1OULA

Structure of the aaa+ protease delivery protein sspb
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYDELNIEPDTEQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 25
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1oulA00
1OULA 1OU8A 1OX8A 2NYSA 1TWBA 1YFNA 1OX9A 1ZSZC 2QASA 1ZSZB 2QAZA 1OU9A 1ZSZA
chains in the Genus database with same CATH superfamily
4PJLA 1EZZB 2EYXA 1OQKA 2JXBA 2YT6A 1GL5A 2FVUA 1VQOT 5GMKj 1PG5B 3L42A 3SHWA 1FWZA 1TWBA 2EQJA 1WIEA 3DKMA 2VGNA 2K7AA 4F04B 1G3YA 1W4SA 2QQBA 4A4HA 2KBTA 2CREA 3E19A 5KYNA 1KFZA 1PKTA 3JCMP 1O9SA 1D3BB 2EW3A 1W70A 5HK3A 4BI3A 3E9FA 3M0UA 1D3BA 2QEXT 2KDSA 4B9WA 2F69A 1OZ2A 4CC2A 4EDUA 1SSHA 4XU0A 2J6FA 2LQKA 4ELYC 5KYXB 2NUZA 5HY6A 4E2FB 4XAXB 3LGFA 3X24B 1VQNA 2FB7A 1RLQC 1H8KA 2YRVA 1M3BA 5GAN4 5CKDA 1M8VA 2RI2A 4JLGA 3IQLA 3I55Q 2FPDA 1YJWQ 4DEYA 4UC4A 4BI8B 2RQWA 2DX1A 4DBRA 2CZ1B 2YUPA 3JCMe 3CCVT 2K3BA 3ZBDA 2W10A 4C0DB 5CO7A 1VQPA 5M9OA 3JB9G 1RAEB 2KRMA 1Q95G 1B34B 2RJDA 1VQMT 1M9SA 1SRLA 2VYTA 1TH7A 3P8DA 3VS4A 5GANg 3HKSA 3RIRA 2VUBA 2GTJA 4M78D 1VQ4T 2XMFA 4M7DD 3EFRA 2M0YA 3X20B 1VYTA 3MHXA 1RI0A 3NFCA 3J80E 1O75A 4GLKA 4MZTA 3SEMA 2O88A 1KC8R 3CCUQ 1HD3A 3CEYA 4B9XA 4IUTA 4AFSC 1ZLMA 4HVUA 2EQUA 1RAGB 2J7IA 3HSBA 1BI3A 2LVMA 4C5IA 1N9SA 1AWOA 2MWPA 3TSWA 3S3MA 1X6OA 2HKNA 3QUIA 3CCEQ 1NEBA 4XTUA 1WDXA 2ROTA 4IIMA 5CKFA 2DFUA 4FW1A 1WGSA 3V7SA 5GAMg 4J9DA 4ELZC 2QAZA 3CCRA 3CCMQ 4QQDA 2VKNA 4Z02A 3PNWC 1VQ8A 1K0SA 2E10A 1MMDA 3PT9A 3P8BB 4JRKA 2O9VA 1NJIC 3KFVA 3D7SB 4EMKC 2HL3A 4A4FA 2V8IA 2M9UA 2XI9A 1VQ6Q 2HBPA 2L8DA 1ZA2B 3HFOA 2DXUA 3VS1A 5L23A 5AYFA 2H3EB 3HRSA 2CSIA 1CKBA 3JB9H 3UA7A 2QA4A 2AHJB 1R0CB 3VRYA 3I55T 1YBYA 4L59A 2V8JA 1XJWB 2DJQA 3CC2Q 1QVFP 1YJ9A 4J9GA 2BUDA 3BDLA 1VQLQ 2E65A 4ZN3A 3VS3A 4C8QE 5GANh 3QWXX 1KQSS 4P5NA 2VB6A 3VUBA 1VQ9A 2DEQA 1YI2Q 4ESRA 3BY7A 3OYMA 1FX7A 2MWOA 1TTHB 5KYUB 5GAOp 2FHDA 3CCQQ 3QPHA 1PNJA 3UT1A 2OTLQ 2KY9A 5KYUA 5LJ5g 4E7KA 4Q5WA 3JCMX 2O4XA 1QCFA 3CCUT 4BY6B 1IGQA 3VRZA 4C8QF 3M59A 1N5ZA 2DIQA 1SSFA 2RPNA 3CD6A 4FSXA 4VUBA 2DERA 2KNBB 4GY5A 3CPWA 3JB9I 3OW2A 4M75G 1A0NB 4JLIA 2XU8A 5GMKm 3CCET 3S6WA 4OB1B 1NG2A 1BI1A 5FU6C 1RUWA 2DTIA 4DBHA 1DJ7B 3C0CA 3NPFA 2I2LA 5GAMh 3CCMT 5EG2A 1G3SA 4QQGA 5LJ3h 1QW1A 1T3SA 4X9CA 4K11A 4LDYA 1UGQB 1IZ6A 4QKUA 2D6FA 2AK5A 2DL3A 4IUQA 4M75B 4FYYB 1T0HA 2QTVA 3FRNA 2K5LA 4M75A 1SEMA 1Q81U 3MEUA 2CT3A 1OX8A 1OPKA 2X51A 1PRLC 4KH1B 4NOYA 1VQ6T 2YUOA 3CC4Q 3G71A 2K2VA 3CCLQ 1NE8A 1NJIR 3CCSQ 2VV5A 1M8MA 4F7UB 2XHCA 4KULA 3CQTA 1EIFA 4CC3A 1Q81C 1KD1C 2LMJA 2JMCA 1UJYA 1UGSB 4E7JA 1ABOA 3FLGA 4C0GA 2K57A 1M27C 3CC2T 2WSFE 2P0PA 1P92A 2RQVA 1XOVA 1VQLT 2KR3A 5GANj 1M1KU 2CT4A 2LZ6B 2OX7A 5HK0A 3H6ZA 2BZXA 2LNHB 3I5RA 2EYYA 2R57A 1YI2T 1OYXA 1UFFA 3NMZC 1VQKQ 4X34A 4FL6A 3R6NA 3C12A 4AMCA 4RTXA 3CCQT 2FZCB 2NUPA 1MV0B 5A0GA 5I2MA 3ZEHA 2OTLT 4ZGEB 2ABLA 3M5AA 5LJ5h 1M1KC 1C6VX 4PJNA 5D6YA 2K3YA 1WLPB 3OY9A 1ZSGA 4M78G 3PGGA 1I1JA 2O01E 2MOXA 4F14A 4ZTFA 1YNZA 3JCMd 5FWBA 3LYIA 5KYWA 1SHGA 3LX7A 4NS5A 1PWTA 1Q86U 2RJFA 1AWWA 5IHIA 1ZQ1A 2QTXA 5ECAA 2VXEA 4M78B 5LJ3j 1JU5C 2MMPA 1TUCA 4ZN1A 4M7DB 1RABB 5KH6A 4GLMA 1JJ2S 1I8FA 3MJXA 1Q86C 3CCJA 4JJDA 4ORZA 4MZPA 3RESA 2CP3A 1IO6A 1KK7A 5CIUA 3I56A 3CC4T 2XDPA 4JJBA 5GAOl 3V7RA 3CCLT 3CCST 4BE2A 1I5OB 5FU7B 2D1XA 4J9EA 1KJWA 1SF9A 3GBQA 5GMKi 2P0QA 1M3CA 3WVEB 2ZAEA 3JCMJ 4M77D 1S72Q 2O9SA 1GCQA 5J39A 2KT8A 4C92D 3CMET 5IH2A 2JS0A 3PTAA 1Q81R 1KD1R 2LCSA 2DL4A 1HXDA 1C0MA 5IXBA 4AFQC 1VQPQ 4C5EA 2A36A 3JCMc 2DRKA 2NLUA 1VQKT 1UTIA 2H3JA 2LQ8A 1H3ZA 1NPRA 1WHLA 1U06A 1OEBA 1FYNA 5GANf 4ME7A 2YHTA 2XICA 3QJ6A 1X43A 4XK8E 2RHIA 1I5LA 5LJ5j 2RK2A 2OAWA 1W2BP 5KYYB 5CR2A 5C6SA 1B07A 1Y0MA 3S3NA 4ATOA 1M1KR 1QMCA 1IREB 9ATCB 2LJ1A 1V1CA 3MP1A 3INZA 4CC7A 1I07A 3QDRB 1WPYA 2H8HA 2JW4A 2VWFA 1QVFA 1RLPC 2DE0X 2EQIA 1YIJA 1LOJA 4FU6A 1RI9A 2JZ2A 3ME9A 3META 4C8QG 2CKKA 3CCRQ 4E6RA 5FLXE 1IB8A 3DB4A 1RACB 5D6XA 