2M02A

3d structure of cap-gly domain of mammalian dynactin determined by magic angle spinning nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin subunit 1
publication title Three-Dimensional Structure of CAP-Gly Domain of Mammalian Dynactin Determined by Magic Angle Spinning NMR Spectroscopy: Conformational Plasticity and Interactions with End-Binding Protein EB1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2m02A00
2E3HA 3RDVA 2CP0A 2E3IA 2CP2A 3TQ7P 1LPLA 1WHLA 1TOVA 2M02A 2HQHA 2CP7A 2COWA 2HKQB 2HKNA 2CP5A 2MPXC 3E2UA 2CP3A 2COZA 4B6MA 1WHMA 1WHHA 2COYA 2HL3A 2HL5C 1WHJA 1WHGA 2CP6A 1WHKA 2QK0A 2Z0WA 1TXQA 1IXDA 2E4HA
chains in the Genus database with same CATH superfamily
4AG1C 2PUKB 3C95A 3TQ7P 4CRIA 5GAMf 2B86A 2DIQA 2HAXA 4NL3A 4J6YA 4M7AB 3EG3A 4PL6A 1VQ7A 4RCCA 2JN0A 1YIJQ 4DA4A 3HRUA 3SWNC 3I56A 1KC8U 3UDCA 1N8RR 1HSQA 2EGEA 1GFCA 4QVDA 4FT4A 2KXCA 3RESA 5GAOr 5J3BA 1LJOA 4FCYA 3E19A 4E7JA 5IAYA 4BE2A 5A2QE 3X28B 2NUTA 4FIBA 1S72Q 3QSUA 3CC4Q 3QDRB 1C1AA 2CUBA 1WNLA 2KEAA 2EWNA 5A0DA 2HNIA 4FM4B 3V8KA 2D0NA 2QQBA 2DERA 4OMMA 3MP1A 2EYYA 2R5AA 1QMCA 2X4YA 5GAN6 2GQVA 1NLOC 4EMKA 2FB7A 3OYLA 3CXCS 1VQ9T 3TCJA 3URGA 3M0QA 4M77C 3NHNA 2O9VA 2W10A 1X2KA 3C94A 2FPDA 4C92F 1ACMB 4AFUC 2KVQG 4EDUA 1WXTA 2CS7A 2CZ0B 1IHVA 1TTHB 2XKOC 1K73C 5GAMj 2LJ1A 4A54A 1K9MC 3HHTB 1VQOA 3CXCP 4QT7A 4J6WA 5KYUA 4PJOF 3G1JA 4OVAA 4FYVB 5GMKj 2LZ6B 3PNWC 4X1VA 1D1CA 2AKLA 2R5MA 1GCQC 2FYKA 1T3LA 1O9SA 2RJCA 1NEGA 3RIRA 2JW4A 1WHLA 3CQTA 4M78C 2JNGA 3CCRQ 4J9EA 1Y96A 4ELYC 4FYXB 2VC8A 4PJNA 4M7DE 3M0SA 2EYQA 5I11A 3RR6A 3JCMd 1M1KU 3EGXB 2P84A 2KYMA 4J7IA 2LT1A 2AHJB 1BCOA 3X20B 2AIRB 2J7IA 3MKDA 3NMZC 1MV0B 5DLOA 3M57A 5LJ5e 3MEVA 1AOJA 2DL8A 3QUIA 1I07A 1ZSZB 5CCAA 4JRIA 1K0XA 1YI2T 2KRNA 2YWWA 3CCRA 2EJGA 4DEYA 2PZ1A 4M4ZA 3V7CA 4M77B 2WSCE 4DBFA 2DL7A 1E7OA 3EG9B 4M7AA 3V8LA 3VS6A 2NLUA 3RERA 2FL7A 4A4GA 1VQ6T 2LQKA 2VXEA 3P8DA 1VQ4T 5GANd 2CUDA 4OB0B 1RAEB 3INZA 4B9XA 2P0KA 4M75C 2F69A 1N8RC 3SEMA 1AZEA 2E6ZA 3F70A 2DF6A 2RMOA 3OY9A 2KE9A 4LDWA 3JCMc 3CD6Q 4OB1B 4C92A 2FG0A 2GF7A 5D7UA 2QEXQ 3LH5A 2LVMA 3GLXA 4N0AA 3VS4A 4LUEA 2V8KA 4CI0C 2LQWA 1W2BP 1ZUKA 2JXBA 2JZ2A 2WSEE 4JZ3A 3H6ZA 1ZLMA 3GIBA 3OB9A 1MMDA 4IURA 3HFNA 4PJOA 2LP5A 1NM7A 5M9OA 1KQSS 2EYXA 4JJCA 3CD6A 2IIMA 1R77A 3ASKA 1I8FA 1VA7A 4M78F 3CCEQ 1XOVA 4C0GA 3OYNA 2LC4A 4RTVA 5CKDA 4JRKA 3CCMT 2DZ9A 3OBYA 2M0YA 4PFZA 4JLGA 2JM9A 4MMKA 4BI4A 2ZGWA 2RQUA 3SWNA 3VU3C 3M0UA 2KROA 2XU8A 1TH7A 3QO3A 2JT4A 1QVGS 1Y0MA 1VQ8Q 2CP3A 5LJ5f 4RCBA 4XU3A 4J6XA 5HKCA 1VQ6A 1NG2A 6AT1B 4FYWB 2KQWA 3EGXA 2EQMA 5D6WA 4Y92A 1E6GA 2RM4A 8ATCB 2EKHA 5LJ5g 1YJWQ 1YJNT 1HJDA 1QLYA 3EGDB 1J3TA 3RKWA 1ZSZA 2MI6A 4M75F 5CQXA 3QKJA 2A0FB 1YJ9Q 1SHGA 3RNJA 4X34A 4XAXB 2VGMA 1DJ7B 2F5KA 1AVZC 4M77A 2E4HA 3A8LB 1S1NA 5LL6S 1WX6A 1WYXA 3M9QA 4Z02A 2DBMA 4A4HA 2LQNA 3HFOA 2COWA 2XDDA 3OBWA 2J06A 5KH6A 1OZ3A 4M7AG 1JB0E 2A36A 1MGQA 4M7DD 3CPFA 4D8DA 4BDZA 1EX4A 5IXFA 1TUCA 4KULA 1X6BA 3I5RA 3TREA 3VS0A 2JOYA 3VJPA 2KR3A 2ZPGB 4M7DG 2VYTA 4EPCA 2QA4T 3CCLT 3JB9F 1HYOA 3CCMA 1GCQA 1M1FA 1BU1A 1I1JA 2RN8A 2FPEA 2GQIA 3M55A 1QCNA 2DNUA 4M78A 4R56A 4F04B 3V8JA 3OW2A 2P0PA 5A0LA 3LWHA 4MZMA 2QTVA 5GAMh 5HCKA 1G83A 1B7TA 3QHSA 1VQNT 2RHIA 2MYSA 5GMKi 3QZ9B 1Z9QA 1V1CA 5GMKh 2Y4YA 1D0XA 2QQ9A 2W0ZA 1Y57A 1YFNA 4K11A 1SRLA 3SFMA 1VQKA 2ENMA 3S3NA 4RTZA 2XHCA 3EFRA 8AT1B 4CC3A 4E7ZA 2QQSA 3VYHB 2RH2A 1N6AA 4LDXA 3H0FA 2VKNA 2DMOA 1YJNA 1LPLA 3EFOB 2VV5A 3I5SA 3M53A 2AK5A 4JJNK 3RMQA 1KC8R 1M2OA 1RAGB 1ZHIA 4V2SA 4FSXA 1JJ2A 3J80E 4C8QC 2DD5A 1WHJA 1AWWA 2MIOA 1M27C 3CCJQ 5LJ3d 1FXXA 1IRXA 2E3IA 2X9HA 4JRPA 2K57A 1GBRA 1X01A 3TU4K 1EZZB 5GAN4 1JXOA 3A8HB 4Y28E 2RPNA 1HD3A 1IB8A 1SHFA 1SEMA 1M3BA 5I2MA 3OS0A 2DD4A 2DYBA 3R6OA 3EGDA 1D1AA 2QI2A 2LCLA 3CCLA 4OMOA 3CCJA 1BKBA 2RQTA 2ZCFB 1QCFA 3TVTA 2K4YA 4ZGDB 1JQQA 4FYYB 3OQ5A 4C0FA 1VQLQ 1B3QA 2DLPA 4L6V5 5FW9A 3CPWS 1WZOA 4FT2A 3JCMV 3L2QA 1WQ7A 1FMVA 5FWCA 5FU7C 4BUGA 4HVVA 2L8DA 1VQNA 2FEIA 5GAMe 1YWOA 3KUFA 2XG8D 1V29B 2JVVA 1NLPC 2LX9A 