3C0CA

X-ray crystal structure of the rat endophilin a2 sh3 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
PLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords Endophilin-A2
publication title Crystal structure of the SH3 domain of rat endophilin A2
rcsb
source organism Rattus norvegicus
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3c0cA00
4A63B 1JXOA 1Z9ZA 2KYBA 2JM9A 4LUEA 3VRZA 1UJYA 2GTJA 4J9EA 2E5KA 2DRKA 3REAB 4R0KA 3VRYA 3PVLA 1G83A 2JMAA 2RMOA 4AFZC 2EW3A 2EGEA 3H41A 2AK5A 2HBWA 1V1CA 1QLYA 1BBZA 1B07A 2LNHB 1OOTA 1T3LA 2X3WD 1MUZA 2J6FA 4JJDA 2RPNA 5IHNA 1WXTA 2KGTA 2PTKA 2SEMA 5FWCA 3VS1A 2MCNA 1PKTA 1UJ0A 1HD3A 1GFDA 4F14A 1M27C 1K9AA 1M3CA 4K11A 4AG1C 4J9GA 2KXDA 2L3QA 5IH2A 2J7IA 2VWFA 1WXUA 2ED0A 2AZVA 4RTXA 2HDAA 1WXBA 2AZSA 4JJBA 2GQIA 1M3BA 1NYFA 1GCQC 2YDLA 3QWYA 4JZ3A 4CC3A 4JJCA 2O9VA 2W10A 1SEMA 4HVVA 2YUQA 1WA7A 3CQTA 4OMMA 2HSPA 1MV0B 4E6RA 2V1RA 1YP5A 1E7OA 2VKNA 1UHCA 1QKXA 2M0YA 2BZXA 2GTOA 5IHKA 1YNZA 1G2BA 2RQVA 2DF6A 5HCKA 1U5SA 2EYWA 4LE9A 5L23A 1BB9A 2J6OA 2F2WA 4KRTA 3RBBB 3U23A 2O31A 4IIOA 3TVTA 2EGAA 2PZ1A 2SRCA 4Y92A 1UTIA 1W6XA 2IIMA 2KNBB 2EQIA 5IXBA 2HEQA 2W0ZA 3NGPA 2EYZA 1WYXA 5I22A 3KFVA 1TUDA 1NM7A 1KSWA 1X2KA 2O9SA 3RNJA 3O5ZA 1XOVA 2F2XA 1K4US 2DILA 1K0XA 4IIMA 2DLPA 2EYXA 2L3SA 5GJWB 1OPLA 2JTEA 4QT7A 2EPDA 1LCKA 1Z9QA 1AWXA 3ULRB 1SHFA 4RTZA 3H0HA 4Z8AA 2FRWA 3SEMA 4AFSC 4OMLA 3EHRA 1HSQA 2CH4A 2ESWA 2BZ8A 1QCFA 3EG0A 2FG0A 1ZUUA 2ROLA 2H8HA 2FRYA 2KROA 4D8KA 2C0TA 1GCQA 4AFQC 2JS2A 2DL4A 2DMOA 1AD5A 1B3QA 1NYGA 1PHTA 2MIOA 1RLPC 1MV3A 2LJ1A 2DVJA 2CSQA 4J9FA 2K3BA 4J9IA 2EKHA 2DBKA 2DL3A 2KR3A 1K76A 3PE0A 4WCIA 4HXJA 1PRMC 1QWEA 2CDTA 2J05A 4J9DA 1WX6A 4HCKA 2G6FX 2C0IA 4AG2C 3I5SA 2EBPA 2KT1A 1NG2A 2NWMA 2BZYA 3M0SA 2JW4A 1Y57A 1E6HA 1QKWA 2L2PA 2B86A 4LUDA 4FSSA 4ESRA 2ED1A 3EGUA 3NMZC 1ZUKA 4JPBW 2DX1A 1ZLMA 4X1VA 2KT8A 1I07A 3VS3A 4M4ZA 1SHGA 5ECAA 2QDLA 3TSZA 2LJ0A 3EG3A 3M0RA 1M30A 2AKLA 3VS0A 2JT4A 3GBQA 1H3HA 2BTTA 2CUDA 4OMPA 1I1JA 2CT3A 1JO8A 1T0HA 1CKAA 3H0IA 2FPFA 3EG2A 3NPFA 1UFFA 2J06A 1GCPA 3IQLA 1J3TA 2LJ3A 1PKSA 2A08A 3VS6A 1YCSB 1VYVA 2LMJA 2DL7A 1VYTA 2LP5A 5I11A 2DE0X 2NUZA 1Y0MA 2CT4A 2D8HA 3UF4A 2D8JA 2KRSA 1K1ZA 2A28A 2J6KA 1UE9A 1JU5C 2KXCA 4ORZA 2K79A 2AKKA 2X3XD 2XMFA 2A36A 1S1NA 4CC2A 1I0CA 2EYYA 2L0AA 1X27A 2DNUA 1OEBA 1YWOA 4Z88A 2LZ6B 2D1XA 1GBRA 2EVRA 2L3PA 1ABOA 1RUWA 2FPDA 1YN8A 2FO0A 3QWXX 5FW9A 2OAWA 2YUOA 2O2OA 1BK2A 2KEAA 5IXFA 1SRLA 2LX7A 4RTTA 1FYNA 2RQTA 2JM8A 1X6GA 4AFUC 1FMKA 3UA6A 3UATA 1A0NB 1U06A 2DYBA 3M0TA 1OV3A 2DL8A 2RNAA 2CSIA 1KFZA 2CUBA 2CH4W 4CC7A 3EHQA 2DBMA 2ECZA 1GRIA 2KBTA 1IO6A 1ZBJA 3I5RA 1SSHA 3VS2A 3EG1A 1WFWA 3ZL7C 3FJ5A 4OMOA 3VS7A 4LN2A 1WLPB 5EC7A 2DL5A 1T3SA 1JQQA 1AWOA 1E6GA 3C0CA 1UHFA 1VA7A 1WIEA 1K0SA 2KRMA 1UG1A 2DM1A 1QWFA 4RTWA 4Z89A 4HVWA 1SRMA 3H0FA 3M0UA 1KJWA 2CREA 3UA7A 2K7AA 4D8DA 1UUEA 1GFCA 1W70A 1BU1A 2GBQA 2O88A 1GL5A 2HCKA 1CSKA 2YUPA 4RTVA 4RTUA 3VS5A 1UECA 2YUNA 1RLQC 4EIKA 1YWPA 2DJQA 2OJ2A 2FEIA 4CC4B 2YSQA 2I0NA 4DEYA 1OPKA 2FPEA 5GJVB 1H8KA 2ROTA 2JS0A 1ZSGA 2LCSA 1TUCA 5FWBA 5IHIA 4J9CA 2RQWA 1UGVA 4DEXA 4JZ4A 1AZGB 3NHNA 2RQUA 1H92A 2KE9A 1X6BA 1AZEA 1X69A 1EFNA 1AEYA 4F16A 1AWWA 4J9BA 2F2VA 3R6NA 1NLOC 2KRNA 3I9QA 2V1QA 3M0PA 3TSWA 3I35A 1JXMA 1ABQA 1N5ZA 1ARKA 1ZUYA 1VYUA 2ENMA 4GLMA 1ZX6A 3SHWA 4LNPA 4OMNA 2GGRA 1WDXA 4RUGA 2RF0A 4GBQA 3A98A 2LQNA 2EGCA 3JV3A 3VS4A 1HJDA 1TG0A 3REBB 1NEBA 1M8MA 3M0QA 4RTYA 1AOJA 1PWTA 2A37A 2JMCA 2P4RA 2K2MA 2KYMA 1UDLA 1JEGA 1PNJA 2JXBA 4ZNXA 1NLPC 1PRLC 2K9GA 4OMQA 2GNCA 2LQWA 1AWJA 2PNIA 1RI9A 4F17A 1W1FA 4HVUA 1KIKA 1U3OA 2DA9A 1M3AA 1GBQA 3LH5A 1SPKA 2K6DA 1CKBA 1X43A 2OI3A 2RQRA 2YT6A 1WI7A 4J9HA 1X2QA 2VVKA 1AVZC 2C0OA 2M51A 2MOXA 2ABLA 1NEGA 3PVQA 3THKA 2DRMA 2RN8A 1T0JA 2D0NA
chains in the Genus database with same CATH superfamily
1JXOA 2RA2A 1VUBA 3ER0A 2DIGA 1YITQ 1UJYA 2OTLQ 1VQ5A 4J9EA 2EQUA 2PUKB 4PFOA 3GPLA 4BE0A 4AFZC 1NBEB 2K5LA 1D0ZA 3GIBA 4PJMA 1D1BA 2RPNA 1X75C 5IHNA 1WXTA 2IVWA 3N5BB 1S72Q 3MO8A 3M54A 4QKUA 3VS1A 2MCNA 1UJ0A 4RCBA 5LJ5j 4F14A 1M27C 1XQHA 3ZFJA 3CCQT 2OTJQ 1IGQA 2KXDA 4KBMB 1PSFA 2CZ0B 2L3QA 3CC2T 4M78C 5IH2A 2J7IA 2VWFA 5AYFA 2EIFA 3DB4A 4N0AA 4MDXA 1WXBA 1M3BA 4A4FA 5LJ5e 5I21A 2YUQA 2ZPFB 2P4TA 4OMMA 4BB7A 3OYGA 2FHDA 4E6RA 1D09B 4M77C 1NE8A 2VKNA 1UHCA 1NJIC 1UGSB 3G1JA 4C92F 4HT9A 3HTRA 2DF6A 5HCKA 4LE9A 2JNGA 3QJYA 2CP5A 2E41A 2HL5C 2DXTA 1SKUB 5CKDA 4PJOC 5GAN8 2HKNA 2COWA 1YJ9A 3META 3SWNB 4JUVA 5IXBA 4LDXA 2K5IA 3G71T 3CBMA 2VGMA 5I22A 4E47A 4HA8A 4X9DA 4HT8A 2QEXQ 2O9SA 3RNJA 1LJOA 4DQ2A 3I55T 3O5ZA 1KK7A 2PU9B 2QXFA 2DO3A 1K0XA 3NFCA 3V7SA 2EYXA 2A3LA 3CD6A 2EPDA 3OQ5A 2FZKB 2M0OA 4JRPA 1N9RA 1TTHB 3OMGA 3CC7Q 2D0QB 1M90U 5J39A 4AFSC 5CQYA 3I56T 2LDMA 1Q81U 4M7DC 3EG0A 1C0MA 1IRXA 1ZUUA 2FG0A 2H8HA 1YJWQ 3JB9H 5LJ5h 3CBPA 3JAME 4AFQC 1IREB 1B3QA 4OB0B 3GNFB 3V7CA 3VUZA 1RLPC 1MV3A 2DVJA 4J9IA 4ZTJA 3FJPA 5DLQE 1TS9A 3M4GA 5GMKi 4HCKA 2X51A 3I5SA 2G3RA 2NWMA 2BZYA 4MZPA 4M7AA 2R5MA 2KAFA 4C8QD 3CC2A 3A8OB 1WHLA 4ESRA 5CVIA 1OU9A 3EGUA 4JPBW 1ZUKA 2DX1A 3H6ZA 2E10A 1I07A 4XU1A 2JOYA 1VQ4T 4FW2A 1NPPA 3VS0A 1LVKA 2BTTA 3PMTA 1KQ1A 1I1JA 1PG5B 5FU7C 4E7SA 3H0IA 1VQOT 4QVDA 1VQPQ 1Q82C 3NPFA 1UFFA 1RAHB 1GCPA 2E6NA 3JB9D 3VS6A 2A08A 4C92C 2DL7A 3QZ5B 2DE0X 2EYQA 4E2FB 5LJ5g 5GMKj 1Y0MA 2CT4A 2D8HA 3UF4A 2RH2A 4QVCA 4M7AC 1KD1C 2D8JA 4CRIA 4HCZA 1K1ZA 4E7IA 4M78D 1RAAB 4ORZA 1M90R 2AKKA 3C95A 2A36A 5IAYA 1Q81R 1VQ8Q 3OB9A 4Z88A 4M77D 3G4SQ 1MHNA 1KQSP 2D1XA 1GBRA 3JB9J 2OTJT 2MAMA 1WHGA 2FPDA 1YN8A 2V8IA 3JCMP 5FW9A 2O01E 4QQDA 3CCSA 2O2OA 2OX7A 1XTDA 2HSEB 1BYMA 3CPWS 1VQLT 1BI2A 4PJOD 4KH1B 2RQTA 1X6GA 1M1KR 5KE2A 1KG1A 2DYBA 3CCEQ 4OB1B 2JVVA 2RNAA 3G6ET 1KFZA 2CUBA 5M9OA 3SWNA 3QPHA 3A8LB 2ZPIB 1SG5A 3EHQA 4BI8B 2DBMA 1GRIA 3RR6A 3HPWA 3A5ZB 4LDYA 3VS2A 3QYGB 3EG1A 3L2ZA 3WVDB 3QZ9B 1R77A 4OMOA 3VS7A 1WLPB 5A0LA 3E1SA 3CCVQ 5LJ5f 3KBGA 1QP3A 3L2WA 1AWOA 1E6GA 3CXCA 4PNOA 1Y96B 3L2RA 1WIEA 3OYNA 2QA4T 1TU0B 3CCMQ 1WJQA 2PQWA 1M1FA 5GMKh 3QSUA 5IN1A 