3VYGA

Crystal structure of thiocyanate hydrolase mutant r136w
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
KPVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thiocyanate hydrolase subunit alpha
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Thiobacillus thioparus
total genus 26
structure length 120
sequence length 120
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vygA00
1AHJB 3X20B 4ZGDB 2D0QB 3QZ5B 5L8RE 2WSCE 3A8HB 3WVDB 1QP3A 3A8MB 3QYGB 3X24B 2ZCFB 2ZZDA 4OB1B 1IREB 1QP2A 2PVGB 2DD5A 2O01E 1UGQB 2WSFE 3X26B 3QXEB 2CZ1B 3VYHB 4ZGEB 1V29B 2ZPBB 4FM4B 1GXIE 3WVEB 1JB0E 2AHJB 3VYGA 4XK8E 4Y28E 3X25B 2CZ7B 4OB0B 2PUOB 4L6V5 4OB2B 3LW5E 3QZ9B 2ZPHB 2ZPEB 1PSFA 3A8LB 4OB3B 1UGRB 2DPPB 3A8GB 2ZPIB 2CYZB 2DXCA 4ZGJB 1DJ7B 1UGPB 3A8OB 4KT0E 1PSEA 2DXBA 2QDYB 2WSEE 2DD4A 2CZ6B 1UGSB 4RKUE 2PU9B 2ZPFB 3QYHB 2PVDB 3HHTB 2PUKB 2PVOB 2CZ0B 2ZPGB 3X28B
chains in the Genus database with same CATH superfamily
1TS9A 4XTXA 4KH1B 3VU3C 4F14A 1K0XA 4GY5A 2JM8A 2PTKA 3HFNA 4A4HA 2YSQA 3G6ET 2COWA 2RHXA 3JCMc 3REBB 1QVFA 1MMNA 1X75C 1VQLA 3ER0A 1I8FA 4L5GA 4ORZA 1IXDA 1BI1A 3CPFA 2HBWA 1T0JA 1RL2A 3C95A 3QSUA 1SRLA 2DIQA 4KUDK 4JJBA 4EMGA 3MHXA 5EG2A 3TQ7P 4ZTJA 1V76A 4BY6C 3X26B 1UG1A 3BFMA 3E2UA 1VYUA 4JS4A 1E6HA 5C6SA 1YJWT 2VB6A 2RJDA 1U06A 4L59A 1QCFA 1KQ2A 1YCYA 3L2RA 4XK8E 5GAMg 5GANe 3EGXA 1VQNT 3M56A 4BE1A 2KSSA 1QVFS 3HP9A 2EKHA 1XQHA 1KQSP 3QKJA 4DBQA 4C5IA 2DILA 5GMKi 3G6EA 2L3RA 2L2PA 1T3SA 4QT7A 1VQPT 3NHNA 4A4KA 2QQAA 2QA4Q 1YHQQ 1I07A 1ZQ1A 4X34A 5KYUA 3INZA 3TSWA 4C8QC 1RI9A 1W6XA 4FT4A 1QMCA 1I81A 4IIOA 2HL3A 2ATCB 2P0QA 3JCMQ 4M7DG 4II1A 3GNFB 2EYZA 2OI3A 2AKKA 3CCQQ 3SHWA 1WX6A 1NPRA 2ZAEA 4J83A 1S72Q 2LCSA 1K0SA 3X28B 2CT3A 4C0ZA 1WFWA 5D6XA 1WZOA 4E7LA 1Q95G 1X6OA 4XU2A 2EYXA 1M3BA 4RCBA 4KH0B 1HSQA 5GAOm 2E65A 2M02A 1VQNA 4EPCA 2RF0A 3ME9A 2QK0A 8AT1B 1UUEA 2XMFA 2ROTA 3EAEA 4ZNXA 5FWCA 3GOXA 3CCMT 2DL5A 4XTUA 4C92G 4BE0A 1KFZA 2DD5A 1NM7A 4M7DE 1N5ZA 2NWMA 2CUDA 2RJEA 2E10A 1Q82C 4N0AC 3L42A 2K57A 2NLUA 2DTIA 1GCQA 2LVMA 3PVQA 4DBRA 2DKGA 3TEEA 4KULA 3S6WA 4C8QG 2KXDA 3VUZA 5LJ3d 1KQSA 1XNIA 3G7ZA 2HAXA 2JZ2A 4M78B 4ME7A 1VQMT 4IUVA 1IZ6A 1IGUA 3EG3A 1OZ3A 4C5EA 1FMKA 5LJ3e 4ZN1A 2LRQA 1WJRA 3BY7A 1YI2Q 4Z89A 2HSEB 3CCEA 3QO3A 1ABOA 3SB2A 4XAXB 1UJYA 2EQIA 4QQDA 2DTOA 3NGPA 2X3XD 3RDVA 1ZUKA 2HKQB 2K79A 1K73C 2OTLA 4IKFA 2K5FA 2ZPFB 2KI7A 4PJOB 2GTJA 1UDLA 3CCVQ 1KQSS 2DXTA 1PD1A 1KD1U 1RABB 2CH4W 3C0CA 3RMQA 3RR6A 2H8HA 3C12A 4RG8A 3G71Q 2YUOA 3LLRA 3QWXX 5L8RE 5M9OA 2AKLA 4JLIA 2V1RA 1X69A 2FPFA 4QQ6A 2P0PA 2RQUA 5CR2A 2EQKA 2LNVA 4N4IA 3OW2P 6AT1B 2YDLA 4M78E 4OVAA 5GANh 1I0CA 1VUBA 2FVUA 3UATA 2DEQA 3OSVA 2DVJA 2WACA 3X24B 1IGQA 3U23A 2J06A 3FJPA 1N8RR 2CGHA 2I0NA 1VQLQ 3EHQA 1IREB 3EG1A 1D3BA 2ROLA 2EKOA 3NTKA 3BDUA 2EFIA 5I11A 3QXEB 4PLIA 2KNBB 3MCAB 1ZHIA 1LCKA 1EIFA 1N9RA 2LJ3A 2K3YA 3RERA 4J9FA 1SG5A 1W2BP 4PJOE 2KT8A 1VQ5A 4M77B 1Q82R 4XU0A 2F5TX 3CMAQ 4LDWA 2GF7A 1MMDA 2CZ7B 4RTVA 4CC4B 3A1PA 3ZL7C 1GFCA 3EH2A 2FRYA 2CDTA 1IHWA 2RK2A 2JN0A 2Y4XA 3A8LB 5LJ5d 3J81E 4OP0A 3SWNB 2K5IA 5C0MA 3JCMX 4QVCA 1R0CB 1BI0A 2QDYB 3J80E 2JOYA 1VQ7Q 4FW2A 4RTZA 4PFPA 5EC7A 4AT1B 2Y4YA 1UHFA 2E4HA 1NEGA 2F69A 2MAMA 3H0HA 2EJGA 2A0FB 2PVDB 1M8VA 3RKXA 4WCIA 1WHMA 2DYIA 1AT1B 4IUQA 1N8RU 1R77A 3M58A 3OW2A 4M7DA 1K73R 1R8OB 1X43A 3OBWA 4MMKA 3TVTA 1U3OA 3VS1A 2O4XA 2XDPA 2QGFB 4M7DF 3O8VA 4M7AD 2XI9A 2KYBA 3OYDA 3LWIA 3CPWP 5FRMA 2G6FX 3CXCP 2ZZDA 1NLOC 4JUVA 1K9AA 5FU7B 4FU6A 5I21A 1VQ8Q 2E3IA 5I22A 2QA4T 4AMCA 5GMKe 1YHQT 1QCOA 3VV0A 1ZUUA 2MK5A 1OX8A 3M54A 1BB9A 4J9EA 4C92A 4XQ3A 3OW2S 4DBFA 3NMZC 4E7IA 4FM4B 4IIMA 3CCQT 3G4ST 2DJZA 2OJ2A 1S72T 1NBEB 2DFUA 3D7SB 4J9HA 3VRZA 3NPFA 1M2VA 5KE3A 2JMAA 2L8DA 1WGSA 1VYVA 3EG9A 2FZGB 4C8QA 2JMCA 4DEXA 1YFNA 2J7IA 1K73U 2QEXQ 2VXFA 2EQUA 3LGLA 3UWNA 2SEMA 3T9NA 1PKTA 3M59A 1VQ4Q 2RI3A 3M4YA 2DXBA 4QW2A 4PLLA 2M0OA 3OYBA 3CCEQ 3A5ZB 2VVKA 5DLOA 3M0PA 2RMOA 3L2WA 1GCQC 2LCLA 2QA4A 1YHQA 2CZ0B 2DK3A 2YT6A 1UFFA 5HY6A 4M78F 1I4K1 2DMOA 2OTLQ 1PM3A 2M9UA 3DB4A 1HK9A 3CCQA 3G4SA 2XD0A 3CPWA 2DLPA 4FCYA 2NUPA 2AZSA 2E64A 2VXEA 3EFRA 1WQWA 2JXBA 3CXCA 4P5NA 4RTYA 4C0FA 2JTEA 2EIFA 2LJ1A 4JRKA 1IHVA 3MPUB 3L2VA 1MNDA 3JCMf 4M75B 9ATCB 2RB6A 1T3LA 2CP2A 4OGCA 1JBMA 2MOXA 4PJOF 1YI2T 4D8KA 2C0OA 2QQSA 1RAEB 2JS0A 5CCAA 4EMKB 3CCUA 2HSPA 2R5MA 5GAN6 1VA7A 2FL7A 3RKYA 3MP6A 1UECA 4CC2A 2DRKA 5GAMj 3UT1A 3CCVT 3WVEB 3CPWS 2HMAA 3JB9J 4RG2A 2CP6A 4MMLA 4DBHA 1VQ6Q 3CXCS 2RJCA 2HL5C 2E5KA 2MMPA 1TUGB 2RQVA 3QDRB 1ZSZA 1BIAA 3G71T 1VQ5Q 2KQWA 4B9XA 4MZTA 1PNJA 2FEIA 3M5AA 3ULRB 2X4WA 1AOJA 3N5BB 2J05A 4JLGA 4LXCA 4M75E 1FMWA 2E1HA 1D0XA 4Z88A 3OYIA 2NUZA 4GBQA 3AHUA 4PFZA 2E12A 4Y92A 3R6OA 1G2BA 1QCNA 1VQLT 3OYGA 1YI2A 5KYXA 3I9QA 4FIBA 3E9FA 3HHTB 1WPYA 4MDWA 5GMKh 5KE2A 4TVRA 2DJQA 2F2XA 2D0QB 2GQIA 1QQJA 5ECAA 4BI4A 3CMAT 3WVDB 1OOTA 1NE8A 1OULA 5KCOA 4M7AE 3OYKA 2AZVA 1RAGB 5HK3A 3H0FA 5D6WA 1MMAA 1YP5A 2H3JA 4HA8A 2J6FA 1KSWA 5CKHA 3G1JA 2C0IA 3V7SA 3OYFA 2CP7A 1SSFA 1OV3A 3OBYA 1QVGP 3HL8A 1YITQ 4N4HA 2WSFE 3REAB 2DM1A 1RADB 1KD1C 3JB9F 1VQ7T 2DRMA 2FRWA 1U1SA 2YXYA 4M7DC 4M78D 2COZA 4KGZB 4AFSC 4BI3A 2DL7A 3EGUA 1JB0E 2A28A 2LT1A 5GAN2 1BK2A 1D3BB 2F5KA 2CKKA 1JRIA 2M51A 2P4TA 5GAOr 1YCSB 3GLXA 2FPEA 2ZPHB 1B34A 3ASKA 2ZPEB 3CMAA 1AWJA 1U1TA 4PNOA 1S1NA 1UGRB 4B9WA 2DPPB 5GAN5 2VV5A 2ZPIB 4OMMA 5KYWB 2M1HA 3JCMg 4PJOD 2EBPA 3GBQA 1JEGA 4J5YA 1RAFB 1TSFA 4CC3A 4JJNK 3LWHA 3FC3A 4FSXA 4YTLA 2LX9A 2D1XA 4C92C 4A4GA 2QAZA 3CBMA 3DKMA 1VQ8T 2KVQG 2BUDA 2RNAA 1FYNA 2KT1A 4AFUC 1XTDA 1VQ7A 1CKAA 4QKUA 2LDMA 2DO3A 1WXTA 2A36A 4O6JA 3QJ6A 2RH2A 2CH4A 1BIBA 3EGDA 4NL2A 2JT4A 2LZ6B 4OMNA 2RQRA 2DA9A 3I35A 3GPLA 4DOWA 3I5RA 2EQJA 1Y96B 1H3ZA 3R6NA 3G4SQ 4AG1C 2BZXA 2YWWA 4CRIA 3VKIA 3FEOA 3DLMA 4AFZC 2L3PA 2X4XA 2JM9A 2XG8D 3S3MA 3VJPA 2QEXT 4M78C 2XU8A 1QP2A 2PVGB 2BZYA 3M0SA 2KRMA 1KIKA 4ELZC 1QKWA 4J9GA 2HZYA 1VQ4T 3CBOA 1ZA2B 4M77D 2XK0A 3META 1RACB 1YJ9A 1N8RC 5KYNA 4BY6B 5KYYA 3CCET 2JUFA 5GANf 1YBYA 1B7TA 5L23A 1VQ8A 4PJJA 3CCUQ 2R58A 1KD1R 1U8RA 1RLQC 3QG1A 4VUBA 4HCZA 4LDXA 2P84A 2OTLT 5J26A 4X9CA 2K3XA 2RHUA 4M75F 4OB2B 2DL8A 1ARKA 2A37A 4J6WA 1Y57A 2DVEA 1WHLA 1QKXA 2K2VA 2QTXA 3WXMB 1PSFA 