1ZQ1A

Structure of gatde trna-dependent amidotransferase from pyrococcus abyssi
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
437
structure length
437
Chain Sequence
b'RVDEFLKERNINVGDFVRITKEEDGEEVTYEGYIMPPYELSAGDTLVLKLENGYNIGIALEKIRRIEVLERAKVKPEVHFEALIEGKPGLPEVTIIGTGGTIASRIDYETGAVYPAFTAEELAKALPEIFEVANVKPKLLFNIFSEDMKPKHWVKIAHEVAKALNSGDYGVVVAHGTDTMGYTAAALSFMLRNLGKPVVLVGAQRSSDRPSSDAAMNLICSVRMATSEVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDVPIAKIWPNGEIEFLRKDYRKRSDEEVEVDDKIEEKVALVKVYPGISSEIIDFLVDKGYKGIVIEGTGLGHTPNDIIPSIERAVEEGVAVCMTSQCIYGRVNLNVYSTGRKLLKAGVIPCEDMLPETAYVKLMWVLGHTQNLEEVRKMMLTNYAGEITPYTRFDTYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit D
publication title Structural Basis for tRNA-Dependent Amidotransferase Function
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Lyase
total genus 101
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 6.3.5.-:
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
A PF18195 GatD_N GatD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.520 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1zq1A01
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zq1A03
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 1zq1A02
1HFKA 1JAZA 5K3OA 5K4GA 1DJOA 5K45A 2P2DA 2OCDA 5K4HA 4NJEB 4RA6B 4RA9B 4ECAA 3ECAA 5I3ZA 5I48A 2GVNA 2HIMA 5I4BA 5F52A 1HG1A 1HFJA 1WNFA 1HFWA 1IHDA 2WLTA 3PGA1 4NJEA 2JK0A 3NXKA 1WSAA 5HW0A 4RA6A 4RA9A 5DNCA 5DNEA 2D6FA 2P2NA 1O7JA 1DJPA 5DNDA 5CBPB 2HLNA 3NTXA 1JSRA 1WLSA 4PGAA 1HO3A 4Q0MA 1JSLA 1AGXA 1ZQ1A 1HG0A 1ZCFA 1JJAA 2WT4A 4R8LA 4R8KA 5CBPA 1NNSA
chains in the Genus database with same CATH superfamily
4YRZA 1GRNA 4FGWA 1GLVA 1VQ6Q 1KMHB 4A9AA 1Y3BE 5K0CA 1NASA 1CEYA 4YP1A 4DV5B 3OLXA 5IUNC 4RSGA 3DOHA 1J20A 4PJOB 2P91A 4XK8E 4MYCA 4ZAVA 1YIJT 4DE5A 2QLTA 4I2VA 2B7BA 3VS0A 3WQQA 1KDZA 4YR7A 3TSAA 5IM4A 4CE6A 2HEQA 2WAMA 3WIBA 2BE9B 5CEEA 3SVZA 1P8JA 1R0YA 1LTHR 2O2DA 4KH1B 1T9KA 2H51A 4JSTA 1NBMD 2YHUA 3G1UA 1XZBA 4FT2A 3SU8A 3K0KA 2O2ZA 4DANA 2DHEA 2ANCA 2BGNA 3S2SA 4O3FA 2BEUB 4C0KA 3O94A 5F7JA 3PGJA 4R8VA 2DJIA 4C7XA 1NXWA 4UATA 2O4XA 3QENA 4C7VA 3K0FA 4B85A 2CS7A 1IMOA 2ZPAA 4HFMA 1FFSA 1NUUA 3KR0A 4K81B 3U3JA 4MSUA 1HZJA 3GP3A 2PUOB 2EYYA 3Q8WA 2JGIA 2VWFA 3GFPA 2P4HX 1MMGA 4HN9A 2LQNA 2DFDA 4KIJA 3LWBA 1C30B 4OMQA 4CLHA 1ADFA 1VQ4T 5IXBA 2YXNA 4OGKA 3KOXA 1NG2A 3CF2A 2CKKA 5DM1A 1R00A 3LX5A 4QOHA 4BV8A 5JH7B 1OAOA 4HTAA 3IMFA 4XD2A 5K8VA 3V1YA 2CUKA 1FA9A 1K73U 3FTEA 5CFRA 2QQ0A 3AM3A 2HRQA 3P0JA 3DEYX 4DLXA 3VH2A 4C78A 1TEVA 4Z49A 5JJBA 2BDEA 1ZXLA 3DTVA 2ORIA 1PJ8A 1V0JA 5TGDA 3LPNA 1WXBA 2VQDA 3IDFA 1B8OA 1NKVA 1P5ZB 3PUIA 2J9GA 5CVEA 2DT8A 5D7NA 2BN4A 2K2WA 2YSQA 1AE1A 1RI5A 5EJ6A 4JZ3A 2ED1A 1Z45A 1YAJA 3GPIA 2XLBA 2X4JA 1XQ1A 2PPLA 4K05A 2BKDN 1NNSA 3OPYA 5FUVA 2CREA 4YC7A 4MDHA 4ZQBA 4RPLA 4V38A 1PCXA 4R3WA 1UADA 3AINA 4BMYA 3RMQA 3HKCA 5GAOm 4H18A 2QNIA 4N03A 2I4OA 3IQZA 1SC3A 1TKCA 1VKNA 4P8RA 5KU1A 4REQA 1XN1A 2DXTA 2CJWA 3I2HA 3PIDA 4FUQA 3G1JA 2P9QA 2X51A 4JUFA 1X1AA 2J85A 2GPYA 1PYGA 1IDN1 2RSLA 5JAZA 3WRXA 2XMPA 1P39A 4OHUA 1AK9A 4FC7A 2RHHA 4NMHA 3GO4A 1SHGA 4BC1A 4C8QA 4EFKA 4WAUA 4LJAA 4O0LA 3AKEA 4C87A 4AJJA 3DLMA 1W76A 2OYCA 2HNKA 4JU8A 1DC3A 4D3YA 3V42A 4B47A 2RO0A 1XA4A 1PFUA 3IAS1 5DI3B 4ENWA 3E8XA 1Z4IA 3T4UA 4NYIQ 4Z9XA 2MMCA 3M0QA 4QYMA 5JS7A 3M3HA 4KYVA 1T0IA 3WB1A 5LIPA 2MINA 5G3YA 5K3FA 4QD3A 4RF5A 4M4ZA 1M5TA 4LE1A 1VQ8T 1F8GA 3VU3A 3SZLA 1TMGE 4F38A 3V2UA 3B1VA 2IOFK 3GUZA 4GPD1 2GASA 1JHMA 1H2HA 4MQ6A 2GF0A 1AKWA 2EERA 4D9IA 1OPLA 4XAQA 3LCJA 3IUYA 5BNFA 4ZVNA 4OQFA 2Q0HA 1U2RA 4RBNA 4UAUA 4C5EA 4JROA 1DFHA 2IUYA 4NE7A 1U4OA 3SQMA 4F2DA 1EP1B 2IYTA 3DCJA 4MI9A 4PR0A 5H59A 3VAAA 3F0TA 3TIFA 1GFSA 4KWCA 5HKOA 1QO0A 1A9YA 1QKIA 4HDKA 5FAKA 3KCQA 2G25A 4S1TA 3ZU2A 1K7CA 1NY6A 4TYPA 1NQAO 2V7TA 3AR9A 4MO9A 2IBTA 3EOBI 1M1KU 1EH5A 4KPEC 1CUCA 3WWYA 5AUOB 2OSBA 2D8MA 4HV4A 4PLLA 2VAXA 4WXYB 2JL1A 3GL9A 2DTOA 3ZCXA 4AZ3B 5DY9A 1T6BY 2GEJA 3NVAA 1L7EA 4KXFB 1NYFA 2RKWA 2EVWX 4DNPA 4XLTA 1G63A 1YV9A 3KR2A 4LDRA 1HURA 4OJYA 1KQPA 5DTRA 2FPPA 3K9FC 4H7IA 2O20A 1JO8A 1TNDA 2FVYA 1F6WA 4FEGA 1QH1B 2QA4Q 1OBVA 3QFTA 4R7TA 2FFQA 1SXJE 2O6HA 2A59A 1Z5GA 1ACMA 3P9RA 3DMTC 3RV3A 1HT2E 4U8GA 4OK3A 1OI3A 3S70A 1JDZA 1W4BA 3B2NA 3QU9A 1DADA 2Y71A 3T7SA 3DFZA 4FIBA 4JI6B 1YIAA 5TARA 4J2OA 1QTNA 4MCAA 1Q7YR 4BVGA 4H1VA 4XOIA 4IIUA 4B33A 3BMCA 3ZWDA 5ICEA 2BEVA 3MTIA 4KQ9A 2RHXA 3S3TA 4X1YA 2DFTA 1JEAA 3EIXA 1Z34A 2MDTA 4G24A 1Q7YC 4L08A 3P27A 2ERXA 1FFAA 4DCOA 3ANLA 3Q3IA 4H59A 2EKDA 2OESA 2NVBA 1JI3A 3SYLA 2WU8A 5KYWA 1CIJA 2Y76A 2FOXA 5ALPA 1WULS 4MVJP 2QV7A 4DYDA 3OIYA 1EVKA 4G26A 4PJOG 5DBIA 2D00A 2FQWA 3GJ8A 1W4LA 4U7HA 1YF3A 4U2BA 4Y30A 4ONEA 1T6ZA 4AY2A 4K9PA 5JLAA 1Q3KA 3NHPA 1TKBA 1QGAA 1RT9A 1GNQA 4O2BA 4C43A 5EIHA 2HWYA 2J06A 4Z0PA 1M8KA 3EGXB 4ZTUB 8LDHA 4WA8A 3Q1LA 1TT5B 2QL6A 1Y3FE 3GJYA 3W7VA 1RZUA 1M73E 3TXAA 3D54D 4DT1B 4IZOA 2Y1XA 3QNMA 4B6RA 4MS4B 3L7YA 4TS1A 3B82A 1VL0A 4PO9A 5MGNA 4XDGA 3ELBA 3VYHB 1E1DA 3CCRQ 2OZKA 3SNKA 3BDUA 3OH8A 2ORVA 2P40A 3MEUA 4Y2JA 2WWXA 