4OMLA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128r
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omlA00
2JXBA 4J9EA 2DRMA 1WX6A 2CUBA 2K79A 3EG3A 3PVQA 1CKAA 2ED1A 3H0HA 1E6HA 1WIEA 2LZ6B 1AWWA 2YUOA 5L23A 4D8KA 2CH4W 2AZSA 1Z9QA 3U23A 5IXFA 5EC7A 2A08A 3CQTA 1MV0B 1QCFA 1JQQA 2L3PA 3I5SA 1A0NB 1X6BA 2EGEA 1CSKA 1E7OA 4HXJA 1WDXA 1MV3A 1T3SA 1AVZC 2AZVA 2L3SA 1GCPA 3VS5A 2RQWA 2BTTA 2KEAA 3O5ZA 1VYTA 2J05A 2K2MA 2FO0A 2OAWA 2QDLA 1GFCA 1GBQA 1GBRA 4LNPA 1JEGA 2JMAA 2P4RA 2V1QA 4OMNA 2C0OA 5ECAA 4J9CA 2EBPA 1UJYA 2YDLA 2EPDA 1NEBA 3SEMA 1PKTA 3NGPA 4DEYA 2AKKA 4AFSC 1SEMA 1K0SA 4OMOA 4FSSA 2GQIA 2MCNA 3A98A 2AKLA 4J9BA 2KT8A 1ZUYA 2KT1A 2DA9A 3UA6A 4IIOA 1GRIA 4AG2C 4HCKA 4OMQA 1SHGA 4HVWA 1CKBA 2J6OA 2EYYA 2M0YA 1YN8A 1T3LA 2DJQA 2XMFA 1AWOA 1E6GA 2EW3A 2J6FA 4J9HA 2AK5A 3EG0A 1U5SA 4OMLA 3PVLA 2L0AA 3EHRA 1X2QA 1WXUA 1X43A 2ROLA 1NEGA 2DL8A 2A28A 1M3CA 1SHFA 2VWFA 2O31A 4ESRA 2NUZA 2RQTA 1UE9A 1Y0MA 3NMZC 1K0XA 3RNJA 4JJBA 1UHCA 2D8JA 1ARKA 2J7IA 4F17A 1G2BA 1X2KA 3QWXX 1SPKA 2ENMA 1WYXA 2ESWA 2K3BA 2SEMA 2KXDA 2LNHB 1QKWA 1GL5A 1T0JA 1HSQA 2J6KA 2FG0A 2LQNA 2ED0A 4AFZC 1TUCA 2KBTA 4LE9A 1UFFA 1NLPC 3H0FA 2GGRA 2V1RA 2YUNA 1QWFA 2MOXA 3TSWA 1BU1A 3I5RA 2SRCA 2JM8A 2CT3A 1AZGB 1K4US 2ABLA 4OMPA 2L3QA 4AFUC 1JXOA 3H0IA 3LH5A 3THKA 2EQIA 2EKHA 3I9QA 3UATA 2ROTA 4IIMA 3RBBB 2BZYA 2FPDA 4GBQA 2OJ2A 1RUWA 1UUEA 4RTUA 3TSZA 1ZX6A 1H8KA 5FWCA 1GCQA 2F2VA 1G83A 1VYVA 1WI7A 5IH2A 1UHFA 2FEIA 1QWEA 1RLPC 3ZL7C 5I11A 1YWPA 2JS0A 1QLYA 5GJWB 1AOJA 2L2PA 1HD3A 2KGTA 2GNCA 1AEYA 1ZLMA 1VYUA 2HSPA 3VS3A 1OPLA 1BK2A 4A63B 4ORZA 2DMOA 1KSWA 4F16A 2FPFA 2IIMA 2H8HA 2O9VA 2KRNA 1I1JA 2D0NA 4HVVA 1WXTA 2CUDA 1NM7A 1WXBA 1YWOA 1AD5A 2LX7A 2PTKA 2F2WA 2KYMA 2CDTA 2B86A 4RUGA 4CC2A 2FRWA 2DL3A 4D8DA 3VS2A 2FPEA 2RQRA 2DLPA 1PNJA 1GFDA 2K9GA 4GLMA 4JJDA 2FRYA 1WFWA 1YNZA 2DBMA 4R0KA 2KXCA 4ZNXA 4F14A 1ZBJA 3IQLA 1ZUUA 1M8MA 3M0PA 4Z89A 2A37A 4J9IA 2JMCA 3VS4A 1W6XA 2KROA 4RTVA 5I22A 2HDAA 2KR3A 1I0CA 3VRYA 1UGVA 1AZEA 3VS6A 2MIOA 3ULRB 2BZXA 3GBQA 1SRMA 2KYBA 1UG1A 1RLQC 5GJVB 5IXBA 5IHNA 5IHKA 2CSIA 1LCKA 1K9AA 2HCKA 1N5ZA 1QKXA 2HEQA 2RN8A 2PZ1A 2LCSA 5IHIA 2W10A 2DM1A 1JO8A 1NYGA 2K7AA 2OI3A 1UECA 5FWBA 1X6GA 4X1VA 1ZUKA 1NLOC 3UF4A 2DVJA 1OOTA 1UDLA 4AFQC 3KFVA 2JT4A 2DL5A 2EYWA 2J06A 2LJ3A 2CREA 2CH4A 2DYBA 2GBQA 2DF6A 4CC4B 2LJ1A 4OMMA 2RMOA 1PRMC 2DRKA 4AG1C 2X3XD 1UJ0A 3VS1A 2YSQA 4JPBW 1X69A 2D1XA 1S1NA 4Y92A 2RF0A 2M51A 1W70A 2LMJA 3SHWA 4DEXA 1U06A 2RQVA 2O9SA 1ZSGA 2EGCA 1H3HA 2LP5A 2BZ8A 4QT7A 1M3BA 2RPNA 2A36A 3H41A 3REBB 5HCKA 2HBWA 2YUPA 4HVUA 1UTIA 2GTJA 2CT4A 2O2OA 2DX1A 4RTXA 3C0CA 3VS7A 4JJCA 3M0RA 3UA7A 3M0SA 1H92A 1ABQA 1BBZA 1EFNA 1K1ZA 2ECZA 1RI9A 4RTTA 1HJDA 3M0UA 1ABOA 2YT6A 1KJWA 2O88A 1TUDA 2K6DA 4RTYA 4K11A 1PRLC 2JM9A 2RQUA 3R6NA 2DNUA 4CC3A 4LUDA 1OEBA 1K76A 4CC7A 4JZ4A 4JZ3A 2YUQA 1NG2A 4E6RA 1VA7A 2NWMA 3M0TA 3FJ5A 1OV3A 1U3OA 3EGUA 1BB9A 2X3WD 3EG1A 1I07A 1M3AA 1SSHA 2KNBB 3PE0A 2DBKA 3TVTA 2D8HA 3I35A 3NPFA 2W0ZA 3NHNA 4J9FA 3EG2A 4Z8AA 1PKSA 2EVRA 2VKNA 1KFZA 1B07A 4J9DA 2G6FX 2EYXA 2EYZA 2JTEA 2F2XA 2DILA 1Y57A 2CSQA 4Z88A 1W1FA 4EIKA 1J3TA 5FW9A 3REAB 1M27C 2DL4A 2VVKA 1JXMA 1X27A 1AWXA 2E5KA 1YCSB 2JS2A 3EHQA 2KRMA 1KIKA 3VRZA 2C0TA 2I0NA 4LN2A 2GTOA 3M0QA 4M4ZA 2EGAA 1WLPB 1PWTA 2DL7A 1V1CA 4LUEA 1XOVA 3JV3A 2KE9A 2KRSA 3VS0A 1FYNA 1M30A 1NYFA 1IO6A 1B3QA 1SRLA 1GCQC 2LQWA 4RTWA 1T0HA 2C0IA 1WA7A 2PNIA 1OPKA 1Z9ZA 4KRTA 1PHTA 3QWYA 2JW4A 1JU5C 2LJ0A 2RNAA 1MUZA 4RTZA 2DE0X 1TG0A 1FMKA 1AWJA 4J9GA 4WCIA 1YP5A
chains in the Genus database with same CATH superfamily
5KYUB 2DXTA 2JXBA 5A2QE 4J9EA 3JB9H 2DRMA 3CEYA 1KHIA 1WX6A 2CUBA 2COWA 1RADB 2LT1A 3PVQA 1CKAA 1MMGA 2ZPEB 5FLXE 3BW1A 3H0HA 5D7UA 1O75A 3L2QA 4PJOD 1AWWA 4ZTJA 4AMCA 5L23A 3DLLA 1ZSZC 1I5OB 4NL3A 5EC7A 2A08A 3LLRA 3P8DA 3TU4K 5GANd 4ELYC 4RCCA 1X6BA 3OYEA 3E9GA 2QTVA 2HQHA 2FZKB 1MV3A 3RESA 2L3SA 2RQWA 1QVGS 2BTTA 2J05A 3L2VA 1I4K1 1PSEA 1JEGA 4BDZA 4FYXB 3PGGA 3OYJA 2E6NA 4M77F 2HD0A 5GAN8 1WHJA 2AKKA 2LQKA 3G71Q 5CKBA 3CC2A 1UGSB 3A98A 3E9FA 2AHJB 3MP6A 3CCMQ 1ZUYA 2DD4A 2JUFA 4BY6B 3CXCS 4OMFB 4IIOA 1HXDA 3C94A 4HCKA 4N0AA 2OTLA 4C0DB 4QVCA 4LDWA 1G3WA 4J9HA 1VQ7Q 4PLIA 2QGGA 1M1KR 1VOMA 3CC4Q 2QGFB 2ROLA 1M3CA 2VWFA 4B6MA 5LJ3g 1VQOQ 2RQTA 3QJ6A 2X4XA 1K0XA 4DBFA 3CMAT 4C0ZA 3A8GB 1VQLA 3JCMg 1X2KA 2HKNA 3PMTA 1WYXA 1KD1U 2K3BA 4A53A 3CCUA 3LGLA 1T0JA 2J6KA 3HTRA 3GOXA 2FB7A 2FG0A 2XKOC 2COZA 2O4XA 4IURA 3RERA 3JRZA 4PK4A 2EIFA 3CCSA 1YHQQ 1Q82U 5GANf 3CMET 3H0FA 1TOVA 1QWFA 1K8AC 3PMIA 2MOXA 3OYBA 4E7HA 2JN0A 2JM8A 1BCMA 3AT1B 1K4US 2ABLA 2R57A 3PIPA 3FLGA 4MMLA 3THKA 2ROTA 3RBBB 2BZYA 1RUWA 1UUEA 2HNIA 2KI7A 3HP9A 4XTXA 3T9NA 4Y91A 3CMAQ 3TSZA 3SD4A 1QP2A 2EYQA 4PJOB 1HK9A 5FWCA 2FZCB 3HHTB 2HL5C 4LDXA 3VYGA 4EDUA 3HL8A 1D1AA 2NUPB 1QWEA 5I11A 3X25B 3HRSA 1BCOA 4M77C 2MK5A 2QG9B 1FXXA 3META 1HD3A 1AEYA 3OBWA 3FC3A 5HKCA 1ZSZB 2DMOA 4QVZA 3VYHB 3CMEQ 4FM4B 5HK0A 1YIJA 2FPFA 1LPLA 2IIMA 1YBYA 2O9VA 3L2RA 3DB4A 3OYAA 4FYVB 2PTKA 4XU0A 1K9MU 4PFOA 2Y4YA 2DL3A 4KUDK 2PU9B 3VS2A 3UDCA 3CC2T 5CQXA 1PM3A 4JJDA 4QQ6A 1VQKA 1VIEA 4BB7A 2DBMA 2IVWA 5L8RE 3MP8A 2MI6A 3ME9A 4J9IA 2JMCA 2OTLT 5LJ5j 4RTVA 5I22A 3P8HA 2DETA 1RAGB 3JCMQ 3V8KA 1I0CA 3VRYA 1AZEA 1XQHA 2RA2A 2X4JA 3HSBA 4M7DA 2WACA 1KG1A 1EZZB 2VC8A 2ZPBB 4PL6A 2M9UA 1QKXA 4BI4A 2PZ1A 4R56A 3EG9B 2DM1A 4E7KA 1JO8A 4D6WA 1VQLT 4ZGEB 1ZUKA 2XG8D 1UDLA 1JB0E 3KFVA 1Q7YR 2QQ9A 2EYWA 3Q1JA 3CCLA 2J06A 4FCYA 2LJ3A 4BI8B 3CCUT 2DF6A 3CCVQ 3QBYA 2X3XD 4AG1C 1B34A 3CC2Q 3VS1A 1X69A 3L2UA 2PUOB 2RF0A 2A7YA 3CCST 1ACMB 1TWBA 3CD6A 2O9SA 1ZA2B 2EGCA 1H3HA 2LP5A 2BZ8A 2HMAA 2IPOB 3H41A 4PFPA 3REBB 4E7ZA 5KYYA 2KSSA 3SDZA 5GAN7 2HBWA 5KE2A 2DX1A 3C0CA 4N0AC 4C92G 2XIDA 3M0RA 1LVKA 3M0SA 1IB8A 1RI9A 2YLBA 3QO3A 4PLLA 5HK3A 3EFRA 3QPHA 4MMKA 3JCMP 3CBPA 2KVQG 3CPWP 2O88A 3V7RA 2RQUA 3DB3A 4WF2A 2MWOA 1OEBA 1K76A 1OULA 1YJWA 4ANJA 2E4HA 4E6RA 5CVIA 3OYYA 3NTKA 2X3WD 1QCOA 1M3AA 3FRNA 1SSHA 2KNBB 2DBKA 2VV5A 3I35A 3NPFA 4KGZB 