4OMLA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128r
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omlA00
3M0TA 1M8MA 2MCNA 2GTJA 1QKXA 3ULRB 2EVRA 2DNUA 2DMOA 1X6GA 3VS1A 1WXUA 2EGCA 3EG0A 1MV3A 2H8HA 2SRCA 4HXJA 1M3BA 2O9SA 1KIKA 4A63B 1JXOA 1AVZC 1QCFA 1SPKA 1VYUA 1SEMA 1UECA 1A0NB 1QWFA 2PTKA 4F16A 2JMAA 4LNPA 1PHTA 1UJYA 1Z9ZA 2YT6A 4CC2A 1RLPC 2K6DA 4ESRA 2F2XA 3O5ZA 4J9CA 2BZXA 1N5ZA 2CSQA 2PZ1A 2QDLA 2DRKA 2C0TA 4E6RA 1H3HA 2KRMA 2DBMA 1G2BA 2W0ZA 2VWFA 2M0YA 1QKWA 2JT4A 1EFNA 4J9HA 1JU5C 3UATA 2ENMA 2EKHA 2IIMA 2D8HA 1YWPA 1YCSB 2EBPA 3M0SA 1OOTA 4IIOA 2JS0A 2OJ2A 3EGUA 4D8DA 2G6FX 1CSKA 2JXBA 1BB9A 1WI7A 1G83A 3KFVA 4ZNXA 1TUDA 1X2QA 3I9QA 4WCIA 3VS7A 3M0RA 2K9GA 1I1JA 1SSHA 3TVTA 3VS6A 2HCKA 3SHWA 2L3PA 2CT3A 2DL3A 1OV3A 4CC4B 4OMQA 3EG3A 1UHCA 2RQVA 1WLPB 1UG1A 2M51A 2LX7A 4ORZA 4EIKA 4D8KA 4F17A 2C0OA 2KRNA 2F2WA 1M3AA 4RTYA 1Y57A 1MV0B 3THKA 2FRWA 2LP5A 2LZ6B 2LQNA 1VYTA 1RUWA 1QWEA 1UGVA 1T0JA 1AWOA 2EYYA 2LJ0A 2JM9A 1JQQA 1J3TA 2D8JA 2D1XA 1QLYA 4RTZA 2KT8A 3RNJA 1UHFA 2AZSA 2KEAA 1Y0MA 1PRLC 2L3SA 2HDAA 1H8KA 2J6FA 1K9AA 1GCQA 2KNBB 1WX6A 1AOJA 1ZBJA 5IHIA 4OMNA 1X6BA 2KYMA 4RUGA 2L2PA 3VS3A 4J9DA 4CC7A 1OEBA 1NLPC 2EW3A 1ABQA 4HVUA 1TUCA 3RBBB 2EGEA 1B07A 1HD3A 2ROLA 2CH4W 1NEBA 2FRYA 1I0CA 2AKLA 1KJWA 5ECAA 2FO0A 1W6XA 2EYZA 3VRZA 3PVQA 5IHNA 1PWTA 3CQTA 1JO8A 1ZSGA 4RTTA 2E5KA 2CDTA 2ED1A 2OI3A 1PRMC 4LUEA 1UUEA 2YSQA 1UFFA 3A98A 4R0KA 5IH2A 2MOXA 1CKAA 2HEQA 2DL7A 4J9FA 3LH5A 4Z89A 4FSSA 2LJ1A 3U23A 2JMCA 1WFWA 2JW4A 1M3CA 1GCQC 2DILA 1V1CA 1NYFA 4HVVA 2RMOA 1WYXA 3EG2A 2V1RA 1AWWA 3FJ5A 2VVKA 3VS5A 1GFCA 1FYNA 2LMJA 2J06A 1K76A 2BTTA 2XMFA 1E7OA 2J05A 2B86A 3TSWA 1Z9QA 4AFUC 2YUPA 2RQWA 2KT1A 4HCKA 2K79A 1UTIA 2EPDA 1YWOA 2RNAA 2PNIA 1SRLA 1YNZA 2BZYA 4OMOA 1NLOC 2CH4A 2RQUA 1BBZA 2O9VA 1X27A 3M0UA 1KSWA 2SEMA 1AWXA 1M30A 1WXBA 3QWYA 2A37A 3NHNA 4LN2A 1AEYA 2DRMA 3TSZA 1HJDA 2L0AA 1OPLA 1BK2A 3QWXX 5I22A 2DE0X 2ED0A 2GTOA 1AD5A 3M0QA 3PE0A 2O88A 2F2VA 5FW9A 3EG1A 1JXMA 1AZEA 2W10A 3I35A 4Z88A 1OPKA 2DL4A 2JS2A 5I11A 2DYBA 5IXBA 2A28A 1B3QA 2CUBA 5FWCA 3EHQA 1X43A 2DBKA 1LCKA 5EC7A 2NUZA 4F14A 4JJDA 1UE9A 2KBTA 1U3OA 1I07A 1E6GA 1U5SA 3R6NA 1ARKA 3GBQA 4GBQA 4GLMA 1AWJA 2DJQA 4J9GA 1SHGA 4RTUA 2K2MA 2RQTA 3ZL7C 1RI9A 2RF0A 1KFZA 3REBB 2D0NA 2KRSA 2EYWA 2AKKA 3VS0A 4JJCA 3H41A 3I5RA 4IIMA 2FPFA 3EHRA 1BU1A 1NEGA 2DL5A 1UDLA 2EGAA 1GBRA 2YUNA 2GQIA 4J9BA 1X69A 1WA7A 2MIOA 2DVJA 1PKTA 4RTVA 3H0IA 1S1NA 2ABLA 1U06A 2FG0A 1K0XA 2RPNA 2X3XD 2KE9A 4J9EA 5L23A 2VKNA 4J9IA 1K1ZA 1NM7A 2KROA 4OMPA 2BZ8A 3UA7A 2OAWA 2CT4A 3C0CA 3M0PA 4LUDA 2RQRA 1YN8A 2J7IA 1VA7A 5GJWB 4AFZC 1YP5A 4JZ3A 2A08A 5HCKA 1T0HA 1XOVA 4JPBW 5IXFA 3SEMA 5FWBA 4AG1C 2A36A 2GNCA 2L3QA 1WIEA 3NGPA 1GCPA 4Y92A 1PKSA 4AFQC 2KR3A 1TG0A 2J6KA 2DA9A 3VS4A 2KGTA 1JEGA 1MUZA 1ABOA 1GRIA 2YDLA 3I5SA 1ZLMA 4RTXA 2KXCA 1CKBA 1M27C 2EYXA 1SRMA 2FEIA 1ZX6A 2ROTA 1K4US 4OMLA 2HBWA 2CREA 2DLPA 1H92A 1NYGA 1GBQA 5GJVB 1NG2A 2KYBA 1WDXA 3JV3A 2YUOA 4DEXA 2YUQA 2ECZA 4M4ZA 5IHKA 2RN8A 4DEYA 2GBQA 4K11A 3PVLA 3UF4A 4LE9A 2DM1A 1E6HA 1X2KA 1ZUYA 2ESWA 2KXDA 1T3SA 1RLQC 2K3BA 2K7AA 1ZUKA 3REAB 1W1FA 2CSIA 3UA6A 2FPDA 2EQIA 2JM8A 2X3WD 4CC3A 2I0NA 4KRTA 2DF6A 2LQWA 1GL5A 2LNHB 4JJBA 4AG2C 1K0SA 2O2OA 2GGRA 2AK5A 1AZGB 1PNJA 2HSPA 1VYVA 3VRYA 1ZUUA 1FMKA 1HSQA 2V1QA 1UJ0A 4OMMA 2C0IA 2DX1A 1GFDA 4HVWA 4JZ4A 2O31A 3NPFA 4Z8AA 4AFSC 2NWMA 3IQLA 1SHFA 2FPEA 2JTEA 1W70A 4QT7A 3NMZC 1T3LA 2LCSA 2DL8A 2CUDA 4RTWA 3VS2A 2P4RA 1WXTA 3H0HA 1IO6A 2J6OA 2LJ3A 4X1VA 3H0FA 2AZVA
chains in the Genus database with same CATH superfamily
1PC0A 3M0TA 1M8MA 2AT1B 2GTJA 5GAMj 4RG2A 1QKXA 1DJ7B 2EVRA 1TSFA 5GAMf 2QA4Q 1B34B 2DNUA 3FB9A 2DMOA 1X6GA 4J6WA 2H8HA 2SRCA 1VQNA 5A0DA 1QCFA 2DXTA 3PFSA 2JUFA 3F70A 4ZN1A 4RCBA 5I21A 2XI9A 4O5VA 2DERA 2K5FA 4J5YA 1BCOA 4J9CA 2BZXA 3M54A 2CSQA 3S3OA 5LJ5j 3OYFA 2PZ1A 4IUUA 2QDLA 2RD1A 3G6EQ 2F69A 5LJ5f 2DBMA 4HCCA 3C12A 3MPUB 3J81E 2VWFA 5GMKj 2HL5C 4FT4A 4AT1B 4PJNA 1EFNA 4D6WA 1ZSZB 4J9HA 1K9MC 4KULA 2FZCB 1VQPA 2ENMA 2EKHA 1ZA1B 4JDSA 4RMOA 1YCSB 3AT1B 4IIOA 1OOTA 5GAN4 4WTOB 2OJ2A 1BKBA 2EIFA 2JXBA 3KFVA 3HFNA 1TUDA 2HL3A 2V8IA 4C5IA 3I9QA 2RHYA 2RJDA 4FU6A 2CP6A 3VS7A 3M0RA 5GAOq 1I1JA 1SSHA 3VS6A 2LX9A 3CCRT 1F1BB 3GP8A 2CT3A 2EYQA 4FIBA 3OYKA 3AHUA 2KAFA 1UGRB 1WLPB 1UG1A 2RQVA 4F17A 4ORZA 3CCLQ 3CCRA 2MPXC 1EIFA 4RTYA 1M3AA 5KYUB 3JB9G 3JCMP 1MV0B 3CXCP 3RIRA 2XG8D 1TXQA 2EYYA 2YRCA 5FRNA 3M5AA 2EFIA 2A0FB 5GAOn 5HKCA 4RTZA 2QAZA 4HT9A 2WSEE 5D6YA 2L3SA 2J6FA 5KYYA 2QTVA 1TH7A 1GCQA 4XU3A 2WACA 4BDYA 4OMNA 1X6BA 4EPCA 2L2PA 4J9DA 4ELYC 3QZ9B 1M1KR 5GAOm 3BW1A 4PJOE 2EGEA 1B07A 4LDWA 2DXBA 1KD1U 1KJWA 1OZ2A 1QVGS 3PVQA 4OB1B 4BB7A 1KHIA 3OYDA 4Z02A 1JO8A 4A53A 4LUEA 5GAN7 1VQ7T 3SB2A 2XK0A 1QP3A 2MOXA 5IH2A 1VQ7A 2EWNA 1CKAA 1M1FA 1VOMA 1KQSS 2HD0A 1QVFA 4R56A 2DILA 2DK3A 2RMOA 2R57A 1U1SA 2V1RA 3GPLA 2NYSA 3L2WA 2ZGWA 1NBEB 1WQWA 3EFSA 3HP9A 5HY6A 3RERA 2HQHA 5CAIA 1Z9QA 4M7DF 3JCMc 4OMFB 1VQ6Q 1YWOA 2RNAA 4QQGA 5GANg 4OMOA 1NLOC 4RKUE 1KSWA 1Q81C 1OI1A 4V2SA 1AWXA 1MMDA 1M30A 2VB6A 2Z0WA 3E9GA 4R55A 4M7DB 1WXBA 3QWYA 3TU4K 3JAME 2X4XA 1D3BB 2DRMA 1OYXA 5I2MA 1HJDA 2L0AA 3OYAA 2OTLT 2R58A 2DTHA 3X20B 4ZN3A 1K9MR 1R0BG 2DE0X 2GTOA 1AD5A 3M0QA 3OYNA 2OTLA 2F2VA 1AZEA 1X6OA 3I35A 3QYHB 1D1CA 1OPKA 4QKUA 4Z88A 4EMKA 3JCMb 2L3RA 5FLXE 1RAIB 2DZCA 2E65A 2BE9B 1EX4A 2RI5A 4N4GA 3C94A 2A28A 1B3QA 1X01A 1C0MA 1M2VA 1B7TA 4Q5WA 3JCMg 4MDWA 5GAOl 2KBTA 1XQHA 1M2OA 2RHIA 3OA6A 2BIVA 2PVOB 2CYZB 2K2MA 2RQTA 3LW5E 1KFZA 3REBB 4M7AF 1YBYA 2RI3A 4XTVA 2DD5A 1WHKA 2EQKA 2IPOB 1BU1A 2JJ9A 2KY9A 2CZ1B 1UDLA 2HAXA 4M7AB 1GBRA 2YUNA 2GQIA 4HCZA 2PVDB 1I4K1 1VQ8Q 4LD6A 2RH2A 4Y28E 4ZGDB 3H0IA 1U06A 1ZHIA 1WHLA 4M7AD 1VQ5Q 3M55A 1NM7A 2KROA 3OW2P 1S72T 2BZ8A 3UA7A 2ZPEB 3C0CA 3FEOA 3SFMA 1S72A 2RQRA 1YN8A 3CMEA 3MP1A 2LNVA 3META 1Q82U 2A08A 1T0HA 3G7ZA 3A8GB 3MJXA 1LJOA 2X51A 1GXIE 1RACB 1IRXA 1N8RC 1KK7A 1WIEA 4BE0A 4Y92A 3M56A 1FXXA 4MMLA 2KR3A 1M9SA 4L5GA 4IUQA 2J6KA 1JEGA 