2M0OA 2X4JA 3RDVA 3U23A 1UGRB 2HNIA 4HVWA 4WCIA 5LJ3f 2KGTA 2OTJA 4M75E 3ULRB 4LD6A 3H9NA 4ZGDB 3WXMB 2DVJA 1Q86R 3CCVQ 4JPBW 2W0ZA 1KC8U 2X4WA 2Z0WA 4MDWA 3ZL7C 4C8QA 2MF2A 4IUVA 1AWJA 2DD5A 3REAB 1F1BB 2RNAA 5GAMe 1S72T 3HRTA 4BDZA 3JCMW 1QVGS 1QWFA 2BZ8A 4F7UE 3E1SA 2DF6A 3DLLA 4PNOA 4KUIA 3MCAB 3R6OA 3JV3A 3LH5A 4M75F 2DXCA 4JJNK 3VKIA 1GRIA 3G6EQ 1YCSB 2NYSA 1N6AA 1VQPT 1VQ7Q 1JB0E 4Z89A 1SG5A 2LQNA 1N9RA 3GF5A 2M02A 1PD1A 5AT1B 3E2UA 3CXCS 4F7UF 3M55A 2LX7A 2GQVA 1VA7A 3GPLA 4HCBA 3MP6A 1KHCA 1PSEA 2NWMA 2HKQB 3EAEA 3EFOB 2QQRA 1YHQQ 1WXUA 3H0FA 2GFUA 2R58A 3QWYA 3CC7A 3A8LB 5DLOA 1HYOA 5LJ5f 2CP5A 2AZSA 1BU1A 1ZBJA 1G3WA 3GNFB 3EGUA 2DBKA 1R0BG 3JCMV 1BI2A 4RKUE 3L2WA 2QDYB 1K9AA 2DPPB 1AEYA 2HD0A 1GFDA 4J7IA 4M4ZA 1TG0A 4PJOD 1NLOC 4A53A 1ZUUA 1H92A 1TXQA 2DD4A 1NYGA 3CCRT 4M7AD 3KBGA 5KYXA 4M78E 1VIEA 2F5TX 3CBOA 2DMOA 3QG1A 2AZVA 4M7DE 4DBFA 1PKSA 4QVCA 2FL7A 3SD4A 4JS4A 3NGPA 1BBZA 3HPWA 2GNCA 2KK4A 4BD3A 4IUUA 3EGDB 2YXYA 3LW5E 2RHUA 4FSSA 4D6WA 4HCZA 4FYXB 1GCQC 1OOTA 4M78F 1B34A 2KQWA 4M7DF 2E1HA 2WSEE 3F70A 2QA4T 2RF0A 3M57A 1G2BA 1VQ5Q 2FO0A 3RKYA 4AFZC 4N0AA 4J5YA 1VUBA 4RTUA 3G6ET 2ESWA 3MEWA 3PE0A 4FT4A 4DOWA 1VQ7T 3EFSA 1M2VB 4FYVB 3LWHA 1BIBA 4BUGA 2CYZB 4EPCA 2DTOA 5IN1A 4BE0A 5IHNA 2K9GA 1WX6A 4BDYA 3QIIA 1UG1A 1RADB 2GFAA 2YLBA 1OULA 2KRNA 4C92G 2CP0A 2F2WA 2RA2A 1FMKA 4LDVA 1MNDA 1YJNQ 5IT9E 8AT1B 2CP2A 1NJIU 1YHQT 2YSQA 5CAIA 3FDRA 2J05A 2K6DA 1LPLA 2DETA 5LJ3g 4M77B 4O6JA 2EWNA 1G5VA 2EGEA 1UHFA 4R0KA 4C92B 1AOJA 3TSZA 1WHGA 2YWWA 2L5QA 1M2OA 4C92A 2MAMA 3O5ZA 4XQ3A 3G4SQ 4OP0A 4LUDA 3L2VA 3RNJA 1XTDA 4ZNXA 2CZ0B 5GMKe 2RQTA 5GAOn 3THKA 1X69A 1RAHB 2ED1A 4AG2C 2PUKB 2K2MA 2HCKA 2D8JA 2RQRA 4X9DA 2LRQA 3J7AF 4XTWA 2KYMA 5CVIA 1ZSZB 4DBQA 1KQSP 3L2QA 3OS0A 1VQMA 3CMAA 1W2BA 4C8QC 4DOVA 3OMCA 4BE1A 1MMAA 4J83A 1VQ4A 4Y91A 4HCCA 4A4EA 3OYNA 1MNEA 3OYBA 3L2ZA 2E3HA 3PVLA 1VQ5T 2D9TA 6AT1B 1IHVA 4XTYA 2DXBA 4PJJA 5IAYA 3TCJA 3GIBA 3MEAA 2E5KA 1Z9QA 4RTZA 1D09B 2RJEA 1WJQA 1BK2A 3M4GA 1U3OA 5FRMA 2RM4A 4JJCA 4E47A 5J3BA 4D8KA 3RMSA 2KYBA 4OF1A 4GBQA 2FEIA 4OB3B 1M5Q1 5I11A 1YJNT 1ACMB 2LNVA 1PM3A 2DEUA 2CP6A 1K73U 2EKOA 3VS5A 4AFUC 3P8HA 3RBBB 1QKWA 5GAMd 4PL6A 2LX9A 2G3RA 2PVGB 4WF2A 2EBPA 1WXBA 3MEVA 2B86A 2XIDA 4F7UG 2HSPA 3VUZA 4JRPA 3TREA 5FROA 1X2QA 2VASA 2C06A 2LJ0A 2JNGA 1K73C 1KD1U 3G4ST 4C5HA 5CK9A 2E5QA 1E6GA 4OMNA 2FPEA 2HDAA 2LCLA 1YIJQ 2CDTA 2A7YA 2MIOA 1Q82C 1ZA1B 4LN2A 2PU9B 4MMLA 1YWOA 4N4HA 2I0NA 3QSUA 2HMAA 3I55A 1GCPA 1G3TA 4F7UA 2HEQA 1YJWA 1LJOA 5CKEA 3V8KA 2QG9B 1X75C 1RAFB 3AHUA 3BE3A 1K0XA 1QP3A 3CMEQ 4J9BA 2LCCA 4B6MA 1RL2A 3SWNB 2AIRB 4C0DC 4R56A 5DY9A 4XU2A 1M30A 4IKFA 3OYDA 4M7AG 2EQKA 2QI2A 1SPKA 2K4YA 2WSCE 5A0LA 3VYGA 4LXCA 1UB4A 3FJPA 5HKCA 4N0AC 3QKJA 4JZ4A 5GAOr 4A54A 2MCNA 4PJOB 2R5AA 4II1A 2EIFA 3UDCA 1VYVA 4KT0E 3OS1A 3CCUA 4M7AB 3OSSC 2ZPHB 3VJPA 4DQ2A 2YRCA 1JQQA 3RKWA 3S3OA 4M7AA 2DL8A 1CSKA 2NUTB 4M7DG 1HJDA 2A0FB 3QZ5B 3L1AA 1WFWA 2MYSA 2FYKA 4OMOA 1T0JA 4Y28E 4XU1A 1V29B 1JJ2P 2XD0A 2X3XD 3EG0A 4A63B 3SB2A 2DXTA 1CKAA 4FM4B 4FYWB 1RAAB 4M78A 3VU3C 3JRZA 1YFNA 2ZPFB 3JCMh 3OYHA 4E7IA 4M7DA 2C0OA 2BE7D 1WHHA 1VQ6A 1BB9A 3X28B 4C92E 2L0AA 2YUQA 2E6NA 2V8KA 3QDFA 3HHTB 2DJZA 3JB9D 2DL7A 1YIJT 1KQ2A 1AWXA 1K73R 2LDMA 4R55A 3EH2A 2ZCFB 2DBMA 2RN8A 4ZTJA 2B8AA 3PVQA 2E41A 1VQNQ 1ABQA 2X4YA 3OB9A 4DEXA 4M77F 1Q82R 1FMVA 3FB9A 1YITA 3VS0A 2P4TA 1JXOA 2DNUA 2A37A 4C92F 1K1ZA 2KE9A 3M53A 1VQLA 2EYZA 2DVEA 3LLRA 2CH4A 1HK9A 2Y4YA 2FZGB 3OYGA 1YI2A 2VC8A 2ZZDA 1AZEA 2L3PA 2K5FA 2X4XA 3EG9B 4N4GA 2GF7A 3CCQA 2JOYA 1AHJB 4LDXA 2J6KA 2OTLA 2CGHA 2XKOC 3M56A 3A8GB 3M58A 4PLIA 5CKBA 4CC4B 3VS6A 2DK3A 3BFMA 4PKCC 3QJYA 3EG1A 3UWNA 4BY6C 1LVKA 2ENMA 2M16A 5KYYA 2C0TA 4L5GA 2OAUA 5GANe 3SFMA 3OYAA 2RH2A 1ARKA 2QQ9A 3JAME 1M4ZA 1JBMA 5J26A 1IGUA 1KQSA 1OX9A 2QQAA 3EHQA 3M0RA 1D0ZA 1AZGB 2XDBA 3UATA 2QGFB 1MMNA 2D0QB 3MKDA 2EVRA 1U5SA 4F16A 4M75C 4EMKB 4J6XA 1VQ8Q 3GNGA 