5GANe 4J9FA 4QKUA 4OGCA 3TEEA 2XI9A 3H6ZA 1PKSA 4DBQA 1D09B 2EYXA 2EYZA 5KYNA 4FT4A 2K2VA 3X26B 5M9OA 2NYSA 1C1AA 1YIJT 2LQ8A 4A4EA 4M77E 5FRNA 2QQBA 5CQYA 2VVKA 1D0YA 1SF9A 2QEXQ 4M77B 2CGHA 2GQVA 2C0TA 3EGXB 3M0QA 2XHCA 1VQKT 4M78A 3RUXA 3G71A 4ZN1A 2QA4A 4KGVB 1VQNQ 3OA6A 4A4KA 4IKFA 1SSFA 3M59A 4QW2A 2YRCA 3VS0A 4BUGA 2LTOA 3CCMA 3J80E 1IO6A 1WJRA 1T0HA 3OMGA 3QJYA 2PNIA 4C8QD 1KQSP 4LDUA 1OI1A 3EG9A 1Q82R 4F7UA 2DEQA 4YTLA 1FMKA 3M55A 4FYYB 4KT0E 4WCIA 1JBMA 1VQ7A 2E65A 2K79A 3NFCA 4BACA 2WSEE 1Y07A 5CR2A 2LZ6B 3CC4A 1RAAB 4L59A 2AZSA 1OYXA 5GAOm 1VQOA 1VQPQ 4DOVA 5IAYA 4Q5WA 4ZN3A 5IXFA 2DIGA 3X28B 2DXCA 4ZGJB 4J6YA 4XTWA 1VQKQ 4O6JA 5KYWA 2V8IA 3CD6T 1WDXA 4HKEA 5KE3A 3OYGA 3VS5A 3MP1A 1VYTA 2K2MA 2FO0A 1VQMA 4XK8E 1GFCA 1GBRA 2P4RA 1YHQA 5J39A 4OMNA 2C0OA 3OW2S 5A0DA 3WVDB 3PT9A 2EPDA 3EGDA 1PKTA 1QCNA 2YWWA 4AFSC 4M78F 1K0SA 3G1JA 4M7DC 3V8JA 1K73R 1OX8A 3CCJA 4M77G 5AYFA 1TU0B 1YJWT 3QUIA 4J5YA 4JRPA 5CKEA 2EQMA 4ME7A 3RR6A 2PUKB 2RI2A 3UA6A 4OMQA 4F7UF 3CCLQ 5DM7R 2RK1A 2J6OA 2EYYA 1T3LA 2DJQA 1E6GA 2EW3A 2GF7A 1PSFA 1WQ7A 3EG0A 1U5SA 4HCZA 3PVLA 2L0AA 3CD6Q 4OB1B 3V8LA 2XDPA 4BD3A 4RMOA 1N8RR 2O31A 4QQGA 2DO3A 2JTMA 2NUZA 4IUPA 1Y0MA 3RNJA 4JJBA 2D8JA 3OS2A 3QWXX 1H641 1PC0A 2ZZDA 1WHLA 2ESWA 2O4XB 2SEMA 2KXDA 1QKWA 3S3OA 2RJDA 4IUUA 3G71T 2ED0A 2QA4T 3ZBDA 4AFZC 4LE9A 4LD6A 1Q7YU 1UFFA 1Q86R 2DXUA 5GMKl 3CCMT 5GAMg 2E5QA 5DY9A 2YUNA 1OZ3A 3OYNA 4XTYA 1BU1A 3G4SA 3INZA 3N5BB 1V76A 5I21A 1P92A 3MEUA 2L3QA 4AFUC 3CPWA 1VQ7T 4M7AF 2JZ2A 3I9QA 3TCJA 1LNXA 2FPDA 5GMKh 3FJPA 4GBQA 2OJ2A 3CC4T 5LJ3f 4LD9K 1QVFS 2DAQA 1VQOT 3OMCA 3JB9G 2HZYA 2CYZB 1H8KA 5GANj 3JCMW 1I8FA 3JCMf 3OQ5A 2EQUA 1D1BA 2X9HA 1G83A 2R5MA 4GY5A 1WI7A 5IH2A 5GAN3 1RLPC 3ZL7C 1BKBA 5GJWB 2L2PA 2DPPB 1KD1C 2HKQB 4M78C 3QZ5B 2KGTA 2QA4Q 3CCVA 1ZLMA 1G3TA 4L6V5 1VQMT 2RJEA 1M90U 2QQAA 1YHQT 4F16A 2H8HA 3VUBA 4XTVA 1WXTA 4M78D 4EMGA 1NM7A 1YWOA 2VXFA 5CKDA 3BY7A 5CKHA 3E19A 4RUGA 4CC2A 2FRWA 4JUVA 4D8DA 4B9XA 1GFDA 2K9GA 4M75F 2L3RA 1BI0A 2FRYA 1WHHA 4JJNK 4M7DE 4ZNXA 1NBEB 1ZBJA 2ZPFB 3MKDA 1WHGA 4Z89A 4PJJA 4MZMA 1BIBA 4R55A 3CPFA 2YHTA 4M7DB 1M4ZA 1JJ2P 4HT9A 2HDAA 1UGVA 1KQSA 3OS1A 3VS6A 3CCEQ 2MIOA 2LX9A 3ULRB 2BZXA 3GBQA 4OP0A 2NUTA 1RLQC 3CCQQ 2Y4XA 5IHNA 5GAMe 2CP0A 2OAUA 4JS4A 2HEQA 1NPPA 1VQMQ 2LCSA 2W10A 1ZQ1A 2OI3A 4FL6A 1X6GA 1NLOC 3VKIA 1OOTA 1B34B 2JT4A 2VUBA 5IN1A 4XQ3A 2CH4A 2DYBA 3DKMA 5KYXA 3CCJQ 2QEXA 4CRIA 4J7FA 1W2BP 2Z0WA 2YSQA 4C5IA 3OYDA 1K9MC 5KYYB 1W70A 4OB0B 1U06A 4C8QA 1YI2A 1M1GA 1TXQA 1ZSGA 2RB6A 4PJOE 3M57A 2RK2A 2RI5A 3G4ST 2YUPA 4PNOA 1Y96A 3HKSA 3EFOA 5GMKi 3FIFA 1VQNA 3I56Q 3FEOA 1ABQA 3JCMX 3E1SA 4M7AD 1HJDA 3M0UA 1ZBXA 1NJIR 3VJPA 1C0MA 2K6DA 2P0PA 1IXDA 4RTYA 3JSCA 2QTXA 2PVDB 2RM4A 3BFMA 4CC3A 3NTIA 2YUQA 1VA7A 2NWMA 3M0TA 2E70A 3FJ5A 1OV3A 1U3OA 3EGUA 1FX7A 2KQWA 3H9NA 4NS5A 3OB9A 1I07A 1K73U 2P84A 3PE0A 2AIRB 2CP3A 1GXIE 2QASA 3MHXA 2W0ZA 3RMQA 1VQPA 4UC4A 2EVRA 1H3ZA 4M7DG 4N4GA 3CCVT 1B07A 4J9DA 2G6FX 2DILA 1K8AU 1Y57A 3GP8A 5GANg 1VQ9A 2CSQA 4Z88A 1J3TA 2BE7D 3G4SQ 5D6YA 1JXMA 1TUGB 1X27A 1M1FA 1WJQA 3GNFB 2JS2A 3CXCP 2RD1A 2R58A 4M78B 4M75D 6AT1B 1N8RU 2K5FA 2M0OA 4C8QF 4ELZC 4BI3A 1KC8R 3QYHB 1O9SA 5A0GA 1WQWA 1PWTA 4F7UE 2MAMA 4EMHA 3I55A 1WPYA 5CO7A 2D0QB 4A4FA 4F7UB 1YJNA 3JV3A 1RACB 2KE9A 2KRSA 1M30A 1B3QA 2LT4A 4RTWA 8ATCB 1WA7A 3M53A 1Z9ZA 1TTHB 4A54A 1PHTA 7AT1B 4BE2A 2FL7A 2MYSA 2PQWA 2LJ0A 2RNAA 2D9TA 1RI0A 1Q86U 3OYFA 4J9GA 4PJOG 2K3YA 1WHMA 4Z02A 3MEWA 3L1AA 5EG2A 1E6HA 1WIEA 3TQ7P 3X24B 3CBMA 1FMWA 1Z9QA 3S3NA 3U23A 5KYWB 2QEXT 1MV0B 1M1KC 2JJ9A 2EQJA 1QCFA 1JQQA 2L3PA 3I5SA 1Q81R 4X9DA 1CSKA 4HXJA 1YI2T 3VU3C 1AVZC 2AZVA 3LX7A 3F70A 3GF5A 5GAN6 1S72A 2G3RA 3O5ZA 1ZA1B 2V8JA 5CIUA 3EGDB 1GBQA 3M5AA 4LNPA 1BIAA 1VQNT 2V1QA 2PVOB 4JRIA 2EBPA 2L89A 1UJYA 4J7IA 2XDBA 2YDLA 1M2VA 4LXCA 1M90R 1NEBA 2DEUA 3SEMA 3MEAA 4OMOA 3OW2A 1WNLA 2PVGB 1RAEB 2GQIA 2AKLA 3A8OB 2DXBA 1YFNA 5LJ5f 4C5HA 3EH1A 2LCLA 2KT1A 1DJ7B 2LC4A 3OYHA 4C0GA 4PJLA 4AG2C 4C92A 1SHGA 1M2OA 4HVWA 1CKBA 5J26A 2M0YA 3A1PA 4BE1A 1JJ2A 3G7ZA 2XMFA 2CP7A 1VQPT 3SFMA 2MPXC 3C4SA 4C5EA 4JS5A 5GAMj 1IHWA 4N4IA 2AK5A 4OMLA 2DTOA 2ATCB 1YI2Q 3EHRA 1WXUA 2VB6A 4C8QC 2CKKA 1NEGA 2DL8A 3J7AF 5LJ3h 2XDDA 1SHFA 1HYOA 1N6AA 1D3BA 3OYLA 4ESRA 2ZPIB 4IUVA 2EFIA 4WTOB 3BE3A 3NMZC 3JCMh 2HSEB 4F17A 2XU8A 1EIFA 1SPKA 2BUDA 2C06A 2ENMA 4HCBA 2RJFA 3CC7A 3NTHA 2K3XA 4EMKA 1W2BA 2JNGA 1HSQA 1XTDA 4FSXA 3PNWC 4J6WA 4IUQA 2CZ7B 4DA4A 3I55T 2DZ9A 4ZTFA 1TUCA 2KBTA 2H3EB 3JB9J 3QKJA 5DLOA 1NLPC 1RAHB 5GAOp 4C0FA 2V26A 2X4YA 4DBHA 3SWNA 3LYIA 1KQ2A 3I5RA 3CCLT 3M9QA 4RKUE 4V2SA 2P0QA 1R8OB 1AZGB 1YCYA 5GMKe 2EAYA 4NOYA 1JXOA 2H3JA 5CCAA 2JOYA 3CCEA 2EQIA 2EKHA 1VQ9Q 5D6XA 3UATA 2LRQA 4IIMA 5KCOA 1VQ6Q 2X35A 1WGSA 3CCQA 4C92F 4OVAA 3OS5A 4RTUA 3A8HB 4E7LA 3WXMB 3RKXA 1NJIU 2RHYA 1GCQA 2FVUA 1QVGA 1VYVA 3J81E 1UHFA 2FEIA 1VQ8Q 1RL2A 2JS0A 2DVEA 1AOJA 3CCRA 5I2MA 3JB9I 2D6FA 5LJ3d 3HFOA 3I55Q 1S72T 5CK9A 2F69A 1YJNQ 4ORZA 3JCMd 3H8ZA 4LDYA 1KSWA 4M7AA 2EQKA 8AT1B 1QW1A 3RDVA 1Q7YC 2KRNA 1I1JA 1RAFB 3TREA 2D0NA 4AT1B 3JCMV 1K8AR 1AD5A 2LX7A 5GAOn 3CXCA 1YJ9A 2B86A 3I56A 3FB9A 1YITA 2DFUA 2FPEA 4GLMA 4EPCA 3A5ZB 4PFZA 1WFWA 5I2SA 5CAIA 3QDFA 4F14A 5J3BA 3AHUA 1M8MA 2RH2A 2A0FB 1RAIB 2KROA 2NUTB 1N9SA 3MJXA 1KC8U 1VQ5Q 2F1LA 3R6OA 5GAOl 4J8OA 5GJVB 5IXBA 5IHKA 2CSIA 1LCKA 4XU3A 2HCKA 1N5ZA 2ZGWA 1S72Q 1LOJA 2HQXA 2CP6A 2KMTA 3QYGB 2RI3A 3OS0A 1IGQA 2RN8A 2VXEA 3GPLA 5IHIA 2M1HA 5FRMA 1NYGA 2K7AA 1XNIA 4M75A 1M8VA 4RG8A 5FWBA 2QDYB 5KYXB 4C8QE 1IZ6A 4A4GA 4OF1A 3CC7T 1BI2A 2CP2A 2DERA 2GBQA 4CC4B 4OMMA 2E3HA 4C8QB 3UPUA 2DRKA 1U8RA 3M54A 2X4WA 1IREB 2OTJQ 2LMJA 3SHWA 1Y96B 4DEXA 2RQVA 3EFOB 4FIBA 2KY9A 4XTZA 4OB3B 4QT7A 1M3BA 2A36A 2XD0A 1Y71A 3HPWA 4C92C 4HVUA 1UTIA 2GTJA 2CT4A 2O2OA 4RTXA 4HA8A 1Q81U 3VS7A 2MMPA 3QZ9B 4JJCA 4PKCC 2HAXA 4DOWA 2ECZA 1BYMA 1B7TA 5GAN2 2QYZA 1ABOA 2YT6A 3CCET 3PIOA 4K11A 3OYIA 1PRLC 4C92D 2KDSA 4MDXA 3CCQT 3R6NA 2E12A 4X9CA 4JZ4A 1I5LA 4A4HA 2EJFA 2XICA 1UEBA 2M16A 2FHDA 