1I1JA

Structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
b'GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MELANOMA DERIVED GROWTH REGULATORY PROTEIN
publication title Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i1jA00
4J9FA 2RN8A 2L3QA 2DRKA 2ED0A 1WLPB 1V1CA 1SHFA 1N5ZA 4JJDA 4CC2A 1X2KA 2EYYA 3I5RA 1ABOA 3O5ZA 1H92A 1K1ZA 2CH4A 1AD5A 1E6HA 1NG2A 2ROLA 1W1FA 2AKKA 3QWYA 1PKTA 1XOVA 1QCFA 3RBBB 1U06A 2KRSA 3VRYA 2V1RA 2YDLA 1OPKA 4JZ3A 4CC7A 1JU5C 1YWOA 1VYVA 5IHKA 1UUEA 2BZXA 2PTKA 2EKHA 1K0XA 5I11A 2KRMA 3TSZA 2SRCA 2CH4W 1J3TA 2DBMA 2A28A 2L3PA 2LQWA 4OMMA 4M4ZA 1MV3A 1WA7A 2JMAA 1M27C 1PWTA 3M0PA 2JTEA 1S1NA 3C0CA 4OMPA 2DL5A 2GNCA 1RLPC 1JXOA 2RPNA 3CQTA 3EGUA 1HJDA 2EYXA 1ARKA 2KYMA 2LP5A 2DRMA 3M0RA 2O9VA 2JW4A 1KSWA 4RTXA 2CUBA 3EG2A 3VS6A 1FMKA 1B07A 3VS3A 2RQVA 3FJ5A 1ZUKA 2RQWA 1UECA 1W70A 1I0CA 3H0FA 1PRMC 4IIMA 2EPDA 2YUPA 1ZUYA 3NGPA 1UHCA 2GBQA 4GLMA 1JO8A 2DBKA 4OMLA 4ESRA 2DL8A 1BK2A 1NYGA 1HSQA 2X3WD 5FWBA 2LZ6B 1KJWA 1SHGA 4J9EA 2DF6A 2VVKA 4J9GA 1OEBA 1UG1A 4HXJA 1U5SA 2HBWA 2KT1A 3KFVA 1EFNA 2ROTA 2FO0A 2MIOA 2W10A 2DM1A 1WI7A 1SPKA 1CKAA 5IHNA 4D8DA 1AZGB 4JJBA 3VS1A 1UGVA 2M0YA 1I07A 2RNAA 2EW3A 2I0NA 1OV3A 2EBPA 3ULRB 3QWXX 4RTTA 1JEGA 1UJYA 4RTWA 1GRIA 2L0AA 4LUEA 3IQLA 1WYXA 1VA7A 2CT3A 2K6DA 2KXCA 2K2MA 2H8HA 2EYZA 4R0KA 2OI3A 3I9QA 1AWWA 4CC3A 2O31A 1T3LA 2KGTA 2LQNA 1RI9A 1K0SA 4ORZA 3U23A 4AFUC 2AZVA 1KIKA 3GBQA 2VKNA 1ABQA 2DJQA 3UA7A 3M0SA 5GJWB 1X6BA 1YWPA 3R6NA 4D8KA 1QKWA 3NHNA 2AK5A 2P4RA 2F2XA 1NLPC 2J6OA 1YCSB 2FRWA 2V1QA 5FW9A 1A0NB 1LCKA 2LCSA 1HD3A 2D1XA 1X2QA 2KROA 1WFWA 4WCIA 4ZNXA 2A08A 4FSSA 5IH2A 1E7OA 1YP5A 2GGRA 4J9CA 2KRNA 2CDTA 2J7IA 1GBRA 2RQUA 3SHWA 3H41A 5GJVB 5EC7A 3EG0A 5IXFA 1FYNA 4HCKA 4JZ4A 1PNJA 2G6FX 2LX7A 2BTTA 5HCKA 2MCNA 4DEXA 4AG2C 1NLOC 3ZL7C 2L3SA 1SRLA 1Y0MA 3VS0A 2DL7A 4HVWA 5IXBA 1UHFA 1AOJA 4A63B 2FRYA 2FEIA 1QLYA 2FPDA 2FG0A 3TVTA 2DL4A 2NUZA 1WXTA 2YUQA 3EHQA 4RUGA 2AKLA 2EGCA 1AVZC 1NYFA 2CSIA 2DNUA 2LJ3A 2FPFA 3M0UA 1GCPA 2DYBA 1UE9A 2JT4A 1BU1A 1K4US 1QWEA 2K3BA 2KEAA 2NWMA 2RQRA 3EHRA 5L23A 3LH5A 1SEMA 3UATA 2CSQA 2M51A 3TSWA 2YT6A 2O9SA 4OMOA 3M0QA 1AWXA 3RNJA 1K9AA 2D8JA 3VS7A 1OOTA 4RTYA 2HCKA 2GQIA 4QT7A 5I22A 4LUDA 1GFCA 1GFDA 1T0HA 1IO6A 2C0IA 2HSPA 3EG3A 3UF4A 4HVUA 2BZ8A 1T3SA 4J9BA 1YN8A 1MV0B 2EYWA 2OAWA 1PRLC 1MUZA 2YUNA 2DVJA 3THKA 2KXDA 4RTZA 1NEBA 2CT4A 2DMOA 1WX6A 2LNHB 2O2OA 2KNBB 1GBQA 1OPLA 1TUCA 1UDLA 2DE0X 4OMNA 3REBB 2ECZA 1BBZA 2MOXA 2W0ZA 4J9HA 3VS4A 2JM8A 2DX1A 1GL5A 2PZ1A 1VYTA 2HDAA 4JJCA 5ECAA 1AZEA 4Y92A 2J6FA 1ZBJA 2CUDA 1GCQC 2A37A 1M3CA 1B3QA 1RUWA 2ENMA 1RLQC 1E6GA 1NM7A 2EGAA 2JXBA 2VWFA 3I35A 1CSKA 2J06A 4Z88A 3NMZC 4K11A 1X6GA 2IIMA 2KYBA 3VS5A 2DL3A 3H0HA 2RQTA 2K7AA 1G2BA 2OJ2A 1PHTA 4Z89A 1Z9ZA 1Y57A 2EGEA 2C0TA 2ESWA 2DILA 4EIKA 4GBQA 2YUOA 1GCQA 2K79A 3PE0A 1I1JA 4RTUA 3EG1A 2JS2A 2F2WA 4CC4B 2CREA 2AZSA 3H0IA 1BB9A 2HEQA 1ZX6A 1WXBA 1ZUUA 2E5KA 2QDLA 3A98A 1KFZA 2GTJA 2YSQA 2GTOA 1WIEA 1T0JA 1H8KA 1U3OA 3JV3A 1TG0A 3PVQA 4HVVA 3I5SA 4J9IA 2KBTA 4F16A 1M3BA 2K9GA 2SEMA 5IHIA 2ED1A 3M0TA 2LJ0A 4LN2A 3VRZA 1QKXA 2DA9A 1UFFA 1JXMA 3PVLA 2FPEA 1Z9QA 4KRTA 2KR3A 4LE9A 1SRMA 2PNIA 3REAB 5FWCA 4LNPA 1QWFA 1M30A 2C0OA 4J9DA 2JMCA 2D0NA 1X43A 1AWJA 4F17A 2O88A 4JPBW 1AWOA 1UTIA 1M3AA 2ABLA 1K76A 1CKBA 1ZSGA 2RF0A 1TUDA 4DEYA 2JS0A 3UA6A 1VYUA 2D8HA 2L2PA 2LJ1A 2A36A 1WXUA 1ZLMA 2XMFA 4AFQC 1AEYA 2J05A 2EVRA 2DLPA 3VS2A 1UJ0A 2KE9A 4IIOA 4E6RA 3SEMA 2F2VA 1X27A 1X69A 3NPFA 4RTVA 2JM9A 2J6KA 1NEGA 4AFSC 2X3XD 1JQQA 4OMQA 4X1VA 1YNZA 4AFZC 1WDXA 2KT8A 2EQIA 4AG1C 4Z8AA 2RMOA 4F14A 1G83A 1M8MA 2B86A 1PKSA 2BZYA 1H3HA 1SSHA 1W6XA 2LMJA
chains in the Genus database with same CATH superfamily
2P84A 4J9FA 4L6V5 4ZGEB 2L3QA 2AIRB 4M77G 1V1CA 3GP8A 3JCMX 1X2KA 2EYYA 3I5RA 1ABOA 3O5ZA 1YJNQ 1VQ9A 4J6WA 3VKIA 2C06A 2JTMA 1AD5A 1NE8A 2KK4A 4PFOA 2HAXA 4M78G 1PKTA 2RHYA 1M1GA 3RDVA 1VQ4A 1U06A 2KRSA 1Y96B 2V1RA 2YDLA 1JU5C 4E7IA 1JB0E 2R58A 1G3SA 1Q81R 2FL7A 2PVOB 2DXUA 3TSZA 2SRCA 2JTFA 1F1BB 1J3TA 2PUOB 4C5GA 2A28A 2L3PA 2LQWA 1YI2Q 1D3BA 1MV3A 1W4SA 2RJFA 2E70A 1JJ2A 1S72Q 3SB2A 1NPPA 2GNCA 2QXFA 3VUBA 4B9WA 4MMLA 1VQMQ 3EGUA 1HJDA 2E5QA 5FLXE 2LP5A 2DEQA 4M75C 4DBFA 5FU7C 3GNFB 2JW4A 4XTUA 3EG2A 3C4SA 3CPWS 4NOYA 2RQVA 3E1SA 1M1FA 1W70A 4GLMA 2DBKA 2QA4A 2DL8A 3OW2A 1OYXA 1KQ1A 5GAOr 1KJWA 4J9EA 1OX8A 3BFMA 1D0XA 2BIVA 3X25B 5CQXA 1O9SA 2E1HA 2F1LA 5CIUA 1R8OB 3KFVA 5HK0A 2FO0A 2MIOA 4QQGA 4HCZA 1AZGB 1UEBA 2E3IA 4C5HA 2RNAA 2EQKA 2EW3A 3GLXA 2I0NA 2VGNA 3NTKA 4ZTJA 4C8QC 1YJWT 3G4SQ 1U1SA 4UC4A 4BUGA 4C92D 4RTWA 1RL2A 1WYXA 4KUDK 3CBOA 5IN1A 1Q82C 2CT3A 3GOXA 3DB4A 3MHXA 3QO3A 2KSSA 3I56A 2D9TA 1LVKA 2HQXA 4LDVA 2QAZA 1RAIB 1T3LA 3CMEQ 3GF5A 4M7DC 1PD1A 2M16A 1KIKA 3UA7A 4JRKA 2YLCA 1B7TA 1X6BA 1YWPA 3S3OA 2E4HA 4DBHA 2X4WA 2P4RA 4FT2A 3CCQQ 2D1XA 2QK0A 2KROA 1TUGB 2XI9A 5I2MA 4FSSA 3M4YA 5IH2A 5LJ3e 2V26A 3RKYA 3CCMT 2CDTA 2DVEA 1G5VA 1GBRA 3HP9A 3QUIA 3SHWA 3H41A 5GJVB 2JVVA 3QZ5B 2BUDA 3L2ZA 4MDXA 4ELZC 5J26A 1RI0A 4JZ4A 2LX7A 2OTLQ 5HCKA 3CXCA 3NFCA 1YJWA 1M90R 2OX7A 5KYUB 2DPPB 1Q82U 5HY6A 1W2BP 2I2LA 3FB9A 4OB3B 3JCMW 1ZA1B 2DFUA 2DL7A 1IHVA 2LTOA 1WQWA 1VQ9Q 1N27A 1AOJA 4A63B 2KDSA 2FEIA 3QYGB 1RAFB 2FG0A 3QJ6A 4EPCA 4M77D 2EYQA 2DZ9A 1TXQA 3HRSA 2MK5A 2HNIA 1AVZC 4FYWB 1VQ4Q 2CZ0B 2DERA 2KI7A 2H3JA 2IG0A 3L2UA 2FPFA 1D3BB 3CCET 1UE9A 2JT4A 1K4US 4M78D 5LJ3j 5CKDA 3CCRT 5L23A 4PJOE 1SEMA 3UATA 3E19A 3TSWA 1QP3A 2O9SA 4OMOA 1C1AA 1YIJT 2RD1A 3LYIA 4HCBA 5GMKe 2GQIA 4QT7A 1T0HA 1C6VX 3PMTA 2DK3A 3EG3A 4WTOB 4FYYB 5A0LA 3QPHA 2XD0A 1T3SA 4HT9A 3HFOA 2YUNA 4XU3A 4RTZA 1YHQT 4XTYA 1NEBA 2HKQB 3JCMg 2KNBB 4DBRA 3M53A 1OPLA 2KMTA 3OYIA 1TUCA 1UDLA 2K4YA 2QA4Q 3BDUA 2MOXA 3LW5E 1JRIA 1BKBA 4MZMA 2CP3A 4HT8A 1I5LA 2R5MA 2J6FA 5GAOm 2KY9A 2RM4A 2A37A 2CP2A 3SFMA 1KQSP 1B3QA 2MMPA 1RLQC 1WHJA 3CC2T 3NTHA 1CSKA 2J06A 1VQ6A 1VQOT 3VS5A 3H0HA 1HK9A 2YRCA 2OJ2A 3CCEA 3QBYA 1Z9ZA 5GMKj 5KYWA 1Y57A 2C0TA 2ESWA 2E10A 5D6WA 1Y71A 2YUOA 1GCQA 3OB9A 1FXXA 3OYCA 