1I1JA

Structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords MELANOMA DERIVED GROWTH REGULATORY PROTEIN
publication title Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i1jA00
2B86A 2L0AA 1WXTA 1UE9A 3TVTA 1X69A 4RTXA 1BK2A 4CC3A 2CH4A 2K7AA 1NYFA 1GBRA 1A0NB 1NG2A 2ED0A 4DEXA 2GTOA 1PHTA 1VYVA 2ESWA 2K9GA 1FYNA 1YWPA 3H41A 1U06A 1OV3A 1T0HA 4AFQC 2V1QA 2RQWA 1PRMC 3REBB 4EIKA 2F2VA 2OJ2A 2DX1A 4Z89A 2CH4W 2W10A 1Z9ZA 3VS1A 1GL5A 1ZLMA 4Y92A 2W0ZA 2CT4A 2JMAA 5GJVB 2BTTA 1TG0A 5IXBA 1KIKA 2FO0A 2FPEA 2LJ3A 1ZUKA 4OMLA 1CSKA 1UHCA 2LP5A 2FPFA 2ROLA 5IHNA 3EGUA 4IIMA 3ULRB 1UGVA 2DILA 1WI7A 2J6OA 2C0TA 2DL3A 1AD5A 1BBZA 1KSWA 1RLQC 4RTWA 3I9QA 3UATA 1M3CA 4HXJA 4JJBA 1OPKA 2DBKA 1H8KA 1AZGB 2O31A 2RNAA 2FRYA 2KNBB 1U5SA 2LQNA 5IH2A 1UJYA 2EYYA 4OMPA 2MOXA 2EGEA 1FMKA 2JM8A 1PRLC 4F14A 2E5KA 2EBPA 4ESRA 2AZVA 2LJ0A 4AFUC 1SHFA 2BZXA 2RF0A 2JW4A 1H92A 1KJWA 4F17A 1JXOA 4GBQA 2KROA 2YUNA 4ORZA 1NEGA 2GNCA 2GBQA 1PKSA 3NGPA 1K9AA 2DYBA 2GTJA 1GRIA 2BZYA 2CSQA 1AWWA 1UG1A 2D8HA 2AZSA 5FWBA 2PZ1A 1GFCA 1JEGA 2EGCA 1QKWA 3GBQA 3LH5A 2NUZA 2PNIA 1ZSGA 3IQLA 3PVLA 1Y0MA 1E7OA 2QDLA 2OI3A 2LX7A 4HCKA 2BZ8A 1UFFA 2DM1A 2F2WA 4RUGA 4JJDA 1B3QA 1YP5A 2A36A 4HVUA 4OMQA 2DRMA 2V1RA 4X1VA 2JS2A 4LUEA 4WCIA 4OMOA 2YDLA 4K11A 5FWCA 4CC7A 2CUDA 4HVVA 2O88A 2YSQA 1T3LA 3QWXX 4J9CA 1ABQA 1J3TA 1YNZA 2DRKA 3H0IA 1HJDA 2AK5A 1AZEA 2JTEA 1K0XA 1OOTA 2RQVA 1XOVA 2DL4A 3CQTA 4E6RA 1G2BA 4J9EA 4LE9A 5ECAA 1T3SA 2KRNA 1X2KA 4J9FA 2K2MA 1X43A 1MV0B 2M51A 2FG0A 2G6FX 5HCKA 1H3HA 5I11A 2EYWA 2O2OA 1S1NA 2RQTA 1ZUUA 2LJ1A 1ABOA 2OAWA 1AEYA 4Z8AA 2DA9A 2LMJA 3KFVA 2HDAA 4LNPA 4OMNA 1QKXA 1WDXA 1X2QA 1JO8A 2J05A 2VVKA 2RQUA 1CKAA 3EG3A 1K4US 1IO6A 1WLPB 2KYMA 5L23A 3PVQA 3A98A 3M0UA 1TUCA 3C0CA 4JZ3A 1K0SA 2J7IA 5GJWB 2L3QA 2J6FA 3EHRA 2IIMA 3I5SA 5IHKA 1MV3A 2NWMA 1M3AA 2A37A 2DJQA 2CSIA 1JU5C 1Y57A 4J9HA 1W70A 2ROTA 2JMCA 1ZBJA 5FW9A 1M8MA 4RTZA 4HVWA 4DEYA 1M27C 2EGAA 3RBBB 2EPDA 1ARKA 2AKKA 2H8HA 2ENMA 1AWXA 3VS2A 1WYXA 3VS4A 1VA7A 2GQIA 2JXBA 1I0CA 1M30A 1NYGA 2D0NA 4GLMA 4AG1C 1AWJA 2KXCA 1HSQA 3EG0A 4CC2A 3M0TA 3NHNA 2FEIA 2DL5A 2EVRA 1AOJA 1I1JA 1TUDA 1EFNA 1YCSB 1SPKA 1GCPA 1WIEA 2CREA 4JPBW 3H0FA 2VKNA 1SEMA 5IXFA 1M3BA 5EC7A 1RUWA 2HSPA 4J9GA 3M0PA 2P4RA 4OMMA 3THKA 2X3XD 1JQQA 1SRLA 1UJ0A 2C0IA 1OEBA 3NMZC 2KYBA 2DVJA 2LCSA 1ZX6A 1LCKA 1K1ZA 1YN8A 2EQIA 2RPNA 2RQRA 4ZNXA 4CC4B 1VYUA 2ECZA 4F16A 2KXDA 2KRMA 2KRSA 4JJCA 1JXMA 3QWYA 4RTUA 1V1CA 2L3SA 1KFZA 1GCQA 3H0HA 4J9DA 2A28A 3I5RA 3UF4A 2KT8A 2GGRA 4LN2A 2L2PA 2ED1A 2XMFA 2J6KA 2RN8A 1E6GA 3EG1A 3M0SA 1AVZC 1T0JA 1WXUA 2D1XA 2LZ6B 2K3BA 2K6DA 4IIOA 2L3PA 1G83A 1U3OA 2EKHA 3M0QA 3NPFA 1N5ZA 2MIOA 4D8KA 2KE9A 4RTVA 3TSWA 2SEMA 1I07A 2KGTA 1GFDA 1WXBA 1Z9QA 3VS3A 1WA7A 1RI9A 2HEQA 3VRZA 1W1FA 2J06A 1CKBA 4LUDA 4AG2C 1MUZA 3REAB 2D8JA 1ZUYA 1WFWA 3TSZA 2M0YA 3M0RA 2CUBA 2O9VA 4J9IA 1B07A 3SEMA 3ZL7C 2JM9A 2KBTA 3O5ZA 2VWFA 1E6HA 2C0OA 2I0NA 4D8DA 3VS5A 2LQWA 1VYTA 1SHGA 4KRTA 1OPLA 3EG2A 2X3WD 3PE0A 3EHQA 2FPDA 2DL8A 2KEAA 2KR3A 2JS0A 2DL7A 4FSSA 2HBWA 5I22A 2JT4A 1X27A 3RNJA 1NLOC 2DE0X 2YUQA 3JV3A 2HCKA 2ABLA 1UHFA 1BU1A 4M4ZA 3I35A 2MCNA 2O9SA 1RLPC 2DBMA 1SSHA 1PKTA 2KT1A 4A63B 1X6BA 3UA7A 2LNHB 2YUPA 2EYXA 3VS7A 2A08A 4Z88A 1UTIA 1QWEA 4J9BA 2DLPA 1UECA 3FJ5A 1K76A 1GBQA 1SRMA 1GCQC 2AKLA 1UUEA 1PNJA 1UDLA 3VRYA 3VS0A 1W6XA 2SRCA 2DNUA 4JZ4A 1NLPC 2RMOA 1YWOA 4R0KA 4RTYA 2FRWA 4AFZC 1AWOA 4RTTA 1QLYA 3SHWA 2YT6A 2F2XA 2K79A 2DMOA 1NM7A 2CDTA 1WX6A 4QT7A 1X6GA 2CT3A 2EW3A 1NEBA 1BB9A 1QWFA 3R6NA 1PWTA 2PTKA 3U23A 4AFSC 3UA6A 5IHIA 1QCFA 1HD3A 2DF6A 2YUOA 3VS6A 2EYZA
chains in the Genus database with same CATH superfamily
1M1KU 2K7AA 1VQLQ 1NYFA 1A0NB 1NG2A 4LDXA 4M7AG 1Q95G 2NYSA 2ED0A 2GTOA 2M02A 4C8QD 1FYNA 3H41A 1U06A 2RJDA 4AFQC 1RACB 1QVPA 4C92G 2VXFA 3VS1A 1GL5A 1LJOA 3BE3A 2CT4A 5GMKh 1TG0A 1KD1R 1M1KC 4BACA 2HL5C 2FPEA 4M7AF 2MWPA 4F04B 3G6EQ 1UHCA 4FT2A 1QVFS 2GQVA 1HXDA 3EGUA 3GNFB 3G7ZA 1UGVA 2DILA 4Y91A 5C6SA 4M77D 1IHVA 3M59A 2J6OA 3QUIA 2DXCA 2Y4XA 3I56T 5LJ3f 2L3RA 4EDUA 2OTLA 4HCZA 2R58A 4DBRA 5IT9E 3L2QA 1AZGB 1Q7YU 2HAXA 5HKCA 4MMKA 3V7SA 3OYJA 4P5NA 4CRIA 1UJYA 3EFSA 1Y7XA 3M53A 5EG2A 1I5LA 1FMKA 2X4WA 3OB9A 1WGSA 2K4YA 4ESRA 1VQOA 4MZMA 4JRKA 2JW4A 3EH1A 4GBQA 3CPWA 3WVEB 2KROA 1NEGA 1K9AA 4Y28E 4J7FA 3PGGA 4JS5A 3CCSA 1Q7YC 1YBYA 2AZSA 5FWBA 1GFCA 1VQNQ 2RA2A 3L1AA 1QKWA 3CC2T 4FSXA 2QGGA 2X4XA 3OMGA 5GAMe 1K9MC 5GAOp 5CCAA 3M57A 3PVLA 1H641 1OI1A 3OY9A 1Y0MA 2DD4A 1N9RA 5CKEA 2JTMA 2QDLA 3LGFA 1Y71A 4AT1B 1YJNA 8ATCB 4L5GA 3MKDA 4M7DA 1D0ZA 4HVUA 4KUIA 1VQ5A 2DRMA 3JCMe 3SDZA 1TUGB 2EQKA 5I21A 2OTLT 3MPUB 2JJ9A 2MWOA 4N4IA 4OMOA 1VQ9A 4CC7A 1Y07A 2COZA 3S3OA 3EGXB 1VQLA 2BE9B 1RL2A 3CMAA 5GMKj 1G3SA 3JB9G 2E5QA 1G3TA 1MNDA 1YNZA 3NTKA 3H0IA 4HT9A 1JBMA 1XOVA 4M78B 1XNIA 1WHKA 2QQAA 2XHCA 1G2BA 3N5BB 2LTOA 5ECAA 3E1SA 2CZ6B 3G71Q 2KRNA 3P8HA 2M51A 1ZUUA 1ZBXA 1VQ6T 3C12A 4C5EA 5KYYB 1EX4A 2H3EB 4LD6A 3KFVA 4JDSA 4LNPA 5CO7A 1JO8A 2VVKA 1K4US 1IO6A 3J81E 1WLPB 2KYMA 5L23A 2DPPB 2K57A 1S72Q 2QTVA 4BY6B 3BW1A 2HQXA 5GANf 1JJ2S 3I5SA 4IUVA 1G8XA 1YCYA 4J9HA 1VQ9T 2AHJB 1VQ7A 3CMAT 1ZA2B 2ROTA 2JMCA 2OTJA 1VQKA 2ZPHB 1M27C 3L2ZA 5FU7B 2E65A 4FL6A 1HYOA 2H8HA 4XK8E 3VS2A 3SWNC 4JLIA 4GLMA 3EGDB 1AWJA 2JVVA 1HSQA 1X6OA 3QG1A 2FEIA 2DL5A 1TUDA 3HRUA 2FZGB 1SPKA 1KG1A 3CCEQ 1WIEA 9ATCB 3H0FA 2VKNA 4C92B 1SEMA 3FJPA 5EC7A 3AT1B 4EMKA 2F69A 4J9GA 4BB7A 2P4RA 1R0CB 2PUOB 2X3XD 2C0IA 3NMZC 1KQ1A 4QQDA 4PJOA 3BDUA 2LCSA 2V8IA 2NUPB 2X9HA 2LQ8A 3HFOA 2EKOA 2QEXQ 1VIEA 2R5MA 3LH0A 3MP6A 3M54A 4BD3A 2O01E 3L2RA 1NJIR 2RQRA 4QQ6A 2QGFB 3M5AA 2QG9B 4OGCA 1KC8R 2KXDA 2KRSA 2DXBA 1V1CA 1GCQA 3H0HA 3TCJA 2CP0A 1VQ7T 3CXCP 3I5RA 2KT8A 2FZCB 2LT4A 3M58A 2J6KA 3RERA 2X51A 2CZ1B 2OTJT 1VQKT 2QDYB 2FL7A 1G83A 2K5FA 2L3PA 1U3OA 3NPFA 1N5ZA 2XU8A 4D8KA 5LJ3e 4JLGA 2HL3A 2PVGB 3QZ9B 3VYHB 1LNXA 3M4GA 1N9SA 3TSWA 1VQ4Q 1I07A 1JRIA 3META 1NZ9A 2ZPIB 1WXBA 3QIIA 3CMET 3VS3A 2RH2A 1WA7A 5GAN4 4Z02A 3VRZA 2C06A 5FLXE 3URGA 2P0PA 1MMAA 