2DIQA 2M16A 2CREA 4D8DA 4OB3B 3S3MA 4PLIA 3X28B 1W70A 5KYXB 3CC7T 2RK1A 4IUTA 1VQNA 2HCKA 3NTKA 4QQ6A 2YUNA 4FM4B 4EIKA 1YWPA 2OJ2A 3QXEB 2HBPA 3RUXA 1IZ6A 3KXTA 1OPKA 2Y90A 1FXXA 4C8QE 1YITA 2OTLA 2LCSA 3TQ7P 1YJWT 4J9CA 3JCMc 9ATCB 1H92A 5A0GA 4E7JA 1X6BA 1AZEA 2KSSA 1EFNA 4PJJA 1V29B 1AWWA 2GF7A 3I9QA 1G3SA 2ZPGB 2V1QA 2M02A 3M0PA 1S72A 4FSXA 1N5ZA 2X4XA 3J81E 1ARKA 3V8LA 2X4JA 1VYUA 4M78B 2KQWA 1C1AA 4IUUA 2CS7A 3OYBA 2OTJA 1YIJQ 1QVGP 4OMNA 2XIDA 5CKEA 4RG8A 4RUGA 2LQNA 2ZPBB 3H8ZA 4C92D 1TG0A 1HYOA 4M77B 5FRNA 2L8DA 4RTYA 2CZ1B 2A37A 2P4RA 3VKIA 2A0FB 4M78E 1G3WA 1TSFA 1U1SA 4XU0A 4OMQA 2GNCA 1M9SA 2LQWA 5D6YA 1AWJA 1K9MU 1RI9A 5AT1B 1N9SA 3CPFA 2EJFA 4JDSA 4HVUA 4PJOB 1VQPT 2AT1B 1KIKA 3HKSA 4IUVA 4M77E 1GBQA 2K6DA 1X43A 3CCRT 2VXFA 1WI7A 1N6AA 4ELZC 4O5VA 1AVZC 2C0OA 2E1HA 2PVGB 2M51A 2MOXA 3V8KA 5I2SA 2VUBA 2WSFE 2QG9B 2DRMA 1T0JA 1WHKA 4RKUE 4XU2A 3NTIA 1DJ7B 2QEXA 4PJOE 2K4YA 5CKFA 2JM9A 2GTJA 3RMSA 4JRIA 2RMOA 1RACB 1ZQ1A 3G71Q 1VQ8T 1V1CA 1QLYA 2XICA 1B07A 3URGA 3G4ST 3CC7A 4HCBA 4Q5WA 4JJDA 4BDYA 3I55Q 2MK5A 2KGTA 2PTKA 2SEMA 1HD3A 1M90C 1GFDA 1K9AA 2CP7A 3V8JA 1K73U 1YJWA 1Q81C 1VQ7T 2LQ8A 4PFZA 1WJSA 1WXUA 3I56Q 2ED0A 1QVFP 2AZSA 4JJBA 2FZCB 2E3IA 3CCET 2YDLA 2XD0A 1M2OA 4JZ3A 1GXIE 4JJCA 3X20B 2W10A 1VQMT 1SEMA 3C4SA 3CQTA 1WA7A 4HVVA 5LJ3d 3TU4K 3J7AF 3EGXB 1E7OA 2O4XB 1Y96A 2E4HA 2GTOA 1YBYA 2H3JA 5GAN5 2RQVA 3INZA 1RAEB 3H9NA 1U5SA 5GAOq 3MKDA 2O31A 4TVRA 3TVTA 2EGAA 1QVFS 4Y92A 3A1PA 3HRUA 1UTIA 1K9MR 2VGNA 2IIMA 3TREA 1YHQT 2CKKA 1XNIA 3CCMT 3OYMA 4L59A 5FU6C 3EAEA 2W0ZA 2EYZA 2RHIA 1KSWA 4JRKA 4BY6B 3DLLA 4C92B 3L2QA 1IB8A 1OPLA 2JTMA 4QT7A 4F7UB 5C0MA 1RAIB 1OZ3A 1Z9QA 2BE7D 4RTZA 1YJNQ 1MGQA 3OYEA 2A7YA 2VB6A 2JJ9A 2GQVA 3A8GB 1B7TA 2PVDB 3EHRA 5GAOr 4C8QC 1TXQA 4IUPA 4M78A 1QCFA 5HK3A 1D3BB 2FRYA 4PK4A 3OY9A 2JS2A 2DL4A 1RABB 3VUBA 1JJ2P 2P0QA 4J9FA 3G4SA 2K3BA 2EKHA 4M77A 2BUDA 1K73R 2DL3A 3VV0A 1YI2A 3OSVA 4E7KA 1I8FA 1YIJT 4ZTFA 2XDDA 1WX6A 3E19A 5GANe 2KT1A 1NG2A 2JW4A 1WHMA 5L8RE 4PJOA 5CR2A 2L2PA 2B86A 4LUDA 4FSSA 3CC4T 3NMZC 2VYTA 1WQ7A 4X1VA 1OYXA 2KT8A 2QGFB 3CCEA 1JJ2S 1SHGA 2XU8A 3TEEA 4C5IA 3TSZA 2RJDA 3EG3A 1BI0A 4KULA 1VQLQ 1M30A 4M75G 2JT4A 2CP2A 2DVEA 4DOWA 4DBFA 1H3HA 2CUDA 4C0FA 5KYNA 2XG8D 1MMGA 1W2BA 2XK0A 3HSBA 1JO8A 1T0HA 3JCMe 3MP1A 3G6EQ 3CCVA 2XHCA 4EDUA 1PKSA 2YHTA 1YCSB 1VYTA 1TUGB 4M7DA 2NUZA 3WVEB 3M56A 2NUPB 1PC0A 3EFRA 3OW2P 5GAN7 4AT1B 1UE9A 1WHJA 4MZTA 5FROA 4BDZA 2MPXC 3OYIA 2K79A 4FYWB 4HKEA 4A54A 3BFMA 3S3OA 3WXMB 2RJFA 2X3XD 2XMFA 1S1NA 3AT1B 2QTXA 1I0CA 3CEYA 2QA4Q 4OVAA 2EYYA 1YCYA 1X27A 1M8VA 1OEBA 1YWOA 5GANd 1EZZB 3L42A 3QDRB 5A0DA 2RM4A 1ZA1B 2EVRA 4RG2A 2YLCA 3EGXA 5KYWB 2LQKA 3OW2S 1KC8R 2O4XA 2MYSA 5CO7A 3E2UA 3CCLQ 3M57A 2KEAA 5IXFA 2LX7A 2HMAA 2WSEE 1FYNA 4J6WA 4V2SA 2JM8A 4AFUC 1FMKA 3EGDB 1N27A 1QP2A 4ELYC 1BIAA 1OV3A 2RB6A 2CSIA 3JCMd 4JS5A 4L6V5 2MI6A 1AHJB 2K2VA 5CKBA 4CC7A 2Z0WA 3CMET 3OBYA 5GAN6 4IKFA 3QDFA 3OYAA 2KBTA 1D1AA 1WQWA 2QI2A 2RJEA 1IO6A 1XJWB 1ZBJA 4BE1A 1M1KU 3QG1A 4EPCA 4C92A 3FJ5A 1Q7YR 4BE2A 2DL5A 4F7UA 2DERA 1JQQA 2CYZB 3CCQA 4JRQA 4F04B 5GAOp 2DK3A 4PLLA 4ZGJB 2K3XA 1UG1A 1IGUA 2LRQA 4Z89A 5EG2A 1SRMA 4OGEA 2E5QA 2DD5A 3M0UA 2DD4A 2QQAA 5CCAA 2NYSA 2QTVA 1U1TA 5C6SA 1D3BA 1K9MC 2HAXA 2DPPB 1BIBA 2DAQA 2LCCA 1BU1A 1YJNT 3RESA 4RCCA 2DXBA 3LGLA 4A4KA 1GL5A 2VASA 4DEYA 4XU3A 4BI3A 2VXEA 4RMOA 2FYKA 2RO0A 4BY6C 3VJPA 2ROTA 3CCRQ 2RQWA 4PJLA 4LDWA 1AZGB 3NHNA 5CQXA 3G71A 1AEYA 5KH6A 2KY9A 3Q1JA 4XTXA 4D6WA 3I55A 3CPWP 3RMQA 3F70A 5IT9E 1PSEA 3TSWA 1ABQA 3UPUA 4KH0B 1KHCA 1ZUYA 3JRZA 2ENMA 3PFSA 3JB9G 4GLMA 2QASA 3L2UA 3OS0A 1WDXA 4VUBA 4GBQA 2JZ2A 5GAOl 1VOMA 2EGCA 3I56A 1K73C 5GAN4 4BI4A 2C06A 2V26A 1NEBA 1M8MA 4M78G 1AOJA 2LVMA 2KYMA 1UDLA 2YRDA 5GAN3 2JUFA 1PNJA 1JEGA 1OX8A 1VQ9T 3LYIA 2K9GA 3CCUT 1VQ7Q 1JRIA 3C94A 4ATOA 2NUPA 3OYCA 3JCMQ 3OSSC 4EMKB 4M77G 4EMGA 1VQMQ 1KHIA 3HP9A 1CKBA 4KUDK 2R57A 2RQRA 5FU6B 4J9HA 5GAMe 1NEGA 4PJOG 4M75F 2RN8A 3QKJA 1ZBXA 2D0NA 1R0BG 1WFWA 1Z9ZA 3QO3A 5HKCA 2DRKA 3REAB 3VRYA 5KYWA 1G83A 1JB0E 4N4HA 1YHQQ 3S6WA 4EMHA 2WSCE 1VQ4A 1TOVA 2EW3A 2EGEA 3H41A 4Z02A 4OB2B 3JCMJ 5KYYB 2AK5A 1BBZA 2LNHB 1BI3A 2ATCB 4C8QB 1T3LA 2X3WD 1Q95G 2J6FA 1EX4A 3EGDA 1AT1B 3P8HA 2KMTA 3UWNA 1VQOA 3MJXA 5FWCA 2EQMA 2HD0A 1PKTA 2LCLA 3CCLT 2RI2A 3X26B 1M3CA 4K11A 3PIOA 4DBRA 4DOVA 4M7DG 1MNDA 3P8DA 1YJ9Q 1RADB 4C5EA 4PKCC 1VQKQ 4RTXA 2F5KA 3M58A 2HDAA 3SFMA 2GQIA 1NYFA 1GCQC 1FWZA 1I81A 4KUIA 3CCJT 1K8AU 3MHXA 2CZ6B 2HSPA 5DM7R 1MV0B 1KC8C 2V1RA 1RL2A 2FVUA 2M0YA 2BZXA 1FX7A 2E64A 2FB7A 2JTFA 1YNZA 6AT1B 5GAMd 4QW2A 2VV5A 2XI9A 2HQEA 4XK8E 2J6OA 2F2WA 4KRTA 4IIOA 3DKMA 2SRCA 1OU8A 5FLXE 2IG0A 1W6XA 4FU6A 1HK9A 2YXYA 3HRSA 4ZN3A 2RJCA 2JN0A 4OGCA 2EQIA 3JSCA 1VQLA 2HEQA 4FYXB 2XDBA 1WYXA 3KFVA 3CC4Q 1NM7A 3MEUA 5LJ3j 3ZEHA 1XOVA 2F2XA 1Q7YC 1K4US 3G6EA 4J7IA 3X24B 5GJWB 4C0DC 3SB2A 3E9GA 3PTAA 4X34A 1SHFA 1G5VA 3H0HA 1C6VX 2FRWA 1UGPB 2COYA 5LJ3e 1QW1A 3SEMA 3BY7A 2KK4A 4C92G 4X9CA 3OYLA 4F7UG 2HQHA 3DB3A 2BZ8A 4XTUA 4M7AG 2ROLA 4D8KA 2C0TA 3M5AA 2EJ9A 5CK9A 2QA4A 2MIOA 1RAGB 2LJ1A 2LNVA 8ATCB 2CSQA 2D6FA 1R8OB 2BIVA 3PE0A 2B8AA 4ZGEB 4WCIA 3M59A 5KCOA 2QQSA 2CDTA 2J05A 4J9DA 4OMFB 8AT1B 1OZ2A 2CGHA 3BE3A 2G6FX 2C0IA 4AG2C 1H3ZA 1K8AR 3M0SA 4EMKA 1Y57A 4E7LA 4CI0C 1E6HA 1QKWA 2VC8A 3PIPA 2ED1A 3CMAT 5FRMA 2MWOA 4GY5A 4M4ZA 1VQ5T 1Y71A 3QUIA 5ECAA 2QDLA 2DTHA 3UDCA 4O6JA 4PL6A 2AKLA 5GMKl 1ZSZB 2CP3A 2YLBA 1R0CB 5D7UA 3QBYA 3RERA 4DBQA 1V76A 2MWPA 2FPFA 5LJ3h 1UEBA 3EG2A 4N4GA 1J3TA 3PGGA 2KDSA 2GFUA 2YRCA 2RK2A 2XKOC 1VYVA 5KYYA 3CMEQ 1M1KC 2LP5A 5I11A 4C8QA 4A4GA 1QVPA 1VQ6Q 2WACA 4Y91A 3CBOA 3C12A 2I2LA 4EMKC 4MDWA 4E7HA 5KYXA 2J6KA 1JU5C 2KXCA 2GFAA 3RKXA 3FEOA 1ACMB 2F69A 5CAIA 4CC2A 2L0AA 2QGGA 2DNUA 1VQPA 2KI7A 2ZCFB 3CXCP 3KUFA 1ABOA 3FIFA 3CCRA 1RUWA 1M5Q1 2K5FA 2YUOA 3PT9A 1BK2A 1YJ9T 2EJGA 1VQKT 3OBWA 1D0XA 1Q86U 1SRLA 4RTTA 2QDYB 3UA6A 3UATA 4QQGA 3MP6A 3D7SB 2L89A 3M0TA 4FL6A 4PJNA 1MMAA 5LJ3g 1KD1R 3RDVA 2RI3A 3CXCS 4PFPA 3CD6T 4C5GA 1VQ8A 5GANj 1KC8U 4ME7A 4M7DF 2ECZA 