4OMLA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128r
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omlA00
1TUDA 2EYXA 1TG0A 1X2KA 1WI7A 2D1XA 1SSHA 2KT1A 1KFZA 3EHRA 2KE9A 3M0UA 1UJ0A 1AWWA 1RLQC 2KR3A 3QWYA 1I1JA 4AFQC 1NYFA 1GRIA 2HDAA 2ROTA 2LJ0A 3NGPA 1M3BA 1VYUA 4RTUA 2C0OA 2PNIA 3I5RA 4WCIA 1HD3A 1FYNA 1VYVA 4DEYA 2ED1A 1WXTA 1E6GA 1OOTA 3CQTA 2DLPA 1WXUA 4OMPA 2EVRA 2JW4A 2EGEA 1AOJA 2RMOA 1UHCA 4FSSA 2O88A 3R6NA 1X43A 4JJDA 1JEGA 1U5SA 2EKHA 4LN2A 2JM8A 2DBMA 2LCSA 2LJ3A 2K6DA 4HVUA 4RTYA 4OMOA 2GTOA 3NHNA 2EYYA 4JZ4A 1N5ZA 2GGRA 4D8KA 3REBB 5IXBA 2JS0A 2YUNA 1PRMC 2DNUA 2EQIA 1SEMA 1YNZA 1HSQA 2CUBA 2DF6A 2KRMA 1PHTA 2X3WD 5EC7A 1B3QA 1AEYA 1GCQA 4F17A 2DJQA 3EG0A 1GFDA 2RF0A 1ZUUA 4J9DA 1YN8A 1AZGB 4K11A 4IIOA 2MIOA 1T3SA 1NG2A 1Z9ZA 1ZBJA 2DL4A 1K1ZA 3PVQA 2H8HA 5IXFA 1AVZC 4HXJA 1A0NB 1ZLMA 2MCNA 1HJDA 2FPDA 4RUGA 2KGTA 2A36A 5FWCA 1WFWA 2KYBA 3FJ5A 2LQNA 1YCSB 2L2PA 2L3QA 1SPKA 1PNJA 3NMZC 2YT6A 1CSKA 1H8KA 1X69A 1X6BA 3LH5A 3M0RA 1BU1A 4LE9A 2ABLA 2YUOA 1NLPC 4HVWA 2YSQA 1UGVA 2L0AA 2IIMA 1QWFA 1PRLC 1ZX6A 2J6FA 2AKLA 1QLYA 1NM7A 2KEAA 4OMNA 4J9HA 1LCKA 2CH4A 2C0TA 2K9GA 1JO8A 2CDTA 1KIKA 2DL7A 4Z88A 1X6GA 2FPFA 2EPDA 2O2OA 2FG0A 1PWTA 1BK2A 1T0JA 4HVVA 2DVJA 1W6XA 3SHWA 4IIMA 3PVLA 1YWPA 5IHKA 1H92A 1KJWA 2F2XA 1FMKA 2EGCA 3RBBB 2D0NA 4AFZC 2OAWA 1SRLA 1GL5A 2J7IA 3A98A 1AD5A 1ZUKA 3H0HA 2F2VA 4Y92A 1GBRA 4HCKA 1CKBA 1B07A 4KRTA 4Z8AA 4LNPA 4F14A 2KRNA 2E5KA 4J9FA 3VS4A 2DILA 2J6OA 4D8DA 2M0YA 4JJCA 5IHNA 1K4US 1V1CA 3C0CA 2RQRA 1ABOA 2FPEA 1UE9A 3RNJA 4GLMA 4CC3A 1E7OA 4CC7A 1X2QA 1K9AA 1UJYA 4J9IA 2SRCA 1AWXA 2KYMA 1NEBA 2CUDA 1UUEA 2RPNA 1X27A 4AG1C 3I5SA 1W1FA 3GBQA 1QCFA 4J9EA 4RTWA 2DMOA 1GCPA 3VS5A 2OI3A 2VVKA 2B86A 2RN8A 1AZEA 2EYZA 1AWOA 2YDLA 2DX1A 1QKWA 1BBZA 2LMJA 2V1QA 1GBQA 3EGUA 2JT4A 2VKNA 2K79A 2KXCA 1WIEA 1RUWA 1QKXA 4J9BA 1M3CA 5L23A 2GQIA 1E6HA 3VS6A 1JXMA 3I9QA 2AK5A 3EG2A 2L3SA 3VS0A 3IQLA 3M0QA 1VYTA 2AZSA 1M3AA 4ESRA 2RNAA 3H0FA 2RQTA 5I22A 1AWJA 1M30A 1NYGA 1G83A 2F2WA 1UHFA 2DE0X 3UA6A 2GNCA 2W0ZA 1MV3A 4RTTA 3QWXX 2X3XD 2A28A 1CKAA 3TSWA 1Z9QA 1TUCA 2J05A 1OEBA 5IH2A 1U3OA 2D8HA 3M0TA 1VA7A 4ORZA 2YUQA 2ECZA 4AFSC 2BZ8A 2DL3A 1OPLA 3EHQA 2C0IA 2O31A 3H0IA 1BB9A 1ZSGA 2XMFA 1WA7A 2PTKA 2JTEA 2GBQA 1XOVA 4RTZA 2FO0A 3VS3A 2AKKA 3VRZA 2JMCA 3KFVA 2LJ1A 3ULRB 2CSIA 2RQUA 1I07A 3TVTA 2NWMA 1JXOA 2BZYA 1UFFA 1EFNA 5HCKA 5I11A 5FWBA 1UECA 1WXBA 2ED0A 3I35A 1RLPC 2CT3A 1ZUYA 1WYXA 4Z89A 1NLOC 1NEGA 2QDLA 2LQWA 3EG3A 4OMMA 2ENMA 4E6RA 2DRKA 1ABQA 4LUDA 4OMLA 2JM9A 4AFUC 2W10A 2I0NA 2ROLA 4J9GA 1T0HA 2KROA 2DM1A 2KXDA 2JMAA 2RQVA 3ZL7C 3THKA 2KRSA 2KT8A 2FEIA 2KBTA 2CH4W 2CT4A 2PZ1A 5FW9A 4DEXA 2EBPA 1IO6A 1JU5C 2ESWA 2LNHB 2BTTA 4RTXA 2O9VA 5GJVB 1PKSA 1MUZA 1G2BA 1QWEA 2D8JA 3VS7A 2HCKA 1MV0B 1SRMA 2K7AA 1M27C 2DL5A 4JJBA 2MOXA 4OMQA 1JQQA 2OJ2A 1J3TA 1RI9A 1U06A 3PE0A 2FRYA 2DBKA 1SHFA 4QT7A 2HBWA 2YUPA 1T3LA 2J6KA 1ARKA 2CREA 5GJWB 1UG1A 4J9CA 3SEMA 2HEQA 2HSPA 1Y0MA 4AG2C 1K0XA 1OV3A 2O9SA 2K3BA 1H3HA 2G6FX 2EGAA 4LUEA 3VS2A 1UDLA 1WDXA 3TSZA 3M0PA 1PKTA 4ZNXA 4RTVA 2EW3A 2JXBA 2SEMA 1YP5A 4CC4B 3UATA 4R0KA 2V1RA 3M0SA 4M4ZA 5ECAA 1WX6A 4EIKA 1WLPB 2A08A 4JPBW 1GCQC 2NUZA 4CC2A 2BZXA 3EG1A 1I0CA 2AZVA 4A63B 3U23A 1KSWA 2LZ6B 3VS1A 3H41A 3UF4A 2FRWA 5IHIA 1M8MA 2CSQA 3REAB 3VRYA 2GTJA 2LP5A 2EYWA 4GBQA 1S1NA 1SHGA 3JV3A 2DA9A 1K76A 3UA7A 1GFCA 2P4RA 2DL8A 1OPKA 2LX7A 2K2MA 3NPFA 1Y57A 1K0SA 3O5ZA 4X1VA 1W70A 2VWFA 2M51A 2J06A 2JS2A 1UTIA 4JZ3A 2DRMA 2DYBA 2L3PA 4F16A 1YWOA 2KNBB 2RQWA 2A37A
chains in the Genus database with same CATH superfamily
3RUXA 1TUDA 5CQYA 3CXCS 2CGHA 1WI7A 3GLXA 5M9OA 4M7AD 4II1A 1SSHA 2YWWA 3G6EQ 2KT1A 3H6ZA 3QIIA 4KUDK 2DEUA 2AIRB 1UJ0A 2E65A 3SWNA 1HK9A 3KBGA 4ZGJB 1I1JA 4BACA 3M4GA 2ROTA 1YJWQ 1LNXA 2C0OA 1VQ4A 3JCMP 3GOXA 2OTJT 1HD3A 1NJIR 1YFNA 2RJFA 1WXTA 3QYGB 1OOTA 3CCEA 1QVFS 3HP9A 4UC4A 2LQKA 2CZ0B 2ZPGB 3SWNC 2EVRA 1Q81R 2RMOA 1UHCA 3OY9A 2NUPA 3OB9A 3R6NA 1JEGA 1AT1B 1VQ6Q 3LX7A 1TXQA 3G71T 1VOMA 1BI3A 1VIFA 1IGUA 2JUFA 2JM8A 1TTHB 4LN2A 3JCMh 1VQOA 2K6DA 4RTYA 4OMOA 4AT1B 1N9RA 3EGXA 3CBPA 4M7AA 1VQ9A 5CVIA 5HK3A 1N5ZA 3REBB 4LDVA 4RCCA 3M59A 4Y28E 3QG1A 3MP1A 4IUUA 1YNZA 1HSQA 2X3WD 3BW1A 1PHTA 1WJRA 4PJOA 3MEAA 4JJNK 3EG0A 3OYCA 1ZUUA 3FB9A 3CC2T 1M1KU 4BDYA 1T3SA 3I55T 2IG0A 3PVQA 2LC4A 3G7ZA 2FZGB 1N6AA 5KYXA 1HJDA 2FPDA 4FU6A 2A36A 2PVOB 1KD1R 1TS9A 1TOVA 3OYYA 3CPWS 4JRQA 4F7UE 1YCSB 1M2OA 4M7DD 2EKOA 4PJOC 1SPKA 2QA4T 3NMZC 1R0BG 4F7UG 1RAFB 1BU1A 2ABLA 4QVCA 4IKFA 2YSQA 1UGVA 3AT1B 2DXTA 2J6FA 3OYFA 3EFRA 1QLYA 4BDZA 2DJZA 4LXCA 2CP6A 2H3JA 1JB0E 2DL7A 1X6GA 1V29B 3EFSA 4ELZC 2FPFA 1Q86C 5HY6A 1WHKA 1VQLT 1ZA1B 1T0JA 1UGSB 3CCLT 3TCJA 1JJ2S 2X51A 3PNWC 2XICA 2RHXA 3PVLA 3RKWA 2QQRA 4O5VA 1VUBA 1VQ5T 5IN1A 1RAAB 3OYEA 2QEXT 2F2XA 3LGLA 1GL5A 2OAWA 4DBFA 3A98A 4E7ZA 4HCKA 1B07A 1M2VB 1WNLA 4PFOA 3JCMg 4XTUA 4JRPA 4Z8AA 3JAME 1WHMA 2ZAEA 2KRNA 2E5KA 4J9FA 3CCSQ 2DILA 5LJ5f 3LWHA 2L3RA 2K4YA 2M0YA 5FU6B 3OYNA 1ACMB 1LJOA 3C0CA 1Q7YC 1S72A 2FPEA 2RI5A 3MEUA 4LD9K 1MHNA 1E7OA 3L2UA 2OTLA 1K9AA 2YRVA 4J9IA 3QPHA 3RIRA 2L5QA 2HKNA 1KG1A 1BIBA 3LH0A 4AG1C 3I5SA 4RTWA 2DMOA 3VS5A 2ZZDA 2B86A 3PIOA 1YHQQ 2LT4A 2DD5A 3RMSA 2CP0A 4FW1A 3OS2A 5GAN5 3VKIA 5D6XA 2JN0A 1BBZA 3OYGA 1WJQA 3EGUA 4N0AA 2JT4A 5HKCA 2K79A 1RUWA 1QKXA 1VQKA 1M3CA 1TSFA 4IUPA 5L23A 1NJIU 4XQ3A 1Y71A 2E3HA 2NLUA 2GQIA 3OMCA 1I8FA 1PCXA 1JXMA 3CC4A 2AK5A 4O6JA 4XTWA 1M1GA 4M7AF 1Q81U 4J5YA 5AYFA 1B7TA 1FMVA 2JZ2A 4KT0E 4JRKA 3D7SB 4A4KA 3CMEQ 1UHFA 4Z02A 2CS7A 4PJLA 3UA6A 2LT1A 3FRNA 1M4ZA 4RTTA 4EPCA 1CKAA 1PSFA 1Y07A 1OEBA 2FB7A 2OX7A 3HPWA 5IH2A 1YJWA 1U3OA 3VJPA 4XAXB 3M0TA 3EG9B 4ORZA 4AFSC 2BZ8A 3CCMT 1VQKT 4DBQA 3EHQA 3H0IA 2K5LA 2RJCA 1C1AA 4F7UB 4FYYB 3F70A 1XOVA 4ZN3A 4RTZA 1KQSS 2FO0A 2L8DA 2JMCA 1HYOA 4OGEA 3KFVA 4OP0A 1VQ6A 4HCCA 2NWMA 2BZYA 3G6ET 5HCKA 3RKXA 4HCBA 4PNOA 5I11A 2HAXA 1EX4A 4J7IA 6AT1B 2KDSA 1K9MU 2E3IA 3M9QA 1YIJQ 4Z89A 1NLOC 2PUOB 1IHVA 5GAOq 1YJWT 4E6RA 4RMOA 1KQ2A 4B9WA 