2EAYA 4ME7A 1S72A 4NL3A 2F1LA 4M75A 4RMOA 4KH0B 3G4SA 3L2UA 1WFWA 2CUBA 2O9VA 1PM3A 1OQKA 4PNOA 1B07A 2JM9A 3O5ZA 3VUBA 1E6HA 2C0OA 2CYZB 3HHTB 1R0BG 2CP3A 4RG8A 3PE0A 4DQ2A 3RMQA 4QQGA 1FMWA 2FPDA 1BCOA 4J83A 4M7DF 2JS0A 2BUDA 2ZAEA 4IUQA 3MEVA 1C0MA 3BFMA 4ZTJA 3RNJA 4XTUA 2DE0X 3OQ5A 2HCKA 4M7DC 1UHFA 2F5TX 1R8OB 3OS0A 1RLPC 1M5Q1 3UA7A 3PMIA 1M2VB 2EYXA 1QVFA 4NS5A 4OB0B 3VS7A 2KI7A 4Z88A 1UTIA 1QWEA 4J9BA 1UECA 1KK7A 1GBQA 3FDRA 3JCMW 1S72T 3JB9J 1PNJA 5DM7R 5GAN2 1MMGA 3G4ST 3LX7A 4JZ4A 2RMOA 2E3IA 4PJJA 1O75A 1X01A 2YT6A 4ANJA 5GAOl 1X75C 2K79A 4XTZA 3I56Q 2EW3A 3KUFA 2O4XB 1PWTA 3CXCA 5IHIA 1QCFA 1XTDA 3VS6A 2ZPGB 1O9SA 2B86A 2LNVA 3I55A 3X28B 1UE9A 2E12A 4WF2A 5GANe 2XDDA 2L89A 2K9GA 2JTFA 2ZGWA 2GFUA 2M9UA 1OV3A 1T0HA 5A0GA 1IHWA 4B9WA 2DX1A 2R5AA 1H3ZA 4Z89A 2CH4W 5D6XA 3PNWC 1BCMA 3OS5A 3SB2A 2W0ZA 4F7UG 2HQHA 3CC2Q 1NJIU 1KIKA 4J5YA 4OMLA 1CSKA 2IG0A 1XJWB 2LP5A 2QQ9A 2ROLA 1U1SA 1WI7A 2RI3A 4BDYA 1RI0A 4B6MA 2LX9A 2C0TA 4PJNA 1AD5A 4M7AD 2VUBA 1KSWA 4BE0A 1N27A 4C8QA 4HXJA 1OPKA 4PJOF 2OTLQ 3CD6Q 1H8KA 4A4EA 1OYXA 2IPOB 1NJIC 2RNAA 4C92D 3TU4K 2LQNA 2EWNA 5KYNA 1YHQA 4KT0E 1KC8C 4OMPA 2RHYA 3FEOA 3JCMb 2MOXA 2EGEA 3I55T 2JM8A 4EMKC 5A0LA 4F14A 3H8ZA 2EBPA 2FYKA 5GANh 3CC7T 5DLQE 4PJOC 1VIFA 4AFUC 2YUNA 2WACA 2GBQA 2MF2A 3GIBA 2DYBA 3EH2A 1VQPA 3S6WA 1EIFA 3A8MB 1UG1A 2D8HA 1JEGA 2PZ1A 2EGCA 3JCMP 5GAN5 3LH5A 5GMKe 5CQYA 1JJ2A 1E7OA 3SD4A 3JCMJ 4XU3A 1VQ6Q 2LX7A 3HL8A 2BZ8A 3EAEA 3GPLA 1UFFA 3TREA 2DM1A 4L59A 1QCOA 4JJDA 4LXCA 3I56A 2QQBA 3LLRA 1MGQA 4M75F 2EQJA 4M78C 5D7UA 1YHQT 2CUDA 3E9FA 2O88A 2FB7A 2YSQA 1T3LA 1VQ9Q 1M90R 3QWXX 3JB9I 1D3BA 5IN1A 3CMAQ 5KYWB 3CEYA 4M75C 5CIUA 1WHLA 3RKXA 3GOXA 1WHHA 1OOTA 2RQVA 3QPHA 4QVZA 1B34A 5GAOm 5GAOr 2A7YA 1VQPT 4J9EA 4A4HA 1VUBA 4OP0A 4NOYA 3CC2A 1T3SA 4J9FA 1X2KA 2K2MA 1MV0B 3H9NA 2QXFA 4XTVA 5I11A 2LJ1A 3OYKA 4X34A 1AEYA 3S3NA 2HDAA 3DKMA 5KYUB 2MMPA 1QKXA 1X2QA 5GANg 2RQUA 2HSEB 5GANj 3JB9D 1V29B 5LJ5d 3M0UA 4JZ3A 3CD6A 2CKKA 3O8VA 2L3QA 3GLXA 2M16A 3GF5A 1M3AA 2A37A 4FM4B 4ELYC 1PCXA 2E4HA 3HFNA 1TSFA 2E64A 4N0AC 1YIJQ 1VQ7Q 3CXCS 5A0DA 1QQJA 2KVQG 3EFOB 3RBBB 2OTJQ 1VQKQ 5J3BA 4D6WA 5KYXA 2ENMA 3A1PA 1AWXA 1WJRA 1YITT 3VS4A 1VA7A 2GQIA 3HRSA 4LDWA 2JXBA 4C0FA 4AG1C 1D1BA 3EG0A 1WPYA 3M0TA 3Q1JA 2EVRA 5KCHA 3JRZA 3CCRA 1I1JA 3QJYA 2WSCE 2ZZDA 1VQ6A 1ZSZB 5IXFA 3CMEQ 3PIPA 2FHDA 4RCCA 4OMMA 3THKA 2YLBA 3PIOA 4F7UB 3NFCA 4DOVA 1SF9A 1LCKA 3FRNA 4HA8A 2RJCA 1YN8A 3CD6T 4RCBA 2YHTA 1BIBA 5HK0A 2DZ9A 1JXMA 4E7IA 4RTUA 4C5HA 5I2SA 2LRQA 2GGRA 4DA4A 2DERA 2XG8D 4DBHA 2RN8A 1TOVA 3VKIA 1LOJA 3M0SA 1AVZC 3EG9B 1Q82U 3QBYA 1NE8A 2VB6A 1W4SA 2K3BA 2K6DA 4IIOA 4C8QF 3HSBA 3OYYA 2QQSA 1W2BP 3J7AF 2KE9A 3CCRT 4C8QC 4V2SA 4J6WA 4EMHA 1PSFA 1D1AA 4XTYA 1Y96A 2EQUA 2HZYA 2AIRB 2HEQA 3FLGA 3OW2P 2E70A 3RUXA 5IAYA 4LUDA 1UGQB 4AG2C 4OB3B 2DK3A 3OBWA 1BYMA 4M77F 1UGPB 3G4SQ 2YRVA 3X26B 3OYCA 4JUVA 1FXXA 2P84A 2P0KA 1M90U 3SEMA 3UWNA 3WVDB 3ZL7C 4TVRA 5KE3A 1MMNA 3OYEA 2RJFA 4M77C 1YIJA 1TTHB 1PD0A 1OPLA 3EG2A 2JZ2A 2X3WD 2QQRA 3MO8A 2QTXA 2KR3A 5GAMd 3CCQA 1WHMA 2HBWA 4R55A 3V7CA 1VQ8A 1NLOC 3DB4A 4M7DE 2G3RA 2XDPA 1M90C 1KQSP 2YUQA 4M7AB 2X4JA 3A8LB 1BU1A 3I35A 4XAXB 2MCNA 2DBMA 2KT1A 4A63B 2B8AA 4ZGDB 5HK3A 3CMEA 3JCMd 2WSEE 1Q86R 5CKBA 2ZPEB 3DLMA 8AT1B 1F1BB 3JCMX 2A3LA 3OYGA 2EJ9A 1RABB 2CP5A 4J6YA 2AKLA 3CCMA 4PLIA 4J6XA 5CKHA 4E7KA 1NPRA 2KQWA 4PK4A 1BI1A 1W6XA 2SRCA 2VXEA 2K3XA 1WQWA 2YRDA 4RTYA 1C6VX 2FRWA 3RMSA 1N8RR 1AWOA 2F2XA 3OYMA 4A4GA 2Z0WA 1NM7A 2CDTA 4QT7A 4BI3A 1YIJT 4UC4A 1QMCA 4JRQA 2JN0A 1QWFA 3F70A 2DF6A 4NL2A 1ZA1B 3SFMA 3CCQT 2RHUA 4MZPA 4VUBA 1WXTA 3VU3C 3EGXA 3TVTA 1WJSA 1VQ8T 3I55Q 1TS9A 1BK2A 3X20B 4DEXA 1YJWT 1PHTA 1VYVA 3CC7Q 3CC4T 1MHNA 1YWPA 3GP8A 5KCOA 4M78A 2V1QA 1PRMC 2F2VA 2OJ2A 3MEWA 1Z9ZA 2PUKB 5D6YA 3OW2A 2JMAA 2FZKB 5GAN7 1D09B 4E2FB 4M7DG 3CCMT 3OYFA 1YJ9T 5IXBA 4A54A 1M9SA 3LYIA 3JCMV 1ZUKA 2KY9A 5KYYA 1MMDA 2V8JA 2ZCFB 4PJLA 1WHJA 2FPFA 5IHNA 3AHUA 5FU6B 4IIMA 3ULRB 3J80E 1YI2A 4OMFB 2DZCA 2P4TA 4JS4A 1AT1B 2DL3A 1K8AR 3VYGA 4RTWA 1WZOA 3I9QA 4FYYB 2YXYA 3UATA 2BE7D 3VV0A 4ATOA 1HK9A 1M4ZA 4JJBA 5AYFA 4FW2A 3P8BB 2DIGA 2FRYA 5IH2A 3UDCA 1M1GA 2EYYA 4RKUE 4FW1A 4O6JA 3QSUA 4E7ZA 4PJOE 1YHQQ 1PRLC 2E5KA 3E2UA 2AZVA 2LJ0A 1AHJB 2BZXA 3QXEB 3EFRA 4KULA 2D9TA 4IKFA 3MJXA 3CCJA 1K73R 2GNCA 4PLLA 4EMGA 2DXUA 2GTJA 2BZYA 1VQPQ 2V8KA 3EGDA 4N0AA 2EJFA 3GBQA 4E7SA 2DTHA 2NUTB 1ZSGA 1IGQA 2VGMA 3IQLA 5KE2A 4C92A 4ZGEB 3SWNB 5AT1B 2CP6A 2F2WA 2XKOC 2E6NA 2WSFE 1YI2T 4FT4A 1YP5A 2A36A 1I5OB 2XIDA 2NUPA 5LJ3d 1PSEA 2V1RA 4M78E 3E9GA 2JS2A 2M1HA 5CKDA 2KAFA 1ZHIA 4XTXA 3ASKA 2H3JA 4K11A 2QAZA 4OB2B 4E7HA 5FWCA 1M2OA 4HVVA 1KQ2A 4M75E 1OU9A 2DAQA 3CC7A 3QZ5B 3CCVT 2DRKA 1VQMA 2RHXA 1Q86U 1K0XA 1BIAA 3CCJT 4BE2A 2DETA 1YITQ 2JOYA 3L42A 3OYBA 2DO3A 3RR6A 4IUPA 1MNEA 4PJOG 2FG0A 2RD1A 5HCKA 2GF7A 5J26A 1N8RU 1PG5B 2EYWA 2O2OA 1S1NA 4PFZA 1BI2A 2ATCB 3VUZA 1D0XA 4Z8AA 2LMJA 1DJ7B 3X24B 1Q86C 1WNLA 4OMNA 1WDXA 2J05A 3EG3A 2E41A 1Q81R 4IURA 4A53A 3OA6A 3ZEHA 3PVQA 3A98A 1TUCA 2NLUA 3C0CA 3OYLA 4FCYA 5GJWB 3EHRA 2IIMA 5IHKA 2NWMA 3PMTA 2E10A 1N8RC 3HPWA 2DJQA 1IZ6A 1Y57A 2CSIA 2E1HA 3MCAB 4LD9K 3E19A 1W70A 4LDYA 4X9DA 1I81A 2KMTA 5GAN3 1ZBJA 1PC0A 5FW9A 1VQMT 4HVWA 4DEYA 4BI4A 1GXIE 5CK9A 5GAN6 2CP7A 1ZSZC 4M78G 2RHZA 3V8LA 2X4YA 4M77A 2MYSA 1Q82R 1UB4A 1I0CA 1M30A 1NYGA 2D0NA 2DEQA 3PT9A 3NHNA 4GLKA 3MEAA 1AOJA 3CPWP 4M75G 4L6V5 1I8FA 4R56A 2X35A 3CCRQ 1OZ2A 2L5QA 1U8RA 3JCMQ 2CREA 2QYZA 1M2VA 1VOMA 1M3BA 1K8AU 1FX7A 1IGUA 1RUWA 3M0PA 3DLLA 2QI2A 4M78F 4C0DB 1ZQ1A 4M7DB 1R77A 2DVJA 1ZX6A 3OW2S 4AMCA 1OX8A 1K1ZA 2EQIA 2RPNA 2A0FB 1KHIA 2KSSA 4CC4B 1P92A 2ECZA 3INZA 1IXDA 2KRMA 4JJCA 4PFOA 3A8OB 3MEUA 4IUUA 2L3SA 3C4SA 1KFZA 2A28A 4B9XA 1K8AC 3UF4A 1QVGP 1K73U 2XI9A 2ED1A 2O4XA 2D0QB 3C95A 1N6AA 3EG1A 1WXUA 2D1XA 2LZ6B 2K5LA 2EKHA 3M0QA 1YITA 3DB3A 1TXQA 5LJ5h 3OMCA 2LVMA 1I4K1 4FYXB 4C8QE 4BE1A 4RTVA 4E7LA 1KQSS 4C5IA 4BY6C 5FROA 1K73C 4PFPA 4KH1B 1Y96B 1RI9A 3QHSA 5KH6A 1BI0A 2OX7A 2VV5A 3REAB 2D8JA 2M0YA 