3PE0A 4PJOB 2RJDA 2JS2A 3H0IA 1VQLT 1BB9A 1ZX6A 3I56Q 4M75G 7AT1B 5CKBA 3QKJA 1Y7XA 3NTIA 1BI1A 4J6XA 1LPLA 3A98A 4JRPA 3PIPA 2YSQA 3G6ET 2EKOA 2K5FA 3SDZA 1TG0A 3PVQA 4HVVA 3UWNA 5GAOl 3MP1A 5FU6C 3SWNA 2K9GA 2ED1A 1ZSZA 1QKXA 3EAEA 2FPEA 4KUIA 3OYHA 3EFRA 1SRMA 3QYHB 1TSFA 2HBPA 4J9DA 4VUBA 4AT1B 4BE0A 2HL3A 4JPBW 4C8QG 4XTZA 1OULA 2CKKA 2Y90A 1QCOA 1CKBA 2L5QA 1ZSGA 2RF0A 4GY5A 4BY6B 3UA6A 1WXUA 1FMVA 5GAN2 1AEYA 2J05A 2EVRA 2DLPA 2X51A 3OMGA 2HL5C 2RA2A 1W2BA 4IIOA 4PJOF 2DO3A 1O75A 1VQLA 3KBGA 2J6KA 4L59A 5D6YA 4M7DG 1KC8R 5GAN7 4AFZC 3URGA 2RJCA 4Z02A 4AG1C 3HRTA 4F04B 1G83A 4FU6A 4F7UE 5LJ3h 1R77A 1HYOA 5GAN4 2VASA 1Q82R 2LMJA 4XU1A 5CK9A 1IXDA 1WLPB 5EG2A 1YBYA 1SHFA 3KXTA 4AMCA 3OYDA 3S3MA 2X4XA 5D7UA 2CH4A 2CGHA 9ATCB 1GXIE 3QWYA 3QZ9B 1QCFA 5GANg 2DJZA 4C0FA 4E7HA 5KE3A 2H3EB 1OPKA 2XHCA 2XDBA 3L42A 1VUBA 1U1TA 5IHKA 1AHJB 2PTKA 1K0XA 3RMSA 5I11A 3N5BB 2WSFE 4PFPA 2DBMA 1WHKA 4J6YA 1QVGS 3CCUA 5LJ3f 1VQNQ 5LJ3d 4ZGDB 1M27C 2JTEA 1KQSA 3ASKA 2XIDA 1JXOA 3L2VA 1YITA 5KYWB 2EYXA 4QVZA 1IGQA 1VQ6Q 2KYMA 4Y28E 3M0RA 5C0MA 4M7AC 1Q86C 3VS6A 2CP6A 3RESA 1AT1B 2LVMA 3I55T 2E3HA 2ATCB 1I0CA 4F7UB 3OYYA 2EPDA 2QI2A 1ZUYA 2GBQA 4EMKB 2WACA 2OTLT 4D6WA 1MMNA 3V7CA 3V7SA 2YLBA 1Q7YC 2X3WD 3QIIA 1SHGA 1QP2A 2DF6A 2VVKA 2LRQA 5DLOA 1N9SA 5A2QE 1MMGA 2HBWA 1WHMA 3CC4T 3SWNB 4PJMA 1MGQA 3ER0A 4KH1B 3A8MB 1ZBXA 4C5IA 1TH7A 2W10A 4M75D 2DM1A 2MAMA 3QJYA 4JJBA 5KYYA 4C92A 3VS1A 3FLGA 3OYMA 4XAXB 3ULRB 3QWXX 1JEGA 2AT1B 1G8XA 2L0AA 4LUEA 3IQLA 3EG9A 4PJLA 2QQSA 2K6DA 1TS9A 5D6XA 2K2MA 2H8HA 2EYZA 1UGQB 3LWIA 4FT4A 3OW2S 1YJ9A 8ATCB 1VQ7A 2K3YA 3CXCP 4R56A 4CC3A 5A0DA 3VUZA 2O31A 1OQKA 1RI9A 3MEUA 1IZ6A 2P4TA 1Q86U 4PLLA 3U23A 2AZVA 3LLRA 3GBQA 1X6OA 1ABQA 2DJQA 3M0SA 5GJWB 2EQUA 3OY9A 1NBEB 5KYUA 3NHNA 3M4GA 2X4YA 4C8QD 2F2XA 2J6OA 4BI4A 3A8HB 1YCSB 5KYXB 1LCKA 3M59A 3HPWA 1Q7YU 1X2QA 1WFWA 2L8DA 3Q1JA 1NPRA 2A08A 3WVDB 2HSEB 3MO8A 3X24B 1YP5A 3CCVA 2KRNA 3ZEHA 1M1KU 2LT4A 3CMAT 4XTVA 3OA6A 4M7DD 3EG0A 1FYNA 1ZA2B 3CCST 1PNJA 3UDCA 1ZSZC 4JS4A 3EH2A 2COZA 2ZPBB 3RUXA 2MCNA 3MKDA 2RHUA 1VQ8A 1WJRA 1PC0A 2QGGA 4MZPA 1SRLA 1Y0MA 4C92E 3RIRA 4OVAA 2CYZB 2LNVA 2P0QA 2DL4A 4FIBA 2NUZA 1WXTA 2YUQA 2V8KA 3EHQA 3JB9J 4KGVB 1G3TA 1QVFP 3CCJT 2LJ3A 3M0UA 2JNGA 1GCPA 1BU1A 1QWEA 2KEAA 2NWMA 2YWWA 3FDRA 4LD6A 2K2VA 1PD0A 2LT1A 2ZZDA 2M51A 2YT6A 1PM3A 3CCUQ 1KC8C 5DM7R 1RABB 5KE2A 3RNJA 1OOTA 4XU2A 3ME9A 4PNOA 4LUDA 2RI5A 1YITQ 2R5AA 3VYHB 4J9BA 1YN8A 1MUZA 2DVJA 4J7IA 2CT4A 1WX6A 3OS1A 2O2OA 1KQ2A 5FROA 1N6AA 3QXEB 4PJOA 2M02A 1Y07A 1EZZB 3M58A 2ECZA 3MPUB 3HKSA 2XK0A 3JCMP 1GL5A 1MMAA 2PZ1A 2CP7A 5ECAA 1AZEA 5KYYB 4C92B 2G3RA 1ZBJA 4IUPA 2NUTB 1I8FA 2EFIA 4E7SA 2HZYA 1PSFA 2EGAA 3CCLT 4PFZA 2P0PA 4K11A 3OYGA 2PVDB 4O5VA 4PK4A 1KHCA 3EG9B 4M77E 2K7AA 1QVPA 1G2BA 1PHTA 4Z89A 1XQHA 4LDWA 1I5OB 1X75C 3G71T 1PG5B 2K79A 3V7RA 1I1JA 2BE7D 4M78E 1KC8U 2F2WA 2CREA 2AZSA 2NUPB 2LX9A 1YJ9Q 3J7AF 1VQ7Q 1IHWA 1IREB 1WXBA 1JJ2S 4M7AG 3LX7A 4LDYA 4J5YA 4BE1A 1TWBA 2E5KA 2HD0A 5GAN3 3JB9I 1WIEA 1VQ5T 1T0JA 3RMQA 2QQBA 2RO0A 4F16A 1M3BA 2K3XA 3VRZA 2EAYA 1YCYA 2X4JA 2XU8A 5J3BA 4OB2B 1UFFA 3L1AA 3A5ZB 3DLLA 4N4GA 4LE9A 3CC7T 3D7SB 3CCVQ 1WHLA 2PNIA 3REAB 4R55A 3L2WA 5FWCA 3TREA 1VQNT 4C92F 4LNPA 3PNWC 1M30A 1OZ2A 3JB9G 2JMCA 2D0NA 1OU9A 1Q86R 3CD6T 1UTIA 1M3AA 2E41A 4M77B 4DEYA 1BI2A 3O8VA 2L2PA 1ZLMA 3CCMA 3FIFA 2DZCA 2YRVA 3PTAA 4NL3A 6AT1B 1UJ0A 2KE9A 1Q7YR 2CZ6B 1VQ8Q 1M5Q1 4E6RA 4M78B 2BE9B 4E2FB 5GAMg 2RHIA 1VQKT 2V8IA 1X27A 5CCAA 4OF1A 3HHTB 1VQPT 2X3XD 1WHGA 2KQWA 1JQQA 1M1KR 2V8JA 5C6SA 2HKNA 4Q5WA 4OMQA 2COYA 4Y91A 4X1VA 2OTJT 4XU0A 2KT8A 1QVFA 2RHXA 4FYXB 4F14A 5L8RE 1PKSA 4XTXA 2K5LA 2GFUA 2RI3A 4LDXA 2ED0A 2ZCFB 1W2BS 4JJDA 5GMKm 3CCRA 4RMOA 2PU9B 1KK7A 2MWPA 2QEXT 3CD6A 1W1FA 2WSEE 2AKKA 2F5KA 1YIJA 4F7UA 4CI0C 2OAUA 4M77F 4CC7A 1YWOA 4EMKA 1IB8A 1VYVA 1UUEA 4E7JA 2CS7A 2EKHA 1RAHB 1XNIA 2KRMA 1YJNT 2CH4W 3HL8A 3OYBA 1YHQA 4OMMA 3GIBA 3UT1A 4M78F 3OBWA 1K8AC 2RI2A 1VQPA 1PWTA 2ZPIB 4C0DB 1B34B 3M0PA 4M7AE 1RLPC 3CQTA 1ARKA 1I81A 3META 3OSVA 3M56A 4KT0E 4KBMB 4ELYC 3A8LB 2EJFA 4ME7A 2CUBA 1FMKA 4NS5A 1B07A 4TVRA 4OGEA 3FJ5A 1YI2T 4IKFA 1ZUKA 5GAN8 5GMKl 1PRMC 4C0ZA 1ACMB 2QQRA 4IIMA 3CC2A 3S3NA 1S72T 1FMWA 3FJPA 1JO8A 2MI6A 4OMLA 1VQMT 2KAFA 3J81E 2GQVA 3LGLA 1VQOA 4FSXA 3C12A 2YHTA 5FWBA 2LZ6B 2PUKB 5KYNA 4J9GA 4E7KA 3QDRB 4BD3A 1YJWQ 2LCLA 3VU3C 5I2SA 3HFNA 2ROTA 1SPKA 4M7AD 2D0QB 1CKAA 5IHNA 4D8DA 1M2VB 4XQ3A 2M0YA 3OMCA 4B9XA 1I07A 2LQKA 4JJNK 4PJOC 1UGSB 3VYGA 3LGFA 1OV3A 3RERA 2EBPA 2DXTA 4RTTA 3EGDB 1UJYA 5KYXA 4FYVB 3A1PA 3G6EA 1FWZA 3RKWA 1K8AU 1V76A 4J8OA 3I9QA 2DYIA 1AWWA 2VXEA 2KGTA 1TOVA 4C8QA 3G4ST 1OU8A 4ORZA 2FZCB 4X34A 3E9GA 4AFUC 3TU4K 4ZGJB 3CCMQ 2CP0A 3P8HA 3R6NA 5CKHA 4D8KA 3WXMB 1HXDA 1BYMA 2V1QA 3FEOA 4YTLA 4A4HA 2LCSA 1HD3A 4WCIA 2MYSA 5LJ3g 2QDYB 3CMET 3PT9A 1M8VA 2GGRA 4J9CA 2J7IA 2FZKB 2RQUA 2L3RA 4BY6C 1I4K1 3OS2A 4A4KA 4JLGA 4JRIA 5IXFA 3CCQT 2GCXA 4M75E 2EQMA 2G6FX 4MDWA 2BTTA 3TQ7P 2E12A 1RAEB 4IUVA 4DEXA 2CZ7B 3CCEQ 3ZL7C 2L3SA 3DKMA 4MZTA 5HKCA 3GNGA 2HQHA 1KD1C 2DD4A 2NYSA 3VS0A 4V2SA 5IXBA 5GMKh 3LH0A 2FRYA 1QLYA 1IRXA 4HKEA 2M1HA 3OYLA 2DD5A 3MEAA 4EDUA 1YIJQ 2AKLA 2EGCA 1NYFA 4JS5A 4QKUA 2CSIA 2DNUA 3QHSA 4GLKA 2EWNA 2K3BA 2VV5A 3JCMV 3OSSC 1VOMA 1M1KC 1VQ9T 2QTVA 2EIFA 3JCMQ 2CSQA 1YHQQ 2XDPA 4C8QE 1AWXA 2NUTA 2D8JA 3VS7A 4LDUA 1VQ4T 1GFCA 2VGMA 4JUVA 1IO6A 4QQ6A 1OX9A 3UF4A 1PSEA 3RR6A 2BZ8A 5LJ5g 3CPWP 1Q95G 1MV0B 1VIEA 3OYEA 2MF2A 3THKA 4HA8A 2KXDA 3MP8A 2DMOA 2QTXA 5GAMe 4M75B 5FU7B 3CC2Q 3JCMe 4JRQA 4M7DE 2M0OA 1K73C 3V8KA 1VQOQ 3HRUA 3REBB 3VS4A 2NUPA 3MEVA 3V8JA 4JJCA 1KD1U 4Y92A 3I55A 2CUDA 1GCQC 1RUWA 2ENMA 1E6GA 1D1CA 2VWFA 4F7UF 1QVGA 2OTLA 4Z88A 2HQEA 3NMZC 2KYBA 1VQLQ 2QA4T 4BACA 3MJXA 4RKUE 1V29B 4LXCA 1PCXA 1C0MA 4EMKC 2RK2A 2EGEA 3CC4A 5CAIA 3CEYA 1MMDA 4ANJA 2A0FB 3X28B 3G6EQ 3E9FA 4RTUA 3C95A 4CC4B 4C8QB 4WF2A 3QDFA 2FVUA 3SWNC 1WNLA 3L2QA 2E65A 3OYJA 5GAMj 3R6OA 3PIOA 3EFOB 4DA4A 3VJPA 1RAGB 2QDLA 4M77A 1KFZA 2Y4YA 1M9SA 2GTJA 4J83A 2GTOA 2F5TX 