3C0CA

X-ray crystal structure of the rat endophilin a2 sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
PLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the SH3 domain of rat endophilin A2
rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords Endophilin-A2
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3c0cA00
1NLOC 3ZL7C 1KFZA 1I1JA 1CSKA 4LUDA 1I0CA 4RTZA 1UECA 4JZ4A 1PWTA 3H0IA 2JXBA 4J9CA 2LJ0A 2J6OA 4F16A 2YSQA 2EYXA 2OJ2A 2DILA 2SRCA 1WDXA 2BZXA 4Y92A 2FPFA 1M3CA 3O5ZA 4GLMA 1SRMA 2DMOA 3THKA 2FRWA 1M3AA 2RN8A 1WLPB 2J6FA 2W10A 2KROA 2LCSA 5IHIA 2GTOA 4JZ3A 2ENMA 2KE9A 1WXUA 1E7OA 2PNIA 2EYYA 4IIMA 3VS5A 2ED1A 1U3OA 1UDLA 4R0KA 3PE0A 2RQWA 2OI3A 4JJBA 1BK2A 2CH4W 4HXJA 1UJYA 4GBQA 2D0NA 2LZ6B 4K11A 2P4RA 2RQVA 1ZSGA 1SPKA 1U06A 4CC2A 3VS6A 4IIOA 2SEMA 2J06A 4LE9A 1ARKA 1PRMC 2RPNA 4ESRA 2ED0A 4J9EA 3VS1A 3EG1A 2O88A 1E6GA 1CKBA 1SHFA 2K6DA 1H3HA 1QCFA 2JS0A 3RBBB 1NEBA 4RTXA 1AZGB 1QKWA 1JO8A 2D1XA 3I9QA 1Z9QA 2HEQA 1G2BA 1OV3A 2CREA 4J9FA 5GJWB 1ZX6A 2KXCA 4J9DA 1WFWA 2LP5A 3EG0A 2DF6A 2DL4A 4RTWA 2JMCA 1AEYA 1VA7A 2J05A 2RMOA 1W1FA 3UA7A 1NYFA 4A63B 1BBZA 2CUBA 4AFZC 1GCQC 1J3TA 1A0NB 1K1ZA 1AZEA 2CT3A 3NGPA 2LQNA 3EG2A 1TG0A 2DE0X 1LCKA 3SEMA 4AG2C 2KRMA 3SHWA 1X6BA 2O2OA 2KYMA 2JM8A 4F17A 5ECAA 1B07A 1UTIA 3UA6A 3JV3A 1YP5A 3R6NA 2HSPA 2KEAA 4HVUA 1GFCA 3QWXX 1PKSA 2YUPA 4FSSA 4Z89A 2EGEA 2JTEA 2EBPA 1GCQA 4CC4B 1SHGA 2EPDA 2BZYA 1JXMA 3NHNA 1TUCA 1YWPA 4Z88A 2GBQA 2BTTA 1FMKA 2X3WD 2W0ZA 4J9IA 2AK5A 1SEMA 3QWYA 2ROTA 4OMPA 2K2MA 2EGCA 1WXBA 2J6KA 2F2XA 2DX1A 1MUZA 5FW9A 2L0AA 1OPKA 2DA9A 1NEGA 3PVQA 3PVLA 3M0TA 4LNPA 2A37A 1K4US 2O9VA 1W6XA 1TUDA 2DYBA 1QLYA 1K0XA 1UGVA 1NG2A 1E6HA 1UFFA 2CSQA 2YUQA 1K76A 2CDTA 1AWWA 2H8HA 2KRNA 1W70A 2OAWA 2CH4A 1QWFA 3REAB 1T0JA 4ZNXA 2KXDA 2KYBA 2CSIA 1QKXA 1Z9ZA 2L3QA 1GL5A 3TSWA 4CC3A 2DL5A 4KRTA 2BZ8A 1ZBJA 2V1RA 2O31A 4LUEA 1NYGA 1WI7A 1UHFA 2V1QA 2RQRA 2L3SA 5EC7A 2HCKA 4Z8AA 2GQIA 1K0SA 3M0RA 2RQUA 1GRIA 2GGRA 2GNCA 2D8HA 1WIEA 1K9AA 1AD5A 2JM9A 2RF0A 1VYTA 1SRLA 1GBRA 2DLPA 1JQQA 1PNJA 1WYXA 2J7IA 2MIOA 2MCNA 1M27C 3H0HA 3UF4A 2DL8A 2DJQA 3NPFA 1KJWA 4CC7A 3VS7A 2PZ1A 2AZVA 2DBKA 2MOXA 3M0UA 1ABOA 2LMJA 1VYVA 2FPDA 2C0TA 2DRKA 2JT4A 2F2VA 3TSZA 1ZLMA 1Y57A 3CQTA 4JJDA 2B86A 1T3SA 2EVRA 3EG3A 1FYNA 4EIKA 1MV3A 4D8KA 4RTUA 2VKNA 2C0OA 5I22A 1UG1A 4JPBW 1M8MA 4E6RA 2K9GA 3GBQA 1YCSB 2EW3A 2C0IA 2VVKA 4J9BA 1HSQA 1GCPA 2K3BA 3I5RA 4AFSC 4J9GA 1V1CA 2KR3A 3I35A 1MV0B 5HCKA 4HVWA 1RLQC 1PKTA 2DBMA 2CT4A 1VYUA 3TVTA 2EYZA 2EYWA 2NWMA 2X3XD 3REBB 1U5SA 3I5SA 4OMOA 2HBWA 3UATA 2DVJA 5IXBA 2O9SA 3H41A 4J9HA 1PRLC 2YUOA 2KRSA 3RNJA 2K79A 5I11A 1ZUYA 2GTJA 1RI9A 1BU1A 5L23A 4F14A 2EGAA 1Y0MA 1X69A 4DEXA 1OEBA 5IHNA 1YWOA 1I07A 2FRYA 1M30A 3C0CA 1CKAA 1NM7A 2PTKA 2QDLA 1T0HA 2ABLA 2A08A 1UJ0A 3H0FA 4OMMA 2DNUA 1QWEA 5FWBA 4RTTA 4RTYA 2L2PA 2EQIA 2XMFA 4HVVA 2KGTA 1KSWA 2G6FX 3VS0A 5IXFA 2LX7A 1X2KA 2IIMA 4OMNA 2FO0A 5IH2A 2YUNA 1XOVA 2FEIA 4OMQA 2ECZA 2JMAA 3U23A 1ZUUA 1WA7A 1SSHA 4DEYA 2DM1A 3M0QA 1NLPC 3A98A 1RLPC 3IQLA 1AWXA 1H8KA 1S1NA 2RNAA 1JXOA 4AFUC 2JS2A 3EHQA 1GFDA 1WX6A 2A28A 1UE9A 2HDAA 1YN8A 2E5KA 2YT6A 2A36A 1ABQA 1PHTA 3KFVA 4HCKA 1JU5C 2JW4A 2M0YA 2AZSA 1WXTA 1EFNA 2ESWA 2L3PA 4ORZA 4WCIA 1OOTA 1T3LA 3M0SA 4M4ZA 2VWFA 1H92A 2D8JA 2DL3A 2KNBB 1OPLA 2DL7A 4AFQC 1AOJA 1AVZC 2KT1A 4D8DA 5GJVB 4AG1C 3EGUA 5FWCA 1UUEA 1X27A 2KT8A 2EKHA 1X2QA 2F2WA 1M3BA 1N5ZA 1RUWA 1HJDA 2I0NA 1ZUKA 3FJ5A 2LNHB 2M51A 2AKLA 1IO6A 3LH5A 2LJ1A 2KBTA 4OMLA 2AKKA 4X1VA 1UHCA 1X6GA 2ROLA 1GBQA 2DRMA 1YNZA 3ULRB 1BB9A 1G83A 5IHKA 4LN2A 1B3QA 1JEGA 2RQTA 2NUZA 4RTVA 3VRYA 1AWOA 1HD3A 3NMZC 3VS4A 1X43A 4RUGA 3VRZA 1AWJA 3VS2A 4QT7A 2K7AA 4JJCA 3VS3A 2CUDA 2FPEA 2YDLA 1KIKA 2LQWA 2FG0A 3EHRA 3M0PA 2LJ3A
chains in the Genus database with same CATH superfamily
3V7CA 3CPWS 3ZL7C 5CQYA 1M8VA 3JSCA 1I1JA 4X9CA 4FYVB 5KYXB 1K73R 4RTZA 2HMAA 4JRPA 1PWTA 2GCXA 2J6OA 5A0LA 3BW1A 1WQWA 2YSQA 1WJRA 1SG5A 3OYJA 4E7ZA 2CP0A 1VQPQ 4ME7A 1PSFA 3BY7A 1M3CA 3JB9H 1SRMA 3E19A 2FZCB 1KHIA 4B9WA 1V29B 4OB0B 2AT1B 4HKEA 2HZYA 5LJ5e 1WLPB 2J6FA 2W10A 5GANf 2E3IA 4JLGA 3OW2P 1JJ2A 2ENMA 3P8BB 4ELYC 4C5IA 3S6WA 2PNIA 4IIMA 2QXFA 2ED1A 2OI3A 4JJBA 2KY9A 1LJOA 1JJ2S 4M7DC 2V8JA 1Y96B 3OY9A 1UJYA 2LZ6B 3QJYA 3J80E 3EFSA 1WJSA 1U06A 2VGMA 4LE9A 1JRIA 3F70A 2ED0A 4J9EA 2RI2A 5GAN7 4BD3A 3EG1A 3JCMQ 2LNVA 4PFPA 2K6DA 4M7AF 2JS0A 2MI6A 3NTIA 1AZGB 5CCAA 3QSUA 5CKFA 3CCJA 4FM4B 2OTJQ 4PLLA 4BI3A 2HNIA 4M77B 4CRIA 3OS5A 3P8DA 3QBYA 1TSFA 3EG0A 2RJEA 5LJ5g 3OYEA 1XTDA 3CCVQ 2KK4A 1W1FA 1QMCA 3UA7A 2EQUA 3CD6Q 1GCQC 5GAOr 1J3TA 1A0NB 2QASA 4J7FA 1JBMA 2CT3A 1VQPA 2XKOC 3NTKA 1PSEA 1QVGP 2KRMA 1N8RU 4J7IA 1Q82U 2P4TA 1O75A 2KYMA 4F17A 1B07A 1UTIA 2KQWA 1Q7YC 4C92F 3RKWA 1VQ8Q 1YJWT 2GFAA 4Z89A 2EGEA 1OU9A 5GAOp 4CC4B 3CMEA 3E2UA 4C8QB 3HRTA 2E65A 2LDMA 1ZA2B 3WXMB 1WHMA 2EKOA 3VYHB 2QYZA 4FW1A 3WVEB 4JRIA 4J9IA 2AK5A 4B6MA 4M7AD 4OMPA 2JVVA 1WXBA 3EFRA 5FW9A 3GLXA 1OPKA 3A8GB 2VXEA 3HFNA 1VQKT 5IAYA 4ELZC 1VQ5Q 3I56Q 2K57A 1NEGA 5GMKi 4II1A 3RMSA 1QVPA 1TUDA 2E12A 4C0DB 1K0XA 2HL5C 5HKCA 1C1AA 1UFFA 4QQGA 4XU2A 3GPLA 4L5GA 1K76A 2E41A 2KRNA 3REAB 4BE1A 2HBPA 3GNGA 3LGLA 3UWNA 1QKXA 4EMGA 4OF1A 4B9XA 1YJ9Q 3RERA 4KRTA 3E9GA 2MWPA 1G3WA 4BE0A 5GAMe 3JRZA 1WI7A 4HCCA 4A4GA 1YCYA 4M77G 2GQIA 3JB9G 3CCUA 4C92D 2RHYA 3H8ZA 5C0MA 5CKEA 1RAIB 4DA4A 1AD5A 1WNLA 4WF2A 5CQXA 2DLPA 2MWOA 2MIOA 1WYXA 2J7IA 2IPOB 1FXXA 1M27C 3MEWA 3V8JA 4DQ2A 1KJWA 2JTFA 4AT1B 2ATCB 2MOXA 1D3BA 1VYVA 1BKBA 1ZLMA 2Y4YA 3CCLA 2B86A 2O4XB 2EVRA 3KBGA 1FYNA 1MV3A 3CXCS 3SD4A 4FT2A 2VKNA 5I22A 1Q95G 3SFMA 1K73C 3GBQA 1M1FA 4J9BA 4JRQA 3I5RA 2M02A 1M2VB 1MV0B 3X28B 5LL6S 2K3YA 1VQ5A 4BUGA 4JS5A 1Q81R 1UGQB 2CT4A 2LT4A 2EYWA 4E2FB 4C92G 3RESA 4OMOA 2HBWA 2YHTA 1YITT 5IXBA 3QYHB 5KYWB 1PRLC 5LJ5h 4JRKA 1AT1B 3ME9A 4NL2A 5IHNA 5HK3A 3CCRA 1I07A 1M30A 4J5YA 4M7DA 2BIVA 1VQMT 1K8AC 2PQWA 2ABLA 2A08A 1UJ0A 2X4XA 4OMMA 1K9MC 2DFUA 5FWBA 2EQIA 3CMEQ 4HVVA 5CKDA 5GAN2 4M75G 1KSWA 4BB7A 4XU0A 2IIMA 3CCMQ 4OMNA 3DLLA 