1OULA

Structure of the aaa+ protease delivery protein sspb
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYDELNIEPDTEQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords Stringent starvation protein B homolog
total genus 25
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1oulA00
1OX8A 1ZSZB 1YFNA 1OU8A 1OU9A 1ZSZA 1ZSZC 2QAZA 1TWBA 2QASA 1OX9A 2NYSA 1OULA
chains in the Genus database with same CATH superfamily
1WQ7A 3MKDA 4LDXA 2PUKB 1EX4A 4PJOA 4A53A 2QA4T 2X4JA 3CC7Q 4EMKA 1W70A 2BIVA 4EMKC 5LJ3e 3CCET 2AHJB 2IG0A 1VQOQ 1K8AR 4J6XA 3QUIA 2OAWA 1N8RC 1FMWA 4P5NA 4HCCA 3QJYA 4M75D 1T3LA 1RAIB 2KR3A 2A7YA 1RI0A 3I5RA 2HBPA 3JB9F 1BI1A 5GAMf 1RABB 2V8JA 3CMAQ 3EH1A 3CCLA 1RACB 2EYQA 3ER0A 2E3IA 4GLKA 5DLOA 1VQMT 1I5LA 2KDSA 3CPWP 4ATOA 3CD6A 2XKOC 1PKTA 1K73U 3REBB 1WLPB 2RNAA 2NUPA 1X6GA 2YLBA 3I55T 3FJPA 3M0TA 2J7IA 4FIBA 2IPOB 3RBBB 4M7DG 1QKXA 4PLIA 1WHGA 8AT1B 4M7AD 3CCSQ 2OJ2A 2HZYA 3RKWA 2X3XD 5A2QE 2AZVA 4JZ3A 1M2VA 2QGGA 5IHKA 2M02A 2LQWA 1FXXA 1X2KA 3L1AA 1SHGA 2CP6A 5IH2A 4FSXA 3OQ5A 3OYYA 3J7AF 2MMPA 4BY6B 2KE9A 3MEWA 4RCBA 2D6FA 2F5TX 3RMSA 1UGVA 4IIMA 2QEXA 1Y07A 5GAOl 2CZ1B 3JCMQ 3CD6T 4RTVA 2LVMA 1UJYA 1NJIC 2DXCA 4FYYB 4QQGA 4XU0A 4ORZA 1AWOA 4LDUA 1IB8A 1OZ2A 1VQ5A 3EFOA 2P4TA 3VKIA 1S72Q 4M78F 4E6RA 1KQSS 1YJ9Q 4C8QE 1QCNA 2L2PA 1WYXA 2KAFA 5GAN2 4DA4A 2DERA 2ZPGB 1M27C 2OX7A 4NOYA 2KROA 5GAN4 4NL3A 3E9GA 3CBMA 2HL3A 4ZTFA 1Q86U 3SWNB 3VRZA 1RAAB 5GMKm 4RMOA 2YT6A 2DYIA 3FIFA 1YIJQ 3EFSA 4OF1A 4KULA 5AT1B 4ELZC 4Z8AA 2A3LA 3M9QA 4L5GA 3ULRB 1ZHIA 3VS5A 2A37A 1NPPA 5CQYA 3EHRA 4IKFA 2OTJA 1ZUKA 3REAB 1YCSB 3NTIA 3L2VA 4PJOB 4E47A 1VQNA 1AZEA 4DBHA 1QVGP 1TXQA 5HK0A 1AVZC 3MPUB 4TVRA 1HYOA 2O9SA 3EFRA 1OOTA 1QVGS 1N9RA 2VWFA 5KCHA 1RLQC 3CCVA 4ZGJB 5GJVB 3CCVT 3CC4T 3NMZC 3PT9A 1B07A 1QWEA 4A4FA 5D6WA 2R58A 2FB7A 2MAMA 1KQSP 3JSCA 3LH0A 4A4HA 1QKWA 1O75A 3VU3C 4HCZA 7AT1B 4M77B 2LCCA 5CQXA 1HSQA 3CQTA 2QDYB 1VQPA 2LT1A 1KIKA 1NE8A 2YRDA 3IQLA 3X28B 5FLXE 3VS6A 4XU2A 4F16A 1VQOT 2GFAA 1GFDA 1PSEA 2CT3A 3JCMc 2CP2A 1LJOA 2K6DA 2LQKA 3NFCA 3OW2S 1JJ2S 4AG2C 4RTUA 3U23A 3UA7A 2JTEA 4J8OA 4IURA 2LRQA 2AIRB 2X35A 4PJOE 3OS5A 2GCXA 1FMKA 4ZN3A 5D7UA 1QQJA 2DEQA 1W2BP 2CS7A 2K3XA 1TUCA 2DJZA 4AFQC 2LJ3A 4C92F 1VQ9Q 1VQMA 4HA8A 3DLMA 5FU6C 1M1KC 1M9SA 3HFNA 1ZSGA 1G3SA 3CCST 3KBGA 3VS7A 4JS4A 1X27A 3META 1Y7XA 3OYAA 1YWOA 4EDUA 3EFOB 2CREA 3I56Q 1IGQA 4MMLA 4PJOC 3UATA 4KUIA 5EG2A 2JMAA 5KYUB 3EGDA 4PJOD 3I9QA 2MWOA 3V8KA 4C5IA 3CCQT 4Z89A 1FYNA 1ZSZB 2DE0X 4OP0A 3TSWA 5CK9A 3BW1A 1YWPA 1HJDA 1UHFA 1GBRA 5GAMh 1MNEA 4GLMA 1PSFA 2H3EB 4FL6A 3QWXX 1TU0B 2PQWA 2FG0A 3C94A 1KG1A 1TTHB 2OTLT 1MHNA 3JCMb 2DTOA 1TUGB 3DB3A 3CC7T 1ZA2B 2D8HA 2FPFA 2DZCA 3E1SA 4OMPA 4F17A 4K11A 3NPFA 4BY6C 2J06A 2DD5A 1KFZA 1WHHA 1NG2A 2MK5A 1MUZA 5I2SA 1H3HA 1KHCA 1GCPA 1D1AA 4EMHA 5HY6A 2RO0A 1GBQA 4ANJA 5A0LA 1N5ZA 4N0AC 2B86A 2DAQA 3HRSA 5GANh 2J05A 4B6MA 1R0BG 1VQ4T 2ZPFB 2RD1A 3X24B 2YWWA 2EQUA 2X3WD 3H0HA 5GMKl 3L42A 4J9BA 1K8AC 1C6VX 1SSHA 3CCRT 3MP6A 1DJ7B 2DJQA 1Y0MA 2DL7A 2XDPA 2AKKA 3V7RA 1KC8U 2QDLA 2VKNA 2WACA 1UE9A 2HQEA 4PJJA 2NUPB 1M8VA 3CC2T 4C8QC 4MDXA 3QYHB 1IRXA 1N6AA 4M7DF 2QGFB 1NEGA 4F7UG 4V2SA 1G2BA 1QP2A 2Y4XA 1VQLA 1U1SA 1Q82C 1NYFA 3H41A 4M75A 1H92A 4L6V5 2YSQA 1X69A 1M8MA 2AT1B 2E6ZA 2RHYA 1RADB 1BI0A 4ZGEB 3UF4A 4LDWA 3VRYA 5LJ5j 1E6HA 1PRMC 2G6FX 2H8HA 4XTVA 1A0NB 3THKA 1UECA 1WQWA 2COYA 3MJXA 5L23A 4FM4B 3MO8A 3OYEA 3EGXB 3M57A 1D09B 2DA9A 2EFIA 1K73C 3C95A 2CUBA 3GNFB 1Q7YU 3CCJT 4OMOA 2HSPA 1PWTA 2ED1A 4JRIA 3V8LA 1Q86C 1VQ7A 2EYZA 2QTXA 1X75C 1H8KA 4HKEA 4M7AE 1IREB 3P8DA 3JAME 1M90U 3M4YA 2LC4A 5KYUA 2JN0A 3GLXA 3I56T 4J5YA 1Z9QA 3L2ZA 1VQ6T 2WSFE 2O4XB 5ECAA 2F2WA 5LJ3f 2F69A 2LCLA 3S6WA 2RQWA 1JXOA 2KRMA 3QBYA 1W2BA 1LPLA 2HD0A 2JTMA 1PCXA 4OGEA 2RB6A 1BKBA 2HKQB 2K7AA 4R55A 3JRZA 4LUDA 3E19A 4E7LA 2EQIA 1UDLA 4DEYA 2DFUA 4ZTJA 2LX9A 1M5Q1 4D8KA 1D3BB 1Q82U 4JJBA 3H9NA 1WHLA 4C8QF 