1ZQ1A

Structure of gatde trna-dependent amidotransferase from pyrococcus abyssi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
437
structure length
437
Chain Sequence
RVDEFLKERNINVGDFVRITKEEDGEEVTYEGYIMPPYELSAGDTLVLKLENGYNIGIALEKIRRIEVLERAKVKPEVHFEALIEGKPGLPEVTIIGTGGTIASRIDYETGAVYPAFTAEELAKALPEIFEVANVKPKLLFNIFSEDMKPKHWVKIAHEVAKALNSGDYGVVVAHGTDTMGYTAAALSFMLRNLGKPVVLVGAQRSSDRPSSDAAMNLICSVRMATSEVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDVPIAKIWPNGEIEFLRKDYRKRSDEEVEVDDKIEEKVALVKVYPGISSEIIDFLVDKGYKGIVIEGTGLGHTPNDIIPSIERAVEEGVAVCMTSQCIYGRVNLNVYSTGRKLLKAGVIPCEDMLPETAYVKLMWVLGHTQNLEEVRKMMLTNYAGEITPYTRFDTYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit D
publication title Structural Basis for tRNA-Dependent Amidotransferase Function
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 101
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 6.3.5.-:
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
A PF18195 GatD_N GatD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.520 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zq1A01
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zq1A03
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1zq1A02
5CBPB 5I3ZA 4RA9A 4RA9B 1JJAA 5HW0A 2P2NA 5F52A 1WNFA 5K4GA 5K45A 2HLNA 1HFWA 1DJPA 4NJEA 5DNDA 4NJEB 3NXKA 4PGAA 2JK0A 4ECAA 1HO3A 5I4BA 5K3OA 1ZQ1A 2GVNA 1AGXA 5DNEA 5K4HA 1HFJA 3NTXA 1O7JA 3ECAA 5DNCA 4Q0MA 1DJOA 4RA6A 1NNSA 2WT4A 2HIMA 4RA6B 2WLTA 1WSAA 2D6FA 1WLSA 1JSRA 4R8KA 2P2DA 1HFKA 2OCDA 5I48A 1HG1A 1HG0A 1IHDA 1JSLA 3PGA1 4R8LA 1JAZA 5CBPA 1ZCFA
chains in the Genus database with same CATH superfamily
1H0KA 1UMCA 1SCQA 7MDHA 2YY7A 2FPIB 1UGPB 1B1AA 3VO2A 1GPBA 1FFHA 4LDNA 3WB1A 3ADOA 1KYZA 1OZFA 4W1SA 1RJFA 4A8TA 3I01M 4H15A 3OCCA 1Y42X 3KXKA 4N3GA 5IM5A 1U3OA 4RV5A 4BMOB 4X1KB 5I45A 3P97A 1Y1LA 1PV2A 3VS5A 1S2LA 4UBKA 1XZDA 1T8WA 1FSGA 2QRVB 1B43A 1A2OA 1EFVB 1U7TA 3MS2A 2C83A 2GESA 2Q3LA 1Z2OX 3FZGA 4ZREA 1BFKA 4PYLA 2QYSA 3AY7A 1RJ9A 3KJGA 3K4HA 2BMAA 1M1FA 1DKQA 2XD9A 3SP1A 4POOA 4IGKA 1U98A 1PEYA 1KXJA 1AE1A 3RRYA 4N7MA 4F2HA 1PT7A 3NFYA 5FRDA 4HVUA 4BI4A 2DBYA 3WXMA 3AOEC 5J39A 3WOVA 1YF3A 1ZNQO 2Z2JA 5JIBA 3OYMA 1Y5IA 2FHDA 4FS3A 2QGGA 1CUGA 1T6YA 4CMCA 2YVQA 1P2VA 2GPJA 4GBJA 5GIOE 4FX2A 2BEUB 4E5VA 1GRIA 1GFZA 2BBOA 1JIJA 3KKQA 3C5CA 4DA4A 1LJUA 1HKHA 2IPMA 1QIEA 1SULA 3IDQA 2HMVA 1K8XB 2ASEA 3CC2Q 3L2QA 2QTNA 1L7XA 4D43A 2AJCA 4RFLA 4RG2A 5TMPA 4LZZA 4G0YA 1BWRA 2XI9A 4EPCA 1BD3A 1UFVA 4MVJP 1ZCBA 4OGFA 2JGIA 1V35A 2GZMA 3PEUA 4L72A 1WOYA 5C46F 1WPQA 4UKDA 5DNAA 4P0PB 4HAWA 4HWKA 2WIDA 1XE3A 5EZQA 2ORWA 2CXTA 5JZ9A 5EWLB 4YHBA 4B4DA 3PXCX 3IE2A 3A9SA 1VCIA 3FN4A 4MVCA 2EZ4A 1ZISA 2XVYA 2HIMA 2VK8A 1GZ6A 1L8QA 2QN9A 1J9EA 3WLQA 1AT1B 4E1AA 3O8OB 2YHUA 4DCCA 5JNRA 5JISA 1O3YA 1XPUA 4RSGA 2ADOA 4H59A 5FJJA 4LWZA 2F1LA 4ZJPA 3WAJA 3FCYA 3K15A 4YDHB 4KO8A 4G0QA 4RKWA 2M6SA 1I01A 3QX3A 1VA7A 5CB4B 5KZMB 1R0CA 3NOXA 1CB7A 4OYYA 2AR0A 1WY5A 3ZEHA 3L2OB 1IZZA 1K8AC 4E47A 2OTLQ 8ADHA 5TQ0A 2QVZX 3CVVA 1Z5GA 1ES9A 4QGBA 4DARA 2XCRB 1USIA 1XOIA 2FSUA 5BN5B 2XKKA 3SK0A 1XZ8A 1VG8A 1T9AA 3F4KA 4UMEA 3HBMA 3BHNA 4HWOA 3H16A 2QAGC 4UMVA 2GXUA 3MW8A 4DEXA 3AIKA 5KYNA 2IVWA 2XODA 2G76A 4XIIA 1HTBA 3EVEA 4P7BA 1L7MA 2JHFA 2RJ3A 5ALSA 3MB8A 3WA6A 4JL5A 3KZCA 5IAAA 3MJVA 2Z3VA 4WESB 4FB5A 5EHGA 4EZEA 1H3ZA 2GD6A 4DQ0A 4KL8S 3HL4A 5EZYB 3MSXA 3AVVA 4YJ3A 3GEGA 1BYMA 4W1RA 4J0EA 2XTNA 1H66A 1UC4B 1MEJA 5D6WA 2QG4A 3C4QA 2GPSA 3MOGA 4QT0A 4OQXA 4LFCB 2RHJA 3VDQA 5AW4A 4WRRA 2GQ0A 4HLQB 3IHWA 1X69A 6PFKA 3QYJA 1OQAA 2R5FA 5BVGB 3LSTA 5IUKC 3SHTA 3EOZA 3AEQB 1WXGA 3VRYA 4TQ9A 5LOVF 4YT5A 5A7HA 4RJLA 2DKGA 2B78A 2V6BA 3SWWA 4MR9B 3WP0A 4JLUA 3IKJA 3KQPA 4B3BA 2D62A 4CC4B 3TCXB 2JFWA 2O88A 2HLDA 3VTFA 4CN9A 1XUOA 4EI9A 4ZZ3A 1NMXA 3BD6A 2KDSA 4DAOA 3E58A 4TYPA 2FW0A 1OFVA 1KD1R 2O7VA 3URGA 1U81A 2R8BA 2XMZA 4HB3A 2OEPA 2CDRA 1TCVA 1YAHA 5LWHA 1AK2A 3OX1A 4GKKB 1YU9A 4TMVA 4IL5A 2PX6A 1YQQA 2IZ7A 2O0MA 2AK3A 2AE2A 4XJXA 2I6SA 4EWLA 3CVYA 4TL6A 1O77A 1GQYA 1HTTA 4HWPA 1ZH0A 2QE7A 4DIOA 4ZVPA 5IVIA 3TTUA 4J3JA 3ZD8A 1M7BA 1FDWA 1M2HA 2H48A 4Q9KA 8OHMA 5K0CA 3PEVA 2JI6A 4QYTA 2VJLA 3L01A 1I4K1 1V47A 1B3BA 2ZAMA 4JZKA 2D8MA 4C06A 2IY8A 1N6HA 3ZY5A 4YDSA 2EJBA 2PBRA 4CRIA 1DS6A 3C15C 4F8EA 4GDFA 4ENUA 3A3PA 3ZU3A 1OPLA 3CSDA 2R57A 3IQGX 3A0RB 3D4PA 4YRSA 2QK0A 4MUYA 5C8YA 1LDGA 5JXGA 3CX6A 1RPNA 3LKBA 3PJGA 4I0WB 4B3DA 4X6UA 1NASA 1A8UA 4MP8A 5A0FA 3PEEA 3S2ZA 2XADA 4MRAA 4L07A 4DLVA 4PPQA 2YHIB 1TJNA 3W77A 2Z0MA 3RWMB 4D4IA 4N0EA 1GTL1 1VJRA 3OT1B 5CRIA 3M0TA 3ZBQA 5HHTA 4J0IA 3CZPA 3Q7EA 2W2PA 3QWHA 2ID9A 2CL0X 1II0A 3P9IA 4AF6A 2Q1YA 2OQRA 3G88A 1UMDB 3QPDA 1Q86U 3I9V6 4CMIA 4DIKA 1FFXA 3TKYA 3V4LA 2BPOA 2N3ZA 3GJ4A 1SRMA 3DKIA 3WK9A 1P7YA 3BTVA 3A1CA 4HT9A 1FY2A 2VSYA 5JCOC 4NJMB 2XUJA 3OOWA 2LC4A 1H92A 4L75A 2GI4A 2MIIA 3K8ZA 3HY6A 2JGAA 1R6XA 5K8JB 2O4XB 4XUGB 4MVJA 2JHAA 1ETHA 4YAKA 3GLGB 2PSDA 2Q0XA 3V80A 4AY6A 1IC6A 2P9CA 4F2WA 4PYNA 3V33A 4Q4AB 5DIFA 621PA 2EQAA 1DV1A 1QCFA 2XUPA 3NYRA 1NBEA 2PRSA 4R31A 2GDZA 1UDRA 5FBHA 4OXYA 