3VYGA

Crystal structure of thiocyanate hydrolase mutant r136w
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
KPVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase subunit alpha
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
total genus 26
structure length 120
sequence length 120
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vygA00
1JB0E 4OB1B 3WVEB 4KT0E 2DPPB 2DD5A 2PUOB 2ZPEB 1UGRB 1UGQB 3A8OB 2ZPBB 2CYZB 2ZPFB 4FM4B 1QP3A 1UGSB 4L6V5 3X25B 1PSFA 3A8HB 2CZ7B 2CZ1B 2ZPHB 2ZCFB 3A8LB 3VYGA 1QP2A 2DD4A 2D0QB 4OB0B 3X20B 2PUKB 3X26B 4ZGJB 3HHTB 1PSEA 2DXBA 1GXIE 2ZZDA 3QZ5B 4ZGDB 2CZ0B 2WSCE 2QDYB 2WSFE 3A8MB 3QYHB 2DXCA 3QYGB 4XK8E 2PVDB 2WSEE 2O01E 2AHJB 3QZ9B 3QXEB 3A8GB 3VYHB 2PU9B 4RKUE 4OB3B 2ZPIB 2ZPGB 4OB2B 1V29B 1AHJB 5L8RE 2PVGB 3X24B 3LW5E 1IREB 4ZGEB 3X28B 3WVDB 2PVOB 4Y28E 1DJ7B 1UGPB 2CZ6B
chains in the Genus database with same CATH superfamily
4V2SA 2K3YA 3JCMW 2DL7A 2DJZA 1WI7A 3JCMf 4M75D 1UB4A 3I5SA 2KK4A 4CRIA 1FMKA 2ENMA 2V8JA 2HSPA 3VU3C 3M0RA 3QJ6A 1T3SA 4C92E 3LGLA 4XTXA 4AG2C 1M2VA 1AT1B 4EDUA 2QAZA 3VUBA 4M78A 1XNIA 3JRZA 2KMTA 4M77E 2L3RA 3SHWA 2DAQA 2DL4A 3JCMe 2XHCA 4XTUA 5FRNA 1IZ6A 5FRMA 3CCLT 2HZYA 2LX7A 4EMKB 1Z9QA 2RHXA 1WXBA 3CCSA 3CC4A 2Y90A 4DBHA 1Q81U 2VKNA 4MZTA 4OB0B 2X3XD 1E6HA 2AZSA 2GNCA 3EGXA 2D0NA 2E64A 3X26B 2BTTA 4C5GA 2RJFA 4M77A 2JS0A 4OMLA 3L42A 1VQ9Q 1UHFA 3CC4T 2VXEA 4PNOA 4C8QC 5CK9A 2DXUA 2RHIA 1PNJA 3I55A 1SPKA 1U5SA 5GMKm 4PJNA 2VASA 4J83A 3VS3A 1VQ4A 4HT9A 3OW2A 3KXTA 1QVGP 3OYCA 3I55T 2B8AA 2O01E 3VS2A 3O5ZA 5GAOn 2EYYA 1KC8U 1VQNA 2EYXA 1VQ4T 4ATOA 2P0PA 4JJNK 1V76A 2E41A 2HCKA 3CCJA 1YIJA 5HCKA 3HFOA 1OULA 2DTOA 1NM7A 2KYBA 2K9GA 3NTHA 1Q82U 1RI9A 2PVGB 1VQNT 1WXUA 4C5EA 1YWPA 1W4SA 1YIJT 2PVOB 5J39A 1KQSS 4IUQA 1M8VA 4A63B 2CZ6B 5LJ5f 1VYUA 4FU6A 1GRIA 1K8AR 2D8HA 3G6EA 4Y92A 4XU3A 4QT7A 2LQNA 3GPLA 1RAIB 2F5TX 1NPPA 2FL7A 4J7FA 3LWHA 3OW2P 2NLUA 1YJWQ 1KD1C 3QWXX 4XTYA 1KC8C 3EFOA 3QSUA 3MEVA 1ABQA 2D8JA 1X6OA 2O4XB 2GQVA 5LJ5e 1YN8A 1WHHA 2LQ8A 3QPHA 3WXMB 5GAOp 1BK2A 2JN0A 2DJQA 4UC4A 3EGUA 1M4ZA 1NLOC 1KQ1A 3VV0A 2CT3A 2V8KA 3LX7A 2K5FA 3S3NA 4FYWB 2ROTA 3X20B 5KYUA 2JT4A 1ZSZC 4C92B 2SEMA 4JJBA 4M7DC 1TUCA 1EFNA 2CP0A 2RQVA 2VGNA 1YJNA 4M77B 1GXIE 4L5GA 1ZX6A 3ZBDA 1K0XA 1FXXA 2WACA 5FROA 2DXCA 3HTRA 4FYXB 4C8QG 1TTHB 4DBFA 1YJNT 4RG8A 5KYWA 4RMOA 1VQKA 8AT1B 3EH1A 3V8KA 3EG2A 2MWOA 3KUFA 3DKMA 1VQ5A 3FIFA 2LCCA 1UDLA 3SD4A 5IXBA 3UPUA 1MUZA 3HKSA 5FU7C 1VQKT 4IURA 5L8RE 1WA7A 1VQ5T 3EG0A 4X1VA 2M0OA 3NPFA 2YRCA 2HBPA 1BI1A 2X4WA 3ME9A 2E1HA 2RM4A 3CMEA 2ED1A 3SWNA 4R56A 2Y4YA 3EG3A 4O5VA 2K2VA 5KE3A 1LCKA 3QDFA 4Z8AA 3OW2S 2ECZA 3JB9I 1G83A 1CSKA 1M9SA 4HA8A 2DE0X 3CMET 4J7IA 1JRIA 2RHUA 3H8ZA 3META 1AZGB 4F7UF 2F69A 1UGSB 5HY6A 1LVKA 2JMAA 2CP3A 3BDLA 5D6YA 3G4SQ 3EFOB 3JCMQ 1QKXA 4X9DA 2CSQA 1K73C 1MV3A 1GFCA 2KI7A 2KY9A 5IT9E 3CCMQ 1PCXA 1I07A 1KFZA 4PJOG 4DBQA 2C0IA 3CC7Q 4QQDA 4PL6A 1QP2A 2RQTA 2FHDA 2QQSA 4C8QE 2EJFA 2XMFA 4GY5A 2EYQA 1YBYA 1QCNA 3HRTA 4WTOB 2MK5A 5GAMh 3PIOA 2P84A 3BFMA 1JBMA 2R57A 2WSCE 3A98A 4M7DG 2ZAEA 3CC2Q 2QQAA 3OY9A 1H8KA 4M7AG 3INZA 3NTKA 2X4JA 4M75C 2OI3A 4PJJA 5CKFA 3RESA 2YLBA 3CCUQ 4FT4A 2YDLA 4LUEA 2SRCA 2LT1A 1WHMA 3MEAA 2I2LA 4M4ZA 4DEXA 3GIBA 3RDVA 1VQ6A 2RPNA 4LDUA 3OYNA 2X35A 5C6SA 1LPLA 4MMLA 2G3RA 1M1FA 1WHKA 3BW1A 3I56T 1D0XA 2ZPEB 3EG9A 1VQ6T 1EIFA 1B07A 4LE9A 2QEXQ 2MWPA 4KGZB 2E6NA 4PJOE 2XG8D 2RHYA 4BI3A 2A37A 2RK2A 3QJYA 1HXDA 1WDXA 4HVUA 2RHZA 2EYWA 4C0DB 3M0QA 2DL8A 1I5OB 4CC3A 1YHQQ 1VQOQ 2DXTA 1K8AC 3H0IA 2YSQA 1ACMB 4A4FA 2CDTA 2DD4A 2JUFA 1VQ8Q 4M7DE 1BIAA 1LOJA 1MMDA 2E70A 2AT1B 1M90C 5KCHA 4M7AE 4BD3A 2F2WA 2M16A 1OU9A 2KRNA 3OB9A 2MPXC 4J9EA 1ZSZA 3PT9A 3G1JA 2JOYA 4ZGDB 4XTWA 2NUPA 4N0AC 2FPFA 2AK5A 4NOYA 1NJIU 4KBMB 4M7DA 5KYYB 4BDYA 3RMQA 4GLMA 1JQQA 2DIQA 1Y96A 1AWXA 2J6KA 1G5VA 3CPWA 5HKCA 4C8QB 2PU9B 3PGGA 1BCOA 2M02A 2XICA 1SF9A 1QMCA 4E2FB 2XIDA 2L0AA 4M75G 1IREB 1ZUKA 2JTMA 1XJWB 4E7HA 3RUXA 5GAMd 3RIRA 4QVCA 4E7IA 1UGPB 1BYMA 4PLLA 3OQ5A 2DPPB 2CUDA 2LP5A 1VQ7T 1B7TA 4ELYC 3L2WA 1K4US 1FYNA 2F2XA 1BBZA 4BI8B 3N5BB 2A08A 3MEWA 3VKIA 4RTUA 4RCCA 4HXJA 3S3OA 5GMKe 4FM4B 2VXFA 3CPWP 4DOWA 4J9BA 1FMVA 1UTIA 1YITQ 2JNGA 4E7KA 4C92F 1HSQA 3KBGA 3CEYA 1AOJA 1W70A 3A8HB 1UG1A 4OF1A 2RK1A 1RUWA 1GBQA 1RADB 4AFUC 1NEGA 1MMNA 4PJOB 1WIEA 3CBOA 5GAN4 4FYYB 4WCIA 3M0SA 1VQ9A 2DXBA 3R6NA 4KH1B 5GANd 4WF2A 5GAMj 3JB9F 2K5LA 3QZ5B 1X69A 2FYKA 1YCYA 2YUNA 2FZKB 2DKGA 1X6GA 2PNIA 2WSFE 1QWEA 2EQIA 1VQ9T 1BI3A 2COYA 4M75E 1Q95G 4XK8E 1BIBA 1RAEB 4OGEA 1KJWA 2A0FB 5GAMg 4M7DB 3CCEA 1N8RU 1M30A 1Y07A 2DMOA 2XU8A 4M7AB 1M1KR 4FSXA 3JSCA 3VS4A 1GCPA 1V29B 4M75A 2DL3A 1S72A 3OS5A 4JRPA 1WGSA 3LLRA 2OJ2A 2KRMA 4ZGEB 3CD6Q 3FRNA 3ASKA 3CXCS 1X6BA 5LJ5h 1B34B 4FCYA 2D6FA 3EGDB 1DJ7B 2HL3A 3NTIA 3CCQQ 2DM1A 5I2SA 1K9MC 1RAFB 1TWBA 2E3IA 3FDRA 1UGQB 2DBMA 5GANj 3M0TA 2AZVA 3A8OB 3CPWS 3C94A 3NHNA 4BY6B 4KUIA 2DEQA 1QP3A 2AKKA 1ZBXA 4CC4B 1UEBA 2X51A 3CQTA 1N27A 2VGMA 4DQ2A 1YJWT 4M78E 2K79A 2C0TA 4KH0B 1WX6A 2HNIA 2FPDA 1B3QA 1OX8A 2DK3A 3VRYA 1EZZB 3REAB 5CO7A 1T0JA 2FO0A 2D0QB 2DZCA 4TVRA 2GFUA 3JCMd 2A28A 3VS6A 1RI0A 2RO0A 1UUEA 4E7LA 1PSEA 4AG1C 2DRKA 3CCLA 2LTOA 4FIBA 1QVGA 4HCCA 2LC4A 2LCSA 2M9UA 4C0GA 2EW3A 2EWNA 4AFQC 4FL6A 2LQKA 4ESRA 3KFVA 1RABB 5GAN2 2COZA 2GGRA 2E5QA 4B9XA 1IXDA 5GAN3 3CBMA 2QQRA 5KYXA 4RTZA 4N0AA 2JS2A 1WJRA 1XQHA 1VUBA 1H641 3ZFJA 3TVTA 3CBPA 4HVWA 5HK3A 3MEUA 2GTOA 3G71Q 3HRUA 3OYJA 2VB6A 4AT1B 1M1GA 4IKFA 5GAN7 3SB2A 2RF0A 1KG1A 1G8XA 4EMHA 4QVDA 1YP5A 3X28B 2DVEA 3GNFB 1H3ZA 2CP5A 5FU6C 2CT4A 1I5LA 2OTLT 1RL2A 3PVQA 4KRTA 4LDVA 2K3BA 1KD1U 3E19A 4OB1B 5GAN5 2FB7A 5A2QE 2KDSA 4NL3A 2NUTB 2HSEB 2DVJA 3JCMg 2QA4Q 1KSWA 1VQPQ 2HKNA 3NMZC 1UGVA 5IHNA 3L2VA 3C12A 5CAIA 1WFWA 1MMAA 1QQJA 3OYMA 3G4SA 4C92D 2L3PA 2DZ9A 3A8LB 1E6GA 3CCRQ 2YT6A 2KSSA 2HMAA 2KR3A 2J6FA 3CCMA 5LJ5d 5DY9A 4A4GA 1VIFA 2RJDA 3G4ST 2HQEA 1G3SA 2KEAA 3VUZA 3OA6A 3V8JA 3CCMT 4PJLA 3VS0A 3JB9H 1CKBA 5IN1A 3CC7T 1M2VB 4XTZA 3PTAA 1TH7A 2YRVA 4M78B 3JB9D 1SSHA 2RMOA 3QKJA 2K7AA 1OPKA 2WSEE 3CC2A 2O88A 1Z9ZA 1SKUB 3TSZA 3OYLA 5GAOl 3JCMP 2DRMA 4RKUE 3CC2T 3MP1A 3EGXB 4ORZA 4RG2A 3CCUA 2V1QA 1ABOA 4C0ZA 1SEMA 5GAOq 2BZ8A 