1I1JA

Structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MELANOMA DERIVED GROWTH REGULATORY PROTEIN
publication title Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i1jA00
5IH2A 1JEGA 4J9IA 5I22A 2ROLA 1QKXA 1GCPA 3QWYA 2ENMA 1Z9ZA 2KE9A 4K11A 4IIOA 3NHNA 2K9GA 2J06A 4AFQC 3PVLA 2MCNA 4HXJA 2JM8A 2LX7A 2J6OA 2D1XA 2DBKA 2P4RA 3I9QA 4HVWA 4JJDA 3VS1A 1BU1A 2F2XA 1ZUUA 1H3HA 1AWXA 2JM9A 2DF6A 2DL7A 5ECAA 2JS2A 1HJDA 1M3CA 1LCKA 3RNJA 1KSWA 4E6RA 1GBQA 1ARKA 4RTTA 3EGUA 2YSQA 2LZ6B 2DL5A 2QDLA 1I0CA 2W10A 3QWXX 5FWBA 2BTTA 3SHWA 2AK5A 2DJQA 4LUDA 4LNPA 2K6DA 2YT6A 2MOXA 3CQTA 1WXBA 2F2WA 3EG2A 1RI9A 2DE0X 2LCSA 2LJ1A 4ORZA 5IHKA 2RQVA 2BZ8A 1GCQC 2HBWA 1PKTA 2KBTA 2L2PA 1H92A 1M27C 1GBRA 2E5KA 3UATA 2J7IA 2GTJA 2K79A 3H0HA 1X43A 4J9CA 2DMOA 2JMAA 1X2QA 1YNZA 1RLPC 2FRWA 1SRLA 2DRKA 3M0TA 5IXFA 2JTEA 1W70A 2KROA 2FG0A 4IIMA 1HSQA 1AZEA 2RN8A 4RTUA 1JXOA 1QCFA 1TUDA 1GFCA 1QWFA 3H0IA 2RPNA 2K3BA 2OAWA 2RQUA 1Y0MA 1CSKA 2CUBA 4JZ3A 1VYUA 4M4ZA 1Y57A 2RMOA 1WI7A 4J9BA 5IHIA 3THKA 4R0KA 3VS7A 2FO0A 4GLMA 4DEXA 3PVQA 1EFNA 2J6KA 1B07A 4OMLA 1YP5A 1SHGA 3H41A 2DILA 3M0SA 2DNUA 2L3QA 2JS0A 2RNAA 2GTOA 1UUEA 1S1NA 1HD3A 1RLQC 4Z8AA 1UJ0A 2D8JA 1WYXA 2RF0A 1PNJA 1JQQA 1VYTA 1UFFA 3IQLA 4D8DA 3RBBB 1E7OA 1UE9A 2ED1A 1AZGB 2CH4W 1U3OA 2EYXA 1ABQA 3EHRA 1IO6A 2EGCA 2KGTA 1W6XA 2M51A 2KT1A 1B3QA 2PTKA 2O88A 1OV3A 2EW3A 2KR3A 1TG0A 4AG1C 1NYGA 2AKKA 1YN8A 2SRCA 2JMCA 2RQWA 1KFZA 1WXUA 2LJ3A 2CSIA 2O31A 2OJ2A 2HSPA 2RQTA 2DX1A 1G83A 1VYVA 5GJWB 1FYNA 1AWWA 2DBMA 2KRSA 1T0JA 2LQNA 4RTVA 2EPDA 1NLPC 2LP5A 4LUEA 3ULRB 4HVUA 4D8KA 4HVVA 2CH4A 1M8MA 1SSHA 2ABLA 2OI3A 1TUCA 2CDTA 2YDLA 2JXBA 2EYWA 3VRZA 4HCKA 1J3TA 3I5SA 1KIKA 2ROTA 1K4US 1AD5A 2AZSA 1OPKA 2CT3A 4ESRA 2VVKA 2EGAA 2O9SA 3ZL7C 4RTXA 3O5ZA 1ZUYA 4RTYA 2FEIA 2HDAA 1N5ZA 4OMNA 1NEBA 1M30A 3NPFA 3EG3A 1BB9A 1UHFA 4RTZA 3UA7A 5EC7A 2J05A 1AWJA 2GNCA 1UGVA 2KRMA 1K0XA 5HCKA 1SPKA 4Z88A 4DEYA 1UTIA 3I35A 1PHTA 4J9GA 2A36A 1OOTA 4X1VA 3M0QA 4FSSA 1NEGA 2LNHB 1A0NB 1AEYA 1SEMA 1AOJA 2EKHA 2HEQA 1I07A 2KYMA 4EIKA 1G2BA 3LH5A 2FPFA 1WA7A 2VWFA 1V1CA 5I11A 1I1JA 2JW4A 2H8HA 2YUPA 2VKNA 1QKWA 2DL8A 1NG2A 1JU5C 2X3XD 1NM7A 1T3LA 1WDXA 1UDLA 2ED0A 3VRYA 3M0RA 4J9DA 5IHNA 1MV0B 4Y92A 1YWPA 3TSWA 4CC4B 2ESWA 2IIMA 1BK2A 3VS2A 2NWMA 2KXCA 2EGEA 3JV3A 4F17A 4AFZC 2V1QA 2YUQA 2DL3A 4JJCA 2EVRA 5FWCA 3UA6A 2NUZA 2DL4A 5IXBA 3VS6A 1K9AA 1KJWA 2EYZA 1AVZC 1AWOA 4RTWA 1GL5A 1M3BA 1K1ZA 2GGRA 2DYBA 1CKBA 2K2MA 2A28A 2CUDA 1X6BA 4JZ4A 1NLOC 1PWTA 2CT4A 1WX6A 2A08A 2ECZA 1JO8A 1U5SA 1W1FA 1X6GA 3M0PA 2A37A 2PNIA 1MV3A 1CKAA 3EHQA 3TVTA 4Z89A 1QWEA 2O2OA 2KNBB 2MIOA 3UF4A 2AKLA 1UG1A 4AG2C 3NGPA 5FW9A 3H0FA 4OMMA 2EBPA 3A98A 4OMOA 1ABOA 1ZLMA 1OEBA 2PZ1A 2FPDA 2W0ZA 4JPBW 4AFUC 3TSZA 1ZBJA 1ZUKA 1OPLA 3VS0A 4A63B 2J6FA 2X3WD 4ZNXA 1UECA 2DA9A 3U23A 2AZVA 2FPEA 4OMPA 3REBB 3M0UA 2GQIA 4F16A 4JJBA 3FJ5A 3VS4A 4LN2A 4J9FA 2DM1A 4CC7A 4KRTA 1WFWA 1PRMC 1ZX6A 3EG1A 3I5RA 2M0YA 3KFVA 1YCSB 2F2VA 4RUGA 2CSQA 2DVJA 2V1RA 2RQRA 2YUOA 1WIEA 2KXDA 1RUWA 2GBQA 3SEMA 4WCIA 1YWOA 1K76A 2KRNA 1SHFA 1T0HA 2L3PA 1BBZA 2LJ0A 2YUNA 4J9HA 3PE0A 2I0NA 4F14A 5GJVB 2LMJA 2G6FX 4QT7A 4AFSC 2BZXA 1T3SA 2DLPA 3EG0A 1K0SA 2BZYA 2HCKA 3R6NA 3C0CA 2DRMA 1NYFA 1QLYA 1GRIA 1X2KA 4GBQA 2L3SA 1Z9QA 3GBQA 1FMKA 1U06A 1GFDA 1X69A 1UJYA 1JXMA 2XMFA 1SRMA 1X27A 2KT8A 2CREA 1WLPB 2C0IA 3REAB 5L23A 1VA7A 1ZSGA 2O9VA 2EQIA 2B86A 2FRYA 1M3AA 2K7AA 2C0TA 2D8HA 2C0OA 1MUZA 4CC2A 1GCQA 1PKSA 2JT4A 1PRLC 2L0AA 2D0NA 2SEMA 2EYYA 4CC3A 2KEAA 1E6HA 2LQWA 3NMZC 2KYBA 1WXTA 3VS3A 1H8KA 4J9EA 4OMQA 3VS5A 4LE9A 1UHCA 1XOVA 1E6GA
chains in the Genus database with same CATH superfamily
4KH1B 5LJ3h 3QG1A 5LJ3e 4J9IA 3SWNA 5J39A 3C12A 5LJ3j 1GCPA 3JCMg 5FLXE 4CI0C 3GNFB 2CKKA 4PJMA 1K8AR 2HQXA 1YI2Q 3CC2A 3CC4A 4OP0A 3X20B 1VQKA 3OW2A 1X75C 4XU3A 3M54A 1IREB 4KGZB 2LX7A 3CCJQ 3I9QA 4OGEA 5GMKm 4P5NA 2DIGA 2AT1B 2O01E 2JM9A 2DL7A 4EMGA 3TEEA 2QEXA 2RJDA 1BCMA 4FIBA 4A4HA 2LQKA 3EFOB 2DZ9A 4E6RA 4M77C 3DLMA 4LDUA 4RG2A 1QW1A 5A2QE 4M75G 2RK1A 3EGUA 4FYYB 1K9MC 1C6VX 3QWXX 2W10A 1MNDA 2E65A 5A0LA 1W2BA 3QDFA 2DO3A 4LD6A 1WXBA 2PVGB 4ZGJB 1RI9A 2DE0X 2X4JA 4M7AF 4X34A 2RQVA 5GAOl 1K9MU 2BZ8A 1VQMQ 4KUDK 1ZSZB 4PFPA 3L1AA 1Y96B 4QVDA 1M27C 2E5KA 3UATA 2J7IA 4BACA 4J6YA 4Y28E 2IVWA 2CP7A 1X43A 3EH1A 4QQGA 1YNZA 1TUGB 1YI2T 1RLPC 3S3OA 2FRWA 4JJNK 2EAYA 3RKXA 3RR6A 3CCJT 3FEOA 1W70A 5D6YA 4M75E 4IIMA 4HT8A 4LXCA 1TUDA 1QWFA 2OAWA 4JLGA 4BD3A 1Y0MA 1MMNA 3INZA 3PNWC 4M4ZA 1Y57A 1D09B 2HQHA 1LVKA 4J9BA 4PKCC 2RJEA 5IHIA 1MGQA 1LPLA 3VS7A 5FROA 4OB3B 5FRNA 2ATCB 3EGXB 4KBMB 4PJOG 2J6KA 1B07A 1YP5A 3M0SA 1ZHIA 5GAOr 3OB9A 1D0XA 2GTOA 4M7AD 5D6XA 2YXYA 4DBRA 2E5QA 4HCZA 3UDCA 2K4YA 2DERA 1KD1C 3CCEQ 1WYXA 4ZTJA 3IQLA 2XG8D 3T9NA 1UE9A 2FZCB 4VUBA 2EKOA 2EGCA 1W6XA 2RK2A 3ZBDA 3OYLA 1IRXA 2O88A 2L8DA 5CIUA 1KD1U 2EW3A 1QVGA 3CMAT 3D7SB 4OF1A 2HSEB 2RA2A 4Y91A 1D1BA 4M7DB 3J80E 2CSIA 2OJ2A 4IUPA 3L2ZA 4FM4B 1G83A 4ZGDB 4HCCA 3OSSC 4E2FB 2LQNA 4RTVA 4PJOE 4HA8A 4DBHA 2LP5A 1YIJA 3DB4A 5FU7C 4D8KA 4HVVA 1LOJA 2CH4A 3P8HA 1TWBA 3OY9A 2QGGA 2X4YA 2EYWA 3P8DA 1I4K1 1XNIA 3ZEHA 1K4US 1O9SA 4ESRA 2VVKA 4C92C 4DQ2A 2EGAA 3M53A 3CCET 2O9SA 8AT1B 3O5ZA 2LTOA 2RI2A 4XAXB 1BB9A 4C8QB 2J05A 5KE2A 1I81A 1S72Q 2KRMA 1VQ6A 4M77E 4DEYA 3I35A 5KYYB 2CP6A 4J5YA 4B9XA 2BUDA 1R8OB 5GAOn 2A36A 2CZ7B 4FSSA 1A0NB 1TSFA 1SEMA 1AOJA 3SWNC 1WZOA 3LGLA 3CMEQ 2E1HA 2OTJA 1X01A 2QTXA 1I1JA 2JW4A 1Q81C 1VIEA 2OAUA 2DL8A 3X26B 2X3XD 4C0GA 4E7HA 1T3LA 3FLGA 1UDLA 3X24B 3CCMQ 1VQNQ 4BE0A 3CCLQ 2ESWA 2IIMA 3VS2A 3OYAA 1Y07A 1VUBA 2QK0A 1KQ2A 4JJCA 4XTVA 2COWA 3EAEA 1MHNA 2IPOB 1DJ7B 4BE1A 2EJ9A 2FYKA 1YJ9Q 3BW1A 2CZ1B 5GAN8 5GAN7 1AWOA 4RTWA 2CS7A 3N5BB 5HK0A 3MEUA 1MMDA 1H641 2GGRA 4ZN1A 2LRQA 2DPPB 4E7KA 1IZ6A 1QCNA 2GFAA 3E2UA 4M7DF 2QG9B 3GLXA 4XTZA 2D0QB 2OTLQ 3MCAB 1K73R 1UB4A 1JO8A 1UGPB 1W1FA 1QVFS 1F1BB 1B34B 1WHKA 2VUBA 4JS4A 4C5GA 3H9NA 3CMET 3OYJA 2KNBB 3C4SA 3M57A 3BFMA 2AKLA 3NGPA 4MMLA 2X9HA 3H0FA 1ZLMA 3CCMT 1G5VA 2E3IA 1AHJB 