4PNOA 1ABOA 3I5SA 4E7SA 5GMKi 5IT9E 4A4KA 2I2LA 1SRMA 3EFRA 1RAHB 1XJWB 1PSEA 4OMLA 1K73C 3CCUQ 2CREA 1H92A 1NG2A 2NLUA 2KYBA 3TQ7P 4CI0C 3UT1A 4E2FB 1SSFA 1R8OB 3PNWC 4M4ZA 4M7AC 2HZYA 5IHKA 2RN8A 1LVKA 3OYCA 4FW2A 2D0QB 1ZUYA 1X2KA 3UWNA 1Q86C 4JS4A 5FROA 1Q81R 2MMPA 3VYHB 3CBPA 3ZFJA 3KUFA 3UA6A 2FPDA 2EQIA 2ZPIB 2E3IA 2RJEA 1R77A 3EGXB 2I0NA 3MP6A 3QJYA 4JJBA 2E3HA 3HL8A 2GGRA 2DAQA 1KC8U 5LJ3d 3MEWA 2HSPA 2QYZA 3VRYA 1ZUUA 1FMKA 1HSQA 2V1QA 1UJ0A 2C0IA 2DJZA 3RR6A 3NPFA 2NWMA 4M75F 3WVDB 2P0KA 3OSVA 1TS9A 3HTRA 4HA8A 4M77E 2JTEA 4OB2B 2DEQA 3JCMQ 2XD0A 2V8JA 4XTXA 5FU6C 1FX7A 3H0HA 2J6OA 2VXFA 3OYEA 3H0FA 1YJ9A 4II1A 4M75B 2MCNA 2LRQA 3GNFB 3ULRB 2MI6A 1MGQA 4M7AG 2LVMA 2HNIA 2KMTA 1MV3A 4IURA 2EQUA 1KIKA 1U8RA 2QEXQ 4M75D 2WSCE 1W2BS 2RK2A 4KT0E 1NJIU 1UECA 3CC4Q 1RADB 3GOXA 4CRIA 5GAOr 1UEBA 1YI2T 2E41A 3SWNB 3G71Q 1PHTA 1UJYA 3CC7T 1YI2A 1QQJA 4PJOD 3O5ZA 3CC7A 4M7DE 1N5ZA 2LDMA 1KQSA 2C0TA 1MNDA 2W0ZA 2ZCFB 2RI2A 4BI4A 2R5MA 2FZGB 3G4ST 2CP5A 3M58A 3G4SA 4JLIA 3BE3A 2D8HA 3CEYA 2EBPA 3M9QA 5J26A 3JCMJ 3M0SA 4JRKA 1YJNQ 1M4ZA 4KH1B 4D8DA 3EAEA 1WI7A 2XU8A 1OULA 2YLBA 4LD9K 3CC2T 2Y4XA 4C5EA 3VUZA 1TTHB 3CC2A 1N8RR 4E47A 4ZGEB 1UHCA 4X9CA 3A8LB 3RMSA 2KRNA 2Y90A 3BFMA 4IUPA 2KK4A 2K2VA 1MMAA 3RDVA 1OU8A 3THKA 3JCMX 2LZ6B 2EJGA 4PLIA 2LQ8A 5GAMg 2MF2A 2VUBA 1RUWA 2RHUA 1YHQQ 2RJFA 1VQLA 1VQPQ 2NUPB 2LCLA 1K73R 1J3TA 4PJOC 2D8JA 2D1XA 1O75A 2MYSA 2YWWA 4DBFA 1NE8A 4MDXA 2KT8A 2X4YA 4M7AE 2NUTB 3L2UA 2AZSA 4QVZA 5FRMA 1H8KA 1NZ9A 5LJ5h 1Y07A 3CCMQ 3M57A 1K8AC 2KNBB 5LJ5e 5KYUA 1NPRA 1Q86R 1VQMQ 1MHNA 5CVIA 5LJ5g 4HVUA 4JRPA 1TUCA 4HKEA 3MO8A 2ROLA 1M1GA 1NEBA 1I0CA 2AKLA 3OYMA 4FM4B 3VRZA 2EYZA 4M78F 3OS1A 5IHNA 3CCVT 3VU3C 4BY6B 1ZSGA 2CDTA 2ED1A 2OI3A 3CCVA 3A8MB 2YSQA 2DKGA 1UFFA 5KYWB 4R0KA 1ZA2B 1BCMA 4C5GA 1RAFB 4M78B 3LH5A 4PJOG 1M1KU 3CBOA 3FDRA 2PUOB 1VQOQ 2JW4A 1YJNT 2D6FA 2F5KA 1V1CA 4HVVA 4M78D 4A4EA 3FJ5A 1FYNA 4AMCA 2XHCA 1K76A 1VQKQ 1TOVA 4JUVA 1E7OA 4PKCC 4AFUC 2M0OA 4HCKA 2K79A 2LC4A 3QIIA 3PIPA 3CCSQ 2FYKA 2RQUA 2COYA 3EFOB 5KH6A 3CCEQ 4A54A 3QSUA 3ER0A 3NHNA 2DXCA 2QG9B 1OX9A 3TCJA 2MWOA 1AEYA 4J7IA 3TSZA 1FMWA 3HPWA 5CQYA 1D1BA 1OPLA 3HRSA 3OY9A 3LWIA 1JJ2P 3PE0A 3P8BB 5FW9A 3EG1A 5IAYA 5HK0A 1VQ4T 2E12A 2CKKA 1Y96B 3OYBA 2DO3A 4BI8B 5CK9A 3QKJA 1PM3A 2QA4T 3P8DA 1LCKA 4M78C 2O01E 4PFPA 1PCXA 4M75E 3HFOA 1U3OA 2IVWA 1E6GA 4FT2A 4QQDA 2EKOA 5FU7B 1VUBA 2OTJQ 4C0FA 3KXTA 4RTUA 5C6SA 2RF0A 1K9MU 4E7KA 4F04B 1PSFA 2D0NA 2KRSA 2EYWA 2AKKA 4JJCA 3M53A 1ZSZC 2K3YA 3I5RA 4IIMA 3S6WA 3DLLA 1VQOT 2L5QA 4M77F 3EHRA 3G6ET 2DL5A 3JB9I 2DTIA 2CP7A 2EGAA 1MNEA 3G6EA 2M02A 1IB8A 2MIOA 1PKTA 3CPFA 4M77B 1K8AR 2X3XD 2VKNA 1OU9A 3Q1JA 3LYIA 3SDZA 3JCMd 4OMPA 4NS5A 4FCYA 2CT4A 2DZ9A 4JJNK 4GLKA 7AT1B 4M77D 4M78G 2J7IA 2JVVA 4M7AA 1YP5A 2FHDA 5GANh 1TWBA 2EAYA 4JZ3A 3WVEB 5HCKA 1YITQ 1LNXA 4JPBW 3I55Q 5IXFA 3LX7A 3JCMV 3CCLT 5GANe 3SEMA 5FWBA 3QXEB 2X35A 3CCLA 1QP2A 2F1LA 4LDVA 3NGPA 1PKSA 4AFQC 2JOYA 3VKIA 3VS4A 2DA9A 2ZAEA 2KGTA 3JB9H 4OP0A 3M59A 4RTXA 2KXCA 4EMGA 2VGMA 5GAN8 1CKBA 1M27C 2EYXA 2FEIA 4MZTA 2Y4YA 2ROTA 3CXCS 1BIAA 3CMEQ 1H641 1NYGA 1GBQA 4C8QF 5GAN5 4M7DD 3OMCA 3L2QA 4KH0B 5CKHA 8AT1B 3JCMh 4DEYA 2QQSA 4K11A 3PVLA 5KYYB 3JCMe 2DFUA 4C8QB 2DM1A 4BE2A 1T3SA 3M4YA 2RO0A 2EJ9A 4M77C 2QQBA 2K3BA 3REAB 4F7UF 1W1FA 3MHXA 3NTKA 1IHWA 2JM8A 4OB3B 4CC3A 2KVQG 4B6MA 1D0ZA 1YIJQ 4C8QD 2DF6A 1GL5A 2YLCA 2X4WA 4X9DA 1XTDA 4IUTA 4F7UB 1HXDA 2DX1A 4JZ4A 2R5AA 2O31A 3OS0A 4AFSC 1D09B 3IQLA 2FPEA 3J80E 3JSCA 1W70A 4M78E 3ZBDA 3MEUA 3NMZC 3X25B 1T3LA 4MZPA 4BDZA 2LCSA 2DL8A 4RCCA 1Q81U 2CUDA 4RTWA 3VS2A 1WXTA 1IO6A 2JNGA 1G5VA 1YCYA 2LJ3A 3C95A 2AZVA 4B9WA 3UDCA 4C0GA 3CPWA 3RKWA 2GF7A 1VIFA 1V76A 4M7DC 1YJWQ 2P0PA 3QPHA 1WXUA 4C5HA 2EGCA 1VQ6T 3EG0A 2BKDN 1M3BA 2C06A 4A63B 1AVZC 1VQ6A 3HSBA 4M77G 4L59A 2E4HA 4DBHA 1VYUA 1RL2A 1QWFA 1ZBXA 2HMAA 1QVFP 4F16A 3UPUA 1WGSA 3V7RA 3FLGA 3PGGA 1Z9ZA 3BDLA 1P92A 2K6DA 4C8QC 5GAOp 2DRKA 4E6RA 3GIBA 2KRMA 2B8AA 1YJ9Q 2L8DA 4JLGA 2M0YA 1QKWA 2JT4A 4PJOA 1JU5C 2RA2A 1AHJB 3LWHA 3S3NA 1SG5A 3HRTA 3UATA 3VJPA 2IIMA 2RB6A 3I56Q 1JBMA 3VYGA 1VQ9Q 3CMAQ 3OYIA 1M8VA 4FYXB 1FMVA 5IN1A 2CZ7B 4J6XA 1CSKA 4M7DG 2PU9B 1X2QA 4E7ZA 3CBMA 3TVTA 3LLRA 2HCKA 3EH2A 5CCAA 2L3PA 2DL3A 4CC4B 1WJSA 2GFUA 5CKEA 2QQ9A 3TREA 4D8KA 2C0OA 2F2WA 1FWZA 4QVDA 1RAGB 2CP3A 2FRWA 2LP5A 2LQNA 2E10A 2RJCA 1BIBA 4KBMB 2DD4A 3RKYA 3OYLA 2EQMA 1BI1A 3CD6Q 1QWEA 1T0JA 3A1PA 2PQWA 4C8QG 2JM9A 1JQQA 1VQ8T 4FYWB 1RABB 3OS2A 3CCQQ 1IZ6A 2ZPHB 2OX7A 1IGQA 4J83A 4C92F 2KEAA 1VQ5T 1KHCA 1N8RU 1Y7XA 4WF2A 1WX6A 1AOJA 1ZBJA 4XTZA 3OS5A 4RUGA 4CC7A 4F7UG 5A0LA 2DXUA 4KGZB 4C92B 3FJPA 3RBBB 4OVAA 1HD3A 2H3JA 2FRYA 4OB0B 3BDUA 3CCJQ 1RI0A 1K73U 2YRVA 1I5OB 1W6XA 4DBQA 3ASKA 3OW2S 3L2VA 2NUTA 1PWTA 1VQLQ 4C92D 5C0MA 4RTTA 2E5KA 2A3LA 2CP0A 3EG9B 3CPWP 3PT9A 1QVGA 1UUEA 3FC3A 2QGFB 3ME9A 4HT8A 2DETA 1M90C 2HEQA 4J9FA 2M1HA 5J39A 1Q86U 4Z89A 4FSSA 2O4XB 5KYNA 3U23A 1RAEB 2DIQA 2JMCA 1WPYA 1WFWA 3CCUT 2V8KA 1M3CA 3OMGA 1JB0E 4PLLA 3CCUA 1WJRA 1B34A 1WYXA 3EG2A 3FIFA 4EDUA 4C0DB 2VVKA 3VS5A 4XU0A 1N6AA 2E70A 2LMJA 2J06A 5LJ5d 1V29B 2XMFA 2E6NA 2L89A 2J05A 4MZMA 5KYWA 4UC4A 5CKFA 2YUPA 1VQNQ 2RQWA 2KT1A 2BE7D 4LDUA 3L2ZA 4M78A 5GAN3 2PNIA 1SRLA 1HK9A 2X4JA 4LDXA 3E2UA 2CH4A 4C8QE 4EMHA 1BBZA 5M9OA 4TVRA 2LT1A 2SEMA 1WHJA 3JB9F 2A37A 4Y91A 5GAMh 1XNIA 4RG8A 4C92C 2MAMA 4M75C 3A5ZB 1ZSZA 1BK2A 5GAMe 3QWXX 1PD0A 2FZKB 1N9SA 4F7UE 1WQ7A 2W10A 4PK4A 5GMKm 3CXCA 2DL4A 2PVGB 3V7SA 2P0QA 3EGDB 1AT1B 2GFAA 1QVPA 2DYBA 5D7UA 3LH0A 8ATCB 2CUBA 5FWCA 1ACMB 1X43A 3JB9D 1G8XA 2DBKA 3SWNC 5CKDA 2NUZA 4F14A 4JJDA 5LJ3j 1I07A 5LJ3f 1G3YA 1U5SA 1JRIA 3R6NA 3GBQA 4GBQA 3ZEHA 2QEXT 2CZ6B 1QCNA 2K3XA 1AWJA 2DJQA 4J9GA 3X28B 1UGSB 2QEXA 3RMQA 3CC4T 5GMKh 3ZL7C 4J6YA 1OZ3A 3P8HA 3CCRQ 3CC4A 3G71T 5A2QE 5GMKe 4C0DC 5KYXB 4IKFA 1QCOA 3NTHA 3G71A 1YFNA 2XDBA 1C6VX 2FPFA 4FYYB 3HHTB 4C92G 3C4SA 5I2SA 5CR2A 2MK5A 4M75G 3QZ5B 4J9BA 1X69A 2KSSA 3INZA 3PMTA 1OX8A 1KQ1A 1R0CB 4ZTJA 5GAN2 2DVJA 4BUGA 1K0XA 