1ZQ1A

Structure of gatde trna-dependent amidotransferase from pyrococcus abyssi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
437
structure length
437
Chain Sequence
RVDEFLKERNINVGDFVRITKEEDGEEVTYEGYIMPPYELSAGDTLVLKLENGYNIGIALEKIRRIEVLERAKVKPEVHFEALIEGKPGLPEVTIIGTGGTIASRIDYETGAVYPAFTAEELAKALPEIFEVANVKPKLLFNIFSEDMKPKHWVKIAHEVAKALNSGDYGVVVAHGTDTMGYTAAALSFMLRNLGKPVVLVGAQRSSDRPSSDAAMNLICSVRMATSEVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDVPIAKIWPNGEIEFLRKDYRKRSDEEVEVDDKIEEKVALVKVYPGISSEIIDFLVDKGYKGIVIEGTGLGHTPNDIIPSIERAVEEGVAVCMTSQCIYGRVNLNVYSTGRKLLKAGVIPCEDMLPETAYVKLMWVLGHTQNLEEVRKMMLTNYAGEITPYTRFDTYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit D
publication title Structural Basis for tRNA-Dependent Amidotransferase Function
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Lyase
total genus 101
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 6.3.5.-:
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
A PF18195 GatD_N GatD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.520 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zq1A01
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zq1A03
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1zq1A02
2HIMA 2WT4A 1AGXA 1HO3A 5K3OA 1HFKA 4R8LA 5DNDA 2JK0A 4R8KA 2HLNA 1NNSA 1IHDA 1O7JA 1DJPA 1WNFA 4ECAA 5HW0A 4RA9B 2P2NA 5I4BA 2D6FA 2WLTA 4RA9A 1JAZA 2GVNA 5K4HA 3PGA1 1HG0A 2OCDA 1WSAA 5F52A 5DNCA 1ZQ1A 3ECAA 1WLSA 1HG1A 1HFWA 1DJOA 4Q0MA 1JSLA 4NJEB 5K4GA 3NXKA 4NJEA 1HFJA 5K45A 4RA6B 4RA6A 2P2DA 3NTXA 5CBPB 1JSRA 5DNEA 1JJAA 5CBPA 5I48A 1ZCFA 4PGAA 5I3ZA
chains in the Genus database with same CATH superfamily
3QBVA 1KK2A 2GXAA 1KGDA 3RC1A 2FEWB 4WACA 1QO7A 2VIIA 2BGGA 2GPAA 1JX6A 1I13A 5ITZA 2RSLA 3MO8A 1R9GA 2OB2A 4CWAA 1F38A 2DH6A 3HFRA 4C2TA 3G79A 2RM4A 4EMTA 1XTJA 2PT5A 1IHXA 5B4TA 5DYWA 3F71A 3N58A 3WA6A 2XMFA 3WFIA 3BC1A 1L7OA 4ZO4A 3RSZA 3BORA 4FFWA 4EFNA 5IXYA 4HVAA 2O48X 2P9GA 2IG0A 1XCJA 4KQIA 3D6JA 3WLQA 4UW9A 2WU0A 1M6EX 5JC1A 1SNYA 2CKKA 5KHLB 4BX3A 3OFVA 2YV4A 1QK4A 1GPYA 3OQMA 1I0CA 421PA 1D6JA 5HGJA 2WQZA 1M2HA 2AFIB 3IAUA 1XTIA 2PUOB 1HQYE 4HWGA 5LSAA 2IQ5A 1I32A 3JAMA 1E3LA 4MO2A 5J4VA 2EJGA 2RK3A 2H92A 2GGSA 2X6RA 4UFNA 3RG8A 2FG7C 1A04A 1YJCA 1W48A 3EK2A 3B3AA 4AG5A 1XZLA 2CXTA 2BBWA 2NZUG 1FRVA 3RF7A 3GLGB 3ZCPA 3UOWA 1AMUA 1S72Q 1KH1A 1GZSA 2P9QA 1JBKA 3W8RA 4PVCA 2JIZA 3LWZA 3NVKI 4YRSA 4MUXA 5FLXA 1V3QE 4QVDA 3RWBA 3WYFA 1K9AA 1VHLA 1GPLA 3F90A 2O4XA 4AJOA 2G80A 5BSFA 4PLPA 5T57A 1DZIA 4YQFA 1T5BA 3RBZA 1K27A 1TC2A 1G6OA 3MLAA 1X7ZB 3KR0A 4ARAA 1QCFA 4XFKA 4CMGA 1WY7A 4KE8A 2VASA 2OESA 3FDZA 5ERXA 4K6CA 3U60B 1V4NA 3QEBZ 2VI5A 2ZJ3A 4GL2A 1SM4A 2O5VA 1WNTA 2RARA 3ABQB 2NUAA 3L4EA 2MSNA 3H87A 1W2GA 5LMCA 4P6VF 2JW5A 1QHHB 2NLOA 4LJ6A 2XI9A 3S28A 4UEJA 3Q15C 1UEIA 1P0PA 2C83A 3K5HA 2ACKA 4M1TA 2GFHA 3KEOA 5EYPA 4OVAA 3CCMA 1Z6PA 4QQFA 4ND6A 3KAQA 1HYGA 2JD2A 1ZGHA 2E5WA 2Q5CA 4MWCA 3HR7A 4KQKA 4BB0A 3TRIA 3IQFA 1XR3A 2P4QA 1RMQA 4H7JA 3FHTA 4MS3B 1QO9A 3GJQA 3GQVA 5AW8A 3KKOA 1X3SA 5I8WA 5FBLB 5K6AC 3ZGOA 3VM6A 2QJOA 5EMNA 1BH6A 3KJIA 2F5TX 2KYBA 1G55A 2WJGA 1BQ4A 4QODA 5JAHA 2Q3MA 2NO9A 1ZL2A 2ZETA 3SYMA 1P4HA 3U39A 2ID8A 3JWIA 4KAXA 3PC2A 3M6FA 1T2UA 3STVA 2L0XA 4PNZA 5DVZA 3NP7A 4CR7A 2K79A 2B61A 5G0UA 1UBUS 1Y3CE 3GLKA 2OZVA 2PWZA 3WLLA 4JHXA 3LP8A 2NO0A 2W2KA 1XB2A 1FMCA 5CXQA 2RJCA 1PDWA 2OTLQ 4IIBA 1YQQA 4M99A 1AUOA 3ER0A 2HXSA 2WWXA 3FCYA 4DBFA 4ZO9A 1S7CA 5A05A 5IVKA 1WHSB 1IK6A 2QDYB 4EYGA 4JYBA 3PC8A 4LVCA 2AKLA 4CL3A 4QC2A 2J0QA 4FB5A 4MUFA 4GBQA 4TUYF 1MVLA 3QNUA 4AQ7A 3LDAA 3WTBA 4PYMA 2JLVA 1Y48E 2FWNA 3B3JA 1O95C 4ZYTA 5GJWB 1E7SA 1W7AA 1Z0DA 3QVGA 4IIOA 4E31A 4N5MA 2B34A 4IX9A 1KE1A 3VPDA 1Y3BE 2HBQA 5KSWB 3GELA 5IZCC 1XGKA 4R0VA 3RE1A 5C4IA 5IJ9A 1YBVA 4RZXA 2FEMA 2B92A 3F5QA 1YXMA 2P0AA 3L2WA 2OBNA 1TGYA 5K6RA 1KP3A 5IN5A 3QOXA 5GAOr 4AF7A 5D86A 1OXMA 1K0FA 1NGSA 2HRBA 5E4TA 3D8SA 2C2MA 3ZWNA 4MDHA 1AD2A 3G0OA 4CV0A 1X77A 1VBMA 4D4JA 1AJEA 1UHCA 1QP7A 4Y92A 5T5QA 3D7SB 5I9NA 5KC8A 2X9HA 1XQVA 4YRJA 1D3BB 4KWIA 4AFUC 1O6ZA 1GPJA 1SZJG 3KLOA 4UDYX 1XMJA 1ZHFA 3D8RA 4EUEA 5D3ZA 4PPYA 4Q15A 4JLSA 1RXEA 1ZN9A 1NJIC 4Z49A 3KRTA 2J05A 4W5RA 1R10A 3MK31 4YV7A 1QGDA 4EYQA 5JALA 3OCCA 2HTEA 5DE3A 3BQMB 3RVPA 2IX3A 4F92B 1L6IA 3UWSA 5BRAA 1PEAA 4BFTA 1RACB 4I50B 4BDZA 1K6IA 3VZRA 2RF0A 2J1LA 4G8BA 4AYXA 1ZW1A 4C6RA 1O4WA 3C16C 4C7MA 3WAGA 4Y8VA 2XVXA 2ZBPA 5BQXA 5JCXA 4DA9A 3SIXA 2ZJBA 2K6DA 3AKEA 3NYWA 4P32A 6ADHA 1Q3KA 2ZYUX 3NUGA 4YEDA 1JIXA 1XRLA 1T2EA 4CM9A 1ZC3A 5HIMA 5F9HA 5LWQA 3AX6A 1DO8A 1HFWA 1P17A 3HADA 5DKFA 1E1RA 4M75E 1XP5A 2JLBA 4JJCA 3ZBPA 3L2OB 2R9VA 1YOVA 2AJDA 3KWJA 4OAQA 4DEYA 3VS5A 4V0LA 2ZJYA 1YI2A 4YWHA 2UKDA 4CKXA 4KIUA 2ZJ1A 4ECEA 3GCZA 3I1FA 3CCVQ 1WMFA 5GAOp 4JLPA 4M7AC 3M6IA 1XAGA 2IITA 4JBNA 3HVJA 3X43A 3WMXA 3PG5A 4C4AA 2ONYA 1P4RA 2LZ6B 1M90R 4PBSA 2B9EA 2HA6A 1EX7A 4A3SA 3X1JA 2EFGA 2BEWB 4M89A 1ECFA 3HRHA 3F4BA 3U3MA 2FRWA 3LBYA 5JAIA 3C3KA 2F1JA 4C0ZA 5EKDA 2VSQA 3BXZA 3LPCA 2WRZA 2HAXA 4PAMA 3WRXA 1R5BA 2X2OA 2VAXA 2MJLA 3D64A 1CHNA 4KR0A 2FQ1A 