3CCLT 4JPBW 3PTAA 1LNXA 2XKOC 2L89A 4Z02A 1ZUKA 1PCXA 5FU6B 1UECA 3E9FA 4MZPA 3VU3C 5IT9E 4C8QF 1YJ9T 4E47A 4OMPA 3G6ET 4O6JA 2GQIA 4F16A 3G4SQ 2EQUA 4JJBA 4MZMA 4M78A 5IN1A 3X28B 4J9FA 2DM1A 2V26A 1TOVA 3FB9A 4E7ZA 1WFWA 4IUTA 2HKQB 1ZX6A 2ZPIB 4M7DD 2M0YA 1YFNA 1YCSB 3I55Q 2CSQA 2DVJA 4FW2A 3QUIA 4XU2A 2YUOA 2KXDA 4E7JA 3BDLA 3SEMA 3JB9H 5CR2A 2KRNA 4ZGEB 2C06A 3OYEA 3CD6A 2LX9A 3HPWA 2L3PA 1BBZA 2VC8A 2XU8A 3PE0A 2I0NA 4PFZA 3JCMd 5I2MA 1M1KR 1Q7YR 3M9QA 2CP3A 3PIPA 1N8RR 2HCKA 1VQ4Q 2K5LA 4C92E 3E19A 1NYFA 4M77A 1NJIC 1Z9QA 1G3YA 1VQPQ 5I21A 3QJ6A 1GFDA 2KAFA 1UJYA 2RJCA 1JXMA 1X27A 4DOVA 2CREA 1WLPB 3VJPA 2G3RA 3M4YA 2K2VA 1JB0E 4C8QD 2D8HA 3JCMQ 3MPUB 1ACMB 5KCHA 4F04B 3PMTA 1Y71A 4X9CA 3G4ST 3G71A 2D0NA 4CC3A 3CC7T 2FHDA 5A0DA 5GMKh 5KYWA 5GMKe 3VS5A 3I55T 3A1PA 1UHCA 1XOVA 4ZTFA 1E6GA 2IG0A 1UGSB 1JEGA 3AHUA 1I5LA 1BIAA 2QDYB 3OBYA 4XQ3A 3I56A 2ROLA 5D7UA 2FZGB 5GAMd 3Q1JA 2GQVA 1YJNQ 3NFCA 5GAOm 1D1CA 2KE9A 4K11A 4PJOB 2KY9A 3JCMh 3JCMe 4BY6B 4AFQC 1VQPT 2MCNA 8ATCB 2P4RA 4HVWA 3VS1A 4EDUA 3JCMW 3JSCA 5ECAA 3OS0A 1KG1A 1LCKA 2DXUA 2Z0WA 2JTMA 1UEBA 4BI3A 4C5IA 3EGDA 3LH0A 4RTTA 2GFUA 2EQJA 2EFIA 4DA4A 2QDLA 4C0ZA 2BTTA 1VQLA 1K9MR 2XDPA 4LUDA 2K6DA 3CXCA 2MOXA 2LCSA 4ORZA 3S3NA 4ME7A 1BI3A 2NUTB 3PGGA 1PKTA 2QTVA 5HKCA 3E1SA 2GTJA 1KHCA 2K79A 2ZPEB 5KE3A 1YJNT 2L3RA 2HQEA 2DMOA 1WPYA 2JMAA 1X2QA 1B7TA 5GAMh 3MKDA 5GAMe 3M0TA 1N8RU 2QAZA 3EFOA 5CAIA 1C1AA 2FB7A 2FG0A 3DLLA 2DXCA 2RN8A 1JXOA 1GFCA 2K3BA 1CSKA 4ANJA 4C92A 4HT9A 2RMOA 4PLLA 5KYUB 2JJ9A 4WTOB 2LCCA 4JRIA 3BE3A 4R0KA 2HBPA 2FO0A 1NPPA 3EG9B 1ZSZA 2CP0A 4GLMA 4DEXA 3PVQA 2AHJB 5AYFA 4QKUA 1LJOA 2RHUA 1SHGA 1VQ9A 2DVEA 4M75D 2RD1A 1UUEA 1JJ2S 1HD3A 1D0ZA 3A8HB 3OYFA 4HKEA 4Z8AA 2CYZB 1PNJA 1I5OB 2HKNA 3OQ5A 4NOYA 3OYMA 3EFSA 4PJOF 1M9SA 4B6MA 1KD1R 4M78C 2H3EB 5DY9A 1U3OA 2KGTA 2M51A 1B3QA 4KUIA 1VQOA 2VASA 1HXDA 2PTKA 4II1A 2PUKB 3QO3A 3HRTA 4AG1C 1NBEB 1NYGA 2SRCA 3PFSA 3CPFA 3MP6A 2RQWA 2JN0A 2RJFA 2O31A 2PUOB 2WSEE 1WQWA 1Q82C 1VYVA 1VQ7Q 1FYNA 3QYGB 1OYXA 4EMKC 1T0JA 3JRZA 1S72A 1RAIB 2NUPA 1OU9A 1BKBA 1GXIE 1YJWQ 3NTHA 1M8MA 4RCCA 4V2SA 3JCMJ 4OB0B 2JOYA 1TUCA 3OYKA 5CKBA 1J3TA 3LWHA 1KIKA 2ROTA 3JB9G 3CPWS 2AZSA 1OPKA 1VQ8Q 2CT3A 1EX4A 3A5ZB 5CCAA 2WSCE 4C0DB 2ZZDA 4PJOD 4D6WA 1ZUYA 2FEIA 1N5ZA 5CKDA 1NEBA 5FRMA 2RM4A 2LC4A 1AWJA 1UGVA 4J83A 2QQSA 1KHIA 4AMCA 1UTIA 4M7AC 1JRIA 1M90C 2DKGA 4J9GA 3GOXA 1FMWA 3CMAQ 2QGFB 4JRKA 4N4HA 2PVDB 1TS9A 2BE7D 1VQ5Q 2KYMA 2ZGWA 4JLIA 1SF9A 5GAN3 1EZZB 1VQ7T 4O5VA 2VWFA 1FX7A 1V1CA 5I11A 1OZ2A 1QCOA 2VKNA 2RI5A 1FMVA 4L6V5 3ER0A 1Q81R 2ED0A 2F69A 3JCMV 1YJWT 3M0RA 1G3WA 4J9DA 1MV0B 5IHNA 3TSWA 3G1JA 1BK2A 4NL3A 3JB9J 3RERA 3TU4K 3M4GA 3L2UA 2YUQA 5FWCA 4M78G 2VXEA 4BUGA 1VQ8T 2DL4A 2QYZA 1K9AA 5KYYA 3QXEB 2QA4A 1K1ZA 4L5GA 2RO0A 3L42A 3MO8A 4J7FA 2BIVA 3CCRQ 1WX6A 2ECZA 2XI9A 5KYXA 1RAHB 1N6AA 1U5SA 3OW2S 2E10A 1X6GA 3OMGA 5GAOp 2ZPHB 2PNIA 3PT9A 4M77G 1CKAA 1VQ5T 2ZCFB 4RCBA 2COYA 2MMPA 3EHQA 3TVTA 4Z89A 4BI4A 3MJXA 1K8AC 2VV5A 1WHGA 1WHJA 2MIOA 3L2WA 2O4XB 2WACA 1UG1A 2ZPGB 2YRCA 1R77A 4OMMA 3VUZA 3A98A 4M78E 1ABOA 2PZ1A 2FPDA 2KDSA 2W0ZA 4AFUC 2P0QA 1YHQQ 3VYHB 3TSZA 2M0OA 1W2BS 3C95A 1PSFA 3ZFJA 4BDZA 2AZVA 5J26A 3OBWA 3WVDB 1VQ4A 2K5FA 3E9GA 3LLRA 3VS4A 4LN2A 1M2VB 1V29B 1QVGP 3VV0A 4OB2B 1PRMC 5GAN4 1ZSZC 3I5RA 3CC2Q 1IHWA 3CC4Q 4RUGA 1BIBA 2V1RA 1QVFP 1VQKQ 1WNLA 2RQRA 3MEAA 3CCRT 1ZQ1A 2DFUA 4WCIA 1H3ZA 1YWOA 1K76A 2MWOA 1KQSA 3M58A 2LJ0A 2LCLA 3CCUA 2YUNA 3V7RA 4XTWA 2KMTA 4AFSC 4E7LA 5KCOA 2QEXQ 5LJ5f 1BI0A 2HMAA 2KK4A 2BZYA 1RI0A 3R6NA 3OSVA 3C0CA 4N0AA 4MDXA 1GRIA 2DTOA 1X2KA 2EQMA 3GBQA 1X69A 3CCSA 2M02A 3LYIA 1YHQT 1SRMA 2KT8A 2DXBA 4M7AE 1VA7A 4F7UB 3JCMP 2O9VA 1Q81U 1ZA1B 4RKUE 2E6NA 3CBPA 4FL6A 3HRUA 3S6WA 4EPCA 2C0TA 1MUZA 3QYHB 1R0CB 4KGXB 2DD4A 3G6EQ 1RAFB 1YITA 2R57A 2SEMA 2VGMA 2CZ6B 2KYBA 3RDVA 1D3BB 4XTXA 3O8VA 5LJ5j 1H8KA 4OMQA 1PG5B 3CC2T 3CC4T 5GANf 1G8XA 1VQKT 4E7IA 4LE9A 3TREA 3NTIA 2PQWA 1IHVA 1QVGS 2HL3A 2COZA 2LVMA 1RAAB 3RIRA 2QEXT 1BI2A 1QKXA 2ENMA 1VOMA 4M7DC 1Z9ZA 4KH0B 3V8LA 5CO7A 1Q95G 2RB6A 2JTFA 4IIOA 4BE2A 2K9GA 2M9UA 3HKSA 2AIRB 1PC0A 4ELYC 3CCQA 1WQ7A 3PVLA 4QQDA 1MMAA 4HXJA 2LT1A 2JM8A 3C94A 3URGA 2DBKA 4JJDA 4C92G 5GAN2 1BU1A 1D1AA 2F2XA 1KQ1A 1ZUUA 3NTKA 1AWXA 4XK8E 4QVCA 5KYNA 2JS2A 3X25B 5GANj 5DM7R 3QDRB 3OS5A 4PNOA 1KSWA 5A0GA 1GBQA 1OZ3A 3MEWA 2YSQA 2DEUA 2JNGA 2DL5A 3CC7Q 5FWBA 4ATOA 2AK5A 4LNPA 2YT6A 3WXMB 3CQTA 4C8QC 1D0YA 3JCMc 1WGSA 2K3XA 1Q86C 4FSXA 3P8BB 1OQKA 1PSEA 5AT1B 1GCQC 2KBTA 4KGVB 5I2SA 1H92A 4M75B 1GBRA 1M8VA 1M5Q1 1WJQA 1QP3A 3H0HA 5LL6S 4J9CA 4PLIA 4EMKA 1YIJQ 4GLKA 1Q86U 1FXXA 3CCVA 4FYXB 1NZ9A 1WHLA 4JUVA 4F7UF 2JTEA 4AT1B 3ME9A 1W4SA 1QCFA 1NJIU 2RPNA 2RQUA 5LJ5g 2XDBA 1KC8C 3RESA 1WHMA 4JZ3A 1VYUA 2QA4T 5CKEA 4QVZA 2ZPFB 4R55A 1YI2A 1HYOA 3M56A 3MHXA 2MWPA 3FIFA 1BI1A 1KC8U 3H41A 2DILA 4M7AA 3CCJA 3DB3A 3SDZA 2JS0A 4OVAA 3OS1A 5CKFA 1S1NA 1RLQC 3V7CA 4J6WA 2D8JA 2RF0A 1JQQA 1N27A 4D8DA 3RBBB 2OTJQ 1E7OA 2CH4W 2DAQA 3L2QA 1SKUB 1IO6A 2LNVA 3JCMX 4EMHA 1YIJT 3QHSA 1K73C 3VKIA 3LWIA 2KR3A 3HFNA 3V8KA 5GANg 2AKKA 1YN8A 2HNIA 1WHHA 4KT0E 1KFZA 2HSPA 1VQMA 2RQTA 2DTHA 2R58A 3HTRA 5J3BA 3EG9A 5GJWB 3QBYA 2DBMA 1Q82R 2WSFE 4N0AC 5FU6C 2EPDA 4XTUA 3ULRB 4DOWA 4LDXA 4OB1B 1JJ2P 1SSHA 4M7DE 2ABLA 1VQ6T 2DD5A 2LQ8A 1EIFA 3FJPA 2YDLA 4M77B 4C5HA 3VRZA 3I5SA 1U8RA 3ASKA 4M75F 1XTDA 2M1HA 4L59A 1PM3A 2YWWA 4RTXA 4N4GA 4PJLA 2OTJT 2HDAA 4OMNA 3NPFA 1M30A 4LDVA 3EG3A 4RTZA 2K3YA 3UA7A 4JRPA 2CP2A 2GNCA 1G3TA 3JB9F 1ZA2B 2MI6A 3OYYA 1K0XA 5HCKA 2MK5A 1N9SA 4Z88A 4WF2A 4CRIA 4YTLA 3CCST 1PHTA 3UWNA 2H3JA 4LDYA 3AT1B 7AT1B 4RMOA 5KYWB 1Q7YC 1M1KC 1NEGA 2LNHB 2EKHA 2HEQA 1I07A 3CCEA 3LH5A 2FPFA 1WA7A 3RUXA 2RHXA 2H8HA 3QZ5B 1TTHB 1NM7A 2V8KA 1M1GA 3VRYA 1JBMA 3CPWP 2X35A 1U1SA 4Y92A 1YWPA 5LJ3f 1Y96A 4FCYA 2RHZA 2EVRA 3GIBA 3CD6Q 3GF5A 2MF2A 4C5EA 1YCYA 3VS6A 3HFOA 1KJWA 2DXTA 3H8ZA 2RHIA 1GL5A 1C0MA 5M9OA 3L2VA 3QJYA 3JB9D 3A8GB 2DYBA 1CKBA 1QQJA 1X6BA 3S3MA 3VUBA 3EGDB 4J6XA 3CCQT 1PWTA 5CKHA 3OYBA 