1I1JA

Structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
106
Chain Sequence
GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords MELANOMA DERIVED GROWTH REGULATORY PROTEIN
total genus 21
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i1jA00
1V1CA 3M0PA 4AFQC 1CKAA 2EGCA 4J9DA 1OOTA 4HVWA 1K0SA 1CSKA 1NEGA 4DEXA 1SPKA 1Y57A 2DL5A 2O2OA 2OJ2A 2FG0A 1I07A 1GRIA 2FRWA 4J9IA 1FMKA 4HCKA 2RF0A 2YDLA 3VS4A 1AWWA 1JXOA 3CQTA 3SHWA 2EVRA 4IIMA 1AD5A 2RQVA 1H92A 4JPBW 2KR3A 2LJ0A 2YUNA 2HSPA 4AFZC 2L3SA 1PWTA 4OMQA 2LX7A 2RQWA 3PVLA 3THKA 3VS6A 2EKHA 4AFSC 2RNAA 3VS2A 1HSQA 2CH4W 4D8DA 5I22A 2PTKA 2YUQA 2C0OA 5EC7A 1H8KA 4CC3A 2KBTA 1K1ZA 1WXTA 3RNJA 3UF4A 1WDXA 3SEMA 2I0NA 2LP5A 1U3OA 1PHTA 3REBB 4Z88A 2K9GA 1B3QA 1UJYA 3U23A 1K4US 2X3WD 1ARKA 4LUDA 2DVJA 4QT7A 1FYNA 1XOVA 4J9BA 3KFVA 3M0QA 4A63B 2K3BA 2DL4A 2KXCA 1PRMC 2AZVA 4D8KA 2F2WA 2BTTA 2QDLA 1BBZA 3EG0A 3VS3A 1YN8A 2RPNA 1LCKA 3JV3A 2G6FX 3M0SA 1SHFA 1HJDA 4LE9A 2DBMA 1NYFA 1OPKA 1UHCA 2DL3A 3NHNA 1WLPB 2RQUA 1GCPA 1X2QA 2J6FA 1ZUUA 3H41A 1NEBA 1I1JA 2DA9A 2DLPA 3VS0A 3H0IA 2CT3A 4OMNA 1AWJA 2YUOA 1T0JA 1AZGB 4Z89A 4K11A 2DL8A 3IQLA 4AFUC 2ABLA 4DEYA 2XMFA 3VRZA 1WXUA 1JU5C 2HCKA 4GLMA 1PNJA 2MOXA 3QWXX 1QWFA 4OMLA 4AG2C 1J3TA 2FPFA 2A08A 2DBKA 2DL7A 3I5RA 1W70A 2FRYA 3VS1A 3NPFA 2CUBA 2LJ3A 1M8MA 2KROA 1RLPC 4F16A 1GFCA 1WYXA 1WA7A 4X1VA 2J06A 2KNBB 2DMOA 4FSSA 1Z9ZA 2KXDA 1T3LA 1RUWA 1QLYA 2RQTA 2JM9A 2PZ1A 2W0ZA 1UECA 1WX6A 1YWPA 2JMCA 3O5ZA 3ZL7C 2D8JA 2DNUA 1A0NB 2CT4A 1G2BA 3PE0A 3NGPA 1G83A 4J9FA 2RQRA 2H8HA 2KGTA 2D8HA 2DJQA 4JJDA 2RN8A 2ROTA 2ROLA 2D1XA 4WCIA 4ESRA 3ULRB 1M3CA 2O9VA 2KT8A 1QWEA 1I0CA 2X3XD 3UATA 3I35A 2ED0A 1MV0B 1ZUYA 1TUCA 2E5KA 4JJBA 1RLQC 4R0KA 4RTTA 2L3QA 2K6DA 2EYZA 1KSWA 1UHFA 5GJWB 2JMAA 1YNZA 1M3BA 2L0AA 3PVQA 2DM1A 1U06A 1K76A 1ABQA 2GQIA 4Y92A 1X27A 5HCKA 3VS7A 1Z9QA 4RUGA 3UA6A 2CDTA 2NUZA 2K7AA 3REAB 4EIKA 1BB9A 4JZ4A 3M0UA 2JXBA 1SSHA 1JQQA 2CSIA 2DRKA 4GBQA 4M4ZA 1IO6A 1AZEA 1ZUKA 2JTEA 2MCNA 1ZX6A 4OMMA 2O9SA 3H0HA 1M3AA 2CUDA 3I9QA 1X2KA 1GCQA 3QWYA 2J6OA 1UDLA 1VYUA 5IXBA 1SRMA 1T3SA 2W10A 4LUEA 2EYXA 5GJVB 2KYMA 2KRSA 4F17A 3C0CA 2KYBA 2DRMA 2LZ6B 4AG1C 2O88A 3M0RA 2GTJA 1OPLA 1W6XA 2HDAA 2EGEA 2LQNA 2EW3A 4E6RA 5L23A 1YP5A 2KRMA 2LQWA 2O31A 2DX1A 1AEYA 2C0IA 2AKKA 2HBWA 1H3HA 3M0TA 2KRNA 1SRLA 1BK2A 2RMOA 1UE9A 2DF6A 1UJ0A 4OMOA 1NM7A 2JS0A 3EG1A 4ZNXA 1GFDA 1E6HA 1X43A 1KJWA 1MV3A 2JW4A 2M51A 2EQIA 1NYGA 2V1RA 1TUDA 1VYTA 2IIMA 5IHIA 2LJ1A 2VKNA 1AOJA 3RBBB 1VA7A 1OV3A 2FPEA 4J9CA 2BZYA 1CKBA 5IH2A 2J6KA 1GBRA 2J7IA 4F14A 2CREA 1SEMA 2KT1A 1YWOA 3VS5A 1WI7A 4CC7A 5IXFA 1QKXA 4OMPA 3NMZC 2YSQA 4J9EA 2JT4A 4RTYA 2OI3A 2EGAA 1GL5A 2AKLA 5FW9A 2EBPA 1UUEA 2GNCA 3FJ5A 5IHKA 3TVTA 2YUPA 1GCQC 2F2VA 1WFWA 1GBQA 1JXMA 4HVUA 2A36A 1AWOA 2ED1A 2A37A 5IHNA 1WIEA 5FWBA 4RTZA 4LN2A 2JS2A 2FO0A 4ORZA 2GGRA 1YCSB 2SRCA 2AZSA 2CSQA 2ESWA 1KFZA 4IIOA 2EPDA 2M0YA 2J05A 2LCSA 2BZXA 4HXJA 2ENMA 2P4RA 3EHQA 1NG2A 2CH4A 2FPDA 2KEAA 1JEGA 1X6GA 1TG0A 1E7OA 2FEIA 4LNPA 1AVZC 5I11A 1T0HA 2LNHB 2DILA 2C0TA 1OEBA 1ZLMA 2K79A 2D0NA 3A98A 3GBQA 1E6GA 1M27C 1Y0MA 2V1QA 4HVVA 3I5SA 2K2MA 1B07A 4J9HA 2A28A 3EG2A 1RI9A 1UTIA 1BU1A 1PKSA 2F2XA 1UGVA 2SEMA 3EG3A 1MUZA 2HEQA 5FWCA 2DE0X 4CC2A 1U5SA 1AWXA 3H0FA 3LH5A 1M30A 1S1NA 1QCFA 2AK5A 2BZ8A 2KE9A 3TSZA 1ZSGA 2GBQA 1JO8A 2OAWA 4JZ3A 1W1FA 1ABOA 1ZBJA 1X69A 1KIKA 2GTOA 1PKTA 2YT6A 4RTVA 1K0XA 1UG1A 1WXBA 3EHRA 2ECZA 4JJCA 4RTUA 1VYVA 1SHGA 2JM8A 4KRTA 2L3PA 1HD3A 2VVKA 4J9GA 3TSWA 1K9AA 5ECAA 1EFNA 2DYBA 2NWMA 1UFFA 2VWFA 1X6BA 2L2PA 1N5ZA 4CC4B 1NLPC 3VRYA 4RTWA 2EYWA 3UA7A 2B86A 4Z8AA 2PNIA 1NLOC 3R6NA 4RTXA 1PRLC 2EYYA 3EGUA 2LMJA 1QKWA 2MIOA
chains in the Genus database with same CATH superfamily
3QDRB 1Q95G 4XTXA 1NPRA 4J9DA 4HVWA 1QMCA 4ZTJA 2BKDN 1KD1U 1K0SA 1CSKA 1VQ6Q 2DD5A 4II1A 2LT4A 4BI4A 2EIFA 2I2LA 5HKCA 1K9MR 5LJ5e 1Q81U 2KSSA 3OB9A 1YI2Q 4XTYA 3INZA 2RF0A 1TU0B 3SFMA 1N8RC 1YJNA 3CD6T 2EKOA 1VQ5T 5LL6S 1JJ2S 3EG9A 4C8QE 2KR3A 2LJ0A 1VQPT 4KGVB 1HYOA 4M77C 4AFZC 1M1KC 4A53A 4M78A 2L3SA 1PWTA 1VQ6A 3I55T 2RQWA 3ZFJA 4J7IA 4OF1A 4IUPA 4GLKA 2RNAA 3VS2A 3OS5A 3VKIA 1MMNA 3LW5E 2CH4W 1N9RA 2L3RA 4OB0B 1FX7A 4HCZA 1K1ZA 1WXTA 4Y28E 1VQPQ 2M9UA 3PNWC 3BFMA 2I0NA 5J26A 2LP5A 3L2RA 3JCMJ 1ZSZC 1U3OA 1WHJA 3EFRA 4M75A 4M7AG 2DPPB 3REBB 4F7UB 2RI3A 1VQ5A 1ACMB 2WSFE 3VYGA 5GAOm 1WJQA 2VB6A 3DB4A 1KK7A 1QP2A 2K3BA 3CCQT 1PRMC 3CCUQ 3FIFA 2X4YA 4FW2A 2QDLA 2RPNA 2LDMA 2G6FX 5CO7A 1HJDA 4LE9A 3NHNA 8ATCB 1WHGA 2PVOB 1WLPB 1GCPA 3A8HB 4ELZC 3OYLA 3H0IA 3HL8A 2CT3A 1IRXA 1WNLA 1EIFA 3KUFA 4N4GA 2LX9A 1NBEB 3FJPA 4HT9A 1YIJA 2XMFA 4PFPA 4M78G 3PIPA 1TOVA 4HCBA 2QAZA 1QWFA 1KQSP 1J3TA 2DIQA 2A08A 4HCCA 2K5LA 3JCMg 4M78E 3VS1A 4XU1A 1VQKT 1M8MA 3OW2A 4J6WA 2DJZA 5I2SA 2J06A 3A8OB 4JRQA 3QSUA 2KXDA 2PZ1A 1WX6A 4E7LA 3O5ZA 3ZL7C 3GNFB 2KI7A 3MP8A 3O8VA 4PJOD 1A0NB 2CT4A 3CC2Q 4NS5A 4R55A 1OZ2A 3PE0A 1D0ZA 2D8HA 2DJQA 2RN8A 2ROLA 5DM7R 1TXQA 1N27A 3ULRB 1M3CA 4GY5A 2PUKB 1W2BP 3OYMA 2VGMA 3I35A 1ZUYA 2FHDA 3QJ6A 2QA4Q 1RLQC 4R0KA 3L2VA 1R0BG 5LJ3j 3OS1A 1K8AC 3TQ7P 1BI0A 1EX4A 1KSWA 5GJWB 3PIOA 1VQ5Q 4X9DA 3ME9A 4A4KA 3OA6A 3LGLA 3M4YA 2MWPA 4PK4A 3PVQA 4QW2A 5CR2A 2YRVA 2RHUA 3CCMT 4Y92A 2HQXA 3M56A 4CRIA 3OYAA 1OX8A 4OVAA 2DZ9A 5GAN8 3REAB 1VQ8T 4FIBA 1RADB 1JQQA 2CSIA 1VQKA 1WQ7A 2EQMA 2R57A 3M53A 4M4ZA 2DVEA 4J5YA 1PG5B 4EDUA 3CCEA 3GNGA 3I9QA 1X2KA 3CMAA 1GCQA 2ZPFB 5HK0A 5IXBA 5GMKe 2MK5A 5GAOn 5GAMe 3NFCA 3OMGA 3JCMc 5KYUB 3CCQA 1P92A 5CQXA 2EYXA 4KULA 2ZPHB 2YLCA 4C8QD 3FEOA 2DRMA 1VQ9T 2LZ6B 4AG1C 1LPLA 2HL3A 2HNIA 5LJ5j 2FB7A 3JCMQ 5CKEA 2RK2A 4HKEA 5CVIA 3RR6A 2EGEA 2LQNA 2OX7A 1UGPB 1G3WA 4C0FA 3MHXA 3PTAA 1MGQA 1RAEB 2DX1A 5A0GA 3QYGB 1VUBA 3CCUT 1WPYA 3M0TA 4XTVA 1WHKA 4M75F 3JCMh 1BK2A 1XQHA 2DF6A 2JUFA 4M7DB 2JW4A 4A4HA 2EQIA 2V1RA 4RCBA 1B34A 4PJOA 1MMGA 1VYTA 3GPLA 5J3BA 2HQHA 4ELYC 1AOJA 1ZA1B 2DXTA 3RBBB 2FL7A 1OV3A 4PLIA 1MNEA 2RI5A 1VQMA 2OTJA 2BZYA 1CKBA 5KYWB 2J6KA 1QVGA 1PD1A 4F14A 2CREA 5CCAA 2FZKB 3I55A 3LX7A 4UC4A 2XHCA 