4R4JA 3DNPA 3GLFA 4RTLA 1HSZA 5LQSA 4GPAA 3I55Q 3KG2A 5TQJA 1NR5A 1GUYA 2HWXA 5D87A 4XPZA 2B4YA 2PRIA 3V7RA 4EYOA 4MI3A 3RB8A 4XK8E 1Z6GA 1P31A 5K8JB 5AJUA 4BMVA 3SM3A 5A9SA 1IN6A 1P8JA 2MHCA 1OI7A 4M4SA 5ALIA 3WGVA 2E0IA 1L1FA 2CHGA 2BKUA 3SSOA 1TTQB 4B6EA 2YOHA 3CUWA 2OWEA 3CCEA 2WKWA 4B0PA 5EHGA 1GCGA 4CQMA 2GAIA 3MA0A 2R3SA 3SR4A 3BTUA 5ALQA 4J1SA 1FXSA 3QKSB 2HSJA 4L07A 3COSA 5FYDA 2AG6A 1HUQA 1YFJA 1XYVA 1KDYA 1HPLA 2YWXA 5T8KC 3PT5A 3GVIA 1XHFA 5TPZD 4DXAA 2B82A 3N8NA 1JAHA 5EG5A 4AS3A 2OSBA 1JV2B 2IC5A 4XJXA 2VK8A 1QHGA 2MMCA 4QAQA 3OZTA 2GAOA 2Z6VA 4DV3B 2B4QA 2H9IA 3P2YA 4HBZA 2G6TA 2ZRQA 3KBOA 1PSZA 3AVVA 4YCJA 2XT6A 2Z1DA 5LBUA 3BL6A 4MRRA 1IRIA 1KU0A 2R6R1 3SHOA 4PC7A 2JLQA 3O3CA 2PWPA 3PKZA 1FNSA 3MTQA 1CV2A 4PHGA 1WD5A 4RE5A 4V0SA 2AHJB 4S1OA 3BMOB 3EDOA 1K73C 2AKEA 1I4WA 1P33A 2IS6A 3BFXA 4IGKA 4YT4A 3AUUA 2XUKA 1JNYA 3FGZA 1WBJB 1P2GA 3Q8LA 3FZGA 2PCJA 4XJTA 3STTA 2WDPA 4R1OA 3L6DA 1VJCA 5CHYA 3V2HA 1G21E 1LNSA 1Z5PA 5L53A 1L5VA 1R0BG 4G0OA 3JQAD 4PIVA 3PGA1 4TLEA 5B4VA 4ER0A 1Y6JA 5CYOA 4DGSA 4DAOA 4CKEA 4G5RA 1AHNA 1VOTA 3AETA 3THWB 4UU0A 3DE0X 1RLQC 5CB4F 3TLYA 3GJ0A 3VHLB 3HDYA 1AUVA 1ZO8A 1M7BA 2J3DA 2WSLA 1Q20A 1V5FA 4PSAA 3MJXA 4X9DA 1EGVB 1ATIA 1IN7A 3QX9A 2V0NA 3SZGA 1DAIA 2V1RA 4KRTA 5CPFA 1N1EA 2VWQA 4R1LA 1MF7A 5DEOA 3QWFA 5DYGA 4BO0A 2PUWA 3BFKA 2J6FA 4JJAA 1U3CA 1HQCA 3KQNA 1HZZA 5JZVA 3GIBA 1XELA 3O8QB 4C5GA 1V2GA 2W48A 4FNMA 2ABLA 4NOLA 2XTMA 4QDJA 2I22A 2FG5A 3KZ1E 2HJVA 3CF4G 2P1ZA 1J39A 3COJA 4Q39A 4BIMA 1X39A 1LDNA 4DFDA 2FH5B 4A8JA 2WUGA 2DWQA 1DTWA 2EHDA 4LYHA 1R8QA 4BO8A 4EG0A 3CCLT 5DX1A 4KRYA 2G76A 4HVCA 1ZRNA 5BV1A 2VKTA 4BVJA 2A1UB 3U7JA 4RTYA 3ZG6A 1XJWB 3WOVA 3HB4X 5EIXA 3LCRA 3EZFA 2FWRA 3V8BA 2AMLA 3IHTA 1J42A 3AR6A 4B4WA 2CDNA 3RAGA 4D41A 3AVQA 3ABRB 5AKJA 2DIQA 3OQOA 3PRKE 1XHLA 3N2EA 3HMQA 4H9GA 2W6JA 1SUAA 4ZPJA 3LHIA 3KJGA 2K2MA 2GJAA 1JB0E 2YN4A 4G4JA 4XDZA 3TINA 3BUSA 2KHZA 1R12A 2HQEA 5T6MA 2GGRA 4KXNA 4RXTA 1FDVA 4EGSA 3N5CA 2ZBFA 4W99A 1AOJA 2YZ2A 3K4PA 3FN4A 1ZGJA 1G8HA 4HDMB 4YUZA 2NZXA 1UKCA 2COWA 1U7UA 3WLEA 4CF7A 3UK0A 1S8AA 5CFPA 4B6RA 1CK4A 3BIXA 3PQ8A 1LKZA 2NU9A 3F2VA 2ZREA 4M8KA 3HBAA 2JFHA 2CT4A 2ZSIA 2RC6A 2BMDA 3A9TA 1HE5A 1E9FA 2I54A 1QP2A 2ORWA 2PZKA 1THZA 5U4QA 1UFFA 4ZOEA 5LOVF 4US1R 1KRXA 2YUNA 2GYVA 3MG9A 3W6ZA 2NSLA 1BBZA 3K0BA 1KVTA 1YR7A 2QTHA 3OZBA 4N4IA 2CNDA 2H2FA 4RK1A 3IFSA 1BHJA 2MPXC 1U81A 2ZR7A 1GU0A 1VQLQ 1BYMA 3FD8A 3KLMX 5ESWA 1MN6A 2VJMB 5EP2A 1AUPA 4HLUA 3AW8A 1Z0IA 2AR0A 3ZXSA 4ND3A 3NR2A 2E85A 3M6WA 4WKCA 1CRQA 3S1SA 3WGZA 2Y76A 3HUTA 1RJEA 1KZ4A 1V37A 1UADA 4WOKA 3I9LA 3UBMA 1XP8A 2AFHA 1H2XA 1NW9B 3QJ6A 4DMGA 1YDHA 1NXTA 2RI5A 3OCZA 2QE7A 3DLPX 3JB9J 3TCKA 4ZT7A 4XYBA 4F96A 2AF4C 2ZUVA 3NZEA 2FK8A 4C92G 3NBKA 4N65A 1L5YA 3N0RA 4CU2A 1ZRHA 4M0PA 3IEKA 2HL5C 3W78A 5A1JA 1RXUA 2YUOA 4O4LA 4N01A 4WRRA 4X60A 4YXWA 1ZHHA 1I6WA 3VKHA 3M1AA 2IL1A 5FADA 1XYYA 2C4UA 3G1JA 4JR1A 1S2OA 1ZOSA 3ORQA 5B2ZA 2IEBA 3C3BA 2MSCB 5JQGF 4DQXA 2G4VA 4AZ3B 2HRCA 1PD0A 2Z3WA 2B5OA 2DFTA 4RTXA 2Z2JA 2AOUB 1VQ4A 3WOHA 1KC8U 3UJ3X 3PP8A 1B3QA 1YB4A 4FSDA 2B7BA 1T0UA 2W22A 3LY8A 3Q1LA 5K01A 3DBIA 4L78A 4KLNA 1KRHA 3B9QA 1DEXA 1CE8B 4B17A 2V5AA 5HVNA 4NECA 2HRZA 2GSWA 1DJMA 4BMZA 7MDHA 3H97A 1PWXA 4KWCA 5HUQA 3DC2A 1AD5A 5B1IA 1P2FA 1H8HD 1E2BA 4YCMA 1UE9A 4N8DA 2NUPA 3DFIA 4YGYA 5K0JA 3NGMA 3IBFA 3U3JA 4ZKDA 1WHGA 5FNVF 2VDNB 4YCSA 2VP6A 5CCDA 5D3MB 1ZBXA 1KP2A 1D09B 5D7UA 4CCWA 4HX5A 4ZQBA 4TLLB 4LZWA 1XXHE 3H2BA 1LQUA 2VBGA 3WLTA 4UXHA 3A1EA 5CBPB 4D9EA 3F73A 4DSUA 2OZPA 3WB2A 1U5BA 3MTBA 2NYRA 4PZDA 4RK7A 2NX2A 2VNJA 5CVEA 3BKWA 4TVBA 3NCTA 1YRHA 1T6ZA 4CKWA 3EFOA 3TUJC 1MAWA 1PV2A 1T2DA 2M16A 3H05A 4HNVA 3L0SA 3CZ9A 2G1UA 3CCQT 3TNDA 1Y1TA 1RKUA 1DOZA 3BDVA 4E5KA 3GDGA 3VZPA 1K1ZA 5M34A 4PGHA 3E2MA 4LZNA 5BRJA 1II0A 1V4BA 2CL5A 3EZLA 4PLIA 5TS2A 2C96A 1O96B 5L95A 3EC2A 4J0HA 1QDEA 3ZIAD 3RKRA 4IIFA 5JMOA 3TI9A 2H1RA 2BFDA 3L8MA 1K6XA 3W5JA 3VPCA 1A4RA 2VYTA 2OVFA 4F5EA 1EEXB 2KRNA 2VT6A 2YBEA 1MQSA 2G5GX 5L4NA 4QWWA 3OOEA 4TLMB 4KFCA 1PFKA 2VR1A 4UAGA 2AL7A 3BB3A 2I6SA 3LGXA 4MKRA 5C1BA 3QG5A 4HS4A 3ZKWB 4CEHB 3DT9A 4QHYA 2P1RA 3KJQA 3UJNA 1BIAA 2GTPA 4JUDX 3TKAA 1PT9A 1UDLA 3VR2D 2J09A 2GTJA 2AUNA 4ZFNA 1Y8AA 3ZU5A 1C4OA 2Z5FA 4WKGA 1CR1A 3M7IA 1A50B 1SBYA 4EF6A 1JKXA 2DK3A 4PFOA 2LP5A 1ZJ6A 1AA6A 3GCWA 1I5OB 4RTSA 1G8MA 5E0KB 1J7KA 3BRWA 1RWMA 5AKIA 4LZPA 4MVJM 2IYOA 2OOSA 3RUIA 1K98A 4XWWA 1R6BX 3P52A 2GTHA 2JD0A 3FH0A 2J7PD 4OB6A 5FTKA 5TQ2B 2KNBB 5JARA 2EGHA 5JTTA 2A92A 4HDKB 4D98A 3F2IA 4ES6A 3EB9A 4K6OA 1YK0A 2FEOA 2Q3CA 1V4VA 2PVPA 1RQNA 2SICE 1RP1A 4XQCA 2IYUA 1E0JA 4DQ0A 1I3LA 3ZWXA 4WNAB 4X5OA 4XJVA 3ZK8A 3JYLA 3L0BA 2BKDN 1NPRA 1NONA 2R00A 4L4XA 4RD1A 1ZBJA 5DEIA 4ZEMA 3BG5A 1MJHA 1QHXA 2QTTA 2WFLA 1IQPA 2WPNA 3N9IA 2PLRA 3IEMA 5FWBA 2DFUA 3D4BA 2K7FA 2FZGB 4HB4A 3ZY5A 3G8YA 4OQZA 4U5XA 5F51A 2B5WA 2FYTA 2O1EA 3DTTA 3E7DA 4NPAA 3X3HA 2KBEA 3AF0A 3NBYC 3HRKA 3DBRA 1RWPA 4EPXA 4JPBW 4AJJA 3ZWDA 1DHTA 1KETA 2J5KA 3WXMA 2RFLA 1Z7YA 3QEMA 4U00A 2WABA 3VYVA 1G9XA 4Y1RA 1B8PA 2NXWA 2RHCA 1M4ZA 3ECSA 1U2RA 1EGAA 4BKOA 3AEUB 