3VYGA

Crystal structure of thiocyanate hydrolase mutant r136w
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
KPVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase subunit alpha
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
total genus 26
structure length 120
sequence length 120
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vygA00
4ZGEB 2ZPIB 1IREB 2DXBA 1QP2A 1PSEA 2O01E 3QYHB 4OB0B 4KT0E 1DJ7B 2PU9B 3A8MB 2CZ7B 3X24B 3A8HB 2PVOB 2CYZB 3VYGA 2ZZDA 2PUKB 3QZ9B 2DD5A 2DD4A 2ZPBB 3QZ5B 1JB0E 4OB1B 4OB3B 2DPPB 2WSCE 4Y28E 5L8RE 1GXIE 4RKUE 2D0QB 3A8LB 2ZCFB 2DXCA 3WVDB 4L6V5 1UGQB 2ZPEB 2AHJB 2ZPHB 2CZ6B 4FM4B 4ZGDB 3A8OB 1UGPB 3QXEB 1UGSB 3HHTB 2PUOB 3X26B 2CZ0B 2CZ1B 3WVEB 3A8GB 3QYGB 3LW5E 4OB2B 3X20B 3X25B 1V29B 1QP3A 2PVDB 2PVGB 3VYHB 2WSEE 3X28B 1PSFA 4ZGJB 2ZPFB 4XK8E 2WSFE 2ZPGB 2QDYB 1UGRB 1AHJB
chains in the Genus database with same CATH superfamily
1Q81R 4GY5A 3H8ZA 4E6RA 4ZN3A 4XTYA 2LP5A 2ROTA 2P0PA 5CKBA 3MP8A 4M78E 1RAGB 5IHIA 2QDLA 2CS7A 4J9EA 2DIQA 1FXXA 1VQNQ 4Q5WA 1H641 2LT4A 3E1SA 1KHIA 3RMSA 2HQXA 1M3CA 3JB9G 3LWIA 3HPWA 4FYVB 3F70A 4CC2A 5IH2A 3L2RA 3VUZA 3A98A 4C8QE 1OULA 3DLMA 3OBYA 5KYYB 3OYKA 2DPPB 1HK9A 1YWPA 2RNAA 2FEIA 1X01A 1QWFA 2E1HA 1YHQA 2CDTA 2D0QB 3REBB 5CK9A 3M56A 3L2QA 1E6HA 1T3SA 2F2XA 3SHWA 4ANJA 2J06A 3ASKA 4DBRA 1MV0B 4DBFA 1H3ZA 5KYYA 4EMKB 1Q95G 1W4SA 2YXYA 5CKDA 4J5YA 3S3MA 1RAHB 3PE0A 4J9IA 1IXDA 3EFRA 1Y96B 2CP0A 4AFZC 1U1SA 1M1KC 3NFCA 3ZL7C 2MIOA 2LNHB 4EMKA 3CC2T 4OMPA 2KEAA 2KROA 3E9GA 2DTIA 1BI3A 4R0KA 3G6EA 4N4GA 1UFFA 2WSFE 1Y96A 4IURA 4L5GA 4PL6A 3TSZA 2HQHA 4RTZA 4C0DC 2ZPGB 2HAXA 1VQ4T 1R77A 2CUBA 3RBBB 5KCOA 1NZ9A 1MGQA 2L5QA 2MI6A 3I5SA 1WYXA 2A08A 5CIUA 4M7AD 1S72T 1JO8A 2EQJA 2HDAA 2KAFA 2DJZA 5GAOq 2DZCA 1RUWA 1TUGB 4F04B 1VQ6Q 1G5VA 1QCOA 2LQKA 5FU7C 3CCMT 1VIFA 2DD4A 3QUIA 4KGVB 3SWNB 3QIIA 4IIMA 2RD1A 4HCBA 1Q81C 1YFNA 1TTHB 3FIFA 3H0FA 1QVPA 5GMKi 1IHVA 4FSXA 4XU1A 3O8VA 1AEYA 1GXIE 4RKUE 2ZAEA 2KNBB 3OY9A 1ZBXA 4FT4A 2RJDA 1M2VB 3SWNA 3CC2Q 3NMZC 3E19A 3HTRA 4XU3A 1O9SA 1BI2A 1QVGA 2CZ6B 4FM4B 1LCKA 1D1BA 2V26A 3PT9A 1M9SA 1YN8A 3CC7Q 1W6XA 1O75A 1X6OA 3M5AA 4BI4A 1BI1A 1UGSB 1M2VA 2E12A 1VQ4Q 4N4IA 5GAOr 5LJ5j 5D6WA 4DBQA 2SRCA 1ZSZC 2JS0A 2HD0A 1S72Q 3OYGA 2AZSA 1GBRA 1PWTA 1K8AC 2QTXA 4WF2A 2ZPFB 2KT8A 3INZA 4DEXA 1G83A 3DB3A 1YJ9A 3OW2A 4C92D 3VRYA 1AOJA 2QA4T 1HXDA 3QWXX 3CCMQ 1X6BA 4M77F 5GMKe 5KYNA 3CPWA 1BIAA 5FWBA 2CSQA 3QBYA 1KD1U 4V2SA 2WACA 4OB0B 1V76A 2LDMA 1Q82U 4C5GA 3OYLA 1CSKA 3KBGA 2PQWA 3A8HB 3MEWA 3M0SA 1VQ9T 1VYUA 2EGAA 2MOXA 3PGGA 3VKIA 2RK1A 1VYVA 5CQYA 4IKFA 3QDRB 5KYUB 2JM9A 1PC0A 1BB9A 2A0FB 4AFSC 1JB0E 3JCMc 1HSQA 3GOXA 2HL3A 2EYXA 1X69A 4LE9A 1KD1R 3AHUA 2FRWA 2M0YA 4FCYA 1UB4A 4QW2A 1Q82R 3CCRT 1YITT 5KYUA 4JRPA 1LVKA 1D0XA 2YDLA 1Q7YU 3CCLT 3M0UA 2OX7A 4L59A 2KBTA 2GF7A 4E7SA 2O2OA 5IXBA 2CH4W 3M58A 2QA4Q 1G3SA 2HSPA 4C0GA 3CCUT 2D0NA 3QXEB 4XTVA 2AKKA 4E7KA 5GAN8 1OEBA 2EYWA 2LC4A 1NM7A 2LJ3A 4RTWA 3VS5A 5IHNA 2PVDB 5I22A 4NS5A 1GL5A 1BK2A 5LJ5h 1VQ9Q 1IGQA 2JW4A 2RH2A 1Q7YR 4ZGJB 2HBWA 4PKCC 3JAME 4II1A 2KMTA 2VB6A 4NL3A 1RACB 3EHQA 3G71T 2QDYB 4RMOA 2EJ9A 2AKLA 1AVZC 1PRMC 4KH1B 1SHFA 2EBPA 2DX1A 1QP2A 1GCPA 2V1RA 2RO0A 1U8RA 1XNIA 1EZZB 2DJQA 1K0XA 1WFWA 2IIMA 3CCRQ 1OPLA 3GNFB 2X9HA 1YITQ 3JCMJ 2CH4A 2QI2A 4B6MA 1AD5A 4PJLA 4P5NA 3CCLQ 1BU1A 1MMNA 2EYQA 3EGUA 3LH5A 3RERA 5CAIA 2ECZA 3DKMA 2EJGA 3SB2A 3CCUQ 3JB9H 4OB1B 4FYYB 2DXTA 2GQIA 4BUGA 4OB3B 3EH1A 2QQRA 3V8LA 3CD6T 2RQUA 2I2LA 2VWFA 1VOMA 2DE0X 2VGNA 2GGRA 3C12A 2W0ZA 3R6OA 1AWWA 2LTOA 2DK3A 3NTHA 4M75B 5EG2A 1EIFA 5GAN6 2LQWA 2IVWA 3E2UA 1VQKT 2HL5C 2R5AA 4M78F 4M75D 2KQWA 5GANh 3G71Q 1MMAA 4E7IA 3ZFJA 4OMLA 3PVQA 1D0YA 1K73U 1KD1C 4BACA 1M8VA 4JS4A 1Q82C 4M75A 4J9DA 3GIBA 3LWHA 4ORZA 4KGXB 2M16A 2OTJT 1MV3A 1WI7A 4FYXB 2DTOA 2C0OA 4C8QF 3I9QA 2KDSA 1JJ2S 5GMKj 4XK8E 2M51A 1W2BS 2LCCA 2X4WA 1LNXA 2ED0A 2DFUA 4JJDA 1VYTA 4PLLA 4E47A 1UECA 1SEMA 2NWMA 2DVJA 1PSEA 3CD6Q 5LJ5f 2C0IA 4AFQC 4B9XA 4WCIA 3V8KA 2O9VA 2D8JA 4B9WA 3EG1A 4FT2A 1SG5A 5LJ5g 1VQMA 1YI2T 3JB9F 5FROA 1Q7YC 2QG9B 4M7DC 1QVFA 1VQ8A 2JM8A 5LJ5d 2K5IA 1WHGA 3EFOB 3CXCS 1PNJA 3CMAA 1I8FA 1G2BA 1VQKQ 3PFSA 3CCET 2JOYA 3A1PA 2L8DA 4N0AC 4BY6B 1CKAA 2XU8A 4LDVA 4HCZA 1KK7A 2BUDA 1C1AA 2QQSA 2CUDA 2WSCE 4M7DG 3RUXA 2ZCFB 3CC4A 5IXFA 2QQBA 3EFOA 5I2SA 2OTJQ 1JJ2P 3JCMQ 3G4SA 3R6NA 2H3JA 3EGXB 1W2BP 5A0LA 4F7UB 2DL8A 2CP7A 3MPUB 2H8HA 4XU0A 3TEEA 4PJOD 2L3SA 1FMVA 2E65A 2MK5A 3G6ET 2O9SA 2O31A 1VQNT 3QYGB 3EGXA 2YWWA 4KGZB 3VRZA 1OOTA 3LLRA 2DILA 4F7UA 5CVIA 4BD3A 4C0ZA 4M7DE 3EGDB 1NJIU 1LJOA 4XTWA 3H0IA 3C4SA 3CXCP 2QQAA 5CKEA 5FRMA 3M57A 2JUFA 2J6OA 1VQPA 4KRTA 1YJWA 3QJ6A 3CCEQ 3CCQT 1PG5B 3PNWC 3VS6A 4A4KA 3CPFA 1M3AA 3C94A 5CKFA 3EGDA 3HKSA 2PNIA 5LJ5e 5CCAA 5GANd 4M78B 2KE9A 2F2VA 4M7AF 5KE3A 2AT1B 5KYXB 1OQKA 2KXDA 3H41A 2EYYA 4FL6A 2CZ7B 2QEXA 2L3PA 3OSSC 2PVOB 1KG1A 2MCNA 1YCSB 5J26A 2M1HA 8ATCB 1RADB 3OYCA 2DD5A 4JZ4A 4IUTA 3G1JA 3OYBA 2XHCA 4JJCA 3TCJA 1TU0B 5KYXA 1VQ5A 4E7ZA 2DYBA 1T0JA 4ESRA 4C5IA 4OMFB 2J6KA 2E3IA 1VQOA 1M90U 3G6EQ 2FL7A 1AWXA 3ZEHA 3GLXA 2DXCA 4GLMA 1Y7XA 2EFIA 4EDUA 2LNVA 1C6VX 4R55A 1WHHA 2L3QA 3UWNA 3D7SB 1HJDA 3TU4K 3KFVA 4QVDA 3NTKA 4JLIA 1RAEB 1MUZA 1N9SA 5GAOl 2P4RA 1N9RA 1V1CA 1N8RU 1VQ7A 2L89A 1B34B 3CCQQ 2X3XD 4OVAA 5AYFA 2LVMA 2CZ0B 1YIJT 4QQDA 5GAMe 2YLCA 1FX7A 3TREA 3GP8A 3OB9A 5LL6S 4Z89A 3CMEA 1VQLT 1VQ6T 1EFNA 2E6NA 1QKXA 4BB7A 2JN0A 3VYHB 1X2QA 2P84A 2WSEE 3PVLA 4HA8A 5GANe 3EG2A 4HCCA 4JPBW 3I55A 1B34A 4C92F 2A7YA 1ZA2B 1AWOA 4ZTJA 5GAOm 1RI9A 4AFUC 2K5LA 5IT9E 4K11A 5GAOp 2MAMA 4X1VA 5IN1A 4A4HA 4ZGEB 1N8RR 1AWJA 3DB4A 1G8XA 4EPCA 1OV3A 3JCMV 1PKSA 3EG3A 4DEYA 3P8DA 4KT0E 4RTTA 2KYMA 4DQ2A 2CREA 1G3YA 2YUQA 2K4YA 2KRNA 3MO8A 2RHUA 2FPFA 1QVFS 3CC7T 3OYFA 1IB8A 4M7AC 2K2VA 3TQ7P 4LXCA 4CI0C 2MPXC 3OYAA 3I5RA 2GFUA 2LCLA 3EFSA 1U06A 2M0OA 3HFOA 3BW1A 2CT3A 2JT4A 4RTUA 2YUPA 1OU9A 3CCSA 5A0GA 1YIJQ 4M7AG 2HBPA 1R0CB 2QASA 2BTTA 2FRYA 2DL7A 2KVQG 3SWNC 1H92A 1VQLQ 2DYIA 1UGVA 1K9MU 4J9CA 4X9CA 3NTIA 4C0DB 2FZGB 2K5FA 3OMCA 4FSSA 2DTHA 1LPLA 3HP9A 1ARKA 2OAUA 1ZUYA 4XAXB 1GFDA 1RAFB 2OJ2A 1GRIA 1SRMA 1TG0A 3QWYA 4CRIA 1NLOC 2DRKA 4OB2B 2JTMA 2MMPA 4M7AE 