2HQXA 2E70A 2LC4A 3I5RA 4C5HA 2K57A 4J5YA 1FMVA 3ZL7C 5EC7A 4E7ZA 1W4SA 3C0CA 1UHFA 1KQSA 1VA7A 3E9FA 1VQ7A 3UT1A 4KT0E 4B9WA 2DJZA 2KRMA 4FT4A 1PM3A 5A2QE 4HVWA 4WTOB 4M75D 2DEUA 1LPLA 1KJWA 1VQMA 3UA7A 1Q7YU 2K7AA 4LD6A 1WJRA 1UUEA 1VQ9Q 1GFCA 3CCUQ 2AHJB 5GAOn 4J6YA 2ZPHB 4XTWA 2O88A 1PD1A 2YUPA 4RTVA 4RTUA 1PCXA 3OYYA 2DZCA 2DJQA 2FEIA 4CC4B 2I0NA 3QHSA 3V7RA 5GJVB 2QQ9A 2JS0A 3EFSA 1ZSGA 4BACA 2F5TX 5IHIA 5FWBA 4DEXA 4ANJA 1VIFA 1YHQA 2RQUA 3CCMA 4XAXB 2PVOB 2EFIA 2P84A 4J9BA 2FZGB 2F2VA 4OF1A 2E65A 5LJ3f 3R6NA 1NLOC 2HL3A 1UB4A 3HFOA 4GLKA 3SDZA 3GOXA 3I35A 4NL3A 1QCOA 1Q86R 5D6XA 5HY6A 4F7UF 2LT4A 3SHWA 4M7AF 1ZSZA 4B9XA 1I5LA 1I5OB 3TCJA 1WNLA 4A4EA 5GANh 2RF0A 1VQKA 3JV3A 4LDVA 1SF9A 3VS4A 3OMCA 3REBB 2MMPA 5KYUB 3M0QA 3QYHB 3FRNA 1Y7XA 1PWTA 3HHTB 4N0AC 2JMCA 2JXBA 4ZNXA 1NLPC 2YRVA 1PRLC 4J6XA 1K8AC 2CP0A 3ME9A 3MEAA 4XTZA 3JCMX 2RI5A 1WHHA 3CCJQ 2DA9A 3G7ZA 1M3AA 3EH1A 3JCMh 1YIJA 3GP8A 1X2QA 3CCST 3A8MB 3MCAB 3QJ6A 1VQ6T 2ABLA 3BW1A 2DXUA 1ZSZC 5LJ5d 3FDRA 4FIBA 3CC4A 3S3NA 4C0DB 1BI1A 4A63B 2KYBA 1QCNA 4LUEA 3VRZA 2EQKA 1QVGA 2E5KA 4R0KA 3PVLA 2JMAA 1G3TA 1OX9A 5GAOm 2DZ9A 2HBWA 4KGZB 4XQ3A 4WF2A 4MMKA 1OOTA 1MUZA 2Y4XA 3LH0A 3BDLA 5GANg 2ZGWA 3EG9B 4M75B 3JCMW 1HXDA 2QAZA 5GAN2 3RKYA 1NZ9A 4MMLA 4AG1C 4J9GA 4C8QG 4DBHA 3OYFA 2QQRA 3P8BB 3M55A 2AZVA 1N8RU 3QWYA 3PMIA 4ZGDB 3EH2A 4CC3A 4M75E 2O9VA 2LTOA 2RHZA 3MP8A 1ZHIA 3JCMg 1MMDA 4B6MA 1YP5A 1QKXA 1F1BB 4MZMA 5J3BA 5IHKA 1VQNT 1G2BA 3OS2A 3LGFA 3OYJA 1KQ2A 2EYWA 3DLMA 5L23A 1BB9A 3RBBB 3U23A 1VIEA 2BKDN 2P0PA 2PZ1A 1YITT 2OTLT 1RAFB 2Y4YA 3R6OA 2KNBB 3OYHA 2R5AA 3FB9A 4C0ZA 2LT1A 3NGPA 1TUDA 5GMKe 4LD9K 3CMAQ 1X2KA 1VQ5Q 1SSFA 2DILA 1S72T 4IIMA 2DLPA 2L3SA 1OQKA 2JTEA 1LCKA 3A8HB 3ZBDA 1QVFA 5DY9A 2DEQA 3QIIA 1YI2Q 2NLUA 5GANf 1O9SA 5GAMj 3CMEA 3L2VA 1AWXA 3ULRB 4OP0A 4JS4A 5DLOA 4LXCA 2RHUA 2X4WA 4Z8AA 4A4HA 3ASKA 1VQ6A 4OMLA 4J7FA 3OA6A 3GF5A 2CZ7B 4C0GA 3MEVA 1HSQA 3OS1A 2X4YA 2CH4A 2ESWA 4N4IA 1U8RA 2K3YA 3LW5E 1W2BP 1RI0A 2KROA 1PD0A 1UGQB 4L5GA 1X6OA 1GCQA 1KQSS 4XTYA 2DMOA 1AD5A 1NYGA 1PHTA 2YWWA 2P0KA 3JCMf 2DBKA 5KYUA 1P92A 1NJIU 2KR3A 1K76A 1G8XA 4HXJA 2PUOB 1NPRA 1PRMC 1QWEA 1YJNA 2COZA 3SD4A 1N8RR 3L1AA 2EBPA 2D9TA 4FCYA 4JJNK 1W2BS 1WPYA 5KCHA 4M7DD 1BKBA 2QYZA 4AMCA 4IURA 2QEXT 5KE3A 2M1HA 2XDPA 1ZLMA 3VS3A 2BE9B 1BCOA 4J83A 4FYYB 1Q86C 1B34B 2LJ0A 4Y28E 3M0RA 3MEWA 2DTOA 3GBQA 1QQJA 1O75A 4OMPA 3SWNC 1M2VB 3LLRA 2CT3A 1CKAA 2F1LA 2FL7A 2J06A 3IQLA 3CD6Q 2LJ3A 1JJ2A 2LMJA 2KVQG 4JLGA 4QVZA 1OI1A 3O8VA 5GAMh 2DXCA 2M9UA 2MF2A 3EG9A 1H641 3M4YA 4YTLA 4M75A 1IHVA 2KRSA 2ZZDA 2A28A 2EQJA 2AIRB 1VQ9A 4FW1A 3CCUA 2DKGA 3EFOB 3JCMV 3FC3A 3PNWC 4A53A 1LOJA 4IUQA 5J26A 2HZYA 2LZ6B 2NUTB 2L3PA 5GMKm 2R58A 1D0YA 2X9HA 2GCXA 3QWXX 2FO0A 3RKWA 2OAWA 3X25B 3HL8A 3M53A 3CCQQ 1NJIR 4M7AD 1IXDA 2IPOB 5HK0A 3CC2Q 1MMNA 1A0NB 4NL2A 1JBMA 1M1GA 7AT1B 3OS5A 2E6ZA 1LNXA 1U06A 4M75C 2EWNA 2RHYA 1FMWA 2DL8A 1QVGS 3HRTA 1TWBA 2CH4W 3OW2A 1WGSA 3JB9I 1Q82U 3NTHA 4ZN1A 4C8QF 3OYKA 1OULA 5GAMg 4UC4A 1SSHA 3LWHA 1IHWA 2HNIA 4LN2A 4HCCA 1T3SA 3CCLA 1KD1U 2E12A 1K0SA 2DM1A 1QWFA 4RTWA 2EKOA 3GLXA 3VYGA 2H3EB 3H0FA 3T9NA 3CCJA 4M7DB 3HFNA 4P5NA 1Y07A 4NOYA 1YI2T 3GNGA 3JB9F 2DYIA 2HKQB 3LX7A 2GBQA 4JLIA 1UGRB 5D6WA 2OAUA 1CSKA 3VS5A 1BCMA 3BDUA 1MNEA 3VYHB 1UECA 3M9QA 1RLQC 2E3HA 2YSQA 4KGXB 2FPEA 4M78F 2QK0A 4M7DE 2RHXA 1H8KA 1QMCA 4II1A 1TUCA 3CCSQ 1UGVA 4JZ4A 2V8KA 4BD3A 2DETA 2RD1A 2DTIA 2KE9A 1X69A 4F16A 5LL6S 4XTVA 1WZOA 4M77F 3AHUA 3JCMb 5I2MA 1TH7A 2KRNA 2DFUA 2L5QA 3LWIA 2X35A 1JXMA 2QQBA 1B34A 3FLGA 3CCVT 1G3YA 1I4K1 1EIFA 2CP6A 5GAMf 4J8OA 1ZX6A 4LNPA 4PJOF 2LX9A 1X01A 2GGRA 4BUGA 3J80E 1M2VA 3A98A 2V8JA 1HJDA 5CIUA 5FU7B 2ZAEA 1Q82R 1ZA2B 2K2MA 5CKHA 1D1CA 1N8RC 3RIRA 2ZPEB 4R55A 2PNIA 1VQ4Q 4F17A 1W1FA 3OYDA 4LDUA 4M7AB 1U3OA 2L3RA 1M4ZA 3LH5A 1SPKA 2EAYA 4R56A 4FT2A 2OI3A 4DA4A 1VQOQ 4NS5A 2YT6A 3EFOA 1YFNA 4FYVB 2VVKA 3MPUB 4C92E 3CPWA 4KGVB 1VQNQ 3PVQA 4F7UE 3THKA 3VU3C 2NUTA 4M7AE 3CMAA
chains in the Genus database with same CATH topology
4A63B 1JXOA 1Z9ZA 2KYBA 2JM9A 4LUEA 3VRZA 1UJYA 2GTJA 4J9EA 2E5KA 2DRKA 3REAB 4R0KA 3VRYA 3PVLA 1G83A 2JMAA 2RMOA 4AFZC 2EW3A 2EGEA 3H41A 2AK5A 2HBWA 1V1CA 1QLYA 1BBZA 1B07A 2LNHB 1OOTA 1T3LA 2X3WD 1MUZA 2J6FA 4JJDA 2RPNA 5IHNA 1WXTA 2KGTA 2PTKA 2SEMA 5FWCA 3VS1A 2MCNA 1PKTA 1UJ0A 1HD3A 1GFDA 4F14A 1M27C 1K9AA 1M3CA 4K11A 4AG1C 4J9GA 2KXDA 2L3QA 5IH2A 2J7IA 2VWFA 1WXUA 2ED0A 2AZVA 4RTXA 2HDAA 1WXBA 2AZSA 4JJBA 2GQIA 1M3BA 1NYFA 1GCQC 2YDLA 3QWYA 4JZ3A 4CC3A 4JJCA 2O9VA 2W10A 1SEMA 4HVVA 2YUQA 1WA7A 3CQTA 4OMMA 2HSPA 1MV0B 4E6RA 2V1RA 1YP5A 1E7OA 2VKNA 1UHCA 1QKXA 2M0YA 2BZXA 2GTOA 5IHKA 1YNZA 1G2BA 2RQVA 2DF6A 5HCKA 1U5SA 2EYWA 4LE9A 5L23A 1BB9A 2J6OA 2F2WA 4KRTA 3RBBB 3U23A 2O31A 4IIOA 3TVTA 2EGAA 2PZ1A 2SRCA 4Y92A 1UTIA 1W6XA 2IIMA 2KNBB 2EQIA 5IXBA 2HEQA 2W0ZA 3NGPA 2EYZA 1WYXA 5I22A 3KFVA 1TUDA 1NM7A 1KSWA 1X2KA 2O9SA 3RNJA 3O5ZA 1XOVA 2F2XA 1K4US 2DILA 1K0XA 4IIMA 2DLPA 2EYXA 2L3SA 5GJWB 1OPLA 2JTEA 4QT7A 2EPDA 1LCKA 1Z9QA 1AWXA 3ULRB 1SHFA 4RTZA 3H0HA 4Z8AA 2FRWA 3SEMA 4AFSC 4OMLA 3EHRA 1HSQA 2CH4A 2ESWA 2BZ8A 1QCFA 3EG0A 2FG0A 1ZUUA 2ROLA 2H8HA 2FRYA 2KROA 4D8KA 2C0TA 1GCQA 4AFQC 2JS2A 2DL4A 2DMOA 1AD5A 1B3QA 1NYGA 1PHTA 2MIOA 1RLPC 1MV3A 2LJ1A 2DVJA 2CSQA 4J9FA 2K3BA 4J9IA 2EKHA 2DBKA 2DL3A 2KR3A 1K76A 3PE0A 4WCIA 4HXJA 1PRMC 1QWEA 2CDTA 2J05A 4J9DA 1WX6A 4HCKA 2G6FX 2C0IA 4AG2C 3I5SA 2EBPA 2KT1A 1NG2A 2NWMA 2BZYA 3M0SA 2JW4A 1Y57A 1E6HA 1QKWA 2L2PA 2B86A 4LUDA 4FSSA 4ESRA 2ED1A 3EGUA 3NMZC 1ZUKA 4JPBW 2DX1A 1ZLMA 4X1VA 2KT8A 1I07A 3VS3A 4M4ZA 1SHGA 5ECAA 2QDLA 3TSZA 2LJ0A 3EG3A 3M0RA 1M30A 2AKLA 3VS0A 2JT4A 3GBQA 1H3HA 2BTTA 2CUDA 4OMPA 1I1JA 2CT3A 1JO8A 1T0HA 1CKAA 3H0IA 2FPFA 3EG2A 3NPFA 1UFFA 2J06A 1GCPA 3IQLA 1J3TA 2LJ3A 1PKSA 2A08A 3VS6A 1YCSB 1VYVA 2LMJA 2DL7A 1VYTA 2LP5A 5I11A 2DE0X 2NUZA 1Y0MA 2CT4A 2D8HA 3UF4A 2D8JA 2KRSA 1K1ZA 2A28A 2J6KA 1UE9A 1JU5C 2KXCA 4ORZA 2K79A 2AKKA 2X3XD 2XMFA 2A36A 1S1NA 4CC2A 1I0CA 2EYYA 2L0AA 1X27A 2DNUA 1OEBA 1YWOA 4Z88A 2LZ6B 2D1XA 1GBRA 2EVRA 