1OULA

Structure of the aaa+ protease delivery protein sspb
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
b'MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYDELNIEPDTEQPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
molecule tags Transport protein
source organism Haemophilus influenzae
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
total genus 25
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1oulA00
1ZSZA 1OULA 1ZSZC 2NYSA 1YFNA 1TWBA 1ZSZB 1OX9A 2QAZA 1OU8A 1OU9A 2QASA 1OX8A
chains in the Genus database with same CATH superfamily
2MF2A 5IH2A 5LL6S 2LQKA 1M27C 3H41A 4XK8E 3C0CA 5IAYA 2DXUA 2DZ9A 1H3ZA 3QDFA 1K9MR 3X28B 2EGEA 1SHFA 1JJ2P 1I1JA 2ED0A 3MP6A 1KHIA 5GANj 1QW1A 3OMCA 1VQ8T 1GCQA 1NBEB 2FG0A 1IGQA 2ENMA 5GMKh 2XD0A 3JCMP 4MMLA 1T3SA 4Y28E 4C8QC 2YUOA 5D6YA 2KRNA 3TCJA 3FEOA 3LH5A 2RI3A 2OTJQ 1ZSZB 1Y7XA 2X35A 3MCAB 1C6VX 4O5VA 2ATCB 2XI9A 2K3YA 3CCLT 2LNVA 4M4ZA 5GAN7 4AFZC 2KR3A 4AFQC 2AKLA 4FT4A 2DTHA 4BUGA 1UGVA 3OBYA 1YJWQ 3AT1B 3GBQA 4Y91A 4J9HA 1N5ZA 2DIGA 4E6RA 3FIFA 3OW2S 2ZPIB 1W4SA 4N0AA 2M1HA 5I2SA 4NS5A 3H0FA 2LQNA 2OTJT 4KT0E 1RADB 2CH4A 5CQYA 2CT4A 2LP5A 2D0QB 1I5LA 3MEVA 2RJEA 4N4HA 2HBPA 3JCMd 1WFWA 3QG1A 1W2BA 2M02A 5CKBA 3G71Q 2BTTA 3FC3A 2O4XB 2DEUA 3C95A 1VIEA 2PQWA 1M90R 1VQ7T 4L59A 4FYXB 1WHGA 2JTEA 3HRSA 2CZ7B 3OW2P 1V1CA 1BCOA 3EHRA 3EGXB 1N8RR 1W6XA 3OYGA 2X4JA 5ECAA 3OYLA 3RERA 3JB9D 2DA9A 3VS0A 4OVAA 3HHTB 3ULRB 3OYYA 1E7OA 3IQLA 4C92G 2ABLA 2HMAA 4PJOG 2QA4Q 2IPOB 1WPYA 1NZ9A 2HL3A 3CC2T 3FRNA 3CCJQ 3RESA 1PHTA 3OS2A 2M51A 4OB2B 3VS1A 2NWMA 2GTJA 2Y4YA 2LDMA 5LJ5d 3A98A 4RTWA 2XG8D 5LJ5e 4Z8AA 2KAFA 2CT3A 2RF0A 5HY6A 2ZPGB 4C8QE 1MNDA 2DBKA 2L5QA 5CKHA 4HA8A 3MEUA 1M1GA 1OI1A 3VJPA 5M9OA 2EYZA 1D1CA 2E70A 3WXMB 2AK5A 1OU9A 3CBOA 2DYIA 1D3BA 4ELYC 1BI2A 2CP3A 3CCSA 2DTOA 1OPKA 3M54A 3X20B 1YITA 2DPPB 2RQRA 1UTIA 4DEYA 3G6ET 4OMFB 4LUDA 2KK4A 4DBHA 3NHNA 1QP2A 2C0IA 1PG5B 1RLPC 1K0SA 2PTKA 2NLUA 1NLPC 3QXEB 4WTOB 2ZPEB 1VUBA 1ZSZA 2A28A 4RUGA 4M78B 4M7DG 1MNEA 4A4HA 2V26A 2MWPA 4E7KA 4OB1B 2RD1A 1M2VA 3VUZA 1B07A 2JMCA 2BUDA 2YRDA 3REBB 4F7UE 2EQIA 1QQJA 1M8VA 3OB9A 2WSEE 1WXUA 1N9RA 2HQHA 1YITQ 1Z9QA 4Q5WA 1TUCA 1M3CA 5GAMj 1JRIA 3C4SA 4OB0B 5C6SA 2DE0X 2H3JA 2RHIA 1YJNQ 2CP2A 3M5AA 3UF4A 3CMAQ 4J7IA 4A4FA 3ZBDA 1UB4A 3RBBB 3CMEA 4N0AC 1OU8A 3HFOA 5GAN6 3FLGA 2HQXA 1AVZC 4OP0A 1NPPA 1LPLA 1K0XA 2K5IA 3LGFA 1YI2A 2O4XA 1Z9ZA 2MOXA 4LD6A 1WGSA 1NJIR 1IZ6A 2VXFA 2C0OA 5EC7A 4JRQA 4RCBA 4M75G 2RM4A 4M78F 5CK9A 3CEYA 3VS2A 1IXDA 4MZPA 4FW2A 4E7HA 2QAZA 3M0QA 2ZPFB 5KCHA 3OYDA 1ZSZC 3E9GA 1WYXA 2EJFA 2VVKA 3R6NA 3VS5A 3DLLA 4ZTJA 3CCRA 5CVIA 4FT2A 3TQ7P 5KYYA 3H0HA 1H641 1TSFA 4JPBW 3WVDB 4M7AF 1BI0A 2X4YA 3EGDA 1KC8R 4M77B 2BZ8A 4KGZB 1VQLA 1VQ4Q 2D6FA 4HT8A 2CSQA 2DXCA 2LCSA 4QKUA 3SEMA 2LRQA 3HFNA 4X34A 3GNFB 2XU8A 4LDVA 2CS7A 2D1XA 1OULA 2R5MA 4B9WA 2F1LA 4EMKC 2DM1A 1W1FA 2EGCA 4F7UG 4J7FA 1FWZA 4CC4B 3QYGB 1U06A 3EGXA 5IXBA 5LJ3h 2DL4A 3GNGA 1A0NB 1KD1R 5HKCA 2F2WA 1AWOA 3JCMg 1BBZA 5J26A 5KH6A 4IKFA 1LOJA 3S3MA 4OMPA 3V7SA 1VQMT 4M75D 1ACMB 1WHMA 4PJOC 2RPNA 3CCUT 1YHQT 3CQTA 2RI5A 3HTRA 3D7SB 1FMWA 1R0CB 4C0ZA 5IHKA 4MDWA 5GAOp 3RDVA 1BK2A 2EKOA 2JXBA 1OZ2A 3X24B 3E19A 3CCEQ 2IG0A 1QCNA 2HDAA 4J8OA 2LNHB 4C92F 3PTAA 2QI2A 1PRMC 3CCQQ 4E7JA 2KE9A 3PIOA 1Q82U 2LJ0A 3GF5A 3VYHB 3TSWA 2XHCA 1IHWA 4ME7A 1S72Q 2O9VA 1MMDA 2J6KA 4F16A 4BDZA 1K73C 2QDLA 3G4ST 2MWOA 3OYIA 5KCOA 1VYTA 4OB3B 1S1NA 2E4HA 2ZGWA 4RKUE 3ASKA 4CC2A 8ATCB 1UJYA 1VQOA 4JRPA 4PFZA 5KE2A 3C94A 1WNLA 2QGFB 5GAN2 1JEGA 4IIOA 4MZTA 3MO8A 1AWWA 1AWJA 2E5KA 2PUKB 2QQ9A 5A2QE 9ATCB 4C92E 3EH2A 4IUPA 4XU3A 1ZLMA 2EYQA 2SRCA 2E3IA 1M2OA 3EAEA 5GMKm 2JNGA 1QKWA 1M90U 4XTZA 4E7LA 1OOTA 1OX9A 3QJYA 5FU7C 2JUFA 2K9GA 4F14A 1SRLA 2OAWA 1D0ZA 2KVQG 1LCKA 3CC4Q 1KD1C 1OZ3A 1C0MA 2ED1A 4D8DA 2RQVA 4FW1A 1UGPB 1M30A 2K5FA 2QTXA 1AOJA 1QWEA 2DX1A 3VKIA 3A8GB 4QT7A 4QQGA 2GBQA 1BB9A 2CZ0B 3M53A 1OEBA 1RAHB 1ZBXA 4XU1A 