2E70A 1Q7YU 5GANj 1OYXA 3EFSA 1EFNA 3M55A 2QQBA 2HD0A 1YJNA 3H0IA 2A08A 5FROA 2VWFA 2RA2A 4XTZA 3CCRQ 2YUQA 2VYTA 2KMTA 1QLYA 1LPLA 1FX7A 2QDLA 4M7AA 2F2WA 3J7AF 4IUTA 3EG9B 4C8QB 4PJMA 2QEXA 3RNJA 1UGSB 2LTOA 5DM7R 1Y71A 3JB9D 4GLKA 2EQMA 5J3BA 2X51A 3JSCA 1AVZC 1N27A 1VQ4A 1VQKQ 4UC4A 4GLMA 3VS4A 4M78G 1LVKA 4M7AF 3MO8A 3A98A 4D8DA 4K11A 4JRIA 1OQKA 2A7YA 3QZ5B 2GFUA 1K76A 2LP5A 2WSCE 4J7FA 2MIOA 1ZSZC 2RHIA 1ABQA 2LQNA 1SEMA 4RTXA 1VQ6T 3MEAA 4PJNA 3EG2A 1Z9ZA 3V8JA 1QP3A 3QYGB 1M30A 4J9BA 4A53A 4ESRA 1VQ5T 5GMKm 1G83A 1SRMA 4MDXA 1MNEA 4OMLA 1WJQA 2LT4A 3JB9H 2QXFA 2NUTA 4PJOG 1D1AA 3QUIA 3RMSA 1G8XA 5D6YA 4HXJA 2C06A 3RKWA 4A63B 3HTRA 4FL6A 1ZBJA 4FYYB 2JW4A 1HYOA 1OEBA 4F7UB 4XU1A 1V29B 3CC4A 5A2QE 3OYMA 1WJSA 4JJDA 3OYNA 1NZ9A 5IHIA 1KJWA 3PFSA 3LX7A 3X25B 2YHTA 1PC0A 4OB0B 5LJ3f 3ZEHA 4XTVA 1XOVA 3PT9A 4BACA 2GGRA 3LH0A 2K4YA 2KBTA 1AZGB 4J9CA 2FB7A 1VQ6A 1GBQA 3GIBA 2GNCA 2R57A 3QDFA 2O88A 5D7UA 1HD3A 4RUGA 1C1AA 2FG0A 1TG0A 3H8ZA 1TOVA 2VASA 2AIRB 2EJ9A 5GAOp 3HFOA 4Z8AA 4QVDA 2EWNA 2VC8A 3FRNA 4JRPA 5IN1A 1BU1A 5DLQE 1YITT 3CQTA 4CC7A 2CREA 1VYTA 5CAIA 2XDDA 2ZPGB 3MEVA 1KG1A 2ED0A 1X6GA 5GANg 1X6BA 3HKSA 1X2KA 1ZLMA 5FU6C 2DXUA 3NTIA 4M75D 5CVIA 3OMGA 1WYXA 1PG5B 5LJ5e 1N6AA 3CC2T 1GBRA 2O9VA 4FW1A 2L5QA 3OS5A 2BE9B 3CC7A 3H9NA 3PE0A 1OZ2A 2QYZA 5IH2A 2J6KA 3RESA 1LOJA 4M77E 5GAOn 1GRIA 2KEAA 1M3AA 3JB9G 1KHIA 3M0QA 1JO8A 3CBPA 4E47A 2E6ZA 2O31A 2CS7A 3M0RA 1YITA 1YN8A 4WF2A 2KRSA 2AHJB 1YJ9Q 4PKCC 1C0MA 3EFOA 5LJ3h 2X9HA 4Z02A 2MCNA 1PD0A 1W2BA 3S3OA 4XTWA 2BIVA 1GFDA 4LNPA 4DA4A 3CC2A 5IXBA 4R56A 2HQHA 3MEUA 3O5ZA 2QQ9A 1AWWA 1TH7A 4LUDA 1DJ7B 2V1QA 3CCLQ 1O9SA 2KYMA 4EMHA 4J9DA 3BW1A 1YJNQ 2I2LA 4ELYC 3URGA 1QWEA 5GAOq 1OU8A 3JCMd 5GAMd 2GFAA 3M0UA 2PZ1A 4M75C 2MF2A 2KE9A 2A3LA 3OYCA 1K8AC 1AHJB 1FMVA 2DF6A 1VQ9Q 4IURA 2QASA 1WNLA 4HCBA 1W2BS 3LGFA 5KH6A 3EGXB 5GAMe 3CCUT 1VIFA 1XJWB 4M78A 1UE9A 1WHKA 4XU3A 5J39A 2VGNA 1E6GA 1BI2A 5LJ3g 1H8KA 2IIMA 4E6RA 2JVVA 3P8HA 4C0DC 1WIEA 3M4GA 1OPKA 4M7AC 4E7SA 5KYUB 2KROA 5CO7A 3BE3A 3CCRT 1AWXA 1K1ZA 1SF9A 3VYHB 1G3TA 4PJOA 5CK9A 1Y07A 1X01A 1IRXA 1KC8U 4N4GA 1VIEA 3OS0A 1VQKT 2KR3A 3OYEA 1AZEA 1TXQA 3CC4Q 3OY9A 4M75G 2PQWA 2DBKA 1JQQA 1HXDA 3LW5E 1JXMA 1PRMC 5IHNA 1P92A 1CSKA 1NLPC 3E9GA 5LJ5h 1VOMA 3A8GB 1MGQA 5FRNA 2DXCA 4ZGJB 2HEQA 4KT0E 1PSEA 3CCJQ 1UJ0A 1HJDA 2K7AA 4J6XA 1ZBXA 2DD4A 1Q86C 2RI5A 2X35A 2PU9B 3HRSA 3CCRA 2PVOB 1W1FA 4M7AG 1NPPA 2BE7D 4OMFB 4BI8B 2HQEA 3X20B 4M77A 2RN8A 1QVFP 4J6YA 1UGVA 1VQKA 1K8AR 2R5AA 4JPBW 3F70A 3ZFJA 2V8JA 1Q7YC 2EAYA 2RO0A 3OYLA 4M77F 2QI2A 3A8MB 3VUBA 1LJOA 3GNGA 2LCCA 3LYIA 2W10A 4JZ4A 3SWNA 4M4ZA 2K6DA 5GAN3 1RAAB 4XTYA 2RI2A 1C6VX 5CKFA 3FJ5A 2IPOB 3CC7Q 1UGQB 3MEWA 3VS6A 3I56A 4OMPA 1OX9A 2FO0A 2X4YA 3VS7A 3P8DA 5GJWB 1GL5A 4E7JA 1PCXA 2G3RA 2OTJA 3RBBB 2YUPA 1AWOA 1M1KU 5CKDA 1H3HA 4IUUA 2PUOB 2W0ZA 2E6NA 4KBMB 4KGXB 2CUBA 2QQRA 3OQ5A 4QQGA 1WDXA 4BE2A 2RHZA 1WHJA 3QWYA 1ZA1B 4DOVA 4C8QD 2KRNA 2Y90A 2L3SA 2MPXC 4D6WA 1K8AU 5GAOl 1ZUYA 3CC2Q 2MWOA 3I55T 1MV3A 4FYWB 4ZTFA 2EYYA 2CZ6B 4X1VA 2XHCA 2LQKA 2DAQA 2YUNA 1SPKA 4RTWA 3EHRA 2M16A 1KK7A 5IHKA 2AT1B 1BCOA 1Q86R 3PGGA 5HK0A 1RLPC 5CKEA 1BBZA 4F04B 1N9SA 3KFVA 1K9MU 3Q1JA 5CIUA 1WQ7A 1MHNA 1PRLC 1FXXA 3M57A 2HKNA 1M9SA 1YJ9T 1Z9QA 4HVVA 1BYMA 3V7RA 3JB9I 5GANd 1CKBA 2D8JA 1AD5A 1TU0B 1WXBA 5FWBA 1R0BG 2BKDN 3FIFA 3BDLA 4BB7A 1Q7YR 2B8AA 3CMEA 1Q81R 4LE9A 3LH5A 2O01E 1M27C 1M90C 3CCLT 3CD6T 1YIJQ 1IB8A 3I55A 4LD6A 1YJNT 2L3QA 2K9GA 1QVGA 1BKBA 1M1FA 1K4US 3VS3A 2CP5A 4M7DB 2B86A 2OAUA 4Y28E 1NJIC 1VQ9T 2KDSA 2CP3A 2CSIA 3DLLA 2NYSA 2DE0X 4HT8A 2DZ9A 2O4XB 2DBMA 2HCKA 2HNIA 5GMKl 2ZGWA 3QZ9B 2OX7A 3CCSQ 1Q86U 2KGTA 4M75A 1YJWA 3H41A 3KUFA 4LDVA 3QJYA 3EFOB 2M0YA 1RI0A 2EW3A 3VS0A 3A8OB 4E7ZA 1A0NB 2E3HA 3JCMV 4BD3A 3L1AA 1SHGA 4EMKA 1VQOQ 4ATOA 1QVGS 4PJOC 2FHDA 4PL6A 4C92B 5KCHA 4KRTA 3CCLA 3CD6A 1D0ZA 1M4ZA 2X3WD 4X9DA 1Q81U 4LDYA 1D1CA 4E7HA 4V2SA 3C94A 2CT4A 1M2VB 2RQWA 3QHSA 1VQPA 3SDZA 2RQTA 3L2UA 4HVUA 4LD9K 4LN2A 1RAHB 3CC4T 1JJ2P 1VQ9A 4CI0C 5DY9A 1WHGA 3JAME 3RUXA 2D6FA 2F1LA 3TCJA 1PKSA 1MMGA 2V26A 2EJFA 4EDUA 2ENMA 1D0YA 3V8LA 4OMOA 2VGMA 2X4JA 3GF5A 3OYAA 1TWBA 3HRTA 3CCJT 2MYSA 2CZ1B 4BDZA 2ED1A 5IXFA 1X2QA 1UEBA 1EZZB 2BZ8A 2RHYA 2ZPBB 3UA7A 1Y0MA 5A0LA 3UDCA 3OS1A 2BTTA 1M90R 4M77C 4C92E 3I56Q 1OI1A 2QG9B 2YRDA 3UA6A 2CP0A 4QVZA 1Y7XA 1NYFA 3CCMA 3SD4A 4NOYA 4JRQA 2NUPB 1ZX6A 1WLPB 4RTTA 3OA6A 2D8HA 2OTJQ 2E41A 5GJVB 1WXUA 2ABLA 4FSSA 4C8QE 1NJIR 5HKCA 5I2SA 5GAN7 3SWNC 3M9QA 3OB9A 3UF4A 3OYYA 3PMIA 2EYQA 1M1GA 1UTIA 4F7UG 3SEMA 5FW9A 5CQYA 4A4EA 4RCCA 2GCXA 2ESWA 2F2VA 4HCKA 4O5VA 1OPLA 1KC8C 4HT9A 3CC7T 4KGVB 1VQMA 2PUKB 4OMQA 4FYVB 4C5HA 2P4RA 2HQXA 5CQXA 3CCJA 2EGAA 1G3WA 3FLGA 1YWOA 4ZGDB 1JJ2A 3OSSC 2K5LA 2FZKB 4PK4A 5LJ3j 1KQ1A 2YRCA 4AG2C 1MV0B 3M53A 1ZSZB 4JJCA 4M77G 4RTUA 2SRCA 7AT1B 4JDSA 1M90U 2RPNA 2DERA 2DL4A 1H641 4F7UE 1LNXA 2ZCFB 2AK5A 4FYXB 1X27A 5FU7C 2Z0WA 2L89A 5KYWA 1E7OA 3E1SA 1G5VA 3NTHA 2KK4A 1GCPA 2FPDA 3PIOA 1WA7A 2JTMA 4R55A 2IVWA 3PMTA 1NJIU 3SFMA 5KYXB 3CMEQ 1YNZA 4EIKA 4ZGEB 1PHTA 1JJ2S 4J7IA 4DEYA 2YLBA 2JNGA 2XKOC 2JS2A 3I55Q 2LQWA 1F1BB 1SKUB 4PJLA 1M2OA 4R0KA 1ZSGA 3G6EQ 1MUZA 4FT2A 3CEYA 5FLXE 4MZMA 2D0NA 2LJ0A 3V8KA 3V7CA 1Y96A 4MZPA 4F16A 2MWPA 1D09B 3ZBDA 3JCMb 1JXOA 1UHCA 2FZCB 2YRVA 1QWFA 4A54A 2RD1A 5CKBA 3RIRA 2O2OA 2GQVA 5A0GA 3HPWA 1YJWQ 1NG2A 1TUDA 1I5OB 3JCMP 2C0TA 1B07A 3QYHB 1W4SA 1B3QA 1YIJT 4F17A 1Q82U 2GTOA 3QIIA 1M1KC 1VQNQ 2XICA 1KC8R 5LJ5f 3JCMJ 3PVLA 2ECZA 3CD6Q 3MJXA 3E19A 3A8HB 3KXTA 3L2QA 4OF1A 5FU6B 3FDRA 1W70A 3AT1B 3C4SA 3OYHA 1UB4A 3OMCA 4ANJA 2K3BA 1IO6A 1B34B 1VQPQ 8ATCB 1AEYA 3S3NA 2LQ8A 2MI6A 2DTHA 3OS2A 3OYJA 1T0HA 3CCST 5LJ5j 4OB1B 5A0DA 4C92F 3JCMe 5GAN8 2V8IA 3KBGA 4EMKC 5LL6S 3EG0A 5AT1B 2DIGA 2HBPA 1KHCA 3PNWC 3P8BB 1D1BA 4C5GA 1VQOT 1I1JA 3HSBA 1GXIE 2L0AA 2LC4A 4C0GA 5IAYA 4PFOA 1K9MC 4C8QF 2P0KA 2DEUA 1YIJA 1SSHA 2LNHB 1WI7A 4J9IA 3THKA 2GBQA 2IG0A 2DZCA 3EGDB 5HCKA 1ACMB 2H3EB 4A4FA 1O75A 2V8KA 2E5QA 3VRYA 4BDYA 4Q5WA 3TSZA 2EYWA 2LMJA 3CCMQ 2EPDA 3DB3A 4OB3B 3MKDA 2COYA 1M3CA 5GMKj 4IUPA 1QVPA 1SHFA 3JV3A 4NS5A 1M5Q1 1S72A 2VUBA 3CCSA 5GAN4 2DX1A 2VKNA 2EVRA 4RKUE 3PTAA 3FB9A 4F7UA 5KYYB 4J8OA 2O9SA 4N0AA 4ZN3A 5GAMf 1TUCA 4JZ3A 2DYBA 2EGCA 2DNUA 1VQOA 4E2FB 1VQMQ 3UPUA 3I56T 4F7UF 4KUIA 3GP8A 1BCMA 2KY9A 2RK1A 1BI3A 5IT9E 1M1KR 1NEBA 2QTVA 1RAIB 1V1CA 1EX4A 2DETA 4HVWA 4OGEA 5AYFA 1TTHB 4B6MA 4HKEA 2OTJT 2HDAA 3QPHA 1JU5C 1WHHA 4C0DB 1I5LA 1RUWA 2JTFA 3M0TA 4LUEA 3TREA 2KAFA 3IQLA 4M7AB 3I5SA 2QGGA 2K2MA 4M7DD 4NL3A 4HCCA 1PWTA 2CSQA 1Q81C 4BUGA 2PNIA 4Y91A 4E7KA 3MP8A 2RJFA 4LDUA 5I2MA 2D9TA 3VYGA 4AFQC 3VS2A 3MP1A 3TU4K 2JJ9A 3H6ZA 1M8MA 5LJ5g 4L6V5 1NYGA 2J6OA 1K9MR 2XDBA 4WTOB 1G3YA 3QBYA 1U5SA 2YLCA 3VS5A 4RMOA 3PIPA 3L2ZA 2CYZB 1OU9A 1G3SA 2FYKA 2NUTB 1UGPB 4C92D 1H92A 4JS5A 3EH1A 3CCVA 3NFCA 2WSEE 1YWPA 3HRUA 1QW1A 3JCMh 2XIDA 3JCMW 1J3TA 2DL3A 5GAMh 1FWZA 3G71A 2RM4A 2KXCA 2OAWA 4DQ2A 2LX7A 2EGEA 3CMET 3JRZA