3X20B 3AT1B 1QKXA 4LD9K 4OB2B 3GIBA 2OI3A 4C92E 3RESA 2XKOC 1OU8A 5FW9A 5GAMd 2EBPA 4MMKA 1YJWA 1UUEA 1IZ6A 1K9MU 8AT1B 5GANj 4IUVA 2K5FA 4BY6C 2F2VA 4C92G 2ED1A 1YI2T 5IHNA 2JVVA 5FWBA 2CP0A 4LN2A 3CMET 3A8MB 2FO0A 1YITA 3EH2A 1YCSB 2IPOB 1EZZB 2CSQA 1C6VX 1KFZA 1VIEA 2M0YA 3V8KA 2LCSA 4C92A 4ZN3A 2QA4A 2CH4A 1Y96A 3J80E 2P0QA 5GAN3 3OW2S 4JDSA 1OQKA 2KK4A 2C0TA 2K79A 2QASA 3A98A 2WACA 4XTUA 2RJDA 2QDYB 2V1QA 2K57A 1G8XA 2QEXT 3EG2A 4IKFA 3EFSA 4C8QA 1PKSA 4BACA 4XTZA 1UGVA 3EG3A 1VQNA 3L42A 2HEQA 5FWCA 3DLMA 4CC2A 1AWXA 4MZMA 5LJ5g 4F7UE 3OYNA 3VYHB 3UWNA 2AK5A 2X9HA 1QVFA 3PMTA 2EJFA 1ZSGA 1JO8A 2P4TA 2RO0A 4C5EA 4F7UG 1W1FA 3P8BB 4RCCA 4BY6B 4E7HA 1ZBJA 1X69A 2LRQA 4KBMB 4RTUA 4L6V5 2RJEA 2JM8A 4KRTA 4J9GA 3JCMV 2R58A 2KAFA 1EFNA 2DYBA 1SG5A 2NWMA 4ATOA 4E7SA 4QVCA 1BI1A 2B86A 2PNIA 1W2BS 3JB9J 1Q7YR 3EGUA 4KUIA 3OMCA 1V1CA 3M0PA 4AFQC 2EGCA 4C92D 1U1SA 4BD3A 2DL5A 2PVDB 2OJ2A 3R6OA 4JLGA 1I07A 1GRIA 2FRWA 5C0MA 3F70A 1FMKA 4OP0A 2LC4A 3OBYA 2YDLA 1AWWA 3CQTA 1UGQB 4N0AC 2EVRA 3EFOB 4IIMA 1AD5A 2RQVA 4JPBW 4E7ZA 1KD1C 5GANg 5CAIA 5FRNA 3BW1A 3PVLA 2QQRA 4AMCA 4AFSC 2DXCA 5KYXA 2CZ1B 2OAUA 3RMQA 2PTKA 2XG8D 3CCVQ 1M2VB 5EC7A 1H8KA 1Q86R 2KBTA 1Y71A 4IURA 4PFZA 3SEMA 2V8IA 1UGRB 4Z88A 1B3QA 2DIGA 2V26A 1WHHA 2RJCA 1JBMA 3A8LB 4LUDA 4QT7A 1FYNA 3OS0A 1YITT 1OZ3A 2YHTA 3KFVA 5GAMf 4ANJA 3X26B 3G4SA 2QXFA 3FLGA 2KXCA 4QVZA 3MJXA 3HFOA 2BTTA 2DERA 1BBZA 3VS3A 1LJOA 1YN8A 4C92C 2MWOA 3M0SA 2DBMA 1NYFA 1UHCA 4A4FA 2CGHA 3RKXA 4P5NA 2VGNA 4MDXA 2RQUA 4JRIA 2HQEA 2NUPA 2DTHA 1WJRA 1NEBA 3E2UA 3OYYA 1JRIA 5GAN7 3CCVT 4OMNA 1AWJA 1M1GA 4J7FA 1XJWB 1OX9A 4DBHA 5GANh 4PJJA 1I8FA 2DL8A 3IQLA 4AFUC 2ABLA 4XU0A 4DEYA 3CCRQ 3CCMQ 4M77D 2M1HA 1YHQT 2E6ZA 2HCKA 2X4WA 1KQ2A 1VQPA 5GANf 3OYKA 2HBPA 5CIUA 1VQ7T 3V8LA 3CPWS 1W70A 4RG8A 1OULA 2NUTA 3J7AF 1WQWA 2Y90A 2LJ3A 3JCMX 3J81E 2ZPIB 4IUUA 1QP3A 1YIJT 1GFCA 1WYXA 4M75C 2G3RA 4VUBA 5IN1A 1QW1A 3SWNC 2RQTA 2YWWA 3MP6A 2BUDA 2JM9A 2W0ZA 1JB0E 4JS5A 3CPWA 1U8RA 4F7UF 5GANe 1TH7A 4J83A 1GXIE 3JCMb 4M7AF 1M1KU 2E41A 4M7DA 2PQWA 4J9FA 5GMKj 2KGTA 2P84A 4ZN1A 4B9XA 3P8HA 5KYXB 1BKBA 3H8ZA 4OGEA 4O5VA 2FZGB 1FMVA 2RHIA 1QWEA 2JNGA 1I0CA 2X3XD 5LJ5h 2ZCFB 3UATA 1YJ9A 2E3IA 2E5KA 4JJBA 2L5QA 3JRZA 4OB1B 4RTTA 3CCET 1M2OA 5LJ3g 1X75C 2K6DA 5FU7C 2EYZA 2DO3A 2F5KA 2HKNA 1VQMQ 1D3BA 1G3TA 2DM1A 3CCJQ 1U06A 3HRSA 2CKKA 5CQYA 3G4SQ 3G4ST 3OBWA 2B8AA 1D09B 1W2BA 1M9SA 1YJ9Q 1VQMT 3QPHA 2NUZA 4HT8A 2K7AA 1BB9A 3EGXA 3M0UA 3V7SA 3TCJA 1SSHA 4GBQA 2HZYA 3AHUA 1IO6A 3MEWA 1QVGS 3G7ZA 1HK9A 1ZX6A 2O9SA 1PD0A 1SRMA 4WF2A 4ZTFA 5KE3A 1PC0A 2O4XA 4LUEA 3CMEQ 2KYMA 4XU3A 4F17A 4QQ6A 3SDZA 2AT1B 2O88A 3M0RA 2GTJA 3FC3A 1W6XA 2HDAA 2QQSA 3BDUA 1QVFP 2EW3A 5L23A 1YP5A 2KRMA 3CD6A 2RJFA 2LQWA 2O31A 1JJ2P 4C0DC 2ZPBB 2ZAEA 5KYYB 2KRNA 5GMKh 1SRLA 2DTOA 2RMOA 4PJOE 1UJ0A 4C0GA 3JCMd 1NM7A 2JS0A 2K2VA 5GANd 4QVDA 2KY9A 1Q7YU 4CI0C 1KJWA 3ZEHA 3UT1A 5GAMg 3RMSA 4M7AB 1NYGA 1OYXA 3CMAT 3OYHA 2IIMA 2JJ9A 4LD6A 5IHIA 3ASKA 3X24B 1VA7A 1N8RR 4C92B 5GMKm 1MMAA 3CD6Q 2FPEA 4C8QF 1GBRA 4PNOA 2J7IA 1K9MC 4EMKC 3QKJA 4XAXB 2NLUA 3P8DA 1SEMA 1YFNA 1D1AA 4YTLA 3VS5A 2QK0A 5IXFA 4FCYA 2KDSA 3NMZC 4OMPA 4J9EA 3MCAB 1PSFA 3VUZA 1YJNQ 2XDDA 1TUGB 1Q82R 1N9SA 4A54A 3VV0A 1GBQA 3EFOA 3SB2A 4HVUA 3VU3C 1Q86U 1WIEA 3JCMf 2QQBA 3S6WA 3OY9A 4FT4A 4ORZA 3PGGA 5I21A 1WHMA 1NPPA 2AZSA 2EPDA 5CK9A 4JJNK 2BZXA 3OSSC 2ENMA 3HRUA 2CP5A 1VQ4Q 3HHTB 3OSVA 1TS9A 4M7AC 4C5HA 1JEGA 1X6GA 4M77A 4J8OA 4LNPA 1VQOQ 4Q5WA 3WXMB 4E2FB 1T0HA 2Z0WA 1ZLMA 3KBGA 2D0NA 2LVMA 1M27C 5CKBA 1Y0MA 2X4XA 4HVVA 3I5SA 2KQWA 2DYIA 4J9HA 2A28A 1RI9A 1K8AU 2SEMA 2EJGA 2OTLT 2MYSA 2DE0X 3X25B 3PMIA 2E6NA 4WTOB 4BE1A 1M30A 4M77G 2EJ9A 4E7KA 1K8AR 2BZ8A 1R0CB 2KE9A 4FW1A 4XK8E 3DKMA 5LJ3f 5IAYA 3QIIA 5GAN6 2CP6A 3MEAA 2GTOA 4M7DF 3EHRA 1FMWA 2ECZA 3L2ZA 1U1TA 2DXUA 3M59A 2GFAA 3TU4K 1K9AA 2VWFA 2COWA 1UFFA 1VQLT 1N5ZA 1NLPC 1D1CA 1K73U 3UA7A 1KQSA 3QHSA 2DEUA 3R6NA 1PRLC 1RAAB 1QVPA 2MMPA 5D6XA 3CC2T 2RHYA 2RH2A 2Y4YA 4PJLA 3M4GA 5GAOr 1OOTA 1Y96B 2KMTA 2DZCA 3RIRA 1NEGA 1RI0A 1Y57A 2O2OA 1S72A 3CBPA 3T9NA 4M75G 3CC4A 4C5IA 1PM3A 4J9IA 4KT0E 3MEVA 3HSBA 1JXOA 3N5BB 2CZ0B 3HTRA 1VQKQ 3CCSQ 1H92A 3EGXB 3QZ5B 3NTHA 2YUNA 2P0PA 2O01E 4M78C 1D0XA 2LX7A 2K3XA 3C12A 3RERA 4PJOF 1QVGP 3OS2A 2EKHA 1V76A 1S72Q 3M5AA 4Y91A 3CCRA 1D3BB 3PT9A 4N0AA 2QTVA 5I22A 2C0OA 2VYTA 1B7TA 2D6FA 1BI2A 3RNJA 1WDXA 2QQAA 5IT9E 2LTOA 3CXCA 2PU9B 3CCST 4EMKA 2CS7A 2DKGA 3U23A 1X6OA 1ARKA 2DVJA 4J9BA 4R56A 4A63B 3JCMW 5FU7B 3HKSA 2EYQA 4PJMA 5FLXE 1XNIA 1LCKA 3S3NA 2FVUA 5HY6A 4NOYA 4QQGA 4BI3A 2CP2A 4X9CA 2J6FA 1ZUUA 2A3LA 2BE9B 3CEYA 1I1JA 2DA9A 5GAN5 3QBYA 3QDFA 4JRKA 1T0JA 1AZGB 4Z89A 2M16A 3CC7T 5KE2A 3Q1JA 5KCHA 1IGQA 4IUTA 3GP8A 1YIJQ 3VRZA 1WXUA 2MI6A 1MHNA 1IGUA 1JU5C 3LGFA 3CCLQ 4EMHA 5FROA 1PNJA 2EQUA 2MOXA 4AG2C 2E1HA 2FPFA 2DBKA 2DL7A 3OYJA 4DBQA 3CC2A 2K5IA 4DOWA 3L2QA 2FRYA 2H3EB 2L8DA 4M77E 1ZSZB 4LDYA 2CUBA 1YHQQ 2CZ6B 2KROA 4F16A 1KQ1A 2MF2A 3JB9F 1WA7A 4X1VA 3RKYA 2KNBB 5M9OA 2DMOA 2K4YA 4FSSA 3LWIA 1RAHB 1TTHB 1T3LA 1QLYA 2EAYA 5FU6C 3LWHA 5GAN2 2JMCA 1VQ7A 2D8JA 4BE0A 2DNUA 4JRPA 4DBRA 4M7AE 3BE3A 1F1BB 1W4SA 1KHCA 2H8HA 1VQ4T 2X4JA 3OYEA 4M77F 1VQ9Q 4XU2A 1HXDA 4M7AA 4ESRA 5GMKl 1KC8R 4M7DE 2QEXA 1K73R 2E12A 2KT8A 1RAFB 2BIVA 3FDRA 2ED0A 1MV0B 1TUCA 2FYKA 3GOXA 4MDWA 2L3QA 2GQVA 3MO8A 2JMAA 1VQ9A 1M3BA 2A0FB 1DJ7B 1KG1A 2L0AA 2QG9B 3M54A 2GQIA 5LJ3h 1VQNT 4M7DC 1X27A 4HA8A 3VS7A 3TEEA 3A1PA 4AT1B 4RG2A 3I56T 3RDVA 5LJ3d 1ZA2B 9ATCB 2X35A 2DEQA 4DA4A 1OU9A 3JB9H 1M90U 3SWNA 1FWZA 2JTFA 4JUVA 1ZUKA 3L2UA 2QA4T 2JTEA 4OMMA 1M8VA 4J6XA 4B6MA 3H0HA 4BDYA 2YXYA 2COYA 2CUDA 5AYFA 2J6OA 1UDLA 1VYUA 2NUPB 1WHLA 2ZPGB 1T3SA 2W10A 3CC4T 5GJVB 4DOVA 2KRSA 4L5GA 4PL6A 3C0CA 1Q82C 5J39A 5FU6B 1Q81C 4NL3A 4C8QG 1OPLA 2V8KA 5KYWA 5LJ5f 5FRMA 1VQLA 2C0IA 2AKKA 2HBWA 3H9NA 3OYDA 3EH1A 1H3HA 1NZ9A 3I56Q 2XD0A 1N6AA 4C0DB 1O9SA 1KHIA 4OMOA 1WZOA 1RL2A 4ZNXA 3CCLA 1GFDA 2RI2A 2DD4A 1E6HA 1X43A 2PUOB 4XTWA 1MV3A 2LCLA 2VXFA 3E9FA 2M51A 4IUQA 3FB9A 2VV5A 2DXBA 