3M0RA 2P0QA 4J9IA 1QCNA 5LL6S 5FU7C 5CKFA 1TH7A 3QKJA 4M77E 1LVKA 4MDWA 2K2VA 2VWFA 3QDRB 4C92F 4D8DA 2ZPFB 2LQWA 1VYTA 2FVUA 1SHGA 4KRTA 4M7AC 3EHQA 3A8GB 1RAEB 3KXTA 2DL8A 2QA4Q 4XQ3A 2KEAA 3OSVA 2HQEA 4A4KA 2XICA 2DL7A 3CCUT 4FSSA 1D0YA 4C92C 5I22A 3CCQQ 3ME9A 1K9MU 3JV3A 1VQ8Q 2EQMA 4M4ZA 2PVDB 1V76A 1SSHA 1FMVA 3JSCA 1YJWQ 1X6BA 2DXTA 5CVIA 2DKGA 3CC4Q 2YUPA 4PJMA 1Q81U 2A08A 4EMKB 2DLPA 3CBPA 4E7JA 1K76A 1SRMA 1TU0B 4PJOB 1D1CA 2VASA 2YRCA 5L8RE 4XU1A 5HY6A 2EFIA 1G3WA 1UDLA 3VRYA 3A8HB 4LDVA 3OYHA 4C8QG 1SKUB 3CCMQ 1YJ9Q 1G3YA 1NLPC 3JAME 2Y90A 2PU9B 1G5VA 4C0ZA 3NTHA 4R0KA 5LJ5g 4AFZC 5J39A 1YFNA 5LJ5j 1QLYA 3SHWA 4J7IA 3OYNA 3CCLA 2DMOA 1WX6A 1UGRB 1X6GA 1Q81C 3OBYA 4GY5A 2HMAA 1NEBA 3R6NA 1SSFA 3U23A 3S3MA 1QVGA 4EPCA 2ZPBB 1RAAB 2EYZA 2L0AA 2CZ0B 3BDLA 2LCLA 3QO3A 1X69A 4M77G 4RTXA 4CC3A 1GBRA 2CH4A 2EIFA 3OYIA 5GMKl 3ZBDA 5KYWA 1VQOT 2DYIA 2ESWA 3UT1A 1RAIB 2RQWA 3REBB 4EIKA 5GAOn 2HNIA 4CI0C 5FU6C 1Q82C 1XQHA 2RHIA 2Y4YA 2F5KA 3CCST 2W10A 4HT8A 1ZLMA 2QASA 4Y92A 2YLCA 4M75B 2PVOB 5GAMh 5GJVB 2BTTA 4N4GA 2FO0A 2LJ3A 3X25B 4BI8B 3G6EA 3JB9F 3HTRA 2GFAA 4KBMB 3LWHA 3L2VA 4MDXA 2LQKA 5KYUA 2RI5A 1YJNT 1YI2Q 3CCLT 3QYGB 2DIQA 1BBZA 1RLQC 2QA4A 1M3CA 3JCMh 1VQ5T 3KBGA 4PL6A 4DBQA 2CP2A 2L8DA 3H6ZA 2DBKA 2O31A 1KHCA 2KNBB 1U5SA 2HKNA 3RKWA 4A4FA 2HBPA 3FIFA 3R6OA 4HCCA 3HRTA 1VQLT 3JB9H 3PFSA 3RIRA 5FRMA 2R57A 2M0OA 4M7DD 1YJWA 3CC4A 1SHFA 3CCVQ 2RF0A 1H92A 1KJWA 5CQXA 4OVAA 1JXOA 4F17A 3EFOA 4ORZA 2I2LA 1PKSA 3NGPA 3CCJQ 1GRIA 2CSQA 1AWWA 1VQNA 1KD1U 3OS2A 4DOWA 2NUZA 1U1TA 2HKQB 4JRPA 1YJ9A 2PNIA 2XD0A 1QVFP 2V26A 3G6ET 4KUDK 2CZ7B 1ZSZA 2MI6A 2OI3A 4HCKA 2AT1B 3FB9A 4JRIA 1M1FA 2COWA 2MAMA 1OULA 4RUGA 1B3QA 1RADB 4F7UA 2RI2A 4BDZA 4OGEA 5LJ5f 1OZ3A 4OMQA 4QVDA 1KD1C 2QA4T 4ZTFA 2D6FA 3V8JA 1NBEB 4X1VA 2OAUA 3JCMc 4C5GA 4II1A 4LUEA 4WCIA 2DVEA 4O5VA 1IREB 1M8VA 2YDLA 2KK4A 2DD5A 5GAMg 4J9CA 5GAMj 1BI3A 1ABQA 1J3TA 1W2BA 2CS7A 1HJDA 3CBOA 2LT1A 2AK5A 3RESA 7AT1B 1AZEA 4JJNK 2JTEA 1VQMQ 3EG9A 4J8OA 3T9NA 2DL4A 3CQTA 4E6RA 1RAGB 4ZGJB 4LE9A 3G71A 2DTIA 1VQNT 2VC8A 4HCBA 3JCMg 3OS1A 1X43A 2G6FX 1H3HA 3TQ7P 1NPPA 2RQTA 1ABOA 2OAWA 3CPWS 4QVCA 2DA9A 2RJEA 2RK1A 1CKAA 5GMKm 2XDBA 1C1AA 3MP8A 3M56A 2VYTA 4C8QB 3UPUA 2JNGA 5I2MA 1K0SA 2J7IA 3V8KA 3QDFA 2J6FA 3RKYA 1MV3A 3CPFA 2PQWA 1JU5C 2JUFA 2BIVA 4FIBA 2DJZA 2RB6A 1RAHB 4LDUA 3CCVA 4PJOD 1KQSA 4Q5WA 1M8MA 4RTZA 3HKSA 4BUGA 1QVGS 2EGAA 4XU2A 1PD1A 2EPDA 3G1JA 1ARKA 2AKKA 5A2QE 3PTAA 1WYXA 2LCCA 3MP1A 4M77B 4OF1A 4F7UE 1QP2A 5LJ3h 3G71T 6AT1B 4M7AA 1IB8A 2E6ZA 2KXCA 3TEEA 4C0DC 4CC2A 2MK5A 3GNGA 1M1KR 3CCEA 1EFNA 2RM4A 1YCSB 3MHXA 1GCPA 4JPBW 4KGXB 3LW5E 5DY9A 2MPXC 1ACMB 4N4HA 2HSPA 1FWZA 2E3HA 2QK0A 1JQQA 1SRLA 1UJ0A 3OSSC 1OEBA 2KYBA 2IVWA 2QEXA 4PKCC 1JJ2P 4OB1B 5GAN8 2KDSA 3HP9A 4ZNXA 4M78D 4YTLA 5C0MA 3CBMA 1VYUA 3QJ6A 4F16A 4WTOB 4MZTA 3QWYA 3OYAA 4J9DA 1D3BB 4LN2A 4ZN1A 2L2PA 4M75D 2XMFA 4ZN3A 3D7SB 1E6GA 4XTWA 5CR2A 5GAMf 1T0JA 2RO0A 3L2WA 1B34B 3CCUQ 2VGNA 1BKBA 2MIOA 1Q7YR 1SG5A 4X9CA 1VQ4A 3V7RA 4FYVB 5M9OA 1K9MR 4QKUA 5CAIA 2SEMA 3CCET 1EZZB 3ZFJA 2KGTA 2COYA 3JCMf 1GFDA 3C94A 3LWIA 1Z9QA 1B7TA 4C0GA 1W1FA 2J06A 1CKBA 4IUTA 1MUZA 4ELZC 4FYWB 2QEXT 1ZUYA 2LC4A 3TSZA 5GAOq 1LPLA 2DFUA 1KC8U 3WXMB 1WQ7A 1QW1A 5LJ3g 2K3YA 5DLOA 2HD0A 5LJ3j 2KBTA 4M7AE 2I0NA 2RK2A 3VS5A 5GMKi 4RG2A 2YWWA 2DEUA 4C92E 4F7UF 2XK0A 2LDMA 5KYXB 2JT4A 1RAFB 1X27A 5LJ5e 3VJPA 3BY7A 3ER0A 4E47A 3QYHB 2ABLA 3M4YA 1W2BS 3M55A 1VQ4T 2O9SA 1QP3A 1PKTA 1TWBA 1VQOQ 4DBFA 2LNHB 5D6WA 2BKDN 1UEBA 5FRNA 3FJ5A 3CCSQ 1UGSB 1GCQC 3OYDA 2K5IA 1UUEA 3P8DA 1WJQA 2NUTA 4KGZB 4FU6A 3VS0A 2DNUA 2EYQA 5GANd 1YWOA 4QW2A 3SWNA 4RTTA 3LGLA 1WHGA 1JB0E 3NTIA 3M9QA 1YJNQ 2CGHA 4HKEA 1IRXA 2EJGA 3CCLQ 3RDVA 1OX9A 2CT3A 2DTOA 3A5ZB 1BB9A 4XU0A 2PTKA 1OU8A 4MMLA 4AFSC 3UA6A 4KGVB 3FC3A 1VQ5Q 3CCUA 1HD3A 2GCXA 2YUOA
chains in the Genus database with same CATH topology
2B86A 2L0AA 1WXTA 1UE9A 3TVTA 1X69A 4RTXA 1BK2A 4CC3A 2CH4A 2K7AA 1NYFA 1GBRA 1A0NB 1NG2A 2ED0A 4DEXA 2GTOA 1PHTA 1VYVA 2ESWA 2K9GA 1FYNA 1YWPA 3H41A 1U06A 1OV3A 1T0HA 4AFQC 2V1QA 2RQWA 1PRMC 3REBB 4EIKA 2F2VA 2OJ2A 2DX1A 4Z89A 2CH4W 2W10A 1Z9ZA 3VS1A 1GL5A 1ZLMA 4Y92A 2W0ZA 2CT4A 2JMAA 5GJVB 2BTTA 1TG0A 5IXBA 1KIKA 2FO0A 2FPEA 2LJ3A 1ZUKA 4OMLA 1CSKA 1UHCA 2LP5A 2FPFA 2ROLA 5IHNA 3EGUA 4IIMA 3ULRB 1UGVA 2DILA 1WI7A 2J6OA 2C0TA 2DL3A 1AD5A 1BBZA 1KSWA 1RLQC 4RTWA 3I9QA 3UATA 1M3CA 4HXJA 4JJBA 1OPKA 2DBKA 1H8KA 1AZGB 2O31A 2RNAA 2FRYA 2KNBB 1U5SA 2LQNA 5IH2A 1UJYA 2EYYA 4OMPA 2MOXA 2EGEA 1FMKA 2JM8A 1PRLC 4F14A 2E5KA 2EBPA 4ESRA 2AZVA 2LJ0A 4AFUC 1SHFA 2BZXA 2RF0A 2JW4A 1H92A 1KJWA 4F17A 1JXOA 4GBQA 2KROA 2YUNA 4ORZA 1NEGA 2GNCA 2GBQA 1PKSA 3NGPA 1K9AA 2DYBA 2GTJA 1GRIA 2BZYA 2CSQA 1AWWA 1UG1A 2D8HA 2AZSA 5FWBA 2PZ1A 1GFCA 1JEGA 2EGCA 1QKWA 3GBQA 3LH5A 2NUZA 2PNIA 1ZSGA 3IQLA 3PVLA 1Y0MA 1E7OA 2QDLA 2OI3A 2LX7A 4HCKA 2BZ8A 1UFFA 2DM1A 2F2WA 4RUGA 4JJDA 1B3QA 1YP5A 2A36A 4HVUA 4OMQA 2DRMA 2V1RA 4X1VA 2JS2A 4LUEA 4WCIA 4OMOA 2YDLA 4K11A 5FWCA 4CC7A 2CUDA 4HVVA 2O88A 2YSQA 1T3LA 3QWXX 4J9CA 1ABQA 1J3TA 1YNZA 2DRKA 3H0IA 1HJDA 2AK5A 1AZEA 2JTEA 1K0XA 1OOTA 2RQVA 1XOVA 2DL4A 3CQTA 4E6RA 1G2BA 4J9EA 4LE9A 5ECAA 1T3SA 2KRNA 1X2KA 4J9FA 2K2MA 1X43A 1MV0B 2M51A 2FG0A 2G6FX 5HCKA 1H3HA 5I11A 2EYWA 2O2OA 1S1NA 2RQTA 1ZUUA 2LJ1A 1ABOA 2OAWA 1AEYA 4Z8AA 2DA9A 2LMJA 3KFVA 2HDAA 4LNPA 4OMNA 1QKXA 1WDXA 1X2QA 1JO8A 2J05A 2VVKA 2RQUA 1CKAA 3EG3A 1K4US 1IO6A 1WLPB 2KYMA 5L23A 3PVQA 3A98A 3M0UA 1TUCA 3C0CA 4JZ3A 1K0SA 2J7IA 5GJWB 2L3QA 2J6FA 3EHRA 2IIMA 3I5SA 5IHKA 1MV3A 2NWMA 1M3AA 2A37A 2DJQA 2CSIA 1JU5C 1Y57A 4J9HA 1W70A 2ROTA 2JMCA 1ZBJA 5FW9A 1M8MA 4RTZA 4HVWA 4DEYA 1M27C 2EGAA 3RBBB 2EPDA 1ARKA 2AKKA 2H8HA 2ENMA 1AWXA 3VS2A 1WYXA 3VS4A 1VA7A 2GQIA 2JXBA 1I0CA 1M30A 1NYGA 2D0NA 4GLMA 4AG1C 1AWJA 2KXCA 1HSQA 3EG0A 4CC2A 3M0TA 3NHNA 2FEIA 2DL5A 2EVRA 1AOJA 1I1JA 1TUDA 1EFNA 1YCSB 1SPKA 1GCPA 1WIEA 2CREA 4JPBW 3H0FA 2VKNA 1SEMA 5IXFA 1M3BA 5EC7A 1RUWA 2HSPA 4J9GA 3M0PA 2P4RA 4OMMA 3THKA 2X3XD 1JQQA 1SRLA 1UJ0A 