3VYGA

Crystal structure of thiocyanate hydrolase mutant r136w
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
KPVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
molecule keywords Thiocyanate hydrolase subunit alpha
total genus 26
structure length 120
sequence length 120
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vygA00
2ZCFB 2DD5A 2ZPFB 4Y28E 4FM4B 2ZZDA 3HHTB 2ZPGB 1DJ7B 2ZPEB 2AHJB 2ZPHB 2WSCE 3A8OB 3QYHB 2CZ7B 4OB1B 1PSFA 4OB0B 2PUOB 3WVDB 3WVEB 2WSFE 2O01E 4OB3B 1V29B 2ZPIB 3X20B 2CZ1B 2WSEE 2CYZB 1UGQB 1UGSB 1PSEA 1AHJB 1UGRB 2PVGB 2DPPB 2DXCA 2CZ0B 2PVOB 4XK8E 3A8GB 3QXEB 3VYGA 4ZGEB 2PUKB 4ZGJB 1QP3A 2DXBA 2ZPBB 3QZ5B 1UGPB 3X28B 1GXIE 2DD4A 2PVDB 2CZ6B 3A8HB 4OB2B 4ZGDB 3QYGB 4L6V5 1IREB 3LW5E 4RKUE 2D0QB 3X24B 2QDYB 3X25B 4KT0E 3VYHB 1QP2A 3A8MB 3X26B 2PU9B 3QZ9B 1JB0E 3A8LB 5L8RE
chains in the Genus database with same CATH superfamily
1JXOA 2RQWA 2X4XA 1K1ZA 3CMAT 1C0MA 1ZBXA 2KROA 1U1TA 5LJ3h 3CCST 3JB9J 3GPLA 4GY5A 3NFCA 1RLQC 4M7DA 3PMIA 1O9SA 2E70A 1Z9QA 4RTZA 3OY9A 1VUBA 3P8BB 2GNCA 3JCMf 5LJ5h 2VYTA 2ZGWA 2LNVA 3OYAA 3GP8A 1OULA 4A4HA 3V7RA 2LP5A 4C5HA 2RO0A 2QA4T 2EGAA 2J6KA 1W2BA 3S3OA 1SPKA 1FXXA 5AYFA 1RADB 4KT0E 3M5AA 1LVKA 1QMCA 5LJ5f 1GCQC 2RQVA 5I22A 4MDXA 5GMKe 4BUGA 1VQMA 1I8FA 1BU1A 3X20B 2XDPA 3LGFA 4RTXA 2CP3A 1YITA 1Y0MA 1JO8A 1QLYA 3QDFA 4RCBA 4HA8A 1WXTA 4PFZA 1V76A 1WA7A 3EG2A 3MHXA 4VUBA 2YT6A 1CSKA 1TWBA 3IQLA 5IXBA 5I2SA 2ABLA 2B86A 2XG8D 4E2FB 1D0XA 1YWPA 1OZ2A 5CVIA 1VQLT 2LTOA 4C5GA 1WX6A 3QO3A 2BKDN 2RJCA 4C92C 3OBWA 1M4ZA 4BB7A 1UJ0A 2XICA 1RI0A 1VQKA 2DTOA 3VRZA 1VQNQ 3F70A 1WJSA 3G6EQ 1AWWA 3RKWA 4LN2A 1TXQA 4KUIA 2Y90A 2R58A 1H641 2HKQB 1R0CB 1QWEA 3OYEA 1VYTA 2BZXA 4A63B 3CC4Q 5IT9E 2CGHA 4M78A 2EYWA 3RERA 2DD5A 1WHMA 3O8VA 3PVLA 1OEBA 1VQOA 1M90U 2DL4A 4C0ZA 5CKFA 2BZ8A 4OB3B 3JSCA 4RG8A 1JXMA 3M55A 3RUXA 5A0DA 2AZVA 5J3BA 1YJNQ 4L59A 4RTTA 2H8HA 4IKFA 5LJ5g 3L2RA 1RAFB 3U23A 3CCLQ 1KC8C 2K3YA 5GMKj 2MIOA 3TVTA 4A4KA 1YHQA 2CSQA 3CQTA 5GMKm 1OQKA 3RKYA 4MDWA 1ABQA 2V8IA 2GCXA 2DXUA 1G3TA 4M75E 3GIBA 2X51A 5GAN8 1KHIA 1G3WA 3DB4A 2DXBA 1ZA1B 1U5SA 2OAWA 1RLPC 1T0JA 2FL7A 4AFSC 1O75A 4C5IA 4JLIA 2FB7A 2DETA 3JRZA 5FWCA 4JZ3A 4QVDA 1K9MC 2JM8A 1T3SA 1B07A 5GMKh 3OYYA 2RPNA 2J6OA 4HKEA 1GXIE 2CP5A 3I9QA 2QGGA 1MGQA 9ATCB 4EMGA 5IHKA 1VQLQ 1MHNA 2KXCA 3S6WA 3CMAQ 1BCOA 2HNIA 2DL7A 4ELZC 1WNLA 3V8JA 3G6ET 3BW1A 4X9DA 4HVUA 2A28A 4LE9A 4M7DC 4ATOA 1RAAB 5KE3A 2DMOA 2QTXA 3PNWC 4CC2A 5GAN2 2DD4A 1WJRA 4XU2A 1QKXA 4LXCA 1IGQA 4OGEA 5D6WA 3OYIA 2C0OA 3RNJA 3OYFA 2RN8A 1QVGS 1PNJA 2HEQA 1K9MR 4AFQC 1YITQ 1AEYA 2D8HA 2RQRA 3E1SA 1ACMB 2COWA 1C1AA 3M56A 4WTOB 5KYWA 5LJ5j 1PWTA 2X35A 5CK9A 2FZGB 3PT9A 4M78B 5IH2A 1RAEB 4F04B 2X4YA 4RKUE 3OYMA 1WHGA 2AKLA 2DERA 4CC4B 1UB4A 2GBQA 3L2ZA 2FYKA 1PD1A 1VQKQ 3VKIA 3HSBA 5FWBA 1ZSZC 2FPEA 1Y57A 3JCMb 1GFDA 2BTTA 4A4FA 1YHQT 5A0GA 1XJWB 3H0FA 5GANf 4IIOA 1NG2A 3X26B 3CCUA 3FRNA 2A3LA 1AZEA 1N8RU 3I5RA 4JJNK 2R5MA 3HKSA 4LUDA 1H3HA 3ZBDA 2E41A 3OYJA 5L23A 