5C0MA 4AG1C 4KGZB 3L2UA 3H8ZA 3CCSA 5GAN3 3OYYA 2F5KA 1WJSA 1QVGP 1D0XA 1R77A 3M9QA 3QXEB 2LT4A 3OYJA 2XDDA 1VQNT 4L6V5 3DLMA 2PUOB 5LJ3e 3QBYA 3PMTA 4C0ZA 2QA4Q 1WHJA 4FW2A 2DIGA 2KEAA 2V1RA 2MI6A 4JS5A 2M51A 3A98A 1NYFA 3CPWS 3OW2S 2RMOA 3CMAQ 3CXCP 1YJ9Q 4LE9A 1VQKA 5GAN2 7AT1B 3DB3A 4E7ZA 3EH1A 2EKHA 2C0IA 1VQ9Q 2EGCA 3MO8A 4F17A 1QLYA 2DZCA 3URGA 2DILA 1V76A 4HXJA 4BI4A 4OB2B 1H3HA 3OSVA 3EGXB 4KBMB 2CUDA 4OMMA 4PJOE 1QQJA 3V8JA 2LC4A 4J9CA 2L3SA 4XU3A 1I81A 3I9QA 3EFOA 4M7AE 1PSFA 3M0SA 3X25B 1U1SA 1T3LA 1UJ0A 3KUFA 1TUGB 2AKLA 3A8MB 5CQYA 1KSWA 1YP5A 1M90U 3CD6Q 1M3AA 3TQ7P 2E64A 5A2QE 5FU6B 2Y90A 2VGMA 2K5IA 1XNIA 1UGPB 2F1LA 4PJOF 4M78C 1EX4A 4FCYA 2IG0A 3GP8A 2RQUA 1QWEA 4M7DC 5LJ5e 4M7AF 1M90C 4NL2A 3EG3A 2BE9B 4KH0B 2RI5A 2K3XA 1I0CA 1WHMA 1VQ8T 4TVRA 1K4US 4EMHA 1KQ1A 2JN0A 2L3RA 2SRCA 3JCMf 1MUZA 1QVPA 4PFPA 4Y92A 4IURA 1QCOA 2GCXA 4C5GA 2XK0A 5HCKA 3FEOA 1MHNA 4QQ6A 3OYCA 3G71Q 2GTOA 2Y4XA 2DYBA 1PD0A 1ZHIA 1S72A 5DLQE 1GXIE 2ZPGB 5FU7C 3TEEA 1OZ3A 4OVAA 3OBYA 3EGDA 4A4GA 2CH4W 4BB7A 4J9IA 2QQSA 2EPDA 2FRWA 1OU8A 2RHXA 5GAN5 2KAFA 1JO8A 1MGQA 1U1TA 2D8HA 1JJ2A 2KXDA 2COZA 3C4SA 3TU4K 2CS7A 2JMAA 2ECZA 3CMAT 1YJ9T 2X35A 1KIKA 4WTOB 2KSSA 1UDLA 1TOVA 3JCMQ 2ATCB 2RO0A 4Z8AA 1AT1B 1M2VA 3QYHB 2JTEA 1VQOA 1VIFA 1VQ9T 4IIOA 4M77G 2G6FX 5I2SA 3A8HB 3VS2A 4JZ3A 5CQXA 3WVDB 2E4HA 2DYIA 3CBMA 4LUEA 5KCOA 3M4YA 3LH0A 1QCNA 2J06A 1K9MU 2JT4A 2L3QA 3MPUB 1AD5A 2P0KA 3NTIA 2YRDA 4YTLA 3A8OB 3RUXA 1YN8A 2P84A 2QEXA 4M77A 3CD6T 4O5VA 1R8OB 4RTWA 1K8AU 5I22A 4PFOA 2JS2A 2X9HA 3J81E 4OMQA 4RUGA 3FIFA 2EFIA 1K9MC 3FJ5A 1NEGA 3H0HA 1B7TA 1BI0A 3M0TA 3V8LA 1C1AA 3TVTA 4E7HA 5FRNA 2LTOA 2HL5C 1K8AC 4ZGJB 3QHSA 2A3LA 1MMGA 5GJVB 1TUDA 2E6ZA 2JUFA 4E7SA 3CCVA 3CCJQ 1TSFA 5GAOm 1M90R 3VYHB 3I56Q 1I4K1 3G71T 1RAIB 1WYXA 4LD9K 4KRTA 4JRIA 2DTHA 1BYMA 3VS7A 1ZSZA 5GANd 3OYEA 3SDZA 2P4RA 3H41A 2CP7A 2ROLA 3LGLA 2EJGA 2GGRA 1YJWT 3G1JA 5KCHA 1X01A 5LL6S 3G6EA 1G83A 4X1VA 2X3WD 1S1NA 4NL3A 1YITQ 1VQ7A 4RTYA 1D1BA 2KRSA 4MZMA 2EGAA 3N5BB 2FPFA 4J6YA 1X6BA 1QVFS 3JB9J 3PIOA 5L8RE 4A4KA 1NPPA 2QGGA 5IHKA 2RJCA 2O2OA 2O4XB 5KE2A 2CZ6B 4JUVA 1LCKA 1MV3A 1YHQA 2PVOB 1QVGA 4MDXA 1IXDA 1OU9A 2RK1A 3OMGA 5EC7A 4C8QD 1Y57A 8ATCB 4N4IA 5LJ3d 2EQMA 1EFNA 4OGCA 4KUDK 3CPFA 3JCMg 2RB6A 4HCKA 1Q82U 1WA7A 3OYFA 3ASKA 1PCXA 1XQHA 5GAN7 4FIBA 3FC3A 3OS2A 1VOMA 1SRMA 4V2SA 4OMLA 1WQWA 4PJMA 2DRMA 3CXCA 1UEBA 2BZYA 2F2VA 4PK4A 5FW9A 3OYIA 5D7UA 1M1FA 5DM7R 3M0QA 4J9HA 2KXCA 3M0PA 2ZPIB 3RR6A 1AVZC 1KHIA 2O31A 3L2RA 1K9MR 1PRMC 1GBRA 1WXTA 2QXFA 1N27A 2HQEA 4XTZA 4J7FA 4LDWA 1Q7YU 1WNLA 2HSEB 3CCJT 3HP9A 2M1HA 5GJWB 1K8AR 1ZX6A 4PLLA 2OTJQ 2HZYA 1HSQA 3I56T 3CBPA 1W1FA 4PJOG 3X26B 2FG0A 1OV3A 3BW1A 1B3QA 3GLXA 2YUNA 3SWNA 1SHFA 4CI0C 1Q7YC 1Y71A 3QO3A 4E7LA 1VQ5A 1IHWA 2E3IA 2QASA 2FZKB 3QYGB 3HRUA 3G7ZA 1NLPC 2ZPEB 1YITT 2AT1B 2QDLA 1ZBXA 2J6OA 4Z88A 2LP5A 5GAN8 3UF4A 5LJ5d 4DA4A 2HAXA 2PTKA 4PJOA 1OI1A 3NTHA 1U8RA 3Q1JA 2HQHA 1YWPA 1NZ9A 2NUPB 1KG1A 4OMFB 2CSQA 2DKGA 2WACA 4RG2A 2EJ9A 1YJNA 1UHCA 5CCAA 3CCEA 2NUTA 1E7OA 2YLCA 2JTFA 2RI3A 3KXTA 1ZUKA 2D0NA 4RMOA 3NHNA 2R5MA 3OYKA 2COWA 3CCMA 1UE9A 1GBQA 2L89A 2BTTA 5KYWB 3C94A 4JDSA 4RCBA 2ED0A 1N8RU 4J8OA 4M77C 1QP2A 1X27A 3CC7Q 1Z9ZA 4M77E 4C92C 2A08A 4D8DA 4OB0B 3G4SA 3E9GA 5FWCA 1G8XA 1NM7A 1D1CA 1QKXA 2KI7A 3OQ5A 1BIAA 5GAMj 3A1PA 1LNXA 3C95A 1N8RC 3JB9F 2FRYA 2DAQA 1BCMA 1JRIA 4QVDA 1FXXA 1W6XA 1GFCA 1K76A 2MPXC 1Y7XA 2DZ9A 4AT1B 1D0YA 1D1AA 2JVVA 1YCYA 2A28A 4HT8A 3HFNA 2BKDN 3PIPA 4HT9A 3LWIA 5I21A 2LJ3A 3CC2A 3RMQA 2OTJT 4PFZA 2LT1A 4CRIA 2ZGWA 2GBQA 1TU0B 2CZ7B 1E6HA 2EJFA 1TS9A 2HQXA 2GQIA 1J3TA 2JTMA 2RD1A 1ZSZC 1SKUB 4MMKA 2AKKA 1VYUA 2DO3A 2F2XA 3VV0A 1WHKA 4QW2A 2MK5A 4C0FA 1ZUYA 2K79A 1UECA 2YDLA 2VVKA 2KROA 1X6GA 1Q7YR 2XG8D 3EG9A 4HKEA 4RG8A 3HTRA 3PMIA 2BIVA 2RHYA 2PVDB 2OI3A 1UGVA 2COYA 4JRQA 3QZ9B 3ZFJA 2OJ2A 2IVWA 3PFSA 2LQWA 1VQOQ 5CKHA 5GMKh 2EYQA 2JJ9A 4KGXB 4LNPA 2JM9A 