2M02A

3d structure of cap-gly domain of mammalian dynactin determined by magic angle spinning nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
b'LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin subunit 1
molecule tags Motor protein
source organism Rattus norvegicus
publication title Three-Dimensional Structure of CAP-Gly Domain of Mammalian Dynactin Determined by Magic Angle Spinning NMR Spectroscopy: Conformational Plasticity and Interactions with End-Binding Protein EB1.
pubmed doi rcsb
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2m02A00
2QK0A 2E4HA 2Z0WA 2CP0A 1TOVA 3RDVA 2HKQB 2E3HA 3E2UA 2CP3A 2HL3A 2M02A 1WHJA 1WHMA 1IXDA 1WHLA 2HL5C 2HQHA 1WHKA 2HKNA 1WHGA 2CP7A 1WHHA 2COZA 2MPXC 3TQ7P 1LPLA 2CP6A 2E3IA 1TXQA 2CP2A 2COYA 2CP5A 2COWA 4B6MA
chains in the Genus database with same CATH superfamily
1M3BA 2FO0A 5J3BA 3WVEB 2DRMA 2NUZA 3VS6A 2YWWA 2ROLA 5GANd 5GAOm 1YN8A 2O4XB 3N5BB 1MHNA 2RB6A 4E6RA 2QYZA 5LJ3e 4OGCA 1JU5C 1WHJA 1UHCA 3L2RA 1UDLA 1B7TA 4TVRA 1M8MA 4L5GA 3J81E 5C0MA 5GAOq 1N9SA 5DLQE 2DL3A 4ZN1A 2AHJB 5GAN7 3GNFB 2FVUA 4IUUA 4LUEA 5EC7A 3PTAA 2FRWA 2DM1A 3RMQA 4ZGEB 4PJOB 3M54A 5GAMj 3CPWP 1MNEA 1ZBXA 2DBKA 3QJ6A 1AOJA 3KXTA 4MZPA 3U23A 1VYUA 2D8JA 5GAOn 3CXCA 1BI1A 4GY5A 3EGDA 2EWNA 2E5KA 2YUQA 3JCMh 2P4TA 1PD1A 1V29B 4EMKA 2ESWA 2JMAA 2P4RA 3L2QA 1NPPA 1WFWA 1UGPB 1V1CA 2EYZA 2LJ3A 3EG1A 2KY9A 5GJWB 2NYSA 3QYHB 2DD5A 4BI3A 4LNPA 2HD0A 2C0OA 4RTXA 3OYAA 4ZTFA 2O01E 4LDUA 4KT0E 1YBYA 2LNVA 3JAME 5LJ3d 3JB9D 1AWWA 1IZ6A 1U3OA 4NOYA 7AT1B 2ZZDA 2CZ6B 3HKSA 1SEMA 1D1CA 1K8AR 3QUIA 4ZN3A 1M2OA 2KNBB 1S72A 4C8QE 2YRCA 2DEQA 2CZ0B 2QQRA 2B86A 1T3SA 3TEEA 2OTLA 1EX4A 1N9RA 3RMSA 4QVCA 1KHIA 3EH2A 2YUOA 1NPRA 4OMOA 2VWFA 3EFRA 2AT1B 3OW2P 3MEUA 4XAXB 1T0HA 3JB9F 1JBMA 1QCFA 1GXIE 2JTMA 2F2WA 4PLIA 2XKOC 2ABLA 1ZUKA 2YUNA 2QQBA 3O5ZA 1YHQT 1UEBA 2QGGA 5FWCA 1PCXA 4F7UF 4E7JA 2B8AA 2DAQA 3VYHB 2I0NA 3CCUA 2MCNA 2BZ8A 5A2QE 5GAOp 3HRUA 5CCAA 3H9NA 4AFZC 3NHNA 3WVDB 3GOXA 3DLLA 4Z02A 4BI4A 1QKWA 2W0ZA 2JM8A 2ZAEA 4JRKA 4LE9A 1NEBA 3I9QA 3VUBA 3DLMA 4E7IA 3A8LB 3VS1A 4DBHA 3EGDB 2DILA 1ZSZA 2VUBA 3MPUB 4Z8AA 5KYYA 1VQ8T 2WSFE 1SSHA 2E4HA 3E9GA 3FIFA 4LD6A 1W70A 2XICA 4M77D 4PFPA 1R0BG 4MZMA 4M4ZA 2FG0A 3ASKA 1FWZA 2ED0A 3M56A 3T9NA 1Q7YU 2KR3A 1BCMA 4OMQA 2V8JA 4RTTA 2CP6A 4R55A 3LH5A 2RK2A 1JEGA 1YIJT 3A8MB 1FX7A 4DEYA 1Y07A 1QVGS 3UA7A 4M7DD 3UPUA 1LVKA 3FRNA 1M27C 3HHTB 2QG9B 1FXXA 1HYOA 4DQ2A 1VQOQ 2KT8A 3CC7T 4M75E 5D6YA 3I55T 3PVLA 1PKTA 2MPXC 1VQKT 2CREA 3QZ5B 3EHQA 2RI5A 5GMKi 1QWFA 2DZ9A 1H8KA 1QVFP 4E2FB 2BE9B 2KE9A 3G71T 1MNDA 1GCQC 2MF2A 1D1BA 5GAOl 1VIEA 4PJJA 5IN1A 4XTZA 3S3NA 1IHVA 1YITA 1M1KU 4IIMA 1K1ZA 4IUVA 4O6JA 4XK8E 2DMOA 3HTRA 2QDYB 5KCHA 2HQEA 3JCMW 2GTJA 1YWPA 1JJ2A 4OB0B 1U1TA 4LUDA 5CVIA 4J9FA 3V7CA 5DLOA 1WLPB 2HQXA 3RKYA 2DERA 3VYGA 1WNLA 1SF9A 2QGFB 4ME7A 4N4GA 4M77A 1ZUUA 1X6GA 2A3LA 2LT4A 5IAYA 1Y7XA 2GGRA 3L2UA 4OB3B 3CCLA 5C6SA 2Z0WA 1M5Q1 1ZUYA 2HCKA 2P0PA 3CMAQ 2LX9A 5LJ3g 1ABOA 4X1VA 5GMKm 4OMLA 2PVOB 1K9MR 2E6ZA 2JUFA 3VS3A 5LJ5g 1GFDA 1SRLA 3OYMA 2A0FB 3ULRB 5GANh 1K9MC 1SRMA 4M7DA 4C0DC 1YITQ 1JO8A 1QCOA 3TVTA 2QK0A 2D9TA 1UHFA 4J9DA 3M58A 4Z89A 3OB9A 2PTKA 2K3YA 2OAWA 3S3MA 2FHDA 3HFOA 4PFZA 4C92B 3VKIA 3VS2A 2FZKB 1O75A 5KCOA 3REAB 2OTJQ 1G3SA 2K5FA 1M1KC 2QEXA 3ZBDA 4EDUA 2EYYA 1VQPA 3MO8A 1OU9A 5GAMe 4HVWA 1Y0MA 1ZSGA 1KIKA 2I2LA 1Y96B 1WA7A 1VIFA 1IHWA 3MP8A 5GMKj 3WXMB 3V7SA 2K4YA 5IHKA 4BDYA 3JCMJ 5GAMg 3QXEB 3QDRB 1Q95G 3A1PA 2F1LA 1JJ2P 1QKXA 2VB6A 1C0MA 2CH4W 2L3RA 1U8RA 1I81A 4HXJA 3RNJA 2IPOB 4M7AB 1OPLA 3E2UA 2RQRA 1H3HA 4F17A 1WXTA 3M57A 3FC3A 4C92G 2YSQA 2D0QB 2XMFA 1PRMC 2LNHB 3OMCA 3OYBA 3QKJA 2SRCA 2MWOA 1R0CB 4M7AD 1ARKA 5CK9A 2QEXQ 2RJEA 1VQPQ 1D0XA 4ZTJA 2EIFA 3CCET 2XD0A 3OYLA 2A36A 1UUEA 1AZGB 5KYWB 2CYZB 1PSFA 1WGSA 1JJ2S 3EFOA 2QTVA 2KXCA 3JCMd 4JRQA 5LJ5f 2DVJA 3CC4Q 2O9SA 1QVFS 4D6WA 2K2VA 4V2SA 3GBQA 4M7AG 2QA4A 4MDWA 2EQKA 4M78E 4E7SA 1X27A 1BI0A 1VQKA 2E10A 3VS0A 3I56Q 4J7IA 3CXCS 5M9OA 4KH1B 1Q7YR 1VQ5Q 2R58A 3SDZA 4JLGA 2X4XA 3JCMQ 