2C0IA 1OEBA 3NMZC 2KYBA 2DVJA 2LCSA 1ZX6A 1LCKA 1K1ZA 1YN8A 2EQIA 2RPNA 2RQRA 4ZNXA 4CC4B 1VYUA 2ECZA 4F16A 2KXDA 2KRMA 2KRSA 4JJCA 1JXMA 3QWYA 4RTUA 1V1CA 2L3SA 1KFZA 1GCQA 3H0HA 4J9DA 2A28A 3I5RA 3UF4A 2KT8A 2GGRA 4LN2A 2L2PA 2ED1A 2XMFA 2J6KA 2RN8A 1E6GA 3EG1A 3M0SA 1AVZC 1T0JA 1WXUA 2D1XA 2LZ6B 2K3BA 2K6DA 4IIOA 2L3PA 1G83A 1U3OA 2EKHA 3M0QA 3NPFA 1N5ZA 2MIOA 4D8KA 2KE9A 4RTVA 3TSWA 2SEMA 1I07A 2KGTA 1GFDA 1WXBA 1Z9QA 3VS3A 1WA7A 1RI9A 2HEQA 3VRZA 1W1FA 2J06A 1CKBA 4LUDA 4AG2C 1MUZA 3REAB 2D8JA 1ZUYA 1WFWA 3TSZA 2M0YA 3M0RA 2CUBA 2O9VA 4J9IA 1B07A 3SEMA 3ZL7C 2JM9A 2KBTA 3O5ZA 2VWFA 1E6HA 2C0OA 2I0NA 4D8DA 3VS5A 2LQWA 1VYTA 1SHGA 4KRTA 1OPLA 3EG2A 2X3WD 3PE0A 3EHQA 2FPDA 2DL8A 2KEAA 2KR3A 2JS0A 2DL7A 4FSSA 2HBWA 5I22A 2JT4A 1X27A 3RNJA 1NLOC 2DE0X 2YUQA 3JV3A 2HCKA 2ABLA 1UHFA 1BU1A 4M4ZA 3I35A 2MCNA 2O9SA 1RLPC 2DBMA 1SSHA 1PKTA 2KT1A 4A63B 1X6BA 3UA7A 2LNHB 2YUPA 2EYXA 3VS7A 2A08A 4Z88A 1UTIA 1QWEA 4J9BA 2DLPA 1UECA 3FJ5A 1K76A 1GBQA 1SRMA 1GCQC 2AKLA 1UUEA 1PNJA 1UDLA 3VRYA 3VS0A 1W6XA 2SRCA 2DNUA 4JZ4A 1NLPC 2RMOA 1YWOA 4R0KA 4RTYA 2FRWA 4AFZC 1AWOA 4RTTA 1QLYA 3SHWA 2YT6A 2F2XA 2K79A 2DMOA 1NM7A 2CDTA 1WX6A 4QT7A 1X6GA 2CT3A 2EW3A 1NEBA 1BB9A 1QWFA 3R6NA 1PWTA 2PTKA 3U23A 4AFSC 3UA6A 5IHIA 1QCFA 1HD3A 2DF6A 2YUOA 3VS6A 2EYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B86 A;  2L0A A;  1WXT A;  1UE9 A;  3TVT A;  1X69 A;  4RTX A;  1BK2 A;  4CC3 A;  2CH4 A;  2K7A A;  1NYF A;  1GBR A;  1A0N B;  1NG2 A;  2ED0 A;  4DEX A;  2GTO A;  1PHT A;  1VYV A;  2ESW A;  2K9G A;  1FYN A;  1YWP A;  3H41 A;  1U06 A;  1OV3 A;  1T0H A;  4AFQ C;  2V1Q A;  2RQW A;  1PRM C;  3REB B;  4EIK A;  2F2V A;  2OJ2 A;  2DX1 A;  4Z89 A;  2CH4 W;  2W10 A;  1Z9Z A;  3VS1 A;  1GL5 A;  1ZLM A;  4Y92 A;  2W0Z A;  2CT4 A;  2JMA A;  5GJV B;  2BTT A;  1TG0 A;  5IXB A;  1KIK A;  2FO0 A;  2FPE A;  2LJ3 A;  1ZUK A;  4OML A;  1CSK A;  1UHC A;  2LP5 A;  2FPF A;  2ROL A;  5IHN A;  3EGU A;  4IIM A;  3ULR B;  1UGV A;  2DIL A;  1WI7 A;  2J6O A;  2C0T A;  2DL3 A;  1AD5 A;  1BBZ A;  1KSW A;  1RLQ C;  4RTW A;  3I9Q A;  3UAT A;  1M3C A;  4HXJ A;  4JJB A;  1OPK A;  2DBK A;  1H8K A;  1AZG B;  2O31 A;  2RNA A;  2FRY A;  2KNB B;  1U5S A;  2LQN A;  5IH2 A;  1UJY A;  2EYY A;  4OMP A;  2MOX A;  2EGE A;  1FMK A;  2JM8 A;  1PRL C;  4F14 A;  2E5K A;  2EBP A;  4ESR A;  2AZV A;  2LJ0 A;  4AFU C;  1SHF A;  2BZX A;  2RF0 A;  2JW4 A;  1H92 A;  1KJW A;  4F17 A;  1JXO A;  4GBQ A;  2KRO A;  2YUN A;  4ORZ A;  1NEG A;  2GNC A;  2GBQ A;  1PKS A;  3NGP A;  1K9A A;  2DYB A;  2GTJ A;  1GRI A;  2BZY A;  2CSQ A;  1AWW A;  1UG1 A;  2D8H A;  2AZS A;  5FWB A;  2PZ1 A;  1GFC A;  1JEG A;  2EGC A;  1QKW A;  3GBQ A;  3LH5 A;  2NUZ A;  2PNI A;  1ZSG A;  3IQL A;  3PVL A;  1Y0M A;  1E7O A;  2QDL A;  2OI3 A;  2LX7 A;  4HCK A;  2BZ8 A;  1UFF A;  2DM1 A;  2F2W A;  4RUG A;  4JJD A;  1B3Q A;  1YP5 A;  2A36 A;  4HVU A;  4OMQ A;  2DRM A;  2V1R A;  4X1V A;  2JS2 A;  4LUE A;  4WCI A;  4OMO A;  2YDL A;  4K11 A;  5FWC A;  4CC7 A;  2CUD A;  4HVV A;  2O88 A;  2YSQ A;  1T3L A;  3QWX X;  4J9C A;  1ABQ A;  1J3T A;  1YNZ A;  2DRK A;  3H0I A;  1HJD A;  2AK5 A;  1AZE A;  2JTE A;  1K0X A;  1OOT A;  2RQV A;  1XOV A;  2DL4 A;  3CQT A;  4E6R A;  1G2B A;  4J9E A;  4LE9 A;  5ECA A;  1T3S A;  2KRN A;  1X2K A;  4J9F A;  2K2M A;  1X43 A;  1MV0 B;  2M51 A;  2FG0 A;  2G6F X;  5HCK A;  1H3H A;  5I11 A;  2EYW A;  2O2O A;  1S1N A;  2RQT A;  1ZUU A;  2LJ1 A;  1ABO A;  2OAW A;  1AEY A;  4Z8A A;  2DA9 A;  2LMJ A;  3KFV A;  2HDA A;  4LNP A;  4OMN A;  1QKX A;  1WDX A;  1X2Q A;  1JO8 A;  2J05 A;  2VVK A;  2RQU A;  1CKA A;  3EG3 A;  1K4U S;  1IO6 A;  1WLP B;  2KYM A;  5L23 A;  3PVQ A;  3A98 A;  3M0U A;  1TUC A;  3C0C A;  4JZ3 A;  1K0S A;  2J7I A;  5GJW B;  2L3Q A;  2J6F A;  3EHR A;  2IIM A;  3I5S A;  5IHK A;  1MV3 A;  2NWM A;  1M3A A;  2A37 A;  2DJQ A;  2CSI A;  1JU5 C;  1Y57 A;  4J9H A;  1W70 A;  2ROT A;  2JMC A;  1ZBJ A;  5FW9 A;  1M8M A;  4RTZ A;  4HVW A;  4DEY A;  1M27 C;  2EGA A;  3RBB B;  2EPD A;  1ARK A;  2AKK A;  2H8H A;  2ENM A;  1AWX A;  3VS2 A;  1WYX A;  3VS4 A;  1VA7 A;  2GQI A;  2JXB A;  1I0C A;  1M30 A;  1NYG A;  2D0N A;  4GLM A;  4AG1 C;  1AWJ A;  2KXC A;  1HSQ A;  3EG0 A;  4CC2 A;  3M0T A;  3NHN A;  2FEI A;  2DL5 A;  2EVR A;  1AOJ A;  1I1J A;  1TUD A;  1EFN A;  1YCS B;  1SPK A;  1GCP A;  1WIE A;  2CRE A;  4JPB W;  3H0F A;  2VKN A;  1SEM A;  5IXF A;  1M3B A;  5EC7 A;  1RUW A;  2HSP A;  4J9G A;  3M0P A;  2P4R A;  4OMM A;  3THK A;  2X3X D;  1JQQ A;  1SRL A;  1UJ0 A;  2C0I A;  1OEB A;  3NMZ C;  2KYB A;  2DVJ A;  2LCS A;  1ZX6 A;  1LCK A;  1K1Z A;  1YN8 A;  2EQI A;  2RPN A;  2RQR A;  4ZNX A;  4CC4 B;  1VYU A;  2ECZ A;  4F16 A;  2KXD A;  2KRM A;  2KRS A;  4JJC A;  1JXM A;  3QWY A;  4RTU A;  1V1C A;  2L3S A;  1KFZ A;  1GCQ A;  3H0H A;  4J9D A;  2A28 A;  3I5R A;  3UF4 A;  2KT8 A;  2GGR A;  4LN2 A;  2L2P A;  2ED1 A;  2XMF A;  2J6K A;  2RN8 A;  1E6G A;  3EG1 A;  3M0S A;  1AVZ C;  1T0J A;  1WXU A;  2D1X A;  2LZ6 B;  2K3B A;  2K6D A;  4IIO A;  2L3P A;  1G83 A;  1U3O A;  2EKH A;  3M0Q A;  3NPF A;  1N5Z A;  2MIO A;  4D8K A;  2KE9 A;  4RTV A;  3TSW A;  2SEM A;  1I07 A;  2KGT A;  1GFD A;  1WXB A;  1Z9Q A;  3VS3 A;  1WA7 A;  1RI9 A;  2HEQ A;  3VRZ A;  1W1F A;  2J06 A;  1CKB A;  4LUD A;  4AG2 C;  1MUZ A;  3REA B;  2D8J A;  1ZUY A;  1WFW A;  3TSZ A;  2M0Y A;  3M0R A;  2CUB A;  2O9V A;  4J9I A;  1B07 A;  3SEM A;  3ZL7 C;  2JM9 A;  2KBT A;  3O5Z A;  2VWF A;  1E6H A;  2C0O A;  2I0N A;  4D8D A;  3VS5 A;  2LQW A;  1VYT A;  1SHG A;  4KRT A;  1OPL A;  3EG2 A;  2X3W D;  3PE0 A;  3EHQ A;  2FPD A;  2DL8 A;  2KEA A;  2KR3 A;  2JS0 A;  2DL7 A;  4FSS A;  2HBW A;  5I22 A;  2JT4 A;  1X27 A;  3RNJ A;  1NLO C;  2DE0 X;  2YUQ A;  3JV3 A;  2HCK A;  2ABL A;  1UHF A;  1BU1 A;  4M4Z A;  3I35 A;  2MCN A;  2O9S A;  1RLP C;  2DBM A;  1SSH A;  1PKT A;  2KT1 A;  4A63 B;  1X6B A;  3UA7 A;  2LNH B;  2YUP A;  2EYX A;  3VS7 A;  2A08 A;  4Z88 A;  1UTI A;  1QWE A;  4J9B A;  2DLP A;  1UEC A;  3FJ5 A;  1K76 A;  1GBQ A;  1SRM A;  1GCQ C;  2AKL A;  1UUE A;  1PNJ A;  1UDL A;  3VRY A;  3VS0 A;  1W6X A;  2SRC A;  2DNU A;  4JZ4 A;  1NLP C;  2RMO A;  1YWO A;  4R0K A;  4RTY A;  2FRW A;  4AFZ C;  1AWO A;  4RTT A;  1QLY A;  3SHW A;  2YT6 A;  2F2X A;  2K79 A;  2DMO A;  1NM7 A;  2CDT A;  1WX6 A;  4QT7 A;  1X6G A;  2CT3 A;  2EW3 A;  1NEB A;  1BB9 A;  1QWF A;  3R6N A;  1PWT A;  2PTK A;  3U23 A;  4AFS C;  3UA6 A;  5IHI A;  1QCF A;  1HD3 A;  2DF6 A;  2YUO A;  3VS6 A;  2EYZ A; 