3DC7A 3KPJA 3CWQA 2UYOA 4Y7DA 2Y1LA 1QHGA 2FWRA 2X1VA 2JJQA 2FZ5A 3VXKA 3PENA 2JKYA 2DJ5A 1Q5PA 4MIKA 3WQQA 4FYYA 2M9MA 5GAMd 2A9RA 4HYQA 5GANf 1WDKA 3G79A 3A8OB 4H08A 2IV3A 3OPYA 3LXXA 2A92A 1V4VA 3BUSA 4NFHA 1KI8A 2CJXA 4YREA 2ODTX 3C3JA 1Q82U 3HE3A 3FCAA 3IRVA 2HBQA 2EJGA 5D51S 2RE8A 3L7CA 5JD3A 3B3GA 1J7KA 1JQAA 3OYJA 1CUUA 1K92A 2L19A 5DBFA 5HF9A 4CDNA 1TMYA 3KT0A 3HHPA 2DKFA 3A0UA 3FPBA 2Y6UA 5IKXA 4UQLA 1GXIE 3CO5A 3PFSA 2VZ0A 4RABA 5A5EA 3JATB 1X1TA 1FJ2A 1DC7A 4GF5A 4RVNA 4M1MA 4AMGA 2POCA 3DMGA 5IC5A 3ASZA 1Y8CA 4B3JA 1ECBA 4GI5A 4G4GA 1ZSYA 2RHLA 1BN6A 2B6HA 1OU4A 2R1VA 3D1LA 2QTGA 5FHQA 3CR8A 1Y3IA 2RKOA 4QGHA 3FSGA 2IOYA 3FTEA 2XVMA 2VF8A 3G6EQ 4MUGA 4FNOA 3LL4A 5DLYA 3JQ7B 4JLPA 4I1UA 4Y6RA 3W0LB 4JBYA 4CDMA 4TZKA 5K8IA 1T2CA 1K3TA 2JBWA 4PFOA 4RTZA 1YT5A 3AQIA 4QBGB 4UU8A 4ERXA 2OWDA 3EQ6A 3R7BA 3JQBC 2NN3C 4AT1A 4FNMA 3TXXA 1JHDA 2P2NA 3NS7A 5FBVB 2G1KA 4MQMA 3GA0A 1PX2A 2H8KA 3QF4A 4OB8A 2Z2YA 4FE3A 5CLIA 5EXPA 4D8KA 4MMKA 2P9FA 2PSSA 4FIDA 1KDPA 4JDUA 3SWNB 4LHZA 1L4GA 4I1IA 1OLSA 3AL2A 5KJ1A 4UAGA 3W4KA 4TSFA 2JFPA 2R2GA 1U8YA 4X20A 2WIGA 4OSOA 2VUSA 3N05A 4PJOE 3U1VA 3T12A 5JHGB 3UO8B 2RKWA 2PMFA 2DT5A 4LRTB 1OYWA 1K6IA 2YV1A 3VUZA 2QHXA 4L6AA 4BEVA 3GROA 2NO6A 4LJ9A 4C8QF 3HO6A 2R8ZA 3GGSA 2IYYA 1X19A 2LX9A 4K81B 3FPGA 1N5IA 3O3NB 2H2FA 4MW4A 4HQKA 4QHYA 3LT0A 5EJGA 4MWBA 3VDNB 1GQQA 2IG0A 1JSXA 1JJ2S 4EUSA 5HFAA 1I5EA 5TGZA 2R5AA 4ILEA 1GY8A 3EZ6A 2XWBF 3BH0A 5IT9E 4RF2A 1K9SA 3ADBA 1F4LA 3O4FA 5A5FA 1PTJC 1NVBA 5BV8A 1PJ8A 2PBLA 4QYIB 4ABTA 4JUIA 1B6TA 2JOYA 2BN4A 1M6EX 4IIXA 4C0WA 4L8VA 1C7FA 1EU1A 2QMQA 1H2RS 5KUTA 3V8QA 2HUNA 5FA5A 2HLHA 5J1TB 2H5LA 2R4UA 3SZLA 3KK0A 5IVHA 1J8VA 4H4DA 4ARVA 1NSYA 1RE0A 4I1VA 4ZCTA 1QVFA 4KWCA 2A37A 2JIBA 2PZFA 1PNTA 4IY1A 5JS1A 2LNVA 5ALHA 1X7WA 2NPOA 1YS1X 3QTTA 1XMQB 2QRLA 2BGGA 1M1NB 1GKYA 1QVVA 1IBMB 2WWVD 3IQIX 2J3DA 3TTXA 4TMXA 2MSCB 2O2IA 4NFLA 2Y9PB 2WACA 2XIJA 3Q6IA 2Z09A 1H2BA 4UE6A 4J43A 3QU7A 3T9CA 2FVYA 4JT2A 2B5WA 4REMA 1V2GA 1RRPA 1VJ1A 2PUWA 3EVFA 2D1QA 1T6BY 5K0JA 4HQLA 2V98A 2VYVA 1YZUA 1Q7YR 4OH7A 1NI4B 1MLDA 3O4RA 4Y2TA 1UJCA 1MIHA 2NACA 4ZVKA 1LUAA 3IVAA 5D86A 2QUBA 5SY9A 3GLHA 4H3VA 3TOCA 4IIUA 2QQFA 4ZKDA 1RJGA 2BSXA 3WP1B 1E94E 3DULA 2XNJA 2CY0A 2J3HA 5EQJB 2H3EA 3H0FA 3MMZA 3EXFA 1GV1A 3L02A 2G09A 3B20A 1C3JA 2OCIA 4ECAA 3SF8B 3BRQA 2RCNA 3CX4A 1JI0A 3DAOA 2G9UA 4LZWA 2C3YA 1UAYA 2V6MA 3OA0A 3TVYA 2PKQP 3JR7A 3FBWA 5K20A 3BSWA 1XHEA 1Z7EA 5KJCA 3BGOS 1SM4A 1UXGA 5BUSA 5KSWB 3G85A 1QE5A 3ZX4A 2LRQA 3X1XA 1J7JA 1M1KU 3DXYA 2I2DA 5D1HA 3BWVA 2WMOB 3BF7A 1ML3A 4PIPA 4MVJG 3GD5A 4YO7A 1G2PA 3D2LA 3QITA 2G25A 1K6MA 2D2EA 3ZLTA 3OWXA 3CONA 3ACBA 1N0IA 4MUXA 1YQXA 4EBBA 3LH0A 1W0KD 2IIPA 1Y6QA 4CEHB 3DQQA 3A4NA 3CWZA 3JU3A 2GM4A 2VZ8A 1G3IA 3P0FA 1T0IA 3C3DA 4DV4B 1JAXA 4LTMA 5EFOA 2A1UB 3THYB 3ZDZB 3JWGA 1KE2A 1N6IA 2X1LA 1PZFA 4N01A 4JLWA 6CHYA 3OYBA 1RRMA 3SYMA 3E81A 3DEFA 4B82A 2YLBA 1GNQA 3A70A 2WSCE 4RM3A 1W5FA 4O4HA 3BX1A 3NBKA 3NRCA 5JQGB 1I0IA 4CBVA 4V0RA 3H2BA 4WL0A 4HQRA 4W1QA 2Z5VA 4JL8A 2IS1A 3L2VA 4LFBB 1ZA2A 3IEPA 1Z4JA 4PC1A 3ZIDA 2XMSA 2J9YB 1YS6A 3KS9A 2TMYA 2PU7A 1I3NA 4L08A 1Z0FA 2HSWA 1EM8A 4BVAA 4DVJA 2YLCA 1BX3A 5KC8A 4CIYA 2YJ3A 5F2EA 4IJWA 4ER5A 3ICQB 1JT2A 4PZZA 5P8WA 1VQKT 3T7TA 4C3VA 1V4BA 2PS3A 1QRSA 3B1YA 3VC2A 5I7FA 2BCGY 3KYIB 4DPKA 4DYDA 1J07A 4XYEA 4LRYA 3RAEC 4CE6A 3RB8A 4LDUA 4ENRA 1XQ6A 1RI2A 4Y0NA 3EZ9A 4GX5A 3DAPA 1VB5A 5HM8A 3EEIA 3BIJA 4YWJA 3TE7A 5AVJA 4J9EA 2P9HA 1HZZA 4AY5A 3P2IA 4LKOA 4W7SA 4NU5A 2H08A 3BSSA 4A53A 1W46A 2G0AA 1C0KA 1Z33A 1ZN2A 1VQKA 5FOUA 3ITNA 5K03A 3P2YA 1TC1A 1SWVA 1JVSA 1QQBA 2CJYA 4RE5A 3AL0C 1QWSA 2DR0A 1CD5A 3DPUA 2D74A 3WWEA 2DTIA 4TTIA 4KIWA 1XQ9A 2HK8A 3SYTA 4IDEA 1KDYA 3V42A 3GJ6A 2RGAA 1RP7A 5LJLA 1IUNA 3C3EA 2WVAA 3RSLA 2WWHA 4E5UA 4NZZA 3FGZA 2ATIA 4KOAA 1TKRA 3LT1A 2H2HA 4DEVA 2EATA 1QHXA 2EYUA 1P75A 1P2BA 5IK2D 3F1LA 4J1TC 5GAOp 3KKNA 4KH0B 4NV0A 3PQEA 3LWHA 5ALXA 5LUBA 3UQZA 3G0IA 4YEDA 3SS9X 3MINB 5KSYA 3HUUA 3RC8A 4HRAA 3U3RA 2NU9B 3I6MA 1EFTA 4KG7A 1VBFA 1CE8B 4WCFA 2Z0WA 1PT9A 1PR4A 2EP7A 2JLBA 4BFCA 1BXZA 4M8NE 1KDZA 4RG8A 1KO5A 1JRLA 2RCYA 1UPXA 2P0QA 4V3CA 1HDCA 3K70C 1BOOA 1Z8HA 3OOJA 3M9QA 1K89A 5H1YA 4ZIRA 1LBHA 5B1EA 3QYPA 4AUEA 5DNYB 4HS4A 1NC1A 1W8IA 2N9UA 2EVWX 3HKBB 3GC6A 5LD2C 1CF9A 4D4HA 1ID8A 2BF7A 5YASA 1DINA 1XTJA 3OB9A 1IBLB 4K9OA 2GYVA 1YWGO 3GEBA 4X64B 3DUFB 4N0AC 4JZYA 1OAOA 4M7DE 1PI3A 3RVBA 5EWMB 3JB9H 3Q2IA 5L45A 4AX8A 2R68A 1WZCA 4YMGA 3HACA 2F17A 1KWGA 1TOAA 3IO3A 2XDQB 5IC6A 3TDMA 2W2NA 4X7RA 4C0HA 4Y2YA 3TLKA 2M0YA 1TJYA 3O7MA 2ZM5A 2BEVB 1X0VA 2FWPA 1Z47A 3VPHA 1ZMXA 2BZYA 4Z2YA 1I1NA 2O2YA 2RHGB 3QKSA 3R7AA 4MMYB 3AUXA 1BWSA 2M6KA 3I30X 1GUBA 1UZLA 3OUTA 5LFAA 1C9MA 3LY5A 4RPHA 2XMBA 3IKVA 1SVNA 1PSEA 4TMKA 5MHTA 4LDYA 4II2A 4BMYA 1J33A 3LOQA 2BR5A 2DF8A 5FOWA 4G36A 3QFTA 4TMZA 5H9VA 4JUDX 2B1JA 4P0QB 2AYYA 4KQKA 1D4AA 4B1FA 1JXOA 1R8QA 3DZIA 2OXEA 5EZSA 3QKJA 4Q1VA 3IE0A 1PQYA 4B0OA 2YVLA 1TDJA 2RK4A 3DXFA 5F51A 5JPDA 3WQSB 2ROTA 4E2FA 1L9KA 2IV7A 2XMPA 2VYCA 5AKJA 2AVDA 2AC7A 3KE8A 3WE7A 4J9BA 4BNZA 4LV6A 2LCIA 