2QQ9A 4IURA 1R0BG 1H8KA 1DJ7B 1SG5A 3JV3A 4M7DB 4M75F 2LQ8A 2DEUA 1K73U 2KBTA 3I56T 4BI8B 5IHIA 4RG2A 2B8AA 4M78A 1WJQA 4QVCA 2DA9A 2R57A 1JXMA 2KVQG 4II1A 4E7LA 4PL6A 1K8AR 3CBPA 1LNXA 1K9MC 4KRTA 5CQYA 3AT1B 2E6ZA 3JCMb 2PQWA 5GAOn 1QWFA 2P0KA 4BDYA 4A4GA 3EFSA 3BW1A 4P5NA 4PJOG 1AWJA 3CXCS 4OMFB 4F17A 1BIBA 2CZ1B 3JB9F 2ABLA 1K76A 1WQ7A 1TUDA 2JS0A 2A36A 3RKXA 2XMFA 4AFQC 2RJEA 4KH0B 2E64A 5GAN5 2JUFA 3CMAA 3VS2A 1XTDA 1NZ9A 1EX4A 5GAOq 3BDLA 2F2VA 1X69A 3NPFA 4RTVA 3CCSA 4C8QF 4N0AA 4RG8A 4IUTA 5CKEA 3JSCA 1N8RR 4QW2A 4C5EA 4Z8AA 1TU0B 1D0ZA 3INZA 3JCMJ 2XDDA 1H3HA 5DY9A 1M4ZA 3EGXB 1G3WA 1SSHA 4M7DF 1K9MU 1QW1A 1LJOA 3CCJA 2RN8A 2DRKA 1B34A 3MP6A 3C94A 1N5ZA 4CC2A 3OYKA 2VUBA 1H92A 3P8BB 1K1ZA 3CPWA 2K5IA 1E6HA 1NG2A 4X9CA 1WPYA 2ROLA 1H641 3PGGA 2GF7A 1XOVA 4OGCA 3RBBB 5CO7A 3VRYA 4JZ3A 5GANe 3OQ5A 1QVFS 3M57A 1IGUA 2EJ9A 2BZXA 5GMKi 4L5GA 4A53A 4X9DA 3LWHA 2FYKA 4M4ZA 4BB7A 2RHZA 1WA7A 2JMAA 3I55Q 2JOYA 3E2UA 4FW1A 2RB6A 4C0GA 1H3ZA 3P8DA 1S1NA 1D0YA 3C0CA 4OMPA 2DL5A 4N4IA 5GAN6 2RPNA 3JAME 1LOJA 2DRMA 1M2VA 1SSFA 2O9VA 1KSWA 4RTXA 2K57A 2E6NA 3VS3A 3DB3A 3CC4Q 2RQWA 1SKUB 1UECA 3EGDA 3H0FA 3CCLA 2YUPA 3PMIA 3NGPA 1BI3A 1UHCA 1D09B 4C92C 4ESRA 4QQDA 5GAOp 1VQ6T 1BK2A 1NYGA 1HSQA 2DXCA 1KD1R 1NJIC 1OZ3A 4M7AA 1WGSA 2HMAA 3JRZA 1JBMA 1OEBA 1UG1A 4HXJA 5GAMh 5CR2A 3OBYA 1U5SA 2FZGB 5GANj 2KT1A 3G71A 3HSBA 3JCMh 2DIGA 4ZTFA 1EFNA 1WI7A 2DKGA 4B6MA 1BCMA 5CKFA 2AHJB 1UGVA 5KH6A 2ZPFB 2EQJA 2QGFB 3TEEA 3M9QA 2YRDA 2NLUA 3M54A 2VYTA 1QQJA 1U8RA 2MWOA 4XTWA 1GRIA 4DOWA 1VA7A 3A8OB 2DETA 5LJ5e 5FU6B 2KXCA 1VQ5A 3ZFJA 4BDZA 5CVIA 4R0KA 5I21A 3F70A 2OI3A 2EJGA 3J80E 4OB1B 4F7UG 1TTHB 1MNDA 2QQAA 3MCAB 2LQNA 1RADB 1K0SA 5GAMf 2DIQA 5GAMd 3JCMf 3CC7A 2VKNA 3JCMd 1YFNA 4PJOD 1VQNA 1K73R 3CMAQ 1QKWA 5FRNA 2AK5A 2ZPGB 4A4FA 4PJJA 1NLPC 1BI0A 1P92A 1Q81C 2FRWA 5FW9A 1A0NB 1UB4A 1OI1A 3CCSQ 1NJIU 3CBMA 4ZNXA 3OYFA 2X35A 2FB7A 2M9UA 4PKCC 1E7OA 4RCBA 5A0GA 4M77C 1VQKA 4FCYA 4PJNA 3S6WA 1BIAA 5EC7A 5LJ5j 4JLIA 4HCKA 4JDSA 5HK3A 4EMHA 5IT9E 3KUFA 2QYZA 4M78C 3A8GB 3G1JA 2OTJA 4AG2C 2O01E 3CCJQ 2DTHA 1NLOC 2LCCA 2QG9B 1D1BA 4FL6A 4E7ZA 2YXYA 4HVWA 2LC4A 1UHFA 4IUUA 2Z0WA 4ATOA 2FPDA 3TVTA 2LDMA 2MPXC 2BKDN 1N9RA 1QCNA 4PLIA 2WSCE 4RUGA 4BE2A 2ZPEB 3SD4A 5KCHA 1SF9A 4M75A 3T9NA 2JZ2A 2QASA 2DYBA 3G7ZA 1UGRB 2RQRA 4ZN1A 3EHRA 1QVGP 3LH5A 1KQSS 1Q81U 2QEXA 4ZN3A 5LL6S 1KHIA 1K9MR 3HTRA 3OYNA 2XICA 3M0QA 1WZOA 4N0AC 1N8RC 1K9AA 3AHUA 4RTYA 2HCKA 5I22A 5AYFA 1GFDA 4E47A 2C0IA 2HSPA 4HVUA 4QVDA 2CP5A 4DOVA 2O4XA 2Y4XA 4MMKA 1ZQ1A 4O6JA 4KGZB 2EYWA 2OAWA 3FC3A 1YJNA 3H9NA 4XK8E 1PRLC 2F69A 3H8ZA 1G3YA 4J7FA 3X20B 3CCUT 2LNHB 2XKOC 1GBQA 3BY7A 3CCLQ 4M7AB 3M55A 3H6ZA 3QG1A 2DE0X 4OMNA 3M5AA 1YITT 1BBZA 4J9HA 2W0ZA 2JM8A 4N4HA 4C0DC 3OS0A 2DX1A 2DTOA 3OYAA 1VYTA 2HDAA 3JB9D 1Y96A 1YI2A 1XJWB 3EFOA 5KCOA 2X9HA 2D6FA 3G71Q 1JJ2P 4A4EA 1M3CA 2VXFA 2DAQA 2A3LA 2ZPHB 1NM7A 4CRIA 1S72A 5GANh 4FM4B 2JXBA 2ZGWA 2JN0A 5J39A 3I35A 1VQMA 1X6GA 2IIMA 2DL3A 2RQTA 3JCMc 4EMGA 4M7DA 2GFAA 1R0CB 2ZAEA 2DILA 4EIKA 4GBQA 3X26B 1VIFA 1M90C 4A54A 3EG1A 1VQ5Q 3OW2P 1KG1A 3L2RA 1N8RU 3V8LA 3CPFA 2HEQA 3EH1A 4OP0A 3DLMA 3JB9H 1D1AA 4NL2A 4BI3A 3FRNA 2XG8D 1ZHIA 1ZUUA 2DXBA 2RK1A 3CC7Q 4LD9K 5GANf 5FRMA 3CCRQ 5GANd 1U3OA 4C92G 3VV0A 5DLQE 2A7YA 1UGPB 1YJ9T 3I5SA 2JJ9A 1VQ7T 4J9IA 3GPLA 2SEMA 4M7AF 2VC8A 3M0TA 2LJ0A 4LN2A 3CD6Q 3G4SA 3UPUA 3PVLA 1BCOA 4RCCA 1Z9QA 5AT1B 2KR3A 4DBQA 4OB0B 1FX7A 2C0OA 1MHNA 1VQKQ 3BE3A 2DTIA 1X43A 2L89A 2O88A 3WVEB 1AWOA 1VQPQ 2COWA 4IUQA 3CMEA 3MEWA 5LJ5h 2RH2A 1VYUA 2D8HA 3ZBDA 2LJ1A 3EGXA 1MNEA 1WJSA 5M9OA 1RACB 3CCVT 2OTJQ 2FHDA 3TCJA 1M90U 1M2OA 1NJIR 1ZSZB 3SEMA 3CCQA 1EIFA 2JM9A 4HCCA 1QMCA 1NEGA 4AFSC 2PVGB 4FW2A 2VB6A 4KULA 4KGXB 1YNZA 8AT1B 1WDXA 3QSUA 2IVWA 2EQIA 1VQ8T 2RMOA 2IPOB 1M8MA 2B86A 2BZYA 3PFSA 1WHHA 2QEXQ 1RAAB 1X01A 1W6XA 5LJ5f 2O4XB 5IAYA 3OS5A 5LJ5d 4DQ2A
chains in the Genus database with same CATH topology
4J9FA 2RN8A 2L3QA 2DRKA 2ED0A 1WLPB 1V1CA 1SHFA 1N5ZA 4JJDA 4CC2A 1X2KA 2EYYA 3I5RA 1ABOA 3O5ZA 1H92A 1K1ZA 2CH4A 1AD5A 1E6HA 1NG2A 2ROLA 1W1FA 2AKKA 3QWYA 1PKTA 1XOVA 1QCFA 3RBBB 1U06A 2KRSA 3VRYA 2V1RA 2YDLA 1OPKA 4JZ3A 4CC7A 1JU5C 1YWOA 1VYVA 5IHKA 1UUEA 2BZXA 2PTKA 2EKHA 1K0XA 5I11A 2KRMA 3TSZA 2SRCA 2CH4W 1J3TA 2DBMA 2A28A 2L3PA 2LQWA 4OMMA 4M4ZA 1MV3A 1WA7A 2JMAA 1M27C 1PWTA 3M0PA 2JTEA 1S1NA 3C0CA 4OMPA 2DL5A 2GNCA 1RLPC 1JXOA 2RPNA 3CQTA 3EGUA 1HJDA 2EYXA 1ARKA 2KYMA 2LP5A 2DRMA 3M0RA 2O9VA 2JW4A 1KSWA 4RTXA 2CUBA 3EG2A 3VS6A 1FMKA 1B07A 3VS3A 2RQVA 3FJ5A 1ZUKA 2RQWA 1UECA 1W70A 1I0CA 3H0FA 1PRMC 4IIMA 2EPDA 2YUPA 1ZUYA 3NGPA 1UHCA 2GBQA 4GLMA 1JO8A 2DBKA 4OMLA 4ESRA 2DL8A 1BK2A 1NYGA 1HSQA 2X3WD 5FWBA 2LZ6B 1KJWA 1SHGA 4J9EA 2DF6A 2VVKA 4J9GA 1OEBA 1UG1A 4HXJA 1U5SA 2HBWA 2KT1A 3KFVA 1EFNA 2ROTA 2FO0A 2MIOA 2W10A 2DM1A 1WI7A 1SPKA 1CKAA 5IHNA 4D8DA 1AZGB 4JJBA 3VS1A 1UGVA 2M0YA 1I07A 2RNAA 2EW3A 2I0NA 1OV3A 2EBPA 3ULRB 3QWXX 4RTTA 1JEGA 1UJYA 4RTWA 1GRIA 2L0AA 4LUEA 3IQLA 1WYXA 1VA7A 2CT3A 2K6DA 2KXCA 2K2MA 2H8HA 2EYZA 4R0KA 2OI3A 3I9QA 1AWWA 4CC3A 2O31A 1T3LA 2KGTA 2LQNA 1RI9A 1K0SA 4ORZA 3U23A 4AFUC 2AZVA 1KIKA 3GBQA 2VKNA 1ABQA 2DJQA 3UA7A 3M0SA 5GJWB 1X6BA 1YWPA 3R6NA 4D8KA 1QKWA 3NHNA 2AK5A 2P4RA 2F2XA 1NLPC 2J6OA 1YCSB 2FRWA 2V1QA 5FW9A 1A0NB 1LCKA 2LCSA 1HD3A 2D1XA 1X2QA 2KROA 1WFWA 4WCIA 4ZNXA 2A08A 4FSSA 5IH2A 1E7OA 1YP5A 2GGRA 4J9CA 2KRNA 2CDTA 2J7IA 1GBRA 2RQUA 3SHWA 3H41A 5GJVB 5EC7A 3EG0A 5IXFA 1FYNA 4HCKA 4JZ4A 1PNJA 2G6FX 2LX7A 2BTTA 5HCKA 2MCNA 4DEXA 4AG2C 1NLOC 3ZL7C 2L3SA 1SRLA 1Y0MA 3VS0A 2DL7A 4HVWA 5IXBA 1UHFA 1AOJA 4A63B 2FRYA 2FEIA 1QLYA 2FPDA 2FG0A 3TVTA 2DL4A 2NUZA 1WXTA 2YUQA 3EHQA 4RUGA 2AKLA 2EGCA 1AVZC 1NYFA 2CSIA 2DNUA 2LJ3A 2FPFA 3M0UA 1GCPA 2DYBA 1UE9A 2JT4A 1BU1A 1K4US 1QWEA 2K3BA 2KEAA 2NWMA 2RQRA 3EHRA 5L23A 3LH5A 1SEMA 3UATA 2CSQA 2M51A 3TSWA 2YT6A 2O9SA 4OMOA 3M0QA 1AWXA 3RNJA 1K9AA 2D8JA 3VS7A 1OOTA 4RTYA 2HCKA 2GQIA 4QT7A 5I22A 4LUDA 1GFCA 1GFDA 1T0HA 1IO6A 2C0IA 2HSPA 3EG3A 3UF4A 4HVUA 2BZ8A 1T3SA 4J9BA 1YN8A 