2GNCA 5GMKe 4J9FA 1BI3A 1VYUA 2DX1A 4R0KA 4F7UB 4KUIA 1I5OB 2IVWA 1AT1B 3CC2Q 2YRDA 4HVUA 4O5VA 4OB3B 4EMKB 1QQJA 4Y91A 1GBQA 3CCQT 3CCVT 3RMSA 1M1KR 2YUPA 1PD0A 3L2WA 3OYEA 4E7LA 2XMFA 1IHWA 2HL3A 2OX7A 2RJEA 3WVDB 3TSWA 4C8QF 3A8OB 2FZCB 2JM8A 2LX7A 4JRQA 1Q81U 2OI3A 1JEGA 4JS4A 2QGGA 2OTJQ 4ME7A 1KD1U 2X3XD 3UT1A 1W4SA 3OYMA 4NS5A 3C12A 1T0HA 4LN2A 2EPDA 5KYUB 1UG1A 5IH2A 3EFOA 3X25B 3UA7A 1QVPA 2RD1A 3U23A 1B34B 5KYXB 3HTRA 4OMLA 3EG1A 2DL3A 2OTJA 1KC8C 4KT0E 3OYGA 1UGSB 2AT1B 2EKOA 3OYIA 5J39A 3O8VA 1K8AR 2HKNA 4HT8A 1U1SA 3PVLA 4LDUA 4XTUA 1OULA 4FL6A 3ZBDA 2EQUA 2K2VA 3E1SA 1MMNA 2AZVA 4RUGA 1AD5A 4J7FA 2KMTA 3I56Q 4XTYA 2O9SA 1S72T 1YBYA 2YDLA 3CC4T 2XIDA 5GAN7 5J26A 4JLIA 1X43A 2F5TX 2CP2A 1OU8A 2QTXA 2HCKA 1U8RA 3CMET 1KHIA 4GBQA 1PHTA 2ZPBB 4E2FB 4PKCC 2EQIA 2GFAA 1AWJA 2PQWA 3A5ZB 1T3SA 2KT1A 2K79A 3CCQA 1TG0A 1U1TA 2DYIA 2F1LA 3EG0A 4NL2A 2AKKA 2AZSA 4TVRA 5GAMg 2DFUA 1T0JA 1MMGA 1X6GA 4LNPA 5LJ5h 4HCBA 2PU9B 1G3SA 2HQEA 1XNIA 1WQWA 2MAMA 1P92A 3A1PA 1WHMA 4IIOA 3JCMb 1OI1A 5KYNA 5KYWB 3MHXA 2R57A 2L89A 4C92B 4F7UA 3NFCA 4QVZA 4C8QA 2ESWA 4OMNA 4R55A 3MEUA 1PRMC 3M4YA 1C0MA 3M59A 1R8OB 2M16A 4RG2A 4KRTA 1VQOQ 2HSEB 2DAQA 1H8KA 2K3BA 3UA6A 4KH1B 2QK0A 3BW1A 3CBOA 4PJOB 2DILA 1MHNA 3EG2A 2DXTA 2O88A 4M7DF 5GAOp 1M1KC 2FZGB 2BZ8A 3I55T 1QP3A 2F2VA 2H8HA 5DLQE 2DXBA 2RHUA 2HEQA 4Z88A 2KDSA 5IHNA 1U3OA 1R0CB 4DQ2A 3ZEHA 4AG2C 3OSVA 4ZN3A 3SWNB 2QGFB 1KQ2A 2DETA 2GTOA 1B34A 1LNXA 5CR2A 5KYXA 4M7AE 4OGEA 3VYGA 1BB9A 4JDSA 4HA8A 2ZPHB 1B07A 1GFDA 1RAIB 2E70A 2O01E 1ZQ1A 3PGGA 2CSQA 2CZ6B 3SB2A 4KH0B 2L0AA 2K6DA 1XTDA 1PKSA 4UC4A 1Y7XA 1N27A 4J9DA 4QQGA 2RJDA 4LD6A 2YLBA 1IGUA 1UEBA 1UE9A 3S6WA 1BI0A 5DM7R 1KFZA 3JCMf 4EMGA 4OMPA 1K8AC 3OYCA 3UATA 1MV3A 2PVGB 3VKIA 1LOJA 4C92E 3MCAB 5FU6C 3G4ST 2QEXT 1RADB 2M0OA 4A63B 4XU2A 3FEOA 4DBHA 2VB6A 2C06A 1HK9A 4JUVA 2GGRA 4XQ3A 2KXDA 3M5AA 5L8RE 1VQ9A 2V1QA 3VS3A 1W2BS 4PJOE 2QYZA 3CMAT 1VQMT 4B9WA 4PLIA 3WXMB 1RI9A 2DJQA 3UPUA 3CCST 3MEWA 3I55A 1QW1A 3OS5A 1K8AU 3LX7A 1TUDA 4ORZA 3BFMA 4XTXA 5KYWA 3OW2P 4QVCA 4E7KA 3LWIA 4FW2A 3X26B 3QJ6A 4M78B 4BY6C 2L3RA 5GAOm 3GPLA 2E1HA 2OJ2A 3FJ5A 4A4FA 2F2XA 3PMTA 1JJ2S 3O5ZA 3UF4A 4JJBA 1K9AA 1PC0A 4IUPA 5GJWB 5CAIA 4XK8E 1VQ5T 2ED1A 4J8OA 1JU5C 3LH0A 1LVKA 2OTLT 2FVUA 3G6ET 3E2UA 1SF9A 5FU6B 2M1HA 1VQPT 5FLXE 5KE2A 1TS9A 1VQ6Q 1TXQA 5CQYA 4J9CA 1VQ4Q 1JJ2P 3HRTA 4EMHA 1OX9A 4O6JA 2X3WD 2E3HA 3RDVA 3DB4A 3P8HA 1I0CA 1YI2A 3OA6A 4GY5A 3G4SA 4M77E 2DJZA 2CT4A 2LJ0A 4MZPA 1YITT 1ARKA 2GTJA 2COZA 4HVWA 4IUQA 2HQXA 2YXYA 4M75B 2JTEA 1EFNA 2HDAA 2JMAA 5GANj 4ZGEB 2KK4A 4LXCA 1FMKA 5IHIA 2VVKA 1VQ4A 2CP0A 5LJ5d 1VQMA 1X27A 4AFSC 1D0ZA 2CT3A 5GMKm 3QBYA 3CCSA 5KE3A 5I2SA 2XICA 1ABOA 4BY6B 2LCSA 2P4RA 3QYHB 3CBMA 4L59A 1NEBA 5KCHA 1BK2A 1I5LA 2ROLA 4KUDK 1NPRA 1CSKA 1SSHA 1AWOA 1ZSGA 4KGXB 1UGQB 1WIEA 5CK9A 2ABLA 1BCMA 3CCUT 2X51A 4KGZB 1G3YA 2RQRA 2CDTA 2EIFA 1ABQA 3OYDA 4M7AD 1RUWA 3CCMQ 1Q81R 2E64A 2EQJA 3MP8A 1RAAB 5CKBA 3G71T 1KD1R 1KJWA 3JB9J 3RUXA 2CH4A 1OU9A 1MUZA 4J9BA 5CO7A 4J83A 1AZGB 3P8BB 2ZPEB 3ER0A 1NJIR 3PE0A 1NPPA 3M56A 2OTLA 4NOYA 2C0TA 1M8MA 1M4ZA 1VQPA 2KRSA 2HBWA 3PIOA 2C0IA 5GAN5 1VQKQ 2YRVA 4ATOA 2BZXA 3JAME 3NGPA 4PNOA 3OS2A 1KK7A 3QWYA 2HMAA 2KBTA 3H41A 5FRNA 4C92G 1OQKA 3FC3A 2DK3A 4JPBW 3OMGA 1YJNQ 1WGSA 2MF2A 3FIFA 1UGPB 2O2OA 3JCMP 5EC7A 1N5ZA 1BYMA 3NTHA 4F14A 4PJOD 1Q7YU 1RABB 2CZ7B 2E6NA 3H0IA 1WJQA 4PJOG 4C5GA 2X4WA 1SPKA 3JCMJ 1M90U 1UJYA 4YTLA 4P5NA 4XU1A 5FWBA 1PG5B 3VS2A 1FYNA 2PUOB 4RTYA 2ED0A 1JXMA 1Q86U 2H3JA 3N5BB 3CC7T 1WHHA 1WHGA 4IUUA 3CCUA 2RO0A 2D1XA 1OYXA 2LDMA 2DRMA 2QA4Q 5A0GA 1TWBA 4JZ4A 3CCLQ 2RI2A 1IZ6A 1QKWA 5GAN2 3PVQA 2MK5A 4M75A 3LYIA 1FWZA 4N4HA 3G71A 4BE0A 1JO8A 4BDYA 2BUDA 5LJ3f 4KGVB 5D6YA 1FMWA 2K3XA 2OAUA 1D1BA 1LCKA 3NTKA 3A8MB 3C4SA 2E5KA 2D8JA 5KYYB 3QYGB 1VQNQ 4Z8AA 1K1ZA 1QCOA 2QA4A 2E5QA 1KQSA 1VIEA 4RG8A 2GBQA 4DBRA 4QKUA 4MDWA 1M2VB 2BE9B 1IGQA 4M77D 3OYBA 2BE7D 1Q95G 2SRCA 4ESRA 1Y71A 4F16A 3REAB 3EAEA 1UHFA 3JRZA 1WHKA 4M77G 1PKTA 3GNGA 1KHCA 4VUBA 1Q81C 1UDLA 