4PJMA 2CYZB 5IN1A 3OS1A 2XIDA 1WHLA 4FSSA 5FW9A 4C0GA 2J7IA 2GQVA 1WHHA 3EG9A 3OYFA 1UGQB 2RN8A 1QMCA 3EG2A 4J9EA 3M59A 2YHTA 4BI4A 1MUZA 4WCIA 3M0UA 4AMCA 2K5LA 3EH1A 1JBMA 1O75A 1VQ9T 1JU5C 4FYYB 1YIJT 2V8IA 5GANf 1LNXA 2LZ6B 2OAUA 2IVWA 2LQWA 3QSUA 3EHQA 2KBTA 4IURA 1CSKA 3P8HA 2QGGA 3JRZA 4BY6C 4DEXA 5GANh 3UPUA 1VQ4T 2JM9A 4D6WA 2KDSA 2KY9A 4J9BA 1M4ZA 2HCKA 1E6HA 2NUTA 2K4YA 2ZZDA 3DLMA 3VU3C 3VRZA 1B34A 3JCMQ 2A08A 2E64A 4JLGA 1WXBA 4PJOF 1YWOA 3URGA 1Q7YC 2DZCA 3RMSA 4C8QF 2KGTA 3QBYA 2H3EB 1FMVA 3QDRB 4M7DC 1YHQQ 1G5VA 2I2LA 3S3NA 2H8HA 4JZ3A 3PNWC 2DO3A 3NMZC 1VQMQ 2NYSA 3QUIA 2KXCA 2QDYB 1NJIC 3LLRA 1E6GA 2D0NA 2CGHA 1BI1A 1Q7YR 4A53A 1JXOA 1BYMA 2ECZA 1ABOA 1G83A 1NLOC 1UHFA 2X4XA 4ATOA 2O88A 3A8HB 3PFSA 2FRYA 1VQ7Q 3JCMb 2P4TA 1VA7A 1I4K1 1KJWA 1NEBA 1VIFA 1UGSB 4PJNA 3INZA 2QASA 2VYTA 1K4US 2P0QA 4PJOB 5GAN5 1VQLT 2O31A 1ZA1B 1W2BS 4C92B 1G3WA 3G71T 1QVFP 3NGPA 4C8QD 1TG0A 1WQWA 4RTYA 2JS2A 2E41A 3G1JA 3OS0A 5GAOr 4PJOD 4M78D 2J05A 1FXXA 2F69A 1IGUA 1X2QA 2PVOB 2QK0A 1Q81U 1BU1A 1MV0B 2E5QA 2WSCE 1XTDA 5LJ3e 1ARKA 1WDXA 2AZVA 2OJ2A 2RJDA 3GPLA 4JJBA 2JN0A 2DRKA 3EG9B 4JRIA 1X01A 2YWWA 5FU6B 4J83A 1YN8A 2YUPA 5A0LA 1UJ0A 2GQIA 4X9DA 2CREA 1YCYA 2EQKA 3MPUB 2P0KA 2FPEA 1U3OA 3QWXX 1RI9A 3A5ZB 3JCMf 2K7AA 1G3TA 4AG1C 5L23A 3CD6A 1VQOT 4KUDK 3KUFA 2LX7A 4HKEA 2QEXQ 2OTLT 3CXCS 3NTHA 4F7UB 1YBYA 4A54A 3G4SA 3RKXA 3I35A 1J3TA 2HAXA 4JS5A 1D3BB 4E47A 3O5ZA 3PGGA 4JS4A 3CCJT 2KMTA 2YUQA 3NTKA 1YIJQ 2RHZA 3A1PA 3V8JA 4J6YA 3J80E 1X69A 1OX8A 3DKMA 4J9IA 4M77G 2RHXA 3QHSA 4HT9A 4JJDA 1ZQ1A 2BZXA 1WX6A 1QP3A 1QVFA 3L2UA 3CCVA 1VQKQ 2L8DA 3EFSA 2WACA 3TEEA 2M0OA 1PNJA 2AHJB 2FZKB 4KGVB 3E9FA 1IHVA 2KI7A 1TS9A 4FM4B 4OGEA 5CAIA 4HVUA 2MI6A 4Z02A 1ZUUA 3RMQA 2DD4A 2DL3A 2PNIA 3KBGA 1TH7A 4M75B 1VQ8A 5J3BA 2FL7A 2RJCA 5HCKA 1VQ9A 1PKSA 1Q81C 1YWPA 2DVJA 1CKBA 3META 4D8KA 2RI2A 5KYUB 5GMKe 1HXDA 4J9GA 4LN2A 1NPRA 1HSQA 4BI3A 4PFPA 3EGDB 3A8MB 3LH0A 2SEMA 2L0AA 3M4YA 4NL3A 2KEAA 1IRXA 1WJQA 3M0RA 3I5RA 1K73R 2F2VA 5IT9E 3V7RA 1KQ2A 6AT1B 1QCOA 1XQHA 5KYWA 3U23A 1Q82C 2JM8A 4HVVA 4YTLA 1U1SA 4M7AG 1Q95G 3CPWA 2LMJA 4C8QB 1OQKA 2MAMA 2Z0WA 4EPCA 3EFOA 3EG1A 3PE0A 2OTLQ 5GAMh 3HP9A 3JB9F 1PCXA 3PMIA 2M0YA 2CUBA 4DBRA 2A36A 1JJ2A 4EMKB 3QO3A 3EGUA 2X3XD 3CBMA 1OPLA 4M7DB 1V76A 2DXTA 2CP5A 2L3RA 2C06A 5KE3A 4MMKA 5CO7A 5EG2A 3MP1A 5DLQE 3JCMX 3CCQA 2HKNA 2G3RA 5C0MA 3L2VA 1YNZA 1VQ6Q 1T3LA 4C5GA 5GAMg 2LCCA 2D9TA 4DOWA 4E7IA 1I5OB 4LUEA 1VQKA 1VQNT 3CD6Q 4LXCA 1YI2T 8AT1B 2B86A 3CBPA 1VQ6T 3SWNB 1NEGA 1VQ5A 4RG8A 4B6MA 3QYHB 2QEXA 3NPFA 3CMET 2RO0A 1SEMA 2BE7D 2HSEB 1K9MC 3SDZA 2VGMA 1SRMA 3JCMe 3E1SA 2MIOA 1YHQA 4QVCA 1VQPQ 2DILA 2KXDA 3CCRQ 1TUDA 1K9MU 1JJ2S 5FWBA 1SKUB 3I55T 1BI3A 3FJPA 2WSFE 5GAOq 3G6EQ 2O2OA 3ME9A 1X6GA 1OYXA 5FRMA 2Y4XA 4OGCA 2EFIA 1W70A 3LWIA 5CR2A 2JMAA 4MZMA 4PFOA 4BB7A 4M7AD 4Y92A 4M77A 2EBPA 1RLQC 1BCMA 3JSCA 1WJSA 3X26B 3P8BB 1M1KC 1GRIA 3TSZA 1PWTA 1NM7A 2A3LA 2J06A 1OV3A 2DBMA 4IUVA 4JZ4A 1KG1A 3JCMh 1WIEA 5GAOl 5DM7R 5FRNA 1D1AA 2HZYA 1W2BP 3OBWA 1H8KA 1ZUKA 2V8JA 1C1AA 4ZN3A 3QPHA 3OS5A 2COYA 2KT8A 2EPDA 3L2RA 3SD4A 1QKXA 3OYEA 1GCQC 4KUIA 4DQ2A 5GAOm 4KBMB 3WVEB 4M7DA 1UFFA 4GLMA 2LT4A 1N27A 1JQQA 1QVPA 2X51A 1UG1A 2KRSA 5D7UA 1K8AR 2VC8A 1XJWB 4RCCA 2DLPA 4IUQA 5GMKj 5AT1B 1BIBA 1F1BB 5LJ5f 4J5YA 4JLIA 2KSSA 4IIMA 5J39A 3LGLA 1IREB 3EFOB 4PK4A 3HRTA 5D6WA 1GFDA 2AZSA 2ESWA 1N8RU 2DETA 2W0ZA 4J9CA 1QVGP 5I11A 1K9AA 1WHJA 2JW4A 1YJ9A 4BACA 3HSBA 3M0PA 3H6ZA 3MJXA 5CKEA 3OYHA 1KQSS 2NUTB 4O6JA 5CCAA 1Q86R 3KFVA 2AIRB 3CCSQ 2XMFA 4ANJA 4UC4A 5GANg 3RNJA 2FRWA 2E1HA 2EJGA 4RMOA 3ZL7C 5GANe 4IUTA 5KYWB 1TTHB 2QG9B 4J6XA 2JVVA 1GXIE 1WI7A 4BE2A 4C92D 1O9SA 1RL2A 4DBQA 2VGNA 3CPFA 3CCMA 2E65A 4HVWA 4KH0B 2XK0A 2HNIA 1UUEA 1Y96B 3MHXA 3I56Q 4OMQA 3GLXA 3PIPA 3GIBA 2HSPA 1D0XA 3LWHA 1WA7A 2EYXA 2YLCA 4XU2A 2BE9B 2DF6A 4M7DF 1X6BA 4QQ6A 2KROA 2XDDA 2JJ9A 5GJVB 4CRIA 1GBRA 2EQJA 3I5SA 1QLYA 1R77A 1AHJB 1RAAB 1D0YA 