1MV0B 2EYWA 2OAWA 1PRLC 1MUZA 2YUNA 2DVJA 3THKA 2KXDA 4RTZA 1NEBA 2CT4A 2DMOA 1WX6A 2LNHB 2O2OA 2KNBB 1GBQA 1OPLA 1TUCA 1UDLA 2DE0X 4OMNA 3REBB 2ECZA 1BBZA 2MOXA 2W0ZA 4J9HA 3VS4A 2JM8A 2DX1A 1GL5A 2PZ1A 1VYTA 2HDAA 4JJCA 5ECAA 1AZEA 4Y92A 2J6FA 1ZBJA 2CUDA 1GCQC 2A37A 1M3CA 1B3QA 1RUWA 2ENMA 1RLQC 1E6GA 1NM7A 2EGAA 2JXBA 2VWFA 3I35A 1CSKA 2J06A 4Z88A 3NMZC 4K11A 1X6GA 2IIMA 2KYBA 3VS5A 2DL3A 3H0HA 2RQTA 2K7AA 1G2BA 2OJ2A 1PHTA 4Z89A 1Z9ZA 1Y57A 2EGEA 2C0TA 2ESWA 2DILA 4EIKA 4GBQA 2YUOA 1GCQA 2K79A 3PE0A 1I1JA 4RTUA 3EG1A 2JS2A 2F2WA 4CC4B 2CREA 2AZSA 3H0IA 1BB9A 2HEQA 1ZX6A 1WXBA 1ZUUA 2E5KA 2QDLA 3A98A 1KFZA 2GTJA 2YSQA 2GTOA 1WIEA 1T0JA 1H8KA 1U3OA 3JV3A 1TG0A 3PVQA 4HVVA 3I5SA 4J9IA 2KBTA 4F16A 1M3BA 2K9GA 2SEMA 5IHIA 2ED1A 3M0TA 2LJ0A 4LN2A 3VRZA 1QKXA 2DA9A 1UFFA 1JXMA 3PVLA 2FPEA 1Z9QA 4KRTA 2KR3A 4LE9A 1SRMA 2PNIA 3REAB 5FWCA 4LNPA 1QWFA 1M30A 2C0OA 4J9DA 2JMCA 2D0NA 1X43A 1AWJA 4F17A 2O88A 4JPBW 1AWOA 1UTIA 1M3AA 2ABLA 1K76A 1CKBA 1ZSGA 2RF0A 1TUDA 4DEYA 2JS0A 3UA6A 1VYUA 2D8HA 2L2PA 2LJ1A 2A36A 1WXUA 1ZLMA 2XMFA 4AFQC 1AEYA 2J05A 2EVRA 2DLPA 3VS2A 1UJ0A 2KE9A 4IIOA 4E6RA 3SEMA 2F2VA 1X27A 1X69A 3NPFA 4RTVA 2JM9A 2J6KA 1NEGA 4AFSC 2X3XD 1JQQA 4OMQA 4X1VA 1YNZA 4AFZC 1WDXA 2KT8A 2EQIA 4AG1C 4Z8AA 2RMOA 4F14A 1G83A 1M8MA 2B86A 1PKSA 2BZYA 1H3HA 1SSHA 1W6XA 2LMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9F A;  2RN8 A;  2L3Q A;  2DRK A;  2ED0 A;  1WLP B;  1V1C A;  1SHF A;  1N5Z A;  4JJD A;  4CC2 A;  1X2K A;  2EYY A;  3I5R A;  1ABO A;  3O5Z A;  1H92 A;  1K1Z A;  2CH4 A;  1AD5 A;  1E6H A;  1NG2 A;  2ROL A;  1W1F A;  2AKK A;  3QWY A;  1PKT A;  1XOV A;  1QCF A;  3RBB B;  1U06 A;  2KRS A;  3VRY A;  2V1R A;  2YDL A;  1OPK A;  4JZ3 A;  4CC7 A;  1JU5 C;  1YWO A;  1VYV A;  5IHK A;  1UUE A;  2BZX A;  2PTK A;  2EKH A;  1K0X A;  5I11 A;  2KRM A;  3TSZ A;  2SRC A;  2CH4 W;  1J3T A;  2DBM A;  2A28 A;  2L3P A;  2LQW A;  4OMM A;  4M4Z A;  1MV3 A;  1WA7 A;  2JMA A;  1M27 C;  1PWT A;  3M0P A;  2JTE A;  1S1N A;  3C0C A;  4OMP A;  2DL5 A;  2GNC A;  1RLP C;  1JXO A;  2RPN A;  3CQT A;  3EGU A;  1HJD A;  2EYX A;  1ARK A;  2KYM A;  2LP5 A;  2DRM A;  3M0R A;  2O9V A;  2JW4 A;  1KSW A;  4RTX A;  2CUB A;  3EG2 A;  3VS6 A;  1FMK A;  1B07 A;  3VS3 A;  2RQV A;  3FJ5 A;  1ZUK A;  2RQW A;  1UEC A;  1W70 A;  1I0C A;  3H0F A;  1PRM C;  4IIM A;  2EPD A;  2YUP A;  1ZUY A;  3NGP A;  1UHC A;  2GBQ A;  4GLM A;  1JO8 A;  2DBK A;  4OML A;  4ESR A;  2DL8 A;  1BK2 A;  1NYG A;  1HSQ A;  2X3W D;  5FWB A;  2LZ6 B;  1KJW A;  1SHG A;  4J9E A;  2DF6 A;  2VVK A;  4J9G A;  1OEB A;  1UG1 A;  4HXJ A;  1U5S A;  2HBW A;  2KT1 A;  3KFV A;  1EFN A;  2ROT A;  2FO0 A;  2MIO A;  2W10 A;  2DM1 A;  1WI7 A;  1SPK A;  1CKA A;  5IHN A;  4D8D A;  1AZG B;  4JJB A;  3VS1 A;  1UGV A;  2M0Y A;  1I07 A;  2RNA A;  2EW3 A;  2I0N A;  1OV3 A;  2EBP A;  3ULR B;  3QWX X;  4RTT A;  1JEG A;  1UJY A;  4RTW A;  1GRI A;  2L0A A;  4LUE A;  3IQL A;  1WYX A;  1VA7 A;  2CT3 A;  2K6D A;  2KXC A;  2K2M A;  2H8H A;  2EYZ A;  4R0K A;  2OI3 A;  3I9Q A;  1AWW A;  4CC3 A;  2O31 A;  1T3L A;  2KGT A;  2LQN A;  1RI9 A;  1K0S A;  4ORZ A;  3U23 A;  4AFU C;  2AZV A;  1KIK A;  3GBQ A;  2VKN A;  1ABQ A;  2DJQ A;  3UA7 A;  3M0S A;  5GJW B;  1X6B A;  1YWP A;  3R6N A;  4D8K A;  1QKW A;  3NHN A;  2AK5 A;  2P4R A;  2F2X A;  1NLP C;  2J6O A;  1YCS B;  2FRW A;  2V1Q A;  5FW9 A;  1A0N B;  1LCK A;  2LCS A;  1HD3 A;  2D1X A;  1X2Q A;  2KRO A;  1WFW A;  4WCI A;  4ZNX A;  2A08 A;  4FSS A;  5IH2 A;  1E7O A;  1YP5 A;  2GGR A;  4J9C A;  2KRN A;  2CDT A;  2J7I A;  1GBR A;  2RQU A;  3SHW A;  3H41 A;  5GJV B;  5EC7 A;  3EG0 A;  5IXF A;  1FYN A;  4HCK A;  4JZ4 A;  1PNJ A;  2G6F X;  2LX7 A;  2BTT A;  5HCK A;  2MCN A;  4DEX A;  4AG2 C;  1NLO C;  3ZL7 C;  2L3S A;  1SRL A;  1Y0M A;  3VS0 A;  2DL7 A;  4HVW A;  5IXB A;  1UHF A;  1AOJ A;  4A63 B;  2FRY A;  2FEI A;  1QLY A;  2FPD A;  2FG0 A;  3TVT A;  2DL4 A;  2NUZ A;  1WXT A;  2YUQ A;  3EHQ A;  4RUG A;  2AKL A;  2EGC A;  1AVZ C;  1NYF A;  2CSI A;  2DNU A;  2LJ3 A;  2FPF A;  3M0U A;  1GCP A;  2DYB A;  1UE9 A;  2JT4 A;  1BU1 A;  1K4U S;  1QWE A;  2K3B A;  2KEA A;  2NWM A;  2RQR A;  3EHR A;  5L23 A;  3LH5 A;  1SEM A;  3UAT A;  2CSQ A;  2M51 A;  3TSW A;  2YT6 A;  2O9S A;  4OMO A;  3M0Q A;  1AWX A;  3RNJ A;  1K9A A;  2D8J A;  3VS7 A;  1OOT A;  4RTY A;  2HCK A;  2GQI A;  4QT7 A;  5I22 A;  4LUD A;  1GFC A;  1GFD A;  1T0H A;  1IO6 A;  2C0I A;  2HSP A;  3EG3 A;  3UF4 A;  4HVU A;  2BZ8 A;  1T3S A;  4J9B A;  1YN8 A;  1MV0 B;  2EYW A;  2OAW A;  1PRL C;  1MUZ A;  2YUN A;  2DVJ A;  3THK A;  2KXD A;  4RTZ A;  1NEB A;  2CT4 A;  2DMO A;  1WX6 A;  2LNH B;  2O2O A;  2KNB B;  1GBQ A;  1OPL A;  1TUC A;  1UDL A;  2DE0 X;  4OMN A;  3REB B;  2ECZ A;  1BBZ A;  2MOX A;  2W0Z A;  4J9H A;  3VS4 A;  2JM8 A;  2DX1 A;  1GL5 A;  2PZ1 A;  1VYT A;  2HDA A;  4JJC A;  5ECA A;  1AZE A;  4Y92 A;  2J6F A;  1ZBJ A;  2CUD A;  1GCQ C;  2A37 A;  1M3C A;  1B3Q A;  1RUW A;  2ENM A;  1RLQ C;  1E6G A;  1NM7 A;  2EGA A;  2JXB A;  2VWF A;  3I35 A;  1CSK A;  2J06 A;  4Z88 A;  3NMZ C;  4K11 A;  1X6G A;  2IIM A;  2KYB A;  3VS5 A;  2DL3 A;  3H0H A;  2RQT A;  2K7A A;  1G2B A;  2OJ2 A;  1PHT A;  4Z89 A;  1Z9Z A;  1Y57 A;  2EGE A;  2C0T A;  2ESW A;  2DIL A;  4EIK A;  4GBQ A;  2YUO A;  1GCQ A;  2K79 A;  3PE0 A;  1I1J A;  4RTU A;  3EG1 A;  2JS2 A;  2F2W A;  4CC4 B;  2CRE A;  2AZS A;  3H0I A;  1BB9 A;  2HEQ A;  1ZX6 A;  1WXB A;  1ZUU A;  2E5K A;  2QDL A;  3A98 A;  1KFZ A;  2GTJ A;  2YSQ A;  2GTO A;  1WIE A;  1T0J A;  1H8K A;  1U3O A;  3JV3 A;  1TG0 A;  3PVQ A;  4HVV A;  3I5S A;  4J9I A;  2KBT A;  4F16 A;  1M3B A;  2K9G A;  2SEM A;  5IHI A;  2ED1 A;  3M0T A;  2LJ0 A;  4LN2 A;  3VRZ A;  1QKX A;  2DA9 A;  1UFF A;  1JXM A;  3PVL A;  2FPE A;  1Z9Q A;  4KRT A;  2KR3 A;  4LE9 A;  1SRM A;  2PNI A;  3REA B;  5FWC A;  4LNP A;  1QWF A;  1M30 A;  2C0O A;  4J9D A;  2JMC A;  2D0N A;  1X43 A;  1AWJ A;  4F17 A;  2O88 A;  4JPB W;  1AWO A;  1UTI A;  1M3A A;  2ABL A;  1K76 A;  1CKB A;  1ZSG A;  2RF0 A;  1TUD A;  4DEY A;  2JS0 A;  3UA6 A;  1VYU A;  2D8H A;  2L2P A;  2LJ1 A;  2A36 A;  1WXU A;  1ZLM A;  2XMF A;  4AFQ C;  1AEY A;  2J05 A;  2EVR A;  2DLP A;  3VS2 A;  1UJ0 A;  2KE9 A;  4IIO A;  4E6R A;  3SEM A;  2F2V A;  1X27 A;  1X69 A;  3NPF A;  4RTV A;  2JM9 A;  2J6K A;  1NEG A;  4AFS C;  2X3X D;  1JQQ A;  4OMQ A;  4X1V A;  1YNZ A;  4AFZ C;  1WDX A;  2KT8 A;  2EQI A;  4AG1 C;  4Z8A A;  2RMO A;  4F14 A;  1G83 A;  1M8M A;  2B86 A;  1PKS A;  2BZY A;  1H3H A;  1SSH A;  1W6X A;  2LMJ A; 
