1OULA

Structure of the aaa+ protease delivery protein sspb
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYDELNIEPDTEQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 25
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1oulA00
2QASA 1TWBA 1ZSZA 1OX9A 1ZSZB 1OU9A 1YFNA 1OULA 1OU8A 2QAZA 2NYSA 1ZSZC 1OX8A
chains in the Genus database with same CATH superfamily
5GANj 3PT9A 4QVDA 2P84A 4QT7A 4BE0A 1YJNQ 3I55A 4XU2A 3OYMA 3CCUT 2DVJA 2DYIA 2O9VA 2HL3A 1QQJA 4XU3A 5IHNA 3CCQQ 4L5GA 2QA4Q 1KHIA 2O01E 2R57A 1GCQC 4C5EA 1VYUA 1KD1C 3CCJT 4IIOA 1H3HA 3OMGA 2KVQG 2K57A 3HRTA 5L23A 1X69A 1XJWB 3G6EQ 2DO3A 2AKKA 1TUDA 1GL5A 4UC4A 2E64A 1N5ZA 1M1KU 2AKLA 4AFSC 3P8DA 2MWPA 1W70A 1TSFA 4J9IA 2CT3A 1QVGA 4PJOB 3EGXB 9ATCB 2EYQA 2ENMA 5LJ5f 1E7OA 1M27C 2DPPB 2RJCA 2XDPA 1X2QA 4B9WA 4A54A 3DB4A 4DOVA 4FSXA 1I5LA 2BKDN 4PJJA 1KJWA 1NLOC 2GTJA 4OMPA 1ZSGA 4HCZA 4XK8E 2OTJQ 1VUBA 4BI4A 1AT1B 1YITA 1MHNA 3JCMf 1AEYA 3PFSA 1HYOA 1RI0A 1EIFA 1YJ9T 1MNDA 5L8RE 3OYJA 1VQ6T 2FG0A 4XTZA 1NYFA 2RB6A 2RMOA 4M77E 2QQBA 1WJRA 1BB9A 4N0AC 2RI3A 5GANh 3SEMA 2FPEA 2XKOC 4F7UE 2CP7A 4AFQC 1H3ZA 3E19A 1YWPA 2X4YA 2CUDA 2M0OA 1WHLA 4X9DA 1YITQ 2PU9B 2DTIA 2QI2A 1H8KA 3TSZA 2L3SA 2L3RA 1X75C 2MYSA 2QASA 2FHDA 4CRIA 2V8KA 4MMKA 1E6HA 1M5Q1 4GLKA 1TU0B 2AT1B 3VRZA 1LJOA 1WHKA 4RTVA 1KQSS 1I8FA 2FPFA 5LJ5e 3CD6A 5HKCA 3FJ5A 1M1GA 2K3BA 4FW1A 3CPWA 2GCXA 4M7DA 3OW2A 2NUZA 4RTYA 1VQOT 1WPYA 3THKA 1UGVA 2PZ1A 1YHQT 4D8KA 2ED0A 2X4WA 1MV0B 3LH5A 2QGGA 2E70A 2JNGA 2HL5C 3QYGB 1IXDA 4PJOC 1AZEA 3SB2A 2KI7A 1NEGA 2KT1A 1X01A 4PFPA 1X6BA 1SKUB 2IG0A 2EQJA 2GTOA 2DNUA 4JDSA 3QIIA 2KE9A 2KQWA 4X1VA 2IVWA 5GAMj 1H641 2AIRB 2DTHA 4KBMB 3P8HA 2DYBA 5GAOp 2DRKA 2QGFB 1M1KR 4M7AA 2QDYB 2EKHA 5CVIA 2KMTA 1QWEA 3OMCA 3CCRQ 1UUEA 3WVDB 1K0XA 1HXDA 2DXCA 2RI5A 1VQKA 2GQIA 4FIBA 3L2QA 2LJ0A 1VIEA 2YRCA 3OB9A 2J6FA 2JJ9A 1WX6A 1M90U 3QSUA 1B07A 1AHJB 5LJ3g 3MEUA 3KXTA 3CBOA 3G4ST 2BE9B 1VQMQ 3UDCA 4DQ2A 4E47A 3G71T 4M78G 1Q95G 2DXTA 2MAMA 5IHKA 1K9MU 1QVFS 4BE1A 3MKDA 1MMNA 2WSEE 4PL6A 3SWNA 1DJ7B 4Z88A 1FX7A 1SG5A 5ECAA 2DTOA 2ECZA 1LPLA 3V8KA 2BTTA 2J6OA 1K1ZA 3CCSQ 1W4SA 4HVVA 3I56A 2YUQA 5GAN3 3CCLA 2RO0A 1PD1A 5HK0A 1VQNQ 1K8AC 3KUFA 4MZMA 2P0QA 1AZGB 1ABOA 2KEAA 4OGEA 2E41A 1Q7YC 4PFOA 2L2PA 2RH2A 4DBRA 1YJNT 5GAMh 1D09B 5EG2A 3UWNA 2DL7A 4A4GA 3MP6A 2DFUA 2DEUA 2LQNA 3OYYA 2P4TA 2RK1A 4IIMA 4F04B 3E9FA 2ZPEB 3CCQT 2F2XA 2JS0A 2QA4T 3CPFA 4CC2A 2LT1A 2D6FA 2EYWA 3CC4A 3N5BB 2MK5A 2HBPA 3MP8A 1MV3A 3JCMV 1U1SA 2AHJB 3I55T 2COZA 4BD3A 5HCKA 2DVEA 1JU5C 4LNPA 5IHIA 2DZCA 1OX8A 1PG5B 1Z9ZA 1NJIC 1KQSA 2OI3A 1ZA1B 1VQ8Q 4N0AA 4DBQA 1IB8A 3EG3A 2RQUA 1PKTA 3CCUQ 4FYYB 1TH7A 4J9EA 1IHVA 2O4XA 1IRXA 2GFUA 4J6YA 3QUIA 1I1JA 4Q5WA 3CCJQ 2OAUA 1YN8A 1WFWA 2ZPGB 3CMEA 3OA6A 4J5YA 4ZGDB 1NM7A 1WXTA 1M90R 1UGSB 2ROLA 2AZVA 3H0IA 4OB2B 2C06A 4C92B 5FRNA 1NJIU 3DLMA 3OBWA 4F7UF 2RA2A 1K9MR 3CC2A 3RDVA 3RKWA 5GAMe 2KYBA 1NG2A 2PQWA 1YITT 4NOYA 5CCAA 2M16A 1D0ZA 4RG8A 2DILA 3R6OA 3FRNA 4JRKA 4XTWA 4PJOA 3EGXA 2EW3A 4M7AE 7AT1B 1S72A 1ZHIA 2BE7D 5CO7A 1UB4A 1VQLQ 2DL4A 4OMFB 1QVFA 2HZYA 2D8JA 1SRLA 5GAOr 4M7DB 1YJ9Q 1Q81U 3M0UA 5KYUB 2LZ6B 3LGFA 1VQ6Q 1UG1A 1WHMA 4C8QD 4IURA 4M75B 3JCMP 4ANJA 5IXBA 1JXMA 1N6AA 3E9GA 1YCSB 5GMKj 1EX4A 3C94A 2EKOA 4LE9A 3J81E 4KH1B 2K6DA 2CP3A 2MOXA 2GNCA 1MMGA 3SDZA 4RTXA 4LDXA 2QQAA 3CCVA 1PC0A 2FZKB 2LVMA 2E3IA 3FB9A 5CK9A 1JO8A 2RHZA 3CD6T 2K79A 2YLCA 1Z9QA 2M51A 4HT8A 1KIKA 3I9QA 5GAN5 2CP6A 1G8XA 1U1TA 2D9TA 2HCKA 5D7UA 3I5SA 5GMKi 4J8OA 4BACA 2DIGA 1YJWA 3NGPA 3CBMA 1NBEB 2CZ7B 2B8AA 3TU4K 4EIKA 4FL6A 4FT2A 3JCMQ 3GNGA 1AWXA 4M77D 4KT0E 1Y96B 3EAEA 4F16A 4OB0B 2LCCA 3BFMA 2LRQA 1ZSZB 1KC8C 1WXBA 1LVKA 1YHQQ 2RJEA 3L2WA 2EBPA 2X4JA 3OBYA 2EWNA 3HRUA 3CC7Q 1G3YA 4DOWA 1VYVA 3GOXA 1RLPC 1N8RU 2MIOA 1M30A 2Y4YA 4MZTA 3HL8A 3EGDB 1U8RA 2LQWA 4X9CA 2DL5A 4JLGA 4NL2A 3LX7A 1XQHA 1QMCA 3M5AA 2DJQA 4J9DA 4M7DC 3QWYA 3OYNA 1X43A 2DXBA 1K73C 