2GF7A 2QQRA 3A8OB 4MZTA 3HHTB 4PJOC 3V8JA 2A37A 3SB2A 4NS5A 2RHYA 4BY6C 1V76A 2JZ2A 2A3LA 5IAYA 5GAN5 2O2OA 1OI1A 2BE9B 3EGXA 3RMSA 3UF4A 2D6FA 4AG2C 3G71Q 3OA6A 5CK9A 1RABB 5FW9A 2EBPA 4NL2A 4QQ6A 4M77F 4RG8A 1Q82U 4A4GA 2YLCA 3RKWA 3UPUA 3VS0A 4A63B 3KXTA 2J6FA 1RL2A 1KK7A 3CXCS 4ZNXA 4B9WA 1VIFA 3CD6T 3VYGA 3JCMb 5FU7B 3CMEA 2HZYA 2FPEA 1QMCA 3TQ7P 2CP5A 3I56Q 1IB8A 1TXQA 3M0UA 3FJ5A 4IUQA 4M78D 4Q5WA 4JDSA 4M7DA 4KRTA 2M16A 3KBGA 3CCMA 3OW2P 3CCVT 1VQNA 3EG1A 3KFVA 2BKDN 5KH6A 1NE8A 4XU0A 3CCLA 4C92B 2X4XA 2OX7A 2GBQA 2Y90A 3FRNA 4LD9K 1PD1A 2O4XA 1I8FA 1SHFA 1T0HA 4IUVA 5C6SA 5DLOA 4F14A 3OYNA 2G6FX 1BCOA 1T3SA 1UGRB 1YJ9A 1YBYA 4A4KA 2VXFA 3G6EA 4PJNA 5GAMg 1M90U 2E64A 2E4HA 3G7ZA 3G71T 2FVUA 2L3SA 4M77D 1W2BP 4HCBA 3SWNB 1OX9A 1U06A 1VQLQ 2E3HA 1AT1B 2OTLA 4DBQA 2GCXA 2C0IA 1ZBXA 1M2VA 2EQIA 4C8QA 2B86A 3UT1A 3I56T 1GCQA 1PKSA 2P0KA 2JT4A 3HSBA 1PRLC 2L0AA 1E6HA 4MDWA 5D6WA 3J7AF 4J9EA 1MMGA 3SD4A 2YHTA 3FC3A 5LJ3g 2NUPB 4A4EA 4PK4A 2KVQG 1RAEB 1VQMT 5IH2A 5I22A 2KSSA 1TH7A 3QWYA 3G4SA 2PU9B 3CC7A 4F7UA 3GPLA 3NHNA 2J06A 3I55A 2FZKB 5C0MA 3OS2A 1VQLT 2HL5C 2DK3A 1QVFA 1VQ9Q 1K8AU 2J6OA 2D1XA 1UGQB 1H3HA 2XDDA 2DF6A 5LJ5d 1D3BA 1HJDA 1M3CA 2K5IA 2YRVA 1XQHA 3RNJA 2DETA 2LT4A 1ARKA 4XTYA 4C92F 4M7AG 1PD0A 2LZ6B 1VQOQ 4XU1A 1I0CA 2K57A 2A7YA 4C0DC 1VQPA 3SHWA 2DJQA 1B34A 2DTIA 1RADB 2F2WA 3EG2A 2LJ1A 5IHKA 2MPXC 3CEYA 2HBWA 1Q86R 2EJGA 2L2PA 2EJFA 3J81E 4TVRA 1FWZA 5GMKl 3CBOA 5GANd 3OYGA 1SRLA 2DRKA 5CQXA 1OX8A 1WJSA 4QW2A 5IXFA 1NJIR 2Y4YA 1X6OA 1P92A 1VQ9T 3BY7A 2KROA 1HSQA 1AZEA 4RTUA 2DEQA 3H0IA 3OMCA 3QZ9B 5KYXB 3JAME 4KULA 4R56A 2CUBA 3PMIA 1YJNA 4C92D 1WI7A 2QXFA 3MP1A 1KC8R 2F5KA 5LJ5h 5LJ5e 3THKA 4IKFA 1VQOT 2DZCA 4J8OA 4OGCA 1KQSP 1EFNA 2E70A 4OMLA 1IGUA 4M75A 2DNUA 2L3QA 2RNAA 2E12A 2X51A 1UJ0A 1VYTA 1UFFA 1M4ZA 2XK0A 2ED1A 1AZGB 2EYXA 3TCJA 1ABQA 2B8AA 3EHRA 2NYSA 1S72T 2KT1A 4E7SA 1OV3A 1TG0A 1QVPA 2JMCA 1WXUA 2LJ3A 5GANh 5GANe 4FT2A 2P4TA 2DX1A 2RH2A 2XICA 1O75A 1SG5A 1AWWA 3DKMA 2KRSA 5EG2A 2KI7A 2P0PA 2QA4Q 1NLPC 2L5QA 3M59A 5HY6A 4LUEA 2YLBA 1VQNT 1XJWB 4HVUA 3M5AA 2F1LA 3RKYA 2OI3A 2CDTA 2JXBA 4HCKA 1AD5A 2QQBA 5HK3A 2JVVA 3EH2A 4PJOA 1KQSS 3ZL7C 4FYWB 2EYQA 5CVIA 4RTYA 2VYTA 1UHFA 2EWNA 5EC7A 2VGNA 2Y4XA 3SFMA 1SPKA 2NLUA 3M55A 3F70A 2OTLT 3A8LB 1OOTA 4X1VA 3M0QA 2HD0A 5DLQE 1AEYA 3LW5E 4EIKA 1G2BA 4UC4A 1N9RA 4N4IA 1IGQA 6AT1B 4C0FA 2YUPA 1QKWA 1RAGB 1NG2A 1JU5C 3QIIA 1WDXA 2R5MA 4CC4B 1VQ6Q 2NWMA 2NUTA 2KXCA 1OULA 2EGEA 3OYCA 3JV3A 3KUFA 4X9DA 3GP8A 3MEVA 4F17A 3QPHA 2ZPBB 4FU6A 4AFZC 2MYSA 2V1QA 2DL3A 3OYIA 3UA6A 2CZ0B 3CCUQ 2NUZA 3EFRA 4IUUA 4M7DG 5IXBA 4IURA 3CBMA 1VQ7A 3PIOA 2EYZA 5GAOq 1AVZC 3JCMf 1OU8A 3JB9I 1M3BA 4JRQA 2K2MA 2A28A 2CUDA 1YJWA 4BI8B 4LDWA 2F5TX 2PVOB 4JZ4A 5GMKj 1NLOC 1JJ2A 2CT4A 3CCSQ 2A08A 4MMKA 4M78B 2VB6A 1BYMA 2MAMA 2YRDA 4PFOA 3M0PA 1VQ8A 1MV3A 4PL6A 5KYUA 2DJZA 3RMQA 4FW1A 2QQ9A 2DYIA 1QWEA 1VQ4T 5GAN6 1K73U 4A54A 3L2RA 2I2LA 1YITQ 3GNGA 2JUFA 4ELZC 4OMOA 3OYDA 1OEBA 2E6ZA 4C8QG 3R6OA 1G3SA 3CMAA 3QKJA 1WJRA 4EMKB 4BB7A 1ZBJA 1OPLA 2DIQA 2X3WD 1IXDA 5GMKi 1VQ5A 3MP8A 2DA9A 3CCUT 3U23A 1M2OA 1QP2A 2QI2A 3HL8A 4ZN3A 1NPRA 2QQAA 3REBB 5GAMf 3H6ZA 2HAXA 4GY5A 4J7IA 2V8IA 5CQYA 4CC7A 5LJ3d 2EIFA 1R0BG 2EQKA 2F2VA 2CGHA 3HP9A 4M75C 3QSUA 3CPWA 3CCQQ 1WIEA 2QASA 1RUWA 1SSFA 2R5AA 1Y7XA 3BDUA 3OYHA 1M90R 2XD0A 9ATCB 4J9HA 1TU0B 4A4FA 5GJVB 2LMJA 4QT7A 1N8RC 2XHCA 2BZXA 4F7UG 3HRSA 2DLPA 4M7AB 2D9TA 3EG0A 1K0SA 4C8QE 1MNEA 2P84A 4A53A 1YITT 2DRMA 1QLYA 3A8MB 3LGFA 4GBQA 2RI3A 1M1KU 3CXCP 1FMKA 1Q7YU 4JS5A 3WVEB 2LDMA 3FDRA 3CCRA 5GAMj 2XMFA 1HK9A 2KQWA 3REAB 5L23A 4DBFA 1ZSGA 2FRYA 2ZAEA 1M3AA 2K7AA 2C0OA 1RACB 1M1FA 2E41A 4FYVB 4CC2A 2FL7A 3META 4OMFB 2EYYA 2KEAA 2LQWA 5L8RE 3NMZC 4FT4A 1WXTA 2V8JA 3VS3A 4PJJA 4M78F 3CCVQ 1U1TA 4BDYA 4F7UE 1YHQA 2A0FB 3V7SA 2XIDA 3LX7A 2X4WA
chains in the Genus database with same CATH topology
5IH2A 1JEGA 4J9IA 5I22A 2ROLA 1QKXA 1GCPA 3QWYA 2ENMA 1Z9ZA 2KE9A 4K11A 4IIOA 3NHNA 2K9GA 2J06A 4AFQC 3PVLA 2MCNA 4HXJA 2JM8A 2LX7A 2J6OA 2D1XA 2DBKA 2P4RA 3I9QA 4HVWA 4JJDA 3VS1A 1BU1A 2F2XA 1ZUUA 1H3HA 1AWXA 2JM9A 2DF6A 2DL7A 5ECAA 2JS2A 1HJDA 1M3CA 1LCKA 3RNJA 1KSWA 4E6RA 1GBQA 1ARKA 4RTTA 3EGUA 2YSQA 2LZ6B 2DL5A 2QDLA 1I0CA 2W10A 3QWXX 5FWBA 2BTTA 3SHWA 2AK5A 2DJQA 4LUDA 4LNPA 2K6DA 2YT6A 2MOXA 3CQTA 1WXBA 2F2WA 3EG2A 1RI9A 2DE0X 2LCSA 2LJ1A 4ORZA 5IHKA 2RQVA 2BZ8A 1GCQC 2HBWA 1PKTA 2KBTA 2L2PA 1H92A 1M27C 1GBRA 2E5KA 3UATA 2J7IA 2GTJA 2K79A 3H0HA 1X43A 4J9CA 2DMOA 2JMAA 1X2QA 1YNZA 1RLPC 2FRWA 1SRLA 2DRKA 3M0TA 5IXFA 2JTEA 1W70A 2KROA 2FG0A 4IIMA 1HSQA 1AZEA 2RN8A 4RTUA 1JXOA 1QCFA 1TUDA 1GFCA 1QWFA 3H0IA 2RPNA 2K3BA 2OAWA 2RQUA 1Y0MA 1CSKA 2CUBA 4JZ3A 1VYUA 4M4ZA 1Y57A 2RMOA 1WI7A 4J9BA 5IHIA 3THKA 4R0KA 3VS7A 2FO0A 4GLMA 4DEXA 3PVQA 1EFNA 2J6KA 1B07A 4OMLA 1YP5A 1SHGA 3H41A 2DILA 3M0SA 2DNUA 2L3QA 2JS0A 2RNAA 2GTOA 1UUEA 1S1NA 1HD3A 1RLQC 4Z8AA 1UJ0A 2D8JA 1WYXA 2RF0A 1PNJA 1JQQA 1VYTA 1UFFA 3IQLA 4D8DA 3RBBB 1E7OA 1UE9A 2ED1A 1AZGB 2CH4W 1U3OA 2EYXA 1ABQA 3EHRA 1IO6A 2EGCA 2KGTA 1W6XA 2M51A 2KT1A 1B3QA 2PTKA 2O88A 1OV3A 2EW3A 2KR3A 1TG0A 4AG1C 1NYGA 2AKKA 1YN8A 2SRCA 2JMCA 2RQWA 1KFZA 1WXUA 2LJ3A 2CSIA 2O31A 2OJ2A 2HSPA 2RQTA 2DX1A 1G83A 1VYVA 5GJWB 1FYNA 1AWWA 2DBMA 2KRSA 1T0JA 2LQNA 4RTVA 2EPDA 1NLPC 2LP5A 4LUEA 3ULRB 4HVUA 4D8KA 4HVVA 2CH4A 1M8MA 1SSHA 2ABLA 2OI3A 1TUCA 2CDTA 2YDLA 2JXBA 2EYWA 3VRZA 4HCKA 1J3TA 3I5SA 1KIKA 2ROTA 1K4US 1AD5A 2AZSA 1OPKA 2CT3A 4ESRA 2VVKA 2EGAA 2O9SA 3ZL7C 4RTXA 3O5ZA 1ZUYA 4RTYA 2FEIA 2HDAA 1N5ZA 4OMNA 1NEBA 1M30A 3NPFA 3EG3A 1BB9A 1UHFA 4RTZA 3UA7A 5EC7A 2J05A 1AWJA 2GNCA 1UGVA 2KRMA 1K0XA 5HCKA 1SPKA 4Z88A 4DEYA 1UTIA 3I35A 1PHTA 4J9GA 2A36A 1OOTA 4X1VA 3M0QA 4FSSA 1NEGA 2LNHB 1A0NB 1AEYA 1SEMA 1AOJA 2EKHA 2HEQA 1I07A 2KYMA 4EIKA 1G2BA 3LH5A 2FPFA 1WA7A 2VWFA 1V1CA 5I11A 1I1JA 2JW4A 2H8HA 2YUPA 2VKNA 1QKWA 2DL8A 1NG2A 1JU5C 2X3XD 1NM7A 1T3LA 1WDXA 1UDLA 2ED0A 3VRYA 3M0RA 4J9DA 5IHNA 1MV0B 4Y92A 1YWPA 3TSWA 4CC4B 2ESWA 2IIMA 1BK2A 3VS2A 2NWMA 2KXCA 2EGEA 