2NWMA 2EQMA 1TOVA 1RAGB 1QVGS 4ZTJA 1JJ2A 2RI2A 2YUQA 1KK7A 2KQWA 5LJ5j 1BB9A 3CCUT 1NYGA 3A1PA 3TREA 1IO6A 3ULRB 2OTJQ 3H0HA 2LCLA 3WVEB 2DLPA 1U1SA 1M1KC 3QIIA 5LJ5g 4C0FA 3CCSQ 4II1A 2ZPBB 1K73U 3E1SA 2GTJA 2GF7A 2VVKA 2XKOC 2EGAA 1E7OA 3EAEA 3RKWA 2DERA 4L6V5 2QEXT 2CKKA 5CR2A 1PSFA 1ZSGA 4JPBW 4DA4A 1YHQA 4OMMA 3HSBA 4HKEA 2EQKA 1VQOA 3QG1A 1M3BA 2DA9A 2JMCA 4ZTFA 3JV3A 1JJ2P 5L23A 2LQWA 1KIKA 1YHQT 1VQOT 1VQ8A 2DETA 2DIGA 4E7SA 1LJOA 1AD5A 2E65A 3DB4A 4J9IA 2HL5C 3EH2A 3P8BB 4P5NA 3CCJQ 3M54A 4MDXA 1OV3A 1VQ8T 4M7AF 2QDYB 3ZEHA 1RLQC 1WPYA 3MO8A 3A8MB 4HCKA 1WJSA 2F5KA 4E7ZA 3J80E 4LN2A 2LJ3A 1TXQA 1ZUUA 3OS1A 3G6EQ 6AT1B 3OYGA 1YJ9Q 4HCZA 4J9FA 1JXOA 1OZ2A 5KYUB 1Q86R 3E9FA 2ZPGB 2CGHA 4EMKC 1TUGB 1LNXA 1N6AA 2QDLA 1YWOA 5CCAA 5GMKh 1I4K1 3E9GA 1TS9A 1MNDA 4EPCA 4L59A 2V8IA 2EFIA 4C5IA 2PQWA 5LJ3h 5KYWB 3M0UA 4CI0C 1PRMC 2EGEA 1OPLA 2KT1A 5J26A 4J9HA 3C0CA 4ZN3A 4A53A 1K8AU 2CYZB 2I0NA 2ZPFB 1AEYA 1VOMA 3I56A 3UWNA 1W2BA 1QVPA 2V1RA 1YITA 1AZEA 2CP2A 1W1FA 1NZ9A 2CZ7B 1D3BA 4EIKA 3AT1B 1R0CB 1VYTA 1M90U 2R5AA 4B6MA 1N8RR 1SSFA 1TSFA 1YITT 3SWNB 1GFDA 1QCFA 2M51A 4ZNXA 2K57A 1U3OA 2PUKB 2A7YA 1VQ5Q 2GCXA 5A0DA 3HL8A 2QASA 1Q7YR 4RTYA 2ZGWA 1O75A 1D1AA 4XAXB 1ZHIA 3UA6A 3LH0A 2VC8A 1OYXA 1VA7A 4QQGA 1NEBA 4XTVA 4IIMA 3QBYA 4JZ3A 1FWZA 3O8VA 1VQMA 1W2BP 4IIOA 2GQIA 2AHJB 4R0KA 5GAOm 3MHXA 3V7SA 4J6YA 2ESWA 3FC3A 2DTIA 1G3WA 1Y57A 5CQYA 3QDRB 3OS2A 3IQLA 4FW2A 4EMGA 1VQMT 1U8RA 5CKEA 4JJCA 3V7RA 2J6OA 5EG2A 2CH4W 1XTDA 2K4YA 3M57A 2BUDA 2M1HA 4D8KA 1C6VX 3CD6A 1JU5C 3OYEA 4C92C 2RJEA 2W0ZA 3OMGA 2EYZA 4MZMA 4F7UA 4Q5WA 4OVAA 4N4HA 3CCQA 3CD6T 3THKA 1GCQC 4OMPA 3NFCA 1YCSB 4XU0A 2KGTA 1PD0A 5CVIA 1VYVA 1H3HA 4N4IA 2HQXA 3M9QA 1QW1A 3CCQT 2K2MA 1VQ7A 1PKTA 1ZA1B 2O2OA 2QYZA 5I2MA 1Q81R 5KCOA 1GL5A 2GBQA 4PJOD 2HDAA 5LJ3f 1K0SA 1ZBJA 2Z0WA 2XD0A 4M78F 2BZXA 1UE9A 3LYIA 3EG9B 5CQXA 4IUPA 3UT1A 3GNGA 1KHCA 1NBEB 5GMKi 4BUGA 2HQHA 5IXFA 3MP6A 2LRQA 1M3CA 1JO8A 1M8MA 2CZ0B 5LJ3e 4DOVA 4LDWA 3LH5A 2BZYA 1KC8R 4M77F 4M7AD 2OAWA 3QYHB 2FRYA 2P4RA 4PLIA 2XI9A 1PG5B 2HBWA 1I8FA 2FVUA 1IB8A 3NGPA 1Q82R 1D1BA 1F1BB 3FLGA 2OAUA 2LZ6B 2JM8A 2YXYA 3CPFA 3QUIA 4QQ6A 3OYDA 2DF6A 2X4XA 1RAAB 2QG9B 2IPOB 4OB2B 3G71A 2KROA 4ME7A 2L2PA 3U23A 2RB6A 4MDWA 1X2KA 1AVZC 1UECA 1IRXA 5GMKj 1K9MU 3JCMX 2FZCB 2LNHB 2LVMA 1ZSZB 2VUBA 4JUVA 3G71T 2NUPB 2YLCA 3FB9A 4EMKA 1M2OA 5I11A 4J6XA 3RMSA 1IGUA 4K11A 4LXCA 1Y96B 4RCBA 1R77A 2LT4A 4NS5A 3GLXA 1FX7A 3CCVQ 1UGRB 3SEMA 1Q86C 1QLYA 2L3QA 2EKOA 2L89A 1BU1A 4QKUA 4C5HA 3JCMc 3CMAQ 5LJ3g 3M59A 5GAOr 4BE2A 4XU2A 4D6WA 5IH2A 3OBYA 2W10A 3TEEA 3EFSA 3M55A 2E6ZA 5FU7B 1PC0A 2FG0A 1VIEA 3BY7A 4E7JA 1AWOA 3VYGA 2QA4T 1QCOA 1YI2Q 2YUPA 1VQPT 1MGQA 1PRLC 2XDPA 4LDYA 1WHGA 4JDSA 2K6DA 2XDDA 4KGXB 4JRKA 3JB9G 4FSSA 1PD1A 1YJWA 3EHQA 1VQLQ 3L2ZA 3OBWA 3BE3A 2HAXA 4OMNA 1HK9A 4HVVA 2EQJA 1ZUYA 2JTEA 1OU8A 4XQ3A 2YUOA 1CKAA 3L1AA 2PVDB 2RI3A 4A4EA 4OMFB 3FJ5A 3S3MA 5A0LA 3QXEB 4C0DC 3A8GB 4BE1A 1K73R 4VUBA 1Q7YC 2QQ9A 3PFSA 3I5RA 2A36A 4CC2A 2MF2A 2ZPIB 2YHTA 1I1JA 2O4XA 4PFPA 4BB7A 2YWWA 1WJQA 1MHNA 3UATA 4PK4A 1NPRA 5CIUA 2P0KA 3PMTA 4GLKA 2EJGA 1BKBA 4RTTA 3OYAA 3HRSA 2DILA 2ROLA 1JB0E 2RI5A 2H3EB 2OTJA 4KT0E 1FMWA 1WXTA 3JB9J 5DLQE 4C92A 2E10A 3MPUB 2JW4A 2B86A 2X9HA 2OTJT 3PE0A 5A0GA 5IAYA 1IHWA 1GCQA 2MOXA 2DL5A 4M75B 4MMKA 4ELZC 3OSVA 2JTFA 1Y71A 5FLXE 3CCST 2DTHA 3JCMJ 2R5MA 4AMCA 1RAHB 2CZ1B 3EFRA 5D6WA 2D9TA 2FPEA 1S1NA 2F2VA 5LL6S 2J05A 5IHIA 3QO3A 2MMPA 5GJWB 1IGQA 2DEUA 4LUDA 4M78D 4AFZC 4ZGJB 3CCEQ 3HHTB 2JZ2A 4Z88A 2EJ9A 2BE9B 3REBB 2CREA 1GBRA 2QGGA 2DYBA 4A4KA 1R0BG 3C4SA 5IHKA 5I21A 5AYFA 1Q81C 2BE7D 1S72Q 3TCJA 1HJDA 1ZLMA 1SRMA 3TQ7P 2L5QA 3CC7A 4MZPA 3UDCA 3CCJT 3QYGB 4M77D 1UJ0A 3RR6A 1K1ZA 4KGVB 1PHTA 2BKDN 1ARKA 3PNWC 1YJ9A 1MNEA 2R58A 4FW1A 2JJ9A 4C8QF 2OTLQ 1D0ZA 2E12A 4GBQA 4F16A 3G6ET 1AWJA 2L3SA 3RBBB 1YJ9T 5CKDA 5KE2A 4E6RA 3OSSC 1M90R 1M1KU 2XK0A 1U1TA 4PJOC 4NL2A 2MIOA 1Q82C 3VJPA 1M3AA 5ECAA 4OMOA 1NYFA 5KYXB 2CP6A 1AWWA 2PUOB 2EQUA 1T3LA 1UJYA 1N9RA 3OYKA 4XU1A 3CCLQ 3OYYA 3I35A 2XDBA 4Z02A 4ZN1A 1BCMA 2K3XA 2VYTA 1QKWA 2E5KA 2JM9A 4M7AC 2CS7A 2E3HA 1WHLA 5KH6A 1K76A 3OYBA 1MMGA 3PIPA 3CC4Q 2OX7A 5GAN6 2QEXA 2KXDA 1NJIR 4J9GA 4PJOF 2G6FX 2P0QA 3EG1A 3I55Q 4ANJA 4J5YA 4B9WA 3L2UA 3F70A 1X75C 2YRDA 1M5Q1 1VQ4Q 3ZL7C 3V7CA 1WHJA 3HPWA 2MI6A 2D1XA 2MYSA 2RH2A 2EIFA 3RERA 5DLOA 3SDZA 1KHIA 4BY6C 3QZ9B 1VQNQ 4Z89A 4N4GA 1QVFA 3RKXA 4IUUA 3M0PA 4M7DF 1YIJQ 2LJ0A 4JS4A 3X24B 4PFZA 4F17A 3LW5E 1RACB 4Y28E 3UA7A 2JVVA 4JLGA 3OS0A 1D09B 2KYMA 2CSIA 2HKQB 1PM3A 4KULA 3GP8A 2KE9A 2FZGB 2A3LA 3D7SB 2ABLA 2Y4XA 2C0OA 3ER0A 2MCNA 2FEIA 4OMQA 5AT1B 4CC7A 2QK0A 3AHUA 1X2QA 2IVWA 2RQWA 3FJPA 3M4GA 3JAME 1M27C 3GF5A 1XOVA 4LDXA 1HYOA 1WYXA 1NE8A 1QVFP 3GBQA 1JEGA 4YTLA 5CKBA 3R6OA 1YFNA 5KYYA 4RTWA 2LNVA 3MJXA 4BACA 1RLPC 1G3YA 1N5ZA 4F7UG 2ZCFB 3JCMb 5FW9A 4JRIA 3J7AF 1WNLA 4JRQA 4C8QA 2J7IA 3HFNA 1WQ7A 2ATCB 4A54A 4JS5A 1PKSA 3I9QA 1PWTA 2KRSA 1K9MR 1OOTA 3LGFA 4J9DA 2O31A 1YJNQ 4DEYA 2QXFA 3J81E 3M53A 2RA2A 2RQUA 1X27A 5GJVB 1JJ2S 4BE0A 1OX9A 3DLMA 2KVQG 2F1LA 4RUGA 2QTVA 1VQKQ 1I81A 2VWFA 1Y7XA 1OI1A 1JXMA 1WZOA 2NYSA 2DO3A 3H9NA 3HP9A 4IUVA 1X43A 2LMJA 4OB3B 1AHJB 3M58A 5GANh 2QI2A 5CKHA 4C8QD 1Y0MA 9ATCB 3QHSA 2BIVA 2NUZA 2LX9A 3RKYA 3OMCA 3WVDB 1K9AA 3CMEQ 3L2RA 4PKCC 1UFFA 4R55A 3PMIA 4M75F 3OYIA 2C06A 3VRZA 3RNJA 1ZA2B 4PJOA 2EKHA 2JXBA 4F7UE 1R8OB 5EC7A 1TU0B 4M78C 4X9CA 3CCVA 2X4YA 3FEOA 1TG0A 1D0YA 4Y91A 3VS7A 2RJCA 3OYFA 1T0HA 5I22A 3TSWA 1QVFS 2RN8A 2HEQA 3OYHA 3CMAA 1SHFA 3PVLA 1OEBA 3CCVT 3X25B 3CXCA 3E2UA 2EVRA 2ZPHB 4F04B 5FWBA 2GFAA 3M5AA 3CMAT 2HD0A 1ZQ1A 5D7UA 4M77C 2EGCA 1YI2A 2EAYA 2E4HA 1YNZA 4M7AA 5FU6B 3JCMV 2J06A 5FWCA 1VQLA 1A0NB 1YI2T 2CP7A 3UF4A 3V8LA 1J3TA 1V1CA 3T9NA 4X34A 4QW2A 2O9SA 2ZZDA 2COWA 2VV5A 1VQLT 1D1CA 4IUTA 1B34A 5GAMf 2X3WD 3EGDA 5GMKl 2CUBA 2EPDA 1D3BB 3S6WA 4HCBA 1U06A 2PZ1A 2IIMA 3H6ZA 1SHGA 3CXCP 1IHVA 2O9VA 5LJ3d 4F14A 3JCMh 1NJIC 4J6WA 1MV0B 1O9SA 3VYHB 2IG0A 3M56A 1OZ3A 3QWYA 4FT2A 4M7DD 1WLPB 3MCAB 5GAMe 3A5ZB 3M4YA 1KD1R 4O6JA 2QGFB 7AT1B 2DBKA 1W2BS 3C95A 4J8OA 3I56Q 4HT8A 1VQ6Q 2EBPA 1Q86U 1N9SA 1BI0A 1TUDA 3L2QA 1G2BA 1X01A 2H3JA 4OGCA 3TU4K 2DD5A 4RTXA 4JZ4A 2FRWA 5KYNA 1BI2A 1SRLA 2PTKA 2RD1A 2DNUA 2RNAA 2M0YA 2L8DA 3P8DA 2LDMA 2CH4A 5GANf 4JLIA 2QTXA 3URGA 4DBRA 4M78G 4JJDA 2DFUA 1HD3A 4FYVB 5LJ3j 3P8HA 3Q1JA 1W6XA 4PFOA 4LNPA 4C92G 4F7UB 1VQMQ 3VS1A 2DX1A 5J3BA 2ED0A 5GANe 4AFSC 2H8HA 3DB3A 1OQKA 1QWFA 2QA4A 2P4TA 4M77G 4A4HA 1VQPA 2KAFA 1SG5A 4PJMA 2KBTA 4QVZA 2KNBB 1KQSA 4LD9K 5DM7R 3DLLA 2KT8A 3CCET 1P92A 1Q7YU 3CCRA 1NLPC 2DYIA 3G7ZA 2QQBA 1UHCA 2AKLA 1WQWA 3H0FA 4E47A 3GOXA 3EHRA 1G3TA 8ATCB 1S72T 3H41A 4BI4A 3CCRT 5M9OA 2NUTA 4D8DA 1NG2A 1C1AA 3BDUA 3MKDA 1EX4A 4RTVA 4J9CA 3LWIA 2LJ1A 4BDZA 2V26A 1C0MA 3VS5A 5D6XA 2K5IA 1H92A 2OTLA 4OP0A 3SWNC 5GAN8 1N8RC 4LD6A 1VQ7Q 2MAMA 3SFMA 5HK0A 1I0CA 5C0MA 3MP8A 2KXCA 2RQRA 1KQ2A 4KUDK 2AIRB 1KQSP 5GANg