1R0BA 5I7OA 2I87A 4XB1A 3UF4A 1O96B 1XMXA 3KFVA 2BCEA 1CKAA 3BQMB 3STYA 2Y2VA 4JLMA 4Q4CA 1JFRA 1WXTA 3C8DA 1S3FA 3UMFA 5MFZA 4Z51A 2JG3A 2BPOA 1BQEA 2ODQA 4ZQCB 2X3XD 3UV3A 2DUUA 3BIWA 4XD7A 3VHRA 3ADKA 5A7GA 1JHXA 1TMYA 4B6MA 2G8LA 4JLAA 4MMXB 3CX4A 4RV9A 2BR5A 2WU4A 3OETA 3E9YA 1FMFA 5KDDA 1JBQA 3K1JA 4RKFA 4HJXA 2WSSA 3N6XA 3AVQA 2VA9A 3WA6A 4N5NA 4AVYA 3MGAA 1OI1A 1FIUA 3D2CA 5CA0B 3N8GA 1VQ1A 3O4FA 5CVIA 3KPYA 4N48A 2HK8A 1T1JA 5I22A 5BYAA 3ZWWA 3N87A 4FHCA 4C92D 4L5AA 1Y96A 1V8FA 2PKQO 1MMFB 2QENA 4S0ZA 4NQRA 1YOVA 1NL3A 3B6MA 1H22A 2D1YA 2Z56A 4IH4A 2WFLA 5BUZA 2BUBA 3GMTA 1BX3A 4EEXA 5EE1A 3EEBA 1A95A 3NVDA 2N0SA 1ECLA 3SXJA 1FDVA 2ZUUA 4RUGA 1U3DA 1FTSA 5AHOA 4GNKA 2PR7A 2P6UA 3NHUA 2YXDA 4BMSA 3FWPA 4OKNA 1JHZA 2B92A 3DZGA 2O31A 2PGIA 4QIHA 3SC4A 1Q2XA 3N5BB 3MEVA 2OV8A 4WOCA 1R0SA 2MSWA 5E9QA 1H92A 4UE6A 2VL7A 1YZFA 1VA4A 2OBMA 2XSZD 3N2KB 4R98A 4YR9A 4TWJA 1M3CA 1H3ZA 4HVCA 4YRPA 1EGQA 2BFEA 1QHEA 4C2TA 1IB0A 3J7AF 4FTWA 4KITB 1E4EA 4A3SA 3D4PA 5CJ2A 2XT6A 1QB7A 2OKCA 1LGYA 4D0GA 2ZSEA 2YL2A 2QLNA 1CY2A 3WHIA 2A7QA 2FMXA 1QFJA 2Y1DA 4KL8S 1UP6A 3VGPA 3A1TA 4PCVA 2ZREA 1FRZA 3NDIA 2XTAA 4Z4IA 1SBNE 3M6VA 4JBLA 3W9BA 4R9VA 5GIOE 4QWMA 4HN2A 5LNK1 1IVNA 3JZIA 3MWYW 2I0NA 5A0VA 3U81A 2FJPA 2XD4A 2JFWA 5EP1A 2QZSA 3NBFA 3DKVA 1M8FA 1OC4A 2P11A 4IUPA 1K86A 2EJWA 3BSWA 5CM2Z 2ZFUA 2MCFA 1L7XA 5BQ5A 4XI9A 3DEJA 2RGGA 4D0LB 5DP2A 1RLTA 1DTSA 3NNSA 4M88A 2C3YA 2WSIA 3ZCRA 1JU4A 3CCLT 1QV7A 1MIHA 4JJAA 1TWBA 3L3BA 3L4BA 4WGGA 1VHLA 1SR8A 3NYIA 5BVGA 1M2EA 2VTKA 2HK7A 4O63O 2HB6A 3PVSA 1SEVA 2QN3A 4C7JA 3GEEA 2GM9A 1WBDA 3GJ4A 4MS3A 1GG8A 4JLUA 4QPCA 4JP8A 5EL0A 3FLGA 3LX6A 3R77A 4XIYA 5JG7A 1LVKA 3SJAA 4NU8X 4A2QA 3PK0A 1SUCA 3CTMA 3H2GA 3IIKA 4YRIA 4HH1A 3RS9A 3WL8A 1XDSA 2H31A 5HRUA 2W70A 1VJGA 5BXQC 4TROA 5TPWB 3TW8A 5HUQA 1FXWA 2IYYA 1JR3E 1DAMA 3P96A 4EMKB 2V7VA 3R6DA 4DFDA 1F2UA 2ZTMA 2FR0A 4E7KA 2J6FA 1Q0RA 1MC8A 4AMZA 5HIMA 5B2FA 4FC6A 5B7GA 1RC8A 2OK8A 2N46A 4XU3A 2DBYA 5JAHA 3AVVA 2NYSA 3TLEA 1XHEA 1RI0A 2H18A 4DWOA 3GDHA 1QFMA 1G0NA 2WM8A 4DDMA 3BGSA 4NDAA 3TJRA 2QGZA 3W8DA 1FUYB 1IEQA 3VOAA 1G3IA 3KYIB 1WHTA 1I6KA 3K1ZA 2AGVA 3T34A 5CA1F 3BZUA 3OF2A 2P8JA 2V7QA 4Z7QB 3EDQA 1IZZA 3JAMA 4DR2B 2JJ2D 1GTG1 1OZ3A 1VQLQ 1GOTA 4F46A 4FIZA 4F84A 4PAWA 1T3HA 3SG0A 4N82A 4OGFA 3PEFA 3M49A 2QVBA 3CLSC 1A27A 4KQ1A 4LVNA 1Q19A 4RYLA 1KAGA 4HYYA 4RK1A 5M7EA 1OLUB 1PW5A 5FOXA 4N4AA 1P4SA 4W5JA 5D3MB 3MHXA 3F8TA 1OI2A 1RD4A 2OCYC 1E96A 3CNBA 2KAFA 1GFZA 3FOWA 2OB2A 1Z75A 3VVMA 4JS0A 2JDIA 1T25A 4XJSA 5A9RA 5EJ5A 4CC7A 2W2LD 1V1RA 5BVHA 4QEZA 2QX7A 1T5BA 3CT6A 1KO1A 4LRTB 1IJFA 5A4DA 4FB5A 4UMVA 1OKKA 1YZNA 3TQRA 4BNHA 4X61A 5B3AA 4OB2B 5THKA 3A3NA 4Z2AA 2QS9A 4NOMA 2C2BA 2FW1A 3EDCA 1B00A 3MF4A 1XAIA 3JV3A 3USZA 4XQ9A 2H4WA 3TD6A 3UT0A 2Y0CA 5AKEA 1J42A 2C4KA 4GDMA 1ZHIA 3A9VA 4CODB 1Y1KE 3AKDA 4HY3A 4QBKA 1F0NA 3EC1A 2V54A 1OX6A 1OD6A 4QKQA 3I9MA 4WLFA 1NR1A 2FCAA 3AJEA 1HYGA 1GCPA 3GHHA 3CZRA 2H92A 1M76A 1QKKA 2QTVB 3FIUA 1F6DA 5C4MA 5IEJA 1RWOA 5F1KA 3C16C 4IWYA 4BP3A 5JZSA 4D5EA 3M4JA 2DQZA 3C41J 5ESWA 3BMXA 3DV0A 4QT4A 3LQ4A 1PZXA 1ABQA 1ADBA 1I80A 1Q83A 4A4HA 2QGFA 2XEDA 4KUDK 3B9PA 4PRLA 2NO6A 3CC2T 4P4UA 2FWBA 1IE3A 1L1FA 1K7YA 2F7SA 2H7YA 3L7DA 1QNFA 4QUDA 1ZO8A 1E1QD 1P7CA 5LCXA 3IP8A 1G2QA 3M0EA 1WTCA 2YHIA 1E1YA 3G82C 2QDXA 3HSSA 3V1MA 2LQKA 4EG5A 2IHTA 4PZDA 5GJVC 2XTNA 1P45A 4MJ3A 2VDRB 2E1RA 5DYTA 1P2TA 3CX8A 4YHHB 3HM9A 1V37A 1JFFB 2WYHA 2ZUDA 1Y71A 4MYHA 4C0DB 2NUTA 2DKFA 3F4BA 3WZMA 3HO1A 4ITUA 4IJQA 2PBFA 4DJEC 5HUJA 4F72A 5ADWA 4RTOA 1ID8A 2VUHB 4MDWA 3HVUA 2ATCB 3LDGA 2VRCD 1E9AA 1LLDA 4S05A 1HYEA 3N59A 3WOHA 1EVQA 3ZXIA 5EHQA 2BEWB 1FBTA 1J3TA 2OBBA 2FQ1A 1JLKA 2VHTA 3CINA 3CWZA 3DBRA 3N6RA 4YJ2B 3KB8A 1OILA 4WK4B 1Y6GA 2AJ8A 1ZDMA 3WC4A 2DL5A 3VUBA 1NLYA 4DR5B 2OILA 1J1ZA 3GQBA 5DJ5A 1VKRA 1FYNA 3WS7A 4ZCRA 3PNKA 5CDFE 4G2TA 4AO8A 1AH2A 1RBYA 1PNTA 5FLXA 2EP5A 3SCZA 2D0PB 1JJBA 3EDOA 3AXSA 3UMBA 1JEYA 2F9MA 3AIOA 2BMWA 1D2RA 1ZSZC 3SC3A 3M6LA 1R9GA 4MW6A 1N2IA 3SEQA 2IUFA 3NAZA 1TL7C 3PRKE 2XE4A 2XKAA 2H2HA 2AUTA 2BM1A 4AW9A 3V2IA 2X0FA 2FRWA 3MZ0A 4MUFA 1NGSA 2VDWA 2HSDA 4ZFNA 1USKA 3FLAA 4DXAA 2EFIA 4ZC8A 2NG1A 3DXXA 4Q05A 4C0BA 4E12A 4EI8A 1JEDA 2A35A 5C7IO 3MUEA 1QU3A 1G38A 4RCCA 4CMCA 4IEEA 5DW3A 3M4GA 2Z2IA 3OY9A 3FF1A 1VG1A 3IQXA 1KDTA 2YV4A 3RT7A 3WDKA 1URPA 1IQUA 3EVEA 1JEGA 5JSKA 2Z8ZA 5K4AA 2BHNA 2YOFA 4M46A 2KQUA 3JCMJ 4KXVA 5KPDA 2VNJA 1P7YA 1Q7YU 2JZOA 3FYDA 2J6KA 2I80A 5LA6F 1GZ3A 3WGHA 3ON5A 1B43A 4HUJA 1PYDA 4DWWA 4QO8A 5AKYA 3UVEA 1OWNA 5BSKA 4HAYA 4JXJA 3R8XA 3U7QB 1P2VA 2RBGA 5FV7A 2C00A 5JBNA 3AY3A 4CMEC 2JAHA 1GGHA 5KQLA 4HNQA 1VMKA 5COBA 4H16A 4D3XA 1N5DA 3RJMA 4HMOA 5FTKA 1TM5E 3CZCA 1ILEA 1T4MA 1SELA 4JUCA 4OLFA 1M5UA 4AUNA 1MRNA 3CCJA 5DCLA 3QW2A 1G9XA 3L1IA 3P2MA 1WIWA 1AZSC 1GQQA 2DXCA 4YCDA 3GRRA 4CV3A 4UC0A 1LD3A 5DOZA 2V6MA 4YJ3B 1P1RA 2M02A 2DFPA 2I0FA 5LQSA 1ADYA 2FMFA 1OIWA 1NYQA 3F2IA 1MFZA 4U7PB 3WMEA 3VS1A 3PQDA 1VFPA 2Q28A 4UXHA 1AO0A 1TUGB 1C4KA 3O6VA 5IN4A 4O4IB 2BR4A 3UATA 4G0WA 4OHZA 3MGBA 4PHHA 4XIGS 4OJMX 3GOHA 3VFDA 3S8YA 3HS3A 2AEJA 