2M02A

3d structure of cap-gly domain of mammalian dynactin determined by magic angle spinning nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin subunit 1
publication title Three-Dimensional Structure of CAP-Gly Domain of Mammalian Dynactin Determined by Magic Angle Spinning NMR Spectroscopy: Conformational Plasticity and Interactions with End-Binding Protein EB1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2m02A00
2CP7A 2HKQB 1WHGA 1WHKA 2E3HA 2CP0A 1WHHA 1WHLA 1WHMA 2CP6A 2HKNA 1TXQA 2HQHA 2MPXC 3TQ7P 2M02A 1WHJA 2CP3A 1IXDA 1LPLA 2CP5A 2CP2A 4B6MA 2HL5C 1TOVA 2E4HA 2Z0WA 2QK0A 2COYA 3RDVA 2COZA 2E3IA 3E2UA 2HL3A 2COWA
chains in the Genus database with same CATH superfamily
3H0FA 3CPWS 1M2VB 1T3LA 2JVVA 3CD6T 1NPRA 2HQHA 2X4YA 3PE0A 5GAMg 4OB0B 2DL4A 1XQHA 5J26A 3TQ7P 1AWOA 4FYVB 3M0UA 3VU3C 3PNWC 4BY6B 2EGCA 2QA4A 3NTHA 1QVFA 2RI3A 2DXBA 3I55A 1YIJT 3CCMQ 4MMKA 2LCLA 2QDLA 3EFOA 1KC8C 1YI2A 4Y91A 1WHLA 3HFOA 1XNIA 4F14A 4EMKA 4KGVB 2OTLT 2G6FX 3VS0A 5CIUA 2ESWA 2RHUA 2RB6A 1UGQB 4C5GA 2RHZA 1S1NA 3OMGA 2DTOA 2EVRA 1G5VA 3H41A 4FYYB 4XTWA 2VGMA 1N5ZA 3L42A 2RQWA 2PU9B 2QQ9A 2XKOC 4BE2A 3A5ZB 4IIMA 1ZHIA 4EPCA 1VQ9T 1C1AA 4M78D 2JW4A 2RK1A 2YHTA 5HK3A 2K6DA 1NZ9A 2K3YA 2FHDA 1AVZC 4LUEA 4RG8A 2L89A 1VQ6Q 5FWBA 1UGSB 1YCSB 1KQSA 1RLPC 1D1CA 2ZPHB 4OMOA 1E6GA 2A08A 2EGAA 3VS7A 4C5HA 2JT4A 1D09B 2NUPB 2E10A 2YRDA 2AZVA 1M90U 2KT1A 3PFSA 2F5TX 1X6GA 3VS6A 1HJDA 2DF6A 3CCLQ 2J05A 1MV3A 1PD0A 1LVKA 3RERA 4C0FA 2E70A 4YTLA 3VS5A 2JUFA 2M1HA 4M75F 4JS4A 1BCOA 1JEGA 4JRKA 2CP3A 4II1A 4C0ZA 4OVAA 3HTRA 2D8JA 1E6HA 3Q1JA 2CT3A 3EGUA 1YCYA 1VQNQ 1X01A 5CQXA 4M77G 2DXCA 2QGGA 1M8MA 2DL3A 2X4XA 2QGFB 5KE3A 5IAYA 3I56Q 1OULA 1RAHB 1Y57A 2K4YA 4NL2A 3RIRA 4FM4B 1UGVA 2HNIA 4M77A 1I07A 1YJ9A 4GLMA 4M75B 4A53A 2DETA 2E1HA 2DVEA 1M3AA 1U1SA 2EIFA 5GANf 3JCMP 4KRTA 3GP8A 4FU6A 1X43A 2DNUA 2YXYA 2HCKA 3NPFA 1GCQC 4DOWA 3QHSA 4A4HA 1K0SA 2WSFE 2XI9A 4AT1B 2MWOA 3V8LA 4J9BA 4A4EA 1VQ7A 5GANd 4XTZA 2F2WA 2X35A 4LD9K 4M78F 1TU0B 4RG2A 3KFVA 1YJNA 4NS5A 1WIEA 1V29B 3PTAA 3L1AA 4E6RA 2EQKA 2DRKA 3CCMA 5DY9A 1N9RA 1YWOA 2V1QA 1M1GA 2J7IA 3HRTA 4GBQA 2EWNA 1JO8A 1JJ2P 1M27C 4MZPA 3BFMA 2DL7A 2MAMA 4C92C 1LOJA 2L3SA 4LDUA 5LJ3f 1B07A 1M3CA 2MI6A 5KYWA 3SEMA 3U23A 2OAUA 4CRIA 4CC3A 1IXDA 1NEGA 3EH2A 3CCVA 3JCMd 4DEYA 1VQ4T 4M78B 4XK8E 4M77C 5A0GA 3EG9B 1WHKA 5LJ3d 1X2KA 3OSSC 2V8KA 1MMGA 4KT0E 2FZKB 1K9MC 2A0FB 4PJOC 2AHJB 3BDLA 2FZCB 2QQBA 2JTEA 2DXUA 5GAN2 3OBWA 3TREA 5GAN7 1NJIR 2VXFA 4B6MA 1VA7A 3EAEA 2YWWA 2HKQB 3V8JA 3NFCA 1CSKA 2KR3A 1WHHA 2KSSA 1AOJA 1QW1A 4VUBA 1CKAA 2AK5A 4M7AD 1N9SA 2XMFA 2JOYA 2EYZA 3G6EQ 3M4YA 4Z88A 1K8AU 2D1XA 2XK0A 1YHQT 3EGDA 4F16A 3S3OA 3JCMQ 2BUDA 1QVFP 1VQKQ 3M5AA 4O5VA 2L0AA 1LNXA 2KXDA 1KC8U 1GL5A 3FJPA 2ABLA 1TUCA 4PJOE 1AD5A 1ZQ1A 1M1KC 2V26A 1P92A 1VQ5A 3LLRA 3IQLA 4BACA 3TSZA 1K9MR 2NWMA 3CXCA 4QQGA 1Q95G 1VQ6T 1G3WA 3SWNA 2F69A 3CMET 4OMNA 1N8RU 1OX8A 1TSFA 2ZCFB 2ZAEA 1QVFS 3MJXA 3GF5A 1M3BA 1RAIB 4B9WA 1HYOA 2QQRA 3O5ZA 3I56A 4BI8B 3MKDA 1D0YA 1T0HA 3CCLT 1OU9A 3JRZA 1TWBA 1BI0A 2COYA 1VIEA 2OAWA 1KQSP 3RBBB 1FX7A 1G83A 3QKJA 5GANj 1SPKA 4PNOA 5I2SA 3EG3A 1NPPA 3OYYA 1F1BB 1M1KR 4F7UF 5GAN5 3M53A 1W2BA 3HL8A 4M78E 2CP5A 2JS0A 2GFAA 4KH0B 1VQNT 1WDXA 2DZCA 1VQPA 5AYFA 3GOXA 5IXFA 2OJ2A 4E7SA 3AHUA 3OYCA 1XJWB 3MP1A 4KUDK 2ED1A 2ZGWA 3I56T 1KQSS 5IHNA 1FXXA 4IUVA 4C0GA 4OP0A 3A1PA 5GMKi 3OMCA 2FPEA 1KHIA 2RQTA 2KBTA 1C6VX 1B34A 1QMCA 1M90C 1ABQA 2QK0A 4X1VA 4OMFB 1I4K1 4BE0A 1I8FA 4RTXA 4RTWA 5LJ5e 4F7UB 2LCCA 2CP7A 3A8HB 5GMKl 2QA4Q 3RESA 5LJ3j 4JJCA 3I55Q 2MIOA 2KE9A 2L8DA 1WJQA 2RNAA 4J6YA 1BU1A 1SHGA 3A8LB 3VUZA 2VVKA 2VGNA 4F04B 1NBEB 2DM1A 2LJ0A 1QVGP 3QBYA 5IN1A 2JMAA 3A98A 3E1SA 4JRIA 3VYGA 1IRXA 5CCAA 2O88A 1SKUB 3SDZA 1G8XA 4X9CA 2RQRA 3UPUA 4E7HA 2E12A 3NMZC 3SHWA 3CCJT 2FVUA 4HT9A 5CO7A 1T0JA 2FEIA 2J6FA 2X4WA 2KQWA 4XU1A 2ECZA 2KYMA 1M90R 3LWIA 4ZGDB 2XD0A 1XOVA 5FROA 1Y96B 2V8IA 2A36A 3J80E 2RI5A 2XIDA 4J83A 1VQKA 4C0DC 3M0TA 4QT7A 1IHVA 4MMLA 2IIMA 2RMOA 5D6WA 3OYJA 2MWPA 