1I1JA

Structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords MELANOMA DERIVED GROWTH REGULATORY PROTEIN
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i1jA00
1UFFA 2YUNA 2XMFA 3PE0A 2L3PA 2RNAA 1VYTA 3EG2A 2KXCA 1TG0A 1M3AA 3EHRA 2ABLA 2EPDA 2YUPA 1UHCA 2J7IA 1PWTA 1X6GA 1QWEA 2K9GA 3EG1A 2KR3A 1V1CA 1GL5A 1Y0MA 2VWFA 1Z9QA 2GGRA 2JW4A 2A28A 1NEGA 1M3BA 1ZUYA 5GJVB 4AFZC 2RQVA 3H0FA 1HD3A 2CUBA 2DL7A 2OAWA 2ENMA 2BZ8A 4F17A 2FPFA 1PNJA 2LNHB 1WIEA 1UJ0A 1AVZC 1JXOA 2L3SA 1K76A 3RBBB 2DX1A 3H0HA 1KFZA 2O9SA 2O2OA 2GTOA 5IHIA 5I11A 2KYBA 3UA7A 1PKTA 1JO8A 1YNZA 2PTKA 1UGVA 2HBWA 2YUOA 1CKAA 4AFSC 1GCQA 4RTVA 1E6GA 2ED0A 1AWWA 3THKA 2W0ZA 2DBKA 2M51A 2CT4A 2DJQA 2AK5A 2O9VA 4HVWA 1YCSB 4E6RA 1UECA 5IHNA 1T3SA 2RN8A 1GRIA 2VKNA 2EYYA 4HVUA 4OMLA 2DRMA 1OPLA 2M0YA 4M4ZA 2BTTA 2D0NA 2OI3A 1CKBA 1W6XA 3I5RA 1T0JA 2B86A 2D8JA 2KGTA 3SHWA 3M0UA 2FEIA 1UJYA 4J9GA 4JJBA 3VS2A 2L3QA 4LE9A 1K0SA 2ROLA 1CSKA 3REAB 2KEAA 1IO6A 4OMQA 3UF4A 2EKHA 1U5SA 4LNPA 1YP5A 1AZGB 2DL5A 4IIOA 2KRMA 2DLPA 4K11A 2EYZA 2KT1A 2DVJA 2DNUA 2RQWA 3R6NA 1SPKA 1U06A 1JXMA 2GTJA 2LQWA 5FWCA 2PZ1A 3REBB 2SRCA 2D1XA 2KRSA 2HSPA 2YDLA 2NUZA 1Z9ZA 1G2BA 2DE0X 1RUWA 1OV3A 4CC2A 3I9QA 1WYXA 1X6BA 3PVLA 2LJ1A 4RTTA 1JQQA 3VS6A 1KIKA 5I22A 2JS2A 2RQUA 3TVTA 2SEMA 3NPFA 1OOTA 2G6FX 1YN8A 1UE9A 1JU5C 2JS0A 1QLYA 2KE9A 1MV0B 1NLPC 1H3HA 2CH4W 2J6OA 2YT6A 2J05A 3TSWA 3M0TA 2JMAA 1UDLA 1X27A 1BK2A 4JZ3A 4AG1C 2H8HA 4QT7A 1U3OA 4Z88A 1RLPC 2LQNA 1NG2A 3VS1A 5IXBA 5FWBA 1YWPA 3JV3A 2J6FA 2JT4A 4ESRA 3I35A 2P4RA 1GFCA 3O5ZA 2IIMA 1K4US 1SHFA 2A36A 2DMOA 1ZUKA 2RPNA 1QKXA 3C0CA 1M8MA 4LUEA 2FRYA 3LH5A 4J9HA 2FPEA 3RNJA 2HDAA 2W10A 1SRLA 2I0NA 2PNIA 1PHTA 1ZBJA 2AZSA 4CC7A 1PKSA 1BU1A 2EW3A 2AKLA 2YUQA 2HEQA 1MUZA 5GJWB 2MCNA 1I0CA 4A63B 4JJDA 3NGPA 1I07A 2L2PA 2FRWA 5HCKA 3GBQA 5FW9A 3NMZC 2JMCA 2L0AA 1OPKA 2J06A 3KFVA 1NYGA 4RUGA 2ROTA 1B07A 3M0SA 1M27C 4D8DA 5EC7A 4LUDA 2DBMA 1WLPB 2DA9A 4J9EA 1S1NA 1K0XA 2RF0A 2GNCA 1AWXA 3EG0A 3IQLA 4R0KA 3NHNA 1HJDA 4DEXA 1ARKA 3PVQA 1ZLMA 2RQTA 2EQIA 4GBQA 2DM1A 2CDTA 2OJ2A 4J9DA 4JJCA 1RI9A 2EGAA 2MOXA 1UUEA 2X3XD 1YWOA 2LMJA 2LCSA 1UG1A 3M0QA 2DF6A 2FG0A 3M0PA 3U23A 1B3QA 2LP5A 1EFNA 3VS5A 1TUDA 5ECAA 2E5KA 1AZEA 1ZUUA 4F16A 4D8KA 1NM7A 3TSZA 2CREA 4Z89A 3H0IA 1LCKA 1OEBA 1RLQC 2DILA 1FYNA 1AD5A 1SSHA 2DL3A 1SHGA 4HVVA 4OMOA 1PRMC 1VYVA 2LJ0A 2K2MA 2NWMA 2BZXA 3VRYA 1WX6A 2K3BA 1WA7A 4ORZA 4HCKA 3M0RA 1KJWA 1JEGA 1XOVA 1SRMA 4HXJA 3SEMA 1ABOA 3QWYA 4KRTA 2C0TA 4RTXA 4JZ4A 2AZVA 1H8KA 2K7AA 2F2VA 3ZL7C 1NEBA 2D8HA 5IH2A 1TUCA 3EG3A 2A37A 3VS7A 4EIKA 2DRKA 4J9CA 2EVRA 4RTWA 2LZ6B 3CQTA 1E6HA 1T3LA 4GLMA 1ZX6A 1UTIA 1H92A 2O31A 1M30A 4IIMA 1N5ZA 1BB9A 1GCQC 2DL8A 4OMMA 1AWJA 1NYFA 1W1FA 3EHQA 1QWFA 2CSIA 3H41A 1GBRA 2KYMA 1ZSGA 4ZNXA 4CC4B 4RTUA 2O88A 1AWOA 1K9AA 2JXBA 4AFQC 1WFWA 2JM8A 2CT3A 3A98A 4F14A 4Y92A 1I1JA 1MV3A 2RQRA 1A0NB 2X3WD 2EGCA 2QDLA 2LJ3A 2K79A 2BZYA 2GBQA 2F2XA 2FPDA 2ESWA 2DL4A 2MIOA 1GBQA 3I5SA 2FO0A 1KSWA 4CC3A 2KBTA 2DYBA 2KNBB 1WXBA 1X43A 1Y57A 3EGUA 1HSQA 1E7OA 2V1QA 4DEYA 3QWXX 3VS0A 5IXFA 1WXTA 4Z8AA 2A08A 1UHFA 4J9FA 3UATA 1WDXA 3VS3A 2V1RA 1X69A 3ULRB 2LX7A 1AOJA 1GCPA 2ECZA 4LN2A 1J3TA 4RTYA 1AEYA 4JPBW 1K1ZA 2KXDA 3VS4A 2K6DA 5IHKA 2KROA 4RTZA 1QCFA 4WCIA 2JM9A 3VRZA 1W70A 4J9IA 1WXUA 2RMOA 1M3CA 2JTEA 2C0IA 4X1VA 3UA6A 1PRLC 2HCKA 4OMNA 2YSQA 1VYUA 2CH4A 4OMPA 2EYXA 1G83A 4J9BA 4FSSA 2F2WA 1X2KA 1SEMA 1GFDA 1FMKA 2EBPA 1ABQA 5L23A 2KT8A 2ED1A 1QKWA 2GQIA 1NLOC 2AKKA 2J6KA 1WI7A 2EGEA 2KRNA 2CUDA 2C0OA 2CSQA 3FJ5A 4AFUC 1X2QA 1T0HA 2EYWA 1BBZA 2VVKA 4AG2C 1VA7A
chains in the Genus database with same CATH superfamily
3UWNA 2ZPBB 3NTHA 4LDXA 1D3BB 1JB0E 3MPUB 3PE0A 5EG2A 1OI1A 2L3PA 2RNAA 5KE2A 1KD1U 1PSEA 1G3WA 3RKYA 2VXFA 1PWTA 3SWNC 5C6SA 3CCJQ 1PM3A 2KR3A 5KCHA 1KD1R 4J5YA 3M54A 2VWFA 3CMEA 4ZTFA 2DZ9A 1KC8C 2X35A 2A28A 1NEGA 2P84A 1ZUYA 4OP0A 3H0FA 2OAWA 5KYWA 2NUPB 4DBFA 3CC4T 1PNJA 1W2BP 1WIEA 1JXOA 3RBBB 3CC7Q 3H0HA 2O2OA 1YBYA 3JSCA 3QO3A 1JO8A 1YNZA 2YUOA 4LDVA 5GAMh 2ZPEB 4AFSC 4RTVA 2KVQG 4N0AA 2W0ZA 4J7FA 2AHJB 1EZZB 4FT4A 3JCMb 4E6RA 3QZ9B 2BE9B 4CI0C 2QAZA 2EYYA 5J39A 2DRMA 2H3EB 4EMKA 4E47A 3AT1B 4M4ZA 1R0BG 5FU6B 2DZCA 2OTLT 2CP5A 2CZ0B 2PVOB 5GAMe 1NPPA 2L89A 3ASKA 4A4FA 2O4XA 3JRZA 3OYAA 3CCSQ 3SHWA 2FEIA 1RAEB 4BE0A 1YHQT 4J9GA 4M75F 2L3QA 1K0SA 4M77E 4RCCA 4PJOF 3OYDA 2EYQA 4QKUA 4HCCA 3UF4A 4BDYA 1UGPB 4BUGA 1VQ5A 4LNPA 2JNGA 2DL5A 2KRMA 4BD3A 2EYZA 2RQWA 3M59A 1SPKA 1U06A 1JXMA 2PZ1A 3REBB 2XG8D 1O75A 4E7HA 2KRSA 2NUZA 1G2BA 2LRQA 1S72A 3VYGA 4EMGA 2KY9A 2DERA 3PVLA 4RTTA 1Q82C 2R5AA 2RK2A 1QQJA 3LWHA 5I22A 5FU7C 1VQPA 1M2VA 3TVTA 1IB8A 4F7UF 2DXCA 1OOTA 3OYKA 2QQSA 2G6FX 1UE9A 4B9XA 1QLYA 2KE9A 2HKQB 2X4XA 2M1HA 1H3HA 2J6OA 1EIFA 3TSWA 2JMAA 1UDLA 4OB0B 1QVGA 4KUDK 2XDDA 1S72T 3ZBDA 3TEEA 4JS5A 5FWBA 3I56T 1FMVA 4M78D 2P4TA 2VGMA 4GY5A 1QW1A 1YJNQ 4M78C 2P4RA 2NUTA 1GFCA 3O5ZA 4N0AC 1K4US 1VQNT 1WJSA 2KK4A 2RPNA 3GNGA 1M8MA 4E7LA 3CBMA 3LH5A 3RMQA 3RNJA 3DKMA 1VQ8A 2DIGA 2HDAA 5FU7B 1SRLA 1OU9A 2I0NA 1ZBJA 2AZSA 4CC7A 5J3BA 1VQ8T 2BE7D 2AKLA 3CMAT 4QVCA 2HEQA 4J8OA 4A63B 3OBYA 1VQOT 5GAN8 5HCKA 3JCMf 3SB2A 3LYIA 1M4ZA 2JMCA 5I21A 4R55A 1OPKA 2J06A 4C0ZA 1NYGA 4RUGA 2ROTA 1B07A 3RUXA 2FZCB 1U1SA 3J7AF 2K3XA 5EC7A 4LUDA 2GCXA 2VYTA 4M78E 2DBMA 4ZGJB 5LJ5f 3HKSA 2A3LA 2DJZA 1S1NA 2DO3A 5KH6A 1K0XA 2RF0A 2GNCA 4C8QF 3NHNA 4LXCA 1HJDA 1ARKA 1M90C 3GPLA 1KHCA 4PLLA 1B34B 3MJXA 3VUBA 5HKCA 3CPWA 2B8AA 1M2VB 2OTJT 5KCOA 2EGAA 2MOXA 5FRNA 2QEXQ 1VQLA 1VQPQ 3PTAA 3PT9A 4DA4A 2JOYA 2COZA 1UG1A 3M0QA 3OB9A 2XICA 4J83A 5LJ5g 1WGSA 1N6AA 3M57A 3HSBA 1IGUA 2FG0A 3M0PA 3U23A 3E9GA 1EFNA 2EQMA 2DVEA 3WVEB 4F16A 1TXQA 2GFUA 2JJ9A 3TSZA 1G5VA 4QVDA 4Z89A 3H0IA 4Z02A 2DXUA 1LCKA 2DILA 3CCVT 1AD5A 1SSHA 3VUZA 4IUQA 1SHGA 5HK0A 1P92A 1PRMC 2LJ0A 4MZPA 2HQXA 1YCYA 4N4IA 4OB3B 3KXTA 1KD1C 2BZXA 3VRYA 3CCUQ 2DXBA 2HL3A 2RJFA 2RHZA 1XOVA 1YIJA 3SEMA 1ABOA 3QWYA 3JB9F 4PJOA 5GMKl 2JTMA 2F2VA 3SD4A 4PJOD 1TUCA 4XK8E 3TQ7P 3EG3A 1LNXA 3V8LA 