3C0CA

X-ray crystal structure of the rat endophilin a2 sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
PLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endophilin-A2
publication title Crystal structure of the SH3 domain of rat endophilin A2
rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3c0cA00
4R0KA 2KR3A 4HVWA 1GCQA 1WIEA 2M0YA 1UE9A 1Z9ZA 1ZBJA 2OI3A 1S1NA 3THKA 1SHGA 2GNCA 3H0HA 2EYWA 1AWJA 1GRIA 2KRMA 2FPDA 1B07A 2NWMA 3M0QA 2VWFA 4JJBA 2L0AA 3EG0A 1MUZA 2D8HA 4KRTA 1H3HA 1BBZA 2RF0A 2MCNA 1X27A 2DLPA 4AFSC 2RNAA 1WXUA 2JW4A 2A36A 1M30A 3VS3A 4CC3A 5FWBA 1M27C 2K9GA 4J9GA 1E6HA 1UTIA 4WCIA 4Z88A 2KEAA 3JV3A 1OPLA 4LE9A 1KIKA 2JS0A 1JEGA 2RN8A 1RUWA 2RQWA 2EPDA 2ENMA 2B86A 3VS2A 4RTTA 1WXBA 4OMPA 4DEXA 2KT1A 3EHRA 2CUDA 1JU5C 1K0SA 2CSIA 2LQNA 3H0IA 2LNHB 1U3OA 1VYVA 1SHFA 2GQIA 1I0CA 2L2PA 4J9EA 1PRMC 2JMAA 1YWPA 2GTJA 1ZSGA 3VS4A 1M3CA 2GTOA 2LJ0A 1PKSA 2BZYA 2FPEA 4CC4B 2CUBA 1H92A 2SEMA 2DJQA 2L3SA 1AVZC 2KROA 1UDLA 1SSHA 2EYYA 1YN8A 2LJ1A 2C0TA 1EFNA 1SEMA 2KXDA 2X3XD 1K76A 4GLMA 3VS7A 3GBQA 2KRSA 1WA7A 2LQWA 4IIOA 2D8JA 1VA7A 3R6NA 1CSKA 3TSWA 3KFVA 2QDLA 1I1JA 3M0PA 2YT6A 2HEQA 2O9SA 2VVKA 2MIOA 1G83A 3O5ZA 3SHWA 2DL4A 1SRLA 4D8DA 1KJWA 2AZVA 1ZUKA 3PE0A 1NLPC 2YUNA 1W70A 2J6OA 1K1ZA 3A98A 2C0IA 1AWXA 2M51A 1E6GA 2PNIA 3H0FA 2BZ8A 4K11A 1G2BA 2EBPA 3VRZA 2I0NA 3VS5A 1A0NB 4OMOA 5GJWB 1UUEA 2DILA 2K3BA 2P4RA 2ROTA 5I22A 3IQLA 1TG0A 1UGVA 3TVTA 1K0XA 1X2KA 3EG3A 2K7AA 2AK5A 2DMOA 1AD5A 2L3QA 2YDLA 3ZL7C 2ED1A 4ZNXA 4RUGA 4OMQA 1AWWA 5IH2A 4M4ZA 2DA9A 2KE9A 5IXBA 1CKAA 2L3PA 1VYTA 2HBWA 3C0CA 1AZGB 2H8HA 1RI9A 1Z9QA 4CC2A 4Y92A 1FMKA 2JM9A 1PHTA 4F14A 1K4US 4LUDA 4LNPA 1QKXA 2CT4A 4AFZC 3M0SA 1UG1A 3I5SA 2ECZA 4HVUA 2SRCA 5IHIA 2DVJA 1Y0MA 2J6KA 1IO6A 1JXOA 2F2VA 4OMMA 4RTZA 1WLPB 2LZ6B 2AKLA 2E5KA 4J9IA 2A08A 2RQRA 2O9VA 2YUPA 2DM1A 2V1RA 2DX1A 2CT3A 3NGPA 3EGUA 1ABOA 3H41A 1V1CA 2IIMA 2DL7A 1VYUA 4QT7A 4E6RA 4Z89A 2CH4W 2EGCA 4DEYA 1YWOA 1I07A 4D8KA 2O2OA 2KRNA 5IXFA 1T3LA 1X43A 1NYFA 1SPKA 1ARKA 2FO0A 1OOTA 2J06A 2KYMA 2FRWA 3NMZC 2KGTA 4J9BA 3I35A 3UA7A 4RTVA 1MV0B 3M0TA 4A63B 2CSQA 2KXCA 2LJ3A 2NUZA 1T0HA 2EW3A 4JJCA 1YP5A 4RTUA 1GBQA 4AFQC 2D1XA 1T0JA 3TSZA 3M0UA 3I5RA 1OEBA 1AZEA 1QWEA 1W6XA 2EQIA 1AWOA 1K9AA 2V1QA 1U5SA 4CC7A 1JXMA 2DE0X 1N5ZA 1GFDA 5EC7A 3EHQA 5FW9A 2DBKA 2DL8A 1GL5A 1FYNA 1GCQC 2DBMA 1BB9A 4FSSA 1RLQC 4F16A 4RTXA 3LH5A 1AEYA 1NM7A 4J9CA 5I11A 1M8MA 3NHNA 2FG0A 2BTTA 1OV3A 1U06A 1H8KA 1WX6A 4RTYA 3RBBB 2JM8A 2ROLA 1X6GA 2GBQA 4ORZA 4IIMA 3RNJA 1ABQA 3UATA 1WDXA 2AKKA 2YUQA 5HCKA 1UECA 4LN2A 1OPKA 2DF6A 1KSWA 1YCSB 1YNZA 4JJDA 2X3WD 3M0RA 2JMCA 1PWTA 3I9QA 4J9DA 2W10A 1M3AA 2PZ1A 2RMOA 4AG2C 2MOXA 3PVLA 1QCFA 3PVQA 1JO8A 4HCKA 2YUOA 1ZLMA 2FRYA 5FWCA 1HD3A 4RTWA 4X1VA 3UA6A 5L23A 2DL3A 4J9HA 1BK2A 2G6FX 1TUDA 3EG1A 1PRLC 3FJ5A 2JS2A 2LP5A 2AZSA 2XMFA 2HDAA 2C0OA 1MV3A 1W1FA 2DRKA 1BU1A 2YSQA 2KYBA 2CDTA 2KNBB 1WI7A 2DYBA 2LMJA 2RQUA 1HJDA 1WXTA 2EGAA 4F17A 2BZXA 3EG2A 1B3QA 1X6BA 1PKTA 1AOJA 1HSQA 1M3BA 1QLYA 1QWFA 4JZ3A 2A37A 3SEMA 2DNUA 2KT8A 1TUCA 2FEIA 1XOVA 2J7IA 2OAWA 5IHKA 2DL5A 3QWYA 2A28A 4AFUC 2JTEA 2HCKA 1NEBA 1SRMA 3VS6A 4HXJA 2W0ZA 1T3SA 2LX7A 2KBTA 3NPFA 2K2MA 2OJ2A 4AG1C 2J6FA 2CH4A 2ED0A 3U23A 2F2WA 2D0NA 1GBRA 3VS0A 1NEGA 5GJVB 2O88A 4HVVA 2EVRA 4LUEA 4EIKA 2HSPA 4GBQA 1RLPC 3VRYA 2RQTA 2RPNA 1WFWA 4Z8AA 3UF4A 1ZUYA 4ESRA 1PNJA 2RQVA 3QWXX 1NG2A 2F2XA 5IHNA 1GFCA 2K6DA 3ULRB 1J3TA 1GCPA 1QKWA 2J05A 2CREA 1UFFA 1UJYA 1X69A 2VKNA 1UHFA 1NLOC 1UJ0A 4OMLA 1LCKA 1JQQA 1ZUUA 2O31A 1CKBA 2ABLA 2FPFA 2DRMA 3REBB 1NYGA 4OMNA 1WYXA 1X2QA 3CQTA 2PTKA 4JPBW 1Y57A 1ZX6A 2ESWA 5ECAA 2JT4A 4JZ4A 2GGRA 2JXBA 2EKHA 1KFZA 2EGEA 2LCSA 2EYXA 3REAB 1E7OA 2EYZA 2K79A 1UHCA 3VS1A 4J9FA
chains in the Genus database with same CATH superfamily
2EJ9A 5GAN8 4FYVB 1Z9ZA 3L2WA 2GNCA 4M75F 3JCMc 2EYWA 3RR6A 1R8OB 3J7AF 5AYFA 3CPWA 1YJ9A 3OYLA 2L0AA 2LX9A 5AT1B 1H3HA 1KQSS 2RJEA 3BDLA 2MCNA 5C6SA 1IGUA 3EGXA 3UDCA 2CKKA 4M7DE 4FSXA 1K8AR 3SD4A 4ANJA 3RERA 2A36A 3V8KA 4XQ3A 1M30A 1TWBA 2DXCA 4CC3A 2L3RA 1G3YA 1M27C 4AT1B 1VQ5A 3OBYA 4QKUA 4FW2A 1JEGA 1RUWA 3M4GA 3UT1A 2PUOB 4E7LA 2ENMA 4XU2A 4N4IA 4RTTA 4OMPA 2G3RA 3EHRA 5KYYA 3CMET 2M02A 4FW1A 4EMKB 3CC2A 2V8IA 1VYVA 2L2PA 4J9EA 3MP6A 4DBHA 1RAGB 1PRMC 2JMAA 2GTJA 5GAOr 9ATCB 2K57A 3VS4A 3JRZA 1OX9A 4PJOD 2VB6A 3LX7A 3I56T 2CS7A 2VYTA 4J6WA 2RHIA 3JCMd 1MMGA 2FPEA 4X9DA 3L2RA 5LJ3f 1FWZA 3PIPA 1NJIU 4JUVA 3CC4T 2EYYA 5J39A 5D6XA 4QQDA 2KXDA 3OSSC 4PLIA 2KRSA 1W4SA 4WF2A 1ZQ1A 5IT9E 1QVGP 3MEVA 2LT4A 3TSWA 2XG8D 1I1JA 3CCSQ 3JSCA 2YT6A 1X75C 3JCMQ 5D7UA 1B34B 3JCMW 1K73R 3SHWA 2XU8A 3OW2A 2ZPFB 1WJQA 2VASA 4M78E 1KJWA 3JCMe 2OTJQ 4QVDA 4DBQA 3BY7A 2BUDA 3KUFA 2FL7A 1PD0A 2C0IA 6AT1B 1E6GA 2VXFA 4UC4A 2BZ8A 4JDSA 2YLBA 4ZGJB 1G2BA 3VRZA 1RAIB 2WSFE 3CMEA 1BYMA 2DFUA 2DILA 2P4RA 2GQVA 1TSFA 1UGVA 3IQLA 3G4SQ 4RCBA 1V29B 2CZ6B 2DMOA 3OYDA 1BIBA 2YDLA 1AWWA 2MYSA 2DA9A 1CKAA 4JRPA 1VYTA 3GOXA 1K9MC 5CKDA 1AZGB 1D1CA 3CCMT 2DO3A 3CD6Q 4CC2A 1RI0A 2QA4A 1FMKA 1KQSA 3QUIA 1SSFA 5KYUB 1PHTA 2HNIA 4C8QF 8ATCB 4LNPA 1WJSA 4EMHA 1K9MU 4XK8E 2CT4A 3M0SA 4EMKC 3I5SA 4HVUA 2DVJA 3M4YA 4QVZA 2F2VA 4N0AA 4RTZA 3QHSA 2YXYA 1WLPB 2CP6A 2E5KA 4PFZA 3SFMA 3QKJA 2V1RA 3CBOA 4C8QG 5GAOn 3NGPA 3H41A 2ZGWA 2IIMA 3ZEHA 1F1BB 1IREB 4QT7A 4E6RA 3X25B 1YHQQ 2EGCA 4DEYA 3E19A 1LPLA 2DIGA 1T3LA 1KD1U 2J06A 3P8BB 2COYA 3CCRT 4WTOB 3NMZC 1QW1A 1I81A 3I35A 2HQHA 2CSQA 3MKDA 3V8LA 4JJCA 3CCMA 3G71T 5KYXB 2K4YA 1Q81R 2KI7A 1QVFS 3M0UA 1C0MA 1WHKA 1OEBA 1AZEA 3FDRA 1ZSZB 2V1QA 2RI3A 2YRDA 4MDXA 1HXDA 4M77F 3PT9A 5LJ5h 3VJPA 4Z02A 1GFDA 5EC7A 4DBRA 3H8ZA 1GL5A 1VQKQ 1AHJB 1FYNA 5KCHA 4BACA 3M53A 3HSBA 1GCQC 5A0DA 4LXCA 5FROA 1M1KC 4RTXA 4KGZB 1M8MA 2FG0A 3L42A 1JRIA 4FCYA 2KK4A 1YI2T 3R6OA 1W2BS 4OB1B 3RBBB 4MZTA 2JM8A 3JB9I 2BIVA 2D9TA 2DIQA 1JJ2S 3UATA 1WDXA 1VQNT 2QQSA 5HCKA 3JB9D 1UGPB 3QZ5B 1KK7A 1M2VA 4M75E 2DF6A 3JB9G 1LOJA 3JCMf 3CBPA 1KSWA 1YJWA 2CP2A 1PM3A 5HK3A 2QI2A 1M3AA 3CCUA 2P84A 2YRVA 2M0OA 2E6NA 1G5VA 4HCKA 5DLQE 