5KYUB 5CQYA 2J6KA 3UT1A 4BD3A 3JCMJ 3CC4A 3C12A 1OQKA 1U3OA 4NL3A 4LDXA 4HVUA 5LJ5g 4DBRA 2KVQG 3CCSA 3PMIA 1UGPB 1UJYA 3MEUA 2QG9B 2KEAA 2HEQA 4M7DC 1ARKA 4DBFA 4D8KA 4LN2A 4CC7A 3H0HA 1X2QA 1Y71A 3I5SA 5IXBA 2FPFA 3G6ET 1K9MU 1JJ2A 3PIOA 1PWTA 2BZ8A 3EHQA 3QJYA 1JU5C 1ZLMA 1KQ2A 2CSIA 4F7UE 2OTJQ 2D0QB 2C0IA 3LX7A 4QQ6A 2Y90A 4C92D 1OI1A 1R77A 4FIBA 4J9IA 1IB8A 2O4XA 3OYIA 3JB9G 5GAN6 1M1FA 1WA7A 1YJ9Q 2VXEA 2ZPEB 3E19A 1WJSA 2LX7A 4LDYA 4M77D 2L3PA 3OYNA 2KI7A 2GQIA 1W4SA 2MMPA 2OX7A 2COWA 3REBB 2LQNA 4PJOD 1D0ZA 2DZ9A 1ZSZA 4QKUA 5KCOA 4M7AE 2RJFA 2CUDA 1VQ7Q 3CXCP 1NG2A 3A8MB 4HKEA 1VOMA 2CKKA 4LUDA 1TG0A 1K8AC 3OYAA 2EYXA 1D1BA 1YJNQ 4C5IA 2DVJA 4O6JA 2L2PA 1M2VA 1VYTA 1UB4A 2XICA 1WYXA 3OW2P 2PTKA 2K5LA 2RI2A 5FU7C 3TVTA 1BK2A 2V8JA 3VRZA 2RF0A 2ZPGB 3EFOB 1VQ8A 3PVLA 2FL7A 2QDYB 1OPKA 2KK4A 3CXCS 4DEXA 1X75C 3I35A 1IO6A 2BZXA 3SD4A 1E7OA 1N8RC 3CCVQ 2PVDB 4FT4A 2K2VA 1VIFA 1QCOA 1PRMC 1AT1B 3SFMA 5KCHA 1RI0A 1W2BP 3OYGA 2D6FA 2EYYA 3M57A 3M55A 3X25B 3QXEB 2JZ2A 4OMMA 4J7IA 2QA4T 5CKEA 1BYMA 1K8AR 3I55T 3M59A 4RKUE 2GBQA 1YI2T 3CCQA 2QEXA 1KC8R 2KRNA 1ZSZC 2M51A 2F1LA 5LL6S 1RABB 1GFCA 4OMPA 2J06A 1W2BS 4QVCA 4C92F 3OA6A 3FEOA 1UUEA 1N8RR 1KG1A 4NOYA 2BTTA 2RH2A 3HRUA 1GRIA 1OZ2A 3M58A 4M4ZA 3H6ZA 2CT4A 4EMKC 5EC7A 2DJZA 1H3ZA 1I5LA 4PK4A 1RACB 1VQ5Q 3E9GA 1AWXA 3GNGA 4PLLA 4ELYC 2DK3A 2O9SA 1KQ1A 4PJOF 2AT1B 3ZEHA 5GAOn 3G4SA 2O2OA 3ULRB 2P0QA 4HCCA 4C8QG 2GGRA 2VYTA 3J81E 4C92B 1ZUUA 2OTJA 2LNHB 4LNPA 3CCEA 2E64A 1ACMB 5M9OA 3LGLA 2JM8A 4N4GA 1JXOA 4M75G 1QVGA 4C8QA 2ZPFB 5KE2A 3DLLA 1FMVA 2HSPA 1BI3A 4N4HA 2C06A 2LZ6B 2ZPBB 1J3TA 1W70A 2DBKA 1UHCA 4OGCA 2LTOA 3RUXA 1U06A 1TS9A 4PJOB 3FIFA 1YN8A 4M75A 2YUOA 1EIFA 2E6NA 3HP9A 2RQVA 2EQIA 3QG1A 5GANh 2PQWA 1VQPQ 3MP6A 1Q86C 2GCXA 5CKHA 4IKFA 2DRMA 4PFOA 2DO3A 2NUZA 2RPNA 4ANJA 1R0CB 1H8KA 4PL6A 3JCMf 4AFUC 5C0MA 3PMTA 4RTTA 5FU6C 1YJ9T 4ZGEB 1RAGB 2KROA 1UEBA 4JDSA 3TEEA 2E41A 4KUIA 2H3JA 4OMQA 2MYSA 1WI7A 2LVMA 2ED0A 2QXFA 3INZA 1ABOA 2VWFA 4R55A 1M8VA 1QQJA 2E5QA 3JCMh 4BI3A 2DERA 2KYBA 3WVDB 4FL6A 4M78G 3JCMb 1PKTA 2COZA 3L2RA 4C8QC 1V76A 3VKIA 1O9SA 1VQ7T 5LJ3h 3MEVA 5DLOA 1Z9ZA 2K3BA 2I0NA 4Z02A 3CC7A 1JJ2S 1Q86R 1UG1A 2YUPA 1YJNT 4M7DD 3CC2A 4M78A 3RKYA 2HBWA 2ROLA 1ZUYA 1D3BB 1MMAA 3EG9A 3CCMT 2LJ3A 2EKOA 2DLPA 4KGXB 1SEMA 4Y28E 4C92E 1WXUA 2P0KA 1WNLA 1UGRB 4HT8A 1ZBJA 2WSCE 1I0CA 2DYBA 4AFQC 1C0MA 2QTXA 4X9DA 3JB9I 1GBRA 2M0YA 3CCVT 3CCRA 1H641 5FRMA 3JCMV 3QZ9B 3FRNA 4M77E 2V1RA 3WVEB 4ZTJA 5FW9A 1HD3A 3OS0A 5IHIA 5GAMd 4ORZA 3R6NA 1WHMA 4JZ4A 5GAOm 3ZBDA 2DL8A 3EG2A 3QSUA 4XU0A 2BKDN 1JRIA 3HFNA 1NYFA 4IIOA 1AHJB 3VJPA 2VASA 1KJWA 1LPLA 3CC4Q 3BE3A 4J9GA 4EMGA 3TCJA 2YDLA 3QYGB 2CZ6B 2VUBA 3RDVA 3CCSQ 1LCKA 1QKWA 2CDTA 3OW2A 2JMCA 1Y7XA 3S6WA 3P8BB 2DA9A 1U1TA 3BY7A 1N27A 1G3SA 2CP6A 1QVPA 1ZX6A 1R8OB 1YITA 2CUBA 3EGXB 2HAXA 2RHXA 1MNEA 4XU2A 2BE7D 3CPFA 1JQQA 3RMSA 4AG1C 4RTZA 3QPHA 1YJWA 2RJEA 2PVOB 1WXTA 3VUBA 4GY5A 1VQMQ 4XTYA 2CP0A 1PRLC 4DA4A 2LQWA 3QWXX 3QZ5B 1VQ5T 3CCUA 4PFPA 3CMAA 2GTJA 4Z89A 1M30A 3X24B 2R58A 1Y0MA 3A8OB 4LXCA 5KYXA 3JCMc 3T9NA 3GBQA 4BUGA 4N0AA 1Q82C 1AWJA 2RM4A 2KRMA 2RHIA 1YIJQ 4M7DF 1X6BA 4D8DA 2GQVA 1KD1C 2B86A 1K76A 4J9FA 1KSWA 2P0PA 3DKMA 3M0RA 3THKA 3KXTA 2QYZA 1SRLA 4A54A 3JB9D 2QI2A 4C0DB 3N5BB 2YLCA 5HY6A 3SWNC 4F7UG 3M9QA 2NUTB 1IZ6A 2MCNA 3VS4A 5GANe 2BE9B 2GTOA 2P4RA 4M7AF 2DILA 1K0XA 3P8DA 4XAXB 1BIAA 1PHTA 4JLGA 4ME7A 2MPXC 2W0ZA 5D7UA 5GMKj 2DKGA 2LMJA 3VRYA 1JB0E 1AZGB 3ASKA 3OYBA 2F2VA 1VQ8Q 3NTIA 1HXDA 2Z0WA 1WQWA 3OBYA 3OS1A 4OB1B 1VQPT 1D0XA 4M7DB 2NLUA 3QUIA 1S72A 2HL3A 3EG1A 3KBGA 3ZL7C 1OEBA 3GNFB 2EJFA 1Q82R 4PLIA 4BE1A 4QW2A 2LP5A 4IUPA 2VB6A 1MNDA 2HQEA 3MPUB 1PD1A 1TUDA 3JCMe 3SB2A 4M7AB 3OYMA 3H8ZA 2XG8D 2F2XA 4J7FA 1CKBA 3HSBA 1Q86U 2RK2A 5LJ3e 1QVGS 3VS1A 1ZA1B 1JBMA 2VV5A 1KK7A 2JXBA 1VQOA 2IG0A 2RA2A 2K7AA 5GAOr 3EH1A 5IT9E 4IUTA 3CCQQ 1KHCA 2JM9A 4J9HA 2QEXQ 5HKCA 2X3XD 5GAOp 3QDFA 4PJJA 4ZGJB 2KRSA 4IUQA 4FCYA 2EQMA 2IPOB 3E2UA 1VQLA 1Y07A 1ZSGA 1O75A 2HDAA 3OYDA 3C94A 4MDXA 4Q5WA 4ZTFA 