3JV3A 4F17A 4AFZC 2V1QA 2YUQA 2DL3A 4JJCA 2EVRA 5FWCA 3UA6A 2NUZA 2DL4A 5IXBA 3VS6A 1K9AA 1KJWA 2EYZA 1AVZC 1AWOA 4RTWA 1GL5A 1M3BA 1K1ZA 2GGRA 2DYBA 1CKBA 2K2MA 2A28A 2CUDA 1X6BA 4JZ4A 1NLOC 1PWTA 2CT4A 1WX6A 2A08A 2ECZA 1JO8A 1U5SA 1W1FA 1X6GA 3M0PA 2A37A 2PNIA 1MV3A 1CKAA 3EHQA 3TVTA 4Z89A 1QWEA 2O2OA 2KNBB 2MIOA 3UF4A 2AKLA 1UG1A 4AG2C 3NGPA 5FW9A 3H0FA 4OMMA 2EBPA 3A98A 4OMOA 1ABOA 1ZLMA 1OEBA 2PZ1A 2FPDA 2W0ZA 4JPBW 4AFUC 3TSZA 1ZBJA 1ZUKA 1OPLA 3VS0A 4A63B 2J6FA 2X3WD 4ZNXA 1UECA 2DA9A 3U23A 2AZVA 2FPEA 4OMPA 3REBB 3M0UA 2GQIA 4F16A 4JJBA 3FJ5A 3VS4A 4LN2A 4J9FA 2DM1A 4CC7A 4KRTA 1WFWA 1PRMC 1ZX6A 3EG1A 3I5RA 2M0YA 3KFVA 1YCSB 2F2VA 4RUGA 2CSQA 2DVJA 2V1RA 2RQRA 2YUOA 1WIEA 2KXDA 1RUWA 2GBQA 3SEMA 4WCIA 1YWOA 1K76A 2KRNA 1SHFA 1T0HA 2L3PA 1BBZA 2LJ0A 2YUNA 4J9HA 3PE0A 2I0NA 4F14A 5GJVB 2LMJA 2G6FX 4QT7A 4AFSC 2BZXA 1T3SA 2DLPA 3EG0A 1K0SA 2BZYA 2HCKA 3R6NA 3C0CA 2DRMA 1NYFA 1QLYA 1GRIA 1X2KA 4GBQA 2L3SA 1Z9QA 3GBQA 1FMKA 1U06A 1GFDA 1X69A 1UJYA 1JXMA 2XMFA 1SRMA 1X27A 2KT8A 2CREA 1WLPB 2C0IA 3REAB 5L23A 1VA7A 1ZSGA 2O9VA 2EQIA 2B86A 2FRYA 1M3AA 2K7AA 2C0TA 2D8HA 2C0OA 1MUZA 4CC2A 1GCQA 1PKSA 2JT4A 1PRLC 2L0AA 2D0NA 2SEMA 2EYYA 4CC3A 2KEAA 1E6HA 2LQWA 3NMZC 2KYBA 1WXTA 3VS3A 1H8KA 4J9EA 4OMQA 3VS5A 4LE9A 1UHCA 1XOVA 1E6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IH2 A;  1JEG A;  4J9I A;  5I22 A;  2ROL A;  1QKX A;  1GCP A;  3QWY A;  2ENM A;  1Z9Z A;  2KE9 A;  4K11 A;  4IIO A;  3NHN A;  2K9G A;  2J06 A;  4AFQ C;  3PVL A;  2MCN A;  4HXJ A;  2JM8 A;  2LX7 A;  2J6O A;  2D1X A;  2DBK A;  2P4R A;  3I9Q A;  4HVW A;  4JJD A;  3VS1 A;  1BU1 A;  2F2X A;  1ZUU A;  1H3H A;  1AWX A;  2JM9 A;  2DF6 A;  2DL7 A;  5ECA A;  2JS2 A;  1HJD A;  1M3C A;  1LCK A;  3RNJ A;  1KSW A;  4E6R A;  1GBQ A;  1ARK A;  4RTT A;  3EGU A;  2YSQ A;  2LZ6 B;  2DL5 A;  2QDL A;  1I0C A;  2W10 A;  3QWX X;  5FWB A;  2BTT A;  3SHW A;  2AK5 A;  2DJQ A;  4LUD A;  4LNP A;  2K6D A;  2YT6 A;  2MOX A;  3CQT A;  1WXB A;  2F2W A;  3EG2 A;  1RI9 A;  2DE0 X;  2LCS A;  2LJ1 A;  4ORZ A;  5IHK A;  2RQV A;  2BZ8 A;  1GCQ C;  2HBW A;  1PKT A;  2KBT A;  2L2P A;  1H92 A;  1M27 C;  1GBR A;  2E5K A;  3UAT A;  2J7I A;  2GTJ A;  2K79 A;  3H0H A;  1X43 A;  4J9C A;  2DMO A;  2JMA A;  1X2Q A;  1YNZ A;  1RLP C;  2FRW A;  1SRL A;  2DRK A;  3M0T A;  5IXF A;  2JTE A;  1W70 A;  2KRO A;  2FG0 A;  4IIM A;  1HSQ A;  1AZE A;  2RN8 A;  4RTU A;  1JXO A;  1QCF A;  1TUD A;  1GFC A;  1QWF A;  3H0I A;  2RPN A;  2K3B A;  2OAW A;  2RQU A;  1Y0M A;  1CSK A;  2CUB A;  4JZ3 A;  1VYU A;  4M4Z A;  1Y57 A;  2RMO A;  1WI7 A;  4J9B A;  5IHI A;  3THK A;  4R0K A;  3VS7 A;  2FO0 A;  4GLM A;  4DEX A;  3PVQ A;  1EFN A;  2J6K A;  1B07 A;  4OML A;  1YP5 A;  1SHG A;  3H41 A;  2DIL A;  3M0S A;  2DNU A;  2L3Q A;  2JS0 A;  2RNA A;  2GTO A;  1UUE A;  1S1N A;  1HD3 A;  1RLQ C;  4Z8A A;  1UJ0 A;  2D8J A;  1WYX A;  2RF0 A;  1PNJ A;  1JQQ A;  1VYT A;  1UFF A;  3IQL A;  4D8D A;  3RBB B;  1E7O A;  1UE9 A;  2ED1 A;  1AZG B;  2CH4 W;  1U3O A;  2EYX A;  1ABQ A;  3EHR A;  1IO6 A;  2EGC A;  2KGT A;  1W6X A;  2M51 A;  2KT1 A;  1B3Q A;  2PTK A;  2O88 A;  1OV3 A;  2EW3 A;  2KR3 A;  1TG0 A;  4AG1 C;  1NYG A;  2AKK A;  1YN8 A;  2SRC A;  2JMC A;  2RQW A;  1KFZ A;  1WXU A;  2LJ3 A;  2CSI A;  2O31 A;  2OJ2 A;  2HSP A;  2RQT A;  2DX1 A;  1G83 A;  1VYV A;  5GJW B;  1FYN A;  1AWW A;  2DBM A;  2KRS A;  1T0J A;  2LQN A;  4RTV A;  2EPD A;  1NLP C;  2LP5 A;  4LUE A;  3ULR B;  4HVU A;  4D8K A;  4HVV A;  2CH4 A;  1M8M A;  1SSH A;  2ABL A;  2OI3 A;  1TUC A;  2CDT A;  2YDL A;  2JXB A;  2EYW A;  3VRZ A;  4HCK A;  1J3T A;  3I5S A;  1KIK A;  2ROT A;  1K4U S;  1AD5 A;  2AZS A;  1OPK A;  2CT3 A;  4ESR A;  2VVK A;  2EGA A;  2O9S A;  3ZL7 C;  4RTX A;  3O5Z A;  1ZUY A;  4RTY A;  2FEI A;  2HDA A;  1N5Z A;  4OMN A;  1NEB A;  1M30 A;  3NPF A;  3EG3 A;  1BB9 A;  1UHF A;  4RTZ A;  3UA7 A;  5EC7 A;  2J05 A;  1AWJ A;  2GNC A;  1UGV A;  2KRM A;  1K0X A;  5HCK A;  1SPK A;  4Z88 A;  4DEY A;  1UTI A;  3I35 A;  1PHT A;  4J9G A;  2A36 A;  1OOT A;  4X1V A;  3M0Q A;  4FSS A;  1NEG A;  2LNH B;  1A0N B;  1AEY A;  1SEM A;  1AOJ A;  2EKH A;  2HEQ A;  1I07 A;  2KYM A;  4EIK A;  1G2B A;  3LH5 A;  2FPF A;  1WA7 A;  2VWF A;  1V1C A;  5I11 A;  1I1J A;  2JW4 A;  2H8H A;  2YUP A;  2VKN A;  1QKW A;  2DL8 A;  1NG2 A;  1JU5 C;  2X3X D;  1NM7 A;  1T3L A;  1WDX A;  1UDL A;  2ED0 A;  3VRY A;  3M0R A;  4J9D A;  5IHN A;  1MV0 B;  4Y92 A;  1YWP A;  3TSW A;  4CC4 B;  2ESW A;  2IIM A;  1BK2 A;  3VS2 A;  2NWM A;  2KXC A;  2EGE A;  3JV3 A;  4F17 A;  4AFZ C;  2V1Q A;  2YUQ A;  2DL3 A;  4JJC A;  2EVR A;  5FWC A;  3UA6 A;  2NUZ A;  2DL4 A;  5IXB A;  3VS6 A;  1K9A A;  1KJW A;  2EYZ A;  1AVZ C;  1AWO A;  4RTW A;  1GL5 A;  1M3B A;  1K1Z A;  2GGR A;  2DYB A;  1CKB A;  2K2M A;  2A28 A;  2CUD A;  1X6B A;  4JZ4 A;  1NLO C;  1PWT A;  2CT4 A;  1WX6 A;  2A08 A;  2ECZ A;  1JO8 A;  1U5S A;  1W1F A;  1X6G A;  3M0P A;  2A37 A;  2PNI A;  1MV3 A;  1CKA A;  3EHQ A;  3TVT A;  4Z89 A;  1QWE A;  2O2O A;  2KNB B;  2MIO A;  3UF4 A;  2AKL A;  1UG1 A;  4AG2 C;  3NGP A;  5FW9 A;  3H0F A;  4OMM A;  2EBP A;  3A98 A;  4OMO A;  1ABO A;  1ZLM A;  1OEB A;  2PZ1 A;  2FPD A;  2W0Z A;  4JPB W;  4AFU C;  3TSZ A;  1ZBJ A;  1ZUK A;  1OPL A;  3VS0 A;  4A63 B;  2J6F A;  2X3W D;  4ZNX A;  1UEC A;  2DA9 A;  3U23 A;  2AZV A;  2FPE A;  4OMP A;  3REB B;  3M0U A;  2GQI A;  4F16 A;  4JJB A;  3FJ5 A;  3VS4 A;  4LN2 A;  4J9F A;  2DM1 A;  4CC7 A;  4KRT A;  1WFW A;  1PRM C;  1ZX6 A;  3EG1 A;  3I5R A;  2M0Y A;  3KFV A;  1YCS B;  2F2V A;  4RUG A;  2CSQ A;  2DVJ A;  2V1R A;  2RQR A;  2YUO A;  1WIE A;  2KXD A;  1RUW A;  2GBQ A;  3SEM A;  4WCI A;  1YWO A;  1K76 A;  2KRN A;  1SHF A;  1T0H A;  2L3P A;  1BBZ A;  2LJ0 A;  2YUN A;  4J9H A;  3PE0 A;  2I0N A;  4F14 A;  5GJV B;  2LMJ A;  2G6F X;  4QT7 A;  4AFS C;  2BZX A;  1T3S A;  2DLP A;  3EG0 A;  1K0S A;  2BZY A;  2HCK A;  3R6N A;  3C0C A;  2DRM A;  1NYF A;  1QLY A;  1GRI A;  1X2K A;  4GBQ A;  2L3S A;  1Z9Q A;  3GBQ A;  1FMK A;  1U06 A;  1GFD A;  1X69 A;  1UJY A;  1JXM A;  2XMF A;  1SRM A;  1X27 A;  2KT8 A;  2CRE A;  1WLP B;  2C0I A;  3REA B;  5L23 A;  1VA7 A;  1ZSG A;  2O9V A;  2EQI A;  2B86 A;  2FRY A;  1M3A A;  2K7A A;  2C0T A;  2D8H A;  2C0O A;  1MUZ A;  4CC2 A;  1GCQ A;  1PKS A;  2JT4 A;  1PRL C;  2L0A A;  2D0N A;  2SEM A;  2EYY A;  4CC3 A;  2KEA A;  1E6H A;  2LQW A;  3NMZ C;  2KYB A;  1WXT A;  3VS3 A;  1H8K A;  4J9E A;  4OMQ A;  3VS5 A;  4LE9 A;  1UHC A;  1XOV A;  1E6G A; 