4TN5A 3GLFB 4EECA 5TB5A 1D2GA 4J1SA 3UK1A 4EHIA 1V11B 2QT1A 3T8YA 2EDCA 2QTGA 3R1IA 3PD7A 3FDZB 4UUQA 1WW8A 1DO2A 4OBEA 2QLFA 4K11A 3A27A 3V2GA 3WZLA 2DUMA 3MPUA 3K96A 3AYXB 3M6AA 2QTHA 2VYNA 4FW8A 2ZPGB 3FPBA 1N9GB 1JRLA 4IXTA 1N75A 4FHEA 3PL1A 2KI7A 1T5TA 3ZVMA 4F8YA 2SKCA 3UUEA 4RE5A 4U8HA 5IUKC 1C1YA 4RHFA 3GV0A 3ZJTA 4FIDA 3N53A 1YVEI 1QO7A 3UQZA 5JVDA 4REMA 1FVHA 4XVQA 2CVFA 3TIGA 2X8BA 3DS8A 4QTXA 4V1CA 4KAXA 4A0HA 2NYVA 1UJ4A 1NUPA 4BRSA 4QYSA 2IV2X 2GILA 2P75A 1J8FA 1ZGGA 4MMZB 5CNJA 1ZP6A 1SUIA 5IASA 4MZPA 5AVRA 1J1IA 3E15A 3QRWA 3RUHA 1R4MB 3HMKA 1EG7A 3FGOA 3DAFA 3VBCA 1UXIA 3DWIA 3RKYA 3IEMA 1IN1A 3GBVA 3VSCA 1VCOA 3UGJA 2RN8A 2XIQA 1ISSA 3U1BA 5JYEA 5HIKA 3Q1JA 3SWNB 5LM3A 1QDLB 1BVUA 1QGUA 1WG8A 4E1AA 1J00A 4M78B 1HQDA 5HRCA 2BFFA 3EVDA 3LA8A 5J2UA 4GNRA 1W34A 4S1PA 2CV0A 1ZJZA 3ML1A 3DLBA 3UK7A 2XDWA 2ZUFA 2LDXA 1QVGA 4ECAA 4HOYA 3O4HA 5F5NA 3BWMA 4HRAA 1GCQA 2JLSA 1DWPA 4HAVA 1H1TA 3QJYA 2ISCA 4WJKB 3KB2A 1JU3A 1HTBA 4RY8A 5A1TA 2ZJYA 4KBFA 3RSZA 2V55B 2JFBA 3GEHA 3IPCA 3HBNA 3RJTA 4WNCA 4FCVA 4KGVA 2LCLA 3HL4A 4CLOB 3CXCA 1NTRA 2QUHA 3INYA 1OLSA 1T5SA 1KI8A 5AESA 1K3TA 5AKZA 1YC5A 3I1IA 1ZM7A 2HU2A 4REOA 1HSQA 4R2MA 5GAN2 5CYPA 3ZVRA 1YZYA 1YIJQ 2RB4A 5KREA 3JB9F 4G4GA 2IE8A 2A9VA 2VYFA 2YRFA 3NDPA 1AKEA 1F1BB 3G1WA 3R6LA 4R05A 5EQTA 2CN1A 1LQUA 1AC5A 3KYDB 2A1TS 1WDXA 1J2JA 4GMDA 2WG0A 4KN5A 1VC2A 1S2NA 4P81A 4KLCA 4FGJA 4MAMA 4OI4A 4JGGA 4Q3KA 2WFZA 2QBYB 2NTEA 4QTZA 1WBBA 4KMOA 2AMYA 4ZQGA 2XYVA 1NYTA 5J5AA 4GP9A 4LBWA 4ZYZA 2PMCA 3N28A 4WN9A 2JBAA 4OHPA 1J5XA 3CB4A 1UK6A 3ZYZA 4RVCA 1N5ZA 3MCAB 3AIMA 1E5TA 1U0LA 1QLYA 2G4VA 2X8AA 3X26B 2FFBA 3VHQA 1DDOA 3W5VA 5K4GA 1L5QA 3HCWA 3EBLA 2HPVA 4KVZA 1DVRA 1BX0A 2AI2A 4FBMA 4XB2A 1VQ4Q 1NPYA 4RKWA 4BACA 1B3RA 1L5RA 2FSVC 2LGJA 1DUSA 3CZ5A 4EGCB 3A9UA 1WCYA 2R4TA 1U0EA 5DGTA 1VBKA 3L4EA 4JLIA 1KYZA 3BBLA 5JSQA 1OOEA 4G0PA 3QSGA 2TS1A 2WTMA 5B7NA 3EPHA 1VXOA 2P78A 4KFTA 3KAQA 5LJ5h 4A4DA 3ZV6A 2R6FA 1QGYA 2HNAA 2A08A 3T52A 1FTYA 3I8XA 1GDHA 1P7VA 1VQ7Q 3IEPA 3ZKWB 5CDSA 3TVDA 4IIXA 3OT1A 4AIIA 5HJEA 2JTEA 2ACVA 1LRLA 4AC9A 4MZTA 2OV2A 3AP2A 3RYCA 3MB8A 3HU2A 4U7GA 2C95A 2IXTA 5A0LA 3TREA 5JIBA 1J2UA 2ZYSA 1HQKA 1QGZA 2VCYA 3WMRA 2AFVA 3RBBB 2R2AA 1T34A 5M2QA 1K6MA 3KQTA 4KGDA 2HIMA 3UKOA 5CB4A 3FNHA 4AP9A 3E9MA 3ZIDA 4E31A 2WI8A 4M83A 2L18A 3JQQA 3EFEA 1FFGA 4X6LA 4BXOA 1K5GA 4NYMR 2FO0A 1D09B 1JJ2S 3T1HB 3MTEA 5FL7A 1W6XA 2IP1A 2DFVA 3JQ7A 5IKEA 4XCXA 3HO6A 1SBIA 3LBNA 4XFKA 5EZYB 3DBLB 2ZJ0A 3PDIA 4J49A 1OYYA 2OXTA 3MTQA 4OA8A 5DKFA 5DHSA 1U9CA 3L2QA 4F6RB 1LBIA 4HP8A 4W8GA 3PNMA 1E60A 1PDVA 1UPXA 3CRRA 2ID9A 1WNFA 2AFHA 5I4IA 5GM2A 2DTXA 4WFJA 1VQKT 5GIPE 4INAA 1UM9B 4RFVA 4IUVA 5FQOA 4EJFA 3M5CA 3ZV3A 1QR6A 5A3SA 4PYKA 3ZNPA 3OZDA 3ZWAA 5CK9A 3D6NB 1OYXA 2SNIE 2Y6VA 2EKHA 3TTWA 5EHIA 2VT6A 1K4MA 3GUYA 2DFLA 2R751 1F2TA 2PLWA 4QJ3A 3N0VA 3PXGA 4KO2S 1CY4A 2ZYWX 1VQ8Q 4ZV9A 3D6MA 3RC7A 3R7SA 4QQFA 3MT9A 2BGLA 1XZJA 3OLQA 5DX1A 4Q1CA 4XTRA 2KE5A 2TSYB 4URWR 3DAPA 1RLJA 3VX3A 3EIQA 4UAGA 3ENWA 4KAFA 4KREA 3U4QB 3A06A 1X1EA 3PE0A 1CUIA 4UQOA 1SH7A 2PQWA 1RQGA 2IIVA 3W1VA 4Z4CA 3VGJA 2D2FA 1G55A 3QKUA 3VHXB 2HKNA 3ZPXA 2EPDA 4CF4A 3OU6A 4CEHB 2G67A 2IZOA 2JD1A 2ZJ2A 1DV1A 5AOBA 4B6PA 1KZ4A 1UWKA 1TTPB 3T7CA 1FMWA 3VO1A 3K9WA 1Q1GA 2PV0A 2Z2YA 1GP2A 3TRFA 1SHKA 1Z0ZA 2P2SA 2BMVA 1E66A 4NOKA 1R8SA 4YPFA 3CCUA 5CO7A 2FG6C 5B4VA 3U5ZB 1S89A 4TRNA 1RS0A 3D81A 3GVXA 1F0KA 4PN3A 3ZH2A 2V4UA 4HCBA 5EE0A 1MCZA 3MRXA 2X6TA 5KZMB 1II9A 1VLMA 3DQPA 4CM7A 2FSHA 1UC9A 3VPAA 1RZVA 3DZFA 4I1OA 2P9YA 5CFOA 1Y3HA 2JLVA 3ICOA 1LA2A 3T1NA 1JU5C 1JMYA 1YQUA 4F7UG 5CCEA 2QVYX 5FHQA 2QAJA 4G5QA 3JQCA 3OCCA 3NVMB 3WBKA 4CBVA 3ROGA 3HB1A 2FG7C 4EZEA 4M7DG 2ONCA 2WYVA 2MSDB 1QHYA 1Y8CA 3EWIA 1WV1A 3RU3A 3E3OA 3GNGA 2W2QA 1ONPA 1RJ9A 1MORA 3KKLA 1Z4QA 3DTYA 2ODPA 4OQYA 2B69A 1RRCA 3E7WA 4GRIA 4EJSA 2QX4A 4FCWA 3NVKI 4IEIA 4BDZA 5TQ0B 2DLPA 2IYEA 4B3MB 1RJEA 2R6DA 1YL7A 1VQPA 1SCJA 3EZNA 3LBYA 1ZJWA 4YP6A 2IBMA 1SPBS 2XRZA 3U48A 1ZBDA 2ROLA 5LL6S 3W8FA 5CAEB 1Y1PA 2PX0A 2VC2B 4KO1S 1U99A 4IRMA 2RQRA 1ZXBA 3JQ8B 2AH5A 1Q0QA 1A5ZA 2QY6A 5L3SA 1OH5A 3SYKA 1TCCA 1I7DA 5TQVA 5H5JA 3UCXA 4DHWA 2AKYA 3IVGA 4BB6A 1NDQA 2OPHA 3WYCA 1UBMS 5BOSA 1NP6A 4GOOD 4UVIA 5ALJA 2Q2NA 5FLYA 2UZ0A 3ONDA 2HH9A 2HQBA 5FWBA 2Y92A 1GGNA 4CF6A 2B82A 1MV5A 2GK3A 5EIOA 3E9DA 3WLJA 4RETA 4HZUB 5CEJA 5DIZA 1I5LA 4K6CA 5IP5A 2Q6KA 3JQPA 2I6XA 3WIUA 1E8NA 2OHGA 1MUUA 1KY4A 4LOIA 5EA2A 4UM9B 5K3DA 1OHHD 2ZRMA 5GMKh 1KSJA 2D8JA 1DCMA 3LVBA 1JIXA 5AHXA 4FBGA 3GRAA 1SBHA 4RVFA 3Q0EA 3A1CA 4GZ5A 2VKTA 1XQHA 3L7NA 4JBWA 1V6SA 2HDOA 3IV9A 5CK5A 2V59A 1W46A 4NZPA 1BRMA 3L84A 1KC8R 2FQXA 3O8QA 4P3YA 4XSVA 1F2VA 3FF4A 4EY4A 4Z86A 4G67A 4R9NA 3AERB 4PVCA 3AW9A 4XWKA 4HGQA 1C1DB 4KUIA 4I50B 1ZGCA 1K9MU 1UZMA 1OWPA 2CXSA 1KC8C 5T67A 3H16A 1UBSB 1M2NA 2AJLI 1KSFX 2R00A 2IXBA 3U9LA 1R10A 4NYIR 4ND1A 2JAQA 3BAZA 1UXGA 1FC0A 5AQ1A 5BWBA 3JWIA 3NFYA 4B5LA 2DNUA 2P2CA 4KBYA 2JFGA 5IT9E 3TLBA 1GNSA 4XUCA 1PKEA 2J7IA 3DF7A 5BYBA 2V9CA 3TCJA 3D8SA 2Y1LA 1NPRA 2OD7A 3DLPX 4ND3A 4LXQA 3OE5A 4MYTA 1X1TA 1GTMA 1G2BA 1I07A 