2L3PA 1ABOA 1RUWA 2FPDA 1YN8A 2FO0A 3QWXX 5FW9A 2OAWA 2YUOA 2O2OA 1BK2A 2KEAA 5IXFA 1SRLA 2LX7A 4RTTA 1FYNA 2RQTA 2JM8A 1X6GA 4AFUC 1FMKA 3UA6A 3UATA 1A0NB 1U06A 2DYBA 3M0TA 1OV3A 2DL8A 2RNAA 2CSIA 1KFZA 2CUBA 2CH4W 4CC7A 3EHQA 2DBMA 2ECZA 1GRIA 2KBTA 1IO6A 1ZBJA 3I5RA 1SSHA 3VS2A 3EG1A 1WFWA 3ZL7C 3FJ5A 4OMOA 3VS7A 4LN2A 1WLPB 5EC7A 2DL5A 1T3SA 1JQQA 1AWOA 1E6GA 3C0CA 1UHFA 1VA7A 1WIEA 1K0SA 2KRMA 1UG1A 2DM1A 1QWFA 4RTWA 4Z89A 4HVWA 1SRMA 3H0FA 3M0UA 1KJWA 2CREA 3UA7A 2K7AA 4D8DA 1UUEA 1GFCA 1W70A 1BU1A 2GBQA 2O88A 1GL5A 2HCKA 1CSKA 2YUPA 4RTVA 4RTUA 3VS5A 1UECA 2YUNA 1RLQC 4EIKA 1YWPA 2DJQA 2OJ2A 2FEIA 4CC4B 2YSQA 2I0NA 4DEYA 1OPKA 2FPEA 5GJVB 1H8KA 2ROTA 2JS0A 1ZSGA 2LCSA 1TUCA 5FWBA 5IHIA 4J9CA 2RQWA 1UGVA 4DEXA 4JZ4A 1AZGB 3NHNA 2RQUA 1H92A 2KE9A 1X6BA 1AZEA 1X69A 1EFNA 1AEYA 4F16A 1AWWA 4J9BA 2F2VA 3R6NA 1NLOC 2KRNA 3I9QA 2V1QA 3M0PA 3TSWA 3I35A 1JXMA 1ABQA 1N5ZA 1ARKA 1ZUYA 1VYUA 2ENMA 4GLMA 1ZX6A 3SHWA 4LNPA 4OMNA 2GGRA 1WDXA 4RUGA 2RF0A 4GBQA 3A98A 2LQNA 2EGCA 3JV3A 3VS4A 1HJDA 1TG0A 3REBB 1NEBA 1M8MA 3M0QA 4RTYA 1AOJA 1PWTA 2A37A 2JMCA 2P4RA 2K2MA 2KYMA 1UDLA 1JEGA 1PNJA 2JXBA 4ZNXA 1NLPC 1PRLC 2K9GA 4OMQA 2GNCA 2LQWA 1AWJA 2PNIA 1RI9A 4F17A 1W1FA 4HVUA 1KIKA 1U3OA 2DA9A 1M3AA 1GBQA 3LH5A 1SPKA 2K6DA 1CKBA 1X43A 2OI3A 2RQRA 2YT6A 1WI7A 4J9HA 1X2QA 2VVKA 1AVZC 2C0OA 2M51A 2MOXA 2ABLA 1NEGA 3PVQA 3THKA 2DRMA 2RN8A 1T0JA 2D0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A63 B;  1JXO A;  1Z9Z A;  2KYB A;  2JM9 A;  4LUE A;  3VRZ A;  1UJY A;  2GTJ A;  4J9E A;  2E5K A;  2DRK A;  3REA B;  4R0K A;  3VRY A;  3PVL A;  1G83 A;  2JMA A;  2RMO A;  4AFZ C;  2EW3 A;  2EGE A;  3H41 A;  2AK5 A;  2HBW A;  1V1C A;  1QLY A;  1BBZ A;  1B07 A;  2LNH B;  1OOT A;  1T3L A;  2X3W D;  1MUZ A;  2J6F A;  4JJD A;  2RPN A;  5IHN A;  1WXT A;  2KGT A;  2PTK A;  2SEM A;  5FWC A;  3VS1 A;  2MCN A;  1PKT A;  1UJ0 A;  1HD3 A;  1GFD A;  4F14 A;  1M27 C;  1K9A A;  1M3C A;  4K11 A;  4AG1 C;  4J9G A;  2KXD A;  2L3Q A;  5IH2 A;  2J7I A;  2VWF A;  1WXU A;  2ED0 A;  2AZV A;  4RTX A;  2HDA A;  1WXB A;  2AZS A;  4JJB A;  2GQI A;  1M3B A;  1NYF A;  1GCQ C;  2YDL A;  3QWY A;  4JZ3 A;  4CC3 A;  4JJC A;  2O9V A;  2W10 A;  1SEM A;  4HVV A;  2YUQ A;  1WA7 A;  3CQT A;  4OMM A;  2HSP A;  1MV0 B;  4E6R A;  2V1R A;  1YP5 A;  1E7O A;  2VKN A;  1UHC A;  1QKX A;  2M0Y A;  2BZX A;  2GTO A;  5IHK A;  1YNZ A;  1G2B A;  2RQV A;  2DF6 A;  5HCK A;  1U5S A;  2EYW A;  4LE9 A;  5L23 A;  1BB9 A;  2J6O A;  2F2W A;  4KRT A;  3RBB B;  3U23 A;  2O31 A;  4IIO A;  3TVT A;  2EGA A;  2PZ1 A;  2SRC A;  4Y92 A;  1UTI A;  1W6X A;  2IIM A;  2KNB B;  2EQI A;  5IXB A;  2HEQ A;  2W0Z A;  3NGP A;  2EYZ A;  1WYX A;  5I22 A;  3KFV A;  1TUD A;  1NM7 A;  1KSW A;  1X2K A;  2O9S A;  3RNJ A;  3O5Z A;  1XOV A;  2F2X A;  1K4U S;  2DIL A;  1K0X A;  4IIM A;  2DLP A;  2EYX A;  2L3S A;  5GJW B;  1OPL A;  2JTE A;  4QT7 A;  2EPD A;  1LCK A;  1Z9Q A;  1AWX A;  3ULR B;  1SHF A;  4RTZ A;  3H0H A;  4Z8A A;  2FRW A;  3SEM A;  4AFS C;  4OML A;  3EHR A;  1HSQ A;  2CH4 A;  2ESW A;  2BZ8 A;  1QCF A;  3EG0 A;  2FG0 A;  1ZUU A;  2ROL A;  2H8H A;  2FRY A;  2KRO A;  4D8K A;  2C0T A;  1GCQ A;  4AFQ C;  2JS2 A;  2DL4 A;  2DMO A;  1AD5 A;  1B3Q A;  1NYG A;  1PHT A;  2MIO A;  1RLP C;  1MV3 A;  2LJ1 A;  2DVJ A;  2CSQ A;  4J9F A;  2K3B A;  4J9I A;  2EKH A;  2DBK A;  2DL3 A;  2KR3 A;  1K76 A;  3PE0 A;  4WCI A;  4HXJ A;  1PRM C;  1QWE A;  2CDT A;  2J05 A;  4J9D A;  1WX6 A;  4HCK A;  2G6F X;  2C0I A;  4AG2 C;  3I5S A;  2EBP A;  2KT1 A;  1NG2 A;  2NWM A;  2BZY A;  3M0S A;  2JW4 A;  1Y57 A;  1E6H A;  1QKW A;  2L2P A;  2B86 A;  4LUD A;  4FSS A;  4ESR A;  2ED1 A;  3EGU A;  3NMZ C;  1ZUK A;  4JPB W;  2DX1 A;  1ZLM A;  4X1V A;  2KT8 A;  1I07 A;  3VS3 A;  4M4Z A;  1SHG A;  5ECA A;  2QDL A;  3TSZ A;  2LJ0 A;  3EG3 A;  3M0R A;  1M30 A;  2AKL A;  3VS0 A;  2JT4 A;  3GBQ A;  1H3H A;  2BTT A;  2CUD A;  4OMP A;  1I1J A;  2CT3 A;  1JO8 A;  1T0H A;  1CKA A;  3H0I A;  2FPF A;  3EG2 A;  3NPF A;  1UFF A;  2J06 A;  1GCP A;  3IQL A;  1J3T A;  2LJ3 A;  1PKS A;  2A08 A;  3VS6 A;  1YCS B;  1VYV A;  2LMJ A;  2DL7 A;  1VYT A;  2LP5 A;  5I11 A;  2DE0 X;  2NUZ A;  1Y0M A;  2CT4 A;  2D8H A;  3UF4 A;  2D8J A;  2KRS A;  1K1Z A;  2A28 A;  2J6K A;  1UE9 A;  1JU5 C;  2KXC A;  4ORZ A;  2K79 A;  2AKK A;  2X3X D;  2XMF A;  2A36 A;  1S1N A;  4CC2 A;  1I0C A;  2EYY A;  2L0A A;  1X27 A;  2DNU A;  1OEB A;  1YWO A;  4Z88 A;  2LZ6 B;  2D1X A;  1GBR A;  2EVR A;  2L3P A;  1ABO A;  1RUW A;  2FPD A;  1YN8 A;  2FO0 A;  3QWX X;  5FW9 A;  2OAW A;  2YUO A;  2O2O A;  1BK2 A;  2KEA A;  5IXF A;  1SRL A;  2LX7 A;  4RTT A;  1FYN A;  2RQT A;  2JM8 A;  1X6G A;  4AFU C;  1FMK A;  3UA6 A;  3UAT A;  1A0N B;  1U06 A;  2DYB A;  3M0T A;  1OV3 A;  2DL8 A;  2RNA A;  2CSI A;  1KFZ A;  2CUB A;  2CH4 W;  4CC7 A;  3EHQ A;  2DBM A;  2ECZ A;  1GRI A;  2KBT A;  1IO6 A;  1ZBJ A;  3I5R A;  1SSH A;  3VS2 A;  3EG1 A;  1WFW A;  3ZL7 C;  3FJ5 A;  4OMO A;  3VS7 A;  4LN2 A;  1WLP B;  5EC7 A;  2DL5 A;  1T3S A;  1JQQ A;  1AWO A;  1E6G A;  3C0C A;  1UHF A;  1VA7 A;  1WIE A;  1K0S A;  2KRM A;  1UG1 A;  2DM1 A;  1QWF A;  4RTW A;  4Z89 A;  4HVW A;  1SRM A;  3H0F A;  3M0U A;  1KJW A;  2CRE A;  3UA7 A;  2K7A A;  4D8D A;  1UUE A;  1GFC A;  1W70 A;  1BU1 A;  2GBQ A;  2O88 A;  1GL5 A;  2HCK A;  1CSK A;  2YUP A;  4RTV A;  4RTU A;  3VS5 A;  1UEC A;  2YUN A;  1RLQ C;  4EIK A;  1YWP A;  2DJQ A;  2OJ2 A;  2FEI A;  4CC4 B;  2YSQ A;  2I0N A;  4DEY A;  1OPK A;  2FPE A;  5GJV B;  1H8K A;  2ROT A;  2JS0 A;  1ZSG A;  2LCS A;  1TUC A;  5FWB A;  5IHI A;  4J9C A;  2RQW A;  1UGV A;  4DEX A;  4JZ4 A;  1AZG B;  3NHN A;  2RQU A;  1H92 A;  2KE9 A;  1X6B A;  1AZE A;  1X69 A;  1EFN A;  1AEY A;  4F16 A;  1AWW A;  4J9B A;  2F2V A;  3R6N A;  1NLO C;  2KRN A;  3I9Q A;  2V1Q A;  3M0P A;  3TSW A;  3I35 A;  1JXM A;  1ABQ A;  1N5Z A;  1ARK A;  1ZUY A;  1VYU A;  2ENM A;  4GLM A;  1ZX6 A;  3SHW A;  4LNP A;  4OMN A;  2GGR A;  1WDX A;  4RUG A;  2RF0 A;  4GBQ A;  3A98 A;  2LQN A;  2EGC A;  3JV3 A;  3VS4 A;  1HJD A;  1TG0 A;  3REB B;  1NEB A;  1M8M A;  3M0Q A;  4RTY A;  1AOJ A;  1PWT A;  2A37 A;  2JMC A;  2P4R A;  2K2M A;  2KYM A;  1UDL A;  1JEG A;  1PNJ A;  2JXB A;  4ZNX A;  1NLP C;  1PRL C;  2K9G A;  4OMQ A;  2GNC A;  2LQW A;  1AWJ A;  2PNI A;  1RI9 A;  4F17 A;  1W1F A;  4HVU A;  1KIK A;  1U3O A;  2DA9 A;  1M3A A;  1GBQ A;  3LH5 A;  1SPK A;  2K6D A;  1CKB A;  1X43 A;  2OI3 A;  2RQR A;  2YT6 A;  1WI7 A;  4J9H A;  1X2Q A;  2VVK A;  1AVZ C;  2C0O A;  2M51 A;  2MOX A;  2ABL A;  1NEG A;  3PVQ A;  3THK A;  2DRM A;  2RN8 A;  1T0J A;  2D0N A; 