2ZAOA 4UPEA 1E60A 5DYNA 2AOWA 2I99A 5KVAA 2WZDA 5FNZA 3ROTA 4HDAA 5BSGA 3QI2A 4MINA 3KALA 4JT8A 1TKRA 2QYZA 2EKOA 5HMMA 4PKCC 5FWDA 4Q9LA 5F23A 5J3BA 3ASUA 4J9FA 4QULA 5BN4B 2W2XA 1JYFA 4P36A 5T4BA 1RABA 3KOUA 2RGUA 4IF6A 3G5UA 1WLSA 3QWBA 4YTEA 2ADFA 5HNKA 1CUAA 4Y98A 3FRIA 3WWEA 5B37A 2VJQA 3U6KA 2RHUA 1NASA 1MV0B 5E9QA 4FZRA 3B1FA 3RASA 1U8AA 3TMAA 5ITVA 3Q2KA 4ZVOA 1MGQA 1K08A 1EK2A 4LPKA 1FTWA 4IDQA 3KTAA 1NJ6A 4I6JA 2FQQA 3EGVA 3TL6A 3KFLA 4QVKA 5FKJA 3K2BA 4MNTA 2J4CA 5DCYA 4M87A 3DWFA 3ETEA 2E10A 1EWQA 1Y3DE 1IN4A 2FUG1 3IPYA 5J47A 2BFWA 2PTKA 4CM3A 1WX1A 5KNCA 1UM9B 3H13A 4TZKA 3HJAA 1VQNA 1TXQA 2WSIA 2V1UA 5LU9A 1VPLA 5IHIA 3TFQA 4D0NA 5K4GA 1NXSA 5K8VA 4ID9A 5L3QA 3OBBA 4MCJA 3TCJA 2MOKA 2W8ZA 5LL6P 4RACA 3LQ2A 1GRQA 3PPVA 3C8ZA 4UEWA 2QEXT 5KNDA 1MX9A 3OYIA 1XF9A 2XKJE 2F69A 4P7JA 5AJYA 3RUAA 4J43A 2ZIXB 3FGOA 3GJ4A 2BM1A 4B8YA 1GT91 1L5MA 4M54A 4KJZA 1O7JA 3INTA 4PZPA 3B82A 1I33A 4NENA 4DHWA 3C3WA 2QI9F 2PKXA 4R2IA 1QRAA 3GROA 1R0ZA 1N7HA 4KFUA 4DLPA 3BSWA 1Y0MA 1E96A 4OJYA 3T5GA 3W9UA 5LZ8A 4YCBA 3HDTA 4ISBA 2WKSA 3A36A 4OEHA 4RM3A 2GRAA 3FCUB 4IHJB 5ECGC 3WQHA 3RT1A 1OI4A 4G67A 3PEFA 2IHZA 5LWHA 3UANA 1RVV1 3BMQB 2PXHA 2CFRA 1T10A 1I4OA 5ALPA 5I8ZA 1ETHA 3ODGA 5CYFA 1UFRA 1ZD9A 2F3RA 4OSEA 5CFNA 4X8HA 5EKUA 3AZPA 2FQXA 1YOBA 4HNAA 2EQAA 1V9SA 3QJ5A 1XTPA 3DE3X 4TL8A 1MX3A 4Q34A 2GCEA 2OCKA 4KULA 1SIUA 3UTDA 4TV9B 2I78A 3VHXB 4NY1A 4MUGA 1FVHA 1QHFA 4Q1FA 4TT3D 2PWBA 2DXTA 3CINA 1VPWA 3FROA 5LQJA 4Y2GA 3P1JA 5G1NA 1F4LA 4LDZA 4I9FA 1V45E 2KMLA 3UC5A 4JI7B 3HLKA 4ZAWA 4BZXA 3IXLA 4CL2A 1ECBA 1ZMRA 2XHCA 1YCFA 2HRDA 3DZ8A 4A7PA 3FKQA 1TUBA 4CTNA 1YN8A 2I8AA 3QLUA 2H8HA 4YJFB 1HNZB 3G71T 1P0CA 2LGJA 3R3XA 2YN2A 5AW1A 4RY2A 3IB6A 1AF4A 2ZBUA 3F9RA 4F2WA 1I0ZA 2N0SA 1PFUA 3JQPA 4AUMA 5TGZA 4KIWA 4S1VA 4XAQA 1VLVA 1RKXA 2PA0A 3A6GA 3JZFA 2H2DA 2RHXA 4NFHA 4R68A 6REQA 4XRGA 2QTZA 3N3BC 4IFBA 3IP6A 1Y4DE 1VCHA 4EX6A 1RYMA 1TEHA 3UAYA 4G9BA 3BRSA 3LHDA 2UUCB 5I51A 1AHIA 1OWNA 1P0QA 5JZBA 5E9WA 3FTFA 1A5ZA 3HFNA 5FLXE 1ODJA 2X23A 3PC3A 1NOJA 5DTIA 5IYZF 4DQLA 2YXEA 3ESBA 4I9HA 4PIMA 5KYYA 2WHQA 1AZEA 2JIRA 2FKAA 5CQXA 1L7NA 3IKMB 4K81B 4KVAA 3JCMc 2CXPA 2D62A 4B31A 3CXUA 2NW6A 4O2BB 1LVHA 2XVMA 3MT7A 4GYWA 5D84A 1WTCA 4P4GA 3GLIE 3AH8A 3PUKA 3KYDB 4R5HA 2GH1A 3PHGA 1BE6A 1C1DA 3ENZA 1Y3AA 3QKWA 1RADA 3S3MA 5DLYA 5A0LA 4ESHA 4YT2A 2QQRA 4ND2A 3H7AA 2GBLC 4MB0A 2JLAA 1RRGA 1EK5A 3KQVA 1R8JA 5DSXA 2R11A 3DEZA 2WILA 5C18A 3U0VA 1V76A 2QGFA 4HVLA 4A6XA 5JXJA 4MHSA 1J8FA 4Y0NA 1QF7A 5E6RA 2YIJA 1PUJA 3GN2A 3KU4A 1JDTA 1VM6A 1WMEA 2OBBA 1BFKA 5L51A 3FWPA 3S1AA 1S89A 4B6JA 2B0JA 4GQIA 2WUEA 2ZIZA 3U3RA 5JSUA 4ZCPA 1Z33A 3F6RA 4MKIA 3N8GA 4C8QF 1PJ3A 1CP3A 1ZM4A 5AT1A 4BTLA 3H11B 2M6LA 3SQWA 3V4ZA 3P2EA 3K70B 3EA4A 2CFIA 2FRDA 3OFKA 4XTUA 2KY9A 3LFUA 5IT9E 2PUTA 3I6MA 4BLWA 4FJ2A 1L4LA 4ND7A 4BX0A 2TYSB 2C2OA 3EVCA 1BJKA 4R1TA 3S99A 4IKFA 1DMRA 1P1JA 3NYQA 1Y37A 1PNVA 9ATCA 1I07A 2CH4W 2D2XA 4WKOA 4J2TA 2XB4A 1S3SA 1E9DA 3H41A 5DASA 2VSXA 2E4VA 4X1OA 2ETXA 1SG5A 1GZDA 2WHPA 4Q3EA 3THXB 1H2RS 4C0GA 3PGVA 5HKKA 3F3SA 2JIQA 5JBQA 5KAPA 2V7QD 3S2YA 4EATA 2BUDA 2OUKA 3CB4A 4FEAA 4FPXA 3RUDA 3UMSA 5A0DA 1XBTA 3N86A 1V8BA 3BGOS 3ZEIA 4KHZA 4MV8A 3U3XA 1Z2NX 3SIPA 3LQQA 2I33A 4QOIA 2XEDA 2LNHB 3RS7A 2PKQO 1YF3A 4RD6A 3H6ZA 2VHXA 1ZM9A 4JI3B 1BU5A 4C92B 1MGPA 5HK9A 2L8DA 1YSCA 3KP1A 4UARA 2R1VA 4OXYA 3QJYA 3A0UA 2O3SA 4M7DD 3EEBA 3AI3A 5EWLB 3B5IA 3MZ0A 2HY7A 2FUKA 4MUEA 5J2UA 1Z63A 3EYAA 1W2HA 2E6ZA 2VF8A 1LTKA 1IEXA 1O87A 1DIGA 3OURA 1TK9A 1C80A 1TRHA 1G20A 1YR8A 4F1JA 2ZZMA 5KHAA 4LISA 2YX1A 4UVEA 2XKAA 3D43A 3QXXA 3GWGA 3S8YA 2NV6A 1KI6B 1FE8A 1YKGA 2PPLA 3VX4A 2KBTA 1M2EA 4W1PA 3FMVA 3EXG1 5JJIA 4D8UA 2YNMC 4BFYA 3L8ZA 1NRXA 3OZUA 1X2BA 3A6JA 3TZCA 5A2QA 4IS2A 2PZEA 3R75A 2FEPA 2VS1A 2PR2A 3WYDA 4ER7A 5FLEX 1PQ4A 3V4VB 2ID7A 4TGLA 1LPNA 4LYJA 1E6KA 1KERA 2XHEA 2AB0A 3U1VA 3UICA 2EJ9A 4TLCA 4CIWA 1CUCA 1P80A 3JZIA 5FFNA 4MB2A 1OTHA 3E5RA 3IX7A 2X5KO 1S1MA 4L3WA 4I9UA 3HKDA 1Y1KE 1YTLA 3W6NA 1L7MA 4EECA 1DWOA 5H4GA 2AG5A 1I3CA 4CNBA 1QPGA 3V3KA 4BUJA 3TSZA 2PCLA 4ZJZA 3F46A 5JYCA 2CV1A 5EHQA 3GRUA 4EGCB 3QU4A 2FGJA 1UXJA 1NQUA 3FC3A 4OM8A 1EM8A 4ZGWA 2X9GA 2K9GA 1EVZA 1YQXA 1XZIA 2XG8D 1ZXBA 2FTKE 5COAA 3G7SA 3F8TA 1JDVA 1X6BA 2ZTMA 3MOSA 2BGMA 2VPYA 3O2QB 2D8JA 4BNNA 1CTQA 3TK1A 2GPNA 4PZEA 1GZ3A 2Z3ZA 1L5OA 5CT6A 1C0PA 3CKLA 4NF2A 4BEWA 4E94A 1HTBA 5IK2D 4LOJA 5LNK6 3O9ZA 1F6DA 2EQJA 2EKHA 2GA8A 1TK3A 4NRDA 4Y1GA 4IIJA 4QGAA 4GZLA 4ZEWA 4NH4A 5E3IA 4Z4EA 4YS6A 1OJLA 1CUBA 3EWNA 1V2HE 3AL3A 4H7EA 4BLVA 3G6EQ 3DHWC 1K4KA 1FX7A 4UHBA 2O9JA 2PSJA 3GLFE 3VKIA 1Q1BA 1FP4B 3R7SA 4BKRA 2CF6A 3JB9D 2P1DA 3K05A 2ABWA 2SCUB 1OY1A 3GGOA 1JFVA 1MOPA 2EQUA 2OA0A 1GUDA 2ZYGA 1V9CA 3C41J 3I01M 2X8JB 2AZSA 5EUQB 5ES4B 3ZDQA 4EY8A 4FMBB 4P8RA 3GNTA 1DC3A 2PS0A 3DFZA 1NTRA 1WSWA 5DBIA 1CR0A 4XEUA 4BB9A 1ISRA 5AW9A 1UKBA 2JLUA 1K8AC 2PJUA 3HFSA 1TKAA 1U0SY 4R1SA 1M1GA 5FI1B 3F5FA 4KQXA 3VDXA 1M1NA 5ALDA 4LE9A 3DDCA 3OX2A 3INYA 5BSWA 2PMCA 2LTAA 4FONA 5FOUA 1GM5A 1U2ZA 4RANA 2P77A 4HB0A 3A8HB 5LCXA 1RWQA 2OO5A 2QTCA 4CPDA 3OJEA 