3TEEA 2PZ1A 1XOVA 1IHVA 4L5GA 1UEBA 5FU6B 5HCKA 3CCJQ 2RHXA 5GANe 1KFZA 2J06A 2LVMA 2K5FA 3H0HA 2QYZA 4X1VA 4C8QC 1IZ6A 1VQ5A 2K3BA 1H8KA 4M7DE 3JB9F 1YJ9T 5I11A 1Y96A 1YCYA 1T0HA 2YRCA 4NOYA 2LJ0A 1MNDA 4C92E 1UECA 5GAMd 1GBQA 2KQWA 2NUPB 3CPFA 1EZZB 2COZA 4FYWB 4C0FA 2JMAA 3REAB 2JTFA 2QEXA 2JOYA 1GCPA 2EJGA 2CUDA 5LJ3d 3NMZC 4XTXA 5GMKi 2FHDA 1PSEA 4A4GA 2AK5A 3QXEB 3L1AA 1ZLMA 1X6OA 3JB9G 3MEAA 3I55A 1U06A 3HRTA 3R6NA 4E7JA 2A36A 1VQ7Q 5J39A 3QSUA 4M75G 1YJ9A 3A1PA 4Y28E 2KEAA 3VJPA 1YP5A 1S72A 1NEGA 2LC4A 2EQIA 5EC7A 2I2LA 1W6XA 2HBWA 3SDZA 1YJNA 2MI6A 2RH2A 2DPPB 2EKHA 2X9HA 2L0AA 1GCQA 1SSHA 4OVAA 4YTLA 3CMET 2E3IA 1U1SA 2DTHA 3MKDA 4E7ZA 3VS0A 3PGGA 1Q82R 3QUIA 4M75F 4PKCC 2WSCE 2K3XA 3V8KA 2DVEA 2CP0A 2PNIA 3CCUT 1AHJB 2M16A 4NL2A 2X4WA 4FT2A 3A8GB 5DM7R 2BUDA 3CXCS 3M4GA 1K8AC 2MAMA 3DB3A 3I35A 2JZ2A 1YN8A 4M7AB 1GBRA 1B34B 1QVFA 1SKUB 4JZ4A 4N0AC 3URGA 3GLXA 3CCSA 4M77C 1OPLA 4BDYA 2KI7A 1JQQA 2LT1A 4JS5A 2ROLA 3CCQT 1WHJA 3UF4A 1W4SA 1HYOA 3G4SQ 1FX7A 4MMLA 3OYLA 3AT1B 3EGDA 2JW4A 2FPFA 4KRTA 2RHZA 1Q82C 1NE8A 5FW9A 1JJ2S 1WXUA 3CCRT 2OTJT 4LDWA 3GF5A 4M77G 2OTLT 1VQMT 1V29B 4C8QG 3CCUQ 2CZ1B 1JBMA 2EVRA 4JLGA 4PJOD 2DL3A 4DBRA 2LCCA 1YJWA 3A8HB 1HSQA 1X6GA 1AWJA 2D0QB 5HY6A 2VKNA 2W0ZA 8ATCB 2ZPEB 4J9IA 4M7DF 4JRPA 3MJXA 4QVCA 3QDRB 2DF6A 2ZPIB 1UGSB 2LNHB 2VWFA 3TSWA 1WQ7A 2L89A 1U8RA 3CCMT 2E6ZA 1B3QA 4KGVB 2K9GA 4C8QB 4DA4A 3FLGA 4M7AC 2L3RA 4M7DD 4EMHA 3LLRA 4R0KA 1W1FA 2Z0WA 3OYKA 1KQSP 3CCRQ 2F2WA 1KC8U 3L2UA 5A2QE 1UE9A 1E6GA 1YIJA 4ZNXA 3M0UA 3NTIA 2KYBA 1Q7YC 4KGZB 5GAMf 2DKGA 2KRNA 1KQSA 4M77A 1R8OB 1WJQA 2QDYB 3OS5A 4M78C 1GFCA 2V1QA 2ZPFB 2K4YA 5KYUA 2RNAA 2P0QA 2KE9A 1K76A 1JJ2P 1HK9A 3ER0A 2P0KA 4R56A 3AHUA 4QVZA 2YSQA 2KK4A 3MP6A 1MV0B 1VQ8A 3X28B 1QVFP 2RF0A 4D6WA 2F1LA 1UHCA 1QW1A 1X69A 2CT3A 3ASKA 3QBYA 4C92A 2HSPA 2RI2A 4AFUC 1AZGB 2AZSA 4FM4B 1TTHB 2XMFA 1M1KC 4E7SA 4ZGEB 1NLOC 1B34A 3E2UA 3NHNA 2XU8A 4EIKA 2DK3A 2QQSA 1AVZC 3M53A 4IUVA 1EIFA 1BI3A 1M2VB 2E65A 2E64A 2WACA 1KQSS 5M9OA 3CCJT 3WVEB 4M75B 2L5QA 4F14A 1YIJT 1BYMA 2KGTA 4KGXB 4E7IA 1KC8R 2DBKA 4OMNA 4B6MA 1IB8A 4RCCA 3JCMh 6AT1B 1G3SA 1YJ9Q 4ZN1A 2K2VA 3EH2A 3A8LB 2EGEA 1NPPA 1N9RA 3SWNC 3CCMA 4DEYA 1G8XA 1Q95G 5GAMg 1M3AA 1MUZA 5GAMe 3JCMc 1WHKA 3E9FA 1D3BA 1D3BB 1WIEA 2RJFA 2MOXA 4FSSA 4N4HA 1SEMA 2HBPA 4OMLA 4AT1B 2GGRA 3SD4A 1ZSGA 2DIQA 4CC3A 3JCMd 2M1HA 2ZCFB 2VV5A 1WXBA 2DRKA 2JTMA 2E3HA 2OTLA 2KXDA 4GLKA 1LCKA 2DXTA 2XI9A 3MEUA 1W70A 1N27A 3CC2Q 4ZTFA 3L2WA 4J9CA 5D6YA 1VQOQ 4OB2B 3ZEHA 5KYYA 4NL3A 2MF2A 4BE2A 4OGCA 1IREB 5FU7C 2HCKA 4M78E 4XU3A 2JM9A 3GOXA 4C92G 2KT1A 2CREA 5FLXE 2AHJB 4IIMA 3EGXA 2OJ2A 2EWNA 3G7ZA 3VUBA 1B7TA 4F7UE 2DYBA 4R55A 1ZUKA 2VGMA 1OI1A 1ZHIA 4F17A 4LDVA 2QXFA 2A37A 4HCZA 3PFSA 3O5ZA 3CPWA 3X24B 2DO3A 2DZCA 1KQ2A 1M2VA 2JUFA 2JNGA 1SG5A 2P84A 1G83A 4RG2A 4LDUA 2HQXA 5LL6S 3CBMA 4QW2A 2WSFE 1M3CA 2V8KA 2BZYA 2DM1A 1QVGP 4OP0A 2PUKB 4PJOF 5GANg 3JCMX 1QKWA 1X2KA 4XTVA 2YLCA 3M4YA 3QHSA 5C6SA 2D1XA 1N8RC 4NS5A 3LX7A 5GAOl 