#chains in the Genus database with same CATH topology
 4KH1 B;  5LJ3 h;  3QG1 A;  5LJ3 e;  4J9I A;  3SWN A;  5J39 A;  3C12 A;  5LJ3 j;  1GCP A;  3JCM g;  5FLX E;  4CI0 C;  3GNF B;  2CKK A;  4PJM A;  1K8A R;  2HQX A;  1YI2 Q;  3CC2 A;  3CC4 A;  4OP0 A;  3X20 B;  1VQK A;  3OW2 A;  1X75 C;  4XU3 A;  3M54 A;  1IRE B;  4KGZ B;  2LX7 A;  3CCJ Q;  3I9Q A;  4OGE A;  5GMK m;  4P5N A;  2DIG A;  2AT1 B;  2O01 E;  2JM9 A;  2DL7 A;  4EMG A;  3TEE A;  2QEX A;  2RJD A;  1BCM A;  4FIB A;  4A4H A;  2LQK A;  3EFO B;  2DZ9 A;  4E6R A;  4M77 C;  3DLM A;  4LDU A;  4RG2 A;  1QW1 A;  5A2Q E;  4M75 G;  2RK1 A;  3EGU A;  4FYY B;  1K9M C;  1C6V X;  3QWX X;  2W10 A;  1MND A;  2E65 A;  5A0L A;  1W2B A;  3QDF A;  2DO3 A;  4LD6 A;  1WXB A;  2PVG B;  4ZGJ B;  1RI9 A;  2DE0 X;  2X4J A;  4M7A F;  4X34 A;  2RQV A;  5GAO l;  1K9M U;  2BZ8 A;  1VQM Q;  4KUD K;  1ZSZ B;  4PFP A;  3L1A A;  1Y96 B;  4QVD A;  1M27 C;  2E5K A;  3UAT A;  2J7I A;  4BAC A;  4J6Y A;  4Y28 E;  2IVW A;  2CP7 A;  1X43 A;  3EH1 A;  4QQG A;  1YNZ A;  1TUG B;  1YI2 T;  1RLP C;  3S3O A;  2FRW A;  4JJN K;  2EAY A;  3RKX A;  3RR6 A;  3CCJ T;  3FEO A;  1W70 A;  5D6Y A;  4M75 E;  4IIM A;  4HT8 A;  4LXC A;  1TUD A;  1QWF A;  2OAW A;  4JLG A;  4BD3 A;  1Y0M A;  1MMN A;  3INZ A;  3PNW C;  4M4Z A;  1Y57 A;  1D09 B;  2HQH A;  1LVK A;  4J9B A;  4PKC C;  2RJE A;  5IHI A;  1MGQ A;  1LPL A;  3VS7 A;  5FRO A;  4OB3 B;  5FRN A;  2ATC B;  3EGX B;  4KBM B;  4PJO G;  2J6K A;  1B07 A;  1YP5 A;  3M0S A;  1ZHI A;  5GAO r;  3OB9 A;  1D0X A;  2GTO A;  4M7A D;  5D6X A;  2YXY A;  4DBR A;  2E5Q A;  4HCZ A;  3UDC A;  2K4Y A;  2DER A;  1KD1 C;  3CCE Q;  1WYX A;  4ZTJ A;  3IQL A;  2XG8 D;  3T9N A;  1UE9 A;  2FZC B;  4VUB A;  2EKO A;  2EGC A;  1W6X A;  2RK2 A;  3ZBD A;  3OYL A;  1IRX A;  2O88 A;  2L8D A;  5CIU A;  1KD1 U;  2EW3 A;  1QVG A;  3CMA T;  3D7S B;  4OF1 A;  2HSE B;  2RA2 A;  4Y91 A;  1D1B A;  4M7D B;  3J80 E;  2CSI A;  2OJ2 A;  4IUP A;  3L2Z A;  4FM4 B;  1G83 A;  4ZGD B;  4HCC A;  3OSS C;  4E2F B;  2LQN A;  4RTV A;  4PJO E;  4HA8 A;  4DBH A;  2LP5 A;  1YIJ A;  3DB4 A;  5FU7 C;  4D8K A;  4HVV A;  1LOJ A;  2CH4 A;  3P8H A;  1TWB A;  3OY9 A;  2QGG A;  2X4Y A;  2EYW A;  3P8D A;  1I4K 1;  1XNI A;  3ZEH A;  1K4U S;  1O9S A;  4ESR A;  2VVK A;  4C92 C;  4DQ2 A;  2EGA A;  3M53 A;  3CCE T;  2O9S A;  8AT1 B;  3O5Z A;  2LTO A;  2RI2 A;  4XAX B;  1BB9 A;  4C8Q B;  2J05 A;  5KE2 A;  1I81 A;  1S72 Q;  2KRM A;  1VQ6 A;  4M77 E;  4DEY A;  3I35 A;  5KYY B;  2CP6 A;  4J5Y A;  4B9X A;  2BUD A;  1R8O B;  5GAO n;  2A36 A;  2CZ7 B;  4FSS A;  1A0N B;  1TSF A;  1SEM A;  1AOJ A;  3SWN C;  1WZO A;  3LGL A;  3CME Q;  2E1H A;  2OTJ A;  1X01 A;  2QTX A;  1I1J A;  2JW4 A;  1Q81 C;  1VIE A;  2OAU A;  2DL8 A;  3X26 B;  2X3X D;  4C0G A;  4E7H A;  1T3L A;  3FLG A;  1UDL A;  3X24 B;  3CCM Q;  1VQN Q;  4BE0 A;  3CCL Q;  2ESW A;  2IIM A;  3VS2 A;  3OYA A;  1Y07 A;  1VUB A;  2QK0 A;  1KQ2 A;  4JJC A;  4XTV A;  2COW A;  3EAE A;  1MHN A;  2IPO B;  1DJ7 B;  4BE1 A;  2EJ9 A;  2FYK A;  1YJ9 Q;  3BW1 A;  2CZ1 B;  5GAN 8;  5GAN 7;  1AWO A;  4RTW A;  2CS7 A;  3N5B B;  5HK0 A;  3MEU A;  1MMD A;  1H64 1;  2GGR A;  4ZN1 A;  2LRQ A;  2DPP B;  4E7K A;  1IZ6 A;  1QCN A;  2GFA A;  3E2U A;  4M7D F;  2QG9 B;  3GLX A;  4XTZ A;  2D0Q B;  2OTL Q;  3MCA B;  1K73 R;  1UB4 A;  1JO8 A;  1UGP B;  1W1F A;  1QVF S;  1F1B B;  1B34 B;  1WHK A;  2VUB A;  4JS4 A;  4C5G A;  3H9N A;  3CME T;  3OYJ A;  2KNB B;  3C4S A;  3M57 A;  3BFM A;  2AKL A;  3NGP A;  4MML A;  2X9H A;  3H0F A;  1ZLM A;  3CCM T;  1G5V A;  2E3I A;  1AHJ B;  3CCL T;  4JPB W;  3PTA A;  1LNX A;  2XKO C;  2L89 A;  4Z02 A;  1ZUK A;  1PCX A;  5FU6 B;  1UEC A;  3E9F A;  4MZP A;  3VU3 C;  5IT9 E;  4C8Q F;  1YJ9 T;  4E47 A;  4OMP A;  3G6E T;  4O6J A;  2GQI A;  4F16 A;  3G4S Q;  2EQU A;  4JJB A;  4MZM A;  4M78 A;  5IN1 A;  3X28 B;  4J9F A;  2DM1 A;  2V26 A;  1TOV A;  3FB9 A;  4E7Z A;  1WFW A;  4IUT A;  2HKQ B;  1ZX6 A;  2ZPI B;  4M7D D;  2M0Y A;  1YFN A;  1YCS B;  3I55 Q;  2CSQ A;  2DVJ A;  4FW2 A;  3QUI A;  4XU2 A;  2YUO A;  2KXD A;  4E7J A;  3BDL A;  3SEM A;  3JB9 H;  5CR2 A;  2KRN A;  4ZGE B;  2C06 A;  3OYE A;  3CD6 A;  2LX9 A;  3HPW A;  2L3P A;  1BBZ A;  2VC8 A;  2XU8 A;  3PE0 A;  2I0N A;  4PFZ A;  3JCM d;  5I2M A;  1M1K R;  1Q7Y R;  3M9Q A;  2CP3 A;  3PIP A;  1N8R R;  2HCK A;  1VQ4 Q;  2K5L A;  4C92 E;  3E19 A;  1NYF A;  4M77 A;  1NJI C;  1Z9Q A;  1G3Y A;  1VQP Q;  5I21 A;  3QJ6 A;  1GFD A;  2KAF A;  1UJY A;  2RJC A;  1JXM A;  1X27 A;  4DOV A;  2CRE A;  1WLP B;  3VJP A;  2G3R A;  3M4Y A;  2K2V A;  1JB0 E;  4C8Q D;  2D8H A;  3JCM Q;  3MPU B;  1ACM B;  5KCH A;  4F04 B;  3PMT A;  1Y71 A;  4X9C A;  3G4S T;  3G71 A;  2D0N A;  4CC3 A;  3CC7 T;  2FHD A;  5A0D A;  5GMK h;  5KYW A;  5GMK e;  3VS5 A;  3I55 T;  3A1P A;  1UHC A;  1XOV A;  4ZTF A;  1E6G A;  2IG0 A;  1UGS B;  1JEG A;  3AHU A;  1I5L A;  1BIA A;  2QDY B;  3OBY A;  4XQ3 A;  3I56 A;  2ROL A;  5D7U A;  2FZG B;  5GAM d;  3Q1J A;  2GQV A;  1YJN Q;  3NFC A;  5GAO m;  1D1C A;  2KE9 A;  4K11 A;  4PJO B;  2KY9 A;  3JCM h;  3JCM e;  4BY6 B;  4AFQ C;  1VQP T;  2MCN A;  8ATC B;  2P4R A;  4HVW A;  3VS1 A;  4EDU A;  3JCM W;  3JSC A;  5ECA A;  3OS0 A;  1KG1 A;  1LCK A;  2DXU A;  2Z0W A;  2JTM A;  1UEB A;  4BI3 A;  4C5I A;  3EGD A;  3LH0 A;  4RTT A;  2GFU A;  2EQJ A;  2EFI A;  4DA4 A;  2QDL A;  4C0Z A;  2BTT A;  1VQL A;  1K9M R;  2XDP A;  4LUD A;  2K6D A;  3CXC A;  2MOX A;  2LCS A;  4ORZ A;  3S3N A;  4ME7 A;  1BI3 A;  2NUT B;  3PGG A;  1PKT A;  2QTV A;  5HKC A;  3E1S A;  2GTJ A;  1KHC A;  