3EG1A 2BE9B 1Q82C 3CC7Q 1AHJB 2B8AA 3TVTA 3LW5E 1KQ1A 3HFNA 3OSSC 3NHNA 3CCRT 3L2ZA 2RHUA 1OU9A 4Z8AA 4EMKC 1M9SA 2HL3A 5IT9E 2VKNA 5GAN5 3ER0A 3OW2P 3CCJT 3PTAA 3OYCA 1FMVA 2JTEA 3L42A 4KH1B 3DLMA 2RHXA 3LGFA 2DJZA 1W1FA 4EIKA 4JRQA 3REAB 1M27C 2CP5A 2DYIA 2DL4A 3SWNC 3MO8A 1AWXA 1YJ9T 3VV0A 2E5KA 3EHQA 5KCHA 5CKFA 1KIKA 1NPRA 2K5LA 3I56T 1EX4A 1YITT 1U1TA 2E10A 2I0NA 1PG5B 4M4ZA 5FROA 2DL7A 2CZ0B 4C8QG 3QG1A 4LUEA 1IGUA 2MWPA 5GAOq 4L5GA 4MZTA 1FYNA 1G8XA 5FU6C 1NYFA 3M4YA 1N27A 2LQWA 1GCQC 1WHKA 2C0IA 2HBPA 5GMKj 5LL6S 4KRTA 2GFUA 2L8DA 1K73C 2JW4A 3CCRQ 1JU5C 4E7SA 1MUZA 4RTZA 2DKGA 4FW1A 3C12A 1XJWB 2QI2A 5LJ5h 3BDLA 2CS7A 3EG3A 1MMAA 3BDUA 4J6XA 2YLCA 3UWNA 2ED1A 4M7AC 1IRXA 5KYUA 3UT1A 2YUOA 4D8KA 2CH4W 3CPWS 2QAZA 2BKDN 1YJ9Q 1G3SA 4DBRA 1U1SA 3V7CA 2XK0A 1YITQ 3CQTA 1OQKA 1W4SA 3GLXA 4E47A 1A0NB 2EGEA 1R0BG 3ZFJA 4KUIA 1E7OA 4TVRA 2FZGB 2QQRA 1N8RC 3QSUA 3JB9F 1T3SA 1M5Q1 1GCPA 2KEAA 1M2VB 2OAWA 2RHZA 2QDLA 3M58A 1R77A 2JMAA 1UB4A 5ECAA 4J9CA 3D7SB 1QVGP 1QVFP 4F04B 2E64A 3NGPA 4DEYA 1SEMA 2K57A 2Y90A 4C92E 1V29B 2VYTA 2E1HA 4FSSA 4FW2A 1TS9A 2E6ZA 2MCNA 4J9BA 4KULA 4C92B 2P0KA 1Q86C 2KT8A 4N4HA 1KHCA 3KXTA 4M75C 2DA9A 4II1A 4M77D 2EJGA 1GRIA 1VQ6A 2F5KA 3VUZA 4VUBA 4M78E 4E7IA 2DZCA 3FDRA 1MNDA 1YN8A 4CI0C 1AWOA 2QK0A 2J6FA 5LJ3e 1SG5A 3EFSA 5LJ5d 1D3BB 3G6EA 1QMCA 1X2QA 1VQ8A 1X43A 3JCMe 2E3IA 3QXEB 1SKUB 2VASA 2V8KA 2A28A 1AT1B 1KQSS 1NE8A 1UE9A 2I2LA 2O01E 1UHCA 1ARKA 2J7IA 4EMKB 1G2BA 1UGPB 3GIBA 2HQEA 2LNHB 2CZ6B 3HRUA 2LNVA 1GL5A 1VUBA 2LQNA 1D0XA 2CZ1B 4DQ2A 3PFSA 3SWNB 2LVMA 1X6OA 4QVDA 5GAMh 1FWZA 1VQ4A 3URGA 1I81A 4BDYA 5GAN4 2GGRA 2V1RA 4RG2A 3TSWA 2SRCA 4HCCA 2CT3A 4OGEA 1UGRB 4OMPA 1VQ5A 3H0IA 3LH5A 2EJ9A 4MZPA 3MCAB 1G3YA 2L5QA 4KBMB 3KBGA 4E7JA 1F1BB 5FU6B 5DLQE 3A8LB 1QVPA 2OTLQ 2YRVA 1TH7A 2GCXA 1ZX6A 3S6WA 4JRKA 2F2VA 2YXYA 3L2WA 3LH0A 4M7AE 2OX7A 1IHVA 2RHIA 4PJOA 1YWPA 1OZ2A 1QLYA 3JB9D 2AT1B 4P5NA 2KK4A 4M7AB 4J83A 2MF2A 3OYMA 2GNCA 2NUPA 1MNEA 1VYUA 2HSPA 3VS3A 4M78G 3EH2A 1OPLA 1BK2A 4A63B 1QP3A 1VQLQ 9ATCB 3WVEB 1D1CA 5FU7C 2OTJA 1LJOA 3LWIA 5GAOr 4HVVA 1ZSZA 4M7DF 2K4YA 1BI3A 2CUDA 3CCUQ 1QQJA 1WXBA 4BE0A 3JCMJ 2DK3A 2F2WA 2KYMA 2CDTA 3EAEA 4F7UG 2RQRA 3CCSQ 3M4GA 2DLPA 1PNJA 1PCXA 5GAMd 4LDVA 1VQ9T 2R5AA 1YNZA 4R0KA 2KXCA 2DTIA 1VQ6T 1Q95G 1ZUUA 3IQLA 3M0PA 1TSFA 2A37A 1M1KU 1C6VX 3VS4A 4XAXB 1W6XA 2JVVA 2KR3A 4M75E 1NJIC 2ZCFB 3G6ET 4XTUA 4MDWA 1SRMA 2KYBA 1VQ8T 3RMSA 1UG1A 5HY6A 4M75B 2RO0A 1VIFA 2E41A 3MEVA 1K9AA 3O8VA 2DD5A 3QIIA 2LCCA 1KD1R 3ZEHA 2FYKA 1UGQB 1YJNT 2QQSA 2ZPHB 2VGMA 2NLUA 2K5IA 1UECA 4XU2A 4X1VA 3UF4A 2DVJA 4XU1A 4AFQC 2ZAEA 4PJOF 2DL5A 2KAFA 2CREA 2LDMA 1JRIA 2LJ1A 2RMOA 1PRMC 1D0ZA 1UJ0A 5AT1B 2P4TA 1KK7A 3ASKA 4JPBW 2D1XA 4C5GA 1S1NA 4Y92A 2YRDA 5LJ5g 2DTHA 1YIJQ 4JLIA 2M51A 1VQ4T 2RPNA 4M7AG 2JTFA 2COYA 5HCKA 2WSCE 2GFAA 3M56A 4BY6C 2WSFE 4JDSA 3UA7A 4ATOA 1H92A 1BBZA 1EFNA 1K1ZA 4KH0B 1PD1A 3OSVA 1VQ5T 1QVFA 4RTTA 3JAME 1KC8C 3G6EQ 1MHNA 1KJWA 1TUDA 4E2FB 4C0DC 2JM9A 1N9RA 5GMKm 3JCMc 2DNUA 4CC7A 4LUDA 2VGNA 1OU8A 3OBYA 4JZ3A 1NG2A 2EKOA 5C0MA 1BB9A 4X34A 3RIRA 5A0LA 5GAMf 3V7SA 1NZ9A 1RABB 5LJ3j 1BI1A 4FT2A 2D8HA 3CBOA 2ZPGB 4GLKA 3EG2A 1KFZA 2F2XA 2X51A 4NL2A 5GANh 2DIQA 3QDRB 2IG0A 1VQ4Q 1K9MR 1JJ2S 3P8BB 4KGXB 2OTJT 4RCBA 3LWHA 3SB2A 4B9WA 4M7DD 3C95A 3OYKA 4M75G 2EWNA 5FW9A 3S3MA 1MGQA 1WZOA 3QHSA 1PD0A 4PJNA 3CMAA 4ZGDB 4O5VA 1YCSB 4IUTA 2KRMA 3KUFA 5D6WA 2A3LA 3RKWA 3VRZA 3MPUB 3OY9A 1Q81C 3RKYA 4LN2A 1R0CB 2GTOA 4JLGA 4Y28E 2EGAA 1WLPB 4OB2B 3JCMb 3E2UA 4M77A 5FU7B 2BIVA 2RJCA 4QQDA 3A8MB 1OX9A 4FU6A 1G5VA 3EGXA 1V1CA 1ZHIA 2M02A 3X20B 1MMDA 2F5TX 1X01A 1XOVA 3CMEA 3GNGA 1SRLA 1MMNA 1W2BS 4FYWB 1M90C 1OPKA 1WJSA 3QWYA 5LJ5e 4HT8A 5KH6A 4PJOC 2DE0X 2QXFA 1TG0A 3HRTA 5C6SA 1YJWQ 1AWJA 1X75C 1YP5A 1Y7XA 4PJMA
chains in the Genus database with same CATH topology
2JXBA 4J9EA 2DRMA 1WX6A 2CUBA 2K79A 3EG3A 3PVQA 1CKAA 2ED1A 3H0HA 1E6HA 1WIEA 2LZ6B 1AWWA 2YUOA 5L23A 4D8KA 2CH4W 2AZSA 1Z9QA 3U23A 5IXFA 5EC7A 2A08A 3CQTA 1MV0B 1QCFA 1JQQA 2L3PA 3I5SA 1A0NB 1X6BA 2EGEA 1CSKA 1E7OA 4HXJA 1WDXA 1MV3A 1T3SA 1AVZC 2AZVA 2L3SA 1GCPA 3VS5A 2RQWA 2BTTA 2KEAA 3O5ZA 1VYTA 2J05A 2K2MA 2FO0A 2OAWA 2QDLA 1GFCA 1GBQA 1GBRA 4LNPA 1JEGA 2JMAA 2P4RA 2V1QA 4OMNA 2C0OA 5ECAA 4J9CA 2EBPA 1UJYA 2YDLA 2EPDA 1NEBA 3SEMA 1PKTA 3NGPA 4DEYA 2AKKA 4AFSC 1SEMA 1K0SA 4OMOA 4FSSA 2GQIA 2MCNA 3A98A 2AKLA 4J9BA 2KT8A 1ZUYA 2KT1A 2DA9A 3UA6A 4IIOA 1GRIA 4AG2C 4HCKA 4OMQA 1SHGA 4HVWA 1CKBA 2J6OA 2EYYA 2M0YA 1YN8A 1T3LA 2DJQA 2XMFA 1AWOA 1E6GA 2EW3A 2J6FA 4J9HA 2AK5A 3EG0A 1U5SA 4OMLA 3PVLA 2L0AA 3EHRA 1X2QA 1WXUA 1X43A 2ROLA 1NEGA 2DL8A 2A28A 1M3CA 1SHFA 2VWFA 2O31A 4ESRA 2NUZA 2RQTA 1UE9A 1Y0MA 3NMZC 1K0XA 3RNJA 4JJBA 1UHCA 2D8JA 1ARKA 2J7IA 4F17A 1G2BA 1X2KA 3QWXX 1SPKA 2ENMA 1WYXA 2ESWA 2K3BA 2SEMA 2KXDA 2LNHB 1QKWA 1GL5A 1T0JA 1HSQA 2J6KA 2FG0A 2LQNA 2ED0A 4AFZC 1TUCA 2KBTA 4LE9A 1UFFA 1NLPC 3H0FA 2GGRA 2V1RA 2YUNA 1QWFA 2MOXA 3TSWA 1BU1A 3I5RA 2SRCA 2JM8A 2CT3A 1AZGB 1K4US 2ABLA 4OMPA 2L3QA 4AFUC 1JXOA 3H0IA 3LH5A 3THKA 2EQIA 2EKHA 3I9QA 3UATA 2ROTA 4IIMA 3RBBB 2BZYA 2FPDA 4GBQA 2OJ2A 1RUWA 1UUEA 4RTUA 3TSZA 1ZX6A 1H8KA 5FWCA 1GCQA 2F2VA 1G83A 1VYVA 1WI7A 5IH2A 1UHFA 2FEIA 1QWEA 1RLPC 3ZL7C 5I11A 1YWPA 2JS0A 1QLYA 5GJWB 1AOJA 2L2PA 1HD3A 2KGTA 2GNCA 1AEYA 1ZLMA 1VYUA 2HSPA 3VS3A 1OPLA 1BK2A 4A63B 4ORZA 2DMOA 1KSWA 4F16A 2FPFA 2IIMA 2H8HA 2O9VA 2KRNA 1I1JA 2D0NA 4HVVA 1WXTA 2CUDA 1NM7A 1WXBA 1YWOA 1AD5A 2LX7A 2PTKA 2F2WA 2KYMA 2CDTA 2B86A 4RUGA 4CC2A 2FRWA 2DL3A 4D8DA 3VS2A 2FPEA 2RQRA 2DLPA 1PNJA 1GFDA 2K9GA 4GLMA 4JJDA 2FRYA 1WFWA 1YNZA 2DBMA 4R0KA 2KXCA 4ZNXA 4F14A 1ZBJA 3IQLA 1ZUUA 1M8MA 3M0PA 4Z89A 2A37A 4J9IA 2JMCA 3VS4A 1W6XA 2KROA 4RTVA 5I22A 2HDAA 2KR3A 1I0CA 3VRYA 1UGVA 1AZEA 3VS6A 2MIOA 3ULRB 2BZXA 3GBQA 1SRMA 2KYBA 1UG1A 1RLQC 5GJVB 5IXBA 5IHNA 5IHKA 2CSIA 1LCKA 1K9AA 2HCKA 1N5ZA 1QKXA 2HEQA 2RN8A 2PZ1A 2LCSA 5IHIA 2W10A 2DM1A 1JO8A 1NYGA 2K7AA 2OI3A 1UECA 5FWBA 1X6GA 4X1VA 1ZUKA 1NLOC 3UF4A 2DVJA 1OOTA 1UDLA 4AFQC 