2DJQA 2JTEA 2M51A 1E6HA 2DVJA 1D1BA 4C5EA 4QT7A 4M7DB 1QP3A 4A53A 5LJ3j 1OPKA 2C0TA 2VVKA 5FRNA 2EYZA 2CT4A 2CP7A 3OYCA 1KQ1A 2VC8A 4CI0C 4KBMB 1M30A 3T9NA 5EG2A 4LDYA 3HRSA 3RESA 2M0YA 3CPWS 3GNGA 2K57A 3V8LA 2AT1B 2NLUA 1OX9A 2XHCA 1LNXA 1TOVA 3CXCP 1Q82U 2E12A 2PVDB 1GRIA 3SEMA 4M4ZA 2GFAA 3C94A 3OW2S 3OYBA 2HQHA 2HL5C 1KIKA 3VV0A 2KDSA 1M2OA 2FG0A 2LQKA 1TS9A 1VQ8Q 3VYGA 3ZL7C 3MO8A 2K5IA 2DX1A 3CCVQ 5HKCA 2VUBA 1D0ZA 3CBPA 2CKKA 2DFUA 1VQNA 3CCLT 4XAXB 1TUDA 1A0NB 3LWHA 2DBMA 2QDLA 1XQHA 4OB0B 5GAN7 2HDAA 2IIMA 1RUWA 1N5ZA 2V1RA 3RBBB 2PVGB 1VIFA 4M7AD 3QJ6A 2A0FB 3M57A 1VQPT 4OF1A 1K73C 3J80E 1PRLC 5GMKl 1NJIC 2K7AA 2O9VA 1NYFA 2QQBA 1Q81R 2NUZA 2RQTA 2F2VA 2QASA 1WI7A 3EFSA 2LMJA 3WXMB 2RHYA 4B9XA 3L42A 2EQJA 2JT4A 3VS6A 3OA6A 3VS1A 2KRMA 2B8AA 3TREA 3RMSA 4JUVA 1BBZA 4J6YA 2CH4A 1VQ9A 3LH0A 3EHQA 2KT8A 1OYXA 3A8OB 3LWIA 2NWMA 3H9NA 3CC4T 2MPXC 2V26A 4RTVA 1K9MU 4EMKA 2LQWA 4HCKA 4OMOA 4ZGDB 2FPDA 1MNEA 4B9WA 3RKXA 3ZFJA 3H41A 3A8MB 4N4GA 3VRYA 2KAFA 2RB6A 2OX7A 5LJ5e 1BIAA 4FCYA 3R6OA 2DTIA 3C95A 3G71Q 4PJOA 2HSEB 1T3LA 3J81E 4PJNA 3CC4A 1VQ7A 3VS4A 1X43A 3BDUA 4F7UA 4F7UB 1N6AA 1QCNA 3FC3A 1X01A 4PJLA 1OZ3A 2BE7D 3VYHB 2EQMA 1MMNA 2KSSA 4M75D 4PFOA 3CC2T 2COYA 2ZPGB 4XTWA 5GAN5 4DBHA 4M77B 2E4HA 1VQ6Q 3FJPA 2OTJA 2O4XB 5GAMh 1HXDA 3ME9A 5IHNA 3FJ5A 2L2PA 2NUPA 2L3QA 1YI2T 3CBOA 1YHQQ 4DEXA 3CC2A 2DJZA 2KY9A 1E7OA 2JJ9A 2ROTA 1VQPA 5CKEA 2QA4A 3ULRB 2J6FA 2PU9B 3BDLA 4XTYA 3NTHA 3HP9A 2JXBA 4M7DG 4IUPA 5CIUA 2ZZDA 3S3NA 2E10A 4XTZA 1M1GA 2QG9B 1PG5B 2J05A 5IAYA 3FB9A 4PJOC 3SHWA 1UGQB 1Y71A 1VQ4T 1D1AA 1YFNA 3QZ5B 2GF7A 3CD6A 5CKHA 4A4EA 2DYIA 4OMMA 1V1CA 2K5LA 1W2BS 3EGUA 3OYGA 1VA7A 3C0CA 1FYNA 3CCEA 4A54A 2F2XA 2X3XD 4FIBA 4ESRA 2MMPA 1M1FA 3JCMV 4C0DB 4Z8AA 2PTKA 3BE3A 4FL6A 4XK8E 2MYSA 3TU4K 1UTIA 1K73R 1MMGA 4M77D 3L2VA 3CCJA 3UWNA 1NJIR 2E6NA 5GANd 4BE0A 4E7LA 2DL8A 2BE9B 1OX8A 2ED1A 2FVUA 1AWOA 3FEOA 1YBYA 2KYMA 1IHWA 2RM4A 4M7AA 3RMQA 4PLIA 5KYUB 3G71T 5CO7A 4OMPA 4L6V5 2RK1A 2MCNA 4RMOA 1VQKT 4ORZA 2L8DA 1J3TA 2YHTA 3CPWP 1YJWT 2JVVA 4GBQA 4J9GA 3LH5A 1KG1A 2QEXT 2FZKB 1WYXA 3M0PA 1K4US 2EJ9A 4M75C 1UGRB 5GJVB 2XDDA 1QVGA 2XKOC 1LJOA 5FU6C 2DILA 4J6XA 1YIJQ 4M7AG 3G4ST 3H8ZA 4CC7A 3CMEQ 1UGVA 3MEWA 2ECZA 3CCQQ 2H3JA 2C06A 2HQEA 2M02A 3QPHA 2L3SA 3DLLA 4DBQA 1M8MA 2O4XA 3JAME 2EYQA 2LX9A 1UDLA 2LDMA 4F7UG 3HFNA 2DNUA 2XIDA 3EHRA 3LW5E 5KE2A 3KFVA 3UATA 3HHTB 4IUTA 2ED0A 5GAMj 3THKA 4XTUA 4Z02A 3SFMA 2KVQG 3PIPA 4BY6C 3EAEA 3EG1A 4EMKC 5CCAA 2YUQA 2QK0A 2J7IA 4PFPA 1RAGB 2CS7A 2CZ6B 3M54A 1TU0B 2LCSA 2G3RA 2LCLA 1TUGB 3QYHB 4RTWA 1I5LA 2AKKA 2ENMA 1ZSZA 1VQPQ 3WVDB 4HVWA 2QA4Q 1PHTA 5GAOq 3QJYA 1VQMQ 2F5TX 1XNIA 2GQVA 4AFZC 1ABOA 1EFNA 4J9FA 4DOVA 3G4SA 1VYVA 3QWXX 1M3BA 2R57A 3QG1A 2GTJA 2QGFB 2JN0A 4HXJA 4BI8B 3VUZA 5HK3A 1RAIB 1ARKA 1BKBA 5AT1B 2YLBA 2ESWA 4JJCA 3PMTA 3CCSQ 4RTUA 3DLMA 2KRSA 1BI0A 3E19A 2VXEA 3I56T 5CAIA 4PLLA 4Z88A 2SRCA 4GLMA 3OSSC 2M9UA 1Q81C 4F16A 1I5OB 2YXYA 3V7CA 2KMTA 3G6EA 1UFFA 3I56A 4HT9A 4JRIA 5D7UA 1KD1C 