2RPNA 2FB7A 3GLXA 2HQXA 2KE9A 4J9EA 5L23A 3DKMA 3QO3A 4J7FA 1VQNT 4J9IA 1QVGP 4YTLA 1G3SA 3M0PA 4LUDA 3MEAA 1YJNA 1U1TA 1BI0A 1D0YA 3QHSA 1KG1A 2CZ0B 2CGHA 2GQVA 3LGFA 1RAAB 1KQSP 4GY5A 1PD1A 1PG5B 2LQKA 4JS5A 4PJMA 4M77A 4LDYA 5A0GA 1K8AU 4PFOA 1M90R 2X9HA 2VYTA 1YHQT 1VQ7Q 2VASA 3PIOA 1VQPT 1WZOA 3A8HB 1I8FA 1YHQA 1MUZA 3N5BB 2DTOA 2E5QA 5GMKl 3H6ZA 1ZX6A 1KD1C 4NL3A 1K4US 4NOYA 2D9TA 2HBWA 4PJLA 2DLPA 5KCHA 3CCMT 2LT4A 3OBYA 1WDXA 4N0AC 3CCMA 4DEXA 1VQMT 4BY6C 5EG2A 2YHTA 1VQMA 2K57A 1VQ4A 3BY7A 4LE9A 1OQKA 2K5LA 1E6HA 2ESWA 2RM4A 2KXDA 5CIUA 3V7CA 3V8KA 5CO7A 4M7DA 4C92E 1RLQC 2ZZDA 2QA4A 2CSIA 1D3BA 4DBRA 2X3WD 5GANd 3H9NA 4KRTA 2K4YA 2RHXA 2LNHB 4AG2C 3JRZA 2JTMA 4OF1A 1PNJA 5DY9A 4FW1A 3DB3A 4Z8AA 2OTLQ 2A7YA 3D7SB 4C8QA 2E1HA 1VQOA 4PJJA 5DLOA 4O6JA 2P4RA 2QTXA 4N4HA 4EIKA 1W4SA 1VQKT 3PMIA 4OGCA 1VQKA 1D0XA 2EJFA 3VS1A 2BUDA 4F7UA 4HXJA 2YRDA 2O9SA 3CCST 1JXOA 2QDYB 1SPKA 3CCSA 1SEMA 3OW2A 1A0NB 1O9SA 2PTKA 3CCET 2HSEB 2JMAA 3G1JA 3CCEA 4LNPA 2YT6A 3E19A 1W2BA 3RUXA 4CC2A 3X26B 1RLPC 4KGXB 4ESRA 2F2XA 2VGNA 9ATCB 4IUVA 2VC8A 1H3HA 2DEUA 5CKBA 1G2BA 2E64A 3QG1A 3FRNA 3A8OB 5FU7C 2VV5A 1WJQA 2XICA 1YWPA 2EQJA 1JJ2S 1I5LA 3EH1A 1S72Q 2JS0A 4HCBA 3EGUA 2G6FX 3MKDA 1BB9A 4C0ZA 1G83A 4ZNXA 4A4GA 1EZZB 2OTJT 4WCIA 5AT1B 4VUBA 2AIRB 2K9GA 3QDRB 3SHWA 2OTJA 1OV3A 1IREB 3OB9A 4OMQA 3EG3A 2M51A 2LX7A 2ZPFB 3WXMB 2HQEA 1Y57A 2KI7A 3VV0A 4NL2A 1VYTA 1UGVA 3KBGA 1AWOA 1TUGB 2LJ0A 1KD1R 2ZPBB 4DOVA 1QLYA 2QQAA 4FSXA 5GANj 4L6V5 3RNJA 5GANf 3OYJA 2QXFA 1Q82C 2E6ZA 1UHFA 2WSFE 3HRUA 1Y0MA 1PRLC 2HDAA 1K9AA 2COWA 3MCAB 4E7LA 1WHHA 4BD3A 5IHIA 4OGEA 2KYMA 4XU2A 3VS3A 1OEBA 1Q7YC 1NLPC 2EW3A 2M9UA 1ABQA 5D6WA 3EGXA 2KQWA 2IG0A 2FVUA 2CH4W 1YITT 3I55T 4MMKA 5ECAA 2K5IA 2FO0A 3H8ZA 1YITA 3QBYA 3I55A 3L42A 3DB4A 3CQTA 3NTIA 1PRMC 5AYFA 2KDSA 3A98A 1IXDA 3JCMf 3E9FA 1G3WA 4ELZC 2DL7A 1LPLA 1QMCA 4QVCA 2LJ1A 4C92A 3JCMW 2RK1A 3QJ6A 1SKUB 4M75A 4BI3A 3CMET 1GCQC 1NYFA 1N27A 2ZPGB 2H3EB 1W2BP 1AWWA 1GFCA 4KUIA 4B9XA 3EG9A 4XTUA 1KC8C 2BTTA 1BI2A 2B86A 3TSWA 1UGPB 1VIEA 1LOJA 4EMKB 4XAXB 3SWNA 1UTIA 2V26A 2EPDA 5FU6B 2M16A 1YNZA 2BZYA 4DOWA 2O4XA 2O9VA 1Q7YU 1X27A 2GCXA 4J8OA 1YIJT 3M0UA 1M2VB 3R6OA 5HK3A 2XKOC 1YI2Q 1YIJA 3TEEA 4ANJA 3CC7Q 2YXYA 4LN2A 5DLQE 1SF9A 3QYGB 3L1AA 4XQ3A 5KE2A 5I22A 2ED0A 2O88A 3JB9J 1JXMA 4JRQA 1WHMA 2JN0A 1D1AA 1NJIC 1C1AA 2JS2A 5LL6S 2PUKB 5I11A 4XK8E 3G4SQ 5IXBA 2DIGA 3E1SA 4PL6A 2JTFA 1VQ8A 1HYOA 1NPPA 3EHQA 1YJWT 2P4TA 4ZTFA 2XDPA 5EC7A 1YJWA 4BACA 1UE9A 1ARKA 4GLMA 1VQ5A 1BYMA 1SHGA 4XU1A 4KGVB 3CC2Q 1RI9A 4N4IA 3J7AF 3OSSC 4A4FA 3DLMA 3OQ5A 3EGDA 3VS0A 2NUPA 2CS7A 4LXCA 3H41A 3RKXA 3GF5A 1NEGA 1G3TA 2P84A 1N9RA 4EMKC 1Q82R 1YJ9T 5D6XA 5GAMd 2FL7A 4E7IA 1QVFS 1WA7A 1IHVA 4PJOF 3T9NA 4RTVA 1WNLA 2RHZA 1S1NA 2ABLA 1IGUA 2FG0A 1MMNA 3O8VA 3I56T 1X75C 1VQ9T 2CP2A 1TU0B 5KCOA 3QDFA 1Q7YR 3X24B 3CMAT 4DA4A 1M5Q1 3I56A 1MMGA 1K1ZA 5KYXA 1VQ9A 2OAWA 2XDDA 3CMAA 4PJOB 2HKNA 4N0AA 2VXEA 4E7JA 4PFZA 4DQ2A 1VA7A 5GJWB 4AFZC 3HKSA 1UGQB 3QUIA 1BI3A 1I81A 1XOVA 2ATCB 5J3BA 2QQRA 1Y71A 3V8JA 5LJ3h 4A4HA 4AG1C 1UB4A 2A36A 4XTWA 3CCVQ 2GNCA 4X34A 3OBWA 2L3QA 3OYYA 5LJ3e 1GCPA 3CD6T 1KQ2A 3RESA 1TG0A 3CD6A 5LJ3g 1WHGA 2F5TX 1GRIA 2YDLA 3CCQT 4E7HA 4QW2A 1ZLMA 3CCQA 2QASA 2DVEA 6AT1B 4ME7A 2DYIA 4QQ6A 3OYHA 5GJVB 1KC8R 2QK0A 2QGGA 3JV3A 2YUOA 4ZGJB 2YUQA 2AHJB 5KE3A 1JJ2A 2ECZA 2OAUA 2COZA 2QI2A 1M90U 2XIDA 5CQXA 2GBQA 3LGLA 3URGA 3EFOA 4BE1A 3UF4A 1QW1A 3CCJT 3M4GA 3PTAA 1M1KC 4P5NA 3CCJA 2K7AA 1ZUKA 2DPPB 4FYVB 1VQLT 5DM7R 4JRIA 2LQWA 2LCCA 1K0SA 2O2OA 2MWPA 3VUBA 2AK5A 1H3ZA 1AZGB 3MP8A 2JZ2A 3OYGA 1ZQ1A 2G3RA 1VYVA 4XTYA 4OMMA 1GFDA 4FL6A 4HVWA 3NFCA 3L2RA 1Y96A 1NJIR 2HBPA 1Q95G 1SHFA 4QT7A 5GAN6 3CPWS 4KUDK 3S3MA 3MEVA 4ATOA 3GNGA 3SD4A 2LTOA 1VQ4Q 5L8RE 4X1VA 3V8LA 2HKQB
chains in the Genus database with same CATH topology
3M0TA 1M8MA 2MCNA 2GTJA 1QKXA 3ULRB 2EVRA 2DNUA 2DMOA 1X6GA 3VS1A 1WXUA 2EGCA 3EG0A 1MV3A 2H8HA 2SRCA 4HXJA 1M3BA 2O9SA 1KIKA 4A63B 1JXOA 1AVZC 1QCFA 1SPKA 1VYUA 1SEMA 1UECA 1A0NB 1QWFA 2PTKA 4F16A 2JMAA 4LNPA 1PHTA 1UJYA 1Z9ZA 2YT6A 4CC2A 1RLPC 2K6DA 4ESRA 2F2XA 3O5ZA 4J9CA 2BZXA 1N5ZA 2CSQA 2PZ1A 2QDLA 2DRKA 2C0TA 4E6RA 1H3HA 2KRMA 2DBMA 1G2BA 2W0ZA 2VWFA 2M0YA 1QKWA 2JT4A 1EFNA 4J9HA 1JU5C 3UATA 2ENMA 2EKHA 2IIMA 2D8HA 1YWPA 1YCSB 2EBPA 3M0SA 1OOTA 4IIOA 2JS0A 2OJ2A 3EGUA 4D8DA 2G6FX 1CSKA 2JXBA 1BB9A 1WI7A 1G83A 3KFVA 4ZNXA 1TUDA 1X2QA 3I9QA 4WCIA 3VS7A 3M0RA 2K9GA 1I1JA 1SSHA 3TVTA 3VS6A 2HCKA 3SHWA 2L3PA 2CT3A 2DL3A 1OV3A 4CC4B 4OMQA 3EG3A 1UHCA 2RQVA 1WLPB 1UG1A 2M51A 2LX7A 4ORZA 4EIKA 4D8KA 4F17A 2C0OA 2KRNA 2F2WA 1M3AA 4RTYA 1Y57A 1MV0B 3THKA 2FRWA 2LP5A 2LZ6B 2LQNA 1VYTA 1RUWA 1QWEA 1UGVA 1T0JA 1AWOA 2EYYA 2LJ0A 2JM9A 1JQQA 1J3TA 2D8JA 2D1XA 1QLYA 4RTZA 2KT8A 3RNJA 1UHFA 2AZSA 2KEAA 1Y0MA 1PRLC 2L3SA 2HDAA 1H8KA 2J6FA 1K9AA 1GCQA 2KNBB 1WX6A 1AOJA 1ZBJA 5IHIA 4OMNA 1X6BA 2KYMA 4RUGA 2L2PA 3VS3A 4J9DA 4CC7A 1OEBA 1NLPC 2EW3A 1ABQA 4HVUA 1TUCA 3RBBB 2EGEA 1B07A 1HD3A 2ROLA 2CH4W 1NEBA 2FRYA 1I0CA 2AKLA 1KJWA 5ECAA 2FO0A 1W6XA 2EYZA 3VRZA 3PVQA 5IHNA 1PWTA 3CQTA 1JO8A 1ZSGA 4RTTA 2E5KA 2CDTA 2ED1A 2OI3A 1PRMC 4LUEA 1UUEA 2YSQA 1UFFA 3A98A 4R0KA 5IH2A 2MOXA 1CKAA 2HEQA 2DL7A 4J9FA 3LH5A 4Z89A 4FSSA 2LJ1A 3U23A 2JMCA 1WFWA 2JW4A 1M3CA 1GCQC 2DILA 1V1CA 1NYFA 4HVVA 2RMOA 1WYXA 3EG2A 2V1RA 1AWWA 3FJ5A 2VVKA 3VS5A 1GFCA 1FYNA 2LMJA 2J06A 1K76A 2BTTA 2XMFA 1E7OA 2J05A 2B86A 3TSWA 1Z9QA 4AFUC 2YUPA 2RQWA 2KT1A 4HCKA 2K79A 1UTIA 2EPDA 1YWOA 2RNAA 2PNIA 1SRLA 1YNZA 2BZYA 4OMOA 1NLOC 2CH4A 2RQUA 1BBZA 2O9VA 1X27A 3M0UA 1KSWA 2SEMA 1AWXA 1M30A 1WXBA 3QWYA 2A37A 3NHNA 4LN2A 1AEYA 2DRMA 3TSZA 1HJDA 2L0AA 1OPLA 1BK2A 3QWXX 5I22A 2DE0X 2ED0A 2GTOA 1AD5A 3M0QA 3PE0A 2O88A 2F2VA 5FW9A 3EG1A 1JXMA 1AZEA 2W10A 3I35A 4Z88A 1OPKA 2DL4A 2JS2A 5I11A 2DYBA 5IXBA 2A28A 1B3QA 2CUBA 5FWCA 3EHQA 1X43A 2DBKA 1LCKA 5EC7A 2NUZA 4F14A 4JJDA 1UE9A 2KBTA 1U3OA 1I07A 1E6GA 1U5SA 3R6NA 1ARKA 3GBQA 4GBQA 4GLMA 1AWJA 2DJQA 4J9GA 1SHGA 4RTUA 2K2MA 2RQTA 3ZL7C 1RI9A 