3CC7Q 4ME7A 3FC3A 2R5MA 2ZPEB 2JM9A 4AFUC 3V7CA 1MMDA 3URGA 1FXXA 3J7AF 2ROLA 1D0ZA 2DM1A 2R58A 4LD6A 2RQVA 5FU6C 3ZL7C 2KRSA 2FEIA 4A4FA 3P8BB 1N8RU 5GMKm 2EBPA 4OB1B 3DLLA 5GMKe 4FIBA 2COWA 4M7DF 2BTTA 2O9VA 3PGGA 5GJVB 4FYWB 4J6YA 1Q82U 4CRIA 1MUZA 2RI3A 2D8JA 2JOYA 5KCHA 4OMQA 1JQQA 1BKBA 5A0DA 4C5HA 2DBKA 4AMCA 3WXMB 4QT7A 2HBWA 2RM4A 3ASKA 2YHTA 2CZ1B 3CXCA 5D7UA 5CKDA 2VGNA 1ARKA 2FHDA 1QP2A 1UG1A 2ZGWA 2B8AA 2EJFA 2HSPA 2X35A 1VQ4Q 4OB0B 3EG9A 3LLRA 3CPFA 1M1FA 2RHZA 3OYMA 2P84A 1UDLA 4OB3B 4L6V5 3OYLA 3CCEQ 4C92B 4F7UA 2X4JA 4E7SA 2EW3A 4B6MA 5GANe 3M55A 1QVFA 1QVPA 2DTIA 5IAYA 4C0DB 5CAIA 4A4HA 5ECAA 4J83A 1VQOQ 2RK2A 3PMIA 1D1CA 2RK1A 4ZTFA 3DB3A 4A63B 3OYBA 3GPLA 1KQ1A 3X28B 4N4GA 4A4EA 4E7IA 2FRWA 4BUGA 5IHIA 1UGPB 4MDXA 3QZ9B 3REAB 2LP5A 2EYWA 3EFOA 4GBQA 2YRDA 4KGZB 1GFCA 2HL3A 4BI3A 5LJ5h 2RA2A 2DL8A 3O5ZA 4PKCC 2VWFA 2C06A 2X4XA 2KMTA 4XTVA 4C8QE 2MPXC 2JS2A 2CP3A 4LDXA 4XU3A 2A37A 3OS5A 1MGQA 2LDMA 2EYXA 3EAEA 5GAMe 1TG0A 1XJWB 1X2KA 2D1XA 4C8QG 4Q5WA 4C92D 4OMFB 3CCST 1M90C 1W4SA 3CPWA 4PJJA 1AWWA 1H641 3UPUA 2GFUA 1NYFA 1D1BA 1GRIA 4MMLA 1R0CB 2LJ0A 3NGPA 1M3BA 3N5BB 1VYUA 1BCOA 3OS1A 2I2LA 4FCYA 4WCIA 3PIPA 4WTOB 1FYNA 2RH2A 1VYVA 3CMEA 2ED1A 1E6GA 3JB9F 1YHQT 5LL6S 5GAN6 3GIBA 3FLGA 4OMPA 3P8DA 4M7DG 1AOJA 2O88A 2V8KA 1YBYA 2AHJB 5LJ3j 2EKHA 1JJ2A 2RHUA 3HRTA 4HVUA 2CZ7B 4PLIA 3S3NA 3V7SA 2EYYA 4BE0A 1D3BB 4C92A 3CCJA 2GGRA 4D8KA 1G3YA 2YUNA 1PRMC 2HSEB 1PG5B 3C95A 1B3QA 1Y7XA 1AEYA 1GCQA 3V8LA 4F17A 2DJQA 5GMKl 2P0QA 2WSEE 2MIOA 1S72Q 2DL4A 1K1ZA 4HXJA 1A0NB 4EMKB 1ZLMA 4C92C 1YIJA 4BI8B 1OI1A 2KGTA 3JB9H 5LJ5g 3CC7A 3MCAB 5GMKi 2HQEA 2XG8D 3M5AA 3T9NA 4C0DC 3JCMb 3DB4A 5LJ3e 1PNJA 2Y4YA 2YT6A 1CSKA 1X69A 5KH6A 5KYWA 4LE9A 3MHXA 2RJDA 5GAN2 2PVDB 2K3XA 2L0AA 3GF5A 1M8VA 2AKLA 3BDLA 2QXFA 2KEAA 3X25B 1I5LA 1K8AR 1KIKA 4Z88A 3CC4Q 4ANJA 2O2OA 1Q7YU 3CD6T 2DAQA 3LGFA 3AHUA 1W6XA 1N9SA 1YI2Q 3CC7T 1YWPA 5KYUB 1H92A 2P0PA 2CP2A 1FMKA 3RBBB 2D0NA 4AFZC 2FVUA 3DKMA 3V8KA 2VV5A 3UDCA 4M78E 1W2BP 4M75E 4PJOD 1VQMT 4KRTA 4C8QB 2LQ8A 4M78G 3VS4A 4M75G 4FM4B 2LX9A 1OU8A 4D8DA 4JJCA 5IHNA 2ZPIB 1V1CA 2FYKA 3QZ5B 3CCRT 1K4US 4N4IA 5C6SA 1D3BA 3MEWA 4FL6A 1UJYA 3EGDA 1BYMA 2QTXA 4X9DA 5D6WA 2SRCA 1AWXA 4DBHA 2F1LA 2KYMA 1KQSA 1NEBA 2K57A 1X27A 4QW2A 2BE7D 4E7HA 1W1FA 1QCFA 4PL6A 5GANd 3CXCP 3JB9G 2VVKA 5CK9A 1BIAA 2V1QA 1GBQA 4ELYC 3OSVA 1RI0A 4GLKA 3QO3A 2RD1A 1WHJA 1VQ4T 2O01E 4J9BA 4M77F 1Q95G 3LYIA 1FWZA 4KGXB 3VS6A 5AT1B 3CCET 3BDUA 1QVFP 3GNFB 3CCQA 3VS0A 4HA8A 1V76A 3VUBA 2AZSA 1M3AA 4JUVA 3H0FA 4C5EA 4QVDA 4E7JA 3OW2S 2G3RA 1NYGA 3L2WA 2F2WA 1K73C 1VQOT 1K9MR 1YJNQ 1C6VX 2Y90A 5GAMd 2W0ZA 1QVGA 1MV3A 1VQ9T 4DQ2A 3TSWA 1KC8C 4HKEA 4KBMB 1ZQ1A 5KYUA 1OPLA 1TWBA 2CKKA 3M56A 2C0IA 5GAN8 1PM3A 5GAOn 4BE2A 3OYIA 2PTKA 1ZSZB 1N8RR 3VRZA 2BIVA 2ZPFB 2DETA 1TH7A 4BI4A 4JLIA 2MI6A 5J26A 2CSIA 2RQUA 1Q82R 3TVTA 5D6YA 4DBRA 4F04B 1UFFA 1RAEB 3CPWP 5KE3A 3CBOA 3HRUA 3HHTB 1WXBA 2E41A 1RLPC 2MAMA 1ZUYA 1NEGA 4XU1A 1RAIB 1X6OA 3RMQA 4KULA 5GAN3 2DRKA 3R6OA 4MZTA 2D9TA 4OMLA 3V8JA 4ATOA 2MYSA 4C8QC 3L2ZA 3QHSA 5GAN7 2QG9B 3E2UA 1IZ6A 3E1SA 2JMAA 1K8AU 3S3OA 2HZYA 2KT8A 3UWNA 2CT4A 4Y91A 5FW9A 4QQGA 1IO6A 1JU5C 2ESWA 4M78B 2LNHB 4M75B 3NTIA 1UB4A 1JJ2P 4RTXA 1VQNQ 4E7LA 3TREA 3G4SQ 2HL5C 2DXCA 3PTAA 1G2BA 1QWEA 1XTDA 1UGQB 2HCKA 2F5TX 1VQ8A 1U1TA 1M9SA 3QBYA 5LJ3d 2OJ2A 1J3TA 2V8JA 1RI9A 1U06A 4XTXA 2YUPA 5GAN4 7AT1B 3VYHB 1S72T 4M77E 2KK4A 1BI1A 1O75A 4JS4A 2OTLT 5C0MA 2HEQA 5A0LA 5CKEA 3I56Q 1OV3A 5GAOm 4M77G 2IPOB 5FU7B 1YI2A 2EGAA 2DTOA 2GCXA 2XDPA 1OX8A 4PJOF 3M0PA 1PKTA 4ZNXA 2AT1B 2JXBA 2SEMA 4CC4B 1ZSZA 3UATA 4KGVB 1VQPA 5GANf 5FRNA 2COYA 2VXEA 2WACA 4EIKA 1Y96B 1FMWA 1ZBXA 3CEYA 4VUBA 4CC2A 2BZXA 3EG1A 1I0CA 5LJ5j 3CCJQ 3U23A 1KSWA 1TU0B 3RR6A 3CC4T 3VS1A 3UF4A 2DZCA 1X01A 3JB9I 2DERA 2QQAA 2PUKB 1M2VA 1ZSZC 3VRYA 2GTJA 4XTZA 4EMHA 1M1KC 1SHGA 3JV3A 3QJ6A 4XK8E 1U8RA 1OPKA 2LX7A 3NPFA 1K0SA 4X1VA 2M51A 3J80E 4TVRA 4JZ3A 2D0QB 2QGGA 4KH1B 3PT9A 2L3PA 4F16A 1YWOA 4M78A 4KUIA 3OA6A 1KFZA 1YITA 5GAMf 2PU9B 2PQWA 1RAHB 2KI7A 4MMKA 3QWYA 2PVGB 3M57A 1KQSP 4EMGA 2DXBA 2EFIA 4PJNA 5DM7R 1VQ6T 2KQWA 4M78C 1HXDA 4M75C 1QVGS 3CQTA 1OQKA 1YJNA 2DLPA 2EQMA 3CMAA 1LVKA 3CCUQ 2JW4A 2EGEA 2XKOC 1H3ZA 4C5GA 2DFUA 1X43A 2GQVA 2JJ9A 1U5SA 2EQKA 2HQHA 2DBMA 2GTOA 2K3YA 3CBMA 8AT1B 1RAGB 1D0XA 4QVZA 3JB9J 2JS0A 3A8HB 2DNUA 2EQIA 3S6WA 2Y4XA 5DLQE 3G71Q 2DF6A 2KRMA 5J39A 4M7AE 1GFDA 2E64A 3NTKA 1YN8A 4K11A 5FU7C 1GXIE 1QVGP 1NG2A 2VB6A 1Q7YR 4M7AG 3JCMJ 1WZOA 2XIDA 4M77B 4RUGA 2CP5A 1WPYA 2KYBA 4D6WA 3CC2Q 2D6FA 2L3QA 5GAOp 1H8KA 4X9CA 4C0FA 1X6BA 3M0RA 4ZTJA 1NLPC 1QWFA 1PRLC 1RACB 3L42A 3X24B 1NJIC 1VQNA 4J9HA 1SF9A 4OGCA 3G4SA 1LCKA 3CCVQ 5GAOl 2C0TA 2K9GA 4ZGDB 5DY9A 1Q81C 3CCQQ 3S3MA 1N27A 4HVVA 3H9NA 3FIFA 4IIMA 4B9XA 1KJWA 5GMKh 2MWPA 4RG8A 3MKDA 3OW2A 2A3LA 1PD0A 1YCYA 2F2VA 2LRQA 1GBRA 4A4GA 3I56A 4JS5A 3Q1JA 2QEXQ 3NTHA 3OBYA 1IGQA 1WQWA 2RHYA 4M7DE 2M16A 1BCMA 1ABOA 2JTMA 3RNJA 4CC3A 2YXYA 4CC7A 3EH2A 5I21A 1KD1C 4NL3A 2CUDA 1UUEA 1G3TA 4KH0B 2NUTB 3GBQA 2FZKB 4J9EA 1GCPA 1VIEA 2RHIA 3SDZA 1LOJA 2HKQB 2EYZA 1AWOA 1EZZB 2DX1A 1QKWA 1K73U 2LMJA 1NPPA 3UT1A 3C94A 4PFPA 3M4YA 1WIEA 1KC8U 4ZN1A 3I56T 5GANh 3VU3C 2VXFA 3JSCA 3CMET 1UEBA 2MMPA 3J81E 2EJGA 3SD4A 4R56A 2L3SA 3JCMe 2DYIA 4ESRA 1Q86U 5IT9E 2RQTA 5I22A 3KXTA 4DA4A 1AWJA 1M30A 4JLGA 4L59A 1G83A 4M7AB 2GNCA 3MP6A 3QWXX 2F69A 2X3XD 2E12A 2A28A 3CCJT 1VQ8Q 1Z9QA 2J05A 4F7UF 5KYYB 1MMAA 1VA7A 3META 2YUQA 1C0MA 3BFMA 1PSEA 4JDSA 3HFNA 1ZSGA 2L89A 1OX9A 2EQUA 2XMFA 5GAMh 2O4XB 5KYXB 3CCUA 3E9FA 1YIJT 2LJ1A 2DTHA 2X4YA 2XDDA 2LVMA 2OTJA 2QASA 4RCBA 1JXOA 2DK3A 2BKDN 1IRXA 2HBPA 2XD0A 4A53A 2ED0A 4R55A 4IURA 2CT3A 2DKGA 2P0KA 1WYXA 3EG3A 3QJYA 1VQPQ 3G71A 2RI2A 1XQHA 4J6XA 4J6WA 2NUTA 2M1HA 2VASA 2KXDA 4QQ6A 3HL8A 3THKA 3L1AA 2CH4W 2PZ1A 3C12A 4FT2A 4J8OA 2E6NA 5GANg 3CCUT 4DEXA 4LDYA 1WHHA 3GNGA 1PKSA 3CC2A 3EH1A 2FL7A 1R77A 3MPUB 4OVAA 3I55A 2YLCA 4M7DB 1IHWA 1NE8A 4E2FB 4EMKA 4OF1A 1D1AA 1QCNA 2YLBA 3PE0A 2FRYA 