3EFRA 3BE3A 1GFCA 5D6XA 2BKDN 2VUBA 4N4IA 1ZUYA 4XTXA 1TOVA 1VQ5T 3RR6A 2COWA 4RTTA 3JCMc 4BI8B 1H92A 2EQMA 2CP0A 4QVDA 2EYWA 2YRCA 3OY9A 4NL2A 3BFMA 3FDRA 1ZHIA 2RJFA 4M78E 2YRVA 1KK7A 3QZ5B 4II1A 2AKKA 2QQRA 1YJ9Q 2JS0A 4HXJA 3VS7A 2YUNA 4OF1A 2M9UA 2VASA 1VQNQ 1GL5A 4HCCA 4M77C 1Y57A 4OMNA 1D09B 4M7AA 1AT1B 1KQ1A 3M0TA 3VS6A 3M57A 2LJ1A 1UDLA 3QJ6A 1K8AU 4M7AE 2KNBB 3M9QA 1RABB 5KYXB 2KT1A 1PD0A 4FCYA 1NJIU 4X1VA 2FO0A 5A0DA 1RAGB 2DJQA 2ZAEA 4GLKA 1V29B 4CC3A 1UGRB 1GBQA 4LNPA 4OMMA 4JJNK 1QWFA 1SSFA 1EZZB 1SF9A 2IIMA 2KRMA 2MPXC 5GMKl 5LJ3g 2K3BA 2QQAA 2RHUA 4HCKA 3HL8A 4BE0A 3H8ZA 1N9SA 3OYCA 2EAYA 4KRTA 3OYNA 2QQSA 1VQ5Q 2DFUA 3M55A 3J81E 2CP6A 1KC8U 3LW5E 2ZPBB 2MMPA 5IHIA 1AEYA 2RK1A 3REAB 1ABQA 3L1AA 3CCEA 2L2PA 3CCMT 4P5NA 5I2MA 2K2VA 3H9NA 2G6FX 4FL6A 2XICA 2GTOA 3CCVT 2YLBA 3I56A 2JOYA 4LE9A 2DEQA 1X2KA 2E6NA 3QKJA 3JB9H 4PJOA 1KSWA 4HCZA 5GJWB 3NTIA 5GMKi 4C92A 4JJCA 4M78C 2LCLA 4XTYA 1U1TA 3CC7Q 3UWNA 3V8LA 4BDYA 1IO6A 1VQKT 2O01E 3TU4K 1RACB 2YDLA 2M16A 4B9XA 5GAOn 3OMGA 4DOVA 3L2ZA 3CCQT 2J6FA 2LX9A 2K2MA 5KYUA 1U5SA 4M75F 4ZGEB 4BD3A 3CCLA 5KYYB 1UE9A 3RKWA 4KH1B 3CD6T 2QQBA 1FMKA 3HPWA 5L8RE 3JV3A 4C0FA 1T0JA 2ROTA 2EKHA 4RG2A 3ZEHA 2RB6A 5I21A 2OX7A 1BIAA 4CI0C 1VQ6A 3CMAA 2OI3A 2FVUA 4E2FB 1Q82R 3PMTA 1VQPA 2LVMA 3CC2A 3L42A 1NE8A 1EFNA 4TVRA 2HBWA 2V1QA 1AWXA 1M5Q1 2EWNA 3SFMA 3UT1A 4XTWA 4PL6A 2GNCA 1VYUA 1M90C 4ZTFA 2FZGB 1YJNT 1FYNA 2F2XA 4DBFA 4M75A 3M58A 2EGAA 1M3BA 1XNIA 4R55A 4BE1A 1LVKA 4ELZC 1PD1A 2HD0A 3G71A 2CUDA 3I9QA 1MHNA 1P92A 4Z88A 3HKSA 4FYWB 3CXCP 2X4WA 1VQ7A 4FU6A 1PKTA 2A7YA 2PU9B 2E12A 5KYXA 5KYNA 3J7AF 1IB8A 2RK2A 2YT6A 3CMAT 2AT1B 2V8KA 5CKFA 1MGQA 2RQWA 4L5GA 4ZNXA 3OYJA 1Y71A 2CP7A 1ZA2B 3SWNC 1GCPA 2K79A 1MMGA 4F17A 2RQUA 1K76A 3JAME 2RHYA 3GOXA 2RQTA 2DL8A 5GAMf 5DY9A 1VQ8Q 2RH2A 4AFSC 4PLIA 2EQUA 2DTIA 5AYFA 3A8OB 3VUBA 2J6OA 4M77D 4ESRA 4LD9K 2VXEA 3LX7A 4RTXA 4LDXA 4GBQA 4N4GA 2CKKA 4FSXA 1Q86U 3G7ZA 1HJDA 1UHCA 4XAXB 1I0CA 2E3HA 2FYKA 1G3SA 4A4GA 4C5HA 4RTVA 2K57A 4C0DB 2HKQB 1DJ7B 4M78A 2GGRA 1PC0A 1UEBA 4EIKA 1MMAA 3TREA 4M78G 4C8QA 2HQEA 2HEQA 2I0NA 1X43A 2KQWA 5GAMd 3V7CA 2FZCB 1JB0E 3SHWA 4XTVA 4A4KA 1S72T 3CCJA 1I81A 3G4SQ 2DL7A 1U8RA 1EIFA 3A8LB 2CDTA 3T9NA 3SB2A 4GY5A 2V1RA 3CXCA 3HRUA 3CPWP 3KXTA 3L2WA 1X6OA 3BDUA 3QIIA 1K1ZA 2XDPA 2F5TX 2DMOA 4ZGDB 2Y90A 2DVEA 3CCST 1YI2Q 4ZGJB 4RTUA 4AG2C 4AFUC 3S6WA 3THKA 1N8RC 2ROLA 3OQ5A 2LT1A 1HD3A 5LJ3d 4X9CA 4XTUA 3JB9G 1UECA 3OYKA 4FYVB 3MEAA 4C92C 1WXTA 3EG0A 3H0IA 2DXBA 3CCMQ 3DB3A 3QZ9B 1KQSP 2NUPB 3I55Q 1M2VB 3VYGA 1XOVA 4DA4A 1KC8C 3MKDA 2CSIA 1G2BA 1X75C 3LYIA 4E7ZA 3F70A 4JRKA 1SG5A 2VB6A 3EG3A 3X25B 4C5IA 2CZ1B 2PUOB 5LJ5g 1PSEA 1VOMA 3CC7A 4ZN1A 1VQ9Q 1HYOA 2CH4W 1KD1U 1YJWT 1RAIB 4A4EA 4E7SA 1WLPB 5IXFA 4RTZA 4AT1B 3MP8A 3DB4A 1TUGB 1WHKA 3RKYA 3MEWA 3GP8A 5FU7B 3CCLQ 1B34B 1KHCA 4PNOA 1ZBJA 4C5EA 2L89A 2P84A 4EMHA 3JB9J 2K6DA 3BW1A 1JXMA 4OMOA 4HCBA 2A0FB 2C0TA 2L3QA 3C12A 2COZA 1D1BA 1SHGA 1QVGA 5I22A 2OTJA 3JCMJ 3JCMV 3N5BB 4XU0A 1Q81R 4M7AC 3CC4T 2CZ6B 2XDBA 4J9DA 2GFAA 1KFZA 4EDUA 1M9SA 2EVRA 2OTLA 4F04B 1NYFA 3M4GA 5FLXE 2D8HA 1R0BG 4QW2A 2QA4A 2QA4T 5FWCA 3CC2Q 4CC7A 2GFUA 3OYAA 2FEIA 2DAQA 3I56T 3R6OA 1M3AA 3VV0A 3JCMW 3E2UA 1VQNA 3VS4A 2PVGB 2PVDB 2NUPA 3CPWS 3CCVQ 4BY6B 2MK5A 1B7TA 3QWYA 4KGXB 2L3SA 2P4RA 3CC4A 1VQ4A 1RI0A 1WQ7A 4JUVA 4C0DC 3PVQA 1QVGS 1B3QA 2X3WD 1VQLQ 1Y96A 3G6EA 3UATA 2FB7A 1G3YA 2EW3A 4K11A 2YXYA 5A0GA 3ER0A 1YIJA 1YFNA 3M56A 5HK0A 4PLLA 3UA6A 1M1KU 3PT9A 2P0PA 4XQ3A 1JO8A 4QVZA 2E6ZA 1YJ9T 2DYBA 2X9HA 1PM3A 4MDXA 1HK9A 3OYMA 1H3HA 5HK3A 1VYVA 2QYZA 1AD5A 4KULA 1WZOA 2F5KA 3RIRA 2LQ8A 5DLOA 1AZGB 5CQXA 2GF7A 1SPKA 4R0KA 3CCUQ 1VQPT 1QCFA 4J9FA 4M77F 7AT1B 1Q86C 3FJ5A 1N6AA 2K3XA 4LDUA 2NUZA 5GAN8 1PSFA 2DKGA 1YJWA 1ZX6A 2QTVA 3OSSC 3UA7A 2JT4A 1G8XA 2DNUA 2KYBA 4NOYA 3CMEQ 1FX7A 4PJJA 1RAEB 1MMNA 3UDCA 1I07A 4F7UA 2XKOC 3FB9A 5FROA 4M75C 4EMGA 1WJRA 1MV3A 1YJNA 1RUWA 2EIFA 3VRYA 2QXFA 5CKDA 