2YUQA 2DIQA 3OYEA 5HK0A 1R0BG 2EKHA 1RI9A 2YRCA 5GANg 8AT1B 2D9TA 5KYUA 2LX9A 1I81A 5C6SA 2L3QA 4CI0C 2LJ1A 1PCXA 4DQ2A 2LQ8A 5CK9A 2E65A 2PUKB 1BKBA 4J9EA 1I1JA 2LNVA 4E7JA 5A0DA 1SHFA 2DFUA 1OPLA 4KULA 1FMWA 4E7ZA 4FYXB 1FMKA 2AZSA 2GFUA 3UDCA 5FU7B 6AT1B 3G4SQ 3LH0A 2F5KA 5GAOq 1VQKT 2D0NA 2HBPA 2A37A 2EQJA 3HPWA 3JB9F 1RADB 1Q7YU 1JXMA 3QIIA 1VQMA 2E5KA 4X34A 2L5QA 3G71A 1KIKA 4HCZA 3CCEQ 1WGSA 4QQDA 3JCMg 1Z9QA 2FB7A 1TUGB 1NM7A 3L2WA 3CC4T 4BDZA 3RNJA 3RKWA 5A2QE 3CCST 4M7DE 5LJ3g 2DXTA 1IGUA 4CC4B 5KYYB 2XDBA 1H3HA 3GLXA 3BW1A 3S3MA 4C8QD 2EJ9A 1RAAB 2RQUA 1YIJA 2E6ZA 4QVDA 2LT4A 5HCKA 2E3HA 3V7RA 1EZZB 5CKFA 4A4FA 3I5RA 4E7IA 2OTLA 2ZPIB 3MHXA 1RUWA 3PVQA 1NE8A 1ZSZB 2HZYA 4HXJA 3M56A 4FW2A 5L23A 2HL5C 1SSFA 2K5IA 3JB9J 2X51A 1X69A 5CKDA 3CBPA 3OSVA 4IUUA 4FSXA 1VQ9A 1PG5B 4DOVA 7AT1B 4B9XA 3QJ6A 2MK5A 1M2OA 3CEYA 4EMKB 5GAN3 4ZN3A 3GIBA 2LDMA 5CR2A 2RJCA 1M4ZA 2DL5A 2O9VA 1U8RA 3JSCA 3X20B 3MEAA 4E7LA 2EAYA 3OW2S 2DPPB 2A3LA 5ECAA 1Q81C 1LJOA 2M16A 2KDSA 2DEUA 2FRYA 2LC4A 3CC7Q 1ZA2B 2MOXA 2X9HA 1NLOC 1Q82U 2K57A 3CC2Q 1YHQQ 1MGQA 1BCMA 1OU8A 4MZMA 1IHWA 1FWZA 2KGTA 1WX6A 4FT2A 1RL2A 1KD1U 1D1AA 1PNJA 3FDRA 1IGQA 2DYIA 5IH2A 1YP5A 1GBQA 1TXQA 1VQ8T 2R5MA 2KXCA 1EX4A 2EYWA 2RJDA 1FYNA 4RMOA 1RLQC 4OF1A 2PZ1A 2H3EB 2AIRB 3LH5A 3CMEQ 3M4GA 5CAIA 3CCRQ 1TH7A 2LT1A 2NUPA 1PC0A 1AWWA 3BDUA 2PUOB 1GCQA 4RTVA 2HSEB 3UATA 4BY6C 2XHCA 2M02A 2DD4A 1BBZA 1ZBXA 4FYWB 9ATCB 4C8QF 4M77F 1Q81R 1PSEA 4P5NA 2DAQA 4DBQA 1N6AA 4A4GA 1K73U 1TTHB 2C0OA 2VKNA 2P4TA 3G1JA 3FJ5A 5FU6B 4C92G 1DJ7B 2AKLA 4OB3B 3CCQT 1WQ7A 2QEXT 2GNCA 1YBYA 4PJLA 3X28B 5CKBA 4L5GA 1XTDA 3DB4A 1QCNA 1QWEA 2EJGA 2HMAA 3OYFA 2JNGA 1K4US 1B7TA 3H9NA 4LE9A 1G3TA 2H8HA 2RHYA 4J9CA 2YSQA 1QLYA 1YITQ 2HD0A 4C92A 1H92A 2K3XA 3JAME 2X3WD 4JS5A 5A0LA 4Z8AA 4MDWA 4TVRA 4JJNK 4C8QB 4M77B 1YJWQ 2JTMA 3EFRA 4WTOB 2QASA 2CGHA 2QTVA 4PJOG 2FPDA 3HKSA 1UECA 1UJ0A 3C95A 2MF2A 5DLQE 5AT1B 3MEWA 4LDWA 4RCCA 5D6YA 3CCUQ 4J6WA 2G3RA 3PT9A 3CMAQ 1U5SA 2VC8A 2CH4W 5EG2A 2JS2A 4PKCC 3AT1B 1GXIE 1YFNA 4Y92A 3G4ST 5LJ5f 4PJOA 2CSQA 1AZEA 1MUZA 3VS2A 2M0OA 2NYSA 5GMKm 2OTJT 1X27A 1OYXA 2LCSA 1UDLA 2HQXA 3CCET 1VQ4A 3NGPA 2JN0A 2K5FA 2A28A 4A63B 1OV3A 5LJ5h 2W10A 5LJ5d 1BB9A 4AG2C 5GJVB 3WXMB 4ATOA 3RR6A 3M0QA 3JB9H 4HCBA 1NJIC 2DX1A 1AEYA 3L2QA 2EQUA 4ZN1A 1UTIA 4RTUA 3CCJQ 1BI1A 3VYHB 1TOVA 5KYWB 3PIPA 4EMHA 4E7KA 2D8HA 3M0PA 2CREA 1WPYA 1NYGA 5L8RE 4OMLA 2CH4A 2FYKA 3RKXA 1S72Q 5GAN4 3C4SA 2O01E 4JUVA 2KT8A 4J6XA 1K1ZA 5GMKh 1WHJA 1YHQA 1WJRA 1RAEB 4XTUA 4IURA 2Y4XA 3S3NA 2I2LA 4M75C 1B3QA 1Q7YC 4XTVA 2Y4YA 2CS7A 4HVVA 4KGZB 1K9AA 5GAMf 3M0SA 2P84A 3J7AF 3CBOA 1D3BA 1NLPC 2ATCB 4JRPA 4JLIA 3KUFA 1VQ6A 1VQOQ 1I5OB 3CMEA 3VS3A 2FG0A 2E4HA 4WCIA 5IHKA 1M9SA 2YT6A 4C8QE 2K2MA 2KY9A 1SG5A 1WFWA 2EFIA 2KAFA 3EGDB 5GAMh 3CPWA 3LW5E 4EDUA 2BIVA 4OB2B 3E9FA 5I22A 2K9GA 3QYHB 3JV3A 3LWHA 2RN8A 1VQLQ 3CC7T 3V7SA 2B8AA 1MMDA 1OZ3A 1G2BA 3CC2T 3CCLA 4RTYA 4M75E 2QQAA 4XU3A 2CP2A 2KNBB 4HCKA 1OOTA 2CZ0B 2DJQA 3CBMA 3SWNB 1Q7YR 1W6XA 2LQKA 4UC4A 3MCAB 1Q81U 3LYIA 4E2FB 3F70A 3L2UA 3X26B 2CYZB 4ESRA 1OX9A 1SF9A 1VQNA 4M78C 3OYKA 4JRQA 4D6WA 4FSSA 3CCRT 2ROTA 3EHRA 4JPBW 4AFSC 3MP8A 1RAFB 2JTFA 4PFZA 2AKKA 2FO0A 3OS2A 4E47A 4AMCA 3G71Q 1UE9A 3META 5CVIA 3EGXA 3FC3A 3C0CA 1YWPA 1MMNA 3URGA 4R0KA 4C5EA 3UA7A 3MO8A 3CD6Q 4KBMB 4DBHA 5FRNA 3HHTB 4XQ3A 3CQTA 5KYXB 5LJ5j 2EYQA 2YUNA 2C0TA 4L59A 2HKNA 1V1CA 4V2SA 2O31A 4RUGA 2BZYA 3A8GB 2DTIA 1QP2A 3QWYA 2QAZA 1YITT 5GJWB 1WXBA 2OTLQ 2RD1A 2LRQA 1G3YA 2R5AA 1YJWT 2A7YA 3NTKA 4HVWA 1B34B 2DIGA 3UWNA 1SRMA 4PJMA 2OI3A 3L2ZA 3M54A 3I9QA 3NHNA 3CCJA 3CCUT 5KYNA 4JZ3A 2SEMA 2DBMA 4KH1B 3CMAT 3OB9A 2NUTA 1VQ9Q 4ZNXA 3ME9A 4F7UA 4BB7A 1BI2A 4M7DG 3D7SB 4OGEA 1HK9A 4R56A 2DEQA 2EBPA 3JCMW 1GCPA 1X6OA 4AFZC 2IVWA 3OY9A 2PNIA 2GF7A 1K73C 4CC2A 2L3RA 4A4KA 1NEBA 1YI2Q 1PKSA 4PJNA 2EW3A 3ER0A 2DTHA 4M7DA 4EIKA 1KD1R 1SSHA 4L6V5 5I11A 4M7AG 1KFZA 2EPDA 1A0NB 1VYVA 3VV0A 3QDRB 2DMOA 3EFSA 3H0IA 3LGFA 2DE0X 4N0AC 2WACA 5GAMj 3PGGA 5FLXE 2KMTA 3V8KA 3QO3A 4M7AA 