2EVRA 4E7IA 1D0XA 3CCST 4FYVB 3A8GB 4R56A 3QJYA 3L2QA 3CQTA 2KDSA 1WHKA 4GLMA 1UTIA 1H92A 2ZGWA 4XTVA 1M30A 1D1CA 2DL8A 3JB9D 3EAEA 1AWJA 2DAQA 2MAMA 4MZMA 4HKEA 1QWFA 2EJGA 5CAIA 3LWIA 4C92D 1YITA 5AYFA 1RAGB 4CC4B 1D09B 2O88A 1AWOA 2JXBA 2K4YA 4AFQC 3L2VA 3QPHA 2JM8A 1VQLT 2E64A 2V8JA 1MV3A 4BI4A 3I55Q 3EGDB 4M7DB 2EGCA 2IPOB 2QDLA 4PJLA 4Y28E 3H6ZA 4IURA 4MMKA 1C0MA 3S6WA 2BZYA 2ESWA 1VQ6T 2F69A 4M78F 2LNVA 1KSWA 1TOVA 3C95A 1QVFP 2KNBB 3EGUA 5AT1B 4E7KA 4DEYA 3CCJA 3VS0A 2RHYA 3QJ6A 1LOJA 4KH0B 1X69A 3KBGA 2V8KA 4AMCA 1J3TA 3BW1A 4JPBW 2VUBA 2NLUA 3HRTA 2K6DA 1QCFA 4M75C 4DOVA 2JM9A 2DKGA 3VRZA 4PFZA 2QXFA 2FB7A 4J9IA 1Y7XA 1VQ4A 3OSVA 3UA6A 2HCKA 3CCJT 4ELYC 3CCUT 3S3OA 4PJOE 4EMKB 2HKNA 4M7AG 2YSQA 1VYUA 2EYXA 4JLGA 4KGZB 1ZSZA 3CCMA 3S3MA 2EBPA 5L23A 3C12A 1IGQA 3FEOA 3OYNA 2QDYB 3LLRA 1M9SA 3QDRB 5DLQE 2KRNA 2NYSA 1QVFA 2V26A 3OYFA 4AFUC 3M53A 5CQXA 1T0HA 2EYWA 2L8DA 4M75E 3CCUA 3LGLA 2H3JA 2OTJQ 2CGHA 2RHUA 5KYYA 1TG0A 1IXDA 1D1BA 3MKDA 2YLCA 5FLXE 2E1HA 1XNIA 2KSSA 5GANh 4DBHA 1UHCA 2J7IA 1FXXA 3PMIA 2K9GA 1G3YA 2E70A 1GL5A 1NJIU 4RMOA 1Q86C 1M3BA 2QA4A 5GJVB 2RQVA 3CCET 2CUBA 2QQBA 4F17A 3CD6T 4JLIA 1AVZC 1K76A 2DX1A 1S72Q 2EJFA 2O9SA 3CPWS 4E7JA 5I11A 3UA7A 1PKTA 1NZ9A 2JN0A 1GCQA 1WJQA 3JCMg 1HK9A 3E2UA 2XKOC 2DBKA 1M90U 2CP0A 2DJQA 4DQ2A 1ZA2B 1RAFB 2HZYA 4F7UE 4BDZA 3G1JA 5IHNA 1GRIA 1RABB 3INZA 2VKNA 1VQ7T 4HVUA 3X25B 4ZTJA 4OMLA 3MCAB 2M0YA 5LJ5d 2CZ6B 4FYXB 1D0YA 3RERA 1CKBA 1W6XA 3OS2A 1NE8A 4C92F 4ZGEB 3VS2A 4LE9A 2ROLA 2P0QA 3RIRA 4C0GA 1KG1A 3CBOA 4XTYA 2EKHA 2FZGB 4QVZA 4FYYB 1YP5A 5GANj 4K11A 2QI2A 4C8QD 4M7AA 2LQWA 5FWCA 1K73U 1YFNA 3JB9H 2SRCA 4B6MA 1RAIB 2D1XA 2X4YA 3GF5A 4FM4B 2E41A 3RESA 3ZFJA 3OYEA 2QGFB 4LD6A 4E7ZA 4GLKA 2RJEA 4CC2A 1VQ9A 3I55T 2LJ1A 5GAOr 4C5IA 1MHNA 1FWZA 1JQQA 5CKDA 3VS6A 4KUIA 2K5IA 1N8RR 1KIKA 5A0LA 1VQ8Q 1KHIA 2RQUA 3MEAA 2DPPB 3NPFA 2F5KA 4TVRA 2VC8A 5LJ3e 1MV0B 1D1AA 4C8QC 2LX9A 1VQNQ 1IRXA 2J05A 1VQKA 1DJ7B 3V7SA 2E10A 1X27A 1BK2A 3G6EQ 4N4HA 1VQ5Q 1U3OA 1RLPC 1NG2A 3URGA 5IXBA 1Q82U 1M5Q1 5CKFA 5LJ3f 2WSCE 1SF9A 3HRSA 4M77B 4M77F 1ZSZB 4FSXA 4X9DA 1ZUKA 3C0CA 2LVMA 2MPXC 4LUEA 3OYIA 1FMWA 4BE1A 5LJ3j 2HAXA 2FPEA 3OY9A 5LJ5h 4F04B 3JB9I 3JCMe 4M75B 3CMAA 3OYLA 4QQ6A 2E6NA 3SWNA 4ZGDB 1YIJQ 1VOMA 2ZPIB 1BU1A 3OYMA 3FIFA 4B9WA 8ATCB 2GF7A 4AT1B 3J81E 2PQWA 2L2PA 2Y4XA 4OGEA 4EMKC 3QHSA 3CCSA 1M1KR 2XU8A 2L0AA 4C0DC 3KFVA 1VQ7Q 4HCZA 3OYHA 2XK0A 1M27C 4YTLA 1M1GA 4A54A 2EIFA 1VQ6A 1VIFA 3NFCA 2PU9B 2DA9A 2PVGB 4R0KA 4JS4A 4DEXA 1ZLMA 2RH2A 2YRDA 2VXEA 2EQIA 3P8DA 4GBQA 2D0QB 2DM1A 4IUUA 2CDTA 1Q7YU 1UUEA 2X3XD 5LJ3g 1YJNA 1YWOA 2RK1A 2KAFA 4M77D 3VJPA 1XQHA 2DF6A 3EFOB 1B3QA 4PJMA 1LPLA 1KC8U 2M02A 2D6FA 5GAN6 2E5KA 1ZUUA 2X9HA 4D8KA 1SKUB 3QBYA 2OTLA 1FYNA 3CCEA 1MMAA 3MEWA 2RO0A 4HVVA 4OMOA 3P8HA 1VYVA 1YJNT 3VKIA 1WA7A 1ACMB 2MK5A 3SWNB 4HXJA 4M75A 4KRTA 2C0TA 4EMHA 4E7SA 3CCMQ 1VQ4Q 1NEBA 5IH2A 1OZ2A 2CP7A 3M4GA 1VQ7A 1M1KC 1ZQ1A 2DRKA 5CKHA 4RTWA 1JBMA 2QQAA 3V7RA 5KYWB 4OF1A 5LJ3h 1YJWT 1IREB 2QA4Q 1E6HA 4IUPA 4XQ3A 4BI8B 3OYYA 3CCLQ 4QQDA 1GCQC 2XDPA 1NYFA 1W1FA 2A0FB 3EHQA 2QQ9A 4XTWA 3G4ST 3JCMV 3H41A 1GBRA 2RJDA 1ZSGA 4ZNXA 4C8QB 2QQRA 1XTDA 4RTUA 1K9AA 1WFWA 3WXMB 1AHJB 2CT3A 3A98A 1WJRA 4FIBA 4C5HA 4A4HA 2DXTA 4D6WA 3BDLA 2ZCFB 2AIRB 2X3WD 2R57A 2BKDN 3CPFA 3VYHB 2PVDB 1LJOA 2K79A 2QTXA 4O5VA 5CIUA 1SG5A 2QTVA 1N27A 3I5SA 4KBMB 2DD5A 2DYBA 1HSQA 1BKBA 1JJ2S 1E7OA 3RKWA 1Y96B 1UGSB 3QKJA 3JCMQ 2A08A 4PLIA 2RI3A 5CQYA 3ULRB 1GCPA 2ECZA 1V29B 3ME9A 1PC0A 2KXDA 2QGGA 4RTZA 1M1FA 3CPWP 1K8AC 1IHWA 2RHXA 1I5LA 3RKXA 3MP8A 3Q1JA 4PJNA 1U8RA 2FHDA 4A53A 3FDRA 1WNLA 1K73R 4OMPA 1AT1B 4BI3A 2DTIA 1X2KA 3OA6A 1OULA 1YI2T 3I55A 1LVKA 2KT8A 2ED1A 1NLOC 2AKKA 3E9FA 1YITQ 1YI2A 5D7UA 4A4KA 2EGEA 3QIIA 2CUDA 3SDZA 2C0OA 2CSQA 3F70A 2EAYA 4IUTA 4FT2A 3S3NA 2VVKA 3HFOA 4AG2C 2QA4T 3L2UA 3G6EA 1QVPA 4C92B 5GAN5 4N4GA 3CXCA 1H641 2XHCA 2YUNA 1VYTA 4XTZA 3EG2A 2EKOA 5FROA 1I5OB 1M3AA 3JCMd 2ABLA 1BI2A 1MNEA 2YUPA 2F1LA 3PGGA 5KYUB 3CCRQ 4NL3A 2X51A 1QWEA 1NJIR 1V1CA 2OX7A 2COYA 2K5FA 2LCLA 4X34A 2GGRA 2JW4A 1QVGP 2DL7A 2ZPFB 2BZ8A 4KGXB 5CR2A 2LNHB 1UJ0A 3LH0A 3CCLA 2L3SA 4UC4A 3CCQQ 3CCVQ 1KFZA 1WPYA 3OMCA 1MMGA 4C5EA 3JCMh 2HBWA 1WHGA 3JCMJ 3JB9G 1R0CB 9ATCB 2R5MA 2ED0A 3GIBA 2YXYA 1ZHIA 1OYXA 5GAOq 2O4XB 2CT4A 1UGRB 5GMKm 1KK7A 3OMGA 5I2MA 3LW5E 1UECA 5GANf 1T3SA 4A4EA 1FX7A 5CK9A 4M78A 2DD4A 2DTOA 4BY6C 5GAMj 1OPLA 4JRPA 3HPWA 2BTTA 4M7DF 2FVUA 2WACA 4IUVA 5A0GA 5LL6S 3NTIA 5FU6C 2QG9B 2M0OA 1VQLQ 1H3ZA 3M0UA 1QVFS 1UJYA 5J26A 1CSKA 1Q81U 1OZ3A 3REAB 3CD6Q 3OYCA 4OMQA 1D3BA 3CMET 2KT1A 2O01E 2QEXA 4ATOA 1YI2Q 2EQUA 1Q81R 1O9SA 1Z9ZA 1I81A 1TUGB 1RUWA 4LDYA 2LQKA 1OV3A 2IVWA 4C0FA 1X6BA 3HTRA 4HT8A 1K8AR 2MYSA 3GP8A 4BB7A 2K3YA 4DBRA 2KMTA 2SEMA 2JS0A 4MZTA 1IZ6A 2HNIA 1NLPC 3BFMA 3H9NA 5GAN4 3GLXA 3MHXA 1B7TA 2CH4W 3G71Q 4PJJA 3C94A 1VQ6Q 2YT6A 3PNWC 3OS1A 3FJPA 1PD1A 4ELZC 2H8HA 4C8QG 1GXIE 2G3RA 4V2SA 2LQNA 5KYNA 3QDFA 3CC4A 4JUVA 2JT4A 4ESRA 1RADB 3HRUA 2RJCA 3EG9A 3UT1A 2JTFA 7AT1B 1Q86R 2L5QA 3ZEHA 3CCRA 2IIMA 2OAUA 1SHFA 2DMOA 1C1AA 1QKXA 4MDWA 4M78B 2ZPHB 2HL5C 2FRYA 4J9HA 1ZBXA 4PJOB 3L2WA 2W10A 3META 3ER0A 3BDUA 4OMFB 5KE3A 1MUZA 1QCNA 4J6YA 3PIPA 1I0CA 5DM7R 3NGPA 1BI1A 3OW2P 1KQSP 1N9SA 3OYBA 1XJWB 3QUIA 5FW9A 4KGVB 4QW2A 4FW2A 3M0SA 3X20B 2MF2A 2RD1A 1K73C 1WLPB 4J9EA 1YJ9Q 4CRIA 1AWXA 3IQLA 5GMKi 3LX7A 2HSEB 2RQTA 3RR6A 3OQ5A 3CCMT 1MGQA 4J9DA 3M58A 3RMSA 4RCBA 3PIOA 3L42A 2CZ1B 4XU2A 5GMKh 2PUOB 3E19A 1R77A 3MP6A 2P0PA 2E3IA 4KH1B 3M4YA 2LP5A 2BUDA 1EX4A 2QYZA 5ECAA 4FW1A 3G71A 1AZEA 4M7AF 4C92G 4BY6B 2AT1B 1RLQC 1VQKT 2K2VA 3V8JA 3TCJA 3A1PA 3CD6A 2VB6A 1VQ9Q 4BE2A 2C06A 3CCRT 2K2MA 4JRKA 3OW2S 1KQSA 1WX6A 2BIVA 4PKCC 1BYMA 4ORZA 4HCKA 1KJWA 2RI2A 1JEGA 3LGFA 1SRMA 3M55A 4II1A 4RTXA 3O8VA 3BE3A 4JZ4A 2AZVA 3QZ5B 3ZL7C 1YJ9A 3I56Q 1X75C 2D8HA 5DLOA 5L8RE 4PFOA 2A37A 4EDUA 5LJ3d 2LT1A 4M77G 2K5LA 2LZ6B 5GAOl 1ZSZC 2HQEA 5KYUA 1T3LA 3MEUA 1ZX6A 1PD0A 1VQOA 1G3TA 4M7DG 3JAME 5CVIA 4IIMA 1N5ZA 1Q7YR 4OMMA 2MWOA 3BY7A 1G8XA 1BIBA 1R8OB 3OSSC 3D7SB 4XTUA 2WSFE 4Q5WA 3OYJA 4PFPA 1N8RU 1YJWQ 4XU1A 2COWA 3V7CA 4P5NA 4ZN3A 1MNDA 4F14A 3TU4K 4Y92A 4ME7A 3I56A 1VQMQ 1YHQA 1A0NB 4E2FB 4XTXA 1JJ2A 2GQVA 2GFAA 4DOWA 1WQWA 2FZKB 2CZ7B 2GBQA 2HMAA 5GAMd 4NL2A 2EWNA 4XU0A 3CXCS 4CC3A 2KBTA 2E65A 1Y57A 1X43A 1M8VA 1BCOA 4PL6A 4LDUA 4X9CA 4C0DB 2V1QA 5CKEA 5IXFA 1WXTA 5IT9E 3A8LB 4Z8AA 2RA2A 1KQ2A 1UHFA 1WDXA 4JRIA 3CCVA 2LX7A 1AOJA 4F7UA 4RTYA 2E6ZA 4C92E 1QCOA 1K1ZA 1TH7A 5GAOn 2IG0A 3X24B 2KROA 4WCIA 4NOYA 5KYXA 1N8RC 3FC3A 1M90R 3JCMc 4C5GA 1WXUA 4F7UB 2RMOA 4NS5A 1M3CA 2JTEA 4X1VA 2MWPA 5IN1A 1PRLC 2Y90A 4OMNA 3QYHB 1G83A 3KUFA 2F2WA 4OB1B 5GAOm 1OQKA 2LT4A 1FMKA 1I8FA 3SFMA 1ABQA 3QYGB 1QMCA 4ZN1A 3M56A 2GQIA 2JUFA 3HP9A 1M1KU 4OB2B 1NPRA 4M78G 5DY9A 1Y96A 3JCMX 5GMKj 1X2QA 2ZAEA 3EFOA 2YLBA 3GNFB 3DLMA 2JZ2A 1BBZA 1MMDA 2CP6A 3EH2A 5KYXB 3RDVA 3A8MB 1VA7A 3X26B 1UFFA 2XMFA 4M7DE 1YITT 2KXCA 1UGQB 2EQJA 4J6WA 2FL7A 1PG5B 2YRCA 3EHRA 3CC2A 2EPDA 3L2ZA 1X6GA 3EG1A 3OS5A 1Y0MA 4C8QA 1Z9QA 2RM4A 1VUBA 4QQGA 1PCXA 4AFZC 2EJ9A 1HD3A 2ATCB 1VQ4T 1RI0A 2ENMA 2X4JA 2RHIA 5A2QE 4Y91A 2FPFA 2YRVA 1VQ9T 2GTOA 5IHIA 5GANe 1X6OA 2Y4YA 2KYBA 1Q7YC 2PTKA 1UGVA 1CKAA 1YIJT 1I4K1 4DBQA 1WHMA 1E6GA 4M7DC 1AWWA 4JDSA 3THKA 2VGNA 2M51A 1PSFA 3P8BB 2AK5A 2O9VA 2X4WA 4HVWA 1YCSB 1D0ZA 3CC4Q 2RN8A 2A7YA 1N9RA 3CC2Q 1X01A 8AT1B 3EFRA 4XU3A 3JCMW 2QK0A 1TWBA 1YJ9T 2D0NA 5CKBA 2OI3A 1RAAB 3CMEQ 3I5RA 1T0JA 2B86A 2DFUA 2D8JA 5GANg 3A8HB 2KGTA 1QP3A 1KQSS 2QASA 4LDWA 4JJBA 3M5AA 1C6VX 2KEAA 5GAMf 1IO6A 1U5SA 1AZGB 4IIOA 5LJ5j 2DEQA 2DLPA 2LTOA 2DVJA 2DNUA 3EH1A 3R6NA 2GTJA 3G4SQ 4RKUE 4JRQA 2E3HA 3G7ZA 5KYYB 2HSPA 2YDLA 2E5QA 2DE0X 3CCQA 4L59A 4PJOC 3CC2T 2P0KA 3I9QA 3M9QA 1WYXA 1VQMT 4RG2A 3FB9A 3GOXA 2JS2A 1VIEA 4HCBA 1YN8A 4L5GA 2OTLQ 1JU5C 1Y07A 2HBPA 5GAN2 1MMNA 2ZZDA 4OGCA 3A5ZB 1JRIA 3M0TA 2DYIA 3VU3C 1RL2A 3N5BB 4JZ3A 4AG1C 3CCQT 2CYZB 4QT7A 1KQ1A 2ZPGB 4Z88A 3VS1A 1YWPA 3JV3A 2J6FA 1ZA1B 5HK3A 4A4GA 4EPCA 3JCMP 4FL6A 1YJWA 1W4SA 3I35A 2DTHA 2V8IA 2PUKB 2F5TX 3OYGA 4M7AB 2A36A 2LCCA 1Y71A 3HHTB 3X28B 4FYWB 1QP2A 3G4SA 2PNIA 1PHTA 4M7AD 1Q81C 1PKSA 5GAMg 3QSUA 2EW3A 2YUQA 5GJWB 3H8ZA 1NBEB 2MCNA 4JJDA 1I07A 3UPUA 2FRWA 3GBQA 3NMZC 2CS7A 2M16A 2XDBA 2WSEE 1VQ5T 4M75D 3OW2A 4D8DA 2VV5A 3J80E 4O6JA 3MP1A 1QVGS 2CKKA 3MEVA 3QXEB 3HL8A 1RACB 1OX8A 3EG0A 1BI0A 2NUPA 1BI3A 3PVQA 1F1BB 3C4SA 2VASA 1W2BA 2OJ2A 4JJCA 1YHQQ 1RI9A 4RG8A 5I2SA 3DB4A 3CC7T 2MMPA 3AHUA 2RI5A 1HXDA 4PNOA 2LMJA 2LCSA 2EFIA 1VQKQ 4OVAA 5D6XA 2E4HA 3EGXB 2XIDA 4FU6A 4WF2A 3G71T 3VS5A 1Q86U 1TUDA 2MI6A 3EGXA 3UDCA 3MO8A 1U1TA 1Q82R 1NM7A 1K9MR 1IHVA 2CREA 5HY6A 1OEBA 1WHLA 2M9UA 3EFSA 4BACA 1UB4A 2DL3A 4VUBA 3L1AA 1VQNA 2NWMA 3PFSA 2R58A 2K3BA 3M0RA 5IAYA 2YWWA 2D9TA 4KULA 4KT0E 3OBWA 2YHTA 1W2BS 1WQ7A 3PMTA 1H8KA 2K7AA 3NTKA 4C8QE 4HA8A 2QEXT 1NJIC 4JJNK 3CMAQ 3VS7A 1SSFA 2LDMA 4J6XA 4EIKA 5D6YA 4J9CA 4F7UG 3T9NA 4PJOG 1KC8R 2I2LA 4FCYA 5GAOp 3CEYA 5GMKe 5C0MA 2LC4A 4M77C 2O31A 1TS9A 4M77A 1BB9A 5CCAA 6AT1B 2LQ8A 5GANd 5D6WA 2DETA 2CP2A 2CSIA 3A8OB 1K8AU 2KYMA 1M2OA 3TREA 1B34A 2K57A 3CC7A 5CO7A 4C92A 4IKFA 2E12A 1VQPT 1I1JA 3WVDB 2RQRA 5LJ5e 1WZOA 4M7AE 2DEUA 2LJ3A 3V8KA 2F2XA 2FPDA 1K9MC 2DL4A 2MIOA 1GBQA 5GAN7 4HT9A 1JJ2P 2FO0A 2FYKA 3VV0A 4M7DD 1BCMA 3R6OA 1WXBA 3CCLT 3G6ET 4M7DA 2RB6A 3CCEQ 1BIAA 2KI7A 3QWXX 3L2RA 2OTJA 1WHJA 2L3RA 4J9FA 3UATA 3VS3A 2V1RA 4M75G 4LN2A 3CXCP 1AEYA 5A0DA 4PK4A 4LD9K 4WTOB 1G3SA 1TU0B 3EG9B 2CP3A 3VS4A 1WHHA 5IHKA 1OU8A 2HQHA 2XI9A 4L6V5 2NUTB 3OS0A 2HD0A 4M7AC 1W70A 3FRNA 2Z0WA 2C0IA 1K9MU 4J7IA 3JB9J 2DIQA 3HFNA 1HYOA 1UEBA 1TSFA 4MMLA 4XAXB 2CH4A 3QG1A 4J9BA 4FSSA 2EQKA 1RAHB 1SEMA 1GFDA 1VQMA 1VQOQ 1OX9A 3CBPA 2JVVA 1QKWA 3EGDA 2J6KA 5M9OA 1WI7A 1Q95G 2KQWA 1V76A 3DB3A 2XD0A 4MDXA 3E1SA 3FJ5A 4C92C 3FLGA 5GAN3 5FRMA 2DK3A 1TTHB 4ANJA 3DLLA
chains in the Genus database with same CATH topology
1UFFA 2YUNA 2XMFA 3PE0A 2L3PA 2RNAA 1VYTA 3EG2A 2KXCA 1TG0A 1M3AA 3EHRA 2ABLA 2EPDA 2YUPA 1UHCA 2J7IA 1PWTA 1X6GA 1QWEA 2K9GA 3EG1A 2KR3A 1V1CA 1GL5A 1Y0MA 2VWFA 1Z9QA 2GGRA 2JW4A 2A28A 1NEGA 1M3BA 1ZUYA 5GJVB 4AFZC 2RQVA 3H0FA 1HD3A 2CUBA 2DL7A 2OAWA 2ENMA 2BZ8A 4F17A 2FPFA 1PNJA 2LNHB 1WIEA 1UJ0A 1AVZC 1JXOA 2L3SA 1K76A 3RBBB 2DX1A 3H0HA 1KFZA 2O9SA 2O2OA 2GTOA 5IHIA 5I11A 2KYBA 3UA7A 1PKTA 1JO8A 1YNZA 2PTKA 1UGVA 2HBWA 2YUOA 1CKAA 4AFSC 1GCQA 4RTVA 1E6GA 2ED0A 1AWWA 3THKA 2W0ZA 2DBKA 2M51A 2CT4A 2DJQA 2AK5A 2O9VA 4HVWA 1YCSB 4E6RA 1UECA 5IHNA 1T3SA 2RN8A 1GRIA 2VKNA 2EYYA 4HVUA 4OMLA 2DRMA 1OPLA 2M0YA 4M4ZA 2BTTA 2D0NA 2OI3A 1CKBA 1W6XA 3I5RA 1T0JA 2B86A 2D8JA 2KGTA 3SHWA 3M0UA 2FEIA 1UJYA 4J9GA 4JJBA 3VS2A 2L3QA 4LE9A 1K0SA 2ROLA 1CSKA 3REAB 2KEAA 1IO6A 4OMQA 3UF4A 2EKHA 1U5SA 4LNPA 1YP5A 1AZGB 2DL5A 4IIOA 2KRMA 2DLPA 4K11A 2EYZA 2KT1A 2DVJA 2DNUA 2RQWA 3R6NA 1SPKA 1U06A 1JXMA 2GTJA 2LQWA 5FWCA 2PZ1A 3REBB 2SRCA 2D1XA 2KRSA 2HSPA 2YDLA 2NUZA 1Z9ZA 1G2BA 2DE0X 1RUWA 1OV3A 4CC2A 3I9QA 1WYXA 1X6BA 3PVLA 2LJ1A 4RTTA 1JQQA 3VS6A 1KIKA 5I22A 2JS2A 2RQUA 3TVTA 2SEMA 3NPFA 1OOTA 2G6FX 1YN8A 1UE9A 1JU5C 2JS0A 1QLYA 2KE9A 1MV0B 1NLPC 1H3HA 2CH4W 2J6OA 2YT6A 2J05A 3TSWA 3M0TA 2JMAA 1UDLA 1X27A 1BK2A 4JZ3A 4AG1C 2H8HA 4QT7A 1U3OA 4Z88A 1RLPC 2LQNA 1NG2A 3VS1A 5IXBA 5FWBA 1YWPA 3JV3A 2J6FA 2JT4A 4ESRA 3I35A 2P4RA 1GFCA 3O5ZA 2IIMA 1K4US 1SHFA 2A36A 2DMOA 1ZUKA 2RPNA 1QKXA 3C0CA 1M8MA 4LUEA 2FRYA 3LH5A 4J9HA 2FPEA 3RNJA 2HDAA 2W10A 1SRLA 2I0NA 2PNIA 1PHTA 1ZBJA 2AZSA 4CC7A 1PKSA 1BU1A 2EW3A 2AKLA 2YUQA 2HEQA 1MUZA 5GJWB 2MCNA 1I0CA 4A63B 4JJDA 3NGPA 1I07A 2L2PA 2FRWA 5HCKA 3GBQA 5FW9A 3NMZC 2JMCA 2L0AA 1OPKA 2J06A 3KFVA 1NYGA 4RUGA 2ROTA 1B07A 3M0SA 1M27C 4D8DA 5EC7A 4LUDA 2DBMA 1WLPB 2DA9A 4J9EA 1S1NA 1K0XA 2RF0A 2GNCA 1AWXA 3EG0A 3IQLA 4R0KA 3NHNA 1HJDA 4DEXA 1ARKA 3PVQA 1ZLMA 2RQTA 2EQIA 4GBQA 2DM1A 2CDTA 2OJ2A 4J9DA 4JJCA 1RI9A 2EGAA 2MOXA 1UUEA 2X3XD 1YWOA 2LMJA 2LCSA 1UG1A 3M0QA 2DF6A 2FG0A 3M0PA 3U23A 1B3QA 2LP5A 1EFNA 3VS5A 1TUDA 5ECAA 2E5KA 1AZEA 1ZUUA 4F16A 4D8KA 1NM7A 3TSZA 2CREA 4Z89A 3H0IA 1LCKA 1OEBA 