#chains in the Genus database with same CATH topology
 1JXO A;  2RA2 A;  1VUB A;  3ER0 A;  2DIG A;  1YIT Q;  1UJY A;  2OTL Q;  1VQ5 A;  4J9E A;  2EQU A;  2PUK B;  4PFO A;  3GPL A;  4BE0 A;  4AFZ C;  1NBE B;  2K5L A;  1D0Z A;  3GIB A;  4PJM A;  1D1B A;  2RPN A;  1X75 C;  5IHN A;  1WXT A;  2IVW A;  3N5B B;  1S72 Q;  3MO8 A;  3M54 A;  4QKU A;  3VS1 A;  2MCN A;  1UJ0 A;  4RCB A;  5LJ5 j;  4F14 A;  1M27 C;  1XQH A;  3ZFJ A;  3CCQ T;  2OTJ Q;  1IGQ A;  2KXD A;  4KBM B;  1PSF A;  2CZ0 B;  2L3Q A;  3CC2 T;  4M78 C;  5IH2 A;  2J7I A;  2VWF A;  5AYF A;  2EIF A;  3DB4 A;  4N0A A;  4MDX A;  1WXB A;  1M3B A;  4A4F A;  5LJ5 e;  5I21 A;  2YUQ A;  2ZPF B;  2P4T A;  4OMM A;  4BB7 A;  3OYG A;  2FHD A;  4E6R A;  1D09 B;  4M77 C;  1NE8 A;  2VKN A;  1UHC A;  1NJI C;  1UGS B;  3G1J A;  4C92 F;  4HT9 A;  3HTR A;  2DF6 A;  5HCK A;  4LE9 A;  2JNG A;  3QJY A;  2CP5 A;  2E41 A;  2HL5 C;  2DXT A;  1SKU B;  5CKD A;  4PJO C;  5GAN 8;  2HKN A;  2COW A;  1YJ9 A;  3MET A;  3SWN B;  4JUV A;  5IXB A;  4LDX A;  2K5I A;  3G71 T;  3CBM A;  2VGM A;  5I22 A;  4E47 A;  4HA8 A;  4X9D A;  4HT8 A;  2QEX Q;  2O9S A;  3RNJ A;  1LJO A;  4DQ2 A;  3I55 T;  3O5Z A;  1KK7 A;  2PU9 B;  2QXF A;  2DO3 A;  1K0X A;  3NFC A;  3V7S A;  2EYX A;  2A3L A;  3CD6 A;  2EPD A;  3OQ5 A;  2FZK B;  2M0O A;  4JRP A;  1N9R A;  1TTH B;  3OMG A;  3CC7 Q;  2D0Q B;  1M90 U;  5J39 A;  4AFS C;  5CQY A;  3I56 T;  2LDM A;  1Q81 U;  4M7D C;  3EG0 A;  1C0M A;  1IRX A;  1ZUU A;  2FG0 A;  2H8H A;  1YJW Q;  3JB9 H;  5LJ5 h;  3CBP A;  3JAM E;  4AFQ C;  1IRE B;  1B3Q A;  4OB0 B;  3GNF B;  3V7C A;  3VUZ A;  1RLP C;  1MV3 A;  2DVJ A;  4J9I A;  4ZTJ A;  3FJP A;  5DLQ E;  1TS9 A;  3M4G A;  5GMK i;  4HCK A;  2X51 A;  3I5S A;  2G3R A;  2NWM A;  2BZY A;  4MZP A;  4M7A A;  2R5M A;  2KAF A;  4C8Q D;  3CC2 A;  3A8O B;  1WHL A;  4ESR A;  5CVI A;  1OU9 A;  3EGU A;  4JPB W;  1ZUK A;  2DX1 A;  3H6Z A;  2E10 A;  1I07 A;  4XU1 A;  2JOY A;  1VQ4 T;  4FW2 A;  1NPP A;  3VS0 A;  1LVK A;  2BTT A;  3PMT A;  1KQ1 A;  1I1J A;  1PG5 B;  5FU7 C;  4E7S A;  3H0I A;  1VQO T;  4QVD A;  1VQP Q;  1Q82 C;  3NPF A;  1UFF A;  1RAH B;  1GCP A;  2E6N A;  3JB9 D;  3VS6 A;  2A08 A;  4C92 C;  2DL7 A;  3QZ5 B;  2DE0 X;  2EYQ A;  4E2F B;  5LJ5 g;  5GMK j;  1Y0M A;  2CT4 A;  2D8H A;  3UF4 A;  2RH2 A;  4QVC A;  4M7A C;  1KD1 C;  2D8J A;  4CRI A;  4HCZ A;  1K1Z A;  4E7I A;  4M78 D;  1RAA B;  4ORZ A;  1M90 R;  2AKK A;  3C95 A;  2A36 A;  5IAY A;  1Q81 R;  1VQ8 Q;  3OB9 A;  4Z88 A;  4M77 D;  3G4S Q;  1MHN A;  1KQS P;  2D1X A;  1GBR A;  3JB9 J;  2OTJ T;  2MAM A;  1WHG A;  2FPD A;  1YN8 A;  2V8I A;  3JCM P;  5FW9 A;  2O01 E;  4QQD A;  3CCS A;  2O2O A;  2OX7 A;  1XTD A;  2HSE B;  1BYM A;  3CPW S;  1VQL T;  1BI2 A;  4PJO D;  4KH1 B;  2RQT A;  1X6G A;  1M1K R;  5KE2 A;  1KG1 A;  2DYB A;  3CCE Q;  4OB1 B;  2JVV A;  2RNA A;  3G6E T;  1KFZ A;  2CUB A;  5M9O A;  3SWN A;  3QPH A;  3A8L B;  2ZPI B;  1SG5 A;  3EHQ A;  4BI8 B;  2DBM A;  1GRI A;  3RR6 A;  3HPW A;  3A5Z B;  4LDY A;  3VS2 A;  3QYG B;  3EG1 A;  3L2Z A;  3WVD B;  3QZ9 B;  1R77 A;  4OMO A;  3VS7 A;  1WLP B;  5A0L A;  3E1S A;  3CCV Q;  5LJ5 f;  3KBG A;  1QP3 A;  3L2W A;  1AWO A;  1E6G A;  3CXC A;  4PNO A;  1Y96 B;  3L2R A;  1WIE A;  3OYN A;  2QA4 T;  1TU0 B;  3CCM Q;  1WJQ A;  2PQW A;  1M1F A;  5GMK h;  3QSU A;  5IN1 A;  2DIQ A;  2M16 A;  2CRE A;  4D8D A;  4OB3 B;  3S3M A;  4PLI A;  3X28 B;  1W70 A;  5KYX B;  3CC7 T;  2RK1 A;  4IUT A;  1VQN A;  2HCK A;  3NTK A;  4QQ6 A;  2YUN A;  4FM4 B;  4EIK A;  1YWP A;  2OJ2 A;  3QXE B;  2HBP A;  3RUX A;  1IZ6 A;  3KXT A;  1OPK A;  2Y90 A;  1FXX A;  4C8Q E;  1YIT A;  2OTL A;  2LCS A;  3TQ7 P;  1YJW T;  4J9C A;  3JCM c;  9ATC B;  1H92 A;  5A0G A;  4E7J A;  1X6B A;  1AZE A;  2KSS A;  1EFN A;  4PJJ A;  1V29 B;  1AWW A;  2GF7 A;  3I9Q A;  1G3S A;  2ZPG B;  2V1Q A;  2M02 A;  3M0P A;  1S72 A;  4FSX A;  1N5Z A;  2X4X A;  3J81 E;  1ARK A;  3V8L A;  2X4J A;  1VYU A;  4M78 B;  2KQW A;  1C1A A;  4IUU A;  2CS7 A;  3OYB A;  2OTJ A;  1YIJ Q;  1QVG P;  4OMN A;  2XID A;  5CKE A;  4RG8 A;  4RUG A;  2LQN A;  2ZPB B;  3H8Z A;  4C92 D;  1TG0 A;  1HYO A;  4M77 B;  5FRN A;  2L8D A;  4RTY A;  2CZ1 B;  2A37 A;  2P4R A;  3VKI A;  2A0F B;  4M78 E;  1G3W A;  1TSF A;  1U1S A;  4XU0 A;  4OMQ A;  2GNC A;  1M9S A;  2LQW A;  5D6Y A;  1AWJ A;  1K9M U;  1RI9 A;  5AT1 B;  1N9S A;  3CPF A;  2EJF A;  4JDS A;  4HVU A;  4PJO B;  1VQP T;  2AT1 B;  1KIK A;  3HKS A;  4IUV A;  4M77 E;  1GBQ A;  2K6D A;  1X43 A;  3CCR T;  2VXF A;  1WI7 A;  1N6A A;  4ELZ C;  4O5V A;  1AVZ C;  2C0O A;  2E1H A;  2PVG B;  2M51 A;  2MOX A;  3V8K A;  5I2S A;  2VUB A;  2WSF E;  2QG9 B;  2DRM A;  1T0J A;  1WHK A;  4RKU E;  4XU2 A;  3NTI A;  1DJ7 B;  2QEX A;  4PJO E;  2K4Y A;  5CKF A;  2JM9 A;  2GTJ A;  3RMS A;  4JRI A;  2RMO A;  1RAC B;  1ZQ1 A;  3G71 Q;  1VQ8 T;  1V1C A;  1QLY A;  2XIC A;  1B07 A;  3URG A;  3G4S T;  3CC7 A;  4HCB A;  4Q5W A;  4JJD A;  4BDY A;  3I55 Q;  2MK5 A;  2KGT A;  2PTK A;  2SEM A;  1HD3 A;  1M90 C;  1GFD A;  1K9A A;  2CP7 A;  3V8J A;  1K73 U;  1YJW A;  1Q81 C;  1VQ7 T;  2LQ8 A;  4PFZ A;  1WJS A;  1WXU A;  3I56 Q;  2ED0 A;  1QVF P;  2AZS A;  4JJB A;  2FZC B;  2E3I A;  3CCE T;  2YDL A;  2XD0 A;  1M2O A;  4JZ3 A;  1GXI E;  4JJC A;  3X20 B;  2W10 A;  1VQM T;  1SEM A;  3C4S A;  3CQT A;  1WA7 A;  4HVV A;  5LJ3 d;  3TU4 K;  3J7A F;  3EGX B;  1E7O A;  2O4X B;  1Y96 A;  2E4H A;  2GTO A;  1YBY A;  2H3J A;  5GAN 5;  2RQV A;  3INZ A;  1RAE B;  3H9N A;  1U5S A;  5GAO