2M02A

3d structure of cap-gly domain of mammalian dynactin determined by magic angle spinning nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structure of CAP-Gly Domain of Mammalian Dynactin Determined by Magic Angle Spinning NMR Spectroscopy: Conformational Plasticity and Interactions with End-Binding Protein EB1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
molecule keywords Dynactin subunit 1
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2m02A00
1WHKA 2COYA 2HL3A 2Z0WA 1WHHA 2E3IA 2CP5A 2M02A 2QK0A 4B6MA 2HL5C 1TXQA 2CP7A 2CP2A 1WHGA 3E2UA 2HQHA 2COZA 1LPLA 1WHMA 1IXDA 2HKNA 2CP0A 2CP6A 3TQ7P 3RDVA 2E3HA 2E4HA 1WHJA 2CP3A 2HKQB 1TOVA 2COWA 1WHLA 2MPXC
chains in the Genus database with same CATH superfamily
4A4GA 3A8LB 4WTOB 3EHQA 2ENMA 5GAN6 1IZ6A 3CMAT 1G3TA 3LLRA 1T3SA 4RTUA 4LNPA 1IGQA 2BUDA 1UTIA 3VRZA 4F16A 4C92G 3CMAQ 4MZPA 4J8OA 2JTMA 4ELYC 3QIIA 2W0ZA 3CCLT 2CUDA 2YLCA 3EH1A 2FVUA 1BK2A 3A8MB 3VS5A 1RADB 2M51A 3HPWA 1IGUA 1X75C 5GAN8 2K5LA 4JRQA 1PD0A 5KE3A 2LQKA 3OQ5A 2CUBA 2MWPA 4FT2A 5GANe 1M90U 3X26B 5HCKA 2C0IA 5GMKh 1PM3A 3VS0A 1VQNA 4PJMA 1VQ8T 3VYHB 3L2RA 1RAGB 2YHTA 4F04B 3PVQA 2HQEA 2ZPIB 4HT8A 1FMVA 1VQOQ 1VQOA 3QXEB 2F2VA 5GAN4 4BDYA 3OW2P 3NTKA 3KFVA 4J9CA 3GNFB 2CSQA 3CQTA 1VQOT 1UDLA 3EGXA 2ECZA 1OI1A 2XD0A 2D8HA 1FMKA 3CCUQ 5D6WA 1WA7A 1W1FA 2LT4A 1IXDA 5LJ3d 1YJWT 3CPWA 1VQ4A 2YUOA 1TS9A 4M77F 3C4SA 4C8QG 4JLGA 3OYCA 1M2VB 3G6ET 3P8HA 2JTEA 2DYBA 5LJ5f 2C0TA 3QHSA 3UA7A 3LYIA 4D8KA 2DTIA 3RESA 2K79A 1ABQA 3EG9A 2EPDA 1D3BB 2DL5A 2HSEB 4KH1B 3JCMW 4Z88A 1BB9A 1VYTA 3CCSA 3JCMJ 1YI2Q 3VKIA 3QWYA 2Y4XA 4CC7A 3CCET 3RIRA 4MZMA 1RABB 3JCMV 2DXTA 1Q7YU 4LN2A 2CP5A 2XIDA 5IT9E 3BE3A 4M7DG 2DMOA 1S72Q 1WXBA 3CCUT 1OQKA 4IUQA 4Z8AA 1PC0A 2DZ9A 1YN8A 2DEQA 2QG9B 1N9RA 1GXIE 1K0XA 3QWXX 4EMHA 5FRNA 1RLPC 4FW1A 3A5ZB 5LL6S 2HEQA 1T0JA 1QKWA 3UA6A 3S3OA 2RK2A 1WFWA 1UGPB 1C1AA 1YJWQ 2DPPB 4M7AB 2RHYA 1D1CA 1UE9A 1JQQA 2EBPA 4FYYB 2J6FA 1BKBA 4PJOG 3BDLA 3VS1A 5KYWA 4ANJA 3EG0A 2DJZA 2MAMA 3QSUA 1UJYA 5GANg 1JB0E 2YRCA 2O2OA 1JJ2P 4PFPA 2RHIA 1GBQA 3OW2S 1VQ4Q 3RR6A 3CXCS 4JS5A 1YITQ 2CZ0B 3V7SA 1HK9A 1G8XA 3FEOA 4J9FA 3L42A 1CKBA 2A37A 2P4TA 3EFOB 2JM9A 5GMKl 1W2BA 4F7UF 1X6GA 4RTXA 6AT1B 4C0FA 2FZKB 2HQXA 2OTJQ 5GMKi 3OYJA 1VUBA 1ACMB 2HNIA 4C0DC 4FYXB 1EFNA 4QQDA 2KY9A 1RACB 2W10A 4RCBA 1VQ6T 1TTHB 3RUXA 2FZGB 2XMFA 5KYWB 2K7AA 1WHKA 2D1XA 3M59A 3SEMA 2M0OA 2JN0A 2FYKA 3PFSA 2DNUA 2CS7A 2GNCA 2QEXT 4E7ZA 5IXBA 2L2PA 3QJ6A 2DL4A 1PSEA 2HDAA 2A0FB 1KFZA 1BU1A 2K4YA 4YTLA 5HKCA 2VUBA 1VQNT 4M78G 1QMCA 2MF2A 4HVUA 1LPLA 1QLYA 2JVVA 2A36A 2X3WD 2LJ3A 2QQRA 2RB6A 3M9QA 1M1GA 4ZGDB 3OY9A 4GY5A 1VQPT 5FU7B 4KGZB 3OBYA 1JRIA 4C8QB 4JDSA 5GAMe 1VQMT 5GAOp 4X9DA 1YHQQ 1X6OA 4L5GA 5LJ3f 1FXXA 2YXYA 5GAOm 1XOVA 2K3BA 4BD3A 1VQMQ 1YHQT 3RMSA 5CQXA 3M58A 3NTIA 3L2VA 3OBWA 2XK0A 2K3YA 1E6GA 3MP8A 2GFAA 1M1KR 1UHFA 3NMZC 1VQ7T 1VQNQ 2OAUA 3VV0A 2ED0A 1QCFA 4MMKA 4C0ZA 4LUDA 5KYUA 1VQPA 4LXCA 2QEXQ 4JJDA 2M1HA 4RCCA 3JCMh 4A4KA 3CPWS 1M30A 1Y57A 5DLQE 2EYWA 2EVRA 1YJ9T 3QJYA 4A4EA 1BIAA 3CC4A 3KBGA 1P92A 3MJXA 2BIVA 2ZAEA 1C6VX 1WGSA 2E64A 1YCYA 3FJPA 1NBEB 2EQKA 3CCRA 2I2LA 3CPFA 3M55A 3I5RA 2ATCB 4ESRA 1JU5C 5KYXA 4HCCA 5I22A 3SB2A 5KE2A 2PZ1A 2DA9A 2DF6A 2A28A 3OSVA 1AWWA 5AYFA 4KGVB 4HCKA 4AG1C 2O88A 1RAEB 2HL3A 1D0XA 3ER0A 1NEGA 3HRTA 5EC7A 1GFDA 1ZBXA 2KBTA 4J9IA 1VQ6A 3ZFJA 3UDCA 2OTLA 1U1SA 3EHRA 3V8JA 4XAXB 1E7OA 1TOVA 2YUPA 4FSSA 2L3RA 4BI4A 2X4XA 3EG9B 4AFZC 2IG0A 1UB4A 2DL3A 3VS4A 4F7UG 2EYZA 1QCOA 3M56A 3E2UA 3OYDA 2NUTA 4EIKA 2VYTA 4CC4B 4M75F 5C0MA 3M0RA 1N5ZA 5M9OA 3LWIA 4ELZC 2KSSA 1QVFS 4BI3A 3KUFA 5CCAA 5J3BA 3JV3A 2WSCE 2EAYA 4C5HA 3NTHA 2LX7A 1OYXA 4RTTA 1Q81C 3R6NA 1WHHA 2D9TA 3J81E 2RJEA 3VRYA 4R0KA 1I0CA 1NZ9A 1K9MC 4HVVA 2G3RA 2EKHA 3CCST 4M7DE 4QQ6A 5I2MA 3MEUA 2KAFA 3TREA 1KC8C 1VQKT 1GCQA 5IHNA 3CCEQ 1AWXA 2CT4A 5GMKe 2C06A 2M16A 2V8IA 5GAN3 5FLXE 4ZNXA 1TWBA 3MKDA 2KI7A 2E4HA 4ZGEB 4M78C 1WIEA 3CMAA 2GTOA 1VQ8Q 1Y07A 1YNZA 2RA2A 1M1KU 4XTWA 1NG2A 2E70A 2KEAA 3VS3A 2DVJA 