1I4K1 1IHWA 2LJ1A 4M77B 4J9CA 5D7UA 3JAME 3EAEA 5IH2A 2QTXA 3H6ZA 1AT1B 2QEXQ 1WGSA 1S72T 3JB9G 2KT1A 2JOYA 3JCMe 5DLQE 3CCJT 1X01A 1WI7A 4CC7A 3CBMA 4E7JA 2EQKA 2YSQA 3OYBA 2EGAA 3LYIA 2YLBA 3CXCP 2GNCA 3PFSA 2DTIA 2OTJQ 1R8OB 2O4XB 3EG9B 5IHKA 4J6YA 4M78F 3TVTA 2WSCE 5KCOA 4E47A 3GLXA 4RTZA 2JS2A 2JN0A 2CZ7B 3HFNA 2ESWA 4QKUA 4O6JA 3G1JA 4ZGJB 4HXJA 4D6WA 1NG2A 5AT1B 3HPWA 4RMOA 2IVWA 2KEAA 1OI1A 4N4IA 4XQ3A 2F5TX 2E65A 2VXEA 1H3ZA 5GAOl 1C0MA 3OQ5A 3CMAQ 1IB8A 3E1SA 2XI9A 2L89A 4FT2A 4KH0B 1E6GA 4QQDA 3CCLT 4KUDK 1YCYA 1UTIA 1BU1A 3CC7Q 3CC7A 4C5GA 3CPFA 2HAXA 1Y07A 1U5SA 5KYYA 1I81A 4C8QB 3H0FA 3LH5A 5CKHA 1S1NA 1QCFA 4M75D 5A0DA 1D0YA 2GCXA 1B34B 3TSZA 2OTLQ 3MKDA 2GBQA 2OAWA 3G6ET 2BE7D 1ABOA 2LQ8A 1G3SA 3URGA 4BE2A 1KIKA 1PKTA 4RTVA 1UG1A 1ZHIA 5LJ3e 3RUXA 1VQ6T 3OYIA 1HD3A 2V8JA 2VVKA 1ZSZA 2H3JA 2RD1A 3VRYA 4LDVA 5LJ5d 1QQJA 2OTJT 4Z8AA 4RTXA 2XK0A 2LMJA 1QKWA 2MIOA 1CKAA 1LOJA 1PCXA 4DEXA 3D7SB 1I5LA 1YBYA 1SPKA 3V7RA 3DLLA 1C1AA 3CCUA 2FG0A 2F69A 3A8GB 2HMAA 2RB6A 4HCKA 2A7YA 3VS4A 3SHWA 3CCVA 1BIBA 2LQKA 1YJWQ 2M02A 1NE8A 2EWNA 1VQ8Q 2CP7A 4EMGA 2HSPA 1IXDA 4OMQA 2C06A 2KVQG 3THKA 1AHJB 1WJSA 2DFUA 3VS6A 4ZGDB 3CCJA 3G71T 4KGXB 1HSQA 4N4HA 4D8DA 2YUQA 4BUGA 2DETA 3QJYA 2GFUA 4CC3A 2EFIA 3UF4A 2LT1A 4F04B 2P0KA 1IREB 3QZ9B 1RAGB 1VOMA 2HD0A 1Q81R 1PHTA 2ATCB 2VC8A 2K9GA 1UJYA 1K4US 5KH6A 1TWBA 2X3WD 2JTMA 1XOVA 1QVFS 3M0QA 2XIDA 2DL4A 1YI2A 3CC4Q 2AZVA 1BYMA 4D8KA 4OMFB 2HL5C 2AIRB 2QGFB 2F2WA 1K73C 1RACB 3CMEA 3GF5A 3CCMA 1MNDA 3EG0A 3JV3A 3CCSA 1VIFA 1SHFA 1OPKA 2DL3A 2NUTB 1M4ZA 1X2QA 2XDPA 2YRCA 4ME7A 1Q86C 3H41A 2RHZA 3SWNB 2DLPA 3VS0A 4BB7A 3CPWP 2E70A 2YUOA 7AT1B 2DAQA 4OGCA 1IHVA 3G71A 4K11A 3G71Q 1VQNQ 3EGDB 2IG0A 1V29B 4GLMA 4DBFA 3QWXX 4OMLA 3C95A 1UGSB 3NTIA 1VQOT 1G5VA 4DQ2A 2HKQB 1MMDA 2X51A 3I5RA 5GAN4 1D1BA 3NPFA 1YJ9T 1RLPC 1Y7XA 4FL6A 1N8RU 4FU6A 1KC8C 1Z9ZA 1RUWA 1LVKA 3E19A 2HSEB 4FYYB 4BDZA 4LDXA 1UECA 1YWPA 2E5QA 1XTDA 4MMLA 1Q7YC 2K3YA 3OYGA 5C6SA 1G2BA 3NGPA 1G83A 2RQRA 3BY7A 4C8QC 2JZ2A 1TSFA 3QO3A 4JJDA 4LDUA 4PJOB 2ROTA 3M9QA 2D1XA 4WCIA 4E7IA 2VASA 4JLIA 1M2VA 3CCQQ 1BCOA 2O9VA 5EG2A 2D0QB 4PJOG 3LH0A 3QXEB 4RKUE 3G6EQ 1UB4A 4F7UA 3UPUA 4M75B 5CKFA 1VQ4A 3JB9D 4PJNA 3CBOA 1VQ8A 3DB3A 1UHFA 3KXTA 1NJIU 4EPCA 1YNZA 3L2WA 3M57A 1YHQA 2XICA 1K76A 1ABQA 3META 3V7CA 5HCKA 1Z9QA 2QGGA 3I55Q 4RUGA 5KYUA 3UA6A 3VJPA 3MPUB 2CDTA 5D6YA 3JSCA 4EIKA 1VQ7Q 4JZ4A 1ZQ1A 2JXBA 2DRKA 3QG1A 1BCMA 1AZEA 5A2QE 3C94A 3L1AA 4MZTA 2MCNA 1M3AA 2FZCB 3QWYA 3CCRT 1SSFA 1O75A 4PJOC 1H641 3EGDA 1M1FA 2XU8A 4B9WA 5GAMj 6AT1B 2E10A 2COZA 2KYBA 1SF9A 3E9GA 2MAMA 3NTKA 3MEUA 4NL2A 3VUBA 4E6RA 3OYCA 4PFOA 4MZPA 2XDBA 1AEYA 2ZPEB 1FXXA 4FSXA 2LNVA 4M7AD 1G3YA 1M5Q1 2RHXA 1YITQ 4TVRA 1UE9A 2QYZA 3EG1A 1M1KR 2R5AA 2D9TA 1I5OB 4BI8B 1TUDA 3HP9A 1NJIC 1QCNA 3QYHB 4M7DD 2VKNA 4PLLA 3CCEQ 3M55A 3ZBDA 3CXCS 4FYWB 2OTLA 3WVDB 2GF7A 5GAOq 2M0OA 3C4SA 2EQJA 3WVEB 1KQSS 1SKUB 1YWOA 2AHJB 1JJ2A 3M58A 1BI3A 2JT4A 2QQ9A 4RTYA 2CP3A 5GAMh 1GL5A 2AKLA 2PVGB 4FM4B 3FJ5A 4A4GA 2YUPA 1GCQC 1WFWA 1RABB 5GAOp 1JXMA 3MP1A 3RKWA 1KC8U 1M90R 2A36A 1VQLQ 1AWOA 4X34A 2A37A 1LNXA 3I56A 1BIAA 3JB9I 3OYFA 1PSEA 4FYVB 2GGRA 2SRCA 4IIOA 2J05A 2DK3A 4M75E 4L59A 2P4RA 3EHQA 2E64A 2FPDA 5CKDA 1RAIB 5DLOA 3A5ZB 3LLRA 3JCMP 3BDLA 1TG0A 1E7OA 2QI2A 3X28B 2FEIA 1AVZC 2F1LA 5I11A 5KYNA 2LNHB 2DILA 5GMKi 1OEBA 3ER0A 1QCOA 3GBQA 2R5MA 4KGZB 1Q82U 3S3OA 1R77A 2CYZB 3UDCA 4M7DG 2K2MA 1B07A 4C0ZA 4EMKB 2F2XA 2WSEE 2LCCA 4FYXB 3S3MA 1MUZA 4M78D 3QUIA 2ZGWA 4C92F 2RA2A 3OW2P 3G6EA 2Y4XA 4ZGEB 5DY9A 2E3HA 1YJWT 3SD4A 1KD1R 4PKCC 1VQOA 2E4HA 5L8RE 2MPXC 3FRNA 1ZBXA 1NJIR 2NYSA 2ZZDA 5A0LA 4JZ3A 3TREA 5I2MA 5D6WA 5HK3A 3HRTA 4A4EA 4V2SA 2YT6A 1K0XA 1WXBA 4JJCA 1M90C 2RM4A 4Z02A 1VYVA 1SHGA 3TSWA 2L3PA 4LXCA 5ECAA 1X6BA 2L2PA 4OB3B 4CC4B 4M78B 4RTWA 2EYWA 3V8JA 2YRDA 1NLOC 2EYYA 4JS4A 1UEBA 4LDWA 4KH1B 1YJNT 2VUBA 2RK1A
chains in the Genus database with same CATH topology
1V1CA 3M0PA 4AFQC 1CKAA 2EGCA 4J9DA 1OOTA 4HVWA 1K0SA 1CSKA 1NEGA 4DEXA 1SPKA 1Y57A 2DL5A 2O2OA 2OJ2A 2FG0A 1I07A 1GRIA 2FRWA 4J9IA 1FMKA 4HCKA 2RF0A 2YDLA 3VS4A 1AWWA 1JXOA 3CQTA 3SHWA 2EVRA 4IIMA 1AD5A 2RQVA 1H92A 4JPBW 2KR3A 2LJ0A 2YUNA 2HSPA 4AFZC 2L3SA 1PWTA 4OMQA 2LX7A 2RQWA 3PVLA 3THKA 3VS6A 2EKHA 4AFSC 2RNAA 3VS2A 1HSQA 2CH4W 4D8DA 5I22A 2PTKA 2YUQA 2C0OA 5EC7A 1H8KA 4CC3A 2KBTA 1K1ZA 1WXTA 3RNJA 3UF4A 1WDXA 3SEMA 2I0NA 2LP5A 1U3OA 1PHTA 3REBB 4Z88A 2K9GA 1B3QA 1UJYA 3U23A 1K4US 2X3WD 1ARKA 4LUDA 2DVJA 4QT7A 1FYNA 1XOVA 4J9BA 3KFVA 3M0QA 4A63B 2K3BA 2DL4A 2KXCA 1PRMC 2AZVA 4D8KA 2F2WA 2BTTA 2QDLA 1BBZA 3EG0A 3VS3A 1YN8A 2RPNA 1LCKA 3JV3A 2G6FX 3M0SA 1SHFA 1HJDA 4LE9A 2DBMA 1NYFA 1OPKA 1UHCA 2DL3A 3NHNA 1WLPB 2RQUA 1GCPA 1X2QA 2J6FA 1ZUUA 3H41A 1NEBA 1I1JA 2DA9A 2DLPA 3VS0A 3H0IA 2CT3A 4OMNA 1AWJA 2YUOA 1T0JA 1AZGB 4Z89A 4K11A 2DL8A 3IQLA 4AFUC 2ABLA 4DEYA 2XMFA 3VRZA 1WXUA 1JU5C 2HCKA 4GLMA 1PNJA 2MOXA 3QWXX 1QWFA 4OMLA 4AG2C 1J3TA 2FPFA 2A08A 2DBKA 2DL7A 3I5RA 1W70A 2FRYA 3VS1A 3NPFA 2CUBA 2LJ3A 1M8MA 2KROA 1RLPC 4F16A 1GFCA 1WYXA 1WA7A 4X1VA 2J06A 2KNBB 2DMOA 4FSSA 1Z9ZA 2KXDA 1T3LA 1RUWA 1QLYA 2RQTA 2JM9A 2PZ1A 2W0ZA 1UECA 1WX6A 1YWPA 2JMCA 3O5ZA 3ZL7C 2D8JA 2DNUA 1A0NB 2CT4A 1G2BA 3PE0A 3NGPA 1G83A 4J9FA 2RQRA 2H8HA 2KGTA 2D8HA 2DJQA 4JJDA 2RN8A 2ROTA 2ROLA 2D1XA 4WCIA 4ESRA 3ULRB 1M3CA 2O9VA 2KT8A 1QWEA 1I0CA 2X3XD 3UATA 3I35A 2ED0A 1MV0B 1ZUYA 1TUCA 2E5KA 4JJBA 1RLQC 4R0KA 4RTTA 2L3QA 2K6DA 2EYZA 1KSWA 1UHFA 5GJWB 2JMAA 1YNZA 1M3BA 2L0AA 3PVQA 2DM1A 1U06A 1K76A 1ABQA 2GQIA 4Y92A 1X27A 5HCKA 3VS7A 1Z9QA 4RUGA 3UA6A 2CDTA 2NUZA 2K7AA 3REAB 4EIKA 1BB9A 4JZ4A 3M0UA 2JXBA 1SSHA 1JQQA 2CSIA 2DRKA 4GBQA 4M4ZA 1IO6A 1AZEA 1ZUKA 2JTEA 2MCNA 1ZX6A 4OMMA 2O9SA 3H0HA 1M3AA 2CUDA 3I9QA 1X2KA 1GCQA 3QWYA 2J6OA 1UDLA 1VYUA 5IXBA 1SRMA 1T3SA 2W10A 4LUEA 2EYXA 5GJVB 2KYMA 2KRSA 4F17A 3C0CA 2KYBA 2DRMA 2LZ6B 4AG1C 2O88A 3M0RA 2GTJA 1OPLA 1W6XA 2HDAA 2EGEA 2LQNA 2EW3A 4E6RA 5L23A 1YP5A 2KRMA 2LQWA 2O31A 2DX1A 1AEYA 2C0IA 2AKKA 2HBWA 1H3HA 3M0TA 2KRNA 1SRLA 