3C0CA

X-ray crystal structure of the rat endophilin a2 sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
b'PLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endophilin-A2
publication title Crystal structure of the SH3 domain of rat endophilin A2
rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3c0cA00
2KNBB 4GLMA 3EG0A 1YWOA 2JMCA 1SEMA 1BU1A 1PHTA 2OI3A 1SPKA 2FG0A 1WIEA 2FO0A 3NHNA 2XMFA 2FRWA 2EYXA 1M3BA 1YCSB 2ABLA 2A08A 2ROLA 1M30A 1UHCA 1E7OA 2KROA 2RF0A 3UATA 1WI7A 2ROTA 1U5SA 2JW4A 2O9VA 1NYGA 1ZBJA 3I9QA 2LX7A 2ED0A 1SRLA 2O9SA 1BBZA 2DRMA 2J06A 1UDLA 2J6KA 1UJ0A 1KIKA 1CKBA 1JU5C 2HSPA 1JO8A 1RUWA 1WYXA 2DM1A 3EHQA 1ZX6A 1OV3A 1TG0A 2H8HA 1U06A 1BB9A 2BZYA 2SRCA 2FEIA 2V1RA 4OMNA 2K7AA 2GBQA 2OJ2A 1AWOA 1AZGB 4RTVA 1A0NB 2C0OA 5I11A 2LP5A 2EW3A 2PTKA 1FYNA 2JMAA 1JXMA 1T0JA 2CH4W 4RTWA 4HCKA 1AWWA 2A37A 4RTTA 1OEBA 1RLPC 2FRYA 3H41A 3PVLA 2BTTA 2F2XA 3M0RA 1UHFA 3R6NA 1N5ZA 2L3PA 2OAWA 1X43A 2LQWA 1X6BA 2RN8A 2EYYA 5L23A 4E6RA 1VA7A 3PE0A 2LNHB 3CQTA 1RI9A 1SHGA 2RMOA 4J9BA 2O88A 2KBTA 1UUEA 2HDAA 1QWFA 4OMQA 1PNJA 1AZEA 1K0SA 2DYBA 3VS0A 3H0HA 3EG1A 2YT6A 1G83A 2CUBA 3UA6A 2DL3A 2L2PA 1NEBA 3U23A 2J05A 1WX6A 4J9IA 4Z89A 2G6FX 3LH5A 1WXBA 1WFWA 4OMPA 1YN8A 4LUEA 2J6FA 4JJCA 2ESWA 1PKTA 1GCQC 1ZUYA 2DL8A 2DLPA 2NWMA 1NM7A 1PKSA 3JV3A 4R0KA 2DE0X 2CT4A 3M0SA 3M0UA 3IQLA 4IIMA 2HCKA 5FW9A 5IHIA 1CSKA 2VVKA 4HVWA 1ABOA 2RQVA 4KRTA 4OMMA 5IH2A 1T3LA 1K76A 2DBMA 3I5SA 3M0TA 1WXTA 4CC3A 2KRSA 4F17A 1K9AA 4DEYA 4DEXA 2DL5A 3TVTA 1K1ZA 2CT3A 4AFSC 2JTEA 4AFQC 3EGUA 3PVQA 2DL7A 2CREA 1AWXA 2CSIA 4RUGA 4RTZA 4CC7A 2K6DA 2KRNA 2GNCA 2KE9A 2SEMA 1E6HA 3VRYA 3VS3A 2DILA 2K2MA 3C0CA 4IIOA 2YUPA 2QDLA 3ZL7C 2LCSA 2K3BA 5EC7A 3NMZC 5HCKA 3A98A 3EHRA 1ZLMA 3EG3A 4LNPA 5FWCA 2YUQA 1RLQC 4JPBW 1OPLA 1UGVA 2KXDA 2LQNA 1UJYA 1NLPC 1YP5A 3RBBB 1U3OA 4ORZA 3M0QA 2DA9A 3VS1A 2DF6A 1AOJA 4AFZC 2J6OA 2EGEA 5IHKA 2FPEA 3H0FA 1XOVA 2GGRA 4RTYA 2D1XA 1UFFA 1VYTA 1JXOA 5GJVB 2LJ0A 1QLYA 3I5RA 1K4US 4ZNXA 1KSWA 2E5KA 1B3QA 1NLOC 1SRMA 4EIKA 2J7IA 2JT4A 5IHNA 1QCFA 4F14A 1WA7A 4F16A 1YNZA 1QKWA 2DX1A 4J9HA 4J9CA 1MUZA 1NYFA 1YWPA 2KGTA 2MIOA 2DVJA 2EPDA 2DRKA 4LUDA 1TUDA 3EG2A 5IXBA 5FWBA 3SEMA 1I07A 3QWXX 1V1CA 2KT8A 1WLPB 2DMOA 4GBQA 2NUZA 3QWYA 2CSQA 1SHFA 2JXBA 1ABQA 4Y92A 2FPFA 1JEGA 1MV0B 1QKXA 1H92A 3FJ5A 1PWTA 2CUDA 4ESRA 2C0TA 2DL4A 2M0YA 2AKKA 2M51A 3NGPA 1GFCA 1X2KA 2L3QA 4OMLA 2EKHA 4HVUA 2O2OA 1FMKA 4RTXA 2I0NA 1UECA 4RTUA 1UG1A 2GTJA 1WDXA 4K11A 4D8KA 4Z88A 1H3HA 1ZUUA 2LZ6B 2P4RA 2A36A 3VRZA 5GJWB 2YUOA 1NG2A 1K0XA 5I22A 2MOXA 4JJBA 2VKNA 2DJQA 4LN2A 4HXJA 2JM9A 2D0NA 4OMOA 3KFVA 1WXUA 2ENMA 1T0HA 1E6GA 2LJ3A 3UF4A 1W70A 2RQWA 3VS5A 4JZ3A 1W6XA 1JQQA 2VWFA 2V1QA 2BZ8A 1PRMC 4JJDA 2B86A 2F2WA 1Y57A 2JS2A 3SHWA 1GBQA 2AZVA 1AEYA 1LCKA 3ULRB 2HEQA 3RNJA 2A28A 2D8HA 4CC2A 3M0PA 1PRLC 1Y0MA 3VS2A 2EGCA 1M3CA 1GRIA 4Z8AA 3O5ZA 2X3XD 1M27C 2HBWA 2EQIA 4HVVA 1GL5A 5IXFA 1J3TA 1TUCA 2YUNA 1X2QA 1G2BA 2CDTA 2D8JA 2ECZA 2GTOA 1GFDA 1KFZA 4CC4B 4D8DA 4AG2C 3TSWA 1GCQA 2BZXA 1UE9A 1Z9QA 2X3WD 4J9EA 2RQRA 3VS6A 2K9GA 2RNAA 2LJ1A 2EVRA 1X69A 4X1VA 2KYBA 2DNUA 1QWEA 1I0CA 1VYUA 4A63B 4JZ4A 1I1JA 2EGAA 2F2VA 2O31A 1EFNA 1HJDA 4QT7A 2W0ZA 4M4ZA 1ARKA 3REAB 1B07A 2RPNA 2W10A 4WCIA 1GCPA 2IIMA 1VYVA 1SSHA 1HD3A 2YDLA 1NEGA 2JS0A 1KJWA 1Z9ZA 3VS7A 4AG1C 2AKLA 1OOTA 4J9GA 2KYMA 3GBQA 2KR3A 2L3SA 2DBKA 2KEAA 2EYWA 1UTIA 1BK2A 2CH4A 2AZSA 2YSQA 1AD5A 3I35A 4J9FA 2MCNA 1W1FA 4AFUC 4LE9A 1ZUKA 2AK5A 1M8MA 4FSSA 2KXCA 2PNIA 2L0AA 1AVZC 1ZSGA 2JM8A 2K79A 2EBPA 3NPFA 3VS4A 1HSQA 1GBRA 2KRMA 4J9DA 1X27A 1AWJA 2RQTA 1MV3A 3UA7A 2EYZA 2KT1A 3TSZA 1X6GA 3THKA 1T3SA 1M3AA 2LMJA 2GQIA 2C0IA 5ECAA 1CKAA 1H8KA 2FPDA 1OPKA 3H0IA 1S1NA 1IO6A 2RQUA 2ED1A 2PZ1A 3REBB
chains in the Genus database with same CATH superfamily
2KNBB 2JMCA 1BU1A 2VASA 4PL6A 2FG0A 2C06A 3JRZA 2XMFA 4OMFB 4FYWB 4DBQA 1YCSB 2EJ9A 1M30A 1UHCA 5FU7C 5CKFA 2AHJB 4QVCA 1WI7A 4EMKA 1BKBA 2ROTA 5CQYA 1XNIA 4C8QA 1NYGA 4N0AA 4OP0A 3MP8A 2RH2A 1XTDA 4J6XA 1YJ9A 1BBZA 1QVFA 5GAN6 4M75F 1RAFB 2DRMA 3DLLA 4F7UB 1UJ0A 2HSPA 2DM1A 3EHQA 1S72T 3NFCA 1TG0A 1U06A 1BB9A 2BZYA 4OB2B 1VQKA 3SFMA 1M90R 3CCST 2GBQA 2OJ2A 1OI1A 5LJ5j 3CC2Q 2LCLA 4FU6A 1BYMA 2V26A 3CPWA 3L2VA 2C0OA 5KE2A 1I5OB 2JMAA 1K73R 1JXMA 1NZ9A 1T0JA 3QDFA 1AWWA 3OS1A 1OEBA 4LDWA 4OGEA 2FRYA 2BTTA 1UHFA 2HZYA 2L3PA 1R77A 2L8DA 1X43A 1K73C 2LQWA 2RN8A 5KCOA 2DAQA 3BY7A 4M75A 3PE0A 2DK3A 2RJEA 1YFNA 4OGCA 1VUBA 5A2QE 1RI9A 3QDRB 4RCCA 2KBTA 3VUBA 1QWFA 5CKHA 1AZEA 4NOYA 3VKIA 2E12A 3ER0A 4KGVB 1WHMA 2YT6A 3OMCA 4FL6A 3X28B 1SKUB 3QO3A 2WACA 4FW1A 2J05A 3RMSA 1WX6A 3HRTA 3J80E 1S72Q 4M7DB 3JCMf 2JJ9A 1YN8A 4FIBA 3KUFA 3JCMb 3CCSQ 4PJOE 5GAMd 2J6FA 2V8IA 2HSEB 3PMTA 2I2LA 1ZUYA 2MYSA 1NM7A 3JV3A 3MEVA 4M7DE 3O8VA 4R0KA 5GAMg 1D0XA 1CSKA 2RQVA 4FT4A 2CP6A 1HK9A 3MPUB 3LWIA 4GY5A 3I5SA 4BD3A 4DEXA 1K1ZA 4MMKA 2LT1A 1KD1U 1QCNA 3RR6A 4JS4A 1TUGB 4RTZA 4CC7A 1KQ1A 1MNDA 2GNCA 2YRCA 5GAOq 2DILA 4C92E 2K2MA 1YJ9Q 4RMOA 3ZL7C 2EIFA 1Q82C 2K3BA 2HAXA 4J7IA 4LNPA 4J7FA 1PSFA 1RLQC 3GPLA 1PCXA 1YP5A 2QA4T 3M0QA 5LJ3h 3LX7A 5FU6B 2DF6A 2ZCFB 2BUDA 1B34A 2R5AA 3TCJA 4DOWA 3H0FA 3C94A 3EFRA 3FJPA 1NPRA 1UFFA 2D1XA 1EIFA 3QZ5B 5KYUA 3G7ZA 4N4GA 1QLYA 3I5RA 4JLGA 1AHJB 3RIRA 3VJPA 3CCUT 1UGPB 2CZ7B 2FHDA 1JRIA 4F16A 2O4XB 3L2UA 3CCJA 4DBRA 2PU9B 1U8RA 5GAN3 2V8JA 4LUDA 3EG2A 3OYLA 5KYYB 1Q7YR 2X51A 4PJOD 1N9RA 1WLPB 5A0DA 1OU9A 4RKUE 3JCMX 4EMKC 2JXBA 4C8QC 1VQ6A 4M7DD 4Y92A 3MO8A 2FPFA 2KMTA 4N0AC 4WTOB 3FC3A 2QA4Q 1Q7YC 4C5IA 2LTOA 2XG8D 5CVIA 2DL4A 1R0BG 3GF5A 3E9GA 3NGPA 2NLUA 4MZTA 1GFCA 2OTJA 1N9SA 2E6NA 5J3BA 1X2KA 2MF2A 2EKHA 2O2OA 3ZFJA 2RI3A 4RTXA 2I0NA 4MDWA 4ZN3A 1KD1C 3H6ZA 3VRZA 2A36A 4PLIA 2YUOA 1NG2A 2MWPA 2RJCA 3BW1A 5IT9E 4FSXA 4LDVA 4LN2A 1BI1A 2D0NA 4C92D 1WXUA 3CCJT 2RHYA 2P0PA 1E6GA 4LD9K 1M2OA 4M75G 2PVOB 2RQWA 4M75C 4NL2A 2P0QA 1W6XA 1VQ7A 1JQQA 3I55A 3M59A 4ANJA 3EG9B 2LQ8A 1PRMC 1Y57A 1SF9A 2JS2A 1GBQA 2AZVA 2Z0WA 3JB9I 2HEQA 2A28A 3EH1A 4JRIA 1PRLC 1Y0MA 1ZBXA 2X4WA 4E7SA 4PJJA 1VQMA 