#chains in the Genus database with same CATH topology
 2P84 A;  4J9F A;  4L6V 5;  4ZGE B;  2L3Q A;  2AIR B;  4M77 G;  1V1C A;  3GP8 A;  3JCM X;  1X2K A;  2EYY A;  3I5R A;  1ABO A;  3O5Z A;  1YJN Q;  1VQ9 A;  4J6W A;  3VKI A;  2C06 A;  2JTM A;  1AD5 A;  1NE8 A;  2KK4 A;  4PFO A;  2HAX A;  4M78 G;  1PKT A;  2RHY A;  1M1G A;  3RDV A;  1VQ4 A;  1U06 A;  2KRS A;  1Y96 B;  2V1R A;  2YDL A;  1JU5 C;  4E7I A;  1JB0 E;  2R58 A;  1G3S A;  1Q81 R;  2FL7 A;  2PVO B;  2DXU A;  3TSZ A;  2SRC A;  2JTF A;  1F1B B;  1J3T A;  2PUO B;  4C5G A;  2A28 A;  2L3P A;  2LQW A;  1YI2 Q;  1D3B A;  1MV3 A;  1W4S A;  2RJF A;  2E70 A;  1JJ2 A;  1S72 Q;  3SB2 A;  1NPP A;  2GNC A;  2QXF A;  3VUB A;  4B9W A;  4MML A;  1VQM Q;  3EGU A;  1HJD A;  2E5Q A;  5FLX E;  2LP5 A;  2DEQ A;  4M75 C;  4DBF A;  5FU7 C;  3GNF B;  2JW4 A;  4XTU A;  3EG2 A;  3C4S A;  3CPW S;  4NOY A;  2RQV A;  3E1S A;  1M1F A;  1W70 A;  4GLM A;  2DBK A;  2QA4 A;  2DL8 A;  3OW2 A;  1OYX A;  1KQ1 A;  5GAO r;  1KJW A;  4J9E A;  1OX8 A;  3BFM A;  1D0X A;  2BIV A;  3X25 B;  5CQX A;  1O9S A;  2E1H A;  2F1L A;  5CIU A;  1R8O B;  3KFV A;  5HK0 A;  2FO0 A;  2MIO A;  4QQG A;  4HCZ A;  1AZG B;  1UEB A;  2E3I A;  4C5H A;  2RNA A;  2EQK A;  2EW3 A;  3GLX A;  2I0N A;  2VGN A;  3NTK A;  4ZTJ A;  4C8Q C;  1YJW T;  3G4S Q;  1U1S A;  4UC4 A;  4BUG A;  4C92 D;  4RTW A;  1RL2 A;  1WYX A;  4KUD K;  3CBO A;  5IN1 A;  1Q82 C;  2CT3 A;  3GOX A;  3DB4 A;  3MHX A;  3QO3 A;  2KSS A;  3I56 A;  2D9T A;  1LVK A;  2HQX A;  4LDV A;  2QAZ A;  1RAI B;  1T3L A;  3CME Q;  3GF5 A;  4M7D C;  1PD1 A;  2M16 A;  1KIK A;  3UA7 A;  4JRK A;  2YLC A;  1B7T A;  1X6B A;  1YWP A;  3S3O A;  2E4H A;  4DBH A;  2X4W A;  2P4R A;  4FT2 A;  3CCQ Q;  2D1X A;  2QK0 A;  2KRO A;  1TUG B;  2XI9 A;  5I2M A;  4FSS A;  3M4Y A;  5IH2 A;  5LJ3 e;  2V26 A;  3RKY A;  3CCM T;  2CDT A;  2DVE A;  1G5V A;  1GBR A;  3HP9 A;  3QUI A;  3SHW A;  3H41 A;  5GJV B;  2JVV A;  3QZ5 B;  2BUD A;  3L2Z A;  4MDX A;  4ELZ C;  5J26 A;  1RI0 A;  4JZ4 A;  2LX7 A;  2OTL Q;  5HCK A;  3CXC A;  3NFC A;  1YJW A;  1M90 R;  2OX7 A;  5KYU B;  2DPP B;  1Q82 U;  5HY6 A;  1W2B P;  2I2L A;  3FB9 A;  4OB3 B;  3JCM W;  1ZA1 B;  2DFU A;  2DL7 A;  1IHV A;  2LTO A;  1WQW A;  1VQ9 Q;  1N27 A;  1AOJ A;  4A63 B;  2KDS A;  2FEI A;  3QYG B;  1RAF B;  2FG0 A;  3QJ6 A;  4EPC A;  4M77 D;  2EYQ A;  2DZ9 A;  1TXQ A;  3HRS A;  2MK5 A;  2HNI A;  1AVZ C;  4FYW B;  1VQ4 Q;  2CZ0 B;  2DER A;  2KI7 A;  2H3J A;  2IG0 A;  3L2U A;  2FPF A;  1D3B B;  3CCE T;  1UE9 A;  2JT4 A;  1K4U S;  4M78 D;  5LJ3 j;  5CKD A;  3CCR T;  5L23 A;  4PJO E;  1SEM A;  3UAT A;  3E19 A;  3TSW A;  1QP3 A;  2O9S A;  4OMO A;  1C1A A;  1YIJ T;  2RD1 A;  3LYI A;  4HCB A;  5GMK e;  2GQI A;  4QT7 A;  1T0H A;  1C6V X;  3PMT A;  2DK3 A;  3EG3 A;  4WTO B;  4FYY B;  5A0L A;  3QPH A;  2XD0 A;  1T3S A;  4HT9 A;  3HFO A;  2YUN A;  4XU3 A;  4RTZ A;  1YHQ T;  4XTY A;  1NEB A;  2HKQ B;  3JCM g;  2KNB B;  4DBR A;  3M53 A;  1OPL A;  2KMT A;  3OYI A;  1TUC A;  1UDL A;  2K4Y A;  2QA4 Q;  3BDU A;  2MOX A;  3LW5 E;  1JRI A;  1BKB A;  4MZM A;  2CP3 A;  4HT8 A;  1I5L A;  2R5M A;  2J6F A;  5GAO m;  2KY9 A;  2RM4 A;  2A37 A;  2CP2 A;  3SFM A;  1KQS P;  1B3Q A;  2MMP A;  1RLQ C;  1WHJ A;  3CC2 T;  3NTH A;  1CSK A;  2J06 A;  1VQ6 A;  1VQO T;  3VS5 A;  3H0H A;  1HK9 A;  2YRC A;  2OJ2 A;  3CCE A;  3QBY A;  1Z9Z A;  5GMK j;  5KYW A;  1Y57 A;  2C0T A;  2ESW A;  2E10 A;  5D6W A;  1Y71 A;  2YUO A;  1GCQ A;  3OB9 A;  1FXX A;  3OYC A;  3PE0 A;  4PJO B;  2RJD A;  2JS2 A;  3H0I A;  1VQL T;  1BB9 A;  1ZX6 A;  3I56 Q;  4M75 G;  7AT1 B;  5CKB A;  3QKJ A;  1Y7X A;  3NTI A;  1BI1 A;  4J6X A;  1LPL A;  3A98 A;  4JRP A;  3PIP A;  2YSQ A;  3G6E T;  2EKO A;  2K5F A;  3SDZ A;  1TG0 A;  3PVQ A;  4HVV A;  3UWN A;  5GAO l;  3MP1 A;  5FU6 C;  3SWN A;  2K9G A;  2ED1 A;  1ZSZ A;  1QKX A;  3EAE A;  2FPE A;  4KUI A;  3OYH A;  3EFR A;  1SRM A;  3QYH B;  1TSF A;  2HBP A;  4J9D A;  4VUB A;  4AT1 B;  4BE0 A;  2HL3 A;  4JPB W;  4C8Q G;  4XTZ A;  1OUL A;  2CKK A;  2Y90 A;  1QCO A;  1CKB A;  2L5Q A;  1ZSG A;  2RF0 A;  4GY5 A;  4BY6 B;  3UA6 A;  1WXU A;  1FMV A;  5GAN 2;  1AEY A;  2J05 A;  2EVR A;  2DLP A;  2X51 A;  3OMG A;  2HL5 C;  2RA2 A;  1W2B A;  4IIO A;  4PJO F;  2DO3 A;  1O75 A;  1VQL A;  3KBG A;  2J6K A;  4L59 A;  5D6Y A;  4M7D G;  1KC8 R;  5GAN 7;  4AFZ C;  3URG A;  2RJC A;  4Z02 A;  4AG1 C;  3HRT A;  4F04 B;  1G83 A;  4FU6 A;  4F7U E;  5LJ3 h;  1R77 A;  1HYO A;  5GAN 4;  2VAS A;  1Q82 R;  2LMJ A;  4XU1 A;  5CK9 A;  1IXD A;  1WLP B;  5EG2 A;  1YBY A;  1SHF A;  3KXT A;  4AMC A;  3OYD A;  3S3M A;  2X4X A;  5D7U A;  2CH4 A;  2CGH A;  9ATC B;  1GXI E;  3QWY A;  3QZ9 B;  1QCF A;  5GAN g;  2DJZ A;  4C0F A;  4E7H A;  5KE3 A;  2H3E B;  1OPK A;  2XHC A;  2XDB A;  3L42 A;  1VUB A;  1U1T A;  5IHK A;  1AHJ B;  2PTK A;  1K0X A;  3RMS A;  5I11 A;  3N5B B;  2WSF E;  4PFP A;  2DBM A;  1WHK A;  4J6Y A;  1QVG S;  3CCU A;  5LJ3 f;  1VQN Q;  5LJ3 d;  4ZGD B;  1M27 C;  2JTE A;  1KQS A;  3ASK A;  2XID A;  1JXO A;  3L2V A;  1YIT A;  5KYW B;  2EYX A;  4QVZ A;  1IGQ A;  1VQ6 Q;  2KYM A;  4Y28 E;  3M0R A;  5C0M A;  4M7A C;  1Q86 C;  3VS6 A;  2CP6 A;  3RES A;  1AT1 B;  2LVM A;  3I55 T;  2E3H A;  2ATC B;  1I0C A;  4F7U B;  3OYY A;  2EPD A;  2QI2 A;  1ZUY A;  2GBQ A;  4EMK B;  2WAC A;  2OTL T;  4D6W A;  1MMN A;  3V7C A;  3V7S A;  2YLB A;  1Q7Y C;  2X3W D;  3QII A;  1SHG A;  1QP2 A;  2DF6 A;  2VVK A;  2LRQ A;  5DLO A;  1N9S A;  5A2Q E;  1MMG A;  2HBW A;  1WHM A;  3CC4 T;  3SWN B;  4PJM A;  1MGQ A;  3ER0 A;  4KH1 B;  3A8M B;  1ZBX A;  4C5I A;  1TH7 A;  2W10 A;  4M75 D;  2DM1 A;  2MAM A;  3QJY A;  4JJB A;  5KYY A;  4C92 A;  3VS1 A;  3FLG A;  3OYM A;  4XAX B;  3ULR B;  3QWX X;  1JEG A;  2AT1 B;  1G8X A;  2L0A A;  4LUE A;  3IQL A;  3EG9 A;  4PJL A;  2QQS A;  2K6D A;  1TS9 A;  5D6X A;  2K2M A;  2H8H A;  2EYZ A;  1UGQ B;  3LWI A;  4FT4 A;  3OW2 S;  1YJ9 A;  8ATC B;  1VQ7 A;  2K3Y A;  3CXC P;  4R56 A;  4CC3 A;  5A0D A;  3VUZ A;  2O31 A;  1OQK A;  1RI9 A;  3MEU A;  1IZ6 A;  2P4T A;  1Q86 U;  4PLL A;  3U23 A;  2AZV A;  3LLR A;  3GBQ A;  1X6O A;  1ABQ A;  2DJQ A;  3M0S A;  5GJW B;  2EQU A;  3OY9 A;  1NBE B;  5KYU A;  3NHN A;  3M4G A;  2X4Y A;  4C8Q D;  2F2X A;  2J6O A;  4BI4 A;  3A8H B;  1YCS B;  5KYX B;  1LCK A;  3M59 A;  3HPW A;  1Q7Y U;  1X2Q A;  1WFW A;  2L8D A;  3Q1J A;  1NPR A;  2A08 A;  3WVD B;  2HSE B;  3MO8 A;  3X24 B;  1YP5 A;  3CCV A;  2KRN A;  3ZEH A;  1M1K U;  2LT4 A;  3CMA T;  4XTV A;  3OA6 A;  4M7D D;  3EG0 A;  1FYN A;  1ZA2 B;  3CCS T;  1PNJ A;  3UDC A;  1ZSZ C;  4JS4 A;  3EH2 A;  2COZ A;  2ZPB B;  3RUX A;  2MCN A;  3MKD A;  2RHU A;  1VQ8 A;  1WJR A;  1PC0 A;  2QGG A;  4MZP A;  1SRL A;  1Y0M A;  4C92 E;  3RIR A;  4OVA A;  2CYZ B;  2LNV A;  2P0Q A;  2DL4 A;  4FIB A;  2NUZ A;  1WXT A;  2YUQ A;  2V8K A;  3EHQ A;  3JB9 J;  4KGV B;  1G3T A;  1QVF P;  3CCJ T;  2LJ3 A;  3M0U A;  2JNG A;  1GCP A;  1BU1 A;  1QWE A;  2KEA A;  2NWM A;  2YWW A;  3FDR A;  4LD6 A;  2K2V A;  1PD0 A;  2LT1 A;  2ZZD A;  2M51 A;  2YT6 A;  1PM3 A;  3CCU Q;  1KC8 C;  5DM7 R;  1RAB B;  5KE2 A;  3RNJ A;  1OOT A;  4XU2 A;  3ME9 A;  4PNO A;  4LUD A;  2RI5 A;  1YIT Q;  2R5A A;  3VYH B;  4J9B A;  1YN8 A;  1MUZ A;  2DVJ A;  4J7I A;  2CT4 A;  1WX6 A;  3OS1 A;  2O2O A;  1KQ2 A;  5FRO A;  1N6A A;  3QXE B;  4PJO A;  2M02 A;  1Y07 A;  1EZZ B;  3M58 A;  2ECZ A;  3MPU B;  3HKS A;  2XK0 A;  3JCM P;  1GL5 A;  1MMA A;  2PZ1 A;  2CP7 A;  5ECA A;  1AZE A;  5KYY B;  4C92 B;  2G3R A;  1ZBJ A;  4IUP A;  2NUT B;  1I8F A;  2EFI A;  4E7S A;  2HZY A;  1PSF A;  2EGA A;  3CCL T;  4PFZ A;  2P0P A;  4K11 A;  3OYG A;  2PVD B;  4O5V A;  4PK4 A;  1KHC A;  3EG9 B;  4M77 E;  2K7A A;  1QVP A;  1G2B A;  1PHT A;  4Z89 A;  1XQH A;  4LDW A;  1I5O B;  1X75 C;  3G71 T;  1PG5 B;  2K79 A;  3V7R A;  1I1J A;  2BE7 D;  4M78 E;  1KC8 U;  2F2W A;  2CRE A;  2AZS A;  2NUP B;  2LX9 A;  1YJ9 Q;  3J7A F;  1VQ7 Q;  1IHW A;  1IRE B;  1WXB A;  1JJ2 S;  4M7A G;  3LX7 A;  4LDY A;  4J5Y A;  4BE1 A;  1TWB A;  2E5K A;  2HD0 A;  5GAN 3;  3JB9 I;  1WIE A;  1VQ5 T;  1T0J A;  3RMQ A;  2QQB A;  2RO0 A;  4F16 A;  1M3B A;  2K3X A;  3VRZ A;  2EAY A;  1YCY A;  2X4J A;  2XU8 A;  5J3B A;  4OB2 B;  1UFF A;  3L1A A;  3A5Z B;  3DLL A;  4N4G A;  4LE9 A;  3CC7 T;  3D7S B;  3CCV Q;  1WHL A;  2PNI A;  3REA B;  4R55 A;  3L2W A;  5FWC A;  3TRE A;  1VQN T;  4C92 F;  4LNP A;  3PNW C;  1M30 A;  1OZ2 A;  3JB9 G;  2JMC A;  2D0N A;  1OU9 A;  1Q86 R;  3CD6 T;  1UTI A;  1M3A A;  2E41 A;  4M77 B;  4DEY A;  1BI2 A;  3O8V A;  2L2P A;  1ZLM A;  3CCM A;  3FIF A;  2DZC A;  2YRV A;  3PTA A;  4NL3 A;  6AT1 B;  1UJ0 A;  2KE9 A;  1Q7Y R;  2CZ6 B;  1VQ8 Q;  1M5Q 1;  4E6R A;  4M78 B;  2BE9 B;  4E2F B;  5GAM g;  2RHI A;  1VQK T;  2V8I A;  1X27 A;  5CCA A;  4OF1 A;  3HHT B;  1VQP T;  2X3X D;  1WHG A;  2KQW A;  1JQQ A;  1M1K R;  2V8J A;  5C6S A;  2HKN A;  4Q5W A;  4OMQ A;  2COY A;  4Y91 A;  4X1V A;  2OTJ T;  4XU0 A;  2KT8 A;  1QVF A;  2RHX A;  4FYX B;  4F14 A;  5L8R E;  1PKS A;  4XTX A;  2K5L A;  2GFU A;  2RI3 A;  4LDX A;  2ED0 A;  2ZCF B;  1W2B S;  4JJD A;  5GMK m;  3CCR A;  4RMO A;  2PU9 B;  1KK7 A;  2MWP A;  2QEX T;  3CD6 A;  1W1F A;  2WSE E;  2AKK A;  2F5K A;  1YIJ A;  4F7U A;  4CI0 C;  2OAU A;  4M77 F;  4CC7 A;  1YWO A;  4EMK A;  1IB8 A;  1VYV A;  1UUE A;  4E7J A;  2CS7 A;  2EKH A;  1RAH B;  1XNI A;  2KRM A;  1YJN T;  2CH4 W;  3HL8 A;  3OYB A;  1YHQ A;  4OMM A;  3GIB A;  3UT1 A;  4M78 F;  3OBW A;  1K8A C;  2RI2 A;  1VQP A;  1PWT A;  2ZPI B;  4C0D B;  1B34 B;  3M0P A;  4M7A E;  1RLP C;  3CQT A;  1ARK A;  1I81 A;  3MET A;  3OSV A;  3M56 A;  4KT0 E;  4KBM B;  4ELY C;  3A8L B;  2EJF A;  4ME7 A;  2CUB A;  1FMK A;  4NS5 A;  1B07 A;  4TVR A;  4OGE A;  3FJ5 A;  1YI2 T;  4IKF A;  1ZUK A;  5GAN 8;  5GMK l;  1PRM C;  4C0Z A;  1ACM B;  2QQR A;  4IIM A;  3CC2 A;  3S3N A;  1S72 T;  1FMW A;  3FJP A;  1JO8 A;  2MI6 A;  4OML A;  1VQM T;  2KAF A;  3J81 E;  2GQV A;  3LGL A;  1VQO A;  4FSX A;  3C12 A;  2YHT A;  5FWB A;  2LZ6 B;  2PUK B;  5KYN A;  4J9G A;  4E7K A;  3QDR B;  4BD3 A;  1YJW Q;  2LCL A;  3VU3 C;  5I2S A;  3HFN A;  2ROT A;  1SPK A;  4M7A D;  2D0Q B;  1CKA A;  5IHN A;  4D8D A;  1M2V B;  4XQ3 A;  2M0Y A;  3OMC A;  4B9X A;  1I07 A;  2LQK A;  4JJN K;  4PJO C;  1UGS B;  3VYG A;  3LGF A;  1OV3 A;  3RER A;  2EBP A;  2DXT A;  4RTT A;  3EGD B;  1UJY A;  5KYX A;  4FYV B;  3A1P A;  3G6E A;  1FWZ A;  3RKW A;  1K8A U;  1V76 A;  4J8O A;  3I9Q A;  2DYI A;  1AWW A;  2VXE A;  2KGT A;  1TOV A;  4C8Q A;  3G4S T;  1OU8 A;  4ORZ A;  2FZC B;  4X34 A;  3E9G A;  4AFU C;  3TU4 K;  4ZGJ B;  3CCM Q;  2CP0 A;  3P8H A;  3R6N A;  5CKH A;  4D8K A;  3WXM B;  1HXD A;  1BYM A;  2V1Q A;  3FEO A;  4YTL A;  4A4H A;  2LCS A;  1HD3 A;  4WCI A;  2MYS A;  5LJ3 g;  2QDY B;  3CME T;  3PT9 A;  1M8V A;  2GGR A;  4J9C A;  2J7I A;  2FZK B;  2RQU A;  2L3R A;  4BY6 C;  1I4K 1;  3OS2 A;  4A4K A;  4JLG A;  4JRI A;  5IXF A;  3CCQ T;  2GCX A;  4M75 E;  2EQM A;  2G6F X;  4MDW A;  2BTT A;  3TQ7 P;  2E12 A;  1RAE B;  4IUV A;  4DEX A;  2CZ7 B;  3CCE Q;  3ZL7 C;  2L3S A;  3DKM A;  4MZT A;  5HKC A;  3GNG A;  2HQH A;  1KD1 C;  2DD4 A;  2NYS A;  3VS0 A;  4V2S A;  5IXB A;  5GMK h;  3LH0 A;  2FRY A;  1QLY A;  1IRX A;  4HKE A;  2M1H A;  3OYL A;  2DD5 A;  3MEA A;  4EDU A;  1YIJ Q;  2AKL A;  2EGC A;  1NYF A;  4JS5 A;  4QKU A;  2CSI A;  2DNU A;  3QHS A;  4GLK A;  2EWN A;  2K3B A;  2VV5 A;  3JCM V;  3OSS C;  1VOM A;  1M1K C;  1VQ9 T;  2QTV A;  2EIF A;  3JCM Q;  2CSQ A;  1YHQ Q;  2XDP A;  4C8Q E;  1AWX A;  2NUT A;  2D8J A;  3VS7 A;  4LDU A;  1VQ4 T;  1GFC A;  2VGM A;  