4FU6A 1KC8U 1XTDA 1M3CA 5GMKh 1K76A 1OI1A 2E65A 3UATA 4OF1A 3KBGA 1M2OA 4M75C 4B6MA 4QW2A 2E1HA 1FYNA 3NPFA 4XTYA 1ZUUA 3CEYA 2F1LA 4KULA 2RI2A 4J7IA 2NWMA 1UEBA 1P92A 2QG9B 1N27A 5LJ3f 5CKHA 2OTLQ 4KUIA 3I56T 1R0CB 2VWFA 5DY9A 3QWXX 4M7AC 3EFRA 2LJ1A 2ZPHB 1Q81R 4OMLA 1OV3A 1SSHA 3VYGA 3CMAA 3V7CA 2P0KA 4ESRA 3VU3C 2O88A 4PNOA 3MCAB 3SFMA 4ELZC 2ROTA 5CQXA 2PTKA 3S3MA 4D8DA 2RPNA 3EH1A 4XTUA 2AZSA 1ABQA 1OPLA 2DMOA 1ZSZC 2E5KA 3FJPA 5KYYB 4JRQA 3RIRA 2VGMA 1B34A 2DF6A 3R6NA 2ESWA 3VUZA 1ACMB 4OVAA 6AT1B 3J7AF 2X51A 3SWNC 2YUOA 3CC4T 4PJOE 1QP2A 4YTLA 2V8IA 1IGQA 3ZFJA 3LGLA 2JZ2A 1K4US 2DA9A 3H41A 2PVOB 1RL2A 1VQPQ 1IGUA 2HEQA 3L1AA 3LWHA 2HAXA 1M1FA 2MI6A 2EIFA 4XU1A 4RTZA 3VS5A 2K3YA 1KQ2A 1G2BA 2QQRA 4LDYA 1QVGP 3I55Q 5LJ3e 3T9NA 2KGTA 1I81A 3S3NA 1XNIA 1TS9A 1RUWA 2SEMA 3HHTB 2CUBA 5D6XA 1N8RR 3SHWA 1RABB 1RADB 2JTEA 3LW5E 3QZ9B 3CMET 2XMFA 1VQ5A 1Y71A 5M9OA 3WXMB 2ZZDA 1KD1U 3BDUA 1HK9A 1NZ9A 2QEXA 4M7AF 4JRPA 2E10A 3JB9D 3MEWA 1Q86C 3X20B 1VQLT 2K2VA 1ZUYA 3HPWA 1OYXA 4ZTFA 1D0XA 3MEAA 2Y90A 2I2LA 2K2MA 1YIJA 4PFZA 2IPOB 2RK2A 4C0DC 1QCOA 4J9GA 1VQ5Q 4A63B 5GAN6 2M9UA 1BIAA 2X9HA 5LL6S 1SPKA 2LT4A 4AFUC 1GFDA 2HMAA 2CH4W 2R5AA 1S72T 4ATOA 4RG2A 4C92A 5GANf 4C8QB 2GGRA 5AYFA 2QAZA 4HA8A 1ZX6A 4MDWA 4C8QG 4XTVA 1C6VX 4VUBA 3QJ6A 5GAOq 3CPWP 1WNLA 3OW2P 3RR6A 3QDRB 1YCYA 3V8JA 2BUDA 1LOJA 1PCXA 3C4SA 8AT1B 4L6V5 2KBTA 4BE2A 3PTAA 3OS2A 3QG1A 4JS5A 4EMGA 1UGRB 2K5IA 5KYUA 1UGPB 2Z0WA 2DBKA 2QTXA 1VQ7A 2QXFA 3JB9J 4OP0A 4M75A 3CC7T 2F69A 1V1CA 1YJWT 1G3WA 1WHHA 2C0TA 1ZA2B 5GAN8 1V76A 2EGEA 1VQ4A 3TEEA 2A3LA 3CD6Q 1WA7A 1SEMA 2LDMA 2KRMA 4M77G 1OU8A 2KXCA 2FZGB 2HKQB 1TUGB 2A7YA 5I2MA 4F7UG 4Z8AA 4NS5A 5J39A 2V1QA 3D7SB 5GANe 3REBB 2HQEA 3FEOA 1KK7A 1QVPA 1QCFA 3VV0A 2YT6A 4ELYC 2J6KA 1WQWA 1KSWA 1JEGA 3RMSA 4RCCA 2E12A 1BCOA 4M78B 4BI8B 4QVCA 1KFZA 3CCEA 5D6WA 1JXOA 1RAAB 3TSWA 1Y96A 4ZGEB 1X6OA 1KD1R 1WHJA 2GFAA 1ZSZA 4EMHA 3H8ZA 1N9SA 2H8HA 3OS0A 2OTLT 3HFNA 2O31A 4J9CA 4JJNK 3LYIA 1VQKQ 1TWBA 1CKBA 3FIFA 5GAOm 3HKSA 3EH2A 1PWTA 3X24B 4PJLA 2GF7A 1D1AA 3MJXA 2XI9A 1SSFA 3EGDA 1B34B 3LH0A 1QCNA 2XICA 4O5VA 2RHXA 2QK0A 2Y4XA 1JJ2S 3PGGA 2COWA 1D3BB 1UE9A 5CAIA 4GBQA 4KUDK 2LTOA 4OMMA 1YI2A 1X27A 4PJOF 5DLOA 2XIDA 2EQIA 3UPUA 3U23A 2ED1A 3I56Q 5A0LA 2FZCB 2QYZA 2ZPBB 1TUCA 3CCLQ 3QHSA 4C0GA 1VQPT 3A98A 1G3SA 5GAMf 3J80E 4FSSA 3M57A 4DEYA 4ZTJA 1BI0A 3UT1A 1Q82C 1T3SA 1UHFA 4BDYA 4BY6B 4FYXB 1K8AU 2A37A 1QWFA 4DBHA 4Z02A 2GBQA 3M0TA 2VUBA 2DL8A 1PRLC 3JCMb 3CCMA 2CH4A 4IKFA 4C92E 2KROA 4M78C 1I0CA 1RI9A 1Q7YU 2P0PA 5D6YA 3PIOA 3M0QA 2CP0A 1F1BB 2CP5A 2FRWA 1R0BG 3CC4Q 5KYYA 1PD0A 3GPLA 4L59A 5KE3A 2SRCA 4XU0A 4LD6A 4EMKB 2FVUA 3FLGA 2E5QA 1WYXA 4HKEA 1IHWA 1Q82U 3PIPA 1WI7A 2QTVA 5LJ5d 1BU1A 1UTIA 2XDDA 2RQWA 3M0PA 2K9GA 1OOTA 3VUBA 1I07A 4M7DE 1U06A 2XHCA 4LUDA 3JCMg 1T0HA 2KYMA 1VQ5T 3PNWC 3NTKA 2JOYA 4M75E 3BY7A 3EG9B 3JCMd 2G6FX 2EVRA 5KE2A 3JB9G 1MNEA 3BE3A 3Q1JA 3CMEQ 4PJOD 1TXQA 5A2QE 3GP8A 4E7ZA 1M3BA 2V26A 2R58A 4N4HA 1YIJT 5GAOl 3RUXA 2PVDB 3A5ZB 1JQQA 1X2KA 2K3XA 3A8LB 3E1SA 3CC2Q 1R77A 2DAQA 4IUVA 2PVGB 2JTMA 1X6GA 2M0YA 3V7SA 3JAME 4C5IA 4BY6C 1ARKA 2F5KA 4RUGA 3ZBDA 4ZNXA 1VA7A 2KRSA 1WGSA 3OS5A 1S72Q 3M58A 4E2FB 3EG1A 4IUUA 3VYHB 1WJQA 2DX1A 1WLPB 2D0QB 3JB9I 4E7HA 1W2BS 2RHYA 1ZUKA 4O6JA 1JJ2A 1OQKA 4NL3A 3DB3A 1OPKA 3PMTA 3EFOB 4EMKC 2NYSA 4C8QA 2M1HA 3OYHA 2EYYA 1FXXA 1SHFA 1K8AR 2CKKA 4BB7A 3RESA 3HRSA 1NPRA 2WACA 1IREB 5CIUA 1VQ7T 1Q7YR 3BDLA 4PJMA 3CCVQ 4KRTA 1GBQA 3X28B 3E2UA 1K0SA 2YHTA 4ME7A 1VQ4T 2WSCE 3OY9A 4GY5A 4C92C 1I5OB 2DJZA 4LDVA 5KCHA 1WIEA 4HVUA 4F14A 2DRMA 4ZN1A 4J9BA 1YJWQ 2HBWA 3VS3A 2V8JA 4A4FA 1BKBA 3F70A 2EQMA 1QP3A 1U5SA 2D0NA 2E4HA 3MP1A 3PVQA 2ZCFB 2GQVA 3QYHB 1VQKT 4M77A 3C12A 1KG1A 2OX7A 3RKYA 3I5RA 2BZXA 3DKMA 3MO8A 1NJIR 2JM9A 2RJFA 3JCMJ 4OMQA 3OYDA 1M2VA 1Y7XA 2I0NA 2MMPA 5A0GA 3G4SA 1YNZA 3CXCP 1ZLMA 3G71A 5FU7B 2VC8A 3M54A 4XQ3A 1C0MA 4M78A 4A53A 2CGHA 3VS4A 