2W10A 1AZEA 1I8FA 2R5AA 5LJ5j 1NYGA 4M75E 2EYYA 3OA6A 5LJ3f 2RNAA 1K73U 1Y07A 4M77E 3L2QA 1S72A 2MYSA 3V8KA 4PJLA 1RAFB 3AHUA 2DIQA 1K8AC 5LJ3j 2R58A 1VQOQ 2VWFA 5FU6C 4M7DD 3VS3A 5LJ5h 1TWBA 5GAN4 4WF2A 2DL5A 3P8DA 2FPFA 3TVTA 1KIKA 2R57A 4EMKA 2E10A 1NG2A 5IHNA 2FHDA 2JZ2A 3M0SA 3CCET 3BDLA 1VQMA 2DJZA 2MCNA 1T0HA 1TXQA 2YSQA 2HL5C 2BZYA 4LDYA 4LDWA 2VKNA 1Q7YU 2DK3A 4IUUA 2DRMA 3I55A 2KYMA 4M7DE 3S3OA 1YCSB 2RA2A 2O9SA 4ORZA 3SWNA 4A63B 3RUXA 2DD5A 2A37A 2VV5A 4FIBA 2LJ3A 2QEXT 2ZPHB 3NFCA 3CCUA 3OYBA 4V2SA 1SSHA 3OSVA 2RMOA 5GAMe 2PZ1A 3PVLA 2BIVA 4Z89A 3JB9I 4OMLA 1YITT 4F7UF 1PRLC 2LC4A 3CC7T 3Q1JA 5GAN3 2FPDA 3O8VA 1LJOA 1KQSA 2GCXA 4PKCC 3CCRT 2EJ9A 2D8JA 1M1KR 1Y0MA 1TU0B 2B8AA 1X27A 1EX4A 3OW2A 4C8QG 2L3PA 2JTMA 1YP5A 4L6V5 5CIUA 4R56A 1QVFS 2DERA 4M7AB 1R8OB 4J6WA 1BKBA 2ZCFB 1ZSGA 2LTOA 1M8MA 1M1FA 3BY7A 4JDSA 5GANd 4PJOE 2JTFA 4VUBA 1CKAA 3ZFJA 4QQDA
chains in the Genus database with same CATH topology
1ZSZA 1OULA 1ZSZC 2NYSA 1YFNA 1TWBA 1ZSZB 1OX9A 2QAZA 1OU8A 1OU9A 2QASA 1OX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSZ A;  1OUL A;  1ZSZ C;  2NYS A;  1YFN A;  1TWB A;  1ZSZ B;  1OX9 A;  2QAZ A;  1OU8 A;  1OU9 A;  2QAS A;  1OX8 A; 
#chains in the Genus database with same CATH topology
 2MF2 A;  5IH2 A;  5LL6 S;  2LQK A;  1M27 C;  3H41 A;  4XK8 E;  3C0C A;  5IAY A;  2DXU A;  2DZ9 A;  1H3Z A;  3QDF A;  1K9M R;  3X28 B;  2EGE A;  1SHF A;  1JJ2 P;  1I1J A;  2ED0 A;  3MP6 A;  1KHI A;  5GAN j;  1QW1 A;  3OMC A;  1VQ8 T;  1GCQ A;  1NBE B;  2FG0 A;  1IGQ A;  2ENM A;  5GMK h;  2XD0 A;  3JCM P;  4MML A;  1T3S A;  4Y28 E;  4C8Q C;  2YUO A;  5D6Y A;  2KRN A;  3TCJ A;  3FEO A;  3LH5 A;  2RI3 A;  2OTJ Q;  1ZSZ B;  1Y7X A;  2X35 A;  3MCA B;  1C6V X;  4O5V A;  2ATC B;  2XI9 A;  2K3Y A;  3CCL T;  2LNV A;  4M4Z A;  5GAN 7;  4AFZ C;  2KR3 A;  4AFQ C;  2AKL A;  4FT4 A;  2DTH A;  4BUG A;  1UGV A;  3OBY A;  1YJW Q;  3AT1 B;  3GBQ A;  4Y91 A;  4J9H A;  1N5Z A;  2DIG A;  4E6R A;  3FIF A;  3OW2 S;  2ZPI B;  1W4S A;  4N0A A;  2M1H A;  5I2S A;  4NS5 A;  3H0F A;  2LQN A;  2OTJ T;  4KT0 E;  1RAD B;  2CH4 A;  5CQY A;  2CT4 A;  2LP5 A;  2D0Q B;  1I5L A;  3MEV A;  2RJE A;  4N4H A;  2HBP A;  3JCM d;  1WFW A;  3QG1 A;  1W2B A;  2M02 A;  5CKB A;  3G71 Q;  2BTT A;  3FC3 A;  2O4X B;  2DEU A;  3C95 A;  1VIE A;  2PQW A;  1M90 R;  1VQ7 T;  4L59 A;  4FYX B;  1WHG A;  2JTE A;  3HRS A;  2CZ7 B;  3OW2 P;  1V1C A;  1BCO A;  3EHR A;  3EGX B;  1N8R R;  1W6X A;  3OYG A;  2X4J A;  5ECA A;  3OYL A;  3RER A;  3JB9 D;  2DA9 A;  3VS0 A;  4OVA A;  3HHT B;  3ULR B;  3OYY A;  1E7O A;  3IQL A;  4C92 G;  2ABL A;  2HMA A;  4PJO G;  2QA4 Q;  2IPO B;  1WPY A;  1NZ9 A;  2HL3 A;  3CC2 T;  3FRN A;  3CCJ Q;  3RES A;  1PHT A;  3OS2 A;  2M51 A;  4OB2 B;  3VS1 A;  2NWM A;  2GTJ A;  2Y4Y A;  2LDM A;  5LJ5 d;  3A98 A;  4RTW A;  2XG8 D;  5LJ5 e;  4Z8A A;  2KAF A;  2CT3 A;  2RF0 A;  5HY6 A;  2ZPG B;  4C8Q E;  1MND A;  2DBK A;  2L5Q A;  5CKH A;  4HA8 A;  3MEU A;  1M1G A;  1OI1 A;  3VJP A;  5M9O A;  2EYZ A;  1D1C A;  2E70 A;  3WXM B;  2AK5 A;  1OU9 A;  3CBO A;  2DYI A;  1D3B A;  4ELY C;  1BI2 A;  2CP3 A;  3CCS A;  2DTO A;  1OPK A;  3M54 A;  3X20 B;  1YIT A;  2DPP B;  2RQR A;  1UTI A;  4DEY A;  3G6E T;  4OMF B;  4LUD A;  2KK4 A;  4DBH A;  3NHN A;  1QP2 A;  2C0I A;  1PG5 B;  1RLP C;  1K0S A;  2PTK A;  2NLU A;  1NLP C;  3QXE B;  4WTO B;  2ZPE B;  1VUB A;  1ZSZ A;  2A28 A;  4RUG A;  4M78 B;  4M7D G;  1MNE A;  4A4H A;  2V26 A;  2MWP A;  4E7K A;  4OB1 B;  2RD1 A;  1M2V A;  3VUZ A;  1B07 A;  2JMC A;  2BUD A;  2YRD A;  3REB B;  4F7U E;  2EQI A;  1QQJ A;  1M8V A;  3OB9 A;  2WSE E;  1WXU A;  1N9R A;  2HQH A;  1YIT Q;  1Z9Q A;  4Q5W A;  1TUC A;  1M3C A;  5GAM j;  1JRI A;  3C4S A;  4OB0 B;  5C6S A;  2DE0 X;  2H3J A;  2RHI A;  1YJN Q;  2CP2 A;  3M5A A;  3UF4 A;  3CMA Q;  4J7I A;  4A4F A;  3ZBD A;  1UB4 A;  3RBB B;  3CME A;  4N0A C;  1OU8 A;  3HFO A;  5GAN 6;  3FLG A;  2HQX A;  1AVZ C;  4OP0 A;  1NPP