#chains in the Genus database with same CATH topology
 1M1K U;  2K7A A;  1VQL Q;  1NYF A;  1A0N B;  1NG2 A;  4LDX A;  4M7A G;  1Q95 G;  2NYS A;  2ED0 A;  2GTO A;  2M02 A;  4C8Q D;  1FYN A;  3H41 A;  1U06 A;  2RJD A;  4AFQ C;  1RAC B;  1QVP A;  4C92 G;  2VXF A;  3VS1 A;  1GL5 A;  1LJO A;  3BE3 A;  2CT4 A;  5GMK h;  1TG0 A;  1KD1 R;  1M1K C;  4BAC A;  2HL5 C;  2FPE A;  4M7A F;  2MWP A;  4F04 B;  3G6E Q;  1UHC A;  4FT2 A;  1QVF S;  2GQV A;  1HXD A;  3EGU A;  3GNF B;  3G7Z A;  1UGV A;  2DIL A;  4Y91 A;  5C6S A;  4M77 D;  1IHV A;  3M59 A;  2J6O A;  3QUI A;  2DXC A;  2Y4X A;  3I56 T;  5LJ3 f;  2L3R A;  4EDU A;  2OTL A;  4HCZ A;  2R58 A;  4DBR A;  5IT9 E;  3L2Q A;  1AZG B;  1Q7Y U;  2HAX A;  5HKC A;  4MMK A;  3V7S A;  3OYJ A;  4P5N A;  4CRI A;  1UJY A;  3EFS A;  1Y7X A;  3M53 A;  5EG2 A;  1I5L A;  1FMK A;  2X4W A;  3OB9 A;  1WGS A;  2K4Y A;  4ESR A;  1VQO A;  4MZM A;  4JRK A;  2JW4 A;  3EH1 A;  4GBQ A;  3CPW A;  3WVE B;  2KRO A;  1NEG A;  1K9A A;  4Y28 E;  4J7F A;  3PGG A;  4JS5 A;  3CCS A;  1Q7Y C;  1YBY A;  2AZS A;  5FWB A;  1GFC A;  1VQN Q;  2RA2 A;  3L1A A;  1QKW A;  3CC2 T;  4FSX A;  2QGG A;  2X4X A;  3OMG A;  5GAM e;  1K9M C;  5GAO p;  5CCA A;  3M57 A;  3PVL A;  1H64 1;  1OI1 A;  3OY9 A;  1Y0M A;  2DD4 A;  1N9R A;  5CKE A;  2JTM A;  2QDL A;  3LGF A;  1Y71 A;  4AT1 B;  1YJN A;  8ATC B;  4L5G A;  3MKD A;  4M7D A;  1D0Z A;  4HVU A;  4KUI A;  1VQ5 A;  2DRM A;  3JCM e;  3SDZ A;  1TUG B;  2EQK A;  5I21 A;  2OTL T;  3MPU B;  2JJ9 A;  2MWO A;  4N4I A;  4OMO A;  1VQ9 A;  4CC7 A;  1Y07 A;  2COZ A;  3S3O A;  3EGX B;  1VQL A;  2BE9 B;  1RL2 A;  3CMA A;  5GMK j;  1G3S A;  3JB9 G;  2E5Q A;  1G3T A;  1MND A;  1YNZ A;  3NTK A;  3H0I A;  4HT9 A;  1JBM A;  1XOV A;  4M78 B;  1XNI A;  1WHK A;  2QQA A;  2XHC A;  1G2B A;  3N5B B;  2LTO A;  5ECA A;  3E1S A;  2CZ6 B;  3G71 Q;  2KRN A;  3P8H A;  2M51 A;  1ZUU A;  1ZBX A;  1VQ6 T;  3C12 A;  4C5E A;  5KYY B;  1EX4 A;  2H3E B;  4LD6 A;  3KFV A;  4JDS A;  4LNP A;  5CO7 A;  1JO8 A;  2VVK A;  1K4U S;  1IO6 A;  3J81 E;  1WLP B;  2KYM A;  5L23 A;  2DPP B;  2K57 A;  1S72 Q;  2QTV A;  4BY6 B;  3BW1 A;  2HQX A;  5GAN f;  1JJ2 S;  3I5S A;  4IUV A;  1G8X A;  1YCY A;  4J9H A;  1VQ9 T;  2AHJ B;  1VQ7 A;  3CMA T;  1ZA2 B;  2ROT A;  2JMC A;  2OTJ A;  1VQK A;  2ZPH B;  1M27 C;  3L2Z A;  5FU7 B;  2E65 A;  4FL6 A;  1HYO A;  2H8H A;  4XK8 E;  3VS2 A;  3SWN C;  4JLI A;  4GLM A;  3EGD B;  1AWJ A;  2JVV A;  1HSQ A;  1X6O A;  3QG1 A;  2FEI A;  2DL5 A;  1TUD A;  3HRU A;  2FZG B;  1SPK A;  1KG1 A;  3CCE Q;  1WIE A;  9ATC B;  3H0F A;  2VKN A;  4C92 B;  1SEM A;  3FJP A;  5EC7 A;  3AT1 B;  4EMK A;  2F69 A;  4J9G A;  4BB7 A;  2P4R A;  1R0C B;  2PUO B;  2X3X D;  2C0I A;  3NMZ C;  1KQ1 A;  4QQD A;  4PJO A;  3BDU A;  2LCS A;  2V8I A;  2NUP B;  2X9H A;  2LQ8 A;  3HFO A;  2EKO A;  2QEX Q;  1VIE A;  2R5M A;  3LH0 A;  3MP6 A;  3M54 A;  4BD3 A;  2O01 E;  3L2R A;  1NJI R;  2RQR A;  4QQ6 A;  2QGF B;  3M5A A;  2QG9 B;  4OGC A;  1KC8 R;  2KXD A;  2KRS A;  2DXB A;  1V1C A;  1GCQ A;  3H0H A;  3TCJ A;  2CP0 A;  1VQ7 T;  3CXC P;  3I5R A;  2KT8 A;  2FZC B;  2LT4 A;  3M58 A;  2J6K A;  3RER A;  2X51 A;  2CZ1 B;  2OTJ T;  1VQK T;  2QDY B;  2FL7 A;  1G83 A;  2K5F A;  2L3P A;  1U3O A;  3NPF A;  1N5Z A;  2XU8 A;  4D8K A;  5LJ3 e;  4JLG A;  2HL3 A;  2PVG B;  3QZ9 B;  3VYH B;  1LNX A;  3M4G A;  1N9S A;  3TSW A;  1VQ4 Q;  1I07 A;  1JRI A;  3MET A;  1NZ9 A;  2ZPI B;  1WXB A;  3QII A;  3CME T;  3VS3 A;  2RH2 A;  1WA7 A;  5GAN 4;  4Z02 A;  3VRZ A;  2C06 A;  5FLX E;  3URG A;  2P0P A;  1MMA A;  2EAY A;  4ME7 A;  1S72 A;  4NL3 A;  2F1L A;  4M75 A;  4RMO A;  4KH0 B;  3G4S A;  3L2U A;  1WFW A;  2CUB A;  2O9V A;  1PM3 A;  1OQK A;  4PNO A;  1B07 A;  2JM9 A;  3O5Z A;  3VUB A;  1E6H A;  2C0O A;  2CYZ B;  3HHT B;  1R0B G;  2CP3 A;  4RG8 A;  3PE0 A;  4DQ2 A;  3RMQ A;  4QQG A;  1FMW A;  2FPD A;  1BCO A;  4J83 A;  4M7D F;  2JS0 A;  2BUD A;  2ZAE A;  4IUQ A;  3MEV A;  1C0M A;  3BFM A;  4ZTJ A;  3RNJ A;  4XTU A;  2DE0 X;  3OQ5 A;  2HCK A;  4M7D C;  1UHF A;  2F5T X;  1R8O B;  3OS0 A;  1RLP C;  1M5Q 1;  3UA7 A;  3PMI A;  1M2V B;  2EYX A;  1QVF A;  4NS5 A;  4OB0 B;  3VS7 A;  2KI7 A;  4Z88 A;  1UTI A;  1QWE A;  4J9B A;  1UEC A;  1KK7 A;  1GBQ A;  3FDR A;  3JCM W;  1S72 T;  3JB9 J;  1PNJ A;  5DM7 R;  5GAN 2;  1MMG A;  3G4S T;  3LX7 A;  4JZ4 A;  2RMO A;  2E3I A;  4PJJ A;  1O75 A;  1X01 A;  2YT6 A;  4ANJ A;  5GAO l;  1X75 C;  2K79 A;  4XTZ A;  3I56 Q;  2EW3 A;  3KUF A;  2O4X B;  1PWT A;  3CXC A;  5IHI A;  1QCF A;  1XTD A;  3VS6 A;  2ZPG B;  1O9S A;  2B86 A;  2LNV A;  3I55 A;  3X28 B;  1UE9 A;  2E12 A;  4WF2 A;  5GAN e;  2XDD A;  2L89 A;  2K9G A;  2JTF A;  2ZGW A;  2GFU A;  2M9U A;  1OV3 A;  1T0H A;  5A0G A;  1IHW A;  4B9W A;  2DX1 A;  2R5A A;  1H3Z A;  4Z89 A;  2CH4 W;  5D6X A;  3PNW C;  1BCM A;  3OS5 A;  3SB2 A;  2W0Z A;  4F7U G;  2HQH A;  3CC2 Q;  1NJI U;  1KIK A;  4J5Y A;  4OML A;  1CSK A;  2IG0 A;  1XJW B;  2LP5 A;  2QQ9 A;  2ROL A;  1U1S A;  1WI7 A;  2RI3 A;  4BDY A;  1RI0 A;  4B6M A;  2LX9 A;  2C0T A;  4PJN A;  1AD5 A;  4M7A D;  2VUB A;  1KSW A;  4BE0 A;  1N27 A;  4C8Q A;  4HXJ A;  1OPK A;  4PJO F;  2OTL Q;  3CD6 Q;  1H8K A;  4A4E A;  1OYX A;  2IPO B;  1NJI C;  2RNA A;  4C92 D;  3TU4 K;  2LQN A;  2EWN A;  5KYN A;  1YHQ A;  4KT0 E;  1KC8 C;  4OMP A;  2RHY A;  3FEO A;  3JCM b;  2MOX A;  2EGE A;  3I55 T;  2JM8 A;  4EMK C;  5A0L A;  4F14 A;  3H8Z A;  2EBP A;  2FYK A;  5GAN h;  3CC7 T;  5DLQ E;  4PJO C;  1VIF A;  4AFU C;  2YUN A;  2WAC A;  2GBQ A;  2MF2 A;  3GIB A;  2DYB A;  3EH2 