1QVFP 2A3LA 3VS4A 1JXMA 1K9MR 3OA6A 2EQIA 2BZYA 4XTXA 1NYGA 1KIKA 5GMKl 2YUNA 3FRNA 2VKNA 1JQQA 3T9NA 3S3NA 1WX6A 4C92C 2B8AA 3OQ5A 3J7AF 4J6WA 3V7CA 1WQWA 3ZBDA 2LJ0A 1QLYA 3GNGA 2E64A 1IZ6A 4C5HA 2F2WA 2RB6A 2B86A 3X24B 3P8BB 4DA4A 2F69A 3UA7A 2X3WD 1JJ2A 4F14A 5GMKm 4C92G 2P0KA 1JBMA 1W2BA 3CCVA 1OPKA 4QVZA 2EQMA 2DA9A 5IHKA 3SFMA 2ZPBB 4QQGA 2X35A 3G7ZA 1N8RC 3A5ZB 1YJNT 2GCXA 4ZTFA 3BFMA 1D3BB 3RIRA 1KC8U 1D1CA 2XDPA 4Y28E 1WJQA 2COYA 2DIGA 3J80E 2L3RA 2E41A 4FW2A 3PMIA 4RTXA 2DL4A 1N6AA 3VS0A 2YRDA 2VC8A 1ZBJA 1PM3A 2ZPEB 2ZPHB 2C0TA 3CXCA 1D3BA 5GAN5 1WZOA 4C92E 2MWPA 2ED1A 1X6GA 4F16A 2K79A 4ZGDB 3I56T 5KYWB 2DEUA 2RI3A 5GAMj 3CQTA 2D1XA 4RCBA 3JRZA 3CC2A 2HQEA 2FHDA 2CP6A 1A0NB 1KC8R 4DOWA 4FU6A 3MEAA 4IUQA 5GANj 1BIBA 5L23A 2QQ9A 1QP3A 4NL2A 2Y4YA 5FWCA 3RKXA 3L42A 3TSWA 2BKDN 5KYWA 2XI9A 1WA7A 5J3BA 5A0DA 2RHYA 1UHFA 3OS2A 1VQ4A 1UE9A 1QWEA 4JRQA 4O5VA 1GCQA 3M0TA 3QDFA 4RG2A 3RNJA 3H6ZA 3JCMh 1VUBA 3VV0A 1WQ7A 2GFAA 3UATA 1YJNQ 2EGEA 1WJSA 5GJWB 3FLGA 3JCMP 4A53A 2YRCA 2PU9B 2FZKB 5LJ3h 3CCMA 1X75C 1Z9ZA 1K9MC 2LCSA 3M55A 1FMWA 2P0QA 1WNLA 4HT9A 4X9DA 4WTOB 4JDSA 2OTLT 2EPDA 2PZ1A 3I56Q 4KH0B 3ER0A 1M27C 3M0RA 4M7DF 2LRQA 1SSHA 2D9TA 3GBQA 1B7TA 3JCMX 5C0MA 5HKCA 3FJ5A 1NYFA 2LMJA 4N4HA 2XIDA 2J05A 3WVDB 1Y07A 1KQSS 2V1QA 3J81E 2JJ9A 3VS2A 4OMQA 2DLPA 4A4GA 3MEUA 2J6FA 2A37A 4HXJA 3UA6A 4BE1A 2DKGA 1U1TA 4M77B 3RKWA 2KRMA 2ENMA 2KI7A 3UDCA 1VQMQ 3CBPA 5J39A 4PLIA 2CZ1B 5CKHA 2K2MA 4Z02A 2XICA 4M77D 2R57A 4OMMA 2DL5A 1VQ8Q 2HKNA 5GAMh 1YCYA 3CMAQ 3RKYA 5FU6C 3X28B 5I11A 1H3HA 3N5BB 1PD1A 4M77A 2MWOA 1HYOA 4EMGA 4M75G 3LH0A 2KY9A 1T0HA 3QPHA 3CCJT 1NEBA 3BDUA 2OTLQ 3SD4A 4TVRA 2JS2A 3CC4Q 3JSCA 2K3YA 2DBKA 1AZGB 1VQ9A 4OGEA 3G4SQ 2J7IA 3H0HA 1TUCA 1DJ7B 5M9OA 3VS3A 2DL3A 1KQSP 2LJ1A 4Y91A 2EKOA 1RLPC 4JUVA 2LX7A 1R0BG 2GTOA 3META 3JCMg 1BCOA 4ELYC 4M75E 2BIVA 3THKA 1K73R 3CCRA 3OYDA 1PHTA 1YITA 3JCMd 1QMCA 2ATCB 3CCLA 1NE8A 4R56A 1NEGA 3EG0A 2X51A 1M5Q1 3OS5A 2E10A 2V8KA 2XDDA 1ZHIA 1WJRA 2VXFA 2FG0A 4J9HA 3OYNA 3CCUA 1F1BB 4UC4A 5LJ3d 1YHQT 1ZA1B 1B07A 1ZQ1A 1S1NA 2NUTB 4A4EA 3CCJQ 4E7JA 1UJYA 2K9GA 4ELZC 1TH7A 1TSFA 4GBQA 1LOJA 4PJOC 1QW1A 2XK0A 2RJEA 2CGHA 2RMOA 4XQ3A 3RESA 2E5KA 4J9FA 5A2QE 2KXCA 2O88A 2R5MA 2NUTA 3L1AA 1TWBA 1M1KU 2I0NA 3G71A 1I0CA 4OMNA 4MDWA 1GFCA 2E4HA 1WXTA 4QT7A 1UJ0A 4PJOG 5FLXE 1I07A 4J9GA 4J7IA 1VQOQ 3HRTA 2RQVA 2R58A 3EH2A 4F7UG 1SKUB 5GAMf 3UF4A 2DAQA 1OX9A 4QVCA 4JJBA 1MMGA 3QYHB 1M8MA 2FYKA 4N0AA 3ULRB 2DO3A 5GAMg 5GANf 3MKDA 3JCMe 2M02A 3JCMW 1ZSGA 2C06A 1M1KR 5GAMd 1VQ7Q 5GANg 1UUEA 4J6XA 3QHSA 1YHQQ 3CD6A 5I2MA 2HNIA 3CCST 2HCKA 4J83A 2EW3A 4PJOE 1UEBA 5LJ3e 2Y4XA 3JV3A 3CMEQ 1NG2A 4J7FA 4F7UE 1SPKA 1U3OA 2JTFA 3RDVA 1RLQC 2GTJA 2X4XA 4M78D 2IPOB 2ROLA 5L8RE 4LDUA 2JXBA 4A4FA 4MZTA 3MEVA 4LDXA 1NJIR 1VQKA 4AMCA 3OS1A 1X27A 2MYSA 5D7UA 4OP0A 4M78A 1UGQB 2D8HA 3NPFA 4C8QB 2G3RA 5FRNA 4RUGA 2L2PA 2V8IA 3U23A 3BE3A 4IUUA 4Y92A 1IGUA 3REAB 2XD0A 1K73C 5C6SA 4C8QD 5ECAA 2BZ8A 2IG0A 4BDYA 3V7SA 2OTJA 1Z9QA 2K3BA 4O6JA 4DOVA 2BE9B 4RG8A 2KRSA 4LD6A 2KR3A 4LDWA 4C8QA 3OYJA 2E6ZA 1KHCA 2D6FA 2EVRA 1K4US 2RQRA 3BY7A 1I81A 4MDXA 5IAYA 2DM1A 2BE7D 2AIRB 2HSEB 2CSIA 3VJPA 2RJCA 2QTVA 2RK2A 1E7OA 1GBQA 1K8AU 2F5TX 2RHIA 4PJMA 3CCSQ 3JB9D 4AG2C 1WIEA 2JVVA 2NYSA 1SSFA 3UT1A 2RI5A 4MZPA 2DXUA 1WHMA 1YJ9T 4EMKC 1YI2A 2SEMA 1M90R 2F1LA 3GF5A 3OYIA 2VXEA 3CCVT 2JZ2A 2GQVA 4MZMA 1G3WA 1OZ2A 3Q1JA 5GAN2 3CCEA 9ATCB 4HT8A 3PIPA 4ATOA 2KYBA 4HVUA 3C95A 1KJWA 2QK0A 3QZ9B 3M0PA 4CC4B 3QZ5B 4IIOA 4Z8AA 2JMAA 1K8AR 1P92A 4JJNK 3LGLA 1NLPC 1K1ZA 2CP3A 3OYMA 5HCKA 3TVTA 1I4K1 4DBHA 3ME9A 2DMOA 2JTEA 4NOYA 3MCAB 1WHLA 3C0CA 4LUDA 2V8JA 1VQNA 2VYTA 1NPRA 1SRLA 4D8KA 3LYIA 5KE2A 1T3LA 5HK0A 3HHTB 2PUOB 3M0QA 4LD9K 1QCNA 2K6DA 4QKUA 1WPYA 1HD3A 1MNDA 1YJ9Q 3OBWA 2NLUA 3LW5E 1NJIC 4M7AB 3X25B 3CCVQ 2EYZA 1KQSA 5KCHA 3M53A 3IQLA 3JCMb 2RI2A 1MNEA 3CCQA 1IHWA 3FJPA 1W70A 4HVWA 2DETA 2QAZA 4M7AA 5HY6A 2DERA 1N27A 4BDZA 2ZPIB 3KUFA 1QCFA 2CP2A 2ZGWA 5FU7B 4AT1B 5CO7A 1SHGA 4M4ZA 2EWNA 2OI3A 2EQUA 4BI3A 3A8MB 2QGGA 5D6YA 5DM7R 4XU2A 2CYZB 1BKBA 4D6WA 3EHRA 4OGCA 1PKTA 2PUKB 1M4ZA 4C0FA 1PD0A 2BZXA 2X4JA 5LJ3j 4MMLA 5DLOA 1NBEB 5CQXA 1BI0A 1AZEA 5KH6A 1M90C 5CR2A 1M30A 1BYMA 2LZ6B 1OU8A 2ESWA 1TUDA 4PJNA 2G6FX 1ACMB 1IRXA 3EAEA 1OX8A 3A8LB 1IO6A 4CC3A 1WGSA 4LNPA 4FIBA 1BBZA 4IUPA 2RN8A 3FEOA 4C92B 1M1GA 2KT1A 3M59A 1TXQA 1X2KA 1YIJA 1D0ZA 1ZSZB 2FB7A 1JXOA 2DNUA 2VGMA 3LGFA 2KGTA 3RMQA 3PTAA 1YWOA 1UGPB 1VQLA 1VQ6A 3HFNA 3WVEB 1KQ2A 2DF6A 2YUOA 4C92A 3L2ZA 5GAOn 1BCMA 1WXBA 3JB9I 1X43A 3RR6A 2FVUA 2VUBA 1ZSZA 1XJWB 3AT1B 2HEQA 4M75F 3OYEA 1PSFA 3BDLA 1JU5C 1XOVA 1Y71A 1GCQC 1B3QA 1WLPB 3HL8A 4LUEA 1NPPA 4FW1A 2A28A 3MHXA 2YT6A 2DVEA 3OYYA 4OF1A 1I5OB 2VV5A 4ZNXA 1FYNA 8AT1B 4E7HA 2QYZA 1IREB 2VASA 2O01E 3FB9A 1W1FA 4PJJA 3CC7A 4MMKA 5AT1B 3S3OA 3NGPA 1I5LA 4EIKA 2W10A 2F5KA 2XKOC 1ZX6A 4QQ6A 2YHTA 3DLLA 2EKHA 4PK4A 1WXUA 2CT4A 3M9QA 2ZZDA 1M2OA 1Y0MA 2JNGA 1VQMT 1S72A 1RAAB 4BI8B 1AT1B 4VUBA 2LQ8A 2JMCA 3MP6A 2QGFB 2RM4A 1VQ8T 7AT1B 2O4XB 2KSSA 2L0AA 4OMOA 2LX9A 4F17A 1M3BA 3GPLA 3CMAT 5DY9A 1UHCA 3FDRA 1H8KA 1K0SA 2X4YA 3HRUA 1OZ3A 3QO3A 2AZVA 1CKBA 2COZA 2AK5A 4KULA 2RQTA 3VS7A 2O4XA 3CC4T 1N5ZA 4J9BA 2HZYA 5GAN4 2DBMA 4HCKA 3I35A 3G4ST 2RJFA 3E9FA 3L2VA 3M54A 2LT1A 3V7RA 3A8GB 3L2UA 1J3TA 1R8OB 3OMGA 3NHNA 2QXFA 2RHZA 4M77C 2P4TA 4PJOF 1UTIA 1RAIB 2RQWA 3SDZA 1FWZA 4F7UF 1G3TA 4FYWB 1XQHA 1K76A 3V8JA 1QKWA 4M75C 3QG1A 2E70A 1I1JA 4M77G 3PMTA 2HMAA 3URGA 3OYHA 1ZUUA 5DLQE 1VQPT 1YJWT 2VVKA 1Q86U 3VU3C 2QA4A 2RF0A 2RPNA 4ME7A 4A63B 3QKJA 2DZ9A 2YLBA 4C5EA 2ABLA 5GAN7 1YJNA 1WDXA 1KQ1A 3OS0A 1QQJA 3JB9J 1PCXA 1MMDA 3KXTA 2NUPB 1WHKA 2QEXT 1QVGS 1KC8C 4RTYA 4XTUA 2LQNA 3H9NA 1SF9A 1RL2A 4E2FB 4D8DA 4KUDK 4LN2A 3SEMA 5FU6B 2XDBA 3MJXA 2RA2A 1OYXA 4ZN1A 2COWA 4M77E 1VQ5T 5GJVB 5HK3A 1VIEA 1M1FA 1JEGA 1Q86R 3FC3A 3JCMf 2YSQA 2NUPA 2DEQA 3OSVA 4PNOA 1JRIA 3EG9B 4IUVA 1D09B 3M4GA 4GLKA 4HKEA 3I56A 4L6V5 1VQOT 4JLGA 2AHJB 3L2WA 4JRKA 4E7LA 5LJ3f 4A54A 4KUIA 1PRLC 4AG1C 2H3EB 3OW2S 1E6GA 2XMFA 3A8OB 2DRMA 2K3XA 2YRVA 3X26B 5LJ3g 3EG9A 3CPWS 5D6XA 3HRSA 1VQPQ 4BY6C 1YJWQ 1VQ7T 1V29B 4X34A 1FMKA 4LDYA 3S6WA 1Y57A 2PVGB 1C0MA 2CKKA 1KSWA 1MHNA 4J8OA 1QVGP 3CMET 2FPDA 1RI0A 4RCCA 3CBOA 2QEXQ 1WHJA 4Z88A 2EQKA 3I55T 1ZUKA 3HSBA 2EIFA 2DXBA 4M7DB 2XG8D 1RABB 2OAWA 3UPUA 2Y90A 2K7AA 2M9UA 4JZ3A 1VQ5Q 1XTDA 4M7DD 3PIOA 1TOVA 4BE2A 3M4YA 2OTLA 3VYGA 4JS5A 1ABOA 5FW9A 4RTVA 2E5QA 1YNZA 2HKQB 4M7DA 1ZLMA 3OW2P 4PJOB 3MP1A 4J6YA 2E3HA 3CPWP 4HVVA 4YTLA 2A36A 3QSUA 5GAN3 1UG1A 4PFPA 4XTZA 1YBYA 1EX4A 1VA7A 1D1AA 1K9AA 1OI1A 2GNCA 2EJFA 3O5ZA 2EGCA 4PJOA 2RHXA 4M78C 2MF2A 2FO0A 4KBMB 3VS1A 1YI2Q 2GBQA 3VUBA 1Q81U 2KK4A 1TS9A 5EC7A 3I55Q 2EAYA 2FPEA 3P8HA 4M78G 5I21A 3CBMA 1Q86C 6AT1B 4C8QC 4JRIA 4EMHA 3X20B 1ABQA 5GMKh 2CP5A 3CEYA 2K57A 1KFZA 3CCJA 2Z0WA 1U5SA 1YP5A 3QJYA 4PFOA 4PFZA 4BE0A 3LX7A 1UDLA 2FZCB 3WXMB 2NUZA 4C8QG 4CC7A 1UGRB 2PTKA 1AHJB