4JJDA 5GMKe 4J9DA 1PM3A 3FLGA 2J6OA 5I2MA 3GPLA 5I21A 2XU8A 1Y96A 3OYHA 1GFDA 1S72T 4BI4A 3OQ5A 3G6EA 4QVZA 2JJ9A 2ENMA 4N4IA 4FW1A 3HRSA 1NJIU 3P8HA 5J3BA 1K73R 3G7ZA 3ZFJA 4LDVA 2XDDA 1MHNA 8ATCB 4WF2A 2DD5A 2PVGB 3DLMA 1QP3A 2QQSA 2R57A 4F17A 3O8VA 2M9UA 5GAMe 3FB9A 1VUBA 1ZUKA 1QWFA 2YRVA 3JCMX 5J39A 1EFNA 3V7CA 1VQOT 2WSEE 4J5YA 2K79A 2FZGB 4BDYA 1UFFA 5D6XA 1MV0B 4RCBA 2RO0A 2X4JA 1WZOA 5GAOl 3R6OA 1VQLT 4JJBA 2CZ1B 5GAN8 1QKXA 4J8OA 4MZTA 2XDPA 3CD6A 3UA6A 3TU4K 3L2VA 2O4XB 4M7AC 5DM7R 1VYUA 3EG0A 3REAB 5KH6A 1UHFA 1PSFA 1IREB 4ELZC 2SRCA 2ZZDA 3OS5A 2E3IA 2CZ7B 3CPWP 1QCFA 4HA8A 1WHGA 4GLKA 1T3SA 4LD6A 1HSQA 1YNZA 3UF4A 5KYYA 4XTXA 2FRWA 3DB3A 1BIBA 1W1FA 3OYLA 1WLPB 4K11A 4M75D 3RMQA 2YLBA 1M5Q1 1VQMT 5FWCA 3G71T 3TSWA 1M1KU 2EGEA 1VQ4Q
chains in the Genus database with same CATH topology
2CP7A 2HKQB 1WHGA 1WHKA 2E3HA 2CP0A 1WHHA 1WHLA 1WHMA 2CP6A 2HKNA 1TXQA 2HQHA 2MPXC 3TQ7P 2M02A 1WHJA 2CP3A 1IXDA 1LPLA 2CP5A 2CP2A 4B6MA 2HL5C 1TOVA 2E4HA 2Z0WA 2QK0A 2COYA 3RDVA 2COZA 2E3IA 3E2UA 2HL3A 2COWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP7 A;  2HKQ B;  1WHG A;  1WHK A;  2E3H A;  2CP0 A;  1WHH A;  1WHL A;  1WHM A;  2CP6 A;  2HKN A;  1TXQ A;  2HQH A;  2MPX C;  3TQ7 P;  2M02 A;  1WHJ A;  2CP3 A;  1IXD A;  1LPL A;  2CP5 A;  2CP2 A;  4B6M A;  2HL5 C;  1TOV A;  2E4H A;  2Z0W A;  2QK0 A;  2COY A;  3RDV A;  2COZ A;  2E3I A;  3E2U A;  2HL3 A;  2COW A; 
#chains in the Genus database with same CATH topology
 3H0F A;  3CPW S;  1M2V B;  1T3L A;  2JVV A;  3CD6 T;  1NPR A;  2HQH A;  2X4Y A;  3PE0 A;  5GAM g;  4OB0 B;  2DL4 A;  1XQH A;  5J26 A;  3TQ7 P;  1AWO A;  4FYV B;  3M0U A;  3VU3 C;  3PNW C;  4BY6 B;  2EGC A;  2QA4 A;  3NTH A;  1QVF A;  2RI3 A;  2DXB A;  3I55 A;  1YIJ T;  3CCM Q;  4MMK A;  2LCL A;  2QDL A;  3EFO A;  1KC8 C;  1YI2 A;  4Y91 A;  1WHL A;  3HFO A;  1XNI A;  4F14 A;  4EMK A;  4KGV B;  2OTL T;  2G6F X;  3VS0 A;  5CIU A;  2ESW A;  2RHU A;  2RB6 A;  1UGQ B;  4C5G A;  2RHZ A;  1S1N A;  3OMG A;  2DTO A;  2EVR A;  1G5V A;  3H41 A;  4FYY B;  4XTW A;  2VGM A;  1N5Z A;  3L42 A;  2RQW A;  2PU9 B;  2QQ9 A;  2XKO C;  4BE2 A;  3A5Z B;  4IIM A;  1ZHI A;  4EPC A;  1VQ9 T;  1C1A A;  4M78 D;  2JW4 A;  2RK1 A;  2YHT A;  5HK3 A;  2K6D A;  1NZ9 A;  2K3Y A;  2FHD A;  1AVZ C;  4LUE A;  4RG8 A;  2L89 A;  1VQ6 Q;  5FWB A;  1UGS B;  1YCS B;  1KQS A;  1RLP C;  1D1C A;  2ZPH B;  4OMO A;  1E6G A;  2A08 A;  2EGA A;  3VS7 A;  4C5H A;  2JT4 A;  1D09 B;  2NUP B;  2E10 A;  2YRD A;  2AZV A;  1M90 U;  2KT1 A;  3PFS A;  2F5T X;  1X6G A;  3VS6 A;  1HJD A;  2DF6 A;  3CCL Q;  2J05 A;  1MV3 A;  1PD0 A;  1LVK A;  3RER A;  4C0F A;  2E70 A;  4YTL A;  3VS5 A;  2JUF A;  2M1H A;  4M75 F;  4JS4 A;  1BCO A;  1JEG A;  4JRK A;  2CP3 A;  4II1 A;  4C0Z A;  4OVA A;  3HTR A;  2D8J A;  1E6H A;  3Q1J A;  2CT3 A;  3EGU A;  1YCY A;  1VQN Q;  1X01 A;  5CQX A;  4M77 G;  2DXC A;  2QGG A;  1M8M A;  2DL3 A;  2X4X A;  2QGF B;  5KE3 A;  5IAY A;  3I56 Q;  1OUL A;  1RAH B;  1Y57 A;  2K4Y A;  4NL2 A;  3RIR A;  4FM4 B;  1UGV A;  2HNI A;  4M77 A;  1I07 A;  1YJ9 A;  4GLM A;  4M75 B;  4A53 A;  2DET A;  2E1H A;  2DVE A;  1M3A A;  1U1S A;  2EIF A;  5GAN f;  3JCM P;  4KRT A;  3GP8 A;  4FU6 A;  1X43 A;  2DNU A;  2YXY A;  2HCK A;  3NPF A;  1GCQ C;  4DOW A;  3QHS A;  4A4H A;  1K0S A;  2WSF E;  2XI9 A;  4AT1 B;  2MWO A;  3V8L A;  4J9B A;  4A4E A;  1VQ7 A;  5GAN d;  4XTZ A;  2F2W A;  2X35 A;  4LD9 K;  4M78 F;  1TU0 B;  4RG2 A;  3KFV A;  1YJN A;  4NS5 A;  1WIE A;  1V29 B;  3PTA A;  3L1A A;  4E6R A;  2EQK A;  2DRK A;  3CCM A;  5DY9 A;  1N9R A;  1YWO A;  2V1Q A;  1M1G A;  2J7I A;  3HRT A;  4GBQ A;  2EWN A;  1JO8 A;  1JJ2 P;  1M27 C;  4MZP A;  3BFM A;  2DL7 A;  2MAM A;  4C92 C;  1LOJ A;  2L3S A;  4LDU A;  5LJ3 f;  1B07 A;  1M3C A;  2MI6 A;  5KYW A;  3SEM A;  3U23 A;  2OAU A;  4CRI A;  4CC3 A;  1IXD A;  1NEG A;  3EH2 A;  3CCV A;  3JCM d;  4DEY A;  1VQ4 T;  4M78 B;  4XK8 E;  4M77 C;  5A0G A;  3EG9 B;  1WHK A;  5LJ3 d;  1X2K A;  3OSS C;  2V8K A;  1MMG A;  4KT0 E;  2FZK B;  1K9M C;  