A;  1LPL A;  1K0X A;  2K5I A;  3LGF A;  1YI2 A;  2O4X A;  1Z9Z A;  2MOX A;  4LD6 A;  1WGS A;  1NJI R;  1IZ6 A;  2VXF A;  2C0O A;  5EC7 A;  4JRQ A;  4RCB A;  4M75 G;  2RM4 A;  4M78 F;  5CK9 A;  3CEY A;  3VS2 A;  1IXD A;  4MZP A;  4FW2 A;  4E7H A;  2QAZ A;  3M0Q A;  2ZPF B;  5KCH A;  3OYD A;  1ZSZ C;  3E9G A;  1WYX A;  2EJF A;  2VVK A;  3R6N A;  3VS5 A;  3DLL A;  4ZTJ A;  3CCR A;  5CVI A;  4FT2 A;  3TQ7 P;  5KYY A;  3H0H A;  1H64 1;  1TSF A;  4JPB W;  3WVD B;  4M7A F;  1BI0 A;  2X4Y A;  3EGD A;  1KC8 R;  4M77 B;  2BZ8 A;  4KGZ B;  1VQL A;  1VQ4 Q;  2D6F A;  4HT8 A;  2CSQ A;  2DXC A;  2LCS A;  4QKU A;  3SEM A;  2LRQ A;  3HFN A;  4X34 A;  3GNF B;  2XU8 A;  4LDV A;  2CS7 A;  2D1X A;  1OUL A;  2R5M A;  4B9W A;  2F1L A;  4EMK C;  2DM1 A;  1W1F A;  2EGC A;  4F7U G;  4J7F A;  1FWZ A;  4CC4 B;  3QYG B;  1U06 A;  3EGX A;  5IXB A;  5LJ3 h;  2DL4 A;  3GNG A;  1A0N B;  1KD1 R;  5HKC A;  2F2W A;  1AWO A;  3JCM g;  1BBZ A;  5J26 A;  5KH6 A;  4IKF A;  1LOJ A;  3S3M A;  4OMP A;  3V7S A;  1VQM T;  4M75 D;  1ACM B;  1WHM A;  4PJO C;  2RPN A;  3CCU T;  1YHQ T;  3CQT A;  2RI5 A;  3HTR A;  3D7S B;  1FMW A;  1R0C B;  4C0Z A;  5IHK A;  4MDW A;  5GAO p;  3RDV A;  1BK2 A;  2EKO A;  2JXB A;  1OZ2 A;  3X24 B;  3E19 A;  3CCE Q;  2IG0 A;  1QCN A;  2HDA A;  4J8O A;  2LNH B;  4C92 F;  3PTA A;  2QI2 A;  1PRM C;  3CCQ Q;  4E7J A;  2KE9 A;  3PIO A;  1Q82 U;  2LJ0 A;  3GF5 A;  3VYH B;  3TSW A;  2XHC A;  1IHW A;  4ME7 A;  1S72 Q;  2O9V A;  1MMD A;  2J6K A;  4F16 A;  4BDZ A;  1K73 C;  2QDL A;  3G4S T;  2MWO A;  3OYI A;  5KCO A;  1VYT A;  4OB3 B;  1S1N A;  2E4H A;  2ZGW A;  4RKU E;  3ASK A;  4CC2 A;  8ATC B;  1UJY A;  1VQO A;  4JRP A;  4PFZ A;  5KE2 A;  3C94 A;  1WNL A;  2QGF B;  5GAN 2;  1JEG A;  4IIO A;  4MZT A;  3MO8 A;  1AWW A;  1AWJ A;  2E5K A;  2PUK B;  2QQ9 A;  5A2Q E;  9ATC B;  4C92 E;  3EH2 A;  4IUP A;  4XU3 A;  1ZLM A;  2EYQ A;  2SRC A;  2E3I A;  1M2O A;  3EAE A;  5GMK m;  2JNG A;  1QKW A;  1M90 U;  4XTZ A;  4E7L A;  1OOT A;  1OX9 A;  3QJY A;  5FU7 C;  2JUF A;  2K9G A;  4F14 A;  1SRL A;  2OAW A;  1D0Z A;  2KVQ G;  1LCK A;  3CC4 Q;  1KD1 C;  1OZ3 A;  1C0M A;  2ED1 A;  4D8D A;  2RQV A;  4FW1 A;  1UGP B;  1M30 A;  2K5F A;  2QTX A;  1AOJ A;  1QWE A;  2DX1 A;  3VKI A;  3A8G B;  4QT7 A;  4QQG A;  2GBQ A;  1BB9 A;  2CZ0 B;  3M53 A;  1OEB A;  1RAH B;  1ZBX A;  4XU1 A;  4PJM A;  2CYZ B;  5IN1 A;  3OS1 A;  2XID A;  1WHL A;  4FSS A;  5FW9 A;  4C0G A;  2J7I A;  2GQV A;  1WHH A;  3EG9 A;  3OYF A;  1UGQ B;  2RN8 A;  1QMC A;  3EG2 A;  4J9E A;  3M59 A;  2YHT A;  4BI4 A;  1MUZ A;  4WCI A;  3M0U A;  4AMC A;  2K5L A;  3EH1 A;  1JBM A;  1O75 A;  1VQ9 T;  1JU5 C;  4FYY B;  1YIJ T;  2V8I A;  5GAN f;  1LNX A;  2LZ6 B;  2OAU A;  2IVW A;  2LQW A;  3QSU A;  3EHQ A;  2KBT A;  4IUR A;  1CSK A;  3P8H A;  2QGG A;  3JRZ A;  4BY6 C;  4DEX A;  5GAN h;  3UPU A;  1VQ4 T;  2JM9 A;  4D6W A;  2KDS A;  2KY9 A;  4J9B A;  1M4Z A;  2HCK A;  1E6H A;  2NUT A;  2K4Y A;  2ZZD A;  3DLM A;  3VU3 C;  3VRZ A;  1B34 A;  3JCM Q;  2A08 A;  2E64 A;  4JLG A;  1WXB A;  4PJO F;  1YWO A;  3URG A;  1Q7Y C;  2DZC A;  3RMS A;  4C8Q F;  2KGT A;  3QBY A;  2H3E B;  1FMV A;  3QDR B;  4M7D C;  1YHQ Q;  1G5V A;  2I2L A;  3S3N A;  2H8H A;  4JZ3 A;  3PNW C;  2DO3 A;  3NMZ C;  1VQM Q;  2NYS A;  3QUI A;  2KXC A;  2QDY B;  1NJI C;  3LLR A;  1E6G A;  2D0N A;  2CGH A;  1BI1 A;  1Q7Y R;  4A53 A;  1JXO A;  1BYM A;  2ECZ A;  1ABO A;  1G83 A;  1NLO C;  1UHF A;  2X4X A;  4ATO A;  2O88 A;  3A8H B;  3PFS A;  2FRY A;  1VQ7 Q;  3JCM b;  2P4T A;  1VA7 A;  1I4K 1;  1KJW A;  1NEB A;  1VIF A;  1UGS B;  4PJN A;  3INZ A;  2QAS A;  2VYT A;  1K4U S;  2P0Q A;  4PJO B;  5GAN 5;  1VQL T;  2O31 A;  1ZA1 B;  1W2B S;  4C92 B;  1G3W A;  3G71 T;  1QVF P;  3NGP A;  4C8Q D;  1TG0 A;  1WQW A;  4RTY A;  2JS2 A;  2E41 A;  3G1J A;  3OS0 A;  5GAO r;  4PJO D;  4M78 D;  2J05 A;  1FXX A;  2F69 A;  1IGU A;  1X2Q A;  2PVO B;  2QK0 A;  1Q81 U;  1BU1 A;  1MV0 B;  2E5Q A;  