5KX5B 2QLBA 3MJEA 2DBRA 2ESRA 3PTLA 5HSGA 4ZZIA 1OIXA 1JAIA 3QXGA 2WAYA 1NVTA 4JWKA 3U44A 2A8YA 3ENKA 3FNGA 5JATA 4TS4A 4JC0A 3BDAA 4BFSA 3LBHA 3MN1A 3H0EA 5EGSA 3FEOA 3DCJA 4OH1A 4P4SB 2UUAB 5M9OA 1KAMA 3YASA 1XAJA 4A27A 4P3YA 1U3OA 1W4RA 4RA6B 4XGQA 4E07A 2FG6C 4WK0B 2H29A 4RDXA 3C6XA 4HJXA 1HK7A 4BVEA 8MHTA 4I1IA 4DMFA 3L8HA 1GCUA 2ZWIA 1FZQA 4C0KA 3H2YA 1RCTE 3HKCB 4BRZA 2VNKA 4XYEA 2FWJA 1ZU5A 2B0CA 1FMTA 2NU6A 3ZWPA 1NU8A 4DMUB 3PNWC 1JFLA 1J90A 3ZH9B 3VU8A 3IDQA 3DQQA 2A5LA 1OX8A 3MGCA 5I45A 4KH0A 1ZUNB 2JIMA 2PU7A 3WGKA 1DE0A 2JARA 3AVYA 4YH1A 3Q8WA 4DTCA 4QDKA 2Z57A 3T1NA 4B8WA 4Y9TA 2NV2B 1VLLA 3ZV6A 1ZX6A 4D57A 3I45A 1TFRA 1SQ5A 2QN7A 3EXIB 4M0EA 1BVRA 2HK6A 4PLGA 2FHSA 5FTJA 1Q95A 3BVPA 4BX2A 4LSMA 2GZAA 2EGEA 2VA9A 2ROTA 5HBGA 4B7AA 1JJ2S 2WJZB 3I37X 4NAVA 5IJZA 1I7NA 1OGIA 4MGEA 1GFCA 5L3ZA 3HXPA 1NRWA 4QO8A 1GL5A 3A7EA 1DS6A 4KXFB 2O8CB 3AEKA 3C85A 3I9KA 4CTOA 2Q4OA 3EIOA 4LJLA 2AT1A 1UMDA 1AF7A 3D1JA 4AKEA 4YCLA 4Q9HA 3M89A 4GE0A 4IXWA 2J5BA 4WZAB 3N7TA 2GLUA 4QA9A 3VXKA 1U3DA 5AKYA 4PO8A 1FDWA 4A4KA 1HTWA 4KTTE 4LDNA 4M7AG 3GJXC 4BMXA 2XQGA 3TQRA 4LJ9A 1W5EA 3JRZA 1GARA 3KPYA 4XWOA 1SXGA 5LU8A 1XJ0A 2JW4A 3VYGA 1EP1B 2GMWA 4O4HF 3IDSA 4J7AA 4RA9A 1E9RA 4KRFA 1VDZA 3SYNA 5TMPA 3G4SA 1JIQA 4FCCA 1U5SA 4BKQA 1AB5A 1JEDA 1TJPB 3W5VA 1Y8QA 2KQWA 2E4YA 3FMGA 1UGRB 1HEUA 1XLUA 3JQFC 4UHHA 4KPYA 4U1RA 4UBJA 4I2VA 4CEIB 2FKNA 3TZ6A 2V6IA 1DO2A 3IKLA 3DXXA 1W49A 3ZS9A 3BT7A 2Z1NA 4DUGD 3KT6A 4JJIA 2QKYA 2NTJA 1TUGB 3B6ZA 3QMVA 4M0DA 4MIEA 3K6SA 1Z5WA 1CG6A 3IPCA 4KGVA 3G9TA 1OX5A 2WV9A 2JTFA 4COKA 3ZLTA 4RIHA 4HAUA 2NO6A 4XB6B 4NH0A 1M90U 2G8LA 1ZINA 4BNJA 3QTLA 4RK5A 1ACLA 3QWHA 2QIOA 5ALMA 2FK7A 3IXMA 2QTWB 4AYTA 4NNPA 5B1SA 2HDHA 5J40A 2VAMA 4X0EA 1BRTA 1YDGA 3V8EA 5JZMA 1MX5A 2Q8PA 3TPFA 1AM4D 1N2JA 1F06A 1RLIA 2FPIA 1WS6A 2ROLA 3NHRA 4IDEA 4MRSA 1E6UA 2DHEA 3W9YA 1L8LA 3HY6A 4XEHA 4N76A 5KNCH 5KOJA 5DHSA 4X9CA 1N1MA 1A98A 5JE8A 4IRUB 3OSVA 1CETA 4HLDA 2WT9A 5KQPA 5F7XA 2O01E 1ZBDA 2QN3A 3MUNA 3WS7A 2AFHE 3NI2A 4Q7KA 2FZWA 2XRYA 3LY9A 1WXDA 2DZ9A 2W83A 2IVZA 3D8NA 1IHYA 1T1SA 1UPXA 1SUWA 1S9DA 3SE0A 2C5GA 5KNDH 2CUTA 3PFBA 3BMCB 4M75C 4CC3A 4HTFA 3M33A 2WP0A 1XALA 4DJFC 4CC7A 3DMHA 2YHSA 3AGPA 2CZ0B 3JQ9C 1MHPA 1QP8A 4ENTA 5HFJA 4C4PA 5BYKA 3LYAA 2MWPA 3S27A 3BDUA 1U1GA 3HUFA 2V7WA 1DB3A 1MHNA 1ZCFA 2FSFA 3PD0A 4NCIA 4Q5WA 2GRJA 4PHHA 1GVHA 5K3FB 2IDJA 4L9WA 1UC9A 1AKNA 1C3VA 4V0NA 2BDUA 4R2HA 4YJ3F 1RLMA 1B23P 4OI0A 4KN9S 2G08A 2XKOC 4Z2YA 2XYQA 4KAFA 4DLWA 2IYAA 4NXNB 3LUKA 3FSGD 4LOIA 2OCLA 5LQDA 5FOVA 5AXBA 2DYBA 1XL1A 2PG3A 4Q9DA 2ODEA 2EW1A 4N5NA 1JU3A 2OWDA 2ZSBA 4AT1B 2WACA 4JIMA 4QBGB 4PZZA 3BDIA 3WLPA 2EJCA 2L2PA 3RT9A 2JFNA 2H59A 1NZ9A 4PYNA 3AVPA 3BJEA 1QH1B 3LZDA 2XHZA 1XDZA 3EBLA 4MYSA 3RKSA 2I3BA 1BZYA 1OI3A 1GSOA 4IDGA 1MXFA 2O2DA 1KFBB 1RAEB 2ZKIA 3DM5A 4PU0A 1VQ5A 1A7KA 2BJVA 3FUUA 3I92A 4JVNA 4W6ZA 5BSUA 3EZXA 3D6FA 1TCAA 3QWIA 2WOOA 3RUFA 3BMXA 2A0FB 1H2BA 3PL5A 2W2LD 3OA2A 1ST2A 2PQ0A 3Q3HA 1LPSA 4PG4A 4WY5A 1XCGB 1TVCA 3G2MA 5TPZA 5LKAA 3K6RA 1U0EA 4ZNXA 1PV1A 4CF5A 4D79A 1CFZA 1RWXA 1XEAA 3CNBA 4R8KA 3WK7A 4YIHA 1PNOA 1JLLB 3OWOA 1XL0A 1FJHA 1N2EA 3N53A 1YCGA 3NRCA 3AKZA 2OBYA 4CG3A 1DC4A 4F2GA 1NYTA 4FHZA 3UAGA 1DBPA 3P9XA 5HX7A 2QXFA 2R00C 2EL7A 4UEQA 1AGRA 3W3AH 2WTNA 1EFNA 3MAJA 3QITA 1L7PA 2FSUA 1I2AA 3M3PA 4Q6BA 4CTJA 1F17A 4TSFD 2C5BA 5FWXB 2OV1A 3JARB 4U9HS 2JAPA 4K9DA 3QU9A 5I7UA 4YRKA 4JKYA 2FAXA 4B3SB 1NG2A 4VUBA 2YDYA 1F14A 4RQBA 2C0QA 3OZAA 5GAN5 3FYSA 2BFAA 4OMPA 1BWRA 3FB1A 4FDUA 3GMDA 4F84A 1SKBA 4IM7A 1ZCZA 3JQAA 5JCOA 3GD5A 5DNWA 2OAUA 3VAAA 2VUIB 4K9SA 2EW8A 4XWTA 5KU1A 4YVFA 3G0HA 4B1FA 2M98A 1UBRS 2I2DA 4D4GA 5LP6A 3DTVD 4E1BA 3ZGNA 4G6ZA 4RD3A 1IPEA 3AYXB 3HCOA 2NO5A 7ABPA 4DV6B 4F7DA 1PWTA 1SK8A 4PLCA 1R6VA 1UDRA 3EQ7A 4NX2A 2B1IA 1M27C 5LP1A 4N9QA 5IDQA 2DEUA 5KWIA 3HYNA 2QF7A 4B3FX 5HFAA 4YJKA 3JVIA 2WKQA 1VDMA 1RJFA 1GKLA 3JQ8A 5DNCA 2HWWA 3ZVKA 4PRKA 3AFHA 4FEYA 2Z9DA 2KGTA 3WGUA 3C6MA 1FFXB 2QTVB 3C45A 5LUBA 1YJNA 3JPYA 2BKXA 3GGCA 5KYWA 1AN9A 3VTAA 2VF5X 2XB8A 4N5IX 2ATEA 3KSDO 3H0CA 1SOUA 1BFUA 5KREA 4BFUA 4UD2A 2FZCB 4B75A 2XA9A 2Z4TA 3IP8A 3MNFA 4WZ6A 2EXXA 1N5RA 1DKMA 2BGRA 1VQ6Q 1IVNA 2VUBA 2BGNA 1NT2A 1TUDA 1O9SA 4J49A 3DV2A 4G0MA 4RIIA 2CT3A 4DCJA 2ZPBB 3ABSB 3I28A 2O2OA 2WIDA 4FCVA 4BQIA 1NBMA 1YHZA 4TPKA 2R0QC 4OFBA 5JJKA 3ZXIA 3M54A 4OXXA 5DGHA 1GQFA 1PSDA 4B47A 3OQBA 2ZRDA 5BRNA 1WZCA 1YRLA 2XDQB 3MEQA 5EIHA 1E3SA 3RHTA 1QAQA 4B3XA 3R5KA 5KEIA 3O74A 3NTXA 4WEOA 4ENRA 2YQ4A 3KSUA 1H6DA 1OXTA 4AJHA 1YZYA 3ZY4A 2BCGY 5GANf 3CRW1 1TG0A 5L3RA 5JH7B 4FW2A 2J4FA 2WDZA 1LK0A 4LMRA 2QL6A 1RD4A 5H83A 4UMFA 2XT9A 3PHIA 1HSQA 2Q6OA 2OI3A 3T3PB 1VQ7A 3WHPA 2FSGA 1VCOA 2JAUA 3AUAA 4FL6A 4CG2A 1TYZA 2OGWA 1WZEA 1KOGA 1OFIA 2XODA 4WLUA 2HQHA 3MWJA 1Q3TA 3OC0A 4AM8A 4UKDA 2YWFA 4FMPA 4KR9A 4KSBA 5JO9A 3GC6A 2I87A 4JVOA 3M0EA 3LU1A 3LRTA 3OTQA 3A4TA 2FUCA 2WMOB 3U7EB 4C3VA 1VL5A 2C57A 1U4NA 4AJEA 3GL9A 1IZ7A 4HEA6 1TK2A 4RZQA 2P9TA 2Y9PB 3ZQKA 3VS6A 3DTYA 3FUXA 1T3SA 4D99A 1NBMD 1ECCA 2A7QA 1EFKA 1F0PA 3T6KA 3EWSA 2YWEA 2X3UA 3PC4A 3L82B 1U8EA 