2A0F B;  4PJO C;  2AHJ B;  3BDL A;  2FZC B;  2QQB A;  2JTE A;  2DXU A;  5GAN 2;  3OBW A;  3TRE A;  5GAN 7;  1NJI R;  2VXF A;  4B6M A;  1VA7 A;  3EAE A;  2YWW A;  2HKQ B;  3V8J A;  3NFC A;  1CSK A;  2KR3 A;  1WHH A;  2KSS A;  1AOJ A;  1QW1 A;  4VUB A;  1CKA A;  2AK5 A;  4M7A D;  1N9S A;  2XMF A;  2JOY A;  2EYZ A;  3G6E Q;  3M4Y A;  4Z88 A;  1K8A U;  2D1X A;  2XK0 A;  1YHQ T;  3EGD A;  4F16 A;  3S3O A;  3JCM Q;  2BUD A;  1QVF P;  1VQK Q;  3M5A A;  4O5V A;  2L0A A;  1LNX A;  2KXD A;  1KC8 U;  1GL5 A;  3FJP A;  2ABL A;  1TUC A;  4PJO E;  1AD5 A;  1ZQ1 A;  1M1K C;  2V26 A;  1P92 A;  1VQ5 A;  3LLR A;  3IQL A;  4BAC A;  3TSZ A;  1K9M R;  2NWM A;  3CXC A;  4QQG A;  1Q95 G;  1VQ6 T;  1G3W A;  3SWN A;  2F69 A;  3CME T;  4OMN A;  1N8R U;  1OX8 A;  1TSF A;  2ZCF B;  2ZAE A;  1QVF S;  3MJX A;  3GF5 A;  1M3B A;  1RAI B;  4B9W A;  1HYO A;  2QQR A;  3O5Z A;  3I56 A;  4BI8 B;  3MKD A;  1D0Y A;  1T0H A;  3CCL T;  1OU9 A;  3JRZ A;  1TWB A;  1BI0 A;  2COY A;  1VIE A;  2OAW A;  1KQS P;  3RBB B;  1FX7 A;  1G83 A;  3QKJ A;  5GAN j;  1SPK A;  4PNO A;  5I2S A;  3EG3 A;  1NPP A;  3OYY A;  1F1B B;  1M1K R;  4F7U F;  5GAN 5;  3M53 A;  1W2B A;  3HL8 A;  4M78 E;  2CP5 A;  2JS0 A;  2GFA A;  4KH0 B;  1VQN T;  1WDX A;  2DZC A;  1VQP A;  5AYF A;  3GOX A;  5IXF A;  2OJ2 A;  4E7S A;  3AHU A;  3OYC A;  1XJW B;  3MP1 A;  4KUD K;  2ED1 A;  2ZGW A;  3I56 T;  1KQS S;  5IHN A;  1FXX A;  4IUV A;  4C0G A;  4OP0 A;  3A1P A;  5GMK i;  3OMC A;  2FPE A;  1KHI A;  2RQT A;  2KBT A;  1C6V X;  1B34 A;  1QMC A;  1M90 C;  1ABQ A;  2QK0 A;  4X1V A;  4OMF B;  1I4K 1;  4BE0 A;  1I8F A;  4RTX A;  4RTW A;  5LJ5 e;  4F7U B;  2LCC A;  2CP7 A;  3A8H B;  5GMK l;  2QA4 Q;  3RES A;  5LJ3 j;  4JJC A;  3I55 Q;  2MIO A;  2KE9 A;  2L8D A;  1WJQ A;  2RNA A;  4J6Y A;  1BU1 A;  1SHG A;  3A8L B;  3VUZ A;  2VVK A;  2VGN A;  4F04 B;  1NBE B;  2DM1 A;  2LJ0 A;  1QVG P;  3QBY A;  5IN1 A;  2JMA A;  3A98 A;  3E1S A;  4JRI A;  3VYG A;  1IRX A;  5CCA A;  2O88 A;  1SKU B;  3SDZ A;  1G8X A;  4X9C A;  2RQR A;  3UPU A;  4E7H A;  2E12 A;  3NMZ C;  3SHW A;  3CCJ T;  2FVU A;  4HT9 A;  5CO7 A;  1T0J A;  2FEI A;  2J6F A;  2X4W A;  2KQW A;  4XU1 A;  2ECZ A;  2KYM A;  1M90 R;  3LWI A;  4ZGD B;  2XD0 A;  1XOV A;  5FRO A;  1Y96 B;  2V8I A;  2A36 A;  3J80 E;  2RI5 A;  2XID A;  4J83 A;  1VQK A;  4C0D C;  3M0T A;  4QT7 A;  1IHV A;  4MML A;  2IIM A;  2RMO A;  5D6W A;  3OYJ A;  2MWP A;  5KYU B;  5CQY A;  2J6K A;  3UT1 A;  4BD3 A;  3JCM J;  3CC4 A;  3C12 A;  1OQK A;  1U3O A;  4NL3 A;  4LDX A;  4HVU A;  5LJ5 g;  4DBR A;  2KVQ G;  3CCS A;  3PMI A;  1UGP B;  1UJY A;  3MEU A;  2QG9 B;  2KEA A;  2HEQ A;  4M7D C;  1ARK A;  4DBF A;  4D8K A;  4LN2 A;  4CC7 A;  3H0H A;  1X2Q A;  1Y71 A;  3I5S A;  5IXB A;  2FPF A;  3G6E T;  1K9M U;  1JJ2 A;  3PIO A;  1PWT A;  2BZ8 A;  3EHQ A;  3QJY A;  1JU5 C;  1ZLM A;  1KQ2 A;  2CSI A;  4F7U E;  2OTJ Q;  2D0Q B;  2C0I A;  3LX7 A;  4QQ6 A;  2Y90 A;  4C92 D;  1OI1 A;  1R77 A;  4FIB A;  4J9I A;  1IB8 A;  2O4X A;  3OYI A;  3JB9 G;  5GAN 6;  1M1F A;  1WA7 A;  1YJ9 Q;  2VXE A;  2ZPE B;  3E19 A;  1WJS A;  2LX7 A;  4LDY A;  4M77 D;  2L3P A;  3OYN A;  2KI7 A;  2GQI A;  1W4S A;  2MMP A;  2OX7 A;  2COW A;  3REB B;  2LQN A;  4PJO D;  1D0Z A;  2DZ9 A;  1ZSZ A;  4QKU A;  5KCO A;  4M7A E;  2RJF A;  2CUD A;  1VQ7 Q;  3CXC P;  1NG2 A;  3A8M B;  4HKE A;  1VOM A;  2CKK A;  4LUD A;  1TG0 A;  1K8A C;  3OYA A;  2EYX A;  1D1B A;  1YJN Q;  4C5I A;  2DVJ A;  4O6J A;  2L2P A;  1M2V A;  1VYT A;  1UB4 A;  2XIC A;  1WYX A;  3OW2 P;  2PTK A;  2K5L A;  2RI2 A;  5FU7 C;  3TVT A;  1BK2 A;  2V8J A;  3VRZ A;  2RF0 A;  2ZPG B;  3EFO B;  1VQ8 A;  3PVL A;  2FL7 A;  2QDY B;  1OPK A;  2KK4 A;  3CXC S;  4DEX A;  1X75 C;  3I35 A;  1IO6 A;  2BZX A;  3SD4 A;  1E7O A;  1N8R C;  3CCV Q;  2PVD B;  4FT4 A;  2K2V A;  1VIF A;  1QCO A;  1PRM C;  1AT1 B;  3SFM A;  5KCH A;  1RI0 A;  1W2B P;  3OYG A;  2D6F A;  2EYY A;  3M57 A;  3M55 A;  3X25 B;  3QXE B;  2JZ2 A;  4OMM A;  4J7I A;  2QA4 T;  5CKE A;  1BYM A;  1K8A R;  3I55 T;  3M59 A;  4RKU