2RF0A 1KFZA 3REBB 2D0NA 2KRSA 2EYWA 2AKKA 3VS0A 4JJCA 3H41A 3I5RA 4IIMA 2FPFA 3EHRA 1BU1A 1NEGA 2DL5A 1UDLA 2EGAA 1GBRA 2YUNA 2GQIA 4J9BA 1X69A 1WA7A 2MIOA 2DVJA 1PKTA 4RTVA 3H0IA 1S1NA 2ABLA 1U06A 2FG0A 1K0XA 2RPNA 2X3XD 2KE9A 4J9EA 5L23A 2VKNA 4J9IA 1K1ZA 1NM7A 2KROA 4OMPA 2BZ8A 3UA7A 2OAWA 2CT4A 3C0CA 3M0PA 4LUDA 2RQRA 1YN8A 2J7IA 1VA7A 5GJWB 4AFZC 1YP5A 4JZ3A 2A08A 5HCKA 1T0HA 1XOVA 4JPBW 5IXFA 3SEMA 5FWBA 4AG1C 2A36A 2GNCA 2L3QA 1WIEA 3NGPA 1GCPA 4Y92A 1PKSA 4AFQC 2KR3A 1TG0A 2J6KA 2DA9A 3VS4A 2KGTA 1JEGA 1MUZA 1ABOA 1GRIA 2YDLA 3I5SA 1ZLMA 4RTXA 2KXCA 1CKBA 1M27C 2EYXA 1SRMA 2FEIA 1ZX6A 2ROTA 1K4US 4OMLA 2HBWA 2CREA 2DLPA 1H92A 1NYGA 1GBQA 5GJVB 1NG2A 2KYBA 1WDXA 3JV3A 2YUOA 4DEXA 2YUQA 2ECZA 4M4ZA 5IHKA 2RN8A 4DEYA 2GBQA 4K11A 3PVLA 3UF4A 4LE9A 2DM1A 1E6HA 1X2KA 1ZUYA 2ESWA 2KXDA 1T3SA 1RLQC 2K3BA 2K7AA 1ZUKA 3REAB 1W1FA 2CSIA 3UA6A 2FPDA 2EQIA 2JM8A 2X3WD 4CC3A 2I0NA 4KRTA 2DF6A 2LQWA 1GL5A 2LNHB 4JJBA 4AG2C 1K0SA 2O2OA 2GGRA 2AK5A 1AZGB 1PNJA 2HSPA 1VYVA 3VRYA 1ZUUA 1FMKA 1HSQA 2V1QA 1UJ0A 4OMMA 2C0IA 2DX1A 1GFDA 4HVWA 4JZ4A 2O31A 3NPFA 4Z8AA 4AFSC 2NWMA 3IQLA 1SHFA 2FPEA 2JTEA 1W70A 4QT7A 3NMZC 1T3LA 2LCSA 2DL8A 2CUDA 4RTWA 3VS2A 2P4RA 1WXTA 3H0HA 1IO6A 2J6OA 2LJ3A 4X1VA 3H0FA 2AZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0T A;  1M8M A;  2MCN A;  2GTJ A;  1QKX A;  3ULR B;  2EVR A;  2DNU A;  2DMO A;  1X6G A;  3VS1 A;  1WXU A;  2EGC A;  3EG0 A;  1MV3 A;  2H8H A;  2SRC A;  4HXJ A;  1M3B A;  2O9S A;  1KIK A;  4A63 B;  1JXO A;  1AVZ C;  1QCF A;  1SPK A;  1VYU A;  1SEM A;  1UEC A;  1A0N B;  1QWF A;  2PTK A;  4F16 A;  2JMA A;  4LNP A;  1PHT A;  1UJY A;  1Z9Z A;  2YT6 A;  4CC2 A;  1RLP C;  2K6D A;  4ESR A;  2F2X A;  3O5Z A;  4J9C A;  2BZX A;  1N5Z A;  2CSQ A;  2PZ1 A;  2QDL A;  2DRK A;  2C0T A;  4E6R A;  1H3H A;  2KRM A;  2DBM A;  1G2B A;  2W0Z A;  2VWF A;  2M0Y A;  1QKW A;  2JT4 A;  1EFN A;  4J9H A;  1JU5 C;  3UAT A;  2ENM A;  2EKH A;  2IIM A;  2D8H A;  1YWP A;  1YCS B;  2EBP A;  3M0S A;  1OOT A;  4IIO A;  2JS0 A;  2OJ2 A;  3EGU A;  4D8D A;  2G6F X;  1CSK A;  2JXB A;  1BB9 A;  1WI7 A;  1G83 A;  3KFV A;  4ZNX A;  1TUD A;  1X2Q A;  3I9Q A;  4WCI A;  3VS7 A;  3M0R A;  2K9G A;  1I1J A;  1SSH A;  3TVT A;  3VS6 A;  2HCK A;  3SHW A;  2L3P A;  2CT3 A;  2DL3 A;  1OV3 A;  4CC4 B;  4OMQ A;  3EG3 A;  1UHC A;  2RQV A;  1WLP B;  1UG1 A;  2M51 A;  2LX7 A;  4ORZ A;  4EIK A;  4D8K A;  4F17 A;  2C0O A;  2KRN A;  2F2W A;  1M3A A;  4RTY A;  1Y57 A;  1MV0 B;  3THK A;  2FRW A;  2LP5 A;  2LZ6 B;  2LQN A;  1VYT A;  1RUW A;  1QWE A;  1UGV A;  1T0J A;  1AWO A;  2EYY A;  2LJ0 A;  2JM9 A;  1JQQ A;  1J3T A;  2D8J A;  2D1X A;  1QLY A;  4RTZ A;  2KT8 A;  3RNJ A;  1UHF A;  2AZS A;  2KEA A;  1Y0M A;  1PRL C;  2L3S A;  2HDA A;  1H8K A;  2J6F A;  1K9A A;  1GCQ A;  2KNB B;  1WX6 A;  1AOJ A;  1ZBJ A;  5IHI A;  4OMN A;  1X6B A;  2KYM A;  4RUG A;  2L2P A;  3VS3 A;  4J9D A;  4CC7 A;  1OEB A;  1NLP C;  2EW3 A;  1ABQ A;  4HVU A;  1TUC A;  3RBB B;  2EGE A;  1B07 A;  1HD3 A;  2ROL A;  2CH4 W;  1NEB A;  2FRY A;  1I0C A;  2AKL A;  1KJW A;  5ECA A;  2FO0 A;  1W6X A;  2EYZ A;  3VRZ A;  3PVQ A;  5IHN A;  1PWT A;  3CQT A;  1JO8 A;  1ZSG A;  4RTT A;  2E5K A;  2CDT A;  2ED1 A;  2OI3 A;  1PRM C;  4LUE A;  1UUE A;  2YSQ A;  1UFF A;  3A98 A;  4R0K A;  5IH2 A;  2MOX A;  1CKA A;  2HEQ A;  2DL7 A;  4J9F A;  3LH5 A;  4Z89 A;  4FSS A;  2LJ1 A;  3U23 A;  2JMC A;  1WFW A;  2JW4 A;  1M3C A;  1GCQ C;  2DIL A;  1V1C A;  1NYF A;  4HVV A;  2RMO A;  1WYX A;  3EG2 A;  2V1R A;  1AWW A;  3FJ5 A;  2VVK A;  3VS5 A;  1GFC A;  1FYN A;  2LMJ A;  2J06 A;  1K76 A;  2BTT A;  2XMF A;  1E7O A;  2J05 A;  2B86 A;  3TSW A;  1Z9Q A;  4AFU C;  2YUP A;  2RQW A;  2KT1 A;  4HCK A;  2K79 A;  1UTI A;  2EPD A;  1YWO A;  2RNA A;  2PNI A;  1SRL A;  1YNZ A;  2BZY A;  4OMO A;  1NLO C;  2CH4 A;  2RQU A;  1BBZ A;  2O9V A;  1X27 A;  3M0U A;  1KSW A;  2SEM A;  1AWX A;  1M30 A;  1WXB A;  3QWY A;  2A37 A;  3NHN A;  4LN2 A;  1AEY A;  2DRM A;  3TSZ A;  1HJD A;  2L0A A;  1OPL A;  1BK2 A;  3QWX X;  5I22 A;  2DE0 X;  2ED0 A;  2GTO A;  1AD5 A;  3M0Q A;  3PE0 A;  2O88 A;  2F2V A;  5FW9 A;  3EG1 A;  1JXM A;  1AZE A;  2W10 A;  3I35 A;  4Z88 A;  1OPK A;  2DL4 A;  2JS2 A;  5I11 A;  2DYB A;  5IXB A;  2A28 A;  1B3Q A;  2CUB A;  5FWC A;  3EHQ A;  1X43 A;  2DBK A;  1LCK A;  5EC7 A;  2NUZ A;  4F14 A;  4JJD A;  1UE9 A;  2KBT A;  1U3O A;  1I07 A;  1E6G A;  1U5S A;  3R6N A;  1ARK A;  3GBQ A;  4GBQ A;  4GLM A;  1AWJ A;  2DJQ A;  4J9G A;  1SHG A;  4RTU A;  2K2M A;  2RQT A;  3ZL7 C;  1RI9 A;  2RF0 A;  1KFZ A;  3REB B;  2D0N A;  2KRS A;  2EYW A;  2AKK A;  3VS0 A;  4JJC A;  3H41 A;  3I5R A;  4IIM A;  2FPF A;  3EHR A;  1BU1 A;  1NEG A;  2DL5 A;  1UDL A;  2EGA A;  1GBR A;  2YUN A;  2GQI A;  4J9B A;  1X69 A;  1WA7 A;  2MIO A;  2DVJ A;  1PKT A;  4RTV A;  3H0I A;  1S1N A;  2ABL A;  1U06 A;  2FG0 A;  1K0X A;  2RPN A;  2X3X D;  2KE9 A;  4J9E A;  5L23 A;  2VKN A;  4J9I A;  1K1Z A;  1NM7 A;  2KRO A;  4OMP A;  2BZ8 A;  3UA7 A;  2OAW A;  2CT4 A;  3C0C A;  3M0P A;  4LUD A;  2RQR A;  1YN8 A;  2J7I A;  1VA7 A;  5GJW B;  4AFZ C;  1YP5 A;  4JZ3 A;  2A08 A;  5HCK A;  1T0H A;  1XOV A;  4JPB W;  5IXF A;  3SEM A;  5FWB A;  4AG1 C;  2A36 A;  2GNC A;  2L3Q A;  1WIE A;  3NGP A;  1GCP A;  4Y92 A;  1PKS A;  4AFQ C;  2KR3 A;  1TG0 A;  2J6K A;  2DA9 A;  3VS4 A;  2KGT A;  1JEG A;  1MUZ A;  1ABO A;  1GRI A;  2YDL A;  3I5S A;  1ZLM A;  4RTX A;  2KXC A;  1CKB A;  1M27 C;  2EYX A;  1SRM A;  2FEI A;  1ZX6 A;  2ROT A;  1K4U S;  4OML A;  2HBW A;  2CRE A;  2DLP A;  1H92 A;  1NYG A;  1GBQ A;  5GJV B;  1NG2 A;  2KYB A;  1WDX A;  3JV3 A;  2YUO A;  4DEX A;  2YUQ A;  2ECZ A;  4M4Z A;  5IHK A;  2RN8 A;  4DEY A;  2GBQ A;  4K11 A;  3PVL A;  3UF4 A;  4LE9 A;  2DM1 A;  1E6H A;  1X2K A;  1ZUY A;  2ESW A;  2KXD A;  1T3S A;  1RLQ C;  2K3B A;  2K7A A;  1ZUK A;  3REA B;  1W1F A;  2CSI A;  3UA6 A;  2FPD A;  2EQI A;  2JM8 A;  2X3W D;  4CC3 A;  2I0N A;  4KRT A;  2DF6 A;  2LQW A;  1GL5 A;  2LNH B;  4JJB A;  4AG2 C;  1K0S A;  2O2O A;  2GGR A;  2AK5 A;  1AZG B;  1PNJ A;  2HSP A;  1VYV A;  3VRY A;  1ZUU A;  1FMK A;  1HSQ A;  2V1Q A;  1UJ0 A;  4OMM A;  2C0I A;  2DX1 A;  1GFD A;  4HVW A;  4JZ4 A;  2O31 A;  3NPF A;  4Z8A A;  4AFS C;  2NWM A;  3IQL A;  1SHF A;  2FPE A;  2JTE A;  1W70 A;  4QT7 A;  3NMZ C;  1T3L A;  2LCS A;  2DL8 A;  2CUD A;  4RTW A;  3VS2 A;  2P4R A;  1WXT A;  3H0H A;  1IO6 A;  2J6O A;  2LJ3 A;  4X1V A;  3H0F A;  2AZV A; 