3CQTA 3URGA 1ZBJA 5GJVB 2OTLQ 4L59A 3BY7A 3OW2S 2DTHA 1YHQQ 4N0AA 1SHGA 3REBB 4BE1A 3PVQA 2DO3A 1ZSZB 5KYYB 4JRIA 4N4HA 3UWNA 2J6FA 3CCQQ 3THKA 4X9CA 4LDVA 2HBWA 3RKXA 2M02A 2MOXA 3JB9I 2YDLA 3JCMP 4BE0A 1WZOA 2KYBA 1G2BA 2LCSA 3L2ZA 1QP2A 3RR6A 5ECAA 4II1A 2JTFA 6AT1B 2Y4YA 5KYUA 1A0NB 4OMPA 5IHIA 2LQKA 2RH2A 3RKWA 1PRLC 2A7YA 1VQ7Q 3UA6A 3MHXA 5CKFA 2RHXA 3GIBA 4BI8B 3GP8A 3MP6A 4FSSA 2FRYA 4CC4B 1VQ5A 1XNIA 3QJYA 4M75D 4ANJA 4ZGDB 2HKQB 5LJ5h 4OF1A 1LNXA 2K3BA 2JXBA 4J83A 3EG9B 1YP5A 5L8RE 3PIOA 3OS2A 1OX8A 4ESRA 1B34A 2NUPA 4RTZA 4HT8A 1PKSA 3JRZA 4C0GA 1E7OA 1Q81U 3G6ET 4RUGA 1AVZC 5GMKl 1ACMB 2DYIA 1X2QA 5I2MA 4BACA 2RHIA 3QHSA 5I2SA 2M9UA 3EFOB 1KQSP 4J6YA 3CCJT 2DRKA 2DBMA 4PJOE 3HRTA 2YLCA 4M7DB 2RD1A 2CH4A 2AK5A 3I55Q 4IUTA 1N6AA 3QBYA 1M9SA 5A0LA 3OW2A 2KK4A 4B9WA 3EH1A 5FROA 3CCRA 5GAOr 2RA2A 3E1SA 4XTVA 2DL8A 1GCQA 2VV5A 1IGQA 2J6KA 1VQOA 4XQ3A 1Q7YC 3A8GB 2RJCA 5LJ5e 3PT9A 3CCVA 2FZGB 3BE3A 5GAN6 2ZCFB 2JTEA 2ROTA 3LWHA 1IXDA 1TUDA 4C8QF 2EKOA 2PVGB 2LDMA 5CQYA 2K5LA 1TSFA 4MDXA 5GAN2 3VS7A 3CC7Q 1D1AA 1YJNA 1MMNA 1VUBA 3VJPA 4FCYA 4ATOA 3CD6Q 4HCKA 1PSEA 4J9IA 3LX7A 2VKNA 3RERA 1VQ4T 2LC4A 4MMKA 1VQNT 2AKLA 1UB4A 3SWNC 4HKEA 3CPWS 2CT3A 4M7AF 3CCQT 4EMKC 1PM3A 3CCJQ 1KK7A 4XU1A 4B6MA 4HCBA 1X69A 3ER0A 4C0ZA 4C8QD 2ZPFB 5CR2A 5A0DA 4JZ3A 1G83A 3PFSA 3NTHA 1KG1A 2DXCA 2KT1A 2AIRB 3CCSA 4XTXA 2LQWA 3A5ZB 4OP0A 1RI0A 4C5GA 3V8LA 1M90R 1RACB 1JXMA 3LH0A 2IIMA 5CKEA 3CC7A 1PNJA 3OSSC 1MUZA 2K57A 5I21A 3OSVA 2DEUA 1FYNA 2DLPA 2RI2A 5GANe 5KYXA 1YJWT 3EG0A 1UGQB 3RBBB 1Q86U 4M77F 3CC2T 2LMJA 4PJOG 2W10A 3VS5A 3OYFA 1MV3A 1QP3A 5LJ5j 4IIOA 4E7HA 4M7DC 2HL5C 4A4GA 2DIQA 5D6WA 3MP1A 2RQTA 2L3QA 4DBRA 3G4SQ 1VQLA 2L3PA 2LRQA 3JCMb 2F5KA 3INZA 2EGAA 4JJBA 5GAN5 2CSIA 4R56A 3QWYA 3OYGA 2L5QA 3META 1S72T 1CKAA 1RAAB 2H8HA 2OX7A 1ABQA 2DL4A 4M78A 2QTXA 2V8IA 2OTLT 4PJOD 4M75F 3M0TA 4AFQC 4BE2A 2X4WA 2DTOA 4KRTA 8ATCB 1W1FA 2P0QA 2RHUA 1OI1A 2L8DA 1VQ8Q 1VYTA 2GNCA 3MEAA 4K11A 1Q86R 1G3YA 2DETA 2BZXA 4L6V5 3JCMX 5KYXB 4C8QG 3H0FA 1WQWA 4ZGJB 1NJIU 1CKBA 1B3QA 1Y57A 2IG0A 4N4IA 9ATCB 3QPHA 1PG5B 1G3WA 2H3EB 2QQAA 2MK5A 5L23A 5GANj 2NUTB 4J6WA 2EQMA 2XK0A 2PNIA 1LPLA 1QW1A 2BKDN 4M78C 2JMCA 1VA7A 1R8OB 1TUCA 3E9FA 1H3ZA 1WYXA 2FPDA 3TU4K 4MZTA 3M4GA 2PU9B 1KSWA 3OYHA 4LXCA 2K79A 1VQ8A 1B07A 2XHCA 2FPEA 1K9AA 2DJQA 2RHYA 1N8RU 2KROA 1KD1R 1WHGA 3BDLA 1W2BA 2LCCA 1KHCA 4OB2B 1T3LA 2YRDA 3EG2A 2ZPIB 2EYWA 2QQSA 4Y91A 3PMTA 1KD1U 4F7UB 2KRSA 2V8KA 2QI2A 1UJYA 2O88A 5EG2A 3JB9G 4VUBA 5KYWA 3SWNA 3OMGA 2YHTA 4J7FA 2VVKA 2NUTA 3H8ZA 3RESA 4PFOA 2DNUA 1KQ1A 2GQIA 2CKKA 1GFCA 3OS0A 1XQHA 2KBTA 1WXUA 2EQIA 1BYMA 1SHFA 2QASA 2CSQA 3E19A 3JV3A 1KQSS 3G1JA 4LN2A 3L42A 1M1GA 2JT4A 1YI2A 4F14A 2RQVA 4BDZA 1VQ7A 1EIFA 4M77B 1PC0A 2COWA 2VGNA 2X4JA 2VC8A 4C0FA 1S72Q 2LJ0A 4RTVA 1IB8A 4OMNA 1X6OA 3OYNA 4QW2A 4M75B 4Y28E 2GQVA 4FYVB 2QA4T 1M90U 5CIUA 4PJOF 2F5TX 1U5SA 1M2VB 2JS0A 2KEAA 3EGXB 4F7UE 1PHTA 4A4HA 4A53A 1UE9A 5GMKh 2JZ2A 3H0IA 3PE0A 2CP0A 3HPWA 1VQ6Q 1WIEA 2DL7A 2EVRA 1UGVA 2IVWA 2EQJA 4B9XA 3C94A 1Z9QA 4CC7A 4OMMA 4DA4A 3P8HA 2K7AA 2MAMA 2DD4A 4J6XA 1D0ZA 2JW4A 3CCRQ 3CCUQ 5FU7B 4M78B 2K6DA 3NTIA 3JCMV 1W4SA 2A37A 3SHWA 3H41A 4IKFA 1Y71A 3I5RA 4LD9K 2A08A 3VV0A 4F7UG 3GNGA 3JSCA 2MI6A 4PNOA 4OVAA 4Z88A 3SB2A 2NUPB 1QCNA 4EMHA 2XI9A 1BIAA 3ZFJA 2ZGWA 1PWTA 1SPKA 5J39A 3EAEA 3JB9H 2G3RA 2OTJT 2DX1A 2MMPA 1NE8A 1D0YA 2C0TA 3A98A 5GAN3 2J6OA 3FDRA 3NPFA 1D3BA 2EGCA 5HK3A 4KULA 2X3XD 2XG8D 4E47A 5D6XA 2EPDA 1NYFA 1JRIA 4BY6C 1QQJA 2BZYA 4XTUA 2DXUA 1I07A 2PQWA 1RAGB 4M7DE 3DB3A 3CCJA 1P92A 2DL5A 3C95A 3FLGA 1IREB 4M7DF 1OV3A 2KAFA 2HEQA 3CCSQ 2VGMA 3CCRT 4JRPA 4C8QB 4M77C 3X24B 4MMLA 1Q81R 5IHNA 2QXFA 1FMWA 2D6FA 1M90C 3EFSA 1GBQA 1UJ0A 4M77E 1H641 3I56T 1K73U 3CCMA 4M75C 2DF6A 1VQMT 2EGEA 3P8BB 4X9DA 2DPPB 4Y92A 2RJDA 3PIPA 1WHHA 4ELZC 1QLYA 4J9CA 1AWXA 4C92C 3CCEQ 4PJMA 4E7KA 4LDXA 1XJWB 1OYXA 4FYWB 2WACA 3NGPA 3L2VA 3LGFA 1Z9ZA 5AT1B 1K4US 1BBZA 3CC4T 2JS2A 3IQLA 4QT7A 3LLRA 3G4SA 1QVFA 2EKHA 4R0KA 4RTYA 3M0PA 2JNGA 5CO7A 2O2OA 2NWMA 1GBRA 