2A7YA 3HRSA 1QVGA 1KD1C 2D0QB 1NYFA 3EGUA 2VUBA 4PK4A 3L2VA 3PT9A 1M1GA 1ZX6A 1YHQT 3X24B 2ECZA 1I81A 2HL5C 1G8XA 5AYFA 1XQHA 2XK0A 4C8QB 2RHXA 1OPLA 1N9SA 2YSQA 3JCMh 3JCMQ 2JJ9A 4MDXA 1GRIA 5HK0A 1JBMA 3CC7A 5AT1B 2CP7A 3Q1JA 4M78G 5LJ3j 2QDLA 3HSBA 2YUQA 1YCYA 5HK3A 3MEAA 2MWOA 1VQ7T 2O4XB 3GF5A 3I56T 2RK2A 3FRNA 4LE9A 4E7HA 4M7AC 3AHUA 1VUBA 2EBPA 1NJIU 1Z9ZA 2BTTA 1ZA1B 3RBBB 5FU7B 4M7DC 1PWTA 4RTXA 4AMCA 3ME9A 3DB3A 1YIJT 1D0YA 2ATCB 2M02A 4IKFA 2V1RA 2DEUA 2EJ9A 3EFSA 1BI1A 2KGTA 1Q82R 2F2WA 2EGCA 4DOWA 4MMLA 2CP6A 3CCQQ 2Y90A 4M75G 3CCVQ 1RI0A 1ZBJA 5CVIA 2K2MA 1YNZA 4CC2A 1WI7A 5KYYA 4Q5WA 4EIKA 4F17A 1YHQA 4F7UE 1G3TA 2RHYA 4C8QE 1BIAA 3CBPA 2KAFA 4E47A 1M5Q1 4AFZC 1M2VA 2E10A 2HSPA 2K5LA 3VRYA 2RHZA 3JCMe 5GAMd 2I0NA 3CCVA 4QW2A 2M9UA 3ZL7C 5GAN8 4ELZC 5CKFA 2DE0X 5CKEA 2LJ3A 1UGVA 3JB9G 1I4K1 2K5FA 1EIFA 2BZYA 3DLMA 2JUFA 3D7SB 2QQRA 3H8ZA 3PIPA 3OYHA 2A28A 2WSFE 4J5YA 4OGCA 3OSSC 1D09B 1AWXA 4M7DB 3FLGA 2K3YA 3I9QA 2BIVA 5DY9A 4OP0A 1WFWA 2YUNA 4JJDA 3TEEA 5GAOq 1V76A 4RMOA 3JCMW 4BI8B 5GANe 4M7AF 2DBKA 1X69A 3GOXA 3H9NA 2O31A 3CCRT 2DXCA 1YIJA 3PFSA 1UJ0A 2RQVA 1SG5A 3CMEQ 4IIMA 2GFUA 1D3BB 1UTIA 2O4XA 1ZSZC 2EYWA 3HKSA 3CPWA 2FRYA 1W1FA 2CP5A 4X9CA 3JSCA 4OF1A 4X9DA 2L2PA 2KY9A 2J05A 1S72A 3BE3A 4QQDA 3CC4A 3A98A 2VXFA 1OZ2A 2G3RA 4WCIA 3META 3QWXX 3CMEA 2RA2A 1FX7A 1VYVA 4IUVA 4BACA 2QDYB 3EHQA 5EG2A 2A37A 3QPHA 3REBB 1AEYA 2RK1A 2NUPB 1N9RA 1G2BA 1IXDA 4ZN1A 3MPUB 2PVOB 2OAWA 1KIKA 2XDPA 2RQWA 1VQ9Q 1H641 3QDFA 1PCXA 1YN8A 2V8JA 2B8AA 2EAYA 2HZYA 5I21A 4GLKA 2HQHA 1Q82C 1ZBXA 2CZ1B 3CD6T 4MZTA 2EYZA 4N4IA 1E6HA 3R6NA 1VIFA 1G3WA 3I55Q 3LLRA 1BBZA 1OPKA 2E12A 2X4XA 1QVFA 3LGLA 1C6VX 1NE8A 3OW2S 2VASA 1M9SA 3JCMg 1Q7YR 3M0RA 3UWNA 1K73U 3OYFA 3OS1A 2MWPA 1K9MU 4J9HA 1H3HA 2KSSA 1WJRA 4OMQA 1M90R 2E65A 4HCCA 1K76A 2COYA 5IT9E 5GANf 1ZUUA 2KT8A 4WF2A 2E41A 2K9GA 2LNVA 3CCET 1RACB 2D8HA 2I2LA 2IPOB 1PNJA 2GCXA 1Q86R 2L3SA 5LJ3h 1TU0B 3QZ5B 4CC7A 1Q82U 3JB9I 4AT1B 4M7DA 2LCCA 1JRIA 3LW5E 4C8QD 2DTOA 5GANg 3EH1A 4M77F 2P4TA 3JB9H 4F7UG 5IXBA 4C8QG 1VQ8T 5FROA 2Y4XA 1VYTA 1YI2Q 1SRMA 3G4SQ 3OYKA 1D3BA 3DKMA 2RI5A 3SDZA 2ROTA 3QIIA 4ZTFA 2CYZB 2VWFA 1YJWT 1QKXA 3ULRB 3IQLA 3MO8A 1K0SA 3J7AF 4PLLA 3M0PA 1MNEA 2CREA 3CMAQ 1VQMQ 2KYBA 1YJ9T 2RB6A 1XJWB 3GNFB 1IO6A 3CCSQ 2QEXA 1SKUB 4PJMA 2KNBB 1IREB 1UGRB 1KSWA 3NPFA 4CC4B 1N8RU 2H3EB 3M54A 5ECAA 2DL5A 3V7RA 4C0DC 2A3LA 3CEYA 2NUZA 4Z89A 4C5EA 1MNDA 3M4GA 4D6WA 3GBQA 2PVDB 2NUPA 5C6SA 1TSFA 3HL8A 2DZCA 5CKHA 1BI2A 1R0BG 5C0MA 3CMAA 3L42A 2EJFA 3CXCA 3VS7A 1F1BB 1KQSP 2BKDN 2XI9A 2RNAA 4IUTA 3CCEA 4GLMA 3AT1B 1YCSB 2KRMA 4ANJA 4E7SA 2C0OA 1VQ5Q 3THKA 2YLCA 1VQKT 2OTLQ 3L2ZA 3G6EQ 5LJ3e 4M78E 3VS1A 1VQPQ 2MOXA 3M0TA 3L2RA 2ZPFB 2LT4A 2JTFA 2ZAEA 3EHRA 1MMAA 1VQ8A 4ZTJA 4II1A 1QVGP 3OMCA 3FDRA 1OOTA 1RL2A 1Q7YC 3QXEB 4HXJA 2DVJA 2K5IA 2M51A 4BD3A 2LQ8A 1VQ5A 2YRCA 5D6XA 3PMIA 2YUOA 2PTKA 4N4GA 3QJYA 1PSEA 2ZZDA 1YITQ 4D8KA 3S3MA 3EG9A 3G6EA 3FJPA 1M90C 2L3QA 3QG1A 2EQKA 1YJWA 2DA9A 4RTTA 3WVEB 2LTOA 2YHTA 4C92D 3BDLA 2HBPA 3J81E 1Q86C 1BIBA 4C0DB 1YJ9A 2V8IA 2DM1A 3DLLA 1OX8A 2EW3A 2G6FX 1YITA 3V7SA 3CCJT 4M75E 1WLPB 2HKQB 1M8VA 2EGAA 2FZKB 1QP2A 2R58A 3CCUQ 5LJ5j 2J6KA 1NYGA 2MMPA 3HP9A 4J9IA 3A8GB 1WXUA 3VRZA 2XD0A 3LGFA 5KCOA 4PFPA 4RTUA 3KBGA 1GL5A 3G71Q 2HD0A 1W2BA 1NBEB 2RI3A 2DXUA 2JTMA 4L5GA 2EVRA 2DL4A 2QG9B 5IN1A 4WTOB 3VS5A 3M58A 3SHWA 1O75A 1W70A 3RKYA 4BB7A 4A4KA 2J6OA 2EFIA 3OYAA 2DKGA 1VQLT 1KQ1A 4J9GA 5CIUA 2V26A 3L2UA 2LRQA 2LNHB 4BI3A 3RKXA 4PJLA 4A4EA 1U06A 4C5IA 4PFOA 1UFFA 2L3PA 2MPXC 2RF0A 1M3CA 1QWFA 4B6MA 4C0ZA 4EMKC 2ZPIB 4A53A 2VGNA 3SD4A 2DTIA 2CH4W 4OMFB 3VV0A 5LJ3g 2FRWA 5GJVB 5I22A 3CC2T 4C5HA 2CSIA 1RLPC 3H0HA 1OEBA 3OYJA 2NYSA 2JMCA 2D9TA 1VOMA 3C0CA 2DO3A 4DEXA 3G7ZA 1M30A 3L1AA 1UB4A 3BDUA 2QASA 2CKKA 4XTWA 1W6XA 5L23A 1AHJB 1PD1A 3EH2A 2X35A 5GAOl 1X6OA 3CC7Q 1M3AA 3FB9A 2OTJT 4OB2B 4DBQA 9ATCB 2YT6A 1H3ZA 4QQ6A 4LDVA 2D6FA 5GAOn 1NJIC 1PSFA 1HXDA 1X75C 2FO0A 2WACA 4E7IA 2FPFA 4JS5A 5FRMA 3VUBA 2DVEA 2NUTB 3JV3A 4M78D 2MCNA 4BE1A 