chains in the Genus database with same CATH topology
2GFAA 4BDZA 4GY5A 2ZPIB 3H8ZA 1WJSA 4ZN3A 4XTYA 3KUFA 3FLGA 2P0PA 1PSEA 5CKBA 3MP8A 5LJ5f 3JCMP 4B9XA 2ZGWA 5FU7B 4A53A 4M78E 3V8KA 5CO7A 2EWNA 2EQUA 4BI3A 4B9WA 2PU9B 3A8MB 2CS7A 5LJ3h 4FT2A 3CCMA 5LJ5g 1X75C 2DIQA 1FXXA 5D6YA 1VQMA 5DM7R 1YI2T 4XU2A 1K9MC 3JB9F 4Q5WA 5FROA 1Q7YC 2CYZB 3M55A 1BKBA 1H641 4D6WA 2LT4A 2P0QA 3E1SA 4OGCA 1WNLA 1KHIA 3RMSA 4M7DC 1QVFA 2HQXA 1M4ZA 2PUKB 4C0FA 3JB9G 1VQ8A 5LJ5d 2X4JA 5LJ3j 3HPWA 3LWIA 2K5IA 3F70A 4MMLA 4HT9A 4X9DA 3CXCS 4JDSA 3CMAA 5DLOA 1I8FA 2OTLT 5CQXA 3PFSA 3CCET 1BI0A 2JOYA 2L8DA 4N0AC 4BY6B 3L2RA 3VUZA 2XU8A 5KH6A 4C8QE 3ER0A 4LDVA 1M90C 5CR2A 4HCZA 1BYMA 4M7DF 3DLMA 3OBYA 2BUDA 2LRQA 3OYKA 2DPPB 2QQSA 1HK9A 2D9TA 2WSCE 1X01A 2E1HA 1YHQA 4M7DG 3EAEA 2D0QB 3A8LB 3JCMX 3RUXA 5C0MA 5CK9A 3M56A 5HKCA 2ZCFB 3L2QA 3CC4A 2QQBA 5I2SA 4N4HA 1WGSA 2XIDA 3WVDB 1Y07A 4FIBA 1KQSS 3ASKA 4IUPA 3JCMQ 3J81E 3G4SA 2H3JA 3FEOA 4C92B 5A0LA 1M1GA 4A4GA 1H3ZA 3MEUA 4F7UB 3M59A 4EMKB 4XU0A 4BE1A 2DKGA 1YIJA 1W4SA 1U1TA 2FB7A 3TEEA 3LGFA 2VGMA 4PJOD 3RMQA 3PTAA 4M77B 3RKWA 1UGPB 4J5YA 5CKDA 1VQLA 1VQ6A 3UDCA 3S3MA 2E65A 3CBPA 5J39A 3EFRA 2CZ1B 4PLIA 3HFNA 3WVEB 1KQ2A 5CKHA 1Y96B 3G6ET 4Z02A 1VQNT 3QYGB 1U1SA 2XICA 4M77D 1M1KC 2R57A 3NFCA 4C92A 3LLRA 3L2ZA 5GAOn 3JB9I 4F7UA 5CVIA 4BD3A 4EMKA 2FVUA 2VUBA 4C0ZA 1YCYA 5GAMh 3CC2T 4M7DE 3RKYA 5FU6C 3X28B 1NJIU 3E9GA 1LJOA 2DTIA 3N5BB 4M75F 4M77A 4XTWA 1PSFA 3BDLA 1BI3A 3OYEA 3G6EA 1XOVA 1Y71A 2MWOA 3C4SA 4EMGA 2QQAA 5CKEA 3HL8A 4N4GA 5FRMA 4M75G 3M57A 2WSFE 1NPPA 1Y96A 2JUFA 4IURA 4L5GA 3LH0A 2KY9A 4PL6A 3QPHA 1VQPA 3CCJT 1YJWA 4C0DC 3MHXA 2ZPGB 2DVEA 3OYYA 3QJ6A 3BDUA 4OF1A 2VV5A 3CCQT 4A4KA 3PNWC 3SD4A 4TVRA 2HAXA 4E7HA 1VQ4T 3CPFA 3JSCA 3C94A 1IREB 5CKFA 3HKSA 5LJ5e 2K3YA 5CCAA 4M78B 2O01E 5GANd 3FB9A 5KCOA 1NZ9A 1VQ9A 1MGQA 2L5QA 2MI6A 4OGEA 4MMKA 5KE3A 3CC7A 4M7AF 3S3OA 5CIUA 1I5LA 1DJ7B 5M9OA 2F5KA 2XKOC 4QQ6A 4FL6A 2CZ7B 1S72T 4M7AD 2EQJA 2QEXA 4M7DB 2YHTA 2KAFA 3OSSC 2PVOB 2DJZA 1KG1A 3DLLA 5GAOq 2DZCA 4Y91A 3M9QA 2EKOA 1G5VA 5J26A 4JUVA 2ZZDA 2M1HA 2JNGA 2LQKA 5FU7C 3OYCA 3CCMT 2DD5A 3META 1VIFA 1VQMT 2DD4A 3QUIA 4IUTA 3SWNB 3JCMg 4ELYC 3QIIA 3OYBA 2XHCA 3TCJA 4BI8B 2RD1A 4HCBA 1Q81C 1VQ5A 4M75E 4VUBA 3FIFA 2LQ8A 1QVPA 2BIVA 3MP6A 4C5IA 3OYDA 5GMKi 3CCRA 1YITA 4OMFB 2RM4A 1VQ8T 2O4XB 3JCMd 2KSSA 4FSXA 2LX9A 4XU1A 3O8VA 3CCLA 3GPLA 1VQOA 5DY9A 3CMAT 1M90U 1NE8A 2FL7A 4R56A 3FDRA 3ZEHA 1GXIE 4RKUE 1M5Q1 3OS5A 2E10A 2V8KA 3OY9A 3GLXA 1ZBXA 4FT4A 2DXCA 2RJDA 2XDDA 1Y7XA 1ZHIA 2EFIA 3SWNA 4EDUA 2X4YA 1WJRA 1OZ3A 2VXFA 3HRUA 2LNVA 3QO3A 4R55A 3OYNA 3CCUA 4UC4A 5LJ3d 3UWNA 3E19A 1YHQT 4KULA 4XU3A 1O9SA 1BI2A 2O4XA 3TU4K 1QVGA 4QVDA 2CZ6B 4FM4B 1ZQ1A 3CC4T 3NTKA 3PT9A 1M9SA 1Q7YU 4JLIA 1N9SA 5GAN4 4A4EA 5GAOl 1N9RA 1O75A 4E7JA 1N8RU 1X6OA 3M5AA 4BI4A 2L89A 2RJFA 3G4ST 3E9FA 1VQ7A 1B34B 1BI1A 1UGSB 4ELZC 1TH7A 4OVAA 5AYFA 3L2VA 2E12A 2LVMA 1LOJA 4N4IA 3M54A 5GAOr 5LJ5j 2CZ0B 1QW1A 2LT1A 2RJEA 2XK0A 2CGHA 4QQDA 3A8GB 5D6WA 3V7RA 5GAMe 2YLCA 3L2UA 1YIJT 4XQ3A 1FX7A 3TREA 3GP8A 3OB9A 5LL6S 1R8OB 3OMGA 1VQKA 3RESA 5A2QE 3CMEA 1VQLT 2R5MA 1VQ6T 1S72A 2E6NA 4BB7A 2JN0A 3VYHB 2HD0A 3L1AA 2QXFA 1M1KU 2WSEE 2RHZA 4HA8A 4M77C 5GANe 3OYGA 2P4TA 4PJOF 3G71A 4HCCA 1N27A 1K8AC 2QTXA 3SDZA 4MDWA 3I55A 1B34A 4C92F 2A7YA 4WF2A 1FWZA 2ZPFB 3INZA 4F7UF 4ZTJA 1G3TA 5GAOm 3DB3A 4PJOG 1YJ9A 5FLXE 3OW2A 4C92D 2QA4T 2K5LA 5IT9E 1HXDA 4J7IA 1XQHA 3V8JA 4M77F 3HRTA 2R58A 4F7UG 5GAOp 2MAMA 4M75C 5IN1A 4A4HA 5GMKe 4ZGEB 5GAMf 3CPWA 3QG1A 1BIAA 2E70A 3QBYA 2DAQA 4M77G 3PMTA 3DB4A 2WACA 3URGA 4QVCA 4EPCA 3OYHA 5DLQE 1KD1U 4V2SA 3QYHB 4N0AA 4OB0B 2FYKA 3JCMV 1YJWT 1VQPT 2LDMA 3VU3C 2QA4A 1Q82U 1Q86U 4C5GA 2DO3A 3OYLA 3P8DA 4KT0E 5GAMg 4ME7A 5GANf 4DQ2A 1G3YA 3KBGA 2PQWA 2K4YA 3MO8A 3A8HB 2DZ9A 2YLBA 2RHUA 3MEWA 3QKJA 4C5EA 3JCMe 3JCMW 1VQ9T 1QVFS 2C06A 3CC7T 5GAMd 5GAN7 3OYFA 3PGGA 3VKIA 5GANg 2RK1A 1YJNA 4M7AC 2K2VA 4J6XA 1KQ1A 3QHSA 3OS0A 3JB9J 4CI0C 5CQYA 3OYAA 4IKFA 5I2MA 3QDRB 3KXTA 2QEXT 2HNIA 2GFUA 3CCST 2LCLA 3CD6A 1QVGS 4J83A 4PJOE 1KC8C 4XTUA 1UEBA 3EFSA 5LJ3e 2Y4XA 1JB0E 3JCMc 3GOXA 1RL2A 4J7FA 4F7UE 2M0OA 4KUDK 2JTFA 3HFOA 3BW1A 5FU6B 2XDBA 2RA2A 1OYXA 4ZN1A 2X4XA 3CCSA 4M78D 5A0GA 3AHUA 4M7AG 4M77E 1VQ5T 2HBPA 5L8RE 4LDUA 1VIEA 1M1FA 5HK3A 4A4FA 1UB4A 4MZTA 3MEVA 4QW2A 3JCMf 3FC3A 3CCRT 2KVQG 3SWNC 1YITT 2DEQA 4LDXA 4JRPA 3OSVA 4PNOA 1JRIA 1K9MU 4X9CA 3M4GA 3NTIA 4GLKA 4IUVA 4HKEA 3OS1A 4OP0A 4C0DB 3I56A 2K5FA 4L6V5 1UGQB 3OMCA 4M78A 4L59A 2DTHA 3CCLT 1VQOT 4JLGA 2AHJB 3L2WA 3HP9A 2OAUA 4JRKA 2GF7A 4C8QB 2G3RA 4E7LA 5FRNA 2V8IA 5LJ3f 4A54A 4KUIA 4IUUA 4XAXB 3M58A 1G3SA 4C0GA 3CCUT 3OW2S 5C6SA 1K73C 2XD0A 3A8OB 4C8QD 3QXEB 4XTVA 2K3XA 4CRIA 2YRVA 3X26B 5LJ3g 2IG0A 4BDYA 3V7SA 2OTJA 3CPWS 4O6JA 4E7KA 4DOVA 4RG8A 5GAN8 5D6XA 2LC4A 3HRSA 4BY6C 4OB2B 4LD6A 4LDWA 4C8QA 1VQ7T 3OYJA 1V29B 2JTMA 4X34A 2MMPA 2E6ZA 1KHCA 4LDYA 3S6WA 2D6FA 2PVDB 4M7AE 2PVGB 4NS5A 2A3LA 3BY7A 1I81A 2CKKA 4MDXA 5IAYA 5LJ5h 3OA6A 2RH2A 4ZGJB 3VJPA 1MHNA 2RJCA 4J8OA 3CMET 1RI0A 4PKCC 2RK2A 4RCCA 4XTXA 3JAME 4II1A 1K8AU 2F5TX 2KMTA 2RHIA 3CBOA 5GMKl 3JB9D 3FRNA 4NL3A 2JVVA 3G71T 2QDYB 2EQKA 4RMOA 1SSFA 2EJ9A 3UT1A 3I55T 3T9NA 3S3NA 4C92C 2RI5A 3HSBA 2B8AA 2EIFA 3OQ5A 4MZPA 3J7AF 2DXUA 2DXBA 1YJ9T 4J6WA 1QP2A 4EMKC 3V7CA 2RO0A 1YI2A 1WQWA 3ZBDA 3GF5A 1U8RA 2XG8D 3OYIA 3UPUA 2VXEA 3GNGA 2Y90A 2E64A 1IZ6A 3CCVT 2JZ2A 1XNIA 2M9UA 4C5HA 2RB6A 1XTDA 2GQVA 4MZMA 1G3WA 3X24B 4M7DD 