3MEAA 3L2WA 3H0IA 4M7DC 3A8OB 4GBQA 3OW2A 1SHFA 2QYZA 2RK2A 2M0OA 1ZSZC 1D0XA 2DVJA 1YI2Q 1R0CB 2PTKA 1JBMA 4DBQA 2EAYA 4PL6A 1OEBA 4BB7A 3HFOA 4O6JA 2HMAA 5GANd 1VIFA 4KH1B 1RI9A 2WSEE 3SWNA 2LNHB 3JCMh 2KGTA 1WPYA 3WVEB 2RHXA 3C4SA 5DLQE 5GAOm 3I56A 3OMGA 1V76A 1BIBA 1AEYA 3QG1A 3OYJA 1AHJB 1D0YA 2CKKA 2PVOB 2HSEB 1BK2A 5CKEA 4RG8A 5GAN3 3OW2P 1LVKA 1BYMA 3FJ5A 3V7CA 3KXTA 4F7UE 1M1GA 1NPRA 5GJWB 1VQ8Q 1S72A 2CSIA 3CMAA 2D0QB 2CH4A 2JOYA 3A98A 2QQAA 2LQ8A 3EG2A 4F7UA 3R6OA 3CXCS 1T0HA 2DX1A 4XK8E 1GCQC 4PJLA 5GANj 2KBTA 3M53A 3ZFJA 3CCQA 2EBPA 3M0SA 2F5KA 2LP5A 3QJ6A 1Y71A 3RERA 4E7SA 3JCMP 3AT1B 3G4ST 1YJWQ 1I07A 1OI1A 3FLGA 1BB9A 2B8AA 3CCLQ 2OTJT 3G6EQ 2XDBA 2KYMA 2XICA 1VA7A 4JRQA 4JRPA 3OSSC 1W1FA 2MOXA 3JV3A 5KYYA 1VQ8T 1S72T 5FU7B 3CCRQ 4HVWA 1OYXA 3S3MA 2E12A 1Q7YR 3OYFA 2DIGA 2KT8A 1B3QA 4OMLA 4M7AB 2JT4A 4EPCA 4Z02A 4A4KA 3MP1A 2ED0A 2RI2A 2GF7A 2KRSA 2RI5A 4LE9A 4BDYA 4QQDA 2IIMA 1W4SA 2GFUA 5CIUA 4E7HA 1QVPA 3FRNA 2NWMA 2QQSA 2WSCE 2DM1A 4OB0B 3VS2A 1JO8A 1B7TA 1YNZA 4HCBA 1YJ9T 2LMJA 1UB4A 2AKLA 1SF9A 4FU6A 1WHMA 4J7IA 1SG5A 2R57A 1YIJA 2DL8A 2YRCA 4JRKA 4MDWA 1G3YA 2BZYA 2GQVA 3SWNC 2QAZA 3RR6A 3CCUA 1WXUA 2GNCA 2XU8A 5GANe 2GQIA 1D3BA 1AT1B 2FZKB 2QQBA 1WHKA 4C0ZA 1WXBA 2YHTA 3UA6A 2X4XA 3LYIA 3VV0A 3PFSA 3JB9H 1SEMA 4M7DA 1YITQ 2XG8D 1X43A 2ROTA 4C0FA 1Q81U 1B34B 3CXCA 1XJWB 1QVFS 1ZUYA 1XTDA 4PLLA 3OYCA 3EH2A 1YHQQ 2LCSA 1VYTA 2V8KA 1S1NA 2AZSA 2HQHA 1XQHA 3L2UA 3BDUA 3H0FA 1GXIE 1JQQA 1ZUUA 4Y91A 3GOXA 5IXFA 3URGA 1KSWA 3QO3A 5KYWA 2HEQA 4PNOA 2CP5A 1RLPC 4J9FA 4E7ZA 3QWYA 2BE7D 4HVVA 2P84A 2VB6A 3CEYA 2O01E 2W10A 1KD1C 2C06A 4M7AA 4M7DB 2PUOB 2DILA 3CCEQ 1VQ6A 4N4HA 4OMFB 5GAMd 6AT1B 1YJNT 2C0OA 1YBYA 5GMKe 5EC7A 3M59A 3JB9J 4IUQA 5KYYB 3OS1A 3X25B 1HXDA 5FWCA 1ZBXA 5LJ3h 4LDYA 4PJNA 3L2QA 3P8BB 4OMNA 1J3TA 3JB9D 5HCKA 1YJWA 1Q81R 3PMIA 3M56A 1K9MU 4QW2A 3PIPA 4CC4B 1U8RA 3A8LB 3ZL7C 1UFFA 3RESA 3G4SQ 3D7SB 4M75E 2BTTA 3O5ZA 1YCYA 2M9UA 1V29B 4HXJA 1M1KU 1FWZA 2DL5A 1F1BB 4PFOA 1RAGB 1LCKA 2A28A 5LJ5f 3OYLA 5D6YA 4ZGDB 1BI2A 5I21A 4KGVB 2XI9A 1JRIA 2CYZB 3A8HB 4R0KA 3SDZA 4J9DA 2ABLA 1JXMA 2V1QA 2V8IA 3TU4K 2RH2A 1UTIA 2Z0WA 4C8QG 2HCKA 4XTXA 2VC8A 2JMCA 1AOJA 2QG9B 2D8JA 2VASA 1KQ1A 3EG3A 2BZ8A 4M78C 1X2QA 3J81E 2L3SA 4PJOG 3EG9A 4JLIA 5GMKj 2K57A 2GTJA 2QASA 4N4GA 5C0MA 4RKUE 1K0SA 3GBQA 1R8OB 3PIOA 2K5LA 3V8JA 1IO6A 3VUZA 5GAOq 1N9SA 4C8QD 3A8GB 1PM3A 2L3PA 2KT1A 4BI4A 2EQMA 4QQ6A 2VV5A 3CCUT 2DXUA 1UGSB 1N8RU 1ACMB 1H641 1Z9ZA 2O31A 2LJ1A 1QCFA 2G3RA 2ZGWA 3PTAA 4C0GA 5GANg 1VQOA 1T3SA 4CC3A 1IGUA 4M77C 1XNIA 5HK3A 2CDTA 1KD1R 4M77G 1C0MA 1EIFA 5GAMj 1I81A 1N8RR 4MZPA 4M4ZA 3CBPA 2JS0A 4X9CA 1NEBA 5A0GA 3OYIA 2HBWA 1YI2A 2NUZA 3JCMd 4OVAA 2A08A 1GFCA 2K3YA 2YUQA 2P4RA 4A54A 4MMKA 1UJ0A 3BDLA 4EMGA 2PVDB 3KUFA 4FYXB 2KXDA 3OSVA 2JZ2A 1G5VA 2V26A 4JS5A 1G3TA 4JPBW 2RPNA 3P8HA 4OB3B 3PMTA 1SPKA 2QA4Q 1RL2A 1WX6A 4KGZB 5KE3A 1U06A 4XQ3A 4F7UF 1NZ9A 1W2BS 3LH5A 3OMCA 4M77E 2MPXC 3JCMf 5LJ3d 2MCNA 4E7KA 3QKJA 3PGGA 1K73R 2QTVA 4M78G 3JB9G 1KC8R 2DXBA 2CP0A 1OX9A 1Y96A 4FW1A 4PFZA 3VS0A 3QHSA 5CKHA 4OB2B 5IHNA 3ME9A 3NGPA 3I35A 1KQ2A 2CZ6B 3G71T 3L2RA 3VYHB 1WJQA 2DTIA 2PZ1A 5D6XA 4RTYA 2RHUA 1K9MR 3QIIA 3RNJA 2ENMA 3OBYA 4KH0B 3G6ET 1WDXA 1WFWA 2RQVA 3CCLT 3EAEA 2PNIA 3CCJA 1OV3A 2FO0A 4C8QA 4CC7A 4C92G 5I11A 2DEUA 3CC2A 4J9EA 4XTWA 3A8MB 2XD0A 2CT4A 2E65A 5DM7R 3CCMA 3PNWC 1EZZB 2DPPB 4RTWA 1YP5A 4HT8A 3R6NA 3M4GA 1M2OA 4BE0A 2FVUA 2ROLA 3VJPA 4M75B 3OS2A 2QEXT 1W6XA 4XU3A 1Y57A 2KI7A 1WGSA 3ZBDA 2JNGA 4M75F 1QCOA 1YN8A 4FYVB 1BCMA 1K9AA 2JS2A 1UGRB 3EG0A 2PU9B 4CC2A 2EWNA 3AHUA 1OZ3A 4DEXA 1VQKT 4IUVA 1LNXA 4NS5A 2BUDA 2LNVA 3RKXA 4C0DB 1K4US 4M77F 1JB0E 3VS3A 4M77A 4VUBA 1B34A 2RN8A 1M3BA 2X4WA 5IT9E 5J26A 2XMFA 2EKOA 3CC7A 1KQSA 1M3AA 5FRMA 3N5BB 2K2VA 3TQ7P 9ATCB 3HRTA 2DBKA 3DLLA 2QI2A 4HCKA 3VS4A 3QYGB 4ESRA 4J83A 4II1A 2RK1A 3TEEA 1VQPT 1MV3A 3CCSA 3C0CA 1VYVA 4EIKA 2DXTA 3DKMA 4EMKB 