chains in the Genus database with same CATH topology
4PLLA 4V2SA 2K3YA 3VJPA 2EFIA 3JCMW 4C5IA 2PQWA 5LJ3h 3OQ5A 2DJZA 2DPPB 3JCMf 4CI0C 1VQ7T 4M75D 1UB4A 2PUOB 2KK4A 4CRIA 4ELYC 2EQUA 3VU3C 2V8JA 3L2WA 1N9RA 3OYKA 5J26A 4BI8B 3QJ6A 4ZN3A 4XU1A 3N5BB 4A53A 4C92E 1K8AU 3LGLA 2CYZB 3MEWA 4XTXA 3VKIA 4RCCA 2ZPFB 3S3OA 4EDUA 5GMKe 4FM4B 2VXFA 3OYYA 4DOWA 3I56A 3UWNA 2XDBA 3VUBA 1W2BA 4M78A 4Z02A 1XNIA 1QVPA 2JNGA 3JRZA 4ZN1A 4E7KA 4C92F 1YITA 2KMTA 4M77E 3KBGA 2K3XA 3CEYA 2L3RA 3A8HB 2VYTA 1NZ9A 2CZ7B 2DAQA 1D3BA 3JCMe 4M7AC 2XHCA 4OF1A 4XTUA 2RK1A 2CS7A 5FRNA 1IZ6A 1M90U 5FRMA 3CCLT 2R5AA 5KH6A 1SSFA 4EMKB 3OYBA 3PIPA 1YITT 2RHXA 3SWNB 5GAN6 3CCSA 2QEXA 3CC4A 2Y90A 2K57A 1Q81U 4MZTA 4OB0B 2PUKB 3X26B 2E64A 2A7YA 4PJOB 2GCXA 2RJFA 4M77A 4C5GA 5A0DA 3HL8A 3CBOA 5GAN4 2ZGWA 1O75A 3L42A 4PJOF 4XAXB 2P0QA 3CC4T 1VQ9A 2DXBA 1ZHIA 2VXEA 3LH0A 2VC8A 4PNOA 4C8QC 5GANd 4WF2A 1OYXA 5GAMj 2K5LA 3JB9F 5CK9A 2DXUA 2RHIA 3QZ5B 4J5YA 4B9WA 3I55A 3L2UA 3F70A 1X75C 2FYKA 4QQGA 1YCYA 5GMKm 4XTVA 1M5Q1 2DKGA 3V7CA 2WSFE 3QBYA 4J83A 1VQ4A 3HPWA 4HT9A 1VQ9T 1BI3A 2MI6A 3OW2A 4M75E 2RH2A 2EIFA 1FWZA 4XK8E 1BIBA 3O8VA 3KXTA 4OGEA 3RERA 5DLOA 3SDZA 1KHIA 4BY6C 3OYCA 3I55T 1VQMA 2B8AA 2O01E 5GAMg 2AHJB 3QZ9B 5GAOm 3MHXA 5GAOn 3V7SA 4M7DB 4J6YA 3FC3A 3CCEA 2DTIA 1N8RU 1G3WA 5CQYA 1KC8U 3QDRB 1VQNA 1VQ4T 4ATOA 2P0PA 1Y07A 4N4GA 3RKXA 3OS2A 4IUUA 2XU8A 4JJNK 1QVFA 4M7DF 4M7AB 2E41A 4EMGA 4FSXA 1VQMT 3CCJA 3JSCA 1YIJA 1V29B 1U8RA 3HFOA 5CKEA 4JS4A 3V7RA 2DTOA 3NTHA 4M75A 1Q82U 5EG2A 2PVGB 1VQNT 3X24B 1S72A 3OS5A 4JRPA 3LW5E 1WGSA 1XTDA 4C5EA 2K4YA 3LLRA 3M57A 4ZGEB 3FRNA 3ASKA 1W4SA 3CXCS 1YIJT 2PVOB 2BUDA 2M1HA 4Y28E 5J39A 5LJ5h 1KQSS 3OYEA 3CD6A 4C92C 4IUQA 1B34B 2JVVA 2RJEA 4JLGA 3OS0A 2D6FA 1M8VA 1DJ7B 2CZ6B 3OMGA 5LJ5f 4FU6A 3NTIA 4MZMA 4F7UA 4Q5WA 3G6EA 4KULA 4OVAA 5I2SA 3GP8A 1K9MC 2A3LA 4N4HA 4XU3A 3CCQA 3CD6T 3GPLA 3NFCA 2F5TX 1NPPA 2FL7A 2Y4XA 4J7FA 3LWHA 3ER0A 3FDRA 1UGQB 2NLUA 5GANj 4XU0A 3A8OB 3CPWS 3AHUA 2IVWA 3C94A 3FJPA 5CVIA 1KD1C 4XTYA 3M4GA 1KC8C 4N4IA 4BY6B 4KUIA 2HQXA 2DEQA 3M9QA 3JAME 3GF5A 1QW1A 3CCQT 1QP3A 3QSUA 3MEVA 1XOVA 1X6OA 2O4XB 4LDXA 2GQVA 1VQ7A 1ZBXA 1NE8A 1UEBA 5LJ5e 4YTLA 5CKBA 1N27A 3R6OA 2VGMA 2LNVA 2LQ8A 4DQ2A 3QPHA 5I2MA 3WXMB 5GAOp 4BACA 1YJWT 5KCOA 4M78E 1G3YA 4PJOD 2JN0A 4F7UG 4UC4A 1GXIE 2ZCFB 3JCMb 1M4ZA 2HNIA 1KQ1A 4JRIA 3VV0A 3J7AF 2DK3A 1WNLA 5LJ3f 2V8KA 4JRQA 3LX7A 5CO7A 2K5FA 2XD0A 4M78F 4C8QA 3S3NA 2D0QB 2DZCA 4TVRA 2GFUA 3X20B 3JCMd 3LYIA 1RI0A 2RO0A 4C92B 3HFNA 1PSEA 5CQXA 4E7LA 1WQ7A 3CCLA 4IUPA 2LTOA 3UT1A 4A54A 3GNGA 1KHCA 4FIBA 4JS5A 1QVGA 4HCCA 4M7DC 5GMKi 3LGFA 2VGNA 2LC4A 4BUGA 2M9UA 3MP6A 4M77B 2QXFA 3J81E 2LRQA 3M53A 4C0GA 4L5GA 1YJNA 2EWNA 2RA2A 2CZ0B 5LJ3e 4DOVA 4FL6A 4BE0A 2LQKA 4LDWA 3ZBDA 3DLMA 2KVQG 1JJ2S 4M77F 1FXXA 4M7AD 5GAN2 2WACA 3QYHB 2E5QA 5FROA 2DXCA 4B9XA 1I81A 5GAN3 4C8QG 3CBMA 1YJNT 4RG8A 4RMOA 4PLIA 1VQKA 1Y7XA 1OI1A 2QQRA 2XI9A 1I8FA 4N0AA 3V8KA 1WJRA 2FVUA 2MWOA 1XQHA 1VUBA 3KUFA 3DKMA 3FLGA 1VQ5A 2OAUA 1H641 2LCCA 3FIFA 3ZFJA 3CPFA 3QUIA 4QQ6A 2DO3A 3CBPA 3SD4A 5HK3A 3OYDA 3HP9A 4IUVA 2X4XA 3UPUA 3MEUA 4OB3B 3HKSA 5FU7C 3HRUA 3OYJA 1VQKT 4IURA 4OB2B 3G71A 4ME7A 1AHJB 3M58A 1M1GA 4IKFA 5L8RE 2RB6A 5GAN7 4MDWA 5GANh 2QI2A 1VQ5T 3SB2A 5CKHA 4C8QD 5GMKj 3QHSA 2BIVA 1K9MU 1KG1A 4EMHA 2LX9A 4QVDA 2M0OA 3RKYA 3JCMX 3X28B 2LVMA 3OMCA 2HBPA 2DVEA 3GNFB 3WVDB 1BI1A 2VUBA 2X4WA 1H3ZA 4JUVA 5FU6C 3G71T 1I5LA 1RL2A 2YLCA 3ME9A 4LDVA 3L2RA 3FB9A 2E1HA 4PKCC 4EMKA 2RM4A 4R55A 3CMEA 1KD1U 3PMIA 3SWNA 4J6XA 3E19A 3RMSA 4M75F 4R56A 3OYIA 4OB1B 2Y4YA 5GAN5 2C06A 1Y96B 4RCBA 4O5VA 2K2VA 2LT4A 3GLXA 4NS5A 1FX7A 5KE3A 2FB7A 3OW2S 4PJOA 4F7UE 3JB9I 5A2QE 1R8OB 1UGRB 2KDSA 4NL3A 1Q86C 1M9SA 4HA8A 4M78C 4X9CA 4J7IA 3CMET 1JRIA 2X4YA 2RHUA 3FEOA 3CCVA 2EKOA 3OYFA 2L89A 4Y91A 2RJCA 3H8ZA 3JCMg 4C5HA 3META 3JCMc 1QVFS 4F7UF 5LJ3g 3OYHA 3M59A 2F69A 5GAOr 1UGSB 5HY6A 3CMAA 4BE2A 4XU2A 4D6WA 3L2VA 3CCVT 3X25B 3CXCA 3C12A 3BDLA 5D6YA 5CAIA 3OBYA 3TEEA 3JCMQ 3EFSA 3M55A 2E6ZA 5FU7B 3OYMA 3G4SA 2ZPHB 4C92D 4X9DA 1VIEA 2DZ9A 3BY7A 1K73C 4E7JA 2GFAA 2KY9A 3A8LB 3M5AA 3VYGA 2QA4T 5IT9E 3CMAT 2HD0A 1ZQ1A 2KSSA 1VQPT 4M77C 1MGQA 4PJOG 3CCMA 1YI2A 2XDPA 4LDYA 2EAYA 4PL6A 1QP2A 4QQDA 4JDSA 5DY9A 4A4GA 5LJ5d 1VIFA 2XDDA 2RJDA 4JRKA 3JB9G 3G4ST 4M7AA 5FU6B 2HQEA 3JCMV 1YJWA 2FHDA 3L2ZA 1G3SA 3OBWA 2QQSA 4C8QE 3VUZA 3OA6A 1VQLA 3V8JA 3CCMT 2EJFA 1YI2T 2HAXA 4GY5A 3JB9H 5IN1A 2EYQA 3CC7T 1YBYA 3V8LA 3HRTA 4XTZA 3T9NA 4X34A 4QW2A 1HK9A 5GAMh 3PIOA 1TH7A 3PTAA 2ZZDA 3BFMA 1JBMA 2VV5A 1VQLT 2R57A 2WSCE 2YRVA 2EQJA 1B34A 4IUTA 4M78B 3JB9D 5GAMf 4XQ3A 4M7DG 3QKJA 5GMKl 2QQAA 1D3BB 3S6WA 3OY9A 3L1AA 2PVDB 2WSEE 3CC2A 4HCBA 4M7AG 3H6ZA 3INZA 2RI3A 3NTKA 4OMFB 4A4EA 3S3MA 5A0LA 2X4JA 5LJ3d 3QXEB 4M75C 4C0DC 3A8GB 3JCMh 4BE1A 3OYLA 4VUBA 5GAOl 1NJIC 1Q7YC 2QQ9A 3PFSA 4J6WA 5CKFA 3VYHB 1O9SA 3JCMP 2IG0A 4RKUE 3M56A 3CC2T 3MP1A 3RESA 1OZ3A 2MF2A 2YLBA 2YHTA 2ZPIB 4FT2A 4FT4A 4RG2A 4M7DD 2O4XA 3MCAB 3CCUA 4BB7A 3A5ZB 5GAMe 2LT1A 3M4YA 4C0ZA 5GAOq 1WJQA 1MHNA 3MEAA 4O6JA 2EQMA 2I2LA 1W2BS 1QVGS 1NPRA 3C95A 4J8OA 4ZTJA 1JJ2A 4HT8A 3GIBA 2RI2A 2KQWA 5CIUA 2P0KA 1Q86U 1N9SA 3PMTA 4GLKA 5LJ5j 1BI0A 2EJGA 3CCUT 1VQ6A 1BKBA 4LDUA 3OYNA 3OYAA 2X35A 3HRSA 5C6SA 3TREA 3L2QA 4MMLA 1X01A 2H3JA 1JB0E 2G3RA 2RI5A 1M1FA 2OTJA 2LCLA 3WVEB 4KT0E 3BW1A 3I56T 4OGCA 3TU4K 2DD5A 2ZPEB 5DLQE 4C92A 2E10A 1U1SA 1EIFA 3JB9J 1M1KC 3QIIA 1VQ6T 5LJ5g 4C0FA 4II1A 2MWPA 1BI2A 2E6NA 2RD1A 