chains in the Genus database with same CATH topology
4M78F 1KG1A 1I4K1 4X9DA 1Q81U 4LDYA 4E7HA 4XTXA 2M9UA 3DB4A 3VU3C 5GANg 4V2SA 3C94A 3HKSA 4GY5A 1HK9A 3QHSA 3CCQA 3G4SA 5FU6C 2XD0A 1VQPA 3CPWA 2DXUA 3NTIA 3SDZA 4M75D 3HFNA 3L2UA 5CVIA 3OMGA 4LD9K 2E64A 2VXEA 3EFRA 5LJ5e 1N6AA 1WQWA 4A4HA 3CC2T 3G6ET 3CXCA 3CC4T 4P5NA 1VQ9A 4CI0C 2RHXA 5DY9A 3JCMc 4C0FA 3JAME 1QVFA 2EIFA 1X75C 1VQLA 4JRKA 3ER0A 3RUXA 2D6FA 3L2VA 2L5QA 3JCMf 3OS5A 4M75B 1I8FA 4L5GA 3CC7A 2RB6A 3TCJA 2EJFA 4EDUA 1BI1A 3CPFA 1OZ2A 4OGCA 1RL2A 1JBMA 3C95A 3QSUA 3RESA 4PJOF 3V8LA 1YI2T 2DIQA 4KUDK 4EMGA 1LOJA 2VGMA 3MHXA 5EG2A 4M77E 2QQSA 5GAOn 2X4JA 3GF5A 4ZTJA 3OYAA 3JB9G 3HRTA 3X26B 4BY6C 5CCAA 3CCJT 1KHIA 4EMKB 3CCUA 3BFMA 2CZ1B 4DQ2A 4BDZA 4JS4A 2R5MA 5GAN6 5C6SA 3CBPA 1YJWT 1UEBA 2RHYA 4E47A 2FL7A 2ZPBB 3RKYA 5A0LA 3MP6A 2RJDA 3UDCA 2E6ZA 3OS1A 5GAMj 4M77C 2CS7A 3UT1A 4L59A 4C92E 1YITA 1OI1A 3CCVT 3WVEB 4WF2A 1KQ2A 3CPWS 1YCYA 3L2RA 3JB9J 2AHJB 4PKCC 4RG2A 4XK8E 5LJ3h 4MMLA 5GAMg 4QVZA 4Z02A 1Y7XA 5GANe 1VQNT 3CCMA 3M56A 3CXCS 2RJCA 4BE1A 3SD4A 2MMPA 4NOYA 4JRQA 2KSSA 1W2BA 1QVFS 3QDRB 3HP9A 1BIAA 3G71T 3OA6A 1XQHA 2KQWA 3S3OA 2E41A 4B9XA 4XTWA 3QKJA 4MZTA 2BIVA 4C8QE 5HKCA 5I2SA 5GAN7 4DA4A 4C5IA 3SWNC 3CC2A 3G6EA 5GMKi 2L3RA 4R56A 3M5AA 3M9QA 3MEUA 3OB9A 2QQ9A 2X4WA 3N5BB 1VQPT 1TH7A 3OYYA 4JLGA 4A4KA 2QQAA 2E1HA 2EYQA 1M1GA 3PMIA 4M75E 1DJ7B 4F7UG 1O9SA 1ZQ1A 3OYIA 4EMHA 5CQYA 4X34A 3INZA 3AHUA 2E12A 3BW1A 4C8QC 4A4EA 4RCCA 2GCXA 4FT4A 3R6OA 1I81A 2I2LA 4ELYC 1VQLT 2P0QA 3JCMQ 3URGA 4II1A 4M7DG 3OYGA 1YI2A 4O5VA 3GNFB 5GAOq 3JCMd 1KC8C 4FIBA 5GAMd 2GFAA 4HT9A 3E9FA 4M75C 3CC7T 1VQMA 3HHTB 2PUKB 1WPYA 2MF2A 1NPRA 4J83A 4MDWA 5GMKh 4C5HA 5CQXA 2HQXA 3X28B 3CCJA 2A3LA 4C0ZA 3OYCA 5KE2A 1G3WA 1K8AC 3FLGA 1AHJB 4TVRA 4IURA 5D6XA 4ZGDB 1JJ2A 3OSSC 1WNLA 4HCBA 1W2BS 2K5LA 2D0QB 3LGFA 5KH6A 4E7LA 5GAMe 1X6OA 5LJ3j 3CCUT 1KQ1A 1VIFA 4XU2A 4M78A 4RCBA 4XU3A 4BI4A 5J39A 3WVDB 3CMAT 5GAOm 2VGNA 2E65A 1NE8A 3M53A 1BI2A 5KCOA 5LJ3g 1VQNA 4EPCA 4M7AE 4M77G 3OYKA 3ME9A 4JDSA 1M90U 5HK3A 5D6WA 2JVVA 2H3JA 3P8HA 1H641 3EAEA 4HA8A 5CKHA 4C0DC 4F7UE 1LNXA 2ZCFB 3GOXA 3CCMT 3V7SA 3OYFA 5FU7C 3M4GA 1SSFA 2L89A 4XTUA 4M7AC 4C92G 3OBYA 3E1SA 1G5VA 4BE0A 3NTHA 2KK4A 2DD5A 5CO7A 3PIOA 4M7DE 3HL8A 4N4HA 3CCRT 2WSFE 2JTMA 4R55A 2IVWA 2RJEA 3PMTA 1NJIU 3SFMA 1KD1C 3JB9F 2E10A 3VYHB 1Q82C 1VQ7T 1G3TA 4PJOA 4N0AC 5CK9A 1Y07A 1X01A 4ZGEB 3L42A 2K57A 2NLUA 1U1SA 1JJ2S 2DTIA 4J7IA 1KC8U 2LVMA 4N4GA 2YLBA 1VIEA 4M7DC 4M78D 3OS0A 2DKGA 3TEEA 4KULA 2JNGA 3S6WA 4C8QG 4BI3A 2XKOC 1JB0E 1VQKT 3VUZA 5LJ3d 1KQSA 2LT1A 1XNIA 3G7ZA 5GAN2 3OYEA 2HAXA 1D3BB 2F5KA 2CKKA 3OY9A 4FT2A 4M75G 2JZ2A 1JRIA 2PQWA 4M78B 4ME7A 3CEYA 5FLXE 1HXDA 2P4TA 3LW5E 4IUVA 4MZMA 1IZ6A 5GAOr 1VQMT 3V8KA 3V7CA 3GLXA 1Y96A 4MZPA 1OZ3A 4C5EA 2MWPA 5LJ3e 2ZPHB 4ZN1A 1B34A 1P92A 2ZPEB 3ASKA 3CMAA 3E9GA 2LRQA 1U1TA 4PNOA 3ZBDA 1WJRA 1UGRB 3BY7A 5LJ5h 4B9WA 2DPPB 3A8GB 5GAN5 3JCMb 3CCEA 1MGQA 2VV5A 2ZPIB 5FRNA 2DXCA 2YRVA 3QO3A 4ZGJB 4A54A 2M1HA 3JCMg 3SB2A 4PJOD 4XAXB 2RD1A 4KT0E 5CKBA 1PSEA 4QQDA 4J5YA 2DTOA 3RIRA 4J6XA 4JJNK 1ZBXA 3LWHA 3FC3A 2DD4A 2GQVA 4FSXA 5A0GA 3HPWA 4YTLA 1Q86C 2LX9A 2RI5A 2X35A 4A4GA 4C92C 1K73C 2K5FA 2PU9B 3CBMA 3DKMA 3JCMP 2OTLA 4IKFA 2ZPFB 3HRSA 3QYHB 2KVQG 2BUDA 1VQ8T 4PJOB 3CCRA 1W4SA 2PVOB 1XTDA 1YIJT 1KQSS 2DXTA 1KD1U 4M7AG 1Q82U 1NPPA 3QIIA 1VQ7A 4OMFB 4BI8B 1M1KC 2HQEA 3X20B 2XICA 4M77A 3RMQA 2LDMA 5LJ5f 2DO3A 3C12A 4RG8A 3JCMJ 4O6JA 3LLRA 4J6YA 3QJ6A 5L8RE 5M9OA 4JLIA 2RH2A 3E19A 1BIBA 3A8HB 3KXTA 1VQKA 4NL2A 3L2QA 4QQ6A 4OF1A 2R5AA 5FU6B 3F70A 3ZFJA 2P0PA 3FDRA 5CR2A 2V8JA 2EQKA 2LNVA 4N4IA 3GPLA 1Q7YC 3C4SA 4DOWA 3OYHA 1UB4A 2EAYA 2EQJA 2RO0A 1Y96B 3OMCA 4M78E 4M77F 2QI2A 3A8MB 1VUBA 3OYLA 1H3ZA 1B34B 2FVUA 3VUBA 2DEQA 1LJOA 3GNGA 2LCCA 3OSVA 3LYIA 2WACA 3X24B 3S3NA 4CRIA 3VKIA 3SWNA 2LQ8A 3FEOA 2MI6A 3FJPA 3DLMA 2DTHA 3OS2A 5GAN3 3OYJA 2CGHA 2X4XA 2XG8D 5LJ5j 4XTYA 3CCST 3S3MA 3VJPA 2QEXT 2RI2A 4M78C 4OB1B 2XU8A 5A0DA 1IREB 5CKFA 1D3BA 1QP2A 2PVGB 4C92F 3JCMe 2EKOA 4ELZC 3NTKA 2V8IA 3BDUA 3KBGA 5GAN8 4EMKC 1UGQB 5LL6S 3MEWA 1VQ4T 2EFIA 3I56A 3CBOA 2DIGA 3QXEB 4M77D 4PLIA 2XK0A 3META 2HBPA 1YJ9A 1N8RC 1KHCA 3MCAB 4BY6B 1ZHIA 3PNWC 3CCET 3P8BB 1EIFA 2JUFA 4C5GA 1N9RA 1VQOT 5GANf 1YBYA 2K3YA 3RERA 3HSBA 4PJOE 1GXIE 2LC4A 4C0GA 5IAYA 2X4YA 1VQ8A 3P8DA 1K9MC 1VQ5A 4C8QF 2R58A 2P0KA 4E7JA 4M77B 1YIJA 4XU0A 2F5TX 1U8RA 3QG1A 2G3RA 4VUBA 2OTJA 4HCZA 4LDXA 4LDWA 5CKDA 2GF7A 1M1KU 2CZ7B 2IG0A 4IUUA 2OTLT 2PUOB 5J26A 2DZCA 2E6NA 4X9CA 2K3XA 2RHUA 4KBMB 4M75F 4OB2B 4A4FA 1O75A 2V8KA 2E5QA 4BDYA 2RK2A 2JN0A 4Q5WA 4J6WA 2QQRA 3OQ5A 2DVEA 4QQGA 4BE2A 2K2VA 2QTXA 2RHZA 2Y4XA 3JB9D 3WXMB 1PSFA 2E70A 1Q7YU 3A8LB 3DB3A 1OYXA 3EFSA 4OB3B 5LJ5d 5GANj 3M55A 2QQBA 4DOVA 4C8QD 2HD0A 3J81E 1YJNA 4OP0A 2Y90A 3SWNB 2K5IA 5FROA 5GMKj 4IUPA 2RA2A 4XTZA 1QVPA 5C0MA 2VYTA 2KMTA 4NS5A 4D6WA 1M5Q1 4QVCA 3JCMX 1K8AU 1FX7A 5GAOl 1BI0A 2QDYB 3J80E 1S72A 2JOYA 3J7AF 4M7AA 2MWOA 2VUBA 4IUTA 3I55T 3CCSA 4ZTFA 5GAN4 2CZ6B 4C8QB 2QEXA 2XHCA 1UGSB 2LTOA 5DM7R 1Y71A 2LQKA 2DAQA 2Y4YA 3FB9A 4GLKA 2EQMA 2F69A 4RKUE 5J3BA 3PTAA 2MAMA 2EJGA 2M16A 4F7UA 3JSCA 2PVDB 1N27A 1VQ4A 4J8OA 4UC4A 1M8VA 3RKXA 4N0AA 4ZN3A 4IUQA 5GAMf 4M78G 1N8RU 4M7AF 3M58A 3MO8A 3OW2A 3PGGA 4M7DA 5HK0A 5CKEA 1R8OB 1VQOA 4JRIA 1N9SA 3UPUA 2A7YA 3OBWA 3QZ5B 3I56T 3Q1JA 1K9MU 2GFUA 5CIUA 4F7UF 2WSCE 4J7FA 4KUIA 3GP8A 4MMKA 1WQ7A 1MHNA 2KY9A 1FXXA 2RK1A 2RHIA 