2MYSA 1LVKA 2ZGWA 1BIAA 2FEIA 2LX9A 2DYIA 3U23A 3I55T 4BDYA 1JB0E 1SSHA 3X24B 3CCRQ 1NLPC 1YIJA 3A98A 4AFUC 3EHQA 2A28A 2HDAA 1YN8A 1KC8R 2E5KA 2YT6A 1ABQA 3KFVA 3PIOA 1N6AA 4KUIA 3CCVA 1BIBA 1NZ9A 2E70A 1QP2A 2FYKA 3JB9F 2LVMA 5CAIA 4WCIA 1OOTA 3OYDA 1LOJA 2D8JA 2DL3A 3UT1A 4M7AB 2DL7A 4PJOA 5GAOm 4AFQC 3BDLA 3JCMV 4C8QA 5KCOA 1YITA 2KT1A 1KC8U 4M7DB 3ASKA 5FWCA 3QPHA 1VQNA 2KT8A 2L5QA 2F2WA 5GAN6 1RUWA 1XNIA 1N8RC 3FEOA 3FJ5A 2Y4XA 4XU3A 2AKLA 1IO6A 2F5KA 3JCMc 4Q5WA 2M16A 5GAMg 1UHCA 1X6GA 2COYA 1YNZA 1G83A 1B3QA 1JEGA 2RJDA 4RTVA 4J6XA 1AWOA 3HPWA 1HD3A 3NMZC 3VS4A 5GAOq 5LJ5j 3G7ZA 4QT7A 2E10A 2X4WA 1TOVA 4XTVA 3CCET 1O9SA 4C5GA 1MMAA 3A8MB 2DEQA 2FG0A 8AT1B 3CEYA 2DEUA 2LJ3A 2GF7A 1KFZA 3EG9B 4LUDA 3H0IA 2JXBA 4C8QF 2LRQA 2E1HA 2EYXA 2OJ2A 4R55A 2XU8A 1WDXA 2H3JA 2HKNA 1TU0B 2DAQA 2LQKA 3M59A 3A8HB 1WZOA 1RADB 3CCVT 1OZ2A 2FRWA 3G6EA 3LW5E 3OYLA 1G8XA 2GTOA 4JZ3A 5J3BA 2KE9A 1VQ7Q 4C5EA 1W2BA 3EG9A 2OX7A 4XTWA 1D1BA 1E7OA 1OQKA 1U3OA 1UDLA 2D0QB 4OB2B 5FU7B 3JCMX 2EJGA 3CCST 3OYBA 2QGGA 1BK2A 2EQJA 2D0NA 2P4RA 1ZSGA 1SPKA 4CC2A 2HQXA 4IIOA 1YFNA 3L2WA 4UC4A 5GAMd 4PK4A 3J81E 4N4HA 1K8AU 3G71A 4PLIA 2MK5A 3CCEQ 5A0GA 3M57A 4M75D 2DZ9A 2IG0A 2FB7A 3LX7A 4C0ZA 4M7AA 4M78C 2K5FA 2O88A 4JJNK 3RBBB 3JB9J 3E9FA 4M75E 2D1XA 1Z9QA 3G6EQ 4E7KA 4C0DC 1VQKA 1OV3A 4J9FA 2ZPGB 5LJ5d 1IGQA 3OBYA 5I2SA 1XQHA 1WFWA 3UDCA 2LP5A 4EDUA 1GXIE 3C94A 3SB2A 4RTWA 2JMCA 2RB6A 1VA7A 2J05A 2RMOA 3QG1A 1IB8A 4M7AE 3HTRA 4A63B 3OYGA 1OULA 5HK0A 2P0KA 1K1ZA 4DBHA 3NGPA 2LQNA 2PVOB 4C92C 2DE0X 1Q81U 3SHWA 1X6BA 3M54A 2O2OA 4CI0C 4EMHA 2OAUA 1M4ZA 2JM8A 4IUTA 3CCSQ 5ECAA 3UA6A 4P5NA 4DBQA 4MZMA 2HSPA 2KEAA 4XQ3A 4HVUA 3QWXX 4NOYA 3HRSA 2QQSA 3QDRB 2EBPA 3HL8A 2EPDA 5GMKh 3X25B 2OTLA 1JXMA 3CC2Q 1TWBA 4OMFB 3NHNA 4KBMB 1TUCA 3RIRA 1N27A 2F1LA 1FMKA 2DERA 2L8DA 1RAAB 2X3WD 2K3XA 1N9SA 2W0ZA 2QEXT 1SEMA 2K2MA 3M5AA 1VQ4A 4A53A 2K2VA 4FU6A 4M77D 4IKFA 1M1KU 2HSEB 5GAOl 5GMKe 5KYXA 3PVLA 3M0TA 2AIRB 2A37A 3HKSA 1VUBA 2DYBA 5J26A 4O6JA 1QLYA 4PJOB 2EYQA 1D09B 1UGVA 1WPYA 4MZTA 1RI0A 2YUQA 1RACB 1G3YA 4PL6A 4KT0E 2I2LA 4BY6C 2RI3A 1NPRA 1Q82C 4MZPA 3TSWA 2DL5A 2QQBA 1YJNT 2V1RA 2BUDA 3OSSC 3OQ5A 2EAYA 1IHWA 4BDZA 1UHFA 3UPUA 2RQRA 4Z8AA 1W2BP 1K0SA 3M0RA 2RQUA 1KHCA 2GGRA 2GQVA 2D8HA 3CCQQ 1WIEA 1K9AA 2O4XA 2HAXA 2RF0A 1VYTA 3AHUA 2WSCE 4HT9A 3I55Q 2DL8A 2CP6A 2VUBA 3NPFA 5GAMh 1RAFB 3MP8A 4A4HA 2PZ1A 3META 4L6V5 5GANe 2LMJA 3CD6A 3EH1A 4KGVB 4QQDA 4M7DG 1Y57A 1HXDA 1Y07A 2E5QA 3EG3A 1Q86C 3G71T 1QW1A 2DXCA 1UG1A 5GAMf 4BACA 2OTJA 2DKGA 3MCAB 4LD9K 2EW3A 2VVKA 3SWNA 1HSQA 2DIQA 2XI9A 1VQPT 2RK1A 4AFSC 1V1CA 1YHQA 3OYCA 3L2QA 2VYTA 2DBMA 3RMQA 2PVDB 4M77A 2M9UA 5DY9A 5LJ3j 1VYUA 2QI2A 2EYZA 2NWMA 1VQLT 3NFCA 2ZZDA 1VQOA 1VQ7A 1BI2A 1KQSS 2DVJA 4J9HA 3MO8A 1KQSP 1YI2T 1X01A 3S3MA 3RNJA 5GAN3 4M75B 5I11A 1MNDA 1ACMB 2EGAA 2P0PA 4KULA 1M90U 3QDFA 3PGGA 4C0FA 1QVGS 4XK8E 4E7LA 1TUGB 3CD6T 4QVDA 1PD0A 1ZSZA 1F1BB 3OB9A 4C8QG 5CIUA 2VC8A 3QO3A 4M7DF 1NM7A 4M75F 3H0FA 2A3LA 1BI0A 4F7UA 4NS5A 5D6WA 4RTTA 1PM3A 2BKDN 4MMLA 4C8QC 3FLGA 2KGTA 2XDBA 5IXFA 2OTJT 5GMKm 3BE3A 4C8QE 5KH6A 3EFOA 2FO0A 1TTHB 1VQ8T 5FRNA 2FVUA 4RG2A 1X6OA 4OMQA 2QAZA 1FWZA 3FB9A 1RAHB 2JMAA 4C0GA 1QQJA 2QGFB 3M4GA 4DEYA 2DM1A 2E4HA 2X4YA 1RLPC 2MMPA 1H8KA 1JXOA 2XIDA 3A8OB 2JS2A 1WX6A 1K9MR 3X26B 2QQAA 1H641 4M78E 4XTZA 3V8KA 3OYAA 1V76A 2DPPB 2KI7A 2L3PA 4ORZA 3TEEA 1T3LA 3M0SA 2QA4A 1W2BS 3KUFA 3QJ6A 3G1JA 4PJJA 4V2SA 2HQHA 2DK3A 4D8DA 1VQNT 4AG1C 1KQSA 1UUEA 3EGXB 1X27A 4QVZA 1M3BA 1D0ZA 1ZQ1A 1DJ7B 1IZ6A 2LCLA 4X9DA 1HJDA 4M78F 1YJNA 5GANd 2FL7A 2LNHB 2M51A 3M4YA 3I56A 1VIFA 3S3OA 4OMLA 3OYMA 2V8IA 4RKUE 2ROLA 1K9MU 1GBQA 4PJOD 2DRMA 1WHLA 2DTHA 2EFIA 4LN2A 4ZTJA 1M5Q1 2DO3A 4RG8A 2LC4A 1VQ8A 3TCJA 1AWJA 2XDPA 2JTMA 2K7AA 4JJCA 2XDDA 1QVFA 1M1GA 3QXEB 2B8AA 3VS3A 2CUDA 2LTOA 3CCMA 3OS1A 3GNFB 2P84A 1N8RR 1TS9A 4Y91A 3M0PA 4PFOA 1VQ6T 4PJMA 3RDVA 2GFUA 1D3BB 1NLOC 4FIBA 3TREA 2FHDA 4FYYB 1CSKA 1I0CA 2CZ1B 4FL6A 1EZZB 1UECA 1S72A 4L59A 4ZGEB 1LPLA 3JAME 3CPWA 3OYHA 1MMDA 2SRCA 4C5HA 2ZPFB 2FPFA 3EGDA 3O5ZA 5LJ5f 4M78A 3L2RA 3CXCP 1G5VA 2DMOA 2X9HA 3LYIA 3THKA 1PD1A 2RN8A 1KC8C 4D6WA 2KROA 2LCSA 5IHIA 1RABB 4ZGDB 1KK7A 1WXUA 3CCUT 5CVIA 2EYYA 1NJIR 4EMKA 5KE2A 2RQVA 2RJCA 5GAN8 3V7SA 2SEMA 2EQKA 2R5MA 3OBWA 3QZ9B 2P0QA 1ARKA 4ESRA 4TVRA 3VS1A 1OX9A 4KH1B 3OS0A 2C06A 3QUIA 2K4YA 3L1AA 1VIEA 1E6GA 1YIJT 1VQ6Q 3SWNB 1WGSA 1H3HA 3CCLQ 1QCFA 2NLUA 1NEBA 2JNGA 4RTXA 3A5ZB 3I9QA 2DTOA 1YITQ 1VOMA 1G2BA 2WSFE 2M0OA 2CREA 5GJWB 1ZX6A 4J9DA 2V26A 4N0AA 2DETA 1Q86U 2DF6A 3RUXA 4PJOG 1S72T 3JCMJ 2CZ6B 4YTLA 1NYFA 4O5VA 4QQ6A 2CUBA 4AFZC 3C4SA 2RK2A 1AZEA 1BCOA 1Y7XA 4M77E 2RHIA 2PUKB 3EG2A 1TG0A 3CCUQ 3MEVA 4RCBA 2NYSA 3ER0A 2WACA 3SDZA 4NL3A 2CYZB 3FDRA 3JV3A 3R6NA 3FIFA 1GFCA 2E6ZA 2RH2A 1MNEA 4F7UB 1C6VX 4FSSA 2OTLT 1MGQA 3JCMb 3HHTB 7AT1B 1EIFA 4XTYA 2CZ7B 3VUZA 3CCRT 3GOXA 1BYMA 3L2UA 2JJ9A 4J8OA 3EFOB 4PNOA 3CMET 1I81A 2BTTA 3VUBA 3NTHA 4DBRA 1ZSZC 3Q1JA 2WSEE 1BI1A 2ZPEB 1I4K1 3QWYA 2ROTA 2EGCA 4VUBA 5KYYA 4F7UF 2F2XA 2D6FA 1MUZA 3ZFJA 2DXBA 2L0AA 3CC4Q 3CC4A 3CCJQ 3MP1A 4E47A 5FU7C 1C0MA 4ZN3A 4LDXA 2EJFA 4M75C 2R58A 1SKUB 4DOWA 3QKJA 1NG2A 2JOYA 3HFOA 1OX8A 2DD4A 3G4SA 4XTUA 2CDTA 2H8HA 2AHJB 3M9QA 5FRMA 3X20B 1G3TA 2HQEA 3PMTA 3GIBA 1R0BG 2F5TX 1T0JA 4ZNXA 1K73U 2KYBA 2XD0A 4PJOC 1Z9ZA 1FX7A 1GL5A 4CC3A 2NUTB 3D7SB 1ZBJA 3T9NA 5CO7A 3LWHA 3JCMP 1NYGA 3J7AF 3M58A 2L3SA 2L3RA 1RAGB 5EC7A 5I2MA 2OTLQ 3L42A 2ZCFB 3VV0A 1QVGA 1OU8A 1QP3A 3JCMd 2JM9A 3VJPA 4IURA 1GBRA 1PNJA 3H0HA 3UF4A 5FROA 2DJQA 2G3RA 5J39A 4ZN1A 3SWNC 4GY5A 2DBKA 3M0UA 3RKXA 5KE3A 2FPDA 2C0TA 2DXTA 2F2VA 2KDSA 2RHXA 4M77C 4JJDA 1T3SA 3QYGB 4EIKA 2CP2A 4PKCC 2CP7A 4D8KA 4RTUA 1M8MA 4JUVA 2ZPIB 3HP9A 3CBMA 2JN0A 2K9GA 1QCOA 4M78B 2C0IA 4DOVA 1YHQT 2K3BA 2YRVA 4ZGJB 5GANg 3ZBDA 2KR3A 5HCKA 1RLQC 3PMIA 1PKTA 2X51A 3VKIA 2QG9B 3TVTA 1VQLA 2DD5A 1B34B 1VQ7T 4HT8A 4FT4A 3REBB 1U5SA 3I5SA 4LD6A 3UATA 2O9SA 2CGHA 3V7RA 2EQMA 3VYGA 1SSFA 2YUOA 4QKUA 1PG5B 2KRSA 3OA6A 2K79A 1VQ9Q 5L8RE 1RI9A 3CC7Q 2H3EB 