2ZPBB 1K73U 4PJOE 2XG8D 3E1SA 2OTJT 2RHYA 4BI3A 2L8DA 5A0GA 3P8DA 2LDMA 2GF7A 5IAYA 5GANf 2RK2A 2XKOC 4JLIA 3QJYA 1HXDA 2QTXA 3EAEA 2RHZA 4M75B 3RKWA 4L6V5 3URGA 4MMKA 4C0DB 3OSVA 2JTFA 1Y71A 4ELZC 4M78G 5FLXE 3CCST 2QEXT 2DTHA 2CKKA 3JCMJ 5CR2A 1PSFA 2R5MA 2CZ1B 4DA4A 3EFRA 5D6WA 1YHQA 2D9TA 2DXTA 2EQKA 4HKEA 3P8HA 5LJ3j 1VQOA 3Q1JA 1K8AC 3HSBA 3QG1A 4C92G 4ZTFA 5LL6S 4A4FA 4F7UB 2DD4A 2JUFA 3QO3A 5J3BA 5GANe 4M7DE 1YHQT 1BIAA 1LOJA 2MMPA 1VQOT 1VQ8A 2DIGA 1LJOA 4M78D 4ZGJB 3DB3A 2JZ2A 3HHTB 2E65A 2EJ9A 3DB4A 2E70A 2P4TA 2QA4A 4M77G 1M90C 4A4HA 5KCHA 3P8BB 2KAFA 1VQPA 4M7AE 4BD3A 2M16A 4P5NA 4QVZA 4A4KA 3M54A 4MDXA 3OB9A 3C4SA 1KQSA 4LD9K 5I21A 1VQ8T 5AYFA 3PT9A 5DM7R 1Q81C 2JOYA 4ZGDB 4XTWA 3DLLA 4M7AF 4N0AC 3TCJA 3CCET 4NOYA 1P92A 2QDYB 1NJIU 4KBMB 1Q7YU 3CCRA 4M7DA 3ZEHA 1WPYA 3G7ZA 2L5QA 3MO8A 4BDYA 3RMQA 2QQBA 3A8MB 1WJSA 1WQWA 3CC7A 4MZPA 3UDCA 2F5KA 3QYGB 3CCJT 2DIQA 4M77D 1Y96A 4E47A 3GOXA 1G5VA 3J80E 2BKDN 1G3TA 3CPWA 3OS1A 3CCRT 4BI4A 1S72T 5M9OA 3OYGA 5HKCA 4HCZA 3BDUA 4C8QB 3PNWC 2PU9B 1YJ9A 1OZ2A 3LWIA 2R58A 3PGGA 3E9FA 2ZPGB 2CGHA 4C8QF 4BDZA 2XICA 2XIDA 5D6XA 4M75G 4EMKC 2K5IA 2E12A 1LNXA 1N6AA 5CCAA 4OP0A 3G6ET 2OTLA 5GMKh 3SWNC 5GAN8 1IREB 1YJ9T 1N8RC 5CKDA 5KE2A 1I4K1 4LD6A 3E9GA 3OSSC 2MAMA 1M1KU 3SFMA 2XK0A 5HK0A 1U1TA 2JTMA 5C0MA 3MP8A 4PJOC 4EPCA 3RUXA 4NL2A 4L59A 5GAMd 4E7HA 2V8IA 3RIRA 4QVCA 4E7IA 1UGPB 4KUDK 1KQ2A 1BYMA 2OTLT 1Q82C 5GANg
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 E;  4OB1 B;  3WVE B;  4KT0 E;  2DPP B;  2DD5 A;  2PUO B;  2ZPE B;  1UGR B;  1UGQ B;  3A8O B;  2ZPB B;  2CYZ B;  2ZPF B;  4FM4 B;  1QP3 A;  1UGS B;  4L6V 5;  3X25 B;  1PSF A;  3A8H B;  2CZ7 B;  2CZ1 B;  2ZPH B;  2ZCF B;  3A8L B;  3VYG A;  1QP2 A;  2DD4 A;  2D0Q B;  4OB0 B;  3X20 B;  2PUK B;  3X26 B;  4ZGJ B;  3HHT B;  1PSE A;  2DXB A;  1GXI E;  2ZZD A;  3QZ5 B;  4ZGD B;  2CZ0 B;  2WSC E;  2QDY B;  2WSF E;  3A8M B;  3QYH B;  2DXC A;  3QYG B;  4XK8 E;  2PVD B;  2WSE E;  2O01 E;  2AHJ B;  3QZ9 B;  3QXE B;  3A8G B;  3VYH B;  2PU9 B;  4RKU E;  4OB3 B;  2ZPI B;  2ZPG B;  4OB2 B;  1V29 B;  1AHJ B;  5L8R E;  2PVG B;  3X24 B;  3LW5 E;  1IRE B;  4ZGE B;  3X28 B;  3WVD B;  2PVO B;  4Y28 E;  1DJ7 B;  1UGP B;  2CZ6 B; 
#chains in the Genus database with same CATH topology
 4V2S A;  2K3Y A;  3JCM W;  2DL7 A;  2DJZ A;  1WI7 A;  3JCM f;  4M75 D;  1UB4 A;  3I5S A;  2KK4 A;  4CRI A;  1FMK A;  2ENM A;  2V8J A;  2HSP A;  3VU3 C;  3M0R A;  3QJ6 A;  1T3S A;  4C92 E;  3LGL A;  4XTX A;  4AG2 C;  1M2V A;  1AT1 B;  4EDU A;  2QAZ A;  3VUB A;  4M78 A;  1XNI A;  3JRZ A;  2KMT A;  4M77 E;  2L3R A;  3SHW A;  2DAQ A;  2DL4 A;  3JCM e;  2XHC A;  4XTU A;  5FRN A;  1IZ6 A;  5FRM A;  3CCL T;  2HZY A;  2LX7 A;  4EMK B;  1Z9Q A;  2RHX A;  1WXB A;  3CCS A;  3CC4 A;  2Y90 A;  4DBH A;  1Q81 U;  2VKN A;  4MZT A;  4OB0 B;  2X3X D;  1E6H A;  2AZS A;  2GNC A;  3EGX A;  2D0N A;  2E64 A;  3X26 B;  2BTT A;  4C5G A;  2RJF A;  4M77 A;  2JS0 A;  4OML A;  3L42 A;  1VQ9 Q;  1UHF A;  3CC4 T;  2VXE A;  4PNO A;  4C8Q C;  5CK9 A;  2DXU A;  2RHI A;  1PNJ A;  3I55 A;  1SPK A;  1U5S A;  5GMK m;  4PJN A;  2VAS A;  4J83 A;  3VS3 A;  1VQ4 A;  4HT9 A;  3OW2 A;  3KXT A;  1QVG P;  3OYC A;  3I55 T;  2B8A A;  2O01 E;  3VS2 A;  3O5Z A;  5GAO n;  2EYY A;  1KC8 U;  1VQN A;  2EYX A;  1VQ4 T;  4ATO A;  2P0P A;  4JJN K;  1V76 A;  2E41 A;  2HCK A;  3CCJ A;  1YIJ A;  5HCK A;  3HFO A;  1OUL A;  2DTO A;  1NM7 A;  2KYB A;  2K9G A;  3NTH A;  1Q82 U;  1RI9 A;  2PVG B;  1VQN T;  1WXU A;  4C5E A;  1YWP A;  1W4S A;  1YIJ T;  2PVO B;  5J39 A;  1KQS S;  4IUQ A;  1M8V A;  4A63 B;  2CZ6 B;  5LJ5 f;  1VYU A;  4FU6 A;  1GRI A;  1K8A R;  2D8H A;  3G6E A;  4Y92 A;  4XU3 A;  4QT7 A;  2LQN A;  3GPL A;  1RAI B;  2F5T X;  1NPP A;  2FL7 A;  4J7F A;  3LWH A;  3OW2 P;  2NLU A;  1YJW Q;  1KD1 C;  3QWX X;  4XTY A;  1KC8 C;  3EFO A;  3QSU A;  3MEV A;  1ABQ A;  2D8J A;  1X6O A;  2O4X B;  2GQV A;  5LJ5 e;  1YN8 A;  1WHH A;  2LQ8 A;  3QPH A;  3WXM B;  5GAO p;  1BK2 A;  2JN0 A;  2DJQ A;  4UC4 A;  3EGU A;  1M4Z A;  1NLO C;  1KQ1 A;  3VV0 A;  2CT3 A;  2V8K A;  3LX7 A;  2K5F A;  3S3N A;  4FYW B;  2ROT A;  3X20 B;  5KYU A;  2JT4 A;  1ZSZ C;  4C92 B;  2SEM A;  4JJB A;  4M7D C;  1TUC A;  1EFN A;  2CP0 A;  2RQV A;  2VGN A;  1YJN A;  4M77 B;  1GXI E;  4L5G A;  1ZX6 A;  3ZBD A;  1K0X A;  1FXX A;  2WAC A;  5FRO A;  2DXC A;  3HTR A;  4FYX B;  4C8Q G;  1TTH B;  4DBF A;  1YJN T;  4RG8 A;  5KYW A;  4RMO A;  1VQK A;  8AT1 B;  3EH1 A;  3V8K A;  3EG2 A;  2MWO A;  3KUF A;  3DKM A;  1VQ5 A;  3FIF A;  2LCC A;  1UDL A;  3SD4 A;  5IXB A;  3UPU A;  1MUZ A;  3HKS A;  5FU7 C;  1VQK T;  4IUR A;  5L8R E;  1WA7 A;  1VQ5 T;  3EG0 A;  4X1V A;  2M0O A;  3NPF A;  2YRC A;  2HBP A;  1BI1 A;  2X4W A;  3ME9 A;  2E1H A;  2RM4 A;  3CME A;  2ED1 A;  3SWN A;  4R56 A;  2Y4Y A;  3EG3 A;  4O5V A;  2K2V A;  5KE3 A;  1LCK A;  3QDF A;  4Z8A A;  3OW2 S;  2ECZ A;  3JB9 I;  1G83 A;  1CSK A;  1M9S A;  4HA8 A;  2DE0 X;  3CME T;  4J7I A;  1JRI A;  2RHU A;  3H8Z A;  3MET A;  1AZG B;  4F7U F;  2F69 A;  1UGS B;  5HY6 A;  1LVK A;  2JMA A;  2CP3 A;  3BDL A;  5D6Y A;  3G4S Q;  3EFO B;  3JCM Q;  1QKX A;  4X9D A;  2CSQ A;  1K73 C;  1MV3 A;  1GFC A;  2KI7 A;  2KY9 A;  5IT9 E;  3CCM Q;  1PCX A;  1I07 A;  1KFZ A;  4PJO G;  4DBQ A;  2C0I A;  3CC7 Q;  4QQD A;  4PL6 A;  1QP2 A;  2RQT A;  2FHD A;  2QQS A;  4C8Q E;  2EJF A;  2XMF A;  4GY5 A;  2EYQ A;  1YBY A;  1QCN A;  3HRT A;  4WTO B;  2MK5 A;  5GAM h;  3PIO A;  2P84 A;  3BFM A;  1JBM A;  2R57 A;  2WSC E;  3A98 A;  4M7D G;  2ZAE A;  3CC2 Q;  2QQA A;  3OY9 A;  1H8K A;  4M7A G;  3INZ A;  3NTK A;  2X4J A;  4M75 C;  2OI3 A;  4PJJ A;  5CKF A;  3RES A;  2YLB A;  3CCU Q;  4FT4 A;  2YDL A;  4LUE A;  2SRC A;  2LT1 A;  1WHM A;  3MEA A;  2I2L A;  4M4Z A;  4DEX A;  3GIB A;  3RDV A;  1VQ6 A;  2RPN A;  4LDU A;  3OYN A;  2X35 A;  5C6S A;  1LPL A;  4MML A;  2G3R A;  1M1F A;  1WHK A;  3BW1 A;  3I56 T;  1D0X A;  2ZPE B;  3EG9 A;  1VQ6 T;  1EIF A;  1B07 A;  4LE9 A;  2QEX Q;  2MWP A;  4KGZ B;  2E6N A;  4PJO E;  2XG8 D;  2RHY A;  4BI3 A;  2A37 A;  2RK2 A;  3QJY A;  1HXD A;  1WDX A;  4HVU A;  2RHZ A;  2EYW A;  4C0D B;  3M0Q A;  2DL8 A;  1I5O B;  4CC3 A;  1YHQ Q;  1VQO