A;  1VQP A;  3S6W A;  1EIF A;  3A8M B;  1UG1 A;  2D8H A;  1JEG A;  2PZ1 A;  2EGC A;  3JCM P;  5GAN 5;  3LH5 A;  5GMK e;  5CQY A;  1JJ2 A;  1E7O A;  3SD4 A;  3JCM J;  4XU3 A;  1VQ6 Q;  2LX7 A;  3HL8 A;  2BZ8 A;  3EAE A;  3GPL A;  1UFF A;  3TRE A;  2DM1 A;  4L59 A;  1QCO A;  4JJD A;  4LXC A;  3I56 A;  2QQB A;  3LLR A;  1MGQ A;  4M75 F;  2EQJ A;  4M78 C;  5D7U A;  1YHQ T;  2CUD A;  3E9F A;  2O88 A;  2FB7 A;  2YSQ A;  1T3L A;  1VQ9 Q;  1M90 R;  3QWX X;  3JB9 I;  1D3B A;  5IN1 A;  3CMA Q;  5KYW B;  3CEY A;  4M75 C;  5CIU A;  1WHL A;  3RKX A;  3GOX A;  1WHH A;  1OOT A;  2RQV A;  3QPH A;  4QVZ A;  1B34 A;  5GAO m;  5GAO r;  2A7Y A;  1VQP T;  4J9E A;  4A4H A;  1VUB A;  4OP0 A;  4NOY A;  3CC2 A;  1T3S A;  4J9F A;  1X2K A;  2K2M A;  1MV0 B;  3H9N A;  2QXF A;  4XTV A;  5I11 A;  2LJ1 A;  3OYK A;  4X34 A;  1AEY A;  3S3N A;  2HDA A;  3DKM A;  5KYU B;  2MMP A;  1QKX A;  1X2Q A;  5GAN g;  2RQU A;  2HSE B;  5GAN j;  3JB9 D;  1V29 B;  5LJ5 d;  3M0U A;  4JZ3 A;  3CD6 A;  2CKK A;  3O8V A;  2L3Q A;  3GLX A;  2M16 A;  3GF5 A;  1M3A A;  2A37 A;  4FM4 B;  4ELY C;  1PCX A;  2E4H A;  3HFN A;  1TSF A;  2E64 A;  4N0A C;  1YIJ Q;  1VQ7 Q;  3CXC S;  5A0D A;  1QQJ A;  2KVQ G;  3EFO B;  3RBB B;  2OTJ Q;  1VQK Q;  5J3B A;  4D6W A;  5KYX A;  2ENM A;  3A1P A;  1AWX A;  1WJR A;  1YIT T;  3VS4 A;  1VA7 A;  2GQI A;  3HRS A;  4LDW A;  2JXB A;  4C0F A;  4AG1 C;  1D1B A;  3EG0 A;  1WPY A;  3M0T A;  3Q1J A;  2EVR A;  5KCH A;  3JRZ A;  3CCR A;  1I1J A;  3QJY A;  2WSC E;  2ZZD A;  1VQ6 A;  1ZSZ B;  5IXF A;  3CME Q;  3PIP A;  2FHD A;  4RCC A;  4OMM A;  3THK A;  2YLB A;  3PIO A;  4F7U B;  3NFC A;  4DOV A;  1SF9 A;  1LCK A;  3FRN A;  4HA8 A;  2RJC A;  1YN8 A;  3CD6 T;  4RCB A;  2YHT A;  1BIB A;  5HK0 A;  2DZ9 A;  1JXM A;  4E7I A;  4RTU A;  4C5H A;  5I2S A;  2LRQ A;  2GGR A;  4DA4 A;  2DER A;  2XG8 D;  4DBH A;  2RN8 A;  1TOV A;  3VKI A;  1LOJ A;  3M0S A;  1AVZ C;  3EG9 B;  1Q82 U;  3QBY A;  1NE8 A;  2VB6 A;  1W4S A;  2K3B A;  2K6D A;  4IIO A;  4C8Q F;  3HSB A;  3OYY A;  2QQS A;  1W2B P;  3J7A F;  2KE9 A;  3CCR T;  4C8Q C;  4V2S A;  4J6W A;  4EMH A;  1PSF A;  1D1A A;  4XTY A;  1Y96 A;  2EQU A;  2HZY A;  2AIR B;  2HEQ A;  3FLG A;  3OW2 P;  2E70 A;  3RUX A;  5IAY A;  4LUD A;  1UGQ B;  4AG2 C;  4OB3 B;  2DK3 A;  3OBW A;  1BYM A;  4M77 F;  1UGP B;  3G4S Q;  2YRV A;  3X26 B;  3OYC A;  4JUV A;  1FXX A;  2P84 A;  2P0K A;  1M90 U;  3SEM A;  3UWN A;  3WVD B;  3ZL7 C;  4TVR A;  5KE3 A;  1MMN A;  3OYE A;  2RJF A;  4M77 C;  1YIJ A;  1TTH B;  1PD0 A;  1OPL A;  3EG2 A;  2JZ2 A;  2X3W D;  2QQR A;  3MO8 A;  2QTX A;  2KR3 A;  5GAM d;  3CCQ A;  1WHM A;  2HBW A;  4R55 A;  3V7C A;  1VQ8 A;  1NLO C;  3DB4 A;  4M7D E;  2G3R A;  2XDP A;  1M90 C;  1KQS P;  2YUQ A;  4M7A B;  2X4J A;  3A8L B;  1BU1 A;  3I35 A;  4XAX B;  2MCN A;  2DBM A;  2KT1 A;  4A63 B;  2B8A A;  4ZGD B;  5HK3 A;  3CME A;  3JCM d;  2WSE E;  1Q86 R;  5CKB A;  2ZPE B;  3DLM A;  8AT1 B;  1F1B B;  3JCM X;  2A3L A;  3OYG A;  2EJ9 A;  1RAB B;  2CP5 A;  4J6Y A;  2AKL A;  3CCM A;  4PLI A;  4J6X A;  5CKH A;  4E7K A;  1NPR A;  2KQW A;  4PK4 A;  1BI1 A;  1W6X A;  2SRC A;  2VXE A;  2K3X A;  1WQW A;  2YRD A;  4RTY A;  1C6V X;  2FRW A;  3RMS A;  1N8R R;  1AWO A;  2F2X A;  3OYM A;  4A4G A;  2Z0W A;  1NM7 A;  2CDT A;  4QT7 A;  4BI3 A;  1YIJ T;  4UC4 A;  1QMC A;  4JRQ A;  2JN0 A;  1QWF A;  3F70 A;  2DF6 A;  4NL2 A;  1ZA1 B;  3SFM A;  3CCQ T;  2RHU A;  4MZP A;  4VUB A;  1WXT A;  3VU3 C;  3EGX A;  3TVT A;  1WJS A;  1VQ8 T;  3I55 Q;  1TS9 A;  1BK2 A;  3X20 B;  4DEX A;  1YJW T;  1PHT A;  1VYV A;  3CC7 Q;  3CC4 T;  1MHN A;  1YWP A;  3GP8 A;  5KCO A;  4M78 A;  2V1Q A;  1PRM C;  2F2V A;  2OJ2 A;  3MEW A;  1Z9Z A;  2PUK B;  5D6Y A;  3OW2 A;  2JMA A;  2FZK B;  5GAN 7;  1D09 B;  4E2F B;  4M7D G;  3CCM T;  3OYF A;  1YJ9 T;  5IXB A;  4A54 A;  1M9S A;  3LYI A;  3JCM V;  1ZUK A;  2KY9 A;  5KYY A;  1MMD A;  2V8J A;  2ZCF B;  4PJL A;  1WHJ A;  2FPF A;  5IHN A;  3AHU A;  5FU6 B;  4IIM A;  3ULR B;  3J80 E;  1YI2 A;  4OMF B;  2DZC A;  2P4T A;  4JS4 A;  1AT1 B;  2DL3 A;  1K8A R;  3VYG A;  4RTW A;  1WZO A;  3I9Q A;  4FYY B;  2YXY A;  3UAT A;  2BE7 D;  3VV0 A;  4ATO A;  1HK9 A;  1M4Z A;  4JJB A;  5AYF A;  4FW2 A;  3P8B B;  2DIG A;  2FRY A;  5IH2 A;  3UDC A;  1M1G A;  2EYY A;  4RKU E;  4FW1 A;  4O6J A;  3QSU A;  4E7Z A;  4PJO E;  1YHQ Q;  1PRL C;  2E5K A;  3E2U A;  2AZV A;  2LJ0 A;  1AHJ B;  2BZX A;  3QXE B;  3EFR A;  4KUL A;  2D9T A;  4IKF A;  3MJX A;  3CCJ A;  1K73 R;  2GNC A;  4PLL A;  4EMG A;  2DXU A;  2GTJ A;  2BZY A;  1VQP Q;  2V8K A;  3EGD A;  4N0A A;  2EJF A;  3GBQ A;  4E7S A;  2DTH A;  2NUT B;  1ZSG A;  1IGQ A;  2VGM A;  3IQL A;  5KE2 A;  4C92 A;  4ZGE B;  3SWN B;  5AT1 B;  2CP6 A;  2F2W A;  2XKO C;  2E6N A;  2WSF E;  1YI2 T;  4FT4 A;  1YP5 A;  2A36 A;  1I5O B;  2XID A;  2NUP A;  5LJ3 d;  1PSE A;  2V1R A;  4M78 E;  3E9G A;  2JS2 A;  2M1H A;  5CKD A;  2KAF A;  1ZHI A;  4XTX A;  3ASK A;  2H3J A;  4K11 A;  2QAZ A;  4OB2 B;  4E7H A;  5FWC A;  1M2O A;  4HVV A;  1KQ2 A;  4M75 E;  1OU9 A;  2DAQ A;  3CC7 A;  3QZ5 B;  3CCV T;  2DRK A;  1VQM A;  2RHX A;  1Q86 U;  1K0X A;  1BIA A;  3CCJ T;  4BE2 A;  2DET A;  1YIT Q;  2JOY A;  3L42 A;  3OYB A;  2DO3 A;  3RR6 A;  4IUP A;  1MNE A;  4PJO G;  2FG0 A;  2RD1 A;  5HCK A;  2GF7 A;  5J26 A;  1N8R U;  1PG5 B;  2EYW A;  2O2O A;  1S1N A;  4PFZ A;  1BI2 A;  2ATC B;  3VUZ A;  1D0X A;  4Z8A A;  2LMJ A;  1DJ7 B;  3X24 B;  1Q86 C;  1WNL A;  4OMN A;  1WDX A;  2J05 A;  3EG3 A;  2E41 A;  1Q81 R;  4IUR A;  4A53 A;  3OA6 A;  3ZEH A;  3PVQ A;  3A98 A;  1TUC A;  2NLU A;  3C0C A;  3OYL A;  4FCY A;  5GJW B;  3EHR A;  2IIM A;  5IHK A;  2NWM A;  3PMT A;  2E10 A;  1N8R C;  3HPW A;  2DJQ A;  1IZ6 A;  1Y57 A;  2CSI A;  2E1H A;  3MCA B;  4LD9 K;  3E19 A;  1W70 A;  4LDY A;  4X9D A;  1I81 A;  2KMT A;  5GAN 3;  1ZBJ A;  1PC0 A;  5FW9 A;  1VQM T;  4HVW A;  4DEY A;  4BI4 A;  1GXI E;  5CK9 A;  5GAN 6;  2CP7 A;  1ZSZ C;  4M78 G;  2RHZ A;  3V8L A;  2X4Y A;  4M77 A;  2MYS A;  1Q82 R;  1UB4 A;  1I0C A;  1M30 