2WSFE 3GBQA 2DIQA 2L0AA 2XD0A 1BK2A 2RQRA 3CCLT 1AWJA 2LNHB 2MCNA 4OB1B 3HFOA 1E6GA 1K73U 2CS7A 2HNIA 5LJ5j 3A8HB 1YI2T 2LQ8A 2JMAA 1FWZA 4E7KA 4KH0B 2RN8A 4JLIA 1MUZA 4EDUA 5GAN2 1W6XA 4JUVA 4JRIA 2LX9A 4C92F 1J3TA 1Y0MA 1U3OA 2KT8A 2DK3A 5KYXB 4IUQA 3JB9H 5KH6A 3CMAQ 1WQ7A 1RACB 1YJNA 2EYZA 3A8MB 2NUPB 1OZ3A 3OS1A 2JVVA 3S6WA 1RAHB 3L2RA 4IUPA 3H6ZA 1D3BA 3CCQA 2JM8A 2FRYA 5GAN7 5C0MA 4E7JA 4C0ZA 3GNFB 1SRMA 1JBMA 4J83A 4A4KA 4AT1B 1M1KC 3CCMT 4HT9A 3PVLA 5FW9A 1W2BA 2NLUA 2YWWA 1KHCA 4J9FA 3HSBA 1BI2A 2XDBA 1BIBA 3G6EA 5GMKe 3OYAA 3RKXA 3QXEB 4E7SA 3M9QA 4M7DF 3QKJA 4RTWA 3OYLA 3P8BB 1G5VA 2X3WD 3QDFA 4ORZA 2L8DA 2OJ2A 3GF5A 4J9HA 4IUTA 4M75F 4QQ6A 2KR3A 4BDZA 3JV3A 1PM3A 2JW4A 1YBYA 2EAYA 1AVZC 5FU7C 3L2VA 2P4RA 2CZ6B 1D1BA 4GLMA 1UHCA 4C8QE 1IO6A 2PUOB 1PKSA 3GIBA 2OTJA 2RNAA 5LJ5h 4R55A 2YRDA 4JPBW 2ZAEA 1KC8R 2EPDA 3CC2T 4FYWB 2EJ9A 4EMKA 4BUGA 2FL7A 4FM4B 1VOMA 4HCBA 4LUEA 3JCMh 2QQ9A 1SHGA 2FYKA 2YLBA 4PJOG 2FB7A 1D0YA 2VB6A 4F17A 2EJGA 1YWOA 4C92D 1K9AA 2QEXQ 2X35A 3A8GB 1H92A 2CZ0B 4Y92A 5AT1B 1G3TA 3HTRA 3S3OA 2KDSA 2MWOA 2O9SA 1UDLA 3H0FA 1CSKA 4OMOA 1C1AA 2LCLA 3EG9A 3MHXA 4CI0C 2QQSA 3SD4A 1K73R 2K7AA 4LDUA 1YIJQ 1QW1A 4OMNA 4B9XA 2YXYA 5DLQE 3PMIA 1Q86U 3RNJA 1CKAA 1AOJA 2KY9A 3ULRB 2JUFA 4XAXB 4MMLA 2EJFA 4PK4A 4MZPA 2HQHA 5HK3A 3VS0A 2EGCA 3L2ZA 2W10A 4M7DD 4EPCA 2RQVA 3CCVT 2JXBA 5EC7A 1GFCA 5CR2A 2V1RA 2LMJA 4M75D 1W1FA 1V29B 4K11A 2CZ1B 3JSCA 3EFSA 1HSQA 3UA7A 3OSSC 2LC4A 4M78E 3O8VA 2DETA 3QJYA 4FCYA 1MGQA 4M77B 1QKXA 3EHQA 3C0CA 3OYFA 3NHNA 3RMQA 5FU6B 1BI1A 4F7UB 4MDXA 4PLIA 2LX7A 4V2SA 1TTHB 4M7AD 1UJYA 2F5TX 1PSEA 1M3AA 4J6XA 1M2VB 1SF9A 2J05A 2EGAA 4Y91A 3JCMe 1M90C 1NYGA 1PRMC 3CCRA 3NMZC 1VQ7Q 3EFOA 2A0FB 1UJ0A 3EHRA 3FC3A 2E6NA 2JN0A 2LP5A 3PE0A 2IIMA 3QZ5B 4Y28E 1OEBA 1K9MC 1VQ4Q 2JMCA 2CREA 2L3QA 1XOVA 2F2VA 4AFZC 5FLXE 3M4GA 2LNVA 2PUKB 1VQMA 3WVEB 1ZBJA 5GMKm 4HXJA 2CDTA 4PJNA 4D6WA 1FMKA 2W0ZA 3VS6A 3GLXA 4Z89A 3V8LA 4C8QC 1T0JA 5HY6A 1HJDA 3ASKA 5GJVB 3JRZA 4WF2A 1GBRA 2NUTB 2HSEB 3BW1A 2D8HA 2MPXC 4RMOA 1O9SA 1WJSA 1AWWA 1PSFA 3VS1A 1BYMA 3AT1B 2EQKA 4WCIA 3CCEQ 4AG1C 3CCSA 3TQ7P 2DBMA 5KYWB 2VXEA 4JZ3A 5LJ3d 2YUPA 1OU9A 3JCMW 2C0OA 3VS7A 1VQNA 1G83A 4CC7A 2X3XD 3EGUA 1BCMA 2L3PA 2F2WA 5FROA 1YFNA 1UGQB 2R5MA 3CMAT 4FT4A 1OULA 1Q86R 1VIFA 1GRIA 1FMWA 1GCQA 4M77C 3CBPA 3X26B 2VYTA 5I22A 1GCPA 2FPDA 3L2UA 1ZBXA 5FU6C 3TREA 4RTUA 2COYA 3FDRA 2PNIA 2KK4A 2M02A 3JCMX 2YRVA 3QBYA 5IN1A 2B86A 4RTTA 1LNXA 3V7RA 2YSQA 3NFCA 3MPUB 4XTXA 4E6RA 1KQSP 2C0IA 2HDAA 1YI2Q 3A8OB 1N9RA 2CSIA 1VQ9A 3I35A 2X4XA 4DA4A 2K5FA 2KAFA 1VQ8A 4ZGJB 4C5GA 4C5HA 1NLPC 3CCUA 2ZPIB 1RAIB 1M8VA 3G6ET 3EG0A 2DEQA 4C8QF 2XG8D 5KYXA 1KQ1A 1VYTA 4E7IA 1D1CA 4DEXA 1NEBA 2FO0A 1EFNA 3VJPA 3CQTA 1R8OB 3CCJA 5LJ5g 2NUPA 1VQ9Q 3CCMQ 2YUNA 2E6ZA 2RM4A 4RKUE 4KGXB 5CKFA 4BI3A 4R56A 4A4HA 3X25B 3M56A 4TVRA 3KFVA 5IH2A 1WHGA 1M8MA 3TCJA 3UA6A 5IAYA 2EQUA 1WXUA 1GXIE 2HKNA 3M59A 5GMKl 2OTJT 5KYNA 2QEXT 3OYBA 2RHIA 3VS2A 2DD4A 1QKWA 3LLRA 4A4EA 4X34A 2EYXA 1NE8A 3QPHA 2BZYA 2DXUA 4PLLA 1Y57A 1O75A 2E3HA 4M77F 2J7IA 1QVFP 4JJDA 2D1XA 3M53A 8ATCB 1Q81C 4FW2A 2RHUA 2DKGA 5GANg 1RLQC 5CKBA 1AWOA 5IXFA 1VQLA 3OQ5A 1M9SA 4E7LA 4LD9K 1UFFA 3META 4HCKA 2AK5A 3ME9A 5GANd 3CXCS 3RERA 4C92G 1YJ9A 4HVWA 2KXDA 2ABLA 1VQ6A 2QDLA 2VXFA 2DLPA 4JJBA 4PKCC 2YDLA 1YP5A 4HCCA 2L5QA 5GAN4 2XU8A 4QQDA 5KCOA 2DERA 2MF2A 2RD1A 3ER0A 3QO3A 3JCMc 5FWCA 1JJ2P 1FMVA 1RAFB 4M78F 4OB3B 4ZN3A 4OGCA 1NPPA 5DM7R 3NTIA 2JT4A 2KNBB 2LQKA 3C95A 4LN2A 4LDWA 5C6SA 1B3QA 1T3LA 2H3EB 2A36A 2CYZB 3H0HA 4M7DG 1PHTA 5I21A 2DM1A 2RF0A 4AG2C 4JZ4A 1PNJA 2JTFA 3INZA 4M75G 1OX9A 1ZQ1A 1B7TA 1QLYA 2K4YA 5LJ3j 2OAWA 3OYIA 2KSSA 1EZZB 2K5LA 3M0SA 4M7AB 4C0FA 1VQOA 4JJCA 1YHQA 3OYKA 1LCKA 1WDXA 4AMCA 1N8RC 2CSQA 1RAEB 1OZ2A 2H3JA 5FRMA 5CKEA 3CC7A 1MMDA 1TOVA 4II1A 5GAOn 2A28A 4M7AG 3MEVA 3M55A 1IZ6A 5CKDA 3DLLA 3HP9A 3CCRT 3TVTA 1TG0A 1QVGS 1BI3A 1Q82R 2HD0A 4J6WA 2VGNA 