#chains in the Genus database with same CATH topology
 1PC0 A;  3M0T A;  1M8M A;  2AT1 B;  2GTJ A;  5GAM j;  4RG2 A;  1QKX A;  1DJ7 B;  2EVR A;  1TSF A;  5GAM f;  2QA4 Q;  1B34 B;  2DNU A;  3FB9 A;  2DMO A;  1X6G A;  4J6W A;  2H8H A;  2SRC A;  1VQN A;  5A0D A;  1QCF A;  2DXT A;  3PFS A;  2JUF A;  3F70 A;  4ZN1 A;  4RCB A;  5I21 A;  2XI9 A;  4O5V A;  2DER A;  2K5F A;  4J5Y A;  1BCO A;  4J9C A;  2BZX A;  3M54 A;  2CSQ A;  3S3O A;  5LJ5 j;  3OYF A;  2PZ1 A;  4IUU A;  2QDL A;  2RD1 A;  3G6E Q;  2F69 A;  5LJ5 f;  2DBM A;  4HCC A;  3C12 A;  3MPU B;  3J81 E;  2VWF A;  5GMK j;  2HL5 C;  4FT4 A;  4AT1 B;  4PJN A;  1EFN A;  4D6W A;  1ZSZ B;  4J9H A;  1K9M C;  4KUL A;  2FZC B;  1VQP A;  2ENM A;  2EKH A;  1ZA1 B;  4JDS A;  4RMO A;  1YCS B;  3AT1 B;  4IIO A;  1OOT A;  5GAN 4;  4WTO B;  2OJ2 A;  1BKB A;  2EIF A;  2JXB A;  3KFV A;  3HFN A;  1TUD A;  2HL3 A;  2V8I A;  4C5I A;  3I9Q A;  2RHY A;  2RJD A;  4FU6 A;  2CP6 A;  3VS7 A;  3M0R A;  5GAO q;  1I1J A;  1SSH A;  3VS6 A;  2LX9 A;  3CCR T;  1F1B B;  3GP8 A;  2CT3 A;  2EYQ A;  4FIB A;  3OYK A;  3AHU A;  2KAF A;  1UGR B;  1WLP B;  1UG1 A;  2RQV A;  4F17 A;  4ORZ A;  3CCL Q;  3CCR A;  2MPX C;  1EIF A;  4RTY A;  1M3A A;  5KYU B;  3JB9 G;  3JCM P;  1MV0 B;  3CXC P;  3RIR A;  2XG8 D;  1TXQ A;  2EYY A;  2YRC A;  5FRN A;  3M5A A;  2EFI A;  2A0F B;  5GAO n;  5HKC A;  4RTZ A;  2QAZ A;  4HT9 A;  2WSE E;  5D6Y A;  2L3S A;  2J6F A;  5KYY A;  2QTV A;  1TH7 A;  1GCQ A;  4XU3 A;  2WAC A;  4BDY A;  4OMN A;  1X6B A;  4EPC A;  2L2P A;  4J9D A;  4ELY C;  3QZ9 B;  1M1K R;  5GAO m;  3BW1 A;  4PJO E;  2EGE A;  1B07 A;  4LDW A;  2DXB A;  1KD1 U;  1KJW A;  1OZ2 A;  1QVG S;  3PVQ A;  4OB1 B;  4BB7 A;  1KHI A;  3OYD A;  4Z02 A;  1JO8 A;  4A53 A;  4LUE A;  5GAN 7;  1VQ7 T;  3SB2 A;  2XK0 A;  1QP3 A;  2MOX A;  5IH2 A;  1VQ7 A;  2EWN A;  1CKA A;  1M1F A;  1VOM A;  1KQS S;  2HD0 A;  1QVF A;  4R56 A;  2DIL A;  2DK3 A;  2RMO A;  2R57 A;  1U1S A;  2V1R A;  3GPL A;  2NYS A;  3L2W A;  2ZGW A;  1NBE B;  1WQW A;  3EFS A;  3HP9 A;  5HY6 A;  3RER A;  2HQH A;  5CAI A;  1Z9Q A;  4M7D F;  3JCM c;  4OMF B;  1VQ6 Q;  1YWO A;  2RNA A;  4QQG A;  5GAN g;  4OMO A;  1NLO C;  4RKU E;  1KSW A;  1Q81 C;  1OI1 A;  4V2S A;  1AWX A;  1MMD A;  1M30 A;  2VB6 A;  2Z0W A;  3E9G A;  4R55 A;  4M7D B;  1WXB A;  3QWY A;  3TU4 K;  3JAM E;  2X4X A;  1D3B B;  2DRM A;  1OYX A;  5I2M A;  1HJD A;  2L0A A;  3OYA A;  2OTL T;  2R58 A;  2DTH A;  3X20 B;  4ZN3 A;  1K9M R;  1R0B G;  2DE0 X;  2GTO A;  1AD5 A;  3M0Q A;  3OYN A;  2OTL A;  2F2V A;  1AZE A;  1X6O A;  3I35 A;  3QYH B;  1D1C A;  1OPK A;  4QKU A;  4Z88 A;  4EMK A;  3JCM b;  2L3R A;  5FLX E;  1RAI B;  2DZC A;  2E65 A;  2BE9 B;  1EX4 A;  2RI5 A;  4N4G A;  3C94 A;  2A28 A;  1B3Q A;  1X01 A;  1C0M A;  1M2V A;  1B7T A;  4Q5W A;  3JCM g;  4MDW A;  5GAO l;  2KBT A;  1XQH A;  1M2O A;  2RHI A;  3OA6 A;  2BIV A;  2PVO B;  2CYZ B;  2K2M A;  2RQT A;  3LW5 E;  1KFZ A;  3REB B;  4M7A F;  1YBY A;  2RI3 A;  4XTV A;  2DD5 A;  1WHK A;  2EQK A;  2IPO B;  1BU1 A;  2JJ9 A;  2KY9 A;  2CZ1 B;  1UDL A;  2HAX A;  4M7A B;  1GBR A;  2YUN A;  2GQI A;  4HCZ A;  2PVD B;  1I4K 1;  1VQ8 Q;  4LD6 A;  2RH2 A;  4Y28 E;  4ZGD B;  3H0I A;  1U06 A;  1ZHI A;  1WHL A;  4M7A D;  1VQ5 Q;  3M55 A;  1NM7 A;  2KRO A;  3OW2 P;  1S72 T;  2BZ8 A;  3UA7 A;  2ZPE B;  3C0C A;  3FEO A;  3SFM A;  1S72 A;  2RQR A;  1YN8 A;  3CME A;  3MP1 A;  2LNV A;  3MET A;  1Q82 U;  2A08 A;  1T0H A;  3G7Z A;  3A8G B;  3MJX A;  1LJO A;  2X51 A;  1GXI E;  1RAC B;  1IRX A;  1N8R C;  1KK7 A;  1WIE A;  4BE0 A;  4Y92 A;  3M56 A;  1FXX A;  4MML A;  2KR3 A;  1M9S A;  4L5G A;  4IUQ A;  2J6K A;  1JEG A;  4PNO A;  1ABO A;  3I5S A;  4E7S A;  5GMK i;  5IT9 E;  4A4K A;  2I2L A;  1SRM A;  3EFR A;  1RAH B;  1XJW B;  1PSE A;  4OML A;  1K73 C;  3CCU Q;  2CRE A;  1H92 A;  1NG2 A;  2NLU A;  2KYB A;  3TQ7 P;  4CI0 C;  3UT1 A;  4E2F B;  1SSF A;  1R8O B;  3PNW C;  4M4Z A;  4M7A C;  2HZY A;  5IHK A;  2RN8 A;  1LVK A;  3OYC A;  4FW2 A;  2D0Q B;  1ZUY A;  1X2K A;  3UWN A;  1Q86 C;  4JS4 A;  5FRO A;  1Q81 R;  2MMP A;  3VYH B;  3CBP A;  3ZFJ A;  3KUF A;  3UA6 A;  2FPD A;  2EQI A;  2ZPI B;  2E3I A;  2RJE A;  1R77 A;  3EGX B;  2I0N A;  3MP6 A;  3QJY A;  4JJB A;  2E3H A;  3HL8 A;  2GGR A;  2DAQ A;  1KC8 U;  5LJ3 d;  3MEW A;  2HSP A;  2QYZ A;  3VRY A;  1ZUU A;  1FMK A;  1HSQ A;  2V1Q A;  1UJ0 A;  2C0I A;  2DJZ A;  3RR6 A;  3NPF A;  2NWM A;  4M75 F;  3WVD B;  2P0K A;  3OSV A;  1TS9 A;  3HTR A;  4HA8 A;  4M77 E;  2JTE A;  4OB2 B;  2DEQ A;  3JCM Q;  2XD0 A;  2V8J A;  4XTX A;  5FU6 C;  1FX7 A;  3H0H A;  2J6O A;  2VXF A;  3OYE A;  3H0F A;  1YJ9 A;  4II1 A;  4M75 B;  2MCN A;  2LRQ A;  3GNF B;  3ULR B;  2MI6 A;  1MGQ A;  4M7A G;  2LVM A;  2HNI A;  2KMT A;  1MV3 A;  4IUR A;  2EQU A;  1KIK A;  1U8R A;  2QEX Q;  4M75 D;  2WSC E;  1W2B S;  2RK2 A;  4KT0 E;  1NJI U;  1UEC A;  3CC4 Q;  1RAD B;  3GOX A;  4CRI A;  5GAO r;  1UEB A;  1YI2 T;  2E41 A;  3SWN B;  3G71 Q;  1PHT A;  1UJY A;  3CC7 T;  1YI2 A;  1QQJ A;  4PJO D;  3O5Z A;  3CC7 A;  4M7D E;  1N5Z A;  2LDM A;  1KQS A;  2C0T A;  1MND A;  2W0Z A;  2ZCF B;  2RI2 A;  4BI4 A;  2R5M A;  2FZG B;  3G4S T;  2CP5 A;  3M58 A;  3G4S A;  4JLI A;  3BE3 A;  2D8H A;  3CEY A;  2EBP A;  3M9Q A;  5J26 A;  3JCM J;  3M0S A;  4JRK A;  1YJN Q;  1M4Z A;  4KH1 B;  4D8D A;  3EAE A;  1WI7 A;  2XU8 A;  1OUL A;  2YLB A;  4LD9 K;  3CC2 T;  2Y4X A;  4C5E A;  3VUZ A;  1TTH B;  3CC2 A;  1N8R R;  4E47 A;  4ZGE B;  1UHC A;  4X9C A;  3A8L B;  3RMS A;  2KRN A;  2Y90 A;  3BFM A;  4IUP A;  2KK4 A;  2K2V A;  1MMA A;  3RDV A;  1OU8 