4JUV A;  1IO6 A;  4QQ6 A;  1OX9 A;  3UF4 A;  1PSE A;  3RR6 A;  2BZ8 A;  5LJ5 g;  3CPW P;  1Q95 G;  1MV0 B;  1VIE A;  3OYE A;  2MF2 A;  3THK A;  4HA8 A;  2KXD A;  3MP8 A;  2DMO A;  2QTX A;  5GAM e;  4M75 B;  5FU7 B;  3CC2 Q;  3JCM e;  4JRQ A;  4M7D E;  2M0O A;  1K73 C;  3V8K A;  1VQO Q;  3HRU A;  3REB B;  3VS4 A;  2NUP A;  3MEV A;  3V8J A;  4JJC A;  1KD1 U;  4Y92 A;  3I55 A;  2CUD A;  1GCQ C;  1RUW A;  2ENM A;  1E6G A;  1D1C A;  2VWF A;  4F7U F;  1QVG A;  2OTL A;  4Z88 A;  2HQE A;  3NMZ C;  2KYB A;  1VQL Q;  2QA4 T;  4BAC A;  3MJX A;  4RKU E;  1V29 B;  4LXC A;  1PCX A;  1C0M A;  4EMK C;  2RK2 A;  2EGE A;  3CC4 A;  5CAI A;  3CEY A;  1MMD A;  4ANJ A;  2A0F B;  3X28 B;  3G6E Q;  3E9F A;  4RTU A;  3C95 A;  4CC4 B;  4C8Q B;  4WF2 A;  3QDF A;  2FVU A;  3SWN C;  1WNL A;  3L2Q A;  2E65 A;  3OYJ A;  5GAM j;  3R6O A;  3PIO A;  3EFO B;  4DA4 A;  3VJP A;  1RAG B;  2QDL A;  4M77 A;  1KFZ A;  2Y4Y A;  1M9S A;  2GTJ A;  4J83 A;  2GTO A;  2F5T X;  2QQ9 A;  4IUR A;  1R0B G;  1H8K A;  1DJ7 B;  1SG5 A;  3JV3 A;  4M7D B;  4M75 F;  2LQ8 A;  2DEU A;  1K73 U;  2KBT A;  3I56 T;  4BI8 B;  5IHI A;  4RG2 A;  2B8A A;  4M78 A;  1WJQ A;  4QVC A;  2DA9 A;  2R57 A;  1JXM A;  2KVQ G;  4II1 A;  4E7L A;  4PL6 A;  1K8A R;  3CBP A;  1LNX A;  1K9M C;  4KRT A;  5CQY A;  3AT1 B;  2E6Z A;  3JCM b;  2PQW A;  5GAO n;  1QWF A;  2P0K A;  4BDY A;  4A4G A;  3EFS A;  3BW1 A;  4P5N A;  4PJO G;  1AWJ A;  3CXC S;  4OMF B;  4F17 A;  1BIB A;  2CZ1 B;  3JB9 F;  2ABL A;  1K76 A;  1WQ7 A;  1TUD A;  2JS0 A;  2A36 A;  3RKX A;  2XMF A;  4AFQ C;  2RJE A;  4KH0 B;  2E64 A;  5GAN 5;  2JUF A;  3CMA A;  3VS2 A;  1XTD A;  1NZ9 A;  1EX4 A;  5GAO q;  3BDL A;  2F2V A;  1X69 A;  3NPF A;  4RTV A;  3CCS A;  4C8Q F;  4N0A A;  4RG8 A;  4IUT A;  5CKE A;  3JSC A;  1N8R R;  4QW2 A;  4C5E A;  4Z8A A;  1TU0 B;  1D0Z A;  3INZ A;  3JCM J;  2XDD A;  1H3H A;  5DY9 A;  1M4Z A;  3EGX B;  1G3W A;  1SSH A;  4M7D F;  1K9M U;  1QW1 A;  1LJO A;  3CCJ A;  2RN8 A;  2DRK A;  1B34 A;  3MP6 A;  3C94 A;  1N5Z A;  4CC2 A;  3OYK A;  2VUB A;  1H92 A;  3P8B B;  1K1Z A;  3CPW A;  2K5I A;  1E6H A;  1NG2 A;  4X9C A;  1WPY A;  2ROL A;  1H64 1;  3PGG A;  2GF7 A;  1XOV A;  4OGC A;  3RBB B;  5CO7 A;  3VRY A;  4JZ3 A;  5GAN e;  3OQ5 A;  1QVF S;  3M57 A;  1IGU A;  2EJ9 A;  2BZX A;  5GMK i;  4L5G A;  4A53 A;  4X9D A;  3LWH A;  2FYK A;  4M4Z A;  4BB7 A;  2RHZ A;  1WA7 A;  2JMA A;  3I55 Q;  2JOY A;  3E2U A;  4FW1 A;  2RB6 A;  4C0G A;  1H3Z A;  3P8D A;  1S1N A;  1D0Y A;  3C0C A;  4OMP A;  2DL5 A;  4N4I A;  5GAN 6;  2RPN A;  3JAM E;  1LOJ A;  2DRM A;  1M2V A;  1SSF A;  2O9V A;  1KSW A;  4RTX A;  2K57 A;  2E6N A;  3VS3 A;  3DB3 A;  3CC4 Q;  2RQW A;  1SKU B;  1UEC A;  3EGD A;  3H0F A;  3CCL A;  2YUP A;  3PMI A;  3NGP A;  1BI3 A;  1UHC A;  1D09 B;  4C92 C;  4ESR A;  4QQD A;  5GAO p;  1VQ6 T;  1BK2 A;  1NYG A;  1HSQ A;  2DXC A;  1KD1 R;  1NJI C;  1OZ3 A;  4M7A A;  1WGS A;  2HMA A;  3JRZ A;  1JBM A;  1OEB A;  1UG1 A;  4HXJ A;  5GAM h;  5CR2 A;  3OBY A;  1U5S A;  2FZG B;  5GAN j;  2KT1 A;  3G71 A;  3HSB A;  3JCM h;  2DIG A;  4ZTF A;  1EFN A;  1WI7 A;  2DKG A;  4B6M A;  1BCM A;  5CKF A;  2AHJ B;  1UGV A;  5KH6 A;  2ZPF B;  2EQJ A;  2QGF B;  3TEE A;  3M9Q A;  2YRD A;  2NLU A;  3M54 A;  2VYT A;  1QQJ A;  1U8R A;  2MWO A;  4XTW A;  1GRI A;  4DOW A;  1VA7 A;  3A8O B;  2DET A;  5LJ5 e;  5FU6 B;  2KXC A;  1VQ5 A;  3ZFJ A;  4BDZ A;  5CVI A;  4R0K A;  5I21 A;  3F70 A;  2OI3 A;  2EJG A;  3J80 E;  4OB1 B;  4F7U G;  1TTH B;  1MND A;  2QQA A;  3MCA B;  2LQN A;  1RAD B;  1K0S A;  5GAM f;  2DIQ A;  5GAM d;  3JCM f;  3CC7 A;  2VKN A;  3JCM d;  1YFN A;  4PJO D;  1VQN A;  1K73 R;  3CMA Q;  1QKW A;  5FRN A;  2AK5 A;  2ZPG B;  4A4F A;  4PJJ A;  1NLP C;  1BI0 A;  1P92 A;  1Q81 C;  2FRW A;  5FW9 A;  1A0N B;  1UB4 A;  1OI1 A;  3CCS Q;  1NJI U;  3CBM A;  4ZNX A;  3OYF A;  2X35 A;  2FB7 A;  2M9U A;  4PKC C;  1E7O A;  4RCB A;  5A0G A;  4M77 C;  1VQK A;  4FCY A;  4PJN A;  3S6W A;  1BIA A;  5EC7 A;  5LJ5 j;  4JLI A;  4HCK A;  4JDS A;  5HK3 A;  4EMH A;  5IT9 E;  3KUF A;  2QYZ A;  4M78 C;  3A8G B;  3G1J A;  2OTJ A;  4AG2 C;  2O01 E;  3CCJ Q;  2DTH A;  1NLO C;  2LCC A;  2QG9 B;  1D1B A;  4FL6 A;  4E7Z A;  2YXY A;  4HVW A;  2LC4 A;  1UHF A;  4IUU A;  2Z0W A;  4ATO A;  2FPD A;  3TVT A;  2LDM A;  2MPX C;  2BKD N;  1N9R A;  1QCN A;  4PLI A;  2WSC E;  4RUG A;  4BE2 A;  2ZPE B;  3SD4 A;  5KCH A;  1SF9 A;  4M75 A;  3T9N A;  2JZ2 A;  2QAS A;  2DYB A;  3G7Z A;  1UGR B;  2RQR A;  4ZN1 A;  3EHR A;  1QVG P;  3LH5 A;  1KQS S;  1Q81 U;  2QEX A;  4ZN3 A;  5LL6 S;  1KHI A;  1K9M R;  3HTR A;  3OYN A;  2XIC A;  3M0Q A;  1WZO A;  4N0A C;  1N8R C;  1K9A A;  3AHU A;  4RTY A;  2HCK A;  5I22 A;  5AYF A;  1GFD A;  4E47 A;  2C0I A;  2HSP A;  4HVU A;  4QVD A;  2CP5 A;  4DOV A;  2O4X A;  2Y4X A;  4MMK A;  1ZQ1 A;  4O6J A;  4KGZ B;  2EYW A;  2OAW A;  3FC3 A;  1YJN A;  3H9N A;  4XK8 E;  1PRL C;  2F69 A;  3H8Z A;  1G3Y A;  4J7F A;  3X20 B;  3CCU T;  2LNH B;  2XKO C;  1GBQ A;  3BY7 A;  3CCL Q;  4M7A B;  3M55 A;  3H6Z A;  3QG1 A;  2DE0 X;  4OMN A;  3M5A A;  1YIT T;  1BBZ A;  4J9H A;  2W0Z A;  2JM8 A;  4N4H A;  4C0D C;  3OS0 A;  2DX1 A;  2DTO A;  3OYA A;  1VYT A;  2HDA A;  3JB9 D;  1Y96 A;  1YI2 A;  1XJW B;  3EFO A;  5KCO A;  2X9H A;  2D6F A;  3G71 Q;  1JJ2 P;  4A4E A;  1M3C A;  2VXF A;  2DAQ A;  2A3L A;  2ZPH B;  1NM7 A;  4CRI A;  1S72 A;  5GAN h;  4FM4 B;  2JXB A;  2ZGW A;  2JN0 A;  5J39 A;  3I35 A;  1VQM A;  1X6G A;  2IIM A;  2DL3 A;  2RQT A;  3JCM c;  4EMG A;  4M7D A;  2GFA A;  1R0C B;  2ZAE A;  2DIL A;  4EIK A;  4GBQ A;  3X26 B;  1VIF A;  1M90 C;  4A54 A;  3EG1 A;  1VQ5 Q;  3OW2 P;  1KG1 A;  3L2R A;  1N8R U;  3V8L A;  3CPF A;  2HEQ A;  3EH1 A;  4OP0 A;  3DLM A;  3JB9 H;  1D1A A;  4NL2 A;  4BI3 A;  3FRN A;  2XG8 D;  1ZHI A;  1ZUU A;  2DXB A;  2RK1 A;  3CC7 Q;  4LD9 K;  5GAN f;  5FRM A;  3CCR Q;  5GAN d;  1U3O A;  4C92 G;  3VV0 A;  5DLQ E;  2A7Y A;  1UGP B;  1YJ9 T;  3I5S A;  2JJ9 A;  1VQ7 T;  4J9I A;  3GPL A;  2SEM A;  4M7A F;  2VC8 A;  3M0T A;  