Q;  2DXT A;  1K8A C;  3H0I A;  2YSQ A;  1ACM B;  4A4F A;  2CDT A;  2DD4 A;  2JUF A;  1VQ8 Q;  4M7D E;  1BIA A;  1LOJ A;  1MMD A;  2E70 A;  2AT1 B;  1M90 C;  5KCH A;  4M7A E;  4BD3 A;  2F2W A;  2M16 A;  1OU9 A;  2KRN A;  3OB9 A;  2MPX C;  4J9E A;  1ZSZ A;  3PT9 A;  3G1J A;  2JOY A;  4ZGD B;  4XTW A;  2NUP A;  4N0A C;  2FPF A;  2AK5 A;  4NOY A;  1NJI U;  4KBM B;  4M7D A;  5KYY B;  4BDY A;  3RMQ A;  4GLM A;  1JQQ A;  2DIQ A;  1Y96 A;  1AWX A;  2J6K A;  1G5V A;  3CPW A;  5HKC A;  4C8Q B;  2PU9 B;  3PGG A;  1BCO A;  2M02 A;  2XIC A;  1SF9 A;  1QMC A;  4E2F B;  2XID A;  2L0A A;  4M75 G;  1IRE B;  1ZUK A;  2JTM A;  1XJW B;  4E7H A;  3RUX A;  5GAM d;  3RIR A;  4QVC A;  4E7I A;  1UGP B;  1BYM A;  4PLL A;  3OQ5 A;  2DPP B;  2CUD A;  2LP5 A;  1VQ7 T;  1B7T A;  4ELY C;  3L2W A;  1K4U S;  1FYN A;  2F2X A;  1BBZ A;  4BI8 B;  3N5B B;  2A08 A;  3MEW A;  3VKI A;  4RTU A;  4RCC A;  4HXJ A;  3S3O A;  5GMK e;  4FM4 B;  2VXF A;  3CPW P;  4DOW A;  4J9B A;  1FMV A;  1UTI A;  1YIT Q;  2JNG A;  4E7K A;  4C92 F;  1HSQ A;  3KBG A;  3CEY A;  1AOJ A;  1W70 A;  3A8H B;  1UG1 A;  4OF1 A;  2RK1 A;  1RUW A;  1GBQ A;  1RAD B;  4AFU C;  1NEG A;  1MMN A;  4PJO B;  1WIE A;  3CBO A;  5GAN 4;  4FYY B;  4WCI A;  3M0S A;  1VQ9 A;  2DXB A;  3R6N A;  4KH1 B;  5GAN d;  4WF2 A;  5GAM j;  3JB9 F;  2K5L A;  3QZ5 B;  1X69 A;  2FYK A;  1YCY A;  2YUN A;  2FZK B;  2DKG A;  1X6G A;  2PNI A;  2WSF E;  1QWE A;  2EQI A;  1VQ9 T;  1BI3 A;  2COY A;  4M75 E;  1Q95 G;  4XK8 E;  1BIB A;  1RAE B;  4OGE A;  1KJW A;  2A0F B;  5GAM g;  4M7D B;  3CCE A;  1N8R U;  1M30 A;  1Y07 A;  2DMO A;  2XU8 A;  4M7A B;  1M1K R;  4FSX A;  3JSC A;  3VS4 A;  1GCP A;  1V29 B;  4M75 A;  2DL3 A;  1S72 A;  3OS5 A;  4JRP A;  1WGS A;  3LLR A;  2OJ2 A;  2KRM A;  4ZGE B;  3CD6 Q;  3FRN A;  3ASK A;  3CXC S;  1X6B A;  5LJ5 h;  1B34 B;  4FCY A;  2D6F A;  3EGD B;  1DJ7 B;  2HL3 A;  3NTI A;  3CCQ Q;  2DM1 A;  5I2S A;  1K9M C;  1RAF B;  1TWB A;  2E3I A;  3FDR A;  1UGQ B;  2DBM A;  5GAN j;  3M0T A;  2AZV A;  3A8O B;  3CPW S;  3C94 A;  3NHN A;  4BY6 B;  4KUI A;  2DEQ A;  1QP3 A;  2AKK A;  1ZBX A;  4CC4 B;  1UEB A;  2X51 A;  3CQT A;  1N27 A;  2VGM A;  4DQ2 A;  1YJW T;  4M78 E;  2K79 A;  2C0T A;  4KH0 B;  1WX6 A;  2HNI A;  2FPD A;  1B3Q A;  1OX8 A;  2DK3 A;  3VRY A;  1EZZ B;  3REA B;  5CO7 A;  1T0J A;  2FO0 A;  2D0Q B;  2DZC A;  4TVR A;  2GFU A;  3JCM d;  2A28 A;  3VS6 A;  1RI0 A;  2RO0 A;  1UUE A;  4E7L A;  1PSE A;  4AG1 C;  2DRK A;  3CCL A;  2LTO A;  4FIB A;  1QVG A;  4HCC A;  2LC4 A;  2LCS A;  2M9U A;  4C0G A;  2EW3 A;  2EWN A;  4AFQ C;  4FL6 A;  2LQK A;  4ESR A;  3KFV A;  1RAB B;  5GAN 2;  2COZ A;  2GGR A;  2E5Q A;  4B9X A;  1IXD A;  5GAN 3;  3CBM A;  2QQR A;  5KYX A;  4RTZ A;  4N0A A;  2JS2 A;  1WJR A;  1XQH A;  1VUB A;  1H64 1;  3ZFJ A;  3TVT A;  3CBP A;  4HVW A;  5HK3 A;  3MEU A;  2GTO A;  3G71 Q;  3HRU A;  3OYJ A;  2VB6 A;  4AT1 B;  1M1G A;  4IKF A;  5GAN 7;  3SB2 A;  2RF0 A;  1KG1 A;  1G8X A;  4EMH A;  4QVD A;  1YP5 A;  3X28 B;  2DVE A;  3GNF B;  1H3Z A;  2CP5 A;  5FU6 C;  2CT4 A;  1I5L A;  2OTL T;  1RL2 A;  3PVQ A;  4KRT A;  4LDV A;  2K3B A;  1KD1 U;  3E19 A;  4OB1 B;  5GAN 5;  2FB7 A;  5A2Q E;  2KDS A;  4NL3 A;  2NUT B;  2HSE B;  2DVJ A;  3JCM g;  2QA4 Q;  1KSW A;  1VQP Q;  2HKN A;  3NMZ C;  1UGV A;  5IHN A;  3L2V A;  3C12 A;  5CAI A;  1WFW A;  1MMA A;  1QQJ A;  3OYM A;  3G4S A;  4C92 D;  2L3P A;  2DZ9 A;  3A8L B;  1E6G A;  3CCR Q;  2YT6 A;  2KSS A;  2HMA A;  2KR3 A;  2J6F A;  3CCM A;  5LJ5 d;  5DY9 A;  4A4G A;  1VIF A;  2RJD A;  3G4S T;  2HQE A;  1G3S A;  2KEA A;  3VUZ A;  3OA6 A;  3V8J A;  3CCM T;  4PJL A;  3VS0 A;  3JB9 H;  1CKB A;  5IN1 A;  3CC7 T;  1M2V B;  4XTZ A;  3PTA A;  1TH7 A;  2YRV A;  4M78 B;  3JB9 D;  1SSH A;  2RMO A;  3QKJ A;  2K7A A;  1OPK A;  2WSE E;  3CC2 A;  2O88 A;  1Z9Z A;  1SKU B;  3TSZ A;  3OYL A;  5GAO l;  3JCM P;  2DRM A;  4RKU E;  3CC2 T;  3MP1 A;  3EGX B;  4ORZ A;  4RG2 A;  3CCU A;  2V1Q A;  1ABO A;  4C0Z A;  1SEM A;  5GAO q;  2BZ8 A;  2NWM A;  2EQM A;  1TOV A;  1RAG B;  1QVG S;  4ZTJ A;  1JJ2 A;  2RI2 A;  2YUQ A;  1KK7 A;  2KQW A;  5LJ5 j;  1BB9 A;  3CCU T;  1NYG A;  3A1P A;  3TRE A;  1IO6 A;  3ULR B;  2OTJ Q;  3H0H A;  2LCL A;  3WVE B;  2DLP A;  1U1S A;  1M1K C;  3QII A;  5LJ5 g;  4C0F A;  3CCS Q;  4II1 A;  2ZPB B;  1K73 U;  3E1S A;  2GTJ A;  2GF7 A;  2VVK A;  2XKO C;  2EGA A;  1E7O A;  3EAE A;  3RKW A;  2DER A;  4L6V 5;  2QEX T;  2CKK A;  5CR2 A;  1PSF A;  1ZSG A;  4JPB W;  4DA4 A;  1YHQ A;  4OMM A;  3HSB A;  4HKE A;  2EQK A;  1VQO A;  3QG1 A;  1M3B A;  2DA9 A;  2JMC A;  4ZTF A;  3JV3 A;  1JJ2 P;  5L23 A;  2LQW A;  1KIK A;  1YHQ T;  1VQO T;  1VQ8 A;  2DET A;  2DIG A;  4E7S A;  1LJO A;  1AD5 A;  2E65 A;  3DB4 A;  4J9I A;  2HL5 C;  3EH2 A;  3P8B B;  4P5N A;  3CCJ Q;  3M54 A;  4MDX A;  1OV3 A;  1VQ8 T;  4M7A F;  2QDY B;  3ZEH A;  1RLQ C;  1WPY A;  3MO8 A;  3A8M B;  4HCK A;  1WJS A;  2F5K A;  4E7Z A;  3J80 E;  4LN2 A;  2LJ3 A;  1TXQ A;  1ZUU A;  3OS1 A;  3G6E Q;  6AT1 B;  3OYG A;  1YJ9 Q;  4HCZ A;  4J9F A;  1JXO A;  1OZ2 A;  5KYU B;  1Q86 R;  3E9F A;  2ZPG B;  2CGH A;  4EMK C;  1TUG B;  1LNX A;  1N6A A;  2QDL A;  1YWO A;  5CCA A;  5GMK h;  1I4K 1;  3E9G A;  1TS9 A;  1MND A;  4EPC A;  4L59 A;  2V8I A;  2EFI A;  4C5I A;  2PQW A;  5LJ3 h;  5KYW B;  3M0U A;  4CI0 C;  1PRM C;  2EGE A;  1OPL A;  2KT1 A;  5J26 A;  4J9H A;  3C0C A;  4ZN3 A;  4A53 A;  1K8A U;  2CYZ B;  2I0N A;  2ZPF B;  1AEY A;  1VOM A;  3I56 A;  3UWN A;  1W2B A;  1QVP A;  2V1R A;  1YIT A;  1AZE A;  2CP2 A;  1W1F A;  1NZ9 A;  2CZ7 B;  1D3B A;  4EIK A;  3AT1 B;  1R0C B;  1VYT A;  1M90 U;  2R5A A;  4B6M A;  1N8R R;  1SSF A;  1TSF A;  1YIT T;  3SWN B;  1GFD A;  1QCF A;  2M51 A;  4ZNX A;  2K57 A;  1U3O A;  2PUK B;  2A7Y A;  1VQ5 Q;  2GCX A;  5A0D A;  3HL8 A;  2QAS A;  1Q7Y R;  4RTY A;  2ZGW A;  1O75 A;  1D1A A;  4XAX B;  1ZHI A;  3UA6 A;  3LH0 A;  2VC8 A;  1OYX A;  1VA7 A;  4QQG A;  1NEB A;  4XTV A;  4IIM A;  3QBY A;  4JZ3 A;  1FWZ A;  3O8V A;  1VQM A;  1W2B P;  4IIO A;  2GQI A;  2AHJ B;  4R0K A;  5GAO m;  3MHX A;  3V7S A;  4J6Y A;  2ESW A;  3FC3 A;  2DTI A;  1G3W A;  1Y57 A;  5CQY A;  3QDR B;  3OS2 A;  3IQL A;  4FW2 A;  4EMG A;  1VQM T;  1U8R A;  