2HBWA 2X4JA 2EQIA 4ZGEB 4KULA 2OTJT 3JAME 3CMAA 3PGGA 3DB3A 1TTHB 3G71A 1X2QA 1Q86U 4ZTJA 2GTOA 1KFZA 4D8DA 1ZSZA 2JZ2A 1GCQA 2BZXA 4C5GA 1K8AR 1Z9QA 3OY9A 3CCJQ 2RQRA 3ASKA 3V7SA 3MKDA 4JRPA 2LJ1A 2LVMA 3M5AA 2DERA 4X1VA 1RI0A 1VYUA 1M2VA 1K8AC 2O31A 4A4KA 2RPNA 1GCPA 2YLCA 2DFUA 2OAUA 3V8LA 1VQ6Q 3JCMP 3CD6T 1HD3A 1NEGA 3SWNB 1VQPA 1UGQB 1Z9ZA 3JCMh 3ZBDA 3HL8A 2AKLA 4P5NA 2KYMA 2OTJQ 2E4HA 4AMCA 3CBMA 2FZCB 3EGXA 2DBKA 4BACA 2EYWA 4GLKA 3FDRA 4IUQA 1QP3A 1AD5A 1FXXA 8ATCB 1KG1A 2JTFA 3CMAT 4DBHA 1MNEA 1IREB 2MMPA 4ZTFA 1YITT 2L0AA 3OYKA 2LNVA 1AVZC 4R56A 5FRNA 2K79A 4RCBA 2CZ6B 2E65A 2KDSA 1X27A 1M1KR 4F7UF 3Q1JA 3PIOA 2A0FB 1W2BP 1IHWA 3DKMA 1M3AA 1VQ7Q 2XDBA 2C0IA 3I55Q 5ECAA 1V29B 3OYYA 3OYAA 1M1KC 2DEUA 3H0IA 3CCMT 1IO6A 1JJ2A 5GAMh 4JUVA 2RJFA 2KQWA 1YWOA 1SEMA 5GANd 3I56A 1NJIR 3PFSA 3OYFA 1MMDA 1M3BA 1D3BB 2ABLA 5GANg 1LVKA 3RERA 2KK4A 1QVGP 3JSCA 1VQMQ 4N4HA 2LDMA 1NJIC 3M57A 4F7UA 3CCQA 2RF0A 3CMAQ 4M78G 1VQ5T 4KH1B 5LL6S 3CPWS 1TSFA 3E9FA 4VUBA 3G71Q 1M8VA 1TU0B 1ZBJA 3I9QA 5C6SA 2ED0A 2O9SA 1TXQA 4PJOF 4B9XA 1RABB 1CKBA 1JO8A 1RUWA 1WYXA 1OV3A 4LDXA 4M7DF 3G4ST 2SRCA 3CC4A 1KHCA 5GAN4 1X01A 2COZA 2AT1B 1AWOA 4OF1A 4RTVA 3CCMQ 1PM3A 2EW3A 3LW5E 4FYVB 3HSBA 3GNFB 1WGSA 1Y96B 2L5QA 2YHTA 4RTTA 4DBFA 4JS5A 4XU2A 1N5ZA 3C4SA 4C0DB 3PTAA 4UC4A 2X9HA 2GFUA 3I56T 5L23A 1D09B 4PJOA 2CP3A 1Q81U 2QTXA 4IUPA 2DIGA 3CQTA 1SHGA 1UUEA 2HDAA 3QJ6A 3CMEA 4M7DA 2QG9B 1OYXA 4C92F 4OMQA 4BY6B 2QQBA 3A1PA 1M1FA 3GLXA 3H0HA 3HPWA 1G83A 3R6OA 2CUBA 2L2PA 1NEBA 5HK0A 1WHHA 2K5FA 4J9IA 2G6FX 1WXBA 1WFWA 1M90U 4OMPA 2IVWA 3A5ZB 3MEWA 5KYWB 1ZSZC 1PKTA 1GCQC 1OQKA 2RI2A 2DLPA 3OS5A 1N8RR 4CRIA 2DE0X 2HQHA 2CT4A 3PNWC 4XTYA 2K3XA 1YIJA 2RK2A 3OSSC 5FW9A 5IHIA 4HVWA 5LJ3e 1ABOA 4OMMA 2DTHA 4C92A 3S3NA 5IH2A 5D6WA 3PT9A 1XJWB 4XU3A 4JLIA 1K76A 3I56Q 1N8RC 4RG2A 5J39A 1NPPA 4E7IA 3QKJA 2DXCA 4DEYA 2DL5A 4II1A 4PNOA 4AFSC 1WQWA 4C5HA 2JTEA 2DTIA 2EQKA 3JCMV 5GMKl 5CIUA 1TS9A 2QEXT 5I21A 1K9MR 4RUGA 2K6DA 2KRNA 1EZZB 2KE9A 5GAN7 3VRYA 4ZN1A 4IIOA 4E7JA 1RAEB 1WHJA 3NMZC 2YWWA 5HCKA 1K9MC 3A98A 2DZCA 1WJSA 5FWCA 2M1HA 2RHZA 2K3YA 4HKEA 3EFOB 1UGVA 2LQNA 1NLPC 3RBBB 4E2FB 2HNIA 1U3OA 2EJGA 2B8AA 3MHXA 2CS7A 4XAXB 3L42A 4J5YA 4QVZA 2O4XA 5IHKA 4F7UE 3JCMd 1XOVA 1NBEB 2QGFB 1IGUA 1Q81C 4NL3A 2CP0A 1BI3A 3C12A 2WSEE 5EG2A 4ZNXA 1KSWA 3JCMg 2E5KA 1D0YA 3OYDA 1SRMA 4YTLA 5KYYA 2J7IA 1GXIE 4QVDA 4F14A 2NUPB 2RB6A 3QUIA 3M55A 1FMVA 2Y4YA 3CCRA 2QEXQ 2ATCB 5A0GA 1YWPA 2X35A 3OYNA 3CMEQ 3QXEB 1ZA1B 1MMGA 5IXBA 1C0MA 5FWBA 3VYHB 3SEMA 1I07A 3QWXX 1G3YA 3WXMB 4TVRA 1V1CA 2KT8A 2M02A 5CKBA 2CSQA 2BKDN 2XICA 1ABQA 3CCVA 5KYXB 2JNGA 1JEGA 3RUXA 2DO3A 1QKXA 2PUKB 1YJ9T 1ZQ1A 3FJ5A 1ACMB 4XTVA 4ESRA 3OW2S 2M51A 1YJWA 1RL2A 3LGFA 4JRKA 4BE1A 1VQKT 2RD1A 3RKWA 3QHSA 3V7CA 1KC8U 4K11A 4B9WA 5DM7R 1ZUUA 2LT4A 5GJWB 5I22A 1D1AA 2MOXA 2ZGWA 4JJBA 1PC0A 4BUGA 4OMOA 4QQDA 4QW2A 2M16A 1RAHB 3UPUA 4PJOG 3CCRT 1RAAB 4PJOC 3VS5A 2KSSA 1Q82R 1VQOA 5GMKh 2BIVA 2XHCA 1RAIB 2VWFA 2V1QA 1O9SA 4M7DC 3TREA 4R55A 2HMAA 3SHWA 3OS0A 2CP5A 5D7UA 3A8LB 4CC2A 3M0PA 3VS2A 3H8ZA 1GRIA 1VQKQ 1WHLA 4HT9A 4KBMB 4RG8A 1M27C 1P92A 1YJWT 4LDYA 3JCMe 5GANh 4Q5WA 2E6ZA 2QQRA 5FROA 2YUNA 3L2QA 1G2BA 3OYHA 5LJ5g 4AG2C 4C92G 3SDZA 4C92C 1O75A 1UE9A 5AYFA 3CCRQ 2QDYB 3HFOA 3CPWP 3VS6A 1KQSA 2EVRA 4L5GA 1XQHA 4A54A 2XKOC 3ME9A 4JJNK 1QWEA 3SWNA 1I0CA 3RESA 1I1JA 3M58A 2EGAA 1G8XA 2F2VA 3CC7A 1FX7A 4QT7A 1VQOT 4M4ZA 2EAYA 2DKGA 3CCVQ 1VYVA 3MP6A 2GF7A 4C8QG 2JS0A 3RDVA 3OYCA 3LYIA 3VS7A 5LJ5f 4AG1C 3BFMA 5GAMe 1KC8C 3KXTA 3A8GB 1YJWQ 2WSFE 4J9GA 1I8FA 3URGA 3OA6A 1KD1R 2L3SA 2AZSA 2YSQA 5A0LA 4BE2A 2DETA 4M75B 1BCOA 2LCCA 3CXCS 5L8RE 4AFUC 1RADB 2AK5A 4J6WA 4FSSA 3S6WA 4MZMA 2V8KA 2JM8A 2RHIA 2RJDA 1WJRA 2KRMA 4HT8A 4ME7A 1MV3A 4KGZB 2COYA 4XK8E 3THKA 1T3SA 3L2WA 2GQIA 1VQOQ 1W2BA 9ATCB 2KVQG 1QW1A 1CKAA 1D3BA 1H8KA 2FPDA 2G3RA 1MHNA 3HFNA 2ED1A 2PZ1A 4QQ6A 3EG0A 1PHTA 4M7AB 1C1AA 2VXEA 2FRWA 2EYXA 4LD6A 2QASA 3QYGB 1VQ6T 2CP7A 5DY9A 2K5IA 4LDUA 2A08A 3M9QA 1IGQA 4M77B 1OX9A 3GNGA 1QVGA 1E7OA 4M7AE 3S3MA 5LJ3j 3UATA 4FM4B 5GMKm 4A4FA 2VGNA 1U5SA 2JW4A 2O9VA 4KUDK 3DB4A 4M77E 2LX7A 4ATOA 3MJXA 1IXDA 1I81A 3HHTB 4E7HA 2J06A 1KK7A 2QQAA 1UDLA 2JTMA 2XDPA 1Y96A 1YCYA 3JCMc 5GAOl 1ZX6A 4LXCA 4MZPA 3OYIA 3FIFA 4OMNA 3V8JA 4Y28E 1F1BB 3CCEA 1AZGB 2R57A 4FW2A 2QI2A 5I11A 3CC7Q 1MMAA 2LP5A 2PTKA 2E1HA 4BB7A 4PKCC 1WHGA 3SD4A 3RKXA 1VQLA 4O5VA 2D6FA 1VQ7T 3I55T 3H41A 3PVLA 3M0RA 3R6NA 1M1GA 2JUFA 3CBPA 2QGGA 2CYZB 2X4YA 2OX7A 2WSCE 4E6RA 1VA7A 5KYUB 1LJOA 2VUBA 3HTRA 1H641 1M5Q1 5KYWA 1VQMT 1AT1B 3BDUA 2DJZA 4DA4A 2CP2A 2DL3A 4OVAA 3D7SB 4Z89A 3G71T 4IURA 4E7ZA 5D6XA 4C5EA 2DVEA 4LUEA 1RAGB 4JJCA 1D1CA 2DTOA 4PJLA 3META 3LH0A 1YHQA 3JB9H 1PKSA 1B7TA 4DOVA 3M54A 3M0SA 3HKSA 2MI6A 2P4TA 3IQLA 2XDDA 2VVKA 2E3IA 3SWNC 1YBYA 4M78B 3OS2A 1UEBA 3OW2P 5IAYA 4M7AD 3M0TA 3J81E 3UT1A 4CC3A 3SB2A 3LLRA 1QVFS 1SSFA 4M78E 1OX8A 4M77D 1I4K1 1VQPT 3EGUA 2F5TX 1U1SA 3PVQA 5DLOA 3CEYA 1BCMA 3JB9D 4A53A 4ELZC 2CREA 1AWXA 1Q86C 1G3WA 2SEMA 4PK4A 1E6HA 3VS3A 2YUPA 1ZA2B 2QDLA 1FMWA 1VQ4A 2LCSA 4Y91A 5EC7A 3EHRA 2DXTA 3HP9A 2YUQA 1OPLA 3P8BB 3G6EA 1UJYA 4DQ2A 4L6V5 4MMLA 3JCMW 5CCAA 4ORZA 2DA9A 3C95A 3S3OA 3VS1A 3CCEQ 3E1SA 4F04B 2OTLA 3FLGA 1AOJA 4AFZC 4ELYC 2NUPA 5CR2A 1WHKA 2EGEA 1YHQT 2HKNA 2DZ9A 2QTVA 1VQLQ 7AT1B 4RTYA 1JXOA 2LJ0A 1VQ9A 2PUOB 3NTIA 1G5VA 1K4US 3L2ZA 1NLOC 4EIKA 1M4ZA 1QP2A 1VQPQ 1WA7A 5LJ3f 5LJ5h 1QQJA 1MUZA 4MDXA 2RK1A 1NYFA 5KYXA 2MIOA 1R8OB 3OYMA 3T9NA 2E3HA 2DRKA 1TUDA 1VQNA 2Y4XA 4IUUA 1Y7XA 3CCQT 4HCCA 4GBQA 5FRMA 4BE0A 3OMGA 2ZPHB 3QWYA 1SHFA 2F5KA 5GMKe 3L1AA 2Y90A 2CUDA 3P8DA 2GCXA 3OYEA 4CI0C 2M0YA 2AKKA 2YXYA 1YHQQ 2LQKA 3NTHA 1K73U 3CC4T 1OULA 3X25B 4RTUA 4X9DA 5FU7B 4M78D 1UG1A 1WDXA 4EPCA 2FZKB 4Z88A 2P4RA 3QPHA 3EGDB 5I2MA 5GAN2 2LX9A 1K0XA 5GANe 5GAMj 3A8OB 2DJQA 2R5MA 1YI2A 1R0CB 2JM9A 4BY6C 2EFIA 3KFVA 2LJ3A 3CXCP 3UF4A 1W70A 3CCQQ 2EQUA 3FRNA 2ZPGB 2NUTB 1H3ZA 4E7KA 1VQNT 5C0MA 5I2SA 3CMET 2BZ8A 2B86A 4L59A 1VQ4Q 3H9NA 1AEYA 1LCKA 3ULRB 1HYOA 2D8HA 