2LJ0 A;  4LN2 A;  3CD6 Q;  3G4S A;  3UPU A;  3PVL A;  1BCO A;  4RCC A;  1Z9Q A;  5AT1 B;  2KR3 A;  4DBQ A;  4OB0 B;  1FX7 A;  2C0O A;  1MHN A;  1VQK Q;  3BE3 A;  2DTI A;  1X43 A;  2L89 A;  2O88 A;  3WVE B;  1AWO A;  1VQP Q;  2COW A;  4IUQ A;  3CME A;  3MEW A;  5LJ5 h;  2RH2 A;  1VYU A;  2D8H A;  3ZBD A;  2LJ1 A;  3EGX A;  1MNE A;  1WJS A;  5M9O A;  1RAC B;  3CCV T;  2OTJ Q;  2FHD A;  3TCJ A;  1M90 U;  1M2O A;  1NJI R;  1ZSZ B;  3SEM A;  3CCQ A;  1EIF A;  2JM9 A;  4HCC A;  1QMC A;  1NEG A;  4AFS C;  2PVG B;  4FW2 A;  2VB6 A;  4KUL A;  4KGX B;  1YNZ A;  8AT1 B;  1WDX A;  3QSU A;  2IVW A;  2EQI A;  1VQ8 T;  2RMO A;  2IPO B;  1M8M A;  2B86 A;  2BZY A;  3PFS A;  1WHH A;  2QEX Q;  1RAA B;  1X01 A;  1W6X A;  5LJ5 f;  2O4X B;  5IAY A;  3OS5 A;  5LJ5 d;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 4J9F A;  2RN8 A;  2L3Q A;  2DRK A;  2ED0 A;  1WLP B;  1V1C A;  1SHF A;  1N5Z A;  4JJD A;  4CC2 A;  1X2K A;  2EYY A;  3I5R A;  1ABO A;  3O5Z A;  1H92 A;  1K1Z A;  2CH4 A;  1AD5 A;  1E6H A;  1NG2 A;  2ROL A;  1W1F A;  2AKK A;  3QWY A;  1PKT A;  1XOV A;  1QCF A;  3RBB B;  1U06 A;  2KRS A;  3VRY A;  2V1R A;  2YDL A;  1OPK A;  4JZ3 A;  4CC7 A;  1JU5 C;  1YWO A;  1VYV A;  5IHK A;  1UUE A;  2BZX A;  2PTK A;  2EKH A;  1K0X A;  5I11 A;  2KRM A;  3TSZ A;  2SRC A;  2CH4 W;  1J3T A;  2DBM A;  2A28 A;  2L3P A;  2LQW A;  4OMM A;  4M4Z A;  1MV3 A;  1WA7 A;  2JMA A;  1M27 C;  1PWT A;  3M0P A;  2JTE A;  1S1N A;  3C0C A;  4OMP A;  2DL5 A;  2GNC A;  1RLP C;  1JXO A;  2RPN A;  3CQT A;  3EGU A;  1HJD A;  2EYX A;  1ARK A;  2KYM A;  2LP5 A;  2DRM A;  3M0R A;  2O9V A;  2JW4 A;  1KSW A;  4RTX A;  2CUB A;  3EG2 A;  3VS6 A;  1FMK A;  1B07 A;  3VS3 A;  2RQV A;  3FJ5 A;  1ZUK A;  2RQW A;  1UEC A;  1W70 A;  1I0C A;  3H0F A;  1PRM C;  4IIM A;  2EPD A;  2YUP A;  1ZUY A;  3NGP A;  1UHC A;  2GBQ A;  4GLM A;  1JO8 A;  2DBK A;  4OML A;  4ESR A;  2DL8 A;  1BK2 A;  1NYG A;  1HSQ A;  2X3W D;  5FWB A;  2LZ6 B;  1KJW A;  1SHG A;  4J9E A;  2DF6 A;  2VVK A;  4J9G A;  1OEB A;  1UG1 A;  4HXJ A;  1U5S A;  2HBW A;  2KT1 A;  3KFV A;  1EFN A;  2ROT A;  2FO0 A;  2MIO A;  2W10 A;  2DM1 A;  1WI7 A;  1SPK A;  1CKA A;  5IHN A;  4D8D A;  1AZG B;  4JJB A;  3VS1 A;  1UGV A;  2M0Y A;  1I07 A;  2RNA A;  2EW3 A;  2I0N A;  1OV3 A;  2EBP A;  3ULR B;  3QWX X;  4RTT A;  1JEG A;  1UJY A;  4RTW A;  1GRI A;  2L0A A;  4LUE A;  3IQL A;  1WYX A;  1VA7 A;  2CT3 A;  2K6D A;  2KXC A;  2K2M A;  2H8H A;  2EYZ A;  4R0K A;  2OI3 A;  3I9Q A;  1AWW A;  4CC3 A;  2O31 A;  1T3L A;  2KGT A;  2LQN A;  1RI9 A;  1K0S A;  4ORZ A;  3U23 A;  4AFU C;  2AZV A;  1KIK A;  3GBQ A;  2VKN A;  1ABQ A;  2DJQ A;  3UA7 A;  3M0S A;  5GJW B;  1X6B A;  1YWP A;  3R6N A;  4D8K A;  1QKW A;  3NHN A;  2AK5 A;  2P4R A;  2F2X A;  1NLP C;  2J6O A;  1YCS B;  2FRW A;  2V1Q A;  5FW9 A;  1A0N B;  1LCK A;  2LCS A;  1HD3 A;  2D1X A;  1X2Q A;  2KRO A;  1WFW A;  4WCI A;  4ZNX A;  2A08 A;  4FSS A;  5IH2 A;  1E7O A;  1YP5 A;  2GGR A;  4J9C A;  2KRN A;  2CDT A;  2J7I A;  1GBR A;  2RQU A;  3SHW A;  3H41 A;  5GJV B;  5EC7 A;  3EG0 A;  5IXF A;  1FYN A;  4HCK A;  4JZ4 A;  1PNJ A;  2G6F X;  2LX7 A;  2BTT A;  5HCK A;  2MCN A;  4DEX A;  4AG2 C;  1NLO C;  3ZL7 C;  2L3S A;  1SRL A;  1Y0M A;  3VS0 A;  2DL7 A;  4HVW A;  5IXB A;  1UHF A;  1AOJ A;  4A63 B;  2FRY A;  2FEI A;  1QLY A;  2FPD A;  2FG0 A;  3TVT A;  2DL4 A;  2NUZ A;  1WXT A;  2YUQ A;  3EHQ A;  4RUG A;  2AKL A;  2EGC A;  1AVZ C;  1NYF A;  2CSI A;  2DNU A;  2LJ3 A;  2FPF A;  3M0U A;  1GCP A;  2DYB A;  1UE9 A;  2JT4 A;  1BU1 A;  1K4U S;  1QWE A;  2K3B A;  2KEA A;  2NWM A;  2RQR A;  3EHR A;  5L23 A;  3LH5 A;  1SEM A;  3UAT A;  2CSQ A;  2M51 A;  3TSW A;  2YT6 A;  2O9S A;  4OMO A;  3M0Q A;  1AWX A;  3RNJ A;  1K9A A;  2D8J A;  3VS7 A;  1OOT A;  4RTY A;  2HCK A;  2GQI A;  4QT7 A;  5I22 A;  4LUD A;  1GFC A;  1GFD A;  1T0H A;  1IO6 A;  2C0I A;  2HSP A;  3EG3 A;  3UF4 A;  4HVU A;  2BZ8 A;  1T3S A;  4J9B A;  1YN8 A;  1MV0 B;  2EYW A;  2OAW A;  1PRL C;  1MUZ A;  2YUN A;  2DVJ A;  3THK A;  2KXD A;  4RTZ A;  1NEB A;  2CT4 A;  2DMO A;  1WX6 A;  2LNH B;  2O2O A;  2KNB B;  1GBQ A;  1OPL A;  1TUC A;  1UDL A;  2DE0 X;  4OMN A;  3REB B;  2ECZ A;  1BBZ A;  2MOX A;  2W0Z A;  4J9H A;  3VS4 A;  2JM8 A;  2DX1 A;  1GL5 A;  2PZ1 A;  1VYT A;  2HDA A;  4JJC A;  5ECA A;  1AZE A;  4Y92 A;  2J6F A;  1ZBJ A;  2CUD A;  1GCQ C;  2A37 A;  1M3C A;  1B3Q A;  1RUW A;  2ENM A;  1RLQ C;  1E6G A;  1NM7 A;  2EGA A;  2JXB A;  2VWF A;  3I35 A;  1CSK A;  2J06 A;  4Z88 A;  3NMZ C;  4K11 A;  1X6G A;  2IIM A;  2KYB A;  3VS5 A;  2DL3 A;  3H0H A;  2RQT A;  2K7A A;  1G2B A;  2OJ2 A;  1PHT A;  4Z89 A;  1Z9Z A;  1Y57 A;  2EGE A;  2C0T A;  2ESW A;  2DIL A;  4EIK A;  4GBQ A;  2YUO A;  1GCQ A;  2K79 A;  3PE0 A;  1I1J A;  4RTU A;  3EG1 A;  2JS2 A;  2F2W A;  4CC4 B;  2CRE A;  2AZS A;  3H0I A;  1BB9 A;  2HEQ A;  1ZX6 A;  1WXB A;  1ZUU A;  2E5K A;  2QDL A;  3A98 A;  1KFZ A;  2GTJ A;  2YSQ A;  2GTO A;  1WIE A;  1T0J A;  1H8K A;  1U3O A;  3JV3 A;  1TG0 A;  3PVQ A;  4HVV A;  3I5S A;  4J9I A;  2KBT A;  4F16 A;  1M3B A;  2K9G A;  2SEM A;  5IHI A;  2ED1 A;  3M0T A;  2LJ0 A;  4LN2 A;  3VRZ A;  1QKX A;  2DA9 A;  1UFF A;  1JXM A;  3PVL A;  2FPE A;  1Z9Q A;  4KRT A;  2KR3 A;  4LE9 A;  1SRM A;  2PNI A;  3REA B;  5FWC A;  4LNP A;  1QWF A;  1M30 A;  2C0O A;  4J9D A;  2JMC A;  2D0N A;  1X43 A;  1AWJ A;  4F17 A;  2O88 A;  4JPB W;  1AWO A;  1UTI A;  1M3A A;  2ABL A;  1K76 A;  1CKB A;  1ZSG A;  2RF0 A;  1TUD A;  4DEY A;  2JS0 A;  3UA6 A;  1VYU A;  2D8H A;  2L2P A;  2LJ1 A;  2A36 A;  1WXU A;  1ZLM A;  2XMF A;  4AFQ C;  1AEY A;  2J05 A;  2EVR A;  2DLP A;  3VS2 A;  1UJ0 A;  2KE9 A;  4IIO A;  4E6R A;  3SEM A;  2F2V A;  1X27 A;  1X69 A;  3NPF A;  4RTV A;  2JM9 A;  2J6K A;  1NEG A;  4AFS C;  2X3X D;  1JQQ A;  4OMQ A;  4X1V A;  1YNZ A;  4AFZ C;  1WDX A;  2KT8 A;  2EQI A;  4AG1 C;  4Z8A A;  2RMO A;  4F14 A;  1G83 A;  1M8M A;  2B86 A;  1PKS A;  2BZY A;  1H3H A;  1SSH A;  1W6X A;  2LMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...