5CKE A;  4JJC A;  3V7R A;  2J6O A;  5EG2 A;  2CH4 W;  1XTD A;  2K4Y A;  3M57 A;  2BUD A;  2M1H A;  4D8K A;  1C6V X;  3CD6 A;  1JU5 C;  3OYE A;  4C92 C;  2RJE A;  2W0Z A;  3OMG A;  2EYZ A;  4MZM A;  4F7U A;  4Q5W A;  4OVA A;  4N4H A;  3CCQ A;  3CD6 T;  3THK A;  1GCQ C;  4OMP A;  3NFC A;  1YCS B;  4XU0 A;  2KGT A;  1PD0 A;  5CVI A;  1VYV A;  1H3H A;  4N4I A;  2HQX A;  3M9Q A;  1QW1 A;  3CCQ T;  2K2M A;  1VQ7 A;  1PKT A;  1ZA1 B;  2O2O A;  2QYZ A;  5I2M A;  1Q81 R;  5KCO A;  1GL5 A;  2GBQ A;  4PJO D;  2HDA A;  5LJ3 f;  1K0S A;  1ZBJ A;  2Z0W A;  2XD0 A;  4M78 F;  2BZX A;  1UE9 A;  3LYI A;  3EG9 B;  5CQX A;  4IUP A;  3UT1 A;  3GNG A;  1KHC A;  1NBE B;  5GMK i;  4BUG A;  2HQH A;  5IXF A;  3MP6 A;  2LRQ A;  1M3C A;  1JO8 A;  1M8M A;  2CZ0 B;  5LJ3 e;  4DOV A;  4LDW A;  3LH5 A;  2BZY A;  1KC8 R;  4M77 F;  4M7A D;  2OAW A;  3QYH B;  2FRY A;  2P4R A;  4PLI A;  2XI9 A;  1PG5 B;  2HBW A;  1I8F A;  2FVU A;  1IB8 A;  3NGP A;  1Q82 R;  1D1B A;  1F1B B;  3FLG A;  2OAU A;  2LZ6 B;  2JM8 A;  2YXY A;  3CPF A;  3QUI A;  4QQ6 A;  3OYD A;  2DF6 A;  2X4X A;  1RAA B;  2QG9 B;  2IPO B;  4OB2 B;  3G71 A;  2KRO A;  4ME7 A;  2L2P A;  3U23 A;  2RB6 A;  4MDW A;  1X2K A;  1AVZ C;  1UEC A;  1IRX A;  5GMK j;  1K9M U;  3JCM X;  2FZC B;  2LNH B;  2LVM A;  1ZSZ B;  2VUB A;  4JUV A;  3G71 T;  2NUP B;  2YLC A;  3FB9 A;  4EMK A;  1M2O A;  5I11 A;  4J6X A;  3RMS A;  1IGU A;  4K11 A;  4LXC A;  1Y96 B;  4RCB A;  1R77 A;  2LT4 A;  4NS5 A;  3GLX A;  1FX7 A;  3CCV Q;  1UGR B;  3SEM A;  1Q86 C;  1QLY A;  2L3Q A;  2EKO A;  2L89 A;  1BU1 A;  4QKU A;  4C5H A;  3JCM c;  3CMA Q;  5LJ3 g;  3M59 A;  5GAO r;  4BE2 A;  4XU2 A;  4D6W A;  5IH2 A;  3OBY A;  2W10 A;  3TEE A;  3EFS A;  3M55 A;  2E6Z A;  5FU7 B;  1PC0 A;  2FG0 A;  1VIE A;  3BY7 A;  4E7J A;  1AWO A;  3VYG A;  2QA4 T;  1QCO A;  1YI2 Q;  2YUP A;  1VQP T;  1MGQ A;  1PRL C;  2XDP A;  4LDY A;  1WHG A;  4JDS A;  2K6D A;  2XDD A;  4KGX B;  4JRK A;  3JB9 G;  4FSS A;  1PD1 A;  1YJW A;  3EHQ A;  1VQL Q;  3L2Z A;  3OBW A;  3BE3 A;  2HAX A;  4OMN A;  1HK9 A;  4HVV A;  2EQJ A;  1ZUY A;  2JTE A;  1OU8 A;  4XQ3 A;  2YUO A;  1CKA A;  3L1A A;  2PVD B;  2RI3 A;  4A4E A;  4OMF B;  3FJ5 A;  3S3M A;  5A0L A;  3QXE B;  4C0D C;  3A8G B;  4BE1 A;  1K73 R;  4VUB A;  1Q7Y C;  2QQ9 A;  3PFS A;  3I5R A;  2A36 A;  4CC2 A;  2MF2 A;  2ZPI B;  2YHT A;  1I1J A;  2O4X A;  4PFP A;  4BB7 A;  2YWW A;  1WJQ A;  1MHN A;  3UAT A;  4PK4 A;  1NPR A;  5CIU A;  2P0K A;  3PMT A;  4GLK A;  2EJG A;  1BKB A;  4RTT A;  3OYA A;  3HRS A;  2DIL A;  2ROL A;  1JB0 E;  2RI5 A;  2H3E B;  2OTJ A;  4KT0 E;  1FMW A;  1WXT A;  3JB9 J;  5DLQ E;  4C92 A;  2E10 A;  3MPU B;  2JW4 A;  2B86 A;  2X9H A;  2OTJ T;  3PE0 A;  5A0G A;  5IAY A;  1IHW A;  1GCQ A;  2MOX A;  2DL5 A;  4M75 B;  4MMK A;  4ELZ C;  3OSV A;  2JTF A;  1Y71 A;  5FLX E;  3CCS T;  2DTH A;  3JCM J;  2R5M A;  4AMC A;  1RAH B;  2CZ1 B;  3EFR A;  5D6W A;  2D9T A;  2FPE A;  1S1N A;  2F2V A;  5LL6 S;  2J05 A;  5IHI A;  3QO3 A;  2MMP A;  5GJW B;  1IGQ A;  2DEU A;  4LUD A;  4M78 D;  4AFZ C;  4ZGJ B;  3CCE Q;  3HHT B;  2JZ2 A;  4Z88 A;  2EJ9 A;  2BE9 B;  3REB B;  2CRE A;  1GBR A;  2QGG A;  2DYB A;  4A4K A;  1R0B G;  3C4S A;  5IHK A;  5I21 A;  5AYF A;  1Q81 C;  2BE7 D;  1S72 Q;  3TCJ A;  1HJD A;  1ZLM A;  1SRM A;  3TQ7 P;  2L5Q A;  3CC7 A;  4MZP A;  3UDC A;  3CCJ T;  3QYG B;  4M77 D;  1UJ0 A;  3RR6 A;  1K1Z A;  4KGV B;  1PHT A;  2BKD N;  1ARK A;  3PNW C;  1YJ9 A;  1MNE A;  2R58 A;  4FW1 A;  2JJ9 A;  4C8Q F;  2OTL Q;  1D0Z A;  2E12 A;  4GBQ A;  4F16 A;  3G6E T;  1AWJ A;  2L3S A;  3RBB B;  1YJ9 T;  5CKD A;  5KE2 A;  4E6R A;  3OSS C;  1M90 R;  1M1K U;  2XK0 A;  1U1T A;  4PJO C;  4NL2 A;  2MIO A;  1Q82 C;  3VJP A;  1M3A A;  5ECA A;  4OMO A;  1NYF A;  5KYX B;  2CP6 A;  1AWW A;  2PUO B;  2EQU A;  1T3L A;  1UJY A;  1N9R A;  3OYK A;  4XU1 A;  3CCL Q;  3OYY A;  3I35 A;  2XDB A;  4Z02 A;  4ZN1 A;  1BCM A;  2K3X A;  2VYT A;  1QKW A;  2E5K A;  2JM9 A;  4M7A C;  2CS7 A;  2E3H A;  1WHL A;  5KH6 A;  1K76 A;  3OYB A;  1MMG A;  3PIP A;  3CC4 Q;  2OX7 A;  5GAN 6;  2QEX A;  2KXD A;  1NJI R;  4J9G A;  4PJO F;  2G6F X;  2P0Q A;  3EG1 A;  3I55 Q;  4ANJ A;  4J5Y A;  4B9W A;  3L2U A;  3F70 A;  1X75 C;  2YRD A;  1M5Q 1;  1VQ4 Q;  3ZL7 C;  3V7C A;  1WHJ A;  3HPW A;  2MI6 A;  2D1X A;  2MYS A;  2RH2 A;  2EIF A;  3RER A;  5DLO A;  3SDZ A;  1KHI A;  4BY6 C;  3QZ9 B;  1VQN Q;  4Z89 A;  4N4G A;  1QVF A;  3RKX A;  4IUU A;  3M0P A;  4M7D F;  1YIJ Q;  2LJ0 A;  4JS4 A;  3X24 B;  4PFZ A;  4F17 A;  3LW5 E;  1RAC B;  4Y28 E;  3UA7 A;  2JVV A;  4JLG A;  3OS0 A;  1D09 B;  2KYM A;  2CSI A;  2HKQ B;  1PM3 A;  4KUL A;  3GP8 A;  2KE9 A;  2FZG B;  2A3L A;  3D7S B;  2ABL A;  2Y4X A;  2C0O A;  3ER0 A;  2MCN A;  2FEI A;  4OMQ A;  5AT1 B;  4CC7 A;  2QK0 A;  3AHU A;  1X2Q A;  2IVW A;  2RQW A;  3FJP A;  3M4G A;  3JAM E;  1M27 C;  3GF5 A;  1XOV A;  4LDX A;  1HYO A;  1WYX A;  1NE8 A;  1QVF P;  3GBQ A;  1JEG A;  4YTL A;  5CKB A;  3R6O A;  1YFN A;  5KYY A;  4RTW A;  2LNV A;  3MJX A;  4BAC A;  1RLP C;  1G3Y A;  1N5Z A;  4F7U G;  2ZCF B;  3JCM b;  5FW9 A;  4JRI A;  3J7A F;  1WNL A;  4JRQ A;  4C8Q A;  2J7I A;  3HFN A;  1WQ7 A;  2ATC B;  4A54 A;  4JS5 A;  1PKS A;  3I9Q A;  1PWT A;  2KRS A;  1K9M R;  1OOT A;  3LGF A;  4J9D A;  2O31 A;  1YJN Q;  4DEY A;  2QXF A;  3J81 E;  3M53 A;  2RA2 A;  2RQU A;  1X27 A;  5GJV B;  1JJ2 S;  4BE0 A;  1OX9 A;  3DLM A;  2KVQ G;  2F1L A;  4RUG A;  2QTV A;  1VQK Q;  1I81 A;  2VWF A;  1Y7X A;  1OI1 A;  1JXM A;  1WZO A;  2NYS A;  2DO3 A;  3H9N A;  3HP9 A;  4IUV A;  1X43 A;  2LMJ A;  4OB3 B;  1AHJ B;  3M58 A;  5GAN h;  2QI2 A;  5CKH A;  4C8Q D;  1Y0M A;  9ATC B;  3QHS A;  2BIV A;  2NUZ A;  2LX9 A;  3RKY A;  3OMC A;  3WVD B;  1K9A A;  3CME Q;  3L2R A;  4PKC C;  1UFF A;  4R55 A;  3PMI A;  4M75 F;  3OYI A;  2C06 A;  3VRZ A;  3RNJ A;  1ZA2 B;  4PJO A;  2EKH A;  2JXB A;  4F7U E;  1R8O B;  5EC7 A;  1TU0 B;  4M78 C;  4X9C A;  3CCV A;  2X4Y A;  3FEO A;  1TG0 A;  1D0Y A;  4Y91 A;  3VS7 A;  2RJC A;  3OYF A;  1T0H A;  5I22 A;  3TSW A;  1QVF S;  2RN8 A;  2HEQ A;  3OYH A;  3CMA A;  1SHF A;  3PVL A;  1OEB A;  3CCV T;  3X25 B;  3CXC A;  3E2U A;  2EVR A;  2ZPH B;  4F04 B;  5FWB A;  2GFA A;  3M5A