3KFVA 2JT4A 2DL5A 2EYWA 2J06A 2LJ3A 2CREA 2CH4A 2DYBA 2GBQA 2DF6A 4CC4B 2LJ1A 4OMMA 2RMOA 1PRMC 2DRKA 4AG1C 2X3XD 1UJ0A 3VS1A 2YSQA 4JPBW 1X69A 2D1XA 1S1NA 4Y92A 2RF0A 2M51A 1W70A 2LMJA 3SHWA 4DEXA 1U06A 2RQVA 2O9SA 1ZSGA 2EGCA 1H3HA 2LP5A 2BZ8A 4QT7A 1M3BA 2RPNA 2A36A 3H41A 3REBB 5HCKA 2HBWA 2YUPA 4HVUA 1UTIA 2GTJA 2CT4A 2O2OA 2DX1A 4RTXA 3C0CA 3VS7A 4JJCA 3M0RA 3UA7A 3M0SA 1H92A 1ABQA 1BBZA 1EFNA 1K1ZA 2ECZA 1RI9A 4RTTA 1HJDA 3M0UA 1ABOA 2YT6A 1KJWA 2O88A 1TUDA 2K6DA 4RTYA 4K11A 1PRLC 2JM9A 2RQUA 3R6NA 2DNUA 4CC3A 4LUDA 1OEBA 1K76A 4CC7A 4JZ4A 4JZ3A 2YUQA 1NG2A 4E6RA 1VA7A 2NWMA 3M0TA 3FJ5A 1OV3A 1U3OA 3EGUA 1BB9A 2X3WD 3EG1A 1I07A 1M3AA 1SSHA 2KNBB 3PE0A 2DBKA 3TVTA 2D8HA 3I35A 3NPFA 2W0ZA 3NHNA 4J9FA 3EG2A 4Z8AA 1PKSA 2EVRA 2VKNA 1KFZA 1B07A 4J9DA 2G6FX 2EYXA 2EYZA 2JTEA 2F2XA 2DILA 1Y57A 2CSQA 4Z88A 1W1FA 4EIKA 1J3TA 5FW9A 3REAB 1M27C 2DL4A 2VVKA 1JXMA 1X27A 1AWXA 2E5KA 1YCSB 2JS2A 3EHQA 2KRMA 1KIKA 3VRZA 2C0TA 2I0NA 4LN2A 2GTOA 3M0QA 4M4ZA 2EGAA 1WLPB 1PWTA 2DL7A 1V1CA 4LUEA 1XOVA 3JV3A 2KE9A 2KRSA 3VS0A 1FYNA 1M30A 1NYFA 1IO6A 1B3QA 1SRLA 1GCQC 2LQWA 4RTWA 1T0HA 2C0IA 1WA7A 2PNIA 1OPKA 1Z9ZA 4KRTA 1PHTA 3QWYA 2JW4A 1JU5C 2LJ0A 2RNAA 1MUZA 4RTZA 2DE0X 1TG0A 1FMKA 1AWJA 4J9GA 4WCIA 1YP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXB A;  4J9E A;  2DRM A;  1WX6 A;  2CUB A;  2K79 A;  3EG3 A;  3PVQ A;  1CKA A;  2ED1 A;  3H0H A;  1E6H A;  1WIE A;  2LZ6 B;  1AWW A;  2YUO A;  5L23 A;  4D8K A;  2CH4 W;  2AZS A;  1Z9Q A;  3U23 A;  5IXF A;  5EC7 A;  2A08 A;  3CQT A;  1MV0 B;  1QCF A;  1JQQ A;  2L3P A;  3I5S A;  1A0N B;  1X6B A;  2EGE A;  1CSK A;  1E7O A;  4HXJ A;  1WDX A;  1MV3 A;  1T3S A;  1AVZ C;  2AZV A;  2L3S A;  1GCP A;  3VS5 A;  2RQW A;  2BTT A;  2KEA A;  3O5Z A;  1VYT A;  2J05 A;  2K2M A;  2FO0 A;  2OAW A;  2QDL A;  1GFC A;  1GBQ A;  1GBR A;  4LNP A;  1JEG A;  2JMA A;  2P4R A;  2V1Q A;  4OMN A;  2C0O A;  5ECA A;  4J9C A;  2EBP A;  1UJY A;  2YDL A;  2EPD A;  1NEB A;  3SEM A;  1PKT A;  3NGP A;  4DEY A;  2AKK A;  4AFS C;  1SEM A;  1K0S A;  4OMO A;  4FSS A;  2GQI A;  2MCN A;  3A98 A;  2AKL A;  4J9B A;  2KT8 A;  1ZUY A;  2KT1 A;  2DA9 A;  3UA6 A;  4IIO A;  1GRI A;  4AG2 C;  4HCK A;  4OMQ A;  1SHG A;  4HVW A;  1CKB A;  2J6O A;  2EYY A;  2M0Y A;  1YN8 A;  1T3L A;  2DJQ A;  2XMF A;  1AWO A;  1E6G A;  2EW3 A;  2J6F A;  4J9H A;  2AK5 A;  3EG0 A;  1U5S A;  4OML A;  3PVL A;  2L0A A;  3EHR A;  1X2Q A;  1WXU A;  1X43 A;  2ROL A;  1NEG A;  2DL8 A;  2A28 A;  1M3C A;  1SHF A;  2VWF A;  2O31 A;  4ESR A;  2NUZ A;  2RQT A;  1UE9 A;  1Y0M A;  3NMZ C;  1K0X A;  3RNJ A;  4JJB A;  1UHC A;  2D8J A;  1ARK A;  2J7I A;  4F17 A;  1G2B A;  1X2K A;  3QWX X;  1SPK A;  2ENM A;  1WYX A;  2ESW A;  2K3B A;  2SEM A;  2KXD A;  2LNH B;  1QKW A;  1GL5 A;  1T0J A;  1HSQ A;  2J6K A;  2FG0 A;  2LQN A;  2ED0 A;  4AFZ C;  1TUC A;  2KBT A;  4LE9 A;  1UFF A;  1NLP C;  3H0F A;  2GGR A;  2V1R A;  2YUN A;  1QWF A;  2MOX A;  3TSW A;  1BU1 A;  3I5R A;  2SRC A;  2JM8 A;  2CT3 A;  1AZG B;  1K4U S;  2ABL A;  4OMP A;  2L3Q A;  4AFU C;  1JXO A;  3H0I A;  3LH5 A;  3THK A;  2EQI A;  2EKH A;  3I9Q A;  3UAT A;  2ROT A;  4IIM A;  3RBB B;  2BZY A;  2FPD A;  4GBQ A;  2OJ2 A;  1RUW A;  1UUE A;  4RTU A;  3TSZ A;  1ZX6 A;  1H8K A;  5FWC A;  1GCQ A;  2F2V A;  1G83 A;  1VYV A;  1WI7 A;  5IH2 A;  1UHF A;  2FEI A;  1QWE A;  1RLP C;  3ZL7 C;  5I11 A;  1YWP A;  2JS0 A;  1QLY A;  5GJW B;  1AOJ A;  2L2P A;  1HD3 A;  2KGT A;  2GNC A;  1AEY A;  1ZLM A;  1VYU A;  2HSP A;  3VS3 A;  1OPL A;  1BK2 A;  4A63 B;  4ORZ A;  2DMO A;  1KSW A;  4F16 A;  2FPF A;  2IIM A;  2H8H A;  2O9V A;  2KRN A;  1I1J A;  2D0N A;  4HVV A;  1WXT A;  2CUD A;  1NM7 A;  1WXB A;  1YWO A;  1AD5 A;  2LX7 A;  2PTK A;  2F2W A;  2KYM A;  2CDT A;  2B86 A;  4RUG A;  4CC2 A;  2FRW A;  2DL3 A;  4D8D A;  3VS2 A;  2FPE A;  2RQR A;  2DLP A;  1PNJ A;  1GFD A;  2K9G A;  4GLM A;  4JJD A;  2FRY A;  1WFW A;  1YNZ A;  2DBM A;  4R0K A;  2KXC A;  4ZNX A;  4F14 A;  1ZBJ A;  3IQL A;  1ZUU A;  1M8M A;  3M0P A;  4Z89 A;  2A37 A;  4J9I A;  2JMC A;  3VS4 A;  1W6X A;  2KRO A;  4RTV A;  5I22 A;  2HDA A;  2KR3 A;  1I0C A;  3VRY A;  1UGV A;  1AZE A;  3VS6 A;  2MIO A;  3ULR B;  2BZX A;  3GBQ A;  1SRM A;  2KYB A;  1UG1 A;  1RLQ C;  5GJV B;  5IXB A;  5IHN A;  5IHK A;  2CSI A;  1LCK A;  1K9A A;  2HCK A;  1N5Z A;  1QKX A;  2HEQ A;  2RN8 A;  2PZ1 A;  2LCS A;  5IHI A;  2W10 A;  2DM1 A;  1JO8 A;  1NYG A;  2K7A A;  2OI3 A;  1UEC A;  5FWB A;  1X6G A;  4X1V A;  1ZUK A;  1NLO C;  3UF4 A;  2DVJ A;  1OOT A;  1UDL A;  4AFQ C;  3KFV A;  2JT4 A;  2DL5 A;  2EYW A;  2J06 A;  2LJ3 A;  2CRE A;  2CH4 A;  2DYB A;  2GBQ A;  2DF6 A;  4CC4 B;  2LJ1 A;  4OMM A;  2RMO A;  1PRM C;  2DRK A;  4AG1 C;  2X3X D;  1UJ0 A;  3VS1 A;  2YSQ A;  4JPB W;  1X69 A;  2D1X A;  1S1N A;  4Y92 A;  2RF0 A;  2M51 A;  1W70 A;  2LMJ A;  3SHW A;  4DEX A;  1U06 A;  2RQV A;  2O9S A;  1ZSG A;  2EGC A;  1H3H A;  2LP5 A;  2BZ8 A;  4QT7 A;  1M3B A;  2RPN A;  2A36 A;  3H41 A;  3REB B;  5HCK A;  2HBW A;  2YUP A;  4HVU A;  1UTI A;  2GTJ A;  2CT4 A;  2O2O A;  2DX1 A;  4RTX A;  3C0C A;  3VS7 A;  4JJC A;  3M0R A;  3UA7 A;  3M0S A;  1H92 A;  1ABQ A;  1BBZ A;  1EFN A;  1K1Z A;  2ECZ A;  1RI9 A;  4RTT A;  1HJD A;  3M0U A;  1ABO A;  2YT6 A;  1KJW A;  2O88 A;  1TUD A;  2K6D A;  4RTY A;  4K11 A;  1PRL C;  2JM9 A;  2RQU A;  3R6N A;  2DNU A;  4CC3 A;  4LUD A;  1OEB A;  1K76 A;  4CC7 A;  4JZ4 A;  4JZ3 A;  2YUQ A;  1NG2 A;  4E6R A;  1VA7 A;  2NWM A;  3M0T A;  3FJ5 A;  1OV3 A;  1U3O A;  3EGU A;  1BB9 A;  2X3W D;  3EG1 A;  1I07 A;  1M3A A;  1SSH A;  2KNB B;  3PE0 A;  2DBK A;  3TVT A;  2D8H A;  3I35 A;  3NPF A;  2W0Z A;  3NHN A;  4J9F A;  3EG2 A;  4Z8A A;  1PKS A;  2EVR A;  2VKN A;  1KFZ A;  1B07 A;  4J9D A;  2G6F X;  2EYX A;  2EYZ A;  2JTE A;  2F2X A;  2DIL A;  1Y57 A;  2CSQ A;  4Z88 A;  1W1F A;  4EIK A;  1J3T A;  5FW9 A;  3REA B;  1M27 C;  2DL4 A;  2VVK A;  1JXM A;  1X27 A;  1AWX A;  2E5K A;  1YCS B;  2JS2 A;  3EHQ A;  2KRM A;  1KIK A;  3VRZ A;  2C0T A;  2I0N A;  4LN2 A;  2GTO A;  3M0Q A;  4M4Z A;  2EGA A;  1WLP B;  1PWT A;  2DL7 A;  1V1C A;  4LUE A;  1XOV A;  3JV3 A;  2KE9 A;  2KRS A;  3VS0 A;  1FYN A;  1M30 A;  1NYF A;  1IO6 A;  1B3Q A;  1SRL A;  1GCQ C;  2LQW A;  4RTW A;  1T0H A;  2C0I A;  1WA7 A;  2PNI A;  1OPK A;  1Z9Z A;  4KRT A;  1PHT A;  3QWY A;  2JW4 A;  1JU5 C;  2LJ0 A;  2RNA A;  1MUZ A;  4RTZ A;  2DE0 X;  1TG0 A;  1FMK A;  1AWJ A;  4J9G A;  4WCI A;  1YP5 A; 