1RR6A 3LC0A 2JKZA 2JS2A 4IUPA 3GLVA 4ZGEB 1OFTA 1WDXA 5F1OA 2OV2A 4F56A 1N2XA 4ZVLA 1KQSS 2VP9A 3MILA 1QP0A 3HJCA 1JHQA 1E6EA 1KMHA 4TSKA 1SXPA 2EARA 1I4EB 2I2LA 4AMBA 3SBOA 4EEKA 2IW1A 1UBSB 2CSIA 1S8OA 3C5CA 1KVRA 4LWOA 1FCJA 3VO8A 5TC4A 2E4WA 1I4DD 1TU3A 4WZZA 2DKOA 1YHYA 2C7OA 3TIVA 1MZVA 4DQ2A 2L2QA 4MARA 2IHJA 3H9QA 4PNHA 2P27A 4RLSA 2WIFA 1JR2A 1FDRA 4BFCA 3JZAA 1L4BA 4IILA 2RGAA 1Q2XA 3HB7A 1OLSA 1DARA 1JHUA 2VDJA 1C8KA 1FP7A 1I6MA 1GYRA 4BUZA 3RPEA 3II6X 3Q9SA 2IDZA 3RCBA 1SZPA 1H9BA 1RIIA 2QGGA 1MTZA 2QR2A 1X13A 1W2BA 1NBHA 5LMNB 1QGED 1B1AA 2NV0A 1E98A 4MQ4A 4ZC1A 3TQCA 2GAJA 1Q84A 5ALOA 1LVUA 5GANh 1U28A 3PFSA 3QX3A 4J6XA 1Q7GA 1NJGA 2ET6A 3GUHA 2A9OA 1YZHA 4M1QA 5EEHA 2B94A 4FZJA 4RYLA 5DM2A 2BP7A 3UHOA 3OZ7A 3QPVA 2O8FB 1EG2A 1YKSA 1H8HA 1G8GA 1CPYA 3FZEA 2RHTA 2G1JA 3PX3A 4HT9A 3I0ZA 5TARA 1FYEA 1HKUA 4TVKA 4RXMA 4IIEA 3C1UA 3WP0A 1PL0A 1SH7A 4NZYA 2H4XA 3CCMT 4KU4A 3OOHA 3PIPA 5AM4A 5AKGA 3CS3A 4C0LA 4NU6A 4Q93A 1U8YA 1FTNA 4QU8A 1I14A 4CF4A 2AJTA 1VJGA 3AU9A 4FD2A 3JZDA 1LDMA 1DWUA 3EHDA 2PSSA 1P6UA 5A6VA 4BYMA 4DZTA 1LLCA 4LXQA 5HOQA 4AG2C 2NZJA 4ON9A 3I83A 3OQJA 2GI4A 3CY6A 4TTAA 2H63A 3ILVA 1E4YA 3IVRA 2HIMA 1OSNA 1J2YA 1Y9ZA 2QE6A 2JD1A 1UQUA 1IAQA 2BKVA 2ATXA 2BBSA 4U2KA 3VC3A 1AWOA 5KE3A 1CZHA 5JHHB 4EQ6B 1MEEA 4E1AA 1C8VB 3R9WA 2GESA 3H4TA 3N3AC 1MQ9A 3ZDBA 3JCMV 2FOXA 3QVJA 3ZIAA 1WQ7A 1K5DA 1Z26A 1W5FA 2K3BA 1C4KA 4AQDA 3LLMA 1ZONA 1F3OA 2RK4A 2OYRA 1OROA 3VSCA 1N6KA 3DFKA 1VPDA 2SKCA 1FFYA 2OBLA 2VBFA 2F48A 1OX9A 3JYPA 4RHXA 1EHIA 3LYIA 4W9RA 4GRAA 5IDVA 5FWYA 2FRDC 1NLUA 4YRFA 5F7JA 3I2KA 3UO8B 1FYNA 4QYIA 2AE2A 4L08A 4MVJD 4D82A 3TQ7P 3VR2A 2P7HA 3KQWA 3FRNA 5CVUA 2DX7A 1U0NA 4LW8A 4LZZA 3ZVNA 2RJ3A 4C0XA 3SC4A 5GAMh 4ARIA 2XSZD 3NVAA 4L2IA 3TQOA 2F4VB 2P69A 3L4JA 3LK7A 3C3JA 3THKA 5IAGA 4CM5A 4K40A 1V11B 2JFPA 4M7AB 2ZT7A 1QKJA 5C52B 4DRXA 1Z18A 3IVGA 2II6A 2QY6A 5F35A 3U4AA 2W93A 5IASA 4BVLA 5GP1A 2J7PA 3IUBA 1Z5UA 2VK2A 4FOSA 3PIOA 4J6EA 2QD5A 1N1GA 5E6SA 2FFAA 2OCBA 3OWXA 1C7JA 4WBSA 3VU9A 1UIMA 1WVMA 1K4MA 4I14A 2IA5A 1VLZA 3TLZA 2GXSA 3IERA 2R79A 2AHRA 3GLRA 1BI0A 2CCGA 1TM2A 4F45A 2Q6IA 4J0IA 1XT6A 4F06A 1HYHA 1ZKDA 2LT4A 4Q21A 3I2IA 3I9FA 2XNKA 4UZFA 1WW8A 4NOJA 3TX2A 2ZBVA 1Y82A 4R2KA 5HA5A 2R8ZA 4TV8B 4G1EB 4J07A 4BNZA 3U61B 1XC7A 4LMAA 4UOZA 4KQEA 4XXHA 1UF9A 3ESZA 4TLBA 4RKEA 3ZN2A 1G21B 3WGGA 4Y2QA 4MX8A 2O7SA 3ER6A 4J4TA 4ACBA 2DH5A 2QVZX 5BUCA 1PRYA 4Q4HB 4L5GA 1JPVA 4FCYA 1I0IA 2D1RA 3VDQA 2DTXA 2O3UA 2WJIA 1H4TA 2HNBA 2C5LA 4EITA 3ET4A 1C9JA 3AKDA 2TECE 3O8RA 1MGOA 2NACA 3OPQA 5G1OA 2AXNA 5JD4A 3VU3A 3UWPA 3INNA 3T7RA 3ZS8A 2D06A 1G7RA 4MVCA 2CFOA 3LA8A 1NVVQ 2XMPA 2A0KA 4A8TA 1RJWA 4E7SA 4F3RA 3E6AA 3ND6A 3TG2A 1NW6A 1RAIB 1YL6A 1K3FA 1YI2T 3MB5A 1A0NB 3GAZA 4PR0A 5DP2A 5DZSA 5T4HA 4HBGA 1O97D 2C20A 2RD2A 3WZ2A 5DGXA 2HCJB 3SNHA 2V1QA 2PLFA 1L4HA 4JP1A 4AY6A 1D07A 2OBFA 1EUQA 4EKYA 1Z56C 2NYUA 4EJSC 2YY6A 1M66A 3HGMA 1VQMA 1YRWA 2W98A 1OLXA 3D0OA 1VRVA 1G3RA 3WTCA 3VVBA 4JBXA 2CFSA 1CW2B 3GRRA 3EZ2A 4FOLA 4FFVA 1JBEA 2XB2A 2P3OA 4OQLA 1C0EA 4GKJB 1MNAA 5CKHA 2I6XA 3TLMA 2DBYA 3QHPA 2Y67A 3L46A 1WKCA 3TFWA 2O8EB 1JJIA 1YHQT 4QG7A 4HT8A 1OFVA 2WFZA 1PQWA 3GT0A 1XZCA 3UXHA 2YWJA 1VLQA 3RS3A 2QMUA 1Y7IA 2F43A 1N9ZA 3ETLA 1RLUA 2BJHA 4DBZA 1QQBA 3K15A 2AQHA 2WWWA 1WETA 4BVAA 4EB8A 2W2TA 1U99A 2Z5GA 4KUEA 2F8MA 3VMMA 4B32A 3ZHRA 4RQUA 1PJCA 1RPTA 1ZJZA 3TTTA 5SZIA 2AQ8A 2LZ0A 4IRMA 2IPAB 3AJAA 4EW1A 2TMYA 1O9HA 4S35A 2VEDA 3PA6A 4R1UA 4JC8A 1ZK4A 3CWZA 1PR6A 4ER6A 2E4ZA 4XSVA 1ABBA 5A2QE 3KE9A 1TCCA 4E2YA 5M5BA 3G2IA 4YALA 2HWYA 2WJ6A 4KV9A 3FVTA 2IIBA 5D85A 2J6KA 4XVRA 1MJGM 5ICCA 2W5UA 4PYQA 7YASA 3OY9A 3Q85A 1LGYA 3DTNA 3NIFB 2C5SA 1K8XB 4I7EA 5C8YB 1YB6A 4QNNA 2AW3A 3ZZTA 4HDNB 4EPYA 2IU4A 1Z22A 3OA6A 1Q1AA 2LCCA 4FLMA 3W7VA 1MKYA 2PZBA 3EDQA 3IAFA 3COVA 2PEZA 1P62B 4DIFA 4Q1EA 4I8IA 4HPWA 1SRRA 3KT0A 2X0EA 2CS7A 3P8ZA 1LNZA 4MUAA 2DWUA 3U4GA 3PEUA 1E2IA 4RETA 3MRXA 4LC1A 4WECA 4A54A 1Y6FA 3RWOA 3S8EA 4U7PB 4NHEA 1VB5A 4GWKA 4DY6A 2FOIA 1BI1A 1U0FA 5DLQE 5AW2A 4I1RA 1I3NA 5ESXA 2QA4Q 1DOAA 1FSPA 1PKTA 4QO7A 1NI4A 3NATA 3HDHA 4L4RA 2FPGB 3PXAA 4P3OA 2WD9A 1SD5A 2WB2A 3FSEA 4BFVA 1HFEL 2YWDA 4TT3A 1GXIE 3Q3IA 3P5SA 1EIFA 4C14A 2CJWB 3R4CA 4N3NA 1AU9A 2J5RA 1KWGA 4D45A 1SQSA 1XLVA 2PS3A 3H99A 2ZJAA 2JGNA 2OV3A 1ULTA 1HLDA 1V16A 4AJ2A 1LLDA 5K3OA 1QJ4A 1XCOA 1DRKA 2WLTA 1BKSB 4MYDA 3TZHA 1XNRB 3KDSE 2ED0A 1YFZA 2DR3A 2ZB4A 3EXHA 1JZQA 3L02A 2I4RA 2K2VA 4O4IA 5TV2A 2ATIA 1PFYA 1HURA 3IRUA 3DBLB 4TWIA 1BAPA 3LCMA 4PPGA 2HQRA 2ECFA 3MHXA 1NW7A 2QV7A 4ZVNA 5CAEA 3IJPA 3VZBA 4RESA 3OEHD 3CCFA 4RZ2A 3KUUA 3CC8A 5FYQA 2EF0A 3OZSA 1OI1A 5HXAA 3B9BA 5CDTA 2PGJA 5ERYA 1R7RA 3O7MA 4Z0HO 5TQVA 4AF8A 1NZJA 1E2HA 5BT8A 3HR4A 3HM2A 3QY9A 1N78A 3SYLA 2B35A 1VMDA 3C43A 3DA8A 3N2GB 4M9XA 4IMRA 2IYQA 3WK4A 4YAWA 1JLMA 2HU8A 1RL2A 5K5EA 3DPSA 1MOQA 3KSBC 3ZNQA 3PS9A 4OUKX 4AFZC 4DLBA 4HGZA 4PEVA 4EWLA 3FF4A 4P5PA 3LOPA 3EDYA 2H06A 3TF5A 3WQRA 1VKJA 1XXHB 2VH1A 1QYDA 1YZ3A 2GD1O 3ZE1B 1VL1A 1XX6A 1GKIA 3NX4A 3P26A 3NUZA 1CT9A 1O5IA 3PXBA 4XH9B 2AFVA 2ODBA 3C24A 3A1NA 5D01A 2IU6A 