3OS1A 2LQNA 4RTWA 3OQ5A 4A4FA 3CC2Q 1F1BB 4KGVB 1E6HA 5FU6C 3HP9A 4C92F 4O5VA 4E7ZA 3CMAA 3J80E 1N8RC 1X75C 1ZSZC 2DKGA 4AT1B 1HK9A 2J7IA 5GAMf 5GANg 1M1KR 2FL7A 2GFAA 4EMGA 5IXBA 1MMAA 2EJFA 2AZSA 2CS7A 3AT1B 2GF7A 2KSSA 3G7ZA 4QQ6A 4Q5WA 4RCBA 1ZQ1A 4DBQA 3CCST 4HVUA 4J5YA 4XU0A 1TS9A 2CDTA 5CKHA 3CEYA 4JS5A 1RAIB 2YUPA 3FB9A 3MKDA 1WQ7A 3X26B 1VQ9T 2M51A 2LTOA 3RIRA 1B34B 2RQWA 1I0CA 3CBOA 4A54A 5J26A 4GLKA 1K0SA 1UG1A 1JXOA 3CC2A 1VQ5T 1BCOA 5DY9A 4JPBW 2BIVA 2E5QA 4XU2A 4PKCC 4JJCA 1QVGA 1QVPA 5FLXE 2HBPA 3UATA 3EGUA 3M4YA 3H6ZA 5GAMd 1TXQA 3G6EA 4WF2A 1C1AA 1YJ9Q 2ZPHB 3OY9A 4KUIA 1FMKA 1BKBA 2LX7A 4KBMB 1NJIC 2PVDB 8AT1B 5AYFA 3F70A 2OJ2A 2PZ1A 2L2PA 1K8AU 5GAMh 2L89A 1UFFA 5FW9A 2KI7A 2RK1A 4AFUC 1Q82U 4FYXB 5FRNA 4M78G 1RLQC 5CAIA 2A28A 2EW3A 2O4XA 4CC3A 1S1NA 1VQ4Q 2E1HA 2E3HA 2KDSA 3CBPA 1TG0A 2LT1A 3H0HA 5GMKe 1WHLA 4OB1B 2RNAA 4PL6A 3I5SA 3P8DA 3X25B 1K73C 1UGRB 4YTLA 3GLXA 1YI2Q 2QA4Q 1JB0E 2EFIA 3QYGB 2WSEE 3PGGA 2V1RA 3CMEA 2VYTA 3L1AA 3SWNB 1YJNT 3LW5E 3BW1A 2O31A 1FMVA 1X01A 1H92A 2DXTA 2E70A 5A0GA 1RL2A 1I5OB 1PD0A 2COYA 3KBGA 5HK0A 1BI3A 4FT4A 1I4K1 1U1SA 2CT4A 1YIJQ 4FSXA 4FYYB 2MIOA 2SEMA 5DM7R 3CCQA 1WJRA 1MV0B 1MMDA 1NYGA 1KQSA 3CPWA 2LJ1A 2Y4XA 1VQ6A 2K9GA 4BB7A 1HXDA 1W6XA 1NLOC 3CD6A 4F04B 2DYBA 4EIKA 1SSFA 1RADB 4FM4B 1TTHB 4PJOC 4DEXA 1BI2A 1RUWA 4D8KA 3KUFA 1RAHB 1T0JA 3VUZA 4CC2A 3OYDA 4M78D 4PJOA 2JJ9A 4HCCA 2H3JA 1Q82R 1M8VA 2FB7A 3OBYA 5GAN8 1YJWA 3JB9J 1OULA 2HMAA 2AKKA 2P84A 3VRZA 2OI3A 3EGXA 4D8DA 2F2XA 1YI2T 3OS5A 1HD3A 3VRYA 2VXEA 4FIBA 1BK2A 1OZ2A 4QKUA 2HSPA 1I1JA 4EPCA 3OBWA 3J7AF 5KE2A 2O9VA 1VQLT 3LGLA 1VOMA 2CP2A 4M7AE 2OAUA 4M75G 2XU8A 1N5ZA 3O8VA 3C12A 3M5AA 5FRMA 2EYQA 1Q82C 1E6GA 4RKUE 2CUDA 2QDLA 3GF5A 3OYKA 5CKBA 5HKCA 4M77G 2JOYA 1OOTA 3JCMf 3UDCA 4A63B 4PLLA 2D1XA 1OU8A 2KVQG 1WJQA 4C5HA 1KC8R 1NLPC 4PK4A 1VQLQ 1AWOA 1OPKA 5KYNA 2E65A 3JCMc 3CBMA 1YJ9T 4DBFA 2MYSA 3CCVQ 3TSZA 4JJDA 1LCKA 2K2MA 2KMTA 1M2VA 4KUDK 1EFNA 3CCUT 3ZL7C 2X4YA 2ECZA 3HL8A 2X51A 3X20B 3DKMA 2FPFA 4KH0B 2J06A 4RTUA 3TQ7P 1XTDA 2RJFA 2K3XA 4QQDA 1GRIA 1O9SA 4KGXB 3NFCA 4JS4A 1KFZA 3QZ9B 1WJSA 3DB4A 2HSEB 4ORZA 4AFSC 1GL5A 1NZ9A 2CUBA 2ZPBB 4PJLA 3L2WA 1DJ7B 2PUKB 4J9BA 1M4ZA 1ZX6A 1X2KA 2EBPA 1LOJA 2FEIA 2EYXA 4WCIA 2OTJA 2RF0A 3M0SA 1WDXA 3X28B 3C4SA 3OA6A 3QDFA 2L0AA 2LZ6B 3LWIA 2EJ9A 2PUOB 1NG2A 2DZCA 2HL3A 1HJDA 1AT1B 2GFUA 4RCCA 5KH6A 1G8XA 2QQ9A 2RMOA 5GAN4 1NEGA 3FJPA 3Q1JA 2HNIA 1OEBA 1IGUA 4C0DB 2E6NA 2HDAA 1OQKA 4C5IA 2DE0X 1TU0B 2BE7D 1MMGA 3A8OB 2XIDA 4J9EA 3M59A 3EG9A 2GTOA 1UTIA 3G71A 2KRNA 3QO3A 2RN8A 4XU3A 4ELYC 1VQMA 1Q86C 1BU1A 4J9GA 2RPNA 2V1QA 2QAZA 1VQ7T 4QQGA 1YITT 2RO0A 2KRMA 3V8JA 2V26A 3UT1A 1K0XA 4C92D 4OGEA 3HSBA 2EAYA 2M0YA 2GBQA 4UC4A 3CPFA 5HY6A 4A4EA 3CC4A 4BD3A 1G3TA 2L3SA 3V7RA 4IUPA 2C06A 3G4ST 3M53A 4FL6A 4GLMA 2LP5A 1XOVA 3RDVA 4NS5A 2G6FX 2R5AA 3JCMe 3G6EQ 2F69A 2P0KA 2RHZA 1WHMA 3CCLT 3CMAT 2ZPGB 4M7AC 1NM7A 5FU7C 3G71Q 3MEVA 2DIGA 3M9QA 1YHQA 4XTWA 2X9HA 5CKDA 2R5MA 1KC8C 3S6WA 2BTTA 4F16A 2FYKA 2YXYA 1TH7A 2KXDA 1N27A 5LJ3j 2EJGA 5LJ3h 4C92E 1TUGB 3HRSA 3M0RA 5HCKA 3OYEA 4FU6A 2KYMA 1AZEA 1JQQA 2DFUA 4RG2A 1MGQA 1RLPC 3TCJA 3SD4A 1VQPT 1OZ3A 1BIBA 2BUDA 2HKNA 2DTIA 3FJ5A 2YLBA 3CMEQ 4F7UA 3MCAB 4AG1C 4FW1A 5LL6S 4C92A 5D7UA 5KE3A 1RABB 1WPYA 2D0NA 1RAFB 1NJIR 1K9MU 2LQ8A 1YIJA 5IT9E 1TWBA 1QVGP 1V76A 4AG2C 2ED1A 1R77A 2E64A 3AHUA 4C8QC 3FEOA 3BFMA 1EZZB 4PJNA 2HQHA 4LDWA 1N8RR 1Y96A 1Q81C 1J3TA 4P5NA 1YFNA 3OYJA 3I55A 2CP3A 3HFNA 5LJ5d 1ZHIA 2ZPEB 3VS4A 3PMIA 1WHKA 1ZA2B 2XDDA 1VQKQ 3KFVA 3I56A 3CCMT 1AHJB 3C0CA 3V8KA 3QIIA 2DA9A 3M0UA 4QVZA 4JJNK 2DXBA 1YJWQ 4J9HA 1UGSB 1IRXA 4BY6B 2JVVA 5CQXA 2HZYA 4M7DG 2DK3A 2C0IA 3LYIA 1YCSB 2Y90A 3NMZC 4QVDA 3TSWA 2K5IA 4AMCA 5I11A 3OYYA 4J8OA 3OYCA 2COZA 2LVMA 2ATCB 4NL2A 4C8QA 2JN0A 3CMET 3NTKA 1ZA1B 2ENMA 5KYUB 1U06A 1YJNQ 3MEWA 1IO6A 4M7AA 1LJOA 4RG8A 1W2BP 3QG1A 4CRIA 5LJ3f 4LDYA 3OYIA 4XTYA 4JUVA 2X35A 1SKUB 1VQ6T 1D3BB 2M1HA 4NL3A 3CD6T 1YWOA 4JLIA 1M30A 3EHRA 1D09B 1WXBA 1AD5A 1VYVA 2CZ7B 4KGZB 2CP7A 4BUGA 1UECA 3GPLA 4HCZA 