3RDVA 2RHUA 1ZQ1A 2YDLA 4KULA 3EGXB 1H3ZA 1SSFA 3C4SA 1VQ6A 3P8HA 5GAOm 2X4JA 1M90C 5FRMA 5GAOr 1WFWA 3JCMe 2HKNA 3QIIA 2DEQA 4X34A 1JU5C 2LZ6B 2YUOA 2RHIA 1NLPC 4C8QA 3SB2A 3VS3A 3CC7Q 1UJYA 3OQ5A 1JRIA 1P92A 1M27C 4FU6A 4N0AA 4Y92A 3MPUB 3CEYA 2FO0A 4M78G 2DZ9A 3FDRA 1VQ8T 4IURA 1Q86U 4E47A 3EG0A 4PJOE 3CXCA 1ZSZB 1I81A 1PSFA 1RACB 2JS0A 4MMKA 2EYYA 4J5YA 2K2MA 3G1JA 2WSEE 2HL3A 1VQNT 4E7KA 3CCEQ 3OS1A 4RUGA 5CQYA 4QKUA 1CKBA 4M7AE 4DOWA 2QQAA 1QVFS 4HCCA 4C92B 3CD6Q 2X3WD 3FIFA 2O2OA 4FYVB 3QZ9B 5KCHA 2YUNA 1PC0A 2L3PA 2LJ1A 3QKJA 1YI2A 1FMWA 1K0SA 3VS5A 1WPYA 1QWFA 3JCMW 3OYNA 1VQOT 4AG2C 3JB9D 3META 1ZA2B 2DEUA 1G2BA 2CP2A 2O01E 5KH6A 1TUCA 2KR3A 1Z9ZA 3UA7A 3M59A 5GANj 3D7SB 1QP2A 1NJIU 3RR6A 3HRUA 3PE0A 3JCMQ 5L8RE 2DRMA 5KYXA 5CKBA 2EYXA 4M7AF 4BE1A 4C92D 4BI3A 5GAN4 1VQ4A 4LUEA 4FSXA 4CRIA 4ZGJB 1OV3A 1XTDA 2RI3A 2VASA 1VQ5Q 1PM3A 4AMCA 3OMGA 5DLQE 4Q5WA 4M78F 2AIRB 5LJ3g 2P4RA 4LNPA 4Z89A 5LJ3e 4J7FA 3CC7T 1N8RR 1AOJA 3H0IA 5I2MA 3PTAA 2QEXQ 2HMAA 3JCMJ 1Q86C 2VB6A 2XK0A 5A0LA 3GNFB 4MZMA 3CCQA 1PKTA 2NUTA 1K9AA 1H92A 2LX7A 1UHFA 3NPFA 2E5KA 2QQ9A 4XU1A 3M0SA 2GTOA 3I5SA 3M0RA 2CP6A 2KBTA 5HK0A 2XD0A 1VQ6T 3OB9A 4UC4A 1SRMA 1WDXA 1IGUA 1X27A 1X6BA 4BDZA 2K79A 3M0QA 3C12A 1Y96B 1I1JA 3BFMA 3VU3C 1DJ7B 4BD3A 4ZN3A 1KHCA 4M75A 1VQ7T 1KD1U 3PVQA 1JEGA 2D0NA 4J9BA 2LQ8A 2ZPBB 2QI2A 4DQ2A 3N5BB 1AWXA 2YUPA 1YITT 1ZBJA 2EIFA 2EKOA 1KJWA 2E5QA 1WQWA 1VQ9T 1YCSB 1FWZA 3SWNB 4J9HA 2RMOA 3UT1A 2RD1A 1BB9A 4LD6A 2OAUA 1ZX6A 5CR2A 4QQDA 1JJ2A 1MMAA 3Q1JA 3I55Q 2JS2A 3HFOA 3OW2P 4PJMA 1Q7YU 1AT1B 3MCAB 1OU9A 2VGNA 3M58A 4PJOG 5KCOA 2EQUA 5ECAA 2CSIA 4E6RA 4OB1B 1PKSA 4C8QD 3JB9H 1S72Q 4JPBW 4WF2A 1FMVA 2QTVA 4ANJA 1CKAA 4D8DA 3VS2A 1Q81U 4C8QE 2Y4XA 1LOJA 4M77E 1FMKA 1WHLA 4J8OA 5GAN6 5CKDA 3P8DA 1VOMA 5IXFA 3JCMg 2C0IA 4JRKA 1KSWA 4IUQA 3I56Q 2EJFA 3KXTA 3EH1A 2DL5A 1M9SA 3EG9A 1K73U 1R0BG 5DLOA 2LJ3A 1G3YA 3UDCA 4PJOB 2FRYA 1K8AR 2NYSA 1AD5A 4BY6B 4KH0B 5KYWB 2MK5A 2EGCA 1I4K1 2OTJQ 4X9CA 1M1KR 4BI4A 1ZUUA 4AG1C 4FYYB 7AT1B 3LGLA 4HCBA 3CC7A 2HD0A 5LJ3f 2PUOB 1K8AU 3UPUA 1NYGA 2CDTA 1SRLA 1BCMA 4J7IA 4PJJA 2DXCA 2PVOB 3TSZA 3J7AF 3EG9B 4FW1A 1WLPB 2LRQA 1PCXA 1D09B 1IO6A 1I0CA 2I0NA 1HD3A 2R5AA 5CQXA 3KUFA 2H3EB 4ELYC 2PQWA 2OI3A 2RQUA 4Y91A 5KYXB 3V7SA 4II1A 2A08A 2A7YA 2LT4A 1RABB 1YWOA 2SEMA 2DIGA 2KNBB 1KD1R 1PD0A 1R77A 2GFUA 2G6FX 3EG3A 4KUDK 2Y4YA 2ATCB 2VXFA 2EW3A 1ZUYA 3CCVA 3QYGB 3PIOA 5KYYB 2DAQA 2O9SA 3NTKA 4WCIA 3EGDB 1YI2Q 3M0TA 4J83A 5GAN3 3OSVA 4N4IA 3JCMP 4JJDA 2YRDA 1NEBA 3EFOA 3MP1A 5I21A 2F69A 3A98A 3VS7A 4P5NA 1EX4A 4QQ6A 2D9TA 1IRXA 1RAHB 5J26A 3INZA 3BY7A 1VQ4Q 3NGPA 3MP8A 1N9SA 2FEIA 3M9QA 5GAOn 1RL2A 1WZOA 4LD9K 4EDUA 3OBYA 3OS0A 2D6FA 1MMDA 3MEVA 1UUEA 4KH1B 2DE0X 1F1BB 3HL8A 1BK2A 4OMQA 4PK4A 4C92F 1LPLA 3TCJA 1SF9A 2IPOB 4J9EA 2QAZA 2EFIA 4FYXB 1M5Q1 3G71A 3CCRA 4J6WA 2CZ7B 1C6VX 3CMEA 2EBPA 1MV3A 4E7HA 3CCMQ 4IUUA 1UGPB 2LQNA 3GBQA 4C8QF 1UG1A 4BACA 1KK7A 1QCOA 4F7UF 1U3OA 3RIRA 1PRMC 3EFRA 2P0PA 1M8VA 3LYIA 3HTRA 1SHGA 