3KXTA 4XTZA 5GAN3 3OYYA 4HT9A 4XU0A 4ZNXA 1VQLA 3E9GA 2RJFA 1G5VA 2X4JA 4ZGJB 2XDBA 2QAZA 1H92A 3T9NA 3VUZA 4FW1A 3CPWP 2Z0WA 1TUGB 1Y07A 2DEQA 4LD9K 3KFVA 1QWEA 1ZA2B 7AT1B 1X2QA 2DTHA 4PJJA 1GXIE 1YP5A 2SEMA 1NZ9A 2DRKA 1GCPA 1PM3A 1RLQC 3MJXA 1UECA 3JCMX 5GANh 3MP6A 4E6RA 2FHDA 1K73R 1WA7A 1WPYA 4HCKA 4KBMB 4F7UF 1YWPA 3NTIA 4RKUE 1CKBA 1K9MR 3CC2A 2L5QA 3I35A 1QVFS 5GMKl 4FU6A 4HCZA 1WDXA 1YHQQ 2CGHA 1TOVA 2QQAA 1SSFA 1WJSA 2JS2A 2NWMA 4M75D 2J6FA 2DPPB 2LMJA 1ZUYA 3GP8A 5HY6A 3PTAA 2IG0A 4HKEA 1K4US 3TSZA 4C92C 2QXFA 1RAFB 1PRLC 4N0AC 2JS0A 3HPWA 2K7AA 1CKAA 1KG1A 1U5SA 1Y96B 2KI7A 4RTWA 4XTVA 4LDYA 1QVFP 3ZFJA 2A08A 3E9FA 4LUDA 1UUEA 1VQ7Q 4AFQC 1UHCA 2DIGA 3S3OA 4DOVA 4PJOC 3BY7A 1OV3A 2PNIA 4FSSA 5IHKA 1A0NB 2P0QA 1WXBA 1VQOT 1RAHB 3JB9D
chains in the Genus database with same CATH topology
2E3HA 3RDVA 2CP0A 2E3IA 2CP2A 3TQ7P 1LPLA 1WHLA 1TOVA 2M02A 2HQHA 2CP7A 2COWA 2HKQB 2HKNA 2CP5A 2MPXC 3E2UA 2CP3A 2COZA 4B6MA 1WHMA 1WHHA 2COYA 2HL3A 2HL5C 1WHJA 1WHGA 2CP6A 1WHKA 2QK0A 2Z0WA 1TXQA 1IXDA 2E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3H A;  3RDV A;  2CP0 A;  2E3I A;  2CP2 A;  3TQ7 P;  1LPL A;  1WHL A;  1TOV A;  2M02 A;  2HQH A;  2CP7 A;  2COW A;  2HKQ B;  2HKN A;  2CP5 A;  2MPX C;  3E2U A;  2CP3 A;  2COZ A;  4B6M A;  1WHM A;  1WHH A;  2COY A;  2HL3 A;  2HL5 C;  1WHJ A;  1WHG A;  2CP6 A;  1WHK A;  2QK0 A;  2Z0W A;  1TXQ A;  1IXD A;  2E4H A; 
#chains in the Genus database with same CATH topology
 4AG1 C;  2PUK B;  3C95 A;  3TQ7 P;  4CRI A;  5GAM f;  2B86 A;  2DIQ A;  2HAX A;  4NL3 A;  4J6Y A;  4M7A B;  3EG3 A;  4PL6 A;  1VQ7 A;  4RCC A;  2JN0 A;  1YIJ Q;  4DA4 A;  3HRU A;  3SWN C;  3I56 A;  1KC8 U;  3UDC A;  1N8R R;  1HSQ A;  2EGE A;  1GFC A;  4QVD A;  4FT4 A;  2KXC A;  3RES A;  5GAO r;  5J3B A;  1LJO A;  4FCY A;  3E19 A;  4E7J A;  5IAY A;  4BE2 A;  5A2Q E;  3X28 B;  2NUT A;  4FIB A;  1S72 Q;  3QSU A;  3CC4 Q;  3QDR B;  1C1A A;  2CUB A;  1WNL A;  2KEA A;  2EWN A;  5A0D A;  2HNI A;  4FM4 B;  3V8K A;  2D0N A;  2QQB A;  2DER A;  4OMM A;  3MP1 A;  2EYY A;  2R5A A;  1QMC A;  2X4Y A;  5GAN 6;  2GQV A;  1NLO C;  4EMK A;  2FB7 A;  3OYL A;  3CXC S;  1VQ9 T;  3TCJ A;  3URG A;  3M0Q A;  4M77 C;  3NHN A;  2O9V A;  2W10 A;  1X2K A;  3C94 A;  2FPD A;  4C92 F;  1ACM B;  4AFU C;  2KVQ G;  4EDU A;  1WXT A;  2CS7 A;  2CZ0 B;  1IHV A;  1TTH B;  2XKO C;  1K73 C;  5GAM j;  2LJ1 A;  4A54 A;  1K9M C;  3HHT B;  1VQO A;  3CXC P;  4QT7 A;  4J6W A;  5KYU A;  4PJO F;  3G1J A;  4OVA A;  4FYV B;  5GMK j;  2LZ6 B;  3PNW C;  4X1V A;  1D1C A;  2AKL A;  2R5M A;  1GCQ C;  2FYK A;  1T3L A;  1O9S A;  2RJC A;  1NEG A;  3RIR A;  2JW4 A;  1WHL A;  3CQT A;  4M78 C;  2JNG A;  3CCR Q;  4J9E A;  1Y96 A;  4ELY C;  4FYX B;  2VC8 A;  4PJN A;  4M7D E;  3M0S A;  2EYQ A;  5I11 A;  3RR6 A;  3JCM d;  1M1K U;  3EGX B;  2P84 A;  2KYM A;  4J7I A;  2LT1 A;  2AHJ B;  1BCO A;  3X20 B;  2AIR B;  2J7I A;  3MKD A;  3NMZ C;  1MV0 B;  5DLO A;  3M57 A;  5LJ5 e;  3MEV A;  1AOJ A;  2DL8 A;  3QUI A;  1I07 A;  1ZSZ B;  5CCA A;  4JRI A;  1K0X A;  1YI2 T;  2KRN A;  2YWW A;  3CCR A;  2EJG A;  4DEY A;  2PZ1 A;  4M4Z A;  3V7C A;  4M77 B;  2WSC E;  4DBF A;  2DL7 A;  1E7O A;  3EG9 B;  4M7A A;  3V8L A;  3VS6 A;  2NLU A;  3RER A;  2FL7 A;  4A4G A;  1VQ6 T;  2LQK A;  2VXE A;  3P8D A;  1VQ4 T;  5GAN d;  2CUD A;  4OB0 B;  1RAE B;  3INZ A;  4B9X A;  2P0K A;  4M75 C;  2F69 A;  1N8R C;  3SEM A;  1AZE A;  2E6Z A;  3F70 A;  2DF6 A;  2RMO A;  3OY9 A;  2KE9 A;  4LDW A;  3JCM c;  3CD6 Q;  4OB1 B;  4C92 A;  2FG0 A;  2GF7 A;  5D7U A;  2QEX Q;  3LH5 A;  2LVM A;  3GLX A;  4N0A A;  3VS4 A;  4LUE A;  2V8K A;  4CI0 C;  2LQW A;  1W2B P;  1ZUK A;  2JXB A;  2JZ2 A;  2WSE E;  4JZ3 A;  3H6Z A;  1ZLM A;  3GIB A;  3OB9 A;  1MMD A;  4IUR A;  3HFN A;  4PJO A;  2LP5 A;  1NM7 A;  5M9O A;  1KQS S;  2EYX A;  4JJC A;  3CD6 A;  2IIM A;  1R77 A;  3ASK A;  1I8F A;  1VA7 A;  4M78 F;  3CCE Q;  1XOV A;  4C0G A;  3OYN A;  2LC4 A;  4RTV A;  5CKD A;  4JRK A;  3CCM T;  2DZ9 A;  3OBY A;  2M0Y A;  4PFZ A;  4JLG A;  