E;  2GBQ A;  1YI2 T;  3CCQ A;  2QEX A;  1KC8 R;  2KRN A;  1ZSZ C;  2M51 A;  2F1L A;  5LL6 S;  1RAB B;  1GFC A;  4OMP A;  2J06 A;  1W2B S;  4QVC A;  4C92 F;  3OA6 A;  3FEO A;  1UUE A;  1N8R R;  1KG1 A;  4NOY A;  2BTT A;  2RH2 A;  3HRU A;  1GRI A;  1OZ2 A;  3M58 A;  4M4Z A;  3H6Z A;  2CT4 A;  4EMK C;  5EC7 A;  2DJZ A;  1H3Z A;  1I5L A;  4PK4 A;  1RAC B;  1VQ5 Q;  3E9G A;  1AWX A;  3GNG A;  4PLL A;  4ELY C;  2DK3 A;  2O9S A;  1KQ1 A;  4PJO F;  2AT1 B;  3ZEH A;  5GAO n;  3G4S A;  2O2O A;  3ULR B;  2P0Q A;  4HCC A;  4C8Q G;  2GGR A;  2VYT A;  3J81 E;  4C92 B;  1ZUU A;  2OTJ A;  2LNH B;  4LNP A;  3CCE A;  2E64 A;  1ACM B;  5M9O A;  3LGL A;  2JM8 A;  4N4G A;  1JXO A;  4M75 G;  1QVG A;  4C8Q A;  2ZPF B;  5KE2 A;  3DLL A;  1FMV A;  2HSP A;  1BI3 A;  4N4H A;  2C06 A;  2LZ6 B;  2ZPB B;  1J3T A;  1W70 A;  2DBK A;  1UHC A;  4OGC A;  2LTO A;  3RUX A;  1U06 A;  1TS9 A;  4PJO B;  3FIF A;  1YN8 A;  4M75 A;  2YUO A;  1EIF A;  2E6N A;  3HP9 A;  2RQV A;  2EQI A;  3QG1 A;  5GAN h;  2PQW A;  1VQP Q;  3MP6 A;  1Q86 C;  2GCX A;  5CKH A;  4IKF A;  2DRM A;  4PFO A;  2DO3 A;  2NUZ A;  2RPN A;  4ANJ A;  1R0C B;  1H8K A;  4PL6 A;  3JCM f;  4AFU C;  5C0M A;  3PMT A;  4RTT A;  5FU6 C;  1YJ9 T;  4ZGE B;  1RAG B;  2KRO A;  1UEB A;  4JDS A;  3TEE A;  2E41 A;  4KUI A;  2H3J A;  4OMQ A;  2MYS A;  1WI7 A;  2LVM A;  2ED0 A;  2QXF A;  3INZ A;  1ABO A;  2VWF A;  4R55 A;  1M8V A;  1QQJ A;  2E5Q A;  3JCM h;  4BI3 A;  2DER A;  2KYB A;  3WVD B;  4FL6 A;  4M78 G;  3JCM b;  1PKT A;  2COZ A;  3L2R A;  4C8Q C;  1V76 A;  3VKI A;  1O9S A;  1VQ7 T;  5LJ3 h;  3MEV A;  5DLO A;  1Z9Z A;  2K3B A;  2I0N A;  4Z02 A;  3CC7 A;  1JJ2 S;  1Q86 R;  1UG1 A;  2YUP A;  1YJN T;  4M7D D;  3CC2 A;  4M78 A;  3RKY A;  2HBW A;  2ROL A;  1ZUY A;  1D3B B;  1MMA A;  3EG9 A;  3CCM T;  2LJ3 A;  2EKO A;  2DLP A;  4KGX B;  1SEM A;  4Y28 E;  4C92 E;  1WXU A;  2P0K A;  1WNL A;  1UGR B;  4HT8 A;  1ZBJ A;  2WSC E;  1I0C A;  2DYB A;  4AFQ C;  1C0M A;  2QTX A;  4X9D A;  3JB9 I;  1GBR A;  2M0Y A;  3CCV T;  3CCR A;  1H64 1;  5FRM A;  3JCM V;  3QZ9 B;  3FRN A;  4M77 E;  2V1R A;  3WVE B;  4ZTJ A;  5FW9 A;  1HD3 A;  3OS0 A;  5IHI A;  5GAM d;  4ORZ A;  3R6N A;  1WHM A;  4JZ4 A;  5GAO m;  3ZBD A;  2DL8 A;  3EG2 A;  3QSU A;  4XU0 A;  2BKD N;  1JRI A;  3HFN A;  1NYF A;  4IIO A;  1AHJ B;  3VJP A;  2VAS A;  1KJW A;  1LPL A;  3CC4 Q;  3BE3 A;  4J9G A;  4EMG A;  3TCJ A;  2YDL A;  3QYG B;  2CZ6 B;  2VUB A;  3RDV A;  3CCS Q;  1LCK A;  1QKW A;  2CDT A;  3OW2 A;  2JMC A;  1Y7X A;  3S6W A;  3P8B B;  2DA9 A;  1U1T A;  3BY7 A;  1N27 A;  1G3S A;  2CP6 A;  1QVP A;  1ZX6 A;  1R8O B;  1YIT A;  2CUB A;  3EGX B;  2HAX A;  2RHX A;  1MNE A;  4XU2 A;  2BE7 D;  3CPF A;  1JQQ A;  3RMS A;  4AG1 C;  4RTZ A;  3QPH A;  1YJW A;  2RJE A;  2PVO B;  1WXT A;  3VUB A;  4GY5 A;  1VQM Q;  4XTY A;  2CP0 A;  1PRL C;  4DA4 A;  2LQW A;  3QWX X;  3QZ5 B;  1VQ5 T;  3CCU A;  4PFP A;  3CMA A;  2GTJ A;  4Z89 A;  1M30 A;  3X24 B;  2R58 A;  1Y0M A;  3A8O B;  4LXC A;  5KYX A;  3JCM c;  3T9N A;  3GBQ A;  4BUG A;  4N0A A;  1Q82 C;  1AWJ A;  2RM4 A;  2KRM A;  2RHI A;  1YIJ Q;  4M7D F;  1X6B A;  4D8D A;  2GQV A;  1KD1 C;  2B86 A;  1K76 A;  4J9F A;  1KSW A;  2P0P A;  3DKM A;  3M0R A;  3THK A;  3KXT A;  2QYZ A;  1SRL A;  4A54 A;  3JB9 D;  2QI2 A;  4C0D B;  3N5B B;  2YLC A;  5HY6 A;  3SWN C;  4F7U G;  3M9Q A;  2NUT B;  1IZ6 A;  2MCN A;  3VS4 A;  5GAN e;  2BE9 B;  2GTO A;  2P4R A;  4M7A F;  2DIL A;  1K0X A;  3P8D A;  4XAX B;  1BIA A;  1PHT A;  4JLG A;  4ME7 A;  2MPX C;  2W0Z A;  5D7U A;  5GMK j;  2DKG A;  2LMJ A;  3VRY A;  1JB0 E;  1AZG B;  3ASK A;  3OYB A;  2F2V A;  1VQ8 Q;  3NTI A;  1HXD A;  2Z0W A;  1WQW A;  3OBY A;  3OS1 A;  4OB1 B;  1VQP T;  1D0X A;  4M7D B;  2NLU A;  3QUI A;  1S72 A;  2HL3 A;  3EG1 A;  3KBG A;  3ZL7 C;  1OEB A;  3GNF B;  2EJF A;  1Q82 R;  4PLI A;  4BE1 A;  4QW2 A;  2LP5 A;  4IUP A;  2VB6 A;  1MND A;  2HQE A;  3MPU B;  1PD1 A;  1TUD A;  3JCM e;  3SB2 A;  4M7A B;  3OYM A;  3H8Z A;  2XG8 D;  2F2X A;  4J7F A;  1CKB A;  3HSB A;  1Q86 U;  2RK2 