q;  3MKD A;  2O31 A;  4TVR A;  3TVT A;  2EGA A;  1QVF S;  4Y92 A;  3A1P A;  3HRU A;  1UTI A;  1K9M R;  2VGN A;  2IIM A;  3TRE A;  1YHQ T;  2CKK A;  1XNI A;  3CCM T;  3OYM A;  4L59 A;  5FU6 C;  3EAE A;  2W0Z A;  2EYZ A;  2RHI A;  1KSW A;  4JRK A;  4BY6 B;  3DLL A;  4C92 B;  3L2Q A;  1IB8 A;  1OPL A;  2JTM A;  4QT7 A;  4F7U B;  5C0M A;  1RAI B;  1OZ3 A;  1Z9Q A;  2BE7 D;  4RTZ A;  1YJN Q;  1MGQ A;  3OYE A;  2A7Y A;  2VB6 A;  2JJ9 A;  2GQV A;  3A8G B;  1B7T A;  2PVD B;  3EHR A;  5GAO r;  4C8Q C;  1TXQ A;  4IUP A;  4M78 A;  1QCF A;  5HK3 A;  1D3B B;  2FRY A;  4PK4 A;  3OY9 A;  2JS2 A;  2DL4 A;  1RAB B;  3VUB A;  1JJ2 P;  2P0Q A;  4J9F A;  3G4S A;  2K3B A;  2EKH A;  4M77 A;  2BUD A;  1K73 R;  2DL3 A;  3VV0 A;  1YI2 A;  3OSV A;  4E7K A;  1I8F A;  1YIJ T;  4ZTF A;  2XDD A;  1WX6 A;  3E19 A;  5GAN e;  2KT1 A;  1NG2 A;  2JW4 A;  1WHM A;  5L8R E;  4PJO A;  5CR2 A;  2L2P A;  2B86 A;  4LUD A;  4FSS A;  3CC4 T;  3NMZ C;  2VYT A;  1WQ7 A;  4X1V A;  1OYX A;  2KT8 A;  2QGF B;  3CCE A;  1JJ2 S;  1SHG A;  2XU8 A;  3TEE A;  4C5I A;  3TSZ A;  2RJD A;  3EG3 A;  1BI0 A;  4KUL A;  1VQL Q;  1M30 A;  4M75 G;  2JT4 A;  2CP2 A;  2DVE A;  4DOW A;  4DBF A;  1H3H A;  2CUD A;  4C0F A;  5KYN A;  2XG8 D;  1MMG A;  1W2B A;  2XK0 A;  3HSB A;  1JO8 A;  1T0H A;  3JCM e;  3MP1 A;  3G6E Q;  3CCV A;  2XHC A;  4EDU A;  1PKS A;  2YHT A;  1YCS B;  1VYT A;  1TUG B;  4M7D A;  2NUZ A;  3WVE B;  3M56 A;  2NUP B;  1PC0 A;  3EFR A;  3OW2 P;  5GAN 7;  4AT1 B;  1UE9 A;  1WHJ A;  4MZT A;  5FRO A;  4BDZ A;  2MPX C;  3OYI A;  2K79 A;  4FYW B;  4HKE A;  4A54 A;  3BFM A;  3S3O A;  3WXM B;  2RJF A;  2X3X D;  2XMF A;  1S1N A;  3AT1 B;  2QTX A;  1I0C A;  3CEY A;  2QA4 Q;  4OVA A;  2EYY A;  1YCY A;  1X27 A;  1M8V A;  1OEB A;  1YWO A;  5GAN d;  1EZZ B;  3L42 A;  3QDR B;  5A0D A;  2RM4 A;  1ZA1 B;  2EVR A;  4RG2 A;  2YLC A;  3EGX A;  5KYW B;  2LQK A;  3OW2 S;  1KC8 R;  2O4X A;  2MYS A;  5CO7 A;  3E2U A;  3CCL Q;  3M57 A;  2KEA A;  5IXF A;  2LX7 A;  2HMA A;  2WSE E;  1FYN A;  4J6W A;  4V2S A;  2JM8 A;  4AFU C;  1FMK A;  3EGD B;  1N27 A;  1QP2 A;  4ELY C;  1BIA A;  1OV3 A;  2RB6 A;  2CSI A;  3JCM d;  4JS5 A;  4L6V 5;  2MI6 A;  1AHJ B;  2K2V A;  5CKB A;  4CC7 A;  2Z0W A;  3CME T;  3OBY A;  5GAN 6;  4IKF A;  3QDF A;  3OYA A;  2KBT A;  1D1A A;  1WQW A;  2QI2 A;  2RJE A;  1IO6 A;  1XJW B;  1ZBJ A;  4BE1 A;  1M1K U;  3QG1 A;  4EPC A;  4C92 A;  3FJ5 A;  1Q7Y R;  4BE2 A;  2DL5 A;  4F7U A;  2DER A;  1JQQ A;  2CYZ B;  3CCQ A;  4JRQ A;  4F04 B;  5GAO p;  2DK3 A;  4PLL A;  4ZGJ B;  2K3X A;  1UG1 A;  1IGU A;  2LRQ A;  4Z89 A;  5EG2 A;  1SRM A;  4OGE A;  2E5Q A;  2DD5 A;  3M0U A;  2DD4 A;  2QQA A;  5CCA A;  2NYS A;  2QTV A;  1U1T A;  5C6S A;  1D3B A;  1K9M C;  2HAX A;  2DPP B;  1BIB A;  2DAQ A;  2LCC A;  1BU1 A;  1YJN T;  3RES A;  4RCC A;  2DXB A;  3LGL A;  4A4K A;  1GL5 A;  2VAS A;  4DEY A;  4XU3 A;  4BI3 A;  2VXE A;  4RMO A;  2FYK A;  2RO0 A;  4BY6 C;  3VJP A;  2ROT A;  3CCR Q;  2RQW A;  4PJL A;  4LDW A;  1AZG B;  3NHN A;  5CQX A;  3G71 A;  1AEY A;  5KH6 A;  2KY9 A;  3Q1J A;  4XTX A;  4D6W A;  3I55 A;  3CPW P;  3RMQ A;  3F70 A;  5IT9 E;  1PSE A;  3TSW A;  1ABQ A;  3UPU A;  4KH0 B;  1KHC A;  1ZUY A;  3JRZ A;  2ENM A;  3PFS A;  3JB9 G;  4GLM A;  2QAS A;  3L2U A;  3OS0 A;  1WDX A;  4VUB A;  4GBQ A;  2JZ2 A;  5GAO l;  1VOM A;  2EGC A;  3I56 A;  1K73 C;  5GAN 4;  4BI4 A;  2C06 A;  2V26 A;  1NEB A;  1M8M A;  4M78 G;  1AOJ A;  2LVM A;  2KYM A;  1UDL A;  2YRD A;  5GAN 3;  2JUF A;  1PNJ A;  1JEG A;  1OX8 A;  1VQ9 T;  3LYI A;  2K9G A;  3CCU T;  1VQ7 Q;  1JRI A;  3C94 A;  4ATO A;  2NUP A;  3OYC A;  3JCM Q;  3OSS C;  4EMK B;  4M77 G;  4EMG A;  1VQM Q;  1KHI A;  3HP9 A;  1CKB A;  4KUD K;  2R57 A;  2RQR A;  5FU6 B;  4J9H A;  5GAM e;  1NEG A;  4PJO G;  4M75 F;  2RN8 A;  3QKJ A;  1ZBX A;  2D0N A;  1R0B G;  1WFW A;  1Z9Z A;  3QO3 A;  5HKC A;  2DRK A;  3REA B;  3VRY A;  5KYW A;  1G83 A;  1JB0 E;  4N4H A;  1YHQ Q;  3S6W A;  4EMH A;  2WSC E;  1VQ4 A;  1TOV A;  2EW3 A;  2EGE A;  3H41 A;  4Z02 A;  4OB2 B;  3JCM J;  5KYY B;  2AK5 A;  1BBZ A;  2LNH B;  1BI3 A;  2ATC B;  4C8Q B;  1T3L A;  2X3W D;  1Q95 G;  2J6F A;  1EX4 A;  3EGD A;  1AT1 B;  3P8H A;  2KMT A;  3UWN A;  1VQO A;  3MJX A;  5FWC A;  2EQM A;  2HD0 A;  1PKT A;  2LCL A;  3CCL T;  2RI2 A;  3X26 B;  1M3C A;  4K11 A;  3PIO A;  4DBR A;  4DOV A;  4M7D G;  1MND A;  3P8D A;  1YJ9 Q;  1RAD B;  4C5E A;  4PKC C;  1VQK Q;  4RTX A;  2F5K A;  3M58 A;  2HDA A;  3SFM A;  2GQI A;  1NYF A;  1GCQ C;  1FWZ A;  1I81 A;  4KUI A;  3CCJ T;  1K8A U;  3MHX A;  2CZ6 B;  2HSP A;  5DM7 R;  1MV0 B;  1KC8 C;  2V1R A;  1RL2 A;  2FVU A;  2M0Y A;  2BZX A;  1FX7 A;  2E64 A;  2FB7 A;  2JTF A;  1YNZ A;  6AT1 B;  5GAM d;  4QW2 A;  2VV5 A;  2XI9 A;  2HQE A;  4XK8 E;  2J6O A;  2F2W A;  4KRT A;  4IIO A;  3DKM A;  2SRC A;  1OU8 A;  5FLX E;  2IG0 A;  1W6X A;  4FU6 A;  1HK9 A;  2YXY A;  3HRS A;  4ZN3 A;  2RJC A;  2JN0 A;  4OGC A;  2EQI A;  3JSC A;  1VQL A;  2HEQ A;  4FYX B;  2XDB A;  1WYX A;  3KFV A;  3CC4 Q;  1NM7 A;  3MEU A;  5LJ3 j;  3ZEH A;  1XOV A;  2F2X A;  1Q7Y C;  1K4U S;  3G6E A;  4J7I A;  3X24 B;  5GJW B;  4C0D C;  3SB2 A;  3E9G A;  3PTA A;  4X34 A;  1SHF A;  1G5V A;  3H0H A;  1C6V X;  2FRW A;  1UGP B;  2COY A;  5LJ3 e;  1QW1 A;  3SEM A;  3BY7 A;  2KK4 A;  4C92 G;  4X9C A;  3OYL A;  4F7U G;  2HQH A;  3DB3 A;  2BZ8 A;  4XTU A;  4M7A G;  2ROL A;  4D8K A;  2C0T A;  3M5A A;  2EJ9 A;  5CK9 A;  2QA4 A;  2MIO A;  1RAG B;  2LJ1 A;  2LNV A;  8ATC B;  2CSQ A;  2D6F A;  1R8O B;  2BIV A;  3PE0 A;  2B8A A;  4ZGE B;  4WCI A;  3M59 A;  5KCO A;  2QQS A;  2CDT A;  2J05 A;  4J9D A;  4OMF B;  8AT1 B;  1OZ2 A;  2CGH A;  3BE3 A;  2G6F X;  2C0I A;  4AG2 C;  1H3Z A;  1K8A R;  3M0S A;  4EMK A;  1Y57 A;  4E7L A;  4CI0 C;  1E6H A;  1QKW A;  2VC8 A;  3PIP A;  2ED1 A;  3CMA T;  5FRM A;  2MWO A;  4GY5 A;  4M4Z A;  1VQ5 T;  1Y71 A;  3QUI A;  5ECA A;  2QDL A;  2DTH A;  3UDC A;  4O6J A;  4PL6 A;  2AKL A;  5GMK l;  1ZSZ B;  2CP3 A;  2YLB A;  1R0C B;  5D7U A;  3QBY A;  3RER A;  4DBQ A;  1V76 