2JM9 A;  4MMK A;  4BI4 A;  2ZGW A;  2RQU A;  3SWN A;  3VU3 C;  3M0U A;  2KRO A;  2XU8 A;  1TH7 A;  3QO3 A;  2JT4 A;  1QVG S;  1Y0M A;  1VQ8 Q;  2CP3 A;  5LJ5 f;  4RCB A;  4XU3 A;  4J6X A;  5HKC A;  1VQ6 A;  1NG2 A;  6AT1 B;  4FYW B;  2KQW A;  3EGX A;  2EQM A;  5D6W A;  4Y92 A;  1E6G A;  2RM4 A;  8ATC B;  2EKH A;  5LJ5 g;  1YJW Q;  1YJN T;  1HJD A;  1QLY A;  3EGD B;  1J3T A;  3RKW A;  1ZSZ A;  2MI6 A;  4M75 F;  5CQX A;  3QKJ A;  2A0F B;  1YJ9 Q;  1SHG A;  3RNJ A;  4X34 A;  4XAX B;  2VGM A;  1DJ7 B;  2F5K A;  1AVZ C;  4M77 A;  2E4H A;  3A8L B;  1S1N A;  5LL6 S;  1WX6 A;  1WYX A;  3M9Q A;  4Z02 A;  2DBM A;  4A4H A;  2LQN A;  3HFO A;  2COW A;  2XDD A;  3OBW A;  2J06 A;  5KH6 A;  1OZ3 A;  4M7A G;  1JB0 E;  2A36 A;  1MGQ A;  4M7D D;  3CPF A;  4D8D A;  4BDZ A;  1EX4 A;  5IXF A;  1TUC A;  4KUL A;  1X6B A;  3I5R A;  3TRE A;  3VS0 A;  2JOY A;  3VJP A;  2KR3 A;  2ZPG B;  4M7D G;  2VYT A;  4EPC A;  2QA4 T;  3CCL T;  3JB9 F;  1HYO A;  3CCM A;  1GCQ A;  1M1F A;  1BU1 A;  1I1J A;  2RN8 A;  2FPE A;  2GQI A;  3M55 A;  1QCN A;  2DNU A;  4M78 A;  4R56 A;  4F04 B;  3V8J A;  3OW2 A;  2P0P A;  5A0L A;  3LWH A;  4MZM A;  2QTV A;  5GAM h;  5HCK A;  1G83 A;  1B7T A;  3QHS A;  1VQN T;  2RHI A;  2MYS A;  5GMK i;  3QZ9 B;  1Z9Q A;  1V1C A;  5GMK h;  2Y4Y A;  1D0X A;  2QQ9 A;  2W0Z A;  1Y57 A;  1YFN A;  4K11 A;  1SRL A;  3SFM A;  1VQK A;  2ENM A;  3S3N A;  4RTZ A;  2XHC A;  3EFR A;  8AT1 B;  4CC3 A;  4E7Z A;  2QQS A;  3VYH B;  2RH2 A;  1N6A A;  4LDX A;  3H0F A;  2VKN A;  2DMO A;  1YJN A;  1LPL A;  3EFO B;  2VV5 A;  3I5S A;  3M53 A;  2AK5 A;  4JJN K;  3RMQ A;  1KC8 R;  1M2O A;  1RAG B;  1ZHI A;  4V2S A;  4FSX A;  1JJ2 A;  3J80 E;  4C8Q C;  2DD5 A;  1WHJ A;  1AWW A;  2MIO A;  1M27 C;  3CCJ Q;  5LJ3 d;  1FXX A;  1IRX A;  2E3I A;  2X9H A;  4JRP A;  2K57 A;  1GBR A;  1X01 A;  3TU4 K;  1EZZ B;  5GAN 4;  1JXO A;  3A8H B;  4Y28 E;  2RPN A;  1HD3 A;  1IB8 A;  1SHF A;  1SEM A;  1M3B A;  5I2M A;  3OS0 A;  2DD4 A;  2DYB A;  3R6O A;  3EGD A;  1D1A A;  2QI2 A;  2LCL A;  3CCL A;  4OMO A;  3CCJ A;  1BKB A;  2RQT A;  2ZCF B;  1QCF A;  3TVT A;  2K4Y A;  4ZGD B;  1JQQ A;  4FYY B;  3OQ5 A;  4C0F A;  1VQL Q;  1B3Q A;  2DLP A;  4L6V 5;  5FW9 A;  3CPW S;  1WZO A;  4FT2 A;  3JCM V;  3L2Q A;  1WQ7 A;  1FMV A;  5FWC A;  5FU7 C;  4BUG A;  4HVV A;  2L8D A;  1VQN A;  2FEI A;  5GAM e;  1YWO A;  3KUF A;  2XG8 D;  1V29 B;  2JVV A;  1NLP C;  2LX9 A;  2GNC A;  5GMK e;  4J9F A;  1BI3 A;  1VYU A;  2DX1 A;  4R0K A;  4F7U B;  4KUI A;  1I5O B;  2IVW A;  1AT1 B;  3CC2 Q;  2YRD A;  4HVU A;  4O5V A;  4OB3 B;  4EMK B;  1QQJ A;  4Y91 A;  1GBQ A;  3CCQ T;  3CCV T;  3RMS A;  1M1K R;  2YUP A;  1PD0 A;  3L2W A;  3OYE A;  4E7L A;  2XMF A;  1IHW A;  2HL3 A;  2OX7 A;  2RJE A;  3WVD B;  3TSW A;  4C8Q F;  3A8O B;  2FZC B;  2JM8 A;  2LX7 A;  4JRQ A;  1Q81 U;  2OI3 A;  1JEG A;  4JS4 A;  2QGG A;  2OTJ Q;  4ME7 A;  1KD1 U;  2X3X D;  3UT1 A;  1W4S A;  3OYM A;  4NS5 A;  3C12 A;  1T0H A;  4LN2 A;  2EPD A;  5KYU B;  1UG1 A;  5IH2 A;  3EFO A;  3X25 B;  3UA7 A;  1QVP A;  2RD1 A;  3U23 A;  1B34 B;  5KYX B;  3HTR A;  4OML A;  3EG1 A;  2DL3 A;  2OTJ A;  1KC8 C;  4KT0 E;  3OYG A;  1UGS B;  2AT1 B;  2EKO A;  3OYI A;  5J39 A;  3O8V A;  1K8A R;  2HKN A;  4HT8 A;  1U1S A;  3PVL A;  4LDU A;  4XTU A;  1OUL A;  4FL6 A;  3ZBD A;  2EQU A;  2K2V A;  3E1S A;  1MMN A;  2AZV A;  4RUG A;  1AD5 A;  4J7F A;  2KMT A;  3I56 Q;  4XTY A;  2O9S A;  1S72 T;  1YBY A;  2YDL A;  3CC4 T;  2XID A;  5GAN 7;  5J26 A;  4JLI A;  1X43 A;  2F5T X;  2CP2 A;  1OU8 A;  2QTX A;  2HCK A;  1U8R A;  3CME T;  1KHI A;  4GBQ A;  1PHT A;  2ZPB B;  4E2F B;  4PKC C;  2EQI A;  2GFA A;  1AWJ A;  2PQW A;  3A5Z B;  1T3S A;  2KT1 A;  2K79 A;  3CCQ A;  1TG0 A;  1U1T A;  2DYI A;  2F1L A;  3EG0 A;  4NL2 A;  2AKK A;  2AZS A;  4TVR A;  5GAM g;  2DFU A;  1T0J A;  1MMG A;  1X6G A;  4LNP A;  5LJ5 h;  4HCB A;  2PU9 B;  1G3S A;  2HQE A;  1XNI A;  1WQW A;  2MAM A;  1P92 A;  3A1P A;  1WHM A;  4IIO A;  3JCM b;  1OI1 A;  5KYN A;  5KYW B;  3MHX A;  2R57 A;  2L89 A;  4C92 B;  4F7U A;  3NFC A;  4QVZ A;  4C8Q A;  2ESW A;  4OMN A;  4R55 A;  3MEU A;  1PRM C;  3M4Y A;  1C0M A;  3M59 A;  1R8O B;  2M16 A;  4RG2 A;  4KRT A;  1VQO Q;  2HSE B;  2DAQ A;  1H8K A;  2K3B A;  3UA6 A;  4KH1 B;  2QK0 A;  3BW1 A;  3CBO A;  4PJO B;  2DIL A;  1MHN A;  3EG2 A;  2DXT A;  2O88 A;  4M7D F;  5GAO p;  1M1K C;  2FZG B;  2BZ8 A;  3I55 T;  1QP3 A;  2F2V A;  2H8H A;  5DLQ E;  2DXB A;  2RHU A;  2HEQ A;  4Z88 A;  2KDS A;  5IHN A;  1U3O A;  1R0C B;  4DQ2 A;  3ZEH A;  4AG2 C;  3OSV A;  4ZN3 A;  3SWN B;  2QGF B;  1KQ2 A;  2DET A;  2GTO A;  1B34 A;  1LNX A;  5CR2 A;  5KYX A;  4M7A E;  4OGE A;  3VYG A;  1BB9 A;  4JDS A;  4HA8 A;  2ZPH B;  1B07 A;  1GFD A;  1RAI B;  2E70 A;  2O01 E;  1ZQ1 A;  3PGG A;  2CSQ A;  2CZ6 B;  3SB2 A;  4KH0 B;  2L0A A;  2K6D A;  1XTD A;  1PKS A;  4UC4 A;  1Y7X A;  1N27 A;  4J9D A;  4QQG A;  2RJD A;  4LD6 A;  2YLB A;  1IGU A;  1UEB A;  1UE9 A;  3S6W A;  1BI0 A;  5DM7 R;  1KFZ A;  3JCM f;  4EMG A;  4OMP A;  1K8A C;  3OYC A;  3UAT A;  1MV3 A;  2PVG B;  3VKI A;  1LOJ A;  4C92 E;  3MCA B;  5FU6 C;  3G4S T;  2QEX T;  1RAD B;  2M0O A;  4A63 B;  4XU2 A;  3FEO A;  4DBH A;  2VB6 A;  2C06 A;  1HK9 A;  4JUV A;  2GGR A;  4XQ3 A;  2KXD A;  3M5A A;  5L8R E;  1VQ9 A;  2V1Q A;  3VS3 A;  1W2B S;  4PJO E;  2QYZ A;  3CMA T;  1VQM T;  4B9W A;  4PLI A;  3WXM B;  1RI9 A;  2DJQ A;  3UPU A;  3CCS T;  3MEW A;  3I55 A;  1QW1 A;  3OS5 A;  1K8A U;  3LX7 A;  1TUD A;  4ORZ A;  3BFM A;  4XTX A;  5KYW A;  3OW2 P;  4QVC A;  4E7K A;  3LWI A;  4FW2 A;  3X26 B;  3QJ6 A;  4M78 B;  4BY6 C;  2L3R A;  5GAO m;  3GPL A;  2E1H A;  2OJ2 A;  3FJ5 A;  4A4F A;  2F2X A;  3PMT A;  1JJ2 S;  3O5Z A;  3UF4 A;  4JJB A;  1K9A A;  1PC0 A;  4IUP A;  5GJW B;  5CAI A;  4XK8 E;  1VQ5 T;  2ED1 A;  4J8O A;  1JU5 C;  3LH0 A;  1LVK A;  2OTL T;  2FVU A;  3G6E T;  3E2U A;  1SF9 A;  5FU6 B;  2M1H A;  1VQP T;  5FLX E;  5KE2 A;  1TS9 A;  1VQ6 Q;  1TXQ A;  5CQY A;  4J9C A;  1VQ4 Q;  1JJ2 P;  3HRT A;  4EMH A;  1OX9 A;  4O6J A;  2X3W D;  2E3H A;  3RDV A;  3DB4 A;  3P8H A;  1I0C A;  1YI2 A;  3OA6 A;  4GY5 A;  3G4S A;  4M77 E;  2DJZ A;  2CT4 A;  2LJ0 A;  4MZP A;  1YIT T;  1ARK A;  2GTJ A;  2COZ A;  4HVW A;  4IUQ A;  2HQX A;  2YXY A;  4M75 B;  2JTE A;  1EFN A;  2HDA A;  2JMA A;  5GAN j;  4ZGE B;  2KK4 A;  4LXC A;  1FMK A;  5IHI A;  2VVK A;  1VQ4 A;  2CP0 A;  5LJ5 d;  1VQM A;  1X27 A;  4AFS C;  1D0Z A;  2CT3 A;  5GMK m;  3QBY A;  3CCS A;  5KE3 A;  5I2S A;  2XIC A;  1ABO A;  4BY6 B;  2LCS A;  2P4R A;  3QYH B;  3CBM A;  4L59 A;  1NEB A;  5KCH A;  1BK2 A;  1I5L A;  2ROL A;  4KUD K;  1NPR A;  1CSK A;  1SSH A;  1AWO A;  1ZSG A;  4KGX B;  1UGQ B;  1WIE A;  5CK9 A;  2ABL A;  1BCM A;  3CCU T;  2X51 A;  4KGZ B;  1G3Y A;  2RQR A;  2CDT A;  2EIF A;  1ABQ A;  3OYD A;  4M7A D;  1RUW A;  3CCM Q;  1Q81 R;  2E64 A;  2EQJ A;  3MP8 A;  1RAA B;  5CKB A;  3G71 T;  1KD1 R;  1KJW A;  3JB9 J;  3RUX A;  2CH4 A;  1OU9 A;  1MUZ A;  4J9B A;  5CO7 A;  4J83 A;  1AZG B;  3P8B B;  2ZPE B;  3ER0 A;  1NJI R;  3PE0 A;  1NPP A;  3M56 A;  2OTL A;  4NOY A;  2C0T A;  1M8M A;  1M4Z A;  1VQP A;  2KRS A;  2HBW A;  3PIO A;  2C0I A;  5GAN 5;  1VQK Q;  2YRV A;  4ATO A;  2BZX A;  3JAM E;  3NGP A;  4PNO A;  3OS2 A;  1KK7 A;  3QWY A;  2HMA A;  2KBT A;  3H41 A;  5FRN A;  4C92 G;  1OQK A;  3FC3 A;  2DK3 A;  4JPB W;  3OMG A;  1YJN Q;  1WGS A;  2MF2 A;  3FIF A;  1UGP B;  2O2O A;  3JCM P;  5EC7 A;  1N5Z A;  1BYM A;  3NTH A;  4F14 A;  4PJO D;  1Q7Y U;  1RAB B;  2CZ7 B;  2E6N A;  3H0I A;  1WJQ A;  4PJO G;  4C5G A;  2X4W A;  1SPK A;  3JCM J;  1M90 U;  1UJY A;  4YTL A;  4P5N A;  4XU1 A;  5FWB A;  1PG5 B;  3VS2 A;  1FYN A;  2PUO B;  4RTY A;  2ED0 A;  1JXM A;  1Q86 U;  2H3J A;  3N5B B;  3CC7 T;  1WHH A;  1WHG A;  4IUU A;  3CCU A;  2RO0 A;  2D1X A;  1OYX A;  2LDM A;  2DRM A;  2QA4 Q;  5A0G A;  1TWB A;  4JZ4 A;  3CCL Q;  2RI2 A;  1IZ6 A;  1QKW A;  5GAN 2;  3PVQ A;  2MK5 A;  4M75 A;  3LYI A;  1FWZ A;  4N4H A;  3G71 A;  4BE0 A;  1JO8 A;  4BDY A;  2BUD A;  5LJ3 f;  4KGV B;  5D6Y A;  1FMW A;  2K3X A;  2OAU A;  1D1B A;  1LCK A;  