1SHFA 3PFSA 2DPPB 4QKUA 2RO0A 3CCVA 1YITQ 3HKSA 4XTYA 1T3LA 2QA4A 1OZ3A 2CREA 3OMGA 1M90R 1KK7A 4GY5A 1MMNA 5GJWB 4C8QD 4PFZA 2E70A 4J9CA 5LJ3h 4XU0A 5CCAA 4C92F 1U1SA 4AG2C 2DXUA 2O9SA 3MEVA 2K3BA 4EMKC 5KYYA 3PMTA 1H3HA 2OAUA 1QQJA 5GAMg 1YJ9Q 1M5Q1 1WDXA 2CP7A 1I5OB 5KYNA 1G3WA 2H3EB 3CMAQ 3JCMW 1QW1A 2VGMA 4M7AC 2O4XA 1VQLA 3CCLA 3JCMc 4R0KA 2MK5A 3OYHA 3OBWA 2V1RA 3M0SA 1QCOA 3TQ7P 1OYXA 1WX6A 1VQ5A 3JCMQ 1WLPB 2A08A 2QEXA 3ZFJA 2BE9B 3CCVT 1BI0A 2DIGA 3RKYA 2AZVA 5GAOr 2KAFA 4FYXB 3V7RA 1OU9A 3H41A 2MF2A 3CCQT 4BE1A 3QXEB 4C8QA 5L8RE 3MP8A 1S1NA 4NOYA 2DA9A 1K76A 3UA7A 2E5QA 4ZGEB 3OW2P 8ATCB 1Y57A 5J3BA 3OQ5A 2J06A 3RERA 2LNVA 3O8VA 1UTIA 3LWIA 3E19A 2DRMA 3VUZA 3M53A 2RQWA 2K5FA 1B34B 4BY6B 4J7FA 5CQXA 1WQ7A 4IUTA 1OZ2A 3EHRA 2KE9A 3M0UA 3OS0A 1UGRB 1RLQC 2KR3A 4XU2A 4AFQC 1NPRA 4M7DA 2HDAA 1BI2A 4RTUA 3I5RA 2PNIA 5FRMA 2DD4A 2XU8A 5CO7A 4DEYA 3JCMd 3A8LB 2VUBA 1AHJB 5LJ3g 1WXUA 2QI2A 3JCMV 2BUDA 3SB2A 4FSSA 1SKUB 2IVWA 2RJEA 4M7DC 4JJDA 3X26B 4OB2B 4RKUE 2XHCA 2V8IA 2LCSA 1O9SA 2LJ3A 2Z0WA 3NHNA 2DZ9A 2EWNA 4JZ4A 3OYAA 1MNDA 2E1HA 4DOVA 5IXBA 2X9HA 4C5IA 3QUIA 2XI9A 2M9UA 5A2QE 3WVDB 1SEMA 2CUBA 1VQ7Q 5EC7A 3RESA 4E7KA 3CCMA 4C92E 3BE3A 4RG2A 4PLLA 3X20B 2RF0A 2ZPHB 4J9DA 1X75C 1AZGB 2DIQA 1EIFA 4IIOA 1Z9ZA 1OULA 1ZBJA 3L2QA 2H8HA 2QTVA 1AVZC 5IXFA 4C92G 2JTFA 4M78D 4M75D 3HSBA 2MCNA 4LDWA 1VQ8T 2R57A 2VC8A 4N0AC 5FWCA 1MMGA 4X34A 3OYDA 1WFWA 3FJ5A 2ATCB 3G6EA 2LQNA 2L2PA 5CKBA 3A1PA 5CKFA 1M90U 1JBMA 3LH5A 3JB9D 2YUOA 4HVWA 5KE2A 4PK4A 2IIMA 1ZX6A 1B34A 1NM7A 4OMNA 1IXDA 1YI2T 2A0FB 2CH4A 2COZA 2GFAA 2CYZB 2ZPBB 3P8HA 1JO8A 2CDTA 2QYZA 1G5VA 2EPDA 5GMKj 2FG0A 1PWTA 1BK2A 1IB8A 2DVJA 1VQPT 3OSSC 2EQJA 3SHWA 1KD1U 4M75A 2QQBA 5IHKA 2VYTA 2WSFE 4BY6C 4C8QF 2EGCA 1SRLA 2J7IA 1K73R 1AD5A 2EJ9A 1ZUKA 3H0HA 3CD6Q 4Y92A 4E47A 5LJ5e 5FLXE 2DEQA 1CKBA 5A0GA 1KC8R 3VV0A 3M54A 3EFOB 1ZA2B 4LNPA 4F14A 3JRZA 4FYVB 2J6OA 3GP8A 3M58A 1YJ9A 2LCCA 9ATCB 2RQRA 1UE9A 4GLMA 4MZPA 1X2QA 1VQMQ 1W2BA 1Q86R 1I81A 3FDRA 2RPNA 2OTJQ 4HT8A 3DLMA 2OI3A 1RADB 3CCRQ 1SSFA 5GANj 2RN8A 1TUGB 1YITT 1AZEA 2YDLA 2QGFB 3NFCA 2VKNA 2KXCA 4MZMA 4NS5A 3QYHB 2R5AA 1XNIA 3QDRB 2XK0A 1K8AC 3L2RA 1Y96A 1YJ9T 3E9GA 1E6HA 1YJNT 2E6ZA 4FSXA 3I9QA 2YRCA 1G8XA 4EDUA 2FZCB 3CMAT 4N4HA 3HFOA 3EG2A 3ZEHA 3BY7A 3IQLA 4PJOE 2E4HA 1VYTA 3M0QA 4L5GA 2X4WA 1I4K1 2RNAA 1QP3A 2HMAA 2K5IA 3JCMf 1DJ7B 2E10A 4PJOG 3MO8A 4HT9A 2QQSA 1NBEB 4MDWA 3I55Q 1FX7A 2DE0X 2ZCFB 5LJ3f 5GAMj 1TUCA 3A8MB 4FT4A 4IUQA 2D8HA 2P4TA 2ECZA 3CCSA 2DL3A 2LCLA 3SFMA 2CZ6B 2QA4Q 3ME9A 2O31A 3A5ZB 3INZA 4NL2A 4BD3A 1BB9A 3RDVA 1WA7A 3QKJA 1VQ9Q 4A54A 2JTEA 1D0YA 2GBQA 2NYSA 4HCZA 1WJSA 3VS3A 2AKKA 2LTOA 1R8OB 1SG5A 3ULRB 2EIFA 1I07A 2HNIA 2K2VA 5CR2A 2KY9A 4P5NA 1EFNA 1YHQA 5FWBA 1UECA 2DVEA 4M77D 2KVQG 3LW5E 1IREB 5CIUA 5KYWB 1F1BB 1KHCA 3I35A 3HRSA 4C0GA 1VQLQ 3KUFA 4LDUA 3CCLQ 2M02A 2QDLA 2LQWA 4OMMA 2ENMA 1WHGA 1JRIA 1VQ7A 1ABQA 4LUDA 1VQ5Q 3A8GB 1NZ9A 2W10A 5HK0A 1VQNT 1PD1A 3G4ST 2I0NA 2QQ9A 4J9GA 4M78F 1T0HA 2KROA 5I2MA 4M75F 2F5KA 4QQDA 3G1JA 3TEEA 4C0ZA 5KCOA 4BB7A 1WGSA 3L2VA 2KBTA 5I2SA 2JVVA 2JNGA 1WHLA 1G3SA 1M1KR 1D09B 1K9MC 1PC0A 3QDFA 3SWNB 1RL2A 1P92A 3VS7A 1MV0B 1SRMA 2K7AA 1M27C 2DL5A 4JJBA 2MOXA 4YTLA 4M77A 5FROA 3H8ZA 1VQ7T 1ZHIA 2KSSA 5DLOA 3ER0A 2J6KA 2GF7A 2QK0A 2HQXA 4PJMA 1N8RC 4DOWA 2QAZA 2V26A 3EGDB 1QMCA 2QDYB 3TU4K 3SEMA 2NUPB 1Y0MA 1K0XA 2M0OA 1Q82C 2MWOA 2G6FX 4M77C 3C4SA 4IUVA 4LUEA 3OYJA 3VS2A 3EGXB 3MJXA 4JRIA 3ZBDA 3TSZA 2EYQA 4RTVA 3CD6A 1YP5A 2OTLQ 3QSUA 2RB6A 1RABB 3WVEB 3FEOA 4M4ZA 2WSCE 3VYGA 4PJOB 4CI0C 4JPBW 2A7YA 1GCQC 2DO3A 5LJ5d 2NUZA 1W2BS 2HD0A 3OYKA 4V2SA 5EG2A 2LZ6B 1VQMA 3JCMX 4FW2A 1MNEA 2XDBA 1M8MA 2CSQA 5CKHA 3HTRA 3CCMQ 1VQKQ 2P4RA 3CCRA 2K2MA 1W70A 1LPLA 1KHIA 2EAYA 4WF2A 2DYBA 3FJPA 2KNBB 3A8OB
chains in the Genus database with same CATH topology
1TUDA 2EYXA 1TG0A 1X2KA 1WI7A 2D1XA 1SSHA 2KT1A 1KFZA 3EHRA 2KE9A 3M0UA 1UJ0A 1AWWA 1RLQC 2KR3A 3QWYA 1I1JA 4AFQC 1NYFA 1GRIA 2HDAA 2ROTA 2LJ0A 3NGPA 1M3BA 1VYUA 4RTUA 2C0OA 2PNIA 3I5RA 4WCIA 1HD3A 1FYNA 1VYVA 4DEYA 2ED1A 1WXTA 1E6GA 1OOTA 3CQTA 2DLPA 1WXUA 4OMPA 2EVRA 2JW4A 2EGEA 1AOJA 2RMOA 1UHCA 4FSSA 2O88A 3R6NA 1X43A 4JJDA 1JEGA 1U5SA 2EKHA 4LN2A 2JM8A 2DBMA 2LCSA 2LJ3A 2K6DA 4HVUA 4RTYA 4OMOA 2GTOA 3NHNA 2EYYA 4JZ4A 1N5ZA 2GGRA 4D8KA 3REBB 5IXBA 2JS0A 2YUNA 1PRMC 2DNUA 2EQIA 1SEMA 1YNZA 1HSQA 2CUBA 2DF6A 2KRMA 1PHTA 2X3WD 5EC7A 1B3QA 1AEYA 1GCQA 4F17A 2DJQA 3EG0A 1GFDA 2RF0A 1ZUUA 4J9DA 1YN8A 1AZGB 4K11A 4IIOA 2MIOA 1T3SA 1NG2A 1Z9ZA 1ZBJA 2DL4A 1K1ZA 3PVQA 2H8HA 5IXFA 1AVZC 4HXJA 1A0NB 1ZLMA 2MCNA 1HJDA 2FPDA 4RUGA 2KGTA 2A36A 5FWCA 1WFWA 2KYBA 3FJ5A 2LQNA 1YCSB 2L2PA 2L3QA 1SPKA 1PNJA 3NMZC 2YT6A 1CSKA 1H8KA 1X69A 1X6BA 3LH5A 3M0RA 1BU1A 4LE9A 2ABLA 2YUOA 1NLPC 4HVWA 2YSQA 1UGVA 2L0AA 2IIMA 1QWFA 1PRLC 1ZX6A 2J6FA 2AKLA 1QLYA 1NM7A 2KEAA 4OMNA 4J9HA 1LCKA 2CH4A 2C0TA 2K9GA 1JO8A 2CDTA 1KIKA 2DL7A 4Z88A 1X6GA 2FPFA 2EPDA 2O2OA 2FG0A 1PWTA 1BK2A 1T0JA 4HVVA 2DVJA 1W6XA 3SHWA 4IIMA 3PVLA 1YWPA 5IHKA 1H92A 1KJWA 2F2XA 1FMKA 2EGCA 3RBBB 2D0NA 4AFZC 2OAWA 1SRLA 1GL5A 2J7IA 3A98A 1AD5A 1ZUKA 3H0HA 2F2VA 4Y92A 1GBRA 4HCKA 1CKBA 1B07A 4KRTA 4Z8AA 4LNPA 4F14A 2KRNA 2E5KA 4J9FA 3VS4A 2DILA 2J6OA 4D8DA 2M0YA 4JJCA 5IHNA 1K4US 1V1CA 3C0CA 2RQRA 1ABOA 2FPEA 1UE9A 3RNJA 4GLMA 4CC3A 1E7OA 4CC7A 1X2QA 1K9AA 1UJYA 4J9IA 2SRCA 1AWXA 2KYMA 1NEBA 2CUDA 1UUEA 2RPNA 1X27A 4AG1C 3I5SA 1W1FA 3GBQA 1QCFA 4J9EA 4RTWA 2DMOA 1GCPA 3VS5A 2OI3A 2VVKA 2B86A 2RN8A 1AZEA 2EYZA 1AWOA 2YDLA 2DX1A 1QKWA 1BBZA 2LMJA 2V1QA 1GBQA 3EGUA 2JT4A 2VKNA 2K79A 2KXCA 1WIEA 1RUWA 1QKXA 4J9BA 1M3CA 5L23A 2GQIA 1E6HA 3VS6A 1JXMA 3I9QA 2AK5A 3EG2A 2L3SA 3VS0A 3IQLA 3M0QA 1VYTA 2AZSA 1M3AA 4ESRA 2RNAA 3H0FA 2RQTA 5I22A 1AWJA 1M30A 1NYGA 1G83A 2F2WA 1UHFA 2DE0X 3UA6A 2GNCA 2W0ZA 1MV3A 4RTTA 3QWXX 2X3XD 2A28A 1CKAA 3TSWA 1Z9QA 1TUCA 2J05A 1OEBA 5IH2A 1U3OA 2D8HA 3M0TA 1VA7A 4ORZA 2YUQA 2ECZA 4AFSC 2BZ8A 2DL3A 1OPLA 3EHQA 2C0IA 2O31A 3H0IA 1BB9A 1ZSGA 2XMFA 1WA7A 2PTKA 2JTEA 2GBQA 1XOVA 