A;  1NYG A;  2D0N A;  2DEQ A;  3PT9 A;  3NHN A;  4GLK A;  3MEA A;  1AOJ A;  3CPW P;  4M75 G;  4L6V 5;  1I8F A;  4R56 A;  2X35 A;  3CCR Q;  1OZ2 A;  2L5Q A;  1U8R A;  3JCM Q;  2CRE A;  2QYZ A;  1M2V A;  1VOM A;  1M3B A;  1K8A U;  1FX7 A;  1IGU A;  1RUW A;  3M0P A;  3DLL A;  2QI2 A;  4M78 F;  4C0D B;  1ZQ1 A;  4M7D B;  1R77 A;  2DVJ A;  1ZX6 A;  3OW2 S;  4AMC A;  1OX8 A;  1K1Z A;  2EQI A;  2RPN A;  2A0F B;  1KHI A;  2KSS A;  4CC4 B;  1P92 A;  2ECZ A;  3INZ A;  1IXD A;  2KRM A;  4JJC A;  4PFO A;  3A8O B;  3MEU A;  4IUU A;  2L3S A;  3C4S A;  1KFZ A;  2A28 A;  4B9X A;  1K8A C;  3UF4 A;  1QVG P;  1K73 U;  2XI9 A;  2ED1 A;  2O4X A;  2D0Q B;  3C95 A;  1N6A A;  3EG1 A;  1WXU A;  2D1X A;  2LZ6 B;  2K5L A;  2EKH A;  3M0Q A;  1YIT A;  3DB3 A;  1TXQ A;  5LJ5 h;  3OMC A;  2LVM A;  1I4K 1;  4FYX B;  4C8Q E;  4BE1 A;  4RTV A;  4E7L A;  1KQS S;  4C5I A;  4BY6 C;  5FRO A;  1K73 C;  4PFP A;  4KH1 B;  1Y96 B;  1RI9 A;  3QHS A;  5KH6 A;  1BI0 A;  2OX7 A;  2VV5 A;  3REA B;  2D8J A;  2M0Y A;  3M0R A;  2P0Q A;  4J9I A;  1QCN A;  5LL6 S;  5FU7 C;  5CKF A;  1TH7 A;  3QKJ A;  4M77 E;  1LVK A;  4MDW A;  2K2V A;  2VWF A;  3QDR B;  4C92 F;  4D8D A;  2ZPF B;  2LQW A;  1VYT A;  2FVU A;  1SHG A;  4KRT A;  4M7A C;  3EHQ A;  3A8G B;  1RAE B;  3KXT A;  2DL8 A;  2QA4 Q;  4XQ3 A;  2KEA A;  3OSV A;  2HQE A;  4A4K A;  2XIC A;  2DL7 A;  3CCU T;  4FSS A;  1D0Y A;  4C92 C;  5I22 A;  3CCQ Q;  3ME9 A;  1K9M U;  3JV3 A;  1VQ8 Q;  2EQM A;  4M4Z A;  2PVD B;  1V76 A;  1SSH A;  1FMV A;  3JSC A;  1YJW Q;  1X6B A;  2DXT A;  5CVI A;  2DKG A;  3CC4 Q;  2YUP A;  4PJM A;  1Q81 U;  2A08 A;  4EMK B;  2DLP A;  3CBP A;  4E7J A;  1K76 A;  1SRM A;  1TU0 B;  4PJO B;  1D1C A;  2VAS A;  2YRC A;  5L8R E;  4XU1 A;  5HY6 A;  2EFI A;  1G3W A;  1UDL A;  3VRY A;  3A8H B;  4LDV A;  3OYH A;  4C8Q G;  1SKU B;  3CCM Q;  1YJ9 Q;  1G3Y A;  1NLP C;  3JAM E;  2Y90 A;  2PU9 B;  1G5V A;  4C0Z A;  3NTH A;  4R0K A;  5LJ5 g;  4AFZ C;  5J39 A;  1YFN A;  5LJ5 j;  1QLY A;  3SHW A;  4J7I A;  3OYN A;  3CCL A;  2DMO A;  1WX6 A;  1UGR B;  1X6G A;  1Q81 C;  3OBY A;  4GY5 A;  2HMA A;  1NEB A;  3R6N A;  1SSF A;  3U23 A;  3S3M A;  1QVG A;  4EPC A;  2ZPB B;  1RAA B;  2EYZ A;  2L0A A;  2CZ0 B;  3BDL A;  2LCL A;  3QO3 A;  1X69 A;  4M77 G;  4RTX A;  4CC3 A;  1GBR A;  2CH4 A;  2EIF A;  3OYI A;  5GMK l;  3ZBD A;  5KYW A;  1VQO T;  2DYI A;  2ESW A;  3UT1 A;  1RAI B;  2RQW A;  3REB B;  4EIK A;  5GAO n;  2HNI A;  4CI0 C;  5FU6 C;  1Q82 C;  1XQH A;  2RHI A;  2Y4Y A;  2F5K A;  3CCS T;  2W10 A;  4HT8 A;  1ZLM A;  2QAS A;  4Y92 A;  2YLC A;  4M75 B;  2PVO B;  5GAM h;  5GJV B;  2BTT A;  4N4G A;  2FO0 A;  2LJ3 A;  3X25 B;  4BI8 B;  3G6E A;  3JB9 F;  3HTR A;  2GFA A;  4KBM B;  3LWH A;  3L2V A;  4MDX A;  2LQK A;  5KYU A;  2RI5 A;  1YJN T;  1YI2 Q;  3CCL T;  3QYG B;  2DIQ A;  1BBZ A;  1RLQ C;  2QA4 A;  1M3C A;  3JCM h;  1VQ5 T;  3KBG A;  4PL6 A;  4DBQ A;  2CP2 A;  2L8D A;  3H6Z A;  2DBK A;  2O31 A;  1KHC A;  2KNB B;  1U5S A;  2HKN A;  3RKW A;  4A4F A;  2HBP A;  3FIF A;  3R6O A;  4HCC A;  3HRT A;  1VQL T;  3JB9 H;  3PFS A;  3RIR A;  5FRM A;  2R57 A;  2M0O A;  4M7D D;  1YJW A;  3CC4 A;  1SHF A;  3CCV Q;  2RF0 A;  1H92 A;  1KJW A;  5CQX A;  4OVA A;  1JXO A;  4F17 A;  3EFO A;  4ORZ A;  2I2L A;  1PKS A;  3NGP A;  3CCJ Q;  1GRI A;  2CSQ A;  1AWW A;  1VQN A;  1KD1 U;  3OS2 A;  4DOW A;  2NUZ A;  1U1T A;  2HKQ B;  4JRP A;  1YJ9 A;  2PNI A;  2XD0 A;  1QVF P;  2V26 A;  3G6E T;  4KUD K;  2CZ7 B;  1ZSZ A;  2MI6 A;  2OI3 A;  4HCK A;  2AT1 B;  3FB9 A;  4JRI A;  1M1F A;  2COW A;  2MAM A;  1OUL A;  4RUG A;  1B3Q A;  1RAD B;  4F7U A;  2RI2 A;  4BDZ A;  4OGE A;  5LJ5 f;  1OZ3 A;  4OMQ A;  4QVD A;  1KD1 C;  2QA4 T;  4ZTF A;  2D6F A;  3V8J A;  1NBE B;  4X1V A;  2OAU A;  3JCM c;  4C5G A;  4II1 A;  4LUE A;  4WCI A;  2DVE A;  4O5V A;  1IRE B;  1M8V A;  2YDL A;  2KK4 A;  2DD5 A;  5GAM g;  4J9C A;  5GAM j;  1BI3 A;  1ABQ A;  1J3T A;  1W2B A;  2CS7 A;  1HJD A;  3CBO A;  2LT1 A;  2AK5 A;  3RES A;  7AT1 B;  1AZE A;  4JJN K;  2JTE A;  1VQM Q;  3EG9 A;  4J8O A;  3T9N A;  2DL4 A;  3CQT A;  4E6R A;  1RAG B;  4ZGJ B;  4LE9 A;  3G71 A;  2DTI A;  1VQN T;  2VC8 A;  4HCB A;  3JCM g;  3OS1 A;  1X43 A;  2G6F X;  1H3H A;  3TQ7 P;  1NPP A;  2RQT A;  1ABO A;  2OAW A;  3CPW S;  4QVC A;  2DA9 A;  2RJE A;  2RK1 A;  1CKA A;  5GMK m;  2XDB A;  1C1A A;  3MP8 A;  3M56 A;  2VYT A;  4C8Q B;  3UPU A;  2JNG A;  5I2M A;  1K0S A;  2J7I A;  3V8K A;  3QDF A;  2J6F A;  3RKY A;  1MV3 A;  3CPF A;  2PQW A;  1JU5 C;  2JUF A;  2BIV A;  4FIB A;  2DJZ A;  2RB6 A;  1RAH B;  4LDU A;  3CCV A;  4PJO D;  1KQS A;  4Q5W A;  1M8M A;  4RTZ A;  3HKS A;  4BUG A;  1QVG S;  2EGA A;  4XU2 A;  1PD1 A;  2EPD A;  3G1J A;  1ARK A;  2AKK A;  5A2Q E;  3PTA A;  1WYX A;  2LCC A;  3MP1 A;  4M77 B;  4OF1 A;  4F7U E;  1QP2 A;  5LJ3 h;  3G71 T;  6AT1 B;  4M7A A;  1IB8 A;  2E6Z A;  2KXC A;  3TEE A;  4C0D C;  4CC2 A;  2MK5 A;  3GNG A;  1M1K R;  3CCE A;  1EFN A;  2RM4 A;  1YCS B;  3MHX A;  1GCP A;  4JPB W;  4KGX B;  3LW5 E;  5DY9 A;  2MPX C;  1ACM B;  4N4H A;  2HSP A;  1FWZ A;  2E3H A;  2QK0 A;  1JQQ A;  1SRL A;  1UJ0 A;  3OSS C;  1OEB A;  2KYB A;  2IVW A;  2QEX A;  4PKC C;  1JJ2 P;  4OB1 B;  5GAN 8;  2KDS A;  3HP9 A;  4ZNX A;  4M78 D;  4YTL A;  5C0M A;  3CBM A;  1VYU A;  3QJ6 A;  4F16 A;  4WTO B;  4MZT A;  3QWY A;  3OYA A;  4J9D A;  1D3B B;  4LN2 A;  4ZN1 A;  2L2P A;  4M75 D;  2XMF A;  4ZN3 A;  3D7S B;  1E6G A;  4XTW A;  5CR2 A;  5GAM f;  1T0J A;  2RO0 A;  3L2W A;  1B34 B;  3CCU Q;  2VGN A;  1BKB A;  2MIO A;  1Q7Y R;  1SG5 A;  4X9C A;  1VQ4 A;  3V7R A;  4FYV B;  5M9O A;  1K9M R;  4QKU A;  5CAI A;  2SEM A;  3CCE T;  1EZZ B;  3ZFJ A;  2KGT A;  2COY A;  3JCM f;  1GFD A;  3C94 A;  3LWI A;  1Z9Q A;  1B7T A;  4C0G A;  1W1F A;  2J06 A;  1CKB A;  4IUT A;  1MUZ A;  4ELZ C;  4FYW B;  2QEX T;  1ZUY A;  2LC4 A;  3TSZ A;  5GAO q;  1LPL A;  2DFU A;  1KC8 U;  3WXM B;  1WQ7 A;  1QW1 A;  5LJ3 g;  2K3Y A;  5DLO A;  2HD0 A;  5LJ3 j;  2KBT A;  4M7A E;  2I0N A;  2RK2 A;  3VS5 A;  5GMK i;  4RG2 A;  2YWW A;  2DEU A;  4C92 E;  4F7U F;  2XK0 A;  2LDM A;  5KYX B;  2JT4 A;  1RAF B;  1X27 A;  5LJ5 e;  3VJP A;  3BY7 A;  3ER0 A;  4E47 A;  3QYH B;  2ABL A;  3M4Y A;  1W2B S;  3M55 A;  1VQ4 T;  2O9S A;  1QP3 A;  1PKT A;  1TWB A;  1VQO Q;  4DBF A;  2LNH B;  5D6W A;  2BKD N;  1UEB A;  5FRN A;  3FJ5 A;  3CCS Q;  1UGS B;  1GCQ C;  3OYD A;  2K5I A;  1UUE A;  3P8D A;  1WJQ A;  2NUT A;  4KGZ B;  4FU6 A;  3VS0 A;  2DNU A;  2EYQ A;  5GAN d;  1YWO A;  4QW2 A;  3SWN A;  4RTT A;  3LGL A;  1WHG A;  1JB0 E;  3NTI A;  3M9Q A;  1YJN Q;  2CGH A;  4HKE A;  1IRX A;  2EJG A;  3CCL Q;  3RDV A;  1OX9 A;  2CT3 A;  2DTO A;  3A5Z B;  1BB9 A;  4XU0 A;  2PTK A;  1OU8 A;  4MML A;  4AFS C;  3UA6 A;  4KGV B;  3FC3 A;  1VQ5 Q;  3CCU A;  1HD3 A;  2GCX A;  2YUO A; 