1OZ2A 3P8BB 3PIOA 4BE2A 3Q1JA 2F69A 3GNFB 4DA4A 5GAN2 3JCMJ 3M4YA 2QI2A 3CCEA 2OTLA 3VYGA 4HT8A 3PIPA 4JS5A 1JJ2A 4P5NA 4ATOA 5GMKm 4C92G 2P0KA 1JBMA 3C95A 2E5QA 1W2BA 3CCVA 4M7DA 3QZ9B 4QVZA 2EQMA 2EYQA 4PJOB 3SFMA 3QZ5B 2ZPBB 3MP1A 4QQGA 5CAIA 2X35A 3RERA 3G7ZA 3DKMA 4J6YA 2EJGA 1P92A 4JJNK 3SB2A 1N8RC 3A5ZB 1YJNT 3JB9H 4OB1B 3LGLA 2DXTA 4YTLA 2GCXA 4OB3B 4BUGA 4ZTFA 2QQRA 3BFMA 3V8LA 3CD6T 1D3BB 3RIRA 1KC8U 3QSUA 5GAN3 2I2LA 4XTZA 1YBYA 2XDPA 4Y28E 1WJQA 2VGNA 1OI1A 2EJFA 3OYMA 2DIGA 3C12A 2L3RA 3J80E 2E41A 3PMIA 3R6OA 4PJOA 1I4K1 2RHXA 1N6AA 4M78C 2MF2A 2LTOA 2VC8A 3ME9A 2ZPEB 2DK3A 3NTHA 4M75B 4NOYA 5EG2A 4KBMB 2ZPHB 1EIFA 5GAN6 3CXCA 3MCAB 2IVWA 1D3BA 5GAN5 4C92E 2MWPA 2V8JA 1VQKT 3VUBA 1VQNA 2R5AA 4M78F 2VYTA 4ZGDB 1NPRA 3I56T 4M75D 1Q81U 2KQWA 2KK4A 3LYIA 5KE2A 5GANh 2RI3A 5GAMj 5HK0A 4RCBA 3JRZA 3HHTB 2PUOB 2EAYA 4E7IA 3ZFJA 3P8HA 3CC2A 4M78G 5I21A 3CBMA 1K73U 2HQEA 1KD1C 4BACA 4LD9K 1WPYA 2FHDA 1M8VA 3OBWA 4JS4A 1Q86C 1Q82C 2NLUA 4M75A 4JRIA 4C8QC 4FU6A 4DOWA 3LW5E 3MEAA 4M7AB 4IUQA 3X20B 4EMHA 5GANj 3X25B 1NJIC 3GIBA 3LWHA 1BIBA 2QQ9A 1QP3A 4NL2A 2Y4YA 5GMKh 2M16A 3RKXA 1KQSA 5KCHA 2OTJT 3CEYA 3L42A 2K57A 3M53A 2BKDN 3CCJA 2XI9A 3JCMb 2RI2A 4PJOC 2DTOA 3CCQA 3QJYA 5J3BA 5A0DA 2RHYA 4C8QF 3OS2A 3FJPA 4BE0A 2KDSA 3LX7A 1VQ4A 1JJ2S 4JRQA 4O5VA 3WXMB 4RG2A 4XK8E 5GMKj 1W2BS 2LCCA 2X4WA 4C8QG 1LNXA 3H6ZA 4M7AA 4PLLA 1UGRB 3JCMh 1VUBA 5HY6A 4E47A 3VV0A 1AHJB 1WQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGE B;  2ZPI B;  1IRE B;  2DXB A;  1QP2 A;  1PSE A;  2O01 E;  3QYH B;  4OB0 B;  4KT0 E;  1DJ7 B;  2PU9 B;  3A8M B;  2CZ7 B;  3X24 B;  3A8H B;  2PVO B;  2CYZ B;  3VYG A;  2ZZD A;  2PUK B;  3QZ9 B;  2DD5 A;  2DD4 A;  2ZPB B;  3QZ5 B;  1JB0 E;  4OB1 B;  4OB3 B;  2DPP B;  2WSC E;  4Y28 E;  5L8R E;  1GXI E;  4RKU E;  2D0Q B;  3A8L B;  2ZCF B;  2DXC A;  3WVD B;  4L6V 5;  1UGQ B;  2ZPE B;  2AHJ B;  2ZPH B;  2CZ6 B;  4FM4 B;  4ZGD B;  3A8O B;  1UGP B;  3QXE B;  1UGS B;  3HHT B;  2PUO B;  3X26 B;  2CZ0 B;  2CZ1 B;  3WVE B;  3A8G B;  3QYG B;  3LW5 E;  4OB2 B;  3X20 B;  3X25 B;  1V29 B;  1QP3 A;  2PVD B;  2PVG B;  3VYH B;  2WSE E;  3X28 B;  1PSF A;  4ZGJ B;  2ZPF B;  4XK8 E;  2WSF E;  2ZPG B;  2QDY B;  1UGR B;  1AHJ B; 
#chains in the Genus database with same CATH topology
 1Q81 R;  4GY5 A;  3H8Z A;  4E6R A;  4ZN3 A;  4XTY A;  2LP5 A;  2ROT A;  2P0P A;  5CKB A;  3MP8 A;  4M78 E;  1RAG B;  5IHI A;  2QDL A;  2CS7 A;  4J9E A;  2DIQ A;  1FXX A;  1VQN Q;  4Q5W A;  1H64 1;  2LT4 A;  3E1S A;  1KHI A;  3RMS A;  2HQX A;  1M3C A;  3JB9 G;  3LWI A;  3HPW A;  4FYV B;  3F70 A;  4CC2 A;  5IH2 A;  3L2R A;  3VUZ A;  3A98 A;  4C8Q E;  1OUL A;  3DLM A;  3OBY A;  5KYY B;  3OYK A;  2DPP B;  1HK9 A;  1YWP A;  2RNA A;  2FEI A;  1X01 A;  1QWF A;  2E1H A;  1YHQ A;  2CDT A;  2D0Q B;  3REB B;  5CK9 A;  3M56 A;  3L2Q A;  1E6H A;  1T3S A;  2F2X A;  3SHW A;  4ANJ A;  2J06 A;  3ASK A;  4DBR A;  1MV0 B;  4DBF A;  1H3Z A;  5KYY A;  4EMK B;  1Q95 G;  1W4S A;  2YXY A;  5CKD A;  4J5Y A;  3S3M A;  1RAH B;  3PE0 A;  4J9I A;  1IXD A;  3EFR A;  1Y96 B;  2CP0 A;  4AFZ C;  1U1S A;  1M1K C;  3NFC A;  3ZL7 C;  2MIO A;  2LNH B;  4EMK A;  3CC2 T;  4OMP A;  2KEA A;  2KRO A;  3E9G A;  2DTI A;  1BI3 A;  4R0K A;  3G6E A;  4N4G A;  1UFF A;  2WSF E;  1Y96 A;  4IUR A;  4L5G A;  4PL6 A;  3TSZ A;  2HQH A;  4RTZ A;  4C0D C;  2ZPG B;  2HAX A;  1VQ4 T;  1R77 A;  2CUB A;  3RBB B;  5KCO A;  1NZ9 A;  1MGQ A;  2L5Q A;  2MI6 A;  3I5S A;  1WYX A;  2A08 A;  5CIU A;  4M7A D;  1S72 T;  1JO8 A;  2EQJ A;  2HDA A;  2KAF A;  2DJZ A;  5GAO q;  2DZC A;  1RUW A;  1TUG B;  4F04 B;  1VQ6 Q;  1G5V A;  1QCO A;  2LQK A;  5FU7 C;  3CCM T;  1VIF A;  2DD4 A;  3QUI A;  4KGV B;  3SWN B;  3QII A;  4IIM A;  2RD1 A;  4HCB A;  1Q81 C;  1YFN A;  1TTH B;  3FIF A;  3H0F A;  1QVP A;  5GMK i;  1IHV A;  4FSX A;  4XU1 A;  3O8V A;  1AEY A;  1GXI E;  4RKU E;  2ZAE A;  2KNB B;  3OY9 A;  1ZBX A;  4FT4 A;  2RJD A;  1M2V B;  3SWN A;  3CC2 Q;  3NMZ C;  3E19 A;  3HTR A;  4XU3 A;  1O9S A;  1BI2 A;  1QVG A;  2CZ6 B;  4FM4 B;  1LCK A;  1D1B A;  2V26 A;  3PT9 A;  1M9S A;  1YN8 A;  3CC7 Q;  1W6X A;  1O75 A;  1X6O A;  3M5A A;  4BI4 A;  1BI1 A;  1UGS B;  1M2V A;  2E12 A;  1VQ4 Q;  4N4I A;  5GAO r;  5LJ5 j;  5D6W A;  4DBQ A;  2SRC A;  1ZSZ C;  2JS0 A;  2HD0 A;  1S72 Q;  3OYG A;  2AZS A;  1GBR A;  1PWT A;  1K8A C;  2QTX A;  4WF2 A;  2ZPF B;  2KT8 A;  3INZ A;  4DEX A;  1G83 A;  3DB3 A;  1YJ9 A;  3OW2 A;  4C92 D;  3VRY A;  1AOJ A;  2QA4 T;  1HXD A;  3QWX X;  3CCM Q;  1X6B A;  4M77 F;  5GMK e;  5KYN A;  3CPW A;  1BIA A;  5FWB A;  2CSQ A;  3QBY A;  1KD1 U;  4V2S A;  2WAC A;  4OB0 B;  1V76 A;  2LDM A;  1Q82 U;  4C5G A;  3OYL A;  1CSK A;  3KBG A;  2PQW A;  3A8H B;  3MEW A;  3M0S A;  1VQ9 T;  1VYU A;  2EGA A;  2MOX A;  3PGG A;  3VKI A;  2RK1 A;  1VYV A;  5CQY A;  4IKF A;  3QDR B;  5KYU B;  2JM9 A;  1PC0 A;  1BB9 A;  2A0F B;  4AFS C;  1JB0 E;  3JCM c;  1HSQ A;  3GOX A;  2HL3 A;  2EYX A;  1X69 A;  4LE9 A;  1KD1 R;  3AHU A;  2FRW A;  2M0Y A;  4FCY A;  1UB4 A;  4QW2 A;  1Q82 R;  3CCR T;  1YIT T;  5KYU A;  4JRP A;  1LVK A;  1D0X A;  2YDL A;  1Q7Y U;  3CCL T;  3M0U A;  2OX7 A;  4L59 A;  2KBT A;  2GF7 A;  4E7S A;  2O2O A;  5IXB A;  2CH4 W;  3M58 A;  2QA4 Q;  1G3S A;  2HSP A;  4C0G A;  3CCU T;  2D0N A;  3QXE B;  4XTV A;  2AKK A;  4E7K A;  5GAN 8;  1OEB A;  2EYW A;  2LC4 A;  1NM7 A;  2LJ3 A;  4RTW A;  3VS5 A;  5IHN A;  2PVD B;  5I22 A;  4NS5 A;  1GL5 A;  1BK2 A;  5LJ5 h;  1VQ9 Q;  1IGQ A;  2JW4 A;  2RH2 A;  1Q7Y R;  4ZGJ B;  2HBW A;  4PKC C;  3JAM E;  4II1 A;  2KMT A;  2VB6 A;  4NL3 A;  1RAC B;  3EHQ A;  3G71 T;  2QDY B;  4RMO A;  2EJ9 A;  2AKL A;  1AVZ C;  1PRM C;  4KH1 B;  1SHF A;  2EBP A;  2DX1 A;  1QP2 A;  1GCP A;  2V1R A;  2RO0 A;  1U8R A;  1XNI A;  1EZZ B;  2DJQ A;  1K0X A;  1WFW A;  2IIM A;  3CCR Q;  1OPL A;  3GNF B;  2X9H A;  1YIT Q;  3JCM J;  2CH4 A;  2QI2 A;  4B6M A;  1AD5 A;  4PJL A;  4P5N A;  3CCL Q;  1BU1 A;  1MMN A;  2EYQ A;  3EGU A;  3LH5 A;  3RER A;  5CAI A;  2ECZ A;  3DKM A;  2EJG A;  3SB2 A;  3CCU Q;  3JB9 H;  4OB1 B;  4FYY B;  2DXT A;  2GQI A;  4BUG A;  4OB3 B;  3EH1 A;  2QQR A;  3V8L A;  3CD6 T;  2RQU A;  2I2L A;  2VWF A;  1VOM A;  2DE0 X;  2VGN