4IUTA 1UG1A 1BI3A 1E6GA 2R5MA 4RTTA 2LX7A 2I0NA 4JDSA 2LZ6B 1U1TA 3MEVA 1VQ5Q 2E41A 5GAN6 4PJOF 2E3HA 3JB9I 5GAN7 1Q95G 4DBFA 3GPLA 2E70A 3GP8A 5DY9A 2M51A 4KT0E 3I55Q 2RJEA 4OGCA 2DTHA 2E4HA 3CCUQ 1HD3A 2RHZA 4C5GA 3EGXA 2LTOA 3OS0A 4A4GA 1QVFP 2FRWA 1EFNA 3G6EA 5GANf 1VQMQ 1PHTA 3LGFA 4QVCA 3T9NA 3RUXA 1OULA 4WF2A 4RUGA 2ZPIB 2D9TA 5FWBA 4LXCA 2JM9A 1YJ9A 2RQTA 4BD3A 2J6FA 1Y96B 3EG1A 2KQWA 3SFMA 2KXCA 3CPWS 2SRCA 3M55A 3JCMV 4AT1B 2BKDN 1QWFA 3OYMA 1G8XA 1NJIR 2MF2A 3LWHA 3CCQQ 3MHXA 1GRIA 2CUDA 3CC4A 2VXEA 2XHCA 1U3OA 3G4SA 3BE3A 3EGUA 2X51A 1WZOA 2RQRA 4YTLA 1M4ZA 1VQNT 2M1HA 4BE1A 1MMDA 5LJ5h 2X9HA 3A5ZB 4BACA 4D6WA 2JXBA 3MP8A 3UT1A 2FHDA 1KC8C 2MWPA 2OAUA 4KRTA 2DVEA 1M3CA 4LD9K 4RTZA 4NL2A 4Q5WA 2Y90A 4M78A 1U5SA 2KYBA 2JM8A 3RDVA 1T0JA 2E1HA 2KVQG 2NYSA 4F7UB 4LDVA 4LNPA 1TH7A 3EGDB 3INZA 1RAFB 1K9MC 5KE2A 3O8VA 3DB4A 3WVDB 1ZX6A 1M2VB 3PVQA 2YUNA 1TS9A 3Q1JA 3CPWA 4HVUA 3HRUA 3M0PA 4XTUA 3TSZA 3FB9A 2EQKA 1QVFA 3EHQA 2OTJQ 2DETA 1WXTA 1NLPC 2CP7A 2MI6A 1YJNQ 4XTYA 4B9WA 5LJ3j 2KNBB 1ZA1B 3S3NA 4D8DA 1JJ2A 2EVRA 1ZBJA 2D0NA 1KD1U 1H3ZA 1OU9A 2DZ9A 2F2VA 2KEAA 4AFZC 3CC4Q 2Y4YA 2EYXA 4ZN1A 4QT7A 1GL5A 1MNDA 1YITA 1PKSA 5AYFA 4AG1C 5LJ5e 4KGXB 4FT4A 3SD4A 2EGAA 1MMGA 2SEMA 3NTKA 2M16A 3M0QA 4PKCC 2OTLQ 1WNLA 2BE9B 2EJGA 2L3RA 2VGMA 3GNGA 1D1CA 4M7AC 3WXMB 5IAYA 2RJCA 1KHIA 5GAN5 2MIOA 3HP9A 1VQLQ 2CZ7B 4CI0C 4WCIA 1ABOA 2BZXA 1YJNA 1I4K1 4FYWB 1AZGB 3VS1A 3FDRA 2O4XA 2EPDA 1K8AU 1PD1A 3I5SA 4M7DE 5CAIA 4C0DC 2EYYA 3X20B 1M30A 2C0TA 4KUDK 2XIDA 2LQNA 1Q7YC 3H6ZA 1VQ4A 1K1ZA 1ZLMA 1BCOA 4J9CA 4M7AG 2EW3A 4QVZA 2HQXA 1M90R 2RM4A 4Y92A 4Y28E 3LX7A 3CBOA 1M1KR 2K2MA 4RTXA 3JCMW 3HTRA 3QXEB 1M1FA 4UC4A 3OY9A 2L5QA 1IHWA 2HDAA 5CVIA 1TOVA 2EGEA 3VYGA 2HNIA 1WI7A 2EJFA 2P0KA 3LW5E 1I1JA 2EYWA 3M54A 5KYXB 1OPLA 2GGRA 3HL8A 2COWA 1PC0A 4F14A 3PVLA 3FEOA 1VQNQ 2O88A 1VQ6Q 2L8DA 2VUBA 4JJCA 4L59A 2HAXA 5KYWB 5CKFA 4J9HA 4C92D 4BI8B 1OU8A 1KJWA 4M75C 5CKBA 4IUUA 1O9SA 1SRLA 2YXYA 1UHCA 2QQ9A 2A36A 5KYNA 1NM7A 4ME7A 5GAN8 1VQ5T 5LJ5g 1WA7A 4DQ2A 3CCJQ 4M78D 4J6WA 1TUDA 3JCMe 2L89A 1YJWT 5I22A 2J6OA 1SKUB 5I2MA 2YLCA 4F04B 1VQPQ 1VUBA 1PG5B 1YIJT 5IHIA 3LWIA 1CSKA 2DMOA 2EIFA 3TCJA 4AFSC 3CCVQ 2EGCA 5FU6B 5FRNA 4DOWA 4M7AF 4QVDA 5L8RE 4QKUA 2KK4A 4C5HA 4MZTA 4LUEA 3MCAB 3PE0A 2L3QA 4PFPA 2JTFA 1XOVA 2LT4A 4E2FB 5GMKh 1UGPB 2ZPHB 3JCMX 1E7OA 2DBMA 1BIAA 3UPUA 1YHQA 2DK3A 4C92C 2PVGB 4J6YA 4C92E 5IN1A 2KRNA 3MEUA 1VOMA 1UUEA 1MV0B 2DLPA 1D1BA 3VUBA 2DIQA 2RJFA 4BI3A 3CCMT 2DRKA 2P0QA 1YFNA 4LN2A 2C0IA 3OYDA 2E10A 2F2XA 2QEXQ 1LOJA 2OTLA 3SEMA 2RF0A 1MMNA 3NHNA 2DKGA 1I5OB 2XDDA 2ATCB 4OB1B 4XAXB 1VQ7Q 1PNJA 2HKNA 1D0ZA 1WHJA 3CCRA 4JUVA 2E5KA 5LJ3g 1VQKA 2FPEA 1SSFA 2FRYA 2VYTA 1VIEA 2D1XA 1KK7A 3QZ5B 5J39A 5FROA 4J9IA 2YUOA 2NLUA 4LD6A 3OYNA 2JUFA 2O9VA 3LGLA 3OYBA 1WIEA 2P0PA 4E7IA 3SB2A 1WJSA 3CMAT 4M7DD 4AFUC 2F1LA 2NUTB 4M78B 4C92A 3M58A 1UGQB 3M0UA 2GTOA 3S3OA 4CRIA 2FL7A 3UDCA 2RMOA 3HPWA 4JJNK 4X1VA 2KSSA 3X26B 1Q81C 1YHQT 2K5IA 2CH4W 2QA4A 3OA6A 1VYUA 1M90C 4FW2A 5LJ5d 3UWNA 2E6NA 1K0XA 2XK0A 5KCOA 2RQUA 3OYGA 5HKCA 2LDMA 3A1PA 1G3WA 4BUGA 2ZCFB 2A0FB 1V1CA 3QDRB 3I55A 4DBRA 3GIBA 4AMCA 4IIOA 1YITT 2CSQA 3G71A 2M0YA 1OPKA 3H8ZA 1GCQA 1X6BA 4KBMB 3CMET 1I8FA 2W0ZA 8ATCB 2E5QA 2RA2A 2DNUA 1AWJA 1VQ8A 1YI2T 3M0RA 5FU7C 3JCMJ 5M9OA 1VQ9T 2K3BA 3TVTA 1G83A 2OI3A 2EJ9A 1C1AA 1TWBA 2GBQA 1QVGA 5CR2A 2DL4A 5CKDA 2E64A 2RI3A 1MMAA 2YDLA 1Q82R 2H3JA 3CMEQ 2LJ0A 1JJ2P 3G1JA 1SRMA 1FX7A 5A0DA 2YRVA 1BU1A 2CP3A 3JCMg 2VGNA 4FCYA 2JVVA 2VXFA 4X34A 1X01A 4XTZA 1BBZA 1MGQA 4DOVA 1AWXA 4JJDA 1K76A 3F70A 4HT9A 1PRLC 5LL6S 3ASKA 4IUPA 3QZ9B 3G7ZA 1ARKA 3C12A 3OYKA 3GF5A 2ZZDA 1RAHB 4JZ4A 2QQRA 2RJDA 4J7FA 5GAMe 1NLOC 1VQ7T 2COZA 3NTHA 2DRMA 2AK5A 3SHWA 4ELYC 1PD0A 1IHVA 1ZQ1A 1VQLT 2DYBA 2DD4A 2QXFA 3BFMA 1QLYA 2O2OA 2NUTA 4BE2A 4MZMA 4C8QB 4PJMA 3CXCP 2DL3A 2FPDA 2KY9A 2QK0A 2ZPBB 2JW4A 3RKYA 4M77D 1RUWA 3CCEA 2EKHA 4A4EA 1IZ6A 3E9FA 