2K79 A;  2ZPE B;  5KE3 A;  1YJN T;  2L3R A;  2HQE A;  2DMO A;  1WPY A;  2JMA A;  1X2Q A;  1B7T A;  5GAM h;  3MKD A;  5GAM e;  3M0T A;  1N8R U;  2QAZ A;  3EFO A;  5CAI A;  1C1A A;  2FB7 A;  2FG0 A;  3DLL A;  2DXC A;  2RN8 A;  1JXO A;  1GFC A;  2K3B A;  1CSK A;  4ANJ A;  4C92 A;  4HT9 A;  2RMO A;  4PLL A;  5KYU B;  2JJ9 A;  4WTO B;  2LCC A;  4JRI A;  3BE3 A;  4R0K A;  2HBP A;  2FO0 A;  1NPP A;  3EG9 B;  1ZSZ A;  2CP0 A;  4GLM A;  4DEX A;  3PVQ A;  2AHJ B;  5AYF A;  4QKU A;  1LJO A;  2RHU A;  1SHG A;  1VQ9 A;  2DVE A;  4M75 D;  2RD1 A;  1UUE A;  1JJ2 S;  1HD3 A;  1D0Z A;  3A8H B;  3OYF A;  4HKE A;  4Z8A A;  2CYZ B;  1PNJ A;  1I5O B;  2HKN A;  3OQ5 A;  4NOY A;  3OYM A;  3EFS A;  4PJO F;  1M9S A;  4B6M A;  1KD1 R;  4M78 C;  2H3E B;  5DY9 A;  1U3O A;  2KGT A;  2M51 A;  1B3Q A;  4KUI A;  1VQO A;  2VAS A;  1HXD A;  2PTK A;  4II1 A;  2PUK B;  3QO3 A;  3HRT A;  4AG1 C;  1NBE B;  1NYG A;  2SRC A;  3PFS A;  3CPF A;  3MP6 A;  2RQW A;  2JN0 A;  2RJF A;  2O31 A;  2PUO B;  2WSE E;  1WQW A;  1Q82 C;  1VYV A;  1VQ7 Q;  1FYN A;  3QYG B;  1OYX A;  4EMK C;  1T0J A;  3JRZ A;  1S72 A;  1RAI B;  2NUP A;  1OU9 A;  1BKB A;  1GXI E;  1YJW Q;  3NTH A;  1M8M A;  4RCC A;  4V2S A;  3JCM J;  4OB0 B;  2JOY A;  1TUC A;  3OYK A;  5CKB A;  1J3T A;  3LWH A;  1KIK A;  2ROT A;  3JB9 G;  3CPW S;  2AZS A;  1OPK A;  1VQ8 Q;  2CT3 A;  1EX4 A;  3A5Z B;  5CCA A;  2WSC E;  4C0D B;  2ZZD A;  4PJO D;  4D6W A;  1ZUY A;  2FEI A;  1N5Z A;  5CKD A;  1NEB A;  5FRM A;  2RM4 A;  2LC4 A;  1AWJ A;  1UGV A;  4J83 A;  2QQS A;  1KHI A;  4AMC A;  1UTI A;  4M7A C;  1JRI A;  1M90 C;  2DKG A;  4J9G A;  3GOX A;  1FMW A;  3CMA Q;  2QGF B;  4JRK A;  4N4H A;  2PVD B;  1TS9 A;  2BE7 D;  1VQ5 Q;  2KYM A;  2ZGW A;  4JLI A;  1SF9 A;  5GAN 3;  1EZZ B;  1VQ7 T;  4O5V A;  2VWF A;  1FX7 A;  1V1C A;  5I11 A;  1OZ2 A;  1QCO A;  2VKN A;  2RI5 A;  1FMV A;  4L6V 5;  3ER0 A;  1Q81 R;  2ED0 A;  2F69 A;  3JCM V;  1YJW T;  3M0R A;  1G3W A;  4J9D A;  1MV0 B;  5IHN A;  3TSW A;  3G1J A;  1BK2 A;  4NL3 A;  3JB9 J;  3RER A;  3TU4 K;  3M4G A;  3L2U A;  2YUQ A;  5FWC A;  4M78 G;  2VXE A;  4BUG A;  1VQ8 T;  2DL4 A;  2QYZ A;  1K9A A;  5KYY A;  3QXE B;  2QA4 A;  1K1Z A;  4L5G A;  2RO0 A;  3L42 A;  3MO8 A;  4J7F A;  2BIV A;  3CCR Q;  1WX6 A;  2ECZ A;  2XI9 A;  5KYX A;  1RAH B;  1N6A A;  1U5S A;  3OW2 S;  2E10 A;  1X6G A;  3OMG A;  5GAO p;  2ZPH B;  2PNI A;  3PT9 A;  4M77 G;  1CKA A;  1VQ5 T;  2ZCF B;  4RCB A;  2COY A;  2MMP A;  3EHQ A;  3TVT A;  4Z89 A;  4BI4 A;  3MJX A;  1K8A C;  2VV5 A;  1WHG A;  1WHJ A;  2MIO A;  3L2W A;  2O4X B;  2WAC A;  1UG1 A;  2ZPG B;  2YRC A;  1R77 A;  4OMM A;  3VUZ A;  3A98 A;  4M78 E;  1ABO A;  2PZ1 A;  2FPD A;  2KDS A;  2W0Z A;  4AFU C;  2P0Q A;  1YHQ Q;  3VYH B;  3TSZ A;  2M0O A;  1W2B S;  3C95 A;  1PSF A;  3ZFJ A;  4BDZ A;  2AZV A;  5J26 A;  3OBW A;  3WVD B;  1VQ4 A;  2K5F A;  3E9G A;  3LLR A;  3VS4 A;  4LN2 A;  1M2V B;  1V29 B;  1QVG P;  3VV0 A;  4OB2 B;  1PRM C;  5GAN 4;  1ZSZ C;  3I5R A;  3CC2 Q;  1IHW A;  3CC4 Q;  4RUG A;  1BIB A;  2V1R A;  1QVF P;  1VQK Q;  1WNL A;  2RQR A;  3MEA A;  3CCR T;  1ZQ1 A;  2DFU A;  4WCI A;  1H3Z A;  1YWO A;  1K76 A;  2MWO A;  1KQS A;  3M58 A;  2LJ0 A;  2LCL A;  3CCU A;  2YUN A;  3V7R A;  4XTW A;  2KMT A;  4AFS C;  4E7L A;  5KCO A;  2QEX Q;  5LJ5 f;  1BI0 A;  2HMA A;  2KK4 A;  2BZY A;  1RI0 A;  3R6N A;  3OSV A;  3C0C A;  4N0A A;  4MDX A;  1GRI A;  2DTO A;  1X2K A;  2EQM A;  3GBQ A;  1X69 A;  3CCS A;  2M02 A;  3LYI A;  1YHQ T;  1SRM A;  2KT8 A;  2DXB A;  4M7A E;  1VA7 A;  4F7U B;  3JCM P;  2O9V A;  1Q81 U;  1ZA1 B;  4RKU E;  2E6N A;  3CBP A;  4FL6 A;  3HRU A;  3S6W A;  4EPC A;  2C0T A;  1MUZ A;  3QYH B;  1R0C B;  4KGX B;  2DD4 A;  3G6E Q;  1RAF B;  1YIT A;  2R57 A;  2SEM A;  2VGM A;  2CZ6 B;  2KYB A;  3RDV A;  1D3B B;  4XTX A;  3O8V A;  5LJ5 j;  1H8K A;  4OMQ A;  1PG5 B;  3CC2 T;  3CC4 T;  5GAN f;  1G8X A;  1VQK T;  4E7I A;  4LE9 A;  3TRE A;  3NTI A;  2PQW A;  1IHV A;  1QVG S;  2HL3 A;  2COZ A;  2LVM A;  1RAA B;  3RIR A;  2QEX T;  1BI2 A;  1QKX A;  2ENM A;  1VOM A;  4M7D C;  1Z9Z A;  4KH0 B;  3V8L A;  5CO7 A;  1Q95 G;  2RB6 A;  2JTF A;  4IIO A;  4BE2 A;  2K9G A;  2M9U A;  3HKS A;  2AIR B;  1PC0 A;  4ELY C;  3CCQ A;  1WQ7 A;  3PVL A;  4QQD A;  1MMA A;  4HXJ A;  2LT1 A;  2JM8 A;  3C94 A;  3URG A;  2DBK A;  4JJD A;  4C92 G;  5GAN 2;  1BU1 A;  1D1A A;  2F2X A;  1KQ1 A;  1ZUU A;  3NTK A;  1AWX A;  4XK8 E;  4QVC A;  5KYN A;  2JS2 A;  3X25 B;  5GAN j;  5DM7 R;  3QDR B;  3OS5 A;  4PNO A;  1KSW A;  5A0G A;  1GBQ A;  1OZ3 A;  3MEW A;  2YSQ A;  2DEU A;  2JNG A;  2DL5 A;  3CC7 Q;  5FWB A;  4ATO A;  2AK5 A;  4LNP A;  2YT6 A;  3WXM B;  3CQT A;  4C8Q C;  1D0Y A;  3JCM c;  1WGS A;  2K3X A;  1Q86 C;  4FSX A;  3P8B B;  1OQK A;  1PSE A;  5AT1 B;  1GCQ C;  2KBT A;  4KGV B;  5I2S A;  1H92 A;  4M75 B;  1GBR A;  1M8V A;  1M5Q 1;  1WJQ A;  1QP3 A;  3H0H A;  5LL6 S;  4J9C A;  4PLI A;  4EMK A;  1YIJ Q;  4GLK A;  1Q86 U;  1FXX A;  3CCV A;  4FYX B;  1NZ9 A;  1WHL A;  4JUV A;  4F7U F;  2JTE A;  4AT1 B;  3ME9 A;  1W4S A;  1QCF A;  1NJI U;  2RPN A;  2RQU A;  5LJ5 g;  2XDB A;  1KC8 C;  3RES A;  1WHM A;  4JZ3 A;  1VYU A;  2QA4 T;  5CKE A;  4QVZ A;  2ZPF B;  4R55 A;  1YI2 A;  1HYO A;  3M56 A;  3MHX A;  2MWP A;  3FIF A;  1BI1 A;  1KC8 U;  3H41 A;  2DIL A;  4M7A A;  3CCJ A;  3DB3 A;  3SDZ A;  2JS0 A;  4OVA A;  3OS1 A;  5CKF A;  1S1N A;  1RLQ C;  3V7C A;  4J6W A;  2D8J A;  2RF0 A;  1JQQ A;  1N27 A;  4D8D A;  3RBB B;  2OTJ Q;  1E7O A;  2CH4 W;  2DAQ A;  3L2Q A;  1SKU B;  1IO6 A;  2LNV A;  3JCM X;  4EMH A;  1YIJ T;  3QHS A;  1K73 C;  3VKI A;  3LWI A;  2KR3 A;  3HFN A;  3V8K A;  5GAN g;  2AKK A;  1YN8 A;  2HNI A;  1WHH A;  4KT0 E;  1KFZ A;  2HSP A;  1VQM A;  2RQT A;  2DTH A;  2R58 A;  3HTR A;  5J3B A;  3EG9 A;  5GJW B;  3QBY A;  2DBM A;  1Q82 R;  2WSF E;  4N0A C;  5FU6 C;  2EPD A;  4XTU A;  3ULR B;  4DOW A;  4LDX A;  4OB1 B;  1JJ2 P;  1SSH A;  4M7D E;  2ABL A;  1VQ6 T;  2DD5 A;  2LQ8 A;  1EIF A;  3FJP A;  2YDL A;  4M77 B;  4C5H A;  3VRZ A;  3I5S A;  1U8R A;  3ASK A;  4M75 F;  1XTD A;  2M1H A;  4L59 A;  1PM3 A;  2YWW A;  4RTX A;  4N4G A;  4PJL A;  2OTJ T;  2HDA A;  4OMN A;  3NPF A;  1M30 A;  4LDV A;  3EG3 A;  4RTZ A;  2K3Y A;  3UA7 A;  4JRP A;  2CP2 A;  2GNC A;  1G3T A;  3JB9 F;  1ZA2 B;  2MI6 A;  3OYY A;  1K0X A;  5HCK A;  2MK5 A;  1N9S A;  4Z88 A;  4WF2 A;  4CRI A;  4YTL A;  3CCS T;  1PHT A;  3UWN A;  2H3J A;  4LDY A;  3AT1 B;  7AT1 B;  4RMO A;  5KYW B;  1Q7Y C;  1M1K C;  1NEG A;  2LNH B;  2EKH A;  2HEQ A;  1I07 A;  3CCE A;  3LH5 A;  2FPF A;  1WA7 A;  3RUX A;  2RHX A;  2H8H A;  3QZ5 B;  1TTH B;  1NM7 A;  2V8K A;  1M1G A;  3VRY A;  1JBM A;  3CPW P;  2X35 A;  1U1S A;  4Y92 A;  1YWP A;  5LJ3 f;  1Y96 A;  4FCY A;  2RHZ A;  2EVR A;  3GIB A;  3CD6 Q;  3GF5 A;  2MF2 A;  4C5E A;  1YCY A;  3VS6 A;  3HFO A;  1KJW A;  2DXT A;  3H8Z A;  2RHI A;  1GL5 A;  1C0M A;  5M9O A;  3L2V A;  3QJY A;  3JB9 D;  3A8G B;  2DYB A;  1CKB A;  1QQJ A;  1X6B A;  3S3M A;  3VUB A;  3EGD B;  4J6X A;  3CCQ T;  1PWT A;  5CKH A;  3OYB A;  2GF7 A;  2QQR A;  3A8O B;  4MZT A;  3HHT B;  4PJO C;  3V8J A;  2A37 A;  3SB2 A;  4NS5 A;  2RHY A;  4BY6 C;  1V76 A;  2JZ2 A;  2A3L A;  5IAY A;  5GAN 5;  2O2O A;  1OI1 A;  2BE9 B;  3EGX A;  3RMS A;  3UF4 A;  2D6F A;  4AG2 C;  3G71 Q;  3OA6 A;  5CK9 A;  1RAB B;  5FW9 A;  2EBP A;  4NL2 A;  4QQ6 A;  4M77 F;  4RG8 A;  1Q82 U;  4A4G A;  2YLC A;  3RKW A;  3UPU A;  3VS0 A;  4A63 B;  3KXT A;  2J6F A;  1RL2 A;  1KK7 A;  3CXC S;  4ZNX A;  4B9W A;  1VIF A;  3CD6 T;  3VYG A;  3JCM b;  5FU7 B;  3CME A;  2HZY A;  2FPE A;  1QMC A;  3TQ7 P;  2CP5 A;  3I56 Q;  1IB8 A;  1TXQ A;  3M0U A;  3FJ5 A;  4IUQ A;  4M78 D;  4Q5W A;  4JDS A;  4M7D A;  4KRT A;  2M16 A;  3KBG A;  3CCM A;  3OW2 P;  3CCV T;  1VQN A;  3EG1 A;  3KFV A;  2BKD N;  5KH6 A;  1NE8 A;  4XU0 A;  3CCL A;  4C92 B;  2X4X A;  2OX7 A;  2GBQ A;  2Y90 A;  3FRN A;  4LD9 K;  1PD1 A;  2O4X A;  1I8F A;  1SHF A;  1T0H A;  4IUV A;  5C6S A;  5DLO A;  4F14 A;  3OYN A;  2G6F X;  1BCO A;  1T3S A;  1UGR B;  1YJ9 A;  1YBY A;  4A4K A;  2VXF A;  3G6E A;  4PJN A;  5GAM g;  1M90 U;  2E64 A;  2E4H A;  3G7Z A;  3G71 T;  2FVU A;  2L3S A;  4M77 D;  1W2B P;  4HCB A;  3SWN B;  1OX9 A;  1U06 A;  1VQL Q;  2E3H A;  1AT1 B;  2OTL A;  4DBQ A;  2GCX A;  2C0I A;  1ZBX A;  1M2V A;  2EQI A;  4C8Q A;  2B86 A;  3UT1 A;  3I56 T;  1GCQ A;  1PKS A;  2P0K A;  2JT4 A;  3HSB A;  1PRL C;  2L0A A;  1E6H A;  4MDW A;  5D6W A;  3J7A F;  4J9E A;  1MMG A;  3SD4 A;  2YHT A;  3FC3 A;  5LJ3 g;  2NUP B;  4A4E A;  4PK4 A;  2KVQ G;  1RAE B;  1VQM T;  5IH2 A;  5I22 A;  2KSS A;  1TH7 A;  3QWY A;  3G4S A;  2PU9 B;  3CC7 A;  4F7U A;  3GPL A;  3NHN A;  2J06 A;  3I55 A;  2FZK B;  5C0M A;  3OS2 A;  1VQL T;  2HL5 C;  2DK3 A;  1QVF A;  1VQ9 Q;  1K8A U;  2J6O A;  2D1X A;  1UGQ B;  1H3H A;  2XDD A;  2DF6 A;  5LJ5 d;  1D3B A;  1HJD A;  1M3C A;  2K5I A;  2YRV A;  1XQH A;  3RNJ A;  2DET A;  2LT4 A;  1ARK A;  4XTY A;  4C92 F;  4M7A G;  1PD0 A;  2LZ6 B;  1VQO Q;  4XU1 A;  1I0C A;  2K57 A;  2A7Y A;  4C0D C;  1VQP A;  3SHW A;  2DJQ A;  1B34 A;  2DTI A;  1RAD B;  2F2W A;  3EG2 A;  2LJ1 A;  5IHK A;  2MPX C;  3CEY A;  2HBW A;  1Q86 R;  2EJG A;  2L2P A;  2EJF A;  3J81 E;  4TVR A;  1FWZ A;  5GMK l;  3CBO A;  5GAN d;  3OYG A;  1SRL A;  2DRK A;  5CQX A;  1OX8 A;  1WJS A;  4QW2 A;  5IXF A;  1NJI R;  2Y4Y A;  1X6O A;  1P92 A;  1VQ9 T;  3BY7 A;  2KRO A;  1HSQ A;  1AZE A;  4RTU A;  2DEQ A;  3H0I A;  3OMC A;  3QZ9 B;  5KYX B;  3JAM E;  4KUL A;  4R56 A;  2CUB A;  3PMI A;  1YJN A;  4C92 D;  1WI7 A;  2QXF A;  3MP1 A;  1KC8 R;  2F5K A;  5LJ5 h;  5LJ5 e;  3THK A;  4IKF A;  1VQO T;  2DZC A;  4J8O A;  4OGC A;  1KQS P;  1EFN A;  2E70 A;  4OML A;  1IGU A;  4M75 A;  2DNU A;  2L3Q A;  2RNA A;  2E12 A;  2X51 A;  1UJ0 A;  1VYT A;  1UFF A;  1M4Z A;  2XK0 A;  2ED1 A;  1AZG B;  2EYX A;  3TCJ A;  1ABQ A;  2B8A A;  3EHR A;  2NYS A;  1S72 T;  2KT1 A;  4E7S A;  1OV3 A;  1TG0 A;  1QVP A;  2JMC A;  1WXU A;  2LJ3 A;  5GAN h;  5GAN e;  4FT2 A;  2P4T A;  2DX1 A;  2RH2 A;  2XIC A;  1O75 A;  1SG5 A;  1AWW A;  3DKM A;  2KRS A;  5EG2 A;  2KI7 A;  2P0P A;  2QA4 Q;  1NLP C;  2L5Q A;  3M59 A;  5HY6 A;  4LUE A;  2YLB A;  1VQN T;  1XJW B;  4HVU A;  3M5A A;  2F1L A;  3RKY A;  2OI3 A;  2CDT A;  2JXB A;  4HCK A;  1AD5 A;  2QQB A;  5HK3 A;  2JVV A;  3EH2 A;  4PJO A;  1KQS S;  3ZL7 C;  4FYW B;  2EYQ A;  5CVI A;  4RTY A;  2VYT A;  1UHF A;  2EWN A;  5EC7 A;  2VGN A;  2Y4X A;  3SFM A;  1SPK A;  2NLU A;  3M55 A;  3F70 A;  2OTL T;  3A8L B;  1OOT A;  4X1V A;  3M0Q A;  2HD0 A;  5DLQ E;  1AEY A;  3LW5 E;  4EIK A;  1G2B A;  4UC4 A;  1N9R A;  4N4I A;  1IGQ A;  6AT1 B;  4C0F A;  2YUP A;  1QKW A;  1RAG B;  1NG2 A;  1JU5 C;  3QII A;  1WDX A;  2R5M A;  4CC4 B;  1VQ6 Q;  2NWM A;  2NUT A;  2KXC A;  1OUL A;  2EGE A;  3OYC A;  3JV3 A;  3KUF A;  4X9D A;  3GP8 A;  3MEV A;  4F17 A;  3QPH A;  2ZPB B;  4FU6 A;  4AFZ C;  2MYS A;  2V1Q A;  2DL3 A;  3OYI A;  3UA6 A;  2CZ0 B;  3CCU Q;  2NUZ A;  3EFR A;  4IUU A;  4M7D G;  5IXB A;  4IUR A;  3CBM A;  1VQ7 A;  3PIO A;  2EYZ A;  5GAO q;  1AVZ C;  3JCM f;  1OU8 A;  3JB9 I;  1M3B A;  4JRQ A;  2K2M A;  2A28 A;  2CUD A;  1YJW A;  4BI8 B;  4LDW A;  2F5T X;  2PVO B;  4JZ4 A;  5GMK j;  1NLO C;  1JJ2 A;  2CT4 A;  3CCS Q;  2A08 A;  4MMK A;  4M78 B;  2VB6 A;  1BYM A;  2MAM A;  2YRD A;  4PFO A;  3M0P A;  1VQ8 A;  1MV3 A;  4PL6 A;  5KYU A;  2DJZ A;  3RMQ A;  4FW1 A;  2QQ9 A;  2DYI A;  1QWE A;  1VQ4 T;  5GAN 6;  1K73 U;  4A54 A;  3L2R A;  2I2L A;  1YIT Q;  3GNG A;  2JUF A;  4ELZ C;  4OMO A;  3OYD A;  1OEB A;  2E6Z A;  4C8Q G;  3R6O A;  1G3S A;  3CMA A;  3QKJ A;  1WJR A;  4EMK B;  4BB7 A;  1ZBJ A;  1OPL A;  2DIQ A;  2X3W D;  1IXD A;  5GMK i;  1VQ5 A;  3MP8 A;  2DA9 A;  3CCU T;  3U23 A;  1M2O A;  1QP2 A;  2QI2 A;  3HL8 A;  4ZN3 A;  1NPR A;  2QQA A;  3REB B;  5GAM f;  3H6Z A;  2HAX A;  4GY5 A;  4J7I A;  2V8I A;  5CQY A;  4CC7 A;  5LJ3 d;  2EIF A;  1R0B G;  2EQK A;  2F2V A;  2CGH A;  3HP9 A;  4M75 C;  3QSU A;  3CPW A;  3CCQ Q;  1WIE A;  2QAS A;  1RUW A;  1SSF A;  2R5A A;  1Y7X A;  3BDU A;  3OYH A;  1M90 R;  2XD0 A;  9ATC B;  4J9H A;  1TU0 B;  4A4F A;  5GJV B;  2LMJ A;  4QT7 A;  1N8R C;  2XHC A;  2BZX A;  4F7U G;  3HRS A;  2DLP A;  4M7A B;  2D9T A;  3EG0 A;  1K0S A;  4C8Q E;  1MNE A;  2P84 A;  4A53 A;  1YIT T;  2DRM A;  1QLY A;  3A8M B;  3LGF A;  4GBQ A;  2RI3 A;  1M1K U;  3CXC P;  1FMK A;  1Q7Y U;  4JS5 A;  3WVE B;  2LDM A;  3FDR A;  3CCR A;  5GAM j;  2XMF A;  1HK9 A;  2KQW A;  3REA B;  5L23 A;  4DBF A;  1ZSG A;  2FRY A;  2ZAE A;  1M3A A;  2K7A A;  2C0O A;  1RAC B;  1M1F A;  2E41 A;  4FYV B;  4CC2 A;  2FL7 A;  3MET A;  4OMF B;  2EYY A;  2KEA A;  2LQW A;  5L8R E;  3NMZ C;  4FT4 A;  1WXT A;  2V8J A;  3VS3 A;  4PJJ A;  4M78 F;  3CCV Q;  1U1T A;  4BDY A;  4F7U E;  1YHQ A;  2A0F B;  3V7S A;  2XID A;  3LX7 A;  2X4W A; 