2P2SA 4JUCA 2WSBA 4M7PA 2PH5A 3LQRA 1QQAA 1JEOA 4DWWA 2FPRA 4BO7A 1G5TA 4FILA 3WYCA 1JDBB 5E6RA 1HYBA 3LYHA 4KR6A 5FR2A 4ZC1A 1FNBA 4HOYA 1N5LA 3TD6A 1R6VA 4P98A 4UU7A 3OZDA 5EG5A 3NIGB 4WA8A 2JLUA 4IHJF 5CO7A 1B7GO 5IC4A 4D8TA 2V7WA 3A1EA 3JAWB 5IDQA 4TTQA 2DEUA 1QO0D 3CCQT 2XKJE 1N7HA 4FM4B 1P0FA 2O3JA 3HB1A 4DNXA 1RYHA 3SJCA 3RV3A 1L4KA 1ZJWA 2I2LA 1MQ8B 2Z5LA 4M7AE 1W5SA 2DPHA 5C2JB 3GRYA 5SYMA 2JM9A 4FFRA 3SHVA 2POQX 1UJBA 1Z18A 3QWAA 1YZKA 4CL8A 2ZVQX 2VWFA 4INOA 3NGLA 3TSYA 3A1TA 2HSEA 4PLWA 4RANA 3SKYA 1J90A 3ZGXA 2PWYA 4QIHA 4YLEA 4R2WA 2JGMA 5DNVA 2FX2A 3KJZA 4P22A 3ABQB 4JS0A 3CCQA 5B3LA 5JLJA 4UBLA 4TL7A 4B6GA 1TA4A 1WDTA 5JBQA 1QIKA 1MJ5A 2QUKA 5K0LA 3M82A 1PT5A 5FQNA 4RTJA 2NUPB 1E1CB 4NFYA 1J42A 1DO2A 1MHTA 3B9PA 1D1BA 1XP5A 4IUBS 1AN9A 2E12A 2X4YA 5IT4A 5C5CA 4KSYA 5DNEA 1NQWA 5D7BA 1XEAA 1WCWA 5JARA 4B84A 4B3SB 4F72A 5JTTA 1TH7A 3GQVA 5LIPA 2AZ4A 3TL6A 4M0UA 3OOHA 5LQUA 4XUEA 4RPCA 4TWRA 5KQGA 1C9NA 2LUOA 4E51A 2H2WA 2QRHA 4OKIA 4DNFA 5FTKA 2PMBA 3FB4A 1ODSA 4XEUA 1HSZA 3DW3X 1YNOA 3QYGB 1JP7A 3P0JA 3Q7RA 4G9BA 2PVOB 2XHZA 4G97A 3IMGA 1NIJA 3PPXA 4MVYA 3F96A 3I55Q 3EWIA 3WKBA 2CVPA 1KKUA 3PHLA 5CA0A 2N47A 3UNXA 4EEXA 3UJDA 2K2QB 3EN0A 3QDFA 1UCFA 4MYDA 2E4ZA 1GPJA 2O5RA 2OAUA 1E2QA 5FUYA 2REXB 3GLKA 4M4ZA 1BN7A 2ZRPA 4Y2XA 1GCOA 3AVPA 4AO8A 4H60A 3H1TA 4FW9A 3JCMJ 1DG1G 3ZDQA 1NW4A 1KK1A 2DZDA 3THXB 2V7UA 5JS6A 2Y27A 4PJOF 4F5YA 2HSZA 3X2SA 3AI3A 2B3TA 3A3KA 1VL6A 1I81A 2P79A 4JU9A 2O14A 1YZQA 3FA2A 4PN3A 2HA3A 3KB1A 3G17A 3WMGA 4DRXA 4GBGA 4I50F 3LBAA 5GJVB 5EKUA 1G83A 3WHKA 3NTVA 1C4XA 3HSYA 2EAYA 1E64A 3WIDA 2BMWA 3GRKA 3RRZA 5GAOl 1BWQA 4C5BA 4GRIA 2GVDC 3TINA 1S6YA 3FHLA 3UOAB 2WF6A 4S12A 2DTDA 4IDDA 1M3SA 4AG3A 1E1QA 2ECKA 2YHAA 4DDUA 1OBVA 3LM8A 3PHHA 3JQ6A 1V4NA 2Y0CA 3FPCA 1Z75A 2A9OA 2QAIA 4Q3OA 1J97A 1WJRA 4E5KA 3C0CA 1OBHA 2I2BA 4G0ZA 2C82A 1R16A 4ZAXA 3WDSA 3GGGA 2P3LA 2R8RA 2HXGA 1FFAA 5K3CA 4YASA 3VR1A 4F3KA 3MRTA 5LJ5g 3H2SA 1DWPA 3I64A 3I4FA 2VXFA 5K0FA 4D42A 1BGWA 1TLTA 3JWPA 2NVWA 3MB5A 2JIZA 2GO1A 2AWOA 3CNNA 4M8LA 3TUIC 2LBPA 3QUTA 3U19A 3M2TA 4YCAA 4Q4JA 2J32A 1E2HA 4KGZA 3ZTYA 3GHYA 2P27A 3TW0A 1YACA 3TKAA 1M30A 4J4BA 5JSZB 4R81A 2DBMA 5GAOn 1F2VA 4ME7A 3VU9A 4YJ2F 3F6YA 2GYYA 3ZBUA 2I4RA 2O2SA 5AVVA 2HO5A 5BUCA 4NATA 2XCSB 1EJ2A 1KEWA 3PVZA 1JJ2P 3WGQA 2VYFA 4YMHA 1CRPA 1VMIA 2ACWA 1R77A 4M75B 2XWJI 1R2QA 2Q8NA 1XI2A 5AOCA 1DLJA 2REOA 1QGDA 4YRQA 3CLSD 3ZZTA 1UWVA 4ETMA 1T0JB 2C2YA 1V76A 2Y92A 4X34A 4L4RA 1GPYA 1BU5A 3JPYA 5DY9A 1L4FA 4B71A 3EZ2A 4AKSA 1XYYA 3PRYA 2FMKA 4C3ZA 3HQ4O 2J6FA 4F2GA 1CVRA 5A71A 1ZSZB 2Q4DA 4YR9A 1O95A 2E65A 3ASKA 3ZS9A 1HG1A 2VVTA 4MWZA 3VSAA 3WGJA 4FUQA 1K9MU 2BKLA 5F23A 1HEYA 4ALJA 4DGSA 4BQEA 3F70A 1YVPA 1Q14A 1EUYA 4BVHA 1MV5A 1SCKA 3U4IA 3GH3A 2BJHA 1GCQA 3OESA 3FR7A 4IOLA 2ZIAA 2AN9A 4KRGA 4KAFA 2X15A 4ZRNA 5L3RA 3DAFA 3HKSA 1H2YA 5BQ3A 1ARZA 2W6JD 4PPYA 5EZ5A 4QU0A 2GVNA 5J26A 4IICA 3R7WA 4GLFA 1Z4MA 4IDPA 2ZU6A 2H1HA 1QB8A 5DRYA 1BU1A 5EP3A 1S9DA 1KJYA 3T61A 2OTJQ 5AK5A 3EGDA 1VQ4T 4YNBA 1S2DA 5A2QA 1RZRD 4ICIA 4ZAYA 4LIPD 4S0XA 1C9KA 1Z2CA 3T4EA 1M3AA 2O4UX 2OTCA 1A97A 2OGZA 3T1VA 1GTG1 5BSFA 4WKGA 3RBZA 3CFYA 1X6VA 4X8HA 2XZOA 1A9XB 4P2GA 3G71A 1JHXA 2VXOA 3DYIA 3L49A 4BMVA 1M1YE 4LXXA 5A7GA 2AHOA 1GPMA 5GGYA 4B45A 3ESYA 2VTBA 3O4IA 2IDZA 4YRRA 4WZ6A 4Y67A 3KLPX 1HQCA 3M58A 3OMGA 5BN1A 2QQ0A 1DC3A 5I9SA 2RAFA 3RV4A 2QTVB 3EFSA 4D74A 1NUHA 1VQ4A 2GPBA 1BRMA 1U28A 1IVYA 1FDUA 3NJRA 5L3QA 5TB5A 1JHZA 2AT1B 1X3SA 4CLRA 3LRPA 4BLPA 4QDJA 2A84A 4KMOA 3EIOA 5EPEA 1QCZA 2FFBA 5BPFA 4MW2A 4N0DA 2P4HX 1SKAA 1CZHA 2ILVA 3EPHA 1TU0B 1W36C 2HK6A 1OW3B 4NZ9A 4BVLA 4IZIA 3JQDA 3HA3A 2V97A 4G81A 2WF9A 2VBCA 5BR4A 1L7BA 2H85A 3HBNA 5JMOA 1DJNA 1DXHA 3B2EA 4EJSC 4F5EA 4Y1RB 4RF3A 4RCVA 3M57A 1TKAA 3QOWA 2FUEA 2HMYB 3LVQE 4CUKA 3DD5A 1PL6A 2DWCA 5A3SA 4YRTA 1JIIA 1P80A 2VQ6A 5J4VA 2D8JA 2V0NA 3H99A 3RRNA 4JJEA 3QXSA 4HVVA 2ZRFA 3WDLA 2JB9A 3NWPA 4U7TB 1F4VA 2XKOC 1POXA 1WM1A 3VR2D 3TLGB 2Q5FA 1MX9A 4RDHA 2A9VA 1PFGA 3PA8A 3ADKA 4MWTA 3CLUC 2OBLA 1VSQA 1IAVA 2BZ1A 2WFZA 5FU6B 2WLTA 2X1HA 1KZGB 1MDFA 2UXBB 1K1EA 1ESMA 1HNZB 5C1DA 1G8SA 3CCUT 3GLUA 5FLXA 4HL6A 5DYNA 2DTXA 1XMVA 2WJWA 2YXYA 1G8HA 3BWMA 1H69A 4A0GA 4DLNA 5IVKA 5AUPB 1NF2A 4C2AA 5K6TA 2Y77A 2REBA 5DF1A 4ZQCB 1UDCA 4NXMB 1IHVA 4OAOA 3RSCA 5KC9A 3WYDA 3IRUA 4UE3S 3AVWA 3ZI0A 1YE5A 4ZZIA 2REQA 1TXGA 2AN1A 4KLZA 3QVOA 2XU8A 3LBYA 2OV6A 1J49A 2Y1EA 4NPHA 3LX5A 4NZNA 4OYRA 3S3MA 2NVBA 2HEIA 5D6NA 1T9BA 1Q1QA 2GETA 2W9XA 4WFKA 4PNHA 1R88A 3MGKA 5K2OA 2D1TA 4B5KA 2FGKA 4FYKA 1P74A 4AKEA 4EA7A 3GX1A 2CHVA 5BSVA 1YRQA 1F2TB 1ZZEA 2EKBA 3NM5A 4S1NA 2OL4A 1AMUA 1T1SA 1N2XA 3PD1A 2HWYA 4QBTA 5IBPA 4JLSA 1QTIA 4BLOA 3LUKA 4WLOA 4EHJA 4M7DF 3SLKA 1SOWA 3DO8A 4F14A 3KKMA 2HHLA 4UUQA 5G1OA 1PW5A 4N1AA 5E8RA 4KXLA 5IXSA 3UPUA 2CFSA 1FZTA 3GAFA 3OE7A 3HSSA 1ZBXA 5K9ZA 1JW9B 4DS3A 1SIOA 2DBRA 1MH1A 4OB3B 1ZBDA 4Y2JA 4TV8B 1I24A 5J40A 1Y9JA 3U49A 2QV7A 4E6EA 4JR1A 4G2NA 3P0IA 2XV1A 1JEYA 2Z4RA 4GLBA 5ICGA 1AHPA 4CPDA 1DBRA 3BG5A 5CVEA 1R9GA 1MB2A 1QCNA 5CA1A 1OILA 3OJXA 5DTQA 4JMPA 4ND8B 4NCKA 1G21B 