#chains in the Genus database with same CATH topology
 5KYU B;  2DXT A;  2JXB A;  5A2Q E;  4J9E A;  3JB9 H;  2DRM A;  3CEY A;  1KHI A;  1WX6 A;  2CUB A;  2COW A;  1RAD B;  2LT1 A;  3PVQ A;  1CKA A;  1MMG A;  2ZPE B;  5FLX E;  3BW1 A;  3H0H A;  5D7U A;  1O75 A;  3L2Q A;  4PJO D;  1AWW A;  4ZTJ A;  4AMC A;  5L23 A;  3DLL A;  1ZSZ C;  1I5O B;  4NL3 A;  5EC7 A;  2A08 A;  3LLR A;  3P8D A;  3TU4 K;  5GAN d;  4ELY C;  4RCC A;  1X6B A;  3OYE A;  3E9G A;  2QTV A;  2HQH A;  2FZK B;  1MV3 A;  3RES A;  2L3S A;  2RQW A;  1QVG S;  2BTT A;  2J05 A;  3L2V A;  1I4K 1;  1PSE A;  1JEG A;  4BDZ A;  4FYX B;  3PGG A;  3OYJ A;  2E6N A;  4M77 F;  2HD0 A;  5GAN 8;  1WHJ A;  2AKK A;  2LQK A;  3G71 Q;  5CKB A;  3CC2 A;  1UGS B;  3A98 A;  3E9F A;  2AHJ B;  3MP6 A;  3CCM Q;  1ZUY A;  2DD4 A;  2JUF A;  4BY6 B;  3CXC S;  4OMF B;  4IIO A;  1HXD A;  3C94 A;  4HCK A;  4N0A A;  2OTL A;  4C0D B;  4QVC A;  4LDW A;  1G3W A;  4J9H A;  1VQ7 Q;  4PLI A;  2QGG A;  1M1K R;  1VOM A;  3CC4 Q;  2QGF B;  2ROL A;  1M3C A;  2VWF A;  4B6M A;  5LJ3 g;  1VQO Q;  2RQT A;  3QJ6 A;  2X4X A;  1K0X A;  4DBF A;  3CMA T;  4C0Z A;  3A8G B;  1VQL A;  3JCM g;  1X2K A;  2HKN A;  3PMT A;  1WYX A;  1KD1 U;  2K3B A;  4A53 A;  3CCU A;  3LGL A;  1T0J A;  2J6K A;  3HTR A;  3GOX A;  2FB7 A;  2FG0 A;  2XKO C;  2COZ A;  2O4X A;  4IUR A;  3RER A;  3JRZ A;  4PK4 A;  2EIF A;  3CCS A;  1YHQ Q;  1Q82 U;  5GAN f;  3CME T;  3H0F A;  1TOV A;  1QWF A;  1K8A C;  3PMI A;  2MOX A;  3OYB A;  4E7H A;  2JN0 A;  2JM8 A;  1BCM A;  3AT1 B;  1K4U S;  2ABL A;  2R57 A;  3PIP A;  3FLG A;  4MML A;  3THK A;  2ROT A;  3RBB B;  2BZY A;  1RUW A;  1UUE A;  2HNI A;  2KI7 A;  3HP9 A;  4XTX A;  3T9N A;  4Y91 A;  3CMA Q;  3TSZ A;  3SD4 A;  1QP2 A;  2EYQ A;  4PJO B;  1HK9 A;  5FWC A;  2FZC B;  3HHT B;  2HL5 C;  4LDX A;  3VYG A;  4EDU A;  3HL8 A;  1D1A A;  2NUP B;  1QWE A;  5I11 A;  3X25 B;  3HRS A;  1BCO A;  4M77 C;  2MK5 A;  2QG9 B;  1FXX A;  3MET A;  1HD3 A;  1AEY A;  3OBW A;  3FC3 A;  5HKC A;  1ZSZ B;  2DMO A;  4QVZ A;  3VYH B;  3CME Q;  4FM4 B;  5HK0 A;  1YIJ A;  2FPF A;  1LPL A;  2IIM A;  1YBY A;  2O9V A;  3L2R A;  3DB4 A;  3OYA A;  4FYV B;  2PTK A;  4XU0 A;  1K9M U;  4PFO A;  2Y4Y A;  2DL3 A;  4KUD K;  2PU9 B;  3VS2 A;  3UDC A;  3CC2 T;  5CQX A;  1PM3 A;  4JJD A;  4QQ6 A;  1VQK A;  1VIE A;  4BB7 A;  2DBM A;  2IVW A;  5L8R E;  3MP8 A;  2MI6 A;  3ME9 A;  4J9I A;  2JMC A;  2OTL T;  5LJ5 j;  4RTV A;  5I22 A;  3P8H A;  2DET A;  1RAG B;  3JCM Q;  3V8K A;  1I0C A;  3VRY A;  1AZE A;  1XQH A;  2RA2 A;  2X4J A;  3HSB A;  4M7D A;  2WAC A;  1KG1 A;  1EZZ B;  2VC8 A;  2ZPB B;  4PL6 A;  2M9U A;  1QKX A;  4BI4 A;  2PZ1 A;  4R56 A;  3EG9 B;  2DM1 A;  4E7K A;  1JO8 A;  4D6W A;  1VQL T;  4ZGE B;  1ZUK A;  2XG8 D;  1UDL A;  1JB0 E;  3KFV A;  1Q7Y R;  2QQ9 A;  2EYW A;  3Q1J A;  3CCL A;  2J06 A;  4FCY A;  2LJ3 A;  4BI8 B;  3CCU T;  2DF6 A;  3CCV Q;  3QBY A;  2X3X D;  4AG1 C;  1B34 A;  3CC2 Q;  3VS1 A;  1X69 A;  3L2U A;  2PUO B;  2RF0 A;  2A7Y A;  3CCS T;  1ACM B;  1TWB A;  3CD6 A;  2O9S A;  1ZA2 B;  2EGC A;  1H3H A;  2LP5 A;  2BZ8 A;  2HMA A;  2IPO B;  3H41 A;  4PFP A;  3REB B;  4E7Z A;  5KYY A;  2KSS A;  3SDZ A;  5GAN 7;  2HBW A;  5KE2 A;  2DX1 A;  3C0C A;  4N0A C;  4C92 G;  2XID A;  3M0R A;  1LVK A;  3M0S A;  1IB8 A;  1RI9 A;  2YLB A;  3QO3 A;  4PLL A;  5HK3 A;  3EFR A;  3QPH A;  4MMK A;  3JCM P;  3CBP A;  2KVQ G;  3CPW P;  2O88 A;  3V7R A;  2RQU A;  3DB3 A;  4WF2 A;  2MWO A;  1OEB A;  1K76 A;  1OUL A;  1YJW A;  4ANJ A;  2E4H A;  4E6R A;  5CVI A;  3OYY A;  3NTK A;  2X3W D;  1QCO A;  1M3A A;  3FRN A;  1SSH A;  2KNB B;  2DBK A;  2VV5 A;  3I35 A;  3NPF A;  4KGZ B;  5GAN e;  4J9F A;  4QKU A;  4OGC A;  3TEE A;  2XI9 A;  3H6Z A;  1PKS A;  4DBQ A;  1D09 B;  2EYX A;  2EYZ A;  5KYN A;  4FT4 A;  2K2V A;  3X26 B;  5M9O A;  2NYS A;  1C1A A;  1YIJ T;  2LQ8 A;  4A4E A;  4M77 E;  5FRN A;  2QQB A;  5CQY A;  2VVK A;  1D0Y A;  1SF9 A;  2QEX Q;  4M77 B;  2CGH A;  2GQV A;  2C0T A;  3EGX B;  3M0Q A;  2XHC A;  1VQK T;  4M78 A;  3RUX A;  3G71 A;  4ZN1 A;  2QA4 A;  4KGV B;  1VQN Q;  3OA6 A;  4A4K A;  4IKF A;  1SSF A;  3M59 A;  4QW2 A;  2YRC A;  3VS0 A;  4BUG A;  2LTO A;  3CCM A;  3J80 E;  1IO6 A;  1WJR A;  1T0H A;  3OMG A;  3QJY A;  2PNI A;  4C8Q D;  1KQS P;  4LDU A;  1OI1 A;  3EG9 A;  1Q82 R;  4F7U A;  2DEQ A;  4YTL A;  1FMK A;  3M55 A;  4FYY B;  4KT0 E;  4WCI A;  1JBM A;  1VQ7 A;  2E65 A;  2K79 A;  3NFC A;  4BAC A;  2WSE E;  1Y07 A;  5CR2 A;  2LZ6 B;  3CC4 A;  1RAA B;  4L59 A;  2AZS A;  1OYX A;  5GAO m;  1VQO A;  1VQP Q;  4DOV A;  5IAY A;  4Q5W A;  4ZN3 A;  5IXF A;  2DIG A;  3X28 B;  2DXC A;  4ZGJ B;  4J6Y A;  4XTW A;  1VQK Q;  4O6J A;  5KYW A;  2V8I A;  3CD6 T;  1WDX A;  4HKE A;  5KE3 A;  3OYG A;  3VS5 A;  3MP1 A;  1VYT A;  2K2M A;  2FO0 A;  1VQM A;  4XK8 E;  1GFC A;  1GBR A;  2P4R A;  1YHQ A;  5J39 A;  4OMN A;  2C0O A;  3OW2 S;  5A0D A;  3WVD B;  3PT9 A;  2EPD A;  3EGD A;  1PKT A;  1QCN A;  2YWW A;  4AFS C;  4M78 F;  1K0S A;  3G1J A;  4M7D C;  3V8J A;  1K73 R;  1OX8 A;  3CCJ A;  4M77 G;  5AYF A;  1TU0 B;  1YJW T;  3QUI A;  4J5Y A;  4JRP A;  5CKE A;  2EQM A;  4ME7 A;  3RR6 A;  2PUK B;  2RI2 A;  3UA6 A;  4OMQ A;  4F7U F;  3CCL Q;  5DM7 R;  2RK1 A;  2J6O A;  2EYY A;  1T3L A;  2DJQ A;  1E6G A;  2EW3 A;  2GF7 A;  1PSF A;  1WQ7 A;  3EG0 A;  1U5S A;  4HCZ A;  3PVL A;  2L0A A;  3CD6 Q;  4OB1 B;  3V8L A;  2XDP A;  4BD3 A;  4RMO A;  1N8R R;  2O31 A;  4QQG A;  2DO3 A;  2JTM A;  2NUZ A;  4IUP A;  1Y0M A;  3RNJ A;  4JJB A;  2D8J A;  3OS2 A;  3QWX X;  1H64 1;  1PC0 A;  2ZZD A;  1WHL A;  2ESW A;  2O4X