5CAIA 3G6EQ 2FVUA 1TWBA 3MEUA 3EAEA 3CC4Q 4Z8AA 1KQSS 1Q81R 3UWNA 2OTLQ 2XI9A 4HVVA 1GL5A 4KUIA 5IXFA 4FYYB 2HD0A 1J3TA 1TUCA 1VQ9Q 2D8JA 5FLXE 4Z02A 1YIJT 1IZ6A 4CC4B 5GAOr 3OYBA 3TSWA 1PD1A 3AHUA 3RMQA 2FYKA 2O01E 2X3WD 4J9EA 1Q95G 1YI2T 1Q82U 1OZ3A 2RNAA 2HL5C 5GAOm 1LNXA 1X69A 2KYBA 2DNUA 1VQNQ 4A63B 4JZ4A 4IUVA 3VYGA 1G3TA 2M0OA 2QYZA 1EFNA 2ZPIB 1OU8A 2DXUA 1C6VX 1M90C 4XU0A 2W0ZA 1ARKA 2CZ1B 2DEQA 3REAB 2W10A 2RO0A 2K2VA 1Y07A 4F7UG 2IIMA 1BIAA 1SSHA 4HA8A 2YDLA 1KJWA 5IN1A 3G1JA 2DIQA 2HQXA 1PSEA 2IPOB 2QQ9A 3KBGA 4M7AF 1NE8A 2FB7A 4FCYA 1IRXA 2KEAA 1WJQA 1UTIA 4M77F 3M4GA 1W2BS 4E47A 5GMKi 4PJOB 4J9FA 2IG0A 1YIJQ 3JB9J 3JB9F 4KH0B 1YJNA 2KY9A 2FL7A 2QA4A 1YI2Q 2EBPA 2H3EB 2P0KA 3NPFA 3GP8A 1GBRA 4J9DA 2HQEA 2RQTA 3EG9A 3QIIA 1X6GA 3QG1A 1VIEA 1Q7YU 1TOVA 4M7AA 1QVGS 3BE3A 1OZ2A 3V8KA 1OPKA 1UGRB 1S1NA 5KH6A 3CCUA 4M77A 5CQXA 4M7DG 4XTWA 4A4GA 4GLMA 4X9CA 2CZ0B 2K5LA 2OI3A 1SPKA 1PG5B 3L2RA 1WIEA 2FO0A 1W4SA 3NHNA 4C0ZA 3CCVT 4C92B 4V2SA 2ROLA 5DLQE 3WVDB 2PQWA 2KROA 4B6MA 4QQGA 3GOXA 2EJFA 3WVEB 4HCZA 5GAMf 3PIPA 5LJ5d 4J6YA 1QVFP 2RA2A 3OQ5A 1SRLA 1KQ2A 3A8HB 3JCMJ 1YJNT 1WZOA 3M53A 5GAOp 2J6KA 1KIKA 1JU5C 1MMNA 4EMKB 5M9OA 2H8HA 1LOJA 4C8QB 1I5LA 2FEIA 2V1RA 4A4HA 2LRQA 2K7AA 2XK0A 3HRSA 1A0NB 2CKKA 4AT1B 1D1BA 1EX4A 1FYNA 4C8QE 4EMHA 2CH4W 4RTWA 4HCKA 2A37A 1RLPC 3TU4K 3GIBA 4J8OA 2F2XA 1HXDA 1SG5A 5CK9A 1KC8R 4WF2A 4M78F 2OAWA 3CCLA 2COWA 1X6BA 3LWHA 2EYYA 5CKDA 1ZHIA 5FU6C 2JVVA 2LNHB 2MPXC 1UGSB 4PLLA 2RMOA 2PVDB 4J9BA 2VV5A 2O88A 2DD5A 4JRQA 1PNJA 2YRVA 1K0SA 1BIBA 2DYBA 3VS0A 3EG1A 1YJNQ 3DLMA 3EH2A 3UA6A 1X75C 4PFZA 3U23A 2RHXA 3M4YA 1K8AU 1JJ2S 3LH5A 3FEOA 3INZA 4IUTA 3HRUA 4M78A 4M75E 2M9UA 2ESWA 2E41A 2DL8A 4HCBA 2NWMA 2KI7A 3OBYA 3FB9A 3M0UA 4IIMA 3CCUQ 2HCKA 1U1TA 4QKUA 5HK3A 3VU3C 4KRTA 2DXBA 5GMKj 4XQ3A 3CC7T 1D0ZA 1T3LA 4PJMA 4ZGJB 2DBMA 1QMCA 2AIRB 1UB4A 3OW2A 2F1LA 1WXTA 2KRSA 4F17A 2VYTA 1M9SA 1K9AA 3CCLT 5GAN8 2K4YA 4OB1B 2CT3A 3TVTA 2CGHA 4AFQC 2ZZDA 2BE9B 2DL7A 2X4XA 1TH7A 2ZAEA 2ZPEB 2CSIA 3CBOA 2E5QA 5AT1B 5LJ5e 3CD6A 1RACB 5HKCA 2EKOA 5GANj 3C0CA 3QZ9B 2D0QB 3RKYA 2KAFA 2A7YA 3MEAA 4BI8B 4C0FA 1ZLMA 3EG3A 1VIFA 1M1KU 5KE3A 4OB3B 2YRDA 4C8QD 4JPBW 4XU1A 1VQ8A 2KXDA 3PMIA 1WPYA 2E70A 3P8HA 1VOMA 2FZGB 2J6OA 2FPEA 2PVGB 2GGRA 5CKEA 4M7AG 2QAZA 1YITA 4M7AC 2MAMA 1VYTA 5GJVB 3X20B 2EQJA 1NJIU 1X6OA 3E2UA 4KT0E 3CCLQ 1B3QA 2BE7D 4M77G 3JCMQ 1KQSP 1WQ7A 2JT4A 4M77C 1B34B 1QCFA 5IHNA 2XIDA 1YNZA 5GAOn 1QKWA 2DX1A 3JB9G 4J9HA 4J9CA 2DD4A 2KGTA 2DVJA 2EPDA 2F69A 4N4IA 3CCMA 4D6WA 3OBWA 2VXFA 2HBPA 4FYXB 5CO7A 1PD0A 4M75D 4XTXA 2DMOA 2NUZA 2VGMA 1BI2A 1N27A 2L89A 2RM4A 2JN0A 1MV0B 3J7AF 1H92A 4BI4A 2EYQA 1PWTA 2C0TA 1JB0E 1N6AA 3EGDA 1VQ8T 1VQ5A 1QVPA 2L3QA 4OMLA 4HVUA 4OB0B 1FMKA 4BDZA 1UECA 3CCET 4JDSA 2GTJA 2YLBA 4D8KA 3OYGA 1H3HA 2LZ6B 1JBMA 1VQLT 2NUTA 2GFAA 3G4SA 5J26A 2VKNA 2QXFA 1FWZA 4HXJA 1Q86R 2E64A 2VB6A 5D6YA 2GQVA 2ENMA 1T0HA 3QBYA 3MP1A 3TEEA 3X26B 4JZ3A 3CXCA 3CD6Q 4J83A 3EFOA 5LJ3d 2ZPFB 2P84A 4JJDA 2F2WA 4BI3A 4EMGA 3RNJA 5LJ3g 3N5BB 1VQ8Q 3F70A 2EGCA 1M3CA 2LC4A 3A8MB 1N8RU 3LGLA 3O5ZA 2X3XD 1KHIA 4M78C 1DJ7B 1YITQ 5HY6A 4NS5A 4KGXB 3UDCA 2K57A 2E10A 2CDTA 2ECZA 4EDUA 8AT1B 3CPFA 4E7LA 1GFDA 2RHUA 3BDLA 2H3JA 3QSUA 2QQSA 5KYNA 2HL3A 4XTUA 2DPPB 2K9GA 2DYIA 1K9MU 5GANf 3E19A 3CC2A 3AT1B 2RI5A 5KCHA 2L3RA 3OSVA 1ZSZB 1HJDA 3MCAB 3ZEHA 1B07A 4WCIA 3V7RA 2R58A 5GAN5 2EWNA 3NTKA 4XTZA 4ZGDB 1IB8A 4O6JA 2HKQB 4BDYA 2A3LA 1VQ4T 1M2VB 1VQ5Q 2VC8A 2QEXA 1OOTA 1BI0A 3GBQA 3G6ET 2KR3A 1LPLA 2MK5A 4X34A 4FT2A 3TQ7P 1BK2A 2CH4A 2QK0A 1MGQA 3I35A 4C0GA 3VUZA 6AT1B 2OTLT 2MCNA 1W1FA 2ZPBB 2XD0A 4C0DC 2MWOA 4LE9A 4A4EA 1Y71A 1ZUKA 3G4SQ 1M8MA 2KXCA 3QJYA 2PNIA 2JOYA 1ZSGA 1S72A 3EGXB 3M56A 3VS4A 1VQ9T 1HSQA 3EFSA 1AWJA 3VV0A 3CCSA 1G3SA 3UA7A 1WNLA 3OB9A 2EYZA 2EQMA 2KT1A 3TSZA 4C8QF 1IHVA 3X24B 2LMJA 4PFPA 3QYHB 4PFOA 2XU8A 3CC2T 4PJNA 1V76A 1JJ2P 3OYJA 2D9TA 2NYSA 2RQUA 1QCOA 4IKFA 3REBB
chains in the Genus database with same CATH topology
2KNBB 4GLMA 3EG0A 1YWOA 2JMCA 1SEMA 1BU1A 1PHTA 2OI3A 1SPKA 2FG0A 1WIEA 2FO0A 3NHNA 2XMFA 2FRWA 2EYXA 1M3BA 1YCSB 2ABLA 2A08A 2ROLA 1M30A 1UHCA 1E7OA 2KROA 2RF0A 3UATA 1WI7A 2ROTA 1U5SA 2JW4A 2O9VA 1NYGA 1ZBJA 3I9QA 2LX7A 2ED0A 1SRLA 2O9SA 1BBZA 2DRMA 2J06A 1UDLA 2J6KA 1UJ0A 1KIKA 1CKBA 1JU5C 2HSPA 1JO8A 1RUWA 1WYXA 2DM1A 3EHQA 1ZX6A 1OV3A 1TG0A 2H8HA 1U06A 1BB9A 2BZYA 2SRCA 2FEIA 2V1RA 4OMNA 2K7AA 2GBQA 2OJ2A 1AWOA 1AZGB 4RTVA 1A0NB 2C0OA 5I11A 2LP5A 2EW3A 2PTKA 1FYNA 2JMAA 1JXMA 1T0JA 2CH4W 4RTWA 4HCKA 1AWWA 2A37A 4RTTA 1OEBA 1RLPC 2FRYA 3H41A 3PVLA 2BTTA 2F2XA 3M0RA 1UHFA 3R6NA 1N5ZA 2L3PA 2OAWA 1X43A 2LQWA 1X6BA 2RN8A 2EYYA 5L23A 4E6RA 1VA7A 3PE0A 2LNHB 3CQTA 1RI9A 1SHGA 2RMOA 4J9BA 2O88A 2KBTA 1UUEA 2HDAA 1QWFA 4OMQA 1PNJA 1AZEA 1K0SA 2DYBA 3VS0A 3H0HA 3EG1A 2YT6A 1G83A 2CUBA 3UA6A 2DL3A 2L2PA 1NEBA 3U23A 2J05A 1WX6A 4J9IA 4Z89A 2G6FX 3LH5A 1WXBA 1WFWA 4OMPA 1YN8A 4LUEA 2J6FA 4JJCA 2ESWA 1PKTA 1GCQC 1ZUYA 2DL8A 2DLPA 2NWMA 1NM7A 1PKSA 3JV3A 4R0KA 2DE0X 2CT4A 3M0SA 3M0UA 3IQLA 4IIMA 2HCKA 5FW9A 5IHIA 1CSKA 2VVKA 4HVWA 1ABOA 2RQVA 4KRTA 4OMMA 5IH2A 1T3LA 1K76A 2DBMA 3I5SA 3M0TA 1WXTA 4CC3A 2KRSA 4F17A 1K9AA 4DEYA 4DEXA 2DL5A 3TVTA 1K1ZA 2CT3A 4AFSC 2JTEA 4AFQC 3EGUA 3PVQA 2DL7A 2CREA 1AWXA 2CSIA 4RUGA 4RTZA 4CC7A 2K6DA 2KRNA 2GNCA 2KE9A 2SEMA 1E6HA 3VRYA 3VS3A 2DILA 2K2MA 3C0CA 4IIOA 2YUPA 2QDLA 3ZL7C 2LCSA 2K3BA 5EC7A 3NMZC 5HCKA 3A98A 3EHRA 1ZLMA 3EG3A 4LNPA 5FWCA 2YUQA 1RLQC 4JPBW 1OPLA 1UGVA 2KXDA 2LQNA 1UJYA 1NLPC 1YP5A 3RBBB 1U3OA 4ORZA 3M0QA 2DA9A 3VS1A 2DF6A 1AOJA 4AFZC 2J6OA 2EGEA 5IHKA 2FPEA 3H0FA 1XOVA 2GGRA 4RTYA 2D1XA 1UFFA 1VYTA 1JXOA 5GJVB 2LJ0A 1QLYA 3I5RA 1K4US 4ZNXA 1KSWA 2E5KA 1B3QA 1NLOC 1SRMA 4EIKA 2J7IA 2JT4A 5IHNA 1QCFA 4F14A 1WA7A 4F16A 1YNZA 1QKWA 2DX1A 4J9HA 4J9CA 1MUZA 1NYFA 1YWPA 2KGTA 2MIOA 2DVJA 2EPDA 2DRKA 4LUDA 1TUDA 3EG2A 5IXBA 5FWBA 3SEMA 1I07A 3QWXX 1V1CA 2KT8A 1WLPB 2DMOA 4GBQA 2NUZA 3QWYA 2CSQA 1SHFA 2JXBA 1ABQA 4Y92A 2FPFA 1JEGA 1MV0B 1QKXA 1H92A 3FJ5A 1PWTA 2CUDA 4ESRA 2C0TA 