A;  5LJ3 e;  1QVG S;  3VS1 A;  1ZA1 B;  1JBM A;  2VV5 A;  1KK7 A;  2JXB A;  1VQO A;  2IG0 A;  2RA2 A;  2K7A A;  5GAO r;  3EH1 A;  5IT9 E;  4IUT A;  3CCQ Q;  1KHC A;  2JM9 A;  4J9H A;  2QEX Q;  5HKC A;  2X3X D;  5GAO p;  3QDF A;  4PJJ A;  4ZGJ B;  2KRS A;  4IUQ A;  4FCY A;  2EQM A;  2IPO B;  3E2U A;  1VQL A;  1Y07 A;  1ZSG A;  1O75 A;  2HDA A;  3OYD A;  3C94 A;  4MDX A;  4Q5W A;  4ZTF A;  2YUQ A;  2DIQ A;  3OYE A;  5HK0 A;  1R0B G;  2EKH A;  1RI9 A;  2YRC A;  5GAN g;  8AT1 B;  2D9T A;  5KYU A;  2LX9 A;  1I81 A;  5C6S A;  2L3Q A;  4CI0 C;  2LJ1 A;  1PCX A;  4DQ2 A;  2LQ8 A;  5CK9 A;  2E65 A;  2PUK B;  1BKB A;  4J9E A;  1I1J A;  2LNV A;  4E7J A;  5A0D A;  1SHF A;  2DFU A;  1OPL A;  4KUL A;  1FMW A;  4E7Z A;  4FYX B;  1FMK A;  2AZS A;  2GFU A;  3UDC A;  5FU7 B;  6AT1 B;  3G4S Q;  3LH0 A;  2F5K A;  5GAO q;  1VQK T;  2D0N A;  2HBP A;  2A37 A;  2EQJ A;  3HPW A;  3JB9 F;  1RAD B;  1Q7Y U;  1JXM A;  3QII A;  1VQM A;  2E5K A;  4X34 A;  2L5Q A;  3G71 A;  1KIK A;  4HCZ A;  3CCE Q;  1WGS A;  4QQD A;  3JCM g;  1Z9Q A;  2FB7 A;  1TUG B;  1NM7 A;  3L2W A;  3CC4 T;  4BDZ A;  3RNJ A;  3RKW A;  5A2Q E;  3CCS T;  4M7D E;  5LJ3 g;  2DXT A;  1IGU A;  4CC4 B;  5KYY B;  2XDB A;  1H3H A;  3GLX A;  3BW1 A;  3S3M A;  4C8Q D;  2EJ9 A;  1RAA B;  2RQU A;  1YIJ A;  2E6Z A;  4QVD A;  2LT4 A;  5HCK A;  2E3H A;  3V7R A;  1EZZ B;  5CKF A;  4A4F A;  3I5R A;  4E7I A;  2OTL A;  2ZPI B;  3MHX A;  1RUW A;  3PVQ A;  1NE8 A;  1ZSZ B;  2HZY A;  4HXJ A;  3M56 A;  4FW2 A;  5L23 A;  2HL5 C;  1SSF A;  2K5I A;  3JB9 J;  2X51 A;  1X69 A;  5CKD A;  3CBP A;  3OSV A;  4IUU A;  4FSX A;  1VQ9 A;  1PG5 B;  4DOV A;  7AT1 B;  4B9X A;  3QJ6 A;  2MK5 A;  1M2O A;  3CEY A;  4EMK B;  5GAN 3;  4ZN3 A;  3GIB A;  2LDM A;  5CR2 A;  2RJC A;  1M4Z A;  2DL5 A;  2O9V A;  1U8R A;  3JSC A;  3X20 B;  3MEA A;  4E7L A;  2EAY A;  3OW2 S;  2DPP B;  2A3L A;  5ECA A;  1Q81 C;  1LJO A;  2M16 A;  2KDS A;  2DEU A;  2FRY A;  2LC4 A;  3CC7 Q;  1ZA2 B;  2MOX A;  2X9H A;  1NLO C;  1Q82 U;  2K57 A;  3CC2 Q;  1YHQ Q;  1MGQ A;  1BCM A;  1OU8 A;  4MZM A;  1IHW A;  1FWZ A;  2KGT A;  1WX6 A;  4FT2 A;  1RL2 A;  1KD1 U;  1D1A A;  1PNJ A;  3FDR A;  1IGQ A;  2DYI A;  5IH2 A;  1YP5 A;  1GBQ A;  1TXQ A;  1VQ8 T;  2R5M A;  2KXC A;  1EX4 A;  2EYW A;  2RJD A;  1FYN A;  4RMO A;  1RLQ C;  4OF1 A;  2PZ1 A;  2H3E B;  2AIR B;  3LH5 A;  3CME Q;  3M4G A;  5CAI A;  3CCR Q;  1TH7 A;  2LT1 A;  2NUP A;  1PC0 A;  1AWW A;  3BDU A;  2PUO B;  1GCQ A;  4RTV A;  2HSE B;  3UAT A;  4BY6 C;  2XHC A;  2M02 A;  2DD4 A;  1BBZ A;  1ZBX A;  4FYW B;  9ATC B;  4C8Q F;  4M77 F;  1Q81 R;  1PSE A;  4P5N A;  2DAQ A;  4DBQ A;  1N6A A;  4A4G A;  1K73 U;  1TTH B;  2C0O A;  2VKN A;  2P4T A;  3G1J A;  3FJ5 A;  5FU6 B;  4C92 G;  1DJ7 B;  2AKL A;  4OB3 B;  3CCQ T;  1WQ7 A;  2QEX T;  2GNC A;  1YBY A;  4PJL A;  3X28 B;  5CKB A;  4L5G A;  1XTD A;  3DB4 A;  1QCN A;  1QWE A;  2EJG A;  2HMA A;  3OYF A;  2JNG A;  1K4U S;  1B7T A;  3H9N A;  4LE9 A;  1G3T A;  2H8H A;  2RHY A;  4J9C A;  2YSQ A;  1QLY A;  1YIT Q;  2HD0 A;  4C92 A;  1H92 A;  2K3X A;  3JAM E;  2X3W D;  4JS5 A;  5A0L A;  4Z8A A;  4MDW A;  4TVR A;  4JJN K;  4C8Q B;  4M77 B;  1YJW Q;  2JTM A;  3EFR A;  4WTO B;  2QAS A;  2CGH A;  2QTV A;  4PJO G;  2FPD A;  3HKS A;  1UEC A;  1UJ0 A;  3C95 A;  2MF2 A;  5DLQ E;  5AT1 B;  3MEW A;  4LDW A;  4RCC A;  5D6Y A;  3CCU Q;  4J6W A;  2G3R A;  3PT9 A;  3CMA Q;  1U5S A;  2VC8 A;  2CH4 W;  5EG2 A;  2JS2 A;  4PKC C;  3AT1 B;  1GXI E;  1YFN A;  4Y92 A;  3G4S T;  5LJ5 f;  4PJO A;  2CSQ A;  1AZE A;  1MUZ A;  3VS2 A;  2M0O A;  2NYS A;  5GMK m;  2OTJ T;  1X27 A;  1OYX A;  2LCS A;  1UDL A;  2HQX A;  3CCE T;  1VQ4 A;  3NGP A;  2JN0 A;  2K5F A;  2A28 A;  4A63 B;  1OV3 A;  5LJ5 h;  2W10 A;  5LJ5 d;  1BB9 A;  4AG2 C;  5GJV B;  3WXM B;  4ATO A;  3RR6 A;  3M0Q A;  3JB9 H;  4HCB A;  1NJI C;  2DX1 A;  1AEY A;  3L2Q A;  2EQU A;  4ZN1 A;  1UTI A;  4RTU A;  3CCJ Q;  1BI1 A;  3VYH B;  1TOV A;  5KYW B;  3PIP A;  4EMH A;  4E7K A;  2D8H A;  3M0P A;  2CRE A;  1WPY A;  1NYG A;  5L8R E;  