A;  2GGR A;  3C12 A;  2W0Z A;  3R6O A;  1AWW A;  2LTO A;  2DK3 A;  3NTH A;  4M75 B;  5EG2 A;  1EIF A;  5GAN 6;  2LQW A;  2IVW A;  3E2U A;  1VQK T;  2HL5 C;  2R5A A;  4M78 F;  4M75 D;  2KQW A;  5GAN h;  3G71 Q;  1MMA A;  4E7I A;  3ZFJ A;  4OML A;  3PVQ A;  1D0Y A;  1K73 U;  1KD1 C;  4BAC A;  1M8V A;  4JS4 A;  1Q82 C;  4M75 A;  4J9D A;  3GIB A;  3LWH A;  4ORZ A;  4KGX B;  2M16 A;  2OTJ T;  1MV3 A;  1WI7 A;  4FYX B;  2DTO A;  2C0O A;  4C8Q F;  3I9Q A;  2KDS A;  1JJ2 S;  5GMK j;  4XK8 E;  2M51 A;  1W2B S;  2LCC A;  2X4W A;  1LNX A;  2ED0 A;  2DFU A;  4JJD A;  1VYT A;  4PLL A;  4E47 A;  1UEC A;  1SEM A;  2NWM A;  2DVJ A;  1PSE A;  3CD6 Q;  5LJ5 f;  2C0I A;  4AFQ C;  4B9X A;  4WCI A;  3V8K A;  2O9V A;  2D8J A;  4B9W A;  3EG1 A;  4FT2 A;  1SG5 A;  5LJ5 g;  1VQM A;  1YI2 T;  3JB9 F;  5FRO A;  1Q7Y C;  2QG9 B;  4M7D C;  1QVF A;  1VQ8 A;  2JM8 A;  5LJ5 d;  2K5I A;  1WHG A;  3EFO B;  3CXC S;  1PNJ A;  3CMA A;  1I8F A;  1G2B A;  1VQK Q;  3PFS A;  3CCE T;  2JOY A;  3A1P A;  2L8D A;  4N0A C;  4BY6 B;  1CKA A;  2XU8 A;  4LDV A;  4HCZ A;  1KK7 A;  2BUD A;  1C1A A;  2QQS A;  2CUD A;  2WSC E;  4M7D G;  3RUX A;  2ZCF B;  3CC4 A;  5IXF A;  2QQB A;  3EFO A;  5I2S A;  2OTJ Q;  1JJ2 P;  3JCM Q;  3G4S A;  3R6N A;  2H3J A;  3EGX B;  1W2B P;  5A0L A;  4F7U B;  2DL8 A;  2CP7 A;  3MPU B;  2H8H A;  4XU0 A;  3TEE A;  4PJO D;  2L3S A;  1FMV A;  2E65 A;  2MK5 A;  3G6E T;  2O9S A;  2O31 A;  1VQN T;  3QYG B;  3EGX A;  2YWW A;  4KGZ B;  3VRZ A;  1OOT A;  3LLR A;  2DIL A;  4F7U A;  5CVI A;  4BD3 A;  4C0Z A;  4M7D E;  3EGD B;  1NJI U;  1LJO A;  4XTW A;  3H0I A;  3C4S A;  3CXC P;  2QQA A;  5CKE A;  5FRM A;  3M57 A;  2JUF A;  2J6O A;  1VQP A;  4KRT A;  1YJW A;  3QJ6 A;  3CCE Q;  3CCQ T;  1PG5 B;  3PNW C;  3VS6 A;  4A4K A;  3CPF A;  1M3A A;  3C94 A;  5CKF A;  3EGD A;  3HKS A;  2PNI A;  5LJ5 e;  5CCA A;  5GAN d;  4M78 B;  2KE9 A;  2F2V A;  4M7A F;  5KE3 A;  2AT1 B;  5KYX B;  1OQK A;  2KXD A;  3H41 A;  2EYY A;  4FL6 A;  2CZ7 B;  2QEX A;  2L3P A;  3OSS C;  2PVO B;  1KG1 A;  2MCN A;  1YCS B;  5J26 A;  2M1H A;  8ATC B;  1RAD B;  3OYC A;  2DD5 A;  4JZ4 A;  4IUT A;  3G1J A;  3OYB A;  2XHC A;  4JJC A;  3TCJ A;  1TU0 B;  5KYX A;  1VQ5 A;  4E7Z A;  2DYB A;  1T0J A;  4ESR A;  4C5I A;  4OMF B;  2J6K A;  2E3I A;  1VQO A;  1M90 U;  3G6E Q;  2FL7 A;  1AWX A;  3ZEH A;  3GLX A;  2DXC A;  4GLM A;  1Y7X A;  2EFI A;  4EDU A;  2LNV A;  1C6V X;  4R55 A;  1WHH A;  2L3Q A;  3UWN A;  3D7S B;  1HJD A;  3TU4 K;  3KFV A;  4QVD A;  3NTK A;  4JLI A;  1RAE B;  1MUZ A;  1N9S A;  5GAO l;  2P4R A;  1N9R A;  1V1C A;  1N8R U;  1VQ7 A;  2L89 A;  1B34 B;  3CCQ Q;  2X3X D;  4OVA A;  5AYF A;  2LVM A;  2CZ0 B;  1YIJ T;  4QQD A;  5GAM e;  2YLC A;  1FX7 A;  3TRE A;  3GP8 A;  3OB9 A;  5LL6 S;  4Z89 A;  3CME A;  1VQL T;  1VQ6 T;  1EFN A;  2E6N A;  1QKX A;  4BB7 A;  2JN0 A;  3VYH B;  1X2Q A;  2P84 A;  2WSE E;  3PVL A;  4HA8 A;  5GAN e;  3EG2 A;  4HCC A;  4JPB W;  3I55 A;  1B34 A;  4C92 F;  2A7Y A;  1ZA2 B;  1AWO A;  4ZTJ A;  5GAO m;  1RI9 A;  4AFU C;  2K5L A;  5IT9 E;  4K11 A;  5GAO p;  2MAM A;  4X1V A;  5IN1 A;  4A4H A;  4ZGE B;  1N8R R;  1AWJ A;  3DB4 A;  1G8X A;  4EPC A;  1OV3 A;  3JCM V;  1PKS A;  3EG3 A;  4DEY A;  3P8D A;  4KT0 E;  4RTT A;  2KYM A;  4DQ2 A;  2CRE A;  1G3Y A;  2YUQ A;  2K4Y A;  2KRN A;  3MO8 A;  2RHU A;  2FPF A;  1QVF S;  3CC7 T;  3OYF A;  1IB8 A;  4M7A C;  2K2V A;  3TQ7 P;  4LXC A;  4CI0 C;  2MPX C;  3OYA A;  3I5R A;  2GFU A;  2LCL A;  3EFS A;  1U06 A;  2M0O A;  3HFO A;  3BW1 A;  2CT3 A;  2JT4 A;  4RTU A;  2YUP A;  1OU9 A;  3CCS A;  5A0G A;  1YIJ Q;  4M7A G;  2HBP A;  1R0C B;  2QAS A;  2BTT A;  2FRY A;  2DL7 A;  2KVQ G;  3SWN C;  1H92 A;  1VQL Q;  2DYI A;  1UGV A;  1K9M U;  4J9C A;  4X9C A;  3NTI A;  4C0D B;  2FZG B;  2K5F A;  3OMC A;  4FSS A;  2DTH A;  1LPL A;  3HP9 A;  1ARK A;  2OAU A;  1ZUY A;  4XAX B;  1GFD A;  1RAF B;  2OJ2 A;  1GRI A;  1SRM A;  1TG0 A;  3QWY A;  4CRI A;  1NLO C;  2DRK A;  4OB2 B;  2JTM A;  2MMP A;  4M7A E;  1QVF P;  2A3L A;  3VS4 A;  1JXM A;  1K9M R;  3OA6 A;  2EQI A;  2BZY A;  4XTX A;  1NYG A;  1KIK A;  5GMK l;  2YUN A;  3FRN A;  2VKN A;  1JQQ A;  3T9N A;  3S3N A;  1WX6 A;  4C92 C;  2B8A A;  3OQ5 A;  3J7A F;  4J6W A;  3V7C A;  1WQW A;  3ZBD A;  2LJ0 A;  1QLY A;  3GNG A;  2E64 A;  1IZ6 A;  4C5H A;  2F2W A;  2RB6 A;  2B86 A;  3X24 B;  3P8B B;  4DA4 A;  2F69 A;  3UA7 A;  2X3W D;  1JJ2 A;  4F14 A;  5GMK m;  4C92 G;  2P0K A;  1JBM A;  1W2B A;  3CCV A;  1OPK A;  4QVZ A;  2EQM A;  2DA9 A;  5IHK A;  3SFM A;  2ZPB B;  4QQG A;  2X35 A;  3G7Z A;  1N8R C;  3A5Z B;  1YJN T;  2GCX A;  4ZTF A;  3BFM A;  1D3B B;  3RIR A;  1KC8 U;  1D1C A;  2XDP A;  4Y28 E;  1WJQ A;  2COY A;  2DIG A;  3J80 E;  2L3R A;  2E41 A;  4FW2 A;  3PMI A;  4RTX A;  2DL4 A;  1N6A A;  3VS0 A;  2YRD A;  2VC8 A;  1ZBJ A;  1PM3 A;  2ZPE B;  2ZPH B;  2C0T A;  3CXC A;  1D3B A;  5GAN 5;  1WZO A;  4C92 E;  2MWP A;  2ED1 A;  1X6G A;  4F16 A;  2K79 A;  4ZGD B;  3I56 T;  5KYW B;  2DEU A;  2RI3 A;  5GAM j;  3CQT A;  2D1X A;  4RCB A;  3JRZ A;  3CC2 A;  2HQE A;  2FHD A;  2CP6 A;  1A0N B;  1KC8 R;  4DOW A;  4FU6 A;  3MEA A;  4IUQ A;  5GAN j;  1BIB A;  5L23 A;  2QQ9 A;  1QP3 A;  4NL2 A;  2Y4Y A;  5FWC A;  3RKX A;  3L42 A;  3TSW A;  2BKD N;  5KYW A;  2XI9 A;  1WA7 A;  5J3B A;  5A0D A;  2RHY A;  1UHF A;  3OS2 A;  1VQ4 A;  1UE9 A;  1QWE A;  4JRQ A;  4O5V A;  1GCQ A;  3M0T A;  3QDF A;  4RG2 A;  3RNJ A;  3H6Z A;  3JCM h;  1VUB A;  3VV0 A;  1WQ7 A;  2GFA A;  3UAT A;  1YJN Q;  2EGE A;  1WJS A;  5GJW B;  3FLG A;  3JCM P;  4A53 A;  2YRC A;  2PU9 B;  2FZK B;  5LJ3 h;  3CCM A;  1X75 C;  1Z9Z A;  1K9M C;  2LCS A;  3M55 A;  1FMW A;  2P0Q A;  1WNL A;  4HT9 A;  4X9D A;  4WTO B;  4JDS A;  2OTL T;  2EPD A;  2PZ1 A;  3I56 Q;  4KH0 B;  3ER0 A;  1M27 C;  3M0R A;  4M7D F;  2LRQ A;  1SSH A;  2D9T A;  3GBQ A;  1B7T A;  3JCM X;  5C0M A;  5HKC A;  3FJ5 A;  1NYF A;  2LMJ A;  4N4H A;  2XID A;  2J05 A;  3WVD B;  1Y07 A;  1KQS S;  2V1Q A;  3J81 E;  2JJ9 A;  3VS2 A;  4OMQ A;  2DLP A;  4A4G A;  3MEU A;  2J6F A;  2A37 A;  4HXJ A;  3UA6 A;  4BE1 A;  2DKG A;  1U1T A;  4M77 B;  3RKW A;  2KRM A;  2ENM A;  2KI7 A;  3UDC A;  1VQM Q;  3CBP A;  5J39 A;  4PLI A;  2CZ1 B;  5CKH A;  