1BI3A 1M9SA 3M57A 5IT9E 1YJ9T 1BYMA 1VQ6T 2O4XA 3MEAA 3V7RA 5GANd 3JB9I 2XDPA 4M7DF 3O8VA 3V8JA 1QP3A 3QYGB 4OGEA 5AYFA 4A53A 1VQ5T 4M7AD 2XI9A 3OYDA 3LWIA 4HKEA 5GMKm 2OTJT 4MDXA 3QPHA 5FRMA 2BKDN 1WJQA 3FIFA 3BDLA 4BB7A 2B8AA 2LT4A 4C0DB 3JB9H 1I5LA 2QXFA 2JTFA 4PJOG 2ZZDA 3QUIA 4JUVA 3RMSA 3CMEA 5FU7B 5D6YA 4FU6A 3TREA 2KAFA 5I21A 2C06A 4M7AB 3RKWA 2O01E 2QA4T 5GMKe 1YHQT 1M90C 3CCLT 4FL6A 3CD6T 3VV0A 4M7DD 3M54A 4NL3A 4OVAA 4C92A 3I55A 4LD6A 4F7UB 4HCCA 1YJNT 4XU1A 4XQ3A 3OW2S 1Q81C 1V29B 4BUGA 4Y91A 1QVGA 4E7IA 3CC4A 1BKBA 1M1FA 5A2QE 4FM4B 3OYMA 1WJSA 4E7KA 3CCQT 3G4ST 3MP8A 2RJFA 2DJZA 4LDUA 5I2MA 3OYNA 4M7DB 1NZ9A 1S72T 2D9TA 3PFSA 3VYGA 2OAUA 3LX7A 4Y28E 3X25B 2YHTA 5KE3A 3MP1A 3TU4K 1NJIC 2L8DA 1VQ9T 4OB0B 2KDSA 3H6ZA 5LJ3f 3ZEHA 4XTVA 1WGSA 1XOVA 5LJ5g 4L6V5 3PT9A 4BACA 3DLLA 3LH0A 4C8QA 2K4YA 4HT8A 2XDBA 2DZ9A 2O4XB 2HNIA 1G3YA 3QBYA 5GMKl 2ZGWA 3QZ9B 2FB7A 1Q86U 1VQ6A 2YLCA 4M75A 1K73U 3GIBA 4RMOA 2VXFA 3PIPA 2R57A 2EQUA 3LGLA 3L2ZA 2CYZB 1YJWA 3KUFA 4LDVA 3T9NA 3QJYA 3UWNA 1G3SA 3H8ZA 3M59A 1RI0A 2FYKA 1UGPB 4C92D 2RI3A 3A8OB 4JS5A 3M4YA 2DXBA 3CCVA 2EJ9A 4QW2A 3HFOA 3NFCA 5GAOp 4QVDA 2EWNA 2M0OA 2WSEE 4PLLA 3L1AA 3JCMV 4BD3A 3OYBA 2VC8A 3FRNA 4JRPA 3A5ZB 5IN1A 4EMKA 4ATOA 4PJOC 1QVGS 2FHDA 5DLQE 3HRUA 5DLOA 4PL6A 1QW1A 5GANh 3L2WA 1YITT 3JCMh 2XIDA 3JCMW 4C92B 5CAIA 5GAMh 1FWZA 2LCLA 5KCHA 3G71A 2RM4A 2CZ0B 2QA4A 1YHQA 2XDDA 2ZPGB 3CCLA 3CD6A 2DK3A 1M4ZA 3MEVA 3CMET 5HY6A 3JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHJ B;  3X20 B;  4ZGD B;  2D0Q B;  3QZ5 B;  5L8R E;  2WSC E;  3A8H B;  3WVD B;  1QP3 A;  3A8M B;  3QYG B;  3X24 B;  2ZCF B;  2ZZD A;  4OB1 B;  1IRE B;  1QP2 A;  2PVG B;  2DD5 A;  2O01 E;  1UGQ B;  2WSF E;  3X26 B;  3QXE B;  2CZ1 B;  3VYH B;  4ZGE B;  1V29 B;  2ZPB B;  4FM4 B;  1GXI E;  3WVE B;  1JB0 E;  2AHJ B;  3VYG A;  4XK8 E;  4Y28 E;  3X25 B;  2CZ7 B;  4OB0 B;  2PUO B;  4L6V 5;  4OB2 B;  3LW5 E;  3QZ9 B;  2ZPH B;  2ZPE B;  1PSF A;  3A8L B;  4OB3 B;  1UGR B;  2DPP B;  3A8G B;  2ZPI B;  2CYZ B;  2DXC A;  4ZGJ B;  1DJ7 B;  1UGP B;  3A8O B;  4KT0 E;  1PSE A;  2DXB A;  2QDY B;  2WSE E;  2DD4 A;  2CZ6 B;  1UGS B;  4RKU E;  2PU9 B;  2ZPF B;  3QYH B;  2PVD B;  3HHT B;  2PUK B;  2PVO B;  2CZ0 B;  2ZPG B;  3X28 B; 
#chains in the Genus database with same CATH topology
 1TS9 A;  4XTX A;  4KH1 B;  3VU3 C;  4F14 A;  1K0X A;  4GY5 A;  2JM8 A;  2PTK A;  3HFN A;  4A4H A;  2YSQ A;  3G6E T;  2COW A;  2RHX A;  3JCM c;  3REB B;  1QVF A;  1MMN A;  1X75 C;  1VQL A;  3ER0 A;  1I8F A;  4L5G A;  4ORZ A;  1IXD A;  1BI1 A;  3CPF A;  2HBW A;  1T0J A;  1RL2 A;  3C95 A;  3QSU A;  1SRL A;  2DIQ A;  4KUD K;  4JJB A;  4EMG A;  3MHX A;  5EG2 A;  3TQ7 P;  4ZTJ A;  1V76 A;  4BY6 C;  3X26 B;  1UG1 A;  3BFM A;  3E2U A;  1VYU A;  4JS4 A;  1E6H A;  5C6S A;  1YJW T;  2VB6 A;  2RJD A;  1U06 A;  4L59 A;  1QCF A;  1KQ2 A;  1YCY A;  3L2R A;  4XK8 E;  5GAM g;  5GAN e;  3EGX A;  1VQN T;  3M56 A;  4BE1 A;  2KSS A;  1QVF S;  3HP9 A;  2EKH A;  1XQH A;  1KQS P;  3QKJ A;  4DBQ A;  4C5I A;  2DIL A;  5GMK i;  3G6E A;  2L3R A;  2L2P A;  1T3S A;  4QT7 A;  1VQP T;  3NHN A;  4A4K A;  2QQA A;  2QA4 Q;  1YHQ Q;  1I07 A;  1ZQ1 A;  4X34 A;  5KYU A;  3INZ A;  3TSW A;  4C8Q C;  1RI9 A;  1W6X A;  4FT4 A;  1QMC A;  1I81 A;  4IIO A;  2HL3 A;  2ATC B;  2P0Q A;  3JCM Q;  4M7D G;  4II1 A;  3GNF B;  2EYZ A;  2OI3 A;  2AKK A;  3CCQ Q;  3SHW A;  1WX6 A;  1NPR A;  2ZAE A;  4J83 A;  1S72 Q;  2LCS A;  1K0S A;  3X28 B;  2CT3 A;  4C0Z A;  1WFW A;  5D6X A;  1WZO A;  4E7L A;  1Q95 G;  1X6O A;  4XU2 A;  2EYX A;  1M3B A;  4RCB A;  4KH0 B;  1HSQ A;  5GAO m;  2E65 A;  2M02 A;  1VQN A;  4EPC A;  2RF0 A;  3ME9 A;  2QK0 A;  8AT1 B;  1UUE A;  2XMF A;  2ROT A;  3EAE A;  4ZNX A;  5FWC A;  3GOX A;  3CCM T;  2DL5 A;  4XTU A;  4C92 G;  4BE0 A;  1KFZ A;  2DD5 A;  1NM7 A;  4M7D E;  1N5Z A;  2NWM A;  2CUD A;  2RJE A;  2E10 A;  1Q82 C;  4N0A C;  3L42 A;  2K57 A;  2NLU A;  2DTI A;  1GCQ A;  2LVM A;  3PVQ A;  4DBR A;  2DKG A;  3TEE A;  4KUL A;  3S6W A;  4C8Q G;  2KXD A;  3VUZ A;  5LJ3 d;  1KQS A;  1XNI A;  3G7Z A;  2HAX A;  2JZ2 A;  4M78 B;  4ME7 A;  1VQM T;  4IUV A;  1IZ6 A;  1IGU A;  3EG3 A;  1OZ3 A;  4C5E A;  1FMK A;  5LJ3 e;  4ZN1 A;  2LRQ A;  1WJR A;  3BY7 A;  1YI2 Q;  4Z89 A;  2HSE B;  3CCE A;  3QO3 A;  1ABO A;  3SB2 A;  4XAX B;  1UJY A;  2EQI A;  4QQD A;  2DTO A;  3NGP A;  2X3X D;  3RDV A;  1ZUK A;  2HKQ B;  2K79 A;  1K73 C;  2OTL A;  4IKF A;  2K5F A;  2ZPF B;  2KI7 A;  4PJO B;  2GTJ A;  1UDL A;  3CCV Q;  1KQS S;  2DXT A;  1PD1 A;  1KD1 U;  1RAB B;  2CH4 W;  3C0C A;  3RMQ A;  3RR6 A;  2H8H A;  3C12 A;  4RG8 A;  3G71 Q;  2YUO A;  3LLR A;  3QWX X;  5L8R E;  5M9O A;  2AKL A;  4JLI A;  2V1R A;  1X69 A;  2FPF A;  4QQ6 A;  2P0P A;  2RQU A;  5CR2 A;  2EQK A;  2LNV A;  4N4I A;  3OW2 P;  6AT1 B;  2YDL A;  4M78 E;  4OVA A;  5GAN h;  1I0C A;  1VUB A;  2FVU A;  3UAT A;  2DEQ A;  3OSV A;  2DVJ A;  2WAC A;  3X24 B;  1IGQ A;  3U23 A;  2J06 A;  3FJP A;  1N8R R;  2CGH A;  2I0N A;  1VQL Q;  3EHQ A;  1IRE B;  3EG1 A;  1D3B A;  2ROL A;  2EKO A;  3NTK A;  3BDU A;  2EFI A;  5I11 A;  3QXE B;  4PLI A;  2KNB B;  3MCA B;  1ZHI A;  1LCK A;  1EIF A;  1N9R A;  2LJ3 A;  2K3Y A;  3RER A;  4J9F A;  1SG5 A;  1W2B P;  4PJO E;  2KT8 A;  1VQ5 A;  4M77 B;  1Q82 R;  4XU0 A;  2F5T X;  3CMA Q;  4LDW A;  2GF7 A;  1MMD A;  2CZ7 B;  4RTV A;  4CC4 B;  3A1P A;  3ZL7 C;  1GFC A;  3EH2 A;  2FRY A;  2CDT A;  1IHW A;  2RK2 A;  2JN0 A;  2Y4X A;  3A8L B;  5LJ5 d;  3J81 E;  4OP0 A;  3SWN B;  2K5I A;  5C0M A;  3JCM X;  4QVC A;  1R0C B;  1BI0 A;  2QDY B;  3J80 E;  2JOY A;  1VQ7 Q;  4FW2 A;  4RTZ A;  4PFP A;  5EC7 A;  4AT1 B;  2Y4Y A;  1UHF A;  2E4H A;  1NEG A;  2F69 A;  2MAM A;  3H0H A;  2EJG A;  2A0F B;  2PVD B;  1M8V A;  3RKX A;  4WCI A;  1WHM A;  2DYI A;  1AT1 B;  4IUQ A;  1N8R U;  1R77 A;  3M58 A;  3OW2 A;  4M7D A;  1K73 R;  1R8O B;  1X43 A;  3OBW A;  4MMK A;  3TVT A;  1U3O A;  3VS1 A;  2O4X A;  2XDP A;  2QGF B;  4M7D F;  3O8V A;  4M7A D;  2XI9 A;  2KYB A;  3OYD A;  3LWI A;  3CPW P;  5FRM A;  2G6F X;  3CXC P;  2ZZD A;  1NLO C;  4JUV A;  1K9A A;  5FU7 B;  4FU6 A;  5I21 A;  1VQ8 Q;  2E3I A;  5I22 A;  2QA4 T;  4AMC A;  5GMK e;  1YHQ T;  1QCO A;  