#chains in the Genus database with same CATH homology
 2B86 A;  2L0A A;  1WXT A;  1UE9 A;  3TVT A;  1X69 A;  4RTX A;  1BK2 A;  4CC3 A;  2CH4 A;  2K7A A;  1NYF A;  1GBR A;  1A0N B;  1NG2 A;  2ED0 A;  4DEX A;  2GTO A;  1PHT A;  1VYV A;  2ESW A;  2K9G A;  1FYN A;  1YWP A;  3H41 A;  1U06 A;  1OV3 A;  1T0H A;  4AFQ C;  2V1Q A;  2RQW A;  1PRM C;  3REB B;  4EIK A;  2F2V A;  2OJ2 A;  2DX1 A;  4Z89 A;  2CH4 W;  2W10 A;  1Z9Z A;  3VS1 A;  1GL5 A;  1ZLM A;  4Y92 A;  2W0Z A;  2CT4 A;  2JMA A;  5GJV B;  2BTT A;  1TG0 A;  5IXB A;  1KIK A;  2FO0 A;  2FPE A;  2LJ3 A;  1ZUK A;  4OML A;  1CSK A;  1UHC A;  2LP5 A;  2FPF A;  2ROL A;  5IHN A;  3EGU A;  4IIM A;  3ULR B;  1UGV A;  2DIL A;  1WI7 A;  2J6O A;  2C0T A;  2DL3 A;  1AD5 A;  1BBZ A;  1KSW A;  1RLQ C;  4RTW A;  3I9Q A;  3UAT A;  1M3C A;  4HXJ A;  4JJB A;  1OPK A;  2DBK A;  1H8K A;  1AZG B;  2O31 A;  2RNA A;  2FRY A;  2KNB B;  1U5S A;  2LQN A;  5IH2 A;  1UJY A;  2EYY A;  4OMP A;  2MOX A;  2EGE A;  1FMK A;  2JM8 A;  1PRL C;  4F14 A;  2E5K A;  2EBP A;  4ESR A;  2AZV A;  2LJ0 A;  4AFU C;  1SHF A;  2BZX A;  2RF0 A;  2JW4 A;  1H92 A;  1KJW A;  4F17 A;  1JXO A;  4GBQ A;  2KRO A;  2YUN A;  4ORZ A;  1NEG A;  2GNC A;  2GBQ A;  1PKS A;  3NGP A;  1K9A A;  2DYB A;  2GTJ A;  1GRI A;  2BZY A;  2CSQ A;  1AWW A;  1UG1 A;  2D8H A;  2AZS A;  5FWB A;  2PZ1 A;  1GFC A;  1JEG A;  2EGC A;  1QKW A;  3GBQ A;  3LH5 A;  2NUZ A;  2PNI A;  1ZSG A;  3IQL A;  3PVL A;  1Y0M A;  1E7O A;  2QDL A;  2OI3 A;  2LX7 A;  4HCK A;  2BZ8 A;  1UFF A;  2DM1 A;  2F2W A;  4RUG A;  4JJD A;  1B3Q A;  1YP5 A;  2A36 A;  4HVU A;  4OMQ A;  2DRM A;  2V1R A;  4X1V A;  2JS2 A;  4LUE A;  4WCI A;  4OMO A;  2YDL A;  4K11 A;  5FWC A;  4CC7 A;  2CUD A;  4HVV A;  2O88 A;  2YSQ A;  1T3L A;  3QWX X;  4J9C A;  1ABQ A;  1J3T A;  1YNZ A;  2DRK A;  3H0I A;  1HJD A;  2AK5 A;  1AZE A;  2JTE A;  1K0X A;  1OOT A;  2RQV A;  1XOV A;  2DL4 A;  3CQT A;  4E6R A;  1G2B A;  4J9E A;  4LE9 A;  5ECA A;  1T3S A;  2KRN A;  1X2K A;  4J9F A;  2K2M A;  1X43 A;  1MV0 B;  2M51 A;  2FG0 A;  2G6F X;  5HCK A;  1H3H A;  5I11 A;  2EYW A;  2O2O A;  1S1N A;  2RQT A;  1ZUU A;  2LJ1 A;  1ABO A;  2OAW A;  1AEY A;  4Z8A A;  2DA9 A;  2LMJ A;  3KFV A;  2HDA A;  4LNP A;  4OMN A;  1QKX A;  1WDX A;  1X2Q A;  1JO8 A;  2J05 A;  2VVK A;  2RQU A;  1CKA A;  3EG3 A;  1K4U S;  1IO6 A;  1WLP B;  2KYM A;  5L23 A;  3PVQ A;  3A98 A;  3M0U A;  1TUC A;  3C0C A;  4JZ3 A;  1K0S A;  2J7I A;  5GJW B;  2L3Q A;  2J6F A;  3EHR A;  2IIM A;  3I5S A;  5IHK A;  1MV3 A;  2NWM A;  1M3A A;  2A37 A;  2DJQ A;  2CSI A;  1JU5 C;  1Y57 A;  4J9H A;  1W70 A;  2ROT A;  2JMC A;  1ZBJ A;  5FW9 A;  1M8M A;  4RTZ A;  4HVW A;  4DEY A;  1M27 C;  2EGA A;  3RBB B;  2EPD A;  1ARK A;  2AKK A;  2H8H A;  2ENM A;  1AWX A;  3VS2 A;  1WYX A;  3VS4 A;  1VA7 A;  2GQI A;  2JXB A;  1I0C A;  1M30 A;  1NYG A;  2D0N A;  4GLM A;  4AG1 C;  1AWJ A;  2KXC A;  1HSQ A;  3EG0 A;  4CC2 A;  3M0T A;  3NHN A;  2FEI A;  2DL5 A;  2EVR A;  1AOJ A;  1I1J A;  1TUD A;  1EFN A;  1YCS B;  1SPK A;  1GCP A;  1WIE A;  2CRE A;  4JPB W;  3H0F A;  2VKN A;  1SEM A;  5IXF A;  1M3B A;  5EC7 A;  1RUW A;  2HSP A;  4J9G A;  3M0P A;  2P4R A;  4OMM A;  3THK A;  2X3X D;  1JQQ A;  1SRL A;  1UJ0 A;  2C0I A;  1OEB A;  3NMZ C;  2KYB A;  2DVJ A;  2LCS A;  1ZX6 A;  1LCK A;  1K1Z A;  1YN8 A;  2EQI A;  2RPN A;  2RQR A;  4ZNX A;  4CC4 B;  1VYU A;  2ECZ A;  4F16 A;  2KXD A;  2KRM A;  2KRS A;  4JJC A;  1JXM A;  3QWY A;  4RTU A;  1V1C A;  2L3S A;  1KFZ A;  1GCQ A;  3H0H A;  4J9D A;  2A28 A;  3I5R A;  3UF4 A;  2KT8 A;  2GGR A;  4LN2 A;  2L2P A;  2ED1 A;  2XMF A;  2J6K A;  2RN8 A;  1E6G A;  3EG1 A;  3M0S A;  1AVZ C;  1T0J A;  1WXU A;  2D1X A;  2LZ6 B;  2K3B A;  2K6D A;  4IIO A;  2L3P A;  1G83 A;  1U3O A;  2EKH A;  3M0Q A;  3NPF A;  1N5Z A;  2MIO A;  4D8K A;  2KE9 A;  4RTV A;  3TSW A;  2SEM A;  1I07 A;  2KGT A;  1GFD A;  1WXB A;  1Z9Q A;  3VS3 A;  1WA7 A;  1RI9 A;  2HEQ A;  3VRZ A;  1W1F A;  2J06 A;  1CKB A;  4LUD A;  4AG2 C;  1MUZ A;  3REA B;  2D8J A;  1ZUY A;  1WFW A;  3TSZ A;  2M0Y A;  3M0R A;  2CUB A;  2O9V A;  4J9I A;  1B07 A;  3SEM A;  3ZL7 C;  2JM9 A;  2KBT A;  3O5Z A;  2VWF A;  1E6H A;  2C0O A;  2I0N A;  4D8D A;  3VS5 A;  2LQW A;  1VYT A;  1SHG A;  4KRT A;  1OPL A;  3EG2 A;  2X3W D;  3PE0 A;  3EHQ A;  2FPD A;  2DL8 A;  2KEA A;  2KR3 A;  2JS0 A;  2DL7 A;  4FSS A;  2HBW A;  5I22 A;  2JT4 A;  1X27 A;  3RNJ A;  1NLO C;  2DE0 X;  2YUQ A;  3JV3 A;  2HCK A;  2ABL A;  1UHF A;  1BU1 A;  4M4Z A;  3I35 A;  2MCN A;  2O9S A;  1RLP C;  2DBM A;  1SSH A;  1PKT A;  2KT1 A;  4A63 B;  1X6B A;  3UA7 A;  2LNH B;  2YUP A;  2EYX A;  3VS7 A;  2A08 A;  4Z88 A;  1UTI A;  1QWE A;  4J9B A;  2DLP A;  1UEC A;  3FJ5 A;  1K76 A;  1GBQ A;  1SRM A;  1GCQ C;  2AKL A;  1UUE A;  1PNJ A;  1UDL A;  3VRY A;  3VS0 A;  1W6X A;  2SRC A;  2DNU A;  4JZ4 A;  1NLP C;  2RMO A;  1YWO A;  4R0K A;  4RTY A;  2FRW A;  4AFZ C;  1AWO A;  4RTT A;  1QLY A;  3SHW A;  2YT6 A;  2F2X A;  2K79 A;  2DMO A;  1NM7 A;  2CDT A;  1WX6 A;  4QT7 A;  1X6G A;  2CT3 A;  2EW3 A;  1NEB A;  1BB9 A;  1QWF A;  3R6N A;  1PWT A;  2PTK A;  3U23 A;  4AFS C;  3UA6 A;  5IHI A;  1QCF A;  1HD3 A;  2DF6 A;  2YUO A;  3VS6 A;  2EYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...