5GAOq 1H641 1WI7A 2V26A 3EG2A 5GMKl 2IIMA 2E12A 2DM1A 3EHRA 2KT1A 3CC7T 5GAN6 1PHTA 1Y07A 1W2BS 3UPUA 2QK0A 2KVQG 2EAYA 2KMTA 2QEXQ 5KE3A 1WJRA 3O8VA 3MP8A 2L2PA 3CC4A 1BKBA 3CCLA 2SEMA 4EMKA 5IXFA 4XTXA 1X2KA 4RTVA 3BDUA 2IPOB 2DL5A 3V7CA 3I5SA 4RCCA 4EIKA 1M1GA 1FMWA 3OA6A 2QYZA 2RHZA 3H0IA 5GAMf 4RTTA 4EMGA 1IRXA 5A0DA 1N8RR 4XTVA 1OPLA 4J6WA 4ANJA 2PQWA 4QVZA 4LDUA 3JSCA 4QT7A 2E70A 3REBB 3CMEA 3CPWP 2DA9A 3OW2P 1UUEA 2V1QA 1BCOA 3RERA 3T9NA 5D6WA 2EYWA 4C8QB 3AT1B 4OGEA 3NTKA 3JCMb 3GOXA 3M54A 1VQMQ 3SWNC 1Y96B 1WZOA 4J9FA 1VQ4Q 2VXFA 3OBWA 1Y96A 1WQ7A 3I35A 4M75D 2PNIA 2ZPBB 3OYLA 4OMPA 3ER0A 4IUPA 1KC8C 4FT2A 2CUBA 4KGVB 1NBEB 2JM8A 4BACA 4PJOC 4HA8A 4HVVA 1PC0A 1JEGA 2PZ1A 3UA6A 2HBWA 3RKXA 4M7AC 3OS5A 2DLPA 3A5ZB 3HL8A 1JXMA 3EGXA
chains in the Genus database with same CATH topology
1OULA 1OU8A 1OX8A 2NYSA 1TWBA 1YFNA 1OX9A 1ZSZC 2QASA 1ZSZB 2QAZA 1OU9A 1ZSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUL A;  1OU8 A;  1OX8 A;  2NYS A;  1TWB A;  1YFN A;  1OX9 A;  1ZSZ C;  2QAS A;  1ZSZ B;  2QAZ A;  1OU9 A;  1ZSZ A; 
#chains in the Genus database with same CATH topology
 4PJL A;  1EZZ B;  2EYX A;  1OQK A;  2JXB A;  2YT6 A;  1GL5 A;  2FVU A;  1VQO T;  5GMK j;  1PG5 B;  3L42 A;  3SHW A;  1FWZ A;  1TWB A;  2EQJ A;  1WIE A;  3DKM A;  2VGN A;  2K7A A;  4F04 B;  1G3Y A;  1W4S A;  2QQB A;  4A4H A;  2KBT A;  2CRE A;  3E19 A;  5KYN A;  1KFZ A;  1PKT A;  3JCM P;  1O9S A;  1D3B B;  2EW3 A;  1W70 A;  5HK3 A;  4BI3 A;  3E9F A;  3M0U A;  1D3B A;  2QEX T;  2KDS A;  4B9W A;  2F69 A;  1OZ2 A;  4CC2 A;  4EDU A;  1SSH A;  4XU0 A;  2J6F A;  2LQK A;  4ELY C;  5KYX B;  2NUZ A;  5HY6 A;  4E2F B;  4XAX B;  3LGF A;  3X24 B;  1VQN A;  2FB7 A;  1RLQ C;  1H8K A;  2YRV A;  1M3B A;  5GAN 4;  5CKD A;  1M8V A;  2RI2 A;  4JLG A;  3IQL A;  3I55 Q;  2FPD A;  1YJW Q;  4DEY A;  4UC4 A;  4BI8 B;  2RQW A;  2DX1 A;  4DBR A;  2CZ1 B;  2YUP A;  3JCM e;  3CCV T;  2K3B A;  3ZBD A;  2W10 A;  4C0D B;  5CO7 A;  1VQP A;  5M9O A;  3JB9 G;  1RAE B;  2KRM A;  1Q95 G;  1B34 B;  2RJD A;  1VQM T;  1M9S A;  1SRL A;  2VYT A;  1TH7 A;  3P8D A;  3VS4 A;  5GAN g;  3HKS A;  3RIR A;  2VUB A;  2GTJ A;  4M78 D;  1VQ4 T;  2XMF A;  4M7D D;  3EFR A;  2M0Y A;  3X20 B;  1VYT A;  3MHX A;  1RI0 A;  3NFC A;  3J80 E;  1O75 A;  4GLK A;  4MZT A;  3SEM A;  2O88 A;  1KC8 R;  3CCU Q;  1HD3 A;  3CEY A;  4B9X A;  4IUT A;  4AFS C;  1ZLM A;  4HVU A;  2EQU A;  1RAG B;  2J7I A;  3HSB A;  1BI3 A;  2LVM A;  4C5I A;  1N9S A;  1AWO A;  2MWP A;  3TSW A;  3S3M A;  1X6O A;  2HKN A;  3QUI A;  3CCE Q;  1NEB A;  4XTU A;  1WDX A;  2ROT A;  4IIM A;  5CKF A;  2DFU A;  4FW1 A;  1WGS A;  3V7S A;  5GAM g;  4J9D A;  4ELZ C;  2QAZ A;  3CCR A;  3CCM Q;  4QQD A;  2VKN A;  4Z02 A;  3PNW C;  1VQ8 A;  1K0S A;  2E10 A;  1MMD A;  3PT9 A;  3P8B B;  4JRK A;  2O9V A;  1NJI C;  3KFV A;  3D7S B;  4EMK C;  2HL3 A;  4A4F A;  2V8I A;  2M9U A;  2XI9 A;  1VQ6 Q;  2HBP A;  2L8D A;  1ZA2 B;  3HFO A;  2DXU A;  3VS1 A;  5L23 A;  5AYF A;  2H3E B;  3HRS A;  2CSI A;  1CKB A;  3JB9 H;  3UA7 A;  2QA4 A;  2AHJ B;  1R0C B;  3VRY A;  3I55 T;  1YBY A;  4L59 A;  2V8J A;  1XJW B;  2DJQ A;  3CC2 Q;  1QVF P;  1YJ9 A;  4J9G A;  2BUD A;  3BDL A;  1VQL Q;  2E65 A;  4ZN3 A;  3VS3 A;  4C8Q E;  5GAN h;  3QWX X;  1KQS S;  4P5N A;  2VB6 A;  3VUB A;  1VQ9 A;  2DEQ A;  1YI2 Q;  4ESR A;  3BY7 A;  3OYM A;  1FX7 A;  2MWO A;  1TTH B;  5KYU B;  5GAO p;  2FHD A;  3CCQ Q;  3QPH A;  1PNJ A;  3UT1 A;  2OTL Q;  2KY9 A;  5KYU A;  5LJ5 g;  4E7K A;  4Q5W A;  3JCM X;  2O4X A;  1QCF A;  3CCU T;  4BY6 B;  1IGQ A;  3VRZ A;  4C8Q F;  3M59 A;  1N5Z A;  2DIQ A;  1SSF A;  2RPN A;  3CD6 A;  4FSX A;  4VUB A;  2DER A;  2KNB B;  4GY5 A;  3CPW A;  3JB9 I;  3OW2 A;  4M75 G;  1A0N B;  4JLI A;  2XU8 A;  5GMK m;  3CCE T;  3S6W A;  4OB1 B;  1NG2 A;  1BI1 A;  5FU6 C;  1RUW A;  2DTI A;  4DBH A;  1DJ7 B;  3C0C A;  3NPF A;  2I2L A;  5GAM h;  3CCM T;  5EG2 A;  1G3S A;  