5IN1A 2DA9A 2HAXA 5D6XA 8AT1B 1NBEB 5LJ5d 4D8KA 1YJNT 4LDXA 5GAOp 2P4TA 1X75C 3A5ZB 3QWYA 1Y07A 2FRWA 4EMKB 5C0MA 2ZAEA 2K6DA 1WHHA 3CCVT 4MZPA 2OTLQ 4DBFA 3X25B 1OU8A 1K0XA 1M1KU 4J9DA 5GANh 2YRVA 2RA2A 2EQKA 1WGSA 2M0OA 1IXDA 2EPDA 4RTYA 1QQJA 2W10A 3OS2A 2QQRA 2IVWA 1M90R 2CYZB 1VQ9Q 3JB9I 1NM7A 1Q86R 4C0GA 3SWNA 3OYDA 2HZYA 4ZTJA 4K11A 3H6ZA 3HPWA 2JMCA 1TH7A 4JJBA 1QCFA 4JDSA 1VIEA 4M78D 2MWOA 1S1NA 4QQGA 3REBB 3EFOB 2O88A 3TQ7P 4MZTA 4EPCA 1NPRA 4PL6A 2RI5A 3OMCA 5IHIA 1W2BP 3S3MA 3KBGA 1RI9A 3I55T 1D0YA 1YNZA 2F5KA 1HJDA 2FZCB 1Q7YR 3CCET 4HVVA 1JB0E 4OMFB 2MWPA 2GQIA 2D8JA 1GL5A 2NUTB 1S72T 5DY9A 2XDBA 4FW2A 3UA6A 2RJDA 3CD6T 1YJWQ 4JS4A 1SHFA 2YWWA 1OOTA 4C0DC 5GJWB 2IG0A 4FT4A 3OYHA 4O5VA 4TVRA 1TSFA 4HT8A 2RJEA 2EAYA 3DKMA 2O31A 1VQLA 4ME7A 5FROA 4M77F 4PNOA 2CH4W 2ZPHB 3CMAA 2BIVA 1QVPA 1VQ5T 3L2QA 1G5VA 1TG0A 2DLPA 3E9GA 1BIBA 3CCLA 1D1CA 2CZ0B 4XQ3A 1VYUA 3OW2A 1NZ9A 1Y7XA 1X2QA 2E1HA 5KYNA 4JRQA 4V2SA 4O6JA 2V8JA 5FU7B 2CUBA 1I07A 3JV3A 1BI1A 4XU0A 1BI2A 2RK2A
chains in the Genus database with same CATH topology
1B34B 3LH0A 5DLQE 1QVFA 2X4XA 4Q5WA 3CMAT 4M78F 1OYXA 1ZBXA 3A8OB 5LJ3g 1U1TA 5LJ3h 4N0AC 4M7AB 3URGA 3LWIA 3GLXA 3CCSA 3CCST 3JB9J 4M77C 4BDYA 3GPLA 3CC4T 4GY5A 3NFCA 2LT1A 1K9MU 4EMKA 4JS5A 5LJ3e 4M7DA 3PMIA 1O9SA 2E70A 4J7FA 3CCQT 3CC7T 5I2MA 3PTAA 3OY9A 4ZGDB 3JCMJ 1VUBA 3P8BB 3JCMf 1Q86C 2XK0A 5LJ5h 2VYTA 2ZGWA 1W4SA 2LNVA 3RKXA 4B9WA 3ZFJA 5A0LA 3OYAA 3A8MB 4N4GA 3GP8A 1FX7A 4MMLA 2KAFA 3GNFB 3OYLA 2RB6A 4A4HA 3V7RA 5LJ5e 1Q82C 2RHZA 4MZMA 1BIAA 1NE8A 3CCQA 1JJ2S 3R6OA 3CCRT 2DTIA 3C95A 4PJOA 2OTJT 4LDWA 3GF5A 3J81E 3CC4A 4M77G 4C5HA 2RO0A 1VQMT 2QA4T 1VQ7A 2OTLT 1V29B 4C8QG 3BDUA 2CZ1B 1JBMA 4F7UA 4F7UB 1W2BA 1N6AA 2QQ9A 4XU1A 3S3OA 4JLGA 4PJOD 3FC3A 2LCCA 3OW2A 5HK0A 3A8HB 1X01A 1YJWA 2XD0A 1VQ6T 3OB9A 1FXXA 4UC4A 5AYFA 1OZ3A 2D0QB 5HY6A 4KT0E 3VYHB 3M5AA 2EQMA 4BDZA 2KSSA 4M75D 3C12A 5LJ5f 1Y96B 4MDXA 3CC2T 3BFMA 2ZPGB 4XTWA 1DJ7B 3VU3C 2ZPEB 4BD3A 5GAN5 4M77B 4M7DF 3FJPA 5GMKe 4ZN3A 2OTJA 4JRPA 4BUGA 2O4XB 1KHCA 4QVCA 3QDRB 4M75A 1HXDA 1I8FA 3ME9A 5GAMh 1VQMA 1KD1U 1VQ7T 2ZPIB 3X20B 1UGSB 2XDPA 1WQ7A 2LQ8A 3LGFA 2L89A 1U8RA 1YI2T 3CBOA 3CCMT 2ZPBB 2E6ZA 3CC2A 2QI2A 4DQ2A 3N5BB 2DJZA 2KY9A 1YITA 1YITT 1VQPA 5CKEA 2QA4A 2EIFA 4RCBA 4C8QB 3FLGA 4DA4A 4M7AC 2EKOA 2PU9B 2L3RA 3BDLA 4HA8A 2E5QA 1WQWA 3LLRA 3NTHA 4XTYA 3HP9A 4EMHA 1VQ9T 1FWZA 4M7DG 3OYKA 3SWNB 4IUPA 3MHXA 2ZZDA 4VUBA 5CIUA 2E10A 3S3NA 4XTZA 1KC8U 1M1GA 3L2UA 5A2QE 5IAYA 3UT1A 2RD1A 3FB9A 5I2SA 2XG8D 4LD6A 1YIJA 2OAUA 4PJOC 1OZ2A 3NTIA 5CR2A 5CVIA 1VQLT 1UGQB 1Y71A 2LTOA 4QQDA 4C5GA 3QO3A 1VQ4T 2BKDN 1Q7YC 5GAMf 2RJCA 1JJ2A 2DKGA 3QZ5B 3Q1JA 3OBWA 4C92C 2GF7A 1KQSA 3CD6A 5CKHA 3HFOA 1M4ZA 4M77A 4A4EA 4BB7A 2XICA 1RI0A 1Q7YU 3MCAB 2VGNA 3M58A 4PJOG 5KCOA 1R8OB 1VQKA 1WJQA 2QDYB 2DTOA 2EQUA 3OS5A 2K5LA 1W2BS 4OB1B 4M78C 3OYGA 3CCEA 4C8QD 3JB9H 4A54A 2ZPFB 4FIBA 2K4YA 3F70A 1WJSA 2P0QA 1HK9A 4WF2A 3RKWA 2MMPA 1M1FA 3ER0A 2P0KA 4R56A 4KUIA 3AHUA 3JCMV 4QVZA 4C0DB 