5L23A 1WJQA 4F14A 1YJWA 3V8LA 1D1CA 1NE8A 1X69A 4A4FA 4DEXA 1YWOA 5D6XA 2FRYA 3JB9I 4RCCA 3TQ7P 4E7SA 4DBFA 5M9OA 2K5IA 3C0CA 2QQ9A 4IUUA 1PCXA 1CKAA 1MMGA 1Q7YU 4FYXB 4IUPA 1IHVA 1QCNA 4E7IA 2L2PA 5LJ3d 1RL2A 5LJ3h 2G6FX 3I55A 2BE9B 5KYUA 1X2KA 1XJWB 5D7UA 5IH2A 4FW2A 2YUNA 1NJIC 1XOVA 3CCQA 1M2VA 1WA7A 1PC0A 3IQLA 4MMKA 1NJIU 2RNAA 1S1NA 4OB1B 1BCMA 1B34A 3MJXA 1YJWQ 4XTXA 2YRCA 4HCKA 1PHTA 5FLXE 1JU5C 4M7DD 2JW4A 2KAFA 3C12A 2AZSA 5DM7R 4PJNA 2RHUA 1FMWA 2YLCA 2VWFA 1H92A 2QK0A 1AOJA 2MAMA 1AVZC 3PNWC 5GJVB 2A7YA 4M78G 2DTIA 3LLRA 2EKHA 4JLIA 1X2QA 3I56T 3GF5A 8ATCB 1ZUKA 2FZGB 1OYXA 1NPPA 1P92A 2LJ1A 2AKKA 3OW2S 5EG2A 5DLOA 3OYNA 5GAN5 2V8KA 3ULRB 1M1KC 5AT1B 3MEUA 2RM4A 2RQTA 4MDWA 4ATOA 1X43A 4RUGA 3VRZA 4BI4A 2QEXA 1X75C 4BE2A 3VS2A 2HKQB 4PJOE 3OYFA 1Q7YR 1VQ4T 2FPEA 2HL3A 3JB9D 2D9TA 1IRXA 3CMAQ 2XHCA 1Q82R 3EHRA 3MHXA 4N4GA 3OMCA 5GMKl 1YIJQ 5DLQE 1RAEB 3N5BB 4FYWB 3RKYA 3JCMh 2CS7A 3S3NA 2M1HA 1R77A 4JZ4A 4PJOF 4J9CA 1LNXA 2LJ0A 3FC3A 4F16A 1VQOT 9ATCB 2DILA 1Y96A 1YI2A 5KCHA 2BZXA 4Y92A 4GLMA 1UGPB 5LJ3g 1S72Q 6AT1B 1M3AA 3M55A 4EPCA 5GANh 2VV5A 2QDYB 4Z02A 4LDVA 1HK9A 4IUQA 3DB3A 4BY6B 4N0AC 2Y90A 3VS5A 3OMGA 4R0KA 3PE0A 1W4SA 2RQWA 1VQ9A 4GLKA 2CH4W 4HXJA 3URGA 4GBQA 4PFZA 1TXQA 4K11A 3MEAA 4QW2A 1MMNA 3VS6A 4J6YA 1VQMA 1U8RA 2J06A 2ZAEA 2JUFA 1PRMC 3KXTA 2RPNA 4IUVA 2FZKB 2RI5A 1VQLQ 4F7UG 2RO0A 1EX4A 4KUDK 3VU3C 3EH2A 3G71Q 2LT1A 3OSVA 4EMKB 1CKBA 2NUPA 4OGCA 2YWWA 1SHFA 1QKWA 1JO8A 4E7HA 5KYNA 2HEQA 3CC4T 3CCJT 2ZPBB 3M56A 2KXCA 2F69A 2XICA 1IXDA 2DL4A 5LJ3f 1IREB 1AEYA 5AYFA 4OGEA 1BBZA 3TU4K 3CCQT 2COWA 2QQRA 3G4ST 1YI2Q 1LCKA 3SEMA 4AG2C 3QIIA 1VQ9T 1D1AA 3LWIA 1ZA1B 4F04B 2LCCA 3EGXA 1OZ3A 2EJ9A 2JZ2A 3PTAA 1H3ZA 1I5LA 1YP5A 2BE7D 5KYWA 3JCMg 5GANj 3CBPA 3LGFA 1PKSA 2YUPA 2JTEA 1GCQA 1SHGA 2PU9B 4KGXB 2BZYA 4FCYA 1KQ1A 2X35A 1YWPA 4Z88A 2GBQA 2VXFA 4XU1A 2DZCA 1Q86R 3FJPA 1WQ7A 1M2OA 1VQ6A 1KG1A 2J6KA 2DX1A 5HY6A 1U1SA 2DA9A 2RJFA 4R56A 1M1KR 1MHNA 1IGUA 1ZHIA 3ZEHA 3MPUB 3JCMW 3PVQA 3OW2A 2YRDA 4BI8B 1Y71A 4LNPA 4A4EA 1K4US 1VQNQ 2O9VA 1W6XA 1KD1R 5A0DA 2VGNA 3H9NA 2QTVA 2RHZA 4F7UE 1E6HA 3PFSA 4C8QD 2Z0WA 2CSQA 3CC7T 5KYYB 1AWWA 3EGDB 1W70A 2OAWA 2CH4A 1QWFA 1YHQQ 2KXDA 2CSIA 2PUOB 2L3QA 3CBOA 5GMKj 4KGZB 2BZ8A 3G6ET 2EWNA 5GAN4 2O31A 1I5OB 1KD1U 4OB3B 1R8OB 4LUEA 1M90R 3MP6A 2R57A 2V1QA 3DKMA 4LDUA 1Q81C 2HCKA 2KVQG 1D0XA 2QTXA 1KD1C 4M7DE 1N9RA 1JJ2P 1GRIA 1QVFS 2ZPHB 2GNCA 4M77F 4AMCA 4JS4A 1SRLA 2IVWA 3C95A 1JQQA 2RA2A 3HSBA 2MCNA 3M53A 3OYYA 1KQ2A 2KSSA 2R5AA 3BDUA 4CC7A 2COZA 2YLBA 3VS7A 1M90C 2AZVA 2XG8D 1VQKQ 3E1SA 1ABOA 3CMAT 3L2ZA 2DRKA 2JT4A 1UGSB 2EIFA 3INZA 3TSZA 1OI1A 4XAXB 3CQTA 4X34A 3CC2T 4M7AC 2C0OA 4A54A 4JPBW 4E6RA 2DXUA 4E7JA 4C92B 3CCEA 3QHSA 5FU6B 2O01E 1WHKA 1YCSB 3CXCA 1GCPA 4C92E 2QEXQ 4J9GA 1FMVA 3WVDB 3R6OA 4HCZA 4QVCA 1YJ9T 3I35A 3A8LB 1QVFP 4HVWA 3MKDA 3HRUA 3GP8A 1WHJA 1WHHA 1VQ5T 3OS2A 4WTOB 2X3XD 2XK0A 4J83A 1UGRB 2QA4Q 1R0CB 4EMKC 5CK9A 3H41A 5I21A 1HYOA 1UEBA 2RD1A 4C92A 1SF9A 2A0FB 1NBEB 1ZUYA 2GTJA 1BU1A 5C6SA 3QZ5B 5CKHA 1VQ4Q 5KYUB 1UB4A 4LDYA 2CP3A 1Y0MA 5CR2A 1OEBA 1U1TA 3OYIA 3EAEA 2QDLA 2PTKA 1T0HA 3CCSA 5LJ3e 5GAOn 2DNUA 4JDSA 3CCLT 1QWEA 3CC2A 1BI3A 4RTYA 2KMTA 2E64A 1D0YA 3P8HA 1B7TA 2XMFA 1YBYA 2K5LA 3VS0A 3CMAA 5GAMj 2LX7A 2VASA 2X4JA 5IN1A 2HD0A 2NUPB 3CPWP 4RMOA 2ECZA 4KH0B 1YJ9A 4OP0A 2LQ8A 1ZUUA 4HCBA 3M0QA 3RR6A 4N4IA 4FSXA 2CP5A 4M7AG 4MDXA 1AWXA 1ZSZB 4PJLA 2L89A 3DLMA 1K8AR 1GFDA 2VB6A 1UE9A 3G4SQ 2MPXC 4OVAA 2A36A 3LH0A 2NUTA 2QA4T 4LDWA 2DJZA 2M0YA 1I8FA 1ZBXA 1AHJB 2MF2A 1WXTA 1EFNA 1M9SA 2ESWA 1VQOQ 4M4ZA 1TH7A 4HA8A 2KNBB 1OPLA 3CC7A 3FRNA 2CKKA 3OYKA 3DB4A 1WHGA 1YJNQ 3EGUA 1G3SA 5D6YA 1VQMQ 1N5ZA 5A2QE 2I0NA 3PT9A 5IT9E 3AT1B 4LXCA 3LH5A 3A1PA 2KBTA 5FU6C 2PVGB 4X1VA 4Y28E 1BB9A 4J6WA 3CPFA 3H6ZA 5IHKA 3L2VA 3BFMA 2NUZA 3VRYA 3O8VA 4ANJA 3CCMT 2E6NA 2YXYA 4M78D 4A4KA 3PIPA 4ZTFA 2YDLA 3JCMf 1KIKA 2DVEA 2LQWA 4M75A 2DIGA 2CZ0B 5CKBA 2E3HA 3JCMe
chains in the Genus database with same CATH topology
1NLOC 3ZL7C 1KFZA 1I1JA 1CSKA 4LUDA 1I0CA 4RTZA 1UECA 4JZ4A 1PWTA 3H0IA 2JXBA 4J9CA 2LJ0A 2J6OA 4F16A 2YSQA 2EYXA 2OJ2A 2DILA 2SRCA 1WDXA 2BZXA 4Y92A 2FPFA 1M3CA 3O5ZA 4GLMA 1SRMA 2DMOA 3THKA 2FRWA 1M3AA 2RN8A 1WLPB 2J6FA 2W10A 2KROA 2LCSA 5IHIA 2GTOA 4JZ3A 2ENMA 2KE9A 1WXUA 1E7OA 2PNIA 2EYYA 4IIMA 3VS5A 2ED1A 1U3OA 1UDLA 4R0KA 3PE0A 2RQWA 2OI3A 4JJBA 1BK2A 2CH4W 4HXJA 1UJYA 4GBQA 2D0NA 2LZ6B 4K11A 2P4RA 2RQVA 1ZSGA 1SPKA 1U06A 4CC2A 3VS6A 4IIOA 2SEMA 2J06A 4LE9A 1ARKA 1PRMC 2RPNA 4ESRA 2ED0A 4J9EA 3VS1A 3EG1A 2O88A 1E6GA 1CKBA 1SHFA 2K6DA 1H3HA 1QCFA 2JS0A 3RBBB 1NEBA 4RTXA 1AZGB 1QKWA 1JO8A 2D1XA 3I9QA 1Z9QA 2HEQA 1G2BA 1OV3A 2CREA 4J9FA 5GJWB 1ZX6A 2KXCA 4J9DA 1WFWA 2LP5A 3EG0A 2DF6A 2DL4A 4RTWA 2JMCA 1AEYA 1VA7A 2J05A 2RMOA 1W1FA 3UA7A 1NYFA 4A63B 1BBZA 2CUBA 4AFZC 1GCQC 1J3TA 1A0NB 1K1ZA 1AZEA 2CT3A 3NGPA 2LQNA 3EG2A 1TG0A 2DE0X 1LCKA 3SEMA 4AG2C 2KRMA 3SHWA 1X6BA 2O2OA 2KYMA 2JM8A 4F17A 5ECAA 1B07A 1UTIA 3UA6A 3JV3A 1YP5A 3R6NA 2HSPA 2KEAA 4HVUA 1GFCA 3QWXX 1PKSA 2YUPA 4FSSA 4Z89A 2EGEA 2JTEA 2EBPA 1GCQA 4CC4B 1SHGA 2EPDA 2BZYA 1JXMA 3NHNA 1TUCA 1YWPA 4Z88A 2GBQA 2BTTA 1FMKA 2X3WD 2W0ZA 4J9IA 2AK5A 1SEMA 3QWYA 2ROTA 4OMPA 2K2MA 2EGCA 1WXBA 2J6KA 2F2XA 2DX1A 1MUZA 5FW9A 2L0AA 1OPKA 2DA9A 1NEGA 3PVQA 3PVLA 3M0TA 4LNPA 2A37A 1K4US 2O9VA 1W6XA 1TUDA 2DYBA 1QLYA 1K0XA 1UGVA 1NG2A 1E6HA 1UFFA 2CSQA 2YUQA 1K76A 2CDTA 1AWWA 2H8HA 2KRNA 1W70A 2OAWA 2CH4A 1QWFA 3REAB 1T0JA 4ZNXA 2KXDA 2KYBA 2CSIA 1QKXA 1Z9ZA 2L3QA 1GL5A 3TSWA 4CC3A 2DL5A 4KRTA 2BZ8A 1ZBJA 2V1RA 2O31A 4LUEA 1NYGA 1WI7A 1UHFA 2V1QA 2RQRA 2L3SA 5EC7A 2HCKA 4Z8AA 2GQIA 1K0SA 3M0RA 2RQUA 1GRIA 2GGRA 2GNCA 2D8HA 1WIEA 1K9AA 1AD5A 2JM9A 2RF0A 1VYTA 1SRLA 1GBRA 2DLPA 1JQQA 1PNJA 1WYXA 2J7IA 2MIOA 2MCNA 1M27C 3H0HA 3UF4A 2DL8A 2DJQA 3NPFA 1KJWA 4CC7A 3VS7A 2PZ1A 2AZVA 2DBKA 2MOXA 3M0UA 1ABOA 2LMJA 1VYVA 2FPDA 2C0TA 2DRKA 2JT4A 2F2VA 3TSZA 1ZLMA 1Y57A 3CQTA 4JJDA 2B86A 1T3SA 2EVRA 3EG3A 1FYNA 4EIKA 1MV3A 4D8KA 4RTUA 2VKNA 2C0OA 5I22A 1UG1A 4JPBW 1M8MA 