4RTZA 2FO0A 3VS3A 2AKKA 3VRZA 2JMCA 3KFVA 2LJ1A 3ULRB 2CSIA 2RQUA 1I07A 3TVTA 2NWMA 1JXOA 2BZYA 1UFFA 1EFNA 5HCKA 5I11A 5FWBA 1UECA 1WXBA 2ED0A 3I35A 1RLPC 2CT3A 1ZUYA 1WYXA 4Z89A 1NLOC 1NEGA 2QDLA 2LQWA 3EG3A 4OMMA 2ENMA 4E6RA 2DRKA 1ABQA 4LUDA 4OMLA 2JM9A 4AFUC 2W10A 2I0NA 2ROLA 4J9GA 1T0HA 2KROA 2DM1A 2KXDA 2JMAA 2RQVA 3ZL7C 3THKA 2KRSA 2KT8A 2FEIA 2KBTA 2CH4W 2CT4A 2PZ1A 5FW9A 4DEXA 2EBPA 1IO6A 1JU5C 2ESWA 2LNHB 2BTTA 4RTXA 2O9VA 5GJVB 1PKSA 1MUZA 1G2BA 1QWEA 2D8JA 3VS7A 2HCKA 1MV0B 1SRMA 2K7AA 1M27C 2DL5A 4JJBA 2MOXA 4OMQA 1JQQA 2OJ2A 1J3TA 1RI9A 1U06A 3PE0A 2FRYA 2DBKA 1SHFA 4QT7A 2HBWA 2YUPA 1T3LA 2J6KA 1ARKA 2CREA 5GJWB 1UG1A 4J9CA 3SEMA 2HEQA 2HSPA 1Y0MA 4AG2C 1K0XA 1OV3A 2O9SA 2K3BA 1H3HA 2G6FX 2EGAA 4LUEA 3VS2A 1UDLA 1WDXA 3TSZA 3M0PA 1PKTA 4ZNXA 4RTVA 2EW3A 2JXBA 2SEMA 1YP5A 4CC4B 3UATA 4R0KA 2V1RA 3M0SA 4M4ZA 5ECAA 1WX6A 4EIKA 1WLPB 2A08A 4JPBW 1GCQC 2NUZA 4CC2A 2BZXA 3EG1A 1I0CA 2AZVA 4A63B 3U23A 1KSWA 2LZ6B 3VS1A 3H41A 3UF4A 2FRWA 5IHIA 1M8MA 2CSQA 3REAB 3VRYA 2GTJA 2LP5A 2EYWA 4GBQA 1S1NA 1SHGA 3JV3A 2DA9A 1K76A 3UA7A 1GFCA 2P4RA 2DL8A 1OPKA 2LX7A 2K2MA 3NPFA 1Y57A 1K0SA 3O5ZA 4X1VA 1W70A 2VWFA 2M51A 2J06A 2JS2A 1UTIA 4JZ3A 2DRMA 2DYBA 2L3PA 4F16A 1YWOA 2KNBB 2RQWA 2A37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUD A;  2EYX A;  1TG0 A;  1X2K A;  1WI7 A;  2D1X A;  1SSH A;  2KT1 A;  1KFZ A;  3EHR A;  2KE9 A;  3M0U A;  1UJ0 A;  1AWW A;  1RLQ C;  2KR3 A;  3QWY A;  1I1J A;  4AFQ C;  1NYF A;  1GRI A;  2HDA A;  2ROT A;  2LJ0 A;  3NGP A;  1M3B A;  1VYU A;  4RTU A;  2C0O A;  2PNI A;  3I5R A;  4WCI A;  1HD3 A;  1FYN A;  1VYV A;  4DEY A;  2ED1 A;  1WXT A;  1E6G A;  1OOT A;  3CQT A;  2DLP A;  1WXU A;  4OMP A;  2EVR A;  2JW4 A;  2EGE A;  1AOJ A;  2RMO A;  1UHC A;  4FSS A;  2O88 A;  3R6N A;  1X43 A;  4JJD A;  1JEG A;  1U5S A;  2EKH A;  4LN2 A;  2JM8 A;  2DBM A;  2LCS A;  2LJ3 A;  2K6D A;  4HVU A;  4RTY A;  4OMO A;  2GTO A;  3NHN A;  2EYY A;  4JZ4 A;  1N5Z A;  2GGR A;  4D8K A;  3REB B;  5IXB A;  2JS0 A;  2YUN A;  1PRM C;  2DNU A;  2EQI A;  1SEM A;  1YNZ A;  1HSQ A;  2CUB A;  2DF6 A;  2KRM A;  1PHT A;  2X3W D;  5EC7 A;  1B3Q A;  1AEY A;  1GCQ A;  4F17 A;  2DJQ A;  3EG0 A;  1GFD A;  2RF0 A;  1ZUU A;  4J9D A;  1YN8 A;  1AZG B;  4K11 A;  4IIO A;  2MIO A;  1T3S A;  1NG2 A;  1Z9Z A;  1ZBJ A;  2DL4 A;  1K1Z A;  3PVQ A;  2H8H A;  5IXF A;  1AVZ C;  4HXJ A;  1A0N B;  1ZLM A;  2MCN A;  1HJD A;  2FPD A;  4RUG A;  2KGT A;  2A36 A;  5FWC A;  1WFW A;  2KYB A;  3FJ5 A;  2LQN A;  1YCS B;  2L2P A;  2L3Q A;  1SPK A;  1PNJ A;  3NMZ C;  2YT6 A;  1CSK A;  1H8K A;  1X69 A;  1X6B A;  3LH5 A;  3M0R A;  1BU1 A;  4LE9 A;  2ABL A;  2YUO A;  1NLP C;  4HVW A;  2YSQ A;  1UGV A;  2L0A A;  2IIM A;  1QWF A;  1PRL C;  1ZX6 A;  2J6F A;  2AKL A;  1QLY A;  1NM7 A;  2KEA A;  4OMN A;  4J9H A;  1LCK A;  2CH4 A;  2C0T A;  2K9G A;  1JO8 A;  2CDT A;  1KIK A;  2DL7 A;  4Z88 A;  1X6G A;  2FPF A;  2EPD A;  2O2O A;  2FG0 A;  1PWT A;  1BK2 A;  1T0J A;  4HVV A;  2DVJ A;  1W6X A;  3SHW A;  4IIM A;  3PVL A;  1YWP A;  5IHK A;  1H92 A;  1KJW A;  2F2X A;  1FMK A;  2EGC A;  3RBB B;  2D0N A;  4AFZ C;  2OAW A;  1SRL A;  1GL5 A;  2J7I A;  3A98 A;  1AD5 A;  1ZUK A;  3H0H A;  2F2V A;  4Y92 A;  1GBR A;  4HCK A;  1CKB A;  1B07 A;  4KRT A;  4Z8A A;  4LNP A;  4F14 A;  2KRN A;  2E5K A;  4J9F A;  3VS4 A;  2DIL A;  2J6O A;  4D8D A;  2M0Y A;  4JJC A;  5IHN A;  1K4U S;  1V1C A;  3C0C A;  2RQR A;  1ABO A;  2FPE A;  1UE9 A;  3RNJ A;  4GLM A;  4CC3 A;  1E7O A;  4CC7 A;  1X2Q A;  1K9A A;  1UJY A;  4J9I A;  2SRC A;  1AWX A;  2KYM A;  1NEB A;  2CUD A;  1UUE A;  2RPN A;  1X27 A;  4AG1 C;  3I5S A;  1W1F A;  3GBQ A;  1QCF A;  4J9E A;  4RTW A;  2DMO A;  1GCP A;  3VS5 A;  2OI3 A;  2VVK A;  2B86 A;  2RN8 A;  1AZE A;  2EYZ A;  1AWO A;  2YDL A;  2DX1 A;  1QKW A;  1BBZ A;  2LMJ A;  2V1Q A;  1GBQ A;  3EGU A;  2JT4 A;  2VKN A;  2K79 A;  2KXC A;  1WIE A;  1RUW A;  1QKX A;  4J9B A;  1M3C A;  5L23 A;  2GQI A;  1E6H A;  3VS6 A;  1JXM A;  3I9Q A;  2AK5 A;  3EG2 A;  2L3S A;  3VS0 A;  3IQL A;  3M0Q A;  1VYT A;  2AZS A;  1M3A A;  4ESR A;  2RNA A;  3H0F A;  2RQT A;  5I22 A;  1AWJ A;  1M30 A;  1NYG A;  1G83 A;  2F2W A;  1UHF A;  2DE0 X;  3UA6 A;  2GNC A;  2W0Z A;  1MV3 A;  4RTT A;  3QWX X;  2X3X D;  2A28 A;  1CKA A;  3TSW A;  1Z9Q A;  1TUC A;  2J05 A;  1OEB A;  5IH2 A;  1U3O A;  2D8H A;  3M0T A;  1VA7 A;  4ORZ A;  2YUQ A;  2ECZ A;  4AFS C;  2BZ8 A;  2DL3 A;  1OPL A;  3EHQ A;  2C0I A;  2O31 A;  3H0I A;  1BB9 A;  1ZSG A;  2XMF A;  1WA7 A;  2PTK A;  2JTE A;  2GBQ A;  1XOV A;  4RTZ A;  2FO0 A;  3VS3 A;  2AKK A;  3VRZ A;  2JMC A;  3KFV A;  2LJ1 A;  3ULR B;  2CSI A;  2RQU A;  1I07 A;  3TVT A;  2NWM A;  1JXO A;  2BZY A;  1UFF A;  1EFN A;  5HCK A;  5I11 A;  5FWB A;  1UEC A;  1WXB A;  2ED0 A;  3I35 A;  1RLP C;  2CT3 A;  1ZUY A;  1WYX A;  4Z89 A;  1NLO C;  1NEG A;  2QDL A;  2LQW A;  3EG3 A;  4OMM A;  2ENM A;  4E6R A;  2DRK A;  1ABQ A;  4LUD A;  4OML A;  2JM9 A;  4AFU C;  2W10 A;  2I0N A;  2ROL A;  4J9G A;  1T0H A;  2KRO A;  2DM1 A;  2KXD A;  2JMA A;  2RQV A;  3ZL7 C;  3THK A;  2KRS A;  2KT8 A;  2FEI A;  2KBT A;  2CH4 W;  2CT4 A;  2PZ1 A;  5FW9 A;  4DEX A;  2EBP A;  1IO6 A;  1JU5 C;  2ESW A;  2LNH B;  2BTT A;  4RTX A;  2O9V A;  5GJV B;  1PKS A;  1MUZ A;  1G2B A;  1QWE A;  2D8J A;  3VS7 A;  2HCK A;  1MV0 B;  1SRM A;  2K7A A;  1M27 C;  2DL5 A;  4JJB A;  2MOX A;  4OMQ A;  1JQQ A;  2OJ2 A;  1J3T A;  1RI9 A;  1U06 A;  3PE0 A;  2FRY A;  2DBK A;  1SHF A;  4QT7 A;  2HBW A;  2YUP A;  1T3L A;  2J6K A;  1ARK A;  2CRE A;  5GJW B;  1UG1 A;  4J9C A;  3SEM A;  2HEQ A;  2HSP A;  1Y0M A;  4AG2 C;  1K0X A;  1OV3 A;  2O9S A;  2K3B A;  1H3H A;  2G6F X;  2EGA A;  4LUE A;  3VS2 A;  1UDL A;  1WDX A;  3TSZ A;  3M0P A;  1PKT A;  4ZNX A;  4RTV A;  2EW3 A;  2JXB A;  2SEM A;  1YP5 A;  4CC4 B;  3UAT A;  4R0K A;  2V1R A;  3M0S A;  4M4Z A;  5ECA A;  1WX6 A;  4EIK A;  1WLP B;  2A08 A;  4JPB W;  1GCQ C;  2NUZ A;  4CC2 A;  2BZX A;  3EG1 A;  1I0C A;  2AZV A;  4A63 B;  3U23 A;  1KSW A;  2LZ6 B;  3VS1 A;  3H41 A;  3UF4 A;  2FRW A;  5IHI A;  1M8M A;  2CSQ A;  3REA B;  3VRY A;  2GTJ A;  2LP5 A;  2EYW A;  4GBQ A;  1S1N A;  1SHG A;  3JV3 A;  2DA9 A;  1K76 A;  3UA7 A;  1GFC A;  2P4R A;  2DL8 A;  1OPK A;  2LX7 A;  2K2M A;  3NPF A;  1Y57 A;  1K0S A;  3O5Z A;  4X1V A;  1W70 A;  2VWF A;  2M51 A;  2J06 A;  2JS2 A;  1UTI A;  4JZ3 A;  2DRM A;  2DYB A;  2L3P A;  4F16 A;  1YWO A;  2KNB B;  2RQW A;  2A37 A; 