2DL4A 2M0YA 2AKKA 2M51A 3NGPA 1GFCA 1X2KA 2L3QA 4OMLA 2EKHA 4HVUA 2O2OA 1FMKA 4RTXA 2I0NA 1UECA 4RTUA 1UG1A 2GTJA 1WDXA 4K11A 4D8KA 4Z88A 1H3HA 1ZUUA 2LZ6B 2P4RA 2A36A 3VRZA 5GJWB 2YUOA 1NG2A 1K0XA 5I22A 2MOXA 4JJBA 2VKNA 2DJQA 4LN2A 4HXJA 2JM9A 2D0NA 4OMOA 3KFVA 1WXUA 2ENMA 1T0HA 1E6GA 2LJ3A 3UF4A 1W70A 2RQWA 3VS5A 4JZ3A 1W6XA 1JQQA 2VWFA 2V1QA 2BZ8A 1PRMC 4JJDA 2B86A 2F2WA 1Y57A 2JS2A 3SHWA 1GBQA 2AZVA 1AEYA 1LCKA 3ULRB 2HEQA 3RNJA 2A28A 2D8HA 4CC2A 3M0PA 1PRLC 1Y0MA 3VS2A 2EGCA 1M3CA 1GRIA 4Z8AA 3O5ZA 2X3XD 1M27C 2HBWA 2EQIA 4HVVA 1GL5A 5IXFA 1J3TA 1TUCA 2YUNA 1X2QA 1G2BA 2CDTA 2D8JA 2ECZA 2GTOA 1GFDA 1KFZA 4CC4B 4D8DA 4AG2C 3TSWA 1GCQA 2BZXA 1UE9A 1Z9QA 2X3WD 4J9EA 2RQRA 3VS6A 2K9GA 2RNAA 2LJ1A 2EVRA 1X69A 4X1VA 2KYBA 2DNUA 1QWEA 1I0CA 1VYUA 4A63B 4JZ4A 1I1JA 2EGAA 2F2VA 2O31A 1EFNA 1HJDA 4QT7A 2W0ZA 4M4ZA 1ARKA 3REAB 1B07A 2RPNA 2W10A 4WCIA 1GCPA 2IIMA 1VYVA 1SSHA 1HD3A 2YDLA 1NEGA 2JS0A 1KJWA 1Z9ZA 3VS7A 4AG1C 2AKLA 1OOTA 4J9GA 2KYMA 3GBQA 2KR3A 2L3SA 2DBKA 2KEAA 2EYWA 1UTIA 1BK2A 2CH4A 2AZSA 2YSQA 1AD5A 3I35A 4J9FA 2MCNA 1W1FA 4AFUC 4LE9A 1ZUKA 2AK5A 1M8MA 4FSSA 2KXCA 2PNIA 2L0AA 1AVZC 1ZSGA 2JM8A 2K79A 2EBPA 3NPFA 3VS4A 1HSQA 1GBRA 2KRMA 4J9DA 1X27A 1AWJA 2RQTA 1MV3A 3UA7A 2EYZA 2KT1A 3TSZA 1X6GA 3THKA 1T3SA 1M3AA 2LMJA 2GQIA 2C0IA 5ECAA 1CKAA 1H8KA 2FPDA 1OPKA 3H0IA 1S1NA 1IO6A 2RQUA 2ED1A 2PZ1A 3REBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNB B;  4GLM A;  3EG0 A;  1YWO A;  2JMC A;  1SEM A;  1BU1 A;  1PHT A;  2OI3 A;  1SPK A;  2FG0 A;  1WIE A;  2FO0 A;  3NHN A;  2XMF A;  2FRW A;  2EYX A;  1M3B A;  1YCS B;  2ABL A;  2A08 A;  2ROL A;  1M30 A;  1UHC A;  1E7O A;  2KRO A;  2RF0 A;  3UAT A;  1WI7 A;  2ROT A;  1U5S A;  2JW4 A;  2O9V A;  1NYG A;  1ZBJ A;  3I9Q A;  2LX7 A;  2ED0 A;  1SRL A;  2O9S A;  1BBZ A;  2DRM A;  2J06 A;  1UDL A;  2J6K A;  1UJ0 A;  1KIK A;  1CKB A;  1JU5 C;  2HSP A;  1JO8 A;  1RUW A;  1WYX A;  2DM1 A;  3EHQ A;  1ZX6 A;  1OV3 A;  1TG0 A;  2H8H A;  1U06 A;  1BB9 A;  2BZY A;  2SRC A;  2FEI A;  2V1R A;  4OMN A;  2K7A A;  2GBQ A;  2OJ2 A;  1AWO A;  1AZG B;  4RTV A;  1A0N B;  2C0O A;  5I11 A;  2LP5 A;  2EW3 A;  2PTK A;  1FYN A;  2JMA A;  1JXM A;  1T0J A;  2CH4 W;  4RTW A;  4HCK A;  1AWW A;  2A37 A;  4RTT A;  1OEB A;  1RLP C;  2FRY A;  3H41 A;  3PVL A;  2BTT A;  2F2X A;  3M0R A;  1UHF A;  3R6N A;  1N5Z A;  2L3P A;  2OAW A;  1X43 A;  2LQW A;  1X6B A;  2RN8 A;  2EYY A;  5L23 A;  4E6R A;  1VA7 A;  3PE0 A;  2LNH B;  3CQT A;  1RI9 A;  1SHG A;  2RMO A;  4J9B A;  2O88 A;  2KBT A;  1UUE A;  2HDA A;  1QWF A;  4OMQ A;  1PNJ A;  1AZE A;  1K0S A;  2DYB A;  3VS0 A;  3H0H A;  3EG1 A;  2YT6 A;  1G83 A;  2CUB A;  3UA6 A;  2DL3 A;  2L2P A;  1NEB A;  3U23 A;  2J05 A;  1WX6 A;  4J9I A;  4Z89 A;  2G6F X;  3LH5 A;  1WXB A;  1WFW A;  4OMP A;  1YN8 A;  4LUE A;  2J6F A;  4JJC A;  2ESW A;  1PKT A;  1GCQ C;  1ZUY A;  2DL8 A;  2DLP A;  2NWM A;  1NM7 A;  1PKS A;  3JV3 A;  4R0K A;  2DE0 X;  2CT4 A;  3M0S A;  3M0U A;  3IQL A;  4IIM A;  2HCK A;  5FW9 A;  5IHI A;  1CSK A;  2VVK A;  4HVW A;  1ABO A;  2RQV A;  4KRT A;  4OMM A;  5IH2 A;  1T3L A;  1K76 A;  2DBM A;  3I5S A;  3M0T A;  1WXT A;  4CC3 A;  2KRS A;  4F17 A;  1K9A A;  4DEY A;  4DEX A;  2DL5 A;  3TVT A;  1K1Z A;  2CT3 A;  4AFS C;  2JTE A;  4AFQ C;  3EGU A;  3PVQ A;  2DL7 A;  2CRE A;  1AWX A;  2CSI A;  4RUG A;  4RTZ A;  4CC7 A;  2K6D A;  2KRN A;  2GNC A;  2KE9 A;  2SEM A;  1E6H A;  3VRY A;  3VS3 A;  2DIL A;  2K2M A;  3C0C A;  4IIO A;  2YUP A;  2QDL A;  3ZL7 C;  2LCS A;  2K3B A;  5EC7 A;  3NMZ C;  5HCK A;  3A98 A;  3EHR A;  1ZLM A;  3EG3 A;  4LNP A;  5FWC A;  2YUQ A;  1RLQ C;  4JPB W;  1OPL A;  1UGV A;  2KXD A;  2LQN A;  1UJY A;  1NLP C;  1YP5 A;  3RBB B;  1U3O A;  4ORZ A;  3M0Q A;  2DA9 A;  3VS1 A;  2DF6 A;  1AOJ A;  4AFZ C;  2J6O A;  2EGE A;  5IHK A;  2FPE A;  3H0F A;  1XOV A;  2GGR A;  4RTY A;  2D1X A;  1UFF A;  1VYT A;  1JXO A;  5GJV B;  2LJ0 A;  1QLY A;  3I5R A;  1K4U S;  4ZNX A;  1KSW A;  2E5K A;  1B3Q A;  1NLO C;  1SRM A;  4EIK A;  2J7I A;  2JT4 A;  5IHN A;  1QCF A;  4F14 A;  1WA7 A;  4F16 A;  1YNZ A;  1QKW A;  2DX1 A;  4J9H A;  4J9C A;  1MUZ A;  1NYF A;  1YWP A;  2KGT A;  2MIO A;  2DVJ A;  2EPD A;  2DRK A;  4LUD A;  1TUD A;  3EG2 A;  5IXB A;  5FWB A;  3SEM A;  1I07 A;  3QWX X;  1V1C A;  2KT8 A;  1WLP B;  2DMO A;  4GBQ A;  2NUZ A;  3QWY A;  2CSQ A;  1SHF A;  2JXB A;  1ABQ A;  4Y92 A;  2FPF A;  1JEG A;  1MV0 B;  1QKX A;  1H92 A;  3FJ5 A;  1PWT A;  2CUD A;  4ESR A;  2C0T A;  2DL4 A;  2M0Y A;  2AKK A;  2M51 A;  3NGP A;  1GFC A;  1X2K A;  2L3Q A;  4OML A;  2EKH A;  4HVU A;  2O2O A;  1FMK A;  4RTX A;  2I0N A;  1UEC A;  4RTU A;  1UG1 A;  2GTJ A;  1WDX A;  4K11 A;  4D8K A;  4Z88 A;  1H3H A;  1ZUU A;  2LZ6 B;  2P4R A;  2A36 A;  3VRZ A;  5GJW B;  2YUO A;  1NG2 A;  1K0X A;  5I22 A;  2MOX A;  4JJB A;  2VKN A;  2DJQ A;  4LN2 A;  4HXJ A;  2JM9 A;  2D0N A;  4OMO A;  3KFV A;  1WXU A;  2ENM A;  1T0H A;  1E6G A;  2LJ3 A;  3UF4 A;  1W70 A;  2RQW A;  3VS5 A;  4JZ3 A;  1W6X A;  1JQQ A;  2VWF A;  2V1Q A;  2BZ8 A;  1PRM C;  4JJD A;  2B86 A;  2F2W A;  1Y57 A;  2JS2 A;  3SHW A;  1GBQ A;  2AZV A;  1AEY A;  1LCK A;  3ULR B;  2HEQ A;  3RNJ A;  2A28 A;  2D8H A;  4CC2 A;  3M0P A;  1PRL C;  1Y0M A;  3VS2 A;  2EGC A;  1M3C A;  1GRI A;  4Z8A A;  3O5Z A;  2X3X D;  1M27 C;  2HBW A;  2EQI A;  4HVV A;  1GL5 A;  5IXF A;  1J3T A;  1TUC A;  2YUN A;  1X2Q A;  1G2B A;  2CDT A;  2D8J A;  2ECZ A;  2GTO A;  1GFD A;  1KFZ A;  4CC4 B;  4D8D A;  4AG2 C;  3TSW A;  1GCQ A;  2BZX A;  1UE9 A;  1Z9Q A;  2X3W D;  4J9E A;  2RQR A;  3VS6 A;  2K9G A;  2RNA A;  2LJ1 A;  2EVR A;  1X69 A;  4X1V A;  2KYB A;  2DNU A;  1QWE A;  1I0C A;  1VYU A;  4A63 B;  4JZ4 A;  1I1J A;  2EGA A;  2F2V A;  2O31 A;  1EFN A;  1HJD A;  4QT7 A;  2W0Z A;  4M4Z A;  1ARK A;  3REA B;  1B07 A;  2RPN A;  2W10 A;  4WCI A;  1GCP A;  2IIM A;  1VYV A;  1SSH A;  1HD3 A;  2YDL A;  1NEG A;  2JS0 A;  1KJW A;  1Z9Z A;  3VS7 A;  4AG1 C;  2AKL A;  1OOT A;  4J9G A;  2KYM A;  3GBQ A;  2KR3 A;  2L3S A;  2DBK A;  2KEA A;  2EYW A;  1UTI A;  1BK2 A;  2CH4 A;  2AZS A;  2YSQ A;  1AD5 A;  3I35 A;  4J9F A;  2MCN A;  1W1F A;  4AFU C;  4LE9 A;  1ZUK A;  2AK5 A;  1M8M A;  4FSS A;  2KXC A;  2PNI A;  2L0A A;  1AVZ C;  1ZSG A;  2JM8 A;  2K79 A;  2EBP A;  3NPF A;  3VS4 A;  1HSQ A;  1GBR A;  2KRM A;  4J9D A;  1X27 A;  1AWJ A;  2RQT A;  1MV3 A;  3UA7 A;  2EYZ A;  2KT1 A;  3TSZ A;  1X6G A;  3THK A;  1T3S A;  1M3A A;  2LMJ A;  2GQI A;  2C0I A;  5ECA A;  1CKA A;  1H8K A;  2FPD A;  1OPK A;  3H0I A;  1S1N A;  1IO6 A;  2RQU A;  2ED1 A;  2PZ1 A;  3REB B; 