3QKSB 3Q6MA 1P91A 3AW8A 3MCVA 3SYMA 1L6IA 1OYWA 4NL2A 3BEOA 4GI5A 3BOSA 4B5KA 2ZRHA 2GBFA 1AHNA 4D6YA 2DY1A 1AZTA 4OO3A 1E8MA 3IVRA 5FBVB 2WP0A 2NSDA 3F6SA 1UGVA 2L3QA 2H3EB 1XTIA 2G71A 3GEBA 4E3WA 1J7KA 1Y33E 4B4VA 5HCIA 2X9HA 2ZT5A 4KR2A 2BGKA 3K15A 4LF9B 1KQFA 3I39X 1ZH4A 3X28B 3COYA 3RUXA 2EARA 5CD9A 2ZP1A 3R3YA 2QMHA 4DA7A 5GJWC 3TLGB 2QGGA 1GUAA 1W88B 2G0NA 1YQXA 2ACKA 3SHVA 3IBCA 2GPTA 4KNYA 1I4TD 1L5VA 1V16B 3P0RA 2A14A 2DQ4A 3CCSQ 2LNVA 3OTOB 2Y1EA 4IJ5A 1U90A 3ASKA 2EYXA 5KKNB 1QO9A 5J40A 3DKMA 4OAOA 3TLCA 3C4VA 1G7RA 3PBKA 2R57A 2H8HA 4PLFA 3W2IA 4UVEA 1D1SA 4M2LA 3E3LA 1L4KA 5IKXA 3GLHE 3THSA 4H7KA 4IYRA 2RQTA 3JCMg 3RRZA 4TTSA 2DFKB 5K0EA 5L3VA 4JI4B 1IGQA 1IY8A 4YFYA 2VP9A 1PTJA 3WGYA 3EG3A 4BX2A 1L7NA 2CWWA 2PLAA 3B8EA 4OOFA 4RZSA 1VE3A 1PQYA 4HDQB 1P1IA 4Y2SA 3B6ZA 1EAMA 3CCLQ 3AY6A 5IJAA 3VM6A 2JGNA 4OB0B 4BUZA 3OYBA 2P9EA 3QVKA 2PMWB 1VA7A 1RI1A 3JD0A 4C1NA 1XTJA 2HRRA 1A9RA 3V9PA 3GRKA 4G4JA 4XVRA 2G77B 3TZQA 3OQ6A 2A9KA 1GKKA 2Q1UA 2F1OA 1WKCA 1M1FA 2D6FA 4FW2A 3CLHA 4K9DA 3B3JA 4E7SA 2W5UA 3RC9A 4AZWA 2D06A 1GUZA 2VQ6A 3WISA 1FRVA 4DLVA 1FNNA 1SEMA 1YB1A 2VB6A 4PIPA 4HX2A 1Q5PA 1M1NB 4DIBA 1KYYA 2G9NA 2DD4A 4G5HA 2EJTA 4RWZA 4O4HB 2DE0X 2WYUA 2A1IA 2GZHA 3TM5A 1P7PA 4F4UA 5K1ZA 1H3FA 4C4TA 1JDUA 1DKOA 2QF7A 3GEMA 3INNA 5BR8B 2OX7A 2C07A 1QRRA 3TM4A 1XF9A 4CV0A 4TVOA 3FBTA 1W25A 3UUGA 1IHOA 3PSAA 1WZ2A 4DGSA 2ZCUA 4MVJH 3T1TA 2MHCA 3CUKA 3PGLA 4WJZA 4JLGA 4QFDA 4OP1A 4K87A 1JR6A 2OHVA 4L4SA 4ESOA 3JALA 3FBGA 4TXHA 2PMBA 3ANMA 3S2GA 3CLUC 5JSZA 4CFZA 4WQMA 2WIFA 4RVSA 3W5AA 4IV5A 3O47A 4UXJA 4OMPA 3OICA 3JXEA 1A82A 1PBTA 4N4GA 3ILXA 3SF8B 2E18A 3IMCA 5AT1A 1H6AA 2YFYA 1W2BA 2KMTA 3M9XA 5KJCA 4M77F 1RRPA 2JCVA 5FDFA 2VDPB 5KNBD 2BSQA 2YYSA 3AQ4A 1UFFA 1SKBA 2Z2XA 3V80A 3N07A 5B3JA 1KI6B 2ECZA 3PWKA 5BYJA 1NJ8A 4QUIA 1E2QA 2IS1A 4YXFA 1YR7A 4RJJA 3BQ9A 1SUSA 3O2QB 1M1YA 5A5DA 2GWHA 4ZT5A 1NSYA 4J6FA 4QQ8A 3WVDB 2IEBA 1EGMB 1QPBA 4UBNA 1QLWA 1L7QA 5LZ5A 1SD5A 1VL6A 3A6JA 1C7RA 2FR8C 4JP3A 4I4TB 3I1YA 2ZBVA 3BMNB 3H0HA 2GN4A 3LDHA 3OAAA 3WBJA 5JC1A 2OGUA 3R4VA 2IL1A 1DDIA 3W2GA 3QWAA 5K3CA 5HZGA 3DVLA 2V6BA 4R41A 1YR2A 2H8KA 5I7RA 1NR5A 1XR3A 2D1SA 5IS2A 2FZGA 1AQIA 1GGEA 2YMQA 2ZIGA 4HNVA 4L5BA 1R15A 2DH6A 1NW6A 4Z0HO 2XVAA 4ZI7F 3UPUA 1I51A 2ZJ5A 2Z8YA 2O7RA 1R2QA 2FW6A 2QMEA 4QOGA 1HXHA 4LDAA 3I6ZA 2A9QA 1VSVA 1WQ3A 5IWAB 3WFIA 4X1IB 3JASA 3K0BA 2X6RA 1AGNA 1KO4A 3D6HA 1P2FA 4V2IA 2GMWA 4FJ1A 1I6LA 4WT7A 5AVKA 4KACA 1NI4B 2OK7A 3MJCA 2COZA 3SOZA 4H7JA 1RABA 3UJBA 3VVCA 4MP3A 2E49A 1OWLA 1CTQA 3EQ6A 2QI9C 4P82A 3G7NA 4KJXA 2QROA 2Y77A 2B8TA 5JAPA 2FMKA 3TF5A 3DE2X 2PJZA 2XUFA 2YWEA 3PXBA 3QMVA 2H4JA 1VHJA 3CJRA 4IOMA 1EX4A 4P7FA 1NG9A 1QVRA 1JYSA 4GBJA 3N2LA 4Q7EA 2VF5X 4G37A 1PG5A 2IJGX 3LSTA 2ZR7A 2GCIA 2RC5A 4TXNA 4J91A 2HO4A 3AG5A 1D1BA 1IEXA 3NTQA 3FSJX 3G71A 2A2ZA 3TLYA 1YUMA 4WX2B 1E3SA 3QKIA 1JB0E 4MUIA 2ECFA 4Y9SA 3K2IA 4K26A 1XOIA 2OCGA 2VKNA 2VF4X 4M49A 1GPJA 1QIFA 2DIGA 2Z3ZA 3ECSA 4G5SA 2VK2A 2P6NA 3D02A 4O2LA 1R6XA 4WOPA 2ZUSA 3TW4A 5C5EA 4GX5A 3A31A 1G66A 1NULA 1PHTA 1M9SA 4FINA 4IDDA 2X4GA 5DXJA 5EWJA 5B12A 3GPCA 2QTZA 1YR8A 5KWVA 5FNVA 1SBTA 3NASA 2H1HA 5I9NA 4TSRA 1M8PA 2MPXC 1KOJA 4KE6A 4M87A 5LD2C 4BQNA 2WHPB 4JXKA 1INLA 2WWTA 4NCKA 3VS7A 1UZUA 4LWOA 3L41A 2PWPA 2BI4A 1RKUA 1OX9A 1DIOB 4TUYF 3RAFC 3KVRA 1R6VA 4ARSA 4OLHA 4E7LA 5DHFA 1RWPA 4BMDA 1UFQA 3UK0A 4OHVA 1WF3A 3DO6A 3EX7C 3REGA 4Y6OA 2Y4XA 3C3YA 4N7MA 4TZ0A 3G9TA 4NE9A 2CNBA 1AVTA 1ADGA 1V41E 4DDTA 1BKDR 3C39A 1LLQA 4BVEA 2QR5A 3B9BA 3TG8A 4DF3A 5KYYA 3FNFA 3ZXYA 4RTUA 2G7ZA 3VNSA 5KTYA 1TYCA 1RXWA 4NR0A 4NDNE 1VL2A 2C99A 5JZ9A 3PKIA 3NJ8A 2QPOA 3Q9SA 3NJ4A 2C2HA 3F5FA 2R7AA 1CZHA 3ZHCA 2A78A 4N6GA 5HILA 1D3AA 2X2OA 2B4YA 5JJ5A 2J3MA 3KAJA 1RKBA 4M76B 3E6AA 4LSZA 3JZFA 1CSKA 2UYQA 1B8NA 5AM5A 1RXSA 5CH8A 4XRGA 5LP6C 5ILOA 5E7QA 7REQA 3KDPA 3V8KA 2Y4NA 1IN8A 4D96A 3VR5A 5AP9A 4ALNA 1GL5A 1ZUNB 5E6RB 1VJ5A 2HO5A 2BBTA 5JS2A 1G8HA 2ZI7A 2VZLA 3WAJA 3G7ZA 4GKVA 4HNTA 4DMCA 3ZK7A 1L7OA 2WC1A 4YYEA 4PPFA 4Y98A 4FFDA 1PO7A 4UTNA 4P3OA 2YRCA 2IU6A 3M34A 1XRSB 1NBEB 1X94A 4XLZA 2MSNA 2J9FA 1YSCA 4QBIA 2XI9A 5EUCA 2ZRNA 2IKSA 4U4AA 4C5BA 3RPEA 1FFCA 3M59A 4RO0A 4BQOA 1K4US 1CR0A 4KN9S 4QHSA 4NS5A 4MUEA 1Z82A 2F3SA 3PR3A 5GAN5 3IPXA 4H1HA 1Y42X 3WWDA 4CI0C 3HB0A 1O5TA 2QY9A 3L0IB 3HFNA 4K88A 1P1JA 3EK2A 3EGUA 1R50A 3LVQE 4DYVA 3IA7A 2RHGB 9ATCA 5IJZA 1CETA 2R4UA 4R2IA 2HZYA 4ZYUA 5GANg 1WHGA 4MRMA 3EARA 3OQIA 4Q1VA 4PYQA 1M7BA 1KC8U 4JGIA 3A11A 2VXCA 4PXAA 2V8JA 4EW1A 2SKEA 1RQNA 4S1VA 3NV7A 4Q9IA 2A8YA 4MV4A 2R6ZA 1CZUA 3BL8A 1V71A 3LT0A 4B7XA 3IUJA 2TMYA 3ZWBA 1N2JA 2F3PA 2X1LA 3U4MA 4M78E 3SM3A 3ZWMA 1YB5A 5TY0A 1KDRA 4DRXB 1YZLA 2FUG6 1O9SA 3NDRA 2IWRA 1SG5A 1RRMA 5EHNA 4E0BA 4QM6A 4G1FA 5HCUA 1U4SA 3B1XA 3BFJA 1V1CA 3ASUA 1RYYA 4IHAA 3RSLA 4WPGA 4Y18A 3BJEA 1SCIA 1LK7A 2W9XA 3B1WA 1HF3A 1VQ5Q 1WSWA 4JOQA 1M8MA 2AYXA 4ZAXA 1S8NA 2EEZA 4MS1B 3PUHA 3P2JA 4RYDA 3KL4A 4YJGB 3STXA 1V6AA 3IX7A 2BIFA 3MCUA 4D8YA 1IH8A 4IHQA 2A9OA 3DMYA 2H1IA 1KZ1A 3WE7A 1BHO1 1I1NA 2V6GA 3EGCA 1CUUA 5HKKA 3NWJA 3AC0A 1UM8A 2PGDA 1ELOA 5ALGA 