3NTK A;  3A8M B;  3C4S A;  2E5K A;  2D8J A;  5KYY B;  3QYG B;  1VQN Q;  4Z8A A;  1K1Z A;  1QCO A;  2QA4 A;  2E5Q A;  1KQS A;  1VIE A;  4RG8 A;  2GBQ A;  4DBR A;  4QKU A;  4MDW A;  1M2V B;  2BE9 B;  1IGQ A;  4M77 D;  3OYB A;  2BE7 D;  1Q95 G;  2SRC A;  4ESR A;  1Y71 A;  4F16 A;  3REA B;  3EAE A;  1UHF A;  3JRZ A;  1WHK A;  4M77 G;  1PKT A;  3GNG A;  1KHC A;  4VUB A;  1Q81 C;  1UDL A;  2A7Y A;  3HRS A;  1QVG A;  1KD1 C;  2D0Q B;  1NYF A;  3EGU A;  2VUB A;  4PK4 A;  3L2V A;  3PT9 A;  1M1G A;  1ZX6 A;  1YHQ T;  3X24 B;  2ECZ A;  1I81 A;  2HL5 C;  1G8X A;  5AYF A;  1XQH A;  2XK0 A;  4C8Q B;  2RHX A;  1OPL A;  1N9S A;  2YSQ A;  3JCM h;  3JCM Q;  2JJ9 A;  4MDX A;  1GRI A;  5HK0 A;  1JBM A;  3CC7 A;  5AT1 B;  2CP7 A;  3Q1J A;  4M78 G;  5LJ3 j;  2QDL A;  3HSB A;  2YUQ A;  1YCY A;  5HK3 A;  3MEA A;  2MWO A;  1VQ7 T;  2O4X B;  3GF5 A;  3I56 T;  2RK2 A;  3FRN A;  4LE9 A;  4E7H A;  4M7A C;  3AHU A;  1VUB A;  2EBP A;  1NJI U;  1Z9Z A;  2BTT A;  1ZA1 B;  3RBB B;  5FU7 B;  4M7D C;  1PWT A;  4RTX A;  4AMC A;  3ME9 A;  3DB3 A;  1YIJ T;  1D0Y A;  2ATC B;  2M02 A;  4IKF A;  2V1R A;  2DEU A;  2EJ9 A;  3EFS A;  1BI1 A;  2KGT A;  1Q82 R;  2F2W A;  2EGC A;  4DOW A;  4MML A;  2CP6 A;  3CCQ Q;  2Y90 A;  4M75 G;  3CCV Q;  1RI0 A;  1ZBJ A;  5CVI A;  2K2M A;  1YNZ A;  4CC2 A;  1WI7 A;  5KYY A;  4Q5W A;  4EIK A;  4F17 A;  1YHQ A;  4F7U E;  1G3T A;  2RHY A;  4C8Q E;  1BIA A;  3CBP A;  2KAF A;  4E47 A;  1M5Q 1;  4AFZ C;  1M2V A;  2E10 A;  2HSP A;  2K5L A;  3VRY A;  2RHZ A;  3JCM e;  5GAM d;  2I0N A;  3CCV A;  4QW2 A;  2M9U A;  3ZL7 C;  5GAN 8;  4ELZ C;  5CKF A;  2DE0 X;  5CKE A;  2LJ3 A;  1UGV A;  3JB9 G;  1I4K 1;  2K5F A;  1EIF A;  2BZY A;  3DLM A;  2JUF A;  3D7S B;  2QQR A;  3H8Z A;  3PIP A;  3OYH A;  2A28 A;  2WSF E;  4J5Y A;  4OGC A;  3OSS C;  1D09 B;  1AWX A;  4M7D B;  3FLG A;  2K3Y A;  3I9Q A;  2BIV A;  5DY9 A;  4OP0 A;  1WFW A;  2YUN A;  4JJD A;  3TEE A;  5GAO q;  1V76 A;  4RMO A;  3JCM W;  4BI8 B;  5GAN e;  4M7A F;  2DBK A;  1X69 A;  3GOX A;  3H9N A;  2O31 A;  3CCR T;  2DXC A;  1YIJ A;  3PFS A;  1UJ0 A;  2RQV A;  1SG5 A;  3CME Q;  4IIM A;  2GFU A;  1D3B B;  1UTI A;  2O4X A;  1ZSZ C;  2EYW A;  3HKS A;  3CPW A;  2FRY A;  1W1F A;  2CP5 A;  4X9C A;  3JSC A;  4OF1 A;  4X9D A;  2L2P A;  2KY9 A;  2J05 A;  1S72 A;  3BE3 A;  4QQD A;  3CC4 A;  3A98 A;  2VXF A;  1OZ2 A;  2G3R A;  4WCI A;  3MET A;  3QWX X;  3CME A;  2RA2 A;  1FX7 A;  1VYV A;  4IUV A;  4BAC A;  2QDY B;  3EHQ A;  5EG2 A;  2A37 A;  3QPH A;  3REB B;  1AEY A;  2RK1 A;  2NUP B;  1N9R A;  1G2B A;  1IXD A;  4ZN1 A;  3MPU B;  2PVO B;  2OAW A;  1KIK A;  2XDP A;  2RQW A;  1VQ9 Q;  1H64 1;  3QDF A;  1PCX A;  1YN8 A;  2V8J A;  2B8A A;  2EAY A;  2HZY A;  5I21 A;  4GLK A;  2HQH A;  1Q82 C;  1ZBX A;  2CZ1 B;  3CD6 T;  4MZT A;  2EYZ A;  4N4I A;  1E6H A;  3R6N A;  1VIF A;  1G3W A;  3I55 Q;  3LLR A;  1BBZ A;  1OPK A;  2E12 A;  2X4X A;  1QVF A;  3LGL A;  1C6V X;  1NE8 A;  3OW2 S;  2VAS A;  1M9S A;  3JCM g;  1Q7Y R;  3M0R A;  3UWN A;  1K73 U;  3OYF A;  3OS1 A;  2MWP A;  1K9M U;  4J9H A;  1H3H A;  2KSS A;  1WJR A;  4OMQ A;  1M90 R;  2E65 A;  4HCC A;  1K76 A;  2COY A;  5IT9 E;  5GAN f;  1ZUU A;  2KT8 A;  4WF2 A;  2E41 A;  2K9G A;  2LNV A;  3CCE T;  1RAC B;  2D8H A;  2I2L A;  2IPO B;  1PNJ A;  2GCX A;  1Q86 R;  2L3S A;  5LJ3 h;  1TU0 B;  3QZ5 B;  4CC7 A;  1Q82 U;  3JB9 I;  4AT1 B;  4M7D A;  2LCC A;  1JRI A;  3LW5 E;  4C8Q D;  2DTO A;  5GAN g;  3EH1 A;  4M77 F;  2P4T A;  3JB9 H;  4F7U G;  5IXB A;  4C8Q G;  1VQ8 T;  5FRO A;  2Y4X A;  1VYT A;  1YI2 Q;  1SRM A;  3G4S Q;  3OYK A;  1D3B A;  3DKM A;  2RI5 A;  3SDZ A;  2ROT A;  3QII A;  4ZTF A;  2CYZ B;  2VWF A;  1YJW T;  1QKX A;  3ULR B;  3IQL A;  3MO8 A;  1K0S A;  3J7A F;  4PLL A;  3M0P A;  1MNE A;  2CRE A;  3CMA Q;  1VQM Q;  2KYB A;  1YJ9 T;  2RB6 A;  1XJW B;  3GNF B;  1IO6 A;  3CCS Q;  2QEX A;  1SKU B;  4PJM A;  2KNB B;  1IRE B;  1UGR B;  1KSW A;  3NPF A;  4CC4 B;  1N8R U;  2H3E B;  3M54 A;  5ECA A;  2DL5 A;  3V7R A;  4C0D C;  2A3L A;  3CEY A;  2NUZ A;  4Z89 A;  