1BK2A 2RMOA 1UE9A 2DF6A 1UJ0A 4OMOA 1NM7A 2JS0A 3EG1A 4ZNXA 1GFDA 1E6HA 1X43A 1KJWA 1MV3A 2JW4A 2M51A 2EQIA 1NYGA 2V1RA 1TUDA 1VYTA 2IIMA 5IHIA 2LJ1A 2VKNA 1AOJA 3RBBB 1VA7A 1OV3A 2FPEA 4J9CA 2BZYA 1CKBA 5IH2A 2J6KA 1GBRA 2J7IA 4F14A 2CREA 1SEMA 2KT1A 1YWOA 3VS5A 1WI7A 4CC7A 5IXFA 1QKXA 4OMPA 3NMZC 2YSQA 4J9EA 2JT4A 4RTYA 2OI3A 2EGAA 1GL5A 2AKLA 5FW9A 2EBPA 1UUEA 2GNCA 3FJ5A 5IHKA 3TVTA 2YUPA 1GCQC 2F2VA 1WFWA 1GBQA 1JXMA 4HVUA 2A36A 1AWOA 2ED1A 2A37A 5IHNA 1WIEA 5FWBA 4RTZA 4LN2A 2JS2A 2FO0A 4ORZA 2GGRA 1YCSB 2SRCA 2AZSA 2CSQA 2ESWA 1KFZA 4IIOA 2EPDA 2M0YA 2J05A 2LCSA 2BZXA 4HXJA 2ENMA 2P4RA 3EHQA 1NG2A 2CH4A 2FPDA 2KEAA 1JEGA 1X6GA 1TG0A 1E7OA 2FEIA 4LNPA 1AVZC 5I11A 1T0HA 2LNHB 2DILA 2C0TA 1OEBA 1ZLMA 2K79A 2D0NA 3A98A 3GBQA 1E6GA 1M27C 1Y0MA 2V1QA 4HVVA 3I5SA 2K2MA 1B07A 4J9HA 2A28A 3EG2A 1RI9A 1UTIA 1BU1A 1PKSA 2F2XA 1UGVA 2SEMA 3EG3A 1MUZA 2HEQA 5FWCA 2DE0X 4CC2A 1U5SA 1AWXA 3H0FA 3LH5A 1M30A 1S1NA 1QCFA 2AK5A 2BZ8A 2KE9A 3TSZA 1ZSGA 2GBQA 1JO8A 2OAWA 4JZ3A 1W1FA 1ABOA 1ZBJA 1X69A 1KIKA 2GTOA 1PKTA 2YT6A 4RTVA 1K0XA 1UG1A 1WXBA 3EHRA 2ECZA 4JJCA 4RTUA 1VYVA 1SHGA 2JM8A 4KRTA 2L3PA 1HD3A 2VVKA 4J9GA 3TSWA 1K9AA 5ECAA 1EFNA 2DYBA 2NWMA 1UFFA 2VWFA 1X6BA 2L2PA 1N5ZA 4CC4B 1NLPC 3VRYA 4RTWA 2EYWA 3UA7A 2B86A 4Z8AA 2PNIA 1NLOC 3R6NA 4RTXA 1PRLC 2EYYA 3EGUA 2LMJA 1QKWA 2MIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  3M0P A;  4AFQ C;  1CKA A;  2EGC A;  4J9D A;  1OOT A;  4HVW A;  1K0S A;  1CSK A;  1NEG A;  4DEX A;  1SPK A;  1Y57 A;  2DL5 A;  2O2O A;  2OJ2 A;  2FG0 A;  1I07 A;  1GRI A;  2FRW A;  4J9I A;  1FMK A;  4HCK A;  2RF0 A;  2YDL A;  3VS4 A;  1AWW A;  1JXO A;  3CQT A;  3SHW A;  2EVR A;  4IIM A;  1AD5 A;  2RQV A;  1H92 A;  4JPB W;  2KR3 A;  2LJ0 A;  2YUN A;  2HSP A;  4AFZ C;  2L3S A;  1PWT A;  4OMQ A;  2LX7 A;  2RQW A;  3PVL A;  3THK A;  3VS6 A;  2EKH A;  4AFS C;  2RNA A;  3VS2 A;  1HSQ A;  2CH4 W;  4D8D A;  5I22 A;  2PTK A;  2YUQ A;  2C0O A;  5EC7 A;  1H8K A;  4CC3 A;  2KBT A;  1K1Z A;  1WXT A;  3RNJ A;  3UF4 A;  1WDX A;  3SEM A;  2I0N A;  2LP5 A;  1U3O A;  1PHT A;  3REB B;  4Z88 A;  2K9G A;  1B3Q A;  1UJY A;  3U23 A;  1K4U S;  2X3W D;  1ARK A;  4LUD A;  2DVJ A;  4QT7 A;  1FYN A;  1XOV A;  4J9B A;  3KFV A;  3M0Q A;  4A63 B;  2K3B A;  2DL4 A;  2KXC A;  1PRM C;  2AZV A;  4D8K A;  2F2W A;  2BTT A;  2QDL A;  1BBZ A;  3EG0 A;  3VS3 A;  1YN8 A;  2RPN A;  1LCK A;  3JV3 A;  2G6F X;  3M0S A;  1SHF A;  1HJD A;  4LE9 A;  2DBM A;  1NYF A;  1OPK A;  1UHC A;  2DL3 A;  3NHN A;  1WLP B;  2RQU A;  1GCP A;  1X2Q A;  2J6F A;  1ZUU A;  3H41 A;  1NEB A;  1I1J A;  2DA9 A;  2DLP A;  3VS0 A;  3H0I A;  2CT3 A;  4OMN A;  1AWJ A;  2YUO A;  1T0J A;  1AZG B;  4Z89 A;  4K11 A;  2DL8 A;  3IQL A;  4AFU C;  2ABL A;  4DEY A;  2XMF A;  3VRZ A;  1WXU A;  1JU5 C;  2HCK A;  4GLM A;  1PNJ A;  2MOX A;  3QWX X;  1QWF A;  4OML A;  4AG2 C;  1J3T A;  2FPF A;  2A08 A;  2DBK A;  2DL7 A;  3I5R A;  1W70 A;  2FRY A;  3VS1 A;  3NPF A;  2CUB A;  2LJ3 A;  1M8M A;  2KRO A;  1RLP C;  4F16 A;  1GFC A;  1WYX A;  1WA7 A;  4X1V A;  2J06 A;  2KNB B;  2DMO A;  4FSS A;  1Z9Z A;  2KXD A;  1T3L A;  1RUW A;  1QLY A;  2RQT A;  2JM9 A;  2PZ1 A;  2W0Z A;  1UEC A;  1WX6 A;  1YWP A;  2JMC A;  3O5Z A;  3ZL7 C;  2D8J A;  2DNU A;  1A0N B;  2CT4 A;  1G2B A;  3PE0 A;  3NGP A;  1G83 A;  4J9F A;  2RQR A;  2H8H A;  2KGT A;  2D8H A;  2DJQ A;  4JJD A;  2RN8 A;  2ROT A;  2ROL A;  2D1X A;  4WCI A;  4ESR A;  3ULR B;  1M3C A;  2O9V A;  2KT8 A;  1QWE A;  1I0C A;  2X3X D;  3UAT A;  3I35 A;  2ED0 A;  1MV0 B;  1ZUY A;  1TUC A;  2E5K A;  4JJB A;  1RLQ C;  4R0K A;  4RTT A;  2L3Q A;  2K6D A;  2EYZ A;  1KSW A;  1UHF A;  5GJW B;  2JMA A;  1YNZ A;  1M3B A;  2L0A A;  3PVQ A;  2DM1 A;  1U06 A;  1K76 A;  1ABQ A;  2GQI A;  4Y92 A;  1X27 A;  5HCK A;  3VS7 A;  1Z9Q A;  4RUG A;  3UA6 A;  2CDT A;  2NUZ A;  2K7A A;  3REA B;  4EIK A;  1BB9 A;  4JZ4 A;  3M0U A;  2JXB A;  1SSH A;  1JQQ A;  2CSI A;  2DRK A;  4GBQ A;  4M4Z A;  1IO6 A;  1AZE A;  1ZUK A;  2JTE A;  2MCN A;  1ZX6 A;  4OMM A;  2O9S A;  3H0H A;  1M3A A;  2CUD A;  3I9Q A;  1X2K A;  1GCQ A;  3QWY A;  2J6O A;  1UDL A;  1VYU A;  5IXB A;  1SRM A;  1T3S A;  2W10 A;  4LUE A;  2EYX A;  5GJV B;  2KYM A;  2KRS A;  4F17 A;  3C0C A;  2KYB A;  2DRM A;  2LZ6 B;  4AG1 C;  2O88 A;  3M0R A;  2GTJ A;  1OPL A;  1W6X A;  2HDA A;  2EGE A;  2LQN A;  2EW3 A;  4E6R A;  5L23 A;  1YP5 A;  2KRM A;  2LQW A;  2O31 A;  2DX1 A;  1AEY A;  2C0I A;  2AKK A;  2HBW A;  1H3H A;  3M0T A;  2KRN A;  1SRL A;  1BK2 A;  2RMO A;  1UE9 A;  2DF6 A;  1UJ0 A;  4OMO A;  1NM7 A;  2JS0 A;  3EG1 A;  4ZNX A;  1GFD A;  1E6H A;  1X43 A;  1KJW A;  1MV3 A;  2JW4 A;  2M51 A;  2EQI A;  1NYG A;  2V1R A;  1TUD A;  1VYT A;  2IIM A;  5IHI A;  2LJ1 A;  2VKN A;  1AOJ A;  3RBB B;  1VA7 A;  1OV3 A;  2FPE A;  4J9C A;  2BZY A;  1CKB A;  5IH2 A;  2J6K A;  1GBR A;  2J7I A;  4F14 A;  2CRE A;  1SEM A;  2KT1 A;  1YWO A;  3VS5 A;  1WI7 A;  4CC7 A;  5IXF A;  1QKX A;  4OMP A;  3NMZ C;  2YSQ A;  4J9E A;  2JT4 A;  4RTY A;  2OI3 A;  2EGA A;  1GL5 A;  2AKL A;  5FW9 A;  2EBP A;  1UUE A;  2GNC A;  3FJ5 A;  5IHK A;  3TVT A;  2YUP A;  1GCQ C;  2F2V A;  1WFW A;  1GBQ A;  1JXM A;  4HVU A;  2A36 A;  1AWO A;  2ED1 A;  2A37 A;  5IHN A;  1WIE A;  5FWB A;  4RTZ A;  4LN2 A;  2JS2 A;  2FO0 A;  4ORZ A;  2GGR A;  1YCS B;  2SRC A;  2AZS A;  2CSQ A;  2ESW A;  1KFZ A;  4IIO A;  2EPD A;  2M0Y A;  2J05 A;  2LCS A;  2BZX A;  4HXJ A;  2ENM A;  2P4R A;  3EHQ A;  1NG2 A;  2CH4 A;  2FPD A;  2KEA A;  1JEG A;  1X6G A;  1TG0 A;  1E7O A;  2FEI A;  4LNP A;  1AVZ C;  5I11 A;  1T0H A;  2LNH B;  2DIL A;  2C0T A;  1OEB A;  1ZLM A;  2K79 A;  2D0N A;  3A98 A;  3GBQ A;  1E6G A;  1M27 C;  1Y0M A;  2V1Q A;  4HVV A;  3I5S A;  2K2M A;  1B07 A;  4J9H A;  2A28 A;  3EG2 A;  1RI9 A;  1UTI A;  1BU1 A;  1PKS A;  2F2X A;  1UGV A;  2SEM A;  3EG3 A;  1MUZ A;  2HEQ A;  5FWC A;  2DE0 X;  4CC2 A;  1U5S A;  1AWX A;  3H0F A;  3LH5 A;  1M30 A;  1S1N A;  1QCF A;  2AK5 A;  2BZ8 A;  2KE9 A;  3TSZ A;  1ZSG A;  2GBQ A;  1JO8 A;  2OAW A;  4JZ3 A;  1W1F A;  1ABO A;  1ZBJ A;  1X69 A;  1KIK A;  2GTO A;  1PKT A;  2YT6 A;  4RTV A;  1K0X A;  1UG1 A;  1WXB A;  3EHR A;  2ECZ A;  4JJC A;  4RTU A;  1VYV A;  1SHG A;  2JM8 A;  4KRT A;  2L3P A;  1HD3 A;  2VVK A;  4J9G A;  3TSW A;  1K9A A;  5ECA A;  1EFN A;  2DYB A;  2NWM A;  1UFF A;  2VWF A;  1X6B A;  2L2P A;  1N5Z A;  4CC4 B;  1NLP C;  3VRY A;  4RTW A;  2EYW A;  3UA7 A;  2B86 A;  4Z8A A;  2PNI A;  1NLO C;  3R6N A;  4RTX A;  1PRL C;  2EYY A;  3EGU A;  2LMJ A;  1QKW A;  2MIO A; 
