1YNZ A;  2HSP A;  1B07 A;  1ARK A;  4Z88 A;  2YSQ A;  3EG3 A;  2K6D A;  1X6G A;  3I35 A;  2EQI A;  1Z9Z A;  2DRM A;  1AWW A;  3UAT A;  2DX1 A;  2RF0 A;  5ECA A;  4RTU A;  2YUQ A;  2C0T A;  1GFC A;  4F16 A;  4AFU C;  4D8K A;  1W70 A;  3I9Q A;  2EPD A;  2SEM A;  4Z89 A;  3M0Q A;  2FEI A;  2YUN A;  3VS2 A;  2A28 A;  4JJC A;  5GJV B;  1A0N B;  4QT7 A;  1B3Q A;  1AZG B;  2BZ8 A;  1HD3 A;  2J6O A;  1UGV A;  4OMN A;  2GGR A;  4K11 A;  1PNJ A;  3SEM A;  5FW9 A;  4RTY A;  3VS6 A;  2J6F A;  1GL5 A;  4CC7 A;  5IHI A;  3M0R A;  1AZE A;  1WX6 A;  2M0Y A;  1ZUK A;  1QLY A;  2DYB A;  3TSZ A;  1KJW A;  2PZ1 A;  4J9F A;  1AWX A;  4FSS A;  4CC2 A;  3KFV A;  2AZV A;  1T3L A;  4DEX A;  4RTW A;  2HBW A;  1UUE A;  1GFD A;  1U5S A;  2YUO A;  3VS7 A;  2RQV A;  1OEB A;  1I0C A;  4LUD A;  2JM8 A;  2LMJ A;  4AG2 C;  1PWT A;  3TVT A;  1V1C A;  1I07 A;  1UFF A;  2AKL A;  4OMO A;  3C0C A;  2DJQ A;  5IHN A;  4ORZ A;  3VRZ A;  4F14 A;  2DMO A;  1SHG A;  2EKH A;  1BK2 A;  1SSH A;  1UHC A;  1UJY A;  2RQW A;  1NM7 A;  2F2W A;  3VS4 A;  1NLP C;  1BB9 A;  1FYN A;  2RN8 A;  4AFQ C;  1K4U S;  1PKT A;  1KIK A;  2LJ3 A;  3ULR B;  2JM9 A;  4IIM A;  4X1V A;  1UHF A;  1WXU A;  1M27 C;  3FJ5 A;  2CRE A;  1ZSG A;  2DL4 A;  4RTT A;  1X6B A;  1YP5 A;  2JS0 A;  1G2B A;  3NMZ C;  2LX7 A;  1KFZ A;  2F2X A;  3M0P A;  2M51 A;  1X2K A;  1MV3 A;  2HEQ A;  2MIO A;  2ROT A;  2KYB A;  1SRL A;  1H3H A;  3RBB B;  1SHF A;  1UDL A;  3NHN A;  4HVW A;  3UA6 A;  1MUZ A;  1E6H A;  2J6K A;  2C0I A;  3VS3 A;  3H0F A;  2ECZ A;  2LP5 A;  2LZ6 B;  2KRN A;  1M3B A;  1AOJ A;  1TUC A;  2KEA A;  1QCF A;  2DL7 A;  2O9S A;  3UF4 A;  3U23 A;  2GNC A;  4OML A;  3IQL A;  1QWE A;  2DIL A;  1OV3 A;  4LE9 A;  2EYW A;  3I5S A;  4HXJ A;  3UA7 A;  1AD5 A;  4D8D A;  5L23 A;  5EC7 A;  2J05 A;  2K3B A;  2EBP A;  2O31 A;  4RTX A;  2BZY A;  2CT3 A;  1HJD A;  1BBZ A;  1U06 A;  1YWO A;  3EG2 A;  2KXD A;  1T0H A;  1PRL C;  1ABQ A;  1TG0 A;  1U3O A;  2F2V A;  2E5K A;  3VS5 A;  4EIK A;  1GCP A;  2EGA A;  2CT4 A;  2OI3 A;  1K0X A;  1X27 A;  1WFW A;  1W1F A;  4LNP A;  2FO0 A;  2AKK A;  2OJ2 A;  1W6X A;  1H8K A;  2ROL A;  1ABO A;  1M30 A;  3I5R A;  4Y92 A;  1S1N A;  4OMQ A;  2O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...