3VV0 A;  1ZUU A;  2MK5 A;  1OX8 A;  3M54 A;  1BB9 A;  4J9E A;  4C92 A;  4XQ3 A;  3OW2 S;  4DBF A;  3NMZ C;  4E7I A;  4FM4 B;  4IIM A;  3CCQ T;  3G4S T;  2DJZ A;  2OJ2 A;  1S72 T;  1NBE B;  2DFU A;  3D7S B;  4J9H A;  3VRZ A;  3NPF A;  1M2V A;  5KE3 A;  2JMA A;  2L8D A;  1WGS A;  1VYV A;  3EG9 A;  2FZG B;  4C8Q A;  2JMC A;  4DEX A;  1YFN A;  2J7I A;  1K73 U;  2QEX Q;  2VXF A;  2EQU A;  3LGL A;  3UWN A;  2SEM A;  3T9N A;  1PKT A;  3M59 A;  1VQ4 Q;  2RI3 A;  3M4Y A;  2DXB A;  4QW2 A;  4PLL A;  2M0O A;  3OYB A;  3CCE Q;  3A5Z B;  2VVK A;  5DLO A;  3M0P A;  2RMO A;  3L2W A;  1GCQ C;  2LCL A;  2QA4 A;  1YHQ A;  2CZ0 B;  2DK3 A;  2YT6 A;  1UFF A;  5HY6 A;  4M78 F;  1I4K 1;  2DMO A;  2OTL Q;  1PM3 A;  2M9U A;  3DB4 A;  1HK9 A;  3CCQ A;  3G4S A;  2XD0 A;  3CPW A;  2DLP A;  4FCY A;  2NUP A;  2AZS A;  2E64 A;  2VXE A;  3EFR A;  1WQW A;  2JXB A;  3CXC A;  4P5N A;  4RTY A;  4C0F A;  2JTE A;  2EIF A;  2LJ1 A;  4JRK A;  1IHV A;  3MPU B;  3L2V A;  1MND A;  3JCM f;  4M75 B;  9ATC B;  2RB6 A;  1T3L A;  2CP2 A;  4OGC A;  1JBM A;  2MOX A;  4PJO F;  1YI2 T;  4D8K A;  2C0O A;  2QQS A;  1RAE B;  2JS0 A;  5CCA A;  4EMK B;  3CCU A;  2HSP A;  2R5M A;  5GAN 6;  1VA7 A;  2FL7 A;  3RKY A;  3MP6 A;  1UEC A;  4CC2 A;  2DRK A;  5GAM j;  3UT1 A;  3CCV T;  3WVE B;  3CPW S;  2HMA A;  3JB9 J;  4RG2 A;  2CP6 A;  4MML A;  4DBH A;  1VQ6 Q;  3CXC S;  2RJC A;  2HL5 C;  2E5K A;  2MMP A;  1TUG B;  2RQV A;  3QDR B;  1ZSZ A;  1BIA A;  3G71 T;  1VQ5 Q;  2KQW A;  4B9X A;  4MZT A;  1PNJ A;  2FEI A;  3M5A A;  3ULR B;  2X4W A;  1AOJ A;  3N5B B;  2J05 A;  4JLG A;  4LXC A;  4M75 E;  1FMW A;  2E1H A;  1D0X A;  4Z88 A;  3OYI A;  2NUZ A;  4GBQ A;  3AHU A;  4PFZ A;  2E12 A;  4Y92 A;  3R6O A;  1G2B A;  1QCN A;  1VQL T;  3OYG A;  1YI2 A;  5KYX A;  3I9Q A;  4FIB A;  3E9F A;  3HHT B;  1WPY A;  4MDW A;  5GMK h;  5KE2 A;  4TVR A;  2DJQ A;  2F2X A;  2D0Q B;  2GQI A;  1QQJ A;  5ECA A;  4BI4 A;  3CMA T;  3WVD B;  1OOT A;  1NE8 A;  1OUL A;  5KCO A;  4M7A E;  3OYK A;  2AZV A;  1RAG B;  5HK3 A;  3H0F A;  5D6W A;  1MMA A;  1YP5 A;  2H3J A;  4HA8 A;  2J6F A;  1KSW A;  5CKH A;  3G1J A;  2C0I A;  3V7S A;  3OYF A;  2CP7 A;  1SSF A;  1OV3 A;  3OBY A;  1QVG P;  3HL8 A;  1YIT Q;  4N4H A;  2WSF E;  3REA B;  2DM1 A;  1RAD B;  1KD1 C;  3JB9 F;  1VQ7 T;  2DRM A;  2FRW A;  1U1S A;  2YXY A;  4M7D C;  4M78 D;  2COZ A;  4KGZ B;  4AFS C;  4BI3 A;  2DL7 A;  3EGU A;  1JB0 E;  2A28 A;  2LT1 A;  5GAN 2;  1BK2 A;  1D3B B;  2F5K A;  2CKK A;  1JRI A;  2M51 A;  2P4T A;  5GAO r;  1YCS B;  3GLX A;  2FPE A;  2ZPH B;  1B34 A;  3ASK A;  2ZPE B;  3CMA A;  1AWJ A;  1U1T A;  4PNO A;  1S1N A;  1UGR B;  4B9W A;  2DPP B;  5GAN 5;  2VV5 A;  2ZPI B;  4OMM A;  5KYW B;  2M1H A;  3JCM g;  4PJO D;  2EBP A;  3GBQ A;  1JEG A;  4J5Y A;  1RAF B;  1TSF A;  4CC3 A;  4JJN K;  3LWH A;  3FC3 A;  4FSX A;  4YTL A;  2LX9 A;  2D1X A;  4C92 C;  4A4G A;  2QAZ A;  3CBM A;  3DKM A;  1VQ8 T;  2KVQ G;  2BUD A;  2RNA A;  1FYN A;  2KT1 A;  4AFU C;  1XTD A;  1VQ7 A;  1CKA A;  4QKU A;  2LDM A;  2DO3 A;  1WXT A;  2A36 A;  4O6J A;  3QJ6 A;  2RH2 A;  2CH4 A;  1BIB A;  3EGD A;  4NL2 A;  2JT4 A;  2LZ6 B;  4OMN A;  2RQR A;  2DA9 A;  3I35 A;  3GPL A;  4DOW A;  3I5R A;  2EQJ A;  1Y96 B;  1H3Z A;  3R6N A;  3G4S Q;  4AG1 C;  2BZX A;  2YWW A;  4CRI A;  3VKI A;  3FEO A;  3DLM A;  4AFZ C;  2L3P A;  2X4X A;  2JM9 A;  2XG8 D;  3S3M A;  3VJP A;  2QEX T;  4M78 C;  2XU8 A;  1QP2 A;  2PVG B;  2BZY A;  3M0S A;  2KRM A;  1KIK A;  4ELZ C;  1QKW A;  4J9G A;  2HZY A;  1VQ4 T;  3CBO A;  1ZA2 B;  4M77 D;  2XK0 A;  3MET A;  1RAC B;  1YJ9 A;  1N8R C;  5KYN A;  4BY6 B;  5KYY A;  3CCE T;  2JUF A;  5GAN f;  1YBY A;  1B7T A;  5L23 A;  1VQ8 A;  4PJJ A;  3CCU Q;  2R58 A;  1KD1 R;  1U8R A;  1RLQ C;  3QG1 A;  4VUB A;  4HCZ A;  4LDX A;  2P84 A;  2OTL T;  5J26 A;  4X9C A;  2K3X A;  2RHU A;  4M75 F;  4OB2 B;  2DL8 A;  1ARK A;  2A37 A;  4J6W A;  1Y57 A;  2DVE A;  1WHL A;  1QKX A;  2K2V A;  2QTX A;  3WXM B;  1PSF A;  2E70 A;  1Q7Y U;  5GAN j;  1OYX A;  3EFS A;  1EFN A;  3M55 A;  2QQB A;  2HD0 A;  1YJN A;  3H0I A;  2A08 A;  5FRO A;  2VWF A;  2RA2 A;  4XTZ A;  3CCR Q;  2YUQ A;  2VYT A;  2KMT A;  1QLY A;  1LPL A;  1FX7 A;  2QDL A;  4M7A A;  2F2W A;  3J7A F;  4IUT A;  3EG9 B;  4C8Q B;  4PJM A;  2QEX A;  3RNJ A;  1UGS B;  2LTO A;  5DM7 R;  1Y71 A;  3JB9 D;  4GLK A;  2EQM A;  5J3B A;  2X51 A;  3JSC A;  1AVZ C;  1N27 A;  1VQ4 A;  1VQK Q;  4UC4 A;  4GLM A;  3VS4 A;  4M78 G;  1LVK A;  4M7A F;  3MO8 A;  3A98 A;  4D8D A;  4K11 A;  4JRI A;  1OQK A;  2A7Y A;  3QZ5 B;  2GFU A;  1K76 A;  2LP5 A;  2WSC E;  4J7F A;  2MIO A;  1ZSZ C;  2RHI A;  1ABQ A;  2LQN A;  1SEM A;  4RTX A;  1VQ6 T;  3MEA A;  4PJN A;  3EG2 A;  1Z9Z A;  3V8J A;  1QP3 A;  3QYG B;  1M30 A;  4J9B A;  4A53 A;  4ESR A;  1VQ5 T;  5GMK m;  1G83 A;  1SRM A;  4MDX A;  1MNE A;  4OML A;  1WJQ A;  2LT4 A;  3JB9 H;  2QXF A;  2NUT A;  4PJO G;  1D1A A;  3QUI A;  3RMS A;  1G8X A;  5D6Y A;  4HXJ A;  2C06 A;  3RKW A;  4A63 B;  3HTR A;  4FL6 A;  1ZBJ A;  4FYY B;  2JW4 A;  1HYO A;  1OEB A;  4F7U B;  4XU1 A;  1V29 B;  3CC4 A;  5A2Q E;  3OYM A;  1WJS A;  4JJD A;  3OYN A;  1NZ9 A;  5IHI A;  1KJW A;  3PFS A;  3LX7 A;  3X25 B;  2YHT A;  1PC0 A;  4OB0 B;  5LJ3 f;  3ZEH A;  4XTV A;  1XOV A;  3PT9 A;  4BAC A;  2GGR A;  3LH0 A;  2K4Y A;  2KBT A;  1AZG B;  4J9C A;  2FB7 A;  1VQ6 A;  1GBQ A;  3GIB A;  2GNC A;  2R57 A;  3QDF A;  2O88 A;  5D7U A;  1HD3 A;  4RUG A;  1C1A A;  2FG0 A;  1TG0 A;  3H8Z A;  1TOV A;  2VAS A;  2AIR B;  2EJ9 A;  5GAO p;  3HFO A;  4Z8A A;  4QVD A;  2EWN A;  2VC8 A;  3FRN A;  4JRP A;  5IN1 A;  1BU1 A;  5DLQ E;  1YIT T;  3CQT A;  4CC7 A;  2CRE A;  1VYT A;  5CAI A;  2XDD A;  2ZPG B;  3MEV A;  1KG1 A;  2ED0 A;  1X6G A;  5GAN g;  1X6B A;  3HKS A;  1X2K A;  1ZLM A;  5FU6 C;  2DXU A;  3NTI A;  4M75 D;  5CVI A;  3OMG A;  1WYX A;  1PG5 B;  5LJ5 e;  1N6A A;  3CC2 T;  1GBR A;  2O9V A;  4FW1 A;  2L5Q A;  3OS5 A;  2BE9 B;  3CC7 A;  3H9N A;  3PE0 A;  1OZ2 A;  2QYZ A;  5IH2 A;  2J6K A;  3RES A;  1LOJ A;  4M77 E;  5GAO n;  1GRI A;  2KEA A;  1M3A A;  3JB9 G;  1KHI A;  3M0Q A;  1JO8 A;  3CBP A;  4E47 A;  2E6Z A;  2O31 A;  2CS7 A;  3M0R A;  1YIT A;  1YN8 A;  4WF2 A;  2KRS A;  2AHJ B;  1YJ9 Q;  