4QKUA 2VKNA 2CT4A 4WTOB 3IQLA 1VQOQ 2DL3A 2BZ8A 3CCET 3G1JA 4KGVB 1M4ZA 4F7UA 3SWNB 2DD5A 1VQMT 3ZEHA 2LCSA 3NTHA 1MMAA 3G7ZA 3OYCA 4JS4A 3M4YA 1I4K1 4RCBA 2CP2A 4N4GA 2JS2A 1JRIA 2HSPA 4M78D 2DE0X 1A0NB 2BIVA 3VRYA 3EG2A 3CCST 2L89A 2OTLA 2HQXA 5J26A 3O5ZA 1VQNT 4CC3A 4R0KA 3RBBB 2A08A 3OSVA 1UECA 5LJ3h 2XK0A 4DBFA 3L42A 4FYVB 2O2OA 3G4SQ 2EFIA 4CC4B 5CQYA 2NUTA 5IT9E 1RAGB 2RJDA 3UF4A 3G71Q 3LWIA 3VKIA 2LJ3A 4J7FA 4M4ZA 3URGA 5A0DA 5GAMg 2ZPFB 3OYGA 3AHUA 2VASA 1AD5A 1S1NA 4QVZA 4KGZB 3CXCA 3OYEA 5KYWA 5GAMd 3M0RA 3JB9F 5FWBA 2J06A 3CPWS 1WZOA 1HD3A 5GJWB 2ATCB 1Y07A 2G3RA 2FEIA 3OW2S 5I11A 2VV5A 1BBZA 3H9NA 1W2BP 2VVKA 4LXCA 4C0DB 4P5NA 3REAB 2ZGWA 2RQTA 1JB0E 1VQPA 2QA4A 5J3BA 3A1PA 5I2SA 4QQGA 2KRNA 3ZL7C 4N4IA 1VQ9T 2DZ9A 2O4XB 1VQ8T
chains in the Genus database with same CATH topology
2QASA 1TWBA 1ZSZA 1OX9A 1ZSZB 1OU9A 1YFNA 1OULA 1OU8A 2QAZA 2NYSA 1ZSZC 1OX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAS A;  1TWB A;  1ZSZ A;  1OX9 A;  1ZSZ B;  1OU9 A;  1YFN A;  1OUL A;  1OU8 A;  2QAZ A;  2NYS A;  1ZSZ C;  1OX8 A; 
#chains in the Genus database with same CATH topology
 5GAN j;  3PT9 A;  4QVD A;  2P84 A;  4QT7 A;  4BE0 A;  1YJN Q;  3I55 A;  4XU2 A;  3OYM A;  3CCU T;  2DVJ A;  2DYI A;  2O9V A;  2HL3 A;  1QQJ A;  4XU3 A;  5IHN A;  3CCQ Q;  4L5G A;  2QA4 Q;  1KHI A;  2O01 E;  2R57 A;  1GCQ C;  4C5E A;  1VYU A;  1KD1 C;  3CCJ T;  4IIO A;  1H3H A;  3OMG A;  2KVQ G;  2K57 A;  3HRT A;  5L23 A;  1X69 A;  1XJW B;  3G6E Q;  2DO3 A;  2AKK A;  1TUD A;  1GL5 A;  4UC4 A;  2E64 A;  1N5Z A;  1M1K U;  2AKL A;  4AFS C;  3P8D A;  2MWP A;  1W70 A;  1TSF A;  4J9I A;  2CT3 A;  1QVG A;  4PJO B;  3EGX B;  9ATC B;  2EYQ A;  2ENM A;  5LJ5 f;  1E7O A;  1M27 C;  2DPP B;  2RJC A;  2XDP A;  1X2Q A;  4B9W A;  4A54 A;  3DB4 A;  4DOV A;  4FSX A;  1I5L A;  2BKD N;  4PJJ A;  1KJW A;  1NLO C;  2GTJ A;  4OMP A;  1ZSG A;  4HCZ A;  4XK8 E;  2OTJ Q;  1VUB A;  4BI4 A;  1AT1 B;  1YIT A;  1MHN A;  3JCM f;  1AEY A;  3PFS A;  1HYO A;  1RI0 A;  1EIF A;  1YJ9 T;  1MND A;  5L8R E;  3OYJ A;  1VQ6 T;  2FG0 A;  4XTZ A;  1NYF A;  2RB6 A;  2RMO A;  4M77 E;  2QQB A;  1WJR A;  1BB9 A;  4N0A C;  2RI3 A;  5GAN h;  3SEM A;  2FPE A;  2XKO C;  4F7U E;  2CP7 A;  4AFQ C;  1H3Z A;  3E19 A;  1YWP A;  2X4Y A;  2CUD A;  2M0O A;  1WHL A;  4X9D A;  1YIT Q;  2PU9 B;  2DTI A;  2QI2 A;  1H8K A;  3TSZ A;  2L3S A;  2L3R A;  1X75 C;  2MYS A;  2QAS A;  2FHD A;  4CRI A;  2V8K A;  4MMK A;  1E6H A;  1M5Q 1;  4GLK A;  1TU0 B;  2AT1 B;  3VRZ A;  1LJO A;  1WHK A;  4RTV A;  1KQS S;  1I8F A;  2FPF A;  5LJ5 e;  3CD6 A;  5HKC A;  3FJ5 A;  1M1G A;  2K3B A;  4FW1 A;  3CPW A;  2GCX A;  4M7D A;  3OW2 A;  2NUZ A;  4RTY A;  1VQO T;  1WPY A;  3THK A;  1UGV A;  2PZ1 A;  1YHQ T;  4D8K A;  2ED0 A;  2X4W A;  1MV0 B;  3LH5 A;  2QGG A;  2E70 A;  2JNG A;  2HL5 C;  3QYG B;  1IXD A;  4PJO C;  1AZE A;  3SB2 A;  2KI7 A;  1NEG A;  2KT1 A;  1X01 A;  4PFP A;  1X6B A;  1SKU B;  2IG0 A;  2EQJ A;  2GTO A;  2DNU A;  4JDS A;  3QII A;  2KE9 A;  2KQW A;  4X1V A;  2IVW A;  5GAM j;  1H64 1;  2AIR B;  2DTH A;  4KBM B;  3P8H A;  2DYB A;  5GAO p;  2DRK A;  2QGF B;  1M1K R;  4M7A A;  2QDY B;  2EKH A;  5CVI A;  2KMT A;  1QWE A;  3OMC A;  3CCR Q;  1UUE A;  3WVD B;  1K0X A;  1HXD A;  2DXC A;  2RI5 A;  1VQK A;  2GQI A;  4FIB A;  3L2Q A;  2LJ0 A;  1VIE A;  2YRC A;  3OB9 A;  2J6F A;  2JJ9 A;  1WX6 A;  1M90 U;  3QSU A;  1B07 A;  1AHJ B;  5LJ3 g;  3MEU A;  3KXT A;  3CBO A;  3G4S T;  2BE9 B;  1VQM Q;  3UDC A;  4DQ2 A;  4E47 A;  3G71 T;  4M78 G;  1Q95 G;  2DXT A;  2MAM A;  5IHK A;  1K9M U;  1QVF S;  4BE1 A;  3MKD A;  1MMN A;  2WSE E;  4PL6 A;  3SWN A;  1DJ7 B;  4Z88 A;  1FX7 A;  1SG5 A;  5ECA A;  2DTO A;  2ECZ A;  1LPL A;  3V8K A;  2BTT A;  2J6O A;  1K1Z A;  3CCS Q;  1W4S A;  4HVV A;  3I56 A;  2YUQ A;  5GAN 3;  3CCL A;  2RO0 A;  1PD1 A;  5HK0 A;  1VQN Q;  1K8A C;  3KUF A;  4MZM A;  2P0Q A;  1AZG B;  1ABO A;  2KEA A;  