1VQ9Q 4V2SA 3G71A 3OMGA 2KQWA 4C92F 4FT2A 2X4WA 2RM4A 3RDVA 5L23A 2DL3A 5CKHA 4M78B 5KYNA 3G7ZA 4C0FA 4BI4A 1TUDA 1Q82U 3RKXA 5GANh 4KGVB 3EGXB 1G3SA 3GF5A 5CIUA 2C0OA 1MV3A 2DRKA 3OS2A 1BU1A 3QXEB 2DZ9A 1XJWB 4C5HA 1BCMA 2KNBB 3OS5A 3HPWA 4P5NA 1WXTA 4KH1B 1B3QA 3VKIA 1PKTA 4HCCA 1YI2A 3MEAA 1AOJA 1HSQA 1RAHB 2ZCFB 1PD1A 1RADB 1NPPA 2IG0A 5KYYB 2KT8A 2LTOA 4C8QA 2FEIA 2E64A 2J7IA 3T9NA 2JTEA 1VQNA 2HCKA 1NEBA 1RAFB 4JLIA 4XU3A 4N4HA 2P0QA 3VS6A 3G6ET 4DBFA 2OJ2A 4EMKA 2CH4A 3JCMJ 1QVFA 2ED0A 3U23A 3HFNA 1YITQ 4PFOA 4JRKA 4LDYA 3OA6A 3HP9A 5GJVB 2EVRA 4LUEA 3OYFA 3BE3A 2M9UA 2RPNA 4Z8AA 5LJ5d 2DETA 1M4ZA 4AMCA 3VU3C 4PLLA 1R0BG 5GAMe 2F2XA 4MMKA 2COZA 3S3MA 3CD6T 4HCBA 1GFCA 1J3TA 1UHFA 4ELYC 1W2BA 2HQEA 4C5GA 5A0LA 4VUBA 5C0MA 2B8AA 5IAYA 1JJ2A 5KYWB 2EYQA 3PFSA 3SWNB 3QIIA 2ABLA 3OYJA 2FPFA 4LDVA 2FYKA 3M59A 4OMNA 5HKCA 3V7CA 1WYXA 4M78C 3V7SA 2X9HA 2EJGA 4JPBW 4Q5WA 2ESWA 3G1JA 4F7UG 1Q86C 1M90C 1M2OA 3I56Q 1YHQT 2JXBA 1KFZA 3A5ZB 4XTWA 2LCSA 5GAMj 4JS4A 1E7OA 3CC4Q 4C8QE 1UHCA 3VS1A 3M55A 1KC8R 3X28B 4HVWA 1GCQA 1Q86U 3L2ZA 1M90U 3G4SA 2KDSA 4M78D 3HHTB 2M0YA 2E65A 1VQLT 4M78G 1VQOQ 2HKQB 3THKA 2RK1A 3ASKA 1M9SA 2DTOA 1OYXA 2LNVA 3CD6A 5KYUA 4OB0B 2XIDA 1GRIA 3PMIA 4OB2B 3EG0A 4EMGA 2D8HA 4KRTA 3C95A 3I55Q 3RKYA 4OP0A 2XICA 3JCMV 2HMAA 4BE0A 4M75B 2RNAA 2JW4A 1E6HA 2QQBA 1Q7YR 2JTMA 4Z88A 2KEAA 2DERA 1OPLA 1O75A 4PJJA 5LJ3e 3MCAB 2RQWA 2QG9B 4DEXA 2RJDA 3CCMQ 1JU5C 1YHQA 2CSIA 3FLGA 3H0IA 2LNHB 4A54A 4OMFB 1SHFA 4IUUA 1ZSGA 1UGQB 3SWNC 1TS9A 4M77E 3C12A 4HKEA 3S3NA 2RD1A 4EDUA 1VQMQ 2GTOA 2EQUA 1N6AA 1PKSA 4Y91A 4CC4B 4IUQA 2SEMA 2KROA 2CP3A 2HQXA 1SSHA 1VQ9T 4BDZA 2RHXA 2CP5A 1SEMA 2X3XD 3GBQA 5GAN7 1WA7A 1SG5A 2D8JA 2PVDB 1CSKA 3LH0A 4NOYA 2K5FA 3RIRA 4JRQA 5LJ3j 2JN0A 4CI0C 1OULA 3LW5E 2O9SA 1EIFA 2QK0A 8AT1B 1KHIA 2DL4A 4J83A 1NJIR 4O6JA 1SRLA 1Y96A 3MEUA 1VQ8T 1W70A 3CCRQ 3NTIA 4CRIA 1M2VB 4FYYB 1PSEA 3A98A 2V8JA 1I4K1 2PNIA 3QYHB 2CP0A 4K11A 3AHUA 3VS5A 2GF7A 2R58A 3G71Q 3CC7Q 4C0DB 1UUEA 1TG0A 1XNIA 3TVTA 3S6WA 4M75C 3EG3A 4F7UA 5LJ5f 4J5YA 4KBMB 4RUGA 5IH2A 4M4ZA 2KE9A 2LDMA 4HA8A 2HBWA 2L5QA 2H8HA 1Z9QA 4IUPA 1YITT 4FM4B 3PTAA 2CGHA 2JM9A 1VQ9A 4FIBA 2RH2A 4NS5A 4M78A 4M75D 1YI2Q 2ECZA 4XTZA 5DLOA 4M75G 4PJNA 2EJFA 2J6KA 2XD0A 2LZ6B 3CXCP 2AKLA 2E1HA 2JTFA 3SDZA 4A4KA 4C8QB 1VQNQ 2YUPA 5GAN3 1V1CA 1VYUA 2XI9A 2CH4W 2K5LA 1PG5B 2NUPB 3GP8A 2DEUA 1SPKA 2E4HA 3NTHA 1HK9A 2O4XB 1ARKA 1OOTA 3CCQQ 4N4GA 1WHJA 1ZA1B 5GANf 3FC3A 2KGTA 2EQJA 4J9BA 1ACMB 4PJOF 3HRUA 4FL6A 1D3BB 4A63B 2LJ3A 2NUZA 2PUKB 2EW3A 1YP5A 4RTUA 2LC4A 1GBQA 1YITA 4AFQC 2D1XA 4F7UE 1QWEA 1U5SA 1O9SA 1KD1R 2CZ0B 1QCOA 1VQOT 2DE0X 1NZ9A 4C0DC 3EHQA 2JOYA 2DBKA 3VUBA 1M8VA 1BB9A 1N8RC 2EIFA 3RUXA 2YLCA 4FYXB 2Y4YA 2LRQA 1AEYA 3I55T 5GAN5 3NHNA 1QCNA 1DJ7B 1BI0A 3FEOA 5KYWA 2JNGA 1H8KA 1U8RA 1OX8A 4M77B 3SWNA 5GAMg 3G6EQ 2K3YA 3A8GB 4ORZA 3HFOA 3GIBA 2MI6A 1UECA 2HL3A 3OS0A 2L89A 1YCSB 2X3WD 2XDBA 2JMCA 3I9QA 2PZ1A 3I56A 1K8AC 1LNXA 4C8QC 3PVQA 3CC4A 2MWPA 2DJZA 4FU6A 3EG9B 3GLXA 1XTDA 1K8AU 4LDXA 1VQMT 3QSUA 2LCLA 3QDFA 2AHJB 2BE7D 3EG1A 1VQOA 3OYCA 2JS2A 2LP5A 2AZSA 2C06A 4QVCA 1W1FA 2VGNA 3KBGA 3S3OA 2KYBA 4C8QD 1FXXA 4B9XA 1UEBA 3A8OB 2LMJA 2KSSA 3I55A 1P92A 2EGAA 4F17A 4BE1A 2BZXA 4M75A 1VQ7T 3J80E 1X6BA 2AIRB 2ZZDA 2XK0A 2ATCB 1VQPQ 1QWFA 3QZ9B 3A8HB 1Q82R 1BI3A 1TUCA 1BIAA 2P4TA 2A28A 4AFUC 1PSFA 1KQSP 3CCEQ 1ZBXA 2HKNA 5CKFA 1MHNA 1VQLQ 2RHUA 1RACB 2KBTA 3BFMA 2CZ7B 2K2MA 2J6FA 2RO0A 1C6VX 2MK5A 1OZ2A 1TH7A 3CC7T 1K73C 1M1FA 3EGDB 1VIFA 5GMKh 2O88A 4M77C 1JB0E 3FIFA 4EIKA 4ZN3A 4GY5A 5A0GA 1N9SA 3DB4A 5KCOA 3UF4A 1QVPA 1VOMA 1PNJA 1VQMA 5I2MA 1NG2A 5LJ3g 3GPLA 4FT4A 5CQYA 3OBWA 4QW2A 3P8HA 2K6DA 3OQ5A 4OF1A 3OSVA 2J05A 4RKUE 4O5VA 1UFFA 3FB9A 1IB8A 2QASA 1NLOC 5KE3A 3URGA 3M5AA 1Y96B 2YWWA 2ZPIB 3RMQA 4M77D 1LCKA 1JQQA 2EAYA 2EWNA 1UGRB 1VQ7A 4IURA 4EPCA 4M77G 2QEXT 4J6YA 1PC0A 1M1KU 2MAMA 3REBB 1AT1B 1D0YA 2NYSA 3WVEB 4MMLA 3QJ6A 1Y57A 2L8DA 2DYIA 4F7UB 3CCRA 4XU1A 2EKHA 4C92C 2KMTA 3REAB 4X9CA 3E1SA 2K2VA 3CC7A 1BKBA 3CCQT 2DD5A 1WIEA 2BE9B 1UE9A 2OI3A 1ZBJA 1NE8A 3LGFA 3DLMA 1S1NA 1SHGA 1IRXA 2QQ9A 4PNOA 3H0HA 1N9RA 5FRMA 2FZCB 4PK4A 5GAOq 2KRMA 2P0PA 4ME7A 3M0QA 3RKWA 3CCVQ 2VWFA 1KHCA 1TU0B 4MZPA 1HYOA 1IXDA 3O8VA 1MUZA 4JRIA 1Y7XA 4C92G 2DK3A 4NL2A 1YCYA 5CVIA 2ZPBB 4PJMA 1VQ8Q 1I5OB 1RABB 1M90R 2PU9B 5KH6A 1X27A 1WXUA 2QAZA 4OGEA 2OTLQ 1VIEA 1H641 3TQ7P 3VS3A 2QEXA 5FWBA 5M9OA 2K9GA 4J9GA 3PNWC 3OMCA 2HZYA 4WCIA 1Q81C 1OU8A 2KVQG 2E6ZA 3JV3A 3WVDB 4LE9A 1KIKA 2QYZA 3N5BB 7AT1B 2ZPEB 1FMWA 3VS2A 1UB4A 2NUPA 4BDYA 2A3LA 3E2UA 2CUDA 1K0SA 1Q81U 5EG2A 2KAFA 4M7DF 1U3OA 1OU9A 2RHYA 2O4XA 1V76A 1TXQA 2GQIA 2R5MA 1MMDA 5GAOp 1YWPA 4HCZA 4ZGEB 3CCQA 4RCCA 3OY9A 2E10A 5CKBA 5GAOl 1D3BA 1LVKA 1M3CA 2LJ0A 2X4JA 2JVVA 1YJNT 1BCOA 5FLXE 2CUBA 1D1BA 1H92A 2DJQA 1AVZC 3OYBA 3JB9J 2LJ1A 4IKFA 2MF2A 1K76A 4GLMA 4RG8A 5IN1A 2IVWA 2YRCA 1BI1A 4XTVA 5GMKe 3M0PA 4LDWA 5HY6A 2QQAA 2X35A 2MIOA 1G83A 3O5ZA 5LJ5e 3CBMA 2X51A 1QVFP 1IHVA 2AZVA 1ZUKA 3PE0A 1NLPC 2YUNA 3L1AA 1D1AA 2GFUA 4M77A 1K1ZA 2CZ1B 1AWXA 2DXTA 2FVUA 1VQPT 2QTXA 3G6EA 1WHMA 4ZGDB 1A0NB 2ROTA 5FU6C 5I22A 3M57A 1K0XA 1X2KA 2AK5A 3CCET 2L3QA 3JCMg 2ED1A 4ZNXA 2L3PA 5GANd 2XHCA 2PQWA 5D6YA 1RI9A 4M7AF 3VUZA 2EQMA 3A8LB 2NUTB 3CXCS 3EG9A 1N27A 4LUDA 4LDUA 1VQ4T 5LJ5j 1QKXA 3JCMP 2Y4XA 1UG1A 3OYNA 3OYMA 1Y0MA 1IO6A 4D6WA 3VV0A 4C92A 5DM7R 4J9IA 2RQRA 1MMAA 5GANe 4HT8A 2O9VA 2DM1A 2CT3A 2K3XA 4BY6B 3LWIA 1ABOA 3F70A 1D0XA 5DY9A 3H6ZA 3M54A 1I07A 2KRNA 1VQPA 3CMAT 5IXFA 1X43A 5D6WA 4C0ZA 2KYMA 2HD0A 2BKDN 1QVGS 3CCEA 5GAN4 3UA7A 1JBMA 4RTVA 1WHHA 2GFAA 3QYGB 3M0TA 3BDUA 4E7JA 1VQLA 3SB2A 3EGDA 2LQKA 3OYIA 1T0JA 2HBPA 2HAXA 3TSZA 3MO8A 1W6XA 1K9AA 5GANj 3HRSA 1JXMA 1VQ7Q 1N5ZA 1H3ZA 2HSEB 1D09B 5FW9A 2E3IA 2H3EB 2DL8A 2F5KA 2DBMA 3CCVT 1RLQC 1KC8C 3L2VA 4L5GA 4B9WA 4F16A 1B7TA 3LH5A 1NM7A 2D0QB 5GMKi 1Y07A 3CPFA 4DQ2A 2RB6A 4RTYA 1SKUB 1TOVA 2OTLT 2ROLA 2AT1B 2QTVA 4A4FA 1MNEA 1VQ5T 5CKEA 4C92E 4IIMA 3RNJA 2IPOB 4C0GA 2YUQA 1TUGB 2ZPHB 4LN2A 4R56A 4JJDA 4A4GA 