A;  3CMA T;  2HD0 A;  1ZQ1 A;  5D7U A;  4M77 C;  2EGC A;  1YI2 A;  2EAY A;  2E4H A;  1YNZ A;  4M7A A;  5FU6 B;  3JCM V;  2J06 A;  5FWC A;  1VQL A;  1A0N B;  1YI2 T;  2CP7 A;  3UF4 A;  3V8L A;  1J3T A;  1V1C A;  3T9N A;  4X34 A;  4QW2 A;  2O9S A;  2ZZD A;  2COW A;  2VV5 A;  1VQL T;  1D1C A;  4IUT A;  1B34 A;  5GAM f;  2X3W D;  3EGD A;  5GMK l;  2CUB A;  2EPD A;  1D3B B;  3S6W A;  4HCB A;  1U06 A;  2PZ1 A;  2IIM A;  3H6Z A;  1SHG A;  3CXC P;  1IHV A;  2O9V A;  5LJ3 d;  4F14 A;  3JCM h;  1NJI C;  4J6W A;  1MV0 B;  1O9S A;  3VYH B;  2IG0 A;  3M56 A;  1OZ3 A;  3QWY A;  4FT2 A;  4M7D D;  1WLP B;  3MCA B;  5GAM e;  3A5Z B;  3M4Y A;  1KD1 R;  4O6J A;  2QGF B;  7AT1 B;  2DBK A;  1W2B S;  3C95 A;  4J8O A;  3I56 Q;  4HT8 A;  1VQ6 Q;  2EBP A;  1Q86 U;  1N9S A;  1BI0 A;  1TUD A;  3L2Q A;  1G2B A;  1X01 A;  2H3J A;  4OGC A;  3TU4 K;  2DD5 A;  4RTX A;  4JZ4 A;  2FRW A;  5KYN A;  1BI2 A;  1SRL A;  2PTK A;  2RD1 A;  2DNU A;  2RNA A;  2M0Y A;  2L8D A;  3P8D A;  2LDM A;  2CH4 A;  5GAN f;  4JLI A;  2QTX A;  3URG A;  4DBR A;  4M78 G;  4JJD A;  2DFU A;  1HD3 A;  4FYV B;  5LJ3 j;  3P8H A;  3Q1J A;  1W6X A;  4PFO A;  4LNP A;  4C92 G;  4F7U B;  1VQM Q;  3VS1 A;  2DX1 A;  5J3B A;  2ED0 A;  5GAN e;  4AFS C;  2H8H A;  3DB3 A;  1OQK A;  1QWF A;  2QA4 A;  2P4T A;  4M77 G;  4A4H A;  1VQP A;  2KAF A;  1SG5 A;  4PJM A;  2KBT A;  4QVZ A;  2KNB B;  1KQS A;  4LD9 K;  5DM7 R;  3DLL A;  2KT8 A;  3CCE T;  1P92 A;  1Q7Y U;  3CCR A;  1NLP C;  2DYI A;  3G7Z A;  2QQB A;  1UHC A;  2AKL A;  1WQW A;  3H0F A;  4E47 A;  3GOX A;  3EHR A;  1G3T A;  8ATC B;  1S72 T;  3H41 A;  4BI4 A;  3CCR T;  5M9O A;  2NUT A;  4D8D A;  1NG2 A;  1C1A A;  3BDU A;  3MKD A;  1EX4 A;  4RTV A;  4J9C A;  3LWI A;  2LJ1 A;  4BDZ A;  2V26 A;  1C0M A;  3VS5 A;  5D6X A;  2K5I A;  1H92 A;  2OTL A;  4OP0 A;  3SWN C;  5GAN 8;  1N8R C;  4LD6 A;  1VQ7 Q;  2MAM A;  3SFM A;  5HK0 A;  1I0C A;  5C0M A;  3MP8 A;  2KXC A;  2RQR A;  1KQ2 A;  4KUD K;  2AIR B;  1KQS P;  5GAN g; 
#chains in the Genus database with same CATH homology
 4PLL A;  4V2S A;  2K3Y A;  3VJP A;  2EFI A;  3JCM W;  4C5I A;  2PQW A;  5LJ3 h;  3OQ5 A;  2DJZ A;  2DPP B;  3JCM f;  4CI0 C;  1VQ7 T;  4M75 D;  1UB4 A;  2PUO B;  2KK4 A;  4CRI A;  4ELY C;  2EQU A;  3VU3 C;  2V8J A;  3L2W A;  1N9R A;  3OYK A;  5J26 A;  4BI8 B;  3QJ6 A;  4ZN3 A;  4XU1 A;  3N5B B;  4A53 A;  4C92 E;  1K8A U;  3LGL A;  2CYZ B;  3MEW A;  4XTX A;  3VKI A;  4RCC A;  2ZPF B;  3S3O A;  4EDU A;  5GMK e;  4FM4 B;  2VXF A;  3OYY A;  4DOW A;  3I56 A;  3UWN A;  2XDB A;  3VUB A;  1W2B A;  4M78 A;  4Z02 A;  1XNI A;  1QVP A;  2JNG A;  3JRZ A;  4ZN1 A;  4E7K A;  4C92 F;  1YIT A;  2KMT A;  4M77 E;  3KBG A;  2K3X A;  3CEY A;  2L3R A;  3A8H B;  2VYT A;  1NZ9 A;  2CZ7 B;  2DAQ A;  1D3B A;  3JCM e;  4M7A C;  2XHC A;  4OF1 A;  4XTU A;  2RK1 A;  2CS7 A;  5FRN A;  1IZ6 A;  1M90 U;  5FRM A;  3CCL T;  2R5A A;  5KH6 A;  1SSF A;  4EMK B;  3OYB A;  3PIP A;  1YIT T;  2RHX A;  3SWN B;  5GAN 6;  3CCS A;  2QEX A;  3CC4 A;  2Y90 A;  2K57 A;  1Q81 U;  4MZT A;  4OB0 B;  2PUK B;  3X26 B;  2E64 A;  2A7Y A;  4PJO B;  2GCX A;  2RJF A;  4M77 A;  4C5G A;  5A0D A;  3HL8 A;  3CBO A;  5GAN 4;  2ZGW A;  1O75 A;  3L42 A;  4PJO F;  4XAX B;  2P0Q A;  3CC4 T;  1VQ9 A;  2DXB A;  1ZHI A;  2VXE A;  3LH0 A;  2VC8 A;  4PNO A;  4C8Q C;  5GAN d;  4WF2 A;  1OYX A;  5GAM j;  2K5L A;  3JB9 F;  5CK9 A;  2DXU A;  2RHI A;  3QZ5 B;  4J5Y A;  4B9W A;  3I55 A;  3L2U A;  3F70 A;  1X75 C;  2FYK A;  4QQG A;  1YCY A;  5GMK m;  4XTV A;  1M5Q 1;  2DKG A;  3V7C A;  2WSF E;  3QBY A;  4J83 A;  1VQ4 A;  3HPW A;  4HT9 A;  1VQ9 T;  1BI3 A;  2MI6 A;  3OW2 A;  4M75 E;  2RH2 A;  2EIF A;  1FWZ A;  4XK8 E;  1BIB A;  3O8V A;  3KXT A;  4OGE A;  3RER A;  5DLO A;  3SDZ A;  1KHI A;  4BY6 C;  3OYC A;  3I55 T;  1VQM A;  2B8A A;  2O01 E;  5GAM g;  2AHJ B;  3QZ9 B;  5GAO m;  3MHX A;  5GAO n;  3V7S A;  4M7D B;  4J6Y A;  3FC3 A;  3CCE A;  2DTI A;  1N8R U;  1G3W A;  5CQY A;  1KC8 U;  3QDR B;  1VQN A;  1VQ4 T;  4ATO A;  2P0P A;  1Y07 A;  4N4G A;  3RKX A;  3OS2 A;  4IUU A;  2XU8 A;  4JJN K;  1QVF A;  4M7D F;  4M7A B;  2E41 A;  4EMG A;  4FSX A;  1VQM T;  3CCJ A;  3JSC A;  1YIJ A;  1V29 B;  1U8R A;  3HFO A;  5CKE A;  4JS4 A;  3V7R A;  2DTO A;  3NTH A;  4M75 A;  1Q82 U;  5EG2 A;  2PVG B;  1VQN T;  3X24 B;  1S72 A;  3OS5 A;  4JRP A;  3LW5 E;  1WGS A;  1XTD A;  4C5E A;  2K4Y A;  3LLR A;  3M57 A;  4ZGE B;  3FRN A;  3ASK A;  1W4S A;  3CXC S;  1YIJ T;  2PVO B;  2BUD A;  2M1H A;  4Y28 E;  5J39 A;  5LJ5 h;  1KQS S;  3OYE A;  3CD6 A;  4C92 C;  4IUQ A;  1B34 B;  2JVV A;  2RJE A;  4JLG A;  3OS0 A;  2D6F A;  1M8V A;  1DJ7 B;  2CZ6 B;  3OMG A;  5LJ5 f;  4FU6 A;  3NTI A;  4MZM A;  4F7U A;  4Q5W A;  3G6E A;  4KUL A;  4OVA A;  5I2S A;  3GP8 A;  1K9M C;  2A3L A;  4N4H A;  4XU3 A;  3CCQ A;  3CD6 T;  3GPL A;  3NFC A;  2F5T X;  1NPP A;  2FL7 A;  2Y4X A;  4J7F A;  3LWH A;  3ER0 A;  3FDR A;  1UGQ B;  2NLU A;  5GAN j;  4XU0 A;  3A8O B;  3CPW S;  3AHU A;  2IVW A;  3C94 A;  3FJP A;  5CVI A;  1KD1 C;  4XTY A;  3M4G A;  1KC8 C;  4N4I A;  4BY6 B;  4KUI A;  2HQX A;  2DEQ A;  3M9Q A;  3JAM E;  3GF5 A;  1QW1 A;  3CCQ T;  1QP3 A;  3QSU A;  3MEV A;  1XOV A;  1X6O A;  2O4X B;  4LDX A;  2GQV A;  1VQ7 A;  1ZBX A;  1NE8 A;  1UEB A;  5LJ5 e;  4YTL A;  5CKB A;  1N27 A;  3R6O A;  2VGM A;  2LNV A;  2LQ8 A;  4DQ2 A;  3QPH A;  5I2M A;  3WXM B;  5GAO p;  4BAC A;  1YJW T;  5KCO A;  4M78 E;  1G3Y A;  4PJO D;  2JN0 A;  4F7U G;  4UC4 A;  1GXI E;  2ZCF B;  3JCM b;  1M4Z A;  2HNI A;  1KQ1 A;  4JRI A;  3VV0 A;  3J7A F;  2DK3 A;  1WNL A;  5LJ3 f;  2V8K A;  4JRQ A;  3LX7 A;  5CO7 A;  2K5F A;  2XD0 A;  4M78 F;  4C8Q A;  3S3N A;  2D0Q B;  2DZC A;  4TVR A;  2GFU A;  3X20 B;  3JCM d;  3LYI A;  1RI0 A;  2RO0 A;  4C92 B;  3HFN A;  1PSE A;  5CQX A;  4E7L A;  1WQ7 A;  3CCL A;  4IUP A;  2LTO A;  3UT1 A;  4A54 A;  3GNG A;  1KHC A;  4FIB A;  4JS5 A;  1QVG A;  4HCC A;  4M7D C;  5GMK i;  3LGF A;  2VGN A;  2LC4 A;  4BUG A;  2M9U A;  3MP6 A;  4M77 B;  2QXF A;  3J81 E;  2LRQ A;  3M53 A;  4C0G A;  4L5G A;  1YJN A;  2EWN A;  2RA2 A;  2CZ0 B;  5LJ3 e;  4DOV A;  4FL6 A;  4BE0 A;  2LQK A;  4LDW A;  3ZBD A;  3DLM A;  2KVQ G;  1JJ2 S;  4M77 F;  1FXX A;  4M7A