2MI6A 4GLOA 1YC5A 2XMDA 1VGQA 3LGSA 3H2JA 4QOFA 3SD7A 3DP7A 3R5FA 4DCSA 1QKXA 1HGXA 2P75A 4B80A 1BCRB 3PDWA 3C94A 1VQ9A 3PFWO 3H8JA 3PHHA 3E7PA 3JAME 3HKBB 1FVOA 1PZNA 5LA6F 1EWYA 3DF7A 4B6FA 4UMVA 3WB9A 3I8SA 5AP9A 5KQMA 1WABA 3E35A 3X1ZA 9LDBA 1GLGA 1KQNA 3FB4A 2V6MA 1CRWG 4EGFA 2BFNA 1HFJA 3CPWA 4HGOA 1AK2A 2GJ4A 3WMFA 4OHFA 1W0KD 4S05A 1I10A 1R0XA 1DKLA 3DDNA 1QK3A 5IMSA 1UPFA 1DG1G 3J80A 3TOZA 2GARA 4ZQIA 2W6QA 1GJRA 1N0HA 2COZA 3OE1A 4R9VA 3B8EA 3OCWA 3ZGLA 2O54A 4CMEA 4LFCB 4BNLA 4Y0AA 1YJ9A 4H7HA 2BSXA 5AW4A 3PNOA 3LKZA 2ZUWA 2CLDX 1ZOOA 1AKEA 5INTA 4CM6A 1NYRA 2ZFUA 1OMOA 3AU8A 4XLZA 5H81A 5JT1A 2GM5A 4BS9A 1T1EA 4DLVA 1U90A 3LPNA 4HD8A 2DHDA 2QUBA 1E2QA 1GTRA 2Q3BA 5HF8A 3PC8C 3N2YA 1QWSA 4Z5XA 2D0NA 2XUDA 3MKDA 4KMSA 5U9CA 2VL7A 5AW3A 4L7VA 2CH4A 3RKUA 4ZVMA 3ETHA 1WCWA 4OMMA 4ZI7A 1LI5A 4CQJA 2QA5A 4PC6A 3JSXA 2IHYA 1Q7BA 3I56T 1E4VA 2ZYTX 3RG2A 2XCRB 3CRRA 2PXXA 5JDCA 2O2ZA 1YFNA 3MWDA 5F9FA 1QIJA 5AI6A 3LLUA 1XV5A 5EPUA 1U6KA 1OQAA 2OK7A 1JLRA 1S8NA 1X2QA 4MZPA 4ZDJA 2V7QA 2FZEA 3EGEA 4OQQA 1RMTA 3D3QA 3FIUA 3KLNA 3T3NA 4UDXX 1YVRA 4EDUA 2AMJA 1B7TA 1E2UA 4BQFA 1S0UA 1OU9A 1FFWA 10MHA 1BJRE 3AIIA 4DREA 3HR8A 3ZE7A 2XGSA 2AK2A 1KDZA 3N6RA 1E1NA 1SHKA 1RYFA 2C3YA 3A1WA 3NRBA 4Q02A 4CLRA 1IULA 4GX5A 3K1AA 1EFRD 2BEUA 4PWYA 3TD9A 1EXDA 4ZO7A 4ZGBA 1E0SA 1Q1GA 3I76A 3E53A 4H1UA 5LB4A 3S70A 3SEFA 5IH7A 4GOND 3MWEA 1SVWA 1Y1SA 2Q62A 1HXHA 4TTSA 1NM5A 4JFAA 2F1HA 1I7QB 4AC9A 2BCJQ 4M7DA 3K71B 2BW0A 1EDZA 4GPBA 2Z8YA 4DADA 5IJAA 2L5QA 1L5HB 2ODPA 3ADDA 4DM7A 1ELOA 3DB3A 3VI3B 1K8ZB 3MS7A 1RFLA 4FYKA 1KSGA 4R05A 3CJRA 2WIBA 4L5YA 1U8TA 3GD7A 3T5BA 3VR6D 4MXDA 3TZBA 5HEKA 4J7IA 1H94A 2XQFA 1QNLA 2AOVA 2MSKA 4WLFA 3VOSA 3Q3JB 4DV5B 1RI2A 2WG2A 3E9MA 1VSBA 3WNCA 1U0BB 2BMEA 3C12A 1UFQA 2UVDA 3EF3A 4X1IB 1VA7A 1M5UA 4NS4A 1R15A 2XB9A 1N8RR 4GVLA 3ZZUA 4IHKA 4MK4A 5ALJA 2QAIA 4OMNA 5HQJA 1PEYA 1LX6A 1ZA2A 1P1FA 3VTFA 2DULA 4LJSA 1T5SA 1SCIA 3CQ9A 2JFQA 1W6RA 3QE9Y 1U8XX 1CLEA 1N8TA 3ZJTA 4JRQA 4QQ8A 4J8PA 1PG5B 3DLLA 1G8PA 1KMIY 3ZHTA 1UK6A 1FL9A 4W5WA 3BWEA 3J81k 3E3OA 4JUVA 2VT2A 1H9CA 3F0TA 4DLYA 4ISCA 3NGLA 3FR8A 4W7SA 5JSZB 5AOVA 2P9CA 3E7FA 2HDWA 4DEXA 1GR0A 1X80A 5JROA 4N3BA 1PSWA 3GLSA 4HYTA 2YH2A 3IELA 3EY9A 1QE5A 1FNNA 4AS1A 2OTJT 3L7LA 1V29B 4EEXA 1BCSA 5KNBD 1BDIA 3VUEA 1DL5A 3MHTA 3WRXC 5IK2A 3GMTA 5ECDA 1D4ZA 1RC0A 3SFTA 2RD1A 2ODAA 4LNUB 4FMDF 5JZSA 3I9OA 2A58A 1XCBA 3SIRA 2JMCA 3R3ZA 4BGIA 1IZ0A 1EVEA 2J3QA 3N70A 1ZVJA 2DTOA 4QU9A 2RGNA 3ED1A 1MCZA 1JILA 4WCFA 1M2GA 2YZ7A 3U7RA 4LJ5A 3TZQA 2KDSA 4F9TA 1NUSA 1JS1X 2WJ3A 4NKRA 3QF4A 4U7HA 1OBOA 2GDZA 3CEAA 4JP3A 3H0IA 4JY7A 4OI4A 3NIBA 4D4LA 4G5QA 2WSSD 5JCOC 4Q3OA 2CVOA 3FGPA 2DWOA 3GEBA 4O4JB 3ILHA 4QGGA 2ENMA 2GD6A 3VTKA 1EWTA 4JV5B 3UENA 3B70A 5LP6C 1VE6A 5IJ0A 1SK9A 3HVIA 1KL7A 2FDXA 1RAHA 2B8TA 1V1MA 1KI9A 4F86A 4DV0B 4Z3DA 3KJXA 3BCSA 3FPEA 1XD2A 3PGLA 4R9NA 1RRPA 4X62B 2OECA 4IBOA 2V54A 3CZ5A 3RERA 3SK0A 1XTSA 4L51A 4P22A 3CPWP 1U3FA 4EVSA 3EG3A 3JCMP 1NM7A 1NVKA 1X8JA 4BFWA 3CX8A 4EO9A 4BV3A 1N2BA 2JFXA 3B85A 5CFOA 1NE7A 1E1MA 2GAFA 1W4LA 1IXSB 4MPJA 4HZGA 4B71A 3ZXUB 4OP2A 4PTZA 5JRDS 1DEHA 3LP6A 1AK9A 1EESA 1N92A 1J9ZA 2WIJA 3MJ4A 2AD5A 2ATCB 4LY3A 1IZZA 3E9QA 2PUFA 1Y71A 4ZVPA 2LVBA 1WXTA 3AO0B 4MKXA 1TB4A 4OM7A 5C6SA 1EK6A 2X5XA 4D9FA 4F3NA 3UA7A 3P97A 3ENWA 4ND8B 5ICFA 1W36D 2GJ8A 1UOEA 2LQ8A 2V96A 1SQ6A 1VQOA 2DVMA 1RU3A 3Q88A 2GASA 4Z9YA 2EBHX 3OFND 5L9AA 3O8LA 2N46A 4EI8A 3EBOA 2VAWA 4M78D 3W9SA 1T5OA 2IY7A 5EUCA 4I81A 3ND7A 4KMRA 2Q50A 1XDWA 3R3WA 3JWPA 1EZZA 5DHUA 1T3GA 1P1RA 5KYKA 2A9JA 3EPLA 2AFRA 4IURA 5TR9A 1CUWA 1WPGA 2REQA 4WA7A 4CDMA 1XMSA 1H6CA 1RM3A 4HAXA 1WA5A 1BX0A 3UB3A 4M75G 1HZZC 1QHYA 5EIAA 2FPRA 4D9IA 2ZE7A 1DBIA 3CCJA 2PK3A 3USCS 4A2QA 3ZD7A 1GAJA 3SZRA 4JI6B 2O4XB 2CEKA 3ROZA 1FC0A 1RQRA 5KIAA 3B5JA 5U1PA 4L8FA 1B0UA 3PVLA 1DJPA 3F47A 4QTZA 5IT5A 4AROA 2WF5A 2IYWA 4A8JC 3RVJA 2G63A 1JWAB 4XRRA 3GLIB 3EGOA 5K6TA 3PENA 5D5QA 5GOTA 1N27A 1JAYA 3NAQA 3OJFA 4HH3C 3OPYB 1TMGE 3AERA 2NUAB 2G7MC 3R09A 1KE2A 1GUZA 1MG5A 1I8FA 2V7UA 2GXQA 1SRMA 1Z5VA 1JG3A 3EMKA 2O50A 2IXFA 5JOQA 4TS9A 3RH0A 2CDTA 4ENVA 3F3YA 3EIXA 1BVUA 5GJVC 2CREA 1UDBA 5FA6A 2PL9A 5BN3A 3W2GA 3K73O 4LNPA 4BN5A 1FQKA 3U7QB 4LZOA 2CP7A 2QJFA 2HMAA 3FHLA 1SF9A 4R2MA 5C80A 4C3UA 1E5DA 3L7CA 2QX7A 3SHQA 4M0KA 2I65A 1JDUA 3TLJA 4BFLA 1YR1A 1SCDA 3LA6A 1H65A 1P5ZB 3I1JA 3G7NA 4FSHA 4DPKA 2HEQA 4J9EA 4Z0TA 3VDNB 4DUGA 4FHEA 3L92A 3P2IA 3MMPA 3KLPX 3S5UA 3LW7A 4CE6A 5CNJA 1QCNA 1ARKA 2JLYA 3ME9A 3H6HA 1T8UA 4C4SA 3ROGA 1V35A 1M5Q1 1YQGA 3NMUF 5GM2A 4ZVQA 2EKQA 2CUDA 2W2KB 2GYWA 2WWHA 3JCMh 3L04A 3WBJA 1MU0A 4ARBA 4U7TB 1UJBA 2L17A 5AJZA 2NUZA 2CEAA 2G07A 5AVUA 1YJWQ 3Q5GA 4MROA 3K53A 3PEEA 2WNIA 1ODSA 1EFVB 3S2SA 3ABZA 3DS8A 1JI0A 3BRCA 2KE5A 3QUBA 5J4LA 4HLUC 4MCIA 3F3KA 5ALNA 2P79A 4WBNF 5EWJB 3QEAZ 2RHHA 1HYEA 4X7BA 1U28C 4LD9K 1QCCA 5DXFA 3C6KA 2I7VA 4DLUA 3L9XA 1VMKA 3QVGB 4ZHSA 4F2HA 1G8KA 2ZBEA 4HJRA 1NSTA 3ZJ5A 2UYQA 4NQRA 1OZ3A 1PTJA 1L7BA 2EG9A 5L8VA 4YUXA 1RJGA 4UZSA 2MIOA 1NBWB 4ASUD 5IVPA 3KT8A 2QZPA 5IJ9B 3WE7A 2ZSJA 4ECAA 6AT1B 1A7JA 