1PWTA 1U1TA 3CXCA 1VQ6Q 2F1LA 1FX7A 2W10A 4AG2C 2MOXA 5A2QE 3CC2T 1XQHA 4BY6C 3ME9A 2YUOA 1ZLMA 3HTRA 3QJYA 1Q7YC 3UA6A 4J9HA 3GNGA 2MPXC 2G6FX 2DAQA 1NBEB 1PRLC 3CEYA 3FJ5A 3TEEA 2QEXQ 1Q7YU 2HDAA 3CCLT 1I8FA 4MZMA 3EFSA 4E2FB 3OYKA 3OYYA 2YSQA 1YFNA 3CCVA 2X4XA 1WI7A 2RQUA 2LT1A 2M1HA 1VQ8A 3EG2A 2VC8A 1K9MR 3VYHB 1Q95G 4E7HA 4M7AA 1M3BA 3LLRA 1QLYA 4JZ3A 2GCXA 2DNUA 2OTLA 1QVGA 3D7SB 1XOVA 2OAWA 4PJOC 5IHKA 5FU7B 4QQ6A 2DL5A 1G3TA 3CPWP 2RI5A 4PJLA 1SRMA 5L8RE 4HXJA 2DTIA 1FMVA 5CO7A 2VV5A 2F2WA 1NJIC 1NEGA 2HSPA 4BI8B 2RA2A 3VRYA 5J26A 4A4HA 2RQTA 2OAUA 4ESRA 1ZUYA 1QP3A 4II1A 4PJOG 2QA4T 1D0ZA 4TVRA 1QKWA 3CCLA 4XU0A 2RK2A 2QGFB 4E7IA 3MP8A 1UJYA 3A1PA 4RG2A 1YIJT 4OMLA 3GNFB 2D6FA 1YBYA 2O31A 2PVOB 4OB3B 3BW1A 1N8RU 2FHDA 5J3BA 2QGGA 4E7ZA 3C94A 1KG1A 3M58A 2E5QA 1G3WA 1VUBA 4KH0B 2JZ2A 4XTUA 2V26A 3H9NA 2DZCA 3TREA 1ZX6A 1EX4A 1U1SA 4IUVA 5ECAA 4JZ4A 2H3JA 2HL5C 2GGRA 4M7AE 1YJNQ 1TTHB 4PKCC 2EYXA 2EYZA 3META 4R0KA 1M1KR 2KR3A 5LJ5g 2FB7A 3MHXA 4DA4A 4BE2A 1IZ6A 3JAME 3OW2P 3CCJT 3C4SA 3JCMX 5CR2A 2LQ8A 1QP2A 4KGXB 4L6V5 4LD9K 5FU7C 1AWJA 2WSEE 2ZAEA 1IGQA 1WJRA 2NUTA 2F69A 2FPDA 1B07A 3JB9H 2NWMA 2LVMA 4JJBA 4BD3A 4C92B 4XTYA 1WPYA 1YIJA 4OGCA 1BBZA 4E47A 2RF0A 4BB7A 4GLKA 2E12A 2DLPA 4AFSC 3PGGA 1WZOA 2ZPGB 4LD6A 2A0FB 1UTIA 3HRTA 3QPHA 2JJ9A 2R57A 1SF9A 2JS0A 2Y90A 1KD1C 2RN8A 1WQWA 3OB9A 3M56A 2EPDA 1QQJA 2B86A 1WXBA 2KT1A 2EFIA 2LQNA 1QMCA 2RJCA 4DOVA 5GMKl 1I0CA 3RESA 5GAMh 4R55A 1M1GA 1VQ4Q 3V8JA 5GANg 1YJWT 1VQ6T 3CCUT 3QDRB 5GAN2 1K73U 3CCJA 2BZYA 2P0KA 3VYGA 2L3SA 1UDLA 1IHWA 4M7DB 1YN8A 2C0TA 4J7FA 1EFNA 4RMOA 3VS7A 3JCMb 3OS1A 2LQWA 1WQ7A 4IIOA 1VA7A 3R6NA 3DB3A 4PJOA 1C1AA 3KFVA 2CP7A 2QDLA 3E9GA 4KULA 2RI2A 2HEQA 2VVKA 4JLGA 3CMAQ 1MGQA 3UWNA 4D8DA 1M5Q1 2QDYB 3JB9F 1RL2A 4B6MA 2J6OA 3X20B 1S72Q 2M51A 3H0FA 1WHGA 1RAAB 5CAIA 2EBPA 3TU4K 2I0NA 3INZA 4OMOA 5GJWB 5HK0A 3UPUA 2K3BA 4QQGA 2K7AA 1AD5A 3ZL7C 4OMQA 5IXBA 2FZKB 2DXUA 3C0CA 1MNDA 3EFOA 1VQ6A 4Y92A 1YJ9Q 1Q82C 4C5EA 4F14A 1K4US 4C92D 1OQKA 3EAEA 2QQRA 2RHZA 1KQ2A 2COWA 4AFZC 4OVAA 1Q86R 5FU6B 2SRCA 5IHIA 3FJPA 4JS5A 4M7AB 1JXOA 4OMMA 2F5TX 1VQ5Q 2E70A 4MDWA 3WXMB 5LJ3h 2A08A 1KQ1A 5I2SA 4BI3A 1RAEB 2DX1A 2DKGA 4PJOE 3EGUA 4M7DC 3CCST 2DL7A 5CK9A 4Z89A 4X34A 1YWOA 3HKSA 3CC2Q 3MP1A 4D8KA 2O2OA 1ZSZC 5GAMd 1NYFA 4ATOA 2OTJT 2FO0A 4KUDK 3X26B 2E3HA 2FRWA 2QXFA 5GAN6 4PFPA 4KT0E 4IUTA 1MV0B 4HT9A 3P8DA 2KXCA 1T0HA 2X4YA 3TCJA 4M7DD 2Z0WA 4ZN1A 3CCLQ 4J7IA 4M7DG 3G4ST 1OZ3A 3EFRA 3I5RA 4J6XA 2EQIA 3LWHA 2VGMA 1AWOA 4CC7A 3OYEA 2K5IA 2DPPB 2R5AA 2MWOA 3MJXA 2DTHA 4XAXB 4FSSA 3EH1A 3NTKA 2EKOA 4YTLA 4J9CA 1R0CB 4Y28E 5I11A 4F7UF 2LCCA 2BTTA 1OV3A 3L2QA 1U06A 1WX6A 3CCSA 4A4EA 4BUGA 1B34A 4PL6A 1X6GA 3CMEQ 2GBQA 1MMNA 4E7SA 1ABQA 3QBYA 2AKKA 3ZBDA 1G8XA 2OTJA 4M78F 4M7AC 1BI2A 1OPKA 3E9FA 5GMKm 1YNZA 2PVGB 3M0RA 1W2BP 4J9DA 2RMOA 2QA4Q 1YJNA 3PVLA 1UGSB 3QG1A 5GMKj 3EH2A 4E7KA 1QCFA 1JO8A 1JJ2P 5CCAA 4J8OA 2FRYA 5FWCA 3Q1JA 1HD3A 4RTWA 4X1VA 2DD4A 3MEWA 2DEQA 3NFCA 3PIOA 3KXTA 1YIJQ 1EZZB 1BK2A 5CQXA 2E41A 1R77A 2XKOC 4ZTJA 2KY9A 3ZFJA 4M7AD 2V8KA 3HL8A 2XMFA 4ELZC 1PCXA 4M7AG 5LJ3d 5FRNA 2CDTA 3L2UA 2M16A 2RJFA 3A8MB 4F04B 2DYBA 1HJDA 3CPWS 3LGLA 1Y71A 4NL3A 1ZHIA 2NLUA 2JUFA 3V7RA 1VQKT 2FZGB 2A37A 2XDDA 3SEMA 2CYZB 2O01E 3DKMA 3X24B 4A53A 3QWYA 3OYHA 3PMTA 1X6OA 1S72T 4JJNK 3CCJQ 2W0ZA 1T3SA 2LX7A 3NPFA 3QO3A 4AG1C 5KE2A 1ZA2B 4XTXA 3OYAA 2D0NA 1GBRA 2DVEA 3VS0A 1WNLA 3MPUB 2DXBA 4HVVA 4FYWB 1WHLA 4L59A 4GBQA 1RLPC 2VXEA 1VQ4A 3M9QA 1WFWA 4PJOB 2RQVA 2I2LA 3QWXX 5IHNA 2YHTA 3JCMh 3LYIA 4M7DA 1LJOA 1YJ9T 3ULRB 5KYXA 1GCPA 4C5IA 2CREA 2VKNA 1X69A 5LL6S 4ZTFA 1ZSZA 3OYGA 1UJ0A 2OX7A 2A7YA 2EQKA 1ZUUA 5I21A 1CKBA 1KC8U 1X01A 3ER0A 5GAMf 4DOWA 2DRMA 1VQKA 1GXIE 1NYGA 1X2QA 2WSCE 3CQTA 3J81E 2XDPA 3CMAA 2PTKA 2MMPA 3AT1B 1YJWQ 2WACA 1WGSA 2JT4A 3OW2S 1I5LA 4N0AC 1NPRA 1OI1A 3RMSA 3CCUQ 1S72A 2EGEA 3FRNA 4KUIA 3DLLA 3EFOB 2VUBA 2K79A 5GAOm 1N8RR 4J9FA
chains in the Genus database with same CATH topology
4R0KA 2KR3A 4HVWA 1GCQA 1WIEA 2M0YA 1UE9A 1Z9ZA 1ZBJA 2OI3A 1S1NA 3THKA 1SHGA 2GNCA 3H0HA 2EYWA 1AWJA 1GRIA 2KRMA 2FPDA 1B07A 2NWMA 3M0QA 2VWFA 4JJBA 2L0AA 3EG0A 1MUZA 2D8HA 4KRTA 1H3HA 1BBZA 2RF0A 2MCNA 1X27A 2DLPA 4AFSC 2RNAA 1WXUA 2JW4A 2A36A 1M30A 3VS3A 4CC3A 5FWBA 1M27C 2K9GA 4J9GA 1E6HA 1UTIA 4WCIA 4Z88A 2KEAA 3JV3A 1OPLA 4LE9A 1KIKA 2JS0A 1JEGA 2RN8A 1RUWA 2RQWA 2EPDA 2ENMA 2B86A 3VS2A 4RTTA 1WXBA 4OMPA 4DEXA 2KT1A 3EHRA 2CUDA 1JU5C 1K0SA 2CSIA 2LQNA 3H0IA 2LNHB 1U3OA 1VYVA 1SHFA 2GQIA 1I0CA 2L2PA 4J9EA 1PRMC 2JMAA 1YWPA 2GTJA 1ZSGA 3VS4A 1M3CA 2GTOA 2LJ0A 1PKSA 2BZYA 2FPEA 4CC4B 2CUBA 1H92A 2SEMA 2DJQA 2L3SA 1AVZC 2KROA 1UDLA 1SSHA 2EYYA 1YN8A 2LJ1A 2C0TA 1EFNA 1SEMA 2KXDA 2X3XD 1K76A 4GLMA 3VS7A 3GBQA 2KRSA 1WA7A 2LQWA 4IIOA 2D8JA 1VA7A 3R6NA 1CSKA 3TSWA 3KFVA 2QDLA 1I1JA 3M0PA 2YT6A 2HEQA 2O9SA 2VVKA 2MIOA 1G83A 3O5ZA 3SHWA 2DL4A 1SRLA 4D8DA 1KJWA 2AZVA 1ZUKA 3PE0A 1NLPC 2YUNA 1W70A 2J6OA 1K1ZA 3A98A 2C0IA 1AWXA 2M51A 1E6GA 2PNIA 3H0FA 2BZ8A 4K11A 1G2BA 2EBPA 3VRZA 2I0NA 3VS5A 1A0NB 4OMOA 5GJWB 1UUEA 2DILA 2K3BA 2P4RA 2ROTA 5I22A 3IQLA 1TG0A 1UGVA 3TVTA 1K0XA 1X2KA 3EG3A 2K7AA 2AK5A 2DMOA 1AD5A 2L3QA 2YDLA 3ZL7C 2ED1A 4ZNXA 4RUGA 4OMQA 1AWWA 5IH2A 4M4ZA 2DA9A 2KE9A 5IXBA 1CKAA 2L3PA 1VYTA 2HBWA 3C0CA 1AZGB 2H8HA 1RI9A 1Z9QA 4CC2A 4Y92A 1FMKA 2JM9A 1PHTA 4F14A 1K4US 4LUDA 4LNPA 1QKXA 2CT4A 4AFZC 3M0SA 1UG1A 3I5SA 2ECZA 4HVUA 2SRCA 5IHIA 2DVJA 1Y0MA 2J6KA 1IO6A 1JXOA 2F2VA 4OMMA 4RTZA 1WLPB 2LZ6B 2AKLA 2E5KA 4J9IA 2A08A 2RQRA 2O9VA 2YUPA 2DM1A 2V1RA 2DX1A 2CT3A 3NGPA 3EGUA 1ABOA 3H41A 1V1CA 2IIMA 2DL7A 1VYUA 4QT7A 4E6RA 4Z89A 2CH4W 2EGCA 4DEYA 1YWOA 1I07A 4D8KA 2O2OA 2KRNA 5IXFA 1T3LA 1X43A 1NYFA 1SPKA 1ARKA 2FO0A 1OOTA 2J06A 2KYMA 2FRWA 3NMZC 2KGTA 4J9BA 3I35A 3UA7A 4RTVA 1MV0B 3M0TA 4A63B 2CSQA 2KXCA 2LJ3A 2NUZA 1T0HA 2EW3A 4JJCA 1YP5A 4RTUA 1GBQA 4AFQC 2D1XA 1T0JA 3TSZA 3M0UA 3I5RA 1OEBA 1AZEA 1QWEA 1W6XA 2EQIA 1AWOA 1K9AA 2V1QA 1U5SA 4CC7A 1JXMA 2DE0X 1N5ZA 1GFDA 5EC7A 3EHQA 5FW9A 2DBKA 2DL8A 1GL5A 1FYNA 