#chains in the Genus database with same CATH topology
 3RUX A;  1TUD A;  5CQY A;  3CXC S;  2CGH A;  1WI7 A;  3GLX A;  5M9O A;  4M7A D;  4II1 A;  1SSH A;  2YWW A;  3G6E Q;  2KT1 A;  3H6Z A;  3QII A;  4KUD K;  2DEU A;  2AIR B;  1UJ0 A;  2E65 A;  3SWN A;  1HK9 A;  3KBG A;  4ZGJ B;  1I1J A;  4BAC A;  3M4G A;  2ROT A;  1YJW Q;  1LNX A;  2C0O A;  1VQ4 A;  3JCM P;  3GOX A;  2OTJ T;  1HD3 A;  1NJI R;  1YFN A;  2RJF A;  1WXT A;  3QYG B;  1OOT A;  3CCE A;  1QVF S;  3HP9 A;  4UC4 A;  2LQK A;  2CZ0 B;  2ZPG B;  3SWN C;  2EVR A;  1Q81 R;  2RMO A;  1UHC A;  3OY9 A;  2NUP A;  3OB9 A;  3R6N A;  1JEG A;  1AT1 B;  1VQ6 Q;  3LX7 A;  1TXQ A;  3G71 T;  1VOM A;  1BI3 A;  1VIF A;  1IGU A;  2JUF A;  2JM8 A;  1TTH B;  4LN2 A;  3JCM h;  1VQO A;  2K6D A;  4RTY A;  4OMO A;  4AT1 B;  1N9R A;  3EGX A;  3CBP A;  4M7A A;  1VQ9 A;  5CVI A;  5HK3 A;  1N5Z A;  3REB B;  4LDV A;  4RCC A;  3M59 A;  4Y28 E;  3QG1 A;  3MP1 A;  4IUU A;  1YNZ A;  1HSQ A;  2X3W D;  3BW1 A;  1PHT A;  1WJR A;  4PJO A;  3MEA A;  4JJN K;  3EG0 A;  3OYC A;  1ZUU A;  3FB9 A;  3CC2 T;  1M1K U;  4BDY A;  1T3S A;  3I55 T;  2IG0 A;  3PVQ A;  2LC4 A;  3G7Z A;  2FZG B;  1N6A A;  5KYX A;  1HJD A;  2FPD A;  4FU6 A;  2A36 A;  2PVO B;  1KD1 R;  1TS9 A;  1TOV A;  3OYY A;  3CPW S;  4JRQ A;  4F7U E;  1YCS B;  1M2O A;  4M7D D;  2EKO A;  4PJO C;  1SPK A;  2QA4 T;  3NMZ C;  1R0B G;  4F7U G;  1RAF B;  1BU1 A;  2ABL A;  4QVC A;  4IKF A;  2YSQ A;  1UGV A;  3AT1 B;  2DXT A;  2J6F A;  3OYF A;  3EFR A;  1QLY A;  4BDZ A;  2DJZ A;  4LXC A;  2CP6 A;  2H3J A;  1JB0 E;  2DL7 A;  1X6G A;  1V29 B;  3EFS A;  4ELZ C;  2FPF A;  1Q86 C;  5HY6 A;  1WHK A;  1VQL T;  1ZA1 B;  1T0J A;  1UGS B;  3CCL T;  3TCJ A;  1JJ2 S;  2X51 A;  3PNW C;  2XIC A;  2RHX A;  3PVL A;  3RKW A;  2QQR A;  4O5V A;  1VUB A;  1VQ5 T;  5IN1 A;  1RAA B;  3OYE A;  2QEX T;  2F2X A;  3LGL A;  1GL5 A;  2OAW A;  4DBF A;  3A98 A;  4E7Z A;  4HCK A;  1B07 A;  1M2V B;  1WNL A;  4PFO A;  3JCM g;  4XTU A;  4JRP A;  4Z8A A;  3JAM E;  1WHM A;  2ZAE A;  2KRN A;  2E5K A;  4J9F A;  3CCS Q;  2DIL A;  5LJ5 f;  3LWH A;  2L3R A;  2K4Y A;  2M0Y A;  5FU6 B;  3OYN A;  1ACM B;  1LJO A;  3C0C A;  1Q7Y C;  1S72 A;  2FPE A;  2RI5 A;  3MEU A;  4LD9 K;  1MHN A;  1E7O A;  3L2U A;  2OTL A;  1K9A A;  2YRV A;  4J9I A;  3QPH A;  3RIR A;  2L5Q A;  2HKN A;  1KG1 A;  1BIB A;  3LH0 A;  4AG1 C;  3I5S A;  4RTW A;  2DMO A;  3VS5 A;  2ZZD A;  2B86 A;  3PIO A;  1YHQ Q;  2LT4 A;  2DD5 A;  3RMS A;  2CP0 A;  4FW1 A;  3OS2 A;  5GAN 5;  3VKI A;  5D6X A;  2JN0 A;  1BBZ A;  3OYG A;  1WJQ A;  3EGU A;  4N0A A;  2JT4 A;  5HKC A;  2K79 A;  1RUW A;  1QKX A;  1VQK A;  1M3C A;  1TSF A;  4IUP A;  5L23 A;  1NJI U;  4XQ3 A;  1Y71 A;  2E3H A;  2NLU A;  2GQI A;  3OMC A;  1I8F A;  1PCX A;  1JXM A;  3CC4 A;  2AK5 A;  4O6J A;  4XTW A;  1M1G A;  4M7A F;  1Q81 U;  4J5Y A;  5AYF A;  1B7T A;  1FMV A;  2JZ2 A;  4KT0 E;  4JRK A;  3D7S B;  4A4K A;  3CME Q;  1UHF A;  4Z02 A;  2CS7 A;  4PJL A;  3UA6 A;  2LT1 A;  3FRN A;  1M4Z A;  4RTT A;  4EPC A;  1CKA A;  1PSF A;  1Y07 A;  1OEB A;  2FB7 A;  2OX7 A;  3HPW A;  5IH2 A;  1YJW A;  1U3O A;  3VJP A;  4XAX B;  3M0T A;  3EG9 B;  4ORZ A;  4AFS C;  2BZ8 A;  3CCM T;  1VQK T;  4DBQ A;  3EHQ A;  3H0I A;  2K5L A;  2RJC A;  1C1A A;  4F7U B;  4FYY B;  3F70 A;  1XOV A;  4ZN3 A;  4RTZ A;  1KQS S;  2FO0 A;  2L8D A;  2JMC A;  1HYO A;  4OGE A;  3KFV A;  4OP0 A;  1VQ6 A;  4HCC A;  2NWM A;  2BZY A;  3G6E T;  5HCK A;  3RKX A;  4HCB A;  4PNO A;  5I11 A;  2HAX A;  1EX4 A;  4J7I A;  6AT1 B;  2KDS A;  1K9M U;  2E3I A;  3M9Q A;  1YIJ Q;  4Z89 A;  1NLO C;  2PUO B;  1IHV A;  5GAO q;  1YJW T;  4E6R A;  4RMO A;  1KQ2 A;  4B9W A;  3CC7 Q;  4ME7 A;  3FC3 A;  2R5M A;  2ZPE B;  2JM9 A;  4AFU C;  3V7C A;  1MMD A;  3URG A;  1FXX A;  3J7A F;  2ROL A;  1D0Z A;  2DM1 A;  2R58 A;  4LD6 A;  2RQV A;  5FU6 C;  3ZL7 C;  2KRS A;  2FEI A;  4A4F A;  3P8B B;  1N8R U;  5GMK m;  2EBP A;  4OB1 B;  3DLL A;  5GMK e;  4FIB A;  2COW A;  4M7D F;  2BTT A;  2O9V A;  3PGG A;  5GJV B;  4FYW B;  4J6Y A;  1Q82 U;  4CRI A;  1MUZ A;  2RI3 A;  2D8J A;  2JOY A;  5KCH A;  4OMQ A;  1JQQ A;  1BKB A;  5A0D A;  4C5H A;  2DBK A;  4AMC A;  3WXM B;  4QT7 A;  2HBW A;  2RM4 A;  3ASK A;  2YHT A;  2CZ1 B;  3CXC A;  5D7U A;  5CKD A;  2VGN A;  1ARK A;  2FHD A;  1QP2 A;  1UG1 A;  2ZGW A;  2B8A A;  2EJF A;  2HSP A;  2X35 A;  1VQ4 Q;  4OB0 B;  3EG9 A;  3LLR A;  3CPF A;  1M1F A;  2RHZ A;  3OYM A;  2P84 A;  1UDL A;  4OB3 B;  4L6V 5;  3OYL A;  3CCE Q;  4C92 B;  4F7U A;  2X4J A;  4E7S A;  2EW3 A;  4B6M A;  5GAN e;  3M55 A;  1QVF A;  1QVP A;  2DTI A;  5IAY A;  4C0D B;  5CAI A;  4A4H A;  5ECA A;  4J83 A;  1VQO Q;  2RK2 A;  3PMI A;  1D1C A;  2RK1 A;  4ZTF A;  3DB3 A;  4A63 B;  3OYB A;  3GPL A;  1KQ1 A;  3X28 B;  4N4G A;  4A4E A;  4E7I A;  2FRW A;  4BUG A;  5IHI A;  1UGP B;  4MDX A;  3QZ9 B;  3REA B;  2LP5 A;  2EYW A;  3EFO A;  4GBQ A;  2YRD A;  4KGZ B;  1GFC A;  2HL3 A;  4BI3 A;  5LJ5 h;  2RA2 A;  2DL8 A;  3O5Z A;  4PKC C;  2VWF A;  2C06 A;  2X4X A;  2KMT A;  4XTV A;  4C8Q E;  2MPX C;  2JS2 A;  2CP3 A;  4LDX A;  4XU3 A;  2A37 A;  3OS5 A;  1MGQ A;  2LDM A;  2EYX A;  3EAE A;  5GAM e;  1TG0 A;  1XJW B;  1X2K A;  2D1X A;  4C8Q G;  4Q5W A;  4C92 D;  4OMF B;  3CCS T;  1M90 C;  1W4S A;  3CPW A;  4PJJ A;  1AWW A;  1H64 1;  3UPU A;  2GFU A;  1NYF A;  1D1B A;  1GRI A;  4MML A;  1R0C B;  2LJ0 A;  3NGP A;  1M3B A;  3N5B B;  1VYU A;  1BCO A;  3OS1 A;  2I2L A;  4FCY A;  4WCI A;  3PIP A;  4WTO B;  1FYN A;  2RH2 A;  1VYV A;  3CME A;  2ED1 A;  1E6G A;  3JB9 F;  1YHQ T;  5LL6 S;  5GAN 6;  3GIB A;  3FLG A;  4OMP