2HQXA 5CH8A 4M21A 4A63B 2P2ZA 1NXQA 3CVWA 4MQUA 1SU4A 1GADO 1T15A 1QGAA 3HA2A 3IO5A 4ETMA 5IAOA 4C0BA 4YMWA 1YJBA 3HHPA 5CJJA 4OXKA 2Z4SA 3M2PA 4L5CA 3QFHA 5DNAA 2X4IA 3PNYA 1H69A 1S3FA 2OHJA 1XZKA 4PQEA 4I4LA 4E13A 1L1RA 4E5NA 3AVUA 1Y9DA 3BULA 2ZTVA 3W5SA 4WGFA 1B8NA 1BDJA 2W2PA 1SC3A 4FQ7A 3RVNA 4WXHA 4NDZA 4L85A 5I22A 4ZAGA 1CDDA 1PT6A 5BUZA 1T4CB 3R77A 1GZ6A 5MN5A 4EW6A 3RR6A 4K1XA 3LBNA 4HX9A 3TMYA 5LDDC 4XM0A 2PX3A 5IVIA 1RYHA 4KQ6A 3S29A 1VG8A 1EX9A 2ES4A 4L76A 2NUTB 3ZWAA 3EG5A 3FSGA 3RRZA 4MLDA 3TREA 1JXAA 4S1NA 1JQJC 4LYEA 1DJNA 5JSYA 1UPBA 5AO9A 2C99A 3LUGA 4B74A 3HYLA 2ADMA 3IUEA 2QAZA 1FRZA 3N0TA 1QM5A 1WUJS 3WDLA 4LHWA 2ILVA 1RM0A 1UWCA 1H3NA 1LPMA 2HIHA 5EZYB 4ZZ2A 4LDQA 3F7MA 2ZQ5A 4KGXB 2IZZA 4RTMA 4L6IA 3NBAA 1JKJA 4NABA 1WBBA 4PTLA 3EAGA 3FLGA 2GCOA 2V65A 3M4GA 1TD1A 2Q6LA 1WCIA 3LDFA 4JP5A 4XWKA 1GILA 1DAFA 4AIRA 4IKOA 1UCFA 3U23A 3PHJA 1A5BB 1FW6A 5FHQA 1YIJQ 3B9PA 1UJ6A 1KYWA 2I55A 3FYTA 2LJ3A 4DJAA 4BFXA 2MMPA 3F1LA 5LJ5d 4MYHA 2W2LA 3AR7A 1P7PA 3A6EA 4EF4A 3T4EA 2CLKB 2AEEA 1BW9A 4L50A 1U1DA 4RPKA 2HDOA 4XTYA 1EDEA 2QX4A 1K6JA 3UQYS 4P9NA 1N7IA 5A4KA 4HB2A 3K0CA 1YO6A 1IY0A 3T9CA 1P9NA 4OMQA 3EWIA 5JJ5A 4QQNA 1HRDA 5K4AA 1XJCA 2QD3A 1XVTA 2V26A 3VR5D 1RRKA 1V7QA 1TQHA 3SBDA 2O2GA 2O1WA 2CCKA 5EHNA 2UZIR 3NT5A 4P0PB 4QM6A 4MI9A 2BKLA 5LQRA 3ZGXA 1FFEA 5A9SB 1ENYA 4TSFA 1L5KA 5DT2A 1VBNA 3EULA 1BDHA 1QTNA 1U1IA 4HCKA 5EOVA 3RKXA 4JLJA 4JJEA 1D1AA 3GLTA 1E2EA 3UXMA 3LHKA 3PE6A 4L0CA 1U65A 2RCNA 1NMQA 3TSCA 2JK1A 3K9GA 1MC8A 4CIDA 2FR0A 3VU3C 2Y68A 3DTVA 2D1FA 1I3KA 3PD7A 2GQVA 2XNSA 1OZFA 5GVSA 3Q3CA 1ENOA 4RORA 4MDEA 2NIPA 1QGUA 2ZXFA 1OX4B 3Q9NA 5BSEA 1Y1RA 4ORZA 1YS2X 4JLOA 1N7JA 1EQ2A 2GCGA 1VIDA 4BE4A 3GZTB 1YQEA 4PBTA 7ADHA 4LDPA 4RTRA 4U6SA 1RRFA 2XDYA 1R3DA 4KUHA 2HGSA 1K2VN 4L0MA 4PQGA 2WG1A 1T36A 1LBHA 3D8UA 3UJCA 4KYUA 2VYND 1Y98A 4CCSA 4IMPA 2WD7A 3TBHA 1RLOA 4N54A 4QX6A 1BU8A 3PQFA 4WXEA 3QHQA 4BWFB 2HBPA 3WI7A 4MZMA 1SBZA 3PIRA 3Q0TA 3A8GB 4AW9A 1LSJA 1K5HA 4GP7A 4W9NA 2D2VA 2KS6A 4E7HA 3PK0A 5GMKe 2W8BA 3Q7QA 4X64B 1CUUA 4NYMQ 4EKEA 5I7HA 2VCEA 3WRWA 4CKEB 3AETB 2ZS9A 1KU6A 4LECA 3AP3A 3V8RA 2R1UA 2XUZA 3U4HA 3WQQA 3QKIA 4CZ2A 1E66A 1OW3B 2JIDA 1FUEA 4LC9A 1YP5A 3SC6A 5LMZA 3K92A 1QZZA 3NDRA 1EB8A 2NWQA 5KMGB 1CUXA 4AF6A 1FP2A 3L7DA 2O2IA 2UVPA 3TR6A 1H93A 1Q1EA 5LXTA 4BWYA 2AH5A 2FI1A 1U94A 4YBRA 3QFRA 4L74A 5EJ5A 3RVSA 4A9AA 1KQFA 5EN4A 5CK5A 2GR9A 5JY1A 5AVJA 1ISSA 2E18A 1E6MA 2X3XD 2X8AA 1Z6XA 3PGMA 3VR0A 1D0YA 1GSHA 4OP1A 1I24A 4DLSA 5GGYA 4E3WA 4NMXB 1IYZA 4C22A 1BEUB 4TQ9A 3T9DA 2EP7A 1FXWA 4LFAB 1W0JD 3LUBA 4QW2A 1HV8A 4FYWB 3N2KA 4HNGA 5C37A 3D2LA 4X1YA 5JPDA 3H83A 2GSDA 2QGNA 4KI7A 1DTWB 3E2UA 1TRKA 4CQLB 1R88A 2LCLA 4GU5A 5IVDA 2VP5A 3KQUA 4EKNB 3UMGA 3EQ2A 2XE7A 4GOXA 1ZNWA 2PQ6A 1T4MA 2JJ8A 3RAEC 2AJBA 1C9KA 3UH1A 4UNSA 2ILTA 3OW2A 4MO9A 4PGFA 1U7XA 1N9RA 3IQIX 4W5TA 1KPGA 4KQCA 3QE0A 5GJVB 2GD2A 4UOEA 1VE7A 3OZVA 3KZMA 4IX1A 3C4QA 1NZDA 3T9EA 2EW3A 3HL0A 4CIBA 4BMOB 5J2TF 1PJ8A 4I8DA 3A6DA 5HM6A 1EAYA 2Q7OE 2R8BA 2AZTA 4QUBA 3K72B 1MNEA 3IUPA 2QXTA 5F4BA 5EJEA 2GN1A 4MJLA 1JXMA 2NU9B 2VPXA 1M1FA 4V3BA 3ETDA 1PCXA 2C9YA 1PR3A 2EJWA 4GMGA 4DMKA 1N0VC 5CDUA 3R74A 1FSFA 1YE5A 2FEAA 4HZUA 3EXHC 3GCGA 3QNWA 2Q3HA 4QUJA 3A8OB 1NVVR 4K6FA 1MV8A 4JI5B 4M83A 5LZ2A 4WSOA 3EX7C 4I4CA 3ROQA 3IDFA 1U9CA 4YV0A 3KYIB 3V4LA 4JDUA 4YRIA 1C0MA 1F8UA 4ZOLA 1JZSA 4Q3DA 4Z99A 3ZU3A 2EV9A 3VNSA 5HK0A 1TZ2A 3O4VA 1Z29A 3U9LA 3CVVA 2FCRA 3DE6X 5AJXA 5L40A 3AF6A 4PCLA 3QVSA 4O8CA 1VKRA 4G0XA 4G9GA 4R41A 1JEYA 5K0CA 1L5WA 4Q16A 5FJJA 3TQHA 2OTCA 5KTYA 2DVEA 4IUCS 2R6GA 2XEXA 3HEMA 4B5KA 1KMNA 1Y6GA 2Z9BA 3VNRA 3G5LA 5L7TA 3VV0A 1UH5A 4JQSA 3HP9A 3AJDA 2D3WA 2WJVA 2RH4A 1T9CA 4GLLA 3WHLA 3ABIA 3QLUC 2NG1A 5C0OE 5E1MA 3BJZA 3JB9H 1QVGA 1J0AA 1G19A 2EATA 4H7DA 3H5VA 2HHCA 3T7SA 3UDCA 3LX7A 3BXXA 3CR3C 2QORA 3SEMA 4P98A 2M9MA 1W88A 2WB4A 2P2DA 1TZKA 3SFZA 1FFAA 4D8WA 1G98A 1OZAA 4JOBA 1ZY2A 3DZBA 3A4MA 4PIPA 5BWOA 2INGX 5JV5A 1YA6A 3P27A 2KW5A 4L02A 4G0NA 2JI9A 1A7UA 2HNAA 3P0RA 4V0RA 2YZGA 3V8VA 4CKBA 3L1UA 3ZDFA 2LDBA 3A4LA 4Z4HA 2FPXA 2WTMA 4O8ZA 4I6GA 4DPLA 4RELA 5GAMf 5I9TA 2PWAA 5FLYA 1PN3A 3A98A 1JR3D 5E38A 5KWVA 3PKJA 1ZITA 1XTBA 5DTEA 3FHJA 2Z09A 5GAN2 4LF5B 4DBRA 4CMEC 2GZ2A 2G4LA 3WYAA 2NUPB 1K86A 2ZB3A 1KVSA 3J81A 2BUAA 3USZA 3LC1O 1C81A 5E2IA 4M75B 2VZ0A 2G9VA 2CXUA 4P2BA 1UDAA 1EUDA 1F6BA 4JB8A 2KWIA 4TN5A 1DQPA 3UAXA 2VF2A 2WICA 3FJ5A 3EVZA 3GXOA 3LHSA 2BEVB 4MKHA 2QG4A 1E5XA 1U5BB 4ZA2A 1FDSA 1U8FO 5GONA 4MVJA 5JSQA 3WP1B 4CKWB 3EFOB 2A4MA 3PI6A 5DYIA 2OZLB 2V4MA 2ACEA 4FGUA 3BMNB 2W7TA 1E3IA 2Z3VA 5IM4A 1KK7A 2XSZA 3RS8A 1BKYA 1JBMA 1YAHA 3LQ4A 1PTKA 5C5CA 5F5XA 3DMPA 3R5XA 3DT6A 1T9GR 3NIGB 4MR7A 1SHZA 2PD6A 2YKGA 2OAGA 1BKBA 4D4IA 1Z83A 1Q82C 2FA9A 3AI2A 2BFEA 4ZQEA 1G5VA 4BNMA 3EISA 4ZICA 3IEUA 4G97A 1CY6A 3FMPB 1Q0QA 2BFDB 4TTRA 4TMFA 1HL3A 4BPRA 4X90A 3J80E 3EHEA 1Z2DA 1QGYA 3AZQA 5JXIA 4CIXA 4ZO8A 4XU3A 1UBJS 7MHTA 4NI5A 4FDMA 5AVQA 2VA8A 3KCQA 3OOJA 4OGWA 2PX0A 2GEJA 2OM2A 4PRZA 2JJYA 2GBIA 3TSAA 2DM1A 4ER5A 4I4TF 1XQWA 3J7TA 3VNVA 3ND9A 2XXAA 4I6EA 4X94A 1V5WA 