#chains in the Genus database with same CATH topology
 2KNB B;  2JMC A;  1BU1 A;  2VAS A;  4PL6 A;  2FG0 A;  2C06 A;  3JRZ A;  2XMF A;  4OMF B;  4FYW B;  4DBQ A;  1YCS B;  2EJ9 A;  1M30 A;  1UHC A;  5FU7 C;  5CKF A;  2AHJ B;  4QVC A;  1WI7 A;  4EMK A;  1BKB A;  2ROT A;  5CQY A;  1XNI A;  4C8Q A;  1NYG A;  4N0A A;  4OP0 A;  3MP8 A;  2RH2 A;  1XTD A;  4J6X A;  1YJ9 A;  1BBZ A;  1QVF A;  5GAN 6;  4M75 F;  1RAF B;  2DRM A;  3DLL A;  4F7U B;  1UJ0 A;  2HSP A;  2DM1 A;  3EHQ A;  1S72 T;  3NFC A;  1TG0 A;  1U06 A;  1BB9 A;  2BZY A;  4OB2 B;  1VQK A;  3SFM A;  1M90 R;  3CCS T;  2GBQ A;  2OJ2 A;  1OI1 A;  5LJ5 j;  3CC2 Q;  2LCL A;  4FU6 A;  1BYM A;  2V26 A;  3CPW A;  3L2V A;  2C0O A;  5KE2 A;  1I5O B;  2JMA A;  1K73 R;  1JXM A;  1NZ9 A;  1T0J A;  3QDF A;  1AWW A;  3OS1 A;  1OEB A;  4LDW A;  4OGE A;  2FRY A;  2BTT A;  1UHF A;  2HZY A;  2L3P A;  1R77 A;  2L8D A;  1X43 A;  1K73 C;  2LQW A;  2RN8 A;  5KCO A;  2DAQ A;  3BY7 A;  4M75 A;  3PE0 A;  2DK3 A;  2RJE A;  1YFN A;  4OGC A;  1VUB A;  5A2Q E;  1RI9 A;  3QDR B;  4RCC A;  2KBT A;  3VUB A;  1QWF A;  5CKH A;  1AZE A;  4NOY A;  3VKI A;  2E12 A;  3ER0 A;  4KGV B;  1WHM A;  2YT6 A;  3OMC A;  4FL6 A;  3X28 B;  1SKU B;  3QO3 A;  2WAC A;  4FW1 A;  2J05 A;  3RMS A;  1WX6 A;  3HRT A;  3J80 E;  1S72 Q;  4M7D B;  3JCM f;  2JJ9 A;  1YN8 A;  4FIB A;  3KUF A;  3JCM b;  3CCS Q;  4PJO E;  5GAM d;  2J6F A;  2V8I A;  2HSE B;  3PMT A;  2I2L A;  1ZUY A;  2MYS A;  1NM7 A;  3JV3 A;  3MEV A;  4M7D E;  3O8V A;  4R0K A;  5GAM g;  1D0X A;  1CSK A;  2RQV A;  4FT4 A;  2CP6 A;  1HK9 A;  3MPU B;  3LWI A;  4GY5 A;  3I5S A;  4BD3 A;  4DEX A;  1K1Z A;  4MMK A;  2LT1 A;  1KD1 U;  1QCN A;  3RR6 A;  4JS4 A;  1TUG B;  4RTZ A;  4CC7 A;  1KQ1 A;  1MND A;  2GNC A;  2YRC A;  5GAO q;  2DIL A;  4C92 E;  2K2M A;  1YJ9 Q;  4RMO A;  3ZL7 C;  2EIF A;  1Q82 C;  2K3B A;  2HAX A;  4J7I A;  4LNP A;  4J7F A;  1PSF A;  1RLQ C;  3GPL A;  1PCX A;  1YP5 A;  2QA4 T;  3M0Q A;  5LJ3 h;  3LX7 A;  5FU6 B;  2DF6 A;  2ZCF B;  2BUD A;  1B34 A;  2R5A A;  3TCJ A;  4DOW A;  3H0F A;  3C94 A;  3EFR A;  3FJP A;  1NPR A;  1UFF A;  2D1X A;  1EIF A;  3QZ5 B;  5KYU A;  3G7Z A;  4N4G A;  1QLY A;  3I5R A;  4JLG A;  1AHJ B;  3RIR A;  3VJP A;  3CCU T;  1UGP B;  2CZ7 B;  2FHD A;  1JRI A;  4F16 A;  2O4X B;  3L2U A;  3CCJ A;  4DBR A;  2PU9 B;  1U8R A;  5GAN 3;  2V8J A;  4LUD A;  3EG2 A;  3OYL A;  5KYY B;  1Q7Y R;  2X51 A;  4PJO D;  1N9R A;  1WLP B;  5A0D A;  1OU9 A;  4RKU E;  3JCM X;  4EMK C;  2JXB A;  4C8Q C;  1VQ6 A;  4M7D D;  4Y92 A;  3MO8 A;  2FPF A;  2KMT A;  4N0A C;  4WTO B;  3FC3 A;  2QA4 Q;  1Q7Y C;  4C5I A;  2LTO A;  2XG8 D;  5CVI A;  2DL4 A;  1R0B G;  3GF5 A;  3E9G A;  3NGP A;  2NLU A;  4MZT A;  1GFC A;  2OTJ A;  1N9S A;  2E6N A;  5J3B A;  1X2K A;  2MF2 A;  2EKH A;  2O2O A;  3ZFJ A;  2RI3 A;  4RTX A;  2I0N A;  4MDW A;  4ZN3 A;  1KD1 C;  3H6Z A;  3VRZ A;  2A36 A;  4PLI A;  2YUO A;  1NG2 A;  2MWP A;  2RJC A;  3BW1 A;  5IT9 E;  4FSX A;  4LDV A;  4LN2 A;  1BI1 A;  2D0N A;  4C92 D;  1WXU A;  3CCJ T;  2RHY A;  2P0P A;  1E6G A;  4LD9 K;  1M2O A;  4M75 G;  2PVO B;  2RQW A;  4M75 C;  4NL2 A;  2P0Q A;  1W6X A;  1VQ7 A;  1JQQ A;  3I55 A;  3M59 A;  4ANJ A;  3EG9 B;  2LQ8 A;  1PRM C;  1Y57 A;  1SF9 A;  2JS2 A;  1GBQ A;  2AZV A;  2Z0W A;  3JB9 I;  2HEQ A;  2A28 A;  3EH1 A;  4JRI A;  1PRL C;  1Y0M A;  1ZBX A;  2X4W A;  4E7S A;  4PJJ A;  1VQM A;  2HBW A;  2X4J A;  2EQI A;  4ZGE B;  4KUL A;  2OTJ T;  3JAM E;  3CMA A;  3PGG A;  3DB3 A;  1TTH B;  3G71 A;  1X2Q A;  1Q86 U;  4ZTJ A;  2GTO A;  1KFZ A;  4D8D A;  1ZSZ A;  2JZ2 A;  1GCQ A;  2BZX A;  4C5G A;  1K8A R;  1Z9Q A;  3OY9 A;  3CCJ Q;  2RQR A;  3ASK A;  3V7S A;  3MKD A;  4JRP A;  2LJ1 A;  2LVM A;  3M5A A;  2DER A;  4X1V A;  1RI0 A;  1VYU A;  1M2V A;  1K8A C;  2O31 A;  4A4K A;  2RPN A;  1GCP A;  2YLC A;  2DFU A;  2OAU A;  3V8L A;  1VQ6 Q;  3JCM P;  3CD6 T;  1HD3 A;  1NEG A;  3SWN B;  1VQP A;  1UGQ B;  1Z9Z A;  3JCM h;  3ZBD A;  3HL8 A;  2AKL A;  4P5N A;  2KYM A;  2OTJ Q;  2E4H A;  4AMC A;  3CBM A;  2FZC B;  3EGX A;  2DBK A;  4BAC A;  2EYW A;  4GLK A;  3FDR A;  4IUQ A;  1QP3 A;  1AD5 A;  1FXX A;  8ATC B;  1KG1 A;  2JTF A;  3CMA T;  4DBH A;  1MNE A;  1IRE B;  2MMP A;  4ZTF A;  1YIT T;  2L0A A;  3OYK A;  2LNV A;  1AVZ C;  4R56 A;  5FRN A;  2K79 A;  4RCB A;  2CZ6 B;  2E65 A;  2KDS A;  1X27 A;  1M1K R;  4F7U F;  3Q1J A;  3PIO A;  2A0F B;  1W2B P;  1IHW A;  3DKM A;  1M3A A;  1VQ7 Q;  2XDB A;  2C0I A;  3I55 Q;  5ECA A;  1V29 B;  3OYY A;  3OYA A;  1M1K C;  2DEU A;  3H0I A;  3CCM T;  1IO6 A;  1JJ2 A;  5GAM h;  4JUV A;  2RJF A;  2KQW A;  1YWO A;  1SEM A;  5GAN d;  3I56 A;  1NJI R;  3PFS A;  3OYF A;  1MMD A;  1M3B A;  1D3B B;  2ABL A;  5GAN g;  1LVK A;  3RER A;  2KK4 A;  1QVG P;  3JSC A;  1VQM Q;  4N4H A;  2LDM A;  1NJI C;  3M57 A;  4F7U A;  3CCQ A;  2RF0 A;  3CMA Q;  4M78 G;  1VQ5 T;  4KH1 B;  5LL6 S;  3CPW S;  1TSF A;  3E9F A;  4VUB A;  3G71 Q;  1M8V A;  1TU0 B;  1ZBJ A;  3I9Q A;  5C6S A;  2ED0 A;  2O9S A;  1TXQ A;  4PJO F;  4B9X A;  1RAB B;  1CKB A;  1JO8 A;  1RUW A;  1WYX A;  1OV3 A;  4LDX A;  4M7D F;  3G4S T;  2SRC A;  3CC4 A;  1KHC A;  5GAN 4;  1X01 A;  2COZ A;  2AT1 B;  1AWO A;  4OF1 A;  4RTV A;  3CCM Q;  1PM3 A;  2EW3 A;  3LW5 E;  4FYV B;  3HSB A;  3GNF B;  1WGS A;  1Y96 B;  2L5Q A;  2YHT A;  4RTT A;  4DBF A;  4JS5 A;  4XU2 A;  1N5Z A;  3C4S A;  4C0D B;  3PTA A;  4UC4 A;  2X9H A;  2GFU A;  3I56 T;  5L23 A;  1D09 B;  4PJO A;  2CP3 A;  1Q81 U;  2QTX A;  4IUP A;  2DIG A;  3CQT A;  1SHG