A;  2MWP A;  2FPF A;  5LJ3 h;  1UEB A;  3EG2 A;  4N4G A;  1J3T A;  3PGG A;  2KDS A;  2GFU A;  2YRC A;  2RK2 A;  2XKO C;  1VYV A;  5KYY A;  3CME Q;  1M1K C;  2LP5 A;  5I11 A;  4C8Q A;  4A4G A;  1QVP A;  1VQ6 Q;  2WAC A;  4Y91 A;  3CBO A;  3C12 A;  2I2L A;  4EMK C;  4MDW A;  4E7H A;  5KYX A;  2J6K A;  1JU5 C;  2KXC A;  2GFA A;  3RKX A;  3FEO A;  1ACM B;  2F69 A;  5CAI A;  4CC2 A;  2L0A A;  2QGG A;  2DNU A;  1VQP A;  2KI7 A;  2ZCF B;  3CXC P;  3KUF A;  1ABO A;  3FIF A;  3CCR A;  1RUW A;  1M5Q 1;  2K5F A;  2YUO A;  3PT9 A;  1BK2 A;  1YJ9 T;  2EJG A;  1VQK T;  3OBW A;  1D0X A;  1Q86 U;  1SRL A;  4RTT A;  2QDY B;  3UA6 A;  3UAT A;  4QQG A;  3MP6 A;  3D7S B;  2L89 A;  3M0T A;  4FL6 A;  4PJN A;  1MMA A;  5LJ3 g;  1KD1 R;  3RDV A;  2RI3 A;  3CXC S;  4PFP A;  3CD6 T;  4C5G A;  1VQ8 A;  5GAN j;  1KC8 U;  4ME7 A;  4M7D F;  2ECZ A;  2HQX A;  2E70 A;  2LC4 A;  3I5R A;  4C5H A;  2K57 A;  4J5Y A;  1FMV A;  3ZL7 C;  5EC7 A;  4E7Z A;  1W4S A;  3C0C A;  1UHF A;  1KQS A;  1VA7 A;  3E9F A;  1VQ7 A;  3UT1 A;  4KT0 E;  4B9W A;  2DJZ A;  2KRM A;  4FT4 A;  1PM3 A;  5A2Q E;  4HVW A;  4WTO B;  4M75 D;  2DEU A;  1LPL A;  1KJW A;  1VQM A;  3UA7 A;  1Q7Y U;  2K7A A;  4LD6 A;  1WJR A;  1UUE A;  1VQ9 Q;  1GFC A;  3CCU Q;  2AHJ B;  5GAO n;  4J6Y A;  2ZPH B;  4XTW A;  2O88 A;  1PD1 A;  2YUP A;  4RTV A;  4RTU A;  1PCX A;  3OYY A;  2DZC A;  2DJQ A;  2FEI A;  4CC4 B;  2I0N A;  3QHS A;  3V7R A;  5GJV B;  2QQ9 A;  2JS0 A;  3EFS A;  1ZSG A;  4BAC A;  2F5T X;  5IHI A;  5FWB A;  4DEX A;  4ANJ A;  1VIF A;  1YHQ A;  2RQU A;  3CCM A;  4XAX B;  2PVO B;  2EFI A;  2P84 A;  4J9B A;  2FZG B;  2F2V A;  4OF1 A;  2E65 A;  5LJ3 f;  3R6N A;  1NLO C;  2HL3 A;  1UB4 A;  3HFO A;  4GLK A;  3SDZ A;  3GOX A;  3I35 A;  4NL3 A;  1QCO A;  1Q86 R;  5D6X A;  5HY6 A;  4F7U F;  2LT4 A;  3SHW A;  4M7A F;  1ZSZ A;  4B9X A;  1I5L A;  1I5O B;  3TCJ A;  1WNL A;  4A4E A;  5GAN h;  2RF0 A;  1VQK A;  3JV3 A;  4LDV A;  1SF9 A;  3VS4 A;  3OMC A;  3REB B;  2MMP A;  5KYU B;  3M0Q A;  3QYH B;  3FRN A;  1Y7X A;  1PWT A;  3HHT B;  4N0A C;  2JMC A;  2JXB A;  4ZNX A;  1NLP C;  2YRV A;  1PRL C;  4J6X A;  1K8A C;  2CP0 A;  3ME9 A;  3MEA A;  4XTZ A;  3JCM X;  2RI5 A;  1WHH A;  3CCJ Q;  2DA9 A;  3G7Z A;  1M3A A;  3EH1 A;  3JCM h;  1YIJ A;  3GP8 A;  1X2Q A;  3CCS T;  3A8M B;  3MCA B;  3QJ6 A;  1VQ6 T;  2ABL A;  3BW1 A;  2DXU A;  1ZSZ C;  5LJ5 d;  3FDR A;  4FIB A;  3CC4 A;  3S3N A;  4C0D B;  1BI1 A;  4A63 B;  2KYB A;  1QCN A;  4LUE A;  3VRZ A;  2EQK A;  1QVG A;  2E5K A;  4R0K A;  3PVL A;  2JMA A;  1G3T A;  1OX9 A;  5GAO m;  2DZ9 A;  2HBW A;  4KGZ B;  4XQ3 A;  4WF2 A;  4MMK A;  1OOT A;  1MUZ A;  2Y4X A;  3LH0 A;  3BDL A;  5GAN g;  2ZGW A;  3EG9 B;  4M75 B;  3JCM W;  1HXD A;  2QAZ A;  5GAN 2;  3RKY A;  1NZ9 A;  4MML A;  4AG1 C;  4J9G A;  4C8Q G;  4DBH A;  3OYF A;  2QQR A;  3P8B B;  3M55 A;  2AZV A;  1N8R U;  3QWY A;  3PMI A;  4ZGD B;  3EH2 A;  4CC3 A;  4M75 E;  2O9V A;  2LTO A;  2RHZ A;  3MP8 A;  1ZHI A;  3JCM g;  1MMD A;  4B6M A;  1YP5 A;  1QKX A;  1F1B B;  4MZM A;  5J3B A;  5IHK A;  1VQN T;  1G2B A;  3OS2 A;  3LGF A;  3OYJ A;  1KQ2 A;  2EYW A;  3DLM A;  5L23 A;  1BB9 A;  3RBB B;  3U23 A;  1VIE A;  2BKD N;  2P0P A;  2PZ1 A;  1YIT T;  2OTL T;  1RAF B;  2Y4Y A;  3R6O A;  2KNB B;  3OYH A;  2R5A A;  3FB9 A;  4C0Z A;  2LT1 A;  3NGP A;  1TUD A;  5GMK e;  4LD9 K;  3CMA Q;  1X2K A;  1VQ5 Q;  1SSF A;  2DIL A;  1S72 T;  4IIM A;  2DLP A;  2L3S A;  1OQK A;  2JTE A;  1LCK A;  3A8H B;  3ZBD A;  1QVF A;  5DY9 A;  2DEQ A;  3QII A;  1YI2 Q;  2NLU A;  5GAN f;  1O9S A;  5GAM j;  3CME A;  3L2V A;  1AWX A;  3ULR B;  4OP0 A;  4JS4 A;  5DLO A;  4LXC A;  2RHU A;  2X4W A;  4Z8A A;  4A4H A;  3ASK A;  1VQ6 A;  4OML A;  4J7F A;  3OA6 A;  3GF5 A;  2CZ7 B;  4C0G A;  3MEV A;  1HSQ A;  3OS1 A;  2X4Y A;  2CH4 A;  2ESW A;  4N4I A;  1U8R A;  2K3Y A;  3LW5 E;  1W2B P;  1RI0 A;  2KRO A;  1PD0 A;  1UGQ B;  4L5G A;  1X6O A;  1GCQ A;  1KQS S;  4XTY A;  2DMO A;  1AD5 A;  1NYG A;  1PHT A;  2YWW A;  2P0K A;  3JCM f;  2DBK A;  5KYU A;  1P92 A;  1NJI U;  2KR3 A;  1K76 A;  1G8X A;  4HXJ A;  2PUO B;  1NPR A;  1PRM C;  1QWE A;  1YJN A;  2COZ A;  3SD4 A;  1N8R R;  3L1A A;  2EBP A;  2D9T A;  4FCY A;  4JJN K;  1W2B S;  1WPY A;  5KCH A;  4M7D D;  1BKB A;  2QYZ A;  4AMC A;  4IUR A;  2QEX T;  5KE3 A;  2M1H A;  2XDP A;  1ZLM A;  3VS3 A;  2BE9 B;  1BCO A;  4J83 A;  4FYY B;  1Q86 C;  1B34 B;  2LJ0 A;  4Y28 E;  3M0R A;  3MEW A;  2DTO A;  3GBQ A;  1QQJ A;  1O75 A;  4OMP A;  3SWN C;  1M2V B;  3LLR A;  2CT3 A;  1CKA A;  2F1L A;  2FL7 A;  2J06 A;  3IQL A;  3CD6 Q;  2LJ3 A;  1JJ2 A;  2LMJ A;  2KVQ G;  4JLG A;  4QVZ A;  1OI1 A;  3O8V A;  5GAM h;  2DXC A;  2M9U A;  2MF2 A;  3EG9 A;  1H64 1;  3M4Y A;  4YTL A;  4M75 A;  1IHV A;  2KRS A;  2ZZD A;  2A28 A;  2EQJ A;  2AIR B;  1VQ9 A;  4FW1 A;  3CCU A;  2DKG A;  3EFO B;  3JCM V;  3FC3 A;  3PNW C;  4A53 A;  1LOJ A;  4IUQ A;  5J26 A;  2HZY A;  2LZ6 B;  2NUT B;  2L3P A;  5GMK m;  2R58 A;  1D0Y A;  2X9H A;  2GCX A;  3QWX X;  2FO0 A;  3RKW A;  2OAW A;  3X25 B;  3HL8 A;  3M53 A;  3CCQ Q;  1NJI R;  4M7A D;  1IXD A;  2IPO B;  5HK0 A;  3CC2 Q;  1MMN A;  1A0N B;  4NL2 A;  1JBM A;  1M1G A;  7AT1 B;  3OS5 A;  2E6Z A;  1LNX A;  1U06 A;  4M75 C;  2EWN A;  2RHY A;  1FMW A;  2DL8 A;  1QVG S;  3HRT A;  1TWB A;  2CH4 W;  3OW2 A;  1WGS A;  3JB9 I;  1Q82 U;  3NTH A;  4ZN1 A;  4C8Q F;  3OYK A;  1OUL A;  5GAM g;  4UC4 A;  1SSH A;  3LWH A;  1IHW A;  2HNI A;  4LN2 A;  4HCC A;  1T3S A;  3CCL A;  1KD1 U;  2E12 A;  1K0S A;  2DM1 A;  1QWF A;  4RTW A;  2EKO A;  3GLX A;  3VYG A;  2H3E B;  3H0F A;  3T9N A;  3CCJ A;  4M7D B;  3HFN A;  4P5N A;  1Y07 A;  4NOY A;  1YI2 T;  3GNG A;  3JB9 F;  2DYI A;  2HKQ B;  3LX7 A;  2GBQ A;  4JLI A;  1UGR B;  5D6W A;  2OAU A;  1CSK A;  3VS5 A;  1BCM A;  3BDU A;  1MNE A;  3VYH B;  1UEC A;  3M9Q A;  1RLQ C;  2E3H A;  2YSQ A;  4KGX B;  2FPE A;  4M78 F;  2QK0 A;  4M7D E;  2RHX A;  1H8K A;  1QMC A;  4II1 A;  1TUC A;  3CCS Q;  1UGV A;  4JZ4 A;  2V8K A;  4BD3 A;  2DET A;  2RD1 A;  2DTI A;  2KE9 A;  1X69 A;  4F16 A;  5LL6 S;  4XTV A;  1WZO A;  4M77 F;  3AHU A;  3JCM b;  5I2M A;  1TH7 A;  2KRN A;  2DFU A;  2L5Q A;  3LWI A;  2X35 A;  1JXM A;  2QQB A;  1B34 A;  3FLG A;  3CCV T;  1G3Y A;  1I4K 1;  1EIF A;  2CP6 A;  5GAM f;  4J8O A;  1ZX6 A;  4LNP A;  4PJO F;  2LX9 A;  1X01 A;  2GGR A;  4BUG A;  3J80 E;  1M2V A;  3A98 A;  2V8J A;  1HJD A;  5CIU A;  5FU7 B;  2ZAE A;  1Q82 R;  1ZA2 B;  2K2M A;  5CKH A;  1D1C A;  1N8R C;  3RIR A;  2ZPE B;  4R55 A;  2PNI A;  1VQ4 Q;  4F17 A;  1W1F A;  3OYD A;  4LDU A;  4M7A B;  1U3O A;  2L3R A;  1M4Z A;  3LH5 A;  1SPK A;  2EAY A;  4R56 A;  4FT2 A;  2OI3 A;  4DA4 A;  1VQO Q;  4NS5 A;  2YT6 A;  3EFO A;  1YFN A;  4FYV B;  2VVK A;  3MPU B;  4C92 E;  3CPW A;  4KGV B;  1VQN Q;  3PVQ A;  4F7U E;  3THK A;  3VU3 C;  2NUT A;  4M7A E;  3CMA A; 