#chains in the Genus database with same CATH topology
 3QDR B;  1Q95 G;  4XTX A;  1NPR A;  4J9D A;  4HVW A;  1QMC A;  4ZTJ A;  2BKD N;  1KD1 U;  1K0S A;  1CSK A;  1VQ6 Q;  2DD5 A;  4II1 A;  2LT4 A;  4BI4 A;  2EIF A;  2I2L A;  5HKC A;  1K9M R;  5LJ5 e;  1Q81 U;  2KSS A;  3OB9 A;  1YI2 Q;  4XTY A;  3INZ A;  2RF0 A;  1TU0 B;  3SFM A;  1N8R C;  1YJN A;  3CD6 T;  2EKO A;  1VQ5 T;  5LL6 S;  1JJ2 S;  3EG9 A;  4C8Q E;  2KR3 A;  2LJ0 A;  1VQP T;  4KGV B;  1HYO A;  4M77 C;  4AFZ C;  1M1K C;  4A53 A;  4M78 A;  2L3S A;  1PWT A;  1VQ6 A;  3I55 T;  2RQW A;  3ZFJ A;  4J7I A;  4OF1 A;  4IUP A;  4GLK A;  2RNA A;  3VS2 A;  3OS5 A;  3VKI A;  1MMN A;  3LW5 E;  2CH4 W;  1N9R A;  2L3R A;  4OB0 B;  1FX7 A;  4HCZ A;  1K1Z A;  1WXT A;  4Y28 E;  1VQP Q;  2M9U A;  3PNW C;  3BFM A;  2I0N A;  5J26 A;  2LP5 A;  3L2R A;  3JCM J;  1ZSZ C;  1U3O A;  1WHJ A;  3EFR A;  4M75 A;  4M7A G;  2DPP B;  3REB B;  4F7U B;  2RI3 A;  1VQ5 A;  1ACM B;  2WSF E;  3VYG A;  5GAO m;  1WJQ A;  2VB6 A;  3DB4 A;  1KK7 A;  1QP2 A;  2K3B A;  3CCQ T;  1PRM C;  3CCU Q;  3FIF A;  2X4Y A;  4FW2 A;  2QDL A;  2RPN A;  2LDM A;  2G6F X;  5CO7 A;  1HJD A;  4LE9 A;  3NHN A;  8ATC B;  1WHG A;  2PVO B;  1WLP B;  1GCP A;  3A8H B;  4ELZ C;  3OYL A;  3H0I A;  3HL8 A;  2CT3 A;  1IRX A;  1WNL A;  1EIF A;  3KUF A;  4N4G A;  2LX9 A;  1NBE B;  3FJP A;  4HT9 A;  1YIJ A;  2XMF A;  4PFP A;  4M78 G;  3PIP A;  1TOV A;  4HCB A;  2QAZ A;  1QWF A;  1KQS P;  1J3T A;  2DIQ A;  2A08 A;  4HCC A;  2K5L A;  3JCM g;  4M78 E;  3VS1 A;  4XU1 A;  1VQK T;  1M8M A;  3OW2 A;  4J6W A;  2DJZ A;  5I2S A;  2J06 A;  3A8O B;  4JRQ A;  3QSU A;  2KXD A;  2PZ1 A;  1WX6 A;  4E7L A;  3O5Z A;  3ZL7 C;  3GNF B;  2KI7 A;  3MP8 A;  3O8V A;  4PJO D;  1A0N B;  2CT4 A;  3CC2 Q;  4NS5 A;  4R55 A;  1OZ2 A;  3PE0 A;  1D0Z A;  2D8H A;  2DJQ A;  2RN8 A;  2ROL A;  5DM7 R;  1TXQ A;  1N27 A;  3ULR B;  1M3C A;  4GY5 A;  2PUK B;  1W2B P;  3OYM A;  2VGM A;  3I35 A;  1ZUY A;  2FHD A;  3QJ6 A;  2QA4 Q;  1RLQ C;  4R0K A;  3L2V A;  1R0B G;  5LJ3 j;  3OS1 A;  1K8A C;  3TQ7 P;  1BI0 A;  1EX4 A;  1KSW A;  5GJW B;  3PIO A;  1VQ5 Q;  4X9D A;  3ME9 A;  4A4K A;  3OA6 A;  3LGL A;  3M4Y A;  2MWP A;  4PK4 A;  3PVQ A;  4QW2 A;  5CR2 A;  2YRV A;  2RHU A;  3CCM T;  4Y92 A;  2HQX A;  3M56 A;  4CRI A;  3OYA A;  1OX8 A;  4OVA A;  2DZ9 A;  5GAN 8;  3REA B;  1VQ8 T;  4FIB A;  1RAD B;  1JQQ A;  2CSI A;  1VQK A;  1WQ7 A;  2EQM A;  2R57 A;  3M53 A;  4M4Z A;  2DVE A;  4J5Y A;  1PG5 B;  4EDU A;  3CCE A;  3GNG A;  3I9Q A;  1X2K A;  3CMA A;  1GCQ A;  2ZPF B;  5HK0 A;  5IXB A;  5GMK e;  2MK5 A;  5GAO n;  5GAM e;  3NFC A;  3OMG A;  3JCM c;  5KYU B;  3CCQ A;  1P92 A;  5CQX A;  2EYX A;  4KUL A;  2ZPH B;  2YLC A;  4C8Q D;  3FEO A;  2DRM A;  1VQ9 T;  2LZ6 B;  4AG1 C;  1LPL A;  2HL3 A;  2HNI A;  5LJ5 j;  2FB7 A;  3JCM Q;  5CKE A;  2RK2 A;  4HKE A;  5CVI A;  3RR6 A;  2EGE A;  2LQN A;  2OX7 A;  1UGP B;  1G3W A;  4C0F A;  3MHX A;  3PTA A;  1MGQ A;  1RAE B;  2DX1 A;  5A0G A;  3QYG B;  1VUB A;  3CCU T;  1WPY A;  3M0T A;  4XTV A;  1WHK A;  4M75 F;  3JCM h;  1BK2 A;  1XQH A;  2DF6 A;  2JUF A;  4M7D B;  2JW4 A;  4A4H A;  2EQI A;  2V1R A;  4RCB A;  1B34 A;  4PJO A;  1MMG A;  1VYT A;  3GPL A;  5J3B A;  2HQH A;  4ELY C;  1AOJ A;  1ZA1 B;  2DXT A;  3RBB B;  2FL7 A;  1OV3 A;  4PLI A;  1MNE A;  2RI5 A;  1VQM A;  2OTJ A;  2BZY A;  1CKB A;  5KYW B;  2J6K A;  1QVG A;  1PD1 A;  4F14 A;  2CRE A;  5CCA A;  2FZK B;  3I55 A;  3LX7 A;  4UC4 A;  2XHC A;  3X20 B;  3AT1 B;  1QKX A;  4LD9 K;  4OB2 B;  3GIB A;  2OI3 A;  4C92 E;  3RES A;  2XKO C;  1OU8 A;  5FW9 A;  5GAM d;  2EBP A;  4MMK A;  1YJW A;  1UUE A;  1IZ6 A;  1K9M U;  8AT1 B;  5GAN j;  4IUV A;  2K5F A;  4BY6 C;  2F2V A;  4C92 G;  2ED1 A;  1YI2 T;  5IHN A;  2JVV A;  5FWB A;  2CP0 A;  4LN2 A;  3CME T;  3A8M B;  2FO0 A;  1YIT A;  3EH2 A;  1YCS B;  2IPO B;  1EZZ B;  2CSQ A;  1C6V X;  1KFZ A;  1VIE A;  2M0Y A;  3V8K A;  2LCS A;  4C92 A;  4ZN3 A;  2QA4 A;  2CH4 A;  1Y96 A;  3J80 E;  2P0Q A;  5GAN 3;  3OW2 S;  4JDS A;  1OQK A;  2KK4 A;  2C0T A;  2K79 A;  2QAS A;  3A98 A;  2WAC A;  4XTU A;  2RJD A;  2QDY B;  2V1Q A;  2K57 A;  1G8X A;  2QEX T;  3EG2 A;  4IKF A;  3EFS A;  4C8Q A;  1PKS A;  4BAC A;  4XTZ A;  1UGV A;  3EG3 A;  1VQN A;  3L42 A;  2HEQ A;  5FWC A;  3DLM A;  4CC2 A;  1AWX A;  4MZM A;  5LJ5 g;  4F7U E;  3OYN A;  3VYH B;  3UWN A;  2AK5 A;  2X9H A;  1QVF A;  3PMT A;  2EJF A;  1ZSG A;  1JO8 A;  2P4T A;  2RO0 A;  4C5E A;  4F7U G;  1W1F A;  3P8B B;  4RCC A;  4BY6 B;  4E7H A;  1ZBJ A;  1X69 A;  2LRQ A;  4KBM B;  4RTU A;  4L6V 5;  2RJE A;  2JM8 A;  4KRT A;  4J9G A;  3JCM V;  2R58 A;  2KAF A;  1EFN A;  2DYB A;  1SG5 A;  2NWM A;  4ATO A;  4E7S A;  4QVC A;  1BI1 A;  2B86 A;  2PNI A;  1W2B S;  3JB9 J;  1Q7Y R;  3EGU A;  4KUI A;  3OMC A;  1V1C A;  3M0P A;  4AFQ C;  2EGC A;  4C92 D;  1U1S A;  4BD3 A;  2DL5 A;  2PVD B;  2OJ2 A;  3R6O A;  4JLG A;  1I07 A;  1GRI A;  2FRW A;  5C0M A;  3F70 A;  1FMK A;  4OP0 A;  2LC4 A;  3OBY A;  2YDL A;  1AWW A;  3CQT A;  1UGQ B;  4N0A C;  2EVR A;  3EFO B;  4IIM A;  1AD5 A;  2RQV A;  4JPB W;  4E7Z A;  1KD1 C;  5GAN g;  5CAI A;  5FRN A;  3BW1 A;  3PVL A;  2QQR A;  4AMC A;  4AFS C;  2DXC A;  5KYX A;  2CZ1 B;  2OAU A;  3RMQ A;  2PTK A;  2XG8 D;  3CCV Q;  1M2V B;  5EC7 A;  1H8K A;  1Q86 R;  2KBT A;  1Y71 A;  4IUR A;  4PFZ A;  3SEM A;  2V8I A;  1UGR B;  4Z88 A;  1B3Q A;  2DIG A;  2V26 A;  1WHH A;  2RJC A;  1JBM A;  3A8L B;  4LUD A;  4QT7 A;  1FYN A;  3OS0 A;  1YIT T;  1OZ3 A;  2YHT A;  3KFV A;  5GAM f;  4ANJ A;  3X26 B;  