2K2M A;  4Z02 A;  2XIC A;  4M77 D;  2R57 A;  4OMM A;  2DL5 A;  1VQ8 Q;  2HKN A;  5GAM h;  1YCY A;  3CMA Q;  3RKY A;  5FU6 C;  3X28 B;  5I11 A;  1H3H A;  3N5B B;  1PD1 A;  4M77 A;  2MWO A;  1HYO A;  4EMG A;  4M75 G;  3LH0 A;  2KY9 A;  1T0H A;  3QPH A;  3CCJ T;  1NEB A;  3BDU A;  2OTL Q;  3SD4 A;  4TVR A;  2JS2 A;  3CC4 Q;  3JSC A;  2K3Y A;  2DBK A;  1AZG B;  1VQ9 A;  4OGE A;  3G4S Q;  2J7I A;  3H0H A;  1TUC A;  1DJ7 B;  5M9O A;  3VS3 A;  2DL3 A;  1KQS P;  2LJ1 A;  4Y91 A;  2EKO A;  1RLP C;  4JUV A;  2LX7 A;  1R0B G;  2GTO A;  3MET A;  3JCM g;  1BCO A;  4ELY C;  4M75 E;  2BIV A;  3THK A;  1K73 R;  3CCR A;  3OYD A;  1PHT A;  1YIT A;  3JCM d;  1QMC A;  2ATC B;  3CCL A;  1NE8 A;  4R56 A;  1NEG A;  3EG0 A;  2X51 A;  1M5Q 1;  3OS5 A;  2E10 A;  2V8K A;  2XDD A;  1ZHI A;  1WJR A;  2VXF A;  2FG0 A;  4J9H A;  3OYN A;  3CCU A;  1F1B B;  4UC4 A;  5LJ3 d;  1YHQ T;  1ZA1 B;  1B07 A;  1ZQ1 A;  1S1N A;  2NUT B;  4A4E A;  3CCJ Q;  4E7J A;  1UJY A;  2K9G A;  4ELZ C;  1TH7 A;  1TSF A;  4GBQ A;  1LOJ A;  4PJO C;  1QW1 A;  2XK0 A;  2RJE A;  2CGH A;  2RMO A;  4XQ3 A;  3RES A;  2E5K A;  4J9F A;  5A2Q E;  2KXC A;  2O88 A;  2R5M A;  2NUT A;  3L1A A;  1TWB A;  1M1K U;  2I0N A;  3G71 A;  1I0C A;  4OMN A;  4MDW A;  1GFC A;  2E4H A;  1WXT A;  4QT7 A;  1UJ0 A;  4PJO G;  5FLX E;  1I07 A;  4J9G A;  4J7I A;  1VQO Q;  3HRT A;  2RQV A;  2R58 A;  3EH2 A;  4F7U G;  1SKU B;  5GAM f;  3UF4 A;  2DAQ A;  1OX9 A;  4QVC A;  4JJB A;  1MMG A;  3QYH B;  1M8M A;  2FYK A;  4N0A A;  3ULR B;  2DO3 A;  5GAM g;  5GAN f;  3MKD A;  3JCM e;  2M02 A;  3JCM W;  1ZSG A;  2C06 A;  1M1K R;  5GAM d;  1VQ7 Q;  5GAN g;  1UUE A;  4J6X A;  3QHS A;  1YHQ Q;  3CD6 A;  5I2M A;  2HNI A;  3CCS T;  2HCK A;  4J83 A;  2EW3 A;  4PJO E;  1UEB A;  5LJ3 e;  2Y4X A;  3JV3 A;  3CME Q;  1NG2 A;  4J7F A;  4F7U E;  1SPK A;  1U3O A;  2JTF A;  3RDV A;  1RLQ C;  2GTJ A;  2X4X A;  4M78 D;  2IPO B;  2ROL A;  5L8R E;  4LDU A;  2JXB A;  4A4F A;  4MZT A;  3MEV A;  4LDX A;  1NJI R;  1VQK A;  4AMC A;  3OS1 A;  1X27 A;  2MYS A;  5D7U A;  4OP0 A;  4M78 A;  1UGQ B;  2D8H A;  3NPF A;  4C8Q B;  2G3R A;  5FRN A;  4RUG A;  2L2P A;  2V8I A;  3U23 A;  3BE3 A;  4IUU A;  4Y92 A;  1IGU A;  3REA B;  2XD0 A;  1K73 C;  5C6S A;  4C8Q D;  5ECA A;  2BZ8 A;  2IG0 A;  4BDY A;  3V7S A;  2OTJ A;  1Z9Q A;  2K3B A;  4O6J A;  4DOV A;  2BE9 B;  4RG8 A;  2KRS A;  4LD6 A;  2KR3 A;  4LDW A;  4C8Q A;  3OYJ A;  2E6Z A;  1KHC A;  2D6F A;  2EVR A;  1K4U S;  2RQR A;  3BY7 A;  1I81 A;  4MDX A;  5IAY A;  2DM1 A;  2BE7 D;  2AIR B;  2HSE B;  2CSI A;  3VJP A;  2RJC A;  2QTV A;  2RK2 A;  1E7O A;  1GBQ A;  1K8A U;  2F5T X;  2RHI A;  4PJM A;  3CCS Q;  3JB9 D;  4AG2 C;  1WIE A;  2JVV A;  2NYS A;  1SSF A;  3UT1 A;  2RI5 A;  4MZP A;  2DXU A;  1WHM A;  1YJ9 T;  4EMK C;  1YI2 A;  2SEM A;  1M90 R;  2F1L A;  3GF5 A;  3OYI A;  2VXE A;  3CCV T;  2JZ2 A;  2GQV A;  4MZM A;  1G3W A;  1OZ2 A;  3Q1J A;  5GAN 2;  3CCE A;  9ATC B;  4HT8 A;  3PIP A;  4ATO A;  2KYB A;  4HVU A;  3C95 A;  1KJW A;  2QK0 A;  3QZ9 B;  3M0P A;  4CC4 B;  3QZ5 B;  4IIO A;  4Z8A A;  2JMA A;  1K8A R;  1P92 A;  4JJN K;  3LGL A;  1NLP C;  1K1Z A;  2CP3 A;  3OYM A;  5HCK A;  3TVT A;  1I4K 1;  4DBH A;  3ME9 A;  2DMO A;  2JTE A;  4NOY A;  3MCA B;  1WHL A;  3C0C A;  4LUD A;  2V8J A;  1VQN A;  2VYT A;  1NPR A;  1SRL A;  4D8K A;  3LYI A;  5KE2 A;  1T3L A;  5HK0 A;  3HHT B;  2PUO B;  3M0Q A;  4LD9 K;  1QCN A;  2K6D A;  4QKU A;  1WPY A;  1HD3 A;  1MND A;  1YJ9 Q;  3OBW A;  2NLU A;  3LW5 E;  1NJI C;  4M7A B;  3X25 B;  3CCV Q;  2EYZ A;  1KQS A;  5KCH A;  3M53 A;  3IQL A;  3JCM b;  2RI2 A;  1MNE A;  3CCQ A;  1IHW A;  3FJP A;  1W70 A;  4HVW A;  2DET A;  2QAZ A;  4M7A A;  5HY6 A;  2DER A;  1N27 A;  4BDZ A;  2ZPI B;  3KUF A;  1QCF A;  2CP2 A;  2ZGW A;  5FU7 B;  4AT1 B;  5CO7 A;  1SHG A;  4M4Z A;  2EWN A;  2OI3 A;  2EQU A;  4BI3 A;  3A8M B;  2QGG A;  5D6Y A;  5DM7 R;  4XU2 A;  2CYZ B;  1BKB A;  4D6W A;  3EHR A;  4OGC A;  1PKT A;  2PUK B;  1M4Z A;  4C0F A;  1PD0 A;  2BZX A;  2X4J A;  5LJ3 j;  4MML A;  5DLO A;  1NBE B;  5CQX A;  1BI0 A;  1AZE A;  5KH6 A;  1M90 C;  5CR2 A;  1M30 A;  1BYM A;  2LZ6 B;  1OU8 A;  2ESW A;  1TUD A;  4PJN A;  2G6F X;  1ACM B;  1IRX A;  3EAE A;  1OX8 A;  3A8L B;  1IO6 A;  4CC3 A;  1WGS A;  4LNP A;  4FIB A;  1BBZ A;  4IUP A;  2RN8 A;  3FEO A;  4C92 B;  1M1G A;  2KT1 A;  3M59 A;  1TXQ A;  1X2K A;  1YIJ A;  1D0Z A;  1ZSZ B;  2FB7 A;  1JXO A;  2DNU A;  2VGM A;  3LGF A;  2KGT A;  3RMQ A;  3PTA A;  1YWO A;  1UGP B;  1VQL A;  1VQ6 A;  3HFN A;  3WVE B;  1KQ2 A;  2DF6 A;  2YUO A;  4C92 A;  3L2Z A;  5GAO n;  1BCM A;  1WXB A;  3JB9 I;  1X43 A;  3RR6 A;  2FVU A;  2VUB A;  1ZSZ A;  1XJW B;  3AT1 B;  2HEQ A;  4M75 F;  3OYE A;  1PSF A;  3BDL A;  1JU5 C;  1XOV A;  1Y71 A;  1GCQ C;  1B3Q A;  1WLP B;  3HL8 A;  4LUE A;  1NPP A;  4FW1 A;  2A28 A;  3MHX A;  2YT6 A;  2DVE A;  3OYY A;  4OF1 A;  1I5O B;  2VV5 A;  4ZNX A;  1FYN A;  8AT1 B;  4E7H A;  2QYZ A;  1IRE B;  2VAS A;  2O01 E;  3FB9 A;  1W1F A;  4PJJ A;  3CC7 A;  4MMK A;  5AT1 B;  3S3O A;  3NGP A;  1I5L A;  4EIK A;  2W10 A;  2F5K A;  2XKO C;  1ZX6 A;  4QQ6 A;  2YHT A;  3DLL A;  2EKH A;  4PK4 A;  1WXU A;  2CT4 A;  3M9Q A;  2ZZD A;  1M2O A;  1Y0M A;  2JNG A;  1VQM T;  1S72 A;  1RAA B;  4BI8 B;  1AT1 B;  4VUB A;  2LQ8 A;  2JMC A;  3MP6 A;  2QGF B;  2RM4 A;  1VQ8 T;  7AT1 B;  2O4X B;  2KSS A;  2L0A A;  4OMO A;  2LX9 A;  4F17 A;  1M3B A;  3GPL A;  3CMA T;  5DY9 A;  1UHC A;  3FDR A;  1H8K A;  1K0S A;  2X4Y A;  3HRU A;  1OZ3 A;  3QO3 A;  2AZV A;  1CKB A;  2COZ A;  2AK5 A;  4KUL A;  2RQT A;  3VS7 A;  2O4X A;  3CC4 T;  1N5Z A;  4J9B A;  2HZY A;  5GAN 4;  2DBM A;  4HCK A;  3I35 A;  3G4S T;  2RJF A;  3E9F A;  3L2V A;  3M54 A;  2LT1 A;  3V7R A;  3A8G B;  3L2U A;  1J3T A;  1R8O B;  3OMG A;  3NHN A;  2QXF A;  2RHZ A;  4M77 C;  2P4T A;  4PJO F;  1UTI A;  1RAI B;  2RQW A;  3SDZ A;  1FWZ A;  4F7U F;  1G3T A;  4FYW B;  1XQH A;  1K76 A;  3V8J A;  1QKW A;  4M75 C;  3QG1 A;  2E70 A;  1I1J A;  4M77 G;  3PMT A;  2HMA A;  3URG A;  3OYH A;  1ZUU A;  5DLQ E;  1VQP T;  1YJW T;  2VVK A;  1Q86 U;  3VU3 C;  2QA4 A;  2RF0 A;  2RPN A;  4ME7 A;  4A63 B;  3QKJ A;  2DZ9 A;  2YLB A;  4C5E A;  2ABL A;  5GAN 7;  