2V1RA 5J3BA 4XU1A 1NYGA 4Z88A 1NBEB 2ZAEA 4OMMA 4B9XA 3CMEA 1CKAA 1OX8A 3M5AA 5GAOn 5GAMg 4A63B 1TG0A 3RMQA 2ZPEB 3KFVA 2HL5C 1IXDA 4OMQA 1QP3A 3QPHA 2CGHA 2YUPA 1CKBA 2JJ9A 3G71Q 1QW1A 4N0AA 2K4YA 2IVWA 2J6KA 4O5VA 2K79A 3QDFA 4ZNXA 3V7SA 1QMCA 4WTOB 1P92A 3QSUA 3E2UA 3HSBA 4C5EA 3EG9B 1JEGA 4N4IA 2L0AA 4RG2A 4C92B 3HHTB 1AD5A 4M78E 2EQJA 3RIRA 3OB9A 4JLGA 4RCCA 3OYHA 3FC3A 1VQKQ 1ABQA 1ZSZA 1JU5C 4GY5A 3CC2Q 4BDZA 2K9GA 5C6SA 1Q86R 5IXBA 2X4YA 1AWWA 2DF6A 2I2LA 4M75G 2R5AA 1R77A 5CCAA 3ZEHA 4FSSA 3CPFA 2RHIA 3OBWA 2CZ0B 1I0CA 5GAOp 1HK9A 3HKSA 2ECZA 5GMKi 1UEBA 4J9GA 3J80E 2FZGB 3BY7A 1VQ4Q 3CCMQ 5FW9A 2FEIA 2ESWA 1NJIU 2MYSA 3CD6Q 1VQ9A 5KH6A 1OQKA 2DO3A 4R56A 1RAEB 5GAOr 2FYKA 1FMVA 4FT2A 4PK4A 4E7JA 1N27A 2KMTA 5KYXA 2VVKA 1X6OA 4X9DA 1TSFA 1WJRA 5CO7A 3TREA 2FZCB 3LLRA 2K5FA
chains in the Genus database with same CATH topology
1OX8A 1ZSZB 1YFNA 1OU8A 1OU9A 1ZSZA 1ZSZC 2QAZA 1TWBA 2QASA 1OX9A 2NYSA 1OULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  1ZSZ B;  1YFN A;  1OU8 A;  1OU9 A;  1ZSZ A;  1ZSZ C;  2QAZ A;  1TWB A;  2QAS A;  1OX9 A;  2NYS A;  1OUL A; 
#chains in the Genus database with same CATH topology
 1WQ7 A;  3MKD A;  4LDX A;  2PUK B;  1EX4 A;  4PJO A;  4A53 A;  2QA4 T;  2X4J A;  3CC7 Q;  4EMK A;  1W70 A;  2BIV A;  4EMK C;  5LJ3 e;  3CCE T;  2AHJ B;  2IG0 A;  1VQO Q;  1K8A R;  4J6X A;  3QUI A;  2OAW A;  1N8R C;  1FMW A;  4P5N A;  4HCC A;  3QJY A;  4M75 D;  1T3L A;  1RAI B;  2KR3 A;  2A7Y A;  1RI0 A;  3I5R A;  2HBP A;  3JB9 F;  1BI1 A;  5GAM f;  1RAB B;  2V8J A;  3CMA Q;  3EH1 A;  3CCL A;  1RAC B;  2EYQ A;  3ER0 A;  2E3I A;  4GLK A;  5DLO A;  1VQM T;  1I5L A;  2KDS A;  3CPW P;  4ATO A;  3CD6 A;  2XKO C;  1PKT A;  1K73 U;  3REB B;  1WLP B;  2RNA A;  2NUP A;  1X6G A;  2YLB A;  3I55 T;  3FJP A;  3M0T A;  2J7I A;  4FIB A;  2IPO B;  3RBB B;  4M7D G;  1QKX A;  4PLI A;  1WHG A;  8AT1 B;  4M7A D;  3CCS Q;  2OJ2 A;  2HZY A;  3RKW A;  2X3X D;  5A2Q E;  2AZV A;  4JZ3 A;  1M2V A;  2QGG A;  5IHK A;  2M02 A;  2LQW A;  1FXX A;  1X2K A;  3L1A A;  1SHG A;  2CP6 A;  5IH2 A;  4FSX A;  3OQ5 A;  3OYY A;  3J7A F;  2MMP A;  4BY6 B;  2KE9 A;  3MEW A;  4RCB A;  2D6F A;  2F5T X;  3RMS A;  1UGV A;  4IIM A;  2QEX A;  1Y07 A;  5GAO l;  2CZ1 B;  3JCM Q;  3CD6 T;  4RTV A;  2LVM A;  1UJY A;  1NJI C;  2DXC A;  4FYY B;  4QQG A;  4XU0 A;  4ORZ A;  1AWO A;  4LDU A;  1IB8 A;  1OZ2 A;  1VQ5 A;  3EFO A;  2P4T A;  3VKI A;  1S72 Q;  4M78 F;  4E6R A;  1KQS S;  1YJ9 Q;  4C8Q E;  1QCN A;  2L2P A;  1WYX A;  2KAF A;  5GAN 2;  4DA4 A;  2DER A;  2ZPG B;  1M27 C;  2OX7 A;  4NOY A;  2KRO A;  5GAN 4;  4NL3 A;  3E9G A;  3CBM A;  2HL3 A;  4ZTF A;  1Q86 U;  3SWN B;  3VRZ A;  1RAA B;  5GMK m;  4RMO A;  2YT6 A;  2DYI A;  3FIF A;  1YIJ Q;  3EFS A;  4OF1 A;  4KUL A;  5AT1 B;  4ELZ C;  4Z8A A;  2A3L A;  3M9Q A;  4L5G A;  3ULR B;  1ZHI A;  3VS5 A;  2A37 A;  1NPP A;  5CQY A;  3EHR A;  4IKF A;  2OTJ A;  1ZUK A;  3REA B;  1YCS B;  3NTI A;  3L2V A;  4PJO B;  4E47 A;  1VQN A;  1AZE A;  4DBH A;  1QVG P;  1TXQ A;  5HK0 A;  1AVZ C;  3MPU B;  4TVR A;  1HYO A;  2O9S A;  3EFR A;  1OOT A;  1QVG S;  1N9R A;  2VWF A;  5KCH A;  1RLQ C;  3CCV A;  4ZGJ B;  5GJV B;  3CCV T;  3CC4 T;  3NMZ C;  3PT9 A;  1B07 A;  1QWE A;  4A4F A;  5D6W A;  2R58 A;  2FB7 A;  2MAM A;  1KQS P;  3JSC A;  3LH0 A;  4A4H A;  1QKW A;  1O75 A;  3VU3 C;  4HCZ A;  7AT1 B;  4M77 B;  2LCC A;  5CQX A;  1HSQ A;  3CQT A;  2QDY B;  1VQP A;  2LT1 A;  1KIK A;  1NE8 A;  2YRD A;  3IQL A;  3X28 B;  5FLX E;  3VS6 A;  4XU2 A;  4F16 A;  1VQO T;  2GFA A;  1GFD A;  1PSE A;  2CT3 A;  3JCM c;  2CP2 A;  1LJO A;  2K6D A;  2LQK A;  3NFC A;  3OW2 S;  1JJ2 S;  4AG2 C;  4RTU A;  3U23 A;  3UA7 A;  2JTE A;  4J8O A;  4IUR A;  2LRQ A;  2AIR B;  2X35 A;  4PJO E;  3OS5 A;  2GCX A;  1FMK A;  4ZN3 A;  5D7U A;  1QQJ A;  2DEQ A;  1W2B P;  2CS7 A;  2K3X A;  1TUC A;  2DJZ A;  4AFQ C;  2LJ3 A;  4C92 F;  1VQ9 Q;  1VQM A;  4HA8 A;  3DLM