1RLQC 2DILA 1FYNA 1AD5A 1SSHA 2DL3A 1SHGA 4HVVA 4OMOA 1PRMC 1VYVA 2LJ0A 2K2MA 2NWMA 2BZXA 3VRYA 1WX6A 2K3BA 1WA7A 4ORZA 4HCKA 3M0RA 1KJWA 1JEGA 1XOVA 1SRMA 4HXJA 3SEMA 1ABOA 3QWYA 4KRTA 2C0TA 4RTXA 4JZ4A 2AZVA 1H8KA 2K7AA 2F2VA 3ZL7C 1NEBA 2D8HA 5IH2A 1TUCA 3EG3A 2A37A 3VS7A 4EIKA 2DRKA 4J9CA 2EVRA 4RTWA 2LZ6B 3CQTA 1E6HA 1T3LA 4GLMA 1ZX6A 1UTIA 1H92A 2O31A 1M30A 4IIMA 1N5ZA 1BB9A 1GCQC 2DL8A 4OMMA 1AWJA 1NYFA 1W1FA 3EHQA 1QWFA 2CSIA 3H41A 1GBRA 2KYMA 1ZSGA 4ZNXA 4CC4B 4RTUA 2O88A 1AWOA 1K9AA 2JXBA 4AFQC 1WFWA 2JM8A 2CT3A 3A98A 4F14A 4Y92A 1I1JA 1MV3A 2RQRA 1A0NB 2X3WD 2EGCA 2QDLA 2LJ3A 2K79A 2BZYA 2GBQA 2F2XA 2FPDA 2ESWA 2DL4A 2MIOA 1GBQA 3I5SA 2FO0A 1KSWA 4CC3A 2KBTA 2DYBA 2KNBB 1WXBA 1X43A 1Y57A 3EGUA 1HSQA 1E7OA 2V1QA 4DEYA 3QWXX 3VS0A 5IXFA 1WXTA 4Z8AA 2A08A 1UHFA 4J9FA 3UATA 1WDXA 3VS3A 2V1RA 1X69A 3ULRB 2LX7A 1AOJA 1GCPA 2ECZA 4LN2A 1J3TA 4RTYA 1AEYA 4JPBW 1K1ZA 2KXDA 3VS4A 2K6DA 5IHKA 2KROA 4RTZA 1QCFA 4WCIA 2JM9A 3VRZA 1W70A 4J9IA 1WXUA 2RMOA 1M3CA 2JTEA 2C0IA 4X1VA 3UA6A 1PRLC 2HCKA 4OMNA 2YSQA 1VYUA 2CH4A 4OMPA 2EYXA 1G83A 4J9BA 4FSSA 2F2WA 1X2KA 1SEMA 1GFDA 1FMKA 2EBPA 1ABQA 5L23A 2KT8A 2ED1A 1QKWA 2GQIA 1NLOC 2AKKA 2J6KA 1WI7A 2EGEA 2KRNA 2CUDA 2C0OA 2CSQA 3FJ5A 4AFUC 1X2QA 1T0HA 2EYWA 1BBZA 2VVKA 4AG2C 1VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFF A;  2YUN A;  2XMF A;  3PE0 A;  2L3P A;  2RNA A;  1VYT A;  3EG2 A;  2KXC A;  1TG0 A;  1M3A A;  3EHR A;  2ABL A;  2EPD A;  2YUP A;  1UHC A;  2J7I A;  1PWT A;  1X6G A;  1QWE A;  2K9G A;  3EG1 A;  2KR3 A;  1V1C A;  1GL5 A;  1Y0M A;  2VWF A;  1Z9Q A;  2GGR A;  2JW4 A;  2A28 A;  1NEG A;  1M3B A;  1ZUY A;  5GJV B;  4AFZ C;  2RQV A;  3H0F A;  1HD3 A;  2CUB A;  2DL7 A;  2OAW A;  2ENM A;  2BZ8 A;  4F17 A;  2FPF A;  1PNJ A;  2LNH B;  1WIE A;  1UJ0 A;  1AVZ C;  1JXO A;  2L3S A;  1K76 A;  3RBB B;  2DX1 A;  3H0H A;  1KFZ A;  2O9S A;  2O2O A;  2GTO A;  5IHI A;  5I11 A;  2KYB A;  3UA7 A;  1PKT A;  1JO8 A;  1YNZ A;  2PTK A;  1UGV A;  2HBW A;  2YUO A;  1CKA A;  4AFS C;  1GCQ A;  4RTV A;  1E6G A;  2ED0 A;  1AWW A;  3THK A;  2W0Z A;  2DBK A;  2M51 A;  2CT4 A;  2DJQ A;  2AK5 A;  2O9V A;  4HVW A;  1YCS B;  4E6R A;  1UEC A;  5IHN A;  1T3S A;  2RN8 A;  1GRI A;  2VKN A;  2EYY A;  4HVU A;  4OML A;  2DRM A;  1OPL A;  2M0Y A;  4M4Z A;  2BTT A;  2D0N A;  2OI3 A;  1CKB A;  1W6X A;  3I5R A;  1T0J A;  2B86 A;  2D8J A;  2KGT A;  3SHW A;  3M0U A;  2FEI A;  1UJY A;  4J9G A;  4JJB A;  3VS2 A;  2L3Q A;  4LE9 A;  1K0S A;  2ROL A;  1CSK A;  3REA B;  2KEA A;  1IO6 A;  4OMQ A;  3UF4 A;  2EKH A;  1U5S A;  4LNP A;  1YP5 A;  1AZG B;  2DL5 A;  4IIO A;  2KRM A;  2DLP A;  4K11 A;  2EYZ A;  2KT1 A;  2DVJ A;  2DNU A;  2RQW A;  3R6N A;  1SPK A;  1U06 A;  1JXM A;  2GTJ A;  2LQW A;  5FWC A;  2PZ1 A;  3REB B;  2SRC A;  2D1X A;  2KRS A;  2HSP A;  2YDL A;  2NUZ A;  1Z9Z A;  1G2B A;  2DE0 X;  1RUW A;  1OV3 A;  4CC2 A;  3I9Q A;  1WYX A;  1X6B A;  3PVL A;  2LJ1 A;  4RTT A;  1JQQ A;  3VS6 A;  1KIK A;  5I22 A;  2JS2 A;  2RQU A;  3TVT A;  2SEM A;  3NPF A;  1OOT A;  2G6F X;  1YN8 A;  1UE9 A;  1JU5 C;  2JS0 A;  1QLY A;  2KE9 A;  1MV0 B;  1NLP C;  1H3H A;  2CH4 W;  2J6O A;  2YT6 A;  2J05 A;  3TSW A;  3M0T A;  2JMA A;  1UDL A;  1X27 A;  1BK2 A;  4JZ3 A;  4AG1 C;  2H8H A;  4QT7 A;  1U3O A;  4Z88 A;  1RLP C;  2LQN A;  1NG2 A;  3VS1 A;  5IXB A;  5FWB A;  1YWP A;  3JV3 A;  2J6F A;  2JT4 A;  4ESR A;  3I35 A;  2P4R A;  1GFC A;  3O5Z A;  2IIM A;  1K4U S;  1SHF A;  2A36 A;  2DMO A;  1ZUK A;  2RPN A;  1QKX A;  3C0C A;  1M8M A;  4LUE A;  2FRY A;  3LH5 A;  4J9H A;  2FPE A;  3RNJ A;  2HDA A;  2W10 A;  1SRL A;  2I0N A;  2PNI A;  1PHT A;  1ZBJ A;  2AZS A;  4CC7 A;  1PKS A;  1BU1 A;  2EW3 A;  2AKL A;  2YUQ A;  2HEQ A;  1MUZ A;  5GJW B;  2MCN A;  1I0C A;  4A63 B;  4JJD A;  3NGP A;  1I07 A;  2L2P A;  2FRW A;  5HCK A;  3GBQ A;  5FW9 A;  3NMZ C;  2JMC A;  2L0A A;  1OPK A;  2J06 A;  3KFV A;  1NYG A;  4RUG A;  2ROT A;  1B07 A;  3M0S A;  1M27 C;  4D8D A;  5EC7 A;  4LUD A;  2DBM A;  1WLP B;  2DA9 A;  4J9E A;  1S1N A;  1K0X A;  2RF0 A;  2GNC A;  1AWX A;  3EG0 A;  3IQL A;  4R0K A;  3NHN A;  1HJD A;  4DEX A;  1ARK A;  3PVQ A;  1ZLM A;  2RQT A;  2EQI A;  4GBQ A;  2DM1 A;  2CDT A;  2OJ2 A;  4J9D A;  4JJC A;  1RI9 A;  2EGA A;  2MOX A;  1UUE A;  2X3X D;  1YWO A;  2LMJ A;  2LCS A;  1UG1 A;  3M0Q A;  2DF6 A;  2FG0 A;  3M0P A;  3U23 A;  1B3Q A;  2LP5 A;  1EFN A;  3VS5 A;  1TUD A;  5ECA A;  2E5K A;  1AZE A;  1ZUU A;  4F16 A;  4D8K A;  1NM7 A;  3TSZ A;  2CRE A;  4Z89 A;  3H0I A;  1LCK A;  1OEB A;  1RLQ C;  2DIL A;  1FYN A;  1AD5 A;  1SSH A;  2DL3 A;  1SHG A;  4HVV A;  4OMO A;  1PRM C;  1VYV A;  2LJ0 A;  2K2M A;  2NWM A;  2BZX A;  3VRY A;  1WX6 A;  2K3B A;  1WA7 A;  4ORZ A;  4HCK A;  3M0R A;  1KJW A;  1JEG A;  1XOV A;  1SRM A;  4HXJ A;  3SEM A;  1ABO A;  3QWY A;  4KRT A;  2C0T A;  4RTX A;  4JZ4 A;  2AZV A;  1H8K A;  2K7A A;  2F2V A;  3ZL7 C;  1NEB A;  2D8H A;  5IH2 A;  1TUC A;  3EG3 A;  2A37 A;  3VS7 A;  4EIK A;  2DRK A;  4J9C A;  2EVR A;  4RTW A;  2LZ6 B;  3CQT A;  1E6H A;  1T3L A;  4GLM A;  1ZX6 A;  1UTI A;  1H92 A;  2O31 A;  1M30 A;  4IIM A;  1N5Z A;  1BB9 A;  1GCQ C;  2DL8 A;  4OMM A;  1AWJ A;  1NYF A;  1W1F A;  3EHQ A;  1QWF A;  2CSI A;  3H41 A;  1GBR A;  2KYM A;  1ZSG A;  4ZNX A;  4CC4 B;  4RTU A;  2O88 A;  1AWO A;  1K9A A;  2JXB A;  4AFQ C;  1WFW A;  2JM8 A;  2CT3 A;  3A98 A;  4F14 A;  4Y92 A;  1I1J A;  1MV3 A;  2RQR A;  1A0N B;  2X3W D;  2EGC A;  2QDL A;  2LJ3 A;  2K79 A;  2BZY A;  2GBQ A;  2F2X A;  2FPD A;  2ESW A;  2DL4 A;  2MIO A;  1GBQ A;  3I5S A;  2FO0 A;  1KSW A;  4CC3 A;  2KBT A;  2DYB A;  2KNB B;  1WXB A;  1X43 A;  1Y57 A;  3EGU A;  1HSQ A;  1E7O A;  2V1Q A;  4DEY A;  3QWX X;  3VS0 A;  5IXF A;  1WXT A;  4Z8A A;  2A08 A;  1UHF A;  4J9F A;  3UAT A;  1WDX A;  3VS3 A;  2V1R A;  1X69 A;  3ULR B;  2LX7 A;  1AOJ A;  1GCP A;  2ECZ A;  4LN2 A;  1J3T A;  4RTY A;  1AEY A;  4JPB W;  1K1Z A;  2KXD A;  3VS4 A;  2K6D A;  5IHK A;  2KRO A;  4RTZ A;  1QCF A;  4WCI A;  2JM9 A;  3VRZ A;  1W70 A;  4J9I A;  1WXU A;  2RMO A;  1M3C A;  2JTE A;  2C0I A;  4X1V A;  3UA6 A;  1PRL C;  2HCK A;  4OMN A;  2YSQ A;  1VYU A;  2CH4 A;  4OMP A;  2EYX A;  1G83 A;  4J9B A;  4FSS A;  2F2W A;  1X2K A;  1SEM A;  1GFD A;  1FMK A;  2EBP A;  1ABQ A;  5L23 A;  2KT8 A;  2ED1 A;  1QKW A;  2GQI A;  1NLO C;  2AKK A;  2J6K A;  1WI7 A;  2EGE A;  2KRN A;  2CUD A;  2C0O A;  2CSQ A;  3FJ5 A;  4AFU C;  1X2Q A;  1T0H A;  2EYW A;  1BBZ A;  2VVK A;  4AG2 C;  1VA7 A; 