3G4S A;  2QXF A;  3FLG A;  2KXC A;  4QVZ A;  3MJX A;  3HFO A;  2BTT A;  2DER A;  1BBZ A;  3VS3 A;  1LJO A;  1YN8 A;  4C92 C;  2MWO A;  3M0S A;  2DBM A;  1NYF A;  1UHC A;  4A4F A;  2CGH A;  3RKX A;  4P5N A;  2VGN A;  4MDX A;  2RQU A;  4JRI A;  2HQE A;  2NUP A;  2DTH A;  1WJR A;  1NEB A;  3E2U A;  3OYY A;  1JRI A;  5GAN 7;  3CCV T;  4OMN A;  1AWJ A;  1M1G A;  4J7F A;  1XJW B;  1OX9 A;  4DBH A;  5GAN h;  4PJJ A;  1I8F A;  2DL8 A;  3IQL A;  4AFU C;  2ABL A;  4XU0 A;  4DEY A;  3CCR Q;  3CCM Q;  4M77 D;  2M1H A;  1YHQ T;  2E6Z A;  2HCK A;  2X4W A;  1KQ2 A;  1VQP A;  5GAN f;  3OYK A;  2HBP A;  5CIU A;  1VQ7 T;  3V8L A;  3CPW S;  1W70 A;  4RG8 A;  1OUL A;  2NUT A;  3J7A F;  1WQW A;  2Y90 A;  2LJ3 A;  3JCM X;  3J81 E;  2ZPI B;  4IUU A;  1QP3 A;  1YIJ T;  1GFC A;  1WYX A;  4M75 C;  2G3R A;  4VUB A;  5IN1 A;  1QW1 A;  3SWN C;  2RQT A;  2YWW A;  3MP6 A;  2BUD A;  2JM9 A;  2W0Z A;  1JB0 E;  4JS5 A;  3CPW A;  1U8R A;  4F7U F;  5GAN e;  1TH7 A;  4J83 A;  1GXI E;  3JCM b;  4M7A F;  1M1K U;  2E41 A;  4M7D A;  2PQW A;  4J9F A;  5GMK j;  2KGT A;  2P84 A;  4ZN1 A;  4B9X A;  3P8H A;  5KYX B;  1BKB A;  3H8Z A;  4OGE A;  4O5V A;  2FZG B;  1FMV A;  2RHI A;  1QWE A;  2JNG A;  1I0C A;  2X3X D;  5LJ5 h;  2ZCF B;  3UAT A;  1YJ9 A;  2E3I A;  2E5K A;  4JJB A;  2L5Q A;  3JRZ A;  4OB1 B;  4RTT A;  3CCE T;  1M2O A;  5LJ3 g;  1X75 C;  2K6D A;  5FU7 C;  2EYZ A;  2DO3 A;  2F5K A;  2HKN A;  1VQM Q;  1D3B A;  1G3T A;  2DM1 A;  3CCJ Q;  1U06 A;  3HRS A;  2CKK A;  5CQY A;  3G4S Q;  3G4S T;  3OBW A;  2B8A A;  1D09 B;  1W2B A;  1M9S A;  1YJ9 Q;  1VQM T;  3QPH A;  2NUZ A;  4HT8 A;  2K7A A;  1BB9 A;  3EGX A;  3M0U A;  3V7S A;  3TCJ A;  1SSH A;  4GBQ A;  2HZY A;  3AHU A;  1IO6 A;  3MEW A;  1QVG S;  3G7Z A;  1HK9 A;  1ZX6 A;  2O9S A;  1PD0 A;  1SRM A;  4WF2 A;  4ZTF A;  5KE3 A;  1PC0 A;  2O4X A;  4LUE A;  3CME Q;  2KYM A;  4XU3 A;  4F17 A;  4QQ6 A;  3SDZ A;  2AT1 B;  2O88 A;  3M0R A;  2GTJ A;  3FC3 A;  1W6X A;  2HDA A;  2QQS A;  3BDU A;  1QVF P;  2EW3 A;  5L23 A;  1YP5 A;  2KRM A;  3CD6 A;  2RJF A;  2LQW A;  2O31 A;  1JJ2 P;  4C0D C;  2ZPB B;  2ZAE A;  5KYY B;  2KRN A;  5GMK h;  1SRL A;  2DTO A;  2RMO A;  4PJO E;  1UJ0 A;  4C0G A;  3JCM d;  1NM7 A;  2JS0 A;  2K2V A;  5GAN d;  4QVD A;  2KY9 A;  1Q7Y U;  4CI0 C;  1KJW A;  3ZEH A;  3UT1 A;  5GAM g;  3RMS A;  4M7A B;  1NYG A;  1OYX A;  3CMA T;  3OYH A;  2IIM A;  2JJ9 A;  4LD6 A;  5IHI A;  3ASK A;  3X24 B;  1VA7 A;  1N8R R;  4C92 B;  5GMK m;  1MMA A;  3CD6 Q;  2FPE A;  4C8Q F;  1GBR A;  4PNO A;  2J7I A;  1K9M C;  4EMK C;  3QKJ A;  4XAX B;  2NLU A;  3P8D A;  1SEM A;  1YFN A;  1D1A A;  4YTL A;  3VS5 A;  2QK0 A;  5IXF A;  4FCY A;  2KDS A;  3NMZ C;  4OMP A;  4J9E A;  3MCA B;  1PSF A;  3VUZ A;  1YJN Q;  2XDD A;  1TUG B;  1Q82 R;  1N9S A;  4A54 A;  3VV0 A;  1GBQ A;  3EFO A;  3SB2 A;  4HVU A;  3VU3 C;  1Q86 U;  1WIE A;  3JCM f;  2QQB A;  3S6W A;  3OY9 A;  4FT4 A;  4ORZ A;  3PGG A;  5I21 A;  1WHM A;  1NPP A;  2AZS A;  2EPD A;  5CK9 A;  4JJN K;  2BZX A;  3OSS C;  2ENM A;  3HRU A;  2CP5 A;  1VQ4 Q;  3HHT B;  3OSV A;  1TS9 A;  4M7A C;  4C5H A;  1JEG A;  1X6G A;  4M77 A;  4J8O A;  4LNP A;  1VQO Q;  4Q5W A;  3WXM B;  4E2F B;  1T0H A;  2Z0W A;  1ZLM A;  3KBG A;  2D0N A;  2LVM A;  1M27 C;  5CKB A;  1Y0M A;  2X4X A;  4HVV A;  3I5S A;  2KQW A;  2DYI A;  4J9H A;  2A28 A;  1RI9 A;  1K8A U;  2SEM A;  2EJG A;  2OTL T;  2MYS A;  2DE0 X;  3X25 B;  3PMI A;  2E6N A;  4WTO B;  4BE1 A;  1M30 A;  4M77 G;  2EJ9 A;  4E7K A;  1K8A R;  2BZ8 A;  1R0C B;  2KE9 A;  4FW1 A;  4XK8 E;  3DKM A;  5LJ3 f;  5IAY A;  3QII A;  5GAN 6;  2CP6 A;  3MEA A;  2GTO A;  4M7D F;  3EHR A;  1FMW A;  2ECZ A;  3L2Z A;  1U1T A;  2DXU A;  3M59 A;  2GFA A;  3TU4 K;  1K9A A;  2VWF A;  2COW A;  1UFF A;  1VQL T;  1N5Z A;  1NLP C;  1D1C A;  1K73 U;  3UA7 A;  1KQS A;  3QHS A;  2DEU A;  3R6N A;  1PRL C;  1RAA B;  1QVP A;  2MMP A;  5D6X A;  3CC2 T;  2RHY A;  2RH2 A;  2Y4Y A;  4PJL A;  3M4G A;  5GAO r;  1OOT A;  1Y96 B;  2KMT A;  2DZC A;  3RIR A;  1NEG A;  1RI0 A;  1Y57 A;  2O2O A;  1S72 A;  3CBP A;  3T9N A;  4M75 G;  3CC4 A;  4C5I A;  1PM3 A;  4J9I A;  4KT0 E;  3MEV A;  3HSB A;  1JXO A;  3N5B B;  2CZ0 B;  3HTR A;  1VQK Q;  3CCS Q;  1H92 A;  3EGX B;  3QZ5 B;  3NTH A;  2YUN A;  2P0P A;  2O01 E;  4M78 C;  1D0X A;  2LX7 A;  2K3X A;  3C12 A;  3RER A;  4PJO F;  1QVG P;  3OS2 A;  2EKH A;  1V76 A;  1S72 Q;  3M5A A;  4Y91 A;  3CCR A;  1D3B B;  3PT9 A;  4N0A A;  2QTV A;  5I22 A;  2C0O A;  2VYT A;  1B7T A;  2D6F A;  1BI2 A;  3RNJ A;  1WDX A;  2QQA A;  5IT9 E;  2LTO A;  3CXC A;  2PU9 B;  3CCS T;  4EMK A;  2CS7 A;  2DKG A;  3U23 A;  1X6O A;  1ARK A;  2DVJ A;  4J9B A;  4R56 A;  4A63 B;  3JCM W;  5FU7 B;  3HKS A;  2EYQ A;  4PJM A;  5FLX E;  1XNI A;  1LCK A;  3S3N A;  2FVU A;  5HY6 A;  4NOY A;  4QQG A;  4BI3 A;  2CP2 A;  4X9C A;  2J6F A;  1ZUU A;  2A3L A;  2BE9 B;  3CEY A;  1I1J A;  2DA9 A;  5GAN 5;  3QBY A;  3QDF A;  4JRK A;  1T0J A;  1AZG B;  4Z89 A;  2M16 A;  3CC7 T;  5KE2 A;  3Q1J A;  5KCH A;  1IGQ A;  4IUT A;  3GP8 A;  1YIJ Q;  3VRZ A;  1WXU A;  2MI6 A;  1MHN A;  1IGU A;  1JU5 C;  3LGF A;  3CCL Q;  4EMH A;  5FRO A;  1PNJ A;  2EQU A;  2MOX A;  4AG2 C;  2E1H A;  2FPF A;  2DBK A;  2DL7 A;  3OYJ A;  4DBQ A;  3CC2 A;  2K5I A;  4DOW A;  3L2Q A;  2FRY A;  2H3E B;  2L8D A;  4M77 E;  1ZSZ B;  4LDY A;  2CUB A;  1YHQ Q;  2CZ6 B;  2KRO A;  4F16 A;  1KQ1 A;  2MF2 A;  3JB9 F;  1WA7 A;  4X1V A;  3RKY A;  2KNB B;  5M9O A;  2DMO A;  2K4Y A;  4FSS A;  3LWI A;  1RAH B;  1TTH B;  1T3L A;  1QLY A;  2EAY A;  5FU6 C;  3LWH A;  5GAN 2;  2JMC A;  1VQ7 A;  2D8J A;  4BE0 A;  2DNU A;  4JRP A;  4DBR A;  4M7A E;  3BE3 A;  1F1B B;  1W4S A;  1KHC A;  2H8H A;  1VQ4 T;  2X4J A;  3OYE A;  4M77 F;  1VQ9 Q;  4XU2 A;  1HXD A;  4M7A A;  4ESR A;  5GMK l;  1KC8 R;  4M7D E;  2QEX A;  1K73 R;  2E12 A;  2KT8 A;  1RAF B;  2BIV A;  3FDR A;  2ED0 A;  1MV0 B;  1TUC A;  2FYK A;  3GOX A;  4MDW A;  2L3Q A;  2GQV A;  3MO8 A;  2JMA A;  1VQ9 A;  1M3B A;  2A0F B;  1DJ7 B;  1KG1 A;  2L0A A;  2QG9 B;  3M54 