1GCQC 2DBMA 1BB9A 4FSSA 1RLQC 4F16A 4RTXA 3LH5A 1AEYA 1NM7A 4J9CA 5I11A 1M8MA 3NHNA 2FG0A 2BTTA 1OV3A 1U06A 1H8KA 1WX6A 4RTYA 3RBBB 2JM8A 2ROLA 1X6GA 2GBQA 4ORZA 4IIMA 3RNJA 1ABQA 3UATA 1WDXA 2AKKA 2YUQA 5HCKA 1UECA 4LN2A 1OPKA 2DF6A 1KSWA 1YCSB 1YNZA 4JJDA 2X3WD 3M0RA 2JMCA 1PWTA 3I9QA 4J9DA 2W10A 1M3AA 2PZ1A 2RMOA 4AG2C 2MOXA 3PVLA 1QCFA 3PVQA 1JO8A 4HCKA 2YUOA 1ZLMA 2FRYA 5FWCA 1HD3A 4RTWA 4X1VA 3UA6A 5L23A 2DL3A 4J9HA 1BK2A 2G6FX 1TUDA 3EG1A 1PRLC 3FJ5A 2JS2A 2LP5A 2AZSA 2XMFA 2HDAA 2C0OA 1MV3A 1W1FA 2DRKA 1BU1A 2YSQA 2KYBA 2CDTA 2KNBB 1WI7A 2DYBA 2LMJA 2RQUA 1HJDA 1WXTA 2EGAA 4F17A 2BZXA 3EG2A 1B3QA 1X6BA 1PKTA 1AOJA 1HSQA 1M3BA 1QLYA 1QWFA 4JZ3A 2A37A 3SEMA 2DNUA 2KT8A 1TUCA 2FEIA 1XOVA 2J7IA 2OAWA 5IHKA 2DL5A 3QWYA 2A28A 4AFUC 2JTEA 2HCKA 1NEBA 1SRMA 3VS6A 4HXJA 2W0ZA 1T3SA 2LX7A 2KBTA 3NPFA 2K2MA 2OJ2A 4AG1C 2J6FA 2CH4A 2ED0A 3U23A 2F2WA 2D0NA 1GBRA 3VS0A 1NEGA 5GJVB 2O88A 4HVVA 2EVRA 4LUEA 4EIKA 2HSPA 4GBQA 1RLPC 3VRYA 2RQTA 2RPNA 1WFWA 4Z8AA 3UF4A 1ZUYA 4ESRA 1PNJA 2RQVA 3QWXX 1NG2A 2F2XA 5IHNA 1GFCA 2K6DA 3ULRB 1J3TA 1GCPA 1QKWA 2J05A 2CREA 1UFFA 1UJYA 1X69A 2VKNA 1UHFA 1NLOC 1UJ0A 4OMLA 1LCKA 1JQQA 1ZUUA 2O31A 1CKBA 2ABLA 2FPFA 2DRMA 3REBB 1NYGA 4OMNA 1WYXA 1X2QA 3CQTA 2PTKA 4JPBW 1Y57A 1ZX6A 2ESWA 5ECAA 2JT4A 4JZ4A 2GGRA 2JXBA 2EKHA 1KFZA 2EGEA 2LCSA 2EYXA 3REAB 1E7OA 2EYZA 2K79A 1UHCA 3VS1A 4J9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0K A;  2KR3 A;  4HVW A;  1GCQ A;  1WIE A;  2M0Y A;  1UE9 A;  1Z9Z A;  1ZBJ A;  2OI3 A;  1S1N A;  3THK A;  1SHG A;  2GNC A;  3H0H A;  2EYW A;  1AWJ A;  1GRI A;  2KRM A;  2FPD A;  1B07 A;  2NWM A;  3M0Q A;  2VWF A;  4JJB A;  2L0A A;  3EG0 A;  1MUZ A;  2D8H A;  4KRT A;  1H3H A;  1BBZ A;  2RF0 A;  2MCN A;  1X27 A;  2DLP A;  4AFS C;  2RNA A;  1WXU A;  2JW4 A;  2A36 A;  1M30 A;  3VS3 A;  4CC3 A;  5FWB A;  1M27 C;  2K9G A;  4J9G A;  1E6H A;  1UTI A;  4WCI A;  4Z88 A;  2KEA A;  3JV3 A;  1OPL A;  4LE9 A;  1KIK A;  2JS0 A;  1JEG A;  2RN8 A;  1RUW A;  2RQW A;  2EPD A;  2ENM A;  2B86 A;  3VS2 A;  4RTT A;  1WXB A;  4OMP A;  4DEX A;  2KT1 A;  3EHR A;  2CUD A;  1JU5 C;  1K0S A;  2CSI A;  2LQN A;  3H0I A;  2LNH B;  1U3O A;  1VYV A;  1SHF A;  2GQI A;  1I0C A;  2L2P A;  4J9E A;  1PRM C;  2JMA A;  1YWP A;  2GTJ A;  1ZSG A;  3VS4 A;  1M3C A;  2GTO A;  2LJ0 A;  1PKS A;  2BZY A;  2FPE A;  4CC4 B;  2CUB A;  1H92 A;  2SEM A;  2DJQ A;  2L3S A;  1AVZ C;  2KRO A;  1UDL A;  1SSH A;  2EYY A;  1YN8 A;  2LJ1 A;  2C0T A;  1EFN A;  1SEM A;  2KXD A;  2X3X D;  1K76 A;  4GLM A;  3VS7 A;  3GBQ A;  2KRS A;  1WA7 A;  2LQW A;  4IIO A;  2D8J A;  1VA7 A;  3R6N A;  1CSK A;  3TSW A;  3KFV A;  2QDL A;  1I1J A;  3M0P A;  2YT6 A;  2HEQ A;  2O9S A;  2VVK A;  2MIO A;  1G83 A;  3O5Z A;  3SHW A;  2DL4 A;  1SRL A;  4D8D A;  1KJW A;  2AZV A;  1ZUK A;  3PE0 A;  1NLP C;  2YUN A;  1W70 A;  2J6O A;  1K1Z A;  3A98 A;  2C0I A;  1AWX A;  2M51 A;  1E6G A;  2PNI A;  3H0F A;  2BZ8 A;  4K11 A;  1G2B A;  2EBP A;  3VRZ A;  2I0N A;  3VS5 A;  1A0N B;  4OMO A;  5GJW B;  1UUE A;  2DIL A;  2K3B A;  2P4R A;  2ROT A;  5I22 A;  3IQL A;  1TG0 A;  1UGV A;  3TVT A;  1K0X A;  1X2K A;  3EG3 A;  2K7A A;  2AK5 A;  2DMO A;  1AD5 A;  2L3Q A;  2YDL A;  3ZL7 C;  2ED1 A;  4ZNX A;  4RUG A;  4OMQ A;  1AWW A;  5IH2 A;  4M4Z A;  2DA9 A;  2KE9 A;  5IXB A;  1CKA A;  2L3P A;  1VYT A;  2HBW A;  3C0C A;  1AZG B;  2H8H A;  1RI9 A;  1Z9Q A;  4CC2 A;  4Y92 A;  1FMK A;  2JM9 A;  1PHT A;  4F14 A;  1K4U S;  4LUD A;  4LNP A;  1QKX A;  2CT4 A;  4AFZ C;  3M0S A;  1UG1 A;  3I5S A;  2ECZ A;  4HVU A;  2SRC A;  5IHI A;  2DVJ A;  1Y0M A;  2J6K A;  1IO6 A;  1JXO A;  2F2V A;  4OMM A;  4RTZ A;  1WLP B;  2LZ6 B;  2AKL A;  2E5K A;  4J9I A;  2A08 A;  2RQR A;  2O9V A;  2YUP A;  2DM1 A;  2V1R A;  2DX1 A;  2CT3 A;  3NGP A;  3EGU A;  1ABO A;  3H41 A;  1V1C A;  2IIM A;  2DL7 A;  1VYU A;  4QT7 A;  4E6R A;  4Z89 A;  2CH4 W;  2EGC A;  4DEY A;  1YWO A;  1I07 A;  4D8K A;  2O2O A;  2KRN A;  5IXF A;  1T3L A;  1X43 A;  1NYF A;  1SPK A;  1ARK A;  2FO0 A;  1OOT A;  2J06 A;  2KYM A;  2FRW A;  3NMZ C;  2KGT A;  4J9B A;  3I35 A;  3UA7 A;  4RTV A;  1MV0 B;  3M0T A;  4A63 B;  2CSQ A;  2KXC A;  2LJ3 A;  2NUZ A;  1T0H A;  2EW3 A;  4JJC A;  1YP5 A;  4RTU A;  1GBQ A;  4AFQ C;  2D1X A;  1T0J A;  3TSZ A;  3M0U A;  3I5R A;  1OEB A;  1AZE A;  1QWE A;  1W6X A;  2EQI A;  1AWO A;  1K9A A;  2V1Q A;  1U5S A;  4CC7 A;  1JXM A;  2DE0 X;  1N5Z A;  1GFD A;  5EC7 A;  3EHQ A;  5FW9 A;  2DBK A;  2DL8 A;  1GL5 A;  1FYN A;  1GCQ C;  2DBM A;  1BB9 A;  4FSS A;  1RLQ C;  4F16 A;  4RTX A;  3LH5 A;  1AEY A;  1NM7 A;  4J9C A;  5I11 A;  1M8M A;  3NHN A;  2FG0 A;  2BTT A;  1OV3 A;  1U06 A;  1H8K A;  1WX6 A;  4RTY A;  3RBB B;  2JM8 A;  2ROL A;  1X6G A;  2GBQ A;  4ORZ A;  4IIM A;  3RNJ A;  1ABQ A;  3UAT A;  1WDX A;  2AKK A;  2YUQ A;  5HCK A;  1UEC A;  4LN2 A;  1OPK A;  2DF6 A;  1KSW A;  1YCS B;  1YNZ A;  4JJD A;  2X3W D;  3M0R A;  2JMC A;  1PWT A;  3I9Q A;  4J9D A;  2W10 A;  1M3A A;  2PZ1 A;  2RMO A;  4AG2 C;  2MOX A;  3PVL A;  1QCF A;  3PVQ A;  1JO8 A;  4HCK A;  2YUO A;  1ZLM A;  2FRY A;  5FWC A;  1HD3 A;  4RTW A;  4X1V A;  3UA6 A;  5L23 A;  2DL3 A;  4J9H A;  1BK2 A;  2G6F X;  1TUD A;  3EG1 A;  1PRL C;  3FJ5 A;  2JS2 A;  2LP5 A;  2AZS A;  2XMF A;  2HDA A;  2C0O A;  1MV3 A;  1W1F A;  2DRK A;  1BU1 A;  2YSQ A;  2KYB A;  2CDT A;  2KNB B;  1WI7 A;  2DYB A;  2LMJ A;  2RQU A;  1HJD A;  1WXT A;  2EGA A;  4F17 A;  2BZX A;  3EG2 A;  1B3Q A;  1X6B A;  1PKT A;  1AOJ A;  1HSQ A;  1M3B A;  1QLY A;  1QWF A;  4JZ3 A;  2A37 A;  3SEM A;  2DNU A;  2KT8 A;  1TUC A;  2FEI A;  1XOV A;  2J7I A;  2OAW A;  5IHK A;  2DL5 A;  3QWY A;  2A28 A;  4AFU C;  2JTE A;  2HCK A;  1NEB A;  1SRM A;  3VS6 A;  4HXJ A;  2W0Z A;  1T3S A;  2LX7 A;  2KBT A;  3NPF A;  2K2M A;  2OJ2 A;  4AG1 C;  2J6F A;  2CH4 A;  2ED0 A;  3U23 A;  2F2W A;  2D0N A;  1GBR A;  3VS0 A;  1NEG A;  5GJV B;  2O88 A;  4HVV A;  2EVR A;  4LUE A;  4EIK A;  2HSP A;  4GBQ A;  1RLP C;  3VRY A;  2RQT A;  2RPN A;  1WFW A;  4Z8A A;  3UF4 A;  1ZUY A;  4ESR A;  1PNJ A;  2RQV A;  3QWX X;  1NG2 A;  2F2X A;  5IHN A;  1GFC A;  2K6D A;  3ULR B;  1J3T A;  1GCP A;  1QKW A;  2J05 A;  2CRE A;  1UFF A;  1UJY A;  1X69 A;  2VKN A;  1UHF A;  1NLO C;  1UJ0 A;  4OML A;  1LCK A;  1JQQ A;  1ZUU A;  2O31 A;  1CKB A;  2ABL A;  2FPF A;  2DRM A;  3REB B;  1NYG A;  4OMN A;  1WYX A;  1X2Q A;  3CQT A;  2PTK A;  4JPB W;  1Y57 A;  1ZX6 A;  2ESW A;  5ECA A;  2JT4 A;  4JZ4 A;  2GGR A;  2JXB A;  2EKH A;  1KFZ A;  2EGE A;  2LCS A;  2EYX A;  3REA B;  1E7O A;  2EYZ A;  2K79 A;  1UHC A;  3VS1 A;  4J9F A; 