4PKC C;  1C0M A;  3EFO A;  5LJ3 h;  2X9H A;  4Z02 A;  2MCN A;  1PD0 A;  1W2B A;  3S3O A;  4XTW A;  2BIV A;  1GFD A;  4LNP A;  4DA4 A;  3CC2 A;  5IXB A;  4R56 A;  2HQH A;  3MEU A;  3O5Z A;  2QQ9 A;  1AWW A;  1TH7 A;  4LUD A;  1DJ7 B;  2V1Q A;  3CCL Q;  1O9S A;  2KYM A;  4EMH A;  4J9D A;  3BW1 A;  1YJN Q;  2I2L A;  4ELY C;  3URG A;  1QWE A;  5GAO q;  1OU8 A;  3JCM d;  5GAM d;  2GFA A;  3M0U A;  2PZ1 A;  4M75 C;  2MF2 A;  2KE9 A;  2A3L A;  3OYC A;  1K8A C;  1AHJ B;  1FMV A;  2DF6 A;  1VQ9 Q;  4IUR A;  2QAS A;  1WNL A;  4HCB A;  1W2B S;  3LGF A;  5KH6 A;  3EGX B;  5GAM e;  3CCU T;  1VIF A;  1XJW B;  4M78 A;  1UE9 A;  1WHK A;  4XU3 A;  5J39 A;  2VGN A;  1E6G A;  1BI2 A;  5LJ3 g;  1H8K A;  2IIM A;  4E6R A;  2JVV A;  3P8H A;  4C0D C;  1WIE A;  3M4G A;  1OPK A;  4M7A C;  4E7S A;  5KYU B;  2KRO A;  5CO7 A;  3BE3 A;  3CCR T;  1AWX A;  1K1Z A;  1SF9 A;  3VYH B;  1G3T A;  4PJO A;  5CK9 A;  1Y07 A;  1X01 A;  1IRX A;  1KC8 U;  4N4G A;  1VIE A;  3OS0 A;  1VQK T;  2KR3 A;  3OYE A;  1AZE A;  1TXQ A;  3CC4 Q;  3OY9 A;  4M75 G;  2PQW A;  2DBK A;  1JQQ A;  1HXD A;  3LW5 E;  1JXM A;  1PRM C;  5IHN A;  1P92 A;  1CSK A;  1NLP C;  3E9G A;  5LJ5 h;  1VOM A;  3A8G B;  1MGQ A;  5FRN A;  2DXC A;  4ZGJ B;  2HEQ A;  4KT0 E;  1PSE A;  3CCJ Q;  1UJ0 A;  1HJD A;  2K7A A;  4J6X A;  1ZBX A;  2DD4 A;  1Q86 C;  2RI5 A;  2X35 A;  2PU9 B;  3HRS A;  3CCR A;  2PVO B;  1W1F A;  4M7A G;  1NPP A;  2BE7 D;  4OMF B;  4BI8 B;  2HQE A;  3X20 B;  4M77 A;  2RN8 A;  1QVF P;  4J6Y A;  1UGV A;  1VQK A;  1K8A R;  2R5A A;  4JPB W;  3F70 A;  3ZFJ A;  2V8J A;  1Q7Y C;  2EAY A;  2RO0 A;  3OYL A;  4M77 F;  2QI2 A;  3A8M B;  3VUB A;  1LJO A;  3GNG A;  2LCC A;  3LYI A;  2W10 A;  4JZ4 A;  3SWN A;  4M4Z A;  2K6D A;  5GAN 3;  1RAA B;  4XTY A;  2RI2 A;  1C6V X;  5CKF A;  3FJ5 A;  2IPO B;  3CC7 Q;  1UGQ B;  3MEW A;  3VS6 A;  3I56 A;  4OMP A;  1OX9 A;  2FO0 A;  2X4Y A;  3VS7 A;  3P8D A;  5GJW B;  1GL5 A;  4E7J A;  1PCX A;  2G3R A;  2OTJ A;  3RBB B;  2YUP A;  1AWO A;  1M1K U;  5CKD A;  1H3H A;  4IUU A;  2PUO B;  2W0Z A;  2E6N A;  4KBM B;  4KGX B;  2CUB A;  2QQR A;  3OQ5 A;  4QQG A;  1WDX A;  4BE2 A;  2RHZ A;  1WHJ A;  3QWY A;  1ZA1 B;  4DOV A;  4C8Q D;  2KRN A;  2Y90 A;  2L3S A;  2MPX C;  4D6W A;  1K8A U;  5GAO l;  1ZUY A;  3CC2 Q;  2MWO A;  3I55 T;  1MV3 A;  4FYW B;  4ZTF A;  2EYY A;  2CZ6 B;  4X1V A;  2XHC A;  2LQK A;  2DAQ A;  2YUN A;  1SPK A;  4RTW A;  3EHR A;  2M16 A;  1KK7 A;  5IHK A;  2AT1 B;  1BCO A;  1Q86 R;  3PGG A;  5HK0 A;  1RLP C;  5CKE A;  1BBZ A;  4F04 B;  1N9S A;  3KFV A;  1K9M U;  3Q1J A;  5CIU A;  1WQ7 A;  1MHN A;  1PRL C;  1FXX A;  3M57 A;  2HKN A;  1M9S A;  1YJ9 T;  1Z9Q A;  4HVV A;  1BYM A;  3V7R A;  3JB9 I;  5GAN d;  1CKB A;  2D8J A;  1AD5 A;  1TU0 B;  1WXB A;  5FWB A;  1R0B G;  2BKD N;  3FIF A;  3BDL A;  4BB7 A;  1Q7Y R;  2B8A A;  3CME A;  1Q81 R;  4LE9 A;  3LH5 A;  2O01 E;  1M27 C;  1M90 C;  3CCL T;  3CD6 T;  1YIJ Q;  1IB8 A;  3I55 A;  4LD6 A;  1YJN T;  2L3Q A;  2K9G A;  1QVG A;  1BKB A;  1M1F A;  1K4U S;  3VS3 A;  2CP5 A;  4M7D B;  2B86 A;  2OAU A;  4Y28 E;  1NJI C;  1VQ9 T;  2KDS A;  2CP3 A;  2CSI A;  3DLL A;  2NYS A;  2DE0 X;  4HT8 A;  2DZ9 A;  2O4X B;  2DBM A;  2HCK A;  2HNI A;  5GMK l;  2ZGW A;  3QZ9 B;  2OX7 A;  3CCS Q;  1Q86 U;  2KGT A;  4M75 A;  1YJW A;  3H41 A;  3KUF A;  4LDV A;  3QJY A;  3EFO B;  2M0Y A;  1RI0 A;  2EW3 A;  3VS0 A;  3A8O B;  4E7Z A;  1A0N B;  2E3H A;  3JCM V;  4BD3 A;  3L1A A;  1SHG A;  4EMK A;  1VQO Q;  4ATO A;  1QVG S;  4PJO C;  2FHD A;  4PL6 A;  4C92 B;  5KCH A;  4KRT A;  3CCL A;  3CD6 A;  1D0Z A;  1M4Z A;  2X3W D;  4X9D A;  1Q81 U;  4LDY A;  1D1C A;  4E7H A;  4V2S A;  3C94 A;  2CT4 A;  1M2V B;  2RQW A;  3QHS A;  1VQP A;  3SDZ A;  2RQT A;  3L2U A;  4HVU A;  4LD9 K;  4LN2 A;  1RAH B;  3CC4 T;  1JJ2 P;  1VQ9 A;  4CI0 C;  5DY9 A;  1WHG A;  3JAM E;  3RUX A;  2D6F A;  2F1L A;  3TCJ A;  1PKS A;  1MMG A;  2V26 A;  2EJF A;  4EDU A;  2ENM A;  1D0Y A;  3V8L A;  4OMO A;  2VGM A;  2X4J A;  3GF5 A;  3OYA A;  1TWB A;  3HRT A;  3CCJ T;  2MYS A;  2CZ1 B;  4BDZ A;  2ED1 A;  5IXF A;  1X2Q A;  1UEB A;  1EZZ B;  2BZ8 A;  2RHY A;  2ZPB B;  3UA7 A;  1Y0M A;  5A0L A;  3UDC A;  3OS1 A;  2BTT A;  1M90 R;  4M77 C;  4C92 E;  3I56 Q;  1OI1 A;  2QG9 B;  2YRD A;  3UA6 A;  2CP0 A;  4QVZ A;  1Y7X A;  1NYF A;  3CCM A;  3SD4 A;  4NOY A;  4JRQ A;  2NUP B;  1ZX6 A;  1WLP B;  4RTT A;  3OA6 A;  2D8H A;  2OTJ Q;  2E41 A;  5GJV B;  1WXU A;  2ABL A;  4FSS A;  4C8Q E;  1NJI R;  5HKC A;  5I2S A;  5GAN 7;  3SWN C;  3M9Q A;  3OB9 A;  3UF4 A;  3OYY A;  3PMI A;  2EYQ A;  1M1G A;  1UTI A;  4F7U G;  3SEM A;  5FW9 A;  5CQY A;  4A4E A;  4RCC A;  2GCX A;  2ESW A;  2F2V A;  4HCK A;  4O5V A;  1OPL A;  1KC8 C;  4HT9 A;  3CC7 T;  4KGV B;  1VQM A;  2PUK B;  4OMQ A;  4FYV B;  4C5H A;  2P4R A;  2HQX A;  5CQX A;  3CCJ A;  2EGA A;  1G3W A;  3FLG A;  1YWO A;  4ZGD B;  1JJ2 A;  3OSS C;  2K5L A;  2FZK B;  4PK4 A;  5LJ3 j;  1KQ1 A;  2YRC A;  4AG2 C;  1MV0 B;  3M53 A;  1ZSZ B;  4JJC A;  4M77 G;  4RTU A;  2SRC A;  7AT1 B;  4JDS A;  1M90 U;  2RPN A;  2DER A;  2DL4 A;  1H64 1;  4F7U E;  1LNX A;  2ZCF B;  2AK5 A;  4FYX B;  1X27 A;  5FU7 C;  2Z0W A;  2L89 A;  5KYW A;  1E7O A;  3E1S A;  1G5V A;  3NTH A;  2KK4 A;  1GCP A;  2FPD A;  3PIO A;  1WA7 A;  2JTM A;  4R55 A;  2IVW A;  3PMT A;  1NJI U;  3SFM A;  5KYX B;  3CME Q;  1YNZ A;  4EIK A;  4ZGE B;  1PHT A;  1JJ2 S;  4J7I A;  4DEY A;  2YLB A;  2JNG A;  2XKO C;  2JS2 A;  3I55 Q;  2LQW A;  1F1B B;  1SKU B;  4PJL A;  1M2O A;  4R0K A;  1ZSG A;  3G6E Q;  1MUZ A;  4FT2 A;  3CEY A;  5FLX E;  4MZM A;  2D0N A;  2LJ0 A;  3V8K A;  3V7C A;  1Y96 A;  4MZP A;  4F16 A;  2MWP A;  1D09 B;  3ZBD A;  3JCM b;  1JXO A;  1UHC A;  2FZC B;  2YRV A;  1QWF A;  4A54 A;  2RD1 A;  5CKB A;  3RIR A;  2O2O A;  2GQV A;  5A0G A;  3HPW A;  1YJW Q;  1NG2 A;  1TUD A;  1I5O B;  3JCM P;  2C0T A;  1B07 A;  3QYH B;  1W4S A;  1B3Q A;  1YIJ T;  4F17 A;  1Q82 U;  2GTO A;  3QII A;  1M1K C;  1VQN Q;  2XIC A;  1KC8 R;  5LJ5 f;  3JCM J;  3PVL A;  2ECZ A;  3CD6 Q;  3MJX A;  3E19 A;  3A8H B;  3KXT A;  3L2Q A;  4OF1 A;  5FU6 B;  3FDR A;  1W70 A;  3AT1 B;  3C4S A;  3OYH A;  1UB4 A;  3OMC A;  4ANJ A;  2K3B A;  1IO6 A;  1B34 B;  1VQP Q;  