1X6BA 1K73R 1VQ9A 1CSKA 1OX9A 2RQUA 4E7LA 3S3OA 5IH2A 1M3AA 1YCYA 3MJXA 4ZNXA 3SEMA 2LCLA 1KJWA 1M3CA 1W2BS 2YRVA 1QMCA 1RAEB 5FU6B 4C5EA 3M55A 2QEXT 1RI9A 4OMFB 2HAXA 4IUQA 4N0AC 1BB9A 1M1FA 1KC8U 1X43A 1GCPA 3BDUA 2VXFA 1AEYA 1ZLMA 2XDPA 2FZCB 1WI7A 2VASA 3VU3C 2KQWA 1G5VA 1K8AC 4FW2A 1KD1C 3SFMA 1C6VX 3PNWC 1TOVA 3A8HB 4CI0C 2MWPA 3ZEHA 4DOWA 4EMKB 4A4KA 5FWBA 1HSQA 3QSUA 2JM9A 2DJZA 3CXCP 3CCLQ 3ME9A 2GCXA 1YNZA 4DOVA 4FT2A 1VQNQ 1KQ2A 2J05A 3M0QA 1VQ9Q 1QWEA 2YT6A 5GANf 2R57A 1K76A 4M78F 1NBEB 2EQUA 4M75A 3RUXA 4WTOB 3JCMg 3CCMQ 2E41A 3D7SB 4X34A 3TREA 4JZ4A 1VQOT 2D8HA 1AWJA 1YJ9A 2RI3A 3CCEA 1I8FA 3CCVT 1SG5A 2F2VA 4JDSA 2WSCE 4RMOA 2E12A 4HVVA 2CZ1B 1I5LA 3R6NA 3UF4A 2X3WD 3EG3A 2AZVA 3QWXX 2KGTA 1VQMQ 3R6OA 2RM4A 2CGHA 5I22A 4GBQA 3I35A 2NLUA 5IXFA 2XDBA 4HT9A 4HA8A 2M0OA 2DVEA 1VQ4A 2E3IA 4IURA 1WX6A 2M16A 1VQNA 2CP5A
chains in the Genus database with same CATH topology
2QK0A 2E4HA 2Z0WA 2CP0A 1TOVA 3RDVA 2HKQB 2E3HA 3E2UA 2CP3A 2HL3A 2M02A 1WHJA 1WHMA 1IXDA 1WHLA 2HL5C 2HQHA 1WHKA 2HKNA 1WHGA 2CP7A 1WHHA 2COZA 2MPXC 3TQ7P 1LPLA 2CP6A 2E3IA 1TXQA 2CP2A 2COYA 2CP5A 2COWA 4B6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QK0 A;  2E4H A;  2Z0W A;  2CP0 A;  1TOV A;  3RDV A;  2HKQ B;  2E3H A;  3E2U A;  2CP3 A;  2HL3 A;  2M02 A;  1WHJ A;  1WHM A;  1IXD A;  1WHL A;  2HL5 C;  2HQH A;  1WHK A;  2HKN A;  1WHG A;  2CP7 A;  1WHH A;  2COZ A;  2MPX C;  3TQ7 P;  1LPL A;  2CP6 A;  2E3I A;  1TXQ A;  2CP2 A;  2COY A;  2CP5 A;  2COW A;  4B6M A; 
#chains in the Genus database with same CATH topology
 1M3B A;  2FO0 A;  5J3B A;  3WVE B;  2DRM A;  2NUZ A;  3VS6 A;  2YWW A;  2ROL A;  5GAN d;  5GAO m;  1YN8 A;  2O4X B;  3N5B B;  1MHN A;  2RB6 A;  4E6R A;  2QYZ A;  5LJ3 e;  4OGC A;  1JU5 C;  1WHJ A;  1UHC A;  3L2R A;  1UDL A;  1B7T A;  4TVR A;  1M8M A;  4L5G A;  3J81 E;  5C0M A;  5GAO q;  1N9S A;  5DLQ E;  2DL3 A;  4ZN1 A;  2AHJ B;  5GAN 7;  3GNF B;  2FVU A;  4IUU A;  4LUE A;  5EC7 A;  3PTA A;  2FRW A;  2DM1 A;  3RMQ A;  4ZGE B;  4PJO B;  3M54 A;  5GAM j;  3CPW P;  1MNE A;  1ZBX A;  2DBK A;  3QJ6 A;  1AOJ A;  3KXT A;  4MZP A;  3U23 A;  1VYU A;  2D8J A;  5GAO n;  3CXC A;  1BI1 A;  4GY5 A;  3EGD A;  2EWN A;  2E5K A;  2YUQ A;  3JCM h;  2P4T A;  1PD1 A;  1V29 B;  4EMK A;  2ESW A;  2JMA A;  2P4R A;  3L2Q A;  1NPP A;  1WFW A;  1UGP B;  1V1C A;  2EYZ A;  2LJ3 A;  3EG1 A;  2KY9 A;  5GJW B;  2NYS A;  3QYH B;  2DD5 A;  4BI3 A;  4LNP A;  2HD0 A;  2C0O A;  4RTX A;  3OYA A;  4ZTF A;  2O01 E;  4LDU A;  4KT0 E;  1YBY A;  2LNV A;  3JAM E;  5LJ3 d;  3JB9 D;  1AWW A;  1IZ6 A;  1U3O A;  4NOY A;  7AT1 B;  2ZZD A;  2CZ6 B;  3HKS A;  1SEM A;  1D1C A;  1K8A R;  3QUI A;  4ZN3 A;  1M2O A;  2KNB B;  1S72 A;  4C8Q E;  2YRC A;  2DEQ A;  2CZ0 B;  2QQR A;  2B86 A;  1T3S A;  3TEE A;  2OTL A;  1EX4 A;  1N9R A;  3RMS A;  4QVC A;  1KHI A;  3EH2 A;  2YUO A;  1NPR A;  4OMO A;  2VWF A;  3EFR A;  2AT1 B;  3OW2 P;  3MEU A;  4XAX B;  1T0H A;  3JB9 F;  1JBM A;  1QCF A;  1GXI E;  2JTM A;  2F2W A;  4PLI A;  2XKO C;  2ABL A;  1ZUK A;  2YUN A;  2QQB A;  3O5Z A;  1YHQ T;  1UEB A;  2QGG A;  5FWC A;  1PCX A;  4F7U F;  4E7J A;  2B8A A;  2DAQ A;  3VYH B;  2I0N A;  3CCU A;  2MCN A;  2BZ8 A;  5A2Q E;  5GAO p;  3HRU A;  5CCA A;  3H9N A;  4AFZ C;  3NHN A;  3WVD B;  3GOX A;  3DLL A;  4Z02 A;  4BI4 A;  1QKW A;  2W0Z A;  2JM8 A;  2ZAE A;  4JRK A;  4LE9 A;  1NEB A;  3I9Q A;  3VUB A;  3DLM A;  4E7I A;  3A8L B;  3VS1 A;  4DBH A;  3EGD B;  2DIL A;  1ZSZ A;  2VUB A;  3MPU B;  4Z8A A;  5KYY A;  1VQ8 T;  2WSF E;  1SSH A;  2E4H A;  3E9G A;  3FIF A;  4LD6 A;  1W70 A;  2XIC A;  4M77 D;  4PFP A;  1R0B G;  4MZM A;  4M4Z A;  2FG0 A;  3ASK A;  1FWZ A;  2ED0 A;  3M56 A;  3T9N A;  1Q7Y U;  2KR3 A;  1BCM A;  4OMQ A;  2V8J A;  4RTT A;  2CP6 A;  4R55 A;  3LH5 A;  2RK2 A;  1JEG A;  1YIJ T;  3A8M B;  1FX7 A;  4DEY A;  1Y07 A;  1QVG S;  3UA7 A;  4M7D D;  3UPU A;  1LVK A;  3FRN A;  1M27 C;  3HHT B;  2QG9 B;  1FXX A;  1HYO A;  4DQ2 A;  1VQO Q;  2KT8 A;  3CC7 T;  4M75 E;  5D6Y A;  3I55 T;  3PVL A;  1PKT A;  2MPX C;  1VQK