A;  5FU6 C;  1M1K C;  1M9S A;  3HFN A;  1ZSG A;  1G3S A;  3CCS T;  3KBG A;  3VS7 A;  4JS4 A;  1X27 A;  3MET A;  1Y7X A;  3OYA A;  1YWO A;  4EDU A;  3EFO B;  2CRE A;  3I56 Q;  1IGQ A;  4MML A;  4PJO C;  3UAT A;  4KUI A;  5EG2 A;  2JMA A;  5KYU B;  3EGD A;  4PJO D;  3I9Q A;  2MWO A;  3V8K A;  4C5I A;  3CCQ T;  4Z89 A;  1FYN A;  1ZSZ B;  2DE0 X;  4OP0 A;  3TSW A;  5CK9 A;  3BW1 A;  1YWP A;  1HJD A;  1UHF A;  1GBR A;  5GAM h;  1MNE A;  4GLM A;  1PSF A;  2H3E B;  4FL6 A;  3QWX X;  1TU0 B;  2PQW A;  2FG0 A;  3C94 A;  1KG1 A;  1TTH B;  2OTL T;  1MHN A;  3JCM b;  2DTO A;  1TUG B;  3DB3 A;  3CC7 T;  1ZA2 B;  2D8H A;  2FPF A;  2DZC A;  3E1S A;  4OMP A;  4F17 A;  4K11 A;  3NPF A;  4BY6 C;  2J06 A;  2DD5 A;  1KFZ A;  1WHH A;  1NG2 A;  2MK5 A;  1MUZ A;  5I2S A;  1H3H A;  1KHC A;  1GCP A;  1D1A A;  4EMH A;  5HY6 A;  2RO0 A;  1GBQ A;  4ANJ A;  5A0L A;  1N5Z A;  4N0A C;  2B86 A;  2DAQ A;  3HRS A;  5GAN h;  2J05 A;  4B6M A;  1R0B G;  1VQ4 T;  2ZPF B;  2RD1 A;  3X24 B;  2YWW A;  2EQU A;  2X3W D;  3H0H A;  5GMK l;  3L42 A;  4J9B A;  1K8A C;  1C6V X;  1SSH A;  3CCR T;  3MP6 A;  1DJ7 B;  2DJQ A;  1Y0M A;  2DL7 A;  2XDP A;  2AKK A;  3V7R A;  1KC8 U;  2QDL A;  2VKN A;  2WAC A;  1UE9 A;  2HQE A;  4PJJ A;  2NUP B;  1M8V A;  3CC2 T;  4C8Q C;  4MDX A;  3QYH B;  1IRX A;  1N6A A;  4M7D F;  2QGF B;  1NEG A;  4F7U G;  4V2S A;  1G2B A;  1QP2 A;  2Y4X A;  1VQL A;  1U1S A;  1Q82 C;  1NYF A;  3H41 A;  4M75 A;  1H92 A;  4L6V 5;  2YSQ A;  1X69 A;  1M8M A;  2AT1 B;  2E6Z A;  2RHY A;  1RAD B;  1BI0 A;  4ZGE B;  3UF4 A;  4LDW A;  3VRY A;  5LJ5 j;  1E6H A;  1PRM C;  2G6F X;  2H8H A;  4XTV A;  1A0N B;  3THK A;  1UEC A;  1WQW A;  2COY A;  3MJX A;  5L23 A;  4FM4 B;  3MO8 A;  3OYE A;  3EGX B;  3M57 A;  1D09 B;  2DA9 A;  2EFI A;  1K73 C;  3C95 A;  2CUB A;  3GNF B;  1Q7Y U;  3CCJ T;  4OMO A;  2HSP A;  1PWT A;  2ED1 A;  4JRI A;  3V8L A;  1Q86 C;  1VQ7 A;  2EYZ A;  2QTX A;  1X75 C;  1H8K A;  4HKE A;  4M7A E;  1IRE B;  3P8D A;  3JAM E;  1M90 U;  3M4Y A;  2LC4 A;  5KYU A;  2JN0 A;  3GLX A;  3I56 T;  4J5Y A;  1Z9Q A;  3L2Z A;  1VQ6 T;  2WSF E;  2O4X B;  5ECA A;  2F2W A;  5LJ3 f;  2F69 A;  2LCL A;  3S6W A;  2RQW A;  1JXO A;  2KRM A;  3QBY A;  1W2B A;  1LPL A;  2HD0 A;  2JTM A;  1PCX A;  4OGE A;  2RB6 A;  1BKB A;  2HKQ B;  2K7A A;  4R55 A;  3JRZ A;  4LUD A;  3E19 A;  4E7L A;  2EQI A;  1UDL A;  4DEY A;  2DFU A;  4ZTJ A;  2LX9 A;  1M5Q 1;  4D8K A;  1D3B B;  1Q82 U;  4JJB A;  3H9N A;  1WHL A;  4C8Q F;  3MEA A;  3L2W A;  3H0I A;  4M7D C;  3A8O B;  4GBQ A;  3OW2 A;  1SHF A;  2QYZ A;  2RK2 A;  2M0O A;  1ZSZ C;  1D0X A;  2DVJ A;  1YI2 Q;  1R0C B;  2PTK A;  1JBM A;  4DBQ A;  2EAY A;  4PL6 A;  1OEB A;  4BB7 A;  3HFO A;  4O6J A;  2HMA A;  5GAN d;  1VIF A;  4KH1 B;  1RI9 A;  2WSE E;  3SWN A;  2LNH B;  3JCM h;  2KGT A;  1WPY A;  3WVE B;  2RHX A;  3C4S A;  5DLQ E;  5GAO m;  3I56 A;  3OMG A;  1V76 A;  1BIB A;  1AEY A;  3QG1 A;  3OYJ A;  1AHJ B;  1D0Y A;  2CKK A;  2PVO B;  2HSE B;  1BK2 A;  5CKE A;  4RG8 A;  5GAN 3;  3OW2 P;  1LVK A;  1BYM A;  3FJ5 A;  3V7C A;  3KXT A;  4F7U E;  1M1G A;  1NPR A;  5GJW B;  1VQ8 Q;  1S72 A;  2CSI A;  3CMA A;  2D0Q B;  2CH4 A;  2JOY A;  3A98 A;  2QQA A;  2LQ8 A;  3EG2 A;  4F7U A;  3R6O A;  3CXC S;  1T0H A;  2DX1 A;  4XK8 E;  1GCQ C;  4PJL A;  5GAN j;  2KBT A;  3M53 A;  3ZFJ A;  3CCQ A;  2EBP A;  3M0S A;  2F5K A;  2LP5 A;  3QJ6 A;  1Y71 A;  3RER A;  4E7S A;  3JCM P;  3AT1 B;  3G4S T;  1YJW Q;  1I07 A;  1OI1 A;  3FLG A;  1BB9 A;  2B8A A;  3CCL Q;  2OTJ T;  3G6E Q;  2XDB A;  2KYM A;  2XIC A;  1VA7 A;  4JRQ A;  4JRP A;  3OSS C;  1W1F A;  2MOX A;  3JV3 A;  5KYY A;  1VQ8 T;  1S72 T;  5FU7 B;  3CCR Q;  4HVW A;  1OYX A;  3S3M A;  2E12 A;  1Q7Y R;  3OYF A;  2DIG A;  2KT8 A;  1B3Q A;  4OML A;  4M7A B;  2JT4 A;  4EPC A;  4Z02 A;  4A4K A;  3MP1 A;  2ED0 A;  2RI2 A;  2GF7 A;  2KRS A;  2RI5 A;  4LE9 A;  4BDY A;  4QQD A;  2IIM A;  1W4S A;  2GFU A;  5CIU A;  4E7H A;  