4E6RA 2K9GA 3GBQA 1YCSB 2EW3A 2C0IA 2VVKA 4J9BA 1HSQA 1GCPA 2K3BA 3I5RA 4AFSC 4J9GA 1V1CA 2KR3A 3I35A 1MV0B 5HCKA 4HVWA 1RLQC 1PKTA 2DBMA 2CT4A 1VYUA 3TVTA 2EYZA 2EYWA 2NWMA 2X3XD 3REBB 1U5SA 3I5SA 4OMOA 2HBWA 3UATA 2DVJA 5IXBA 2O9SA 3H41A 4J9HA 1PRLC 2YUOA 2KRSA 3RNJA 2K79A 5I11A 1ZUYA 2GTJA 1RI9A 1BU1A 5L23A 4F14A 2EGAA 1Y0MA 1X69A 4DEXA 1OEBA 5IHNA 1YWOA 1I07A 2FRYA 1M30A 3C0CA 1CKAA 1NM7A 2PTKA 2QDLA 1T0HA 2ABLA 2A08A 1UJ0A 3H0FA 4OMMA 2DNUA 1QWEA 5FWBA 4RTTA 4RTYA 2L2PA 2EQIA 2XMFA 4HVVA 2KGTA 1KSWA 2G6FX 3VS0A 5IXFA 2LX7A 1X2KA 2IIMA 4OMNA 2FO0A 5IH2A 2YUNA 1XOVA 2FEIA 4OMQA 2ECZA 2JMAA 3U23A 1ZUUA 1WA7A 1SSHA 4DEYA 2DM1A 3M0QA 1NLPC 3A98A 1RLPC 3IQLA 1AWXA 1H8KA 1S1NA 2RNAA 1JXOA 4AFUC 2JS2A 3EHQA 1GFDA 1WX6A 2A28A 1UE9A 2HDAA 1YN8A 2E5KA 2YT6A 2A36A 1ABQA 1PHTA 3KFVA 4HCKA 1JU5C 2JW4A 2M0YA 2AZSA 1WXTA 1EFNA 2ESWA 2L3PA 4ORZA 4WCIA 1OOTA 1T3LA 3M0SA 4M4ZA 2VWFA 1H92A 2D8JA 2DL3A 2KNBB 1OPLA 2DL7A 4AFQC 1AOJA 1AVZC 2KT1A 4D8DA 5GJVB 4AG1C 3EGUA 5FWCA 1UUEA 1X27A 2KT8A 2EKHA 1X2QA 2F2WA 1M3BA 1N5ZA 1RUWA 1HJDA 2I0NA 1ZUKA 3FJ5A 2LNHB 2M51A 2AKLA 1IO6A 3LH5A 2LJ1A 2KBTA 4OMLA 2AKKA 4X1VA 1UHCA 1X6GA 2ROLA 1GBQA 2DRMA 1YNZA 3ULRB 1BB9A 1G83A 5IHKA 4LN2A 1B3QA 1JEGA 2RQTA 2NUZA 4RTVA 3VRYA 1AWOA 1HD3A 3NMZC 3VS4A 1X43A 4RUGA 3VRZA 1AWJA 3VS2A 4QT7A 2K7AA 4JJCA 3VS3A 2CUDA 2FPEA 2YDLA 1KIKA 2LQWA 2FG0A 3EHRA 3M0PA 2LJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLO C;  3ZL7 C;  1KFZ A;  1I1J A;  1CSK A;  4LUD A;  1I0C A;  4RTZ A;  1UEC A;  4JZ4 A;  1PWT A;  3H0I A;  2JXB A;  4J9C A;  2LJ0 A;  2J6O A;  4F16 A;  2YSQ A;  2EYX A;  2OJ2 A;  2DIL A;  2SRC A;  1WDX A;  2BZX A;  4Y92 A;  2FPF A;  1M3C A;  3O5Z A;  4GLM A;  1SRM A;  2DMO A;  3THK A;  2FRW A;  1M3A A;  2RN8 A;  1WLP B;  2J6F A;  2W10 A;  2KRO A;  2LCS A;  5IHI A;  2GTO A;  4JZ3 A;  2ENM A;  2KE9 A;  1WXU A;  1E7O A;  2PNI A;  2EYY A;  4IIM A;  3VS5 A;  2ED1 A;  1U3O A;  1UDL A;  4R0K A;  3PE0 A;  2RQW A;  2OI3 A;  4JJB A;  1BK2 A;  2CH4 W;  4HXJ A;  1UJY A;  4GBQ A;  2D0N A;  2LZ6 B;  4K11 A;  2P4R A;  2RQV A;  1ZSG A;  1SPK A;  1U06 A;  4CC2 A;  3VS6 A;  4IIO A;  2SEM A;  2J06 A;  4LE9 A;  1ARK A;  1PRM C;  2RPN A;  4ESR A;  2ED0 A;  4J9E A;  3VS1 A;  3EG1 A;  2O88 A;  1E6G A;  1CKB A;  1SHF A;  2K6D A;  1H3H A;  1QCF A;  2JS0 A;  3RBB B;  1NEB A;  4RTX A;  1AZG B;  1QKW A;  1JO8 A;  2D1X A;  3I9Q A;  1Z9Q A;  2HEQ A;  1G2B A;  1OV3 A;  2CRE A;  4J9F A;  5GJW B;  1ZX6 A;  2KXC A;  4J9D A;  1WFW A;  2LP5 A;  3EG0 A;  2DF6 A;  2DL4 A;  4RTW A;  2JMC A;  1AEY A;  1VA7 A;  2J05 A;  2RMO A;  1W1F A;  3UA7 A;  1NYF A;  4A63 B;  1BBZ A;  2CUB A;  4AFZ C;  1GCQ C;  1J3T A;  1A0N B;  1K1Z A;  1AZE A;  2CT3 A;  3NGP A;  2LQN A;  3EG2 A;  1TG0 A;  2DE0 X;  1LCK A;  3SEM A;  4AG2 C;  2KRM A;  3SHW A;  1X6B A;  2O2O A;  2KYM A;  2JM8 A;  4F17 A;  5ECA A;  1B07 A;  1UTI A;  3UA6 A;  3JV3 A;  1YP5 A;  3R6N A;  2HSP A;  2KEA A;  4HVU A;  1GFC A;  3QWX X;  1PKS A;  2YUP A;  4FSS A;  4Z89 A;  2EGE A;  2JTE A;  2EBP A;  1GCQ A;  4CC4 B;  1SHG A;  2EPD A;  2BZY A;  1JXM A;  3NHN A;  1TUC A;  1YWP A;  4Z88 A;  2GBQ A;  2BTT A;  1FMK A;  2X3W D;  2W0Z A;  4J9I A;  2AK5 A;  1SEM A;  3QWY A;  2ROT A;  4OMP A;  2K2M A;  2EGC A;  1WXB A;  2J6K A;  2F2X A;  2DX1 A;  1MUZ A;  5FW9 A;  2L0A A;  1OPK A;  2DA9 A;  1NEG A;  3PVQ A;  3PVL A;  3M0T A;  4LNP A;  2A37 A;  1K4U S;  2O9V A;  1W6X A;  1TUD A;  2DYB A;  1QLY A;  1K0X A;  1UGV A;  1NG2 A;  1E6H A;  1UFF A;  2CSQ A;  2YUQ A;  1K76 A;  2CDT A;  1AWW A;  2H8H A;  2KRN A;  1W70 A;  2OAW A;  2CH4 A;  1QWF A;  3REA B;  1T0J A;  4ZNX A;  2KXD A;  2KYB A;  2CSI A;  1QKX A;  1Z9Z A;  2L3Q A;  1GL5 A;  3TSW A;  4CC3 A;  2DL5 A;  4KRT A;  2BZ8 A;  1ZBJ A;  2V1R A;  2O31 A;  4LUE A;  1NYG A;  1WI7 A;  1UHF A;  2V1Q A;  2RQR A;  2L3S A;  5EC7 A;  2HCK A;  4Z8A A;  2GQI A;  1K0S A;  3M0R A;  2RQU A;  1GRI A;  2GGR A;  2GNC A;  2D8H A;  1WIE A;  1K9A A;  1AD5 A;  2JM9 A;  2RF0 A;  1VYT A;  1SRL A;  1GBR A;  2DLP A;  1JQQ A;  1PNJ A;  1WYX A;  2J7I A;  2MIO A;  2MCN A;  1M27 C;  3H0H A;  3UF4 A;  2DL8 A;  2DJQ A;  3NPF A;  1KJW A;  4CC7 A;  3VS7 A;  2PZ1 A;  2AZV A;  2DBK A;  2MOX A;  3M0U A;  1ABO A;  2LMJ A;  1VYV A;  2FPD A;  2C0T A;  2DRK A;  2JT4 A;  2F2V A;  3TSZ A;  1ZLM A;  1Y57 A;  3CQT A;  4JJD A;  2B86 A;  1T3S A;  2EVR A;  3EG3 A;  1FYN A;  4EIK A;  1MV3 A;  4D8K A;  4RTU A;  2VKN A;  2C0O A;  5I22 A;  1UG1 A;  4JPB W;  1M8M A;  4E6R A;  2K9G A;  3GBQ A;  1YCS B;  2EW3 A;  2C0I A;  2VVK A;  4J9B A;  1HSQ A;  1GCP A;  2K3B A;  3I5R A;  4AFS C;  4J9G A;  1V1C A;  2KR3 A;  3I35 A;  1MV0 B;  5HCK A;  4HVW A;  1RLQ C;  1PKT A;  2DBM A;  2CT4 A;  1VYU A;  3TVT A;  2EYZ A;  2EYW A;  2NWM A;  2X3X D;  3REB B;  1U5S A;  3I5S A;  4OMO A;  2HBW A;  3UAT A;  2DVJ A;  5IXB A;  2O9S A;  3H41 A;  4J9H A;  1PRL C;  2YUO A;  2KRS A;  3RNJ A;  2K79 A;  5I11 A;  1ZUY A;  2GTJ A;  1RI9 A;  1BU1 A;  5L23 A;  4F14 A;  2EGA A;  1Y0M A;  1X69 A;  4DEX A;  1OEB A;  5IHN A;  1YWO A;  1I07 A;  2FRY A;  1M30 A;  3C0C A;  1CKA A;  1NM7 A;  2PTK A;  2QDL A;  1T0H A;  2ABL A;  2A08 A;  1UJ0 A;  3H0F A;  4OMM A;  2DNU A;  1QWE A;  5FWB A;  4RTT A;  4RTY A;  2L2P A;  2EQI A;  2XMF A;  4HVV A;  2KGT A;  1KSW A;  2G6F X;  3VS0 A;  5IXF A;  2LX7 A;  1X2K A;  2IIM A;  4OMN A;  2FO0 A;  5IH2 A;  2YUN A;  1XOV A;  2FEI A;  4OMQ A;  2ECZ A;  2JMA A;  3U23 A;  1ZUU A;  1WA7 A;  1SSH A;  4DEY A;  2DM1 A;  3M0Q A;  1NLP C;  3A98 A;  1RLP C;  3IQL A;  1AWX A;  1H8K A;  1S1N A;  2RNA A;  1JXO A;  4AFU C;  2JS2 A;  3EHQ A;  1GFD A;  1WX6 A;  2A28 A;  1UE9 A;  2HDA A;  1YN8 A;  2E5K A;  2YT6 A;  2A36 A;  1ABQ A;  1PHT A;  3KFV A;  4HCK A;  1JU5 C;  2JW4 A;  2M0Y A;  2AZS A;  1WXT A;  1EFN A;  2ESW A;  2L3P A;  4ORZ A;  4WCI A;  1OOT A;  1T3L A;  3M0S A;  4M4Z A;  2VWF A;  1H92 A;  2D8J A;  2DL3 A;  2KNB B;  1OPL A;  2DL7 A;  4AFQ C;  1AOJ A;  1AVZ C;  2KT1 A;  4D8D A;  5GJV B;  4AG1 C;  3EGU A;  5FWC A;  1UUE A;  1X27 A;  2KT8 A;  2EKH A;  1X2Q A;  2F2W A;  1M3B A;  1N5Z A;  1RUW A;  1HJD A;  2I0N A;  1ZUK A;  3FJ5 A;  2LNH B;  2M51 A;  2AKL A;  1IO6 A;  3LH5 A;  2LJ1 A;  2KBT A;  4OML A;  2AKK A;  4X1V A;  1UHC A;  1X6G A;  2ROL A;  1GBQ A;  2DRM A;  1YNZ A;  3ULR B;  1BB9 A;  1G83 A;  5IHK A;  4LN2 A;  1B3Q A;  1JEG A;  2RQT A;  2NUZ A;  4RTV A;  3VRY A;  1AWO A;  1HD3 A;  3NMZ C;  3VS4 A;  1X43 A;  4RUG A;  3VRZ A;  1AWJ A;  3VS2 A;  4QT7 A;  2K7A A;  4JJC A;  3VS3 A;  2CUD A;  2FPE A;  2YDL A;  1KIK A;  2LQW A;  2FG0 A;  3EHR A;  3M0P A;  2LJ3 A; 