4QQG A;  5LJ3 h;  1QW1 A;  1T3S A;  4X9C A;  4K11 A;  4LDY A;  1UGQ B;  1IZ6 A;  4QKU A;  2D6F A;  2AK5 A;  2DL3 A;  4IUQ A;  4M75 B;  4FYY B;  1T0H A;  2QTV A;  3FRN A;  2K5L A;  4M75 A;  1SEM A;  1Q81 U;  3MEU A;  2CT3 A;  1OX8 A;  1OPK A;  2X51 A;  1PRL C;  4KH1 B;  4NOY A;  1VQ6 T;  2YUO A;  3CC4 Q;  3G71 A;  2K2V A;  3CCL Q;  1NE8 A;  1NJI R;  3CCS Q;  2VV5 A;  1M8M A;  4F7U B;  2XHC A;  4KUL A;  3CQT A;  1EIF A;  4CC3 A;  1Q81 C;  1KD1 C;  2LMJ A;  2JMC A;  1UJY A;  1UGS B;  4E7J A;  1ABO A;  3FLG A;  4C0G A;  2K57 A;  1M27 C;  3CC2 T;  2WSF E;  2P0P A;  1P92 A;  2RQV A;  1XOV A;  1VQL T;  2KR3 A;  5GAN j;  1M1K U;  2CT4 A;  2LZ6 B;  2OX7 A;  5HK0 A;  3H6Z A;  2BZX A;  2LNH B;  3I5R A;  2EYY A;  2R57 A;  1YI2 T;  1OYX A;  1UFF A;  3NMZ C;  1VQK Q;  4X34 A;  4FL6 A;  3R6N A;  3C12 A;  4AMC A;  4RTX A;  3CCQ T;  2FZC B;  2NUP A;  1MV0 B;  5A0G A;  5I2M A;  3ZEH A;  2OTL T;  4ZGE B;  2ABL A;  3M5A A;  5LJ5 h;  1M1K C;  1C6V X;  4PJN A;  5D6Y A;  2K3Y A;  1WLP B;  3OY9 A;  1ZSG A;  4M78 G;  3PGG A;  1I1J A;  2O01 E;  2MOX A;  4F14 A;  4ZTF A;  1YNZ A;  3JCM d;  5FWB A;  3LYI A;  5KYW A;  1SHG A;  3LX7 A;  4NS5 A;  1PWT A;  1Q86 U;  2RJF A;  1AWW A;  5IHI A;  1ZQ1 A;  2QTX A;  5ECA A;  2VXE A;  4M78 B;  5LJ3 j;  1JU5 C;  2MMP A;  1TUC A;  4ZN1 A;  4M7D B;  1RAB B;  5KH6 A;  4GLM A;  1JJ2 S;  1I8F A;  3MJX A;  1Q86 C;  3CCJ A;  4JJD A;  4ORZ A;  4MZP A;  3RES A;  2CP3 A;  1IO6 A;  1KK7 A;  5CIU A;  3I56 A;  3CC4 T;  2XDP A;  4JJB A;  5GAO l;  3V7R A;  3CCL T;  3CCS T;  4BE2 A;  1I5O B;  5FU7 B;  2D1X A;  4J9E A;  1KJW A;  1SF9 A;  3GBQ A;  5GMK i;  2P0Q A;  1M3C A;  3WVE B;  2ZAE A;  3JCM J;  4M77 D;  1S72 Q;  2O9S A;  1GCQ A;  5J39 A;  2KT8 A;  4C92 D;  3CME T;  5IH2 A;  2JS0 A;  3PTA A;  1Q81 R;  1KD1 R;  2LCS A;  2DL4 A;  1HXD A;  1C0M A;  5IXB A;  4AFQ C;  1VQP Q;  4C5E A;  2A36 A;  3JCM c;  2DRK A;  2NLU A;  1VQK T;  1UTI A;  2H3J A;  2LQ8 A;  1H3Z A;  1NPR A;  1WHL A;  1U06 A;  1OEB A;  1FYN A;  5GAN f;  4ME7 A;  2YHT A;  2XIC A;  3QJ6 A;  1X43 A;  4XK8 E;  2RHI A;  1I5L A;  5LJ5 j;  2RK2 A;  2OAW A;  1W2B P;  5KYY B;  5CR2 A;  5C6S A;  1B07 A;  1Y0M A;  3S3N A;  4ATO A;  1M1K R;  1QMC A;  1IRE B;  9ATC B;  2LJ1 A;  1V1C A;  3MP1 A;  3INZ A;  4CC7 A;  1I07 A;  3QDR B;  1WPY A;  2H8H A;  2JW4 A;  2VWF A;  1QVF A;  1RLP C;  2DE0 X;  2EQI A;  1YIJ A;  1LOJ A;  4FU6 A;  1RI9 A;  2JZ2 A;  3ME9 A;  3MET A;  4C8Q G;  2CKK A;  3CCR Q;  4E6R A;  5FLX E;  1IB8 A;  3DB4 A;  1RAC B;  5D6X A;  2M0O A;  2X4J A;  3RDV A;  3U23 A;  1UGR B;  2HNI A;  4HVW A;  4WCI A;  5LJ3 f;  2KGT A;  2OTJ A;  4M75 E;  3ULR B;  4LD6 A;  3H9N A;  4ZGD B;  3WXM B;  2DVJ A;  1Q86 R;  3CCV Q;  4JPB W;  2W0Z A;  1KC8 U;  2X4W A;  2Z0W A;  4MDW A;  3ZL7 C;  4C8Q A;  2MF2 A;  4IUV A;  1AWJ A;  2DD5 A;  3REA B;  1F1B B;  2RNA A;  5GAM e;  1S72 T;  3HRT A;  4BDZ A;  3JCM W;  1QVG S;  1QWF A;  2BZ8 A;  4F7U E;  3E1S A;  2DF6 A;  3DLL A;  4PNO A;  4KUI A;  3MCA B;  3R6O A;  3JV3 A;  3LH5 A;  4M75 F;  2DXC A;  4JJN K;  3VKI A;  1GRI A;  3G6E Q;  1YCS B;  2NYS A;  1N6A A;  1VQP T;  1VQ7 Q;  1JB0 E;  4Z89 A;  1SG5 A;  2LQN A;  1N9R A;  3GF5 A;  2M02 A;  1PD1 A;  5AT1 B;  3E2U A;  3CXC S;  4F7U F;  3M55 A;  2LX7 A;  2GQV A;  1VA7 A;  3GPL A;  4HCB A;  3MP6 A;  1KHC A;  1PSE A;  2NWM A;  2HKQ B;  3EAE A;  3EFO B;  2QQR A;  1YHQ Q;  1WXU A;  3H0F A;  2GFU A;  2R58 A;  3QWY A;  3CC7 A;  3A8L B;  5DLO A;  1HYO A;  5LJ5 f;  2CP5 A;  2AZS A;  1BU1 A;  1ZBJ A;  1G3W A;  3GNF B;  3EGU A;  2DBK A;  1R0B G;  3JCM V;  1BI2 A;  4RKU E;  3L2W A;  2QDY B;  1K9A A;  2DPP B;  1AEY A;  2HD0 A;  1GFD A;  4J7I A;  4M4Z A;  1TG0 A;  4PJO D;  1NLO C;  4A53 A;  1ZUU A;  1H92 A;  1TXQ A;  2DD4 A;  1NYG A;  3CCR T;  4M7A D;  3KBG A;  5KYX A;  4M78 E;  1VIE A;  2F5T X;  3CBO A;  2DMO A;  3QG1 A;  2AZV A;  4M7D E;  4DBF A;  1PKS A;  4QVC A;  2FL7 A;  3SD4 A;  4JS4 A;  3NGP A;  