4OGE A;  2E41 A;  1Q7Y C;  4PFO A;  2L2P A;  2RH2 A;  4DBR A;  1YJN T;  5GAM h;  1D09 B;  5EG2 A;  3UWN A;  2DL7 A;  4A4G A;  3MP6 A;  2DFU A;  2DEU A;  2LQN A;  3OYY A;  2P4T A;  2RK1 A;  4IIM A;  4F04 B;  3E9F A;  2ZPE B;  3CCQ T;  2F2X A;  2JS0 A;  2QA4 T;  3CPF A;  4CC2 A;  2LT1 A;  2D6F A;  2EYW A;  3CC4 A;  3N5B B;  2MK5 A;  2HBP A;  3MP8 A;  1MV3 A;  3JCM V;  1U1S A;  2AHJ B;  3I55 T;  2COZ A;  4BD3 A;  5HCK A;  2DVE A;  1JU5 C;  4LNP A;  5IHI A;  2DZC A;  1OX8 A;  1PG5 B;  1Z9Z A;  1NJI C;  1KQS A;  2OI3 A;  1ZA1 B;  1VQ8 Q;  4N0A A;  4DBQ A;  1IB8 A;  3EG3 A;  2RQU A;  1PKT A;  3CCU Q;  4FYY B;  1TH7 A;  4J9E A;  1IHV A;  2O4X A;  1IRX A;  2GFU A;  4J6Y A;  3QUI A;  1I1J A;  4Q5W A;  3CCJ Q;  2OAU A;  1YN8 A;  1WFW A;  2ZPG B;  3CME A;  3OA6 A;  4J5Y A;  4ZGD B;  1NM7 A;  1WXT A;  1M90 R;  1UGS B;  2ROL A;  2AZV A;  3H0I A;  4OB2 B;  2C06 A;  4C92 B;  5FRN A;  1NJI U;  3DLM A;  3OBW A;  4F7U F;  2RA2 A;  1K9M R;  3CC2 A;  3RDV A;  3RKW A;  5GAM e;  2KYB A;  1NG2 A;  2PQW A;  1YIT T;  4NOY A;  5CCA A;  2M16 A;  1D0Z A;  4RG8 A;  2DIL A;  3R6O A;  3FRN A;  4JRK A;  4XTW A;  4PJO A;  3EGX A;  2EW3 A;  4M7A E;  7AT1 B;  1S72 A;  1ZHI A;  2BE7 D;  5CO7 A;  1UB4 A;  1VQL Q;  2DL4 A;  4OMF B;  1QVF A;  2HZY A;  2D8J A;  1SRL A;  5GAO r;  4M7D B;  1YJ9 Q;  1Q81 U;  3M0U A;  5KYU B;  2LZ6 B;  3LGF A;  1VQ6 Q;  1UG1 A;  1WHM A;  4C8Q D;  4IUR A;  4M75 B;  3JCM P;  4ANJ A;  5IXB A;  1JXM A;  1N6A A;  3E9G A;  1YCS B;  5GMK j;  1EX4 A;  3C94 A;  2EKO A;  4LE9 A;  3J81 E;  4KH1 B;  2K6D A;  2CP3 A;  2MOX A;  2GNC A;  1MMG A;  3SDZ A;  4RTX A;  4LDX A;  2QQA A;  3CCV A;  1PC0 A;  2FZK B;  2LVM A;  2E3I A;  3FB9 A;  5CK9 A;  1JO8 A;  2RHZ A;  3CD6 T;  2K79 A;  2YLC A;  1Z9Q A;  2M51 A;  4HT8 A;  1KIK A;  3I9Q A;  5GAN 5;  2CP6 A;  1G8X A;  1U1T A;  2D9T A;  2HCK A;  5D7U A;  3I5S A;  5GMK i;  4J8O A;  4BAC A;  2DIG A;  1YJW A;  3NGP A;  3CBM A;  1NBE B;  2CZ7 B;  2B8A A;  3TU4 K;  4EIK A;  4FL6 A;  4FT2 A;  3JCM Q;  3GNG A;  1AWX A;  4M77 D;  4KT0 E;  1Y96 B;  3EAE A;  4F16 A;  4OB0 B;  2LCC A;  3BFM A;  2LRQ A;  1ZSZ B;  1KC8 C;  1WXB A;  1LVK A;  1YHQ Q;  2RJE A;  3L2W A;  2EBP A;  2X4J A;  3OBY A;  2EWN A;  3HRU A;  3CC7 Q;  1G3Y A;  4DOW A;  1VYV A;  3GOX A;  1RLP C;  1N8R U;  2MIO A;  1M30 A;  2Y4Y A;  4MZT A;  3HL8 A;  3EGD B;  1U8R A;  2LQW A;  4X9C A;  2DL5 A;  4JLG A;  4NL2 A;  3LX7 A;  1XQH A;  1QMC A;  3M5A A;  2DJQ A;  4J9D A;  4M7D C;  3QWY A;  3OYN A;  1X43 A;  2DXB A;  1K73 C;  4FU6 A;  1KC8 U;  1XTD A;  1M3C A;  5GMK h;  1K76 A;  1OI1 A;  2E65 A;  3UAT A;  4OF1 A;  3KBG A;  1M2O A;  4M75 C;  4B6M A;  4QW2 A;  2E1H A;  1FYN A;  3NPF A;  4XTY A;  1ZUU A;  3CEY A;  2F1L A;  4KUL A;  2RI2 A;  4J7I A;  2NWM A;  1UEB A;  1P92 A;  2QG9 B;  1N27 A;  5LJ3 f;  5CKH A;  2OTL Q;  4KUI A;  3I56 T;  1R0C B;  2VWF A;  5DY9 A;  3QWX X;  4M7A C;  3EFR A;  2LJ1 A;  2ZPH B;  1Q81 R;  4OML A;  1OV3 A;  1SSH A;  3VYG A;  3CMA A;  3V7C A;  2P0K A;  4ESR A;  3VU3 C;  2O88 A;  4PNO A;  3MCA B;  3SFM A;  4ELZ C;  2ROT A;  5CQX A;  2PTK A;  3S3M A;  4D8D A;  2RPN A;  3EH1 A;  4XTU A;  2AZS A;  1ABQ A;  1OPL A;  2DMO A;  1ZSZ C;  2E5K A;  3FJP A;  5KYY B;  4JRQ A;  3RIR A;  2VGM A;  1B34 A;  2DF6 A;  3R6N A;  2ESW A;  3VUZ A;  1ACM B;  4OVA A;  6AT1 B;  3J7A F;  2X51 A;  3SWN C;  2YUO A;  3CC4 T;  4PJO E;  1QP2 A;  4YTL A;  2V8I A;  1IGQ A;  3ZFJ A;  3LGL A;  2JZ2 A;  1K4U S;  2DA9 A;  3H41 A;  2PVO B;  1RL2 A;  1VQP Q;  1IGU A;  2HEQ A;  3L1A A;  3LWH A;  2HAX A;  1M1F A;  2MI6 A;  2EIF A;  4XU1 A;  4RTZ A;  3VS5 A;  2K3Y A;  1KQ2 A;  1G2B A;  2QQR A;  4LDY A;  1QVG P;  3I55 Q;  5LJ3 e;  3T9N A;  2KGT A;  1I81 A;  3S3N A;  1XNI A;  1TS9 A;  1RUW A;  2SEM A;  3HHT B;  2CUB A;  5D6X A;  1N8R R;  3SHW A;  1RAB B;  1RAD B;  2JTE A;  3LW5 E;  3QZ9 B;  3CME T;  2XMF A;  1VQ5 A;  1Y71 A;  5M9O A;  3WXM B;  2ZZD A;  1KD1 U;  3BDU A;  