#chains in the Genus database with same CATH topology
 3V7C A;  3CPW S;  3ZL7 C;  5CQY A;  1M8V A;  3JSC A;  1I1J A;  4X9C A;  4FYV B;  5KYX B;  1K73 R;  4RTZ A;  2HMA A;  4JRP A;  1PWT A;  2GCX A;  2J6O A;  5A0L A;  3BW1 A;  1WQW A;  2YSQ A;  1WJR A;  1SG5 A;  3OYJ A;  4E7Z A;  2CP0 A;  1VQP Q;  4ME7 A;  1PSF A;  3BY7 A;  1M3C A;  3JB9 H;  1SRM A;  3E19 A;  2FZC B;  1KHI A;  4B9W A;  1V29 B;  4OB0 B;  2AT1 B;  4HKE A;  2HZY A;  5LJ5 e;  1WLP B;  2J6F A;  2W10 A;  5GAN f;  2E3I A;  4JLG A;  3OW2 P;  1JJ2 A;  2ENM A;  3P8B B;  4ELY C;  4C5I A;  3S6W A;  2PNI A;  4IIM A;  2QXF A;  2ED1 A;  2OI3 A;  4JJB A;  2KY9 A;  1LJO A;  1JJ2 S;  4M7D C;  2V8J A;  1Y96 B;  3OY9 A;  1UJY A;  2LZ6 B;  3QJY A;  3J80 E;  3EFS A;  1WJS A;  1U06 A;  2VGM A;  4LE9 A;  1JRI A;  3F70 A;  2ED0 A;  4J9E A;  2RI2 A;  5GAN 7;  4BD3 A;  3EG1 A;  3JCM Q;  2LNV A;  4PFP A;  2K6D A;  4M7A F;  2JS0 A;  2MI6 A;  3NTI A;  1AZG B;  5CCA A;  3QSU A;  5CKF A;  3CCJ A;  4FM4 B;  2OTJ Q;  4PLL A;  4BI3 A;  2HNI A;  4M77 B;  4CRI A;  3OS5 A;  3P8D A;  3QBY A;  1TSF A;  3EG0 A;  2RJE A;  5LJ5 g;  3OYE A;  1XTD A;  3CCV Q;  2KK4 A;  1W1F A;  1QMC A;  3UA7 A;  2EQU A;  3CD6 Q;  1GCQ C;  5GAO r;  1J3T A;  1A0N B;  2QAS A;  4J7F A;  1JBM A;  2CT3 A;  1VQP A;  2XKO C;  3NTK A;  1PSE A;  1QVG P;  2KRM A;  1N8R U;  4J7I A;  1Q82 U;  2P4T A;  1O75 A;  2KYM A;  4F17 A;  1B07 A;  1UTI A;  2KQW A;  1Q7Y C;  4C92 F;  3RKW A;  1VQ8 Q;  1YJW T;  2GFA A;  4Z89 A;  2EGE A;  1OU9 A;  5GAO p;  4CC4 B;  3CME A;  3E2U A;  4C8Q B;  3HRT A;  2E65 A;  2LDM A;  1ZA2 B;  3WXM B;  1WHM A;  2EKO A;  3VYH B;  2QYZ A;  4FW1 A;  3WVE B;  4JRI A;  4J9I A;  2AK5 A;  4B6M A;  4M7A D;  4OMP A;  2JVV A;  1WXB A;  3EFR A;  5FW9 A;  3GLX A;  1OPK A;  3A8G B;  2VXE A;  3HFN A;  1VQK T;  5IAY A;  4ELZ C;  1VQ5 Q;  3I56 Q;  2K57 A;  1NEG A;  5GMK i;  4II1 A;  3RMS A;  1QVP A;  1TUD A;  2E12 A;  4C0D B;  1K0X A;  2HL5 C;  5HKC A;  1C1A A;  1UFF A;  4QQG A;  4XU2 A;  3GPL A;  4L5G A;  1K76 A;  2E41 A;  2KRN A;  3REA B;  4BE1 A;  2HBP A;  3GNG A;  3LGL A;  3UWN A;  1QKX A;  4EMG A;  4OF1 A;  4B9X A;  1YJ9 Q;  3RER A;  4KRT A;  3E9G A;  2MWP A;  1G3W A;  4BE0 A;  5GAM e;  3JRZ A;  1WI7 A;  4HCC A;  4A4G A;  1YCY A;  4M77 G;  2GQI A;  3JB9 G;  3CCU A;  4C92 D;  2RHY A;  3H8Z A;  5C0M A;  5CKE A;  1RAI B;  4DA4 A;  1AD5 A;  1WNL A;  4WF2 A;  5CQX A;  2DLP A;  2MWO A;  2MIO A;  1WYX A;  2J7I A;  2IPO B;  1FXX A;  1M27 C;  3MEW A;  3V8J A;  4DQ2 A;  1KJW A;  2JTF A;  4AT1 B;  2ATC B;  2MOX A;  1D3B A;  1VYV A;  1BKB A;  1ZLM A;  2Y4Y A;  3CCL A;  2B86 A;  2O4X B;  2EVR A;  3KBG A;  1FYN A;  1MV3 A;  3CXC S;  3SD4 A;  4FT2 A;  2VKN A;  5I22 A;  1Q95 G;  3SFM A;  1K73 C;  3GBQ A;  1M1F A;  4J9B A;  4JRQ A;  3I5R A;  2M02 A;  1M2V B;  1MV0 B;  3X28 B;  5LL6 S;  2K3Y A;  1VQ5 A;  4BUG A;  4JS5 A;  1Q81 R;  1UGQ B;  2CT4 A;  2LT4 A;  2EYW A;  4E2F B;  4C92 G;  3RES A;  4OMO A;  2HBW A;  2YHT A;  1YIT T;  5IXB A;  3QYH B;  5KYW B;  1PRL C;  5LJ5 h;  4JRK A;  1AT1 B;  3ME9 A;  4NL2 A;  5IHN A;  5HK3 A;  3CCR A;  1I07 A;  1M30 A;  4J5Y A;  4M7D A;  2BIV A;  1VQM T;  1K8A C;  2PQW A;  2ABL A;  2A08 A;  1UJ0 A;  2X4X A;  4OMM A;  1K9M C;  2DFU A;  5FWB A;  2EQI A;  3CME Q;  4HVV A;  5CKD A;  5GAN 2;  4M75 G;  1KSW A;  4BB7 A;  4XU0 A;  2IIM A;  3CCM Q;  4OMN A;  3DLL A;  2MYS A;  1LVK A;  2ZGW A;  1BIA A;  2FEI A;  2LX9 A;  2DYI A;  3U23 A;  3I55 T;  4BDY A;  1JB0 E;  1SSH A;  3X24 B;  3CCR Q;  1NLP C;  1YIJ A;  3A98 A;  4AFU C;  3EHQ A;  2A28 A;  2HDA A;  1YN8 A;  1KC8 R;  2E5K A;  2YT6 A;  1ABQ A;  3KFV A;  3PIO A;  1N6A A;  4KUI A;  3CCV A;  1BIB A;  1NZ9 A;  2E70 A;  1QP2 A;  2FYK A;  3JB9 F;  2LVM A;  5CAI A;  4WCI A;  1OOT A;  3OYD A;  1LOJ A;  2D8J A;  2DL3 A;  3UT1 A;  4M7A B;  2DL7 A;  4PJO A;  5GAO m;  4AFQ C;  3BDL A;  3JCM V;  4C8Q A;  5KCO A;  1YIT A;  2KT1 A;  1KC8 U;  4M7D B;  3ASK A;  5FWC A;  3QPH A;  1VQN A;  2KT8 A;  2L5Q A;  2F2W A;  5GAN 6;  1RUW A;  1XNI A;  1N8R C;  3FEO A;  3FJ5 A;  2Y4X A;  4XU3 A;  2AKL A;  1IO6 A;  2F5K A;  3JCM c;  4Q5W A;  2M16 A;  5GAM g;  1UHC A;  1X6G A;  2COY A;  1YNZ A;  1G83 A;  1B3Q A;  1JEG A;  2RJD A;  4RTV A;  4J6X A;  1AWO A;  3HPW A;  1HD3 A;  3NMZ C;  3VS4 A;  5GAO q;  5LJ5 j;  3G7Z A;  4QT7 A;  2E10 A;  2X4W A;  1TOV A;  4XTV A;  3CCE T;  1O9S A;  4C5G A;  1MMA A;  3A8M B;  2DEQ A;  2FG0 A;  8AT1 B;  3CEY A;  2DEU A;  2LJ3 A;  2GF7 A;  1KFZ A;  3EG9 B;  4LUD A;  3H0I A;  2JXB A;  4C8Q F;  2LRQ A;  2E1H A;  2EYX A;  2OJ2 A;  4R55 A;  2XU8 A;  1WDX A;  2H3J A;  2HKN A;  1TU0 B;  2DAQ A;  2LQK A;  3M59 A;  3A8H B;  1WZO A;  1RAD B;  3CCV T;  1OZ2 A;  2FRW A;  3G6E A;  3LW5 E;  3OYL A;  1G8X A;  2GTO A;  4JZ3 A;  5J3B A;  2KE9 A;  1VQ7 Q;  4C5E A;  1W2B A;  3EG9 A;  2OX7 A;  4XTW A;  1D1B A;  1E7O A;  1OQK A;  1U3O A;  1UDL A;  2D0Q B;  4OB2 B;  5FU7 B;  3JCM X;  2EJG A;  3CCS T;  3OYB A;  2QGG A;  1BK2 A;  2EQJ A;  2D0N A;  2P4R A;  1ZSG A;  1SPK A;  4CC2 A;  2HQX A;  4IIO A;  1YFN A;  3L2W A;  4UC4 A;  5GAM d;  4PK4 A;  3J81 E;  4N4H A;  1K8A U;  3G71 A;  4PLI A;  2MK5 A;  3CCE Q;  5A0G A;  3M57 A;  4M75 D;  2DZ9 A;  2IG0 A;  2FB7 A;  3LX7 A;  4C0Z A;  4M7A A;  4M78 C;  2K5F A;  2O88 A;  4JJN K;  3RBB B;  3JB9 J;  3E9F A;  4M75 E;  2D1X A;  1Z9Q A;  3G6E Q;  4E7K A;  4C0D C;  1VQK A;  1OV3 A;  4J9F A;  2ZPG B;  5LJ5 d;  1IGQ A;  3OBY A;  5I2S A;  1XQH A;  1WFW A;  3UDC A;  2LP5 A;  4EDU A;  1GXI E;  3C94 A;  3SB2 