1YJN A;  1WDX A;  1KQ1 A;  3OS0 A;  1QQJ A;  3JB9 J;  1PCX A;  1MMD A;  3KXT A;  2NUP B;  1WHK A;  2QEX T;  1QVG S;  1KC8 C;  4RTY A;  4XTU A;  2LQN A;  3H9N A;  1SF9 A;  1RL2 A;  4E2F B;  4D8D A;  4KUD K;  4LN2 A;  3SEM A;  5FU6 B;  2XDB A;  3MJX A;  2RA2 A;  1OYX A;  4ZN1 A;  2COW A;  4M77 E;  1VQ5 T;  5GJV B;  5HK3 A;  1VIE A;  1M1F A;  1JEG A;  1Q86 R;  3FC3 A;  3JCM f;  2YSQ A;  2NUP A;  2DEQ A;  3OSV A;  4PNO A;  1JRI A;  3EG9 B;  4IUV A;  1D09 B;  3M4G A;  4GLK A;  4HKE A;  3I56 A;  4L6V 5;  1VQO T;  4JLG A;  2AHJ B;  3L2W A;  4JRK A;  4E7L A;  5LJ3 f;  4A54 A;  4KUI A;  1PRL C;  4AG1 C;  2H3E B;  3OW2 S;  1E6G A;  2XMF A;  3A8O B;  2DRM A;  2K3X A;  2YRV A;  3X26 B;  5LJ3 g;  3EG9 A;  3CPW S;  5D6X A;  3HRS A;  1VQP Q;  4BY6 C;  1YJW Q;  1VQ7 T;  1V29 B;  4X34 A;  1FMK A;  4LDY A;  3S6W A;  1Y57 A;  2PVG B;  1C0M A;  2CKK A;  1KSW A;  1MHN A;  4J8O A;  1QVG P;  3CME T;  2FPD A;  1RI0 A;  4RCC A;  3CBO A;  2QEX Q;  1WHJ A;  4Z88 A;  2EQK A;  3I55 T;  1ZUK A;  3HSB A;  2EIF A;  2DXB A;  4M7D B;  2XG8 D;  1RAB B;  2OAW A;  3UPU A;  2Y90 A;  2K7A A;  2M9U A;  4JZ3 A;  1VQ5 Q;  1XTD A;  4M7D D;  3PIO A;  1TOV A;  4BE2 A;  3M4Y A;  2OTL A;  3VYG A;  4JS5 A;  1ABO A;  5FW9 A;  4RTV A;  2E5Q A;  1YNZ A;  2HKQ B;  4M7D A;  1ZLM A;  3OW2 P;  4PJO B;  3MP1 A;  4J6Y A;  2E3H A;  3CPW P;  4HVV A;  4YTL A;  2A36 A;  3QSU A;  5GAN 3;  1UG1 A;  4PFP A;  4XTZ A;  1YBY A;  1EX4 A;  1VA7 A;  1D1A A;  1K9A A;  1OI1 A;  2GNC A;  2EJF A;  3O5Z A;  2EGC A;  4PJO A;  2RHX A;  4M78 C;  2MF2 A;  2FO0 A;  4KBM B;  3VS1 A;  1YI2 Q;  2GBQ A;  3VUB A;  1Q81 U;  2KK4 A;  1TS9 A;  5EC7 A;  3I55 Q;  2EAY A;  2FPE A;  3P8H A;  4M78 G;  5I21 A;  3CBM A;  1Q86 C;  6AT1 B;  4C8Q C;  4JRI A;  4EMH A;  3X20 B;  1ABQ A;  5GMK h;  2CP5 A;  3CEY A;  2K57 A;  1KFZ A;  3CCJ A;  2Z0W A;  1U5S A;  1YP5 A;  3QJY A;  4PFO A;  4PFZ A;  4BE0 A;  3LX7 A;  1UDL A;  2FZC B;  3WXM B;  2NUZ A;  4C8Q G;  4CC7 A;  1UGR B;  2PTK A;  1AHJ B; 
#chains in the Genus database with same CATH homology
 2GFA A;  4BDZ A;  4GY5 A;  2ZPI B;  3H8Z A;  1WJS A;  4ZN3 A;  4XTY A;  3KUF A;  3FLG A;  2P0P A;  1PSE A;  5CKB A;  3MP8 A;  5LJ5 f;  3JCM P;  4B9X A;  2ZGW A;  5FU7 B;  4A53 A;  4M78 E;  3V8K A;  5CO7 A;  2EWN A;  2EQU A;  4BI3 A;  4B9W A;  2PU9 B;  3A8M B;  2CS7 A;  5LJ3 h;  4FT2 A;  3CCM A;  5LJ5 g;  1X75 C;  2DIQ A;  1FXX A;  5D6Y A;  1VQM A;  5DM7 R;  1YI2 T;  4XU2 A;  1K9M C;  3JB9 F;  4Q5W A;  5FRO A;  1Q7Y C;  2CYZ B;  3M55 A;  1BKB A;  1H64 1;  4D6W A;  2LT4 A;  2P0Q A;  3E1S A;  4OGC A;  1WNL A;  1KHI A;  3RMS A;  4M7D C;  1QVF A;  2HQX A;  1M4Z A;  2PUK B;  4C0F A;  3JB9 G;  1VQ8 A;  5LJ5 d;  2X4J A;  5LJ3 j;  3HPW A;  3LWI A;  2K5I A;  3F70 A;  4MML A;  4HT9 A;  4X9D A;  3CXC S;  4JDS A;  3CMA A;  5DLO A;  1I8F A;  2OTL T;  5CQX A;  3PFS A;  3CCE T;  1BI0 A;  2JOY A;  2L8D A;  4N0A C;  4BY6 B;  3L2R A;  3VUZ A;  2XU8 A;  5KH6 A;  4C8Q E;  3ER0 A;  4LDV A;  1M90 C;  5CR2 A;  4HCZ A;  1BYM A;  4M7D F;  3DLM A;  3OBY A;  2BUD A;  2LRQ A;  3OYK A;  2DPP B;  2QQS A;  1HK9 A;  2D9T A;  2WSC E;  1X01 A;  2E1H A;  1YHQ A;  4M7D G;  3EAE A;  2D0Q B;  3A8L B;  3JCM X;  3RUX A;  5C0M A;  5CK9 A;  3M56 A;  5HKC A;  2ZCF B;  3L2Q A;  3CC4 A;  2QQB A;  5I2S A;  4N4H A;  1WGS A;  2XID A;  3WVD B;  1Y07 A;  4FIB A;  1KQS S;  3ASK A;  4IUP A;  3JCM Q;  3J81 E;  3G4S A;  2H3J A;  3FEO A;  4C92 B;  5A0L A;  1M1G A;  4A4G A;  1H3Z A;  3MEU A;  4F7U B;  3M59 A;  4EMK B;  4XU0 A;  4BE1 A;  2DKG A;  1YIJ A;  1W4S A;  1U1T A;  2FB7 A;  3TEE A;  3LGF A;  2VGM A;  4PJO D;  3RMQ A;  3PTA A;  4M77 B;  3RKW A;  1UGP B;  4J5Y A;  5CKD A;  1VQL A;  1VQ6 A;  3UDC A;  3S3M A;  2E65 A;  3CBP A;  5J39 A;  3EFR A;  2CZ1 B;  4PLI A;  3HFN A;  3WVE B;  1KQ2 A;  5CKH A;  1Y96 B;  3G6E T;  4Z02 A;  1VQN T;  3QYG B;  1U1S A;  2XIC A;  4M77 D;  1M1K C;  2R57 A;  3NFC A;  4C92 A;  3LLR A;  3L2Z A;  5GAO n;  3JB9 I;  4F7U A;  5CVI A;  4BD3 A;  4EMK A;  2FVU A;  2VUB A;  4C0Z A;  1YCY A;  5GAM h;  3CC2 T;  4M7D E;  3RKY A;  5FU6 C;  3X28 B;  1NJI U;  3E9G A;  1LJO A;  2DTI A;  3N5B B;  4M75 F;  4M77 A;  4XTW A;  1PSF A;  3BDL A;  1BI3 A;  3OYE A;  3G6E A;  1XOV A;  1Y71 A;  2MWO A;  3C4S A;  4EMG A;  2QQA A;  5CKE A;  3HL8 A;  4N4G A;  5FRM A;  4M75 G;  3M57 A;  2WSF E;  1NPP A;  1Y96 A;  2JUF A;  4IUR A;  4L5G A;  3LH0 A;  2KY9 A;  4PL6 A;  3QPH A;  1VQP A;  3CCJ T;  1YJW A;  4C0D C;  3MHX A;  2ZPG B;  2DVE A;  3OYY A;  3QJ6 A;  3BDU A;  4OF1 A;  2VV5 A;  3CCQ T;  4A4K A;  3PNW C;  3SD4 A;  4TVR A;  2HAX A;  4E7H A;  1VQ4 T;  3CPF A;  3JSC A;  3C94 A;  1IRE B;  5CKF A;  3HKS A;  5LJ5 e;  2K3Y A;  5CCA A;  4M78 B;  2O01 E;  5GAN d;  3FB9 A;  5KCO A;  1NZ9 A;  1VQ9 A;  1MGQ A;  2L5Q A;  2MI6 A;  4OGE A;  4MMK A;  5KE3 A;  3CC7 A;  4M7A F;  3S3O A;  5CIU A;  1I5L A;  1DJ7 B;  5M9O A;  2F5K A;  2XKO C;  4QQ6 A;  4FL6 A;  2CZ7 B;  1S72 T;  4M7A D;  2EQJ A;  2QEX A;  4M7D B;  2YHT A;  2KAF A;  3OSS C;  2PVO B;  2DJZ A;  1KG1 A;  3DLL A;  5GAO q;  2DZC A;  4Y91 A;  3M9Q A;  2EKO A;  1G5V A;  5J26 A;  4JUV A;  2ZZD A;  2M1H A;  2JNG A;  2LQK A;  5FU7 C;  3OYC A;  3CCM T;  2DD5 A;  3MET A;  1VIF A;  1VQM T;  2DD4 A;  3QUI A;  4IUT A;  3SWN B;  3JCM g;  4ELY C;  3QII A;  3OYB A;  2XHC A;  3TCJ A;  4BI8 B;  2RD1 A;  4HCB A;  1Q81 C;  1VQ5 A;  4M75 E;  4VUB A;  3FIF A;  2LQ8 A;  1QVP A;  2BIV A;  3MP6 A;  4C5I A;  3OYD A;  5GMK i;  3CCR A;  1YIT A;  4OMF B;  2RM4 A;  1VQ8 T;  2O4X B;  3JCM d;  2KSS A;  4FSX A;  2LX9 A;  4XU1 A;  3O8V A;  3CCL A;  3GPL A;  1VQO A;  5DY9 A;  3CMA T;  1M90 U;  1NE8 A;  2FL7 A;  4R56 A;  3FDR A;  3ZEH A;  1GXI E;  4RKU E;  1M5Q 1;  3OS5 A;  2E10 A;  2V8K A;  3OY9 A;  3GLX A;  1ZBX A;  4FT4 A;  2DXC A;  2RJD A;  2XDD A;  1Y7X A;  1ZHI A;  2EFI A;  3SWN A;  4EDU A;  2X4Y A;  1WJR A;  1OZ3 A;  2VXF A;  3HRU A;  2LNV A;  3QO3 A;  4R55 A;  3OYN A;  3CCU A;  4UC4 A;  5LJ3 d;  3UWN A;  3E19 A;  1YHQ T;  4KUL A;  4XU3 A;  1O9S A;  1BI2 A;  2O4X A;  3TU4 K;  1QVG A;  4QVD A;  2CZ6 B;  4FM4 B;  1ZQ1 A;  3CC4 T;  3NTK A;  3PT9 A;  1M9S A;  1Q7Y U;  4JLI A;  1N9S A;  5GAN 4;  4A4E A;  5GAO l;  1N9R A;  1O75 A;  4E7J A;  