1QVP A;  3FRN A;  2NWM A;  2QQS A;  2WSC E;  2DM1 A;  4OB0 B;  3VS2 A;  1JO8 A;  1B7T A;  1YNZ A;  4HCB A;  1YJ9 T;  2LMJ A;  1UB4 A;  2AKL A;  1SF9 A;  4FU6 A;  1WHM A;  4J7I A;  1SG5 A;  2R57 A;  1YIJ A;  2DL8 A;  2YRC A;  4JRK A;  4MDW A;  1G3Y A;  2BZY A;  2GQV A;  3SWN C;  2QAZ A;  3RR6 A;  3CCU A;  1WXU A;  2GNC A;  2XU8 A;  5GAN e;  2GQI A;  1D3B A;  1AT1 B;  2FZK B;  2QQB A;  1WHK A;  4C0Z A;  1WXB A;  2YHT A;  3UA6 A;  2X4X A;  3LYI A;  3VV0 A;  3PFS A;  3JB9 H;  1SEM A;  4M7D A;  1YIT Q;  2XG8 D;  1X43 A;  2ROT A;  4C0F A;  1Q81 U;  1B34 B;  3CXC A;  1XJW B;  1QVF S;  1ZUY A;  1XTD A;  4PLL A;  3OYC A;  3EH2 A;  1YHQ Q;  2LCS A;  1VYT A;  2V8K A;  1S1N A;  2AZS A;  2HQH A;  1XQH A;  3L2U A;  3BDU A;  3H0F A;  1GXI E;  1JQQ A;  1ZUU A;  4Y91 A;  3GOX A;  5IXF A;  3URG A;  1KSW A;  3QO3 A;  5KYW A;  2HEQ A;  4PNO A;  2CP5 A;  1RLP C;  4J9F A;  4E7Z A;  3QWY A;  2BE7 D;  4HVV A;  2P84 A;  2VB6 A;  3CEY A;  2O01 E;  2W10 A;  1KD1 C;  2C06 A;  4M7A A;  4M7D B;  2PUO B;  2DIL A;  3CCE Q;  1VQ6 A;  4N4H A;  4OMF B;  5GAM d;  6AT1 B;  1YJN T;  2C0O A;  1YBY A;  5GMK e;  5EC7 A;  3M59 A;  3JB9 J;  4IUQ A;  5KYY B;  3OS1 A;  3X25 B;  1HXD A;  5FWC A;  1ZBX A;  5LJ3 h;  4LDY A;  4PJN A;  3L2Q A;  3P8B B;  4OMN A;  1J3T A;  3JB9 D;  5HCK A;  1YJW A;  1Q81 R;  3PMI A;  3M56 A;  1K9M U;  4QW2 A;  3PIP A;  4CC4 B;  1U8R A;  3A8L B;  3ZL7 C;  1UFF A;  3RES A;  3G4S Q;  3D7S B;  4M75 E;  2BTT A;  3O5Z A;  1YCY A;  2M9U A;  1V29 B;  4HXJ A;  1M1K U;  1FWZ A;  2DL5 A;  1F1B B;  4PFO A;  1RAG B;  1LCK A;  2A28 A;  5LJ5 f;  3OYL A;  5D6Y A;  4ZGD B;  1BI2 A;  5I21 A;  4KGV B;  2XI9 A;  1JRI A;  2CYZ B;  3A8H B;  4R0K A;  3SDZ A;  4J9D A;  2ABL A;  1JXM A;  2V1Q A;  2V8I A;  3TU4 K;  2RH2 A;  1UTI A;  2Z0W A;  4C8Q G;  2HCK A;  4XTX A;  2VC8 A;  2JMC A;  1AOJ A;  2QG9 B;  2D8J A;  2VAS A;  1KQ1 A;  3EG3 A;  2BZ8 A;  4M78 C;  1X2Q A;  3J81 E;  2L3S A;  4PJO G;  3EG9 A;  4JLI A;  5GMK j;  2K57 A;  2GTJ A;  2QAS A;  4N4G A;  5C0M A;  4RKU E;  1K0S A;  3GBQ A;  1R8O B;  3PIO A;  2K5L A;  3V8J A;  1IO6 A;  3VUZ A;  5GAO q;  1N9S A;  4C8Q D;  3A8G B;  1PM3 A;  2L3P A;  2KT1 A;  4BI4 A;  2EQM A;  4QQ6 A;  2VV5 A;  3CCU T;  2DXU A;  1UGS B;  1N8R U;  1ACM B;  1H64 1;  1Z9Z A;  2O31 A;  2LJ1 A;  1QCF A;  2G3R A;  2ZGW A;  3PTA A;  4C0G A;  5GAN g;  1VQO A;  1T3S A;  4CC3 A;  1IGU A;  4M77 C;  1XNI A;  5HK3 A;  2CDT A;  1KD1 R;  4M77 G;  1C0M A;  1EIF A;  5GAM j;  1I81 A;  1N8R R;  4MZP A;  4M4Z A;  3CBP A;  2JS0 A;  4X9C A;  1NEB A;  5A0G A;  3OYI A;  2HBW A;  1YI2 A;  2NUZ A;  3JCM d;  4OVA A;  2A08 A;  1GFC A;  2K3Y A;  2YUQ A;  2P4R A;  4A54 A;  4MMK A;  1UJ0 A;  3BDL A;  4EMG A;  2PVD B;  3KUF A;  4FYX B;  2KXD A;  3OSV A;  2JZ2 A;  1G5V A;  2V26 A;  4JS5 A;  1G3T A;  4JPB W;  2RPN A;  3P8H A;  4OB3 B;  3PMT A;  1SPK A;  2QA4 Q;  1RL2 A;  1WX6 A;  4KGZ B;  5KE3 A;  1U06 A;  4XQ3 A;  4F7U F;  1NZ9 A;  1W2B S;  3LH5 A;  3OMC A;  4M77 E;  2MPX C;  3JCM f;  5LJ3 d;  2MCN A;  4E7K A;  3QKJ A;  3PGG A;  1K73 R;  2QTV A;  4M78 G;  3JB9 G;  1KC8 R;  2DXB A;  2CP0 A;  1OX9 A;  1Y96 A;  4FW1 A;  4PFZ A;  3VS0 A;  3QHS A;  5CKH A;  4OB2 B;  5IHN A;  3ME9 A;  3NGP A;  3I35 A;  1KQ2 A;  2CZ6 B;  3G71 T;  3L2R A;  3VYH B;  1WJQ A;  2DTI A;  2PZ1 A;  5D6X A;  4RTY A;  2RHU A;  1K9M R;  3QII A;  3RNJ A;  2ENM A;  3OBY A;  4KH0 B;  3G6E T;  1WDX A;  1WFW A;  2RQV A;  3CCL T;  3EAE A;  2PNI A;  3CCJ A;  1OV3 A;  2FO0 A;  4C8Q A;  4CC7 A;  4C92 G;  5I11 A;  2DEU A;  3CC2 A;  4J9E A;  4XTW A;  3A8M B;  2XD0 A;  2CT4 A;  2E65 A;  5DM7 R;  3CCM A;  3PNW C;  1EZZ B;  2DPP B;  4RTW A;  1YP5 A;  4HT8 A;  3R6N A;  3M4G A;  1M2O A;  4BE0 A;  2FVU A;  2ROL A;  3VJP A;  4M75 B;  3OS2 A;  2QEX T;  1W6X A;  4XU3 A;  1Y57 A;  2KI7 A;  1WGS A;  3ZBD A;  2JNG A;  4M75 F;  1QCO A;  1YN8 A;  4FYV B;  1BCM A;  1K9A A;  2JS2 A;  1UGR B;  3EG0 A;  2PU9 B;  4CC2 A;  2EWN