T;  2CRE A;  3QZ5 B;  3EHQ A;  2RI5 A;  5GMK i;  1QWF A;  2DZ9 A;  1H8K A;  1QVF P;  4E2F B;  2BE9 B;  2KE9 A;  3G71 T;  1MND A;  1GCQ C;  2MF2 A;  1D1B A;  5GAO l;  1VIE A;  4PJJ A;  5IN1 A;  4XTZ A;  3S3N A;  1IHV A;  1YIT A;  1M1K U;  4IIM A;  1K1Z A;  4IUV A;  4O6J A;  4XK8 E;  2DMO A;  3HTR A;  2QDY B;  5KCH A;  2HQE A;  3JCM W;  2GTJ A;  1YWP A;  1JJ2 A;  4OB0 B;  1U1T A;  4LUD A;  5CVI A;  4J9F A;  3V7C A;  5DLO A;  1WLP B;  2HQX A;  3RKY A;  2DER A;  3VYG A;  1WNL A;  1SF9 A;  2QGF B;  4ME7 A;  4N4G A;  4M77 A;  1ZUU A;  1X6G A;  2A3L A;  2LT4 A;  5IAY A;  1Y7X A;  2GGR A;  3L2U A;  4OB3 B;  3CCL A;  5C6S A;  2Z0W A;  1M5Q 1;  1ZUY A;  2HCK A;  2P0P A;  3CMA Q;  2LX9 A;  5LJ3 g;  1ABO A;  4X1V A;  5GMK m;  4OML A;  2PVO B;  1K9M R;  2E6Z A;  2JUF A;  3VS3 A;  5LJ5 g;  1GFD A;  1SRL A;  3OYM A;  2A0F B;  3ULR B;  5GAN h;  1K9M C;  1SRM A;  4M7D A;  4C0D C;  1YIT Q;  1JO8 A;  1QCO A;  3TVT A;  2QK0 A;  2D9T A;  1UHF A;  4J9D A;  3M58 A;  4Z89 A;  3OB9 A;  2PTK A;  2K3Y A;  2OAW A;  3S3M A;  2FHD A;  3HFO A;  4PFZ A;  4C92 B;  3VKI A;  3VS2 A;  2FZK B;  1O75 A;  5KCO A;  3REA B;  2OTJ Q;  1G3S A;  2K5F A;  1M1K C;  2QEX A;  3ZBD A;  4EDU A;  2EYY A;  1VQP A;  3MO8 A;  1OU9 A;  5GAM e;  4HVW A;  1Y0M A;  1ZSG A;  1KIK A;  2I2L A;  1Y96 B;  1WA7 A;  1VIF A;  1IHW A;  3MP8 A;  5GMK j;  3WXM B;  3V7S A;  2K4Y A;  5IHK A;  4BDY A;  3JCM J;  5GAM g;  3QXE B;  3QDR B;  1Q95 G;  3A1P A;  2F1L A;  1JJ2 P;  1QKX A;  2VB6 A;  1C0M A;  2CH4 W;  2L3R A;  1U8R A;  1I81 A;  4HXJ A;  3RNJ A;  2IPO B;  4M7A B;  1OPL A;  3E2U A;  2RQR A;  1H3H A;  4F17 A;  1WXT A;  3M57 A;  3FC3 A;  4C92 G;  2YSQ A;  2D0Q B;  2XMF A;  1PRM C;  2LNH B;  3OMC A;  3OYB A;  3QKJ A;  2SRC A;  2MWO A;  1R0C B;  4M7A D;  1ARK A;  5CK9 A;  2QEX Q;  2RJE A;  1VQP Q;  1D0X A;  4ZTJ A;  2EIF A;  3CCE T;  2XD0 A;  3OYL A;  2A36 A;  1UUE A;  1AZG B;  5KYW B;  2CYZ B;  1PSF A;  1WGS A;  1JJ2 S;  3EFO A;  2QTV A;  2KXC A;  3JCM d;  4JRQ A;  5LJ5 f;  2DVJ A;  3CC4 Q;  2O9S A;  1QVF S;  4D6W A;  2K2V A;  4V2S A;  3GBQ A;  4M7A G;  2QA4 A;  4MDW A;  2EQK A;  4M78 E;  4E7S A;  1X27 A;  1BI0 A;  1VQK A;  2E10 A;  3VS0 A;  3I56 Q;  4J7I A;  3CXC S;  5M9O A;  4KH1 B;  1Q7Y R;  1VQ5 Q;  2R58 A;  3SDZ A;  4JLG A;  2X4X A;  3JCM Q;  3CQT A;  3URG A;  1ZBJ A;  5GJV B;  2OTL Q;  4L59 A;  3BY7 A;  3OW2 S;  2DTH A;  1YHQ Q;  4N0A A;  1SHG A;  3REB B;  4BE1 A;  3PVQ A;  2DO3 A;  1ZSZ B;  5KYY B;  4JRI A;  4N4H A;  3UWN A;  2J6F A;  3CCQ Q;  3THK A;  4X9C A;  4LDV A;  2HBW A;  3RKX A;  2M02 A;  2MOX A;  3JB9 I;  2YDL A;  3JCM P;  4BE0 A;  1WZO A;  2KYB A;  1G2B A;  2LCS A;  3L2Z A;  1QP2 A;  3RR6 A;  5ECA A;  4II1 A;  2JTF A;  6AT1 B;  2Y4Y A;  5KYU A;  1A0N B;  4OMP A;  5IHI A;  2LQK A;  2RH2 A;  3RKW A;  1PRL C;  2A7Y A;  1VQ7 Q;  3UA6 A;  3MHX A;  5CKF A;  2RHX A;  3GIB A;  4BI8 B;  3GP8 A;  3MP6 A;  4FSS A;  2FRY A;  4CC4 B;  1VQ5 A;  1XNI A;  3QJY A;  4M75 D;  4ANJ A;  4ZGD B;  2HKQ B;  5LJ5 h;  4OF1 A;  1LNX A;  2K3B A;  2JXB A;  4J83 A;  3EG9 B;  1YP5 A;  5L8R E;  3PIO A;  3OS2 A;  1OX8 A;  4ESR A;  1B34 A;  2NUP A;  4RTZ A;  4HT8 A;  1PKS A;  3JRZ A;  4C0G A;  1E7O A;  1Q81 U;  3G6E T;  4RUG A;  1AVZ C;  5GMK l;  1ACM B;  2DYI A;  1X2Q A;  5I2M A;  4BAC A;  2RHI A;  3QHS A;  5I2S A;  2M9U A;  3EFO B;  1KQS P;  4J6Y A;  3CCJ T;  2DRK A;  2DBM A;  4PJO E;  3HRT A;  2YLC A;  4M7D B;  2RD1 A;  2CH4 A;  2AK5 A;  3I55 Q;  4IUT A;  1N6A A;  3QBY A;  1M9S A;  5A0L A;  3OW2 A;  2KK4 A;  4B9W A;  3EH1 A;  5FRO A;  3CCR A;  5GAO r;  2RA2 A;  3E1S A;  4XTV A;  2DL8 A;  1GCQ A;  2VV5 A;  1IGQ A;  2J6K A;  1VQO A;  4XQ3 A;  1Q7Y C;  3A8G B;  2RJC A;  5LJ5 e;  3PT9 A;  3CCV A;  2FZG B;  3BE3 A;  5GAN 6;  2ZCF B;  2JTE A;  2ROT A;  3LWH A;  1IXD A;  1TUD A;  4C8Q F;  2EKO A;  2PVG B;  2LDM A;  5CQY A;  2K5L A;  1TSF A;  4MDX A;  5GAN 2;  3VS7 A;  3CC7 Q;  1D1A A;  1YJN A;  1MMN A;  1VUB A;  3VJP A;  4FCY A;  4ATO A;  3CD6 Q;  4HCK A;  1PSE A;  4J9I A;  3LX7 A;  2VKN A;  3RER A;  1VQ4 T;  2LC4 A;  