A;  4RTW A;  2JMC A;  2RB6 A;  1VA7 A;  2J05 A;  2RMO A;  3QG1 A;  1IB8 A;  4M7A E;  3HTR A;  4A63 B;  3OYG A;  1OUL A;  5HK0 A;  2P0K A;  1K1Z A;  4DBH A;  3NGP A;  2LQN A;  2PVO B;  4C92 C;  2DE0 X;  1Q81 U;  3SHW A;  1X6B A;  3M54 A;  2O2O A;  4CI0 C;  4EMH A;  2OAU A;  1M4Z A;  2JM8 A;  4IUT A;  3CCS Q;  5ECA A;  3UA6 A;  4P5N A;  4DBQ A;  4MZM A;  2HSP A;  2KEA A;  4XQ3 A;  4HVU A;  3QWX X;  4NOY A;  3HRS A;  2QQS A;  3QDR B;  2EBP A;  3HL8 A;  2EPD A;  5GMK h;  3X25 B;  2OTL A;  1JXM A;  3CC2 Q;  1TWB A;  4OMF B;  3NHN A;  4KBM B;  1TUC A;  3RIR A;  1N27 A;  2F1L A;  1FMK A;  2DER A;  2L8D A;  1RAA B;  2X3W D;  2K3X A;  1N9S A;  2W0Z A;  2QEX T;  1SEM A;  2K2M A;  3M5A A;  1VQ4 A;  4A53 A;  2K2V A;  4FU6 A;  4M77 D;  4IKF A;  1M1K U;  2HSE B;  5GAO l;  5GMK e;  5KYX A;  3PVL A;  3M0T A;  2AIR B;  2A37 A;  3HKS A;  1VUB A;  2DYB A;  5J26 A;  4O6J A;  1QLY A;  4PJO B;  2EYQ A;  1D09 B;  1UGV A;  1WPY A;  4MZT A;  1RI0 A;  2YUQ A;  1RAC B;  1G3Y A;  4PL6 A;  4KT0 E;  2I2L A;  4BY6 C;  2RI3 A;  1NPR A;  1Q82 C;  4MZP A;  3TSW A;  2DL5 A;  2QQB A;  1YJN T;  2V1R A;  2BUD A;  3OSS C;  3OQ5 A;  2EAY A;  1IHW A;  4BDZ A;  1UHF A;  3UPU A;  2RQR A;  4Z8A A;  1W2B P;  1K0S A;  3M0R A;  2RQU A;  1KHC A;  2GGR A;  2GQV A;  2D8H A;  3CCQ Q;  1WIE A;  1K9A A;  2O4X A;  2HAX A;  2RF0 A;  1VYT A;  3AHU A;  2WSC E;  4HT9 A;  3I55 Q;  2DL8 A;  2CP6 A;  2VUB A;  3NPF A;  5GAM h;  1RAF B;  3MP8 A;  4A4H A;  2PZ1 A;  3MET A;  4L6V 5;  5GAN e;  2LMJ A;  3CD6 A;  3EH1 A;  4KGV B;  4QQD A;  4M7D G;  1Y57 A;  1HXD A;  1Y07 A;  2E5Q A;  3EG3 A;  1Q86 C;  3G71 T;  1QW1 A;  2DXC A;  1UG1 A;  5GAM f;  4BAC A;  2OTJ A;  2DKG A;  3MCA B;  4LD9 K;  2EW3 A;  2VVK A;  3SWN A;  1HSQ A;  2DIQ A;  2XI9 A;  1VQP T;  2RK1 A;  4AFS C;  1V1C A;  1YHQ A;  3OYC A;  3L2Q A;  2VYT A;  2DBM A;  3RMQ A;  2PVD B;  4M77 A;  2M9U A;  5DY9 A;  5LJ3 j;  1VYU A;  2QI2 A;  2EYZ A;  2NWM A;  1VQL T;  3NFC A;  2ZZD A;  1VQO A;  1VQ7 A;  1BI2 A;  1KQS S;  2DVJ A;  4J9H A;  3MO8 A;  1KQS P;  1YI2 T;  1X01 A;  3S3M A;  3RNJ A;  5GAN 3;  4M75 B;  5I11 A;  1MND A;  1ACM B;  2EGA A;  2P0P A;  4KUL A;  1M90 U;  3QDF A;  3PGG A;  4C0F A;  1QVG S;  4XK8 E;  4E7L A;  1TUG B;  3CD6 T;  4QVD A;  1PD0 A;  1ZSZ A;  1F1B B;  3OB9 A;  4C8Q G;  5CIU A;  2VC8 A;  3QO3 A;  4M7D F;  1NM7 A;  4M75 F;  3H0F A;  2A3L A;  1BI0 A;  4F7U A;  4NS5 A;  5D6W A;  4RTT A;  1PM3 A;  2BKD N;  4MML A;  4C8Q C;  3FLG A;  2KGT A;  2XDB A;  5IXF A;  2OTJ T;  5GMK m;  3BE3 A;  4C8Q E;  5KH6 A;  3EFO A;  2FO0 A;  1TTH B;  1VQ8 T;  5FRN A;  2FVU A;  4RG2 A;  1X6O A;  4OMQ A;  2QAZ A;  1FWZ A;  3FB9 A;  1RAH B;  2JMA A;  4C0G A;  1QQJ A;  2QGF B;  3M4G A;  4DEY A;  2DM1 A;  2E4H A;  2X4Y A;  1RLP C;  2MMP A;  1H8K A;  1JXO A;  2XID A;  3A8O B;  2JS2 A;  1WX6 A;  1K9M R;  3X26 B;  2QQA A;  1H64 1;  4M78 E;  4XTZ A;  3V8K A;  3OYA A;  1V76 A;  2DPP B;  2KI7 A;  2L3P A;  4ORZ A;  3TEE A;  1T3L A;  3M0S A;  2QA4 A;  1W2B S;  3KUF A;  3QJ6 A;  3G1J A;  4PJJ A;  4V2S A;  2HQH A;  2DK3 A;  4D8D A;  1VQN T;  4AG1 C;  1KQS A;  1UUE A;  3EGX B;  1X27 A;  4QVZ A;  1M3B A;  1D0Z A;  1ZQ1 A;  1DJ7 B;  1IZ6 A;  2LCL A;  4X9D A;  1HJD A;  4M78 F;  1YJN A;  5GAN d;  2FL7 A;  2LNH B;  2M51 A;  3M4Y A;  3I56 A;  1VIF A;  3S3O A;  4OML A;  3OYM A;  2V8I A;  4RKU E;  2ROL A;  1K9M U;  1GBQ A;  4PJO D;  2DRM A;  1WHL A;  2DTH A;  2EFI A;  4LN2 A;  4ZTJ A;  1M5Q 1;  2DO3 A;  4RG8 A;  2LC4 A;  1VQ8 A;  3TCJ A;  1AWJ A;  2XDP A;  2JTM A;  2K7A A;  4JJC A;  2XDD A;  1QVF A;  1M1G A;  3QXE B;  2B8A A;  3VS3 A;  2CUD A;  2LTO A;  3CCM A;  3OS1 A;  3GNF B;  2P84 A;  1N8R R;  1TS9 A;  4Y91 A;  3M0P A;  4PFO A;  1VQ6 T;  4PJM A;  3RDV A;  2GFU A;  1D3B B;  1NLO C;  4FIB A;  3TRE A;  2FHD A;  4FYY B;  1CSK A;  1I0C A;  2CZ1 B;  4FL6 A;  1EZZ B;  1UEC A;  1S72 A;  4L59 A;  4ZGE B;  1LPL A;  3JAM E;  3CPW A;  3OYH A;  1MMD A;  2SRC A;  4C5H A;  2ZPF B;  2FPF A;  3EGD A;  3O5Z A;  5LJ5 f;  4M78 A;  3L2R A;  3CXC P;  1G5V A;  2DMO A;  2X9H A;  3LYI A;  3THK A;  1PD1 A;  2RN8 A;  1KC8 C;  4D6W A;  2KRO A;  2LCS A;  5IHI A;  1RAB B;  4ZGD B;  1KK7 A;  1WXU A;  3CCU T;  5CVI A;  2EYY A;  1NJI R;  4EMK A;  5KE2 A;  2RQV A;  2RJC A;  5GAN 8;  3V7S A;  2SEM A;  2EQK A;  2R5M A;  3OBW A;  3QZ9 B;  2P0Q A;  1ARK A;  4ESR A;  4TVR A;  3VS1 A;  1OX9 A;  4KH1 B;  3OS0 A;  2C06 A;  3QUI A;  2K4Y A;  3L1A A;  1VIE A;  1E6G A;  1YIJ T;  1VQ6 Q;  3SWN B;  1WGS A;  1H3H A;  3CCL Q;  1QCF A;  2NLU A;  1NEB A;  2JNG A;  4RTX A;  3A5Z B;  3I9Q A;  2DTO A;  1YIT Q;  1VOM A;  1G2B A;  2WSF E;  2M0O A;  2CRE A;  5GJW B;  1ZX6 A;  4J9D A;  2V26 A;  4N0A A;  2DET A;  1Q86 U;  2DF6 A;  3RUX A;  4PJO G;  1S72 T;  3JCM J;  2CZ6 B;  4YTL A;  1NYF A;  4O5V A;  4QQ6 A;  2CUB A;  4AFZ C;  3C4S A;  2RK2 A;  1AZE A;  1BCO A;  1Y7X A;  4M77 E;  2RHI A;  2PUK B;  3EG2 A;  1TG0 A;  3CCU Q;  3MEV A;  4RCB A;  2NYS A;  3ER0 A;  2WAC A;  3SDZ A;  4NL3 A;  2CYZ B;  3FDR A;  3JV3 A;  3R6N A;  3FIF A;  1GFC A;  2E6Z A;  2RH2 A;  1MNE A;  4F7U B;  1C6V X;  4FSS A;  2OTL T;  1MGQ A;  3JCM b;  3HHT B;  7AT1 B;  1EIF A;  4XTY A;  2CZ7 B;  3VUZ A;  3CCR T;  3GOX A;  1BYM A;  3L2U A;  2JJ9 A;  4J8O A;  3EFO B;  4PNO A;  3CME T;  1I81 A;  2BTT A;  3VUB A;  3NTH A;  4DBR A;  1ZSZ C;  3Q1J A;  2WSE E;  1BI1 A;  2ZPE B;  1I4K 1;  3QWY A;  2ROT A;  2EGC A;  4VUB A;  5KYY A;  4F7U F;  2F2X A;  2D6F A;  1MUZ A;  3ZFJ A;  2DXB A;  2L0A A;  3CC4 Q;  3CC4 A;  3CCJ Q;  3MP1 A;  4E47 A;  5FU7 C;  1C0M A;  4ZN3 A;  4LDX A;  2EJF A;  4M75 C;  2R58 A;  1SKU B;  4DOW A;  3QKJ A;  1NG2 A;  2JOY A;  3HFO A;  1OX8 A;  2DD4 A;  3G4S A;  4XTU A;  2CDT A;  2H8H A;  2AHJ B;  3M9Q A;  5FRM A;  3X20 B;  1G3T A;  2HQE A;  3PMT A;  3GIB A;  1R0B G;  2F5T X;  1T0J A;  4ZNX A;  1K73 U;  2KYB A;  2XD0 A;  4PJO C;  1Z9Z A;  1FX7 A;  1GL5 A;  4CC3 A;  2NUT B;  3D7S B;  1ZBJ A;  3T9N A;  5CO7 A;  3LWH A;  3JCM P;  1NYG A;  3J7A F;  3M58 A;  2L3S A;  2L3R A;  1RAG B;  5EC7 A;  5I2M A;  2OTL