1N8R U;  1X6O A;  3M5A A;  4BI4 A;  2L89 A;  2RJF A;  3G4S T;  3E9F A;  1VQ7 A;  1B34 B;  1BI1 A;  1UGS B;  4ELZ C;  1TH7 A;  4OVA A;  5AYF A;  3L2V A;  2E12 A;  2LVM A;  1LOJ A;  4N4I A;  3M54 A;  5GAO r;  5LJ5 j;  2CZ0 B;  1QW1 A;  2LT1 A;  2RJE A;  2XK0 A;  2CGH A;  4QQD A;  3A8G B;  5D6W A;  3V7R A;  5GAM e;  2YLC A;  3L2U A;  1YIJ T;  4XQ3 A;  1FX7 A;  3TRE A;  3GP8 A;  3OB9 A;  5LL6 S;  1R8O B;  3OMG A;  1VQK A;  3RES A;  5A2Q E;  3CME A;  1VQL T;  2R5M A;  1VQ6 T;  1S72 A;  2E6N A;  4BB7 A;  2JN0 A;  3VYH B;  2HD0 A;  3L1A A;  2QXF A;  1M1K U;  2WSE E;  2RHZ A;  4HA8 A;  4M77 C;  5GAN e;  3OYG A;  2P4T A;  4PJO F;  3G71 A;  4HCC A;  1N27 A;  1K8A C;  2QTX A;  3SDZ A;  4MDW A;  3I55 A;  1B34 A;  4C92 F;  2A7Y A;  4WF2 A;  1FWZ A;  2ZPF B;  3INZ A;  4F7U F;  4ZTJ A;  1G3T A;  5GAO m;  3DB3 A;  4PJO G;  1YJ9 A;  5FLX E;  3OW2 A;  4C92 D;  2QA4 T;  2K5L A;  5IT9 E;  1HXD A;  4J7I A;  1XQH A;  3V8J A;  4M77 F;  3HRT A;  2R58 A;  4F7U G;  5GAO p;  2MAM A;  4M75 C;  5IN1 A;  4A4H A;  5GMK e;  4ZGE B;  5GAM f;  3CPW A;  3QG1 A;  1BIA A;  2E70 A;  3QBY A;  2DAQ A;  4M77 G;  3PMT A;  3DB4 A;  2WAC A;  3URG A;  4QVC A;  4EPC A;  3OYH A;  5DLQ E;  1KD1 U;  4V2S A;  3QYH B;  4N0A A;  4OB0 B;  2FYK A;  3JCM V;  1YJW T;  1VQP T;  2LDM A;  3VU3 C;  2QA4 A;  1Q82 U;  1Q86 U;  4C5G A;  2DO3 A;  3OYL A;  3P8D A;  4KT0 E;  5GAM g;  4ME7 A;  5GAN f;  4DQ2 A;  1G3Y A;  3KBG A;  2PQW A;  2K4Y A;  3MO8 A;  3A8H B;  2DZ9 A;  2YLB A;  2RHU A;  3MEW A;  3QKJ A;  4C5E A;  3JCM e;  3JCM W;  1VQ9 T;  1QVF S;  2C06 A;  3CC7 T;  5GAM d;  5GAN 7;  3OYF A;  3PGG A;  3VKI A;  5GAN g;  2RK1 A;  1YJN A;  4M7A C;  2K2V A;  4J6X A;  1KQ1 A;  3QHS A;  3OS0 A;  3JB9 J;  4CI0 C;  5CQY A;  3OYA A;  4IKF A;  5I2M A;  3QDR B;  3KXT A;  2QEX T;  2HNI A;  2GFU A;  3CCS T;  2LCL A;  3CD6 A;  1QVG S;  4J83 A;  4PJO E;  1KC8 C;  4XTU A;  1UEB A;  3EFS A;  5LJ3 e;  2Y4X A;  1JB0 E;  3JCM c;  3GOX A;  1RL2 A;  4J7F A;  4F7U E;  2M0O A;  4KUD K;  2JTF A;  3HFO A;  3BW1 A;  5FU6 B;  2XDB A;  2RA2 A;  1OYX A;  4ZN1 A;  2X4X A;  3CCS A;  4M78 D;  5A0G A;  3AHU A;  4M7A G;  4M77 E;  1VQ5 T;  2HBP A;  5L8R E;  4LDU A;  1VIE A;  1M1F A;  5HK3 A;  4A4F A;  1UB4 A;  4MZT A;  3MEV A;  4QW2 A;  3JCM f;  3FC3 A;  3CCR T;  2KVQ G;  3SWN C;  1YIT T;  2DEQ A;  4LDX A;  4JRP A;  3OSV A;  4PNO A;  1JRI A;  1K9M U;  4X9C A;  3M4G A;  3NTI A;  4GLK A;  4IUV A;  4HKE A;  3OS1 A;  4OP0 A;  4C0D B;  3I56 A;  2K5F A;  4L6V 5;  1UGQ B;  3OMC A;  4M78 A;  4L59 A;  2DTH A;  3CCL T;  1VQO T;  4JLG A;  2AHJ B;  3L2W A;  3HP9 A;  2OAU A;  4JRK A;  2GF7 A;  4C8Q B;  2G3R A;  4E7L A;  5FRN A;  2V8I A;  5LJ3 f;  4A54 A;  4KUI A;  4IUU A;  4XAX B;  3M58 A;  1G3S A;  4C0G A;  3CCU T;  3OW2 S;  5C6S A;  1K73 C;  2XD0 A;  3A8O B;  4C8Q D;  3QXE B;  4XTV A;  2K3X A;  4CRI A;  2YRV A;  3X26 B;  5LJ3 g;  2IG0 A;  4BDY A;  3V7S A;  2OTJ A;  3CPW S;  4O6J A;  4E7K A;  4DOV A;  4RG8 A;  5GAN 8;  5D6X A;  2LC4 A;  3HRS A;  4BY6 C;  4OB2 B;  4LD6 A;  4LDW A;  4C8Q A;  1VQ7 T;  3OYJ A;  1V29 B;  2JTM A;  4X34 A;  2MMP A;  2E6Z A;  1KHC A;  4LDY A;  3S6W A;  2D6F A;  2PVD B;  4M7A E;  2PVG B;  4NS5 A;  2A3L A;  3BY7 A;  1I81 A;  2CKK A;  4MDX A;  5IAY A;  5LJ5 h;  3OA6 A;  2RH2 A;  4ZGJ B;  3VJP A;  1MHN A;  2RJC A;  4J8O A;  3CME T;  1RI0 A;  4PKC C;  2RK2 A;  4RCC A;  4XTX A;  3JAM E;  4II1 A;  1K8A U;  2F5T X;  2KMT A;  2RHI A;  3CBO A;  5GMK l;  3JB9 D;  3FRN A;  4NL3 A;  2JVV A;  3G71 T;  2QDY B;  2EQK A;  4RMO A;  1SSF A;  2EJ9 A;  3UT1 A;  3I55 T;  3T9N A;  3S3N A;  4C92 C;  2RI5 A;  3HSB A;  2B8A A;  2EIF A;  3OQ5 A;  4MZP A;  3J7A F;  2DXU A;  2DXB A;  1YJ9 T;  4J6W A;  1QP2 A;  4EMK C;  3V7C A;  2RO0 A;  1YI2 A;  1WQW A;  3ZBD A;  3GF5 A;  1U8R A;  2XG8 D;  3OYI A;  3UPU A;  2VXE A;  3GNG A;  2Y90 A;  2E64 A;  1IZ6 A;  3CCV T;  2JZ2 A;  1XNI A;  2M9U A;  4C5H A;  2RB6 A;  1XTD A;  2GQV A;  4MZM A;  1G3W A;  3X24 B;  4M7D D;  1OZ2 A;  3P8B B;  3PIO A;  4BE2 A;  3Q1J A;  2F69 A;  3GNF B;  4DA4 A;  5GAN 2;  3JCM J;  3M4Y A;  2QI2 A;  3CCE A;  2OTL A;  3VYG A;  4HT8 A;  3PIP A;  4JS5 A;  1JJ2 A;  4P5N A;  4ATO A;  5GMK m;  4C92 G;  2P0K A;  1JBM A;  3C95 A;  2E5Q A;  1W2B A;  3CCV A;  4M7D A;  3QZ9 B;  4QVZ A;  2EQM A;  2EYQ A;  4PJO B;  3SFM A;  3QZ5 B;  2ZPB B;  3MP1 A;  4QQG A;  5CAI A;  2X35 A;  3RER A;  3G7Z A;  3DKM A;  4J6Y A;  2EJG A;  1P92 A;  4JJN K;  3SB2 A;  1N8R C;  3A5Z B;  1YJN T;  3JB9 H;  4OB1 B;  3LGL A;  2DXT A;  4YTL A;  2GCX A;  4OB3 B;  4BUG A;  4ZTF A;  2QQR A;  3BFM A;  3V8L A;  3CD6 T;  1D3B B;  3RIR A;  1KC8 U;  3QSU A;  5GAN 3;  2I2L A;  4XTZ A;  1YBY A;  2XDP A;  4Y28 E;  1WJQ A;  2VGN A;  1OI1 A;  2EJF A;  3OYM A;  2DIG A;  3C12 A;  2L3R A;  3J80 E;  2E41 A;  3PMI A;  3R6O A;  4PJO A;  1I4K 1;  2RHX A;  1N6A A;  4M78 C;  2MF2 A;  2LTO A;  2VC8 A;  3ME9 A;  2ZPE B;  2DK3 A;  3NTH A;  4M75 B;  4NOY A;  5EG2 A;  4KBM B;  2ZPH B;  1EIF A;  5GAN 6;  3CXC A;  3MCA B;  2IVW A;  1D3B A;  5GAN 5;  4C92 E;  2MWP A;  2V8J A;  1VQK T;  3VUB A;  1VQN A;  2R5A A;  4M78 F;  2VYT A;  4ZGD B;  1NPR A;  3I56 T;  4M75 D;  1Q81 U;  2KQW A;  2KK4 A;  3LYI A;  5KE2 A;  5GAN h;  2RI3 A;  5GAM j;  5HK0 A;  4RCB A;  3JRZ A;  3HHT B;  2PUO B;  2EAY A;  4E7I A;  3ZFJ A;  3P8H A;  3CC2 A;  4M78 G;  5I21 A;  3CBM A;  1K73 U;  2HQE A;  1KD1 C;  4BAC A;  4LD9 K;  1WPY A;  2FHD A;  1M8V A;  3OBW A;  4JS4 A;  1Q86 C;  1Q82 C;  2NLU A;  4M75 A;  4JRI A;  4C8Q C;  4FU6 A;  4DOW A;  3LW5 E;  3MEA A;  4M7A B;  4IUQ A;  3X20 B;  4EMH A;  5GAN j;  3X25 B;  1NJI C;  3GIB A;  3LWH A;  1BIB A;  2QQ9 A;  1QP3 A;  4NL2 A;  2Y4Y A;  5GMK h;  2M16 A;  3RKX A;  1KQS A;  5KCH A;  2OTJ T;  3CEY A;  3L42 A;  2K57 A;  3M53 A;  2BKD N;  3CCJ A;  2XI9 A;  3JCM b;  2RI2 A;  4PJO C;  2DTO A;  3CCQ A;  3QJY A;  5J3B A;  5A0D A;  2RHY A;  4C8Q F;  3OS2 A;  3FJP A;  4BE0 A;  2KDS A;  3LX7 A;  1VQ4 A;  1JJ2 S;  4JRQ A;  4O5V A;  3WXM B;  4RG2 A;  4XK8 E;  5GMK j;  1W2B S;  2LCC A;  2X4W A;  4C8Q G;  1LNX A;  3H6Z A;  4M7A A;  4PLL A;  1UGR B;  3JCM h;  1VUB A;  5HY6 A;  4E47 A;  3VV0 A;  1AHJ B;  1WQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...