2Y90A 2R58A 2KK4A 1Q81U 1H641 4C8QE 2Y4XA 3MP6A 4FL6A 4XK8E 1LOJA 3TU4K 4M77E 5GAN6 5CKDA 4J8OA 1VQ8A 3P8DA 3X28B 4M77D 3OYEA 4D6WA 3L2VA 3CCJA 1QW1A 3ASKA 3QBYA 4JRKA 3JCMg 3UWNA 4C92A 2RI2A 4IUQA 2EJFA 2CGHA 5IT9E 4M78A 3KXTA 3RERA 2DD5A 1M9SA 1K73U 4FM4B 5DLOA 3O8VA 2E6NA 5GANd 4BE0A 4E7LA 3UDCA 1G3YA 1VQOA 1M1KC 1M90U 4PJOB 2FVUA 4C0ZA 5CKFA 3FEOA 4OB3B 1YBYA 3JSCA 4BY6B 4RG8A 3M55A 3RUXA 5A0DA 5J3BA 2RM4A 4M7AA 4ZGEB 1B34A 3RMQA 4PLIA 4L59A 1I4K1 3G71T 2XU8A 5CO7A 4X9CA 2DK3A 4L6V5 4BI4A 2RK1A 4IKFA 4RMOA 2QQSA 5LJ5g 1VQKT 3M53A 3L2RA 3LGLA 4IUVA 2L8DA 1EIFA 4HCBA 1BI3A 2YHTA 1KC8C 2K3YA 5GMKj 3CC7A 4A4KA 2HD0A 1YHQA 2E65A 2E64A 5GMKm 2WACA 1KQSS 3RKYA 1YJWT 4MDWA 2JVVA 5LJ3f 5M9OA 3CCJT 2V8IA 2QEXT 2GCXA 1KG1A 2DXUA 3WVEB 2PUOB 4M75B 1G3TA 2L5QA 3UPUA 1YIJT 1K8AU 1BYMA 2EJ9A 4M75E 3GIBA 4M75C 5GAN8 1UGRB 4J7IA 4E7IA 2DXCA 2PVOB 1KHIA 1G3WA 3J7AF 3DB4A 2DXBA 2XDDA 4RCCA 1QVGA 2XKOC 1LJOA 2FL7A 5FU6C 4J6XA 2LRQA 1O75A 3JCMh 3G4ST 4C5IA 4M7AG 1G3SA 4JLIA 3H8ZA 2FB7A 5CQXA 2R5AA 4ZN1A 2K2VA 3KUFA 3MEWA 3A8LB 4ELYC 2PQWA 3JRZA 2H3JA 1NPPA 1N9RA 2HQEA 3SWNC 4Y91A 3QPHA 3CCMA 2C06A 4QVDA 3V7SA 4II1A 1K9MC 2A7YA 2LT4A 3DLLA 2O4XA 2DIGA 3JAME 2EYQA 5GAMg 2GFUA 5GMKh 3OYYA 4KUDK 2Y4YA 2LX9A 3JCMc 5GAMe 3E9FA 2LDMA 4HKEA 1D3BA 3HFNA 4F7UG 1D3BB 2VXFA 1GXIE 2XIDA 2RJFA 4N4HA 2HBPA 3CCVA 3QYGB 3PIOA 3LW5E 5KE2A 1MGQA 3SD4A 2DAQA 4EMGA 1MHNA 3NTKA 2DIQA 3JCMd 2M1HA 3HHTB 2ZCFB 4IUTA 2VV5A 3S6WA 5GAMj 4XTUA 2HNIA 4Z02A 4ELZC 1WNLA 3SFMA 3V8JA 3G6ET 2KVQG 4J83A 3BW1A 3PIPA 4BY6C 3EAEA 3OSVA 2JTMA 4N4IA 4X9DA 5GAN3 3JCMP 2OTLA 4GLKA 4EMKC 2DXTA 4ATOA 4M7DC 5CCAA 2XI9A 3MEUA 3MP1A 1N27A 5I21A 5KE3A 4ZTFA 3L2WA 2CS7A 2QTXA 3PNWC 2F69A 5D6YA 5GAN2 2DD4A 2CZ6B 3M54A 1WJRA 4OB2B 4P5NA 3ZEHA 4XU2A 2MF2A 4NL3A 4BE2A 4OGCA 4QQ6A 1IREB 5FU7C 2D9TA 4OGEA 5D6WA 3OYIA 4M78E 2G3RA 4XU3A 5J26A 3INZA 3BY7A 4C92G 3OYFA 3GOXA 2LCLA 3MP8A 1QVGS 5FLXE 2AHJB 1N9SA 3QYHB 1I5LA 3M9QA 2EWNA 3G7ZA 3WVDB 3VUBA 5GAOn 1RL2A 4LD9K 4F7UE 5GAOq 3E1SA 3QJYA 4R55A 2F5TX 1XNIA 2GQVA 4EDUA 3OBYA 2VGMA 3OS0A 3M56A 1OI1A 1ZHIA 2D6FA 3MEVA 5LJ5j 4LDVA 2QXFA 2X35A 5CK9A 4HCZA 3HL8A 3PT9A 3PFSA 4DOVA 4M78B 3G4SA 3OYMA 2X4YA 4RKUE 3X24B 2DO3A 3CPWA 2DZCA 4C92F 2R57A 3TCJA 1KQ2A 2JUFA 1UB4A 2JNGA 3QG1A 2JN0A 4BI8B 3VUZA 5HK3A 2EFIA 1BKBA 3L2ZA 1M5Q1 2YLBA 2FYKA 4RG2A 3G71A 4LDUA 2HQXA 3CCRA 4J6WA 2CZ7B 3PMTA 5LL6S 3CBMA 3VKIA 3CMEA 4QW2A 2WSFE 3HSBA 2V8KA 3JCMb 4E7HA 3DLMA 4A4FA 1YHQT 4OP0A 2PUKB 4IUUA 1UGPB 4PJOF 5GANg 3JCMX 1BI0A 4C8QF 5A0GA 3E19A 4XTVA 2VXEA 2YLCA 3I56T 5CAIA 4BACA 3M4YA 3QHSA 5C6SA 4F7UF 5GANf 4PLLA 3RIRA 3X26B 1N8RC 3EFRA 4NS5A 2P0PA 3LX7A 3FRNA 2A3LA 5GAOl 3CCUA 1M8VA 3LYIA 3OSSC 2M9UA 1Q81C 5IN1A 1N8RU 4JJNK 2R5MA 5D6XA 3V7CA 3HKSA 2KMTA 2HAXA 3G6EA 3I56A 4HT9A 4JRIA 3ZBDA 5LJ5d 4C5EA 1YJNT 1KD1C 5GAOp 2E41A 1X75C 2P4TA 3A5ZB 2RHUA 1ZQ1A 4LDXA 1Y07A 3OYJA 4EMKB 4KULA 1QP3A 3TEEA 4A53A 5C0MA 4M7DB 1H3ZA 1SSFA 5LJ3j 3C4SA 1XOVA 3CCVT 1VQ6A 3P8HA 4L5GA 2X4JA 1UEBA 4MZPA 5FU6B 