3F9CA 5B57C 5ENDA 4PRKA 3C3DA 4QUJA 1GFCA 4B71A 5KSYA 3CVVA 3H1BA 3MRSA 3L7OA 1VQNA 3E35A 4AS1A 3QELB 2ZYTX 1A97A 1J0AA 1NN5A 2PHZA 5JZVA 1EVLA 4QYIA 3RC2A 3U13A 3TKAA 2IIMA 2WVGA 1FX0B 2OBLA 3CTPA 5EXSA 3DMTA 1NBOA 4GUDA 2Y4OA 4EM6A 5AKGA 5BQPA 3UBTA 1Z2OX 3OZTA 4HQLA 1H0SA 4P0PB 5DHAA 2PSJA 1IQRA 5TS3A 1SJ9A 2O6LA 4PL6A 4RTNA 5LYYA 1X01A 1F0YA 3L1JA 5IMBA 3BHMA 4E4RA 5C34B 2JLZA 4CKEB 1DI0A 2YMMA 1LWOA 2LVBA 3T5GA 1H9AA 5AI8A 5CJJA 2QR3A 3UKDA 2AZMA 5CPBA 3I01M 2AX4A 1AF7A 2HIHA 5GVSA 5MHTA 5A5GA 3ULRB 2PO7A 5E0OA 3ER6A 4WW0A 2JARA 3I9V6 4TKUB 4EF5A 2JK1A 2E1PA 3ZZNA 4NICA 1MO2A 2NVUB 3PIIA 4JAVC 3A1FA 3E9FA 3STTA 4GSLA 4I8XA 3O9ZA 3HVJA 4RVGA 2OFFA 3FFXA 4IDHA 3M1YA 1R1DA 2UUAB 3FCCA 1C3OA 5AYVA 3V4VB 1E7QA 1Z5UA 5L7YA 1ZIDA 5SY4A 3NGLA 1QU2A 4LE9A 4U5QA 4HBZA 3WZ2A 3O4RA 4TRMA 3M5WA 5JALA 1EXWA 3L43A 4Q82A 4UM8B 5KWEA 1TJNA 1QYDA 4CEJB 4KXWA 3JCMX 2ZCVA 2AKKA 1J0BA 4GX0A 1I1OA 2WRZA 3JYHA 4TS4A 5I7EA 5M9OA 1NUTA 3FUTA 1KHHA 5LQNA 2W2KA 5AW2A 3N0WA 3LLVA 4LOAA 3NM6B 5HE9A 1R0WA 2ZUBA 1JEJA 2AZDA 5CU7A 2X1VA 1R6BX 3H3FA 5ALDA 5B2EA 4M7AF 5KB3A 3NJRA 2IF2A 2W6PA 4DLPA 1DXQA 2ZRJA 5A62A 2JJ8A 4OHOA 3NHBA 1K5HA 4OQDA 4KG7A 4J7XA 2BTOA 1CQZA 3ZD6A 2ZI9A 2OP0A 2VHQA 4CR8A 3UOWA 2ED0A 1EDDA 2FHSA 1YL5A 2PGLA 2H5JA 1E6KA 2EKLA 4JA2A 3QFSA 1HI9A 1SIBE 4MOWA 5IH3A 4YP0A 1KEUA 4CT0A 2PZJA 2O07A 3TLXA 3TPCA 4OXNA 3GDGA 121PA 3NHRA 4IHJF 4YAWA 2DXIA 4QDUA 4R2KA 1RSZA 4FFBB 1N6AA 4PG5A 4JWKA 1FUUA 3THYA 3CVWA 4XWWA 4DB4A 1EJ0A 3SFTA 2VOEA 3AIIA 4WBNF 4Q7JB 3P9NA 1R5BA 3GJ7A 4LXTA 2L2QA 2RJCA 1VQKQ 2VP2A 1K7SN 4ZEMA 3WRVA 1M6NA 4ARAA 4MKGA 1QLJA 3OQBA 1P29A 1KJWA 1ZPDA 1JYFA 4I9NA 1P2DA 1Z9ZA 1U1FA 3O8NA 1QMGA 1I2BA 4W5NA 1DXOA 3RB8A 3G4ST 2A28A 1YCFA 2G70A 1DU4A 1JP7A 3GDOA 4B34A 3JAKB 3ZWXA 2RB6A 1XTSA 3WVEB 2DUWA 1O4WA 4GPZA 4HQFA 3W5HA 4PQEA 4X24A 5CKBA 4L6CA 3I52A 1MAUA 1UMDB 4YAGA 4B6SA 2QPLA 3AL2A 2IZ6A 4FYWB 3C6MA 4QXQA 3I6IA 2FEKA 2ZWOA 3GJXC 1VE9A 3QO3A 2HXYA 4G86A 1A71A 3SKYA 9ABPA 5CX1A 5HYVA 1C8BA 4N12A 1JG6A 1TI7A 4OF1A 2HWUA 4I6JA 5FJJA 2WBLC 4DA6A 3CYFA 4OY3A 2CMFA 2PMFA 4IIDA 3FPAA 3IQGX 3COPA 1Y82A 1IAVA 4QVDA 2PZ8A 1K76A 2Z3VA 1NF8A 3OW2S 2P3LA 4L27A 2OUIA 1FP7A 1V1JA 4L74A 5CCBA 1H9CA 5FF9A 2XMCA 3G02A 1YQQA 1GEGA 5LOVF 1AQ6A 3PDUA 4NZYA 4M9ZA 2FZVA 2AEEA 4FHFA 4KX5A 5L3ZA 3PJGA 2RI2A 3VH4A 3U7JA 3ZZ1A 4N6NA 5DX8A 1UXHA 5I7WA 4BNXA 1N36B 2M0YA 1C5KA 4NFSA 4BO7A 3WHPA 2GN6A 4M6WB 5BMVF 5JBIA 3GUHA 3M55A 3SK0A 2FPGA 5BSHA 4PAQA 2ORED 3H6ZA 4UDYX 2K4YA 2W22A 2G6FX 1L4EA 2UVPA 2ZRFA 2J3LA 1FDWA 3H18A 1LW7A 4GX2A 3LT4A 1TK9A 2PRSA 4R1OA 4V0OA 2AWNA 2AC4A 4CL2A 4EA8A 2QTMA 6AT1B 2FUCA 1JKXA 5C32A 4BCBA 5PGMA 4A8PA 1PTKA 3K94A 3EAGA 3LL7A 4KLRA 3A3KA 4LV8B 3TTUA 3HEAA 3OQJA 3REBB 3WWZA 1CW2B 3WGVA 1J4AA 1NBHA 3L7AA 1Z9BA 2V8OA 2ZSBA 1U9IA 4FNAA 4IVPA 3FYUC 1K7FB 1S2LA 4YI5A 1OUMA 4P08A 4MRNA 1M6YA 4G0ZA 4R16A 3V7NA 3FN4A 3RNLA 1LPLA 4KPUB 1A9QA 4G1BA 3Q41A 3W05A 1PWYE 8ATCB 2NYAA 2D1FA 3UMYA 4CQMB 1JPJA 3DAOA 3OFVA 1VJCA 1LU9A 1GTVA 4WZBA 4XKJA 2NXWA 4ZO8A 3KYJB 2EF0A 1G3SA 1R16A 3SXUB 2Q0SA 4KLNA 2WB4A 2WJJA 1SIUA 2ZYRA 1Q95A 3ECAA 1M7HA 5FL3A 2EATA 2B35A 2CD7A 4N3NA 2GPNA 5LXTF 3IAUA 1IHYA 1RRKA 2QZZA 4PAMA 1M2VB 3UXEA 3OLZA 1TLTA 5AXDA 3GK3A 4MZDA 4JKIA 1XMSA 2XXBA 4IF6A 4ZRDA 1QVFP 4LWZA 3Q8XB 2HGSA 1NV8A 4LQDA 3GJ3A 3M3DA 2Y6UA 5TPZA 4ZCSA 4OHXA 4IAOA 2B4QA 4IX9A 4P38A 5FTNA 1VG8A 5E1BA 1ADCA 1CUAA 3X1XA 1RKXA 4RQUA 3ZNQA 1HD3A 4HPXB 2PVDB 1S2MA 4N47A 3E19A 2Q3HA 3C3EA 4LTDA 5H9VA 1I1HA 2QXUA 4KTTE 4QLOA 1OX4A 3F47A 3GLIB 2QQGA 1TIPA 3F5SA 4E2XA 5TE9A 2WB2A 5IVHA 4BQPA 1OZAA 3F70A 3ROMA 1QCFA 3P0IA 1B16A 2GRAA 3BB4A 3TJMA 4UUAA 3AHFA 4MKFA 4M38A 4Z4QA 2GTHA 2JIZD 4Y0VA 1N9ZA 4HB4A 1IUNA 1Y7TA 4DILA 1WY5A 1BMFD 1NP7A 4W9RA 4IMRA 4KOEC 2ORYA 3OC0A 3WKEA 4QPDA 3IUSA 4OKIA 5JY1A 1DKRA 1VQOA 3HFOA 221PA 3OX4A 2JI6A 4F7UB 2G3RA 3RREA 1VKOA 3UJHA 5G3ZA 1EP9A 4OM8A 2R86A 2I1WA 4Z7JA 1KK3A 1TAHA 2AG0A 4MRSA 4FONA 4DY6A 4M7DB 5FJIA 3AHIA 1DB3A 3L2WA 1U0SY 1N9KA 4KFRA 2H5IA 4PG4A 3HU1A 4AL4A 3ZY4A 1Z0FA 1Q6YA 1SOUA 1GQYA 2Y2UA 1OIVA 4C92C 3JB9D 4Q16A 4PJOE 4EW3A 1KI1A 4N0DA 3EVTA 3BSFA 2JBWA 5FROA 5IKOA 4NOYA 5FHRA 6ADHA 2BIVA 1DOAA 3M4NA 1BHJA 4C03A 2F69A 2HREA 2XZPA 2J0SA 5H3CA 1FRQA 2YHSA 1ZKDA 5I4KA 2IUUA 1GL6A 3EVFA 2Z57A 1YKGA 3A3PA 2B8WA 3EHDA 3PT5A 3OA6A 1MR3F 3R0IA 2LX7A 4DJ5X 3I76A 4I3GA 4XUDA 3E9ZA 3T3GA 2E4AA 1G8SA 3QI2A 4AJ2A 4CLRA 2R8YA 5KJFA 3RU9A 4ALJA 3N2EA 2M6KA 5EUQB 1BD3A 2TYSB 3WQSB 4IIJF 3CZ9A 1VE5A 2JTMA 2C5EA 5GAMh 4CVNA 4AMBA 4UDXX 4DMKA 3EHQA 4KDRA 3IILA 4DM7A 5C7OO 1NLPC 1BEUB 4AKSA 4EJMA 3EPLA 4DV4B 2B5VA 4XPIB 1S1CA 2CL0X 1R9NA 4MTLA 2HBQA 5KNCD 1ZD1A 2VUUA 3LGLA 1EJ2A 3DM9B 3NX4A 2CZ0B 4DMGA 2RGUA 4WEOA 3S2UA 3BL5A 1ONSA 1N0HA 5JRZA 1JLHA 4Z7OB 5FYQA 2WA1A 4H4DA 3W1EA 1Z2CA 3AWDA 2XW6A 1ZSZA 4K46A 1YDGA 3I9FA 1T43A 4UREA 4CM5A 3HNOA 4TZKA 4B81A 4FPXA 1HLFA 1JHVA 3ZZ0A 2O2YA 2SCUB 2BZ0A 2D74A 4PNZA 2E12A 2J07A 3QYJA 1N4DA 2ZWPA 5DX0A 1OXVA 1M2KA 5IH2A 5CFLA 3P7MA 5K99A 2NSJA 1YB4A 3WFJA 2LP4Y 3TRKA 1CEQA 1E89A 1M2GA 1GTZA 3OTGA 5IJ9A 3OE4A 3TTXA 3V55A 4MLPA 2YV1A 1DKNA 4WIAA 