1HK9 A;  1NZ9 A;  2QEX A;  4M7A F;  4JRP A;  2E10 A;  3JB9 D;  3MEW A;  1Q86 C;  3X20 B;  1VQL T;  2K2V A;  1ZUY A;  3HPW A;  1OYX A;  4ZTF A;  1D0X A;  3MEA A;  2Y90 A;  2I2L A;  2K2M A;  1YIJ A;  4PFZ A;  2IPO B;  2RK2 A;  4C0D C;  1QCO A;  4J9G A;  1VQ5 Q;  4A63 B;  5GAN 6;  2M9U A;  1BIA A;  2X9H A;  5LL6 S;  1SPK A;  2LT4 A;  4AFU C;  1GFD A;  2HMA A;  2CH4 W;  2R5A A;  1S72 T;  4ATO A;  4RG2 A;  4C92 A;  5GAN f;  4C8Q B;  2GGR A;  5AYF A;  2QAZ A;  4HA8 A;  1ZX6 A;  4MDW A;  4C8Q G;  4XTV A;  1C6V X;  4VUB A;  3QJ6 A;  5GAO q;  3CPW P;  1WNL A;  3OW2 P;  3RR6 A;  3QDR B;  1YCY A;  3V8J A;  2BUD A;  1LOJ A;  1PCX A;  3C4S A;  8AT1 B;  4L6V 5;  2KBT A;  4BE2 A;  3PTA A;  3OS2 A;  3QG1 A;  4JS5 A;  4EMG A;  1UGR B;  2K5I A;  5KYU A;  1UGP B;  2Z0W A;  2DBK A;  2QTX A;  1VQ7 A;  2QXF A;  3JB9 J;  4OP0 A;  4M75 A;  3CC7 T;  2F69 A;  1V1C A;  1YJW T;  1G3W A;  1WHH A;  2C0T A;  1ZA2 B;  5GAN 8;  1V76 A;  2EGE A;  1VQ4 A;  3TEE A;  2A3L A;  3CD6 Q;  1WA7 A;  1SEM A;  2LDM A;  2KRM A;  4M77 G;  1OU8 A;  2KXC A;  2FZG B;  2HKQ B;  1TUG B;  2A7Y A;  5I2M A;  4F7U G;  4Z8A A;  4NS5 A;  5J39 A;  2V1Q A;  3D7S B;  5GAN e;  3REB B;  2HQE A;  3FEO A;  1KK7 A;  1QVP A;  1QCF A;  3VV0 A;  2YT6 A;  4ELY C;  2J6K A;  1WQW A;  1KSW A;  1JEG A;  3RMS A;  4RCC A;  2E12 A;  1BCO A;  4M78 B;  4BI8 B;  4QVC A;  1KFZ A;  3CCE A;  5D6W A;  1JXO A;  1RAA B;  3TSW A;  1Y96 A;  4ZGE B;  1X6O A;  1KD1 R;  1WHJ A;  2GFA A;  1ZSZ A;  4EMH A;  3H8Z A;  1N9S A;  2H8H A;  3OS0 A;  2OTL T;  3HFN A;  2O31 A;  4J9C A;  4JJN K;  3LYI A;  1VQK Q;  1TWB A;  1CKB A;  3FIF A;  5GAO m;  3HKS A;  3EH2 A;  1PWT A;  3X24 B;  4PJL A;  2GF7 A;  1D1A A;  3MJX A;  2XI9 A;  1SSF A;  3EGD A;  1B34 B;  3LH0 A;  1QCN A;  2XIC A;  4O5V A;  2RHX A;  2QK0 A;  2Y4X A;  1JJ2 S;  3PGG A;  2COW A;  1D3B B;  1UE9 A;  5CAI A;  4GBQ A;  4KUD K;  2LTO A;  4OMM A;  1YI2 A;  1X27 A;  4PJO F;  5DLO A;  2XID A;  2EQI A;  3UPU A;  3U23 A;  2ED1 A;  3I56 Q;  5A0L A;  2FZC B;  2QYZ A;  2ZPB B;  1TUC A;  3CCL Q;  3QHS A;  4C0G A;  1VQP T;  3A98 A;  1G3S A;  5GAM f;  3J80 E;  4FSS A;  3M57 A;  4DEY A;  4ZTJ A;  1BI0 A;  3UT1 A;  1Q82 C;  1T3S A;  1UHF A;  4BDY A;  4BY6 B;  4FYX B;  1K8A U;  2A37 A;  1QWF A;  4DBH A;  4Z02 A;  2GBQ A;  3M0T A;  2VUB A;  2DL8 A;  1PRL C;  3JCM b;  3CCM A;  2CH4 A;  4IKF A;  4C92 E;  2KRO A;  4M78 C;  1I0C A;  1RI9 A;  1Q7Y U;  2P0P A;  5D6Y A;  3PIO A;  3M0Q A;  2CP0 A;  1F1B B;  2CP5 A;  2FRW A;  1R0B G;  3CC4 Q;  5KYY A;  1PD0 A;  3GPL A;  4L59 A;  5KE3 A;  2SRC A;  4XU0 A;  4LD6 A;  4EMK B;  2FVU A;  3FLG A;  2E5Q A;  1WYX A;  4HKE A;  1IHW A;  1Q82 U;  3PIP A;  1WI7 A;  2QTV A;  5LJ5 d;  1BU1 A;  1UTI A;  2XDD A;  2RQW A;  3M0P A;  2K9G A;  1OOT A;  3VUB A;  1I07 A;  4M7D E;  1U06 A;  2XHC A;  4LUD A;  3JCM g;  1T0H A;  2KYM A;  1VQ5 T;  3PNW C;  3NTK A;  2JOY A;  4M75 E;  3BY7 A;  3EG9 B;  3JCM d;  2G6F X;  2EVR A;  5KE2 A;  3JB9 G;  1MNE A;  3BE3 A;  3Q1J A;  3CME Q;  4PJO D;  1TXQ A;  5A2Q E;  3GP8 A;  4E7Z A;  1M3B A;  2V26 A;  2R58 A;  4N4H A;  1YIJ T;  5GAO l;  3RUX A;  2PVD B;  3A5Z B;  1JQQ A;  1X2K A;  2K3X A;  3A8L B;  3E1S A;  3CC2 Q;  1R77 A;  2DAQ A;  4IUV A;  2PVG B;  2JTM A;  1X6G A;  2M0Y A;  3V7S A;  3JAM E;  4C5I A;  4BY6 C;  1ARK A;  2F5K A;  4RUG A;  3ZBD A;  4ZNX A;  1VA7 A;  2KRS A;  1WGS A;  3OS5 A;  1S72 Q;  3M58 A;  4E2F B;  3EG1 A;  4IUU A;  3VYH B;  1WJQ A;  2DX1 A;  1WLP B;  2D0Q B;  3JB9 I;  4E7H A;  1W2B S;  2RHY A;  1ZUK A;  4O6J A;  1JJ2 A;  1OQK A;  4NL3 A;  3DB3 A;  1OPK A;  3PMT A;  3EFO B;  4EMK C;  2NYS A;  4C8Q A;  2M1H A;  3OYH A;  2EYY A;  1FXX A;  1SHF A;  1K8A R;  2CKK A;  4BB7 A;  3RES A;  3HRS A;  1NPR A;  2WAC A;  1IRE B;  5CIU A;  1VQ7 T;  1Q7Y R;  3BDL A;  4PJM A;  3CCV Q;  4KRT A;  1GBQ A;  3X28 B;  3E2U A;  1K0S A;  2YHT A;  4ME7 A;  1VQ4 T;  2WSC E;  3OY9 A;  4GY5 A;  4C92 C;  1I5O B;  2DJZ A;  