B;  2SEM A;  2KXD A;  1QKW A;  3S3O A;  2RJD A;  4IUU A;  3G71 T;  2ED0 A;  2QA4 T;  3ZBD A;  4AFZ C;  4LE9 A;  4LD6 A;  1Q7Y U;  1UFF A;  1Q86 R;  2DXU A;  5GMK l;  3CCM T;  5GAM g;  2E5Q A;  5DY9 A;  2YUN A;  1OZ3 A;  3OYN A;  4XTY A;  1BU1 A;  3G4S A;  3INZ A;  3N5B B;  1V76 A;  5I21 A;  1P92 A;  3MEU A;  2L3Q A;  4AFU C;  3CPW A;  1VQ7 T;  4M7A F;  2JZ2 A;  3I9Q A;  3TCJ A;  1LNX A;  2FPD A;  5GMK h;  3FJP A;  4GBQ A;  2OJ2 A;  3CC4 T;  5LJ3 f;  4LD9 K;  1QVF S;  2DAQ A;  1VQO T;  3OMC A;  3JB9 G;  2HZY A;  2CYZ B;  1H8K A;  5GAN j;  3JCM W;  1I8F A;  3JCM f;  3OQ5 A;  2EQU A;  1D1B A;  2X9H A;  1G83 A;  2R5M A;  4GY5 A;  1WI7 A;  5IH2 A;  5GAN 3;  1RLP C;  3ZL7 C;  1BKB A;  5GJW B;  2L2P A;  2DPP B;  1KD1 C;  2HKQ B;  4M78 C;  3QZ5 B;  2KGT A;  2QA4 Q;  3CCV A;  1ZLM A;  1G3T A;  4L6V 5;  1VQM T;  2RJE A;  1M90 U;  2QQA A;  1YHQ T;  4F16 A;  2H8H A;  3VUB A;  4XTV A;  1WXT A;  4M78 D;  4EMG A;  1NM7 A;  1YWO A;  2VXF A;  5CKD A;  3BY7 A;  5CKH A;  3E19 A;  4RUG A;  4CC2 A;  2FRW A;  4JUV A;  4D8D A;  4B9X A;  1GFD A;  2K9G A;  4M75 F;  2L3R A;  1BI0 A;  2FRY A;  1WHH A;  4JJN K;  4M7D E;  4ZNX A;  1NBE B;  1ZBJ A;  2ZPF B;  3MKD A;  1WHG A;  4Z89 A;  4PJJ A;  4MZM A;  1BIB A;  4R55 A;  3CPF A;  2YHT A;  4M7D B;  1M4Z A;  1JJ2 P;  4HT9 A;  2HDA A;  1UGV A;  1KQS A;  3OS1 A;  3VS6 A;  3CCE Q;  2MIO A;  2LX9 A;  3ULR B;  2BZX A;  3GBQ A;  4OP0 A;  2NUT A;  1RLQ C;  3CCQ Q;  2Y4X A;  5IHN A;  5GAM e;  2CP0 A;  2OAU A;  4JS4 A;  2HEQ A;  1NPP A;  1VQM Q;  2LCS A;  2W10 A;  1ZQ1 A;  2OI3 A;  4FL6 A;  1X6G A;  1NLO C;  3VKI A;  1OOT A;  1B34 B;  2JT4 A;  2VUB A;  5IN1 A;  4XQ3 A;  2CH4 A;  2DYB A;  3DKM A;  5KYX A;  3CCJ Q;  2QEX A;  4CRI A;  4J7F A;  1W2B P;  2Z0W A;  2YSQ A;  4C5I A;  3OYD A;  1K9M C;  5KYY B;  1W70 A;  4OB0 B;  1U06 A;  4C8Q A;  1YI2 A;  1M1G A;  1TXQ A;  1ZSG A;  2RB6 A;  4PJO E;  3M57 A;  2RK2 A;  2RI5 A;  3G4S T;  2YUP A;  4PNO A;  1Y96 A;  3HKS A;  3EFO A;  5GMK i;  3FIF A;  1VQN A;  3I56 Q;  3FEO A;  1ABQ A;  3JCM X;  3E1S A;  4M7A D;  1HJD A;  3M0U A;  1ZBX A;  1NJI R;  3VJP A;  1C0M A;  2K6D A;  2P0P A;  1IXD A;  4RTY A;  3JSC A;  2QTX A;  2PVD B;  2RM4 A;  3BFM A;  4CC3 A;  3NTI A;  2YUQ A;  1VA7 A;  2NWM A;  3M0T A;  2E70 A;  3FJ5 A;  1OV3 A;  1U3O A;  3EGU A;  1FX7 A;  2KQW A;  3H9N A;  4NS5 A;  3OB9 A;  1I07 A;  1K73 U;  2P84 A;  3PE0 A;  2AIR B;  2CP3 A;  1GXI E;  2QAS A;  3MHX A;  2W0Z A;  3RMQ A;  1VQP A;  4UC4 A;  2EVR A;  1H3Z A;  4M7D G;  4N4G A;  3CCV T;  1B07 A;  4J9D A;  2G6F X;  2DIL A;  1K8A U;  1Y57 A;  3GP8 A;  5GAN g;  1VQ9 A;  2CSQ A;  4Z88 A;  1J3T A;  2BE7 D;  3G4S Q;  5D6Y A;  1JXM A;  1TUG B;  1X27 A;  1M1F A;  1WJQ A;  3GNF B;  2JS2 A;  3CXC P;  2RD1 A;  2R58 A;  4M78 B;  4M75 D;  6AT1 B;  1N8R U;  2K5F A;  2M0O A;  4C8Q F;  4ELZ C;  4BI3 A;  1KC8 R;  3QYH B;  1O9S A;  5A0G A;  1WQW A;  1PWT A;  4F7U E;  2MAM A;  4EMH A;  3I55 A;  1WPY A;  5CO7 A;  2D0Q B;  4A4F A;  4F7U B;  1YJN A;  3JV3 A;  1RAC B;  2KE9 A;  2KRS A;  1M30 A;  1B3Q A;  2LT4 A;  4RTW A;  8ATC B;  1WA7 A;  3M53 A;  1Z9Z A;  1TTH B;  4A54 A;  1PHT A;  7AT1 B;  4BE2 A;  2FL7 A;  2MYS A;  2PQW A;  2LJ0 A;  2RNA A;  2D9T A;  1RI0 A;  1Q86 U;  3OYF A;  4J9G A;  4PJO G;  2K3Y A;  1WHM A;  4Z02 A;  3MEW A;  3L1A A;  5EG2 A;  1E6H A;  1WIE A;  3TQ7 P;  3X24 B;  3CBM A;  1FMW A;  1Z9Q A;  3S3N A;  3U23 A;  5KYW B;  2QEX T;  1MV0 B;  1M1K C;  2JJ9 A;  2EQJ A;  1QCF A;  1JQQ A;  2L3P A;  3I5S A;  1Q81 R;  4X9D A;  1CSK A;  4HXJ A;  1YI2 T;  3VU3 C;  1AVZ C;  2AZV A;  3LX7 A;  3F70 A;  3GF5 A;  5GAN 6;  1S72 A;  2G3R A;  3O5Z A;  1ZA1 B;  2V8J A;  5CIU A;  3EGD B;  1GBQ A;  3M5A A;  4LNP A;  1BIA A;  1VQN T;  2V1Q A;  2PVO B;  4JRI A;  2EBP A;  2L89 A;  1UJY A;  4J7I A;  2XDB A;  2YDL A;  1M2V A;  4LXC A;  1M90 R;  1NEB A;  2DEU A;  3SEM A;  3MEA A;  4OMO A;  3OW2 A;  1WNL A;  2PVG B;  1RAE B;  2GQI A;  2AKL A;  3A8O B;  2DXB A;  1YFN A;  5LJ5 f;  4C5H A;  3EH1 A;  2LCL A;  2KT1 A;  1DJ7 B;  2LC4 A;  3OYH A;  4C0G A;  4PJL A;  4AG2 C;  4C92 A;  1SHG A;  1M2O A;  4HVW A;  1CKB A;  5J26 A;  2M0Y A;  3A1P A;  4BE1 A;  1JJ2 A;  3G7Z A;  2XMF A;  2CP7 A;  1VQP T;  3SFM A;  2MPX C;  3C4S A;  4C5E A;  4JS5 A;  5GAM j;  1IHW A;  4N4I A;  2AK5 A;  4OML A;  2DTO A;  2ATC B;  1YI2 Q;  3EHR A;  1WXU A;  2VB6 A;  4C8Q C;  2CKK A;  1NEG A;  2DL8 A;  3J7A F;  5LJ3 h;  2XDD A;  1SHF A;  1HYO A;  1N6A A;  1D3B A;  3OYL A;  4ESR A;  2ZPI B;  4IUV A;  2EFI A;  4WTO B;  3BE3 A;  3NMZ C;  3JCM h;  2HSE B;  4F17 A;  2XU8 A;  1EIF A;  1SPK A;  2BUD A;  2C06 A;  2ENM A;  4HCB A;  2RJF A;  3CC7 A;  3NTH A;  2K3X A;  4EMK A;  1W2B A;  2JNG A;  1HSQ A;  1XTD A;  4FSX A;  3PNW C;  4J6W A;  4IUQ A;  2CZ7 B;  4DA4 A;  3I55 T;  2DZ9 A;  4ZTF A;  1TUC A;  2KBT A;  2H3E B;  3JB9 J;  3QKJ A;  5DLO A;  1NLP C;  1RAH B;  5GAO p;  4C0F A;  2V26 A;  2X4Y A;  4DBH A;  3SWN A;  3LYI A;  1KQ2 A;  3I5R A;  3CCL T;  3M9Q A;  4RKU E;  4V2S A;  2P0Q A;  1R8O B;  1AZG B;  1YCY A;  5GMK e;  2EAY A;  4NOY A;  1JXO A;  2H3J A;  5CCA A;  2JOY A;  3CCE A;  2EQI A;  2EKH A;  1VQ9 Q;  5D6X A;  3UAT A;  2LRQ A;  4IIM A;  5KCO A;  1VQ6 Q;  2X35 A;  1WGS A;  3CCQ A;  4C92 F;  4OVA A;  3OS5 A;  4RTU A;  3A8H B;  4E7L A;  3WXM B;  3RKX A;  1NJI U;  2RHY A;  1GCQ A;  2FVU A;  1QVG A;  1VYV A;  3J81 E;  1UHF A;  2FEI A;  1VQ8 Q;  1RL2 A;  2JS0 A;  2DVE A;  1AOJ A;  3CCR A;  5I2M A;  3JB9 I;  2D6F A;  5LJ3 d;  3HFO A;  3I55 Q;  1S72 T;  5CK9 A;  2F69 A;  1YJN Q;  4ORZ A;  3JCM d;  3H8Z A;  4LDY A;  1KSW A;  4M7A A;  2EQK A;  8AT1 B;  1QW1 A;  3RDV A;  1Q7Y C;  2KRN A;  1I1J A;  1RAF B;  3TRE A;  2D0N A;  4AT1 B;  3JCM V;  1K8A R;  1AD5 A;  2LX7 A;  5GAO n;  3CXC A;  1YJ9 A;  2B86 A;  3I56 A;  3FB9 A;  1YIT A;  2DFU A;  2FPE A;  4GLM A;  4EPC A;  3A5Z B;  4PFZ A;  1WFW A;  5I2S A;  5CAI A;  3QDF A;  4F14 A;  5J3B A;  3AHU A;  1M8M A;  2RH2 A;  2A0F B;  1RAI B;  2KRO A;  2NUT B;  1N9S A;  3MJX A;  1KC8 U;  1VQ5 Q;  