A;  3AHU A;  1OZ3 A;  4DEX A;  1VQK T;  4IUV A;  1LNX A;  4NS5 A;  2BUD A;  2LNV A;  3RKX A;  4C0D B;  1K4U S;  4M77 F;  1JB0 E;  3VS3 A;  4M77 A;  4VUB A;  1B34 A;  2RN8 A;  1M3B A;  2X4W A;  5IT9 E;  5J26 A;  2XMF A;  2EKO A;  3CC7 A;  1KQS A;  1M3A A;  5FRM A;  3N5B B;  2K2V A;  3TQ7 P;  9ATC B;  3HRT A;  2DBK A;  3DLL A;  2QI2 A;  4HCK A;  3VS4 A;  3QYG B;  4ESR A;  4J83 A;  4II1 A;  2RK1 A;  3TEE A;  1VQP T;  1MV3 A;  3CCS A;  3C0C A;  1VYV A;  4EIK A;  2DXT A;  3DKM A;  4EMK B;  4IUT A;  1UG1 A;  1BI3 A;  1E6G A;  2R5M A;  4RTT A;  2LX7 A;  2I0N A;  4JDS A;  2LZ6 B;  1U1T A;  3MEV A;  1VQ5 Q;  2E41 A;  5GAN 6;  4PJO F;  2E3H A;  3JB9 I;  5GAN 7;  1Q95 G;  4DBF A;  3GPL A;  2E70 A;  3GP8 A;  5DY9 A;  2M51 A;  4KT0 E;  3I55 Q;  2RJE A;  4OGC A;  2DTH A;  2E4H A;  3CCU Q;  1HD3 A;  2RHZ A;  4C5G A;  3EGX A;  2LTO A;  3OS0 A;  4A4G A;  1QVF P;  2FRW A;  1EFN A;  3G6E A;  5GAN f;  1VQM Q;  1PHT A;  3LGF A;  4QVC A;  3T9N A;  3RUX A;  1OUL A;  4WF2 A;  4RUG A;  2ZPI B;  2D9T A;  5FWB A;  4LXC A;  2JM9 A;  1YJ9 A;  2RQT A;  4BD3 A;  2J6F A;  1Y96 B;  3EG1 A;  2KQW A;  3SFM A;  2KXC A;  3CPW S;  2SRC A;  3M55 A;  3JCM V;  4AT1 B;  2BKD N;  1QWF A;  3OYM A;  1G8X A;  1NJI R;  2MF2 A;  3LWH A;  3CCQ Q;  3MHX A;  1GRI A;  2CUD A;  3CC4 A;  2VXE A;  2XHC A;  1U3O A;  3G4S A;  3BE3 A;  3EGU A;  2X51 A;  1WZO A;  2RQR A;  4YTL A;  1M4Z A;  1VQN T;  2M1H A;  4BE1 A;  1MMD A;  5LJ5 h;  2X9H A;  3A5Z B;  4BAC A;  4D6W A;  2JXB A;  3MP8 A;  3UT1 A;  2FHD A;  1KC8 C;  2MWP A;  2OAU A;  4KRT A;  2DVE A;  1M3C A;  4LD9 K;  4RTZ A;  4NL2 A;  4Q5W A;  2Y90 A;  4M78 A;  1U5S A;  2KYB A;  2JM8 A;  3RDV A;  1T0J A;  2E1H A;  2KVQ G;  2NYS A;  4F7U B;  4LDV A;  4LNP A;  1TH7 A;  3EGD B;  3INZ A;  1RAF B;  1K9M C;  5KE2 A;  3O8V A;  3DB4 A;  3WVD B;  1ZX6 A;  1M2V B;  3PVQ A;  2YUN A;  1TS9 A;  3Q1J A;  3CPW A;  4HVU A;  3HRU A;  3M0P A;  4XTU A;  3TSZ A;  3FB9 A;  2EQK A;  1QVF A;  3EHQ A;  2OTJ Q;  2DET A;  1WXT A;  1NLP C;  2CP7 A;  2MI6 A;  1YJN Q;  4XTY A;  4B9W A;  5LJ3 j;  2KNB B;  1ZA1 B;  3S3N A;  4D8D A;  1JJ2 A;  2EVR A;  1ZBJ A;  2D0N A;  1KD1 U;  1H3Z A;  1OU9 A;  2DZ9 A;  2F2V A;  2KEA A;  4AFZ C;  3CC4 Q;  2Y4Y A;  2EYX A;  4ZN1 A;  4QT7 A;  1GL5 A;  1MND A;  1YIT A;  1PKS A;  5AYF A;  4AG1 C;  5LJ5 e;  4KGX B;  4FT4 A;  3SD4 A;  2EGA A;  1MMG A;  2SEM A;  3NTK A;  2M16 A;  3M0Q A;  4PKC C;  2OTL Q;  1WNL A;  2BE9 B;  2EJG A;  2L3R A;  2VGM A;  3GNG A;  1D1C A;  4M7A C;  3WXM B;  5IAY A;  2RJC A;  1KHI A;  5GAN 5;  2MIO A;  3HP9 A;  1VQL Q;  2CZ7 B;  4CI0 C;  4WCI A;  1ABO A;  2BZX A;  1YJN A;  1I4K 1;  4FYW B;  1AZG B;  3VS1 A;  3FDR A;  2O4X A;  2EPD A;  1K8A U;  1PD1 A;  3I5S A;  4M7D E;  5CAI A;  4C0D C;  2EYY A;  3X20 B;  1M30 A;  2C0T A;  4KUD K;  2XID A;  2LQN A;  1Q7Y C;  3H6Z A;  1VQ4 A;  1K1Z A;  1ZLM A;  1BCO A;  4J9C A;  4M7A G;  2EW3 A;  4QVZ A;  2HQX A;  1M90 R;  2RM4 A;  4Y92 A;  4Y28 E;  3LX7 A;  3CBO A;  1M1K R;  2K2M A;  4RTX A;  3JCM W;  3HTR A;  3QXE B;  1M1F A;  4UC4 A;  3OY9 A;  2L5Q A;  1IHW A;  2HDA A;  5CVI A;  1TOV A;  2EGE A;  3VYG A;  2HNI A;  1WI7 A;  2EJF A;  2P0K A;  3LW5 E;  1I1J A;  2EYW A;  3M54 A;  5KYX B;  1OPL A;  2GGR A;  3HL8 A;  2COW A;  1PC0 A;  4F14 A;  3PVL A;  3FEO A;  1VQN Q;  2O88 A;  1VQ6 Q;  2L8D A;  2VUB A;  4JJC A;  4L59 A;  2HAX A;  5KYW B;  5CKF A;  4J9H A;  4C92 D;  4BI8 B;  1OU8 A;  1KJW A;  4M75 C;  5CKB A;  4IUU A;  1O9S A;  1SRL A;  2YXY A;  1UHC A;  2QQ9 A;  2A36 A;  5KYN A;  1NM7 A;  4ME7 A;  5GAN 8;  1VQ5 T;  5LJ5 g;  1WA7 A;  4DQ2 A;  3CCJ Q;  4M78 D;  4J6W A;  1TUD A;  3JCM e;  2L89 A;  1YJW T;  5I22 A;  2J6O A;  1SKU B;  5I2M A;  2YLC A;  4F04 B;  1VQP Q;  1VUB A;  1PG5 B;  1YIJ T;  5IHI A;  3LWI A;  1CSK A;  2DMO A;  2EIF A;  3TCJ A;  4AFS C;  3CCV Q;  2EGC A;  5FU6 B;  5FRN A;  4DOW A;  4M7A F;  4QVD A;  5L8R E;  4QKU A;  2KK4 A;  4C5H A;  4MZT A;  4LUE A;  