A;  1UUE A;  2HDA A;  3QJ6 A;  3CME A;  4M7D A;  2QG9 B;  1OYX A;  4C92 F;  4OMQ A;  4BY6 B;  2QQB A;  3A1P A;  1M1F A;  3GLX A;  3H0H A;  3HPW A;  1G83 A;  3R6O A;  2CUB A;  2L2P A;  1NEB A;  5HK0 A;  1WHH A;  2K5F A;  4J9I A;  2G6F X;  1WXB A;  1WFW A;  1M90 U;  4OMP A;  2IVW A;  3A5Z B;  3MEW A;  5KYW B;  1ZSZ C;  1PKT A;  1GCQ C;  1OQK A;  2RI2 A;  2DLP A;  3OS5 A;  1N8R R;  4CRI A;  2DE0 X;  2HQH A;  2CT4 A;  3PNW C;  4XTY A;  2K3X A;  1YIJ A;  2RK2 A;  3OSS C;  5FW9 A;  5IHI A;  4HVW A;  5LJ3 e;  1ABO A;  4OMM A;  2DTH A;  4C92 A;  3S3N A;  5IH2 A;  5D6W A;  3PT9 A;  1XJW B;  4XU3 A;  4JLI A;  1K76 A;  3I56 Q;  1N8R C;  4RG2 A;  5J39 A;  1NPP A;  4E7I A;  3QKJ A;  2DXC A;  4DEY A;  2DL5 A;  4II1 A;  4PNO A;  4AFS C;  1WQW A;  4C5H A;  2JTE A;  2DTI A;  2EQK A;  3JCM V;  5GMK l;  5CIU A;  1TS9 A;  2QEX T;  5I21 A;  1K9M R;  4RUG A;  2K6D A;  2KRN A;  1EZZ B;  2KE9 A;  5GAN 7;  3VRY A;  4ZN1 A;  4IIO A;  4E7J A;  1RAE B;  1WHJ A;  3NMZ C;  2YWW A;  5HCK A;  1K9M C;  3A98 A;  2DZC A;  1WJS A;  5FWC A;  2M1H A;  2RHZ A;  2K3Y A;  4HKE A;  3EFO B;  1UGV A;  2LQN A;  1NLP C;  3RBB B;  4E2F B;  2HNI A;  1U3O A;  2EJG A;  2B8A A;  3MHX A;  2CS7 A;  4XAX B;  3L42 A;  4J5Y A;  4QVZ A;  2O4X A;  5IHK A;  4F7U E;  3JCM d;  1XOV A;  1NBE B;  2QGF B;  1IGU A;  1Q81 C;  4NL3 A;  2CP0 A;  1BI3 A;  3C12 A;  2WSE E;  5EG2 A;  4ZNX A;  1KSW A;  3JCM g;  2E5K A;  1D0Y A;  3OYD A;  1SRM A;  4YTL A;  5KYY A;  2J7I A;  1GXI E;  4QVD A;  4F14 A;  2NUP B;  2RB6 A;  3QUI A;  3M55 A;  1FMV A;  2Y4Y A;  3CCR A;  2QEX Q;  2ATC B;  5A0G A;  1YWP A;  2X35 A;  3OYN A;  3CME Q;  3QXE B;  1ZA1 B;  1MMG A;  5IXB A;  1C0M A;  5FWB A;  3VYH B;  3SEM A;  1I07 A;  3QWX X;  1G3Y A;  3WXM B;  4TVR A;  1V1C A;  2KT8 A;  2M02 A;  5CKB A;  2CSQ A;  2BKD N;  2XIC A;  1ABQ A;  3CCV A;  5KYX B;  2JNG A;  1JEG A;  3RUX A;  2DO3 A;  1QKX A;  2PUK B;  1YJ9 T;  1ZQ1 A;  3FJ5 A;  1ACM B;  4XTV A;  4ESR A;  3OW2 S;  2M51 A;  1YJW A;  1RL2 A;  3LGF A;  4JRK A;  4BE1 A;  1VQK T;  2RD1 A;  3RKW A;  3QHS A;  3V7C A;  1KC8 U;  4K11 A;  4B9W A;  5DM7 R;  1ZUU A;  2LT4 A;  5GJW B;  5I22 A;  1D1A A;  2MOX A;  2ZGW A;  4JJB A;  1PC0 A;  4BUG A;  4OMO A;  4QQD A;  4QW2 A;  2M16 A;  1RAH B;  3UPU A;  4PJO G;  3CCR T;  1RAA B;  4PJO C;  3VS5 A;  2KSS A;  1Q82 R;  1VQO A;  5GMK h;  2BIV A;  2XHC A;  1RAI B;  2VWF A;  2V1Q A;  1O9S A;  4M7D C;  3TRE A;  4R55 A;  2HMA A;  3SHW A;  3OS0 A;  2CP5 A;  5D7U A;  3A8L B;  4CC2 A;  3M0P A;  3VS2 A;  3H8Z A;  1GRI A;  1VQK Q;  1WHL A;  4HT9 A;  4KBM B;  4RG8 A;  1M27 C;  1P92 A;  1YJW T;  4LDY A;  3JCM e;  5GAN h;  4Q5W A;  2E6Z A;  2QQR A;  5FRO A;  2YUN A;  3L2Q A;  1G2B A;  3OYH A;  5LJ5 g;  4AG2 C;  4C92 G;  3SDZ A;  4C92 C;  1O75 A;  1UE9 A;  5AYF A;  3CCR Q;  2QDY B;  3HFO A;  3CPW P;  3VS6 A;  1KQS A;  2EVR A;  4L5G A;  1XQH A;  4A54 A;  2XKO C;  3ME9 A;  4JJN K;  1QWE A;  3SWN A;  1I0C A;  3RES A;  1I1J A;  3M58 A;  2EGA A;  1G8X A;  2F2V A;  3CC7 A;  1FX7 A;  4QT7 A;  1VQO T;  4M4Z A;  2EAY A;  2DKG A;  3CCV Q;  1VYV A;  3MP6 A;  2GF7 A;  4C8Q G;  2JS0 A;  3RDV A;  3OYC A;  3LYI A;  3VS7 A;  5LJ5 f;  4AG1 C;  3BFM A;  5GAM e;  1KC8 C;  3KXT A;  3A8G B;  1YJW Q;  2WSF E;  4J9G A;  1I8F A;  3URG A;  3OA6 A;  1KD1 R;  2L3S A;  2AZS A;  2YSQ A;  5A0L A;  4BE2 A;  2DET A;  4M75 B;  1BCO A;  2LCC A;  3CXC S;  5L8R E;  4AFU C;  1RAD B;  2AK5 A;  4J6W A;  4FSS A;  3S6W A;  4MZM A;  2V8K A;  2JM8 A;  2RHI A;  2RJD A;  1WJR A;  2KRM A;  4HT8 A;  4ME7 A;  1MV3 A;  4KGZ B;  2COY A;  4XK8 E;  3THK A;  1T3S A;  3L2W A;  2GQI A;  1VQO Q;  1W2B A;  9ATC B;  2KVQ G;  1QW1 A;  1CKA A;  1D3B A;  1H8K A;  2FPD A;  2G3R A;  1MHN A;  3HFN A;  2ED1 A;  2PZ1 A;  4QQ6 A;  3EG0 A;  1PHT A;  4M7A B;  1C1A A;  2VXE A;  2FRW A;  2EYX A;  4LD6 A;  2QAS A;  3QYG B;  1VQ6 T;  2CP7 A;  5DY9 A;  2K5I A;  4LDU A;  2A08 A;  3M9Q A;  1IGQ A;  4M77 B;  1OX9 A;  3GNG A;  1QVG A;  1E7O A;  4M7A E;  3S3M A;  5LJ3 j;  3UAT A;  4FM4 B;  5GMK m;  4A4F A;  2VGN A;  1U5S A;  2JW4 A;  2O9V A;  4KUD K;  3DB4 A;  4M77 E;  2LX7 A;  4ATO A;  3MJX A;  1IXD A;  1I81 A;  3HHT B;  4E7H A;  2J06 A;  1KK7 A;  2QQA A;  1UDL A;  2JTM A;  2XDP A;  1Y96 A;  1YCY A;  3JCM c;  5GAO l;  1ZX6 A;  4LXC A;  4MZP A;  3OYI A;  3FIF A;  4OMN A;  3V8J A;  4Y28 E;  1F1B B;  3CCE A;  1AZG B;  2R57 A;  4FW2 A;  2QI2 A;  5I11 A;  3CC7 Q;  1MMA A;  2LP5 A;  2PTK A;  2E1H A;  4BB7 A;  4PKC C;  1WHG A;  3SD4 A;  3RKX A;  1VQL A;  4O5V A;  2D6F A;  1VQ7 T;  3I55 T;  3H41 A;  3PVL A;  3M0R A;  3R6N A;  1M1G A;  2JUF A;  3CBP A;  2QGG A;  2CYZ B;  2X4Y A;  2OX7 A;  2WSC E;  4E6R A;  1VA7 A;  5KYU B;  1LJO A;  2VUB A;  3HTR A;  1H64 1;  1M5Q 1;  5KYW A;  1VQM T;  1AT1 B;  3BDU A;  2DJZ A;  4DA4 A;  2CP2 A;  2DL3 A;  4OVA A;  3D7S B;  4Z89 A;  3G71 T;  4IUR A;  4E7Z A;  5D6X A;  4C5E A;  2DVE A;  4LUE A;  1RAG B;  4JJC A;  1D1C A;  2DTO A;  4PJL A;  3MET A;  3LH0 A;  1YHQ A;  3JB9 H;  1PKS A;  1B7T A;  4DOV A;  3M54 A;  3M0S A;  3HKS A;  2MI6 A;  2P4T A;  3IQL A;  2XDD A;  2VVK A;  2E3I A;  3SWN C;  1YBY A;  4M78 B;  3OS2 A;  1UEB A;  3OW2 P;  5IAY A;  4M7A D;  3M0T A;  3J81 E;  3UT1 A;  4CC3 A;  3SB2 A;  3LLR A;  1QVF S;  1SSF A;  4M78 E;  1OX8 A;  4M77 D;  1I4K 1;  1VQP T;  3EGU A;  2F5T X;  1U1S A;  3PVQ A;  5DLO A;  3CEY A;  1BCM A;  3JB9 D;  4A53 A;  4ELZ C;  2CRE A;  1AWX A;  1Q86 C;  1G3W A;  2SEM A;  4PK4 A;  1E6H A;  3VS3 A;  2YUP A;  1ZA2 B;  2QDL A;  1FMW A;  1VQ4 A;  2LCS A;  4Y91 A;  5EC7 A;  3EHR A;  2DXT A;  3HP9 A;  2YUQ A;  1OPL A;  3P8B B;  3G6E A;  1UJY A;  4DQ2 A;  4L6V 5;  4MML A;  3JCM W;  5CCA A;  4ORZ A;  2DA9 A;  3C95 A;  3S3O A;  3VS1 A;  3CCE Q;  3E1S A;  4F04 B;  2OTL A;  3FLG A;  1AOJ A;  4AFZ C;  4ELY C;  2NUP A;  5CR2 A;  1WHK A;  2EGE A;  1YHQ T;  2HKN A;  2DZ9 A;  2QTV A;  1VQL Q;  7AT1 B;  4RTY A;  1JXO A;  2LJ0 A;  1VQ9 A;  2PUO B;  3NTI A;  1G5V A;  1K4U S;  3L2Z A;  1NLO C;  4EIK A;  1M4Z A;  1QP2 A;  1VQP Q;  1WA7 A;  5LJ3 f;  5LJ5 h;  