3AB8A 3JQEA 4L28A 3SZOA 1K63A 2J0UA 4TV9A 3KKZA 1FTNA 2MSEB 4IIMA 4FFVA 2J09A 1IZ9A 3SE7A 5A0GA 1A1SA 1X69A 1THTA 2IHNA 3DEHA 4Y2TA 3NT4A 1USUA 3I37X 2R6CA 5EFZA 3U7FB 3S1SA 5CXXA 2H7CA 3I04M 3DWGA 2VEDA 4LJ6A 2FXVA 1CKBA 4MUMA 3TWOA 3PF8A 4TV8F 4TN1A 3OZXA 5B3LA 3PB3A 1E32A 4XVUA 1KDYA 1JS1X 5AW9A 2NPFA 2QQSA 2OWEA 4KJZA 2PUKB 5C6SA 1XG5A 3BDLA 2WZBA 1W70A 1RLUA 3CE9A 3W8EA 2LCIA 1FZTA 2VBCA 1G3TA 3SJ7A 5SYAA 1NWHA 4TTVA 3IR6A 4DY4A 2R5AA 4OATA 3RFCA 3CUYA 1MX3A 1ZSVA 4EY6A 1QP3A 4I66A 5G1NA 3PXUA 3TINA 2ECOA 3KBOA 4KN8A 1DAKA 1Y9EA 1G60A 4QQNA 4ZZ3A 3DYBA 3KHKA 1OLOA 1RACA 4Y7DA 4D8WA 2QE6A 1H6CA 1J5PA 4M8IA 2APJA 3UHPA 4G85A 4FOLA 2FYKA 4LY6A 4QQDA 1SBCA 3OQOA 4XQEA 3WDLA 1RHKA 7GPBA 3NANA 3WVNA 3NWEA 1KI9A 1KSHA 1KARA 5E6UA 2DWPA 3C3XA 5FUBA 1QYXA 1JSRA 3ZEHA 2FN4A 4M8SA 4OGLA 4MJXA 4E2FB 4TMVA 5HZKA 1XCOA 5FQNA 3C4JA 1QE3A 1QIEA 3EHEA 3L42A 1NX9A 5CW2A 4MKIA 5P8WA 1YR9A 3S1LA 3R7NA 2JLQA 4KLAA 2HBWA 3ORHA 5JANA 3M0RA 1ODTC 1CKEA 4E5VA 2J3QA 2WU0A 1TZCA 4AMYA 5DLEA 2FPMA 1H66A 5GAN7 5FR1A 4R5HA 5DNYB 4N7BA 3CRQA 1HO3A 5IC5A 3ZCVA 1F4LA 5DK4A 5EIFA 2E4HA 4P54A 1DBIA 4YAKA 3QX3A 5HFJA 4RQTA 4YP7A 4J9GA 3RIYA 1VDZA 4YS6A 3IEXA 3TR0A 1BVRA 1ST3A 4XIFA 4N3GA 3ESBA 1GGVA 3KJNA 2PZAA 1Q0UA 4BGEA 1X38A 2ST1A 3KYCB 4J7AA 4RJIA 3AMVA 2VUTA 1NSTA 3LWNA 2JIMA 4UM5A 2D5CA 2JGRA 1FYXA 3O8OB 3LY9A 2CE2X 1CWUA 1V45E 2WHEA 4E51A 2QV0A 3A14A 3RG8A 5CBPB 3PQ7A 4ZZ0A 1PFQA 3EPPA 1TFRA 2PNIA 2L3SA 4P34A 1PP4A 4RH0A 3M1IA 1EUYA 3QWYA 3R09A 5DRYA 4OL0A 2QIOA 3HO8A 3KEOA 1KI2A 4MR9B 5JZMA 4ER6A 5JEEA 3KU4A 4YEDA 4ZTJA 1PR5A 1N6HA 4B84A 3TOVA 1CBUA 4GEGA 5EAIA 4LNUB 3D7SB 1L4NA 3TNYA 3RSSA 2CB0A 2JH8A 3AOEC 4HEA6 1ZU4A 2B4RO 3QZ9B 1VUBA 2NSYA 9LDTA 2PAAA 3IERA 3ZTTA 3E2PA 2V45A 2WJVA 4MYDA 2D0OB 3OZSA 3L7BA 4R1QA 4LZLA 4RTSA 3ZGXA 2ZRGA 1BO6A 2XV1A 4N8EA 1I0ZA 2QK4A 4E07A 1DTWA 4LYYA 5FUQA 1LV7A 5FPYA 4PLTA 4RY2A 4CKYA 1OGJA 4ZO7A 4DBLE 2ONKA 1XD2B 1NKSA 5KVVA 5JRDS 3BJZA 2WUVA 4JDPA 3E1SA 2GN2A 4J83A 1N3IA 4L9WA 3RBAA 1GN9A 3ZHSA 4UUBA 4U0JA 2XAAA 3PEWA 4B3GA 3PZBA 4I6GA 4R01A 5IYZF 3ISVA 3EVNA 3NZEA 1SRLA 4RFSA 3L82B 5DN6D 3DT9A 1HETA 1X8LA 4URXR 1L5WA 1E20A 4CKCB 2ZAIA 5JNRA 1VYHA 4D0NA 3PXEA 4ZT4A 1T6YA 2F3TA 4IZIA 3IAM6 2BL4A 4ZDWA 2RGRA 3D3EA 2FPPB 3UJ6A 1OC2A 2VO1A 4ZGWA 1XQWA 2PU5A 4ZAYA 2FSVA 1B42A 1EIWA 1NM7A 4E6PA 3SLGA 1WBJB 1G5TA 5JY6A 4BGUA 4F2WA 4GPIB 2ZOSA 4PYIA 1GLGA 1X3LA 4PO8A 3AF3A 3PFHA 5JHGB 2XWPA 4DDHA 1R0XA 3K9LA 3K70D 5C80A 4BDTA 2BONA 1XJ5A 1RWNA 5ITVA 5J1SB 3K8QA 1X39A 5ALRA 3OPNA 3L1VA 1U9JA 2P1DA 3QGMA 3ER8A 1FSSA 2AUMA 2WF9A 5BMOA 3QPUA 2BR3A 2JJQA 3R7WB 3WSVA 1DFGA 2VYQA 3T3IA 1GAEO 3RVPA 4NOLA 4MAAA 3CPWS 1U2QA 2CXNA 5KYWB 3CPFA 4N0EA 3CUUA 1R12A 2D1QA 5E4YA 1CVLA 5DSZA 3OSVA 2CZ7B 3GLGB 1U8ZA 2QU7A 3HN2A 2RH9B 4LRQA 4B83A 1VJDA 3H9NA 2MMPA 4WACA 1EG2A 4A0RA 5G0VA 1UGSB 1G20A 2ZB4A 1KVSA 2IWHA 3GN1A 1FJXA 1TLLA 2ZVPX 3IODA 1Z4MA 4FM4B 3BB3A 2RC6A 4BVHA 3K2QA 3THWA 2ZWIA 5MGBA 4LF7B 2DXBA 2C7QA 1PQUA 5K3BA 3AP3A 3KDAA 1S2IA 2IP2A 1BN7A 1IUKA 4L7VA 4I1RA 4HNUA 1JA0A 5GONF 1Z0UA 2P69A 3CBPA 1XHLA 1SEPA 4CDGA 4WOJA 4KMSA 4G89A 4NBNA 1N6IA 1Z26A 3WKBA 3Q3GE 3L0YA 4MYRA 1QYRA 3L04A 1O75A 3GFOA 1HBJA 1QVWA 3HP1A 4QOSA 1GBRA 3LW7A 1A98A 4NV1A 4GOLD 4KKVA 1MB3A 3GPBA 5MFPA 2JFYA 1ECGA 4KE9A 1H5QA 4XX0A 3MWLA 2B21A 3BFVA 3QJ6A 2X19A 2DTDA 3LNCA 3GFBA 4ZVTA 2ZSUA 5LDGA 5SZHB 4UHHA 3CH6A 2YXLA 3I64A 4ALLA 1XTVA 2EJGA 1QP0A 5L3RA 3V9AA 2GS9A 4NABA 2I29A 3CEAA 1U5BB 1RXUA 3MT8A 1U2ZA 2PGOA 4KIGA 1AEYA 2OCLA 2CXHA 1KGDA 5HQ3A 2YCBA 2OAEA 5JJCA 1ETHA 1WCWA 3E9CA 5KYKA 2D0QB 5EJ8A 4MYUA 1CDEA 3H87A 3FB1A 4ROTA 4NECA 2AIRB 2MSCB 4BMVA 2G08A 4BRWA 1IGUA 2HT6A 2QAGC 3ANXA 3WLLA 5KX5B 3OE7D 3D31A 1Y96B 5DU2A 1EZ4A 3PD0A 4EGJA 3HABA 2WPDD 4HWKA 1S7GA 1T2UA 3PNPA 5FD8A 1E6MA 3PC4A 1B3BA 5CHYA 4DXHA 3LG2A 2XYPA 2G9UA 1MV3A 3BFMA 1QBGA 1Y1RA 1ODIA 3FGPA 4J9IA 3M0SA 1UP4A 4I81A 4OX9B 3TOSA 2KRMA 1UINA 4FKZA 3MOGA 3P9YA 4ZI2A 3NXSA 1SSHA 1SN7A 1GNTA 4I1UA 2AMFA 1HY3A 5LMCA 3SQWA 1GADO 1WTAA 2QG4A 4LISA 2VUBA 4Y6PA 1VQ6A 1I9CA 1Z9QA 2QJOA 2QAIA 3HXPA 3HMQA 1IHXA 2IYNA 1T8PA 3U3ZA 4ZV4A 1W5TA 4C8QG 2NZYA 3JAWB 4M77D 5BN3B 1SVWA 1UL1X 3NR2A 4HWPA 3F1LA 1TGYA 4J9HA 3JR3A 4CUKA 4HT8A 4H1TA 4HZIA 1CUFA 5KU7A 4Q03A 4MUJA 5LYJF 4DG9A 4M75C 4N01A 4C3ZA 5JSUA 1PGOA 4Q3OA 1ZGAA 3QUQA 4LXGA 1S4QA 1JAYA 4NCAA 1SOMA 4NK5A 1V9SA 3P1JA 3GLRA 2FE4A 1S3IA 3EOAI 3VPDA 3GCZA 4EY3A 1LBSA 5GQSA 5AI5A 2HKQB 4KXQA 3QKTA 4RLQA 4OAPA 5TSDA 3U4HA 3PTZA 1WHSB 3HADA 3L0DA 3D6AA 4Q4DA 3ENZA 1XZLA 4QGHA 4ANFA 2XBLA 4FOOA 1Y37A 3LC0A 4YVFA 2CBGA 1U7PA 1SBQA 3QBYA 4GP6A 2QW1A 4XDYA 1NVAA 3IMGA 1AV6A 3DOIA 2ZIWB 3KJGA 2GA8A 2ET6A 3LAWA 3LV8A 2Z9DA 5LKAA 2CP3A 2F1RA 4NFYA 5EKXA 3GIDA 3OMLA 2E4ZA 2PBLA 3RAPR 2C88A 2VHJA 5KNBH 1K3UB 4NEQA 2WF5A 5KINB 2CSIA 1N3BA 2YRVA 1WXHA 1WP4A 4CIWA 3LWZA 1AA6A 3O2SB 2DBRA 2ZGWA 2GN9A 3ZHVA 3H0FA 1YI1A 2FFJA 3FUXA 3D4OA 1F2UB 3S8EA 2HJWA 5C2JB 1AZWA 4HRXA 3PFWO 3W2FA 2XGGA 1NBIA 3KNZA 1X1RA 2WVAA 1KK2A 2GXQA 1MOSA 2COKA 2B83A 3LW8A 2QVXX 4C08A 1YJAA 2X3UA 5LJ5f 5DBFA 1A9XB 3EQ9A 3ESYA 4QU9A 4W5OA 3D4IA 1DMRA 4LFBB 