A;  3THK A;  3JCM X;  2LZ6 B;  2EJG A;  4PLI A;  2LQ8 A;  5GAM g;  2MF2 A;  2VUB A;  1RUW A;  2RHU A;  1YHQ Q;  2RJF A;  1VQL A;  1VQP Q;  2NUP B;  2LCL A;  1K73 R;  1J3T A;  4PJO C;  2D8J A;  2D1X A;  1O75 A;  2MYS A;  2YWW A;  4DBF A;  1NE8 A;  4MDX A;  2KT8 A;  2X4Y A;  4M7A E;  2NUT B;  3L2U A;  2AZS A;  4QVZ A;  5FRM A;  1H8K A;  1NZ9 A;  5LJ5 h;  1Y07 A;  3CCM Q;  3M57 A;  1K8A C;  2KNB B;  5LJ5 e;  5KYU A;  1NPR A;  1Q86 R;  1VQM Q;  1MHN A;  5CVI A;  5LJ5 g;  4HVU A;  4JRP A;  1TUC A;  4HKE A;  3MO8 A;  2ROL A;  1M1G A;  1NEB A;  1I0C A;  2AKL A;  3OYM A;  4FM4 B;  3VRZ A;  2EYZ A;  4M78 F;  3OS1 A;  5IHN A;  3CCV T;  3VU3 C;  4BY6 B;  1ZSG A;  2CDT A;  2ED1 A;  2OI3 A;  3CCV A;  3A8M B;  2YSQ A;  2DKG A;  1UFF A;  5KYW B;  4R0K A;  1ZA2 B;  1BCM A;  4C5G A;  1RAF B;  4M78 B;  3LH5 A;  4PJO G;  1M1K U;  3CBO A;  3FDR A;  2PUO B;  1VQO Q;  2JW4 A;  1YJN T;  2D6F A;  2F5K A;  1V1C A;  4HVV A;  4M78 D;  4A4E A;  3FJ5 A;  1FYN A;  4AMC A;  2XHC A;  1K76 A;  1VQK Q;  1TOV A;  4JUV A;  1E7O A;  4PKC C;  4AFU C;  2M0O A;  4HCK A;  2K79 A;  2LC4 A;  3QII A;  3PIP A;  3CCS Q;  2FYK A;  2RQU A;  2COY A;  3EFO B;  5KH6 A;  3CCE Q;  4A54 A;  3QSU A;  3ER0 A;  3NHN A;  2DXC A;  2QG9 B;  1OX9 A;  3TCJ A;  2MWO A;  1AEY A;  4J7I A;  3TSZ A;  1FMW A;  3HPW A;  5CQY A;  1D1B A;  1OPL A;  3HRS A;  3OY9 A;  3LWI A;  1JJ2 P;  3PE0 A;  3P8B B;  5FW9 A;  3EG1 A;  5IAY A;  5HK0 A;  1VQ4 T;  2E12 A;  2CKK A;  1Y96 B;  3OYB A;  2DO3 A;  4BI8 B;  5CK9 A;  3QKJ A;  1PM3 A;  2QA4 T;  3P8D A;  1LCK A;  4M78 C;  2O01 E;  4PFP A;  1PCX A;  4M75 E;  3HFO A;  1U3O A;  2IVW A;  1E6G A;  4FT2 A;  4QQD A;  2EKO A;  5FU7 B;  1VUB A;  2OTJ Q;  4C0F A;  3KXT A;  4RTU A;  5C6S A;  2RF0 A;  1K9M U;  4E7K A;  4F04 B;  1PSF A;  2D0N A;  2KRS A;  2EYW A;  2AKK A;  4JJC A;  3M53 A;  1ZSZ C;  2K3Y A;  3I5R A;  4IIM A;  3S6W A;  3DLL A;  1VQO T;  2L5Q A;  4M77 F;  3EHR A;  3G6E T;  2DL5 A;  3JB9 I;  2DTI A;  2CP7 A;  2EGA A;  1MNE A;  3G6E A;  2M02 A;  1IB8 A;  2MIO A;  1PKT A;  3CPF A;  4M77 B;  1K8A R;  2X3X D;  2VKN A;  1OU9 A;  3Q1J A;  3LYI A;  3SDZ A;  3JCM d;  4OMP A;  4NS5 A;  4FCY A;  2CT4 A;  2DZ9 A;  4JJN K;  4GLK A;  7AT1 B;  4M77 D;  4M78 G;  2J7I A;  2JVV A;  4M7A A;  1YP5 A;  2FHD A;  5GAN h;  1TWB A;  2EAY A;  4JZ3 A;  3WVE B;  5HCK A;  1YIT Q;  1LNX A;  4JPB W;  3I55 Q;  5IXF A;  3LX7 A;  3JCM V;  3CCL T;  5GAN e;  3SEM A;  5FWB A;  3QXE B;  2X35 A;  3CCL A;  1QP2 A;  2F1L A;  4LDV A;  3NGP A;  1PKS A;  4AFQ C;  2JOY A;  3VKI A;  3VS4 A;  2DA9 A;  2ZAE A;  2KGT A;  3JB9 H;  4OP0 A;  3M59 A;  4RTX A;  2KXC A;  4EMG A;  2VGM A;  5GAN 8;  1CKB A;  1M27 C;  2EYX A;  2FEI A;  4MZT A;  2Y4Y A;  2ROT A;  3CXC S;  1BIA A;  3CME Q;  1H64 1;  1NYG A;  1GBQ A;  4C8Q F;  5GAN 5;  4M7D D;  3OMC A;  3L2Q A;  4KH0 B;  5CKH A;  8AT1 B;  3JCM h;  4DEY A;  2QQS A;  4K11 A;  3PVL A;  5KYY B;  3JCM e;  2DFU A;  4C8Q B;  2DM1 A;  4BE2 A;  1T3S A;  3M4Y A;  2RO0 A;  2EJ9 A;  4M77 C;  2QQB A;  2K3B A;  3REA B;  4F7U F;  1W1F A;  3MHX A;  3NTK A;  1IHW A;  2JM8 A;  4OB3 B;  4CC3 A;  2KVQ G;  4B6M A;  1D0Z A;  1YIJ Q;  4C8Q D;  2DF6 A;  1GL5 A;  2YLC A;  2X4W A;  4X9D A;  1XTD A;  4IUT A;  4F7U B;  1HXD A;  2DX1 A;  4JZ4 A;  2R5A A;  2O31 A;  3OS0 A;  4AFS C;  1D09 B;  3IQL A;  2FPE A;  3J80 E;  3JSC A;  1W70 A;  4M78 E;  3ZBD A;  3MEU A;  3NMZ C;  3X25 B;  1T3L A;  4MZP A;  4BDZ A;  2LCS A;  2DL8 A;  4RCC A;  1Q81 U;  2CUD A;  4RTW A;  3VS2 A;  1WXT A;  1IO6 A;  2JNG A;  1G5V A;  1YCY A;  2LJ3 A;  3C95 A;  2AZV A;  4B9W A;  3UDC A;  4C0G A;  3CPW A;  3RKW A;  2GF7 A;  1VIF A;  1V76 A;  4M7D C;  1YJW Q;  2P0P A;  3QPH A;  1WXU A;  4C5H A;  2EGC A;  1VQ6 T;  3EG0 A;  2BKD N;  1M3B A;  2C06 A;  4A63 B;  1AVZ C;  1VQ6 A;  3HSB A;  4M77 G;  4L59 A;  2E4H A;  4DBH A;  1VYU A;  1RL2 A;  1QWF A;  1ZBX A;  2HMA A;  1QVF P;  4F16 A;  3UPU A;  1WGS A;  3V7R A;  3FLG A;  3PGG A;  1Z9Z A;  3BDL A;  1P92 A;  2K6D A;  4C8Q C;  5GAO p;  2DRK A;  4E6R A;  3GIB A;  2KRM A;  2B8A A;  1YJ9 Q;  2L8D A;  4JLG A;  2M0Y A;  1QKW A;  2JT4 A;  4PJO A;  1JU5 C;  2RA2 A;  1AHJ B;  3LWH A;  3S3N A;  1SG5 A;  3HRT A;  3UAT A;  3VJP A;  2IIM A;  2RB6 A;  3I56 Q;  1JBM A;  3VYG A;  1VQ9 Q;  3CMA Q;  3OYI A;  1M8V A;  4FYX B;  1FMV A;  5IN1 A;  2CZ7 B;  4J6X A;  1CSK A;  4M7D G;  2PU9 B;  1X2Q A;  4E7Z A;  3CBM A;  3TVT A;  3LLR A;  2HCK A;  3EH2 A;  5CCA A;  2L3P A;  2DL3 A;  4CC4 B;  1WJS A;  2GFU A;  5CKE A;  2QQ9 A;  3TRE A;  4D8K A;  2C0O A;  2F2W A;  1FWZ A;  4QVD A;  1RAG B;  2CP3 A;  2FRW A;  2LP5 A;  2LQN A;  2E10 A;  2RJC A;  1BIB A;  4KBM B;  2DD4 A;  3RKY A;  3OYL A;  2EQM A;  1BI1 A;  3CD6 Q;  1QWE A;  1T0J A;  3A1P A;  2PQW A;  4C8Q G;  2JM9 A;  1JQQ A;  1VQ8 T;  4FYW B;  1RAB B;  3OS2 A;  3CCQ Q;  1IZ6 A;  2ZPH B;  2OX7 A;  1IGQ A;  4J83 A;  4C92 F;  2KEA A;  1VQ5 T;  1KHC A;  1N8R U;  1Y7X A;  4WF2 A;  1WX6 A;  1AOJ A;  1ZBJ A;  4XTZ A;  3OS5 A;  4RUG A;  4CC7 A;  4F7U G;  5A0L A;  2DXU A;  4KGZ B;  4C92 B;  3FJP A;  3RBB B;  4OVA A;  1HD3 A;  2H3J A;  2FRY A;  4OB0 B;  3BDU A;  3CCJ Q;  1RI0 A;  1K73 U;  2YRV A;  1I5O B;  1W6X A;  4DBQ A;  3ASK A;  3OW2 S;  3L2V A;  2NUT A;  1PWT A;  1VQL Q;  4C92 D;  5C0M A;  4RTT A;  2E5K A;  2A3L A;  2CP0 A;  3EG9 B;  3CPW P;  3PT9 A;  1QVG A;  1UUE A;  3FC3 A;  2QGF B;  3ME9 A;  4HT8 A;  2DET A;  1M90 C;  2HEQ A;  4J9F A;  2M1H A;  5J39 A;  1Q86 U;  4Z89 A;  4FSS A;  2O4X B;  5KYN A;  3U23 A;  1RAE B;  2DIQ A;  2JMC A;  1WPY A;  1WFW A;  3CCU T;  2V8K A;  1M3C A;  3OMG A;  1JB0 E;  4PLL A;  3CCU A;  1WJR A;  1B34 A;  1WYX A;  3EG2 A;  3FIF A;  4EDU A;  4C0D B;  2VVK A;  3VS5 A;  4XU0 A;  1N6A A;  2E70 A;  2LMJ A;  2J06 A;  5LJ5 d;  1V29 B;  2XMF A;  2E6N A;  2L89 A;  2J05 A;  4MZM A;  5KYW A;  4UC4 A;  5CKF A;  2YUP A;  1VQN Q;  2RQW A;  2KT1 A;  2BE7 D;  4LDU A;  3L2Z A;  4M78 A;  5GAN 3;  2PNI A;  1SRL A;  1HK9 A;  2X4J A;  4LDX A;  3E2U A;  2CH4 A;  4C8Q E;  4EMH A;  1BBZ A;  