4MMK A;  1VQN T;  2AKL A;  1UB4 A;  3SWN C;  4HKE A;  3CPW S;  2CT3 A;  4M7A F;  3CCQ T;  4EMK C;  1PM3 A;  3CCJ Q;  1KK7 A;  4XU1 A;  4B6M A;  4HCB A;  1X69 A;  3ER0 A;  4C0Z A;  4C8Q D;  2ZPF B;  5CR2 A;  5A0D A;  4JZ3 A;  1G83 A;  3PFS A;  3NTH A;  1KG1 A;  2DXC A;  2KT1 A;  2AIR B;  3CCS A;  4XTX A;  2LQW A;  3A5Z B;  4OP0 A;  1RI0 A;  4C5G A;  3V8L A;  1M90 R;  1RAC B;  1JXM A;  3LH0 A;  2IIM A;  5CKE A;  3CC7 A;  1PNJ A;  3OSS C;  1MUZ A;  2K57 A;  5I21 A;  3OSV A;  2DEU A;  1FYN A;  2DLP A;  2RI2 A;  5GAN e;  5KYX A;  1YJW T;  3EG0 A;  1UGQ B;  3RBB B;  1Q86 U;  4M77 F;  3CC2 T;  2LMJ A;  4PJO G;  2W10 A;  3VS5 A;  3OYF A;  1MV3 A;  1QP3 A;  5LJ5 j;  4IIO A;  4E7H A;  4M7D C;  2HL5 C;  4A4G A;  2DIQ A;  5D6W A;  3MP1 A;  2RQT A;  2L3Q A;  4DBR A;  3G4S Q;  1VQL A;  2L3P A;  2LRQ A;  3JCM b;  2F5K A;  3INZ A;  2EGA A;  4JJB A;  5GAN 5;  2CSI A;  4R56 A;  3QWY A;  3OYG A;  2L5Q A;  3MET A;  1S72 T;  1CKA A;  1RAA B;  2H8H A;  2OX7 A;  1ABQ A;  2DL4 A;  4M78 A;  2QTX A;  2V8I A;  2OTL T;  4PJO D;  4M75 F;  3M0T A;  4AFQ C;  4BE2 A;  2X4W A;  2DTO A;  4KRT A;  8ATC B;  1W1F A;  2P0Q A;  2RHU A;  1OI1 A;  2L8D A;  1VQ8 Q;  1VYT A;  2GNC A;  3MEA A;  4K11 A;  1Q86 R;  1G3Y A;  2DET A;  2BZX A;  4L6V 5;  3JCM X;  5KYX B;  4C8Q G;  3H0F A;  1WQW A;  4ZGJ B;  1NJI U;  1CKB A;  1B3Q A;  1Y57 A;  2IG0 A;  4N4I A;  9ATC B;  3QPH A;  1PG5 B;  1G3W A;  2H3E B;  2QQA A;  2MK5 A;  5L23 A;  5GAN j;  2NUT B;  4J6W A;  2EQM A;  2XK0 A;  2PNI A;  1LPL A;  1QW1 A;  2BKD N;  4M78 C;  2JMC A;  1VA7 A;  1R8O B;  1TUC A;  3E9F A;  1H3Z A;  1WYX A;  2FPD A;  3TU4 K;  4MZT A;  3M4G A;  2PU9 B;  1KSW A;  3OYH A;  4LXC A;  2K79 A;  1VQ8 A;  1B07 A;  2XHC A;  2FPE A;  1K9A A;  2DJQ A;  2RHY A;  1N8R U;  2KRO A;  1KD1 R;  1WHG A;  3BDL A;  1W2B A;  2LCC A;  1KHC A;  4OB2 B;  1T3L A;  2YRD A;  3EG2 A;  2ZPI B;  2EYW A;  2QQS A;  4Y91 A;  3PMT A;  1KD1 U;  4F7U B;  2KRS A;  2V8K A;  2QI2 A;  1UJY A;  2O88 A;  5EG2 A;  3JB9 G;  4VUB A;  5KYW A;  3SWN A;  3OMG A;  2YHT A;  4J7F A;  2VVK A;  2NUT A;  3H8Z A;  3RES A;  4PFO A;  2DNU A;  1KQ1 A;  2GQI A;  2CKK A;  1GFC A;  3OS0 A;  1XQH A;  2KBT A;  1WXU A;  2EQI A;  1BYM A;  1SHF A;  2QAS A;  2CSQ A;  3E19 A;  3JV3 A;  1KQS S;  3G1J A;  4LN2 A;  3L42 A;  1M1G A;  2JT4 A;  1YI2 A;  4F14 A;  2RQV A;  4BDZ A;  1VQ7 A;  1EIF A;  4M77 B;  1PC0 A;  2COW A;  2VGN A;  2X4J A;  2VC8 A;  4C0F A;  1S72 Q;  2LJ0 A;  4RTV A;  1IB8 A;  4OMN A;  1X6O A;  3OYN A;  4QW2 A;  4M75 B;  4Y28 E;  2GQV A;  4FYV B;  2QA4 T;  1M90 U;  5CIU A;  4PJO F;  2F5T X;  1U5S A;  1M2V B;  2JS0 A;  2KEA A;  3EGX B;  4F7U E;  1PHT A;  4A4H A;  4A53 A;  1UE9 A;  5GMK h;  2JZ2 A;  3H0I A;  3PE0 A;  2CP0 A;  3HPW A;  1VQ6 Q;  1WIE A;  2DL7 A;  2EVR A;  1UGV A;  2IVW A;  2EQJ A;  4B9X A;  3C94 A;  1Z9Q A;  4CC7 A;  4OMM A;  4DA4 A;  3P8H A;  2K7A A;  2MAM A;  2DD4 A;  4J6X A;  1D0Z A;  2JW4 A;  3CCR Q;  3CCU Q;  5FU7 B;  4M78 B;  2K6D A;  3NTI A;  3JCM V;  1W4S A;  2A37 A;  3SHW A;  3H41 A;  4IKF A;  1Y71 A;  3I5R A;  4LD9 K;  2A08 A;  3VV0 A;  4F7U G;  3GNG A;  3JSC A;  2MI6 A;  4PNO A;  4OVA A;  4Z88 A;  3SB2 A;  2NUP B;  1QCN A;  4EMH A;  2XI9 A;  1BIA A;  3ZFJ A;  2ZGW A;  1PWT A;  1SPK A;  5J39 A;  3EAE A;  3JB9 H;  2G3R A;  2OTJ T;  2DX1 A;  2MMP A;  1NE8 A;  1D0Y A;  2C0T A;  3A98 A;  5GAN 3;  2J6O A;  3FDR A;  3NPF A;  1D3B A;  2EGC A;  5HK3 A;  4KUL A;  2X3X D;  2XG8 D;  4E47 A;  5D6X A;  2EPD A;  1NYF A;  1JRI A;  4BY6 C;  1QQJ A;  2BZY A;  4XTU A;  2DXU A;  1I07 A;  2PQW A;  1RAG B;  4M7D E;  3DB3 A;  3CCJ A;  1P92 A;  2DL5 A;  3C95 A;  3FLG A;  1IRE B;  4M7D F;  1OV3 A;  2KAF A;  2HEQ A;  3CCS Q;  2VGM A;  3CCR T;  4JRP A;  4C8Q B;  4M77 C;  3X24 B;  4MML A;  1Q81 R;  5IHN A;  2QXF A;  1FMW A;  2D6F A;  1M90 C;  3EFS A;  1GBQ A;  1UJ0 A;  4M77 E;  1H64 1;  3I56 T;  1K73 U;  3CCM A;  4M75 C;  2DF6 A;  1VQM T;  2EGE A;  3P8B B;  4X9D A;  2DPP B;  4Y92 A;  2RJD A;  3PIP A;  1WHH A;  4ELZ C;  1QLY A;  4J9C A;  1AWX A;  4C92 C;  3CCE Q;  4PJM