1AD5A 1KD1R 3E19A 3JB9H 3DLLA 2LJ1A 2K9GA 1NJIR 1W4SA 3SD4A 4IURA 4C5IA 1VQKQ 3RKWA 5D6YA 4OMQA 2X51A 1GL5A 1AEYA 2KGTA 3M0TA 3CCMT 2RPNA 3X24B 1YP5A 2QI2A 1E6HA 1RAIB 4M7AG 2EQMA 1WXUA 2DFUA 2L3QA 2QQAA 5DY9A 2JJ9A 3V8LA 3JB9F 2DL7A 1I81A 3QDRB 2C0OA 1W2BP 1JEGA 2DAQA 2P0QA 4PNOA 4XU0A 5FRMA 2P84A 1KQSA 2YDLA 3CCQA 2CT3A 2ZZDA 5IXFA 1VQ6Q 3PE0A 4M78A 2IIMA 1PRMC 4DA4A 4PFZA 4PFOA 4C8QA 2M0YA 1KQSP 1M8VA 4RTZA 1WDXA 2J7IA 4AG2C 2MPXC 2QA4A 1K8AC 3PVLA 4OMMA 2OI3A 1ZX6A 2Z0WA 1WQ7A 3JAME 2OTLT 2K5FA 2LJ0A 3A8HB 3A8OB 4RTVA 3CCRQ 2VV5A 3RMQA 4BY6C 1XTDA 3VS2A 4B9WA 3LGFA 2QQBA 1I1JA 2ROTA 2GQVA 2JXBA 3TSZA 2DRKA 5DLOA 3CMEQ 4C92E 1G3WA 3HL8A 4BB7A 4LDWA 4RG2A 2CKKA 2YWWA 4M7AC 1QKXA 4J6YA 4B6MA 4XTXA 3P8DA 3OYAA 4NL3A 5GAN5 3Q1JA 4M78E 5CKEA 3CCVQ 2QA4Q 4NS5A 3RERA 3DLMA 1VQ5T 2DEUA 3CD6T 1Q86C 5LJ5j 1K8AU 1TU0B 4RTWA 4QW2A 5CAIA 2KXDA 2FRYA 3F70A 2E65A 1K1ZA 3CC4Q 1M8MA 2OTJT 1MGQA 1UGQB 1W70A 5GAMf 5CQYA 3I55Q 4M7DC 3HFOA 2JNGA 3OSSC 2DM1A 1YHQA 3S3NA 4JJBA 4E7SA 1GFCA 2PVOB 1OU8A 2NUPA 4A54A 3CBMA 3BFMA 3O8VA 1NEBA 4N4GA 2B86A 2D0QB 2E3IA 1KSWA 3LH5A 1OEBA 1H92A 3H41A 2YRVA 4M78D 4XTUA 4KGXB 2EFIA 2JT4A 4M7DD 5C6SA 1OOTA 3CC2T 2CP3A 2HKQB 5J39A 2CREA 4PJOD 2AKLA 2RF0A 1PWTA 4ZGJB 1RI9A 5HY6A 2JTFA 3HHTB 3QPHA 3I55T 4JRKA 2LQNA 2OAWA 4J9GA 4XTZA 4JZ3A 3CPWP 4PL6A 2AT1B 2QDYB 2K2VA 3PIOA 1QVGA 2K57A 1ZBJA 2RHZA 4EPCA 3QO3A 2KYBA 1UHCA 4R55A 5GAMh 4M77G 1Q81R 5IHIA 2CZ1B 1K76A 4MDXA 4PJOC 4PLIA 1JJ2S 1V29B 3MP6A 3ME9A 1NPRA 1JO8A 2EJFA 5LJ3j 1Y0MA 3QYGB 2DLPA 1K73C 3VJPA 4P5NA 1YJ9A 1YI2T 4PJOE 1KHCA 3JB9G 1K73U 2DXBA 3CC2A 2Y4YA 1OX8A 1QP2A 4NOYA 5I2SA 1MV0B 1BI0A 4F17A 2XI9A 2CP2A 2H8HA 4OB2B 1QVFA 2AZSA 1UFFA 4RUGA 5GANh 1M90R 2H3EB 4M7DA 1VQLA 4WF2A 2HBWA 1ZUYA 3OS5A 1IREB 2RM4A 2YLBA 3HRUA 4OMPA 2L3PA 5GAMd 4M7DF 3EGXB 1D1BA 3A8GB 1K9AA 1ZSZC 4LE9A 4QVDA 5GAN7 1M1FA 3SWNB 2LQWA 3OYFA 3FLGA 1VA7A 4JLIA 4M7AA 1AZGB 3RKXA 4OF1A 1W6XA 2L0AA 4XU3A 4KRTA 4PKCC 1H641 3G4SQ 4JUVA 2CP7A 4JRIA 1U06A 2HQHA 2QTVA 4O6JA 4HXJA 4ZTJA 5GAOl 3WXMB 1VQ7A 5GAMj 4UC4A 3HKSA 1AZEA 1BIBA 5D7UA 3VU3C 4EDUA 1YJWA 2KMTA 4N4IA 4C92D 3CCQT 1HD3A 5HK3A 3HTRA 2KRMA 4PLLA 1ZLMA 5A0GA 3GPLA 1K0SA 2QGFB 3C94A 2E3HA 1UJ0A 3J80E 4KUDK 1DJ7B 1D1AA 3QDFA 3CCVA 1QW1A 1S72A 1OU9A 2AKKA 3MCAB 5GANj 2SEMA 1WQWA 5KYYA 1R0CB 3GF5A 1YJNQ 1AHJB 2BE7D 4C92C 2XICA 3G6EA 5CO7A 3QZ5B 3SFMA 5FU7C 3HSBA 5L23A 3VS6A 3RDVA 3V8KA 1B34A 1F1BB 2JM8A 1Q82U 4RMOA 1WX6A 8ATCB 4F7UE 3CCMQ 3JCMX 2EQJA 1SPKA 4BE1A 4J83A 5LJ3g 1EZZB 4M7AF 1Q86R 2K6DA 1U1TA 3HFNA 4D8DA 2DO3A 3JSCA 1K73R 1WJSA 4FM4B 4ME7A 3HP9A 4E2FB 1BI1A 3JCMP 4MDWA 3M4YA 3BY7A 2XDBA 3JB9D 3TSWA 4IUPA 4PJLA 1OPKA 4N0AC 2ABLA 5HK0A 2E6NA 2X35A 2QAZA 2O4XA 1TH7A 4LDUA 5KH6A 1WLPB 2LCSA 4M78F 2JMAA 1M90C 2B8AA 2SRCA 2JOYA 2X9HA 1D3BA 1IO6A 2KQWA 5GAOn 1OULA 2MWOA 2NUPB 4XU2A 4A4FA 2RI2A 3HRSA 3EG1A 1TUGB 3S3MA 1NM7A 5IN1A 4E7KA 1VQ4T 4PJNA 4AFQC 2RK1A 1QVGP 2K3XA 1GCPA 2F5KA 2XU8A 2BTTA 2I0NA 1KC8R 1KG1A 3P8BB 3VUBA 3RKYA 1UGSB 1UUEA 1I4K1 4E7HA 1YIJT 4GLMA 2GQIA 2NLUA 3X25B 1VQ5Q 1I5LA 1MNDA 2DVEA 3PGGA 2NYSA 4J6WA 2KROA 2M02A 1NE8A 4M7AD 3G4SA 4CRIA 3D7SB 2L5QA 3JCMc 2DE0X 3CCJT 2FPFA 1GBRA 1PCXA 3QKJA 5GANd 4GLKA 3JB9J 1R8OB 3PT9A 2ED1A 3A98A 3OS1A 2PNIA 1SG5A 3LW5E 3JB9I 3M5AA 3IQLA 1YITA 3L1AA 1Q82C 1YCSB 3PTAA 4L6V5 2J05A 3VYGA 1KHIA 3CCRT 5GJWB 2MIOA 1ZA1B 2HL5C 2L8DA 3DKMA 1G3YA 5CKBA 5GAN2 1NLPC 4C8QD 3A1PA 4M77D 3MO8A 3SWNC 2J06A 3EG3A 1S1NA 2R5AA 5ECAA 1RI0A 4BI8B 1WHJA 4FIBA 2KDSA 3MEVA 4LDXA 1EIFA 1B3QA 2O4XB 1N8RU 1MUZA 2L89A 2PU9B 2RQWA 2LC4A 2KRNA 2EWNA 4M78B 1K9MU 1X01A 4X9CA 4M75A 2DD5A 4VUBA 1KIKA 3CCLA 2DILA 1SRMA 2J6KA 2E1HA 3OS0A 1LCKA 1IHWA 1QVGS 1UGVA 1RAFB 1RAAB 1YJ9Q 4XTVA 3L2QA 1IRXA 5LJ5h 1M2OA 1OZ3A 1X43A 2EW3A 4FCYA 3M0QA 2JZ2A 4M75C 2LCLA 2DZCA 2VGMA 1X2KA 2E41A 2FB7A 3JCMQ 4XU1A 1K9MR 4M77E 1KD1C 2BE9B 5CKDA 2DD4A 1RLQC 2LVMA 1LJOA 2VGNA 4NL2A 1KK7A 3SWNA 1AVZC 4LD9K 1NJIC 2R58A 2EGAA 1M4ZA 3TEEA 4RG8A 2BZXA 1AT1B 2KYMA 4IIOA 2O01E 4JPBW 3N5BB 1QWFA 3QZ9B 1S72T 3LGLA 2RJFA 4FYVB 