4OML A;  2CH4 A;  2FYK A;  3RKX A;  1S72 Q;  5GAN 4;  3C4S A;  2O01 E;  4JUV A;  2KT8 A;  4J6X A;  1K1Z A;  5GMK h;  1WHJ A;  1YHQ A;  1WJR A;  1RAE B;  4XTU A;  4IUR A;  2Y4X A;  3S3N A;  2I2L A;  4M75 C;  1B3Q A;  1Q7Y C;  4XTV A;  2Y4Y A;  2CS7 A;  4HVV A;  4KGZ B;  1K9A A;  5GAM f;  3M0S A;  2P84 A;  3J7A F;  3CBO A;  1D3B A;  1NLP C;  2ATC B;  4JRP A;  4JLI A;  3KUF A;  1VQ6 A;  1VQO Q;  1I5O B;  3CME A;  3VS3 A;  2FG0 A;  2E4H A;  4WCI A;  5IHK A;  1M9S A;  2YT6 A;  4C8Q E;  2K2M A;  2KY9 A;  1SG5 A;  1WFW A;  2EFI A;  2KAF A;  3EGD B;  5GAM h;  3CPW A;  3LW5 E;  4EDU A;  2BIV A;  4OB2 B;  3E9F A;  5I22 A;  2K9G A;  3QYH B;  3JV3 A;  3LWH A;  2RN8 A;  1VQL Q;  3CC7 T;  3V7S A;  2B8A A;  1MMD A;  1OZ3 A;  1G2B A;  3CC2 T;  3CCL A;  4RTY A;  4M75 E;  2QQA A;  4XU3 A;  2CP2 A;  2KNB B;  4HCK A;  1OOT A;  2CZ0 B;  2DJQ A;  3CBM A;  3SWN B;  1Q7Y R;  1W6X A;  2LQK A;  4UC4 A;  3MCA B;  1Q81 U;  3LYI A;  4E2F B;  3F70 A;  3L2U A;  3X26 B;  2CYZ B;  4ESR A;  1OX9 A;  1SF9 A;  1VQN A;  4M78 C;  3OYK A;  4JRQ A;  4D6W A;  4FSS A;  3CCR T;  2ROT A;  3EHR A;  4JPB W;  4AFS C;  3MP8 A;  1RAF B;  2JTF A;  4PFZ A;  2AKK A;  2FO0 A;  3OS2 A;  4E47 A;  4AMC A;  3G71 Q;  1UE9 A;  3MET A;  5CVI A;  3EGX A;  3FC3 A;  3C0C A;  1YWP A;  1MMN A;  3URG A;  4R0K A;  4C5E A;  3UA7 A;  3MO8 A;  3CD6 Q;  4KBM B;  4DBH A;  5FRN A;  3HHT B;  4XQ3 A;  3CQT A;  5KYX B;  5LJ5 j;  2EYQ A;  2YUN A;  2C0T A;  4L59 A;  2HKN A;  1V1C A;  4V2S A;  2O31 A;  4RUG A;  2BZY A;  3A8G B;  2DTI A;  1QP2 A;  3QWY A;  2QAZ A;  1YIT T;  5GJW B;  1WXB A;  2OTL Q;  2RD1 A;  2LRQ A;  1G3Y A;  2R5A A;  1YJW T;  2A7Y A;  3NTK A;  4HVW A;  1B34 B;  2DIG A;  3UWN A;  1SRM A;  4PJM A;  2OI3 A;  3L2Z A;  3M54 A;  3I9Q A;  3NHN A;  3CCJ A;  3CCU T;  5KYN A;  4JZ3 A;  2SEM A;  2DBM A;  4KH1 B;  3CMA T;  3OB9 A;  2NUT A;  1VQ9 Q;  4ZNX A;  3ME9 A;  4F7U A;  4BB7 A;  1BI2 A;  4M7D G;  3D7S B;  4OGE A;  1HK9 A;  4R56 A;  2DEQ A;  2EBP A;  3JCM W;  1GCP A;  1X6O A;  4AFZ C;  2IVW A;  3OY9 A;  2PNI A;  2GF7 A;  1K73 C;  4CC2 A;  2L3R A;  4A4K A;  1NEB A;  1YI2 Q;  1PKS A;  4PJN A;  2EW3 A;  3ER0 A;  2DTH A;  4M7D A;  4EIK A;  1KD1 R;  1SSH A;  4L6V 5;  5I11 A;  4M7A G;  1KFZ A;  2EPD A;  1A0N B;  1VYV A;  3VV0 A;  3QDR B;  2DMO A;  3EFS A;  3H0I A;  3LGF A;  2DE0 X;  4N0A C;  2WAC A;  5GAM j;  3PGG A;  5FLX E;  2KMT A;  3V8K A;  3QO3 A;  4M7A A;  4JJD A;  5GMK e;  4J9D A;  1PM3 A;  3FLG A;  2J6O A;  5I2M A;  3GPL A;  5I21 A;  2XU8 A;  1Y96 A;  3OYH A;  1GFD A;  1S72 T;  4BI4 A;  3OQ5 A;  3G6E A;  4QVZ A;  2JJ9 A;  2ENM A;  4N4I A;  4FW1 A;  3HRS A;  1NJI U;  3P8H A;  5J3B A;  1K73 R;  3G7Z A;  3ZFJ A;  4LDV A;  2XDD A;  1MHN A;  8ATC B;  4WF2 A;  2DD5 A;  2PVG B;  3DLM A;  1QP3 A;  2QQS A;  2R57 A;  4F17 A;  3O8V A;  2M9U A;  5GAM e;  3FB9 A;  1VUB A;  1ZUK A;  1QWF A;  2YRV A;  3JCM X;  5J39 A;  1EFN A;  3V7C A;  1VQO T;  2WSE E;  4J5Y A;  2K79 A;  2FZG B;  4BDY A;  1UFF A;  5D6X A;  1MV0 B;  4RCB A;  2RO0 A;  2X4J A;  1WZO A;  5GAO l;  3R6O A;  1VQL T;  4JJB A;  2CZ1 B;  5GAN 8;  1QKX A;  4J8O A;  4MZT A;  2XDP A;  3CD6 A;  3UA6 A;  3TU4 K;  3L2V A;  2O4X B;  4M7A C;  5DM7 R;  1VYU A;  3EG0 A;  3REA B;  5KH6 A;  1UHF A;  1PSF A;  1IRE B;  4ELZ C;  2SRC A;  2ZZD A;  3OS5 A;  2E3I A;  2CZ7 B;  3CPW P;  1QCF A;  4HA8 A;  1WHG A;  4GLK A;  1T3S A;  4LD6 A;  1HSQ A;  1YNZ A;  3UF4 A;  5KYY A;  4XTX A;  2FRW A;  3DB3 A;  1BIB A;  1W1F A;  3OYL A;  1WLP B;  4K11 A;  4M75 D;  3RMQ A;  2YLB A;  1M5Q 1;  1VQM T;  5FWC A;  3G71 T;  3TSW A;  1M1K U;  2EGE A;  1VQ4 Q; 
#chains in the Genus database with same CATH homology
 2CP7 A;  2HKQ B;  1WHG A;  1WHK A;  2E3H A;  2CP0 A;  1WHH A;  1WHL A;  1WHM A;  2CP6 A;  2HKN A;  1TXQ A;  2HQH A;  2MPX C;  3TQ7 P;  2M02 A;  1WHJ A;  2CP3 A;  1IXD A;  1LPL A;  2CP5 A;  2CP2 A;  4B6M A;  2HL5 C;  1TOV A;  2E4H A;  2Z0W A;  2QK0 A;  2COY A;  3RDV A;  2COZ A;  2E3I A;  3E2U A;  2HL3 A;  2COW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...