#chains in the Genus database with same CATH topology
 3UWN A;  2ZPB B;  3NTH A;  4LDX A;  1D3B B;  1JB0 E;  3MPU B;  3PE0 A;  5EG2 A;  1OI1 A;  2L3P A;  2RNA A;  5KE2 A;  1KD1 U;  1PSE A;  1G3W A;  3RKY A;  2VXF A;  1PWT A;  3SWN C;  5C6S A;  3CCJ Q;  1PM3 A;  2KR3 A;  5KCH A;  1KD1 R;  4J5Y A;  3M54 A;  2VWF A;  3CME A;  4ZTF A;  2DZ9 A;  1KC8 C;  2X35 A;  2A28 A;  1NEG A;  2P84 A;  1ZUY A;  4OP0 A;  3H0F A;  2OAW A;  5KYW A;  2NUP B;  4DBF A;  3CC4 T;  1PNJ A;  1W2B P;  1WIE A;  1JXO A;  3RBB B;  3CC7 Q;  3H0H A;  2O2O A;  1YBY A;  3JSC A;  3QO3 A;  1JO8 A;  1YNZ A;  2YUO A;  4LDV A;  5GAM h;  2ZPE B;  4AFS C;  4RTV A;  2KVQ G;  4N0A A;  2W0Z A;  4J7F A;  2AHJ B;  1EZZ B;  4FT4 A;  3JCM b;  4E6R A;  3QZ9 B;  2BE9 B;  4CI0 C;  2QAZ A;  2EYY A;  5J39 A;  2DRM A;  2H3E B;  4EMK A;  4E47 A;  3AT1 B;  4M4Z A;  1R0B G;  5FU6 B;  2DZC A;  2OTL T;  2CP5 A;  2CZ0 B;  2PVO B;  5GAM e;  1NPP A;  2L89 A;  3ASK A;  4A4F A;  2O4X A;  3JRZ A;  3OYA A;  3CCS Q;  3SHW A;  2FEI A;  1RAE B;  4BE0 A;  1YHQ T;  4J9G A;  4M75 F;  2L3Q A;  1K0S A;  4M77 E;  4RCC A;  4PJO F;  3OYD A;  2EYQ A;  4QKU A;  4HCC A;  3UF4 A;  4BDY A;  1UGP B;  4BUG A;  1VQ5 A;  4LNP A;  2JNG A;  2DL5 A;  2KRM A;  4BD3 A;  2EYZ A;  2RQW A;  3M59 A;  1SPK A;  1U06 A;  1JXM A;  2PZ1 A;  3REB B;  2XG8 D;  1O75 A;  4E7H A;  2KRS A;  2NUZ A;  1G2B A;  2LRQ A;  1S72 A;  3VYG A;  4EMG A;  2KY9 A;  2DER A;  3PVL A;  4RTT A;  1Q82 C;  2R5A A;  2RK2 A;  1QQJ A;  3LWH A;  5I22 A;  5FU7 C;  1VQP A;  1M2V A;  3TVT A;  1IB8 A;  4F7U F;  2DXC A;  1OOT A;  3OYK A;  2QQS A;  2G6F X;  1UE9 A;  4B9X A;  1QLY A;  2KE9 A;  2HKQ B;  2X4X A;  2M1H A;  1H3H A;  2J6O A;  1EIF A;  3TSW A;  2JMA A;  1UDL A;  4OB0 B;  1QVG A;  4KUD K;  2XDD A;  1S72 T;  3ZBD A;  3TEE A;  4JS5 A;  5FWB A;  3I56 T;  1FMV A;  4M78 D;  2P4T A;  2VGM A;  4GY5 A;  1QW1 A;  1YJN Q;  4M78 C;  2P4R A;  2NUT A;  1GFC A;  3O5Z A;  4N0A C;  1K4U S;  1VQN T;  1WJS A;  2KK4 A;  2RPN A;  3GNG A;  1M8M A;  4E7L A;  3CBM A;  3LH5 A;  3RMQ A;  3RNJ A;  3DKM A;  1VQ8 A;  2DIG A;  2HDA A;  5FU7 B;  1SRL A;  1OU9 A;  2I0N A;  1ZBJ A;  2AZS A;  4CC7 A;  5J3B A;  1VQ8 T;  2BE7 D;  2AKL A;  3CMA T;  4QVC A;  2HEQ A;  4J8O A;  4A63 B;  3OBY A;  1VQO T;  5GAN 8;  5HCK A;  3JCM f;  3SB2 A;  3LYI A;  1M4Z A;  2JMC A;  5I21 A;  4R55 A;  1OPK A;  2J06 A;  4C0Z A;  1NYG A;  4RUG A;  2ROT A;  1B07 A;  3RUX A;  2FZC B;  1U1S A;  3J7A F;  2K3X A;  5EC7 A;  4LUD A;  2GCX A;  2VYT A;  4M78 E;  2DBM A;  4ZGJ B;  5LJ5 f;  3HKS A;  2A3L A;  2DJZ A;  1S1N A;  2DO3 A;  5KH6 A;  1K0X A;  2RF0 A;  2GNC A;  4C8Q F;  3NHN A;  4LXC A;  1HJD A;  1ARK A;  1M90 C;  3GPL A;  1KHC A;  4PLL A;  1B34 B;  3MJX A;  3VUB A;  5HKC A;  3CPW A;  2B8A A;  1M2V B;  2OTJ T;  5KCO A;  2EGA A;  2MOX A;  5FRN A;  2QEX Q;  1VQL A;  1VQP Q;  3PTA A;  3PT9 A;  4DA4 A;  2JOY A;  2COZ A;  1UG1 A;  3M0Q A;  3OB9 A;  2XIC A;  4J83 A;  5LJ5 g;  1WGS A;  1N6A A;  3M57 A;  3HSB A;  1IGU A;  2FG0 A;  3M0P A;  3U23 A;  3E9G A;  1EFN A;  2EQM A;  2DVE A;  3WVE B;  4F16 A;  1TXQ A;  2GFU A;  2JJ9 A;  3TSZ A;  1G5V A;  4QVD A;  4Z89 A;  3H0I A;  4Z02 A;  2DXU A;  1LCK A;  2DIL A;  3CCV T;  1AD5 A;  1SSH A;  3VUZ A;  4IUQ A;  1SHG A;  5HK0 A;  1P92 A;  1PRM C;  2LJ0 A;  4MZP A;  2HQX A;  1YCY A;  4N4I A;  4OB3 B;  3KXT A;  1KD1 C;  2BZX A;  3VRY A;  3CCU Q;  2DXB A;  2HL3 A;  2RJF A;  2RHZ A;  1XOV A;  1YIJ A;  3SEM A;  1ABO A;  3QWY A;  3JB9 F;  4PJO A;  5GMK l;  2JTM A;  2F2V A;  3SD4 A;  4PJO D;  1TUC A;  4XK8 E;  3TQ7 P;  3EG3 A;  1LNX A;  3V8L A;  2EVR A;  4E7I A;  1D0X A;  3CCS T;  4FYV B;  3A8G B;  4R56 A;  3QJY A;  3L2Q A;  3CQT A;  2KDS A;  1WHK A;  4GLM A;  1UTI A;  1H92 A;  2ZGW A;  4XTV A;  1M30 A;  1D1C A;  2DL8 A;  3JB9 D;  3EAE A;  1AWJ A;  2DAQ A;  2MAM A;  4MZM A;  4HKE A;  1QWF A;  2EJG A;  5CAI A;  3LWI A;  4C92 D;  1YIT A;  5AYF A;  1RAG B;  4CC4 B;  1D09 B;  2O88 A;  1AWO A;  2JXB A;  2K4Y A;  4AFQ C;  3L2V A;  3QPH A;  2JM8 A;  1VQL T;  2E64 A;  2V8J A;  1MV3 A;  4BI4 A;  3I55 Q;  3EGD B;  4M7D B;  2EGC A;  2IPO B;  2QDL A;  4PJL A;  4Y28 E;  3H6Z A;  4IUR A;  4MMK A;  1C0M A;  3S6W A;  2BZY A;  2ESW A;  1VQ6 T;  2F69 A;  4M78 F;  2LNV A;  1KSW A;  1TOV A;  3C95 A;  1QVF P;  2KNB B;  3EGU A;  5AT1 B;  4E7K A;  4DEY A;  3CCJ A;  3VS0 A;  2RHY A;  3QJ6 A;  1LOJ A;  4KH0 B;  1X69 A;  3KBG A;  2V8K A;  4AMC A;  1J3T A;  3BW1 A;  4JPB W;  2VUB A;  2NLU A;  3HRT A;  2K6D A;  1QCF A;  4M75 C;  4DOV A;  2JM9 A;  2DKG A;  3VRZ A;  4PFZ A;  2QXF A;  2FB7 A;  4J9I A;  1Y7X A;  1VQ4 A;  3OSV A;  3UA6 A;  2HCK A;  3CCJ T;  4ELY C;  3CCU T;  3S3O A;  4PJO E;  4EMK B;  2HKN A;  4M7A G;  2YSQ A;  1VYU A;  2EYX A;  4JLG A;  4KGZ B;  1ZSZ A;  3CCM A;  3S3M A;  2EBP A;  5L23 A;  3C12 A;  1IGQ A;  3FEO A;  3OYN A;  2QDY B;  3LLR A;  1M9S A;  3QDR B;  5DLQ E;  2KRN A;  2NYS A;  1QVF A;  2V26 A;  3OYF A;  4AFU C;  3M53 A;  5CQX A;  1T0H A;  2EYW A;  2L8D A;  4M75 E;  3CCU A;  3LGL A;  2H3J A;  2OTJ Q;  2CGH A;  2RHU A;  5KYY A;  1TG0 A;  1IXD A;  1D1B A;  3MKD A;  2YLC A;  5FLX E;  2E1H A;  1XNI A;  2KSS A;  5GAN h;  4DBH A;  1UHC A;  2J7I A;  1FXX A;  3PMI A;  2K9G A;  1G3Y A;  2E70 A;  1GL5 A;  1NJI U;  4RMO A;  1Q86 C;  1M3B A;  2QA4 A;  5GJV B;  2RQV A;  3CCE T;  2CUB A;  2QQB A;  4F17 A;  3CD6 T;  4JLI A;  1AVZ C;  1K76 A;  2DX1 A;  1S72 Q;  2EJF A;  2O9S A;  3CPW S;  4E7J A;  5I11 A;  3UA7 A;  1PKT A;  1NZ9 A;  2JN0 A;  1GCQ A;  1WJQ A;  3JCM g;  1HK9 A;  3E2U A;  2XKO C;  2DBK A;  1M90 U;  2CP0 