8ATC B;  1AEY A;  3S3N A;  2LQ8 A;  2MI6 A;  2DTH A;  3OS2 A;  3OYJ A;  1T0H A;  3CCS T;  5LJ5 j;  4OB1 B;  5A0D A;  4C92 F;  3JCM e;  5GAN 8;  2V8I A;  3KBG A;  4EMK C;  5LL6 S;  3EG0 A;  5AT1 B;  2DIG A;  2HBP A;  1KHC A;  3PNW C;  3P8B B;  1D1B A;  4C5G A;  1VQO T;  1I1J A;  3HSB A;  1GXI E;  2L0A A;  2LC4 A;  4C0G A;  5IAY A;  4PFO A;  1K9M C;  4C8Q F;  2P0K A;  2DEU A;  1YIJ A;  1SSH A;  2LNH B;  1WI7 A;  4J9I A;  3THK A;  2GBQ A;  2IG0 A;  2DZC A;  3EGD B;  5HCK A;  1ACM B;  2H3E B;  4A4F A;  1O75 A;  2V8K A;  2E5Q A;  3VRY A;  4BDY A;  4Q5W A;  3TSZ A;  2EYW A;  2LMJ A;  3CCM Q;  2EPD A;  3DB3 A;  4OB3 B;  3MKD A;  2COY A;  1M3C A;  5GMK j;  4IUP A;  1QVP A;  1SHF A;  3JV3 A;  4NS5 A;  1M5Q 1;  1S72 A;  2VUB A;  3CCS A;  5GAN 4;  2DX1 A;  2VKN A;  2EVR A;  4RKU E;  3PTA A;  3FB9 A;  4F7U A;  5KYY B;  4J8O A;  2O9S A;  4N0A A;  4ZN3 A;  5GAM f;  1TUC A;  4JZ3 A;  2DYB A;  2EGC A;  2DNU A;  1VQO A;  4E2F B;  1VQM Q;  3UPU A;  3I56 T;  4F7U F;  4KUI A;  3GP8 A;  1BCM A;  2KY9 A;  2RK1 A;  1BI3 A;  5IT9 E;  1M1K R;  1NEB A;  2QTV A;  1RAI B;  1V1C A;  1EX4 A;  2DET A;  4HVW A;  4OGE A;  5AYF A;  1TTH B;  4B6M A;  4HKE A;  2OTJ T;  2HDA A;  3QPH A;  1JU5 C;  1WHH A;  4C0D B;  1I5L A;  1RUW A;  2JTF A;  3M0T A;  4LUE A;  3TRE A;  2KAF A;  3IQL A;  4M7A B;  3I5S A;  2QGG A;  2K2M A;  4M7D D;  4NL3 A;  4HCC A;  1PWT A;  2CSQ A;  1Q81 C;  4BUG A;  2PNI A;  4Y91 A;  4E7K A;  3MP8 A;  2RJF A;  4LDU A;  5I2M A;  2D9T A;  3VYG A;  4AFQ C;  3VS2 A;  3MP1 A;  3TU4 K;  2JJ9 A;  3H6Z A;  1M8M A;  5LJ5 g;  4L6V 5;  1NYG A;  2J6O A;  1K9M R;  2XDB A;  4WTO B;  1G3Y A;  3QBY A;  1U5S A;  2YLC A;  3VS5 A;  4RMO A;  3PIP A;  3L2Z A;  2CYZ B;  1OU9 A;  1G3S A;  2FYK A;  2NUT B;  1UGP B;  4C92 D;  1H92 A;  4JS5 A;  3EH1 A;  3CCV A;  3NFC A;  2WSE E;  1YWP A;  3HRU A;  1QW1 A;  3JCM h;  2XID A;  3JCM W;  1J3T A;  2DL3 A;  5GAM h;  1FWZ A;  3G71 A;  2RM4 A;  2KXC A;  2OAW A;  4DQ2 A;  2LX7 A;  2EGE A;  3CME T;  3JRZ A; 
#chains in the Genus database with same CATH homology
 4M78 F;  1KG1 A;  1I4K 1;  4X9D A;  1Q81 U;  4LDY A;  4E7H A;  4XTX A;  2M9U A;  3DB4 A;  3VU3 C;  5GAN g;  4V2S A;  3C94 A;  3HKS A;  4GY5 A;  1HK9 A;  3QHS A;  3CCQ A;  3G4S A;  5FU6 C;  2XD0 A;  1VQP A;  3CPW A;  2DXU A;  3NTI A;  3SDZ A;  4M75 D;  3HFN A;  3L2U A;  5CVI A;  3OMG A;  4LD9 K;  2E64 A;  2VXE A;  3EFR A;  5LJ5 e;  1N6A A;  1WQW A;  4A4H A;  3CC2 T;  3G6E T;  3CXC A;  3CC4 T;  4P5N A;  1VQ9 A;  4CI0 C;  2RHX A;  5DY9 A;  3JCM c;  4C0F A;  3JAM E;  1QVF A;  2EIF A;  1X75 C;  1VQL A;  4JRK A;  3ER0 A;  3RUX A;  2D6F A;  3L2V A;  2L5Q A;  3JCM f;  3OS5 A;  4M75 B;  1I8F A;  4L5G A;  3CC7 A;  2RB6 A;  3TCJ A;  2EJF A;  4EDU A;  1BI1 A;  3CPF A;  1OZ2 A;  4OGC A;  1RL2 A;  1JBM A;  3C95 A;  3QSU A;  3RES A;  4PJO F;  3V8L A;  1YI2 T;  2DIQ A;  4KUD K;  4EMG A;  1LOJ A;  2VGM A;  3MHX A;  5EG2 A;  4M77 E;  2QQS A;  5GAO n;  2X4J A;  3GF5 A;  4ZTJ A;  3OYA A;  3JB9 G;  3HRT A;  3X26 B;  4BY6 C;  5CCA A;  3CCJ T;  1KHI A;  4EMK B;  3CCU A;  3BFM A;  2CZ1 B;  4DQ2 A;  4BDZ A;  4JS4 A;  2R5M A;  5GAN 6;  5C6S A;  3CBP A;  1YJW T;  1UEB A;  2RHY A;  4E47 A;  2FL7 A;  2ZPB B;  3RKY A;  5A0L A;  3MP6 A;  2RJD A;  3UDC A;  2E6Z A;  3OS1 A;  5GAM j;  4M77 C;  2CS7 A;  3UT1 A;  4L59 A;  4C92 E;  1YIT A;  1OI1 A;  3CCV T;  3WVE B;  4WF2 A;  1KQ2 A;  3CPW S;  1YCY A;  3L2R A;  3JB9 J;  2AHJ B;  4PKC C;  4RG2 A;  4XK8 E;  5LJ3 h;  4MML A;  5GAM g;  4QVZ A;  4Z02 A;  1Y7X A;  5GAN e;  1VQN T;  3CCM A;  3M56 A;  3CXC S;  2RJC A;  4BE1 A;  3SD4 A;  2MMP A;  4NOY A;  4JRQ A;  2KSS A;  1W2B A;  1QVF S;  3QDR B;  3HP9 A;  1BIA A;  3G71 T;  3OA6 A;  1XQH A;  2KQW A;  3S3O A;  2E41 A;  4B9X A;  4XTW A;  3QKJ A;  4MZT A;  2BIV A;  4C8Q E;  5HKC A;  5I2S A;  5GAN 7;  4DA4 A;  4C5I A;  3SWN C;  3CC2 A;  3G6E A;  5GMK i;  2L3R A;  4R56 A;  3M5A A;  3M9Q A;  3MEU A;  3OB9 A;  2QQ9 A;  2X4W A;  3N5B B;  1VQP T;  1TH7 A;  3OYY A;  4JLG A;  4A4K A;  2QQA A;  2E1H A;  2EYQ A;  1M1G A;  3PMI A;  4M75 E;  1DJ7 B;  4F7U G;  1O9S A;  1ZQ1 A;  3OYI A;  4EMH A;  5CQY A;  4X34 A;  3INZ A;  3AHU A;  2E12 A;  3BW1 A;  4C8Q C;  4A4E A;  4RCC A;  2GCX A;  4FT4 A;  3R6O A;  1I81 A;  2I2L A;  4ELY C;  1VQL T;  2P0Q A;  3JCM Q;  3URG A;  4II1 A;  4M7D G;  3OYG A;  1YI2 A;  4O5V A;  3GNF B;  5GAO q;  3JCM d;  1KC8 C;  4FIB A;  5GAM d;  2GFA A;  4HT9 A;  3E9F A;  4M75 C;  3CC7 T;  1VQM A;  3HHT B;  2PUK B;  1WPY A;  2MF2 A;  1NPR A;  4J83 A;  4MDW A;  5GMK h;  4C5H A;  5CQX A;  2HQX A;  3X28 B;  3CCJ A;  2A3L A;  4C0Z A;  3OYC A;  5KE2 A;  1G3W A;  1K8A C;  3FLG A;  1AHJ B;  4TVR A;  4IUR A;  5D6X A;  4ZGD B;  1JJ2 A;  3OSS C;  1WNL A;  4HCB A;  1W2B S;  2K5L A;  2D0Q B;  3LGF A;  5KH6 A;  4E7L A;  5GAM e;  1X6O A;  5LJ3 j;  3CCU T;  1KQ1 A;  1VIF A;  4XU2 A;  4M78 A;  4RCB A;  4XU3 A;  4BI4 A;  5J39 A;  3WVD B;  3CMA T;  5GAO m;  2VGN A;  2E65 A;  1NE8 A;  3M53 A;  1BI2 A;  5KCO A;  5LJ3 g;  1VQN A;  4EPC A;  4M7A E;  4M77 G;  3OYK A;  3ME9 A;  4JDS A;  1M90 U;  5HK3 A;  5D6W A;  2JVV A;  2H3J A;  3P8H A;  1H64 1;  3EAE A;  4HA8 A;  5CKH A;  4C0D C;  4F7U E;  1LNX A;  2ZCF B;  3GOX A;  3CCM T;  3V7S A;  3OYF A;  5FU7 C;  3M4G A;  1SSF A;  2L89 A;  4XTU A;  4M7A C;  4C92 G;  3OBY A;  3E1S A;  1G5V A;  4BE0 A;  3NTH A;  2KK4 A;  2DD5 A;  5CO7 A;  3PIO A;  4M7D E;  3HL8 A;  4N4H A;  3CCR T;  2WSF E;  2JTM A;  4R55 A;  2IVW A;  2RJE A;  3PMT A;  1NJI U;  3SFM A;  1KD1 C;  3JB9 F;  2E10 A;  3VYH B;  1Q82 C;  1VQ7 T;  1G3T A;  4PJO A;  4N0A C;  5CK9 A;  1Y07 A;  1X01 A;  4ZGE B;  3L42 A;  2K57 A;  2NLU A;  1U1S A;  1JJ2 S;  2DTI A;  4J7I A;  1KC8 U;  2LVM A;  4N4G A;  2YLB A;  1VIE A;  4M7D C;  4M78 D;  3OS0 A;  2DKG A;  3TEE A;  4KUL A;  2JNG A;  3S6W A;  4C8Q G;  4BI3 A;  2XKO C;  1JB0 E;  1VQK T;  3VUZ A;  5LJ3 d;  1KQS A;  2LT1 A;  1XNI A;  3G7Z A;  5GAN 2;  3OYE A;  2HAX A;  1D3B B;  2F5K A;  2CKK A;  3OY9 A;  4FT2 A;  4M75 G;  2JZ2 A;  1JRI A;  2PQW A;  4M78 B;  4ME7 A;  3CEY A;  5FLX E;  1HXD A;  2P4T A;  3LW5 E;  4IUV A;  4MZM A;  1IZ6 A;  5GAO r;  1VQM T;  3V8K A;  3V7C A;  3GLX A;  1Y96 A;  4MZP A;  1OZ3 A;  4C5E A;  2MWP