1M3CA 3I5SA 1PD1A 3EFRA 4AFSC 2EYYA 2EJ9A 2YRDA 4B9XA 2V26A 3EH2A 3SHWA 2CZ7B 3M53A 1U3OA 2E10A 1IB8A 2KVQG 4CC3A 4XK8E 3OB9A 3X20B 1FYNA 2FG0A 1AWOA 2XKOC 1NYGA 2YUNA 1WJRA 2DRMA 2COZA 2QQSA 4M77A 4CI0C 2EQIA 3NHNA 3PMIA 1KJWA 3E9GA 4N4HA 4DBHA 1MHNA 2F1LA 3CC7T 2KE9A 2EQUA 2AHJB 2V1QA 2YSQA 2YUQA 1KC8U 1N8RR 1X2QA 2OX7A 3CCSQ 1A0NB 1VQKA 1I07A 4Q5WA 1N6AA 3DB4A 1MMDA 4OGCA 2DBKA 4HVWA 3M0UA 2DXCA 2DTOA 1SF9A 2RHUA 3VUZA 3REAB 3KXTA 3MP1A 3NFCA 3OYBA 2RQVA 2FO0A 2X4JA 4Y91A 3M0SA 3BW1A 9ATCB 2RN8A 1FX7A 2QEXA 2XG8D 4DEYA 1CSKA 2XDDA 4LD6A 4E47A 4N0AA 2DKGA 1T0HA 4EMKC 3VS7A 1NLOC 3C95A 2QYZA 2J6OA 3EGDB 4EMGA 2JS2A 4DOWA 4AT1B 3CCEA 2ZPEB 4RKUE 2KT1A 3OYLA 4DEXA 5IAYA 4KULA 4M7AE 4FW2A 2D6FA 2DX1A 2EGEA 1ZSZB 5IHKA 4O5VA 2DBMA 1Q86U 4E7JA 3EG2A 2D8JA 2MCNA 1D0YA 2V8JA 5LJ3h 5GAOr 3G6EQ 4X1VA 2CGHA 2EGCA 4OP0A 1Q82R 1BCMA 3FC3A 3GBQA 3S6WA 2P0KA 4C92F 2ZPBB 1ABOA 5KCOA 4J7FA 2ZGWA 1G5VA 2MK5A 2DXUA 2JUFA 5LJ5g 3JCMb 4E7LA 4ZN1A 1WHGA 2DERA 1MNEA 4C8QE 2GGRA 1W2BS 1HYOA 5D6XA 2CP6A 1MMAA 1H8KA 2F5TX 4JRPA 4C8QF 4FYWB 3JCMf 2HMAA 2YT6A 5CKFA 1LOJA 2E5QA 2OTJA 1HXDA 3E9FA 1SKUB 1M1KC 2RMOA 2NWMA 2CYZB 4LDYA 3CXCA 3H6ZA 3CBOA 5KYNA 1OX9A 1R0BG 1GRIA 1SSFA 4L59A 5LJ5d 3UT1A 3OYHA 3LH0A 4J5YA 4HKEA 3I35A 3ZL7C 3CBPA 1D09B 1UGRB 4TVRA 1KQSS 2KT8A 3UWNA 2O9VA 4QVZA 4QVCA 3CC7A 4Z02A 1ZSZA 2VB6A 2QQ9A 2RO0A 2ZPGB 4OB0B 3V7CA 4FT4A 2MOXA 3OMCA 1NYFA 5FWCA 4C92A 4KH0B 2ROLA 2KR3A 2QA4T 1VQ8A 2H3JA 3MEAA 1YITT 2XDPA 1M3AA 2ESWA 5GMKm 2JS0A 2FZCB 3PNWC 2EJGA 3GLXA 2RD1A 2KXCA 4ZTFA 1Y96B 1UEBA 3QYHB 5EG2A 5LJ3e 3OYGA 2RI3A 2PVGB 3EAEA 5CR2A 1WI7A 1O9SA 1M27C 1RAHB 1TXQA 1Z9QA 4J9BA 4C5EA 5IH2A 3U23A 5AT1B 2CH4W 1I8FA 2QDLA 3META 3ASKA 3J7AF 4PJOF 4C0DB 5CK9A 1VQ9Q 2CSIA 3NPFA 4BE0A 1KQ1A 3GNGA 4Y28E 2PQWA 2V8KA 2QK0A 4KUIA 1JXMA 3RNJA 1QCNA 1NPPA 2EYXA 4GBQA 3M54A 1VIEA 4JZ4A 3FJ5A 2A08A 4OMOA 3TQ7P 2GFUA 2AK5A 2WSFE 3NGPA 3SDZA 2LDMA 4X34A 1QVFP 2A7YA 2RH2A 1M9SA 2IVWA 3CD6A 1YWPA 2HD0A 1M2VA 3E1SA 1JJ2A 2DJQA 2X4YA 2LT1A 3UPUA 5A0DA 1RUWA 4Z89A 2PVDB 2NUZA 2DL8A 1QQJA 1X69A 4PK4A 3GP8A 1VQ9T 2E6ZA 5I21A 3QBYA 3H8ZA 3CCLQ 1TG0A 1YWOA 2FEIA 2LMJA 2MI6A 3OYKA 1ARKA 1IHVA 3TU4K 2DETA 3QG1A 1V76A 3UATA 4BACA 4DBQA 3I55A 3G1JA 3GIBA 3CC2Q 3H9NA 1Y96A 4BUGA 1SEMA 3L2WA 1B34B 1Q81U 5KCHA 1HJDA 2RQRA 4PJOA 4EMKB 2NUTB 3OYYA 2PUKB 2VVKA 1BI3A 4MZTA 1PSFA 1M5Q1 3PMTA 4J9HA 1YBYA 2HCKA 1WHMA 1ZUUA 3ULRB 3CC7Q 4F7UB 4FU6A 2XHCA 4A63B 2BKDN 1VQPQ 1K8AR 1PNJA 1WPYA 5FU6C 5J26A 1X6BA 1AOJA 2OJ2A 2QASA 3OS2A 1ZA2B 3CMEA 3G7ZA 2BZ8A 1O75A 1N8RC 4JJCA 3URGA 2IPOB 2WACA 2ZCFB 1VOMA 4CC2A 3G4ST 1VQMA 1OZ2A 4ZN3A 1X27A 2GCXA 2VKNA 5FROA 5A2QE 1VQ7Q 3GOXA 1XNIA 1VQ5A 2HZYA 4XTYA 4AFUC 1ZSGA 2LNHB 3L2ZA 4A53A 1BYMA 2E12A 4C8QC 2V1RA 1Y7XA 1Q7YR 2HKNA 3CCQQ 3JCMd 4Y92A 2O9SA 2LZ6B 2RJCA 2CP0A 1V1CA 2F69A 2E5KA 2FPEA 3MEWA 1Z9ZA 2RJDA 4PJJA 3ZBDA 1RL2A 4OVAA 4FL6A 3C0CA 2VASA 1M3BA 1WNLA 3C12A 2R57A 2OTLQ 1WZOA 2PTKA 4QT7A 1J3TA 2VXEA 1JBMA 2Y90A 2AIRB 2RNAA 1SSHA 2EYQA 1OV3A 1WXTA 4C5GA 3JRZA 1PG5B 4IIMA 4BDZA 4LDVA 2LP5A 3JCMg 5LJ5e 3OA6A 1LNXA 2AZVA 2FL7A 4OB3B 2DTHA 4E6RA 5FWBA 5GAOq 1SHFA 1PKTA 2L3SA 1D0ZA 1EX4A 2CH4A 3FRNA 1XJWB 4DOVA 1H3HA 4R56A 4WCIA 2EKOA 7AT1B 5I11A 4IUUA 1NJIU 3H0IA 3EGDA 5DM7R 5A0LA 3BDUA 5FW9A 4IUVA 1PKSA 2VWFA 2GF7A 3JCMe 2COWA 1FWZA 4OMNA 2VC8A 4RTYA 3TCJA 2P0PA 3I56T 5GJVB 3CC4T 1MV3A 1YJNA 2X3XD 4IUTA 3DB3A 1H3ZA 2RHXA 2LX9A 3X28B 1FMWA 1G83A 1B07A 1WYXA 4DBRA 3CCJQ 4K11A 3LWHA 3AHUA 1K4US 3L2UA 1MMNA 4M75G 4C0GA 2RQUA 4BE2A 2HSPA 2RQTA 4HCZA 4J9DA 3ZEHA 2HAXA 3G71A 2KK4A 1SHGA 4BY6B 3CEYA 4XQ3A 1BBZA 3OW2A 1OPLA 4LUEA 2O31A 2LTOA 4OB1B 3THKA 1U5SA 1SRLA 4II1A 4C92B 3I56A 2KNBB 2DIGA 2BZYA 1G3SA 2A3LA 2EIFA 2ZPFB 2QTXA 4OGEA 1KQ2A 4J6XA 4KT0E 1BI2A 4M77B 1QP3A 2LRQA 4M4ZA 1XQHA 2LQ8A 2HBPA 3G71Q 3EGUA 2FPDA 4F7UA 4D6WA 2QXFA 1KD1U 4QQGA 3G71T 3CXCP 3REBB 1TUCA 5GANf 2DYIA 1B7TA 2GBQA 3EFSA 4ORZA 4HT9A 1PRLC 4EMKA 3CCJA 3CD6Q 5KYXB 3I56Q 2CDTA 1HSQA 3PIPA 4V2SA 2D0NA 1UECA 3R6OA 1YI2A 1TUDA 1MMGA 3RBBB 1VIFA 4KBMB 4AMCA 1VYUA 