4LDV A;  5KCH A;  1WIE A;  4HVU A;  4F14 A;  2DRM A;  4ZN1 A;  4J9B A;  1YJW Q;  2HBW A;  3VS3 A;  2V8J A;  4A4F A;  1BKB A;  3F70 A;  2EQM A;  1QP3 A;  1U5S A;  2D0N A;  2E4H A;  3MP1 A;  3PVQ A;  2ZCF B;  2GQV A;  3QYH B;  1VQK T;  4M77 A;  3C12 A;  1KG1 A;  2OX7 A;  3RKY A;  3I5R A;  2BZX A;  3DKM A;  3MO8 A;  1NJI R;  2JM9 A;  2RJF A;  3JCM J;  4OMQ A;  3OYD A;  1M2V A;  1Y7X A;  2I0N A;  2MMP A;  5A0G A;  3G4S A;  1YNZ A;  3CXC P;  1ZLM A;  3G71 A;  5FU7 B;  2VC8 A;  3M54 A;  4XQ3 A;  1C0M A;  4M78 A;  4A53 A;  2CGH A;  3VS4 A;  2WSF E;  3GBQ A;  2DIQ A;  2L0A A;  2XD0 A;  1BK2 A;  2RQR A;  3CCL T;  1AWJ A;  2LNH B;  2MCN A;  4OB1 B;  3HFO A;  1E6G A;  1K73 U;  2CS7 A;  2HNI A;  5LJ5 j;  3A8H B;  1YI2 T;  2LQ8 A;  2JMA A;  1FWZ A;  4E7K A;  4KH0 B;  2RN8 A;  4JLI A;  1MUZ A;  4EDU A;  5GAN 2;  1W6X A;  4JUV A;  4JRI A;  2LX9 A;  4C92 F;  1J3T A;  1Y0M A;  1U3O A;  2KT8 A;  2DK3 A;  5KYX B;  4IUQ A;  3JB9 H;  5KH6 A;  3CMA Q;  1WQ7 A;  1RAC B;  1YJN A;  2EYZ A;  3A8M B;  2NUP B;  1OZ3 A;  3OS1 A;  2JVV A;  3S6W A;  1RAH B;  3L2R A;  4IUP A;  3H6Z A;  1D3B A;  3CCQ A;  2JM8 A;  2FRY A;  5GAN 7;  5C0M A;  4E7J A;  4C0Z A;  3GNF B;  1SRM A;  1JBM A;  4J83 A;  4A4K A;  4AT1 B;  1M1K C;  3CCM T;  4HT9 A;  3PVL A;  5FW9 A;  1W2B A;  2NLU A;  2YWW A;  1KHC A;  4J9F A;  3HSB A;  1BI2 A;  2XDB A;  1BIB A;  3G6E A;  5GMK e;  3OYA A;  3RKX A;  3QXE B;  4E7S A;  3M9Q A;  4M7D F;  3QKJ A;  4RTW A;  3OYL A;  3P8B B;  1G5V A;  2X3W D;  3QDF A;  4ORZ A;  2L8D A;  2OJ2 A;  3GF5 A;  4J9H A;  4IUT A;  4M75 F;  4QQ6 A;  2KR3 A;  4BDZ A;  3JV3 A;  1PM3 A;  2JW4 A;  1YBY A;  2EAY A;  1AVZ C;  5FU7 C;  3L2V A;  2P4R A;  2CZ6 B;  1D1B A;  4GLM A;  1UHC A;  4C8Q E;  1IO6 A;  2PUO B;  1PKS A;  3GIB A;  2OTJ A;  2RNA A;  5LJ5 h;  4R55 A;  2YRD A;  4JPB W;  2ZAE A;  1KC8 R;  2EPD A;  3CC2 T;  4FYW B;  2EJ9 A;  4EMK A;  4BUG A;  2FL7 A;  4FM4 B;  1VOM A;  4HCB A;  4LUE A;  3JCM h;  2QQ9 A;  1SHG A;  2FYK A;  2YLB A;  4PJO G;  2FB7 A;  1D0Y A;  2VB6 A;  4F17 A;  2EJG A;  1YWO A;  4C92 D;  1K9A A;  2QEX Q;  2X35 A;  3A8G B;  1H92 A;  2CZ0 B;  4Y92 A;  5AT1 B;  1G3T A;  3HTR A;  3S3O A;  2KDS A;  2MWO A;  2O9S A;  1UDL A;  3H0F A;  1CSK A;  4OMO A;  1C1A A;  2LCL A;  3EG9 A;  3MHX A;  4CI0 C;  2QQS A;  3SD4 A;  1K73 R;  2K7A A;  4LDU A;  1YIJ Q;  1QW1 A;  4OMN A;  4B9X A;  2YXY A;  5DLQ E;  3PMI A;  1Q86 U;  3RNJ A;  1CKA A;  1AOJ A;  2KY9 A;  3ULR B;  2JUF A;  4XAX B;  4MML A;  2EJF A;  4PK4 A;  4MZP A;  2HQH A;  5HK3 A;  3VS0 A;  2EGC A;  3L2Z A;  2W10 A;  4M7D D;  4EPC A;  2RQV A;  3CCV T;  2JXB A;  5EC7 A;  1GFC A;  5CR2 A;  2V1R A;  2LMJ A;  4M75 D;  1W1F A;  1V29 B;  4K11 A;  2CZ1 B;  3JSC A;  3EFS A;  1HSQ A;  3UA7 A;  3OSS C;  2LC4 A;  4M78 E;  3O8V A;  2DET A;  3QJY A;  4FCY A;  1MGQ A;  4M77 B;  1QKX A;  3EHQ A;  3C0C A;  3OYF A;  3NHN A;  3RMQ A;  5FU6 B;  1BI1 A;  4F7U B;  4MDX A;  4PLI A;  2LX7 A;  4V2S A;  1TTH B;  4M7A D;  1UJY A;  2F5T X;  1PSE A;  1M3A A;  4J6X A;  1M2V B;  1SF9 A;  2J05 A;  2EGA A;  4Y91 A;  3JCM e;  1M90 C;  1NYG A;  1PRM C;  3CCR A;  3NMZ C;  1VQ7 Q;  3EFO A;  2A0F B;  1UJ0 A;  3EHR A;  3FC3 A;  2E6N A;  2JN0 A;  2LP5 A;  3PE0 A;  2IIM A;  3QZ5 B;  4Y28 E;  1OEB A;  1K9M C;  1VQ4 Q;  2JMC A;  2CRE A;  2L3Q A;  1XOV A;  2F2V A;  4AFZ C;  5FLX E;  3M4G A;  2LNV A;  2PUK B;  1VQM A;  3WVE B;  1ZBJ A;  5GMK m;  4HXJ A;  2CDT A;  4PJN A;  4D6W A;  1FMK A;  2W0Z A;  3VS6 A;  3GLX A;  4Z89 A;  3V8L A;  4C8Q C;  1T0J A;  5HY6 A;  1HJD A;  3ASK A;  5GJV B;  3JRZ A;  4WF2 A;  1GBR A;  2NUT B;  2HSE B;  3BW1 A;  2D8H A;  2MPX C;  4RMO A;  1O9S A;  1WJS A;  1AWW A;  1PSF A;  3VS1 A;  1BYM A;  3AT1 B;  2EQK A;  4WCI A;  3CCE Q;  4AG1 C;  3CCS A;  3TQ7 P;  2DBM A;  5KYW B;  2VXE A;  4JZ3 A;  5LJ3 d;  2YUP A;  1OU9 A;  3JCM W;  2C0O A;  3VS7 A;  1VQN A;  1G83 A;  4CC7 A;  2X3X D;  3EGU A;  1BCM A;  2L3P A;  2F2W A;  