A;  3P8D A;  4M7D G;  1AOJ A;  2O88 A;  2V8K A;  1YBY A;  2AHJ B;  5LJ3 j;  2EKH A;  1JJ2 A;  2RHU A;  3HRT A;  4HVU A;  2CZ7 B;  4PLI A;  3S3N A;  3V7S A;  2EYY A;  4BE0 A;  1D3B B;  4C92 A;  3CCJ A;  2GGR A;  4D8K A;  1G3Y A;  2YUN A;  1PRM C;  2HSE B;  1PG5 B;  3C95 A;  1B3Q A;  1Y7X A;  1AEY A;  1GCQ A;  3V8L A;  4F17 A;  2DJQ A;  5GMK l;  2P0Q A;  2WSE E;  2MIO A;  1S72 Q;  2DL4 A;  1K1Z A;  4HXJ A;  1A0N B;  4EMK B;  1ZLM A;  4C92 C;  1YIJ A;  4BI8 B;  1OI1 A;  2KGT A;  3JB9 H;  5LJ5 g;  3CC7 A;  3MCA B;  5GMK i;  2HQE A;  2XG8 D;  3M5A A;  3T9N A;  4C0D C;  3JCM b;  3DB4 A;  5LJ3 e;  1PNJ A;  2Y4Y A;  2YT6 A;  1CSK A;  1X69 A;  5KH6 A;  5KYW A;  4LE9 A;  3MHX A;  2RJD A;  5GAN 2;  2PVD B;  2K3X A;  2L0A A;  3GF5 A;  1M8V A;  2AKL A;  3BDL A;  2QXF A;  2KEA A;  3X25 B;  1I5L A;  1K8A R;  1KIK A;  4Z88 A;  3CC4 Q;  4ANJ A;  2O2O A;  1Q7Y U;  3CD6 T;  2DAQ A;  3LGF A;  3AHU A;  1W6X A;  1N9S A;  1YI2 Q;  3CC7 T;  1YWP A;  5KYU B;  1H92 A;  2P0P A;  2CP2 A;  1FMK A;  3RBB B;  2D0N A;  4AFZ C;  2FVU A;  3DKM A;  3V8K A;  2VV5 A;  3UDC A;  4M78 E;  1W2B P;  4M75 E;  4PJO D;  1VQM T;  4KRT A;  4C8Q B;  2LQ8 A;  4M78 G;  3VS4 A;  4M75 G;  4FM4 B;  2LX9 A;  1OU8 A;  4D8D A;  4JJC A;  5IHN A;  2ZPI B;  1V1C A;  2FYK A;  3QZ5 B;  3CCR T;  1K4U S;  4N4I A;  5C6S A;  1D3B A;  3MEW A;  4FL6 A;  1UJY A;  3EGD A;  1BYM A;  2QTX A;  4X9D A;  5D6W A;  2SRC A;  1AWX A;  4DBH A;  2F1L A;  2KYM A;  1KQS A;  1NEB A;  2K57 A;  1X27 A;  4QW2 A;  2BE7 D;  4E7H A;  1W1F A;  1QCF A;  4PL6 A;  5GAN d;  3CXC P;  3JB9 G;  2VVK A;  5CK9 A;  1BIA A;  2V1Q A;  1GBQ A;  4ELY C;  3OSV A;  1RI0 A;  4GLK A;  3QO3 A;  2RD1 A;  1WHJ A;  1VQ4 T;  2O01 E;  4J9B A;  4M77 F;  1Q95 G;  3LYI A;  1FWZ A;  4KGX B;  3VS6 A;  5AT1 B;  3CCE T;  3BDU A;  1QVF P;  3GNF B;  3CCQ A;  3VS0 A;  4HA8 A;  1V76 A;  3VUB A;  2AZS A;  1M3A A;  4JUV A;  3H0F A;  4C5E A;  4QVD A;  4E7J A;  3OW2 S;  2G3R A;  1NYG A;  3L2W A;  2F2W A;  1K73 C;  1VQO T;  1K9M R;  1YJN Q;  1C6V X;  2Y90 A;  5GAM d;  2W0Z A;  1QVG A;  1MV3 A;  1VQ9 T;  4DQ2 A;  3TSW A;  1KC8 C;  4HKE A;  4KBM B;  1ZQ1 A;  5KYU A;  1OPL A;  1TWB A;  2CKK A;  3M56 A;  2C0I A;  5GAN 8;  1PM3 A;  5GAO n;  4BE2 A;  3OYI A;  2PTK A;  1ZSZ B;  1N8R R;  3VRZ A;  2BIV A;  2ZPF B;  2DET A;  1TH7 A;  4BI4 A;  4JLI A;  2MI6 A;  5J26 A;  2CSI A;  2RQU A;  1Q82 R;  3TVT A;  5D6Y A;  4DBR A;  4F04 B;  1UFF A;  1RAE B;  3CPW P;  5KE3 A;  3CBO A;  3HRU A;  3HHT B;  1WXB A;  2E41 A;  1RLP C;  2MAM A;  1ZUY A;  1NEG A;  4XU1 A;  1RAI B;  1X6O A;  3RMQ A;  4KUL A;  5GAN 3;  2DRK A;  3R6O A;  4MZT A;  2D9T A;  4OML A;  3V8J A;  4ATO A;  2MYS A;  4C8Q C;  3L2Z A;  3QHS A;  5GAN 7;  2QG9 B;  3E2U A;  1IZ6 A;  3E1S A;  2JMA A;  1K8A U;  3S3O A;  2HZY A;  2KT8 A;  3UWN A;  2CT4 A;  4Y91 A;  5FW9 A;  4QQG A;  1IO6 A;  1JU5 C;  2ESW A;  4M78 B;  2LNH B;  4M75 B;  3NTI A;  1UB4 A;  1JJ2 P;  4RTX A;  1VQN Q;  4E7L A;  3TRE A;  3G4S Q;  2HL5 C;  2DXC A;  3PTA A;  1G2B A;  1QWE A;  1XTD A;  1UGQ B;  2HCK A;  2F5T X;  1VQ8 A;  1U1T A;  1M9S A;  3QBY A;  5LJ3 d;  2OJ2 A;  1J3T A;  2V8J A;  1RI9 A;  1U06 A;  4XTX A;  2YUP A;  5GAN 4;  7AT1 B;  3VYH B;  1S72 T;  4M77 E;  2KK4 A;  1BI1 A;  1O75 A;  4JS4 A;  2OTL T;  5C0M A;  2HEQ A;  5A0L A;  5CKE A;  3I56 Q;  1OV3 A;  5GAO m;  4M77 G;  2IPO B;  5FU7 B;  1YI2 A;  2EGA A;  2DTO A;  2GCX A;  2XDP A;  1OX8 A;  4PJO F;  3M0P A;  1PKT A;  4ZNX A;  2AT1 B;  2JXB A;  2SEM A;  4CC4 B;  1ZSZ A;  3UAT A;  4KGV B;  1VQP A;  5GAN f;  5FRN A;  2COY A;  2VXE A;  2WAC A;  4EIK A;  1Y96 B;  1FMW A;  1ZBX A;  3CEY A;  4VUB A;  4CC2 A;  2BZX A;  3EG1 A;  1I0C A;  5LJ5 j;  3CCJ Q;  3U23 A;  1KSW A;  1TU0 B;  3RR6 A;  3CC4 T;  3VS1 A;  3UF4 A;  2DZC A;  1X01 A;  3JB9 I;  2DER A;  2QQA A;  2PUK B;  1M2V A;  1ZSZ C;  3VRY A;  2GTJ A;  4XTZ A;  4EMH A;  1M1K C;  1SHG A;  3JV3 A;  3QJ6 A;  4XK8 E;  1U8R A;  1OPK A;  2LX7 A;  3NPF A;  1K0S A;  4X1V A;  2M51 A;  3J80 E;  4TVR A;  4JZ3 A;  2D0Q B;  2QGG A;  4KH1 B;  3PT9 A;  2L3P A;  4F16 A;  1YWO A;  4M78 A;  4KUI A;  3OA6 A;  1KFZ A;  1YIT A;  5GAM f;  2PU9 B;  2PQW A;  1RAH B;  2KI7 A;  4MMK A;  3QWY A;  2PVG B;  3M57 A;  1KQS P;  4EMG A;  2DXB A;  2EFI A;  4PJN A;  5DM7 R;  1VQ6 T;  2KQW A;  4M78 C;  1HXD A;  4M75 C;  1QVG S;  3CQT A;  1OQK A;  1YJN A;  2DLP A;  2EQM A;  3CMA A;  1LVK A;  3CCU Q;  2JW4 A;  2EGE A;  2XKO C;  1H3Z A;  4C5G A;  2DFU A;  1X43 A;  2GQV A;  2JJ9 A;  1U5S A;  2EQK A;  2HQH A;  2DBM A;  2GTO A;  2K3Y A;  3CBM A;  8AT1 B;  1RAG B;  1D0X A;  4QVZ A;  3JB9 J;  2JS0 A;  3A8H B;  2DNU A;  2EQI A;  3S6W A;  2Y4X A;  5DLQ E;  3G71 Q;  2DF6 A;  2KRM A;  5J39 A;  4M7A E;  1GFD A;  2E64 A;  3NTK A;  1YN8 A;  4K11 A;  5FU7 C;  1GXI E;  1QVG P;  1NG2 A;  2VB6 A;  1Q7Y R;  4M7A G;  3JCM J;  1WZO A;  2XID A;  4M77 B;  4RUG A;  2CP5 A;  1WPY A;  2KYB A;  4D6W A;  3CC2 Q;  2D6F A;  2L3Q A;  5GAO p;  1H8K A;  4X9C A;  4C0F A;  1X6B A;  3M0R A;  4ZTJ A;  1NLP C;  1QWF A;  1PRL C;  1RAC B;  3L42 A;  3X24 B;  1NJI C;  1VQN A;  4J9H A;  1SF9 A;  4OGC A;  3G4S A;  1LCK A;  3CCV Q;  5GAO l;  2C0T A;  2K9G A;  4ZGD B;  5DY9 A;  1Q81 C;  3CCQ Q;  3S3M A;  1N27 A;  4HVV A;  3H9N A;  3FIF A;  4IIM A;  4B9X A;  1KJW A;  5GMK h;  2MWP A;  4RG8 A;  3MKD A;  3OW2 A;  2A3L A;  1PD0 A;  1YCY A;  2F2V A;  2LRQ A;  1GBR A;  4A4G A;  3I56 A;  4JS5 A;  3Q1J A;  2QEX Q;  3NTH A;  3OBY A;  1IGQ A;  1WQW A;  2RHY A;  4M7D E;  2M16 A;  1BCM A;  1ABO A;  2JTM A;  3RNJ A;  4CC3 A;  2YXY A;  4CC7 A;  3EH2 A;  5I21 A;  1KD1 C;  4NL3 A;  2CUD A;  1UUE A;  1G3T A;  4KH0 B;  2NUT B;  3GBQ A;  2FZK B;  4J9E A;  1GCP A;  1VIE A;  2RHI A;  3SDZ A;  1LOJ A;  2HKQ B;  2EYZ A;  1AWO A;  1EZZ B;  2DX1 A;  1QKW A;  1K73 U;  2LMJ A;  1NPP A;  3UT1 A;  3C94 A;  4PFP A;  3M4Y A;  1WIE A;  1KC8 U;  4ZN1 A;  3I56 T;  5GAN h;  3VU3 C;  2VXF A;  3JSC A;  3CME T;  1UEB A;  2MMP A;  3J81 E;  2EJG A;  3SD4 A;  4R56 A;  2L3S A;  3JCM e;  2DYI A;  4ESR