A;  4E7K A;  4LDX A;  1XJW B;  1OYX A;  4FYW B;  2WAC A;  3NGP A;  3L2V A;  3LGF A;  1Z9Z A;  5AT1 B;  1K4U S;  1BBZ A;  3CC4 T;  2JS2 A;  3IQL A;  4QT7 A;  3LLR A;  3G4S A;  1QVF A;  2EKH A;  4R0K A;  4RTY A;  3M0P A;  2JNG A;  5CO7 A;  2O2O A;  2NWM A;  1GBR A;  3OS1 A;  2LQN A;  4RTW A;  3OQ5 A;  4A4F A;  3CC2 Q;  1F1B B;  4KGV B;  1E6H A;  5FU6 C;  3HP9 A;  4C92 F;  4O5V A;  4E7Z A;  3CMA A;  3J80 E;  1N8R C;  1X75 C;  1ZSZ C;  2DKG A;  4AT1 B;  1HK9 A;  2J7I A;  5GAM f;  5GAN g;  1M1K R;  2FL7 A;  2GFA A;  4EMG A;  5IXB A;  1MMA A;  2EJF A;  2AZS A;  2CS7 A;  3AT1 B;  2GF7 A;  2KSS A;  3G7Z A;  4QQ6 A;  4Q5W A;  4RCB A;  1ZQ1 A;  4DBQ A;  3CCS T;  4HVU A;  4J5Y A;  4XU0 A;  1TS9 A;  2CDT A;  5CKH A;  3CEY A;  4JS5 A;  1RAI B;  2YUP A;  3FB9 A;  3MKD A;  1WQ7 A;  3X26 B;  1VQ9 T;  2M51 A;  2LTO A;  3RIR A;  1B34 B;  2RQW A;  1I0C A;  3CBO A;  4A54 A;  5J26 A;  4GLK A;  1K0S A;  1UG1 A;  1JXO A;  3CC2 A;  1VQ5 T;  1BCO A;  5DY9 A;  4JPB W;  2BIV A;  2E5Q A;  4XU2 A;  4PKC C;  4JJC A;  1QVG A;  1QVP A;  5FLX E;  2HBP A;  3UAT A;  3EGU A;  3M4Y A;  3H6Z A;  5GAM d;  1TXQ A;  3G6E A;  4WF2 A;  1C1A A;  1YJ9 Q;  2ZPH B;  3OY9 A;  4KUI A;  1FMK A;  1BKB A;  2LX7 A;  4KBM B;  1NJI C;  2PVD B;  8AT1 B;  5AYF A;  3F70 A;  2OJ2 A;  2PZ1 A;  2L2P A;  1K8A U;  5GAM h;  2L89 A;  1UFF A;  5FW9 A;  2KI7 A;  2RK1 A;  4AFU C;  1Q82 U;  4FYX B;  5FRN A;  4M78 G;  1RLQ C;  5CAI A;  2A28 A;  2EW3 A;  2O4X A;  4CC3 A;  1S1N A;  1VQ4 Q;  2E1H A;  2E3H A;  2KDS A;  3CBP A;  1TG0 A;  2LT1 A;  3H0H A;  5GMK e;  1WHL A;  4OB1 B;  2RNA A;  4PL6 A;  3I5S A;  3P8D A;  3X25 B;  1K73 C;  1UGR B;  4YTL A;  3GLX A;  1YI2 Q;  2QA4 Q;  1JB0 E;  2EFI A;  3QYG B;  2WSE E;  3PGG A;  2V1R A;  3CME A;  2VYT A;  3L1A A;  3SWN B;  1YJN T;  3LW5 E;  3BW1 A;  2O31 A;  1FMV A;  1X01 A;  1H92 A;  2DXT A;  2E70 A;  5A0G A;  1RL2 A;  1I5O B;  1PD0 A;  2COY A;  3KBG A;  5HK0 A;  1BI3 A;  4FT4 A;  1I4K 1;  1U1S A;  2CT4 A;  1YIJ Q;  4FSX A;  4FYY B;  2MIO A;  2SEM A;  5DM7 R;  3CCQ A;  1WJR A;  1MV0 B;  1MMD A;  1NYG A;  1KQS A;  3CPW A;  2LJ1 A;  2Y4X A;  1VQ6 A;  2K9G A;  4BB7 A;  1HXD A;  1W6X A;  1NLO C;  3CD6 A;  4F04 B;  2DYB A;  4EIK A;  1SSF A;  1RAD B;  4FM4 B;  1TTH B;  4PJO C;  4DEX A;  1BI2 A;  1RUW A;  4D8K A;  3KUF A;  1RAH B;  1T0J A;  3VUZ A;  4CC2 A;  3OYD A;  4M78 D;  4PJO A;  2JJ9 A;  4HCC A;  2H3J A;  1Q82 R;  1M8V A;  2FB7 A;  3OBY A;  5GAN 8;  1YJW A;  3JB9 J;  1OUL A;  2HMA A;  2AKK A;  2P84 A;  3VRZ A;  2OI3 A;  3EGX A;  4D8D A;  2F2X A;  1YI2 T;  3OS5 A;  1HD3 A;  3VRY A;  2VXE A;  4FIB A;  1BK2 A;  1OZ2 A;  4QKU A;  2HSP A;  1I1J A;  4EPC A;  3OBW A;  3J7A F;  5KE2 A;  2O9V A;  1VQL T;  3LGL A;  1VOM A;  2CP2 A;  4M7A E;  2OAU A;  4M75 G;  2XU8 A;  1N5Z A;  3O8V A;  3C12 A;  3M5A A;  5FRM A;  2EYQ A;  1Q82 C;  1E6G A;  4RKU E;  2CUD A;  2QDL A;  3GF5 A;  3OYK A;  5CKB A;  5HKC A;  4M77 G;  2JOY A;  1OOT A;  3JCM f;  3UDC A;  4A63 B;  4PLL A;  2D1X A;  1OU8 A;  2KVQ G;  1WJQ A;  4C5H A;  1KC8 R;  1NLP C;  4PK4 A;  1VQL Q;  1AWO A;  1OPK A;  5KYN A;  2E65 A;  3JCM c;  3CBM A;  1YJ9 T;  4DBF A;  2MYS A;  3CCV Q;  3TSZ A;  4JJD A;  1LCK A;  2K2M A;  2KMT A;  1M2V A;  4KUD K;  1EFN A;  3CCU T;  3ZL7 C;  2X4Y A;  2ECZ A;  3HL8 A;  2X51 A;  3X20 B;  3DKM A;  2FPF A;  4KH0 B;  2J06 A;  4RTU A;  3TQ7 P;  1XTD A;  2RJF A;  2K3X A;  4QQD A;  1GRI A;  1O9S A;  4KGX B;  3NFC A;  4JS4 A;  1KFZ A;  3QZ9 B;  1WJS A;  3DB4 A;  2HSE B;  4ORZ A;  4AFS C;  1GL5 A;  1NZ9 A;  2CUB A;  2ZPB B;  4PJL A;  3L2W A;  1DJ7 B;  2PUK B;  4J9B A;  1M4Z A;  1ZX6 A;  1X2K A;  2EBP A;  1LOJ A;  2FEI A;  2EYX A;  4WCI A;  2OTJ A;  2RF0 A;  3M0S A;  1WDX A;  3X28 B;  3C4S A;  3OA6 A;  3QDF A;  2L0A A;  2LZ6 B;  3LWI A;  2EJ9 A;  2PUO B;  1NG2 A;  2DZC A;  2HL3 A;  1HJD A;  1AT1 B;  2GFU A;  4RCC A;  5KH6 A;  1G8X A;  2QQ9 A;  2RMO A;  5GAN 4;  1NEG A;  3FJP A;  3Q1J A;  2HNI A;  1OEB A;  1IGU A;  4C0D B;  2E6N A;  2HDA A;  1OQK A;  4C5I A;  2DE0 X;  1TU0 B;  2BE7 D;  1MMG A;  3A8O B;  