#chains in the Genus database with same CATH homology
 4A63 B;  1JXO A;  1Z9Z A;  2KYB A;  2JM9 A;  4LUE A;  3VRZ A;  1UJY A;  2GTJ A;  4J9E A;  2E5K A;  2DRK A;  3REA B;  4R0K A;  3VRY A;  3PVL A;  1G83 A;  2JMA A;  2RMO A;  4AFZ C;  2EW3 A;  2EGE A;  3H41 A;  2AK5 A;  2HBW A;  1V1C A;  1QLY A;  1BBZ A;  1B07 A;  2LNH B;  1OOT A;  1T3L A;  2X3W D;  1MUZ A;  2J6F A;  4JJD A;  2RPN A;  5IHN A;  1WXT A;  2KGT A;  2PTK A;  2SEM A;  5FWC A;  3VS1 A;  2MCN A;  1PKT A;  1UJ0 A;  1HD3 A;  1GFD A;  4F14 A;  1M27 C;  1K9A A;  1M3C A;  4K11 A;  4AG1 C;  4J9G A;  2KXD A;  2L3Q A;  5IH2 A;  2J7I A;  2VWF A;  1WXU A;  2ED0 A;  2AZV A;  4RTX A;  2HDA A;  1WXB A;  2AZS A;  4JJB A;  2GQI A;  1M3B A;  1NYF A;  1GCQ C;  2YDL A;  3QWY A;  4JZ3 A;  4CC3 A;  4JJC A;  2O9V A;  2W10 A;  1SEM A;  4HVV A;  2YUQ A;  1WA7 A;  3CQT A;  4OMM A;  2HSP A;  1MV0 B;  4E6R A;  2V1R A;  1YP5 A;  1E7O A;  2VKN A;  1UHC A;  1QKX A;  2M0Y A;  2BZX A;  2GTO A;  5IHK A;  1YNZ A;  1G2B A;  2RQV A;  2DF6 A;  5HCK A;  1U5S A;  2EYW A;  4LE9 A;  5L23 A;  1BB9 A;  2J6O A;  2F2W A;  4KRT A;  3RBB B;  3U23 A;  2O31 A;  4IIO A;  3TVT A;  2EGA A;  2PZ1 A;  2SRC A;  4Y92 A;  1UTI A;  1W6X A;  2IIM A;  2KNB B;  2EQI A;  5IXB A;  2HEQ A;  2W0Z A;  3NGP A;  2EYZ A;  1WYX A;  5I22 A;  3KFV A;  1TUD A;  1NM7 A;  1KSW A;  1X2K A;  2O9S A;  3RNJ A;  3O5Z A;  1XOV A;  2F2X A;  1K4U S;  2DIL A;  1K0X A;  4IIM A;  2DLP A;  2EYX A;  2L3S A;  5GJW B;  1OPL A;  2JTE A;  4QT7 A;  2EPD A;  1LCK A;  1Z9Q A;  1AWX A;  3ULR B;  1SHF A;  4RTZ A;  3H0H A;  4Z8A A;  2FRW A;  3SEM A;  4AFS C;  4OML A;  3EHR A;  1HSQ A;  2CH4 A;  2ESW A;  2BZ8 A;  1QCF A;  3EG0 A;  2FG0 A;  1ZUU A;  2ROL A;  2H8H A;  2FRY A;  2KRO A;  4D8K A;  2C0T A;  1GCQ A;  4AFQ C;  2JS2 A;  2DL4 A;  2DMO A;  1AD5 A;  1B3Q A;  1NYG A;  1PHT A;  2MIO A;  1RLP C;  1MV3 A;  2LJ1 A;  2DVJ A;  2CSQ A;  4J9F A;  2K3B A;  4J9I A;  2EKH A;  2DBK A;  2DL3 A;  2KR3 A;  1K76 A;  3PE0 A;  4WCI A;  4HXJ A;  1PRM C;  1QWE A;  2CDT A;  2J05 A;  4J9D A;  1WX6 A;  4HCK A;  2G6F X;  2C0I A;  4AG2 C;  3I5S A;  2EBP A;  2KT1 A;  1NG2 A;  2NWM A;  2BZY A;  3M0S A;  2JW4 A;  1Y57 A;  1E6H A;  1QKW A;  2L2P A;  2B86 A;  4LUD A;  4FSS A;  4ESR A;  2ED1 A;  3EGU A;  3NMZ C;  1ZUK A;  4JPB W;  2DX1 A;  1ZLM A;  4X1V A;  2KT8 A;  1I07 A;  3VS3 A;  4M4Z A;  1SHG A;  5ECA A;  2QDL A;  3TSZ A;  2LJ0 A;  3EG3 A;  3M0R A;  1M30 A;  2AKL A;  3VS0 A;  2JT4 A;  3GBQ A;  1H3H A;  2BTT A;  2CUD A;  4OMP A;  1I1J A;  2CT3 A;  1JO8 A;  1T0H A;  1CKA A;  3H0I A;  2FPF A;  3EG2 A;  3NPF A;  1UFF A;  2J06 A;  1GCP A;  3IQL A;  1J3T A;  2LJ3 A;  1PKS A;  2A08 A;  3VS6 A;  1YCS B;  1VYV A;  2LMJ A;  2DL7 A;  1VYT A;  2LP5 A;  5I11 A;  2DE0 X;  2NUZ A;  1Y0M A;  2CT4 A;  2D8H A;  3UF4 A;  2D8J A;  2KRS A;  1K1Z A;  2A28 A;  2J6K A;  1UE9 A;  1JU5 C;  2KXC A;  4ORZ A;  2K79 A;  2AKK A;  2X3X D;  2XMF A;  2A36 A;  1S1N A;  4CC2 A;  1I0C A;  2EYY A;  2L0A A;  1X27 A;  2DNU A;  1OEB A;  1YWO A;  4Z88 A;  2LZ6 B;  2D1X A;  1GBR A;  2EVR A;  2L3P A;  1ABO A;  1RUW A;  2FPD A;  1YN8 A;  2FO0 A;  3QWX X;  5FW9 A;  2OAW A;  2YUO A;  2O2O A;  1BK2 A;  2KEA A;  5IXF A;  1SRL A;  2LX7 A;  4RTT A;  1FYN A;  2RQT A;  2JM8 A;  1X6G A;  4AFU C;  1FMK A;  3UA6 A;  3UAT A;  1A0N B;  1U06 A;  2DYB A;  3M0T A;  1OV3 A;  2DL8 A;  2RNA A;  2CSI A;  1KFZ A;  2CUB A;  2CH4 W;  4CC7 A;  3EHQ A;  2DBM A;  2ECZ A;  1GRI A;  2KBT A;  1IO6 A;  1ZBJ A;  3I5R A;  1SSH A;  3VS2 A;  3EG1 A;  1WFW A;  3ZL7 C;  3FJ5 A;  4OMO A;  3VS7 A;  4LN2 A;  1WLP B;  5EC7 A;  2DL5 A;  1T3S A;  1JQQ A;  1AWO A;  1E6G A;  3C0C A;  1UHF A;  1VA7 A;  1WIE A;  1K0S A;  2KRM A;  1UG1 A;  2DM1 A;  1QWF A;  4RTW A;  4Z89 A;  4HVW A;  1SRM A;  3H0F A;  3M0U A;  1KJW A;  2CRE A;  3UA7 A;  2K7A A;  4D8D A;  1UUE A;  1GFC A;  1W70 A;  1BU1 A;  2GBQ A;  2O88 A;  1GL5 A;  2HCK A;  1CSK A;  2YUP A;  4RTV A;  4RTU A;  3VS5 A;  1UEC A;  2YUN A;  1RLQ C;  4EIK A;  1YWP A;  2DJQ A;  2OJ2 A;  2FEI A;  4CC4 B;  2YSQ A;  2I0N A;  4DEY A;  1OPK A;  2FPE A;  5GJV B;  1H8K A;  2ROT A;  2JS0 A;  1ZSG A;  2LCS A;  1TUC A;  5FWB A;  5IHI A;  4J9C A;  2RQW A;  1UGV A;  4DEX A;  4JZ4 A;  1AZG B;  3NHN A;  2RQU A;  1H92 A;  2KE9 A;  1X6B A;  1AZE A;  1X69 A;  1EFN A;  1AEY A;  4F16 A;  1AWW A;  4J9B A;  2F2V A;  3R6N A;  1NLO C;  2KRN A;  3I9Q A;  2V1Q A;  3M0P A;  3TSW A;  3I35 A;  1JXM A;  1ABQ A;  1N5Z A;  1ARK A;  1ZUY A;  1VYU A;  2ENM A;  4GLM A;  1ZX6 A;  3SHW A;  4LNP A;  4OMN A;  2GGR A;  1WDX A;  4RUG A;  2RF0 A;  4GBQ A;  3A98 A;  2LQN A;  2EGC A;  3JV3 A;  3VS4 A;  1HJD A;  1TG0 A;  3REB B;  1NEB A;  1M8M A;  3M0Q A;  4RTY A;  1AOJ A;  1PWT A;  2A37 A;  2JMC A;  2P4R A;  2K2M A;  2KYM A;  1UDL A;  1JEG A;  1PNJ A;  2JXB A;  4ZNX A;  1NLP C;  1PRL C;  2K9G A;  4OMQ A;  2GNC A;  2LQW A;  1AWJ A;  2PNI A;  1RI9 A;  4F17 A;  1W1F A;  4HVU A;  1KIK A;  1U3O A;  2DA9 A;  1M3A A;  1GBQ A;  3LH5 A;  1SPK A;  2K6D A;  1CKB A;  1X43 A;  2OI3 A;  2RQR A;  2YT6 A;  1WI7 A;  4J9H A;  1X2Q A;  2VVK A;  1AVZ C;  2C0O A;  2M51 A;  2MOX A;  2ABL A;  1NEG A;  3PVQ A;  3THK A;  2DRM A;  2RN8 A;  1T0J A;  2D0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...