2WSC E;  1XTD A;  5LJ3 e;  1ARK A;  1WDX A;  2AZV A;  2OJ2 A;  2RJD A;  3GPL A;  4JJB A;  2JN0 A;  2DRK A;  3EG9 B;  4JRI A;  1X01 A;  2YWW A;  5FU6 B;  4J83 A;  1YN8 A;  2YUP A;  5A0L A;  1UJ0 A;  2GQI A;  4X9D A;  2CRE A;  1YCY A;  2EQK A;  3MPU B;  2P0K A;  2FPE A;  1U3O A;  3QWX X;  1RI9 A;  3A5Z B;  3JCM f;  2K7A A;  1G3T A;  4AG1 C;  5L23 A;  3CD6 A;  1VQO T;  4KUD K;  3KUF A;  2LX7 A;  4HKE A;  2QEX Q;  2OTL T;  3CXC S;  3NTH A;  4F7U B;  1YBY A;  4A54 A;  3G4S A;  3RKX A;  3I35 A;  1J3T A;  2HAX A;  4JS5 A;  1D3B B;  4E47 A;  3O5Z A;  3PGG A;  4JS4 A;  3CCJ T;  2KMT A;  2YUQ A;  3NTK A;  1YIJ Q;  2RHZ A;  3A1P A;  3V8J A;  4J6Y A;  3J80 E;  1X69 A;  1OX8 A;  3DKM A;  4J9I A;  4M77 G;  2RHX A;  3QHS A;  4HT9 A;  4JJD A;  1ZQ1 A;  2BZX A;  1WX6 A;  1QP3 A;  1QVF A;  3L2U A;  3CCV A;  1VQK Q;  2L8D A;  3EFS A;  2WAC A;  3TEE A;  2M0O A;  1PNJ A;  2AHJ B;  2FZK B;  4KGV B;  3E9F A;  1IHV A;  2KI7 A;  1TS9 A;  4FM4 B;  4OGE A;  5CAI A;  4HVU A;  2MI6 A;  4Z02 A;  1ZUU A;  3RMQ A;  2DD4 A;  2DL3 A;  2PNI A;  3KBG A;  1TH7 A;  4M75 B;  1VQ8 A;  5J3B A;  2FL7 A;  2RJC A;  5HCK A;  1VQ9 A;  1PKS A;  1Q81 C;  1YWP A;  2DVJ A;  1CKB A;  3MET A;  4D8K A;  2RI2 A;  5KYU B;  5GMK e;  1HXD A;  4J9G A;  4LN2 A;  1NPR A;  1HSQ A;  4BI3 A;  4PFP A;  3EGD B;  3A8M B;  3LH0 A;  2SEM A;  2L0A A;  3M4Y A;  4NL3 A;  2KEA A;  1IRX A;  1WJQ A;  3M0R A;  3I5R A;  1K73 R;  2F2V A;  5IT9 E;  3V7R A;  1KQ2 A;  6AT1 B;  1QCO A;  1XQH A;  5KYW A;  3U23 A;  1Q82 C;  2JM8 A;  4HVV A;  4YTL A;  1U1S A;  4M7A G;  1Q95 G;  3CPW A;  2LMJ A;  4C8Q B;  1OQK A;  2MAM A;  2Z0W A;  4EPC A;  3EFO A;  3EG1 A;  3PE0 A;  2OTL Q;  5GAM h;  3HP9 A;  3JB9 F;  1PCX A;  3PMI A;  2M0Y A;  2CUB A;  4DBR A;  2A36 A;  1JJ2 A;  4EMK B;  3QO3 A;  3EGU A;  2X3X D;  3CBM A;  1OPL A;  4M7D B;  1V76 A;  2DXT A;  2CP5 A;  2L3R A;  2C06 A;  5KE3 A;  4MMK A;  5CO7 A;  5EG2 A;  3MP1 A;  5DLQ E;  3JCM X;  3CCQ A;  2HKN A;  2G3R A;  5C0M A;  3L2V A;  1YNZ A;  1VQ6 Q;  1T3L A;  4C5G A;  5GAM g;  2LCC A;  2D9T A;  4DOW A;  4E7I A;  1I5O B;  4LUE A;  1VQK A;  1VQN T;  3CD6 Q;  4LXC A;  1YI2 T;  8AT1 B;  2B86 A;  3CBP A;  1VQ6 T;  3SWN B;  1NEG A;  1VQ5 A;  4RG8 A;  4B6M A;  3QYH B;  2QEX A;  3NPF A;  3CME T;  2RO0 A;  1SEM A;  2BE7 D;  2HSE B;  1K9M C;  3SDZ A;  2VGM A;  1SRM A;  3JCM e;  3E1S A;  2MIO A;  1YHQ A;  4QVC A;  1VQP Q;  2DIL A;  2KXD A;  3CCR Q;  1TUD A;  1K9M U;  1JJ2 S;  5FWB A;  1SKU B;  3I55 T;  1BI3 A;  3FJP A;  2WSF E;  5GAO q;  3G6E Q;  2O2O A;  3ME9 A;  1X6G A;  1OYX A;  5FRM A;  2Y4X A;  4OGC A;  2EFI A;  1W70 A;  3LWI A;  5CR2 A;  2JMA A;  4MZM A;  4PFO A;  4BB7 A;  4M7A D;  4Y92 A;  4M77 A;  2EBP A;  1RLQ C;  1BCM A;  3JSC A;  1WJS A;  3X26 B;  3P8B B;  1M1K C;  1GRI A;  3TSZ A;  1PWT A;  1NM7 A;  2A3L A;  2J06 A;  1OV3 A;  2DBM A;  4IUV A;  4JZ4 A;  1KG1 A;  3JCM h;  1WIE A;  5GAO l;  5DM7 R;  5FRN A;  1D1A A;  2HZY A;  1W2B P;  3OBW A;  1H8K A;  1ZUK A;  2V8J A;  1C1A A;  4ZN3 A;  3QPH A;  3OS5 A;  2COY A;  2KT8 A;  2EPD A;  3L2R A;  3SD4 A;  1QKX A;  3OYE A;  1GCQ C;  4KUI A;  4DQ2 A;  5GAO m;  4KBM B;  3WVE B;  4M7D A;  1UFF A;  4GLM A;  2LT4 A;  1N27 A;  1JQQ A;  1QVP A;  2X51 A;  1UG1 A;  2KRS A;  5D7U A;  1K8A R;  2VC8 A;  1XJW B;  4RCC A;  2DLP A;  4IUQ A;  5GMK j;  5AT1 B;  1BIB A;  1F1B B;  5LJ5 f;  4J5Y A;  4JLI A;  2KSS A;  4IIM A;  5J39 A;  3LGL A;  1IRE B;  3EFO B;  4PK4 A;  3HRT A;  5D6W A;  1GFD A;  2AZS A;  2ESW A;  1N8R U;  2DET A;  2W0Z A;  4J9C A;  1QVG P;  5I11 A;  1K9A A;  1WHJ A;  2JW4 A;  1YJ9 A;  4BAC A;  3HSB A;  3M0P A;  3H6Z A;  3MJX A;  5CKE A;  3OYH A;  1KQS S;  2NUT B;  4O6J A;  5CCA A;  1Q86 R;  3KFV A;  2AIR B;  3CCS Q;  2XMF A;  4ANJ A;  4UC4 A;  5GAN g;  3RNJ A;  2FRW A;  2E1H A;  2EJG A;  4RMO A;  3ZL7 C;  5GAN e;  4IUT A;  5KYW B;  1TTH B;  2QG9 B;  4J6X A;  2JVV A;  1GXI E;  1WI7 A;  4BE2 A;  4C92 D;  1O9S A;  1RL2 A;  4DBQ A;  2VGN