3FAZA 2ON6A 5CT8A 5IXYA 3TEEA 2O1SA 3L6EA 1WPQA 3P94A 4L3WA 3D1JA 4A15A 3RJ5A 1HC7A 2P5SA 3CC2Q 1GD1O 2GXUA 4DSZA 1E79D 3LCMA 2P0QA 2ZZDA 1ZVJA 3AVWA 4FX5A 4XR9A 2JH9A 1TYAE 5FI5A 5EKUA 3A5ZB 3RIHA 2ASEA 4RMJA 1Q91A 2BP7B 1CR1A 5HKCA 4FNOA 5CTAA 4D99A 2F3QA 1XXHA 2A9PA 2WD9A 2FYTA 3SR4A 1IBKB 1AWXA 3E7DA 3A6PC 4L2IA 2XHCA 1I01A 2LMJA 2V7PA 2GBPA 4EIWA 3SSOA 3TSZA 3PHJA 1D07A 1Z63A 4A0SA 3E61A 3KQLA 1XTUA 3MKDA 2CNWD 2DTEA 1J8YF 2C0CA 2YBDA 1RXVA 5BVHB 2Z95A 3JRXA 2XVZA 2Q1TA 1RLQC 4WNAB 2OGZA 3G4SQ 3D8TA 4WV3A 2CDCA 5KJ6A 5C51B 5LZ2A 4MB2A 1E2JA 4RKQA 3MEQA 5CAIA 2JLUA 4LDXA 4FYMA 1E2HA 4FI3F 4D02A 1JDBB 4CLDA 3BW1A 2OOSA 2DETA 5JD3A 3TUZC 1T0BA 1XAGA 5KH6A 2OBFA 2Y0BA 2D2VA 2XCUA 1OLXA 3JVVA 2KB0A 2E3HA 3AZOA 1BU5A 4ZEXA 1PVVA 1CRPA 2KMLA 5KE2A 2UZAA 2ZSFA 4RGYA 3WL5A 3A9SA 2ZPTX 1PBNA 3DV0B 3SMQA 4DCCA 4WESA 3OB9A 4UU7A 3ECCA 2X6QA 5IJ0B 4NHEA 1U1IA 4C3OB 3FA2A 2P5UA 2WWGA 1QV6A 1WLPB 3TAXA 1QF7A 1YJ9A 1MH9A 2A5JA 1R3DA 4LEIA 1BE6A 3ZHTA 1P62B 3HR7A 5HTKA 4BCDA 4BDYA 4HI0E 5A9SA 3K6SA 3HY3A 3PJDA 1QYVA 3L1KA 3BDAA 3FX2A 1UPBA 3O74A 1WZEA 2JI8A 1T0UA 1FOEB 4WK0B 2C3OA 3TN7A 3GGGA 2COUA 2WJ3A 3ELDA 4IYJA 2HQ1A 1GG5A 2GAOA 4Y67A 4F9GA 2J9YB 2YN4A 2YY6A 2QA4A 2G28A 4J1QA 4MWCA 2WWVD 2Q7DA 5AKKA 1RLMA 2NUTB 1SBZA 2EHJA 1RLPC 1ZUKA 2H0QA 1PJBA 3TQCA 4DC0A 2FZEA 3CBMA 2CLMB 3NS7A 2P41A 4J0QA 3ETLA 3LX8A 1IIRA 2VP6A 1OMOA 4CV2A 3K8ZA 1M30A 1LPNA 4QSMA 1Z5VA 2WJZB 2I3DA 3PUVA 5CH5A 2Z58A 2E0IA 4GM0A 1X7GA 3MNFA 4EA9A 3FFBA 1NW8A 3KOZA 3QXGA 1H2WA 4P5DA 5JTTA 1AWOA 3OMWA 4EG6A 5KNDD 2O50A 5FWYB 1EM6A 3EEIA 4R68A 3KZCA 2CUNA 1W2HA 3J81E 1A9ZA 4J29A 5DLYA 1KP2A 1QIKA 2OB1A 4ND6A 2LIVA 2OZEA 2WSYB 3LP5A 2KT1A 5CB8A 4KHZA 2XB6A 5C8DA 4LJ5A 3RIMA 4AFZC 4HAWA 2PS9A 4CMIA 3KPWA 4XW2A 4TLDA 2IS4A 1ABEA 1EBFA 3Q5GA 4L8LA 4YT8A 1NEGA 1EFHA 3TQQA 3V7FA 3GLFE 2GZ1A 5C1OA 5BQOA 3HC7A 5CYGA 3ABOB 4E30A 1I4OA 2DH5A 5L7WA 5H8WA 4J0DA 2D7JA 2ADMA 4PLGA 1TZMA 2GAFA 5FPQA 4BVFA 2JAWA 2Z0WA 2VZ9A 3QLJA 2VDWB 2Z0MA 4GD3Q 4H3HB 3JATA 1O0CA 1LJ8A 3ICEA 1WXEA 3L6BA 1K8ZB 1MC4A 1YZ3A 3LNTA 3H9BA 1GAQA 4FDVA 3GLIE 1ECPA 4ZDKA 1GPAA 3T54A 1KZ9A 1GWNA 4V0ME 5KWSA 4KGZB 1PWZA 2NN3C 1KBQA 2BH2A 4XWOA 1IUPA 5E95A 1W93A 3CCRA 4W4TA 2FF7A 3V7CA 1G3YA 2WAAA 1E0AA 1U7XA 3B6IA 5C8YA 2Y1CA 3PUZA 3QSYA 2XIJA 4O5AA 2JIRA 3OQHA 2UXCB 1SQSA 2ZI3A 3PNYA 4M9XA 4F7UE 3HBFA 3V8JA 2OXIA 4GXNA 4I4NA 2ZJ6A 2RHIA 4ZOLB 2UYHA 1NPDA 4KQ2A 3S6WA 4OSOA 4JI8B 3P9IA 2BZ8A 3RS5A 3N8IA 1E2GA 1JU9A 4BNWA 5HKAA 2W37A 4M7DE 3H0IA 2VSYA 1CFZA 2Q4OA 4DSOA 1SUFA 2ZRBA 1SFRA 4OG2A 1K5PA 2W2MA 1WZCA 4Y2VA 4BLSA 1QM5A 3QK7A 5HGXA 1LI7A 5JH7F 3QVGA 1I13A 3WK7A 4NRDA 3ONNA 5I8WA 2JIQA 2G4LA 3EH2A 2X4IA 3LHKA 2EX0A 3I6BA 2CF5A 2UXBB 2R5NA 3RUEA 2Y1OA 3LTEA 4HMQA 4G0OA 2M2IA 2JASA 4HD8A 5BURA 3KWJA 5ECDA 2N75A 4YALA 4HLNA 4JJ8A 4RM3A 1ZW1A 2GEFA 1XTKA 3FHTA 1N8NA 5JAIA 1PL6A 5HEKA 4JNKA 2W4IA 1AK1A 2XMGA 3PRYA 4JJ4A 5J3BA 1PJLA 2Q21A 3C8MA 3RD5A 2YQ4A 1RZRA 1K8AR 1XTBA 3WOVA 3BF8A 1P2BA 4R6WA 1PEYA 1US8A 4Q37A 3AT1A 4L9SA 2IV3A 3U49A 4AJ1A 4OHKA 4E5UA 2C0IA 1U80A 3WGMA 1JG7A 3WTCA 2GBGA 1XQYA 3SYRA 3CPSA 3VRHA 5FFMA 1K8AC 5DWQA 3CLRD 4FYVA 4GGPA 4ZHQA 3TKYA 1T36A 4J3FA 4UBKA 4IMIB 1P0FA 4CG2A 2C0OA 2IHJA 4N6OA 1YRLA 1RJGA 1E4YA 2C1XA 3D3NA 3N2GA 2G04A 3ONVA 5ELLA 5E2BA 4RMGA 3TG2A 3E3NA 4M0KA 3WHLA 3W9UA 1QH0A 2XUJA 2X23A 2A3RA 2QJFA 3PGXA 3QLUC 4RWEA 5LJ3g 4N7RA 4ETMA 4PZLA 2WMOB 4L5CA 1XGKA 2YN2A 4OQNA 5CCXA 3RQIA 1O5IA 2FPSA 2BBWA 4I4CA 4V1CB 4K3VA 2XUZA 3B38A 4IP0A 3GY0A 4ZTBA 4EYSA 1O54A 4D9KA 3SIRA 3G5TA 2ZRKA 4KPGA 3U19A 3DM5A 1RTKA 2NXJA 4RVNA 1WW3A 1P6QA 1UANA 3ROXA 4AKHA 4LYAA 1Z3CA 1P4AA 4IUDS 4JJNK 1XEFA 3QWBA 3KPVA 4EUHA 3GAZA 4N9WA 4ZU1X 4JUDX 2GBCA 1L5KA 421PA 3CCET 1RPAA 2CT8A 2IUTA 3P4YA 5ADVA 1FQOA 5IFLA 3JQFC 5DYYA 3K16A 3WDSA 1A5TA 4WXPA 3U4CA 3RM3A 1L7MA 2HV8A 2NZ8A 5J2UB 4ESVA 2PAFA 3BXZA 2IBSA 4IV8A 1PRMC 2RAUA 4KFSA 2WSMA 1E59A 4AWXA 2YX1A 1XU9A 2RCYA 4M7AD 5JNVA 2PV7A 2CYAA 2WM9B 2V6IA 1UOQA 1MJFA 4GPTA 5AUNB 4Y2RA 3T4XA 3TI9A 4C89A 4BBZA 2QLMA 4HH0A 4LRWA 4RA6B 3BN3A 2NU9B 3JCMb 1CEXA 3KSZO 4QOJA 4IJUA 1G3QA 2F2TA 4L6IA 2OCPA 5JATA 2C78A 3R3SA 2HCKA 5DMXA 3N8HA 2H3HA 3W3AD 2K3BA 4X3OA 4M9SA 5UKDA 3VXKA 5DP1A 1OY1A 3INZA 2REQB 2HCFA 3K7EA 2FOLA 3L06A 5B7PA 2O19A 2W8ZA 3E5RA 3VJKA 2JXBA 4Q9NA 1I7LA 1F20A 3DVAA 3TE6A 3OOEA 2YIVX 2E7ZA 4EKNB 3OJXA 2Q62A 1OR8A 4MW9A 3HJCA 3AESB 4NE2A 5K0GA 3HK2A 3QPAA 2K3YA 1SRQA 1Y7LA 4B2YA 2DZCA 5LP6A 1Y4AE 4B80A 1HM5A 1RL2A 1W581 4DPLA 2CMDA 1CX9B 1CUBA 2RARA 3FNEA 4XCVA 2ZTVA 5ALYA 4TXJA 2D2XA 1H93A 2ZE7A 3KE9A 1HDGO 1VQLA 2BAGA 2PKYX 5AW4A 5M04A 2R4QA 3QXJA 5BUCA 1I8TA 2ZXFA 4A10A 3KALA 1G21B 1OJLA 1D4AA 3ZBQA 2WKQA 3NTVA 2ATEA 1YCSB 2F3UA 2VT2A 1SZDA 5B2ZA 4MJ7A 2AN1A 4DJFC 2C06A 1RE1A 3I5UA 2CT4A 5I5EA 1W94A 1E7YA 4I55A 5K51A 3WAKA 4QEDA 2PS1A 1NNI1 4E5YA 1X1CA 3DUWA 1JIIA 1IB8A 4C0XA 2WQ6A 4OHBA 4Q4AB 3OU2A 1JR2A 4EGQA 4Q9HA 2OBYA 3OQ5A 2WD7B 4ESRA 4PINA 3CB2A 4IUCS 2GVNA 5JJLA 4F5ZA 5AJVB 5JU6A 5TGTA 2YXPX 2J7PD 4JL8A 1JWAB 2WKWA 4TMWA 1QW1A 3RYCB 2W7TA 1TA4A 4U6QA 2V7BA 2R8RA 2F4NA 5F23A 3WICA 3A32A 3WJ1A 1YVRA 1GPH1 