Q;  3L42 A;  2ZCF B;  3VV0 A;  1QVG A;  1OU8 A;  1QP3 A;  3JCM d;  2JM9 A;  3VJP A;  4IUR A;  1GBR A;  1PNJ A;  3H0H A;  3UF4 A;  5FRO A;  2DJQ A;  2G3R A;  5J39 A;  4ZN1 A;  3SWN C;  4GY5 A;  2DBK A;  3M0U A;  3RKX A;  5KE3 A;  2FPD A;  2C0T A;  2DXT A;  2F2V A;  2KDS A;  2RHX A;  4M77 C;  4JJD A;  1T3S A;  3QYG B;  4EIK A;  2CP2 A;  4PKC C;  2CP7 A;  4D8K A;  4RTU A;  1M8M A;  4JUV A;  2ZPI B;  3HP9 A;  3CBM A;  2JN0 A;  2K9G A;  1QCO A;  4M78 B;  2C0I A;  4DOV A;  1YHQ T;  2K3B A;  2YRV A;  4ZGJ B;  5GAN g;  3ZBD A;  2KR3 A;  5HCK A;  1RLQ C;  3PMI A;  1PKT A;  2X51 A;  3VKI A;  2QG9 B;  3TVT A;  1VQL A;  2DD5 A;  1B34 B;  1VQ7 T;  4HT8 A;  4FT4 A;  3REB B;  1U5S A;  3I5S A;  4LD6 A;  3UAT A;  2O9S A;  2CGH A;  3V7R A;  2EQM A;  3VYG A;  1SSF A;  2YUO A;  4QKU A;  1PG5 B;  2KRS A;  3OA6 A;  2K79 A;  1VQ9 Q;  5L8R E;  1RI9 A;  3CC7 Q;  2H3E B;  5L23 A;  1WJQ A;  4F14 A;  1YJW A;  3V8L A;  1D1C A;  1NE8 A;  1X69 A;  4A4F A;  4DEX A;  1YWO A;  5D6X A;  2FRY A;  3JB9 I;  4RCC A;  3TQ7 P;  4E7S A;  4DBF A;  5M9O A;  2K5I A;  3C0C A;  2QQ9 A;  4IUU A;  1PCX A;  1CKA A;  1MMG A;  1Q7Y U;  4FYX B;  4IUP A;  1IHV A;  1QCN A;  4E7I A;  2L2P A;  5LJ3 d;  1RL2 A;  5LJ3 h;  2G6F X;  3I55 A;  2BE9 B;  5KYU A;  1X2K A;  1XJW B;  5D7U A;  5IH2 A;  4FW2 A;  2YUN A;  1NJI C;  1XOV A;  3CCQ A;  1M2V A;  1WA7 A;  1PC0 A;  3IQL A;  4MMK A;  1NJI U;  2RNA A;  1S1N A;  4OB1 B;  1BCM A;  1B34 A;  3MJX A;  1YJW Q;  4XTX A;  2YRC A;  4HCK A;  1PHT A;  5FLX E;  1JU5 C;  4M7D D;  2JW4 A;  2KAF A;  3C12 A;  2AZS A;  5DM7 R;  4PJN A;  2RHU A;  1FMW A;  2YLC A;  2VWF A;  1H92 A;  2QK0 A;  1AOJ A;  2MAM A;  1AVZ C;  3PNW C;  5GJV B;  2A7Y A;  4M78 G;  2DTI A;  3LLR A;  2EKH A;  4JLI A;  1X2Q A;  3I56 T;  3GF5 A;  8ATC B;  1ZUK A;  2FZG B;  1OYX A;  1NPP A;  1P92 A;  2LJ1 A;  2AKK A;  3OW2 S;  5EG2 A;  5DLO A;  3OYN A;  5GAN 5;  2V8K A;  3ULR B;  1M1K C;  5AT1 B;  3MEU A;  2RM4 A;  2RQT A;  4MDW A;  4ATO A;  1X43 A;  4RUG A;  3VRZ A;  4BI4 A;  2QEX A;  1X75 C;  4BE2 A;  3VS2 A;  2HKQ B;  4PJO E;  3OYF A;  1Q7Y R;  1VQ4 T;  2FPE A;  2HL3 A;  3JB9 D;  2D9T A;  1IRX A;  3CMA Q;  2XHC A;  1Q82 R;  3EHR A;  3MHX A;  4N4G A;  3OMC A;  5GMK l;  1YIJ Q;  5DLQ E;  1RAE B;  3N5B B;  4FYW B;  3RKY A;  3JCM h;  2CS7 A;  3S3N A;  2M1H A;  1R77 A;  4JZ4 A;  4PJO F;  4J9C A;  1LNX A;  2LJ0 A;  3FC3 A;  4F16 A;  1VQO T;  9ATC B;  2DIL A;  1Y96 A;  1YI2 A;  5KCH A;  2BZX A;  4Y92 A;  4GLM A;  1UGP B;  5LJ3 g;  1S72 Q;  6AT1 B;  1M3A A;  3M55 A;  4EPC A;  5GAN h;  2VV5 A;  2QDY B;  4Z02 A;  4LDV A;  1HK9 A;  4IUQ A;  3DB3 A;  4BY6 B;  4N0A C;  2Y90 A;  3VS5 A;  3OMG A;  4R0K A;  3PE0 A;  1W4S A;  2RQW A;  1VQ9 A;  4GLK A;  2CH4 W;  4HXJ A;  3URG A;  4GBQ A;  4PFZ A;  1TXQ A;  4K11 A;  3MEA A;  4QW2 A;  1MMN A;  3VS6 A;  4J6Y A;  1VQM A;  1U8R A;  2J06 A;  2ZAE A;  2JUF A;  1PRM C;  3KXT A;  2RPN A;  4IUV A;  2FZK B;  2RI5 A;  1VQL Q;  4F7U G;  2RO0 A;  1EX4 A;  4KUD K;  3VU3 C;  3EH2 A;  3G71 Q;  2LT1 A;  3OSV A;  4EMK B;  1CKB A;  2NUP A;  4OGC A;  2YWW A;  1SHF A;  1QKW A;  1JO8 A;  4E7H A;  5KYN A;  2HEQ A;  3CC4 T;  3CCJ T;  2ZPB B;  3M56 A;  2KXC A;  2F69 A;  2XIC A;  1IXD A;  2DL4 A;  5LJ3 f;  1IRE B;  1AEY A;  5AYF A;  4OGE A;  1BBZ A;  3TU4 K;  3CCQ T;  2COW A;  2QQR A;  3G4S T;  1YI2 Q;  1LCK A;  3SEM A;  4AG2 C;  3QII A;  1VQ9 T;  1D1A A;  3LWI A;  1ZA1 B;  4F04 B;  2LCC A;  3EGX A;  1OZ3 A;  2EJ9 A;  2JZ2 A;  3PTA A;  1H3Z A;  1I5L A;  1YP5 A;  2BE7 D;  5KYW A;  3JCM g;  5GAN j;  3CBP A;  3LGF A;  1PKS A;  2YUP A;  2JTE A;  1GCQ A;  1SHG A;  2PU9 B;  4KGX B;  2BZY A;  4FCY A;  1KQ1 A;  2X35 A;  1YWP A;  4Z88 A;  2GBQ A;  2VXF A;  4XU1 A;  2DZC A;  1Q86 R;  3FJP A;  1WQ7 A;  1M2O A;  1VQ6 A;  1KG1 A;  2J6K A;  2DX1 A;  5HY6 A;  1U1S A;  2DA9 A;  2RJF A;  4R56 A;  1M1K R;  1MHN A;  1IGU A;  1ZHI A;  3ZEH A;  3MPU B;  3JCM W;  3PVQ A;  3OW2 A;  2YRD A;  4BI8 B;  1Y71 A;  4LNP A;  4A4E A;  1K4U S;  1VQN Q;  2O9V A;  1W6X A;  1KD1 R;  5A0D A;  2VGN A;  3H9N A;  2QTV A;  2RHZ A;  4F7U E;  1E6H A;  3PFS A;  4C8Q D;  2Z0W A;  2CSQ A;  3CC7 T;  5KYY B;  1AWW A;  3EGD B;  1W70 A;  2OAW A;  2CH4 A;  1QWF A;  1YHQ Q;  2KXD A;  2CSI A;  2PUO B;  2L3Q A;  3CBO A;  5GMK j;  4KGZ B;  2BZ8 A;  3G6E T;  2EWN A;  5GAN 4;  2O31 A;  1I5O B;  1KD1 U;  4OB3 B;  1R8O B;  4LUE A;  1M90 R;  3MP6 A;  2R57 A;  2V1Q A;  3DKM A;  4LDU A;  1Q81 C;  2HCK A;  2KVQ G;  1D0X A;  2QTX A;  1KD1 C;  4M7D E;  1N9R A;  1JJ2 P;  1GRI A;  1QVF S;  2ZPH B;  2GNC A;  4M77 F;  4AMC A;  4JS4 A;  1SRL A;  2IVW A;  3C95 A;  1JQQ A;  2RA2 A;  3HSB A;  2MCN A;  3M53 A;  3OYY A;  1KQ2 A;  2KSS A;  2R5A A;  3BDU A;  4CC7 A;  2COZ A;  2YLB A;  3VS7 A;  1M90 C;  2AZV A;  2XG8 D;  1VQK Q;  3E1S A;  1ABO A;  3CMA T;  3L2Z A;  2DRK A;  2JT4 A;  1UGS B;  2EIF A;  3INZ A;  3TSZ A;  1OI1 A;  4XAX B;  3CQT A;  4X34 A;  3CC2 T;  4M7A C;  2C0O A;  4A54 A;  4JPB W;  4E6R A;  2DXU A;  4E7J A;  4C92 B;  3CCE A;  3QHS A;  5FU6 B;  2O01 E;  1WHK A;  1YCS B;  3CXC A;  1GCP A;  4C92 E;  2QEX Q;  4J9G A;  1FMV A;  3WVD B;  3R6O A;  4HCZ A;  4QVC A;  1YJ9 T;  3I35 A;  3A8L B;  1QVF P;  4HVW A;  3MKD A;  3HRU A;  3GP8 A;  1WHJ A;  1WHH A;  1VQ5 T;  3OS2 A;  4WTO B;  2X3X D;  2XK0 A;  4J83 A;  1UGR B;  2QA4 Q;  1R0C B;  4EMK C;  5CK9 A;  3H41 A;  5I21 A;  1HYO A;  1UEB A;  2RD1 A;  4C92 A;  1SF9 A;  2A0F B;  1NBE B;  1ZUY A;  2GTJ A;  1BU1 A;  5C6S A;  3QZ5 B;  5CKH A;  1VQ4 Q;  5KYU B;  1UB4 A;  4LDY A;  2CP3 A;  1Y0M A;  5CR2 A;  1OEB A;  1U1T A;  3OYI A;  3EAE A;  2QDL A;  2PTK A;  1T0H A;  3CCS A;  5LJ3 e;  5GAO n;  2DNU A;  4JDS A;  3CCL T;  1QWE A;  3CC2 A;  1BI3 A;  4RTY A;  2KMT A;  2E64 A;  1D0Y A;  3P8H A;  1B7T A;  2XMF A;  1YBY A;  2K5L A;  3VS0 A;  3CMA A;  5GAM j;  2LX7 A;  2VAS A;  2X4J A;  5IN1 A;  2HD0 A;  2NUP B;  3CPW P;  4RMO A;  2ECZ A;  4KH0 B;  1YJ9 A;  4OP0 A;  2LQ8 A;  1ZUU A;  4HCB A;  3M0Q A;  3RR6 A;  4N4I A;  4FSX A;  2CP5 A;  4M7A G;  4MDX A;  1AWX A;  1ZSZ B;  4PJL A;  2L89 A;  3DLM A;  1K8A R;  1GFD A;  2VB6 A;  1UE9 A;  3G4S Q;  2MPX C;  4OVA A;  2A36 A;  3LH0 A;  2NUT A;  2QA4 T;  4LDW A;  2DJZ A;  2M0Y A;  1I8F A;  1ZBX A;  1AHJ B;  2MF2 A;  1WXT A;  1EFN A;  1M9S A;  2ESW A;  1VQO Q;  4M4Z A;  1TH7 A;  4HA8 A;  2KNB B;  1OPL A;  3CC7 A;  3FRN A;  2CKK A;  3OYK A;  3DB4 A;  1WHG A;  1YJN Q;  3EGU A;  1G3S A;  5D6Y A;  1VQM Q;  1N5Z A;  5A2Q E;  2I0N A;  3PT9 A;  5IT9 E;  3AT1 B;  4LXC A;  3LH5 A;  3A1P A;  2KBT A;  5FU6 C;  2PVG B;  4X1V A;  4Y28 E;  1BB9 A;  4J6W A;  3CPF A;  3H6Z A;  5IHK A;  3L2V A;  3BFM A;  2NUZ A;  3VRY A;  3O8V A;  4ANJ A;  3CCM T;  2E6N A;  2YXY A;  4M78 D;  4A4K A;  3PIP A;  4ZTF A;  2YDL A;  3JCM f;  1KIK A;  2DVE A;  2LQW A;  4M75 A;  2DIG A;  2CZ0 B;  5CKB A;  2E3H A;  3JCM e; 