1XFDA 1UBCA 1V3QE 4OP3A 4MZTA 4X71A 4CRWB 4AJ2A 3QX7A 2GZ3A 4G8CA 3C1AA 9LDTA 1VRVA 1XZQA 5IBRA 5GIPE 4FU6A 2VRCD 1ABFA 1SSFA 3MEWA 1PUJA 1CQWA 5AESA 1RKVA 2Q5LA 4HB4A 4P5DA 2MSEB 3EEOA 1O58A 4B33A 3O4JA 5CGZA 1YRAA 4LE1A 4LK2A 1J8QA 1MGPA 5A3RA 5LJ3j 2AFIE 2IITA 4HMQA 2CVQA 1WV0A 4R51A 1Z17A 4ILKA 4LOKA 5ANRB 1EVQA 1H42A 4GYWA 4AWBA 4KUIA 4Z8YA 3TZLA 4BO9A 2H1SA 4GPD1 1IPFA 2CFCA 1UDAA 2QR3A 3Q15C 3GQBB 3VTKA 4OJMX 5HS6A 2A28A 3MTJA 3RMSA 3ILSA 2QBYB 2IPLA 3QEMA 1JHAA 3QENA 5LQJA 2VSXA 2CYZB 3KSDO 1OXBB 3PGA1 1TL7C 2BBWA 1GNRA 4AZVA 3ZY3A 4P3NA 5KU7A 1U7PA 4K1LA 1X14A 1J9GA 1A88A 3OX3A 4M7AF 4RFVA 2WY2D 5ECAA 3I0MA 4N9WA 4IZ6A 4PR0A 1PJQA 2QJRA 4DMGA 1VXOA 2B98A 5K8UA 4NOLA 4EDFA 5AJWA 2QAZA 1GFCA 3R9WA 2X0RA 4C6TA 1NNLA 3OLVA 4KVFA 3GRUA 1NXXA 3HRKA 3AJAA 4QPNA 4EYOA 3PNOA 4IO0A 1DEOA 4IKEA 3NPMA 3D6MA 4ZQIA 2XXJA 2GF7A 3ZG6A 1W30A 3CCBA 4M49A 1PNOA 2JF0A 1UK9A 4MQUA 2PH1A 2AVNA 1UM9A 1GZ5A 2EDCA 4ZCQA 1XQ1A 4RHYA 2D1XA 3LYAA 4HAUA 1BXGA 4CQMB 2BVNA 2QQAA 5EPUA 1Z6TA 5B2ZA 3IP6A 1G18A 4DM4A 5LXTF 4M9UA 1QS0A 1T5IA 1FFBA 1C7IA 2ZK7A 4J2TA 1SBTA 2XIQA 4R40A 1V8DA 1BA2A 4GP9A 2HT1A 3JRZA 1YBVA 4E7PA 1VQLT 4NXNB 1ZW6A 3H1FA 2UZ1A 5CCBA 5FBLB 3IIMA 3F6EX 5G40A 3G6KA 4RD1A 1JGTA 1Z2NX 4FMCB 4Q9AA 4LAFA 2VEDA 4GVXA 2QT0A 4WNAB 5ALKA 4JSTA 4GGMX 3L8CA 3E7FA 5C1OA 1UKYA 5KCMA 3T9BA 5CKFA 4I55F 3WI7A 3WZMA 4F17A 1KAEA 4BN4A 4CM9A 1AQ6A 3QFSA 3QI7A 4Y3UA 1X2EA 2I6TA 1U0EA 2K5UA 2ZI9A 4FYMA 3MJ4A 1UODA 5T4HA 3PDJA 3IOBA 3ZY4A 2Z6VA 3U4DA 3DO5A 1VQLA 4JVLA 4C7OA 1NOIA 4KDEA 2Z8XA 4J0QA 3A1UA 4XM1A 4XWOA 2HQHA 1UFOA 2P6UA 5KX5F 4KEAA 3KZXA 3HPWA 3JTEA 3KJEA 3IOYA 2W98A 4RACA 1KI6A 2WJIA 4HI0E 3HCCA 4WY5A 4TLAA 4KFRA 2WQ7A 2X77A 4HAXA 3ESRA 2BL4A 2WSSD 2AXQA 3MCAA 4H27A 1AA9A 2BELA 4ZGWA 4DBRA 3N2NA 3AM5A 5DLQE 4KQXA 5C8XA 2XMCA 1RACA 1KRHA 3CCVT 2F9MA 2FN4A 4CCWA 3ANTA 4EFKA 1KIKA 2HK7A 1PWHA 5B4UA 4MYUA 3H3JA 4D81A 4KSBA 1AQJA 1KY4A 1ZOLA 5FOQA 3O03A 2P9EA 5CCXA 1T0UA 3C48A 3F78A 3PVCA 3BK2A 1CDZA 2GZ1A 3AG5A 1PT8A 3CEMA 2VJNA 3YASA 1U2GC 4TLCA 4D8YA 3U3XA 3OQBA 4Y6OA 1VHLA 1YJQA 1Y8RB 3AJ8A 1Y1KE 5FNVA 4E70A 3QIVA 1YR2A 4N7RA 1FS6A 4U7HA 2R79A 3K9QO 3CCVA 2YY5A 2L3RA 4H17A 1QKJA 4EMSA 3KNZA 2C4WA 4OMQA 3BDAA 5F4BA 1WKVA 1ZYUA 2ZYSA 4JX9A 3ZE6A 1L5ZA 3EAEA 2FPWA 1MAUA 1G6KA 4HF7A 3CNHA 4LUDA 3BTSA 3DYVA 3G71Q 2FQ1A 2OO7A 1RP1A 4O8ZA 3HO8A 1I4LD 1ENYA 4C0ZA 2PG3A 3CMET 4DR7B 1VE1A 4YCDA 1TQ4A 1FJGB 1A7AA 2LDXA 1OWMA 3A5ZB 5F9HA 4J9GA 4IKPA 4RXMA 3CBPA 4RHFA 3JQ9C 2YXNA 2ZJ5A 4U2FA 2GOYA 4DE5A 3MWEA 2QGFB 4R2MA 2DA9A 1S3GA 4EATA 5C7LO 5LJ3h 1XRSB 1HBJA 3JQEA 4XX0A 1JKXA 2ZSEA 2RIPA 1ULAA 3G2NA 1YFZA 4I4TF 3IUPA 4Z9BA 3I04A 4OPMA 2GFIA 1HT2E 2FV8A 2WM3A 3BFXA 1DZIA 1U06A 5EIAA 2PL1A 5KVAA 3DS8A 2P1RA 5GOTA 3IQHX 4Y2PA 3OEHA 4Y2SA 4OF1A 2EKQA 3M1LA 3IAS6 3ODPA 3K6SA 2E4YA 3KT8A 2WJHA 3DZCA 3H5LA 4URYR 3DPSA 3GARA 3NBAA 2H11A 3RH0A 3AF0A 3ONDA 4EHDA 1KMMA 1YL7A 4JELA 3W9BA 4OP1A 2IKQA 3E9EA 3VR0A 3RS9A 2AJ8A 1SUCA 3U0VA 1GQ2A 3NBMA 5DRTA 1KAOA 2J9FA 3L3BA 2RC6A 3CBOA 2ZB3A 1XN1A 4RKEA 1E79D 2X9NA 3HYCA 3DVLA 2EKZA 3L42A 2JCVA 1I8TA 2L69A 3FWZA 4EJ2A 4B3HA 1T9DA 3MXOA 2NNWB 3PRHA 4W6QA 4LBWA 2KAFA 3UWNA 1V9SA 4MV6A 1DDGA 3AEKB 1L4LA 2NGRA 3C8HA 3KT3A 3RRBA 4AKIA 3KQMA 4KH1A 4LE9A 3A1DA 4CM1A 2G9RA 4GSKA 1XZBA 4DHEA 2Y6VA 1T1GA 1MZVA 4BJ3A 1PRYA 2IELA 4YVFA 2ZR0A 5TX7A 3AVOA 2RA2A 1N8RR 1IVNA 3OY7A 5JAZA 3GMIA 3OQ6A 4F04B 2HCBA 3M3PA 3HEMA 3GIDA 2PLRA 1S7GA 1MEEA 5B2FA 4LWOA 3DZFA 3IVXA 2WSMA 3OT4A 1JYFA 4OAQA 3VJPA 1Q3TA 3G3EA 3ZN2A 2WIAA 1KYQA 4B6RA 2QTZA 1K7XB 1VOMA 4EG8A 5JAOA 1EAMA 3LKVA 3QFHA 3DDNA 3HXMA 1ZKMA 4CHGA 4M0PA 1E6LA 4DLLA 1DBSA 2FB7A 2QGZA 5BYAA 4B6EA 3MTIA 3N86A 3ZWOA 1K1ZA 2Z43A 2W58A 4G09A 4GOND 3UQYS 1SHFA 1NAIA 2V3WA 1GFIA 2NIPA 2DXTA 1ZGBA 2GMWA 1BBZA 3OZ7A 3COWA 2WVJA 1NXTA 1USWA 4BCDA 2AMYA 4AO6A 1Q12A 4AK9A 1BZYA 1I36A 1FU4A 5ALOA 5CFZA 4NEQA 2WKSA 1DRJA 3DGEC 1J1IA 5EINA 1YS9A 5GAN8 3OYFA 3UAVA 2Z6QA 1HEIA 2XE7A 3RU3A 1Z5WA 2IOFA 3LA6A 3Q9NA 4G5GA 3HEBA 3I0ZA 1VHWA 4IXMA 4R9UC 3HEAA 4DMMA 4REQA 4BDTA 2AUNA 2HWUA 2AEEA 2HA7A 3HO1A 2CFOA 3FHJA 3IS3A 3OOEA 3S2UA 4HDAA 4OQPA 1GA6A 5F76A 1G8PA 3UPTA 3U80A 3NU1A 1S0UA 4FI3C 1ADFA 2XZTA 1B14A 3HFRA 5FORA 4MKRA 2I22A 3GEEA 4RU1A 1LZLA 1NW6A 1TK3A 4MW6A 1GBRA 4P58A 1AUXA 2NSHA 1AXRA 1EDDA 3WBBA 3G2OA 2YHSA 3CX3A 4GMKA 3UMSA 2PS9A 3ZE7A 1CQJB 2EWWA 1UJMA 4MVXA 4FLEA 3GLQA 4CM5A 2PUOB 1N5KA 5D7NA 3NNSA 2WYWA 3EQ8A 5K0GA 2JJMA 5IXBA 3A9VA 3DONA 1I7SB 3C97A 1Y5LA 3PITA 2I1WA 4C87A 3IOMA 5CDTA 5ICEA 2Y4YA 5EXXA 4AW9A 3V4VB 4NOYA 5L40A 3PIRA 3PP8A 2AYXA 3I2FA 4TV9A 4IUTA 3LCVB 2M1XA 1QVRA 1M6YA 1U8TA 3G2PA 5IN5A 3ZV3A 2R751 2RHTA 3FYUB 2PDAA 3O47A 2WYHA 3JD3A 4DSAA 1IPEA 2QIOA 2FB9A 4LNAA 1JU4A 3UWKA 1P5RA 3VRHA 3ZBDA 2H59A 2IYWA 3OZTA 1XL0A 4IXDA 4EHLA 3MWLA 2J59A 1GPWB 1DQNA 3Q7QA 3FJ5A 1J5PA 1PFQA 4P7GA 4YT2A 3GFFA 4OLHA 4L4YA 2ZBUA 1BKBA 5IBQA 1TYCA 2HL6A 1KG1A 3O8CA 1O8CA 5AW0A 3M5DA 3GUYA 3GELA 5EJFA 1SU4A 1U1TA 4Y0VA 4DLUA 5FJIA 1EWQA 5KTMA 1SBIA 1N4DA 1R4NA 5MFPA 4BJ5A 2GT1A 2QXTA 1YBFA 5AHOA 3ZZ1A 4ZOLA 1B8OA 4L6IA 1C41A 2C7BA 5JXIA 2WSYB 