5M9O A;  4TVR A;  2LT1 A;  2SEM A;  1WHJ A;  3JB9 F;  2A37 A;  4Y91 A;  5GAM h;  1XNI A;  4RG8 A;  4C92 C;  2MAM A;  4M75 C;  3A5Z B;  1ZSZ A;  1BK2 A;  5GAM e;  3QWX X;  1PD0 A;  2FZK B;  1N9S A;  4F7U E;  1WQ7 A;  2W10 A;  4PK4 A;  5GMK m;  3CXC A;  2DL4 A;  2PVG B;  3V7S A;  2P0Q A;  3EGD B;  1AT1 B;  2GFA A;  1QVP A;  2DYB A;  5D7U A;  3LH0 A;  8ATC B;  2CUB A;  5FWC A;  1ACM B;  1X43 A;  3JB9 D;  1G8X A;  2DBK A;  3SWN C;  5CKD A;  2NUZ A;  4F14 A;  4JJD A;  5LJ3 j;  1I07 A;  5LJ3 f;  1G3Y A;  1U5S A;  1JRI A;  3R6N A;  3GBQ A;  4GBQ A;  3ZEH A;  2QEX T;  2CZ6 B;  1QCN A;  2K3X A;  1AWJ A;  2DJQ A;  4J9G A;  3X28 B;  1UGS B;  2QEX A;  3RMQ A;  3CC4 T;  5GMK h;  3ZL7 C;  4J6Y A;  1OZ3 A;  3P8H A;  3CCR Q;  3CC4 A;  3G71 T;  5A2Q E;  5GMK e;  4C0D C;  5KYX B;  4IKF A;  1QCO A;  3NTH A;  3G71 A;  1YFN A;  2XDB A;  1C6V X;  2FPF A;  4FYY B;  3HHT B;  4C92 G;  3C4S A;  5I2S A;  5CR2 A;  2MK5 A;  4M75 G;  3QZ5 B;  4J9B A;  1X69 A;  2KSS A;  3INZ A;  3PMT A;  1OX8 A;  1KQ1 A;  1R0C B;  4ZTJ A;  5GAN 2;  2DVJ A;  4BUG A;  1K0X A;  2RPN A;  2FB7 A;  3GLX A;  2HQX A;  2KE9 A;  4J9E A;  5L23 A;  3DKM A;  3QO3 A;  4J7F A;  1VQN T;  4J9I A;  1QVG P;  4YTL A;  1G3S A;  3M0P A;  4LUD A;  3MEA A;  1YJN A;  1U1T A;  1BI0 A;  1D0Y A;  3QHS A;  1KG1 A;  2CZ0 B;  2CGH A;  2GQV A;  3LGF A;  1RAA B;  1KQS P;  4GY5 A;  1PD1 A;  1PG5 B;  2LQK A;  4JS5 A;  4PJM A;  4M77 A;  4LDY A;  5A0G A;  1K8A U;  4PFO A;  1M90 R;  2X9H A;  2VYT A;  1YHQ T;  1VQ7 Q;  2VAS A;  3PIO A;  1VQP T;  1WZO A;  3A8H B;  1I8F A;  1YHQ A;  1MUZ A;  3N5B B;  2DTO A;  2E5Q A;  5GMK l;  3H6Z A;  1ZX6 A;  1KD1 C;  4NL3 A;  1K4U S;  4NOY A;  2D9T A;  2HBW A;  4PJL A;  2DLP A;  5KCH A;  3CCM T;  2LT4 A;  3OBY A;  1WDX A;  4N0A C;  3CCM A;  4DEX A;  1VQM T;  4BY6 C;  5EG2 A;  2YHT A;  1VQM A;  2K57 A;  1VQ4 A;  3BY7 A;  4LE9 A;  1OQK A;  2K5L A;  1E6H A;  2ESW A;  2RM4 A;  2KXD A;  5CIU A;  3V7C A;  3V8K A;  5CO7 A;  4M7D A;  4C92 E;  1RLQ C;  2ZZD A;  2QA4 A;  2CSI A;  1D3B A;  4DBR A;  2X3W D;  5GAN d;  3H9N A;  4KRT A;  2K4Y A;  2RHX A;  2LNH B;  4AG2 C;  3JRZ A;  2JTM A;  4OF1 A;  1PNJ A;  5DY9 A;  4FW1 A;  3DB3 A;  4Z8A A;  2OTL Q;  2A7Y A;  3D7S B;  4C8Q A;  2E1H A;  1VQO A;  4PJJ A;  5DLO A;  4O6J A;  2P4R A;  2QTX A;  4N4H A;  4EIK A;  1W4S A;  1VQK T;  3PMI A;  4OGC A;  1VQK A;  1D0X A;  2EJF A;  3VS1 A;  2BUD A;  4F7U A;  4HXJ A;  2YRD A;  2O9S A;  3CCS T;  1JXO A;  2QDY B;  1SPK A;  3CCS A;  1SEM A;  3OW2 A;  1A0N B;  1O9S A;  2PTK A;  3CCE T;  2HSE B;  2JMA A;  3G1J A;  3CCE A;  4LNP A;  2YT6 A;  3E19 A;  1W2B A;  3RUX A;  4CC2 A;  3X26 B;  1RLP C;  4KGX B;  4ESR A;  2F2X A;  2VGN A;  9ATC B;  4IUV A;  2VC8 A;  1H3H A;  2DEU A;  5CKB A;  1G2B A;  2E64 A;  3QG1 A;  3FRN A;  3A8O B;  5FU7 C;  2VV5 A;  1WJQ A;  2XIC A;  1YWP A;  2EQJ A;  1JJ2 S;  1I5L A;  3EH1 A;  1S72 Q;  2JS0 A;  4HCB A;  3EGU A;  2G6F X;  3MKD A;  1BB9 A;  4C0Z A;  1G83 A;  4ZNX A;  4A4G A;  1EZZ B;  2OTJ T;  4WCI A;  5AT1 B;  4VUB A;  2AIR B;  2K9G A;  3QDR B;  3SHW A;  2OTJ A;  1OV3 A;  1IRE B;  3OB9 A;  4OMQ A;  3EG3 A;  2M51 A;  2LX7 A;  2ZPF B;  3WXM B;  2HQE A;  1Y57 A;  2KI7 A;  3VV0 A;  4NL2 A;  1VYT A;  1UGV A;  3KBG A;  1AWO A;  1TUG B;  2LJ0 A;  1KD1 R;  2ZPB B;  4DOV A;  1QLY A;  2QQA A;  4FSX A;  5GAN j;  4L6V 5;  3RNJ A;  5GAN f;  3OYJ A;  2QXF A;  1Q82 C;  2E6Z A;  1UHF A;  2WSF E;  3HRU A;  1Y0M A;  1PRL C;  2HDA A;  1K9A A;  2COW A;  3MCA B;  4E7L A;  1WHH A;  4BD3 A;  5IHI A;  4OGE A;  2KYM A;  4XU2 A;  3VS3 A;  1OEB A;  1Q7Y C;  1NLP C;  2EW3 A;  2M9U A;  1ABQ A;  5D6W A;  3EGX A;  2KQW A;  2IG0 A;  2FVU A;  2CH4 W;  1YIT T;  3I55 T;  4MMK A;  5ECA A;  2K5I A;  2FO0 A;  3H8Z A;  1YIT A;  3QBY A;  3I55 A;  3L42 A;  3DB4 A;  3CQT A;  3NTI A;  1PRM C;  5AYF A;  2KDS A;  3A98 A;  1IXD A;  3JCM f;  3E9F A;  1G3W A;  4ELZ C;  2DL7 A;  1LPL A;  1QMC A;  4QVC A;  2LJ1 A;  4C92 A;  3JCM W;  2RK1 A;  3QJ6 A;  1SKU B;  4M75 A;  4BI3 A;  3CME T;  1GCQ C;  1NYF A;  1N27 A;  2ZPG B;  2H3E B;  1W2B P;  1AWW A;  1GFC A;  4KUI A;  4B9X A;  3EG9 A;  4XTU A;  1KC8 C;  2BTT A;  1BI2 A;  2B86 A;  3TSW A;  1UGP B;  1VIE A;  1LOJ A;  4EMK B;  4XAX B;  3SWN A;  1UTI A;  2V26 A;  2EPD A;  5FU6 B;  2M16 A;  1YNZ A;  2BZY A;  4DOW A;  2O4X A;  2O9V A;  1Q7Y U;  1X27 A;  2GCX A;  4J8O A;  1YIJ T;  3M0U A;  1M2V B;  3R6O A;  5HK3 A;  2XKO C;  1YI2 Q;  1YIJ A;  3TEE A;  4ANJ A;  3CC7 Q;  2YXY A;  4LN2 A;  5DLQ E;  1SF9 A;  3QYG B;  3L1A A;  4XQ3 A;  5KE2 A;  5I22 A;  2ED0 A;  2O88 A;  3JB9 J;  1JXM A;  4JRQ A;  1WHM A;  2JN0 A;  1D1A A;  1NJI C;  1C1A A;  2JS2 A;  5LL6 S;  2PUK B;  5I11 A;  4XK8 E;  3G4S Q;  5IXB A;  2DIG A;  3E1S A;  4PL6 A;  2JTF A;  1VQ8 A;  1HYO A;  1NPP A;  3EHQ A;  1YJW T;  2P4T A;  4ZTF A;  2XDP A;  5EC7 A;  1YJW A;  4BAC A;  1UE9 A;  1ARK A;  4GLM A;  1VQ5 A;  1BYM A;  1SHG A;  4XU1 A;  4KGV B;  3CC2 Q;  1RI9 A;  4N4I A;  3J7A F;  3OSS C;  4A4F A;  3DLM A;  3OQ5 A;  3EGD A;  3VS0 A;  2NUP A;  2CS7 A;  4LXC A;  3H41 A;  3RKX A;  3GF5 A;  1NEG A;  1G3T A;  2P84 A;  1N9R A;  4EMK C;  1Q82 R;  1YJ9 T;  5D6X A;  5GAM d;  2FL7 A;  4E7I A;  1QVF S;  1WA7 A;  1IHV A;  4PJO F;  3T9N A;  4RTV A;  1WNL A;  2RHZ A;  1S1N A;  2ABL A;  1IGU A;  2FG0 A;  1MMN A;  3O8V A;  3I56 T;  1X75 C;  1VQ9 T;  2CP2 A;  1TU0 B;  5KCO A;  3QDF A;  1Q7Y R;  3X24 B;  3CMA T;  4DA4 A;  1M5Q 1;  3I56 A;  1MMG A;  1K1Z A;  5KYX A;  1VQ9 A;  2OAW A;  2XDD A;  3CMA A;  4PJO B;  2HKN A;  4N0A A;  2VXE A;  4E7J A;  4PFZ A;  4DQ2 A;  1VA7 A;  5GJW B;  4AFZ C;  3HKS A;  1UGQ B;  3QUI A;  1BI3 A;  1I81 A;  1XOV A;  2ATC B;  5J3B A;  2QQR A;  1Y71 A;  3V8J A;  5LJ3 h;  4A4H A;  4AG1 C;  1UB4 A;  2A36 A;  4XTW A;  3CCV Q;  2GNC A;  4X34 A;  3OBW A;  2L3Q A;  3OYY A;  5LJ3 e;  1GCP A;  3CD6 T;  1KQ2 A;  3RES A;  1TG0 A;  3CD6 A;  5LJ3 g;  1WHG A;  2F5T X;  1GRI A;  2YDL A;  3CCQ T;  4E7H A;  4QW2 A;  1ZLM A;  3CCQ A;  2QAS A;  2DVE A;  6AT1 B;  4ME7 A;  2DYI A;  4QQ6 A;  3OYH A;  5GJV B;  1KC8 R;  2QK0 A;  2QGG A;  3JV3 A;  2YUO A;  4ZGJ B;  2YUQ A;  2AHJ B;  5KE3 A;  1JJ2 A;  2ECZ A;  2OAU A;  2COZ A;  2QI2 A;  1M90 U;  2XID A;  5CQX A;  2GBQ A;  3LGL A;  3URG A;  3EFO A;  4BE1 A;  3UF4 A;  1QW1 A;  3CCJ T;  3M4G A;  3PTA A;  1M1K C;  4P5N A;  3CCJ A;  2K7A A;  1ZUK A;  2DPP B;  4FYV B;  1VQL T;  5DM7 R;  4JRI A;  2LQW A;  2LCC A;  1K0S A;  2O2O A;  2MWP A;  3VUB A;  2AK5 A;  1H3Z A;  1AZG B;  3MP8 A;  2JZ2 A;  3OYG A;  1ZQ1 A;  2G3R A;  1VYV A;  4XTY A;  4OMM A;  1GFD A;  4FL6 A;  4HVW A;  3NFC A;  3L2R A;  1Y96 A;  1NJI R;  2HBP A;  1Q95 G;  1SHF A;  4QT7 A;  5GAN 6;  3CPW S;  4KUD K;  3S3M A;  3MEV A;  4ATO A;  3GNG A;  3SD4 A;  2LTO A;  1VQ4 Q;  5L8R E;  4X1V A;  3V8L A;  2HKQ B; 