4DV1B 5IKOA 1SVOA 2GF2A 1J06A 2CNKA 5FU6C 3DW1X 2APJA 1DTEA 5HCNA 2C7VA 4EZIA 1KIMA 3JR3A 4D5EA 3QLEA 1JYSA 3CPEA 5F5LA 1UMBA 1NJ5A 5LL6S 2CVZA 1N5JA 3N05A 1P4SA 4YRRA 2C4WA 3PYMA 2QL9A 2ZB8A 3E27A 3SBEA 3RTBA 1KYYA 4J7UA 1Q11A 3E8MA 4GYYA 5C51B 4A16A 2XT0A 2XGMA 5AUPB 1EGMB 4NP6A 1Q6ZA 1C6VX 4E03A 1SRLA 4Q19A 4HA8A 1G60A 3B1XA 3R7LA 1PGPA 3EGXA 4Q1AA 1E5LA 3CCSA 3HVKA 3CN9A 4TRNA 3AHFA 4KYIB 4AG1C 1BXKA 3H5AA 2RC5A 3QDFA 5F3WB 2WFLB 3U17A 4LX8A 1Q92A 1DI0A 3ZE6A 5IXSA 1FMFA 4XDHA 3AF1A 2YZKA 2I9PA 4HAYA 3D9QX 3T4UA 4RCCA 3LX4A 4GSKA 5ELXA 3JSCA 4PO1A 2YR0A 3QYAA 4W1SA 5JAQA 4LYAA 4KVGA 1I2MA 4B33A 1U31A 3V4RA 3QEMB 1JIJA 5G2OA 3GGJA 3BS4A 4EH1A 4HWOA 1Q95G 5HS4A 4EHDA 2PKWA 2IXGA 5EVCA 1W34A 1FFCA 1O57A 2AHOA 3I5AA 2DUUA 5AKXA 1K89A 3SX4A 4CKCA 1E6WA 2WU3A 5CB4A 2WY2D 2IDMA 2QRVA 3ANNA 3D59A 4G0YA 2KT1A 2BN4A 2RJDA 1J5XA 4FYHA 4XGIA 3GZNA 4ZAVA 4N41A 1RABB 3CBOA 4LUEA 1CR6A 4GYJA 3NTLA 2E3JA 4UNIA 4RLQA 4ZWNA 2C0CA 4NZPA 4QOHA 2R751 2RGNC 1XWWA 4GMKA 5F3DA 4Y6GB 1VQ5T 5LZ7A 2GK6A 2D5AA 4WCFC 3T1OA 2L0AA 2PMDA 4CU5A 1PLLA 4FYMA 1Z2PX 4ID3A 4Q9IA 5FJIA 1W1UA 4UUAA 1PGOA 4H6XA 4C1NA 2DPLA 4DTIA 2VLBA 1TJYA 3AJ9A 1RYZA 4ZYYA 1ZX1A 5DIZA 3ZDDA 1NOKA 1BSVA 3ZV7A 4UBMA 1OFHA 1DTSA 3G13A 1DCMA 2DBZA 3NFCA 2H2IA 1IM2A 4D46A 5BNFA 1TW3A 1QIFA 5B4UA 4MZDA 2I3AA 5DRYA 4GMHA 3HXOA 4L9SA 2SNIE 1C7RA 3WGLA 3B1YA 5LZ5A 2XNCA 2P65A 2XE6A 3JV3A 4DT1A 4JU8A 3LVQE 4X6UA 1W2BP 1ECLA 1SC6A 5DLQC 4BXOA 1G20E 4KIGA 4RVDA 2ACVA 2A9RA 4NTZA 2IGBA 1Z8HA 1JG6A 1NUAA 3ACCA 2MINA 3THSA 3ZW7A 4JB0A 3QE2A 2WSFE 1C3OB 1XCMA 1RE1A 2ZSAA 3B3GA 1G0NA 4IV0A 2KT8A 5K03A 2FPMA 2C06A 4PPQA 3MPUB 2GN4A 1M5RA 5JO0A 3CCET 1PT7A 3HL4A 3ONEA 5AQ1A 2ZI3A 1J0EA 3QYJA 4IH1A 1IHPA 1C1HA 1U9YA 1L1QA 2H2AA 1ZEMA 1EFPB 1KDRA 2PUCA 1GTZA 4ENPA 4QYTA 4IJVA 4OH7A 1AXRA 4JT2A 5E4JA 3LRXA 2OZEA 4NENB 1Z2CA 1T0HA 1NXXA 3RIGA 3KSZO 1AQLA 2YXDA 5EG2A 2CYAA 3ROMA 4IRXA 2VP4A 3D02A 1SCJA 3DBHA 5DHTA 4AP9A 3PQCA 5EKTA 2ODQA 4QXPA 2QENA 3BSYA 2FMUA 3DKPA 1OFUA 2NPFA 5CBKA 3UWNA 3GRYA 3M1IA 4FDTA 3T5PA 1NHGA 3NIWA 4OA5A 3E0QA 3T3IA 4RJJA 4MV6A 5HKCA 2AIRA 4MVJP 4JLKA 4A53A 2JPDA 2GZ1A 4UPVA 4WUVA 1LSOA 4YMUA 4GC9A 1Y80A 4AL4A 4WMLA 1EWVA 1QCYA 2OO5C 3OEHA 5CCAA 3OBYA 2UDPA 1KKMA 5DULA 1EX6A 4X8OA 1HKHA 2GDJA 3ZLJA 2YFKA 2PGDA 1KEKA 1YJNT 1LPBB 3MC1A 4AKSA 1QVFA 2GOYA 1X70A 3RRXA 1S72A 2QVLA 4QAJA 3RIHA 3QYFA 4Y28E 3IB3A 2YLCA 1VHQA 5IZ4A 4B45A 4FMCB 4ZK6A 3K0AA 4D96A 1KJJA 4RHYA 3GT4A 1FK8A 2W2NA 3AJRA 1O9BA 4QHSA 5EQFA 1O5OA 4MQ5A 1V3VA 5CA0B 1CNMA 7REQA 1LS1A 3IJ5A 1YR2A 2P5YA 3CLTD 5HGXA 4NBTA 3R3YA 5LZ9A 3A9UA 1H5QA 4PR3A 4IGAA 1ATZA 1CP2A 1ZVKA 2QN2A 1H8KA 3A4YA 2HBZA 5CFZA 1N9GB 3O82A 4UASA 5JQGA 1YITQ 1VLMA 2J9GA 3IHWA 1J99A 2IOFK 1EINA 2DXUA 1GA1A 4O5VA 4DC9A 1EXWA 1R50A 4WTOB 4I19A 1G16A 1P7CA 3HZZA 6REQB 6LDHA 2BISA 1GTSA 3PHCA 4BMCA 4LHVA 3UMCA 2VP0A 1Z0FA 1W0KA 3LBIA 5KQSA 1Y3HA 2C4HA 5DW3A 1C8BA 1D4FA 3W2EA 2VDLB 3KJFA 1TTPB 3DWIA 3GJ7A 3WADA 4CMHA 4Z9XA 2HMYB 2RI1A 4C3OB 4PLZA 1BWSA 4MDYA 5DHAA 4KE7A 3PE4A 4E08A 3GFFA 3WNDA 2EKPA 4LE0A 3KUFA 4QQ6A 1VQPQ 3A3PA 4F1WA 5F73A 3OQ6A 2FW8A 3ESDA 4URWR 3QBTA 5H1YA 2FE1A 1WZOA 3WXBA 4TWZA 4ETWA 5KWEA 3OZEA 2DPMA 3CLVA 2GXUA 2YRXA 1Z6TA 3UV6A 1G66A 1C1DB 1GOTA 1QHEA 3DONA 1NNSA 1JDJA 1I1JA 1DFHA 2IVFA 2VCHA 3PGGA 1EGHA 3EH1A 3ELDA 3ANLA 4AJIA 1I1NA 4FI3F 3SSNA 1G3TA 4F16A 2LX7A 3HRSA 3KOWA 4W8OA 2OXTA 2OYCA 3BHMA 3NKLA 2C8KA 3LG2A 1NQXA 2PUAA 4J0GA 3KUDA 5HYVA 2B6NA 1PTJC 2Y1WA 3UJHA 3RR2A 2QGFB 4RTOA 1N8RU 4TKUA 2QRKA 3UK1A 1TUIA 2M9UA 3CVOA 4QTTB 1RAGA 2GZDA 3D6VA 4YQYA 3WWYA 4JJ8A 1SXHA 4E5SA 3SLKA 4TWRA 4OIFA 4C89A 1ZVQA 2O0MA 3QWYA 2J9FA 2LV8A 3ZEAA 3PE3A 4TN1A 1Y4ZA 2H6EA 4UTOA 4C01A 2HMTA 3EA0A 3LO5A 4ESRA 1NQWA 1H05A 1PJQA 4DR5B 2QM7A 1QBGA 2EVWX 4M6WB 5DMHA 1Z4KA 5LYJF 1M3SA 3P8HA 4IOMA 3UC9A 3RMQA 3M6XA 5CVCA 1EFRA 2I80A 5AK3A 2MU1A 4YLYA 4KZPA 2DFDA 3TRKA 3LK6A 1HLPA 5ESRA 2DCUA 2XICA 3W4IA 4AN1A 2F55A 3TVDA 1Q0PA 2E9SA 2EOAA 4R0KA 4GC5A 2Z6UA 3NO4A 1XN1A 5CITA 4ARSA 2O1SA 1QH9A 1E7WA 4RGVA 4FCTA 3L7BA 1OAAA 1FU8A 3VR6A 2VDKB 3STUA 4N6GA 3EVAA 1R5JA 1W44A 3V5NA 3ELUA 1T0PA 4ARCA 4WXRA 1F1BA 1FLAA 4E88A 2HREA 3H2KA 3NAGA 1ZU4A 3DO5A 3T0IA 3UJ8A 3GHYA 1VQ4T 1GN8A 1T4BA 1L4FA 4JEHA 4A4HA 3JATB 3UXYA 4TMZA 1HQDA 5CX1B 1UXOA 5F78A 3ANSA 3N2LA 4NESA 4OHWA 3D3JA 3SZ3A 4PNOA 3QUTA 1KQOA 3GFRA 5A5EA 1Q22A 3AIKA 1QYIA 4R8RA 3V2GA 3H1FA 1C4WA 5B7PA 3G8DA 5K3BA 1QZXA 5J2UB 2ZQYA 5HCKA 5C3UA 1WDWB 2XXJA 3LXUX 5KTMA 1CEXA 3NTIA 1Y6ZA 2B98A 2EP5A 3AEQB 1TM5E 2JFWA 5B6PA 4HMPA 3Q98A 3R0VA 1D6NA 2ISSD 2MAMA 2BI4A 5AHWA 4DIUA 2JZNA 5KNBA 3Q5DA 3AHCA 1QMPA 2NNWB 3K0CC 1AT1B 3RTDA 4X93A 3RJ9A 4H4CA 3VYTB 1AY0A 3JAKA 3TH5A 5FUYA 1MDFA 1ZFNA 3MQ4A 1W76A 2XUGA 2ZRHA 4XPIA 4KQWA 4LRWA 4KBMB 3RYCA 1QVRA 3I01A 4BQEA 3THYA 1X94A 2I8CA 4D9GA 2XW6A 1UEJA 1QC5A 1J6UA 1HOXA 2FCAA 5DM1A 3HKDB 2IZ1A 4EAQA 4EJSB 3BXHA 3AB7A 5B7QA 4DDTA 4ELYC 5GMOA 2I1QA 3EXFA 4PJLA 1FSSA 3E3LA 2FPWA 3MWFA 4HX2A 3BFVA 3OHPA 4XGNA 3DL0A 4B43A 3RC7A 2HPAA 2WSSA 4ZHQF 4II1A 4N7MA 4XX0A 1YRAA 1PRMC 4PLFA 4C1BA 2V9PA 4ZDKA 3HJBA 5TQ0A 2HNIA 1IM8A 2CNNA