4DQ2A 1VQLQ 1QWEA 2KRSA 1VQ9A 3CCUA 1U8RA 4ATOA 1YJNT 1GCQC 1C0MA 2MYSA 4OMFB 1PHTA 2DK3A 5KYUB 3CMET 4J9EA 2K2MA 3CCMA 2VXFA 3INZA 4J7IA 5CIUA 2JW4A 4JS4A 3OYMA 4M77C 3V7RA 1WHLA 2LCCA 4M7DB 3EFOA 4DBFA 2COYA 2F2XA 2CZ6B 1I5OB 4M75E 2PUOB 2G6FX 4A4HA 1WJQA 2FRWA 1N27A 3M0PA 1CKAA 5L8RE 2QGGA 3MHXA 1ZUKA 2P4RA 1Q7YC 1LVKA 3M4GA 1TSFA 2RI5A 1N9SA 2LNVA 5GMKj 2K5IA 3MPUB 1BCOA 1T3LA 2WSEE 3LX7A 1QVPA 1JXOA 3OYEA 1R77A 3H0FA 4MMLA 2F2WA 3TVTA 2R5MA 4PJOB 1VQLT 3FIFA 5CKHA 5GAMg 3M57A 1ZHIA 3O5ZA 2GTJA 3I9QA 4HA8A 2M9UA 4OMLA 3H0HA 3UF4A 4FSXA 2MMPA 1G2BA 8AT1B 4E7IA 3OYIA 1YFNA 3FB9A 4HCBA 3WVDB 4M75D 4F14A 1Q95G 5FU6B 1ZQ1A 3OMGA 3CCVT 2FHDA 3AT1B 1AWJA 1YIJQ 1YIJA 2ZPHB 3T9NA 3OYNA 3QUIA 1Y71A 5KYYB 3WVEB 1VYVA 5CVIA 2JMCA 4M75B 2X4WA 1UG1A 4JJNK 4QKUA 3FDRA 2DIQA 4IKFA
chains in the Genus database with same CATH topology
1WHKA 2COYA 2HL3A 2Z0WA 1WHHA 2E3IA 2CP5A 2M02A 2QK0A 4B6MA 2HL5C 1TXQA 2CP7A 2CP2A 1WHGA 3E2UA 2HQHA 2COZA 1LPLA 1WHMA 1IXDA 2HKNA 2CP0A 2CP6A 3TQ7P 3RDVA 2E3HA 2E4HA 1WHJA 2CP3A 2HKQB 1TOVA 2COWA 1WHLA 2MPXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHK A;  2COY A;  2HL3 A;  2Z0W A;  1WHH A;  2E3I A;  2CP5 A;  2M02 A;  2QK0 A;  4B6M A;  2HL5 C;  1TXQ A;  2CP7 A;  2CP2 A;  1WHG A;  3E2U A;  2HQH A;  2COZ A;  1LPL A;  1WHM A;  1IXD A;  2HKN A;  2CP0 A;  2CP6 A;  3TQ7 P;  3RDV A;  2E3H A;  2E4H A;  1WHJ A;  2CP3 A;  2HKQ B;  1TOV A;  2COW A;  1WHL A;  2MPX C; 
#chains in the Genus database with same CATH topology
 4A4G A;  3A8L B;  4WTO B;  3EHQ A;  2ENM A;  5GAN 6;  1IZ6 A;  3CMA T;  1G3T A;  3LLR A;  1T3S A;  4RTU A;  4LNP A;  1IGQ A;  2BUD A;  1UTI A;  3VRZ A;  4F16 A;  4C92 G;  3CMA Q;  4MZP A;  4J8O A;  2JTM A;  4ELY C;  3QII A;  2W0Z A;  3CCL T;  2CUD A;  2YLC A;  3EH1 A;  2FVU A;  1BK2 A;  3A8M B;  3VS5 A;  1RAD B;  2M51 A;  3HPW A;  1IGU A;  1X75 C;  5GAN 8;  2K5L A;  4JRQ A;  1PD0 A;  5KE3 A;  2LQK A;  3OQ5 A;  2CUB A;  2MWP A;  4FT2 A;  5GAN e;  1M90 U;  3X26 B;  5HCK A;  2C0I A;  5GMK h;  1PM3 A;  3VS0 A;  1VQN A;  4PJM A;  1VQ8 T;  3VYH B;  3L2R A;  1RAG B;  2YHT A;  4F04 B;  3PVQ A;  2HQE A;  2ZPI B;  4HT8 A;  1FMV A;  1VQO Q;  1VQO A;  3QXE B;  2F2V A;  5GAN 4;  4BDY A;  3OW2 P;  3NTK A;  3KFV A;  4J9C A;  3GNF B;  2CSQ A;  3CQT A;  1VQO T;  1UDL A;  3EGX A;  2ECZ A;  1OI1 A;  2XD0 A;  2D8H A;  1FMK A;  3CCU Q;  5D6W A;  1WA7 A;  1W1F A;  2LT4 A;  1IXD A;  5LJ3 d;  1YJW T;  3CPW A;  1VQ4 A;  2YUO A;  1TS9 A;  4M77 F;  3C4S A;  4C8Q G;  4JLG A;  3OYC A;  1M2V B;  3G6E T;  3P8H A;  2JTE A;  2DYB A;  5LJ5 f;  2C0T A;  3QHS A;  3UA7 A;  3LYI A;  4D8K A;  2DTI A;  3RES A;  2K79 A;  1ABQ A;  3EG9 A;  2EPD A;  1D3B B;  2DL5 A;  2HSE B;  4KH1 B;  3JCM W;  4Z88 A;  1BB9 A;  1VYT A;  3CCS A;  3JCM J;  1YI2 Q;  3VKI A;  3QWY A;  2Y4X A;  4CC7 A;  3CCE T;  3RIR A;  4MZM A;  1RAB B;  3JCM V;  2DXT A;  1Q7Y U;  4LN2 A;  2CP5 A;  2XID A;  5IT9 E;  3BE3 A;  4M7D G;  2DMO A;  1S72 Q;  1WXB A;  3CCU T;  1OQK A;  4IUQ A;  4Z8A A;  1PC0 A;  2DZ9 A;  1YN8 A;  2DEQ A;  2QG9 B;  1N9R A;  1GXI E;  1K0X A;  3QWX X;  4EMH A;  5FRN A;  1RLP C;  4FW1 A;  3A5Z B;  5LL6 S;  2HEQ A;  1T0J A;  1QKW A;  3UA6 A;  3S3O A;  2RK2 A;  1WFW A;  1UGP B;  1C1A A;  1YJW Q;  2DPP B;  4M7A B;  2RHY A;  1D1C A;  1UE9 A;  1JQQ A;  2EBP A;  4FYY B;  2J6F A;  1BKB A;  4PJO G;  3BDL A;  3VS1 A;  5KYW A;  4ANJ A;  3EG0 A;  2DJZ A;  2MAM A;  3QSU A;  1UJY A;  5GAN g;  1JB0 E;  2YRC A;  2O2O A;  1JJ2 P;  4PFP A;  2RHI A;  1GBQ A;  3OW2 S;  1VQ4 Q;  3RR6 A;  3CXC S;  4JS5 A;  1YIT Q;  2CZ0 B;  3V7S A;  1HK9 A;  1G8X A;  3FEO A;  4J9F A;  3L42 A;  1CKB A;  2A37 A;  2P4T A;  3EFO B;  2JM9 A;  5GMK l;  1W2B A;  4F7U F;  1X6G A;  4RTX A;  6AT1 B;  4C0F A;  2FZK B;  2HQX A;  2OTJ Q;  5GMK i;  3OYJ A;  1VUB A;  1ACM B;  2HNI A;  4C0D C;  4FYX B;  1EFN A;  4QQD A;  2KY9 A;  1RAC B;  2W10 A;  4RCB A;  1VQ6 T;  1TTH B;  3RUX A;  2FZG B;  2XMF A;  5KYW B;  2K7A A;  1WHK A;  2D1X A;  3M59 A;  3SEM A;  2M0O A;  2JN0 A;  2FYK A;  3PFS A;  2DNU