5GAOm 2RHXA 5GANe 3X25B 5FRNA 2LVMA 3OYCA 1M90C 1M1KU 1KQ1A 5FRMA 5GAOr 2K5FA 3JCMe 2VC8A 4C8QC 4CI0C 3QIIA 2DEQA 4X34A 4KBMB 5GANh 2YRVA 2RA2A 2EQKA 1WGSA 2M0OA 5EG2A 4LDYA 1IZ6A 3HRSA 3T9NA 3RESA 1VQ5A 2RHIA 3CPWS 3GNGA 2K57A 3V8LA 3OS2A 2NLUA 2QQRA 2IVWA 3SB2A 4C8QA 3JB9F 1YJ9T 2CYZB 4M7DE 2XHCA 1LNXA 3JB9I 1Y96A 1YCYA 3OQ5A 4C0GA 1Q82U 1JRIA 3SWNA 1P92A 3OYDA 2E12A 2PVDB 4FU6A 4N0AA 4ZTJA 4NOYA 3CEYA 3H6ZA 3HPWA 4C92E 1TH7A 5GAMd 2KQWA 4JDSA 4M78G 3CPFA 1VIEA 2DZ9A 3FDRA 2GFAA 4M78D 2MWOA 3C94A 4IURA 3OW2S 4C0FA 3OYBA 1Q86U 1VQ8T 4E47A 4PJOE 3CXCA 2JTFA 4QQGA 2QEXA 1I81A 2JOYA 1PSFA 3VV0A 2KDSA 2EJGA 4MMKA 4J5YA 4XTXA 5LJ3d 5GMKi 2FHDA 2WSEE 1PSEA 4MZTA 2LQKA 4A4GA 4EPCA 4E7KA 1NPRA 1VQNT 4PL6A 3OS1A 3VYGA 3QXEB 5CQYA 3L1AA 2RI5A 3OMCA 4M7AE 3MO8A 2K5IA 2QQAA 1X6OA 4DOWA 1QVFS 3S3MA 3KBGA 4HCCA 4C92B 5HKCA 3I55T 3MEAA 3JB9G 3I55A 2VUBA 3CBPA 2CKKA 2F5KA 3FIFA 3HRTA 4E7JA 5J39A 3CCET 3QZ9B 5KCHA 3QSUA 1JB0E 2MWPA 4M75G 4OMFB 3QKJA 1YJ9A 3CCLT 1VQNA 4Y28E 1YI2A 3VJPA 1S72T 4XAXB 1S72A 5DY9A 2XDBA 3LWHA 1WPYA 2RJDA 3CD6T 3JCMW 2LC4A 3OYNA 1VQOT 3JB9D 1XQHA 4OB0B 3META 4JS4A 5GAN7 2O01E 2I2LA 3SDZA 5KH6A 1YJNA 2MI6A 2RH2A 2PVGB 4C0DC 2DPPB 2IG0A 1VIFA 4FT4A 3OYHA 4O5VA 4M7AD 3QJ6A 4TVRA 4HT8A 3M59A 2RJEA 4OVAA 4YTLA 3M57A 3CMET 2EAYA 5GANj 4OF1A 1VQPT 3DKMA 1QP2A 1U1SA 2DTHA 1NJIU 3JCMQ 3HRUA 1K73C 4ME7A 5L8RE 3J80E 5FROA 3PGGA 4M77F 1VQLA 3QUIA 5CKBA 5GMKl 1NJIC 4PNOA 4M7AF 4M75F 2ZPHB 3CMAA 4PKCC 2WSCE 4BE1A 2BIVA 1QVPA 2K3XA 2QQBA 3V8KA 1VQ5T 2DVEA 3L2QA 1G5VA 4C92D 4M7DD 4BI3A 3E9GA 1BIBA 5GAN4 3CCUT 1AHJB 2M16A 4NL2A 1VQ4A 3CCLA 2X4WA 2CZ0B 3EFSA 4FSXA 3A8GB 4FT2A 4XQ3A 4CRIA 4ZGJB 3WXMB 5DM7R 1NZ9A 2RHYA 2BUDA 1XTDA 2RI3A 3L42A 3M4GA 4B9XA 3CXCS 1Y7XA 2EQJA 1K8AC 2E1HA 4JRQA 4V2SA 2MAMA 4O6JA 3OA6A 2V8JA 5FU7B 2B8AA 3TREA 3DB3A 3OMGA 4JUVA 3RMSA 1BI1A 2JZ2A 4J6YA 4XU0A 1BI2A 2RK2A 1VQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  2DD5 A;  2ZPF B;  4Y28 E;  4FM4 B;  2ZZD A;  3HHT B;  2ZPG B;  1DJ7 B;  2ZPE B;  2AHJ B;  2ZPH B;  2WSC E;  3A8O B;  3QYH B;  2CZ7 B;  4OB1 B;  1PSF A;  4OB0 B;  2PUO B;  3WVD B;  3WVE B;  2WSF E;  2O01 E;  4OB3 B;  1V29 B;  2ZPI B;  3X20 B;  2CZ1 B;  2WSE E;  2CYZ B;  1UGQ B;  1UGS B;  1PSE A;  1AHJ B;  1UGR B;  2PVG B;  2DPP B;  2DXC A;  2CZ0 B;  2PVO B;  4XK8 E;  3A8G B;  3QXE B;  3VYG A;  4ZGE B;  2PUK B;  4ZGJ B;  1QP3 A;  2DXB A;  2ZPB B;  3QZ5 B;  1UGP B;  3X28 B;  1GXI E;  2DD4 A;  2PVD B;  2CZ6 B;  3A8H B;  4OB2 B;  4ZGD B;  3QYG B;  4L6V 5;  1IRE B;  3LW5 E;  4RKU E;  2D0Q B;  3X24 B;  2QDY B;  3X25 B;  4KT0 E;  3VYH B;  1QP2 A;  3A8M B;  3X26 B;  2PU9 B;  3QZ9 B;  1JB0 E;  3A8L B;  5L8R E; 
#chains in the Genus database with same CATH topology