3F98A 2FWNA 3V2UA 5BSEA 3VC7A 3F2VA 3M4XA 1V16A 5C5EA 2BGJA 4WACA 1ORTA 4MQFB 4N7JA 4QFMA 2FRYA 1V8FA 1JLSA 3MJDA 4BUCA 5DW3A 5E0OA 2KB0A 4UBMA 2R9VA 3L4BA 2GARA 3FKSA 3FI0A 5I4KA 3Q3EA 1LH0A 1KC8C 1W8DA 4RELA 5AUOB 2ACKA 1QKWA 2VSQA 4X1IB 4DJFC 1PS0A 2ENWA 1X7XA 4OI4A 3T8YA 3WYFA 2P4RA 3M3DA 2J3EA 1RKXA 3PNBA 2V7EA 1RW4A 3GAAA 3ID6C 3OLXA 1E60A 5GAN6 1FJXA 1DKLA 4PC7A 2VUHB 2J41A 3L0IB 4OUDA 3KEGA 3RHSA 3PCXA 3VS3A 1E2LA 1X9HA 4LVNA 5U9CA 1XXLA 4RZHA 1CZLA 4MGEA 2Q0SA 1FSFA 1VQPT 4X41A 2GZSA 3WNZA 3GUZA 1HE3A 2EFEB 1YDFA 2Q9UA 3PHGA 1PZEA 4GC9A 4ZCLA 4IXTA 4EG1A 2FL7A 4QREA 4DWJA 1D1PA 2JGLA 5CBPB 4QDTA 3P2MA 1QP4A 3UH0A 3OQIB 2JLYA 1EXDA 4MSUA 1R0BA 3EH1A 2QTCA 2QD2A 5HF6A 5BRJA 2ERXA 4PCVA 5ECDA 3FDXA 4ZALA 2JKZA 3QJ6A 2OQIA 2PTHA 1OAKA 1TM7E 3T5TA 3IAAA 1UZMA 2NTEA 5I22A 2AX4A 1R0LA 2W2LA 2HT6A 5JCJA 2Y71A 1E3EA 3UUWA 3H5AA 1NW8A 4JIMA 1VQPA 2O8NA 1Y9DA 2H9YA 1YE8A 4F1WA 4YUWA 1E7SA 4PC3A 1PO7A 4JKIA 2Q2OA 4PCUA 2A58A 3NCTA 3MMSA 4MO9A 5BSHA 3RYFB 4KK4A 4Q9HA 2VR1A 2LP4Y 1D0VA 3SWNC 3CYFA 4FYXA 1AGNA 1KOLA 3P9PA 4I08A 1QV6A 4O2BA 5AM3A 5KHLB 3NXKA 5DX1A 2PRJA 4MAMA 1Z37A 1XLTA 2K6GA 2YRFA 5A9SA 3ENWA 4ND3A 5CDSA 3O95A 4IEIA 5J5CA 3SKVA 3W6PA 1EDBA 4QVIA 4P36A 2BKUA 1UM8A 4QECA 2WAAA 5K0SA 1TNDA 4D9HA 3LUCA 2J87A 5MN5A 1IVSA 5HPYB 4EMKA 2K3BA 1RWXA 2N75A 1V8OA 5WRFA 4LGYA 1X6GA 2FW7A 1Y96B 1M75A 4NP6A 2VP6A 5IEJA 4LVOA 3HA5A 4RCBA 2GHQA 2QKYA 4EHHA 1C30A 2GGSA 1QP0A 4TUYF 3BXHA 3NM4A 2CLFB 3HI4A 4EJFA 4HT8A 1XJCA 4ZO8A 4PRZA 2VDPB 5FBZA 5A2GA 5EWJA 3TSOA 2O8EA 1WPRA 2NVUA 4YPVA 2A7XA 2W11A 4Q48A 4F6RB 2P1ZA 3DHEA 2IHTA 3GLIE 3L7BA 4TMYA 3QF7A 3LPNA 5LQSA 1C8LA 4GZMA 1EFPB 4HT3B 2Q45A 2YUOA 1JPJA 4JEIA 4G1BA 4RCZA 1IL0A 4OI0A 1P3Y1 2F9LA 3CLTD 4B81A 3TW4A 4X0EA 4GI1A 3F9CA 4KWIA 3LZDA 4C92D 4XVHA 3CLRD 4BZZA 3I4LA 1ZC4A 5JJBA 4DA9A 3IBCA 3G9TA 2FW1A 1KSGA 3RTEA 3RTBA 4TS3A 5LBIA 3NTIA 1QZUA 3TZQA 1ONOA 4FR5A 1NY5A 4DILA 5KINB 4MI1A 4QM6A 4B4VA 4MQ6A 1NLMA 3IQXA 4HPWA 3VJKA 3AM3A 5JAQA 4JXXA 3CD6T 1RHKA 2JJ8A 2GWHA 4QU8A 3OZFA 2LRHA 2ZI5A 2FN9A 2A3NA 1SKYE 3FUTA 3W9SA 1N3YA 2CNLA 3H75A 1G8XA 3RC7A 3VS1A 2O7SA 3TQ7P 2RB4A 5CFOA 5BSKA 1YOVB 4YHHB 1Q1NA 2ARKA 4J9IA 2FEWB 5JW6A 2VG8A 1FU7A 5JSUA 1EBFA 4INAA 1YJBA 4OQNA 5AKZA 2ED0A 1KFKB 3IUQA 2J4DA 4GKAA 3KV3O 3PQ6A 1W48A 3CD6A 5HK9A 1RM5A 5E4FA 1M66A 1BVYF 4X62B 3KZVA 1YUBA 3IUEA 5HKKD 2Z2XA 4AS2A 3UY4A 3MMXA 5E7JA 2F1JA 3E3LA 4GZ3A 2IODA 3EUEA 4NCXA 4ZYLA 2ZUWA 1PSWA 2ZOSA 3ZHXA 4PBTA 4G5QA 3LGFA 2Y2UA 2YT6A 4BFTA 5HOEA 2JH3A 1FVXA 1XR3A 4Y28E 1WDLA 2WZCA 1P8JA 1CVIA 4J4TA 4Y9RA 1LVHA 4KPEC 3JB9G 1KORA 1YA6A 4RVUA 1O87A 4DV2B 2QZPA 2DO3A 2RK3A 1HZJA 3FD8A 1FL9A 1G20B 2QTMA 3VI3B 3DMTC 1QP7A 4ZRDA 2BIVA 1X80A 5B55A 3UA3A 5JANA 4V1CI 2PLNA 1FSSA 3AEYA 2VHEA 1IRXA 2MYTA 3CKLA 3NFRA 4EA8A 4UM8B 1IQUA 3CCJT 5J2UF 3T7EA 1S4MA 4B6OA 1MGQA 1QUFA 1LC0A 3PVQA 2XG8D 1SHJA 3JQCA 1RHRA 4B44A 1E7RA 2QQ9A 5BRNA 1LI5A 5KJFA 1ZK4A 2ISQA 1QV7A 1U4OA 1WYXA 4ZI2A 3PNKA 4GBMA 4TTJA 3UMGA 2OKGA 4D9KA 2LQWA 2ZB2A 5LLSA 4RMGA 5H3LA 1KFBB 5CT5A 1Y1PA 2PUKB 4Y6LA 1BEZA 5AHXA 4HLNA 1FTNA 1ISPA 3F7NA 3UJBA 3JAKA 2UUPA 2DL8A 3RLFA 4A3SA 3CCJA 4JI6B 3RKUA 5C5DA 3G1WA 3OTGA 5KYWA 2FSIA 3VGJA 1VPWA 5K4AA 4YQFA 1W85A 1F8YA 4NZPA 5EHNA 3OYAA 5B7NA 1OA0A 4NVRA 3UB2A 3PX2A 1KMIY 3SMVA 1SHZA 5ALTA 3PQ3A 3C0KA 3KTFA 2IEZA 4CCAA 3LO5A 2H1WA 1ABOA 3QYHB 3FUXA 2Z04A 2LT4A 3R4VA 4UREA 1SPXA 1UZAA 1Y7PA 1RXCA 1DCFA 2PBFA 1FFSA 3R3SA 1IE3A 1R0BG 1PR1A 2LVMA 2XMDA 2C31A 3KE9A 3I9FA 3DR5A 3GBPA 3MIZA 3VISA 4BDZA 1V5FA 2ZPAA 2XLBA 5CT6A 2BFDA 3QKRA 2Y05A 4R1MA 3T9AA 1DWQA 4NIMA 1TYZA 1T3HA 4PVCA 1IGUA 4ZDIA 2W2XA 2ORED 4DANA 1R8XA 3KSAC 2VV5A 4NYJR 4K11A 1G7SA 1GKUB 1GFWA 4X61A 2DAQA 4DR5B 2RGNC 5KOJB 2GEUA 1LK0A 1YCDA 1I3KA 2AEJA 2XB2A 1PQWA 1NXWA 5CLLA 4XGQA 1RMYA 1ZD8A 4D3ZA 1S3FA 3C12A 2A9PA 1YNSA 3DXXA 1BI1A 5FX2A 3I5SA 4NICA 4PLYA 4EG3A 3R3UA 4RMHA 2B4TO 4F6LA 4NK4A 5I7WA 3QLVA 3R20A 3HDVA 5M5BA 8MHTA 1KI7A 1VFPA 1KEZA 1HLPA 3CUUA 2HTEA 5BN3B 1RQGA 4HZUA 1KXZA 3LX6A 3L7OA 2NTJA 1NQTA 3O4HA 5J58A 1EG2A 2ZYRA 4IIEA 3N6VA 3DMHA 1SOAA 1Y07A 3CC4T 2CMGA 4ZQHA 1OZ2A 3ADPA 4BWFB 1VPTA 2XXBA 2HV9A 1VYTA 2ZWIA 1N1MA 1GGKA 3QFRA 4C07A 3OOSA 4X7PA 3L7NA 5T4FA 3K30A 4OHXA 4OI1A 5F33A 3RCBA 3W5VA 3H86A 4BB9A 3O21A 3WB2A 1EX6A 4I4IA 3WR5A 3STVA 1J39A 2GZHA 3KSMA 4YAUA 1X6OA 1ZD2P 2CF6A 4MKHA 3FDZB 1DJPA 2BJVA 3IBTA 3RK4A 3TLCA 1I4DD 3G8DA 1VJCA 2JFVA 5I7HA 3H5VA 3QSYA 3B60A 5LNK6 3IA7A 4C88A 4FHGA 1MQSA 2HCRA 5H4HA 3EGXB 4YP1A 4JDPA 3BT7A 4L15A 2CXNA 1QJ4A 3UMVA 1YRHA 2C03A 1K8RA 2YCLA 2A5LA 1EINA 3I2KA 2AS0A 1EH5A 1UKAA 3M55A 4LNUA 4B2IA 4UUBA 1TMGE 4YRZA 3TZCA 2W0MA 3WKCA 1NG1A 4XYBA 1A27A 4O4IB 1WUJS 1KVUA 3CUKA 2CUNA 2QD5A 1ZWLA 1A2QA 4EENA 4X9DA 2F5TX 2GKOA 1L7VC 1IHXA 5F3DA 2RGWA 4I4LA 4RH3A 4GM0A 2M6LA 5L3SB 3HLYA 1M8JA 5B4TA 1PSZA 3OPNA 4N6OA 5ARDA 2IHVA 3IAM1 1C2YA 1XTIA 2JFFA 3SXJA 3KDSE 3U7QA 3LQ1A 2WQ6A 5ITSA 1EP9A 3JCMW 3WRYC 2ID8A 5TT0A 2NO9A 4NH0A 4BV8A 4LJ4A 2O1EA 2B86A 3AB8A 2Z6AA 3WMXA 2IPOB 3U7IA 4ELYC 3CT6A 3D6JA 4LFAB 3H8VA 2HLPA 2ZRQA 3ORRA 4MINA 1ZL2A 5C4GB 1U04A 4YCBA 2GS9A 3TMYA 