4C5E A;  1MND A;  3M4G A;  4D6W A;  3GBQ A;  2PVD B;  2NUP A;  5C6S A;  1TSF A;  3HL8 A;  2DZC A;  5CKH A;  1BI2 A;  1R0B G;  5C0M A;  3CMA A;  3L42 A;  2EJF A;  3CXC A;  3VS7 A;  1F1B B;  1KQS P;  2BKD N;  2XI9 A;  2RNA A;  4IUT A;  3CCE A;  4GLM A;  3AT1 B;  1YCS B;  2KRM A;  4ANJ A;  4E7S A;  2C0O A;  1VQ5 Q;  3THK A;  2YLC A;  1VQK T;  2OTL Q;  3L2Z A;  3G6E Q;  5LJ3 e;  4M78 E;  3VS1 A;  1VQP Q;  2MOX A;  3M0T A;  3L2R A;  2ZPF B;  2LT4 A;  2JTF A;  2ZAE A;  3EHR A;  1MMA A;  1VQ8 A;  4ZTJ A;  4II1 A;  1QVG P;  3OMC A;  3FDR A;  1OOT A;  1RL2 A;  1Q7Y C;  3QXE B;  4HXJ A;  2DVJ A;  2K5I A;  2M51 A;  4BD3 A;  2LQ8 A;  1VQ5 A;  2YRC A;  5D6X A;  3PMI A;  2YUO A;  2PTK A;  4N4G A;  3QJY A;  1PSE A;  2ZZD A;  1YIT Q;  4D8K A;  3S3M A;  3EG9 A;  3G6E A;  3FJP A;  1M90 C;  2L3Q A;  3QG1 A;  2EQK A;  1YJW A;  2DA9 A;  4RTT A;  3WVE B;  2LTO A;  2YHT A;  4C92 D;  3BDL A;  2HBP A;  3J81 E;  1Q86 C;  1BIB A;  4C0D B;  1YJ9 A;  2V8I A;  2DM1 A;  3DLL A;  1OX8 A;  2EW3 A;  2G6F X;  1YIT A;  3V7S A;  3CCJ T;  4M75 E;  1WLP B;  2HKQ B;  1M8V A;  2EGA A;  2FZK B;  1QP2 A;  2R58 A;  3CCU Q;  5LJ5 j;  2J6K A;  1NYG A;  2MMP A;  3HP9 A;  4J9I A;  3A8G B;  1WXU A;  3VRZ A;  2XD0 A;  3LGF A;  5KCO A;  4PFP A;  4RTU A;  3KBG A;  1GL5 A;  3G71 Q;  2HD0 A;  1W2B A;  1NBE B;  2RI3 A;  2DXU A;  2JTM A;  4L5G A;  2EVR A;  2DL4 A;  2QG9 B;  5IN1 A;  4WTO B;  3VS5 A;  3M58 A;  3SHW A;  1O75 A;  1W70 A;  3RKY A;  4BB7 A;  4A4K A;  2J6O A;  2EFI A;  3OYA A;  2DKG A;  1VQL T;  1KQ1 A;  4J9G A;  5CIU A;  2V26 A;  3L2U A;  2LRQ A;  2LNH B;  4BI3 A;  3RKX A;  4PJL A;  4A4E A;  1U06 A;  4C5I A;  4PFO A;  1UFF A;  2L3P A;  2MPX C;  2RF0 A;  1M3C A;  1QWF A;  4B6M A;  4C0Z A;  4EMK C;  2ZPI B;  4A53 A;  2VGN A;  3SD4 A;  2DTI A;  2CH4 W;  4OMF B;  3VV0 A;  5LJ3 g;  2FRW A;  5GJV B;  5I22 A;  3CC2 T;  4C5H A;  2CSI A;  1RLP C;  3H0H A;  1OEB A;  3OYJ A;  2NYS A;  2JMC A;  2D9T A;  1VOM A;  3C0C A;  2DO3 A;  4DEX A;  3G7Z A;  1M30 A;  3L1A A;  1UB4 A;  3BDU A;  2QAS A;  2CKK A;  4XTW A;  1W6X A;  5L23 A;  1AHJ B;  1PD1 A;  3EH2 A;  2X35 A;  5GAO l;  1X6O A;  3CC7 Q;  1M3A A;  3FB9 A;  2OTJ T;  4OB2 B;  4DBQ A;  9ATC B;  2YT6 A;  1H3Z A;  4QQ6 A;  4LDV A;  2D6F A;  5GAO n;  1NJI C;  1PSF A;  1HXD A;  1X75 C;  2FO0 A;  2WAC A;  4E7I A;  2FPF A;  4JS5 A;  5FRM A;  3VUB A;  2DVE A;  2NUT B;  3JV3 A;  4M78 D;  2MCN A;  4BE1 A;  3KXT A;  4XTZ A;  5GAN 3;  3OYY A;  4HT9 A;  4XU0 A;  4ZNX A;  1VQL A;  3E9G A;  2RJF A;  1G5V A;  2X4J A;  4ZGJ B;  2XDB A;  2QAZ A;  1H92 A;  3T9N A;  3VUZ A;  4FW1 A;  3CPW P;  2Z0W A;  1TUG B;  1Y07 A;  2DEQ A;  4LD9 K;  3KFV A;  1QWE A;  1ZA2 B;  7AT1 B;  1X2Q A;  2DTH A;  4PJJ A;  1GXI E;  1YP5 A;  2SEM A;  1NZ9 A;  2DRK A;  1GCP A;  1PM3 A;  1RLQ C;  3MJX A;  1UEC A;  3JCM X;  5GAN h;  3MP6 A;  4E6R A;  2FHD A;  1K73 R;  1WA7 A;  1WPY A;  4HCK A;  4KBM B;  4F7U F;  1YWP A;  3NTI A;  4RKU E;  1CKB A;  1K9M R;  3CC2 A;  2L5Q A;  3I35 A;  1QVF S;  5GMK l;  4FU6 A;  4HCZ A;  1WDX A;  1YHQ Q;  2CGH A;  1TOV A;  2QQA A;  1SSF A;  1WJS A;  2JS2 A;  2NWM A;  4M75 D;  2J6F A;  2DPP B;  2LMJ A;  1ZUY A;  3GP8 A;  5HY6 A;  3PTA A;  2IG0 A;  4HKE A;  1K4U S;  3TSZ A;  4C92 C;  2QXF A;  1RAF B;  1PRL C;  4N0A C;  2JS0 A;  3HPW A;  2K7A A;  1CKA A;  1KG1 A;  1U5S A;  1Y96 B;  2KI7 A;  4RTW A;  4XTV A;  4LDY A;  1QVF P;  3ZFJ A;  2A08 A;  3E9F A;  4LUD A;  1UUE A;  1VQ7 Q;  4AFQ C;  1UHC A;  2DIG A;  3S3O A;  4DOV A;  4PJO C;  3BY7 A;  1OV3 A;  2PNI A;  4FSS A;  5IHK A;  1A0N B;  2P0Q A;  1WXB A;  1VQO T;  1RAH B;  3JB9 D; 
#chains in the Genus database with same CATH homology
 2E3H A;  3RDV A;  2CP0 A;  2E3I A;  2CP2 A;  3TQ7 P;  1LPL A;  1WHL A;  1TOV A;  2M02 A;  2HQH A;  2CP7 A;  2COW A;  2HKQ B;  2HKN A;  2CP5 A;  2MPX C;  3E2U A;  2CP3 A;  2COZ A;  4B6M A;  1WHM A;  1WHH A;  2COY A;  2HL3 A;  2HL5 C;  1WHJ A;  1WHG A;  2CP6 A;  1WHK A;  2QK0 A;  2Z0W A;  1TXQ A;  1IXD A;  2E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...