#chains in the Genus database with same CATH homology
 1NLO C;  3ZL7 C;  1KFZ A;  1I1J A;  1CSK A;  4LUD A;  1I0C A;  4RTZ A;  1UEC A;  4JZ4 A;  1PWT A;  3H0I A;  2JXB A;  4J9C A;  2LJ0 A;  2J6O A;  4F16 A;  2YSQ A;  2EYX A;  2OJ2 A;  2DIL A;  2SRC A;  1WDX A;  2BZX A;  4Y92 A;  2FPF A;  1M3C A;  3O5Z A;  4GLM A;  1SRM A;  2DMO A;  3THK A;  2FRW A;  1M3A A;  2RN8 A;  1WLP B;  2J6F A;  2W10 A;  2KRO A;  2LCS A;  5IHI A;  2GTO A;  4JZ3 A;  2ENM A;  2KE9 A;  1WXU A;  1E7O A;  2PNI A;  2EYY A;  4IIM A;  3VS5 A;  2ED1 A;  1U3O A;  1UDL A;  4R0K A;  3PE0 A;  2RQW A;  2OI3 A;  4JJB A;  1BK2 A;  2CH4 W;  4HXJ A;  1UJY A;  4GBQ A;  2D0N A;  2LZ6 B;  4K11 A;  2P4R A;  2RQV A;  1ZSG A;  1SPK A;  1U06 A;  4CC2 A;  3VS6 A;  4IIO A;  2SEM A;  2J06 A;  4LE9 A;  1ARK A;  1PRM C;  2RPN A;  4ESR A;  2ED0 A;  4J9E A;  3VS1 A;  3EG1 A;  2O88 A;  1E6G A;  1CKB A;  1SHF A;  2K6D A;  1H3H A;  1QCF A;  2JS0 A;  3RBB B;  1NEB A;  4RTX A;  1AZG B;  1QKW A;  1JO8 A;  2D1X A;  3I9Q A;  1Z9Q A;  2HEQ A;  1G2B A;  1OV3 A;  2CRE A;  4J9F A;  5GJW B;  1ZX6 A;  2KXC A;  4J9D A;  1WFW A;  2LP5 A;  3EG0 A;  2DF6 A;  2DL4 A;  4RTW A;  2JMC A;  1AEY A;  1VA7 A;  2J05 A;  2RMO A;  1W1F A;  3UA7 A;  1NYF A;  4A63 B;  1BBZ A;  2CUB A;  4AFZ C;  1GCQ C;  1J3T A;  1A0N B;  1K1Z A;  1AZE A;  2CT3 A;  3NGP A;  2LQN A;  3EG2 A;  1TG0 A;  2DE0 X;  1LCK A;  3SEM A;  4AG2 C;  2KRM A;  3SHW A;  1X6B A;  2O2O A;  2KYM A;  2JM8 A;  4F17 A;  5ECA A;  1B07 A;  1UTI A;  3UA6 A;  3JV3 A;  1YP5 A;  3R6N A;  2HSP A;  2KEA A;  4HVU A;  1GFC A;  3QWX X;  1PKS A;  2YUP A;  4FSS A;  4Z89 A;  2EGE A;  2JTE A;  2EBP A;  1GCQ A;  4CC4 B;  1SHG A;  2EPD A;  2BZY A;  1JXM A;  3NHN A;  1TUC A;  1YWP A;  4Z88 A;  2GBQ A;  2BTT A;  1FMK A;  2X3W D;  2W0Z A;  4J9I A;  2AK5 A;  1SEM A;  3QWY A;  2ROT A;  4OMP A;  2K2M A;  2EGC A;  1WXB A;  2J6K A;  2F2X A;  2DX1 A;  1MUZ A;  5FW9 A;  2L0A A;  1OPK A;  2DA9 A;  1NEG A;  3PVQ A;  3PVL A;  3M0T A;  4LNP A;  2A37 A;  1K4U S;  2O9V A;  1W6X A;  1TUD A;  2DYB A;  1QLY A;  1K0X A;  1UGV A;  1NG2 A;  1E6H A;  1UFF A;  2CSQ A;  2YUQ A;  1K76 A;  2CDT A;  1AWW A;  2H8H A;  2KRN A;  1W70 A;  2OAW A;  2CH4 A;  1QWF A;  3REA B;  1T0J A;  4ZNX A;  2KXD A;  2KYB A;  2CSI A;  1QKX A;  1Z9Z A;  2L3Q A;  1GL5 A;  3TSW A;  4CC3 A;  2DL5 A;  4KRT A;  2BZ8 A;  1ZBJ A;  2V1R A;  2O31 A;  4LUE A;  1NYG A;  1WI7 A;  1UHF A;  2V1Q A;  2RQR A;  2L3S A;  5EC7 A;  2HCK A;  4Z8A A;  2GQI A;  1K0S A;  3M0R A;  2RQU A;  1GRI A;  2GGR A;  2GNC A;  2D8H A;  1WIE A;  1K9A A;  1AD5 A;  2JM9 A;  2RF0 A;  1VYT A;  1SRL A;  1GBR A;  2DLP A;  1JQQ A;  1PNJ A;  1WYX A;  2J7I A;  2MIO A;  2MCN A;  1M27 C;  3H0H A;  3UF4 A;  2DL8 A;  2DJQ A;  3NPF A;  1KJW A;  4CC7 A;  3VS7 A;  2PZ1 A;  2AZV A;  2DBK A;  2MOX A;  3M0U A;  1ABO A;  2LMJ A;  1VYV A;  2FPD A;  2C0T A;  2DRK A;  2JT4 A;  2F2V A;  3TSZ A;  1ZLM A;  1Y57 A;  3CQT A;  4JJD A;  2B86 A;  1T3S A;  2EVR A;  3EG3 A;  1FYN A;  4EIK A;  1MV3 A;  4D8K A;  4RTU A;  2VKN A;  2C0O A;  5I22 A;  1UG1 A;  4JPB W;  1M8M A;  4E6R A;  2K9G A;  3GBQ A;  1YCS B;  2EW3 A;  2C0I A;  2VVK A;  4J9B A;  1HSQ A;  1GCP A;  2K3B A;  3I5R A;  4AFS C;  4J9G A;  1V1C A;  2KR3 A;  3I35 A;  1MV0 B;  5HCK A;  4HVW A;  1RLQ C;  1PKT A;  2DBM A;  2CT4 A;  1VYU A;  3TVT A;  2EYZ A;  2EYW A;  2NWM A;  2X3X D;  3REB B;  1U5S A;  3I5S A;  4OMO A;  2HBW A;  3UAT A;  2DVJ A;  5IXB A;  2O9S A;  3H41 A;  4J9H A;  1PRL C;  2YUO A;  2KRS A;  3RNJ A;  2K79 A;  5I11 A;  1ZUY A;  2GTJ A;  1RI9 A;  1BU1 A;  5L23 A;  4F14 A;  2EGA A;  1Y0M A;  1X69 A;  4DEX A;  1OEB A;  5IHN A;  1YWO A;  1I07 A;  2FRY A;  1M30 A;  3C0C A;  1CKA A;  1NM7 A;  2PTK A;  2QDL A;  1T0H A;  2ABL A;  2A08 A;  1UJ0 A;  3H0F A;  4OMM A;  2DNU A;  1QWE A;  5FWB A;  4RTT A;  4RTY A;  2L2P A;  2EQI A;  2XMF A;  4HVV A;  2KGT A;  1KSW A;  2G6F X;  3VS0 A;  5IXF A;  2LX7 A;  1X2K A;  2IIM A;  4OMN A;  2FO0 A;  5IH2 A;  2YUN A;  1XOV A;  2FEI A;  4OMQ A;  2ECZ A;  2JMA A;  3U23 A;  1ZUU A;  1WA7 A;  1SSH A;  4DEY A;  2DM1 A;  3M0Q A;  1NLP C;  3A98 A;  1RLP C;  3IQL A;  1AWX A;  1H8K A;  1S1N A;  2RNA A;  1JXO A;  4AFU C;  2JS2 A;  3EHQ A;  1GFD A;  1WX6 A;  2A28 A;  1UE9 A;  2HDA A;  1YN8 A;  2E5K A;  2YT6 A;  2A36 A;  1ABQ A;  1PHT A;  3KFV A;  4HCK A;  1JU5 C;  2JW4 A;  2M0Y A;  2AZS A;  1WXT A;  1EFN A;  2ESW A;  2L3P A;  4ORZ A;  4WCI A;  1OOT A;  1T3L A;  3M0S A;  4M4Z A;  2VWF A;  1H92 A;  2D8J A;  2DL3 A;  2KNB B;  1OPL A;  2DL7 A;  4AFQ C;  1AOJ A;  1AVZ C;  2KT1 A;  4D8D A;  5GJV B;  4AG1 C;  3EGU A;  5FWC A;  1UUE A;  1X27 A;  2KT8 A;  2EKH A;  1X2Q A;  2F2W A;  1M3B A;  1N5Z A;  1RUW A;  1HJD A;  2I0N A;  1ZUK A;  3FJ5 A;  2LNH B;  2M51 A;  2AKL A;  1IO6 A;  3LH5 A;  2LJ1 A;  2KBT A;  4OML A;  2AKK A;  4X1V A;  1UHC A;  1X6G A;  2ROL A;  1GBQ A;  2DRM A;  1YNZ A;  3ULR B;  1BB9 A;  1G83 A;  5IHK A;  4LN2 A;  1B3Q A;  1JEG A;  2RQT A;  2NUZ A;  4RTV A;  3VRY A;  1AWO A;  1HD3 A;  3NMZ C;  3VS4 A;  1X43 A;  4RUG A;  3VRZ A;  1AWJ A;  3VS2 A;  4QT7 A;  2K7A A;  4JJC A;  3VS3 A;  2CUD A;  2FPE A;  2YDL A;  1KIK A;  2LQW A;  2FG0 A;  3EHR A;  3M0P A;  2LJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...