A;  2DJQ A;  4DQ2 A;  1ZA2 B;  1RAF B;  2HZY A;  4F7U E;  4BDZ A;  3G1J A;  5IHN A;  1GRI A;  1RAB B;  3INZ A;  2VKN A;  1VQ7 T;  4HVU A;  3X25 B;  4ZTJ A;  4OML A;  3MCA B;  2M0Y A;  5LJ5 d;  2CZ6 B;  4FYX B;  1D0Y A;  3RER A;  1CKB A;  1W6X A;  3OS2 A;  1NE8 A;  4C92 F;  4ZGE B;  3VS2 A;  4LE9 A;  2ROL A;  2P0Q A;  3RIR A;  4C0G A;  1KG1 A;  3CBO A;  4XTY A;  2EKH A;  2FZG B;  4QVZ A;  4FYY B;  1YP5 A;  5GAN j;  4K11 A;  2QI2 A;  4C8Q D;  4M7A A;  2LQW A;  5FWC A;  1K73 U;  1YFN A;  3JB9 H;  2SRC A;  4B6M A;  1RAI B;  2D1X A;  2X4Y A;  3GF5 A;  4FM4 B;  2E41 A;  3RES A;  3ZFJ A;  3OYE A;  2QGF B;  4LD6 A;  4E7Z A;  4GLK A;  2RJE A;  4CC2 A;  1VQ9 A;  3I55 T;  2LJ1 A;  5GAO r;  4C5I A;  1MHN A;  1FWZ A;  1JQQ A;  5CKD A;  3VS6 A;  4KUI A;  2K5I A;  1N8R R;  1KIK A;  5A0L A;  1VQ8 Q;  1KHI A;  2RQU A;  3MEA A;  2DPP B;  3NPF A;  2F5K A;  4TVR A;  2VC8 A;  5LJ3 e;  1MV0 B;  1D1A A;  4C8Q C;  2LX9 A;  1VQN Q;  1IRX A;  2J05 A;  1VQK A;  1DJ7 B;  3V7S A;  2E10 A;  1X27 A;  1BK2 A;  3G6E Q;  4N4H A;  1VQ5 Q;  1U3O A;  1RLP C;  1NG2 A;  3URG A;  5IXB A;  1Q82 U;  1M5Q 1;  5CKF A;  5LJ3 f;  2WSC E;  1SF9 A;  3HRS A;  4M77 B;  4M77 F;  1ZSZ B;  4FSX A;  4X9D A;  1ZUK A;  3C0C A;  2LVM A;  2MPX C;  4LUE A;  3OYI A;  1FMW A;  4BE1 A;  5LJ3 j;  2HAX A;  2FPE A;  3OY9 A;  5LJ5 h;  4F04 B;  3JB9 I;  3JCM e;  4M75 B;  3CMA A;  3OYL A;  4QQ6 A;  2E6N A;  3SWN A;  4ZGD B;  1YIJ Q;  1VOM A;  2ZPI B;  1BU1 A;  3OYM A;  3FIF A;  4B9W A;  8ATC B;  2GF7 A;  4AT1 B;  3J81 E;  2PQW A;  2L2P A;  2Y4X A;  4OGE A;  4EMK C;  3QHS A;  3CCS A;  1M1K R;  2XU8 A;  2L0A A;  4C0D C;  3KFV A;  1VQ7 Q;  4HCZ A;  3OYH A;  2XK0 A;  1M27 C;  4YTL A;  1M1G A;  4A54 A;  2EIF A;  1VQ6 A;  1VIF A;  3NFC A;  2PU9 B;  2DA9 A;  2PVG B;  4R0K A;  4JS4 A;  4DEX A;  1ZLM A;  2RH2 A;  2YRD A;  2VXE A;  2EQI A;  3P8D A;  4GBQ A;  2D0Q B;  2DM1 A;  4IUU A;  2CDT A;  1Q7Y U;  1UUE A;  2X3X D;  5LJ3 g;  1YJN A;  1YWO A;  2RK1 A;  2KAF A;  4M77 D;  3VJP A;  1XQH A;  2DF6 A;  3EFO B;  1B3Q A;  4PJM A;  1LPL A;  1KC8 U;  2M02 A;  2D6F A;  5GAN 6;  2E5K A;  1ZUU A;  2X9H A;  4D8K A;  1SKU B;  3QBY A;  2OTL A;  1FYN A;  3CCE A;  1MMA A;  3MEW A;  2RO0 A;  4HVV A;  4OMO A;  3P8H A;  1VYV A;  1YJN T;  3VKI A;  1WA7 A;  1ACM B;  2MK5 A;  3SWN B;  4HXJ A;  4M75 A;  4KRT A;  2C0T A;  4EMH A;  4E7S A;  3CCM Q;  1VQ4 Q;  1NEB A;  5IH2 A;  1OZ2 A;  2CP7 A;  3M4G A;  1VQ7 A;  1M1K C;  1ZQ1 A;  2DRK A;  5CKH A;  4RTW A;  1JBM A;  2QQA A;  3V7R A;  5KYW B;  4OF1 A;  5LJ3 h;  1YJW T;  1IRE B;  2QA4 Q;  1E6H A;  4IUP A;  4XQ3 A;  4BI8 B;  3OYY A;  3CCL Q;  4QQD A;  1GCQ C;  2XDP A;  1NYF A;  1W1F A;  2A0F B;  3EHQ A;  2QQ9 A;  4XTW A;  3G4S T;  3JCM V;  3H41 A;  1GBR A;  2RJD A;  1ZSG A;  4ZNX A;  4C8Q B;  2QQR A;  1XTD A;  4RTU A;  1K9A A;  1WFW A;  3WXM B;  1AHJ B;  2CT3 A;  3A98 A;  1WJR A;  4FIB A;  4C5H A;  4A4H A;  2DXT A;  4D6W A;  3BDL A;  2ZCF B;  2AIR B;  2X3W D;  2R57 A;  2BKD N;  3CPF A;  3VYH B;  2PVD B;  1LJO A;  2K79 A;  2QTX A;  4O5V A;  5CIU A;  1SG5 A;  2QTV A;  1N27 A;  3I5S A;  4KBM B;  2DD5 A;  2DYB A;  1HSQ A;  1BKB A;  1JJ2 S;  1E7O A;  3RKW A;  1Y96 B;  1UGS B;  3QKJ A;  3JCM Q;  2A08 A;  4PLI A;  2RI3 A;  5CQY A;  3ULR B;  1GCP A;  2ECZ A;  1V29 B;  3ME9 A;  1PC0 A;  2KXD A;  2QGG A;  4RTZ A;  1M1F A;  3CPW P;  1K8A C;  1IHW A;  2RHX A;  1I5L A;  3RKX A;  3MP8 A;  3Q1J A;  4PJN A;  1U8R A;  2FHD A;  4A53 A;  3FDR A;  1WNL A;  1K73 R;  4OMP A;  1AT1 B;  4BI3 A;  2DTI A;  1X2K A;  3OA6 A;  1OUL A;  1YI2 T;  3I55 A;  1LVK A;  2KT8 A;  2ED1 A;  1NLO C;  2AKK A;  3E9F A;  1YIT Q;  1YI2 A;  5D7U A;  4A4K A;  2EGE A;  3QII A;  2CUD A;  3SDZ A;  2C0O A;  2CSQ A;  3F70 A;  2EAY A;  4IUT A;  4FT2 A;  3S3N A;  2VVK A;  3HFO A;  4AG2 C;  2QA4 T;  3L2U A;  3G6E A;  1QVP A;  4C92 B;  5GAN 5;  4N4G A;  3CXC A;  1H64 1;  2XHC A;  2YUN A;  1VYT A;  4XTZ A;  3EG2 A;  2EKO A;  5FRO A;  1I5O B;  1M3A A;  3JCM d;  2ABL A;  1BI2 A;  1MNE A;  2YUP A;  2F1L A;  3PGG A;  5KYU B;  3CCR Q;  4NL3 A;  2X51 A;  1QWE A;  1NJI R;  1V1C A;  2OX7 A;  2COY A;  2K5F A;  2LCL A;  4X34 A;  2GGR A;  2JW4 A;  1QVG P;  2DL7 A;  2ZPF B;  2BZ8 A;  4KGX B;  5CR2 A;  2LNH B;  1UJ0 A;  3LH0 A;  3CCL A;  2L3S A;  4UC4 A;  3CCQ Q;  3CCV Q;  1KFZ A;  1WPY A;  3OMC A;  1MMG A;  4C5E A;  3JCM h;  2HBW A;  1WHG A;  3JCM J;  3JB9 G;  1R0C B;  9ATC B;  2R5M A;  2ED0 A;  3GIB A;  2YXY A;  1ZHI A;  1OYX A;  5GAO q;  2O4X B;  2CT4 A;  1UGR B;  5GMK m;  1KK7 A;  3OMG A;  5I2M A;  3LW5 E;  1UEC A;  5GAN f;  1T3S A;  4A4E A;  1FX7 A;  5CK9 A;  4M78 A;  2DD4 A;  2DTO A;  4BY6 C;  5GAM j;  1OPL A;  4JRP A;  3HPW A;  2BTT A;  4M7D F;  2FVU A;  2WAC A;  4IUV A;  5A0G A;  5LL6 S;  3NTI A;  5FU6 C;  2QG9 B;  2M0O A;  1VQL Q;  1H3Z A;  3M0U A;  1QVF S;  1UJY A;  5J26 A;  1CSK A;  1Q81 U;  1OZ3 A;  3REA B;  3CD6 Q;  3OYC A;  4OMQ A;  1D3B A;  3CME T;  2KT1 A;  2O01 E;  2QEX A;  4ATO A;  1YI2 Q;  2EQU A;  1Q81 R;  1O9S A;  1Z9Z A;  1I81 A;  1TUG B;  1RUW A;  4LDY A;  2LQK A;  1OV3 A;  2IVW A;  4C0F A;  1X6B A;  3HTR A;  4HT8 A;  1K8A R;  2MYS A;  3GP8 A;  4BB7 A;  2K3Y A;  4DBR A;  2KMT A;  2SEM A;  2JS0 A;  4MZT A;  1IZ6 A;  2HNI A;  1NLP C;  3BFM A;  3H9N A;  5GAN 4;  3GLX A;  3MHX A;  1B7T A;  2CH4 W;  3G71 Q;  4PJJ A;  3C94 A;  1VQ6 Q;  2YT6 A;  3PNW C;  3OS1 A;  3FJP A;  1PD1 A;  4ELZ C;  2H8H A;  4C8Q G;  1GXI E;  2G3R A;  4V2S A;  2LQN A;  5KYN A;  3QDF A;  3CC4 A;  4JUV A;  2JT4 A;  4ESR A;  1RAD B;  3HRU A;  2RJC A;  3EG9 A;  3UT1 A;  2JTF A;  7AT1 B;  1Q86 R;  2L5Q A;  3ZEH A;  3CCR A;  2IIM A;  2OAU A;  1SHF A;  2DMO A;  1C1A A;  1QKX A;  4MDW A;  4M78 B;  2ZPH B;  2HL5 C;  2FRY A;  4J9H A;  1ZBX A;  4PJO B;  3L2W A;  2W10 A;  3MET A;  3ER0 A;  3BDU A;  4OMF B;  5KE3 A;  1MUZ A;  1QCN A;  4J6Y A;  3PIP A;  1I0C A;  5DM7 R;  3NGP A;  1BI1 A;  3OW2 P;  1KQS P;  1N9S A;  3OYB A;  1XJW B;  3QUI A;  5FW9 A;  4KGV B;  4QW2 A;  4FW2 A;  3M0S A;  3X20 B;  2MF2 A;  2RD1 A;  