#chains in the Genus database with same CATH homology
 3M0T A;  1M8M A;  2MCN A;  2GTJ A;  1QKX A;  3ULR B;  2EVR A;  2DNU A;  2DMO A;  1X6G A;  3VS1 A;  1WXU A;  2EGC A;  3EG0 A;  1MV3 A;  2H8H A;  2SRC A;  4HXJ A;  1M3B A;  2O9S A;  1KIK A;  4A63 B;  1JXO A;  1AVZ C;  1QCF A;  1SPK A;  1VYU A;  1SEM A;  1UEC A;  1A0N B;  1QWF A;  2PTK A;  4F16 A;  2JMA A;  4LNP A;  1PHT A;  1UJY A;  1Z9Z A;  2YT6 A;  4CC2 A;  1RLP C;  2K6D A;  4ESR A;  2F2X A;  3O5Z A;  4J9C A;  2BZX A;  1N5Z A;  2CSQ A;  2PZ1 A;  2QDL A;  2DRK A;  2C0T A;  4E6R A;  1H3H A;  2KRM A;  2DBM A;  1G2B A;  2W0Z A;  2VWF A;  2M0Y A;  1QKW A;  2JT4 A;  1EFN A;  4J9H A;  1JU5 C;  3UAT A;  2ENM A;  2EKH A;  2IIM A;  2D8H A;  1YWP A;  1YCS B;  2EBP A;  3M0S A;  1OOT A;  4IIO A;  2JS0 A;  2OJ2 A;  3EGU A;  4D8D A;  2G6F X;  1CSK A;  2JXB A;  1BB9 A;  1WI7 A;  1G83 A;  3KFV A;  4ZNX A;  1TUD A;  1X2Q A;  3I9Q A;  4WCI A;  3VS7 A;  3M0R A;  2K9G A;  1I1J A;  1SSH A;  3TVT A;  3VS6 A;  2HCK A;  3SHW A;  2L3P A;  2CT3 A;  2DL3 A;  1OV3 A;  4CC4 B;  4OMQ A;  3EG3 A;  1UHC A;  2RQV A;  1WLP B;  1UG1 A;  2M51 A;  2LX7 A;  4ORZ A;  4EIK A;  4D8K A;  4F17 A;  2C0O A;  2KRN A;  2F2W A;  1M3A A;  4RTY A;  1Y57 A;  1MV0 B;  3THK A;  2FRW A;  2LP5 A;  2LZ6 B;  2LQN A;  1VYT A;  1RUW A;  1QWE A;  1UGV A;  1T0J A;  1AWO A;  2EYY A;  2LJ0 A;  2JM9 A;  1JQQ A;  1J3T A;  2D8J A;  2D1X A;  1QLY A;  4RTZ A;  2KT8 A;  3RNJ A;  1UHF A;  2AZS A;  2KEA A;  1Y0M A;  1PRL C;  2L3S A;  2HDA A;  1H8K A;  2J6F A;  1K9A A;  1GCQ A;  2KNB B;  1WX6 A;  1AOJ A;  1ZBJ A;  5IHI A;  4OMN A;  1X6B A;  2KYM A;  4RUG A;  2L2P A;  3VS3 A;  4J9D A;  4CC7 A;  1OEB A;  1NLP C;  2EW3 A;  1ABQ A;  4HVU A;  1TUC A;  3RBB B;  2EGE A;  1B07 A;  1HD3 A;  2ROL A;  2CH4 W;  1NEB A;  2FRY A;  1I0C A;  2AKL A;  1KJW A;  5ECA A;  2FO0 A;  1W6X A;  2EYZ A;  3VRZ A;  3PVQ A;  5IHN A;  1PWT A;  3CQT A;  1JO8 A;  1ZSG A;  4RTT A;  2E5K A;  2CDT A;  2ED1 A;  2OI3 A;  1PRM C;  4LUE A;  1UUE A;  2YSQ A;  1UFF A;  3A98 A;  4R0K A;  5IH2 A;  2MOX A;  1CKA A;  2HEQ A;  2DL7 A;  4J9F A;  3LH5 A;  4Z89 A;  4FSS A;  2LJ1 A;  3U23 A;  2JMC A;  1WFW A;  2JW4 A;  1M3C A;  1GCQ C;  2DIL A;  1V1C A;  1NYF A;  4HVV A;  2RMO A;  1WYX A;  3EG2 A;  2V1R A;  1AWW A;  3FJ5 A;  2VVK A;  3VS5 A;  1GFC A;  1FYN A;  2LMJ A;  2J06 A;  1K76 A;  2BTT A;  2XMF A;  1E7O A;  2J05 A;  2B86 A;  3TSW A;  1Z9Q A;  4AFU C;  2YUP A;  2RQW A;  2KT1 A;  4HCK A;  2K79 A;  1UTI A;  2EPD A;  1YWO A;  2RNA A;  2PNI A;  1SRL A;  1YNZ A;  2BZY A;  4OMO A;  1NLO C;  2CH4 A;  2RQU A;  1BBZ A;  2O9V A;  1X27 A;  3M0U A;  1KSW A;  2SEM A;  1AWX A;  1M30 A;  1WXB A;  3QWY A;  2A37 A;  3NHN A;  4LN2 A;  1AEY A;  2DRM A;  3TSZ A;  1HJD A;  2L0A A;  1OPL A;  1BK2 A;  3QWX X;  5I22 A;  2DE0 X;  2ED0 A;  2GTO A;  1AD5 A;  3M0Q A;  3PE0 A;  2O88 A;  2F2V A;  5FW9 A;  3EG1 A;  1JXM A;  1AZE A;  2W10 A;  3I35 A;  4Z88 A;  1OPK A;  2DL4 A;  2JS2 A;  5I11 A;  2DYB A;  5IXB A;  2A28 A;  1B3Q A;  2CUB A;  5FWC A;  3EHQ A;  1X43 A;  2DBK A;  1LCK A;  5EC7 A;  2NUZ A;  4F14 A;  4JJD A;  1UE9 A;  2KBT A;  1U3O A;  1I07 A;  1E6G A;  1U5S A;  3R6N A;  1ARK A;  3GBQ A;  4GBQ A;  4GLM A;  1AWJ A;  2DJQ A;  4J9G A;  1SHG A;  4RTU A;  2K2M A;  2RQT A;  3ZL7 C;  1RI9 A;  2RF0 A;  1KFZ A;  3REB B;  2D0N A;  2KRS A;  2EYW A;  2AKK A;  3VS0 A;  4JJC A;  3H41 A;  3I5R A;  4IIM A;  2FPF A;  3EHR A;  1BU1 A;  1NEG A;  2DL5 A;  1UDL A;  2EGA A;  1GBR A;  2YUN A;  2GQI A;  4J9B A;  1X69 A;  1WA7 A;  2MIO A;  2DVJ A;  1PKT A;  4RTV A;  3H0I A;  1S1N A;  2ABL A;  1U06 A;  2FG0 A;  1K0X A;  2RPN A;  2X3X D;  2KE9 A;  4J9E A;  5L23 A;  2VKN A;  4J9I A;  1K1Z A;  1NM7 A;  2KRO A;  4OMP A;  2BZ8 A;  3UA7 A;  2OAW A;  2CT4 A;  3C0C A;  3M0P A;  4LUD A;  2RQR A;  1YN8 A;  2J7I A;  1VA7 A;  5GJW B;  4AFZ C;  1YP5 A;  4JZ3 A;  2A08 A;  5HCK A;  1T0H A;  1XOV A;  4JPB W;  5IXF A;  3SEM A;  5FWB A;  4AG1 C;  2A36 A;  2GNC A;  2L3Q A;  1WIE A;  3NGP A;  1GCP A;  4Y92 A;  1PKS A;  4AFQ C;  2KR3 A;  1TG0 A;  2J6K A;  2DA9 A;  3VS4 A;  2KGT A;  1JEG A;  1MUZ A;  1ABO A;  1GRI A;  2YDL A;  3I5S A;  1ZLM A;  4RTX A;  2KXC A;  1CKB A;  1M27 C;  2EYX A;  1SRM A;  2FEI A;  1ZX6 A;  2ROT A;  1K4U S;  4OML A;  2HBW A;  2CRE A;  2DLP A;  1H92 A;  1NYG A;  1GBQ A;  5GJV B;  1NG2 A;  2KYB A;  1WDX A;  3JV3 A;  2YUO A;  4DEX A;  2YUQ A;  2ECZ A;  4M4Z A;  5IHK A;  2RN8 A;  4DEY A;  2GBQ A;  4K11 A;  3PVL A;  3UF4 A;  4LE9 A;  2DM1 A;  1E6H A;  1X2K A;  1ZUY A;  2ESW A;  2KXD A;  1T3S A;  1RLQ C;  2K3B A;  2K7A A;  1ZUK A;  3REA B;  1W1F A;  2CSI A;  3UA6 A;  2FPD A;  2EQI A;  2JM8 A;  2X3W D;  4CC3 A;  2I0N A;  4KRT A;  2DF6 A;  2LQW A;  1GL5 A;  2LNH B;  4JJB A;  4AG2 C;  1K0S A;  2O2O A;  2GGR A;  2AK5 A;  1AZG B;  1PNJ A;  2HSP A;  1VYV A;  3VRY A;  1ZUU A;  1FMK A;  1HSQ A;  2V1Q A;  1UJ0 A;  4OMM A;  2C0I A;  2DX1 A;  1GFD A;  4HVW A;  4JZ4 A;  2O31 A;  3NPF A;  4Z8A A;  4AFS C;  2NWM A;  3IQL A;  1SHF A;  2FPE A;  2JTE A;  1W70 A;  4QT7 A;  3NMZ C;  1T3L A;  2LCS A;  2DL8 A;  2CUD A;  4RTW A;  3VS2 A;  2P4R A;  1WXT A;  3H0H A;  1IO6 A;  2J6O A;  2LJ3 A;  4X1V A;  3H0F A;  2AZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...