A;  1Q86 U;  5IT9 E;  2RQT A;  5I22 A;  3KXT A;  4DA4 A;  1AWJ A;  1M30 A;  4JLG A;  4L59 A;  1G83 A;  4M7A B;  2GNC A;  3MP6 A;  3QWX X;  2F69 A;  2X3X D;  2E12 A;  2A28 A;  3CCJ T;  1VQ8 Q;  1Z9Q A;  2J05 A;  4F7U F;  5KYY B;  1MMA A;  1VA7 A;  3MET A;  2YUQ A;  1C0M A;  3BFM A;  1PSE A;  4JDS A;  3HFN A;  1ZSG A;  2L89 A;  1OX9 A;  2EQU A;  2XMF A;  5GAM h;  2O4X B;  5KYX B;  3CCU A;  3E9F A;  1YIJ T;  2LJ1 A;  2DTH A;  2X4Y A;  2XDD A;  2LVM A;  2OTJ A;  2QAS A;  4RCB A;  1JXO A;  2DK3 A;  2BKD N;  1IRX A;  2HBP A;  2XD0 A;  4A53 A;  2ED0 A;  4R55 A;  4IUR A;  2CT3 A;  2DKG A;  2P0K A;  1WYX A;  3EG3 A;  3QJY A;  1VQP Q;  3G71 A;  2RI2 A;  1XQH A;  4J6X A;  4J6W A;  2NUT A;  2M1H A;  2VAS A;  2KXD A;  4QQ6 A;  3HL8 A;  3THK A;  3L1A A;  2CH4 W;  2PZ1 A;  3C12 A;  4FT2 A;  4J8O A;  2E6N A;  5GAN g;  3CCU T;  4DEX A;  4LDY A;  1WHH A;  3GNG A;  1PKS A;  3CC2 A;  3EH1 A;  2FL7 A;  1R77 A;  3MPU B;  4OVA A;  3I55 A;  2YLC A;  4M7D B;  1IHW A;  1NE8 A;  4E2F B;  4EMK A;  4OF1 A;  1D1A A;  1QCN A;  2YLB A;  3PE0 A;  2FRY A;  1SHF A;  3PFS A;  2DPP B;  4QKU A;  2RO0 A;  3CCV A;  1YIT Q;  3HKS A;  4XTY A;  1T3L A;  2QA4 A;  1OZ3 A;  2CRE A;  3OMG A;  1M90 R;  1KK7 A;  4GY5 A;  1MMN A;  5GJW B;  4C8Q D;  4PFZ A;  2E70 A;  4J9C A;  5LJ3 h;  4XU0 A;  5CCA A;  4C92 F;  1U1S A;  4AG2 C;  2DXU A;  2O9S A;  3MEV A;  2K3B A;  4EMK C;  5KYY A;  3PMT A;  1H3H A;  2OAU A;  1QQJ A;  5GAM g;  1YJ9 Q;  1M5Q 1;  1WDX A;  2CP7 A;  1I5O B;  5KYN A;  1G3W A;  2H3E B;  3CMA Q;  3JCM W;  1QW1 A;  2VGM A;  4M7A C;  2O4X A;  1VQL A;  3CCL A;  3JCM c;  4R0K A;  2MK5 A;  3OYH A;  3OBW A;  2V1R A;  3M0S A;  1QCO A;  3TQ7 P;  1OYX A;  1WX6 A;  1VQ5 A;  3JCM Q;  1WLP B;  2A08 A;  2QEX A;  3ZFJ A;  2BE9 B;  3CCV T;  1BI0 A;  2DIG A;  3RKY A;  2AZV A;  5GAO r;  2KAF A;  4FYX B;  3V7R A;  1OU9 A;  3H41 A;  2MF2 A;  3CCQ T;  4BE1 A;  3QXE B;  4C8Q A;  5L8R E;  3MP8 A;  1S1N A;  4NOY A;  2DA9 A;  1K76 A;  3UA7 A;  2E5Q A;  4ZGE B;  3OW2 P;  8ATC B;  1Y57 A;  5J3B A;  3OQ5 A;  2J06 A;  3RER A;  2LNV A;  3O8V A;  1UTI A;  3LWI A;  3E19 A;  2DRM A;  3VUZ A;  3M53 A;  2RQW A;  2K5F A;  1B34 B;  4BY6 B;  4J7F A;  5CQX A;  1WQ7 A;  4IUT A;  1OZ2 A;  3EHR A;  2KE9 A;  3M0U A;  3OS0 A;  1UGR B;  1RLQ C;  2KR3 A;  4XU2 A;  4AFQ C;  1NPR A;  4M7D A;  2HDA A;  1BI2 A;  4RTU A;  3I5R A;  2PNI A;  5FRM A;  2DD4 A;  2XU8 A;  5CO7 A;  4DEY A;  3JCM d;  3A8L B;  2VUB A;  1AHJ B;  5LJ3 g;  1WXU A;  2QI2 A;  3JCM V;  2BUD A;  3SB2 A;  4FSS A;  1SKU B;  2IVW A;  2RJE A;  4M7D C;  4JJD A;  3X26 B;  4OB2 B;  4RKU E;  2XHC A;  2V8I A;  2LCS A;  1O9S A;  2LJ3 A;  2Z0W A;  3NHN A;  2DZ9 A;  2EWN A;  4JZ4 A;  3OYA A;  1MND A;  2E1H A;  4DOV A;  5IXB A;  2X9H A;  4C5I A;  3QUI A;  2XI9 A;  2M9U A;  5A2Q E;  3WVD B;  1SEM A;  2CUB A;  1VQ7 Q;  5EC7 A;  3RES A;  4E7K A;  3CCM A;  4C92 E;  3BE3 A;  4RG2 A;  4PLL A;  3X20 B;  2RF0 A;  2ZPH B;  4J9D A;  1X75 C;  1AZG B;  2DIQ A;  1EIF A;  4IIO A;  1Z9Z A;  1OUL A;  1ZBJ A;  3L2Q A;  2H8H A;  2QTV A;  1AVZ C;  5IXF A;  4C92 G;  2JTF A;  4M78 D;  4M75 D;  3HSB A;  2MCN A;  4LDW A;  1VQ8 T;  2R57 A;  2VC8 A;  4N0A C;  5FWC A;  1MMG A;  4X34 A;  3OYD A;  1WFW A;  3FJ5 A;  2ATC B;  3G6E A;  2LQN A;  2L2P A;  5CKB A;  3A1P A;  5CKF A;  1M90 U;  1JBM A;  3LH5 A;  3JB9 D;  2YUO A;  4HVW A;  5KE2 A;  4PK4 A;  2IIM A;  1ZX6 A;  1B34 A;  1NM7 A;  4OMN A;  1IXD A;  1YI2 T;  2A0F B;  2CH4 A;  2COZ A;  2GFA A;  2CYZ B;  2ZPB B;  3P8H A;  1JO8 A;  2CDT A;  2QYZ A;  1G5V A;  2EPD A;  5GMK j;  2FG0 A;  1PWT A;  1BK2 A;  1IB8 A;  2DVJ A;  1VQP T;  3OSS C;  2EQJ A;  3SHW A;  1KD1 U;  4M75 A;  2QQB A;  5IHK A;  2VYT A;  2WSF E;  4BY6 C;  4C8Q F;  2EGC A;  1SRL A;  2J7I A;  1K73 R;  1AD5 A;  2EJ9 A;  1ZUK A;  3H0H A;  3CD6 Q;  4Y92 A;  4E47 A;  5LJ5 e;  5FLX E;  2DEQ A;  1CKB A;  5A0G A;  1KC8 R;  3VV0 A;  3M54 A;  3EFO B;  1ZA2 B;  4LNP A;  4F14 A;  3JRZ A;  4FYV B;  2J6O A;  3GP8 A;  3M58 A;  1YJ9 A;  2LCC A;  9ATC B;  2RQR A;  1UE9 A;  4GLM A;  4MZP A;  1X2Q A;  1VQM Q;  1W2B A;  1Q86 R;  1I81 A;  3FDR A;  2RPN A;  2OTJ Q;  4HT8 A;  3DLM A;  2OI3 A;  1RAD B;  3CCR Q;  1SSF A;  5GAN j;  2RN8 A;  1TUG B;  1YIT T;  1AZE A;  2YDL A;  2QGF B;  3NFC A;  2VKN A;  2KXC A;  4MZM A;  4NS5 A;  3QYH B;  2R5A A;  1XNI A;  3QDR B;  2XK0 A;  1K8A C;  3L2R A;  1Y96 A;  1YJ9 T;  3E9G A;  1E6H A;  1YJN T;  2E6Z A;  4FSX A;  3I9Q A;  2YRC A;  1G8X A;  4EDU A;  2FZC B;  3CMA T;  4N4H A;  3HFO A;  3EG2 A;  3ZEH A;  3BY7 A;  3IQL A;  4PJO E;  2E4H A;  1VYT A;  3M0Q A;  4L5G A;  2X4W A;  1I4K 1;  2RNA A;  1QP3 A;  2HMA A;  2K5I A;  3JCM f;  1DJ7 B;  2E10 A;  4PJO G;  3MO8 A;  4HT9 A;  2QQS A;  1NBE B;  4MDW A;  3I55 Q;  1FX7 A;  2DE0 X;  2ZCF B;  5LJ3 f;  5GAM j;  1TUC A;  3A8M B;  4FT4 A;  4IUQ A;  2D8H A;  2P4T A;  2ECZ A;  3CCS A;  2DL3 A;  2LCL A;  3SFM A;  2CZ6 B;  2QA4 Q;  3ME9 A;  2O31 A;  3A5Z B;  3INZ A;  4NL2 A;  4BD3 A;  1BB9 A;  3RDV A;  1WA7 A;  3QKJ A;  1VQ9 Q;  4A54 A;  2JTE A;  1D0Y A;  2GBQ A;  2NYS A;  4HCZ A;  1WJS A;  3VS3 A;  2AKK A;  2LTO A;  1R8O B;  1SG5 A;  3ULR B;  2EIF A;  1I07 A;  2HNI A;  2K2V A;  5CR2 A;  2KY9 A;  4P5N A;  1EFN A;  1YHQ A;  5FWB A;  1UEC A;  2DVE A;  4M77 D;  2KVQ G;  3LW5 E;  1IRE B;  5CIU A;  5KYW B;  1F1B B;  1KHC A;  3I35 A;  3HRS A;  4C0G A;  1VQL Q;  3KUF A;  4LDU A;  3CCL Q;  2M02 A;  2QDL A;  2LQW A;  4OMM A;  2ENM A;  1WHG A;  1JRI A;  1VQ7 A;  1ABQ A;  4LUD A;  1VQ5 Q;  3A8G B;  1NZ9 A;  2W10 A;  5HK0 A;  1VQN T;  1PD1 A;  3G4S T;  2I0N A;  2QQ9 A;  4J9G A;  4M78 F;  1T0H A;  2KRO A;  5I2M A;  4M75 F;  2F5K A;  4QQD A;  3G1J A;  3TEE A;  4C0Z A;  5KCO A;  4BB7 A;  1WGS A;  3L2V A;  2KBT A;  5I2S A;  2JVV A;  2JNG A;  1WHL A;  1G3S A;  1M1K R;  1D09 B;  1K9M C;  1PC0 A;  3QDF A;  3SWN B;  1RL2 A;  1P92 A;  3VS7 A;  1MV0 B;  1SRM A;  2K7A A;  1M27 C;  2DL5 A;  4JJB A;  2MOX A;  4YTL A;  4M77 A;  5FRO A;  3H8Z A;  1VQ7 T;  1ZHI A;  2KSS A;  5DLO A;  3ER0 A;  2J6K A;  2GF7 A;  2QK0 A;  2HQX A;  4PJM A;  1N8R C;  4DOW A;  2QAZ A;  2V26 A;  3EGD B;  1QMC A;  2QDY B;  3TU4 K;  3SEM A;  2NUP B;  1Y0M A;  1K0X A;  2M0O A;  1Q82 C;  2MWO A;  2G6F X;  4M77 C;  3C4S A;  4IUV A;  4LUE A;  3OYJ A;  3VS2 A;  3EGX B;  3MJX A;  4JRI A;  3ZBD A;  3TSZ A;  2EYQ A;  4RTV A;  3CD6 A;  1YP5 A;  2OTL Q;  3QSU A;  2RB6 A;  1RAB B;  3WVE B;  3FEO A;  4M4Z A;  2WSC E;  3VYG A;  4PJO B;  4CI0 C;  4JPB W;  2A7Y A;  1GCQ C;  2DO3 A;  5LJ5 d;  2NUZ A;  1W2B S;  2HD0 A;  3OYK A;  4V2S A;  5EG2 A;  2LZ6 B;  1VQM A;  3JCM X;  4FW2 A;  1MNE A;  2XDB A;  1M8M A;  2CSQ A;  5CKH A;  3HTR A;  3CCM Q;  1VQK Q;  2P4R A;  3CCR A;  2K2M A;  1W70 A;  1LPL A;  1KHI A;  2EAY A;  4WF2 A;  2DYB A;  3FJP A;  2KNB B;  3A8O B; 