A;  2GQI A;  5LJ3 h;  1VQN T;  4M7D C;  1X27 A;  4HA8 A;  3VS7 A;  3TEE A;  3A1P A;  4AT1 B;  4RG2 A;  3I56 T;  3RDV A;  5LJ3 d;  1ZA2 B;  9ATC B;  2X35 A;  2DEQ A;  4DA4 A;  1OU9 A;  3JB9 H;  1M90 U;  3SWN A;  1FWZ A;  2JTF A;  4JUV A;  1ZUK A;  3L2U A;  2QA4 T;  2JTE A;  4OMM A;  1M8V A;  4J6X A;  4B6M A;  3H0H A;  4BDY A;  2YXY A;  2COY A;  2CUD A;  5AYF A;  2J6O A;  1UDL A;  1VYU A;  2NUP B;  1WHL A;  2ZPG B;  1T3S A;  2W10 A;  3CC4 T;  5GJV B;  4DOV A;  2KRS A;  4L5G A;  4PL6 A;  3C0C A;  1Q82 C;  5J39 A;  5FU6 B;  1Q81 C;  4NL3 A;  4C8Q G;  1OPL A;  2V8K A;  5KYW A;  5LJ5 f;  5FRM A;  1VQL A;  2C0I A;  2AKK A;  2HBW A;  3H9N A;  3OYD A;  3EH1 A;  1H3H A;  1NZ9 A;  3I56 Q;  2XD0 A;  1N6A A;  4C0D B;  1O9S A;  1KHI A;  4OMO A;  1WZO A;  1RL2 A;  4ZNX A;  3CCL A;  1GFD A;  2RI2 A;  2DD4 A;  1E6H A;  1X43 A;  2PUO B;  4XTW A;  1MV3 A;  2LCL A;  2VXF A;  3E9F A;  2M51 A;  4IUQ A;  3FB9 A;  2VV5 A;  2DXB A;  1I4K 1;  1IHW A;  2LJ1 A;  4M77 B;  4J9C A;  5D7U A;  3JAM E;  3EAE A;  5IH2 A;  2QTX A;  3H6Z A;  1AT1 B;  2QEX Q;  1WGS A;  1S72 T;  3JB9 G;  2KT1 A;  2JOY A;  3JCM e;  5DLQ E;  3CCJ T;  1X01 A;  1WI7 A;  4CC7 A;  3CBM A;  4E7J A;  2EQK A;  2YSQ A;  3OYB A;  2EGA A;  3LYI A;  2YLB A;  3CXC P;  2GNC A;  3PFS A;  2DTI A;  2OTJ Q;  1R8O B;  2O4X B;  3EG9 B;  5IHK A;  4J6Y A;  4M78 F;  3TVT A;  2WSC E;  5KCO A;  4E47 A;  3GLX A;  4RTZ A;  2JS2 A;  2JN0 A;  2CZ7 B;  3HFN A;  2ESW A;  4QKU A;  4O6J A;  3G1J A;  4ZGJ B;  4HXJ A;  4D6W A;  1NG2 A;  5AT1 B;  3HPW A;  4RMO A;  2IVW A;  2KEA A;  1OI1 A;  4N4I A;  4XQ3 A;  2F5T X;  2E65 A;  2VXE A;  1H3Z A;  5GAO l;  1C0M A;  3OQ5 A;  3CMA Q;  1IB8 A;  3E1S A;  2XI9 A;  2L89 A;  4FT2 A;  4KH0 B;  1E6G A;  4QQD A;  3CCL T;  4KUD K;  1YCY A;  1UTI A;  1BU1 A;  3CC7 Q;  3CC7 A;  4C5G A;  3CPF A;  2HAX A;  1Y07 A;  1U5S A;  5KYY A;  1I81 A;  4C8Q B;  3H0F A;  3LH5 A;  5CKH A;  1S1N A;  1QCF A;  4M75 D;  5A0D A;  1D0Y A;  2GCX A;  1B34 B;  3TSZ A;  2OTL Q;  3MKD A;  2GBQ A;  2OAW A;  3G6E T;  2BE7 D;  1ABO A;  2LQ8 A;  1G3S A;  3URG A;  4BE2 A;  1KIK A;  1PKT A;  4RTV A;  1UG1 A;  1ZHI A;  5LJ3 e;  3RUX A;  1VQ6 T;  3OYI A;  1HD3 A;  2V8J A;  2VVK A;  1ZSZ A;  2H3J A;  2RD1 A;  3VRY A;  4LDV A;  5LJ5 d;  1QQJ A;  2OTJ T;  4Z8A A;  4RTX A;  2XK0 A;  2LMJ A;  1QKW A;  2MIO A;  1CKA A;  1LOJ A;  1PCX A;  4DEX A;  3D7S B;  1I5L A;  1YBY A;  1SPK A;  3V7R A;  3DLL A;  1C1A A;  3CCU A;  2FG0 A;  2F69 A;  3A8G B;  2HMA A;  2RB6 A;  4HCK A;  2A7Y A;  3VS4 A;  3SHW A;  3CCV A;  1BIB A;  2LQK A;  1YJW Q;  2M02 A;  1NE8 A;  2EWN A;  1VQ8 Q;  2CP7 A;  4EMG A;  2HSP A;  1IXD A;  4OMQ A;  2C06 A;  2KVQ G;  3THK A;  1AHJ B;  1WJS A;  2DFU A;  3VS6 A;  4ZGD B;  3CCJ A;  3G71 T;  4KGX B;  1HSQ A;  4N4H A;  4D8D A;  2YUQ A;  4BUG A;  2DET A;  3QJY A;  2GFU A;  4CC3 A;  2EFI A;  3UF4 A;  2LT1 A;  4F04 B;  2P0K A;  1IRE B;  3QZ9 B;  1RAG B;  1VOM A;  2HD0 A;  1Q81 R;  1PHT A;  2ATC B;  2VC8 A;  2K9G A;  1UJY A;  1K4U S;  5KH6 A;  1TWB A;  2X3W D;  2JTM A;  1XOV A;  1QVF S;  3M0Q A;  2XID A;  2DL4 A;  1YI2 A;  3CC4 Q;  2AZV A;  1BYM A;  4D8K A;  4OMF B;  2HL5 C;  2AIR B;  2QGF B;  2F2W A;  1K73 C;  1RAC B;  3CME A;  3GF5 A;  3CCM A;  1MND A;  3EG0 A;  3JV3 A;  3CCS A;  1VIF A;  1SHF A;  1OPK A;  2DL3 A;  2NUT B;  1M4Z A;  1X2Q A;  2XDP A;  2YRC A;  4ME7 A;  1Q86 C;  3H41 A;  2RHZ A;  3SWN B;  2DLP A;  3VS0 A;  4BB7 A;  3CPW P;  2E70 A;  2YUO A;  7AT1 B;  2DAQ A;  4OGC A;  1IHV A;  3G71 A;  4K11 A;  3G71 Q;  1VQN Q;  3EGD B;  2IG0 A;  1V29 B;  4GLM A;  4DBF A;  3QWX X;  4OML A;  3C95 A;  1UGS B;  3NTI A;  1VQO T;  1G5V A;  4DQ2 A;  2HKQ B;  1MMD A;  2X51 A;  3I5R A;  5GAN 4;  1D1B A;  3NPF A;  1YJ9 T;  1RLP C;  1Y7X A;  4FL6 A;  1N8R U;  4FU6 A;  1KC8 C;  1Z9Z A;  1RUW A;  1LVK A;  3E19 A;  2HSE B;  4FYY B;  4BDZ A;  4LDX A;  1UEC A;  1YWP A;  2E5Q A;  1XTD A;  4MML A;  1Q7Y C;  2K3Y A;  3OYG A;  5C6S A;  1G2B A;  3NGP A;  1G83 A;  2RQR A;  3BY7 A;  4C8Q C;  2JZ2 A;  1TSF A;  3QO3 A;  4JJD A;  4LDU A;  4PJO B;  2ROT A;  3M9Q A;  2D1X A;  4WCI A;  4E7I A;  2VAS A;  4JLI A;  1M2V A;  3CCQ Q;  1BCO A;  2O9V A;  5EG2 A;  2D0Q B;  4PJO G;  3LH0 A;  3QXE B;  4RKU E;  3G6E Q;  1UB4 A;  4F7U A;  3UPU A;  4M75 B;  5CKF A;  1VQ4 A;  3JB9 D;  4PJN A;  3CBO A;  1VQ8 A;  3DB3 A;  1UHF A;  3KXT A;  1NJI U;  4EPC A;  1YNZ A;  3L2W A;  3M57 A;  1YHQ A;  2XIC A;  1K76 A;  1ABQ A;  3MET A;  3V7C A;  5HCK A;  1Z9Q A;  2QGG A;  3I55 Q;  4RUG A;  5KYU A;  3UA6 A;  3VJP A;  3MPU B;  2CDT A;  5D6Y A;  3JSC A;  4EIK A;  1VQ7 Q;  4JZ4 A;  1ZQ1 A;  2JXB A;  2DRK A;  3QG1 A;  1BCM A;  1AZE A;  5A2Q E;  3C94 A;  3L1A A;  4MZT A;  2MCN A;  1M3A A;  2FZC B;  3QWY A;  3CCR T;  1SSF A;  1O75 A;  4PJO C;  1H64 1;  3EGD A;  1M1F A;  2XU8 A;  4B9W A;  5GAM j;  6AT1 B;  2E10 A;  2COZ A;  2KYB A;  1SF9 A;  3E9G A;  2MAM A;  3NTK A;  3MEU A;  4NL2 A;  3VUB A;  4E6R A;  3OYC A;  4PFO A;  4MZP A;  2XDB A;  1AEY A;  2ZPE B;  1FXX A;  4FSX A;  2LNV A;  4M7A D;  1G3Y A;  1M5Q 1;  2RHX A;  1YIT Q;  4TVR A;  1UE9 A;  2QYZ A;  3EG1 A;  1M1K R;  2R5A A;  2D9T A;  1I5O B;  4BI8 B;  1TUD A;  3HP9 A;  1NJI C;  1QCN A;  3QYH B;  4M7D D;  2VKN A;  4PLL A;  3CCE Q;  3M55 A;  3ZBD A;  3CXC S;  4FYW B;  2OTL A;  3WVD B;  2GF7 A;  5GAO q;  2M0O A;  3C4S A;  2EQJ A;  3WVE B;  1KQS S;  1SKU B;  1YWO A;  2AHJ B;  1JJ2 A;  3M58 A;  1BI3 A;  2JT4 A;  2QQ9 A;  4RTY A;  2CP3 A;  5GAM h;  1GL5 A;  2AKL A;  2PVG B;  4FM4 B;  3FJ5 A;  4A4G A;  2YUP A;  1GCQ C;  1WFW A;  1RAB B;  5GAO p;  1JXM A;  3MP1 A;  3RKW A;  1KC8 U;  1M90 R;  2A36 A;  1VQL Q;  1AWO A;  4X34 A;  2A37 A;  1LNX A;  3I56 A;  1BIA A;  3JB9 I;  3OYF A;  1PSE A;  4FYV B;  2GGR A;  2SRC A;  4IIO A;  2J05 A;  2DK3 A;  4M75 E;  4L59 A;  2P4R A;  3EHQ A;  2E64 A;  2FPD A;  5CKD A;  1RAI B;  5DLO A;  3A5Z B;  3LLR A;  3JCM P;  3BDL A;  1TG0 A;  1E7O A;  2QI2 A;  3X28 B;  2FEI A;  1AVZ C;  2F1L A;  5I11 A;  5KYN A;  2LNH B;  2DIL A;  5GMK i;  1OEB A;  3ER0 A;  1QCO A;  3GBQ A;  2R5M A;  4KGZ B;  1Q82 U;  3S3O A;  1R77 A;  2CYZ B;  3UDC A;  4M7D G;  2K2M A;  1B07 A;  4C0Z A;  4EMK B;  2F2X A;  2WSE E;  2LCC A;  4FYX B;  3S3M A;  1MUZ A;  4M78 D;  3QUI A;  2ZGW A;  4C92 F;  2RA2 A;  3OW2 P;  3G6E A;  2Y4X A;  4ZGE B;  5DY9 A;  2E3H A;  1YJW T;  3SD4 A;  1KD1 R;  4PKC C;  1VQO A;  2E4H A;  5L8R E;  2MPX C;  3FRN A;  1ZBX A;  1NJI R;  2NYS A;  2ZZD A;  5A0L A;  4JZ3 A;  3TRE A;  5I2M A;  5D6W A;  5HK3 A;  3HRT A;  4A4E A;  4V2S A;  2YT6 A;  1K0X A;  1WXB A;  4JJC A;  1M90 C;  2RM4 A;  4Z02 A;  1VYV A;  1SHG A;  3TSW A;  2L3P A;  4LXC A;  5ECA A;  1X6B A;  2L2P A;  4OB3 B;  4CC4 B;  4M78 B;  4RTW A;  2EYW A;  3V8J A;  2YRD A;  1NLO C;  2EYY A;  4JS4 A;  1UEB A;  4LDW A;  4KH1 B;  1YJN T;  2VUB A;  2RK1 A; 