#chains in the Genus database with same CATH homology
 5IH2 A;  1JEG A;  4J9I A;  5I22 A;  2ROL A;  1QKX A;  1GCP A;  3QWY A;  2ENM A;  1Z9Z A;  2KE9 A;  4K11 A;  4IIO A;  3NHN A;  2K9G A;  2J06 A;  4AFQ C;  3PVL A;  2MCN A;  4HXJ A;  2JM8 A;  2LX7 A;  2J6O A;  2D1X A;  2DBK A;  2P4R A;  3I9Q A;  4HVW A;  4JJD A;  3VS1 A;  1BU1 A;  2F2X A;  1ZUU A;  1H3H A;  1AWX A;  2JM9 A;  2DF6 A;  2DL7 A;  5ECA A;  2JS2 A;  1HJD A;  1M3C A;  1LCK A;  3RNJ A;  1KSW A;  4E6R A;  1GBQ A;  1ARK A;  4RTT A;  3EGU A;  2YSQ A;  2LZ6 B;  2DL5 A;  2QDL A;  1I0C A;  2W10 A;  3QWX X;  5FWB A;  2BTT A;  3SHW A;  2AK5 A;  2DJQ A;  4LUD A;  4LNP A;  2K6D A;  2YT6 A;  2MOX A;  3CQT A;  1WXB A;  2F2W A;  3EG2 A;  1RI9 A;  2DE0 X;  2LCS A;  2LJ1 A;  4ORZ A;  5IHK A;  2RQV A;  2BZ8 A;  1GCQ C;  2HBW A;  1PKT A;  2KBT A;  2L2P A;  1H92 A;  1M27 C;  1GBR A;  2E5K A;  3UAT A;  2J7I A;  2GTJ A;  2K79 A;  3H0H A;  1X43 A;  4J9C A;  2DMO A;  2JMA A;  1X2Q A;  1YNZ A;  1RLP C;  2FRW A;  1SRL A;  2DRK A;  3M0T A;  5IXF A;  2JTE A;  1W70 A;  2KRO A;  2FG0 A;  4IIM A;  1HSQ A;  1AZE A;  2RN8 A;  4RTU A;  1JXO A;  1QCF A;  1TUD A;  1GFC A;  1QWF A;  3H0I A;  2RPN A;  2K3B A;  2OAW A;  2RQU A;  1Y0M A;  1CSK A;  2CUB A;  4JZ3 A;  1VYU A;  4M4Z A;  1Y57 A;  2RMO A;  1WI7 A;  4J9B A;  5IHI A;  3THK A;  4R0K A;  3VS7 A;  2FO0 A;  4GLM A;  4DEX A;  3PVQ A;  1EFN A;  2J6K A;  1B07 A;  4OML A;  1YP5 A;  1SHG A;  3H41 A;  2DIL A;  3M0S A;  2DNU A;  2L3Q A;  2JS0 A;  2RNA A;  2GTO A;  1UUE A;  1S1N A;  1HD3 A;  1RLQ C;  4Z8A A;  1UJ0 A;  2D8J A;  1WYX A;  2RF0 A;  1PNJ A;  1JQQ A;  1VYT A;  1UFF A;  3IQL A;  4D8D A;  3RBB B;  1E7O A;  1UE9 A;  2ED1 A;  1AZG B;  2CH4 W;  1U3O A;  2EYX A;  1ABQ A;  3EHR A;  1IO6 A;  2EGC A;  2KGT A;  1W6X A;  2M51 A;  2KT1 A;  1B3Q A;  2PTK A;  2O88 A;  1OV3 A;  2EW3 A;  2KR3 A;  1TG0 A;  4AG1 C;  1NYG A;  2AKK A;  1YN8 A;  2SRC A;  2JMC A;  2RQW A;  1KFZ A;  1WXU A;  2LJ3 A;  2CSI A;  2O31 A;  2OJ2 A;  2HSP A;  2RQT A;  2DX1 A;  1G83 A;  1VYV A;  5GJW B;  1FYN A;  1AWW A;  2DBM A;  2KRS A;  1T0J A;  2LQN A;  4RTV A;  2EPD A;  1NLP C;  2LP5 A;  4LUE A;  3ULR B;  4HVU A;  4D8K A;  4HVV A;  2CH4 A;  1M8M A;  1SSH A;  2ABL A;  2OI3 A;  1TUC A;  2CDT A;  2YDL A;  2JXB A;  2EYW A;  3VRZ A;  4HCK A;  1J3T A;  3I5S A;  1KIK A;  2ROT A;  1K4U S;  1AD5 A;  2AZS A;  1OPK A;  2CT3 A;  4ESR A;  2VVK A;  2EGA A;  2O9S A;  3ZL7 C;  4RTX A;  3O5Z A;  1ZUY A;  4RTY A;  2FEI A;  2HDA A;  1N5Z A;  4OMN A;  1NEB A;  1M30 A;  3NPF A;  3EG3 A;  1BB9 A;  1UHF A;  4RTZ A;  3UA7 A;  5EC7 A;  2J05 A;  1AWJ A;  2GNC A;  1UGV A;  2KRM A;  1K0X A;  5HCK A;  1SPK A;  4Z88 A;  4DEY A;  1UTI A;  3I35 A;  1PHT A;  4J9G A;  2A36 A;  1OOT A;  4X1V A;  3M0Q A;  4FSS A;  1NEG A;  2LNH B;  1A0N B;  1AEY A;  1SEM A;  1AOJ A;  2EKH A;  2HEQ A;  1I07 A;  2KYM A;  4EIK A;  1G2B A;  3LH5 A;  2FPF A;  1WA7 A;  2VWF A;  1V1C A;  5I11 A;  1I1J A;  2JW4 A;  2H8H A;  2YUP A;  2VKN A;  1QKW A;  2DL8 A;  1NG2 A;  1JU5 C;  2X3X D;  1NM7 A;  1T3L A;  1WDX A;  1UDL A;  2ED0 A;  3VRY A;  3M0R A;  4J9D A;  5IHN A;  1MV0 B;  4Y92 A;  1YWP A;  3TSW A;  4CC4 B;  2ESW A;  2IIM A;  1BK2 A;  3VS2 A;  2NWM A;  2KXC A;  2EGE A;  3JV3 A;  4F17 A;  4AFZ C;  2V1Q A;  2YUQ A;  2DL3 A;  4JJC A;  2EVR A;  5FWC A;  3UA6 A;  2NUZ A;  2DL4 A;  5IXB A;  3VS6 A;  1K9A A;  1KJW A;  2EYZ A;  1AVZ C;  1AWO A;  4RTW A;  1GL5 A;  1M3B A;  1K1Z A;  2GGR A;  2DYB A;  1CKB A;  2K2M A;  2A28 A;  2CUD A;  1X6B A;  4JZ4 A;  1NLO C;  1PWT A;  2CT4 A;  1WX6 A;  2A08 A;  2ECZ A;  1JO8 A;  1U5S A;  1W1F A;  1X6G A;  3M0P A;  2A37 A;  2PNI A;  1MV3 A;  1CKA A;  3EHQ A;  3TVT A;  4Z89 A;  1QWE A;  2O2O A;  2KNB B;  2MIO A;  3UF4 A;  2AKL A;  1UG1 A;  4AG2 C;  3NGP A;  5FW9 A;  3H0F A;  4OMM A;  2EBP A;  3A98 A;  4OMO A;  1ABO A;  1ZLM A;  1OEB A;  2PZ1 A;  2FPD A;  2W0Z A;  4JPB W;  4AFU C;  3TSZ A;  1ZBJ A;  1ZUK A;  1OPL A;  3VS0 A;  4A63 B;  2J6F A;  2X3W D;  4ZNX A;  1UEC A;  2DA9 A;  3U23 A;  2AZV A;  2FPE A;  4OMP A;  3REB B;  3M0U A;  2GQI A;  4F16 A;  4JJB A;  3FJ5 A;  3VS4 A;  4LN2 A;  4J9F A;  2DM1 A;  4CC7 A;  4KRT A;  1WFW A;  1PRM C;  1ZX6 A;  3EG1 A;  3I5R A;  2M0Y A;  3KFV A;  1YCS B;  2F2V A;  4RUG A;  2CSQ A;  2DVJ A;  2V1R A;  2RQR A;  2YUO A;  1WIE A;  2KXD A;  1RUW A;  2GBQ A;  3SEM A;  4WCI A;  1YWO A;  1K76 A;  2KRN A;  1SHF A;  1T0H A;  2L3P A;  1BBZ A;  2LJ0 A;  2YUN A;  4J9H A;  3PE0 A;  2I0N A;  4F14 A;  5GJV B;  2LMJ A;  2G6F X;  4QT7 A;  4AFS C;  2BZX A;  1T3S A;  2DLP A;  3EG0 A;  1K0S A;  2BZY A;  2HCK A;  3R6N A;  3C0C A;  2DRM A;  1NYF A;  1QLY A;  1GRI A;  1X2K A;  4GBQ A;  2L3S A;  1Z9Q A;  3GBQ A;  1FMK A;  1U06 A;  1GFD A;  1X69 A;  1UJY A;  1JXM A;  2XMF A;  1SRM A;  1X27 A;  2KT8 A;  2CRE A;  1WLP B;  2C0I A;  3REA B;  5L23 A;  1VA7 A;  1ZSG A;  2O9V A;  2EQI A;  2B86 A;  2FRY A;  1M3A A;  2K7A A;  2C0T A;  2D8H A;  2C0O A;  1MUZ A;  4CC2 A;  1GCQ A;  1PKS A;  2JT4 A;  1PRL C;  2L0A A;  2D0N A;  2SEM A;  2EYY A;  4CC3 A;  2KEA A;  1E6H A;  2LQW A;  3NMZ C;  2KYB A;  1WXT A;  3VS3 A;  1H8K A;  4J9E A;  4OMQ A;  3VS5 A;  4LE9 A;  1UHC A;  1XOV A;  1E6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...