2XID A;  4J9E A;  3M59 A;  3EG9 A;  2GTO A;  1UTI A;  3G71 A;  2KRN A;  3QO3 A;  2RN8 A;  4XU3 A;  4ELY C;  1VQM A;  1Q86 C;  1BU1 A;  4J9G A;  2RPN A;  2V1Q A;  2QAZ A;  1VQ7 T;  4QQG A;  1YIT T;  2RO0 A;  2KRM A;  3V8J A;  2V26 A;  3UT1 A;  1K0X A;  4C92 D;  4OGE A;  3HSB A;  2EAY A;  2M0Y A;  2GBQ A;  4UC4 A;  3CPF A;  5HY6 A;  4A4E A;  3CC4 A;  4BD3 A;  1G3T A;  2L3S A;  3V7R A;  4IUP A;  2C06 A;  3G4S T;  3M53 A;  4FL6 A;  4GLM A;  2LP5 A;  1XOV A;  3RDV A;  4NS5 A;  2G6F X;  2R5A A;  3JCM e;  3G6E Q;  2F69 A;  2P0K A;  2RHZ A;  1WHM A;  3CCL T;  3CMA T;  2ZPG B;  4M7A C;  1NM7 A;  5FU7 C;  3G71 Q;  3MEV A;  2DIG A;  3M9Q A;  1YHQ A;  4XTW A;  2X9H A;  5CKD A;  2R5M A;  1KC8 C;  3S6W A;  2BTT A;  4F16 A;  2FYK A;  2YXY A;  1TH7 A;  2KXD A;  1N27 A;  5LJ3 j;  2EJG A;  5LJ3 h;  4C92 E;  1TUG B;  3HRS A;  3M0R A;  5HCK A;  3OYE A;  4FU6 A;  2KYM A;  1AZE A;  1JQQ A;  2DFU A;  4RG2 A;  1MGQ A;  1RLP C;  3TCJ A;  3SD4 A;  1VQP T;  1OZ3 A;  1BIB A;  2BUD A;  2HKN A;  2DTI A;  3FJ5 A;  2YLB A;  3CME Q;  4F7U A;  3MCA B;  4AG1 C;  4FW1 A;  5LL6 S;  4C92 A;  5D7U A;  5KE3 A;  1RAB B;  1WPY A;  2D0N A;  1RAF B;  1NJI R;  1K9M U;  2LQ8 A;  1YIJ A;  5IT9 E;  1TWB A;  1QVG P;  1V76 A;  4AG2 C;  2ED1 A;  1R77 A;  2E64 A;  3AHU A;  4C8Q C;  3FEO A;  3BFM A;  1EZZ B;  4PJN A;  2HQH A;  4LDW A;  1N8R R;  1Y96 A;  1Q81 C;  1J3T A;  4P5N A;  1YFN A;  3OYJ A;  3I55 A;  2CP3 A;  3HFN A;  5LJ5 d;  1ZHI A;  2ZPE B;  3VS4 A;  3PMI A;  1WHK A;  1ZA2 B;  2XDD A;  1VQK Q;  3KFV A;  3I56 A;  3CCM T;  1AHJ B;  3C0C A;  3V8K A;  3QII A;  2DA9 A;  3M0U A;  4QVZ A;  4JJN K;  2DXB A;  1YJW Q;  4J9H A;  1UGS B;  1IRX A;  4BY6 B;  2JVV A;  5CQX A;  2HZY A;  4M7D G;  2DK3 A;  2C0I A;  3LYI A;  1YCS B;  2Y90 A;  3NMZ C;  4QVD A;  3TSW A;  2K5I A;  4AMC A;  5I11 A;  3OYY A;  4J8O A;  3OYC A;  2COZ A;  2LVM A;  2ATC B;  4NL2 A;  4C8Q A;  2JN0 A;  3CME T;  3NTK A;  1ZA1 B;  2ENM A;  5KYU B;  1U06 A;  1YJN Q;  3MEW A;  1IO6 A;  4M7A A;  1LJO A;  4RG8 A;  1W2B P;  3QG1 A;  4CRI A;  5LJ3 f;  4LDY A;  3OYI A;  4XTY A;  4JUV A;  2X35 A;  1SKU B;  1VQ6 T;  1D3B B;  2M1H A;  4NL3 A;  3CD6 T;  1YWO A;  4JLI A;  1M30 A;  3EHR A;  1D09 B;  1WXB A;  1AD5 A;  1VYV A;  2CZ7 B;  4KGZ B;  2CP7 A;  4BUG A;  1UEC A;  3GPL A;  4HCZ A;  1X6B A;  1K73 R;  1VQ9 A;  1CSK A;  1OX9 A;  2RQU A;  4E7L A;  3S3O A;  5IH2 A;  1M3A A;  1YCY A;  3MJX A;  4ZNX A;  3SEM A;  2LCL A;  1KJW A;  1M3C A;  1W2B S;  2YRV A;  1QMC A;  1RAE B;  5FU6 B;  4C5E A;  3M55 A;  2QEX T;  1RI9 A;  4OMF B;  2HAX A;  4IUQ A;  4N0A C;  1BB9 A;  1M1F A;  1KC8 U;  1X43 A;  1GCP A;  3BDU A;  2VXF A;  1AEY A;  1ZLM A;  2XDP A;  2FZC B;  1WI7 A;  2VAS A;  3VU3 C;  2KQW A;  1G5V A;  1K8A C;  4FW2 A;  1KD1 C;  3SFM A;  1C6V X;  3PNW C;  1TOV A;  3A8H B;  4CI0 C;  2MWP A;  3ZEH A;  4DOW A;  4EMK B;  4A4K A;  5FWB A;  1HSQ A;  3QSU A;  2JM9 A;  2DJZ A;  3CXC P;  3CCL Q;  3ME9 A;  2GCX A;  1YNZ A;  4DOV A;  4FT2 A;  1VQN Q;  1KQ2 A;  2J05 A;  3M0Q A;  1VQ9 Q;  1QWE A;  2YT6 A;  5GAN f;  2R57 A;  1K76 A;  4M78 F;  1NBE B;  2EQU A;  4M75 A;  3RUX A;  4WTO B;  3JCM g;  3CCM Q;  2E41 A;  3D7S B;  4X34 A;  3TRE A;  4JZ4 A;  1VQO T;  2D8H A;  1AWJ A;  1YJ9 A;  2RI3 A;  3CCE A;  1I8F A;  3CCV T;  1SG5 A;  2F2V A;  4JDS A;  2WSC E;  4RMO A;  2E12 A;  4HVV A;  2CZ1 B;  1I5L A;  3R6N A;  3UF4 A;  2X3W D;  3EG3 A;  2AZV A;  3QWX X;  2KGT A;  1VQM Q;  3R6O A;  2RM4 A;  2CGH A;  5I22 A;  4GBQ A;  3I35 A;  2NLU A;  5IXF A;  2XDB A;  4HT9 A;  4HA8 A;  2M0O A;  2DVE A;  1VQ4 A;  2E3I A;  4IUR A;  1WX6 A;  2M16 A;  1VQN A;  2CP5 A; 
#chains in the Genus database with same CATH homology
 2QK0 A;  2E4H A;  2Z0W A;  2CP0 A;  1TOV A;  3RDV A;  2HKQ B;  2E3H A;  3E2U A;  2CP3 A;  2HL3 A;  2M02 A;  1WHJ A;  1WHM A;  1IXD A;  1WHL A;  2HL5 C;  2HQH A;  1WHK A;  2HKN A;  1WHG A;  2CP7 A;  1WHH A;  2COZ A;  2MPX C;  3TQ7 P;  1LPL A;  2CP6 A;  2E3I A;  1TXQ A;  2CP2 A;  2COY A;  2CP5 A;  2COW A;  4B6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...