3MCA B;  3PE0 A;  2L3Q A;  4PFP A;  2JTF A;  1XOV A;  2LT4 A;  4E2F B;  5GMK h;  1UGP B;  2ZPH B;  3JCM X;  1E7O A;  2DBM A;  1BIA A;  3UPU A;  1YHQ A;  2DK3 A;  4C92 C;  2PVG B;  4J6Y A;  4C92 E;  5IN1 A;  2KRN A;  3MEU A;  1VOM A;  1UUE A;  1MV0 B;  2DLP A;  1D1B A;  3VUB A;  2DIQ A;  2RJF A;  4BI3 A;  3CCM T;  2DRK A;  2P0Q A;  1YFN A;  4LN2 A;  2C0I A;  3OYD A;  2E10 A;  2F2X A;  2QEX Q;  1LOJ A;  2OTL A;  3SEM A;  2RF0 A;  1MMN A;  3NHN A;  2DKG A;  1I5O B;  2XDD A;  2ATC B;  4OB1 B;  4XAX B;  1VQ7 Q;  1PNJ A;  2HKN A;  1D0Z A;  1WHJ A;  3CCR A;  4JUV A;  2E5K A;  5LJ3 g;  1VQK A;  2FPE A;  1SSF A;  2FRY A;  2VYT A;  1VIE A;  2D1X A;  1KK7 A;  3QZ5 B;  5J39 A;  5FRO A;  4J9I A;  2YUO A;  2NLU A;  4LD6 A;  3OYN A;  2JUF A;  2O9V A;  3LGL A;  3OYB A;  1WIE A;  2P0P A;  4E7I A;  3SB2 A;  1WJS A;  3CMA T;  4M7D D;  4AFU C;  2F1L A;  2NUT B;  4M78 B;  4C92 A;  3M58 A;  1UGQ B;  3M0U A;  2GTO A;  3S3O A;  4CRI A;  2FL7 A;  3UDC A;  2RMO A;  3HPW A;  4JJN K;  4X1V A;  2KSS A;  3X26 B;  1Q81 C;  1YHQ T;  2K5I A;  2CH4 W;  2QA4 A;  3OA6 A;  1VYU A;  1M90 C;  4FW2 A;  5LJ5 d;  3UWN A;  2E6N A;  1K0X A;  2XK0 A;  5KCO A;  2RQU A;  3OYG A;  5HKC A;  2LDM A;  3A1P A;  1G3W A;  4BUG A;  2ZCF B;  2A0F B;  1V1C A;  3QDR B;  3I55 A;  4DBR A;  3GIB A;  4AMC A;  4IIO A;  1YIT T;  2CSQ A;  3G71 A;  2M0Y A;  1OPK A;  3H8Z A;  1GCQ A;  1X6B A;  4KBM B;  3CME T;  1I8F A;  2W0Z A;  8ATC B;  2E5Q A;  2RA2 A;  2DNU A;  1AWJ A;  1VQ8 A;  1YI2 T;  3M0R A;  5FU7 C;  3JCM J;  5M9O A;  1VQ9 T;  2K3B A;  3TVT A;  1G83 A;  2OI3 A;  2EJ9 A;  1C1A A;  1TWB A;  2GBQ A;  1QVG A;  5CR2 A;  2DL4 A;  5CKD A;  2E64 A;  2RI3 A;  1MMA A;  2YDL A;  1Q82 R;  2H3J A;  3CME Q;  2LJ0 A;  1JJ2 P;  3G1J A;  1SRM A;  1FX7 A;  5A0D A;  2YRV A;  1BU1 A;  2CP3 A;  3JCM g;  2VGN A;  4FCY A;  2JVV A;  2VXF A;  4X34 A;  1X01 A;  4XTZ A;  1BBZ A;  1MGQ A;  4DOV A;  1AWX A;  4JJD A;  1K76 A;  3F70 A;  4HT9 A;  1PRL C;  5LL6 S;  3ASK A;  4IUP A;  3QZ9 B;  3G7Z A;  1ARK A;  3C12 A;  3OYK A;  3GF5 A;  2ZZD A;  1RAH B;  4JZ4 A;  2QQR A;  2RJD A;  4J7F A;  5GAM e;  1NLO C;  1VQ7 T;  2COZ A;  3NTH A;  2DRM A;  2AK5 A;  3SHW A;  4ELY C;  1PD0 A;  1IHV A;  1ZQ1 A;  1VQL T;  2DYB A;  2DD4 A;  2QXF A;  3BFM A;  1QLY A;  2O2O A;  2NUT A;  4BE2 A;  4MZM A;  4C8Q B;  4PJM A;  3CXC P;  2DL3 A;  2FPD A;  2KY9 A;  2QK0 A;  2ZPB B;  2JW4 A;  3RKY A;  4M77 D;  1RUW A;  3CCE A;  2EKH A;  4A4E A;  1IZ6 A;  3E9F A;  2V1R A;  5J3B A;  4XU1 A;  1NYG A;  4Z88 A;  1NBE B;  2ZAE A;  4OMM A;  4B9X A;  3CME A;  1CKA A;  1OX8 A;  3M5A A;  5GAO n;  5GAM g;  4A63 B;  1TG0 A;  3RMQ A;  2ZPE B;  3KFV A;  2HL5 C;  1IXD A;  4OMQ A;  1QP3 A;  3QPH A;  2CGH A;  2YUP A;  1CKB A;  2JJ9 A;  3G71 Q;  1QW1 A;  4N0A A;  2K4Y A;  2IVW A;  2J6K A;  4O5V A;  2K79 A;  3QDF A;  4ZNX A;  3V7S A;  1QMC A;  4WTO B;  1P92 A;  3QSU A;  3E2U A;  3HSB A;  4C5E A;  3EG9 B;  1JEG A;  4N4I A;  2L0A A;  4RG2 A;  4C92 B;  3HHT B;  1AD5 A;  4M78 E;  2EQJ A;  3RIR A;  3OB9 A;  4JLG A;  4RCC A;  3OYH A;  3FC3 A;  1VQK Q;  1ABQ A;  1ZSZ A;  1JU5 C;  4GY5 A;  3CC2 Q;  4BDZ A;  2K9G A;  5C6S A;  1Q86 R;  5IXB A;  2X4Y A;  1AWW A;  2DF6 A;  2I2L A;  4M75 G;  2R5A A;  1R77 A;  5CCA A;  3ZEH A;  4FSS A;  3CPF A;  2RHI A;  3OBW A;  2CZ0 B;  1I0C A;  5GAO p;  1HK9 A;  3HKS A;  2ECZ A;  5GMK i;  1UEB A;  4J9G A;  3J80 E;  2FZG B;  3BY7 A;  1VQ4 Q;  3CCM Q;  5FW9 A;  2FEI A;  2ESW A;  1NJI U;  2MYS A;  3CD6 Q;  1VQ9 A;  5KH6 A;  1OQK A;  2DO3 A;  4R56 A;  1RAE B;  5GAO r;  2FYK A;  1FMV A;  4FT2 A;  4PK4 A;  4E7J A;  1N27 A;  2KMT A;  5KYX A;  2VVK A;  1X6O A;  4X9D A;  1TSF A;  1WJR A;  5CO7 A;  3TRE A;  2FZC B;  3LLR A;  2K5F A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  1ZSZ B;  1YFN A;  1OU8 A;  1OU9 A;  1ZSZ A;  1ZSZ C;  2QAZ A;  1TWB A;  2QAS A;  1OX9 A;  2NYS A;  1OUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...