4F8JA 3TNYA 4KLCA 3DV0A 1US8B 1H1DA 2RH8A 3N7UA 1DRUA 1BI3A 3NJ4A 1QIMA 2IWHA 2YWHA 1B0PA 4AYWA 1QHYA 3LCJA 3P9RA 3D81A 2F1RA 5LMCA 2FZKB 1LJOA 4KACA 2JHGA 1XNIA 3Q9UA 1KJQA 2WZQA 2ONZA 1GEEA 1O54A 5JYEA 1TTQB 1PHPA 4NBWA 1IBRA 1IJEA 3A05A 5CFMA 4F3NA 2PQ0A 5TNXA 3UUFA 1N27A 5FV4A 2Q6KA 2ZJYA 3IKTA 2FUG6 2EJCA 5JZMA 4WKOA 3BDIA 3ZDFA 3KQYA 2VF4X 3BMQA 1NJIC 1VYUA 1HXHA 1RLTA 3RW9A 1KA9H 3DOOA 1XROA 4BIMA 2BEWB 4UU0A 3CX7A 1OCEA 4OXKA 4ZO9A 3F3KA 3QQPA 4YUZA 3KTDA 1GAEO 2G07A 4F92B 3KHKA 3D2CA 2ZETA 2OHOA 3LECA 1SVIA 3OFVA 4L5CA 1S72T 5ES3A 1BAPA 2OV2A 3ILXA 3U3ZA 3A28A 5CYGA 3B6KA 2NVOA 4JL6A 2I2AA 2VDNB 2C84A 1XZJA 2EV9A 3QVLA 4HTFA 2JGFA 3CVJA 2EIFA 4KK3A 4AZ3B 3DUWA 2H4XA 2TYSB 5A4AA 4QFBA 3UHAA 1EHCA 5IRCD 1LX6A 2W0SA 3FCCA 3TLEA 4W5HA 2WHYA 3AWIA 3HZOA 1VQKQ 1YDWA 2KEAA 1IY0A 2BM8A 4DV0B 2G9NA 4R6XA 1GZHB 1SQ0A 3TL2A 4J6YA 5I4IA 3JVDA 2NUBA 2JFQA 5K05A 2VDUE 1KNXA 3DMYA 3M5PA 3MWDA 2MIOA 2A3LA 1E3TA 3NUGA 5SZKB 2ZWAA 2CW5A 5EXEA 2X51A 1UEXC 1AZTA 2WAOA 3JWEA 2QI2A 5A0VA 2HX1A 4XR9A 4KUDK 4ZA2A 3RJMA 7REQB 5K45A 2KXCA 4JI0B 4PGGA 1WU8A 1D6JA 2NYUA 2ZZNA 4BWYA 2P0AA 5CDGA 1M8PA 3U62A 4Y9DA 2WVHA 5KWVA 1YQEA 1MO6A 3LDGA 5DWVA 4LXQA 3CXCS 4Q1DA 3ZBTA 2RGBA 2ECZA 4DSTA 4XFKA 4LHXA 3D3NA 2H1LA 2V9ZA 3C3BA 2VNAA 3OO0A 2YWJA 4CDRA 4M0CA 1QFZA 4DIEA 3H11A 3S4YA 4YBZA 4BMXA 1QM5A 2JFBA 3ASVA 3D7NA 4NL4H 3A9CA 2BE9B 1D09B 2C1EA 1DFGA 3Q6MA 1YQ9A 3GNSA 1IZ9A 1K7FB 1OFIA 2WRZA 4JJKA 1JB0E 4F5DA 3GV0A 1ISJA 2Q5IA 2YVKA 1YJ8A 3SVLA 4U2EA 3EGEA 1RQXA 2D00A 3AI7A 2NV0A 1KZ4A 1AQNA 3T41A 3ESZA 3GJTA 1VKHA 4TTVA 4GU5A 3C4SA 4I9UA 1TWBA 1ACMA 4GLLA 4XQ9A 4E5NA 4JBWA 5LP6B 4ARZA 4YMVA 3D2BA 2H1CA 5C0MA 3OYEA 3GDWA 1R3DA 2IQ5A 2QNRA 4QVKA 1DTWB 4QO8A 1QH0A 5JAUA 4HYTA 4MS1B 4MJLA 1O2DA 2LNDA 1P2GA 5EIBC 5L9AA 4Z8AA 5TJ9A 1QKKA 2XYRA 3BEOA 3OFNA 1D4ZA 2WU3A 1GQRA 3RC1A 1UG1A 1W4AA 3R5TA 2AG1A 4H16A 1XZKA 4RA9A 5GVRA 3WL4A 2FY8A 4J94A 1XA3A 2QS9A 1IM8A 2VP0A 4BJ6A 5LR6A 2IH5A 2C0IA 1FQOA 3HHEA 5I9TA 2HLDD 1V9LA 2CSXA 4ZVMA 3WGHA 2A5DA 1R8OB 3Q5EA 3MJRA 1MF7A 2YWXA 4WLNA 3H2JA 5EMHA 4MGYR 3DOEA 1EGMB 1PWYE 3X1WA 4S04A 1UXIA 5DHUA 2Q7OE 4PX3A 4JI4B 2OSBA 4M75C 3NB0A 3BC1A 1N2IA 5COQA 2W37A 3V8PA 5CXUA 4GMXA 1PJCA 4M78C 3QUBA 2BEJA 1IMJA 2GLTA 3UW3A 2ZTMA 3L7MA 1BOFA 5B6IA 1ZH6A 4RTXA 3BXEA 1N2JA 1TUDA 3JVEA 4NR0A 3K9NA 2LDMA 5CNMA 2HH9A 4CV3A 5C6SA 5GANd 1T10A 4N39A 2M51A 3CRZA 3WO1A 1WB9A 3UK0A 1N9RA 2XUDA 3Q72A 3K16A 1PWZA 4MZMA 1RSZA 5EE1A 3ZXIA 4EHIA 1U6KA 1R15A 4FGJA 3PIPA 1GILA 4ZI3A 1H65A 3KP1A 4BEBA 4QUHA 3DBLA 1UPAA 4G2TA 1VB3A 3GDFA 3R5JA 1WXDA 1ZVMA 4M54A 4F7UB 3FVVA 4MMXB 3C1TA 1KQOA 3L1IA 5AVWA 5JO9A 4F8YA 2CHFA 4NCHA 4I6GA 1K98A 4MV1A 1Y5RA 1LPSA 1VIVA 3KLNA 1NBOA 1RJDA 1A0OA 1EXVA 2UUBB 3CCUA 1LXCA 2F4NA 2PX5A 3DE4X 4AJOA 1LW6E 3WC4A 1H2WA 4WN9A 1LNZA 2SKEA 3VJRA 4IOJA 1JJ2A 3N7AA 3NR2A 2A0FA 2XOEA 5FWYA 1ZGZA 3CCQQ 1JXMA 3BGSA 1Q77A 3F9IA 1T0HB 2DX7A 4HDKB 1UBGA 4Q18A 3R7LA 1C1DB 1ZRMA 1ORVA 1ICIA 4Q9JA 2K87A 4NF2A 1GBQA 4K05A 5D87A 1J99A 1VI2A 3JV3A 4R1NA 5AW7A 3E5RA 1L6IA 3QWBA 5HVNA 2VDMB 1NYRA 4FP9A 3BBLA 3IT1A 2ZJ8A 2WWIA 1ZLYA 1ZQ9A 3EYWA 1T8YA 3FPLA 5F35A 2CFRA 4CKBB 2W8BB 3UM9A 4IO1A 4ZEOA 3CW9A 1GA1A 1P0PA 2VOJA 5AWFC 1U3UA 2QN7A 3TQIA 5C3UA 4ZDWA 4MQEA 4AX4A 3SEMA 2YVAA 1KRWA 4DSNA 1LS1A 1G8MA 1AZGB 4L4UA 4ZI5A 2GPAA 4Z3KA 1WUKS 3C8ZA 3ZWPA 3U7JA 1ZGJA 3QFFA 4R1PA 3AETA 3WFJA 4V03A 4DCSA 4RKYA 3IPXA 1EVJA 1G9SA 5K6AC 4KPUA 4RJ2A 4O4JF 3CR7A 4UTOA 2PHZA 3U6KA 2P6OA 5FPQA 1E59A 2PUVA 2Q0HA 3CSUA 4EF4A 4FS8A 1Q86C 2Y0EA 1ZY2A 1RI3A 5C3MA 3EFBA 5HCNA 4WBNF 3KJQA 1UXKA 2DHRA 3GRVA 4IIOA 2OV1A 1H6CA 3N9IA 1RAAB 4YUYA 1PGPA 3R3HA 2O8CA 1VBMA 4MMZB 4D97A 3OCZA 2QPLA 5ALRA 3CV3A 2JCYA 3ISJA 3T7DA 5AICA 1R5JA 1XAHA 4UNQA 3R3ZA 2ZM6B 2EGUA 4CMHA 1GFSA 2QG6A 1JAHA 3DHWC 3MCWA 3U7EB 3KJNA 1B34B 5FBKA 4CTNA 4IR7A 1ECJA 3GEDA 4W1PA 1NPDA 1FDVA 4U7JA 1DG9A 1A9OA 3SLRA 3FSGD 5H68A 3FFXA 1XZPA 4RADA 4TXHA 3ZH9B 5B58C 2CREA 1WDWB 2WHRA 1RDFA 2E5FA 3HFGA 1E5VA 5JMTA 4C05A 1FMKA 2P5TB 4GSLA 4KLRA 2ZI6A 5CU7A 3TPFA 3PGGA 2JBAA 5CEEA 1H5QA 5D5PA 3U4GA 5CX1B 4HYEA 3DE6X 4CVNA 1XPOA 3JQGA 1JSCA 2Y0PA 4R0MA 2PUBA 1CUXA 2QN3A 1J22A 1Q82C 2Q7DA 1KQ3A 1K3UB 4HGQA 1ONSA 3RASA 5LYJB 3SIPA 4JB2A 4NDZA 2AJLI 4ZMBA 4B79A 4RY2A 3VS4A 1HE4A 4LMPA 4CKEA 3KKPA 3FNRA 2O8DA 4EYSA 6REQA 4M77A 3FG9A 3KAJA 1BX0A 2X1MA 4N8EA 4HQ6A 1KTVA 4AMVA 1PK9A 3TJMA 4IUUA 2QDKA 1G5QA 1SPKA 2GZAA 1GL6A 1X1CA 3OYHA 4Y18A 3IQFA 4IDOA 3ANXA 3BRSA 5BN4B 5EYPB 4JC8A 5I51A 3S40A 4ER7A 4GT1A 1TTPB 2PGJA 1FVOA 4WLFA 4B3XA 1I4WA 1D3BB 4BDSA 4FFPA 3KC2A 3HJRA 5DYWA 1TKCA 4DVGA 2EKPA 1JPNA 1NN3A 2SCUB 2NUAB 3SD7A 3LC0A 4B80A 1H3HA 2ZYIA 4ZT3A 3M70A 2YC2C 2Q07A 3LE8A 2FW8A 5DYGA 4OQ4A 2WPDA 5AJTA 4LX8A 4BB5A 3JCMX 2FEPA 1BSVA 2H54A 3CNBA 4RTQA 3VU3C 1EQ2A 1MT3A 1B8UA 1ZOIA 2IVFA 2C92A 4YRGA 3MBIA 3WK5A 2V54A 1VHJA 3EXHC 1YZGA 1AQLA 1K7CA 4KAXA 5HBGA 4C0XA 4LNHA 1PLJA 3ZJ4A 4HXEB 1HF3A 2YZ7A 1YRLA 1QHFA 1QOZA 1HMPA 4K9KA 3MTBA 3FYSA 3PV0A 1MO5A 3NUZA 4ACAA 2XUQA 4XLLA 2BM0A 2WKPA 2VHJA 4ZICA 3DMRA 4XOUA 1NV8A 4B3IA 2I91A 4BASA 2E10A 4FOOA 2Z57A 3VNQA 2FLVA 2HWWA 