1QQJ A;  1MUZ A;  4MDX A;  2RK1 A;  1NYF A;  5KYX A;  2MIO A;  1R8O B;  3OYM A;  3T9N A;  2E3H A;  2DRK A;  1TUD A;  1VQN A;  2Y4X A;  4IUU A;  1Y7X A;  3CCQ T;  4HCC A;  4GBQ A;  5FRM A;  4BE0 A;  3OMG A;  2ZPH B;  3QWY A;  1SHF A;  2F5K A;  5GMK e;  3L1A A;  2Y90 A;  2CUD A;  3P8D A;  2GCX A;  3OYE A;  4CI0 C;  2M0Y A;  2AKK A;  2YXY A;  1YHQ Q;  2LQK A;  3NTH A;  1K73 U;  3CC4 T;  1OUL A;  3X25 B;  4RTU A;  4X9D A;  5FU7 B;  4M78 D;  1UG1 A;  1WDX A;  4EPC A;  2FZK B;  4Z88 A;  2P4R A;  3QPH A;  3EGD B;  5I2M A;  5GAN 2;  2LX9 A;  1K0X A;  5GAN e;  5GAM j;  3A8O B;  2DJQ A;  2R5M A;  1YI2 A;  1R0C B;  2JM9 A;  4BY6 C;  2EFI A;  3KFV A;  2LJ3 A;  3CXC P;  3UF4 A;  1W70 A;  3CCQ Q;  2EQU A;  3FRN A;  2ZPG B;  2NUT B;  1H3Z A;  4E7K A;  1VQN T;  5C0M A;  5I2S A;  3CME T;  2BZ8 A;  2B86 A;  4L59 A;  1VQ4 Q;  3H9N A;  1AEY A;  1LCK A;  3ULR B;  1HYO A;  2D8H A;  5CAI A;  3G6E Q;  2FVU A;  1TWB A;  3MEU A;  3EAE A;  3CC4 Q;  4Z8A A;  1KQS S;  1Q81 R;  3UWN A;  2OTL Q;  2XI9 A;  4HVV A;  1GL5 A;  4KUI A;  5IXF A;  4FYY B;  2HD0 A;  1J3T A;  1TUC A;  1VQ9 Q;  2D8J A;  5FLX E;  4Z02 A;  1YIJ T;  1IZ6 A;  4CC4 B;  5GAO r;  3OYB A;  3TSW A;  1PD1 A;  3AHU A;  3RMQ A;  2FYK A;  2O01 E;  2X3W D;  4J9E A;  1Q95 G;  1YI2 T;  1Q82 U;  1OZ3 A;  2RNA A;  2HL5 C;  5GAO m;  1LNX A;  1X69 A;  2KYB A;  2DNU A;  1VQN Q;  4A63 B;  4JZ4 A;  4IUV A;  3VYG A;  1G3T A;  2M0O A;  2QYZ A;  1EFN A;  2ZPI B;  1OU8 A;  2DXU A;  1C6V X;  1M90 C;  4XU0 A;  2W0Z A;  1ARK A;  2CZ1 B;  2DEQ A;  3REA B;  2W10 A;  2RO0 A;  2K2V A;  1Y07 A;  4F7U G;  2IIM A;  1BIA A;  1SSH A;  4HA8 A;  2YDL A;  1KJW A;  5IN1 A;  3G1J A;  2DIQ A;  2HQX A;  1PSE A;  2IPO B;  2QQ9 A;  3KBG A;  4M7A F;  1NE8 A;  2FB7 A;  4FCY A;  1IRX A;  2KEA A;  1WJQ A;  1UTI A;  4M77 F;  3M4G A;  1W2B S;  4E47 A;  5GMK i;  4PJO B;  4J9F A;  2IG0 A;  1YIJ Q;  3JB9 J;  3JB9 F;  4KH0 B;  1YJN A;  2KY9 A;  2FL7 A;  2QA4 A;  1YI2 Q;  2EBP A;  2H3E B;  2P0K A;  3NPF A;  3GP8 A;  1GBR A;  4J9D A;  2HQE A;  2RQT A;  3EG9 A;  3QII A;  1X6G A;  3QG1 A;  1VIE A;  1Q7Y U;  1TOV A;  4M7A A;  1QVG S;  3BE3 A;  1OZ2 A;  3V8K A;  1OPK A;  1UGR B;  1S1N A;  5KH6 A;  3CCU A;  4M77 A;  5CQX A;  4M7D G;  4XTW A;  4A4G A;  4GLM A;  4X9C A;  2CZ0 B;  2K5L A;  2OI3 A;  1SPK A;  1PG5 B;  3L2R A;  1WIE A;  2FO0 A;  1W4S A;  3NHN A;  4C0Z A;  3CCV T;  4C92 B;  4V2S A;  2ROL A;  5DLQ E;  3WVD B;  2PQW A;  2KRO A;  4B6M A;  4QQG A;  3GOX A;  2EJF A;  3WVE B;  4HCZ A;  5GAM f;  3PIP A;  5LJ5 d;  4J6Y A;  1QVF P;  2RA2 A;  3OQ5 A;  1SRL A;  1KQ2 A;  3A8H B;  3JCM J;  1YJN T;  1WZO A;  3M53 A;  5GAO p;  2J6K A;  1KIK A;  1JU5 C;  1MMN A;  4EMK B;  5M9O A;  2H8H A;  1LOJ A;  4C8Q B;  1I5L A;  2FEI A;  2V1R A;  4A4H A;  2LRQ A;  2K7A A;  2XK0 A;  3HRS A;  1A0N B;  2CKK A;  4AT1 B;  1D1B A;  1EX4 A;  1FYN A;  4C8Q E;  4EMH A;  2CH4 W;  4RTW A;  4HCK A;  2A37 A;  1RLP C;  3TU4 K;  3GIB A;  4J8O A;  2F2X A;  1HXD A;  1SG5 A;  5CK9 A;  1KC8 R;  4WF2 A;  4M78 F;  2OAW A;  3CCL A;  2COW A;  1X6B A;  3LWH A;  2EYY A;  5CKD A;  1ZHI A;  5FU6 C;  2JVV A;  2LNH B;  2MPX C;  1UGS B;  4PLL A;  2RMO A;  2PVD B;  4J9B A;  2VV5 A;  2O88 A;  2DD5 A;  4JRQ A;  1PNJ A;  2YRV A;  1K0S A;  1BIB A;  2DYB A;  3VS0 A;  3EG1 A;  1YJN Q;  3DLM A;  3EH2 A;  3UA6 A;  1X75 C;  4PFZ A;  3U23 A;  2RHX A;  3M4Y A;  1K8A U;  1JJ2 S;  3LH5 A;  3FEO A;  3INZ A;  4IUT A;  3HRU A;  4M78 A;  4M75 E;  2M9U A;  2ESW A;  2E41 A;  2DL8 A;  4HCB A;  2NWM A;  2KI7 A;  3OBY A;  3FB9 A;  3M0U A;  4IIM A;  3CCU Q;  2HCK A;  1U1T A;  4QKU A;  5HK3 A;  3VU3 C;  4KRT A;  2DXB A;  5GMK j;  4XQ3 A;  3CC7 T;  1D0Z A;  1T3L A;  4PJM A;  4ZGJ B;  2DBM A;  1QMC A;  2AIR B;  1UB4 A;  3OW2 A;  2F1L A;  1WXT A;  2KRS A;  4F17 A;  2VYT A;  1M9S A;  1K9A A;  3CCL T;  5GAN 8;  2K4Y A;  4OB1 B;  2CT3 A;  3TVT A;  2CGH A;  4AFQ C;  2ZZD A;  2BE9 B;  2DL7 A;  2X4X A;  1TH7 A;  2ZAE A;  2ZPE B;  2CSI A;  3CBO A;  2E5Q A;  5AT1 B;  5LJ5 e;  3CD6 A;  1RAC B;  5HKC A;  2EKO A;  5GAN j;  3C0C A;  3QZ9 B;  2D0Q B;  3RKY A;  2KAF A;  2A7Y A;  3MEA A;  4BI8 B;  4C0F A;  1ZLM A;  3EG3 A;  1VIF A;  1M1K U;  5KE3 A;  4OB3 B;  2YRD A;  4C8Q D;  4JPB W;  4XU1 A;  1VQ8 A;  2KXD A;  3PMI A;  1WPY A;  2E70 A;  3P8H A;  1VOM A;  2FZG B;  2J6O A;  2FPE A;  2PVG B;  2GGR A;  5CKE A;  4M7A G;  2QAZ A;  1YIT A;  4M7A C;  2MAM A;  1VYT A;  5GJV B;  3X20 B;  2EQJ A;  1NJI U;  1X6O A;  3E2U A;  4KT0 E;  3CCL Q;  1B3Q A;  2BE7 D;  4M77 G;  3JCM Q;  1KQS P;  1WQ7 A;  2JT4 A;  4M77 C;  1B34 B;  1QCF A;  5IHN A;  2XID A;  1YNZ A;  5GAO n;  1QKW A;  2DX1 A;  3JB9 G;  4J9H A;  4J9C A;  2DD4 A;  2KGT A;  2DVJ A;  2EPD A;  2F69 A;  4N4I A;  3CCM A;  4D6W A;  3OBW A;  2VXF A;  2HBP A;  4FYX B;  5CO7 A;  1PD0 A;  4M75 D;  4XTX A;  2DMO A;  2NUZ A;  2VGM A;  1BI2 A;  1N27 A;  2L89 A;  2RM4 A;  2JN0 A;  1MV0 B;  3J7A F;  1H92 A;  4BI4 A;  2EYQ A;  1PWT A;  2C0T A;  1JB0 E;  1N6A A;  3EGD A;  1VQ8 T;  1VQ5 A;  1QVP A;  2L3Q A;  4OML A;  4HVU A;  4OB0 B;  1FMK A;  4BDZ A;  1UEC A;  3CCE T;  4JDS A;  2GTJ A;  2YLB A;  4D8K A;  3OYG A;  1H3H A;  2LZ6 B;  1JBM A;  1VQL T;  2NUT A;  2GFA A;  3G4S A;  5J26 A;  2VKN A;  2QXF A;  1FWZ A;  4HXJ A;  1Q86 R;  2E64 A;  2VB6 A;  5D6Y A;  2GQV A;  2ENM A;  1T0H A;  3QBY A;  3MP1 A;  3TEE A;  3X26 B;  4JZ3 A;  3CXC A;  3CD6 Q;  4J83 A;  3EFO A;  5LJ3 d;  2ZPF B;  2P84 A;  4JJD A;  2F2W A;  4BI3 A;  4EMG A;  3RNJ A;  5LJ3 g;  3N5B B;  1VQ8 Q;  3F70 A;  2EGC A;  1M3C A;  2LC4 A;  3A8M B;  1N8R U;  3LGL A;  3O5Z A;  2X3X D;  1KHI A;  4M78 C;  1DJ7 B;  1YIT Q;  5HY6 A;  4NS5 A;  4KGX B;  3UDC A;  2K57 A;  2E10 A;  2CDT A;  2ECZ A;  4EDU A;  8AT1 B;  3CPF A;  4E7L A;  1GFD A;  2RHU A;  3BDL A;  2H3J A;  3QSU A;  2QQS A;  5KYN A;  2HL3 A;  4XTU A;  2DPP B;  2K9G A;  2DYI A;  1K9M U;  5GAN f;  3E19 A;  3CC2 A;  3AT1 B;  2RI5 A;  5KCH A;  2L3R A;  3OSV A;  1ZSZ B;  1HJD A;  3MCA B;  3ZEH A;  1B07 A;  4WCI A;  3V7R A;  2R58 A;  5GAN 5;  2EWN A;  3NTK A;  4XTZ A;  4ZGD B;  1IB8 A;  4O6J A;  2HKQ B;  4BDY A;  2A3L A;  1VQ4 T;  1M2V B;  1VQ5 Q;  2VC8 A;  2QEX A;  1OOT A;  1BI0 A;  3GBQ A;  3G6E T;  2KR3 A;  1LPL A;  2MK5 A;  4X34 A;  4FT2 A;  3TQ7 P;  1BK2 A;  2CH4 A;  2QK0 A;  1MGQ A;  3I35 A;  4C0G A;  3VUZ A;  6AT1 B;  2OTL T;  2MCN A;  1W1F A;  2ZPB B;  2XD0 A;  4C0D C;  2MWO A;  4LE9 A;  4A4E A;  1Y71 A;  1ZUK A;  3G4S Q;  1M8M A;  2KXC A;  3QJY A;  2PNI A;  2JOY A;  1ZSG A;  1S72 A;  3EGX B;  3M56 A;  3VS4 A;  1VQ9 T;  1HSQ A;  3EFS A;  1AWJ A;  3VV0 A;  3CCS A;  1G3S A;  3UA7 A;  1WNL A;  3OB9 A;  2EYZ A;  2EQM A;  2KT1 A;  3TSZ A;  4C8Q F;  1IHV A;  3X24 B;  2LMJ A;  4PFP A;  3QYH B;  4PFO A;  2XU8 A;  3CC2 T;  4PJN A;  1V76 A;  1JJ2 P;  3OYJ A;  2D9T A;  2NYS A;  2RQU A;  1QCO A;  4IKF A;  3REB B; 