1K73 C;  1WLP B;  4J9E A;  1YJ9 Q;  4CRI A;  1AWX A;  3IQL A;  5GMK i;  3LX7 A;  2HSE B;  2RQT A;  3RR6 A;  3OQ5 A;  3CCM T;  1MGQ A;  4J9D A;  3M58 A;  3RMS A;  4RCB A;  3PIO A;  3L42 A;  2CZ1 B;  4XU2 A;  5GMK h;  2PUO B;  3E19 A;  1R77 A;  3MP6 A;  2P0P A;  2E3I A;  4KH1 B;  3M4Y A;  2LP5 A;  2BUD A;  1EX4 A;  2QYZ A;  5ECA A;  4FW1 A;  3G71 A;  1AZE A;  4M7A F;  4C92 G;  4BY6 B;  2AT1 B;  1RLQ C;  1VQK T;  2K2V A;  3V8J A;  3TCJ A;  3A1P A;  3CD6 A;  2VB6 A;  1VQ9 Q;  4BE2 A;  2C06 A;  3CCR T;  2K2M A;  4JRK A;  3OW2 S;  1KQS A;  1WX6 A;  2BIV A;  4PKC C;  1BYM A;  4ORZ A;  4HCK A;  1KJW A;  2RI2 A;  1JEG A;  3LGF A;  1SRM A;  3M55 A;  4II1 A;  4RTX A;  3O8V A;  3BE3 A;  4JZ4 A;  2AZV A;  3QZ5 B;  3ZL7 C;  1YJ9 A;  3I56 Q;  1X75 C;  2D8H A;  5DLO A;  5L8R E;  4PFO A;  2A37 A;  4EDU A;  5LJ3 d;  2LT1 A;  4M77 G;  2K5L A;  2LZ6 B;  5GAO l;  1ZSZ C;  2HQE A;  5KYU A;  1T3L A;  3MEU A;  1ZX6 A;  1PD0 A;  1VQO A;  1G3T A;  4M7D G;  3JAM E;  5CVI A;  4IIM A;  1N5Z A;  1Q7Y R;  4OMM A;  2MWO A;  3BY7 A;  1G8X A;  1BIB A;  1R8O B;  3OSS C;  3D7S B;  4XTU A;  2WSF E;  4Q5W A;  3OYJ A;  4PFP A;  1N8R U;  1YJW Q;  4XU1 A;  2COW A;  3V7C A;  4P5N A;  4ZN3 A;  1MND A;  4F14 A;  3TU4 K;  4Y92 A;  4ME7 A;  3I56 A;  1VQM Q;  1YHQ A;  1A0N B;  4E2F B;  4XTX A;  1JJ2 A;  2GQV A;  2GFA A;  4DOW A;  1WQW A;  2FZK B;  2CZ7 B;  2GBQ A;  2HMA A;  5GAM d;  4NL2 A;  2EWN A;  4XU0 A;  3CXC S;  4CC3 A;  2KBT A;  2E65 A;  1Y57 A;  1X43 A;  1M8V A;  1BCO A;  4PL6 A;  4LDU A;  4X9C A;  4C0D B;  2V1Q A;  5CKE A;  5IXF A;  1WXT A;  5IT9 E;  3A8L B;  4Z8A A;  2RA2 A;  1KQ2 A;  1UHF A;  1WDX A;  4JRI A;  3CCV A;  2LX7 A;  1AOJ A;  4F7U A;  4RTY A;  2E6Z A;  4C92 E;  1QCO A;  1K1Z A;  1TH7 A;  5GAO n;  2IG0 A;  3X24 B;  2KRO A;  4WCI A;  4NOY A;  5KYX A;  1N8R C;  3FC3 A;  1M90 R;  3JCM c;  4C5G A;  1WXU A;  4F7U B;  2RMO A;  4NS5 A;  1M3C A;  2JTE A;  4X1V A;  2MWP A;  5IN1 A;  1PRL C;  2Y90 A;  4OMN A;  3QYH B;  1G83 A;  3KUF A;  2F2W A;  4OB1 B;  5GAO m;  1OQK A;  2LT4 A;  1FMK A;  1I8F A;  3SFM A;  1ABQ A;  3QYG B;  1QMC A;  4ZN1 A;  3M56 A;  2GQI A;  2JUF A;  3HP9 A;  1M1K U;  4OB2 B;  1NPR A;  4M78 G;  5DY9 A;  1Y96 A;  3JCM X;  5GMK j;  1X2Q A;  2ZAE A;  3EFO A;  2YLB A;  3GNF B;  3DLM A;  2JZ2 A;  1BBZ A;  1MMD A;  2CP6 A;  3EH2 A;  5KYX B;  3RDV A;  3A8M B;  1VA7 A;  3X26 B;  1UFF A;  2XMF A;  4M7D E;  1YIT T;  2KXC A;  1UGQ B;  2EQJ A;  4J6W A;  2FL7 A;  1PG5 B;  2YRC A;  3EHR A;  3CC2 A;  2EPD A;  3L2Z A;  1X6G A;  3EG1 A;  3OS5 A;  1Y0M A;  4C8Q A;  1Z9Q A;  2RM4 A;  1VUB A;  4QQG A;  1PCX A;  4AFZ C;  2EJ9 A;  1HD3 A;  2ATC B;  1VQ4 T;  1RI0 A;  2ENM A;  2X4J A;  2RHI A;  5A2Q E;  4Y91 A;  2FPF A;  2YRV A;  1VQ9 T;  2GTO A;  5IHI A;  5GAN e;  1X6O A;  2Y4Y A;  2KYB A;  1Q7Y C;  2PTK A;  1UGV A;  1CKA A;  1YIJ T;  1I4K 1;  4DBQ A;  1WHM A;  1E6G A;  4M7D C;  1AWW A;  4JDS A;  3THK A;  2VGN A;  2M51 A;  1PSF A;  3P8B B;  2AK5 A;  2O9V A;  2X4W A;  4HVW A;  1YCS B;  1D0Z A;  3CC4 Q;  2RN8 A;  2A7Y A;  1N9R A;  3CC2 Q;  1X01 A;  8AT1 B;  3EFR A;  4XU3 A;  3JCM W;  2QK0 A;  1TWB A;  1YJ9 T;  2D0N A;  5CKB A;  2OI3 A;  1RAA B;  3CME Q;  3I5R A;  1T0J A;  2B86 A;  2DFU A;  2D8J A;  5GAN g;  3A8H B;  2KGT A;  1QP3 A;  1KQS S;  2QAS A;  4LDW A;  4JJB A;  3M5A A;  1C6V X;  2KEA A;  5GAM f;  1IO6 A;  1U5S A;  1AZG B;  4IIO A;  5LJ5 j;  2DEQ A;  2DLP A;  2LTO A;  2DVJ A;  2DNU A;  3EH1 A;  3R6N A;  2GTJ A;  3G4S Q;  4RKU E;  4JRQ A;  2E3H A;  3G7Z A;  5KYY B;  2HSP A;  2YDL A;  2E5Q A;  2DE0 X;  3CCQ A;  4L59 A;  4PJO C;  3CC2 T;  2P0K A;  3I9Q A;  3M9Q A;  1WYX A;  1VQM T;  4RG2 A;  3FB9 A;  3GOX A;  2JS2 A;  1VIE A;  4HCB A;  1YN8 A;  4L5G A;  2OTL Q;  1JU5 C;  1Y07 A;  2HBP A;  5GAN 2;  1MMN A;  2ZZD A;  4OGC A;  3A5Z B;  1JRI A;  3M0T A;  2DYI A;  3VU3 C;  1RL2 A;  3N5B B;  4JZ3 A;  4AG1 C;  3CCQ T;  2CYZ B;  4QT7 A;  1KQ1 A;  2ZPG B;  4Z88 A;  3VS1 A;  1YWP A;  3JV3 A;  2J6F A;  1ZA1 B;  5HK3 A;  4A4G A;  4EPC A;  3JCM P;  4FL6 A;  1YJW A;  1W4S A;  3I35 A;  2DTH A;  2V8I A;  2PUK B;  2F5T X;  3OYG A;  4M7A B;  2A36 A;  2LCC A;  1Y71 A;  3HHT B;  3X28 B;  4FYW B;  1QP2 A;  3G4S A;  2PNI A;  1PHT A;  4M7A D;  1Q81 C;  1PKS A;  5GAM g;  3QSU A;  2EW3 A;  2YUQ A;  5GJW B;  3H8Z A;  1NBE B;  2MCN A;  4JJD A;  1I07 A;  3UPU A;  2FRW A;  3GBQ A;  3NMZ C;  2CS7 A;  2M16 A;  2XDB A;  2WSE E;  1VQ5 T;  4M75 D;  3OW2 A;  4D8D A;  2VV5 A;  3J80 E;  4O6J A;  3MP1 A;  1QVG S;  2CKK A;  3MEV A;  3QXE B;  3HL8 A;  1RAC B;  1OX8 A;  3EG0 A;  1BI0 A;  2NUP A;  1BI3 A;  3PVQ A;  1F1B B;  3C4S A;  2VAS A;  1W2B A;  2OJ2 A;  4JJC A;  1YHQ Q;  1RI9 A;  4RG8 A;  5I2S A;  3DB4 A;  3CC7 T;  2MMP A;  3AHU A;  2RI5 A;  1HXD A;  4PNO A;  2LMJ A;  2LCS A;  2EFI A;  1VQK Q;  4OVA A;  5D6X A;  2E4H A;  3EGX B;  2XID A;  4FU6 A;  4WF2 A;  3G71 T;  3VS5 A;  1Q86 U;  1TUD A;  2MI6 A;  3EGX A;  3UDC A;  3MO8 A;  1U1T A;  1Q82 R;  1NM7 A;  1K9M R;  1IHV A;  2CRE A;  5HY6 A;  1OEB A;  1WHL A;  2M9U A;  3EFS A;  4BAC A;  1UB4 A;  2DL3 A;  4VUB A;  3L1A A;  1VQN A;  2NWM A;  3PFS A;  2R58 A;  2K3B A;  3M0R A;  5IAY A;  2YWW A;  2D9T A;  4KUL A;  4KT0 E;  3OBW A;  2YHT A;  1W2B S;  1WQ7 A;  3PMT A;  1H8K A;  2K7A A;  3NTK A;  4C8Q E;  4HA8 A;  2QEX T;  1NJI C;  4JJN K;  3CMA Q;  3VS7 A;  1SSF A;  2LDM A;  4J6X A;  4EIK A;  5D6Y A;  4J9C A;  4F7U G;  3T9N A;  4PJO G;  1KC8 R;  2I2L A;  4FCY A;  5GAO p;  3CEY A;  5GMK e;  5C0M A;  2LC4 A;  4M77 C;  2O31 A;  1TS9 A;  4M77 A;  1BB9 A;  5CCA A;  6AT1 B;  2LQ8 A;  5GAN d;  5D6W A;  2DET A;  2CP2 A;  2CSI A;  3A8O B;  1K8A U;  2KYM A;  1M2O A;  3TRE A;  1B34 A;  2K57 A;  3CC7 A;  5CO7 A;  4C92 A;  4IKF A;  2E12 A;  1VQP T;  1I1J A;  3WVD B;  2RQR A;  5LJ5 e;  1WZO A;  4M7A E;  2DEU A;  2LJ3 A;  3V8K A;  2F2X A;  2FPD A;  1K9M C;  2DL4 A;  2MIO A;  1GBQ A;  5GAN 7;  4HT9 A;  1JJ2 P;  2FO0 A;  2FYK A;  3VV0 A;  4M7D D;  1BCM A;  3R6O A;  1WXB A;  3CCL T;  3G6E T;  4M7D A;  2RB6 A;  3CCE Q;  1BIA A;  2KI7 A;  3QWX X;  3L2R A;  2OTJ A;  1WHJ A;  2L3R A;  4J9F A;  3UAT A;  3VS3 A;  2V1R A;  4M75 G;  4LN2 A;  3CXC P;  1AEY A;  5A0D A;  4PK4 A;  4LD9 K;  4WTO B;  1G3S A;  1TU0 B;  3EG9 B;  2CP3 A;  3VS4 A;  1WHH A;  5IHK A;  1OU8 A;  2HQH A;  2XI9 A;  4L6V 5;  2NUT B;  3OS0 A;  2HD0 A;  4M7A C;  1W70 A;  3FRN A;  2Z0W A;  2C0I A;  1K9M U;  4J7I A;  3JB9 J;  2DIQ A;  3HFN A;  1HYO A;  1UEB A;  1TSF A;  4MML A;  4XAX B;  2CH4 A;  3QG1 A;  4J9B A;  4FSS A;  2EQK A;  1RAH B;  1SEM A;  1GFD A;  1VQM A;  1VQO Q;  1OX9 A;  3CBP A;  2JVV A;  1QKW A;  3EGD A;  2J6K A;  5M9O A;  1WI7 A;  1Q95 G;  2KQW A;  1V76 A;  3DB3 A;  2XD0 A;  4MDX A;  3E1S A;  3FJ5 A;  4C92 C;  3FLG A;  5GAN 3;  5FRM A;  2DK3 A;  1TTH B;  4ANJ A;  3DLL A; 