1RAFB 4PLFA 4BPBA 3FPEA 1RS0A 2VJMB 4ZGDB 2K7AA 4BKPA 4JZ4A 4AY4A 3X2FA 4OMLA 2CZGA 3JQ8A 2IY7A 1U0FA 1ZXLA 1YHQT 5EXTA 3QP9A 2XICA 4MARA 1AWWA 1RPAA 3FROA 2C57A 3QVXA 2PZJA 1T2DA 3PNSA 1XRMA 5AM0A 1PSFA 2QZJA 3N8DA 4IWNA 1D2CA 2C04A 4MROA 2YSQA 4G5FA 3UJ7A 3VUFA 3TYXA 3RU7A 3PICA 2OQ2A 1Q84A 2C9BA 1SG0A 3EMVA 1PEDA 3B1XA 2F43A 3MO8A 4RGQA 4MA4A 3W06A 1XKXA 2WHEA 4GPAA 3L7LA 3R76A 3S2IA 4GKJB 4Q82A 1KC3A 3NYQA 3U9LA 4O2AF 1YHQA 1CWUA 3TOXA 2DF6A 2ZYGA 2PSFA 1YZNA 3L0YA 4HDSB 5FI1B 3QLTA 1SKUA 4FNGA 2EZ9A 1AUOA 4UW9A 5EVCA 1D07A 5DP1A 2X5NA 2ABWA 3R6OA 3DVAA 1NE8A 2GYWA 5A1TA 2A0WA 4WZAE 4DUZB 3Q0IA 1TZKA 4BZXA 2CT3A 4M9SA 3JASA 2YMQA 4YRLA 1VQ4Q 1BXRB 3DOIA 3L93A 4KNVA 2YHBA 1RZVA 3QELB 3G1UA 3B9BA 1QF9A 3KKKA 3WGGA 4LYGA 4M3NA 4D45A 3QKWA 3OHPA 4ZJUA 5KWIA 3EG9B 3N2KB 2AWNA 2LWIA 1D4OA 1DBQA 3M6LA 3CMEA 4I8IA 2BR4A 2L18A 4DQDA 1T9KA 3SOZA 5AQ1A 2YX1A 5KDLA 3I76A 3RKXA 1EDOA 3CF2A 2BZGA 1Z7YA 2CMHA 3P0EA 1CS0B 2ODNA 3CPSA 1SEPA 2BGKA 3GD7A 1M2OA 1QDEA 1LSJA 1P1RA 4AU1A 1C1AA 5REQB 2FSVC 3KXDA 4AUKA 3WMFA 2ET6A 1SBHA 1XKTA 4DNOA 3FYCA 1DDIA 3RVOA 1XKQA 3AU9A 3NONA 4JJCA 1T1RA 4RGVA 3GP8A 2IEIA 1EVYA 1U0GA 2ZREA 3X25B 2G7MC 5E2AA 1XJQA 4DMHA 1LBTA 3DLAA 2GFUA 3IQDB 4IIJF 1M1KC 3JQFC 4O0MA 1T5TA 1W87A 2HPZA 5GAMj 1N2CB 4ZVTA 1PZNA 1D0IA 4EPXA 3FUCA 5CX4A 1B6GA 1NNI1 3DEKA 4K9MA 3GVXA 2FLWA 3ANSA 1MW9X 4DC9A 2GBFA 3ONNA 2DRIA 3FOBA 2QQEA 2LDBA 4Q4HA 2K5FA 5BW5A 2JGKA 4G07A 3SNKA 1OV4A 5JH7B 3O82A 3NTKA 4DR6B 1N6KA 1HYOA 3ZZ0A 3K9LA 2AJTA 4BXOB 1HJDA 2PWZA 1F3OA 5AJYA 4H1WA 2TMDA 1I7PA 1N36B 4KO4S 2TSYB 1QONA 1Y4UA 4JHLA 3I23A 3BSFA 4YAWA 2RHDA 1SQGA 3DLMA 2PK3A 1WA5A 4ZCSA 3EDRA 3CCUQ 1IOZA 2E48A 4HWSA 3DL7A 3LO8A 3WJ7A 2XGMA 2AXPA 2B4KA 3A7DA 4A0SA 2D5CA 2JW4A 2UYGA 1GRCA 1IG0A 1PNVA 3O0DA 5DOVA 1Y34E 1KFEB 5IVDA 1H641 1CLUA 2O2DA 4RV9A 1NOKA 3E1SA 1J0DA 4MUJA 4Q02A 1QH1A 1DAHA 4PYRA 1JVBA 1YJCA 4M77G 4LOAA 1W2WB 2DBKA 4QAJA 3PGJA 5JFOA 1SUPA 1F8FA 4RA6B 5IHNA 1CUZA 1JJFA 3C5WP 2A4KA 2ZJ4A 5THKA 2C77A 2FZLA 3B8EA 4B3CA 4DCGA 3OBYA 3P52A 3S27A 3GCWA 2JGDA 2QRPA 4BEJA 1ULTA 2PWPA 1FP4B 4FSSA 1OWLA 3TLMA 3EWSA 4MUHA 4OJNA 4P3XA 4R6WA 1AHHA 1P9WA 2HJWA 4Y92A 3O5AA 1L7DA 2PCJA 3EX7C 4AG1C 1U8EA 2RAPA 1TCBA 5CDFA 2FRVA 4NENB 4CV0A 2WKRA 2VQFB 3VHLB 1CHNA 3VC1A 3MXTA 5F1OA 2JFXA 3NHRA 2A1IA 2VGMA 5JVDF 4P4UA 5E9AA 1WX1A 1F9EA 3D3QA 1U7UA 2BFEA 1O6BA 4AKGA 1FP1D 4WIAA 3IOCA 1RLMA 3CXCP 1FDTA 4NQZA 3KHUA 4UNSA 3TB6A 4QW2A 1KJ9A 4K6FA 5DP2A 3RTDA 1YMQA 2PE5A 4LV5B 1Z5NA 1TAGA 1LKZA 4YB8A 4Z54A 2HL3A 3HB0A 4GKBA 1P2UA 1O7JA 2HJRA 3ETNA 3FGNA 4J9CA 1XEWX 4LN2A 4B76A 4ON9A 3I01A 5COBA 3L46A 3HXQA 2HWXA 1V45E 5A4MS 2NSJA 1UP6A 1TJPB 3WRVA 2D2FA 3K2EA 4C4SA 1C4KA 1GNTA 2GKSA 2WP8J 3UWSA 3CCET 1D7AA 3HWSA 4HX5A 4BFXA 3EF0A 4K5QA 2RF0A 3MCTA 2QDLA 2AN4A 4KVZA 3ENNA 1XYVA 3EVDA 3PYXA 4E14A 4XIJA 4ARUA 4YJGB 4LHYA 4WOPA 2E6ZA 2AI1A 3HJAA 3HVHA 5B1SA 2PMEA 3UMBA 1RBZA 1XF9A 5IUNC 2CHQA 2J67A 4JNCA 4GICA 4FCTA 1GKKA 2E3HA 4C0QC 2I2CA 1OBCA 8AT1B 2GNOA 2ZAGA 3DNPA 2C06A 5FAXA 2JLRA 2YFKA 4KR2A 2Y67A 3RROA 3RS3A 5I7SA 3G68A 2HREA 4WZZA 1U9JA 2BCEA 2GNCA 3U3JA 3VYGA 5GZ1A 3WSVA 4YRNA 3U4CA 3LIIA 2L42A 5LJIA 1UJNA 5EXSA 1TAUA 2ORVA 3O8QB 1E3WA 3SAJA 3RR6A 3EEYA 1NMEA 1NOJA 3LV8A 3VVLA 1L4HA 2D0PB 3CEHA 3AT1B 1E1MA 3AUFA 4MITA 2WTBA 4HZGA 1OHHA 1W0CA 2MYNA 1GDTA 3AZQA 3FOCA 3B78A 2BHNA 1DVRA 2CJWA 3E5HA 1S2OA 2BEKA 1T9GR 2PUEA 5H8WA 1TA9A 3LC1O 3GZNA 5LM3A 2RI1A 2FYTA 5GONB 4OFBA 1GR0A 1NJ5A 1M6VB 3W6NA 3CKYA 1XP8A 3FVRA 1ECGA 2SKDA 2PKRA 4BO6A 1RWOA 1GTSA 3REAB 2F3RA 3ZWNA 1KPIA 2YN4A 4FLFA 4L5JA 2R0QC 5DN6A 1MGOA 1JIVA 3N8IA 4HLCA 3NUQA 2GN2A 4PYJA 4BNVA 2IXAA 3UG7A 2WF5A 3NHMA 5IJZA 1HFKA 4NYIQ 2Q62A 2I3BA 2NG1A 4D8DA 2R6R1 3DE2X 3A4VA 4EYGA 2K4YA 4IH1A 4O8CA 2ZRHA 2I4OA 1R0ZA 5ITWA 5GAMh 3ASYA 5IARA 2BHTA 2JD2A 1FUIA 4ZAVA 1CUEA 4TKMA 3ZTTA 4ZT5A 5TVGA 2ZPBB 3OURA 4PICA 5FHRA 2A33A 2QDYB 3NHKA 3UF0A 3RYHB 1U8XX 4JRKA 1PCXA 4JASB 4D57A 1VQLQ 3VSCA 1NKTA 4PV7A 4UFOA 4PFKA 2JG3A 2W6PA 4HLDA 3OZIA 5TIIA 3HYRA 2EBHX 3E82A 2OHGA 5IKOA 2CZ1B 1G5FA 1XX6A 5TQVA 3TEMA 1BMFA 3NKLA 4D8XA 5J47A 1I3OA 9ATCB 5CM9C 1TEHA 4CF7A 4HJXA 1ZA1A 2FZCA 1GUDA 1DXOA 5HZGA 1RXWA 2AYZA 3X24B 2KJQA 5IJXA 1A2BA 3GGDA 3PPWA 1XD2B 2OZEA 3OKAA 3BJEA 4X3PA 4ZYTA 3D8RA 3AQ4A 3ICWA 2HBWA 3EFOB 3HCEA 1HDRA 3S6JA 5LPNA 4BBZA 1XEWY 4B75A 1X13A 2VKQA 2EJUA 2LQ8A 3L6CA 5A04A 2EBPA 1HWYA 4WLUA 2ZRGA 3E7XA 3BFMA 4Q3AA 5GINE 4CL0A 4L4ZA 1JHYA 2ENUA 3AYXB 3T4PA 3QX9A 1AIPA 3BJIC 4X1OA 3FYUC 4CL2A 1U0JA 4LGVA 3O83A 4AD8A 1KVQA 5HFJA 1E4OA 4AZ0A 1WAMA 2JNWA 1SIBE 1ZNXA 2C9MA 4KFCA 3CCVQ 4RZIA 4RVSA 1GT6A 3SHQA 4UHKA 1U11A 4BQSA 1SAYA 4MHSA 3N58A 4EHFA 2H63A 4HX2A 4EQ6A 1CUAA 1SUWA 3IEVA 1CUWA 4F9TA 4TS9A 1N0VC 3SJBA 1Z4IA 3DW1X 5DCWA 2ZS9A 2H29A 3JCMf 4KT0E 3HFJA 3MFYA 1ZUYA 4V0NA 2BM9A 4IIYA 3NYIA 3H3FA 3UA4A 1NRXA 4LDRA 4EO7A 4ITRC 4JI8B 3NT2A 1WB5A 4DTIA 3GIWA 3PWKA 3K9CA 4EDUA 4HAYA 1FC0A 3B85A 4RH0A 2P67A 3HCFA 5IBCA 1EIFA 2XRFA 1ZFNA 3Q40A 5AJZA 3ROZA 1GL7A 4MGKR 1UJ4A 2XJ9A 3BM5A 4PSVA 5TC4A 2MCFA 4DMRA 2B4YA 2FYKA 5E9WA 1C0EA 1XLWA 4YRJA 3H2ZA 3CMEQ 4GZLA 5B53A 