A;  2CS7 A;  2GNC A;  2QEX T;  4E7Z A;  5IXB A;  2L2P A;  3QJ6 A;  2DL4 A;  1PSE A;  2HDA A;  2A0F B;  1KFZ A;  1BU1 A;  2K4Y A;  4YTL A;  5HKC A;  2VUB A;  1VQN T;  4M78 G;  1QMC A;  2MF2 A;  4HVU A;  1LPL A;  1QLY A;  2JVV A;  2A36 A;  2X3W D;  2LJ3 A;  2QQR A;  2RB6 A;  3M9Q A;  1M1G A;  4ZGD B;  3OY9 A;  4GY5 A;  1VQP T;  5FU7 B;  4KGZ B;  3OBY A;  1JRI A;  4C8Q B;  4JDS A;  5GAM e;  1VQM T;  5GAO p;  4X9D A;  1YHQ Q;  1X6O A;  4L5G A;  5LJ3 f;  1FXX A;  2YXY A;  5GAO m;  1XOV A;  2K3B A;  4BD3 A;  1VQM Q;  1YHQ T;  3RMS A;  5CQX A;  3M58 A;  3NTI A;  3L2V A;  3OBW A;  2XK0 A;  2K3Y A;  1E6G A;  3MP8 A;  2GFA A;  1M1K R;  1UHF A;  3NMZ C;  1VQ7 T;  1VQN Q;  2OAU A;  3VV0 A;  2ED0 A;  1QCF A;  4MMK A;  4C0Z A;  4LUD A;  5KYU A;  1VQP A;  4LXC A;  2QEX Q;  4JJD A;  2M1H A;  4RCC A;  3JCM h;  4A4K A;  3CPW S;  1M30 A;  1Y57 A;  5DLQ E;  2EYW A;  2EVR A;  1YJ9 T;  3QJY A;  4A4E A;  1BIA A;  3CC4 A;  3KBG A;  1P92 A;  3MJX A;  2BIV A;  2ZAE A;  1C6V X;  1WGS A;  2E64 A;  1YCY A;  3FJP A;  1NBE B;  2EQK A;  3CCR A;  2I2L A;  3CPF A;  3M55 A;  3I5R A;  2ATC B;  4ESR A;  1JU5 C;  5KYX A;  4HCC A;  5I22 A;  3SB2 A;  5KE2 A;  2PZ1 A;  2DA9 A;  2DF6 A;  2A28 A;  3OSV A;  1AWW A;  5AYF A;  4KGV B;  4HCK A;  4AG1 C;  2O88 A;  1RAE B;  2HL3 A;  1D0X A;  3ER0 A;  1NEG A;  3HRT A;  5EC7 A;  1GFD A;  1ZBX A;  2KBT A;  4J9I A;  1VQ6 A;  3ZFJ A;  3UDC A;  2OTL A;  1U1S A;  3EHR A;  3V8J A;  4XAX B;  1E7O A;  1TOV A;  2YUP A;  4FSS A;  2L3R A;  4BI4 A;  2X4X A;  3EG9 B;  4AFZ C;  2IG0 A;  1UB4 A;  2DL3 A;  3VS4 A;  4F7U G;  2EYZ A;  1QCO A;  3M56 A;  3E2U A;  3OYD A;  2NUT A;  4EIK A;  2VYT A;  4CC4 B;  4M75 F;  5C0M A;  3M0R A;  1N5Z A;  5M9O A;  3LWI A;  4ELZ C;  2KSS A;  1QVF S;  4BI3 A;  3KUF A;  5CCA A;  5J3B A;  3JV3 A;  2WSC E;  2EAY A;  4C5H A;  3NTH A;  2LX7 A;  1OYX A;  4RTT A;  1Q81 C;  3R6N A;  1WHH A;  2D9T A;  3J81 E;  2RJE A;  3VRY A;  4R0K A;  1I0C A;  1NZ9 A;  1K9M C;  4HVV A;  2G3R A;  2EKH A;  3CCS T;  4M7D E;  4QQ6 A;  5I2M A;  3MEU A;  2KAF A;  3TRE A;  1KC8 C;  1VQK T;  1GCQ A;  5IHN A;  3CCE Q;  1AWX A;  2CT4 A;  5GMK e;  2C06 A;  2M16 A;  2V8I A;  5GAN 3;  5FLX E;  4ZNX A;  1TWB A;  3MKD A;  2KI7 A;  2E4H A;  4ZGE B;  4M78 C;  1WIE A;  3CMA A;  2GTO A;  1VQ8 Q;  1Y07 A;  1YNZ A;  2RA2 A;  1M1K U;  4XTW A;  1NG2 A;  2E70 A;  2KEA A;  3VS3 A;  2DVJ A;  1AD5 A;  1KD1 R;  3E19 A;  3JB9 H;  3DLL A;  2LJ1 A;  2K9G A;  1NJI R;  1W4S A;  3SD4 A;  4IUR A;  4C5I A;  1VQK Q;  3RKW A;  5D6Y A;  4OMQ A;  2X51 A;  1GL5 A;  1AEY A;  2KGT A;  3M0T A;  3CCM T;  2RPN A;  3X24 B;  1YP5 A;  2QI2 A;  1E6H A;  1RAI B;  4M7A G;  2EQM A;  1WXU A;  2DFU A;  2L3Q A;  2QQA A;  5DY9 A;  2JJ9 A;  3V8L A;  3JB9 F;  2DL7 A;  1I81 A;  3QDR B;  2C0O A;  1W2B P;  1JEG A;  2DAQ A;  2P0Q A;  4PNO A;  4XU0 A;  5FRM A;  2P84 A;  1KQS A;  2YDL A;  3CCQ A;  2CT3 A;  2ZZD A;  5IXF A;  1VQ6 Q;  3PE0 A;  4M78 A;  2IIM A;  1PRM C;  4DA4 A;  4PFZ A;  4PFO A;  4C8Q A;  2M0Y A;  1KQS P;  1M8V A;  4RTZ A;  1WDX A;  2J7I A;  4AG2 C;  2MPX C;  2QA4 A;  1K8A C;  3PVL A;  4OMM A;  2OI3 A;  1ZX6 A;  2Z0W A;  1WQ7 A;  3JAM E;  2OTL T;  2K5F A;  2LJ0 A;  3A8H B;  3A8O B;  4RTV A;  3CCR Q;  2VV5 A;  3RMQ A;  4BY6 C;  1XTD A;  3VS2 A;  4B9W A;  3LGF A;  2QQB A;  1I1J A;  2ROT A;  2GQV A;  2JXB A;  3TSZ A;  2DRK A;  5DLO A;  3CME Q;  4C92 E;  1G3W A;  3HL8 A;  4BB7 A;  4LDW A;  4RG2 A;  2CKK A;  2YWW A;  4M7A C;  1QKX A;  4J6Y A;  4B6M A;  4XTX A;  3P8D A;  3OYA A;  4NL3 A;  5GAN 5;  3Q1J A;  4M78 E;  5CKE A;  3CCV Q;  2QA4 Q;  4NS5 A;  3RER A;  3DLM A;  1VQ5 T;  2DEU A;  3CD6 T;  1Q86 C;  5LJ5 j;  1K8A U;  1TU0 B;  4RTW A;  4QW2 A;  5CAI A;  2KXD A;  2FRY A;  3F70 A;  2E65 A;  1K1Z A;  3CC4 Q;  1M8M A;  2OTJ T;  1MGQ A;  1UGQ B;  1W70 A;  5GAM f;  5CQY A;  3I55 Q;  4M7D C;  3HFO A;  2JNG A;  3OSS C;  2DM1 A;  1YHQ A;  3S3N A;  4JJB A;  4E7S A;  1GFC A;  2PVO B;  1OU8 A;  2NUP A;  4A54 A;  3CBM A;  3BFM A;  3O8V A;  1NEB A;  4N4G A;  2B86 A;  2D0Q B;  2E3I A;  1KSW A;  