5FRO A;  1YFN A;  1UGQ B;  2R5M A;  3CMA T;  4FT4 A;  1OUL A;  1Q86 R;  1VIF A;  1GRI A;  1FMW A;  1GCQ A;  4M77 C;  3CBP A;  3X26 B;  2VYT A;  5I22 A;  1GCP A;  2FPD A;  3L2U A;  1ZBX A;  5FU6 C;  3TRE A;  4RTU A;  2COY A;  3FDR A;  2PNI A;  2KK4 A;  2M02 A;  3JCM X;  2YRV A;  3QBY A;  5IN1 A;  2B86 A;  4RTT A;  1LNX A;  3V7R A;  2YSQ A;  3NFC A;  3MPU B;  4XTX A;  4E6R A;  1KQS P;  2C0I A;  2HDA A;  1YI2 Q;  3A8O B;  1N9R A;  2CSI A;  1VQ9 A;  3I35 A;  2X4X A;  4DA4 A;  2K5F A;  2KAF A;  1VQ8 A;  4ZGJ B;  4C5G A;  4C5H A;  1NLP C;  3CCU A;  2ZPI B;  1RAI B;  1M8V A;  3G6E T;  3EG0 A;  2DEQ A;  4C8Q F;  2XG8 D;  5KYX A;  1KQ1 A;  1VYT A;  4E7I A;  1D1C A;  4DEX A;  1NEB A;  2FO0 A;  1EFN A;  3VJP A;  3CQT A;  1R8O B;  3CCJ A;  5LJ5 g;  2NUP A;  1VQ9 Q;  3CCM Q;  2YUN A;  2E6Z A;  2RM4 A;  4RKU E;  4KGX B;  5CKF A;  4BI3 A;  4R56 A;  4A4H A;  3X25 B;  3M56 A;  4TVR A;  3KFV A;  5IH2 A;  1WHG A;  1M8M A;  3TCJ A;  3UA6 A;  5IAY A;  2EQU A;  1WXU A;  1GXI E;  2HKN A;  3M59 A;  5GMK l;  2OTJ T;  5KYN A;  2QEX T;  3OYB A;  2RHI A;  3VS2 A;  2DD4 A;  1QKW A;  3LLR A;  4A4E A;  4X34 A;  2EYX A;  1NE8 A;  3QPH A;  2BZY A;  2DXU A;  4PLL A;  1Y57 A;  1O75 A;  2E3H A;  4M77 F;  2J7I A;  1QVF P;  4JJD A;  2D1X A;  3M53 A;  8ATC B;  1Q81 C;  4FW2 A;  2RHU A;  2DKG A;  5GAN g;  1RLQ C;  5CKB A;  1AWO A;  5IXF A;  1VQL A;  3OQ5 A;  1M9S A;  4E7L A;  4LD9 K;  1UFF A;  3MET A;  4HCK A;  2AK5 A;  3ME9 A;  5GAN d;  3CXC S;  3RER A;  4C92 G;  1YJ9 A;  4HVW A;  2KXD A;  2ABL A;  1VQ6 A;  2QDL A;  2VXF A;  2DLP A;  4JJB A;  4PKC C;  2YDL A;  1YP5 A;  4HCC A;  2L5Q A;  5GAN 4;  2XU8 A;  4QQD A;  5KCO A;  2DER A;  2MF2 A;  2RD1 A;  3ER0 A;  3QO3 A;  3JCM c;  5FWC A;  1JJ2 P;  1FMV A;  1RAF B;  4M78 F;  4OB3 B;  4ZN3 A;  4OGC A;  1NPP A;  5DM7 R;  3NTI A;  2JT4 A;  2KNB B;  2LQK A;  3C95 A;  4LN2 A;  4LDW A;  5C6S A;  1B3Q A;  1T3L A;  2H3E B;  2A36 A;  2CYZ B;  3H0H A;  4M7D G;  1PHT A;  5I21 A;  2DM1 A;  2RF0 A;  4AG2 C;  4JZ4 A;  1PNJ A;  2JTF A;  3INZ A;  4M75 G;  1OX9 A;  1ZQ1 A;  1B7T A;  1QLY A;  2K4Y A;  5LJ3 j;  2OAW A;  3OYI A;  2KSS A;  1EZZ B;  2K5L A;  3M0S A;  4M7A B;  4C0F A;  1VQO A;  4JJC A;  1YHQ A;  3OYK A;  1LCK A;  1WDX A;  4AMC A;  1N8R C;  2CSQ A;  1RAE B;  1OZ2 A;  2H3J A;  5FRM A;  5CKE A;  3CC7 A;  1MMD A;  1TOV A;  4II1 A;  5GAO n;  2A28 A;  4M7A G;  3MEV A;  3M55 A;  1IZ6 A;  5CKD A;  3DLL A;  3HP9 A;  3CCR T;  3TVT A;  1TG0 A;  1QVG S;  1BI3 A;  1Q82 R;  2HD0 A;  4J6W A;  2VGN A;  4QKU A;  2VKN A;  2CT4 A;  4WTO B;  3IQL A;  1VQO Q;  2DL3 A;  2BZ8 A;  3CCE T;  3G1J A;  4KGV B;  1M4Z A;  4F7U A;  3SWN B;  2DD5 A;  1VQM T;  3ZEH A;  2LCS A;  3NTH A;  1MMA A;  3G7Z A;  3OYC A;  4JS4 A;  3M4Y A;  1I4K 1;  4RCB A;  2CP2 A;  4N4G A;  2JS2 A;  1JRI A;  2HSP A;  4M78 D;  2DE0 X;  1A0N B;  2BIV A;  3VRY A;  3EG2 A;  3CCS T;  2L89 A;  2OTL A;  2HQX A;  5J26 A;  3O5Z A;  1VQN T;  4CC3 A;  4R0K A;  3RBB B;  2A08 A;  3OSV A;  1UEC A;  5LJ3 h;  2XK0 A;  4DBF A;  3L42 A;  4FYV B;  2O2O A;  3G4S Q;  2EFI A;  4CC4 B;  5CQY A;  2NUT A;  5IT9 E;  1RAG B;  2RJD A;  3UF4 A;  3G71 Q;  3LWI A;  3VKI A;  2LJ3 A;  4J7F A;  4M4Z A;  3URG A;  5A0D A;  5GAM g;  2ZPF B;  3OYG A;  3AHU A;  2VAS A;  1AD5 A;  1S1N A;  4QVZ A;  4KGZ B;  3CXC A;  3OYE A;  5KYW A;  5GAM d;  3M0R A;  3JB9 F;  5FWB A;  2J06 A;  3CPW S;  1WZO A;  1HD3 A;  5GJW B;  2ATC B;  1Y07 A;  2G3R A;  2FEI A;  3OW2 S;  5I11 A;  2VV5 A;  1BBZ A;  3H9N A;  1W2B P;  2VVK A;  4LXC A;  4C0D B;  4P5N A;  3REA B;  2ZGW A;  2RQT A;  1JB0 E;  1VQP A;  2QA4 A;  5J3B A;  3A1P A;  5I2S A;  4QQG A;  2KRN A;  3ZL7 C;  4N4I A;  1VQ9 T;  2DZ9 A;  2O4X B;  1VQ8 T; 
#chains in the Genus database with same CATH homology
 2QAS A;  1TWB A;  1ZSZ A;  1OX9 A;  1ZSZ B;  1OU9 A;  1YFN A;  1OUL A;  1OU8 A;  2QAZ A;  2NYS A;  1ZSZ C;  1OX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...