A;  3CPF A;  3CCM A;  2E65 A;  4HVW A;  4KH0 B;  2XK0 A;  2HNI A;  1UUE A;  1Y96 B;  3MHX A;  3I56 Q;  4OMQ A;  3GLX A;  3PIP A;  3GIB A;  2HSP A;  1D0X A;  3LWH A;  1WA7 A;  2EYX A;  2YLC A;  4XU2 A;  2BE9 B;  2DF6 A;  4M7D F;  1X6B A;  4QQ6 A;  2KRO A;  2XDD A;  2JJ9 A;  5GJV B;  4CRI A;  1GBR A;  2EQJ A;  3I5S A;  1QLY A;  1R77 A;  1AHJ B;  1RAA B;  1D0Y A;  3EFR A;  3BE3 A;  1GFC A;  5D6X A;  2BKD N;  2VUB A;  4N4I A;  1ZUY A;  4XTX A;  1TOV A;  1VQ5 T;  3RR6 A;  2COW A;  4RTT A;  3JCM c;  4BI8 B;  1H92 A;  2EQM A;  2CP0 A;  4QVD A;  2EYW A;  2YRC A;  3OY9 A;  4NL2 A;  3BFM A;  3FDR A;  1ZHI A;  2RJF A;  4M78 E;  2YRV A;  1KK7 A;  3QZ5 B;  4II1 A;  2AKK A;  2QQR A;  1YJ9 Q;  2JS0 A;  4HXJ A;  3VS7 A;  2YUN A;  4OF1 A;  2M9U A;  2VAS A;  1VQN Q;  1GL5 A;  4HCC A;  4M77 C;  1Y57 A;  4OMN A;  1D09 B;  4M7A A;  1AT1 B;  1KQ1 A;  3M0T A;  3VS6 A;  3M57 A;  2LJ1 A;  1UDL A;  3QJ6 A;  1K8A U;  4M7A E;  2KNB B;  3M9Q A;  1RAB B;  5KYX B;  2KT1 A;  1PD0 A;  4FCY A;  1NJI U;  4X1V A;  2FO0 A;  5A0D A;  1RAG B;  2DJQ A;  2ZAE A;  4GLK A;  1V29 B;  4CC3 A;  1UGR B;  1GBQ A;  4LNP A;  4OMM A;  4JJN K;  1QWF A;  1SSF A;  1EZZ B;  1SF9 A;  2IIM A;  2KRM A;  2MPX C;  5GMK l;  5LJ3 g;  2K3B A;  2QQA A;  2RHU A;  4HCK A;  3HL8 A;  4BE0 A;  3H8Z A;  1N9S A;  3OYC A;  2EAY A;  4KRT A;  3OYN A;  2QQS A;  1VQ5 Q;  2DFU A;  3M55 A;  3J81 E;  2CP6 A;  1KC8 U;  3LW5 E;  2ZPB B;  2MMP A;  5IHI A;  1AEY A;  2RK1 A;  3REA B;  1ABQ A;  3L1A A;  3CCE A;  2L2P A;  3CCM T;  4P5N A;  5I2M A;  2K2V A;  3H9N A;  2G6F X;  4FL6 A;  2XIC A;  2GTO A;  3CCV T;  2YLB A;  3I56 A;  2JOY A;  4LE9 A;  2DEQ A;  1X2K A;  2E6N A;  3QKJ A;  3JB9 H;  4PJO A;  1KSW A;  4HCZ A;  5GJW B;  3NTI A;  5GMK i;  4C92 A;  4JJC A;  4M78 C;  2LCL A;  4XTY A;  1U1T A;  3CC7 Q;  3UWN A;  3V8L A;  4BDY A;  1IO6 A;  1VQK T;  2O01 E;  3TU4 K;  1RAC B;  2YDL A;  2M16 A;  4B9X A;  5GAO n;  3OMG A;  4DOV A;  3L2Z A;  3CCQ T;  2J6F A;  2LX9 A;  2K2M A;  5KYU A;  1U5S A;  4M75 F;  4ZGE B;  4BD3 A;  3CCL A;  5KYY B;  1UE9 A;  3RKW A;  4KH1 B;  3CD6 T;  2QQB A;  1FMK A;  3HPW A;  5L8R E;  3JV3 A;  4C0F A;  1T0J A;  2ROT A;  2EKH A;  4RG2 A;  3ZEH A;  2RB6 A;  5I21 A;  2OX7 A;  1BIA A;  4CI0 C;  1VQ6 A;  3CMA A;  2OI3 A;  2FVU A;  4E2F B;  1Q82 R;  3PMT A;  1VQP A;  2LVM A;  3CC2 A;  3L42 A;  1NE8 A;  1EFN A;  4TVR A;  2HBW A;  2V1Q A;  1AWX A;  1M5Q 1;  2EWN A;  3SFM A;  3UT1 A;  4XTW A;  4PL6 A;  2GNC A;  1VYU A;  1M90 C;  4ZTF A;  2FZG B;  1YJN T;  1FYN A;  2F2X A;  4DBF A;  4M75 A;  3M58 A;  2EGA A;  1M3B A;  1XNI A;  4R55 A;  4BE1 A;  1LVK A;  4ELZ C;  1PD1 A;  2HD0 A;  3G71 A;  2CUD A;  3I9Q A;  1MHN A;  1P92 A;  4Z88 A;  3HKS A;  4FYW B;  3CXC P;  2X4W A;  1VQ7 A;  4FU6 A;  1PKT A;  2A7Y A;  2PU9 B;  2E12 A;  5KYX A;  5KYN A;  3J7A F;  1IB8 A;  2RK2 A;  2YT6 A;  3CMA T;  2AT1 B;  2V8K A;  5CKF A;  1MGQ A;  2RQW A;  4L5G A;  4ZNX A;  3OYJ A;  1Y71 A;  2CP7 A;  1ZA2 B;  3SWN C;  1GCP A;  2K79 A;  1MMG A;  4F17 A;  2RQU A;  1K76 A;  3JAM E;  2RHY A;  3GOX A;  2RQT A;  2DL8 A;  5GAM f;  5DY9 A;  1VQ8 Q;  2RH2 A;  4AFS C;  4PLI A;  2EQU A;  2DTI A;  5AYF A;  3A8O B;  3VUB A;  2J6O A;  4M77 D;  4ESR A;  4LD9 K;  2VXE A;  3LX7 A;  4RTX A;  4LDX A;  4GBQ A;  4N4G A;  2CKK A;  4FSX A;  1Q86 U;  3G7Z A;  1HJD A;  1UHC A;  4XAX B;  1I0C A;  2E3H A;  2FYK A;  1G3S A;  4A4G A;  4C5H A;  4RTV A;  2K57 A;  4C0D B;  2HKQ B;  1DJ7 B;  4M78 A;  2GGR A;  1PC0 A;  1UEB A;  4EIK A;  1MMA A;  3TRE A;  4M78 G;  4C8Q A;  2HQE A;  2HEQ A;  2I0N A;  1X43 A;  2KQW A;  5GAM d;  3V7C A;  2FZC B;  1JB0 E;  3SHW A;  4XTV A;  4A4K A;  1S72 T;  3CCJ A;  1I81 A;  3G4S Q;  2DL7 A;  1U8R A;  1EIF A;  3A8L B;  2CDT A;  3T9N A;  3SB2 A;  4GY5 A;  2V1R A;  3CXC A;  3HRU A;  3CPW P;  3KXT A;  3L2W A;  1X6O A;  3BDU A;  3QII A;  1K1Z A;  2XDP A;  2F5T X;  2DMO A;  4ZGD B;  2Y90 A;  2DVE A;  3CCS T;  1YI2 Q;  4ZGJ B;  4RTU A;  4AG2 C;  