3LH5 A;  1OEB A;  1H92 A;  3H41 A;  2YRV A;  4M78 D;  4XTU A;  4KGX B;  2EFI A;  2JT4 A;  4M7D D;  5C6S A;  1OOT A;  3CC2 T;  2CP3 A;  2HKQ B;  5J39 A;  2CRE A;  4PJO D;  2AKL A;  2RF0 A;  1PWT A;  4ZGJ B;  1RI9 A;  5HY6 A;  2JTF A;  3HHT B;  3QPH A;  3I55 T;  4JRK A;  2LQN A;  2OAW A;  4J9G A;  4XTZ A;  4JZ3 A;  3CPW P;  4PL6 A;  2AT1 B;  2QDY B;  2K2V A;  3PIO A;  1QVG A;  2K57 A;  1ZBJ A;  2RHZ A;  4EPC A;  3QO3 A;  2KYB A;  1UHC A;  4R55 A;  5GAM h;  4M77 G;  1Q81 R;  5IHI A;  2CZ1 B;  1K76 A;  4MDX A;  4PJO C;  4PLI A;  1JJ2 S;  1V29 B;  3MP6 A;  3ME9 A;  1NPR A;  1JO8 A;  2EJF A;  5LJ3 j;  1Y0M A;  3QYG B;  2DLP A;  1K73 C;  3VJP A;  4P5N A;  1YJ9 A;  1YI2 T;  4PJO E;  1KHC A;  3JB9 G;  1K73 U;  2DXB A;  3CC2 A;  2Y4Y A;  1OX8 A;  1QP2 A;  4NOY A;  5I2S A;  1MV0 B;  1BI0 A;  4F17 A;  2XI9 A;  2CP2 A;  2H8H A;  4OB2 B;  1QVF A;  2AZS A;  1UFF A;  4RUG A;  5GAN h;  1M90 R;  2H3E B;  4M7D A;  1VQL A;  4WF2 A;  2HBW A;  1ZUY A;  3OS5 A;  1IRE B;  2RM4 A;  2YLB A;  3HRU A;  4OMP A;  2L3P A;  5GAM d;  4M7D F;  3EGX B;  1D1B A;  3A8G B;  1K9A A;  1ZSZ C;  4LE9 A;  4QVD A;  5GAN 7;  1M1F A;  3SWN B;  2LQW A;  3OYF A;  3FLG A;  1VA7 A;  4JLI A;  4M7A A;  1AZG B;  3RKX A;  4OF1 A;  1W6X A;  2L0A A;  4XU3 A;  4KRT A;  4PKC C;  1H64 1;  3G4S Q;  4JUV A;  2CP7 A;  4JRI A;  1U06 A;  2HQH A;  2QTV A;  4O6J A;  4HXJ A;  4ZTJ A;  5GAO l;  3WXM B;  1VQ7 A;  5GAM j;  4UC4 A;  3HKS A;  1AZE A;  1BIB A;  5D7U A;  3VU3 C;  4EDU A;  1YJW A;  2KMT A;  4N4I A;  4C92 D;  3CCQ T;  1HD3 A;  5HK3 A;  3HTR A;  2KRM A;  4PLL A;  1ZLM A;  5A0G A;  3GPL A;  1K0S A;  2QGF B;  3C94 A;  2E3H A;  1UJ0 A;  3J80 E;  4KUD K;  1DJ7 B;  1D1A A;  3QDF A;  3CCV A;  1QW1 A;  1S72 A;  1OU9 A;  2AKK A;  3MCA B;  5GAN j;  2SEM A;  1WQW A;  5KYY A;  1R0C B;  3GF5 A;  1YJN Q;  1AHJ B;  2BE7 D;  4C92 C;  2XIC A;  3G6E A;  5CO7 A;  3QZ5 B;  3SFM A;  5FU7 C;  3HSB A;  5L23 A;  3VS6 A;  3RDV A;  3V8K A;  1B34 A;  1F1B B;  2JM8 A;  1Q82 U;  4RMO A;  1WX6 A;  8ATC B;  4F7U E;  3CCM Q;  3JCM X;  2EQJ A;  1SPK A;  4BE1 A;  4J83 A;  5LJ3 g;  1EZZ B;  4M7A F;  1Q86 R;  2K6D A;  1U1T A;  3HFN A;  4D8D A;  2DO3 A;  3JSC A;  1K73 R;  1WJS A;  4FM4 B;  4ME7 A;  3HP9 A;  4E2F B;  1BI1 A;  3JCM P;  4MDW A;  3M4Y A;  3BY7 A;  2XDB A;  3JB9 D;  3TSW A;  4IUP A;  4PJL A;  1OPK A;  4N0A C;  2ABL A;  5HK0 A;  2E6N A;  2X35 A;  2QAZ A;  2O4X A;  1TH7 A;  4LDU A;  5KH6 A;  1WLP B;  2LCS A;  4M78 F;  2JMA A;  1M90 C;  2B8A A;  2SRC A;  2JOY A;  2X9H A;  1D3B A;  1IO6 A;  2KQW A;  5GAO n;  1OUL A;  2MWO A;  2NUP B;  4XU2 A;  4A4F A;  2RI2 A;  3HRS A;  3EG1 A;  1TUG B;  3S3M A;  1NM7 A;  5IN1 A;  4E7K A;  1VQ4 T;  4PJN A;  4AFQ C;  2RK1 A;  1QVG P;  2K3X A;  1GCP A;  2F5K A;  2XU8 A;  2BTT A;  2I0N A;  1KC8 R;  1KG1 A;  3P8B B;  3VUB A;  3RKY A;  1UGS B;  1UUE A;  1I4K 1;  4E7H A;  1YIJ T;  4GLM A;  2GQI A;  2NLU A;  3X25 B;  1VQ5 Q;  1I5L A;  1MND A;  2DVE A;  3PGG A;  2NYS A;  4J6W A;  2KRO A;  2M02 A;  1NE8 A;  4M7A D;  3G4S A;  4CRI A;  3D7S B;  2L5Q A;  3JCM c;  2DE0 X;  3CCJ T;  2FPF A;  1GBR A;  1PCX A;  3QKJ A;  5GAN d;  4GLK A;  3JB9 J;  1R8O B;  3PT9 A;  2ED1 A;  3A98 A;  3OS1 A;  2PNI A;  1SG5 A;  3LW5 E;  3JB9 I;  3M5A A;  3IQL A;  1YIT A;  3L1A A;  1Q82 C;  1YCS B;  3PTA A;  4L6V 5;  2J05 A;  3VYG A;  1KHI A;  3CCR T;  5GJW B;  2MIO A;  1ZA1 B;  2HL5 C;  2L8D A;  3DKM A;  1G3Y A;  5CKB A;  5GAN 2;  1NLP C;  4C8Q D;  3A1P A;  4M77 D;  3MO8 A;  3SWN C;  2J06 A;  3EG3 A;  1S1N A;  2R5A A;  5ECA A;  1RI0 A;  4BI8 B;  1WHJ A;  4FIB A;  2KDS A;  3MEV A;  4LDX A;  1EIF A;  1B3Q A;  2O4X B;  1N8R U;  1MUZ A;  2L89 A;  2PU9 B;  2RQW A;  2LC4 A;  2KRN A;  2EWN A;  4M78 B;  1K9M U;  1X01 A;  4X9C A;  4M75 A;  2DD5 A;  4VUB A;  1KIK A;  3CCL A;  2DIL A;  1SRM A;  2J6K A;  2E1H A;  3OS0 A;  1LCK A;  1IHW A;  1QVG S;  1UGV A;  1RAF B;  1RAA B;  1YJ9 Q;  4XTV A;  3L2Q A;  1IRX A;  5LJ5 h;  1M2O A;  1OZ3 A;  1X43 A;  2EW3 A;  4FCY A;  3M0Q A;  2JZ2 A;  4M75 C;  2LCL A;  2DZC A;  2VGM A;  