2F1L A;  3R6O A;  5GAO l;  4J8O A;  5GJV B;  5IXB A;  5IHK A;  2CSI A;  1LCK A;  4XU3 A;  2HCK A;  1N5Z A;  2ZGW A;  1S72 Q;  1LOJ A;  2HQX A;  2CP6 A;  2KMT A;  3QYG B;  2RI3 A;  3OS0 A;  1IGQ A;  2RN8 A;  2VXE A;  3GPL A;  5IHI A;  2M1H A;  5FRM A;  1NYG A;  2K7A A;  1XNI A;  4M75 A;  1M8V A;  4RG8 A;  5FWB A;  2QDY B;  5KYX B;  4C8Q E;  1IZ6 A;  4A4G A;  4OF1 A;  3CC7 T;  1BI2 A;  2CP2 A;  2DER A;  2GBQ A;  4CC4 B;  4OMM A;  2E3H A;  4C8Q B;  3UPU A;  2DRK A;  1U8R A;  3M54 A;  2X4W A;  1IRE B;  2OTJ Q;  2LMJ A;  3SHW A;  1Y96 B;  4DEX A;  2RQV A;  3EFO B;  4FIB A;  2KY9 A;  4XTZ A;  4OB3 B;  4QT7 A;  1M3B A;  2A36 A;  2XD0 A;  1Y71 A;  3HPW A;  4C92 C;  4HVU A;  1UTI A;  2GTJ A;  2CT4 A;  2O2O A;  4RTX A;  4HA8 A;  1Q81 U;  3VS7 A;  2MMP A;  3QZ9 B;  4JJC A;  4PKC C;  2HAX A;  4DOW A;  2ECZ A;  1BYM A;  1B7T A;  5GAN 2;  2QYZ A;  1ABO A;  2YT6 A;  3CCE T;  3PIO A;  4K11 A;  3OYI A;  1PRL C;  4C92 D;  2KDS A;  4MDX A;  3CCQ T;  3R6N A;  2E12 A;  4X9C A;  4JZ4 A;  1I5L A;  4A4H A;  2EJF A;  2XIC A;  1UEB A;  2M16 A;  2FHD A;  3EG1 A;  2BE9 B;  1Q82 C;  3CC7 Q;  1AHJ B;  2B8A A;  3TVT A;  3LW5 E;  1KQ1 A;  3HFN A;  3OSS C;  3NHN A;  3CCR T;  3L2Z A;  2RHU A;  1OU9 A;  4Z8A A;  4EMK C;  1M9S A;  2HL3 A;  5IT9 E;  2VKN A;  5GAN 5;  3ER0 A;  3OW2 P;  3CCJ T;  3PTA A;  3OYC A;  1FMV A;  2JTE A;  3L42 A;  4KH1 B;  3DLM A;  2RHX A;  3LGF A;  2DJZ A;  1W1F A;  4EIK A;  4JRQ A;  3REA B;  1M27 C;  2CP5 A;  2DYI A;  2DL4 A;  3SWN C;  3MO8 A;  1AWX A;  1YJ9 T;  3VV0 A;  2E5K A;  3EHQ A;  5KCH A;  5CKF A;  1KIK A;  1NPR A;  2K5L A;  3I56 T;  1EX4 A;  1YIT T;  1U1T A;  2E10 A;  2I0N A;  1PG5 B;  4M4Z A;  5FRO A;  2DL7 A;  2CZ0 B;  4C8Q G;  3QG1 A;  4LUE A;  1IGU A;  2MWP A;  5GAO q;  4L5G A;  4MZT A;  1FYN A;  1G8X A;  5FU6 C;  1NYF A;  3M4Y A;  1N27 A;  2LQW A;  1GCQ C;  1WHK A;  2C0I A;  2HBP A;  5GMK j;  5LL6 S;  4KRT A;  2GFU A;  2L8D A;  1K73 C;  2JW4 A;  3CCR Q;  1JU5 C;  4E7S A;  1MUZ A;  4RTZ A;  2DKG A;  4FW1 A;  3C12 A;  1XJW B;  2QI2 A;  5LJ5 h;  3BDL A;  2CS7 A;  3EG3 A;  1MMA A;  3BDU A;  4J6X A;  2YLC A;  3UWN A;  2ED1 A;  4M7A C;  1IRX A;  5KYU A;  3UT1 A;  2YUO A;  4D8K A;  2CH4 W;  3CPW S;  2QAZ A;  2BKD N;  1YJ9 Q;  1G3S A;  4DBR A;  1U1S A;  3V7C A;  2XK0 A;  1YIT Q;  3CQT A;  1OQK A;  1W4S A;  3GLX A;  4E47 A;  1A0N B;  2EGE A;  1R0B G;  3ZFJ A;  4KUI A;  1E7O A;  4TVR A;  2FZG B;  2QQR A;  1N8R C;  3QSU A;  3JB9 F;  1T3S A;  1M5Q 1;  1GCP A;  2KEA A;  1M2V B;  2OAW A;  2RHZ A;  2QDL A;  3M58 A;  1R77 A;  2JMA A;  1UB4 A;  5ECA A;  4J9C A;  3D7S B;  1QVG P;  1QVF P;  4F04 B;  2E64 A;  3NGP A;  4DEY A;  1SEM A;  2K57 A;  2Y90 A;  4C92 E;  1V29 B;  2VYT A;  2E1H A;  4FSS A;  4FW2 A;  1TS9 A;  2E6Z A;  2MCN A;  4J9B A;  4KUL A;  4C92 B;  2P0K A;  1Q86 C;  2KT8 A;  4N4H A;  1KHC A;  3KXT A;  4M75 C;  2DA9 A;  4II1 A;  4M77 D;  2EJG A;  1GRI A;  1VQ6 A;  2F5K A;  3VUZ A;  4VUB A;  4M78 E;  4E7I A;  2DZC A;  3FDR A;  1MND A;  1YN8 A;  4CI0 C;  1AWO A;  2QK0 A;  2J6F A;  5LJ3 e;  1SG5 A;  3EFS A;  5LJ5 d;  1D3B B;  3G6E A;  1QMC A;  1X2Q A;  1VQ8 A;  1X43 A;  3JCM e;  2E3I A;  3QXE B;  1SKU B;  2VAS A;  2V8K A;  2A28 A;  1AT1 B;  1KQS S;  1NE8 A;  1UE9 A;  2I2L A;  2O01 E;  1UHC A;  1ARK A;  2J7I A;  4EMK B;  1G2B A;  1UGP B;  3GIB A;  2HQE A;  2LNH B;  2CZ6 B;  3HRU A;  2LNV A;  1GL5 A;  1VUB A;  2LQN A;  1D0X A;  2CZ1 B;  4DQ2 A;  3PFS A;  3SWN B;  2LVM A;  1X6O A;  4QVD A;  5GAM h;  1FWZ A;  1VQ4 A;  3URG A;  1I81 A;  4BDY A;  5GAN 4;  2GGR A;  2V1R A;  4RG2 A;  3TSW A;  2SRC A;  4HCC A;  2CT3 A;  4OGE A;  1UGR B;  4OMP A;  1VQ5 A;  3H0I A;  3LH5 A;  2EJ9 A;  4MZP A;  3MCA B;  1G3Y A;  2L5Q A;  4KBM B;  3KBG A;  4E7J A;  1F1B B;  5FU6 B;  5DLQ E;  3A8L B;  1QVP A;  2OTL Q;  2YRV A;  1TH7 A;  2GCX A;  1ZX6 A;  3S6W A;  4JRK A;  2F2V A;  2YXY A;  3L2W A;  3LH0 A;  4M7A E;  2OX7 A;  1IHV A;  2RHI A;  4PJO A;  1YWP A;  1OZ2 A;  1QLY A;  3JB9 D;  2AT1 B;  4P5N A;  2KK4 A;  4M7A B;  4J83 A;  2MF2 A;  3OYM A;  2GNC A;  2NUP A;  1MNE A;  1VYU A;  2HSP A;  3VS3 A;  4M78 G;  3EH2 A;  1OPL A;  1BK2 A;  4A63 B;  1QP3 A;  1VQL Q;  9ATC B;  3WVE B;  1D1C A;  5FU7 C;  2OTJ A;  1LJO A;  3LWI A;  5GAO r;  4HVV A;  1ZSZ A;  4M7D F;  2K4Y A;  1BI3 A;  2CUD A;  3CCU Q;  1QQJ A;  1WXB A;  4BE0 A;  3JCM J;  2DK3 A;  2F2W A;  2KYM A;  2CDT A;  3EAE A;  4F7U G;  2RQR A;  3CCS Q;  3M4G A;  2DLP A;  1PNJ A;  1PCX A;  5GAM d;  4LDV A;  1VQ9 T;  2R5A A;  1YNZ A;  4R0K A;  2KXC A;  2DTI A;  1VQ6 T;  1Q95 G;  1ZUU A;  3IQL A;  3M0P A;  1TSF A;  2A37 A;  1M1K U;  1C6V X;  3VS4 A;  4XAX B;  1W6X A;  2JVV A;  2KR3 A;  4M75 E;  1NJI C;  2ZCF B;  3G6E T;  4XTU A;  4MDW A;  1SRM A;  2KYB A;  1VQ8 T;  3RMS A;  1UG1 A;  5HY6 A;  4M75 B;  2RO0 A;  1VIF A;  2E41 A;  3MEV A;  1K9A A;  3O8V A;  2DD5 A;  3QII A;  2LCC A;  1KD1 R;  3ZEH A;  2FYK A;  1UGQ B;  1YJN T;  2QQS A;  2ZPH B;  2VGM A;  2NLU A;  2K5I A;  1UEC A;  4XU2 A;  4X1V A;  3UF4 A;  2DVJ A;  4XU1 A;  4AFQ C;  2ZAE A;  4PJO F;  2DL5 A;  2KAF A;  2CRE A;  2LDM A;  1JRI A;  2LJ1 A;  2RMO A;  1PRM C;  1D0Z A;  1UJ0 A;  5AT1 B;  2P4T A;  1KK7 A;  3ASK A;  4JPB W;  2D1X A;  4C5G A;  1S1N A;  4Y92 A;  2YRD A;  5LJ5 g;  2DTH A;  1YIJ Q;  4JLI A;  2M51 A;  1VQ4 T;  2RPN A;  4M7A G;  2JTF A;  2COY A;  5HCK A;  2WSC E;  2GFA A;  3M56 A;  4BY6 C;  2WSF E;  4JDS A;  3UA7 A;  4ATO A;  1H92 A;  1BBZ A;  1EFN A;  1K1Z A;  4KH0 B;  1PD1 A;  3OSV A;  1VQ5 T;  1QVF A;  4RTT A;  3JAM E;  1KC8 C;  3G6E Q;  1MHN A;  1KJW A;  1TUD A;  4E2F B;  4C0D C;  2JM9 A;  1N9R A;  5GMK m;  3JCM c;  2DNU A;  4CC7 A;  4LUD A;  2VGN A;  1OU8 A;  3OBY A;  4JZ3 A;  1NG2 A;  2EKO A;  5C0M A;  1BB9 A;  4X34 A;  3RIR A;  5A0L A;  5GAM f;  3V7S A;  1NZ9 A;  1RAB B;  5LJ3 j;  1BI1 A;  4FT2 A;  2D8H A;  3CBO A;  2ZPG B;  4GLK A;  3EG2 A;  1KFZ A;  2F2X A;  2X51 A;  4NL2 A;  5GAN h;  2DIQ A;  3QDR B;  2IG0 A;  1VQ4 Q;  1K9M R;  1JJ2 S;  3P8B B;  4KGX B;  2OTJ T;  4RCB A;  3LWH A;  3SB2 A;  4B9W A;  4M7D D;  3C95 A;  3OYK A;  4M75 G;  2EWN A;  5FW9 A;  3S3M A;  1MGQ A;  1WZO A;  3QHS A;  1PD0 A;  4PJN A;  3CMA A;  4ZGD B;  4O5V A;  1YCS B;  4IUT A;  2KRM A;  3KUF A;  5D6W A;  2A3L A;  3RKW A;  3VRZ A;  3MPU B;  3OY9 A;  1Q81 C;  3RKY A;  4LN2 A;  1R0C B;  2GTO A;  4JLG A;  4Y28 E;  2EGA A;  1WLP B;  4OB2 B;  3JCM b;  3E2U A;  4M77 A;  5FU7 B;  2BIV A;  2RJC A;  4QQD A;  3A8M B;  1OX9 A;  4FU6 A;  1G5V A;  3EGX A;  1V1C A;  1ZHI A;  2M02 A;  3X20 B;  1MMD A;  2F5T X;  1X01 A;  1XOV A;  3CME A;  3GNG A;  1SRL A;  1MMN A;  1W2B S;  4FYW B;  1M90 C;  1OPK A;  1WJS A;  3QWY A;  5LJ5 e;  4HT8 A;  5KH6 A;  4PJO C;  2DE0 X;  2QXF A;  1TG0 A;  3HRT A;  5C6S A;  1YJW Q;  1AWJ A;  1X75 C;  1YP5 A;  1Y7X A;  4PJM A; 