#chains in the Genus database with same CATH topology
 2EJ9 A;  5GAN 8;  4FYV B;  1Z9Z A;  3L2W A;  2GNC A;  4M75 F;  3JCM c;  2EYW A;  3RR6 A;  1R8O B;  3J7A F;  5AYF A;  3CPW A;  1YJ9 A;  3OYL A;  2L0A A;  2LX9 A;  5AT1 B;  1H3H A;  1KQS S;  2RJE A;  3BDL A;  2MCN A;  5C6S A;  1IGU A;  3EGX A;  3UDC A;  2CKK A;  4M7D E;  4FSX A;  1K8A R;  3SD4 A;  4ANJ A;  3RER A;  2A36 A;  3V8K A;  4XQ3 A;  1M30 A;  1TWB A;  2DXC A;  4CC3 A;  2L3R A;  1G3Y A;  1M27 C;  4AT1 B;  1VQ5 A;  3OBY A;  4QKU A;  4FW2 A;  1JEG A;  1RUW A;  3M4G A;  3UT1 A;  2PUO B;  4E7L A;  2ENM A;  4XU2 A;  4N4I A;  4RTT A;  4OMP A;  2G3R A;  3EHR A;  5KYY A;  3CME T;  2M02 A;  4FW1 A;  4EMK B;  3CC2 A;  2V8I A;  1VYV A;  2L2P A;  4J9E A;  3MP6 A;  4DBH A;  1RAG B;  1PRM C;  2JMA A;  2GTJ A;  5GAO r;  9ATC B;  2K57 A;  3VS4 A;  3JRZ A;  1OX9 A;  4PJO D;  2VB6 A;  3LX7 A;  3I56 T;  2CS7 A;  2VYT A;  4J6W A;  2RHI A;  3JCM d;  1MMG A;  2FPE A;  4X9D A;  3L2R A;  5LJ3 f;  1FWZ A;  3PIP A;  1NJI U;  4JUV A;  3CC4 T;  2EYY A;  5J39 A;  5D6X A;  4QQD A;  2KXD A;  3OSS C;  4PLI A;  2KRS A;  1W4S A;  4WF2 A;  1ZQ1 A;  5IT9 E;  1QVG P;  3MEV A;  2LT4 A;  3TSW A;  2XG8 D;  1I1J A;  3CCS Q;  3JSC A;  2YT6 A;  1X75 C;  3JCM Q;  5D7U A;  1B34 B;  3JCM W;  1K73 R;  3SHW A;  2XU8 A;  3OW2 A;  2ZPF B;  1WJQ A;  2VAS A;  4M78 E;  1KJW A;  3JCM e;  2OTJ Q;  4QVD A;  4DBQ A;  3BY7 A;  2BUD A;  3KUF A;  2FL7 A;  1PD0 A;  2C0I A;  6AT1 B;  1E6G A;  2VXF A;  4UC4 A;  2BZ8 A;  4JDS A;  2YLB A;  4ZGJ B;  1G2B A;  3VRZ A;  1RAI B;  2WSF E;  3CME A;  1BYM A;  2DFU A;  2DIL A;  2P4R A;  2GQV A;  1TSF A;  1UGV A;  3IQL A;  3G4S Q;  4RCB A;  1V29 B;  2CZ6 B;  2DMO A;  3OYD A;  1BIB A;  2YDL A;  1AWW A;  2MYS A;  2DA9 A;  1CKA A;  4JRP A;  1VYT A;  3GOX A;  1K9M C;  5CKD A;  1AZG B;  1D1C A;  3CCM T;  2DO3 A;  3CD6 Q;  4CC2 A;  1RI0 A;  2QA4 A;  1FMK A;  1KQS A;  3QUI A;  1SSF A;  5KYU B;  1PHT A;  2HNI A;  4C8Q F;  8ATC B;  4LNP A;  1WJS A;  4EMH A;  1K9M U;  4XK8 E;  2CT4 A;  3M0S A;  4EMK C;  3I5S A;  4HVU A;  2DVJ A;  3M4Y A;  4QVZ A;  2F2V A;  4N0A A;  4RTZ A;  3QHS A;  2YXY A;  1WLP B;  2CP6 A;  2E5K A;  4PFZ A;  3SFM A;  3QKJ A;  2V1R A;  3CBO A;  4C8Q G;  5GAO n;  3NGP A;  3H41 A;  2ZGW A;  2IIM A;  3ZEH A;  1F1B B;  1IRE B;  4QT7 A;  4E6R A;  3X25 B;  1YHQ Q;  2EGC A;  4DEY A;  3E19 A;  1LPL A;  2DIG A;  1T3L A;  1KD1 U;  2J06 A;  3P8B B;  2COY A;  3CCR T;  4WTO B;  3NMZ C;  1QW1 A;  1I81 A;  3I35 A;  2HQH A;  2CSQ A;  3MKD A;  3V8L A;  4JJC A;  3CCM A;  3G71 T;  5KYX B;  2K4Y A;  1Q81 R;  2KI7 A;  1QVF S;  3M0U A;  1C0M A;  1WHK A;  1OEB A;  1AZE A;  3FDR A;  1ZSZ B;  2V1Q A;  2RI3 A;  2YRD A;  4MDX A;  1HXD A;  4M77 F;  3PT9 A;  5LJ5 h;  3VJP A;  4Z02 A;  1GFD A;  5EC7 A;  4DBR A;  3H8Z A;  1GL5 A;  1VQK Q;  1AHJ B;  1FYN A;  5KCH A;  4BAC A;  3M53 A;  3HSB A;  1GCQ C;  5A0D A;  4LXC A;  5FRO A;  1M1K C;  4RTX A;  4KGZ B;  1M8M A;  2FG0 A;  3L42 A;  1JRI A;  4FCY A;  2KK4 A;  1YI2 T;  3R6O A;  1W2B S;  4OB1 B;  3RBB B;  4MZT A;  2JM8 A;  3JB9 I;  2BIV A;  2D9T A;  2DIQ A;  1JJ2 S;  3UAT A;  1WDX A;  1VQN T;  2QQS A;  5HCK A;  3JB9 D;  1UGP B;  3QZ5 B;  1KK7 A;  1M2V A;  4M75 E;  2DF6 A;  3JB9 G;  1LOJ A;  3JCM f;  3CBP A;  1KSW A;  1YJW A;  2CP2 A;  1PM3 A;  5HK3 A;  2QI2 A;  1M3A A;  3CCU A;  2P84 A;  2YRV A;  2M0O A;  2E6N A;  1G5V A;  4HCK A;  5DLQ E;  1VQ9 Q;  4V2S A;  3G71 A;  3OMG A;  2KQW A;  4C92 F;  4FT2 A;  2X4W A;  2RM4 A;  3RDV A;  5L23 A;  2DL3 A;  5CKH A;  4M78 B;  5KYN A;  3G7Z A;  4C0F A;  4BI4 A;  1TUD A;  1Q82 U;  3RKX A;  5GAN h;  4KGV B;  3EGX B;  1G3S A;  3GF5 A;  5CIU A;  2C0O A;  1MV3 A;  2DRK A;  3OS2 A;  1BU1 A;  3QXE B;  2DZ9 A;  1XJW B;  4C5H A;  1BCM A;  2KNB B;  3OS5 A;  3HPW A;  4P5N A;  1WXT A;  4KH1 B;  1B3Q A;  3VKI A;  1PKT A;  4HCC A;  1YI2 A;  3MEA A;  1AOJ A;  1HSQ A;  1RAH B;  2ZCF B;  1PD1 A;  1RAD B;  1NPP A;  2IG0 A;  5KYY B;  2KT8 A;  2LTO A;  4C8Q A;  2FEI A;  2E64 A;  2J7I A;  3T9N A;  2JTE A;  1VQN A;  2HCK A;  1NEB A;  1RAF B;  4JLI A;  4XU3 A;  4N4H A;  2P0Q A;  3VS6 A;  3G6E T;  4DBF A;  2OJ2 A;  4EMK A;  2CH4 A;  3JCM J;  1QVF A;  2ED0 A;  3U23 A;  3HFN A;  1YIT Q;  4PFO A;  4JRK A;  4LDY A;  3OA6 A;  3HP9 A;  5GJV B;  2EVR A;  4LUE A;  3OYF A;  3BE3 A;  2M9U A;  2RPN A;  4Z8A A;  5LJ5 d;  2DET A;  1M4Z A;  4AMC A;  3VU3 C;  4PLL A;  1R0B G;  5GAM e;  2F2X A;  4MMK A;  2COZ A;  3S3M A;  3CD6 T;  4HCB A;  1GFC A;  1J3T A;  1UHF A;  4ELY C;  1W2B A;  2HQE A;  4C5G A;  5A0L A;  4VUB A;  5C0M A;  2B8A A;  5IAY A;  1JJ2 A;  5KYW B;  2EYQ A;  3PFS A;  3SWN B;  3QII A;  2ABL A;  3OYJ A;  2FPF A;  4LDV A;  2FYK A;  3M59 A;  4OMN A;  5HKC A;  3V7C A;  1WYX A;  4M78 C;  3V7S A;  2X9H A;  2EJG A;  4JPB W;  4Q5W A;  2ESW A;  3G1J A;  4F7U G;  1Q86 C;  1M90 C;  1M2O A;  3I56 Q;  1YHQ T;  2JXB A;  1KFZ A;  3A5Z B;  4XTW A;  2LCS A;  5GAM j;  4JS4 A;  1E7O A;  3CC4 Q;  4C8Q E;  1UHC A;  3VS1 A;  3M55 A;  1KC8 R;  3X28 B;  4HVW A;  1GCQ A;  1Q86 U;  3L2Z A;  1M90 U;  3G4S A;  2KDS A;  4M78 D;  3HHT B;  2M0Y A;  2E65 A;  1VQL T;  4M78 G;  1VQO Q;  2HKQ B;  3THK A;  2RK1 A;  3ASK A;  1M9S A;  2DTO A;  1OYX A;  2LNV A;  3CD6 A;  5KYU A;  4OB0 B;  2XID A;  1GRI A;  3PMI A;  4OB2 B;  3EG0 A;  4EMG A;  2D8H A;  4KRT A;  3C95 A;  3I55 Q;  3RKY A;  4OP0 A;  2XIC A;  3JCM V;  2HMA A;  4BE0 A;  4M75 B;  2RNA A;  2JW4 A;  1E6H A;  2QQB A;  1Q7Y R;  2JTM A;  4Z88 A;  2KEA A;  2DER A;  1OPL A;  1O75 A;  4PJJ A;  5LJ3 