1X2K A;  2E41 A;  2FB7 A;  3JCM Q;  4XU1 A;  1K9M R;  4M77 E;  1KD1 C;  2BE9 B;  5CKD A;  2DD4 A;  1RLQ C;  2LVM A;  1LJO A;  2VGN A;  4NL2 A;  1KK7 A;  3SWN A;  1AVZ C;  4LD9 K;  1NJI C;  2R58 A;  2EGA A;  1M4Z A;  3TEE A;  4RG8 A;  2BZX A;  1AT1 B;  2KYM A;  4IIO A;  2O01 E;  4JPB W;  3N5B B;  1QWF A;  3QZ9 B;  1S72 T;  3LGL A;  2RJF A;  4FYV B;  1M3C A;  3I5S A;  1PD1 A;  3EFR A;  4AFS C;  2EYY A;  2EJ9 A;  2YRD A;  4B9X A;  2V26 A;  3EH2 A;  3SHW A;  2CZ7 B;  3M53 A;  1U3O A;  2E10 A;  1IB8 A;  2KVQ G;  4CC3 A;  4XK8 E;  3OB9 A;  3X20 B;  1FYN A;  2FG0 A;  1AWO A;  2XKO C;  1NYG A;  2YUN A;  1WJR A;  2DRM A;  2COZ A;  2QQS A;  4M77 A;  4CI0 C;  2EQI A;  3NHN A;  3PMI A;  1KJW A;  3E9G A;  4N4H A;  4DBH A;  1MHN A;  2F1L A;  3CC7 T;  2KE9 A;  2EQU A;  2AHJ B;  2V1Q A;  2YSQ A;  2YUQ A;  1KC8 U;  1N8R R;  1X2Q A;  2OX7 A;  3CCS Q;  1A0N B;  1VQK A;  1I07 A;  4Q5W A;  1N6A A;  3DB4 A;  1MMD A;  4OGC A;  2DBK A;  4HVW A;  3M0U A;  2DXC A;  2DTO A;  1SF9 A;  2RHU A;  3VUZ A;  3REA B;  3KXT A;  3MP1 A;  3NFC A;  3OYB A;  2RQV A;  2FO0 A;  2X4J A;  4Y91 A;  3M0S A;  3BW1 A;  9ATC B;  2RN8 A;  1FX7 A;  2QEX A;  2XG8 D;  4DEY A;  1CSK A;  2XDD A;  4LD6 A;  4E47 A;  4N0A A;  2DKG A;  1T0H A;  4EMK C;  3VS7 A;  1NLO C;  3C95 A;  2QYZ A;  2J6O A;  3EGD B;  4EMG A;  2JS2 A;  4DOW A;  4AT1 B;  3CCE A;  2ZPE B;  4RKU E;  2KT1 A;  3OYL A;  4DEX A;  5IAY A;  4KUL A;  4M7A E;  4FW2 A;  2D6F A;  2DX1 A;  2EGE A;  1ZSZ B;  5IHK A;  4O5V A;  2DBM A;  1Q86 U;  4E7J A;  3EG2 A;  2D8J A;  2MCN A;  1D0Y A;  2V8J A;  5LJ3 h;  5GAO r;  3G6E Q;  4X1V A;  2CGH A;  2EGC A;  4OP0 A;  1Q82 R;  1BCM A;  3FC3 A;  3GBQ A;  3S6W A;  2P0K A;  4C92 F;  2ZPB B;  1ABO A;  5KCO A;  4J7F A;  2ZGW A;  1G5V A;  2MK5 A;  2DXU A;  2JUF A;  5LJ5 g;  3JCM b;  4E7L A;  4ZN1 A;  1WHG A;  2DER A;  1MNE A;  4C8Q E;  2GGR A;  1W2B S;  1HYO A;  5D6X A;  2CP6 A;  1MMA A;  1H8K A;  2F5T X;  4JRP A;  4C8Q F;  4FYW B;  3JCM f;  2HMA A;  2YT6 A;  5CKF A;  1LOJ A;  2E5Q A;  2OTJ A;  1HXD A;  3E9F A;  1SKU B;  1M1K C;  2RMO A;  2NWM A;  2CYZ B;  4LDY A;  3CXC A;  3H6Z A;  3CBO A;  5KYN A;  1OX9 A;  1R0B G;  1GRI A;  1SSF A;  4L59 A;  5LJ5 d;  3UT1 A;  3OYH A;  3LH0 A;  4J5Y A;  4HKE A;  3I35 A;  3ZL7 C;  3CBP A;  1D09 B;  1UGR B;  4TVR A;  1KQS S;  2KT8 A;  3UWN A;  2O9V A;  4QVZ A;  4QVC A;  3CC7 A;  4Z02 A;  1ZSZ A;  2VB6 A;  2QQ9 A;  2RO0 A;  2ZPG B;  4OB0 B;  3V7C A;  4FT4 A;  2MOX A;  3OMC A;  1NYF A;  5FWC A;  4C92 A;  4KH0 B;  2ROL A;  2KR3 A;  2QA4 T;  1VQ8 A;  2H3J A;  3MEA A;  1YIT T;  2XDP A;  1M3A A;  2ESW A;  5GMK m;  2JS0 A;  2FZC B;  3PNW C;  2EJG A;  3GLX A;  2RD1 A;  2KXC A;  4ZTF A;  1Y96 B;  1UEB A;  3QYH B;  5EG2 A;  5LJ3 e;  3OYG A;  2RI3 A;  2PVG B;  3EAE A;  5CR2 A;  1WI7 A;  1O9S A;  1M27 C;  1RAH B;  1TXQ A;  1Z9Q A;  4J9B A;  4C5E A;  5IH2 A;  3U23 A;  5AT1 B;  2CH4 W;  1I8F A;  2QDL A;  3MET A;  3ASK A;  3J7A F;  4PJO F;  4C0D B;  5CK9 A;  1VQ9 Q;  2CSI A;  3NPF A;  4BE0 A;  1KQ1 A;  3GNG A;  4Y28 E;  2PQW A;  2V8K A;  2QK0 A;  4KUI A;  1JXM A;  3RNJ A;  1QCN A;  1NPP A;  2EYX A;  4GBQ A;  3M54 A;  1VIE A;  4JZ4 A;  3FJ5 A;  2A08 A;  4OMO A;  3TQ7 P;  2GFU A;  2AK5 A;  2WSF E;  3NGP A;  3SDZ A;  2LDM A;  4X34 A;  1QVF P;  2A7Y A;  2RH2 A;  1M9S A;  2IVW A;  3CD6 A;  1YWP A;  2HD0 A;  1M2V A;  3E1S A;  1JJ2 A;  2DJQ A;  2X4Y A;  2LT1 A;  3UPU A;  5A0D A;  1RUW A;  4Z89 A;  2PVD B;  2NUZ A;  2DL8 A;  1QQJ A;  1X69 A;  4PK4 A;  3GP8 A;  1VQ9 T;  2E6Z A;  5I21 A;  3QBY A;  3H8Z A;  3CCL Q;  1TG0 A;  1YWO A;  2FEI A;  2LMJ A;  2MI6 A;  3OYK A;  1ARK A;  1IHV A;  3TU4 K;  2DET A;  3QG1 A;  1V76 A;  3UAT A;  4BAC A;  4DBQ A;  3I55 A;  3G1J A;  3GIB A;  3CC2 Q;  3H9N A;  1Y96 A;  4BUG A;  1SEM A;  3L2W A;  1B34 B;  1Q81 U;  5KCH A;  1HJD A;  2RQR A;  4PJO A;  4EMK B;  2NUT B;  3OYY A;  2PUK B;  2VVK A;  1BI3 A;  4MZT A;  1PSF A;  1M5Q 1;  3PMT A;  4J9H A;  1YBY A;  2HCK A;  1WHM A;  1ZUU A;  3ULR B;  3CC7 Q;  4F7U B;  4FU6 A;  2XHC A;  4A63 B;  2BKD N;  1VQP