#chains in the Genus database with same CATH homology
 2JXB A;  4J9E A;  2DRM A;  1WX6 A;  2CUB A;  2K79 A;  3EG3 A;  3PVQ A;  1CKA A;  2ED1 A;  3H0H A;  1E6H A;  1WIE A;  2LZ6 B;  1AWW A;  2YUO A;  5L23 A;  4D8K A;  2CH4 W;  2AZS A;  1Z9Q A;  3U23 A;  5IXF A;  5EC7 A;  2A08 A;  3CQT A;  1MV0 B;  1QCF A;  1JQQ A;  2L3P A;  3I5S A;  1A0N B;  1X6B A;  2EGE A;  1CSK A;  1E7O A;  4HXJ A;  1WDX A;  1MV3 A;  1T3S A;  1AVZ C;  2AZV A;  2L3S A;  1GCP A;  3VS5 A;  2RQW A;  2BTT A;  2KEA A;  3O5Z A;  1VYT A;  2J05 A;  2K2M A;  2FO0 A;  2OAW A;  2QDL A;  1GFC A;  1GBQ A;  1GBR A;  4LNP A;  1JEG A;  2JMA A;  2P4R A;  2V1Q A;  4OMN A;  2C0O A;  5ECA A;  4J9C A;  2EBP A;  1UJY A;  2YDL A;  2EPD A;  1NEB A;  3SEM A;  1PKT A;  3NGP A;  4DEY A;  2AKK A;  4AFS C;  1SEM A;  1K0S A;  4OMO A;  4FSS A;  2GQI A;  2MCN A;  3A98 A;  2AKL A;  4J9B A;  2KT8 A;  1ZUY A;  2KT1 A;  2DA9 A;  3UA6 A;  4IIO A;  1GRI A;  4AG2 C;  4HCK A;  4OMQ A;  1SHG A;  4HVW A;  1CKB A;  2J6O A;  2EYY A;  2M0Y A;  1YN8 A;  1T3L A;  2DJQ A;  2XMF A;  1AWO A;  1E6G A;  2EW3 A;  2J6F A;  4J9H A;  2AK5 A;  3EG0 A;  1U5S A;  4OML A;  3PVL A;  2L0A A;  3EHR A;  1X2Q A;  1WXU A;  1X43 A;  2ROL A;  1NEG A;  2DL8 A;  2A28 A;  1M3C A;  1SHF A;  2VWF A;  2O31 A;  4ESR A;  2NUZ A;  2RQT A;  1UE9 A;  1Y0M A;  3NMZ C;  1K0X A;  3RNJ A;  4JJB A;  1UHC A;  2D8J A;  1ARK A;  2J7I A;  4F17 A;  1G2B A;  1X2K A;  3QWX X;  1SPK A;  2ENM A;  1WYX A;  2ESW A;  2K3B A;  2SEM A;  2KXD A;  2LNH B;  1QKW A;  1GL5 A;  1T0J A;  1HSQ A;  2J6K A;  2FG0 A;  2LQN A;  2ED0 A;  4AFZ C;  1TUC A;  2KBT A;  4LE9 A;  1UFF A;  1NLP C;  3H0F A;  2GGR A;  2V1R A;  2YUN A;  1QWF A;  2MOX A;  3TSW A;  1BU1 A;  3I5R A;  2SRC A;  2JM8 A;  2CT3 A;  1AZG B;  1K4U S;  2ABL A;  4OMP A;  2L3Q A;  4AFU C;  1JXO A;  3H0I A;  3LH5 A;  3THK A;  2EQI A;  2EKH A;  3I9Q A;  3UAT A;  2ROT A;  4IIM A;  3RBB B;  2BZY A;  2FPD A;  4GBQ A;  2OJ2 A;  1RUW A;  1UUE A;  4RTU A;  3TSZ A;  1ZX6 A;  1H8K A;  5FWC A;  1GCQ A;  2F2V A;  1G83 A;  1VYV A;  1WI7 A;  5IH2 A;  1UHF A;  2FEI A;  1QWE A;  1RLP C;  3ZL7 C;  5I11 A;  1YWP A;  2JS0 A;  1QLY A;  5GJW B;  1AOJ A;  2L2P A;  1HD3 A;  2KGT A;  2GNC A;  1AEY A;  1ZLM A;  1VYU A;  2HSP A;  3VS3 A;  1OPL A;  1BK2 A;  4A63 B;  4ORZ A;  2DMO A;  1KSW A;  4F16 A;  2FPF A;  2IIM A;  2H8H A;  2O9V A;  2KRN A;  1I1J A;  2D0N A;  4HVV A;  1WXT A;  2CUD A;  1NM7 A;  1WXB A;  1YWO A;  1AD5 A;  2LX7 A;  2PTK A;  2F2W A;  2KYM A;  2CDT A;  2B86 A;  4RUG A;  4CC2 A;  2FRW A;  2DL3 A;  4D8D A;  3VS2 A;  2FPE A;  2RQR A;  2DLP A;  1PNJ A;  1GFD A;  2K9G A;  4GLM A;  4JJD A;  2FRY A;  1WFW A;  1YNZ A;  2DBM A;  4R0K A;  2KXC A;  4ZNX A;  4F14 A;  1ZBJ A;  3IQL A;  1ZUU A;  1M8M A;  3M0P A;  4Z89 A;  2A37 A;  4J9I A;  2JMC A;  3VS4 A;  1W6X A;  2KRO A;  4RTV A;  5I22 A;  2HDA A;  2KR3 A;  1I0C A;  3VRY A;  1UGV A;  1AZE A;  3VS6 A;  2MIO A;  3ULR B;  2BZX A;  3GBQ A;  1SRM A;  2KYB A;  1UG1 A;  1RLQ C;  5GJV B;  5IXB A;  5IHN A;  5IHK A;  2CSI A;  1LCK A;  1K9A A;  2HCK A;  1N5Z A;  1QKX A;  2HEQ A;  2RN8 A;  2PZ1 A;  2LCS A;  5IHI A;  2W10 A;  2DM1 A;  1JO8 A;  1NYG A;  2K7A A;  2OI3 A;  1UEC A;  5FWB A;  1X6G A;  4X1V A;  1ZUK A;  1NLO C;  3UF4 A;  2DVJ A;  1OOT A;  1UDL A;  4AFQ C;  3KFV A;  2JT4 A;  2DL5 A;  2EYW A;  2J06 A;  2LJ3 A;  2CRE A;  2CH4 A;  2DYB A;  2GBQ A;  2DF6 A;  4CC4 B;  2LJ1 A;  4OMM A;  2RMO A;  1PRM C;  2DRK A;  4AG1 C;  2X3X D;  1UJ0 A;  3VS1 A;  2YSQ A;  4JPB W;  1X69 A;  2D1X A;  1S1N A;  4Y92 A;  2RF0 A;  2M51 A;  1W70 A;  2LMJ A;  3SHW A;  4DEX A;  1U06 A;  2RQV A;  2O9S A;  1ZSG A;  2EGC A;  1H3H A;  2LP5 A;  2BZ8 A;  4QT7 A;  1M3B A;  2RPN A;  2A36 A;  3H41 A;  3REB B;  5HCK A;  2HBW A;  2YUP A;  4HVU A;  1UTI A;  2GTJ A;  2CT4 A;  2O2O A;  2DX1 A;  4RTX A;  3C0C A;  3VS7 A;  4JJC A;  3M0R A;  3UA7 A;  3M0S A;  1H92 A;  1ABQ A;  1BBZ A;  1EFN A;  1K1Z A;  2ECZ A;  1RI9 A;  4RTT A;  1HJD A;  3M0U A;  1ABO A;  2YT6 A;  1KJW A;  2O88 A;  1TUD A;  2K6D A;  4RTY A;  4K11 A;  1PRL C;  2JM9 A;  2RQU A;  3R6N A;  2DNU A;  4CC3 A;  4LUD A;  1OEB A;  1K76 A;  4CC7 A;  4JZ4 A;  4JZ3 A;  2YUQ A;  1NG2 A;  4E6R A;  1VA7 A;  2NWM A;  3M0T A;  3FJ5 A;  1OV3 A;  1U3O A;  3EGU A;  1BB9 A;  2X3W D;  3EG1 A;  1I07 A;  1M3A A;  1SSH A;  2KNB B;  3PE0 A;  2DBK A;  3TVT A;  2D8H A;  3I35 A;  3NPF A;  2W0Z A;  3NHN A;  4J9F A;  3EG2 A;  4Z8A A;  1PKS A;  2EVR A;  2VKN A;  1KFZ A;  1B07 A;  4J9D A;  2G6F X;  2EYX A;  2EYZ A;  2JTE A;  2F2X A;  2DIL A;  1Y57 A;  2CSQ A;  4Z88 A;  1W1F A;  4EIK A;  1J3T A;  5FW9 A;  3REA B;  1M27 C;  2DL4 A;  2VVK A;  1JXM A;  1X27 A;  1AWX A;  2E5K A;  1YCS B;  2JS2 A;  3EHQ A;  2KRM A;  1KIK A;  3VRZ A;  2C0T A;  2I0N A;  4LN2 A;  2GTO A;  3M0Q A;  4M4Z A;  2EGA A;  1WLP B;  1PWT A;  2DL7 A;  1V1C A;  4LUE A;  1XOV A;  3JV3 A;  2KE9 A;  2KRS A;  3VS0 A;  1FYN A;  1M30 A;  1NYF A;  1IO6 A;  1B3Q A;  1SRL A;  1GCQ C;  2LQW A;  4RTW A;  1T0H A;  2C0I A;  1WA7 A;  2PNI A;  1OPK A;  1Z9Z A;  4KRT A;  1PHT A;  3QWY A;  2JW4 A;  1JU5 C;  2LJ0 A;  2RNA A;  1MUZ A;  4RTZ A;  2DE0 X;  1TG0 A;  1FMK A;  1AWJ A;  4J9G A;  4WCI A;  1YP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...