1G7RA 4QT4A 2V74B 1X7YA 3LY7A 3DSRA 3AP2A 1ZGAA 2FWAA 2GJAA 3P27A 2ZATA 2MINB 1ZI8A 1OA1A 1YDEA 1JBMA 5JAPA 3I4CA 5JADA 5TS2A 3QI2A 3EZYA 4E03A 1EUCB 1IZYA 4RMIA 4IUQA 5A0GA 4CGZA 1J2EA 1I10A 4BRWA 4HUQB 1YL5A 3A9RA 1E1QD 2DLCX 3H4MA 2X4LA 2YW2A 4QPPA 1WSBA 4EUFA 1O08A 2OCBA 2J3JA 4JOCA 3NHSA 1QQ6A 4AC9A 5HFNA 4J16A 2HMAA 1ZMBA 1O6FA 3MM4A 4N5MA 4LDXA 2AFHB 3GLFE 4OB7A 4KQCA 5TEVA 3CM0A 3W2HA 5HIAA 1NT4A 3RM3A 3MP8A 5FF9A 3S8YA 1LCKA 2IPNA 4PLPA 2IHZA 4AP5A 1X94A 3UAYA 1V3VA 2PJDA 5BVHB 1EVZA 3C7KA 4Q5WA 3LCUA 1O8BA 1VHDA 4F3RA 4LRXA 3GFBA 2DR3A 3EAFA 2JIZD 1P0QA 1IJBA 2RN8A 3QNMA 4O1MA 4V0ME 4KQIA 4MDHA 2AZDA 2C4UA 1EXWA 3D4OA 2VUIB 4OI2A 4V0QA 4EGFA 2R5NA 3DDZX 4WE3A 5CB0A 3BRWA 2Z1NA 1DNPA 2A30A 4CJXA 4ZN1A 4GZ5A 1PDOA 1HTWA 4QVCA 3A4LA 2VZLA 3WQBA 3PTZA 1OASA 4P1ZA 3C45A 1RAHA 2Q5JA 1GG2A 2B1IA 1SA0A 4A4KA 3H6HA 1L1EA 3UCEA 5ALWA 4AKHA 1KARA 2V7BA 4Q1AA 2MAMA 3LYLA 2QW1A 4Y0AA 1KQPA 1SVOA 2AZTA 3QE3A 5ARBA 2JGEA 2FMUA 3N0XA 1UBRS 1M0TA 4H4CA 3D6AA 3SJ7A 3B3FA 5K09A 3N8GA 1BHO1 1PGOA 1TUBB 1QYWA 3VNRA 2CLCX 2NZ2A 4J6EA 3TQSA 4ZCMA 2IYLD 1QDLB 2VK4A 5DSXA 4FGZA 1IXSB 1FMWA 4KXVA 1X6BA 1FBNA 5LIRA 3U1TA 4EX7A 4P33A 2UVPB 3VU0A 1FVHA 1U5BB 1O95D 1T8UA 4B2YA 1KI9A 1RYZA 3BE5A 1Y0BA 4C7BA 4C92B 3PDIA 2KT1A 5EZ6B 5J2TB 1TJ3A 3KOYA 1CUYA 1JFLA 2D9TA 3WL8A 2HEQA 3VNAA 4DFDA 4PZEA 3IXMA 1CUCA 4F96A 1K5DA 2XYQA 1V9CA 3PLNA 3WLIA 4LF8B 3N28A 3D3WA 1I2AA 3BTUA 1HR0B 3ZHUA 1V25A 4K8RB 3KR9A 4IXWA 3VC3A 2VNSA 3GNLA 1L5HB 1Q3HA 3I1IA 5DDIP 1FP7A 5EOVA 4ZI7A 3OZEA 1Y7TA 1DV2A 2ZYHA 3V3TA 3QIAA 3LOPA 5IAJA 4UHJA 4YDQA 1C4OA 1F8GA 3TLYA 3C3MA 1FDOA 2VJBA 2EW3A 3DCJA 3OZCA 4X6XA 5IABA 4JP5A 1UMBA 3ABSB 1P17A 3DEJA 1MB4A 1DTEA 1UXJA 1K8AR 3SFTA 3UFXB 1TF2A 2VO1A 4JI1B 1KAGA 1T4CB 3W3ZB 3T9NA 3TREA 5D3MA 2FR8A 1SUBA 1K9MC 5HMMA 3HMKA 2O6LA 3VYUB 3WK7A 2O0KA 3QLUA 3THSA 3RIYA 4LHEA 3MNFA 2DXIA 3ANYB 1U3VA 2WTNA 3ZE2B 1NLZA 4XU0A 3OCXA 4MS3B 4OHCA 3AHUA 2GILA 2CXXA 4XSVA 4IVPA 3RRMA 4B8ZA 1NN1A 4ZZ1A 1WCV1 4HRXA 2NLUA 1E9DA 2F8MA 2WBLC 5L6MB 4LEIA 5D2CA 4K2HA 3MVEA 2TS1A 2HQXA 1BS1A 2A08A 5IF9A 3VPBA 5IT9A 1R7RA 16PKA 5BWLA 1TKBA 1U7OA 3WWOA 4IJQA 1Q7BA 4PKCC 3W6OA 2PU5A 4IV5A 1ZK1A 4DMKA 3EXEA 3WJ2A 1R74A 5IZCC 3WMEA 1Y6GA 2O52A 1LDEA 2EYYA 1XZGA 3C4JA 1XXHB 4EZBA 1EKXA 3D02A 2ZG6A 3OQ5A 1NXSA 4F86A 5FLYA 5K01A 1A4IA 3V7UA 5GAN3 2RGCA 4UMDA 2VAWA 4DIBA 1QGED 4QDKA 3P8HA 5FPHA 3TQCA 3WYGA 4C01A 1E9BA 2FDCA 5IYZA 4Q9DA 4DLWA 5EG2A 1ZSNA 2NZYA 2G0NA 2FQQA 3FDJA 1H3FA 4ETNA 4WFQA 4JOBA 1U63A 2DBVO 3U4QA 4MGIR 3BFKA 3CC4A 3SXUA 3Q3VA 1AKTA 3ESDA 5K3AA 2WT4A 2B35A 2Z98A 4TKVB 1NT2A 2O19A 1V6CA 4YRKA 2CZ0B 4MQBA 5JHHB 2WFMA 2ODPA 2YV3A 3AHEA 4AIRA 2ZPIB 3BBPA 4D7AA 1TT5A 2UZ4A 5JYCA 2GAOA 1TAHA 1GL3A 5IHXA 3O8BA 4OBEA 4S0ZA 2CSIA 4NNPA 3HMQA 1WVMA 4ARAA 1KDTA 1QDUA 3EVNA 4I4NA 4QPJC 3ZGNA 1A9ZA 2ZBQA 4Q9IA 3T5AA 4QELA 1ZH8A 4RH1A 2Q2VA 2NADA 4KREA 3GY0A 3QBTA 4LKRA 5F73A 5DLEA 4H6WA 1VQPQ 3N8KA 4XFJA 4GS5A 2E5WA 1G0OA 4G1CA 3TQOA 3OC0A 2ZSUA 2OHFA 3CNOA 2YR0A 1E92A 4H4EA 4FSDA 4D1YA 4KIJA 1GGMA 1ZIOA 1CG6A 4PSUA 4Q21A 2FPEA 2O9JA 1JU9A 1MC8A 3Q1LA 3JQQA 1EBBA 3ROTA 1LCIA 3SQLA 2ZJOA 3OYGA 1IH8A 3SBDA 3M6MD 3M6XA 2AIRA 4O4LB 4QXMA 2DFTA 1GN8A 3Q9SA 3TCNA 1J5XA 4CM3A 3LIPA 2CGEA 1JDBC 3I32A 4O2LA 5BT8A 3L7DA 4ATOA 4N65A 3EF1A 4UUOA 2JZ2A 1P6XA 3ZD9A 2ZRCA 2V8IA 3L18A 3VYHB 2V4ZA 1WP4A 3N3AC 2HQEA 4S1OA 4CWAA 1Q21A 4WVLA 3VPDA 3CTMA 2O2EA 4TPKA 2VPPA 1IUPA 5HKAA 4WEQA 2C7VA 4E6RA 1IHWA 3N59A 2DXCA 3WXBA 1HLDA 3BGVA 5HCUA 1G6HA 2EGGA 1Z5PA 5CITA 1NLYA 3IVGA 5K2MA 4Z6KA 1XJ5A 4RZ2A 4G1UC 4EH1A 4IIDA 5DCLA 5DFAA 3D6TB 2L3QA 3IUYA 3B1ZA 3U5TA 5I7UA 4GUAA 2PKWA 5JI3E 4E7ZA 2C95A 4KGVA 1LGYA 2P11A 4M1KA 3PIDA 1CP3A 3PPYA 2CVOA 4JJBA 2H4WA 3WLKX 1GEGA 4J7UA 5CYOA 4PBRA 1J1UA 2PUTA 3A27A 1HDEA 1U2PA 1R0SA 3OBIA 2ZI3A 4AJLA 4D5GA 3WA7A 3LHSA 1NRIA 2JAQA 2XMFA 5DMHA 5M04A 4EHAA 2VOEA 3N70A 2HBZA 3ORFA 4XD2A 1B7TA 2IYEA 2Q2NA 1ZINA 2R1TB 5JDIC 2H7XA 1K6XA 3KQHA 2ZWOA 1QH8A 3DMDA 1AZSC 1T5OA 2WM9B 4MZXA 3HL8A 1W2GA 5HOQA 2P2ZA 3RVDA 1K7YA 3INRA 2P5YA 4MR7B 2O23A 4LJ8A 4I6JA 4G4SO 2AKEA 2MT9A 4KRTA 1W4RA 1H2XA 4KWTA 3AJRA 4RY8A 3G5TA 1H8KA 1YZFA 1NMYA 3FNHA 1EX1A 1D9XA 1P4RA 5I8PA 3KKLA 4CQLB 2DTHA 2MR6A 4RTNA 1RPZA 2DL3A 3LUPA 4L7QA 4FTWA 2AC4A 1S72A 2VWGA 2I99A 4YAEA 1FUEA 3VAZA 3OYDA 5B5SA 4N5HX 3O2SB 4H0FA 3I0NA 2Q2QA 4OXXA 1QMPA 3S29A 3RNJA 3IX7A 4DKJA 7AT1B 1VP3A 4ZVLA 3CD6Q 1UK6A 2Q5HA 1J20A 1XRQA 4L5GA 4R0VA 1L4BA 5IJWA 3NH6A 5PNTA 1K5HA 3SBOA 1UDWA 1U3GA 2ATEA 4GOXA 3GZJA 4WFIA 1J09A 3QVSA 2WU4A 1UMCB 4J6FA 4RCCA 3B6IA 1JWBB 1Q81U 4NAUA 3C6BA 2BGUA 1GFDA 1CTQA 3GYGA 5JNUA 1WHHA 4JEUA 3AHHA 4OU4A 3UOWA 4UTRA 4I46A 1YL6A 1PR9A 4CM9D 4OL9A 5GJVC 4F4IA 4QRDA 3NFCA 4M0LA 3HR4A 5KNBH 1N32B 2FSHA 2YBDA 2DHQA 3T4UA 4E46A 5BR7A 3PJFA 2GSWA 2CJPA 2GTPA 5AOBA 4DGQA 1Q2XA 3W2TA 1RD4A 2HMUA 2FEOA 3BJZA 5SYAA 2QUZA 5DTJA 1TO6A 4XB2A 1EJ6A 2R5WA 4Q7QA 3GF4A 2WINI 5HJEA 3CQTA 1TCUA 4M0KA 5F64A 4HH1A 3R5SA 3M6FA 4O1IA 1K6JA 2ZE5A 1RJ9B 2Z4TA 3B82A 4JQCA 4JJDA 5ES4B 3RWOA 1FYVA 1LLFA 4JWTA 1IN1A 2AHJB 2YDLA 1WPXA 1K2VN 4C08A 4FZJA 3WXMB 1ZONA 5BQP