#chains in the Genus database with same CATH homology
 1TUD A;  2EYX A;  1TG0 A;  1X2K A;  1WI7 A;  2D1X A;  1SSH A;  2KT1 A;  1KFZ A;  3EHR A;  2KE9 A;  3M0U A;  1UJ0 A;  1AWW A;  1RLQ C;  2KR3 A;  3QWY A;  1I1J A;  4AFQ C;  1NYF A;  1GRI A;  2HDA A;  2ROT A;  2LJ0 A;  3NGP A;  1M3B A;  1VYU A;  4RTU A;  2C0O A;  2PNI A;  3I5R A;  4WCI A;  1HD3 A;  1FYN A;  1VYV A;  4DEY A;  2ED1 A;  1WXT A;  1E6G A;  1OOT A;  3CQT A;  2DLP A;  1WXU A;  4OMP A;  2EVR A;  2JW4 A;  2EGE A;  1AOJ A;  2RMO A;  1UHC A;  4FSS A;  2O88 A;  3R6N A;  1X43 A;  4JJD A;  1JEG A;  1U5S A;  2EKH A;  4LN2 A;  2JM8 A;  2DBM A;  2LCS A;  2LJ3 A;  2K6D A;  4HVU A;  4RTY A;  4OMO A;  2GTO A;  3NHN A;  2EYY A;  4JZ4 A;  1N5Z A;  2GGR A;  4D8K A;  3REB B;  5IXB A;  2JS0 A;  2YUN A;  1PRM C;  2DNU A;  2EQI A;  1SEM A;  1YNZ A;  1HSQ A;  2CUB A;  2DF6 A;  2KRM A;  1PHT A;  2X3W D;  5EC7 A;  1B3Q A;  1AEY A;  1GCQ A;  4F17 A;  2DJQ A;  3EG0 A;  1GFD A;  2RF0 A;  1ZUU A;  4J9D A;  1YN8 A;  1AZG B;  4K11 A;  4IIO A;  2MIO A;  1T3S A;  1NG2 A;  1Z9Z A;  1ZBJ A;  2DL4 A;  1K1Z A;  3PVQ A;  2H8H A;  5IXF A;  1AVZ C;  4HXJ A;  1A0N B;  1ZLM A;  2MCN A;  1HJD A;  2FPD A;  4RUG A;  2KGT A;  2A36 A;  5FWC A;  1WFW A;  2KYB A;  3FJ5 A;  2LQN A;  1YCS B;  2L2P A;  2L3Q A;  1SPK A;  1PNJ A;  3NMZ C;  2YT6 A;  1CSK A;  1H8K A;  1X69 A;  1X6B A;  3LH5 A;  3M0R A;  1BU1 A;  4LE9 A;  2ABL A;  2YUO A;  1NLP C;  4HVW A;  2YSQ A;  1UGV A;  2L0A A;  2IIM A;  1QWF A;  1PRL C;  1ZX6 A;  2J6F A;  2AKL A;  1QLY A;  1NM7 A;  2KEA A;  4OMN A;  4J9H A;  1LCK A;  2CH4 A;  2C0T A;  2K9G A;  1JO8 A;  2CDT A;  1KIK A;  2DL7 A;  4Z88 A;  1X6G A;  2FPF A;  2EPD A;  2O2O A;  2FG0 A;  1PWT A;  1BK2 A;  1T0J A;  4HVV A;  2DVJ A;  1W6X A;  3SHW A;  4IIM A;  3PVL A;  1YWP A;  5IHK A;  1H92 A;  1KJW A;  2F2X A;  1FMK A;  2EGC A;  3RBB B;  2D0N A;  4AFZ C;  2OAW A;  1SRL A;  1GL5 A;  2J7I A;  3A98 A;  1AD5 A;  1ZUK A;  3H0H A;  2F2V A;  4Y92 A;  1GBR A;  4HCK A;  1CKB A;  1B07 A;  4KRT A;  4Z8A A;  4LNP A;  4F14 A;  2KRN A;  2E5K A;  4J9F A;  3VS4 A;  2DIL A;  2J6O A;  4D8D A;  2M0Y A;  4JJC A;  5IHN A;  1K4U S;  1V1C A;  3C0C A;  2RQR A;  1ABO A;  2FPE A;  1UE9 A;  3RNJ A;  4GLM A;  4CC3 A;  1E7O A;  4CC7 A;  1X2Q A;  1K9A A;  1UJY A;  4J9I A;  2SRC A;  1AWX A;  2KYM A;  1NEB A;  2CUD A;  1UUE A;  2RPN A;  1X27 A;  4AG1 C;  3I5S A;  1W1F A;  3GBQ A;  1QCF A;  4J9E A;  4RTW A;  2DMO A;  1GCP A;  3VS5 A;  2OI3 A;  2VVK A;  2B86 A;  2RN8 A;  1AZE A;  2EYZ A;  1AWO A;  2YDL A;  2DX1 A;  1QKW A;  1BBZ A;  2LMJ A;  2V1Q A;  1GBQ A;  3EGU A;  2JT4 A;  2VKN A;  2K79 A;  2KXC A;  1WIE A;  1RUW A;  1QKX A;  4J9B A;  1M3C A;  5L23 A;  2GQI A;  1E6H A;  3VS6 A;  1JXM A;  3I9Q A;  2AK5 A;  3EG2 A;  2L3S A;  3VS0 A;  3IQL A;  3M0Q A;  1VYT A;  2AZS A;  1M3A A;  4ESR A;  2RNA A;  3H0F A;  2RQT A;  5I22 A;  1AWJ A;  1M30 A;  1NYG A;  1G83 A;  2F2W A;  1UHF A;  2DE0 X;  3UA6 A;  2GNC A;  2W0Z A;  1MV3 A;  4RTT A;  3QWX X;  2X3X D;  2A28 A;  1CKA A;  3TSW A;  1Z9Q A;  1TUC A;  2J05 A;  1OEB A;  5IH2 A;  1U3O A;  2D8H A;  3M0T A;  1VA7 A;  4ORZ A;  2YUQ A;  2ECZ A;  4AFS C;  2BZ8 A;  2DL3 A;  1OPL A;  3EHQ A;  2C0I A;  2O31 A;  3H0I A;  1BB9 A;  1ZSG A;  2XMF A;  1WA7 A;  2PTK A;  2JTE A;  2GBQ A;  1XOV A;  4RTZ A;  2FO0 A;  3VS3 A;  2AKK A;  3VRZ A;  2JMC A;  3KFV A;  2LJ1 A;  3ULR B;  2CSI A;  2RQU A;  1I07 A;  3TVT A;  2NWM A;  1JXO A;  2BZY A;  1UFF A;  1EFN A;  5HCK A;  5I11 A;  5FWB A;  1UEC A;  1WXB A;  2ED0 A;  3I35 A;  1RLP C;  2CT3 A;  1ZUY A;  1WYX A;  4Z89 A;  1NLO C;  1NEG A;  2QDL A;  2LQW A;  3EG3 A;  4OMM A;  2ENM A;  4E6R A;  2DRK A;  1ABQ A;  4LUD A;  4OML A;  2JM9 A;  4AFU C;  2W10 A;  2I0N A;  2ROL A;  4J9G A;  1T0H A;  2KRO A;  2DM1 A;  2KXD A;  2JMA A;  2RQV A;  3ZL7 C;  3THK A;  2KRS A;  2KT8 A;  2FEI A;  2KBT A;  2CH4 W;  2CT4 A;  2PZ1 A;  5FW9 A;  4DEX A;  2EBP A;  1IO6 A;  1JU5 C;  2ESW A;  2LNH B;  2BTT A;  4RTX A;  2O9V A;  5GJV B;  1PKS A;  1MUZ A;  1G2B A;  1QWE A;  2D8J A;  3VS7 A;  2HCK A;  1MV0 B;  1SRM A;  2K7A A;  1M27 C;  2DL5 A;  4JJB A;  2MOX A;  4OMQ A;  1JQQ A;  2OJ2 A;  1J3T A;  1RI9 A;  1U06 A;  3PE0 A;  2FRY A;  2DBK A;  1SHF A;  4QT7 A;  2HBW A;  2YUP A;  1T3L A;  2J6K A;  1ARK A;  2CRE A;  5GJW B;  1UG1 A;  4J9C A;  3SEM A;  2HEQ A;  2HSP A;  1Y0M A;  4AG2 C;  1K0X A;  1OV3 A;  2O9S A;  2K3B A;  1H3H A;  2G6F X;  2EGA A;  4LUE A;  3VS2 A;  1UDL A;  1WDX A;  3TSZ A;  3M0P A;  1PKT A;  4ZNX A;  4RTV A;  2EW3 A;  2JXB A;  2SEM A;  1YP5 A;  4CC4 B;  3UAT A;  4R0K A;  2V1R A;  3M0S A;  4M4Z A;  5ECA A;  1WX6 A;  4EIK A;  1WLP B;  2A08 A;  4JPB W;  1GCQ C;  2NUZ A;  4CC2 A;  2BZX A;  3EG1 A;  1I0C A;  2AZV A;  4A63 B;  3U23 A;  1KSW A;  2LZ6 B;  3VS1 A;  3H41 A;  3UF4 A;  2FRW A;  5IHI A;  1M8M A;  2CSQ A;  3REA B;  3VRY A;  2GTJ A;  2LP5 A;  2EYW A;  4GBQ A;  1S1N A;  1SHG A;  3JV3 A;  2DA9 A;  1K76 A;  3UA7 A;  1GFC A;  2P4R A;  2DL8 A;  1OPK A;  2LX7 A;  2K2M A;  3NPF A;  1Y57 A;  1K0S A;  3O5Z A;  4X1V A;  1W70 A;  2VWF A;  2M51 A;  2J06 A;  2JS2 A;  1UTI A;  4JZ3 A;  2DRM A;  2DYB A;  2L3P A;  4F16 A;  1YWO A;  2KNB B;  2RQW A;  2A37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...