4AFU C;  3S6W A;  3THK A;  1N8R C;  2ROL A;  3OQ5 A;  2LT1 A;  1HD3 A;  5LJ3 d;  4X9C A;  4XTU A;  3JB9 G;  1UEC A;  3OYK A;  4FYV B;  3MEA A;  4C92 C;  1WXT A;  3EG0 A;  3H0I A;  2DXB A;  3CCM Q;  3DB3 A;  3QZ9 B;  1KQS P;  2NUP B;  3I55 Q;  1M2V B;  3VYG A;  1XOV A;  4DA4 A;  1KC8 C;  3MKD A;  2CSI A;  1G2B A;  1X75 C;  3LYI A;  4E7Z A;  3F70 A;  4JRK A;  1SG5 A;  2VB6 A;  3EG3 A;  3X25 B;  4C5I A;  2CZ1 B;  2PUO B;  5LJ5 g;  1PSE A;  1VOM A;  3CC7 A;  4ZN1 A;  1VQ9 Q;  1HYO A;  2CH4 W;  1KD1 U;  1YJW T;  1RAI B;  4A4E A;  4E7S A;  1WLP B;  5IXF A;  4RTZ A;  4AT1 B;  3MP8 A;  3DB4 A;  1TUG B;  1WHK A;  3RKY A;  3MEW A;  3GP8 A;  5FU7 B;  3CCL Q;  1B34 B;  1KHC A;  4PNO A;  1ZBJ A;  4C5E A;  2L89 A;  2P84 A;  4EMH A;  3JB9 J;  2K6D A;  3BW1 A;  1JXM A;  4OMO A;  4HCB A;  2A0F B;  2C0T A;  2L3Q A;  3C12 A;  2COZ A;  1D1B A;  1SHG A;  1QVG A;  5I22 A;  2OTJ A;  3JCM J;  3JCM V;  3N5B B;  4XU0 A;  1Q81 R;  4M7A C;  3CC4 T;  2CZ6 B;  2XDB A;  4J9D A;  2GFA A;  1KFZ A;  4EDU A;  1M9S A;  2EVR A;  2OTL A;  4F04 B;  1NYF A;  3M4G A;  5FLX E;  2D8H A;  1R0B G;  4QW2 A;  2QA4 A;  2QA4 T;  5FWC A;  3CC2 Q;  4CC7 A;  2GFU A;  3OYA A;  2FEI A;  2DAQ A;  3I56 T;  3R6O A;  1M3A A;  3VV0 A;  3JCM W;  3E2U A;  1VQN A;  3VS4 A;  2PVG B;  2PVD B;  2NUP A;  3CPW S;  3CCV Q;  4BY6 B;  2MK5 A;  1B7T A;  3QWY A;  4KGX B;  2L3S A;  2P4R A;  3CC4 A;  1VQ4 A;  1RI0 A;  1WQ7 A;  4JUV A;  4C0D C;  3PVQ A;  1QVG S;  1B3Q A;  2X3W D;  1VQL Q;  1Y96 A;  3G6E A;  3UAT A;  2FB7 A;  1G3Y A;  2EW3 A;  4K11 A;  2YXY A;  5A0G A;  3ER0 A;  1YIJ A;  1YFN A;  3M56 A;  5HK0 A;  4PLL A;  3UA6 A;  1M1K U;  3PT9 A;  2P0P A;  4XQ3 A;  1JO8 A;  4QVZ A;  2E6Z A;  1YJ9 T;  2DYB A;  2X9H A;  1PM3 A;  4MDX A;  1HK9 A;  3OYM A;  1H3H A;  5HK3 A;  1VYV A;  2QYZ A;  1AD5 A;  4KUL A;  1WZO A;  2F5K A;  3RIR A;  2LQ8 A;  5DLO A;  1AZG B;  5CQX A;  2GF7 A;  1SPK A;  4R0K A;  3CCU Q;  1VQP T;  1QCF A;  4J9F A;  4M77 F;  7AT1 B;  1Q86 C;  3FJ5 A;  1N6A A;  2K3X A;  4LDU A;  2NUZ A;  5GAN 8;  1PSF A;  2DKG A;  1YJW A;  1ZX6 A;  2QTV A;  3OSS C;  3UA7 A;  2JT4 A;  1G8X A;  2DNU A;  2KYB A;  4NOY A;  3CME Q;  1FX7 A;  4PJJ A;  1RAE B;  1MMN A;  3UDC A;  1I07 A;  4F7U A;  2XKO C;  3FB9 A;  5FRO A;  4M75 C;  4EMG A;  1WJR A;  1MV3 A;  1YJN A;  1RUW A;  2EIF A;  3VRY A;  2QXF A;  5CKD A;  2W10 A;  1AZE A;  1I8F A;  2R5A A;  5LJ5 j;  1NYG A;  4M75 E;  2EYY A;  3OA6 A;  5LJ3 f;  2RNA A;  1K73 U;  1Y07 A;  4M77 E;  3L2Q A;  1S72 A;  2MYS A;  3V8K A;  4PJL A;  1RAF B;  3AHU A;  2DIQ A;  1K8A C;  5LJ3 j;  2R58 A;  1VQO Q;  2VWF A;  5FU6 C;  4M7D D;  3VS3 A;  5LJ5 h;  1TWB A;  5GAN 4;  4WF2 A;  2DL5 A;  3P8D A;  2FPF A;  3TVT A;  1KIK A;  2R57 A;  4EMK A;  2E10 A;  1NG2 A;  5IHN A;  2FHD A;  2JZ2 A;  3M0S A;  3CCE T;  3BDL A;  1VQM A;  2DJZ A;  2MCN A;  1T0H A;  1TXQ A;  2YSQ A;  2HL5 C;  2BZY A;  4LDY A;  4LDW A;  2VKN A;  1Q7Y U;  2DK3 A;  4IUU A;  2DRM A;  3I55 A;  2KYM A;  4M7D E;  3S3O A;  1YCS B;  2RA2 A;  2O9S A;  4ORZ A;  3SWN A;  4A63 B;  3RUX A;  2DD5 A;  2A37 A;  2VV5 A;  4FIB A;  2LJ3 A;  2QEX T;  2ZPH B;  3NFC A;  3CCU A;  3OYB A;  4V2S A;  1SSH A;  3OSV A;  2RMO A;  5GAM e;  2PZ1 A;  3PVL A;  2BIV A;  4Z89 A;  3JB9 I;  4OML A;  1YIT T;  4F7U F;  1PRL C;  2LC4 A;  3CC7 T;  3Q1J A;  5GAN 3;  2FPD A;  3O8V A;  1LJO A;  1KQS A;  2GCX A;  4PKC C;  3CCR T;  2EJ9 A;  2D8J A;  1M1K R;  1Y0M A;  1TU0 B;  2B8A A;  1X27 A;  1EX4 A;  3OW2 A;  4C8Q G;  2L3P A;  2JTM A;  1YP5 A;  4L6V 5;  5CIU A;  4R56 A;  1QVF S;  2DER A;  4M7A B;  1R8O B;  4J6W A;  1BKB A;  2ZCF B;  1ZSG A;  2LTO A;  1M8M A;  1M1F A;  3BY7 A;  4JDS A;  5GAN d;  4PJO E;  2JTF A;  4VUB A;  1CKA A;  3ZFJ A;  4QQD A; 
#chains in the Genus database with same CATH homology
 1ZSZ A;  1OUL A;  1ZSZ C;  2NYS A;  1YFN A;  1TWB A;  1ZSZ B;  1OX9 A;  2QAZ A;  1OU8 A;  1OU9 A;  2QAS A;  1OX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...