4W5TA 3I1FA 4LRUA 3BQNB 1BWQA 3TZBA 3L8DA 2IGTA 4NMLA 1AS2A 2WWHA 4FE3A 3HKSA 2A0FA 3GJ5A 2EVRA 3L5OA 3RS8A 3AR8A 5AVYA 2WMNB 2YRWA 2B3TA 1SF9A 3G9UA 4IBOA 5FTMA 1WU8A 2PH3A 1KERA 1NZJA 2J0VA 4EPCA 4B76A 2EYUA 2J59A 1FXUA 5D51S 4FR5A 3GT4A 1CRWG 2WTBA 5J58A 1JSXA 1X8KA 2BLLA 5IHXA 4NEHB 4ZMRA 4Z1MD 2I4TA 4ASUD 3UAVA 2NO5A 3S7TA 4E7JA 2JK0A 2GN0A 2XWSA 1LSJA 3TB4A 4NG5A 4XOUA 2OSVA 1CUHA 4W63A 2DKOA 4A36A 2AFHB 4A2WA 1YKFA 2CFSA 3QEMB 3UA6A 1KNXA 1DAGA 4P92A 5JW6A 3ZY2A 5ALSA 3UFXA 3S55A 2YHTA 5FIUA 1X7YA 1HORA 2HF2A 3W5BA 4CTJA 3LHDA 2QUKA 1NXVA 3TBHA 2QUIA 2J4CA 2MIIA 4HC4A 3DB1A 1TZKA 1UMCB 1JFVA 4OXKA 3UV6A 3I55A 1F2TB 1A50B 3X1MA 1TVEA 4LI0A 3ZKAA 2ZT7A 1GA1A 2XKKA 3ZWOA 2H1OA 1KEVA 2HWWA 1AZGB 3NHKA 1ZZGA 4BAUA 1MUZA 3AF4A 3EIFA 4P58A 1BI1A 2XOEA 4U9IS 2Q3FA 4X7BA 3BGWA 1QP8A 1RMTA 3NIDB 1QJ4A 3AVPA 4YXWA 1QHHA 3ITDA 4D74A 2BFBA 2WINI 3N2YA 1WRBA 3S29A 1E9RA 2M6RA 5BSVA 1PE0A 3C3AA 2VHVA 3AHJA 1SC6A 1S8OA 4BO8A 4XFDA 3RFUA 2IKQA 2OGWA 2ISQA 4AZ0A 5AOAA 1VGVA 2H2AA 3DB4A 1CUYA 3ICQB 3T1OA 2XB2A 1T0PA 3F4KA 4LGVA 3ADCA 2DMOA 4DA0A 4FGZA 1K4YA 2WW8A 1ZK0A 5KO2A 4RY0A 1ESCA 3UIEA 5CDTA 2GXAA 2OXRA 3H0EA 3E7XA 4Q1FA 1VGRA 3AVUA 5DB4A 3EWNA 1KMQA 2ZUCA 4DCJA 2ZIAA 2PWAA 5HK9A 3VZDA 4P7JA 1NBMA 4R56A 2CJXA 3S8MA 1N1MA 4PZCA 3H05A 1M10A 4BJHB 1E94E 3IALA 4WOKA 3LUCA 1AWJA 4DUGA 5BWMA 3RYFA 1WO8A 3QWIA 4UEKA 5BV8A 3LD9A 1XQ6A 2IVZA 2V7WA 3D8UA 2YWCA 3AVTA 4EUKA 1G4HA 1GUDA 5IXJA 5H1YA 4PPGA 3PCRB 2EKPA 2R2GA 1SUPA 2VNAA 1HMPA 2H48A 1K5DA 1EDZA 3ZE1B 3MWDA 3NIBA 3GLGE 1Y8RA 2GJ9A 3M70A 3MTDA 2F2VA 2I4LA 3RANA 1FFDA 3VH1A 3H65A 1EFAA 5LKRA 3T3DA 3L8GA 1E2IA 1KVRA 1ZRHA 1BS9A 4O29A 2XCQA 1T4GA 3AJRA 3PE3A 1F4VA 1WPXA 2ES4A 2ZBGA 1M1UA 7MDHA 4MGZR 3OOYA 3T5BA 3CRMA 1RPTA 1XZNA 1WFWA 3NRBA 3L9WA 3FGZA 4ER5A 1NC3A 4NS1A 1RADA 2XUOA 1DXYA 3H11B 3SJBA 4YT5A 1O89A 3AHGA 4MVJA 2QGNA 3N0RA 4V3CA 3R7BA 2B1QA 5DISB 4UFOA 1BU8A 3AF6A 3H17A 2HK9A 2AZSA 2ZETA 1UZNA 3MFQA 5BY2A 4RANA 2FN7A 4JLNA 1REQB 2VTEA 3GNQA 1ISJA 2EU8A 2GB4A 3H1GA 3EVBA 1RHJA 2WIAA 2FRDC 1JTVA 5I9IA 4LMAA 1FXXA 4HTFB 5D1NA 1FS6A 3I6YA 5ICCA 2KEAA 3AYZB 4EP1A 2IELA 3NAQA 4LZJA 5DYNA 4LN1A 5BOSB 1U5CA 4FLFA 1C14A 2FKNA 5INTA 5E0KB 4YRRA 2K6DA 1UGPB 4FYIA 4DVJA 1MB9A 4KI7A 3B1JA 1Z5ZA 3LC2O 3EXEA 3UAGA 3EFRA 3F3KA 2Q2WA 3K30A 4A0FA 4CT4B 3SKXA 2ZWAA 3RYHA 3H6KA 2AEFA 2Y0EA 4JN6B 2RH8A 3H5WA 1Z08A 3NKFA 1X77A 2HHCA 1XTQA 1QP2A 1UWVA 4JCCA 3WQHA 1DBRA 3VAZA 4HDAA 4GZ6A 3OOHA 3QUBA 5IEBA 3WWEA 5BORA 3W5JA 4MCIA 3ODPA 2IIQA 3F97A 3T6KA 1PW7A 2KSSA 1ND6A 5IKMA 4XJVA 1K8YB 1C1HA 3PS9A 1F3OA 3OECA 1NBAA 2B1GA 3KLNA 3RTBA 4HDRA 2Q8NA 2YICA 2FEOA 3HYRA 3NT2A 4A91A 3UGKA 1VQ9T 2KVQG 1XDZA 3ETGA 3PUWA 1N1EA 5FORA 3S40A 3QF7A 5KWJA 3QXCA 4GC9A 4HCKA 4QE3A 5CKEA 3U0VA 4ZVLA 2ZU0C 4L3VA 1F9AA 1RYHA 1MO4A 3RS3A 1JQEA 2GSDA 5AVQA 1L3IA 4RA9B 1OF1A 4RCBA 4F3NA 2CDRA 5ITWA 1JLLB 1QFSA 1XKXA 1I3KA 1DTEA 2B34A 5FR2A 2AX3A 4FVTA 1E1MA 4P5PA 3RRXA 4IJKA 3G9QA 3VYUB 3ODGA 1TF2A 1PZFA 2H1CA 4AKGA 4OD0A 3AJAA 4YMSA 2B7CA 1ZX6A 4OGGA 1GAJA 1KYIA 1T0JB 3UJNA 4ND8B 4EHFA 4X7MA 1TVCA 2JLRA 1FYEA 1MNEA 3HKEA 2OM2A 1H2YA 3U61B 4II3A 4OUKX 2XJ9A 5F3DA 2AZ4A 5JUWA 3PVCA 4OMUA 3ZS9A 3HVIA 4B2LA 1TD1A 4FW9A 1WS6A 1R6DA 4E7HA 4QUBA 4TLAA 3UAWA 4E32A 1BG6A 1QV9A 4UTRA 2B2XA 1WJRA 4DLAA 4JJ7A 2B25A 3UJDA 4ZXPA 2XUPA 1YIJA 3PQ6A 3VJPA 2A5LA 2HQRA 4B0PA 1ZMTA 1IM2A 5IT0A 1YK0A 1BCSA 2FR1A 1NIJA 1DGQA 2O2XA 4FOSA 3VNUA 5CDHA 1VLVA 1Q1NA 1I7SB 1LQTA 2VSNA 3I0NA 1KY5A 4B7UA 3EXHC 1U1CA 3N39C 1SXJD 4ENQA 4CMEA 1H5NA 1UIMA 2GUGA 1MQ9A 2W93A 5FLEX 3H4MA 4PC2A 4DVGA 3FYUA 4GBED 5J4LA 3FPCA 1TXGA 1XFDA 2X77A 4CC4B 2QRUA 4F60A 2O4XB 2QLBA 3UN1A 3FOFC 2OCXA 4UHKA 3MILA 3K0FB 3H5OA 2IEZA 3R24A 3DOOA 3LF2A 2HEIA 4ZKDA 3ZJVA 4DSUA 3KRTA 4MXDA 3MWJA 2LCFA 1BMTA 1VQ4A 3VS3A 1XA0A 3LCVB 1EHYA 1M4ZA 3W6OA 1IVSA 5DM2A 3HDTA 3GT3A 1TS9A 4H4CA 1PDOA 4X9XA 5CTJA 3S1AA 4R9RA 1XJ0A 1E3IA 1YH3A 3X24B 1T2NA 2JFZA 3E0QA 4D3FA 1JIJA 2CNOA 1CY7A 1A1VA 1FTWA 1B6TA 3SZUA 4JMLA 1P3Y1 2V1RA 5F1PA 1SQ5A 4I1PA 1YS9A 1VQ7A 2OCIA 2Y1FA 4B6JA 3NCTA 2PUEA 3MAGA 1W5SA 4WXRA 2LWIA 2H16A 4BS9A 2UVDA 2QE7D 3DTVB 3M81A 3AF5A 4B8WA 2P30A 5EIAA 2GH1A 4G9EA 5DCWA 4LOHA 5JPIA 2JFPA 3PC6A 1V48A 4BECA 1ZUYA 3TSWA 3IDQA 3P97A 3P2OA 3U40A 1Z6TA 5L51A 4W9NC 1KR5A 1UK7A 3M4XA 3VZBA 1QK3A 3QOXA 1WKVA 5AJXA 3K0EA 2V0CA 4AQYB 3I9KA 2WJAA 5EJ7A 5JYBA 3UH1A 3OPYB 1FB5A 1ZIOA 3BXOA 4DARA 3QJGA 3N86A 1BCMA 2FGKA 5HCKA 1NJ6A 5JSZB 1YITT 2WG2A 2IITA 2LPMA 3HKCB 3C8HA 3MMXA 4RQAA 2DHQA 1K6JA 1YZQA 2JFHA 4WZZA 4HX9A 4REQB 1D9XA 3HCEA 3ZHBA 5AT1B 4QWWA 1YDHA 2CJWB 3RDPA 1FS4A 4CQLA 4N3BA 3VO2A 1R18A 5DCUA 1OWOA 2X0NA 1E3QA 1YO6A 5FU6C 1WPYA 2K79A 1VIEA 3CISA 2P0YA 3U2QA 1I2DA 4C6HA 5J4YA 2FU5C 3NMUF 5I21A 4B73A 1YASA 4C8QB 5K8IA 4YRAA 4PKCC 3FWKA 2RCNA 4R6XA 1XL0A 1K6EA 1E3LA 1T5LA 1RAFA 4GBGA 4C92A 2HHLA 1E58A 2C20A 5KVAA 3FG9A 3BIOA 3INTA 3ICWA 2D1TA 2VT7A 3B8HA 2KW5A 4F9EA 2ZRLA 1VQ8A 4F7WA 1QAQA 3WNZA 2MINB 5BXYA 3ILVA 1GLNA 5GAOq 1ZG3A 4I5IA 5K3FB 3TSYA 3KYBA 2YASA 5B7QA 2G80A 1WMDA 1U8RA 2KLHA 3ZDYB 4O4IF 1Y8AA 3OIVA 2J31A 3IGFA 2FV8A 3B6JA 4BPBA