Q;  1K8A R;  1PNJ A;  1WPY A;  5FU6 C;  5J26 A;  1X6B A;  1AOJ A;  2OJ2 A;  2QAS A;  3OS2 A;  1ZA2 B;  3CME A;  3G7Z A;  2BZ8 A;  1O75 A;  1N8R C;  4JJC A;  3URG A;  2IPO B;  2WAC A;  2ZCF B;  1VOM A;  4CC2 A;  3G4S T;  1VQM A;  1OZ2 A;  4ZN3 A;  1X27 A;  2GCX A;  2VKN A;  5FRO A;  5A2Q E;  1VQ7 Q;  3GOX A;  1XNI A;  1VQ5 A;  2HZY A;  4XTY A;  4AFU C;  1ZSG A;  2LNH B;  3L2Z A;  4A53 A;  1BYM A;  2E12 A;  4C8Q C;  2V1R A;  1Y7X A;  1Q7Y R;  2HKN A;  3CCQ Q;  3JCM d;  4Y92 A;  2O9S A;  2LZ6 B;  2RJC A;  2CP0 A;  1V1C A;  2F69 A;  2E5K A;  2FPE A;  3MEW A;  1Z9Z A;  2RJD A;  4PJJ A;  3ZBD A;  1RL2 A;  4OVA A;  4FL6 A;  3C0C A;  2VAS A;  1M3B A;  1WNL A;  3C12 A;  2R57 A;  2OTL Q;  1WZO A;  2PTK A;  4QT7 A;  1J3T A;  2VXE A;  1JBM A;  2Y90 A;  2AIR B;  2RNA A;  1SSH A;  2EYQ A;  1OV3 A;  1WXT A;  4C5G A;  3JRZ A;  1PG5 B;  4IIM A;  4BDZ A;  4LDV A;  2LP5 A;  3JCM g;  5LJ5 e;  3OA6 A;  1LNX A;  2AZV A;  2FL7 A;  4OB3 B;  2DTH A;  4E6R A;  5FWB A;  5GAO q;  1SHF A;  1PKT A;  2L3S A;  1D0Z A;  1EX4 A;  2CH4 A;  3FRN A;  1XJW B;  4DOV A;  1H3H A;  4R56 A;  4WCI A;  2EKO A;  7AT1 B;  5I11 A;  4IUU A;  1NJI U;  3H0I A;  3EGD A;  5DM7 R;  5A0L A;  3BDU A;  5FW9 A;  4IUV A;  1PKS A;  2VWF A;  2GF7 A;  3JCM e;  2COW A;  1FWZ A;  4OMN A;  2VC8 A;  4RTY A;  3TCJ A;  2P0P A;  3I56 T;  5GJV B;  3CC4 T;  1MV3 A;  1YJN A;  2X3X D;  4IUT A;  3DB3 A;  1H3Z A;  2RHX A;  2LX9 A;  3X28 B;  1FMW A;  1G83 A;  1B07 A;  1WYX A;  4DBR A;  3CCJ Q;  4K11 A;  3LWH A;  3AHU A;  1K4U S;  3L2U A;  1MMN A;  4M75 G;  4C0G A;  2RQU A;  4BE2 A;  2HSP A;  2RQT A;  4HCZ A;  4J9D A;  3ZEH A;  2HAX A;  3G71 A;  2KK4 A;  1SHG A;  4BY6 B;  3CEY A;  4XQ3 A;  1BBZ A;  3OW2 A;  1OPL A;  4LUE A;  2O31 A;  2LTO A;  4OB1 B;  3THK A;  1U5S A;  1SRL A;  4II1 A;  4C92 B;  3I56 A;  2KNB B;  2DIG A;  2BZY A;  1G3S A;  2A3L A;  2EIF A;  2ZPF B;  2QTX A;  4OGE A;  1KQ2 A;  4J6X A;  4KT0 E;  1BI2 A;  4M77 B;  1QP3 A;  2LRQ A;  4M4Z A;  1XQH A;  2LQ8 A;  2HBP A;  3G71 Q;  3EGU A;  2FPD A;  4F7U A;  4D6W A;  2QXF A;  1KD1 U;  4QQG A;  3G71 T;  3CXC P;  3REB B;  1TUC A;  5GAN f;  2DYI A;  1B7T A;  2GBQ A;  3EFS A;  4ORZ A;  4HT9 A;  1PRL C;  4EMK A;  3CCJ A;  3CD6 Q;  5KYX B;  3I56 Q;  2CDT A;  1HSQ A;  3PIP A;  4V2S A;  2D0N A;  1UEC A;  3R6O A;  1YI2 A;  1TUD A;  1MMG A;  3RBB B;  1VIF A;  4KBM B;  4AMC A;  1VYU A;  4DQ2 A;  1VQL Q;  1QWE A;  2KRS A;  1VQ9 A;  3CCU A;  1U8R A;  4ATO A;  1YJN T;  1GCQ C;  1C0M A;  2MYS A;  4OMF B;  1PHT A;  2DK3 A;  5KYU B;  3CME T;  4J9E A;  2K2M A;  3CCM A;  2VXF A;  3INZ A;  4J7I A;  5CIU A;  2JW4 A;  4JS4 A;  3OYM A;  4M77 C;  3V7R A;  1WHL A;  2LCC A;  4M7D B;  3EFO A;  4DBF A;  2COY A;  2F2X A;  2CZ6 B;  1I5O B;  4M75 E;  2PUO B;  2G6F X;  4A4H A;  1WJQ A;  2FRW A;  1N27 A;  3M0P A;  1CKA A;  5L8R E;  2QGG A;  3MHX A;  1ZUK A;  2P4R A;  1Q7Y C;  1LVK A;  3M4G A;  1TSF A;  2RI5 A;  1N9S A;  2LNV A;  5GMK j;  2K5I A;  3MPU B;  1BCO A;  1T3L A;  2WSE E;  3LX7 A;  1QVP A;  1JXO A;  3OYE A;  1R77 A;  3H0F A;  4MML A;  2F2W A;  3TVT A;  2R5M A;  4PJO B;  1VQL T;  3FIF A;  5CKH A;  5GAM g;  3M57 A;  1ZHI A;  3O5Z A;  2GTJ A;  3I9Q A;  4HA8 A;  2M9U A;  4OML A;  3H0H A;  3UF4 A;  4FSX A;  2MMP A;  1G2B A;  8AT1 B;  4E7I A;  3OYI A;  1YFN A;  3FB9 A;  4HCB A;  3WVD B;  4M75 D;  4F14 A;  1Q95 G;  5FU6 B;  1ZQ1 A;  3OMG A;  3CCV T;  2FHD A;  3AT1 B;  1AWJ A;  1YIJ Q;  1YIJ A;  2ZPH B;  3T9N A;  3OYN A;  3QUI A;  1Y71 A;  5KYY B;  3WVE B;  1VYV A;  5CVI A;  2JMC A;  4M75 B;  2X4W A;  1UG1 A;  4JJN K;  4QKU A;  3FDR A;  2DIQ A;  4IKF A; 
#chains in the Genus database with same CATH homology
 1WHK A;  2COY A;  2HL3 A;  2Z0W A;  1WHH A;  2E3I A;  2CP5 A;  2M02 A;  2QK0 A;  4B6M A;  2HL5 C;  1TXQ A;  2CP7 A;  2CP2 A;  1WHG A;  3E2U A;  2HQH A;  2COZ A;  1LPL A;  1WHM A;  1IXD A;  2HKN A;  2CP0 A;  2CP6 A;  3TQ7 P;  3RDV A;  2E3H A;  2E4H A;  1WHJ A;  2CP3 A;  2HKQ B;  1TOV A;  2COW A;  1WHL A;  2MPX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...