e;  3MCA B;  2RQW A;  2QG9 B;  4DEX A;  2RJD A;  3CCM Q;  1JU5 C;  1YHQ A;  2CSI A;  3FLG A;  3H0I A;  2LNH B;  4A54 A;  4OMF B;  1SHF A;  4IUU A;  1ZSG A;  1UGQ B;  3SWN C;  1TS9 A;  4M77 E;  3C12 A;  4HKE A;  3S3N A;  2RD1 A;  4EDU A;  1VQM Q;  2GTO A;  2EQU A;  1N6A A;  1PKS A;  4Y91 A;  4CC4 B;  4IUQ A;  2SEM A;  2KRO A;  2CP3 A;  2HQX A;  1SSH A;  1VQ9 T;  4BDZ A;  2RHX A;  2CP5 A;  1SEM A;  2X3X D;  3GBQ A;  5GAN 7;  1WA7 A;  1SG5 A;  2D8J A;  2PVD B;  1CSK A;  3LH0 A;  4NOY A;  2K5F A;  3RIR A;  4JRQ A;  5LJ3 j;  2JN0 A;  4CI0 C;  1OUL A;  3LW5 E;  2O9S A;  1EIF A;  2QK0 A;  8AT1 B;  1KHI A;  2DL4 A;  4J83 A;  1NJI R;  4O6J A;  1SRL A;  1Y96 A;  3MEU A;  1VQ8 T;  1W70 A;  3CCR Q;  3NTI A;  4CRI A;  1M2V B;  4FYY B;  1PSE A;  3A98 A;  2V8J A;  1I4K 1;  2PNI A;  3QYH B;  2CP0 A;  4K11 A;  3AHU A;  3VS5 A;  2GF7 A;  2R58 A;  3G71 Q;  3CC7 Q;  4C0D B;  1UUE A;  1TG0 A;  1XNI A;  3TVT A;  3S6W A;  4M75 C;  3EG3 A;  4F7U A;  5LJ5 f;  4J5Y A;  4KBM B;  4RUG A;  5IH2 A;  4M4Z A;  2KE9 A;  2LDM A;  4HA8 A;  2HBW A;  2L5Q A;  2H8H A;  1Z9Q A;  4IUP A;  1YIT T;  4FM4 B;  3PTA A;  2CGH A;  2JM9 A;  1VQ9 A;  4FIB A;  2RH2 A;  4NS5 A;  4M78 A;  4M75 D;  1YI2 Q;  2ECZ A;  4XTZ A;  5DLO A;  4M75 G;  4PJN A;  2EJF A;  2J6K A;  2XD0 A;  2LZ6 B;  3CXC P;  2AKL A;  2E1H A;  2JTF A;  3SDZ A;  4A4K A;  4C8Q B;  1VQN Q;  2YUP A;  5GAN 3;  1V1C A;  1VYU A;  2XI9 A;  2CH4 W;  2K5L A;  1PG5 B;  2NUP B;  3GP8 A;  2DEU A;  1SPK A;  2E4H A;  3NTH A;  1HK9 A;  2O4X B;  1ARK A;  1OOT A;  3CCQ Q;  4N4G A;  1WHJ A;  1ZA1 B;  5GAN f;  3FC3 A;  2KGT A;  2EQJ A;  4J9B A;  1ACM B;  4PJO F;  3HRU A;  4FL6 A;  1D3B B;  4A63 B;  2LJ3 A;  2NUZ A;  2PUK B;  2EW3 A;  1YP5 A;  4RTU A;  2LC4 A;  1GBQ A;  1YIT A;  4AFQ C;  2D1X A;  4F7U E;  1QWE A;  1U5S A;  1O9S A;  1KD1 R;  2CZ0 B;  1QCO A;  1VQO T;  2DE0 X;  1NZ9 A;  4C0D C;  3EHQ A;  2JOY A;  2DBK A;  3VUB A;  1M8V A;  1BB9 A;  1N8R C;  2EIF A;  3RUX A;  2YLC A;  4FYX B;  2Y4Y A;  2LRQ A;  1AEY A;  3I55 T;  5GAN 5;  3NHN A;  1QCN A;  1DJ7 B;  1BI0 A;  3FEO A;  5KYW A;  2JNG A;  1H8K A;  1U8R A;  1OX8 A;  4M77 B;  3SWN A;  5GAM g;  3G6E Q;  2K3Y A;  3A8G B;  4ORZ A;  3HFO A;  3GIB A;  2MI6 A;  1UEC A;  2HL3 A;  3OS0 A;  2L89 A;  1YCS B;  2X3W D;  2XDB A;  2JMC A;  3I9Q A;  2PZ1 A;  3I56 A;  1K8A C;  1LNX A;  4C8Q C;  3PVQ A;  3CC4 A;  2MWP A;  2DJZ A;  4FU6 A;  3EG9 B;  3GLX A;  1XTD A;  1K8A U;  4LDX A;  1VQM T;  3QSU A;  2LCL A;  3QDF A;  2AHJ B;  2BE7 D;  3EG1 A;  1VQO A;  3OYC A;  2JS2 A;  2LP5 A;  2AZS A;  2C06 A;  4QVC A;  1W1F A;  2VGN A;  3KBG A;  3S3O A;  2KYB A;  4C8Q D;  1FXX A;  4B9X A;  1UEB A;  3A8O B;  2LMJ A;  2KSS A;  3I55 A;  1P92 A;  2EGA A;  4F17 A;  4BE1 A;  2BZX A;  4M75 A;  1VQ7 T;  3J80 E;  1X6B A;  2AIR B;  2ZZD A;  2XK0 A;  2ATC B;  1VQP Q;  1QWF A;  3QZ9 B;  3A8H B;  1Q82 R;  1BI3 A;  1TUC A;  1BIA A;  2P4T A;  2A28 A;  4AFU C;  1PSF A;  1KQS P;  3CCE Q;  1ZBX A;  2HKN A;  5CKF A;  1MHN A;  1VQL Q;  2RHU A;  1RAC B;  2KBT A;  3BFM A;  2CZ7 B;  2K2M A;  2J6F A;  2RO0 A;  1C6V X;  2MK5 A;  1OZ2 A;  1TH7 A;  3CC7 T;  1K73 C;  1M1F A;  3EGD B;  1VIF A;  5GMK h;  2O88 A;  4M77 C;  1JB0 E;  3FIF A;  4EIK A;  4ZN3 A;  4GY5 A;  5A0G A;  1N9S A;  3DB4 A;  5KCO A;  3UF4 A;  1QVP A;  1VOM A;  1PNJ A;  1VQM A;  5I2M A;  1NG2 A;  5LJ3 g;  3GPL A;  4FT4 A;  5CQY A;  3OBW A;  4QW2 A;  3P8H A;  2K6D A;  3OQ5 A;  4OF1 A;  3OSV A;  2J05 A;  4RKU E;  4O5V A;  1UFF A;  3FB9 A;  1IB8 A;  2QAS A;  1NLO C;  5KE3 A;  3URG A;  3M5A A;  1Y96 B;  2YWW A;  2ZPI B;  3RMQ A;  4M77 D;  1LCK A;  1JQQ A;  2EAY A;  2EWN A;  1UGR B;  1VQ7 A;  4IUR A;  4EPC A;  4M77 G;  2QEX T;  4J6Y A;  1PC0 A;  1M1K U;  2MAM A;  3REB B;  1AT1 B;  1D0Y A;  2NYS A;  3WVE B;  4MML A;  3QJ6 A;  1Y57 A;  2L8D A;  2DYI A;  4F7U B;  3CCR A;  4XU1 A;  2EKH A;  4C92 C;  2KMT A;  3REA B;  4X9C A;  3E1S A;  2K2V A;  3CC7 A;  1BKB A;  3CCQ T;  2DD5 A;  1WIE A;  2BE9 B;  1UE9 A;  2OI3 A;  1ZBJ A;  1NE8 A;  3LGF A;  3DLM A;  1S1N A;  1SHG A;  1IRX A;  2QQ9 A;  4PNO A;  3H0H A;  1N9R A;  5FRM A;  2FZC B;  4PK4 A;  5GAO q;  2KRM A;  2P0P A;  4ME7 A;  3M0Q A;  3RKW A;  3CCV Q;  2VWF A;  1KHC A;  1TU0 B;  4MZP A;  1HYO A;  1IXD A;  3O8V A;  1MUZ A;  4JRI A;  1Y7X A;  4C92 G;  2DK3 A;  4NL2 A;  1YCY A;  5CVI A;  2ZPB B;  4PJM A;  1VQ8 Q;  1I5O B;  1RAB B;  1M90 R;  2PU9 B;  5KH6 A;  1X27 A;  1WXU A;  2QAZ A;  4OGE A;  2OTL Q;  1VIE A;  1H64 1;  3TQ7 P;  3VS3 A;  2QEX A;  5FWB A;  5M9O A;  2K9G A;  4J9G A;  3PNW C;  3OMC A;  2HZY A;  4WCI A;  1Q81 C;  1OU8 A;  2KVQ G;  2E6Z A;  3JV3 A;  3WVD B;  4LE9 A;  1KIK A;  2QYZ A;  3N5B B;  7AT1 B;  2ZPE B;  1FMW A;  3VS2 A;  1UB4 A;  2NUP A;  4BDY A;  2A3L A;  3E2U A;  2CUD A;  1K0S A;  1Q81 U;  5EG2 A;  2KAF A;  4M7D F;  1U3O A;  1OU9 A;  2RHY A;  2O4X A;  1V76 A;  1TXQ A;  2GQI A;  2R5M A;  1MMD A;  5GAO p;  1YWP A;  4HCZ A;  4ZGE B;  3CCQ A;  4RCC A;  3OY9 A;  2E10 A;  5CKB A;  5GAO l;  1D3B A;  1LVK A;  1M3C A;  2LJ0 A;  2X4J A;  2JVV A;  1YJN T;  1BCO A;  5FLX E;  2CUB A;  1D1B A;  1H92 A;  2DJQ A;  1AVZ C;  3OYB A;  3JB9 J;  2LJ1 A;  4IKF A;  2MF2 A;  1K76 A;  4GLM A;  4RG8 A;  5IN1 A;  2IVW A;  2YRC A;  1BI1 A;  4XTV A;  5GMK e;  3M0P A;  4LDW A;  5HY6 A;  2QQA A;  2X35 A;  2MIO A;  1G83 A;  3O5Z A;  5LJ5 e;  3CBM A;  2X51 A;  1QVF P;  1IHV A;  2AZV A;  1ZUK A;  3PE0 A;  1NLP C;  2YUN A;  3L1A A;  1D1A A;  2GFU A;  4M77 A;  1K1Z A;  2CZ1 B;  1AWX A;  2DXT A;  2FVU A;  1VQP T;  2QTX A;  3G6E A;  1WHM A;  4ZGD B;  1A0N B;  2ROT A;  5FU6 C;  5I22 A;  3M57 A;  1K0X A;  1X2K A;  2AK5 A;  3CCE T;  2L3Q A;  3JCM g;  2ED1 A;  4ZNX A;  2L3P A;  5GAN d;  2XHC A;  2PQW A;  5D6Y A;  1RI9 A;  4M7A F;  3VUZ A;  2EQM A;  3A8L B;  2NUT B;  3CXC S;  3EG9 A;  1N27 A;  4LUD A;  4LDU A;  1VQ4 T;  5LJ5 j;  1QKX A;  3JCM P;  2Y4X A;  1UG1 A;  3OYN A;  3OYM A;  1Y0M A;  1IO6 A;  4D6W A;  3VV0 A;  4C92 A;  5DM7 R;  4J9I A;  2RQR A;  1MMA A;  5GAN e;  4HT8 A;  2O9V A;  2DM1 A;  2CT3 A;  