A;  5LJ3 e;  2ZPH B;  4ZN1 A;  1B34 A;  1P92 A;  2ZPE B;  3ASK A;  3CMA A;  3E9G A;  2LRQ A;  1U1T A;  4PNO A;  3ZBD A;  1WJR A;  1UGR B;  3BY7 A;  5LJ5 h;  4B9W A;  2DPP B;  3A8G B;  5GAN 5;  3JCM b;  3CCE A;  1MGQ A;  2VV5 A;  2ZPI B;  5FRN A;  2DXC A;  2YRV A;  3QO3 A;  4ZGJ B;  4A54 A;  2M1H A;  3JCM g;  3SB2 A;  4PJO D;  4XAX B;  2RD1 A;  4KT0 E;  5CKB A;  1PSE A;  4QQD A;  4J5Y A;  2DTO A;  3RIR A;  4J6X A;  4JJN K;  1ZBX A;  3LWH A;  3FC3 A;  2DD4 A;  2GQV A;  4FSX A;  5A0G A;  3HPW A;  4YTL A;  1Q86 C;  2LX9 A;  2RI5 A;  2X35 A;  4A4G A;  4C92 C;  1K73 C;  2K5F A;  2PU9 B;  3CBM A;  3DKM A;  3JCM P;  2OTL A;  4IKF A;  2ZPF B;  3HRS A;  3QYH B;  2KVQ G;  2BUD A;  1VQ8 T;  4PJO B;  3CCR A;  1W4S A;  2PVO B;  1XTD A;  1YIJ T;  1KQS S;  2DXT A;  1KD1 U;  4M7A G;  1Q82 U;  1NPP A;  3QII A;  1VQ7 A;  4OMF B;  4BI8 B;  1M1K C;  2HQE A;  3X20 B;  2XIC A;  4M77 A;  3RMQ A;  2LDM A;  5LJ5 f;  2DO3 A;  3C12 A;  4RG8 A;  3JCM J;  4O6J A;  3LLR A;  4J6Y A;  3QJ6 A;  5L8R E;  5M9O A;  4JLI A;  2RH2 A;  3E19 A;  1BIB A;  3A8H B;  3KXT A;  1VQK A;  4NL2 A;  3L2Q A;  4QQ6 A;  4OF1 A;  2R5A A;  5FU6 B;  3F70 A;  3ZFJ A;  2P0P A;  3FDR A;  5CR2 A;  2V8J A;  2EQK A;  2LNV A;  4N4I A;  3GPL A;  1Q7Y C;  3C4S A;  4DOW A;  3OYH A;  1UB4 A;  2EAY A;  2EQJ A;  2RO0 A;  1Y96 B;  3OMC A;  4M78 E;  4M77 F;  2QI2 A;  3A8M B;  1VUB A;  3OYL A;  1H3Z A;  1B34 B;  2FVU A;  3VUB A;  2DEQ A;  1LJO A;  3GNG A;  2LCC A;  3OSV A;  3LYI A;  2WAC A;  3X24 B;  3S3N A;  4CRI A;  3VKI A;  3SWN A;  2LQ8 A;  3FEO A;  2MI6 A;  3FJP A;  3DLM A;  2DTH A;  3OS2 A;  5GAN 3;  3OYJ A;  2CGH A;  2X4X A;  2XG8 D;  5LJ5 j;  4XTY A;  3CCS T;  3S3M A;  3VJP A;  2QEX T;  2RI2 A;  4M78 C;  4OB1 B;  2XU8 A;  5A0D A;  1IRE B;  5CKF A;  1D3B A;  1QP2 A;  2PVG B;  4C92 F;  3JCM e;  2EKO A;  4ELZ C;  3NTK A;  2V8I A;  3BDU A;  3KBG A;  5GAN 8;  4EMK C;  1UGQ B;  5LL6 S;  3MEW A;  1VQ4 T;  2EFI A;  3I56 A;  3CBO A;  2DIG A;  3QXE B;  4M77 D;  4PLI A;  2XK0 A;  3MET A;  2HBP A;  1YJ9 A;  1N8R C;  1KHC A;  3MCA B;  4BY6 B;  1ZHI A;  3PNW C;  3CCE T;  3P8B B;  1EIF A;  2JUF A;  4C5G A;  1N9R A;  1VQO T;  5GAN f;  1YBY A;  2K3Y A;  3RER A;  3HSB A;  4PJO E;  1GXI E;  2LC4 A;  4C0G A;  5IAY A;  2X4Y A;  1VQ8 A;  3P8D A;  1K9M C;  1VQ5 A;  4C8Q F;  2R58 A;  2P0K A;  4E7J A;  4M77 B;  1YIJ A;  4XU0 A;  2F5T X;  1U8R A;  3QG1 A;  2G3R A;  4VUB A;  2OTJ A;  4HCZ A;  4LDX A;  4LDW A;  5CKD A;  2GF7 A;  1M1K U;  2CZ7 B;  2IG0 A;  4IUU A;  2OTL T;  2PUO B;  5J26 A;  2DZC A;  2E6N A;  4X9C A;  2K3X A;  2RHU A;  4KBM B;  4M75 F;  4OB2 B;  4A4F A;  1O75 A;  2V8K A;  2E5Q A;  4BDY A;  2RK2 A;  2JN0 A;  4Q5W A;  4J6W A;  2QQR A;  3OQ5 A;  2DVE A;  4QQG A;  4BE2 A;  2K2V A;  2QTX A;  2RHZ A;  2Y4X A;  3JB9 D;  3WXM B;  1PSF A;  2E70 A;  1Q7Y U;  3A8L B;  3DB3 A;  1OYX A;  3EFS A;  4OB3 B;  5LJ5 d;  5GAN j;  3M55 A;  2QQB A;  4DOV A;  4C8Q D;  2HD0 A;  3J81 E;  1YJN A;  4OP0 A;  2Y90 A;  3SWN B;  2K5I A;  5FRO A;  5GMK j;  4IUP A;  2RA2 A;  4XTZ A;  1QVP A;  5C0M A;  2VYT A;  2KMT A;  4NS5 A;  4D6W A;  1M5Q 1;  4QVC A;  3JCM X;  1K8A U;  1FX7 A;  5GAO l;  1BI0 A;  2QDY B;  3J80 E;  1S72 A;  2JOY A;  3J7A F;  4M7A A;  2MWO A;  2VUB A;  4IUT A;  3I55 T;  3CCS A;  4ZTF A;  5GAN 4;  2CZ6 B;  4C8Q B;  2QEX A;  2XHC A;  1UGS B;  2LTO A;  5DM7 R;  1Y71 A;  2LQK A;  2DAQ A;  2Y4Y A;  3FB9 A;  4GLK A;  2EQM A;  2F69 A;  4RKU E;  5J3B A;  3PTA A;  2MAM A;  2EJG A;  2M16 A;  4F7U A;  3JSC A;  2PVD B;  1N27 A;  1VQ4 A;  4J8O A;  4UC4 A;  1M8V A;  3RKX A;  4N0A A;  4ZN3 A;  4IUQ A;  5GAM f;  4M78 G;  1N8R U;  4M7A F;  3M58 A;  3MO8 A;  3OW2 A;  3PGG A;  4M7D A;  5HK0 A;  5CKE A;  1R8O B;  1VQO A;  4JRI A;  1N9S A;  3UPU A;  2A7Y A;  3OBW A;  3QZ5 B;  3I56 T;  3Q1J A;  1K9M U;  2GFU A;  5CIU A;  4F7U F;  2WSC E;  4J7F A;  4KUI A;  3GP8 A;  4MMK A;  1WQ7 A;  1MHN A;  2KY9 A;  1FXX A;  2RK1 A;  2RHI A;  1BI3 A;  1M9S A;  3M57 A;  5IT9 E;  1YJ9 T;  1BYM A;  1VQ6 T;  2O4X A;  3MEA A;  3V7R A;  5GAN d;  3JB9 I;  2XDP A;  4M7D F;  3O8V A;  3V8J A;  1QP3 A;  3QYG B;  4OGE A;  5AYF A;  4A53 A;  1VQ5 T;  4M7A D;  2XI9 A;  3OYD A;  3LWI A;  4HKE A;  5GMK m;  2OTJ T;  4MDX A;  3QPH A;  5FRM A;  2BKD N;  1WJQ A;  3FIF A;  3BDL A;  4BB7 A;  2B8A A;  2LT4 A;  4C0D B;  3JB9 H;  1I5L A;  2QXF A;  2JTF A;  4PJO G;  2ZZD A;  3QUI A;  4JUV A;  3RMS A;  3CME A;  5FU7 B;  5D6Y A;  4FU6 A;  3TRE A;  2KAF A;  5I21 A;  2C06 A;  4M7A B;  3RKW A;  2O01 E;  2QA4 T;  5GMK e;  1YHQ T;  1M90 C;  3CCL T;  4FL6 A;  3CD6 T;  3VV0 A;  4M7D D;  3M54 A;  4NL3 A;  4OVA A;  4C92 A;  3I55 A;  4LD6 A;  4F7U B;  4HCC A;  1YJN T;  4XU1 A;  4XQ3 A;  3OW2 S;  1Q81 C;  1V29 B;  4BUG A;  4Y91 A;  1QVG A;  4E7I A;  3CC4 A;  1BKB A;  1M1F A;  5A2Q E;  4FM4 B;  3OYM A;  1WJS A;  4E7K A;  3CCQ T;  3G4S T;  3MP8 A;  2RJF A;  2DJZ A;  4LDU A;  5I2M A;  3OYN A;  4M7D B;  1NZ9 A;  1S72 T;  2D9T A;  3PFS A;  3VYG A;  2OAU A;  3LX7 A;  4Y28 E;  3X25 B;  2YHT A;  5KE3 A;  3MP1 A;  3TU4 K;  1NJI C;  2L8D A;  1VQ9 T;  4OB0 B;  2KDS A;  3H6Z A;  5LJ3 f;  3ZEH A;  4XTV A;  1WGS A;  1XOV A;  5LJ5 g;  4L6V 5;  3PT9 A;  4BAC A;  3DLL A;  3LH0 A;  4C8Q A;  2K4Y A;  4HT8 A;  2XDB A;  2DZ9 A;  2O4X B;  2HNI A;  1G3Y A;  3QBY A;  5GMK l;  2ZGW A;  3QZ9 B;  2FB7 A;  1Q86 U;  1VQ6 A;  2YLC A;  4M75 A;  1K73 U;  3GIB A;  4RMO A;  2VXF A;  3PIP A;  2R57 A;  2EQU A;  3LGL A;  3L2Z A;  2CYZ B;  1YJW A;  3KUF A;  4LDV A;  3T9N A;  3QJY A;  3UWN A;  1G3S A;  3H8Z A;  3M59 A;  1RI0 A;  2FYK A;  1UGP B;  4C92 D;  2RI3 A;  3A8O B;  4JS5 A;  3M4Y A;  2DXB A;  3CCV A;  2EJ9 A;  4QW2 A;  3HFO A;  3NFC A;  5GAO p;  4QVD A;  2EWN A;  2M0O A;  2WSE E;  4PLL A;  3L1A A;  3JCM V;  4BD3 A;  3OYB A;  2VC8 A;  3FRN A;  4JRP A;  3A5Z B;  5IN1 A;  4EMK A;  4ATO A;  4PJO C;  1QVG S;  2FHD A;  5DLQ E;  3HRU A;  5DLO A;  4PL6 A;  1QW1 A;  5GAN h;  3L2W A;  1YIT T;  3JCM h;  2XID A;  3JCM W;  4C92 B;  5CAI A;  5GAM h;  1FWZ A;  2LCL A;  5KCH A;  3G71 A;  2RM4 A;  2CZ0 B;  2QA4 A;  1YHQ A;  2XDD A;  2ZPG B;  3CCL A;  3CD6 A;  2DK3 A;  1M4Z A;  3MEV A;  3CME T;  5HY6 A;  3JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...