#chains in the Genus database with same CATH homology
 1V1C A;  3M0P A;  4AFQ C;  1CKA A;  2EGC A;  4J9D A;  1OOT A;  4HVW A;  1K0S A;  1CSK A;  1NEG A;  4DEX A;  1SPK A;  1Y57 A;  2DL5 A;  2O2O A;  2OJ2 A;  2FG0 A;  1I07 A;  1GRI A;  2FRW A;  4J9I A;  1FMK A;  4HCK A;  2RF0 A;  2YDL A;  3VS4 A;  1AWW A;  1JXO A;  3CQT A;  3SHW A;  2EVR A;  4IIM A;  1AD5 A;  2RQV A;  1H92 A;  4JPB W;  2KR3 A;  2LJ0 A;  2YUN A;  2HSP A;  4AFZ C;  2L3S A;  1PWT A;  4OMQ A;  2LX7 A;  2RQW A;  3PVL A;  3THK A;  3VS6 A;  2EKH A;  4AFS C;  2RNA A;  3VS2 A;  1HSQ A;  2CH4 W;  4D8D A;  5I22 A;  2PTK A;  2YUQ A;  2C0O A;  5EC7 A;  1H8K A;  4CC3 A;  2KBT A;  1K1Z A;  1WXT A;  3RNJ A;  3UF4 A;  1WDX A;  3SEM A;  2I0N A;  2LP5 A;  1U3O A;  1PHT A;  3REB B;  4Z88 A;  2K9G A;  1B3Q A;  1UJY A;  3U23 A;  1K4U S;  2X3W D;  1ARK A;  4LUD A;  2DVJ A;  4QT7 A;  1FYN A;  1XOV A;  4J9B A;  3KFV A;  3M0Q A;  4A63 B;  2K3B A;  2DL4 A;  2KXC A;  1PRM C;  2AZV A;  4D8K A;  2F2W A;  2BTT A;  2QDL A;  1BBZ A;  3EG0 A;  3VS3 A;  1YN8 A;  2RPN A;  1LCK A;  3JV3 A;  2G6F X;  3M0S A;  1SHF A;  1HJD A;  4LE9 A;  2DBM A;  1NYF A;  1OPK A;  1UHC A;  2DL3 A;  3NHN A;  1WLP B;  2RQU A;  1GCP A;  1X2Q A;  2J6F A;  1ZUU A;  3H41 A;  1NEB A;  1I1J A;  2DA9 A;  2DLP A;  3VS0 A;  3H0I A;  2CT3 A;  4OMN A;  1AWJ A;  2YUO A;  1T0J A;  1AZG B;  4Z89 A;  4K11 A;  2DL8 A;  3IQL A;  4AFU C;  2ABL A;  4DEY A;  2XMF A;  3VRZ A;  1WXU A;  1JU5 C;  2HCK A;  4GLM A;  1PNJ A;  2MOX A;  3QWX X;  1QWF A;  4OML A;  4AG2 C;  1J3T A;  2FPF A;  2A08 A;  2DBK A;  2DL7 A;  3I5R A;  1W70 A;  2FRY A;  3VS1 A;  3NPF A;  2CUB A;  2LJ3 A;  1M8M A;  2KRO A;  1RLP C;  4F16 A;  1GFC A;  1WYX A;  1WA7 A;  4X1V A;  2J06 A;  2KNB B;  2DMO A;  4FSS A;  1Z9Z A;  2KXD A;  1T3L A;  1RUW A;  1QLY A;  2RQT A;  2JM9 A;  2PZ1 A;  2W0Z A;  1UEC A;  1WX6 A;  1YWP A;  2JMC A;  3O5Z A;  3ZL7 C;  2D8J A;  2DNU A;  1A0N B;  2CT4 A;  1G2B A;  3PE0 A;  3NGP A;  1G83 A;  4J9F A;  2RQR A;  2H8H A;  2KGT A;  2D8H A;  2DJQ A;  4JJD A;  2RN8 A;  2ROT A;  2ROL A;  2D1X A;  4WCI A;  4ESR A;  3ULR B;  1M3C A;  2O9V A;  2KT8 A;  1QWE A;  1I0C A;  2X3X D;  3UAT A;  3I35 A;  2ED0 A;  1MV0 B;  1ZUY A;  1TUC A;  2E5K A;  4JJB A;  1RLQ C;  4R0K A;  4RTT A;  2L3Q A;  2K6D A;  2EYZ A;  1KSW A;  1UHF A;  5GJW B;  2JMA A;  1YNZ A;  1M3B A;  2L0A A;  3PVQ A;  2DM1 A;  1U06 A;  1K76 A;  1ABQ A;  2GQI A;  4Y92 A;  1X27 A;  5HCK A;  3VS7 A;  1Z9Q A;  4RUG A;  3UA6 A;  2CDT A;  2NUZ A;  2K7A A;  3REA B;  4EIK A;  1BB9 A;  4JZ4 A;  3M0U A;  2JXB A;  1SSH A;  1JQQ A;  2CSI A;  2DRK A;  4GBQ A;  4M4Z A;  1IO6 A;  1AZE A;  1ZUK A;  2JTE A;  2MCN A;  1ZX6 A;  4OMM A;  2O9S A;  3H0H A;  1M3A A;  2CUD A;  3I9Q A;  1X2K A;  1GCQ A;  3QWY A;  2J6O A;  1UDL A;  1VYU A;  5IXB A;  1SRM A;  1T3S A;  2W10 A;  4LUE A;  2EYX A;  5GJV B;  2KYM A;  2KRS A;  4F17 A;  3C0C A;  2KYB A;  2DRM A;  2LZ6 B;  4AG1 C;  2O88 A;  3M0R A;  2GTJ A;  1OPL A;  1W6X A;  2HDA A;  2EGE A;  2LQN A;  2EW3 A;  4E6R A;  5L23 A;  1YP5 A;  2KRM A;  2LQW A;  2O31 A;  2DX1 A;  1AEY A;  2C0I A;  2AKK A;  2HBW A;  1H3H A;  3M0T A;  2KRN A;  1SRL A;  1BK2 A;  2RMO A;  1UE9 A;  2DF6 A;  1UJ0 A;  4OMO A;  1NM7 A;  2JS0 A;  3EG1 A;  4ZNX A;  1GFD A;  1E6H A;  1X43 A;  1KJW A;  1MV3 A;  2JW4 A;  2M51 A;  2EQI A;  1NYG A;  2V1R A;  1TUD A;  1VYT A;  2IIM A;  5IHI A;  2LJ1 A;  2VKN A;  1AOJ A;  3RBB B;  1VA7 A;  1OV3 A;  2FPE A;  4J9C A;  2BZY A;  1CKB A;  5IH2 A;  2J6K A;  1GBR A;  2J7I A;  4F14 A;  2CRE A;  1SEM A;  2KT1 A;  1YWO A;  3VS5 A;  1WI7 A;  4CC7 A;  5IXF A;  1QKX A;  4OMP A;  3NMZ C;  2YSQ A;  4J9E A;  2JT4 A;  4RTY A;  2OI3 A;  2EGA A;  1GL5 A;  2AKL A;  5FW9 A;  2EBP A;  1UUE A;  2GNC A;  3FJ5 A;  5IHK A;  3TVT A;  2YUP A;  1GCQ C;  2F2V A;  1WFW A;  1GBQ A;  1JXM A;  4HVU A;  2A36 A;  1AWO A;  2ED1 A;  2A37 A;  5IHN A;  1WIE A;  5FWB A;  4RTZ A;  4LN2 A;  2JS2 A;  2FO0 A;  4ORZ A;  2GGR A;  1YCS B;  2SRC A;  2AZS A;  2CSQ A;  2ESW A;  1KFZ A;  4IIO A;  2EPD A;  2M0Y A;  2J05 A;  2LCS A;  2BZX A;  4HXJ A;  2ENM A;  2P4R A;  3EHQ A;  1NG2 A;  2CH4 A;  2FPD A;  2KEA A;  1JEG A;  1X6G A;  1TG0 A;  1E7O A;  2FEI A;  4LNP A;  1AVZ C;  5I11 A;  1T0H A;  2LNH B;  2DIL A;  2C0T A;  1OEB A;  1ZLM A;  2K79 A;  2D0N A;  3A98 A;  3GBQ A;  1E6G A;  1M27 C;  1Y0M A;  2V1Q A;  4HVV A;  3I5S A;  2K2M A;  1B07 A;  4J9H A;  2A28 A;  3EG2 A;  1RI9 A;  1UTI A;  1BU1 A;  1PKS A;  2F2X A;  1UGV A;  2SEM A;  3EG3 A;  1MUZ A;  2HEQ A;  5FWC A;  2DE0 X;  4CC2 A;  1U5S A;  1AWX A;  3H0F A;  3LH5 A;  1M30 A;  1S1N A;  1QCF A;  2AK5 A;  2BZ8 A;  2KE9 A;  3TSZ A;  1ZSG A;  2GBQ A;  1JO8 A;  2OAW A;  4JZ3 A;  1W1F A;  1ABO A;  1ZBJ A;  1X69 A;  1KIK A;  2GTO A;  1PKT A;  2YT6 A;  4RTV A;  1K0X A;  1UG1 A;  1WXB A;  3EHR A;  2ECZ A;  4JJC A;  4RTU A;  1VYV A;  1SHG A;  2JM8 A;  4KRT A;  2L3P A;  1HD3 A;  2VVK A;  4J9G A;  3TSW A;  1K9A A;  5ECA A;  1EFN A;  2DYB A;  2NWM A;  1UFF A;  2VWF A;  1X6B A;  2L2P A;  1N5Z A;  4CC4 B;  1NLP C;  3VRY A;  4RTW A;  2EYW A;  3UA7 A;  2B86 A;  4Z8A A;  2PNI A;  1NLO C;  3R6N A;  4RTX A;  1PRL C;  2EYY A;  3EGU A;  2LMJ A;  1QKW A;  2MIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...