1BBZ A;  3HPW A;  2GNC A;  2KK4 A;  4BD3 A;  4IUU A;  3EGD B;  2YXY A;  3LW5 E;  2RHU A;  4FSS A;  4D6W A;  4HCZ A;  4FYX B;  1GCQ C;  1OOT A;  4M78 F;  1B34 A;  2KQW A;  4M7D F;  2E1H A;  2WSE E;  3F70 A;  2QA4 T;  2RF0 A;  3M57 A;  1G2B A;  1VQ5 Q;  2FO0 A;  3RKY A;  4AFZ C;  4N0A A;  4J5Y A;  1VUB A;  4RTU A;  3G6E T;  2ESW A;  3MEW A;  3PE0 A;  4FT4 A;  4DOW A;  1VQ7 T;  3EFS A;  1M2V B;  4FYV B;  3LWH A;  1BIB A;  4BUG A;  2CYZ B;  4EPC A;  2DTO A;  5IN1 A;  4BE0 A;  5IHN A;  2K9G A;  1WX6 A;  4BDY A;  3QII A;  1UG1 A;  1RAD B;  2GFA A;  2YLB A;  1OUL A;  2KRN A;  4C92 G;  2CP0 A;  2F2W A;  2RA2 A;  1FMK A;  4LDV A;  1MND A;  1YJN Q;  5IT9 E;  8AT1 B;  2CP2 A;  1NJI U;  1YHQ T;  2YSQ A;  5CAI A;  3FDR A;  2J05 A;  2K6D A;  1LPL A;  2DET A;  5LJ3 g;  4M77 B;  4O6J A;  2EWN A;  1G5V A;  2EGE A;  1UHF A;  4R0K A;  4C92 B;  1AOJ A;  3TSZ A;  1WHG A;  2YWW A;  2L5Q A;  1M2O A;  4C92 A;  2MAM A;  3O5Z A;  4XQ3 A;  3G4S Q;  4OP0 A;  4LUD A;  3L2V A;  3RNJ A;  1XTD A;  4ZNX A;  2CZ0 B;  5GMK e;  2RQT A;  5GAO n;  3THK A;  1X69 A;  1RAH B;  2ED1 A;  4AG2 C;  2PUK B;  2K2M A;  2HCK A;  2D8J A;  2RQR A;  4X9D A;  2LRQ A;  3J7A F;  4XTW A;  2KYM A;  5CVI A;  1ZSZ B;  4DBQ A;  1KQS P;  3L2Q A;  3OS0 A;  1VQM A;  3CMA A;  1W2B A;  4C8Q C;  4DOV A;  3OMC A;  4BE1 A;  1MMA A;  4J83 A;  1VQ4 A;  4Y91 A;  4HCC A;  4A4E A;  3OYN A;  1MNE A;  3OYB A;  3L2Z A;  2E3H A;  3PVL A;  1VQ5 T;  2D9T A;  6AT1 B;  1IHV A;  4XTY A;  2DXB A;  4PJJ A;  5IAY A;  3TCJ A;  3GIB A;  3MEA A;  2E5K A;  1Z9Q A;  4RTZ A;  1D09 B;  2RJE A;  1WJQ A;  1BK2 A;  3M4G A;  1U3O A;  5FRM A;  2RM4 A;  4JJC A;  4E47 A;  5J3B A;  4D8K A;  3RMS A;  2KYB A;  4OF1 A;  4GBQ A;  2FEI A;  4OB3 B;  1M5Q 1;  5I11 A;  1YJN T;  1ACM B;  2LNV A;  1PM3 A;  2DEU A;  2CP6 A;  1K73 U;  2EKO A;  3VS5 A;  4AFU C;  3P8H A;  3RBB B;  1QKW A;  5GAM d;  4PL6 A;  2LX9 A;  2G3R A;  2PVG B;  4WF2 A;  2EBP A;  1WXB A;  3MEV A;  2B86 A;  2XID A;  4F7U G;  2HSP A;  3VUZ A;  4JRP A;  3TRE A;  5FRO A;  1X2Q A;  2VAS A;  2C06 A;  2LJ0 A;  2JNG A;  1K73 C;  1KD1 U;  3G4S T;  4C5H A;  5CK9 A;  2E5Q A;  1E6G A;  4OMN A;  2FPE A;  2HDA A;  2LCL A;  1YIJ Q;  2CDT A;  2A7Y A;  2MIO A;  1Q82 C;  1ZA1 B;  4LN2 A;  2PU9 B;  4MML A;  1YWO A;  4N4H A;  2I0N A;  3QSU A;  2HMA A;  3I55 A;  1GCP A;  1G3T A;  4F7U A;  2HEQ A;  1YJW A;  1LJO A;  5CKE A;  3V8K A;  2QG9 B;  1X75 C;  1RAF B;  3AHU A;  3BE3 A;  1K0X A;  1QP3 A;  3CME Q;  4J9B A;  2LCC A;  4B6M A;  1RL2 A;  3SWN B;  2AIR B;  4C0D C;  4R56 A;  5DY9 A;  4XU2 A;  1M30 A;  4IKF A;  3OYD A;  4M7A G;  2EQK A;  2QI2 A;  1SPK A;  2K4Y A;  2WSC E;  5A0L A;  3VYG A;  4LXC A;  1UB4 A;  3FJP A;  5HKC A;  4N0A C;  3QKJ A;  4JZ4 A;  5GAO r;  4A54 A;  2MCN A;  4PJO B;  2R5A A;  4II1 A;  2EIF A;  3UDC A;  1VYV A;  4KT0 E;  3OS1 A;  3CCU A;  4M7A B;  3OSS C;  2ZPH B;  3VJP A;  4DQ2 A;  2YRC A;  1JQQ A;  3RKW A;  3S3O A;  4M7A A;  2DL8 A;  1CSK A;  2NUT B;  4M7D G;  1HJD A;  2A0F B;  3QZ5 B;  3L1A A;  1WFW A;  2MYS A;  2FYK A;  4OMO A;  1T0J A;  4Y28 E;  4XU1 A;  1V29 B;  1JJ2 P;  2XD0 A;  2X3X D;  3EG0 A;  4A63 B;  3SB2 A;  2DXT A;  1CKA A;  4FM4 B;  4FYW B;  1RAA B;  4M78 A;  3VU3 C;  3JRZ A;  1YFN A;  2ZPF B;  3JCM h;  3OYH A;  4E7I A;  4M7D A;  2C0O A;  2BE7 D;  1WHH A;  1VQ6 A;  1BB9 A;  3X28 B;  4C92 E;  2L0A A;  2YUQ A;  2E6N A;  2V8K A;  3QDF A;  3HHT B;  2DJZ A;  3JB9 D;  2DL7 A;  1YIJ T;  1KQ2 A;  1AWX A;  1K73 R;  2LDM A;  4R55 A;  3EH2 A;  2ZCF B;  2DBM A;  2RN8 A;  4ZTJ A;  2B8A A;  3PVQ A;  2E41 A;  1VQN Q;  1ABQ A;  2X4Y A;  3OB9 A;  4DEX A;  4M77 F;  1Q82 R;  1FMV A;  3FB9 A;  1YIT A;  3VS0 A;  2P4T A;  1JXO A;  2DNU A;  2A37 A;  4C92 F;  1K1Z A;  2KE9 A;  3M53 A;  1VQL A;  2EYZ A;  2DVE A;  3LLR A;  2CH4 A;  1HK9 A;  2Y4Y A;  2FZG B;  3OYG A;  1YI2 A;  2VC8 A;  2ZZD A;  1AZE A;  2L3P A;  2K5F A;  2X4X A;  3EG9 B;  4N4G A;  2GF7 A;  3CCQ A;  