D;  5GAN 2;  2WAC A;  3QYH B;  2E5Q A;  5FRO A;  2DXC A;  4B9X A;  1I81 A;  5GAN 3;  4C8Q G;  3CBM A;  1YJN T;  4RG8 A;  4RMO A;  4PLI A;  1VQK A;  1Y7X A;  1OI1 A;  2QQR A;  2XI9 A;  1I8F A;  4N0A A;  3V8K A;  1WJR A;  2FVU A;  2MWO A;  1XQH A;  1VUB A;  3KUF A;  3DKM A;  3FLG A;  1VQ5 A;  2OAU A;  1H64 1;  2LCC A;  3FIF A;  3ZFJ A;  3CPF A;  3QUI A;  4QQ6 A;  2DO3 A;  3CBP A;  3SD4 A;  5HK3 A;  3OYD A;  3HP9 A;  4IUV A;  2X4X A;  3UPU A;  3MEU A;  4OB3 B;  3HKS A;  5FU7 C;  3HRU A;  3OYJ A;  1VQK T;  4IUR A;  4OB2 B;  3G71 A;  4ME7 A;  1AHJ B;  3M58 A;  1M1G A;  4IKF A;  5L8R E;  2RB6 A;  5GAN 7;  4MDW A;  5GAN h;  2QI2 A;  1VQ5 T;  3SB2 A;  5CKH A;  4C8Q D;  5GMK j;  3QHS A;  2BIV A;  1K9M U;  1KG1 A;  4EMH A;  2LX9 A;  4QVD A;  2M0O A;  3RKY A;  3JCM X;  3X28 B;  2LVM A;  3OMC A;  2HBP A;  2DVE A;  3GNF B;  3WVD B;  1BI1 A;  2VUB A;  2X4W A;  1H3Z A;  4JUV A;  5FU6 C;  3G71 T;  1I5L A;  1RL2 A;  2YLC A;  3ME9 A;  4LDV A;  3L2R A;  3FB9 A;  2E1H A;  4PKC C;  4EMK A;  2RM4 A;  4R55 A;  3CME A;  1KD1 U;  3PMI A;  3SWN A;  4J6X A;  3E19 A;  3RMS A;  4M75 F;  4R56 A;  3OYI A;  4OB1 B;  2Y4Y A;  5GAN 5;  2C06 A;  1Y96 B;  4RCB A;  4O5V A;  2K2V A;  2LT4 A;  3GLX A;  4NS5 A;  1FX7 A;  5KE3 A;  2FB7 A;  3OW2 S;  4PJO A;  4F7U E;  3JB9 I;  5A2Q E;  1R8O B;  1UGR B;  2KDS A;  4NL3 A;  1Q86 C;  1M9S A;  4HA8 A;  4M78 C;  4X9C A;  4J7I A;  3CME T;  1JRI A;  2X4Y A;  2RHU A;  3FEO A;  3CCV A;  2EKO A;  3OYF A;  2L89 A;  4Y91 A;  2RJC A;  3H8Z A;  3JCM g;  4C5H A;  3MET A;  3JCM c;  1QVF S;  4F7U F;  5LJ3 g;  3OYH A;  3M59 A;  2F69 A;  5GAO r;  1UGS B;  5HY6 A;  3CMA A;  4BE2 A;  4XU2 A;  4D6W A;  3L2V A;  3CCV T;  3X25 B;  3CXC A;  3C12 A;  3BDL A;  5D6Y A;  5CAI A;  3OBY A;  3TEE A;  3JCM Q;  3EFS A;  3M55 A;  2E6Z A;  5FU7 B;  3OYM A;  3G4S A;  2ZPH B;  4C92 D;  4X9D A;  1VIE A;  2DZ9 A;  3BY7 A;  1K73 C;  4E7J A;  2GFA A;  2KY9 A;  3A8L B;  3M5A A;  3VYG A;  2QA4 T;  5IT9 E;  3CMA T;  2HD0 A;  1ZQ1 A;  2KSS A;  1VQP T;  4M77 C;  1MGQ A;  4PJO G;  3CCM A;  1YI2 A;  2XDP A;  4LDY A;  2EAY A;  4PL6 A;  1QP2 A;  4QQD A;  4JDS A;  5DY9 A;  4A4G A;  5LJ5 d;  1VIF A;  2XDD A;  2RJD A;  4JRK A;  3JB9 G;  3G4S T;  4M7A A;  5FU6 B;  2HQE A;  3JCM V;  1YJW A;  2FHD A;  3L2Z A;  1G3S A;  3OBW A;  2QQS A;  4C8Q E;  3VUZ A;  3OA6 A;  1VQL A;  3V8J A;  3CCM T;  2EJF A;  1YI2 T;  2HAX A;  4GY5 A;  3JB9 H;  5IN1 A;  2EYQ A;  3CC7 T;  1YBY A;  3V8L A;  3HRT A;  4XTZ A;  3T9N A;  4X34 A;  4QW2 A;  1HK9 A;  5GAM h;  3PIO A;  1TH7 A;  3PTA A;  2ZZD A;  3BFM A;  1JBM A;  2VV5 A;  1VQL T;  2R57 A;  2WSC E;  2YRV A;  2EQJ A;  1B34 A;  4IUT A;  4M78 B;  3JB9 D;  5GAM f;  4XQ3 A;  4M7D G;  3QKJ A;  5GMK l;  2QQA A;  1D3B B;  3S6W A;  3OY9 A;  3L1A A;  2PVD B;  2WSE E;  3CC2 A;  4HCB A;  4M7A G;  3H6Z A;  3INZ A;  2RI3 A;  3NTK A;  4OMF B;  4A4E A;  3S3M A;  5A0L A;  2X4J A;  5LJ3 d;  3QXE B;  4M75 C;  4C0D C;  3A8G B;  3JCM h;  4BE1 A;  3OYL A;  4VUB A;  5GAO l;  1NJI C;  1Q7Y C;  2QQ9 A;  3PFS A;  4J6W A;  5CKF A;  3VYH B;  1O9S A;  3JCM P;  2IG0 A;  4RKU E;  3M56 A;  3CC2 T;  3MP1 A;  3RES A;  1OZ3 A;  2MF2 A;  2YLB A;  2YHT A;  2ZPI B;  4FT2 A;  4FT4 A;  4RG2 A;  4M7D D;  2O4X A;  3MCA B;  3CCU A;  4BB7 A;  3A5Z B;  5GAM e;  2LT1 A;  3M4Y A;  4C0Z A;  5GAO q;  1WJQ A;  1MHN A;  3MEA A;  4O6J A;  2EQM A;  2I2L A;  1W2B S;  1QVG S;  1NPR A;  3C95 A;  4J8O A;  4ZTJ A;  1JJ2 A;  4HT8 A;  3GIB A;  2RI2 A;  2KQW A;  5CIU A;  2P0K A;  1Q86 U;  1N9S A;  3PMT A;  4GLK A;  5LJ5 j;  1BI0 A;  2EJG A;  3CCU T;  1VQ6 A;  1BKB A;  4LDU A;  3OYN A;  3OYA A;  2X35 A;  3HRS A;  5C6S A;  3TRE A;  3L2Q A;  4MML A;  1X01 A;  2H3J A;  1JB0 E;  2G3R A;  2RI5 A;  1M1F A;  2OTJ A;  2LCL A;  3WVE B;  4KT0 E;  3BW1 A;  3I56 T;  4OGC A;  3TU4 K;  2DD5 A;  2ZPE B;  5DLQ E;  4C92 A;  2E10 A;  1U1S A;  1EIF A;  3JB9 J;  1M1K C;  3QII A;  1VQ6 T;  5LJ5 g;  4C0F A;  4II1 A;  2MWP A;  1BI2 A;  2E6N A;  2RD1 A;  2ZPB B;  1K73 U;  4PJO E;  2XG8 D;  3E1S A;  2OTJ T;  2RHY A;  4BI3 A;  2L8D A;  5A0G A;  3P8D A;  2LDM A;  2GF7 A;  5IAY A;  5GAN f;  2RK2 A;  2XKO C;  4JLI A;  3QJY A;  1HXD A;  2QTX A;  3EAE A;  2RHZ A;  4M75 B;  3RKW A;  4L6V 5;  3URG A;  4MMK A;  4C0D B;  3OSV A;  2JTF A;  1Y71 A;  4ELZ C;  4M78 G;  5FLX E;  3CCS T;  2QEX T;  2DTH A;  2CKK A;  3JCM J;  5CR2 A;  1PSF A;  2R5M A;  2CZ1 B;  4DA4 A;  3EFR A;  5D6W A;  1YHQ A;  2D9T A;  2DXT A;  2EQK A;  4HKE A;  3P8H A;  5LJ3 j;  1VQO A;  3Q1J A;  1K8A C;  3HSB A;  3QG1 A;  4C92 G;  4ZTF A;  5LL6 S;  4A4F A;  4F7U B;  2DD4 A;  2JUF A;  3QO3 A;  5J3B A;  5GAN e;  4M7D E;  1YHQ T;  1BIA A;  1LOJ A;  2MMP A;  1VQO T;  1VQ8 A;  2DIG A;  1LJO A;  4M78 D;  4ZGJ B;  3DB3 A;  2JZ2 A;  3HHT B;  2E65 A;  2EJ9 A;  3DB4 A;  2E70 A;  2P4T A;  2QA4 A;  4M77 G;  1M90 C;  4A4H A;  5KCH A;  3P8B B;  2KAF A;  1VQP A;  4M7A E;  4BD3 A;  2M16 A;  4P5N A;  4QVZ A;  4A4K A;  3M54 A;  4MDX A;  3OB9 A;  3C4S A;  1KQS A;  4LD9 K;  5I21 A;  1VQ8 T;  5AYF A;  3PT9 A;  5DM7 R;  1Q81 C;  2JOY A;  4ZGD B;  4XTW A;  3DLL A;  4M7A F;  4N0A C;  3TCJ A;  3CCE T;  4NOY A;  1P92 A;  2QDY B;  1NJI U;  4KBM B;  1Q7Y U;  3CCR A;  4M7D A;  3ZEH A;  1WPY A;  3G7Z A;  2L5Q A;  3MO8 A;  4BDY A;  3RMQ A;  2QQB A;  3A8M B;  1WJS A;  1WQW A;  3CC7 A;  4MZP A;  3UDC A;  2F5K A;  3QYG B;  3CCJ T;  2DIQ A;  4M77 D;  1Y96 A;  4E47 A;  3GOX A;  1G5V A;  3J80 E;  2BKD N;  1G3T A;  3CPW A;  3OS1 A;  3CCR T;  4BI4 A;  1S72 T;  5M9O A;  3OYG A;  5HKC A;  4HCZ A;  3BDU A;  4C8Q B;  3PNW C;  2PU9 B;  1YJ9 A;  1OZ2 A;  3LWI A;  2R58 A;  3PGG A;  3E9F A;  2ZPG B;  2CGH A;  4C8Q F;  4BDZ A;  2XIC A;  2XID A;  5D6X A;  4M75 G;  4EMK C;  2K5I A;  2E12 A;  1LNX A;  1N6A A;  5CCA A;  4OP0 A;  3G6E T;  2OTL A;  5GMK h;  3SWN C;  5GAN 8;  1IRE B;  1YJ9 T;  1N8R C;  5CKD A;  5KE2 A;  1I4K 1;  4LD6 A;  3E9G A;  3OSS C;  2MAM A;  1M1K U;  3SFM A;  2XK0 A;  5HK0 A;  1U1T A;  2JTM A;  5C0M A;  3MP8 A;  4PJO C;  4EPC A;  3RUX A;  4NL2 A;  4L59 A;  5GAM d;  4E7H A;  2V8I A;  3RIR A;  4QVC A;  4E7I A;  1UGP B;  4KUD K;  1KQ2 A;  1BYM A;  2OTL T;  1Q82 C;  5GAN g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...