#chains in the Genus database with same CATH homology
 2KNB B;  4GLM A;  3EG0 A;  1YWO A;  2JMC A;  1SEM A;  1BU1 A;  1PHT A;  2OI3 A;  1SPK A;  2FG0 A;  1WIE A;  2FO0 A;  3NHN A;  2XMF A;  2FRW A;  2EYX A;  1M3B A;  1YCS B;  2ABL A;  2A08 A;  2ROL A;  1M30 A;  1UHC A;  1E7O A;  2KRO A;  2RF0 A;  3UAT A;  1WI7 A;  2ROT A;  1U5S A;  2JW4 A;  2O9V A;  1NYG A;  1ZBJ A;  3I9Q A;  2LX7 A;  2ED0 A;  1SRL A;  2O9S A;  1BBZ A;  2DRM A;  2J06 A;  1UDL A;  2J6K A;  1UJ0 A;  1KIK A;  1CKB A;  1JU5 C;  2HSP A;  1JO8 A;  1RUW A;  1WYX A;  2DM1 A;  3EHQ A;  1ZX6 A;  1OV3 A;  1TG0 A;  2H8H A;  1U06 A;  1BB9 A;  2BZY A;  2SRC A;  2FEI A;  2V1R A;  4OMN A;  2K7A A;  2GBQ A;  2OJ2 A;  1AWO A;  1AZG B;  4RTV A;  1A0N B;  2C0O A;  5I11 A;  2LP5 A;  2EW3 A;  2PTK A;  1FYN A;  2JMA A;  1JXM A;  1T0J A;  2CH4 W;  4RTW A;  4HCK A;  1AWW A;  2A37 A;  4RTT A;  1OEB A;  1RLP C;  2FRY A;  3H41 A;  3PVL A;  2BTT A;  2F2X A;  3M0R A;  1UHF A;  3R6N A;  1N5Z A;  2L3P A;  2OAW A;  1X43 A;  2LQW A;  1X6B A;  2RN8 A;  2EYY A;  5L23 A;  4E6R A;  1VA7 A;  3PE0 A;  2LNH B;  3CQT A;  1RI9 A;  1SHG A;  2RMO A;  4J9B A;  2O88 A;  2KBT A;  1UUE A;  2HDA A;  1QWF A;  4OMQ A;  1PNJ A;  1AZE A;  1K0S A;  2DYB A;  3VS0 A;  3H0H A;  3EG1 A;  2YT6 A;  1G83 A;  2CUB A;  3UA6 A;  2DL3 A;  2L2P A;  1NEB A;  3U23 A;  2J05 A;  1WX6 A;  4J9I A;  4Z89 A;  2G6F X;  3LH5 A;  1WXB A;  1WFW A;  4OMP A;  1YN8 A;  4LUE A;  2J6F A;  4JJC A;  2ESW A;  1PKT A;  1GCQ C;  1ZUY A;  2DL8 A;  2DLP A;  2NWM A;  1NM7 A;  1PKS A;  3JV3 A;  4R0K A;  2DE0 X;  2CT4 A;  3M0S A;  3M0U A;  3IQL A;  4IIM A;  2HCK A;  5FW9 A;  5IHI A;  1CSK A;  2VVK A;  4HVW A;  1ABO A;  2RQV A;  4KRT A;  4OMM A;  5IH2 A;  1T3L A;  1K76 A;  2DBM A;  3I5S A;  3M0T A;  1WXT A;  4CC3 A;  2KRS A;  4F17 A;  1K9A A;  4DEY A;  4DEX A;  2DL5 A;  3TVT A;  1K1Z A;  2CT3 A;  4AFS C;  2JTE A;  4AFQ C;  3EGU A;  3PVQ A;  2DL7 A;  2CRE A;  1AWX A;  2CSI A;  4RUG A;  4RTZ A;  4CC7 A;  2K6D A;  2KRN A;  2GNC A;  2KE9 A;  2SEM A;  1E6H A;  3VRY A;  3VS3 A;  2DIL A;  2K2M A;  3C0C A;  4IIO A;  2YUP A;  2QDL A;  3ZL7 C;  2LCS A;  2K3B A;  5EC7 A;  3NMZ C;  5HCK A;  3A98 A;  3EHR A;  1ZLM A;  3EG3 A;  4LNP A;  5FWC A;  2YUQ A;  1RLQ C;  4JPB W;  1OPL A;  1UGV A;  2KXD A;  2LQN A;  1UJY A;  1NLP C;  1YP5 A;  3RBB B;  1U3O A;  4ORZ A;  3M0Q A;  2DA9 A;  3VS1 A;  2DF6 A;  1AOJ A;  4AFZ C;  2J6O A;  2EGE A;  5IHK A;  2FPE A;  3H0F A;  1XOV A;  2GGR A;  4RTY A;  2D1X A;  1UFF A;  1VYT A;  1JXO A;  5GJV B;  2LJ0 A;  1QLY A;  3I5R A;  1K4U S;  4ZNX A;  1KSW A;  2E5K A;  1B3Q A;  1NLO C;  1SRM A;  4EIK A;  2J7I A;  2JT4 A;  5IHN A;  1QCF A;  4F14 A;  1WA7 A;  4F16 A;  1YNZ A;  1QKW A;  2DX1 A;  4J9H A;  4J9C A;  1MUZ A;  1NYF A;  1YWP A;  2KGT A;  2MIO A;  2DVJ A;  2EPD A;  2DRK A;  4LUD A;  1TUD A;  3EG2 A;  5IXB A;  5FWB A;  3SEM A;  1I07 A;  3QWX X;  1V1C A;  2KT8 A;  1WLP B;  2DMO A;  4GBQ A;  2NUZ A;  3QWY A;  2CSQ A;  1SHF A;  2JXB A;  1ABQ A;  4Y92 A;  2FPF A;  1JEG A;  1MV0 B;  1QKX A;  1H92 A;  3FJ5 A;  1PWT A;  2CUD A;  4ESR A;  2C0T A;  2DL4 A;  2M0Y A;  2AKK A;  2M51 A;  3NGP A;  1GFC A;  1X2K A;  2L3Q A;  4OML A;  2EKH A;  4HVU A;  2O2O A;  1FMK A;  4RTX A;  2I0N A;  1UEC A;  4RTU A;  1UG1 A;  2GTJ A;  1WDX A;  4K11 A;  4D8K A;  4Z88 A;  1H3H A;  1ZUU A;  2LZ6 B;  2P4R A;  2A36 A;  3VRZ A;  5GJW B;  2YUO A;  1NG2 A;  1K0X A;  5I22 A;  2MOX A;  4JJB A;  2VKN A;  2DJQ A;  4LN2 A;  4HXJ A;  2JM9 A;  2D0N A;  4OMO A;  3KFV A;  1WXU A;  2ENM A;  1T0H A;  1E6G A;  2LJ3 A;  3UF4 A;  1W70 A;  2RQW A;  3VS5 A;  4JZ3 A;  1W6X A;  1JQQ A;  2VWF A;  2V1Q A;  2BZ8 A;  1PRM C;  4JJD A;  2B86 A;  2F2W A;  1Y57 A;  2JS2 A;  3SHW A;  1GBQ A;  2AZV A;  1AEY A;  1LCK A;  3ULR B;  2HEQ A;  3RNJ A;  2A28 A;  2D8H A;  4CC2 A;  3M0P A;  1PRL C;  1Y0M A;  3VS2 A;  2EGC A;  1M3C A;  1GRI A;  4Z8A A;  3O5Z A;  2X3X D;  1M27 C;  2HBW A;  2EQI A;  4HVV A;  1GL5 A;  5IXF A;  1J3T A;  1TUC A;  2YUN A;  1X2Q A;  1G2B A;  2CDT A;  2D8J A;  2ECZ A;  2GTO A;  1GFD A;  1KFZ A;  4CC4 B;  4D8D A;  4AG2 C;  3TSW A;  1GCQ A;  2BZX A;  1UE9 A;  1Z9Q A;  2X3W D;  4J9E A;  2RQR A;  3VS6 A;  2K9G A;  2RNA A;  2LJ1 A;  2EVR A;  1X69 A;  4X1V A;  2KYB A;  2DNU A;  1QWE A;  1I0C A;  1VYU A;  4A63 B;  4JZ4 A;  1I1J A;  2EGA A;  2F2V A;  2O31 A;  1EFN A;  1HJD A;  4QT7 A;  2W0Z A;  4M4Z A;  1ARK A;  3REA B;  1B07 A;  2RPN A;  2W10 A;  4WCI A;  1GCP A;  2IIM A;  1VYV A;  1SSH A;  1HD3 A;  2YDL A;  1NEG A;  2JS0 A;  1KJW A;  1Z9Z A;  3VS7 A;  4AG1 C;  2AKL A;  1OOT A;  4J9G A;  2KYM A;  3GBQ A;  2KR3 A;  2L3S A;  2DBK A;  2KEA A;  2EYW A;  1UTI A;  1BK2 A;  2CH4 A;  2AZS A;  2YSQ A;  1AD5 A;  3I35 A;  4J9F A;  2MCN A;  1W1F A;  4AFU C;  4LE9 A;  1ZUK A;  2AK5 A;  1M8M A;  4FSS A;  2KXC A;  2PNI A;  2L0A A;  1AVZ C;  1ZSG A;  2JM8 A;  2K79 A;  2EBP A;  3NPF A;  3VS4 A;  1HSQ A;  1GBR A;  2KRM A;  4J9D A;  1X27 A;  1AWJ A;  2RQT A;  1MV3 A;  3UA7 A;  2EYZ A;  2KT1 A;  3TSZ A;  1X6G A;  3THK A;  1T3S A;  1M3A A;  2LMJ A;  2GQI A;  2C0I A;  5ECA A;  1CKA A;  1H8K A;  2FPD A;  1OPK A;  3H0I A;  1S1N A;  1IO6 A;  2RQU A;  2ED1 A;  2PZ1 A;  3REB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...