2JOY A;  1AHJ B;  4LDX A;  2J6K A;  2OTL A;  2CGH A;  2XKO C;  3M56 A;  3A8G B;  3M58 A;  4PLI A;  5CKB A;  4CC4 B;  3VS6 A;  2DK3 A;  3BFM A;  4PKC C;  3QJY A;  3EG1 A;  3UWN A;  4BY6 C;  1LVK A;  2ENM A;  2M16 A;  5KYY A;  2C0T A;  4L5G A;  2OAU A;  5GAN e;  3SFM A;  3OYA A;  2RH2 A;  1ARK A;  2QQ9 A;  3JAM E;  1M4Z A;  1JBM A;  5J26 A;  1IGU A;  1KQS A;  1OX9 A;  2QQA A;  3EHQ A;  3M0R A;  1D0Z A;  1AZG B;  2XDB A;  3UAT A;  2QGF B;  1MMN A;  2D0Q B;  3MKD A;  2EVR A;  1U5S A;  4F16 A;  4M75 C;  4EMK B;  4J6X A;  1VQ8 Q;  3GNG A;  5C0M A;  4AG1 C;  4KGZ B;  3L2U A;  3H8Z A;  3CCS A;  5GAN 3;  3OYY A;  2F5K A;  1WJS A;  1QVG P;  1D0X A;  1R77 A;  3M9Q A;  3QXE B;  2LT4 A;  3OYJ A;  2XDD A;  1VQN T;  4L6V 5;  3DLM A;  2PUO B;  5LJ3 e;  3QBY A;  3PMT A;  4C0Z A;  2QA4 Q;  1WHJ A;  4FW2 A;  2DIG A;  2KEA A;  2V1R A;  2MI6 A;  4JS5 A;  2M51 A;  3A98 A;  1NYF A;  3CPW S;  3OW2 S;  2RMO A;  3CMA Q;  3CXC P;  1YJ9 Q;  4LE9 A;  1VQK A;  5GAN 2;  7AT1 B;  3DB3 A;  4E7Z A;  3EH1 A;  2EKH A;  2C0I A;  1VQ9 Q;  2EGC A;  3MO8 A;  4F17 A;  1QLY A;  2DZC A;  3URG A;  2DIL A;  1V76 A;  4HXJ A;  4BI4 A;  4OB2 B;  1H3H A;  3OSV A;  3EGX B;  4KBM B;  2CUD A;  4OMM A;  4PJO E;  1QQJ A;  3V8J A;  2LC4 A;  4J9C A;  2L3S A;  4XU3 A;  1I81 A;  3I9Q A;  3EFO A;  4M7A E;  1PSF A;  3M0S A;  3X25 B;  1U1S A;  1T3L A;  1UJ0 A;  3KUF A;  1TUG B;  2AKL A;  3A8M B;  5CQY A;  1KSW A;  1YP5 A;  1M90 U;  3CD6 Q;  1M3A A;  3TQ7 P;  2E64 A;  5A2Q E;  5FU6 B;  2Y90 A;  2VGM A;  2K5I A;  1XNI A;  1UGP B;  2F1L A;  4PJO F;  4M78 C;  1EX4 A;  4FCY A;  2IG0 A;  3GP8 A;  2RQU A;  1QWE A;  4M7D C;  5LJ5 e;  4M7A F;  1M90 C;  4NL2 A;  3EG3 A;  2BE9 B;  4KH0 B;  2RI5 A;  2K3X A;  1I0C A;  1WHM A;  1VQ8 T;  4TVR A;  1K4U S;  4EMH A;  1KQ1 A;  2JN0 A;  2L3R A;  2SRC A;  3JCM f;  1MUZ A;  1QVP A;  4PFP A;  4Y92 A;  4IUR A;  1QCO A;  2GCX A;  4C5G A;  2XK0 A;  5HCK A;  3FEO A;  1MHN A;  4QQ6 A;  3OYC A;  3G71 Q;  2GTO A;  2Y4X A;  2DYB A;  1PD0 A;  1ZHI A;  1S72 A;  5DLQ E;  1GXI E;  2ZPG B;  5FU7 C;  3TEE A;  1OZ3 A;  4OVA A;  3OBY A;  3EGD A;  4A4G A;  2CH4 W;  4BB7 A;  4J9I A;  2QQS A;  2EPD A;  2FRW A;  1OU8 A;  2RHX A;  5GAN 5;  2KAF A;  1JO8 A;  1MGQ A;  1U1T A;  2D8H A;  1JJ2 A;  2KXD A;  2COZ A;  3C4S A;  3TU4 K;  2CS7 A;  2JMA A;  2ECZ A;  3CMA T;  1YJ9 T;  2X35 A;  1KIK A;  4WTO B;  2KSS A;  1UDL A;  1TOV A;  3JCM Q;  2ATC B;  2RO0 A;  4Z8A A;  1AT1 B;  1M2V A;  3QYH B;  2JTE A;  1VQO A;  1VIF A;  1VQ9 T;  4IIO A;  4M77 G;  2G6F X;  5I2S A;  3A8H B;  3VS2 A;  4JZ3 A;  5CQX A;  3WVD B;  2E4H A;  2DYI A;  3CBM A;  4LUE A;  5KCO A;  3M4Y A;  3LH0 A;  1QCN A;  2J06 A;  1K9M U;  2JT4 A;  2L3Q A;  3MPU B;  1AD5 A;  2P0K A;  3NTI A;  2YRD A;  4YTL A;  3A8O B;  3RUX A;  1YN8 A;  2P84 A;  2QEX A;  4M77 A;  3CD6 T;  4O5V A;  1R8O B;  4RTW A;  1K8A U;  5I22 A;  4PFO A;  2JS2 A;  2X9H A;  3J81 E;  4OMQ A;  4RUG A;  3FIF A;  2EFI A;  1K9M C;  3FJ5 A;  1NEG A;  3H0H A;  1B7T A;  1BI0 A;  3M0T A;  3V8L A;  1C1A A;  3TVT A;  4E7H A;  5FRN A;  2LTO A;  2HL5 C;  1K8A C;  4ZGJ B;  3QHS A;  2A3L A;  1MMG A;  5GJV B;  1TUD A;  2E6Z A;  2JUF A;  4E7S A;  3CCV A;  3CCJ Q;  1TSF A;  5GAO m;  1M90 R;  3VYH B;  3I56 Q;  1I4K 1;  3G71 T;  1RAI B;  1WYX A;  4LD9 K;  4KRT A;  4JRI A;  2DTH A;  1BYM A;  3VS7 A;  1ZSZ A;  5GAN d;  3OYE A;  3SDZ A;  2P4R A;  3H41 A;  2CP7 A;  2ROL A;  3LGL A;  2EJG A;  2GGR A;  1YJW T;  3G1J A;  5KCH A;  1X01 A;  5LL6 S;  3G6E A;  1G83 A;  4X1V A;  2X3W D;  1S1N A;  4NL3 A;  1YIT Q;  1VQ7 A;  4RTY A;  1D1B A;  2KRS A;  4MZM A;  2EGA A;  3N5B B;  2FPF A;  4J6Y A;  1X6B A;  1QVF S;  3JB9 J;  3PIO A;  5L8R E;  4A4K A;  1NPP A;  2QGG A;  5IHK A;  2RJC A;  2O2O A;  2O4X B;  5KE2 A;  2CZ6 B;  4JUV A;  1LCK A;  1MV3 A;  1YHQ A;  2PVO B;  1QVG A;  4MDX A;  1IXD A;  1OU9 A;  2RK1 A;  3OMG A;  5EC7 A;  4C8Q D;  1Y57 A;  8ATC B;  4N4I A;  5LJ3 d;  2EQM A;  