2K3X A;  4BY6 B;  3LWI A;  1ABO A;  3F70 A;  1D0X A;  5DY9 A;  3H6Z A;  3M54 A;  1I07 A;  2KRN A;  1VQP A;  3CMA T;  5IXF A;  1X43 A;  5D6W A;  4C0Z A;  2KYM A;  2HD0 A;  2BKD N;  1QVG S;  3CCE A;  5GAN 4;  3UA7 A;  1JBM A;  4RTV A;  1WHH A;  2GFA A;  3QYG B;  3M0T A;  3BDU A;  4E7J A;  1VQL A;  3SB2 A;  3EGD A;  2LQK A;  3OYI A;  1T0J A;  2HBP A;  2HAX A;  3TSZ A;  3MO8 A;  1W6X A;  1K9A A;  5GAN j;  3HRS A;  1JXM A;  1VQ7 Q;  1N5Z A;  1H3Z A;  2HSE B;  1D09 B;  5FW9 A;  2E3I A;  2H3E B;  2DL8 A;  2F5K A;  2DBM A;  3CCV T;  1RLQ C;  1KC8 C;  3L2V A;  4L5G A;  4B9W A;  4F16 A;  1B7T A;  3LH5 A;  1NM7 A;  2D0Q B;  5GMK i;  1Y07 A;  3CPF A;  4DQ2 A;  2RB6 A;  4RTY A;  1SKU B;  1TOV A;  2OTL T;  2ROL A;  2AT1 B;  2QTV A;  4A4F A;  1MNE A;  1VQ5 T;  5CKE A;  4C92 E;  4IIM A;  3RNJ A;  2IPO B;  4C0G A;  2YUQ A;  1TUG B;  2ZPH B;  4LN2 A;  4R56 A;  4JJD A;  4A4G A;  1PWT A;  1U1T A;  3CXC A;  1VQ6 Q;  2F1L A;  1FX7 A;  2W10 A;  4AG2 C;  2MOX A;  5A2Q E;  3CC2 T;  1XQH A;  4BY6 C;  3ME9 A;  2YUO A;  1ZLM A;  3HTR A;  3QJY A;  1Q7Y C;  3UA6 A;  4J9H A;  3GNG A;  2MPX C;  2G6F X;  2DAQ A;  1NBE B;  1PRL C;  3CEY A;  3FJ5 A;  3TEE A;  2QEX Q;  1Q7Y U;  2HDA A;  3CCL T;  1I8F A;  4MZM A;  3EFS A;  4E2F B;  3OYK A;  3OYY A;  2YSQ A;  1YFN A;  3CCV A;  2X4X A;  1WI7 A;  2RQU A;  2LT1 A;  2M1H A;  1VQ8 A;  3EG2 A;  2VC8 A;  1K9M R;  3VYH B;  1Q95 G;  4E7H A;  4M7A A;  1M3B A;  3LLR A;  1QLY A;  4JZ3 A;  2GCX A;  2DNU A;  2OTL A;  1QVG A;  3D7S B;  1XOV A;  2OAW A;  4PJO C;  5IHK A;  5FU7 B;  4QQ6 A;  2DL5 A;  1G3T A;  3CPW P;  2RI5 A;  4PJL A;  1SRM A;  5L8R E;  4HXJ A;  2DTI A;  1FMV A;  5CO7 A;  2VV5 A;  2F2W A;  1NJI C;  1NEG A;  2HSP A;  4BI8 B;  2RA2 A;  3VRY A;  5J26 A;  4A4H A;  2RQT A;  2OAU A;  4ESR A;  1ZUY A;  1QP3 A;  4II1 A;  4PJO G;  2QA4 T;  1D0Z A;  4TVR A;  1QKW A;  3CCL A;  4XU0 A;  2RK2 A;  2QGF B;  4E7I A;  3MP8 A;  1UJY A;  3A1P A;  4RG2 A;  1YIJ T;  4OML A;  3GNF B;  2D6F A;  1YBY A;  2O31 A;  2PVO B;  4OB3 B;  3BW1 A;  1N8R U;  2FHD A;  5J3B A;  2QGG A;  4E7Z A;  3C94 A;  1KG1 A;  3M58 A;  2E5Q A;  1G3W A;  1VUB A;  4KH0 B;  2JZ2 A;  4XTU A;  2V26 A;  3H9N A;  2DZC A;  3TRE A;  1ZX6 A;  1EX4 A;  1U1S A;  4IUV A;  5ECA A;  4JZ4 A;  2H3J A;  2HL5 C;  2GGR A;  4M7A E;  1YJN Q;  1TTH B;  4PKC C;  2EYX A;  2EYZ A;  3MET A;  4R0K A;  1M1K R;  2KR3 A;  5LJ5 g;  2FB7 A;  3MHX A;  4DA4 A;  4BE2 A;  1IZ6 A;  3JAM E;  3OW2 P;  3CCJ T;  3C4S A;  3JCM X;  5CR2 A;  2LQ8 A;  1QP2 A;  4KGX B;  4L6V 5;  4LD9 K;  5FU7 C;  1AWJ A;  2WSE E;  2ZAE A;  1IGQ A;  1WJR A;  2NUT A;  2F69 A;  2FPD A;  1B07 A;  3JB9 H;  2NWM A;  2LVM A;  4JJB A;  4BD3 A;  4C92 B;  4XTY A;  1WPY A;  1YIJ A;  4OGC A;  1BBZ A;  4E47 A;  2RF0 A;  4BB7 A;  4GLK A;  2E12 A;  2DLP A;  4AFS C;  3PGG A;  1WZO A;  2ZPG B;  4LD6 A;  2A0F B;  1UTI A;  3HRT A;  3QPH A;  2JJ9 A;  2R57 A;  1SF9 A;  2JS0 A;  2Y90 A;  1KD1 C;  2RN8 A;  1WQW A;  3OB9 A;  3M56 A;  2EPD A;  1QQJ A;  2B86 A;  1WXB A;  2KT1 A;  2EFI A;  2LQN A;  1QMC A;  2RJC A;  4DOV A;  5GMK l;  1I0C A;  3RES A;  5GAM h;  4R55 A;  1M1G A;  1VQ4 Q;  3V8J A;  5GAN g;  1YJW T;  1VQ6 T;  3CCU T;  3QDR B;  5GAN 2;  1K73 U;  3CCJ A;  2BZY A;  2P0K A;  3VYG A;  2L3S A;  1UDL A;  1IHW A;  4M7D B;  1YN8 A;  2C0T A;  4J7F A;  1EFN A;  4RMO A;  3VS7 A;  3JCM b;  3OS1 A;  2LQW A;  1WQ7 A;  4IIO A;  1VA7 A;  3R6N A;  3DB3 A;  4PJO A;  1C1A A;  3KFV A;  2CP7 A;  2QDL A;  3E9G A;  4KUL A;  2RI2 A;  2HEQ A;  2VVK A;  4JLG A;  3CMA Q;  1MGQ A;  3UWN A;  4D8D A;  1M5Q 1;  2QDY B;  3JB9 F;  1RL2 A;  4B6M A;  2J6O A;  3X20 B;  1S72 Q;  2M51 A;  3H0F A;  1WHG A;  1RAA B;  5CAI A;  2EBP A;  3TU4 K;  2I0N A;  3INZ A;  4OMO A;  5GJW B;  5HK0 A;  3UPU A;  2K3B A;  4QQG A;  2K7A A;  1AD5 A;  3ZL7 C;  4OMQ A;  5IXB A;  2FZK B;  2DXU A;  3C0C A;  1MND A;  3EFO A;  1VQ6 A;  4Y92 A;  1YJ9 Q;  1Q82 C;  4C5E A;  4F14 A;  1K4U S;  4C92 D;  1OQK A;  3EAE A;  2QQR A;  2RHZ A;  1KQ2 A;  2COW A;  4AFZ C;  4OVA A;  1Q86 R;  5FU6 B;  2SRC A;  5IHI A;  3FJP A;  4JS5 A;  4M7A B;  1JXO A;  4OMM A;  2F5T X;  1VQ5 Q;  2E70 A;  4MDW A;  3WXM B;  5LJ3 h;  2A08 A;  1KQ1 A;  5I2S A;  4BI3 A;  1RAE B;  2DX1 A;  2DKG A;  4PJO E;  3EGU A;  4M7D C;  3CCS T;  2DL7 A;  5CK9 A;  4Z89 A;  4X34 A;  1YWO A;  3HKS A;  3CC2 Q;  3MP1 A;  4D8K A;  2O2O A;  1ZSZ C;  5GAM d;  1NYF A;  4ATO A;  2OTJ T;  2FO0 A;  4KUD K;  3X26 B;  2E3H A;  2FRW A;  2QXF A;  5GAN 6;  4PFP A;  4KT0 E;  4IUT A;  1MV0 B;  4HT9 A;  3P8D A;  2KXC A;  1T0H A;  2X4Y A;  3TCJ A;  4M7D D;  2Z0W A;  4ZN1 A;  3CCL Q;  4J7I A;  4M7D G;  3G4S T;  1OZ3 A;  3EFR A;  3I5R A;  4J6X A;  2EQI A;  3LWH A;  2VGM A;  1AWO A;  4CC7 A;  3OYE A;  2K5I A;  2DPP B;  2R5A A;  2MWO A;  3MJX A;  2DTH A;  4XAX B;  4FSS A;  3EH1 A;  3NTK A;  2EKO A;  4YTL A;  4J9C A;  1R0C B;  4Y28 E;  5I11 A;  4F7U F;  2LCC A;  2BTT A;  1OV3 A;  3L2Q A;  1U06 A;  1WX6 A;  3CCS A;  4A4E A;  4BUG A;  1B34 A;  4PL6 A;  1X6G A;  3CME Q;  2GBQ A;  1MMN A;  4E7S A;  1ABQ A;  3QBY A;  2AKK A;  3ZBD A;  1G8X A;  2OTJ A;  4M78 F;  4M7A C;  1BI2 A;  1OPK A;  3E9F A;  5GMK m;  1YNZ A;  2PVG B;  3M0R A;  1W2B P;  4J9D A;  2RMO A;  2QA4 Q;  1YJN A;  3PVL A;  1UGS B;  3QG1 A;  5GMK j;  3EH2 A;  4E7K A;  1QCF A;  1JO8 A;  1JJ2 P;  5CCA A;  4J8O A;  2FRY A;  5FWC A;  3Q1J A;  1HD3 A;  4RTW A;  4X1V A;  2DD4 A;  3MEW A;  2DEQ A;  3NFC A;  3PIO A;  3KXT A;  1YIJ Q;  1EZZ B;  1BK2 A;  5CQX A;  2E41 A;  1R77 A;  2XKO C;  4ZTJ A;  2KY9 A;  3ZFJ A;  4M7A D;  2V8K A;  3HL8 A;  2XMF A;  4ELZ C;  1PCX A;  4M7A G;  5LJ3 d;  5FRN A;  2CDT A;  3L2U A;  2M16 A;  2RJF A;  3A8M B;  4F04 B;  2DYB A;  1HJD A;  3CPW S;  3LGL A;  1Y71 A;  4NL3 A;  1ZHI A;  2NLU A;  2JUF A;  3V7R A;  1VQK T;  2FZG B;  2A37 A;  2XDD A;  3SEM A;  2CYZ B;  2O01 E;  3DKM A;  3X24 B;  4A53 A;  3QWY A;  3OYH A;  3PMT A;  1X6O A;  1S72 T;  4JJN K;  3CCJ Q;  2W0Z A;  1T3S A;  2LX7 A;  3NPF A;  3QO3 A;  4AG1 C;  5KE2 A;  1ZA2 B;  4XTX A;  3OYA A;  2D0N A;  1GBR A;  2DVE A;  3VS0 A;  1WNL A;  3MPU B;  2DXB A;  4HVV A;  4FYW B;  1WHL A;  4L59 A;  4GBQ A;  1RLP C;  2VXE A;  1VQ4 A;  3M9Q A;  1WFW A;  4PJO B;  2RQV A;  2I2L A;  3QWX X;  5IHN A;  2YHT A;  3JCM h;  3LYI A;  4M7D A;  1LJO A;  1YJ9 T;  3ULR B;  5KYX A;  1GCP A;  4C5I A;  2CRE A;  2VKN A;  1X69 A;  5LL6 S;  4ZTF A;  1ZSZ A;  3OYG A;  1UJ0 A;  2OX7 A;  2A7Y A;  2EQK A;  1ZUU A;  5I21 A;  1CKB A;  1KC8 U;  1X01 A;  3ER0 A;  5GAM f;  4DOW A;  2DRM A;  1VQK A;  1GXI E;  1NYG A;  1X2Q A;  2WSC E;  3CQT A;  3J81 E;  2XDP A;  3CMA A;  2PTK A;  2MMP A;  3AT1 B;  1YJW Q;  2WAC A;  1WGS A;  2JT4 A;  3OW2 S;  1I5L A;  4N0A C;  1NPR A;  1OI1 A;  3RMS A;  3CCU Q;  1S72 A;  2EGE A;  3FRN A;  4KUI A;  3DLL A;  3EFO B;  2VUB A;  2K79 A;  5GAO m;  1N8R R;  4J9F A; 