#chains in the Genus database with same CATH homology
 1UFF A;  2YUN A;  2XMF A;  3PE0 A;  2L3P A;  2RNA A;  1VYT A;  3EG2 A;  2KXC A;  1TG0 A;  1M3A A;  3EHR A;  2ABL A;  2EPD A;  2YUP A;  1UHC A;  2J7I A;  1PWT A;  1X6G A;  1QWE A;  2K9G A;  3EG1 A;  2KR3 A;  1V1C A;  1GL5 A;  1Y0M A;  2VWF A;  1Z9Q A;  2GGR A;  2JW4 A;  2A28 A;  1NEG A;  1M3B A;  1ZUY A;  5GJV B;  4AFZ C;  2RQV A;  3H0F A;  1HD3 A;  2CUB A;  2DL7 A;  2OAW A;  2ENM A;  2BZ8 A;  4F17 A;  2FPF A;  1PNJ A;  2LNH B;  1WIE A;  1UJ0 A;  1AVZ C;  1JXO A;  2L3S A;  1K76 A;  3RBB B;  2DX1 A;  3H0H A;  1KFZ A;  2O9S A;  2O2O A;  2GTO A;  5IHI A;  5I11 A;  2KYB A;  3UA7 A;  1PKT A;  1JO8 A;  1YNZ A;  2PTK A;  1UGV A;  2HBW A;  2YUO A;  1CKA A;  4AFS C;  1GCQ A;  4RTV A;  1E6G A;  2ED0 A;  1AWW A;  3THK A;  2W0Z A;  2DBK A;  2M51 A;  2CT4 A;  2DJQ A;  2AK5 A;  2O9V A;  4HVW A;  1YCS B;  4E6R A;  1UEC A;  5IHN A;  1T3S A;  2RN8 A;  1GRI A;  2VKN A;  2EYY A;  4HVU A;  4OML A;  2DRM A;  1OPL A;  2M0Y A;  4M4Z A;  2BTT A;  2D0N A;  2OI3 A;  1CKB A;  1W6X A;  3I5R A;  1T0J A;  2B86 A;  2D8J A;  2KGT A;  3SHW A;  3M0U A;  2FEI A;  1UJY A;  4J9G A;  4JJB A;  3VS2 A;  2L3Q A;  4LE9 A;  1K0S A;  2ROL A;  1CSK A;  3REA B;  2KEA A;  1IO6 A;  4OMQ A;  3UF4 A;  2EKH A;  1U5S A;  4LNP A;  1YP5 A;  1AZG B;  2DL5 A;  4IIO A;  2KRM A;  2DLP A;  4K11 A;  2EYZ A;  2KT1 A;  2DVJ A;  2DNU A;  2RQW A;  3R6N A;  1SPK A;  1U06 A;  1JXM A;  2GTJ A;  2LQW A;  5FWC A;  2PZ1 A;  3REB B;  2SRC A;  2D1X A;  2KRS A;  2HSP A;  2YDL A;  2NUZ A;  1Z9Z A;  1G2B A;  2DE0 X;  1RUW A;  1OV3 A;  4CC2 A;  3I9Q A;  1WYX A;  1X6B A;  3PVL A;  2LJ1 A;  4RTT A;  1JQQ A;  3VS6 A;  1KIK A;  5I22 A;  2JS2 A;  2RQU A;  3TVT A;  2SEM A;  3NPF A;  1OOT A;  2G6F X;  1YN8 A;  1UE9 A;  1JU5 C;  2JS0 A;  1QLY A;  2KE9 A;  1MV0 B;  1NLP C;  1H3H A;  2CH4 W;  2J6O A;  2YT6 A;  2J05 A;  3TSW A;  3M0T A;  2JMA A;  1UDL A;  1X27 A;  1BK2 A;  4JZ3 A;  4AG1 C;  2H8H A;  4QT7 A;  1U3O A;  4Z88 A;  1RLP C;  2LQN A;  1NG2 A;  3VS1 A;  5IXB A;  5FWB A;  1YWP A;  3JV3 A;  2J6F A;  2JT4 A;  4ESR A;  3I35 A;  2P4R A;  1GFC A;  3O5Z A;  2IIM A;  1K4U S;  1SHF A;  2A36 A;  2DMO A;  1ZUK A;  2RPN A;  1QKX A;  3C0C A;  1M8M A;  4LUE A;  2FRY A;  3LH5 A;  4J9H A;  2FPE A;  3RNJ A;  2HDA A;  2W10 A;  1SRL A;  2I0N A;  2PNI A;  1PHT A;  1ZBJ A;  2AZS A;  4CC7 A;  1PKS A;  1BU1 A;  2EW3 A;  2AKL A;  2YUQ A;  2HEQ A;  1MUZ A;  5GJW B;  2MCN A;  1I0C A;  4A63 B;  4JJD A;  3NGP A;  1I07 A;  2L2P A;  2FRW A;  5HCK A;  3GBQ A;  5FW9 A;  3NMZ C;  2JMC A;  2L0A A;  1OPK A;  2J06 A;  3KFV A;  1NYG A;  4RUG A;  2ROT A;  1B07 A;  3M0S A;  1M27 C;  4D8D A;  5EC7 A;  4LUD A;  2DBM A;  1WLP B;  2DA9 A;  4J9E A;  1S1N A;  1K0X A;  2RF0 A;  2GNC A;  1AWX A;  3EG0 A;  3IQL A;  4R0K A;  3NHN A;  1HJD A;  4DEX A;  1ARK A;  3PVQ A;  1ZLM A;  2RQT A;  2EQI A;  4GBQ A;  2DM1 A;  2CDT A;  2OJ2 A;  4J9D A;  4JJC A;  1RI9 A;  2EGA A;  2MOX A;  1UUE A;  2X3X D;  1YWO A;  2LMJ A;  2LCS A;  1UG1 A;  3M0Q A;  2DF6 A;  2FG0 A;  3M0P A;  3U23 A;  1B3Q A;  2LP5 A;  1EFN A;  3VS5 A;  1TUD A;  5ECA A;  2E5K A;  1AZE A;  1ZUU A;  4F16 A;  4D8K A;  1NM7 A;  3TSZ A;  2CRE A;  4Z89 A;  3H0I A;  1LCK A;  1OEB A;  1RLQ C;  2DIL A;  1FYN A;  1AD5 A;  1SSH A;  2DL3 A;  1SHG A;  4HVV A;  4OMO A;  1PRM C;  1VYV A;  2LJ0 A;  2K2M A;  2NWM A;  2BZX A;  3VRY A;  1WX6 A;  2K3B A;  1WA7 A;  4ORZ A;  4HCK A;  3M0R A;  1KJW A;  1JEG A;  1XOV A;  1SRM A;  4HXJ A;  3SEM A;  1ABO A;  3QWY A;  4KRT A;  2C0T A;  4RTX A;  4JZ4 A;  2AZV A;  1H8K A;  2K7A A;  2F2V A;  3ZL7 C;  1NEB A;  2D8H A;  5IH2 A;  1TUC A;  3EG3 A;  2A37 A;  3VS7 A;  4EIK A;  2DRK A;  4J9C A;  2EVR A;  4RTW A;  2LZ6 B;  3CQT A;  1E6H A;  1T3L A;  4GLM A;  1ZX6 A;  1UTI A;  1H92 A;  2O31 A;  1M30 A;  4IIM A;  1N5Z A;  1BB9 A;  1GCQ C;  2DL8 A;  4OMM A;  1AWJ A;  1NYF A;  1W1F A;  3EHQ A;  1QWF A;  2CSI A;  3H41 A;  1GBR A;  2KYM A;  1ZSG A;  4ZNX A;  4CC4 B;  4RTU A;  2O88 A;  1AWO A;  1K9A A;  2JXB A;  4AFQ C;  1WFW A;  2JM8 A;  2CT3 A;  3A98 A;  4F14 A;  4Y92 A;  1I1J A;  1MV3 A;  2RQR A;  1A0N B;  2X3W D;  2EGC A;  2QDL A;  2LJ3 A;  2K79 A;  2BZY A;  2GBQ A;  2F2X A;  2FPD A;  2ESW A;  2DL4 A;  2MIO A;  1GBQ A;  3I5S A;  2FO0 A;  1KSW A;  4CC3 A;  2KBT A;  2DYB A;  2KNB B;  1WXB A;  1X43 A;  1Y57 A;  3EGU A;  1HSQ A;  1E7O A;  2V1Q A;  4DEY A;  3QWX X;  3VS0 A;  5IXF A;  1WXT A;  4Z8A A;  2A08 A;  1UHF A;  4J9F A;  3UAT A;  1WDX A;  3VS3 A;  2V1R A;  1X69 A;  3ULR B;  2LX7 A;  1AOJ A;  1GCP A;  2ECZ A;  4LN2 A;  1J3T A;  4RTY A;  1AEY A;  4JPB W;  1K1Z A;  2KXD A;  3VS4 A;  2K6D A;  5IHK A;  2KRO A;  4RTZ A;  1QCF A;  4WCI A;  2JM9 A;  3VRZ A;  1W70 A;  4J9I A;  1WXU A;  2RMO A;  1M3C A;  2JTE A;  2C0I A;  4X1V A;  3UA6 A;  1PRL C;  2HCK A;  4OMN A;  2YSQ A;  1VYU A;  2CH4 A;  4OMP A;  2EYX A;  1G83 A;  4J9B A;  4FSS A;  2F2W A;  1X2K A;  1SEM A;  1GFD A;  1FMK A;  2EBP A;  1ABQ A;  5L23 A;  2KT8 A;  2ED1 A;  1QKW A;  2GQI A;  1NLO C;  2AKK A;  2J6K A;  1WI7 A;  2EGE A;  2KRN A;  2CUD A;  2C0O A;  2CSQ A;  3FJ5 A;  4AFU C;  1X2Q A;  1T0H A;  2EYW A;  1BBZ A;  2VVK A;  4AG2 C;  1VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...