1EFN A;  4OGC A;  4KUD K;  3CPF A;  3JCM g;  2RB6 A;  4HCK A;  1Q82 U;  1WA7 A;  3OYF A;  3ASK A;  1PCX A;  1XQH A;  5GAN 7;  4FIB A;  3FC3 A;  3OS2 A;  1VOM A;  1SRM A;  4V2S A;  4OML A;  1WQW A;  4PJM A;  2DRM A;  3CXC A;  1UEB A;  2BZY A;  2F2V A;  4PK4 A;  5FW9 A;  3OYI A;  5D7U A;  1M1F A;  5DM7 R;  3M0Q A;  4J9H A;  2KXC A;  3M0P A;  2ZPI B;  3RR6 A;  1AVZ C;  1KHI A;  2O31 A;  3L2R A;  1K9M R;  1PRM C;  1GBR A;  1WXT A;  2QXF A;  1N27 A;  2HQE A;  4XTZ A;  4J7F A;  4LDW A;  1Q7Y U;  1WNL A;  2HSE B;  3CCJ T;  3HP9 A;  2M1H A;  5GJW B;  1K8A R;  1ZX6 A;  4PLL A;  2OTJ Q;  2HZY A;  1HSQ A;  3I56 T;  3CBP A;  1W1F A;  4PJO G;  3X26 B;  2FG0 A;  1OV3 A;  3BW1 A;  1B3Q A;  3GLX A;  2YUN A;  3SWN A;  1SHF A;  4CI0 C;  1Q7Y C;  1Y71 A;  3QO3 A;  4E7L A;  1VQ5 A;  1IHW A;  2E3I A;  2QAS A;  2FZK B;  3QYG B;  3HRU A;  3G7Z A;  1NLP C;  2ZPE B;  1YIT T;  2AT1 B;  2QDL A;  1ZBX A;  2J6O A;  4Z88 A;  2LP5 A;  5GAN 8;  3UF4 A;  5LJ5 d;  4DA4 A;  2HAX A;  2PTK A;  4PJO A;  1OI1 A;  3NTH A;  1U8R A;  3Q1J A;  2HQH A;  1YWP A;  1NZ9 A;  2NUP B;  1KG1 A;  4OMF B;  2CSQ A;  2DKG A;  2WAC A;  4RG2 A;  2EJ9 A;  1YJN A;  1UHC A;  5CCA A;  3CCE A;  2NUT A;  1E7O A;  2YLC A;  2JTF A;  2RI3 A;  3KXT A;  1ZUK A;  2D0N A;  4RMO A;  3NHN A;  2R5M A;  3OYK A;  2COW A;  3CCM A;  1UE9 A;  1GBQ A;  2L89 A;  2BTT A;  5KYW B;  3C94 A;  4JDS A;  4RCB A;  2ED0 A;  1N8R U;  4J8O A;  4M77 C;  1QP2 A;  1X27 A;  3CC7 Q;  1Z9Z A;  4M77 E;  4C92 C;  2A08 A;  4D8D A;  4OB0 B;  3G4S A;  3E9G A;  5FWC A;  1G8X A;  1NM7 A;  1D1C A;  1QKX A;  2KI7 A;  3OQ5 A;  1BIA A;  5GAM j;  3A1P A;  1LNX A;  3C95 A;  1N8R C;  3JB9 F;  2FRY A;  2DAQ A;  1BCM A;  1JRI A;  4QVD A;  1FXX A;  1W6X A;  1GFC A;  1K76 A;  2MPX C;  1Y7X A;  2DZ9 A;  4AT1 B;  1D0Y A;  1D1A A;  2JVV A;  1YCY A;  2A28 A;  4HT8 A;  3HFN A;  2BKD N;  3PIP A;  4HT9 A;  3LWI A;  5I21 A;  2LJ3 A;  3CC2 A;  3RMQ A;  2OTJ T;  4PFZ A;  2LT1 A;  4CRI A;  2ZGW A;  2GBQ A;  1TU0 B;  2CZ7 B;  1E6H A;  2EJF A;  1TS9 A;  2HQX A;  2GQI A;  1J3T A;  2JTM A;  2RD1 A;  1ZSZ C;  1SKU B;  4MMK A;  2AKK A;  1VYU A;  2DO3 A;  2F2X A;  3VV0 A;  1WHK A;  4QW2 A;  2MK5 A;  4C0F A;  1ZUY A;  2K79 A;  1UEC A;  2YDL A;  2VVK A;  2KRO A;  1X6G A;  1Q7Y R;  2XG8 D;  3EG9 A;  4HKE A;  4RG8 A;  3HTR A;  3PMI A;  2BIV A;  2RHY A;  2PVD B;  2OI3 A;  1UGV A;  2COY A;  4JRQ A;  3QZ9 B;  3ZFJ A;  2OJ2 A;  2IVW A;  3PFS A;  2LQW A;  1VQO Q;  5CKH A;  5GMK h;  2EYQ A;  2JJ9 A;  4KGX B;  4LNP A;  2JM9 A;  5GAO q;  1H64 1;  1WI7 A;  2V26 A;  3EG2 A;  5GMK l;  2IIM A;  2E12 A;  2DM1 A;  3EHR A;  2KT1 A;  3CC7 T;  5GAN 6;  1PHT A;  1Y07 A;  1W2B S;  3UPU A;  2QK0 A;  2KVQ G;  2EAY A;  2KMT A;  2QEX Q;  5KE3 A;  1WJR A;  3O8V A;  3MP8 A;  2L2P A;  3CC4 A;  1BKB A;  3CCL A;  2SEM A;  4EMK A;  5IXF A;  4XTX A;  1X2K A;  4RTV A;  3BDU A;  2IPO B;  2DL5 A;  3V7C A;  3I5S A;  4RCC A;  4EIK A;  1M1G A;  1FMW A;  3OA6 A;  2QYZ A;  2RHZ A;  3H0I A;  5GAM f;  4RTT A;  4EMG A;  1IRX A;  5A0D A;  1N8R R;  4XTV A;  1OPL A;  4J6W A;  4ANJ A;  2PQW A;  4QVZ A;  4LDU A;  3JSC A;  4QT7 A;  2E70 A;  3REB B;  3CME A;  3CPW P;  2DA9 A;  3OW2 P;  1UUE A;  2V1Q A;  1BCO A;  3RER A;  3T9N A;  5D6W A;  2EYW A;  4C8Q B;  3AT1 B;  4OGE A;  3NTK A;  3JCM b;  3GOX A;  3M54 A;  1VQM Q;  3SWN C;  1Y96 B;  1WZO A;  4J9F A;  1VQ4 Q;  2VXF A;  3OBW A;  1Y96 A;  1WQ7 A;  3I35 A;  4M75 D;  2PNI A;  2ZPB B;  3OYL A;  4OMP A;  3ER0 A;  4IUP A;  1KC8 C;  4FT2 A;  2CUB A;  4KGV B;  1NBE B;  2JM8 A;  4BAC A;  4PJO C;  4HA8 A;  4HVV A;  1PC0 A;  1JEG A;  2PZ1 A;  3UA6 A;  2HBW A;  3RKX A;  4M7A C;  3OS5 A;  2DLP A;  3A5Z B;  3HL8 A;  1JXM A;  3EGX A; 
#chains in the Genus database with same CATH homology
 1OUL A;  1OU8 A;  1OX8 A;  2NYS A;  1TWB A;  1YFN A;  1OX9 A;  1ZSZ C;  2QAS A;  1ZSZ B;  2QAZ A;  1OU9 A;  1ZSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...