#chains in the Genus database with same CATH homology
 4R0K A;  2KR3 A;  4HVW A;  1GCQ A;  1WIE A;  2M0Y A;  1UE9 A;  1Z9Z A;  1ZBJ A;  2OI3 A;  1S1N A;  3THK A;  1SHG A;  2GNC A;  3H0H A;  2EYW A;  1AWJ A;  1GRI A;  2KRM A;  2FPD A;  1B07 A;  2NWM A;  3M0Q A;  2VWF A;  4JJB A;  2L0A A;  3EG0 A;  1MUZ A;  2D8H A;  4KRT A;  1H3H A;  1BBZ A;  2RF0 A;  2MCN A;  1X27 A;  2DLP A;  4AFS C;  2RNA A;  1WXU A;  2JW4 A;  2A36 A;  1M30 A;  3VS3 A;  4CC3 A;  5FWB A;  1M27 C;  2K9G A;  4J9G A;  1E6H A;  1UTI A;  4WCI A;  4Z88 A;  2KEA A;  3JV3 A;  1OPL A;  4LE9 A;  1KIK A;  2JS0 A;  1JEG A;  2RN8 A;  1RUW A;  2RQW A;  2EPD A;  2ENM A;  2B86 A;  3VS2 A;  4RTT A;  1WXB A;  4OMP A;  4DEX A;  2KT1 A;  3EHR A;  2CUD A;  1JU5 C;  1K0S A;  2CSI A;  2LQN A;  3H0I A;  2LNH B;  1U3O A;  1VYV A;  1SHF A;  2GQI A;  1I0C A;  2L2P A;  4J9E A;  1PRM C;  2JMA A;  1YWP A;  2GTJ A;  1ZSG A;  3VS4 A;  1M3C A;  2GTO A;  2LJ0 A;  1PKS A;  2BZY A;  2FPE A;  4CC4 B;  2CUB A;  1H92 A;  2SEM A;  2DJQ A;  2L3S A;  1AVZ C;  2KRO A;  1UDL A;  1SSH A;  2EYY A;  1YN8 A;  2LJ1 A;  2C0T A;  1EFN A;  1SEM A;  2KXD A;  2X3X D;  1K76 A;  4GLM A;  3VS7 A;  3GBQ A;  2KRS A;  1WA7 A;  2LQW A;  4IIO A;  2D8J A;  1VA7 A;  3R6N A;  1CSK A;  3TSW A;  3KFV A;  2QDL A;  1I1J A;  3M0P A;  2YT6 A;  2HEQ A;  2O9S A;  2VVK A;  2MIO A;  1G83 A;  3O5Z A;  3SHW A;  2DL4 A;  1SRL A;  4D8D A;  1KJW A;  2AZV A;  1ZUK A;  3PE0 A;  1NLP C;  2YUN A;  1W70 A;  2J6O A;  1K1Z A;  3A98 A;  2C0I A;  1AWX A;  2M51 A;  1E6G A;  2PNI A;  3H0F A;  2BZ8 A;  4K11 A;  1G2B A;  2EBP A;  3VRZ A;  2I0N A;  3VS5 A;  1A0N B;  4OMO A;  5GJW B;  1UUE A;  2DIL A;  2K3B A;  2P4R A;  2ROT A;  5I22 A;  3IQL A;  1TG0 A;  1UGV A;  3TVT A;  1K0X A;  1X2K A;  3EG3 A;  2K7A A;  2AK5 A;  2DMO A;  1AD5 A;  2L3Q A;  2YDL A;  3ZL7 C;  2ED1 A;  4ZNX A;  4RUG A;  4OMQ A;  1AWW A;  5IH2 A;  4M4Z A;  2DA9 A;  2KE9 A;  5IXB A;  1CKA A;  2L3P A;  1VYT A;  2HBW A;  3C0C A;  1AZG B;  2H8H A;  1RI9 A;  1Z9Q A;  4CC2 A;  4Y92 A;  1FMK A;  2JM9 A;  1PHT A;  4F14 A;  1K4U S;  4LUD A;  4LNP A;  1QKX A;  2CT4 A;  4AFZ C;  3M0S A;  1UG1 A;  3I5S A;  2ECZ A;  4HVU A;  2SRC A;  5IHI A;  2DVJ A;  1Y0M A;  2J6K A;  1IO6 A;  1JXO A;  2F2V A;  4OMM A;  4RTZ A;  1WLP B;  2LZ6 B;  2AKL A;  2E5K A;  4J9I A;  2A08 A;  2RQR A;  2O9V A;  2YUP A;  2DM1 A;  2V1R A;  2DX1 A;  2CT3 A;  3NGP A;  3EGU A;  1ABO A;  3H41 A;  1V1C A;  2IIM A;  2DL7 A;  1VYU A;  4QT7 A;  4E6R A;  4Z89 A;  2CH4 W;  2EGC A;  4DEY A;  1YWO A;  1I07 A;  4D8K A;  2O2O A;  2KRN A;  5IXF A;  1T3L A;  1X43 A;  1NYF A;  1SPK A;  1ARK A;  2FO0 A;  1OOT A;  2J06 A;  2KYM A;  2FRW A;  3NMZ C;  2KGT A;  4J9B A;  3I35 A;  3UA7 A;  4RTV A;  1MV0 B;  3M0T A;  4A63 B;  2CSQ A;  2KXC A;  2LJ3 A;  2NUZ A;  1T0H A;  2EW3 A;  4JJC A;  1YP5 A;  4RTU A;  1GBQ A;  4AFQ C;  2D1X A;  1T0J A;  3TSZ A;  3M0U A;  3I5R A;  1OEB A;  1AZE A;  1QWE A;  1W6X A;  2EQI A;  1AWO A;  1K9A A;  2V1Q A;  1U5S A;  4CC7 A;  1JXM A;  2DE0 X;  1N5Z A;  1GFD A;  5EC7 A;  3EHQ A;  5FW9 A;  2DBK A;  2DL8 A;  1GL5 A;  1FYN A;  1GCQ C;  2DBM A;  1BB9 A;  4FSS A;  1RLQ C;  4F16 A;  4RTX A;  3LH5 A;  1AEY A;  1NM7 A;  4J9C A;  5I11 A;  1M8M A;  3NHN A;  2FG0 A;  2BTT A;  1OV3 A;  1U06 A;  1H8K A;  1WX6 A;  4RTY A;  3RBB B;  2JM8 A;  2ROL A;  1X6G A;  2GBQ A;  4ORZ A;  4IIM A;  3RNJ A;  1ABQ A;  3UAT A;  1WDX A;  2AKK A;  2YUQ A;  5HCK A;  1UEC A;  4LN2 A;  1OPK A;  2DF6 A;  1KSW A;  1YCS B;  1YNZ A;  4JJD A;  2X3W D;  3M0R A;  2JMC A;  1PWT A;  3I9Q A;  4J9D A;  2W10 A;  1M3A A;  2PZ1 A;  2RMO A;  4AG2 C;  2MOX A;  3PVL A;  1QCF A;  3PVQ A;  1JO8 A;  4HCK A;  2YUO A;  1ZLM A;  2FRY A;  5FWC A;  1HD3 A;  4RTW A;  4X1V A;  3UA6 A;  5L23 A;  2DL3 A;  4J9H A;  1BK2 A;  2G6F X;  1TUD A;  3EG1 A;  1PRL C;  3FJ5 A;  2JS2 A;  2LP5 A;  2AZS A;  2XMF A;  2HDA A;  2C0O A;  1MV3 A;  1W1F A;  2DRK A;  1BU1 A;  2YSQ A;  2KYB A;  2CDT A;  2KNB B;  1WI7 A;  2DYB A;  2LMJ A;  2RQU A;  1HJD A;  1WXT A;  2EGA A;  4F17 A;  2BZX A;  3EG2 A;  1B3Q A;  1X6B A;  1PKT A;  1AOJ A;  1HSQ A;  1M3B A;  1QLY A;  1QWF A;  4JZ3 A;  2A37 A;  3SEM A;  2DNU A;  2KT8 A;  1TUC A;  2FEI A;  1XOV A;  2J7I A;  2OAW A;  5IHK A;  2DL5 A;  3QWY A;  2A28 A;  4AFU C;  2JTE A;  2HCK A;  1NEB A;  1SRM A;  3VS6 A;  4HXJ A;  2W0Z A;  1T3S A;  2LX7 A;  2KBT A;  3NPF A;  2K2M A;  2OJ2 A;  4AG1 C;  2J6F A;  2CH4 A;  2ED0 A;  3U23 A;  2F2W A;  2D0N A;  1GBR A;  3VS0 A;  1NEG A;  5GJV B;  2O88 A;  4HVV A;  2EVR A;  4LUE A;  4EIK A;  2HSP A;  4GBQ A;  1RLP C;  3VRY A;  2RQT A;  2RPN A;  1WFW A;  4Z8A A;  3UF4 A;  1ZUY A;  4ESR A;  1PNJ A;  2RQV A;  3QWX X;  1NG2 A;  2F2X A;  5IHN A;  1GFC A;  2K6D A;  3ULR B;  1J3T A;  1GCP A;  1QKW A;  2J05 A;  2CRE A;  1UFF A;  1UJY A;  1X69 A;  2VKN A;  1UHF A;  1NLO C;  1UJ0 A;  4OML A;  1LCK A;  1JQQ A;  1ZUU A;  2O31 A;  1CKB A;  2ABL A;  2FPF A;  2DRM A;  3REB B;  1NYG A;  4OMN A;  1WYX A;  1X2Q A;  3CQT A;  2PTK A;  4JPB W;  1Y57 A;  1ZX6 A;  2ESW A;  5ECA A;  2JT4 A;  4JZ4 A;  2GGR A;  2JXB A;  2EKH A;  1KFZ A;  2EGE A;  2LCS A;  2EYX A;  3REA B;  1E7O A;  2EYZ A;  2K79 A;  1UHC A;  3VS1 A;  4J9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...