 1JXO A;  2RQW A;  2X4X A;  1K1Z A;  3CMA T;  1C0M A;  1ZBX A;  2KRO A;  1U1T A;  5LJ3 h;  3CCS T;  3JB9 J;  3GPL A;  4GY5 A;  3NFC A;  1RLQ C;  4M7D A;  3PMI A;  1O9S A;  2E70 A;  1Z9Q A;  4RTZ A;  3OY9 A;  1VUB A;  3P8B B;  2GNC A;  3JCM f;  5LJ5 h;  2VYT A;  2ZGW A;  2LNV A;  3OYA A;  3GP8 A;  1OUL A;  4A4H A;  3V7R A;  2LP5 A;  4C5H A;  2RO0 A;  2QA4 T;  2EGA A;  2J6K A;  1W2B A;  3S3O A;  1SPK A;  1FXX A;  5AYF A;  1RAD B;  4KT0 E;  3M5A A;  1LVK A;  1QMC A;  5LJ5 f;  1GCQ C;  2RQV A;  5I22 A;  4MDX A;  5GMK e;  4BUG A;  1VQM A;  1I8F A;  1BU1 A;  3X20 B;  2XDP A;  3LGF A;  4RTX A;  2CP3 A;  1YIT A;  1Y0M A;  1JO8 A;  1QLY A;  3QDF A;  4RCB A;  4HA8 A;  1WXT A;  4PFZ A;  1V76 A;  1WA7 A;  3EG2 A;  3MHX A;  4VUB A;  2YT6 A;  1CSK A;  1TWB A;  3IQL A;  5IXB A;  5I2S A;  2ABL A;  2B86 A;  2XG8 D;  4E2F B;  1D0X A;  1YWP A;  1OZ2 A;  5CVI A;  1VQL T;  2LTO A;  4C5G A;  1WX6 A;  3QO3 A;  2BKD N;  2RJC A;  4C92 C;  3OBW A;  1M4Z A;  4BB7 A;  1UJ0 A;  2XIC A;  1RI0 A;  1VQK A;  2DTO A;  3VRZ A;  1VQN Q;  3F70 A;  1WJS A;  3G6E Q;  1AWW A;  3RKW A;  4LN2 A;  1TXQ A;  4KUI A;  2Y90 A;  2R58 A;  1H64 1;  2HKQ B;  1R0C B;  1QWE A;  3OYE A;  1VYT A;  2BZX A;  4A63 B;  3CC4 Q;  5IT9 E;  2CGH A;  4M78 A;  2EYW A;  3RER A;  2DD5 A;  1WHM A;  3O8V A;  3PVL A;  1OEB A;  1VQO A;  1M90 U;  2DL4 A;  4C0Z A;  5CKF A;  2BZ8 A;  4OB3 B;  3JSC A;  4RG8 A;  1JXM A;  3M55 A;  3RUX A;  5A0D A;  2AZV A;  5J3B A;  1YJN Q;  4L59 A;  4RTT A;  2H8H A;  4IKF A;  5LJ5 g;  3L2R A;  1RAF B;  3U23 A;  3CCL Q;  1KC8 C;  2K3Y A;  5GMK j;  2MIO A;  3TVT A;  4A4K A;  1YHQ A;  2CSQ A;  3CQT A;  5GMK m;  1OQK A;  3RKY A;  4MDW A;  1ABQ A;  2V8I A;  2GCX A;  2DXU A;  1G3T A;  4M75 E;  3GIB A;  2X51 A;  5GAN 8;  1KHI A;  1G3W A;  3DB4 A;  2DXB A;  1ZA1 B;  1U5S A;  2OAW A;  1RLP C;  1T0J A;  2FL7 A;  4AFS C;  1O75 A;  4C5I A;  4JLI A;  2FB7 A;  2DET A;  3JRZ A;  5FWC A;  4JZ3 A;  4QVD A;  1K9M C;  2JM8 A;  1T3S A;  1B07 A;  5GMK h;  3OYY A;  2RPN A;  2J6O A;  4HKE A;  1GXI E;  2CP5 A;  3I9Q A;  2QGG A;  1MGQ A;  9ATC B;  4EMG A;  5IHK A;  1VQL Q;  1MHN A;  2KXC A;  3S6W A;  3CMA Q;  1BCO A;  2HNI A;  2DL7 A;  4ELZ C;  1WNL A;  3V8J A;  3G6E T;  3BW1 A;  4X9D A;  4HVU A;  2A28 A;  4LE9 A;  4M7D C;  4ATO A;  1RAA B;  5KE3 A;  2DMO A;  2QTX A;  3PNW C;  4CC2 A;  5GAN 2;  2DD4 A;  1WJR A;  4XU2 A;  1QKX A;  4LXC A;  1IGQ A;  4OGE A;  5D6W A;  3OYI A;  2C0O A;  3RNJ A;  3OYF A;  2RN8 A;  1QVG S;  1PNJ A;  2HEQ A;  1K9M R;  4AFQ C;  1YIT Q;  1AEY A;  2D8H A;  2RQR A;  3E1S A;  1ACM B;  2COW A;  1C1A A;  3M56 A;  4WTO B;  5KYW A;  5LJ5 j;  1PWT A;  2X35 A;  5CK9 A;  2FZG B;  3PT9 A;  4M78 B;  5IH2 A;  1RAE B;  4F04 B;  2X4Y A;  4RKU E;  3OYM A;  1WHG A;  2AKL A;  2DER A;  4CC4 B;  1UB4 A;  2GBQ A;  3L2Z A;  2FYK A;  1PD1 A;  1VQK Q;  3VKI A;  3HSB A;  5FWB A;  1ZSZ C;  2FPE A;  1Y57 A;  3JCM b;  1GFD A;  2BTT A;  4A4F A;  1YHQ T;  5A0G A;  1XJW B;  3H0F A;  5GAN f;  4IIO A;  1NG2 A;  3X26 B;  3CCU A;  3FRN A;  2A3L A;  1AZE A;  1N8R U;  3I5R A;  4JJN K;  2R5M A;  3HKS A;  4LUD A;  1H3H A;  3ZBD A;  2E41 A;  3OYJ A;  5L23 A;  3TEE A;  2PZ1 A;  1XOV A;  1IHV A;  4L5G A;  1UEB A;  5FU6 B;  5HCK A;  3CCJ Q;  2RHX A;  5GAN e;  1KFZ A;  2J06 A;  2LVM A;  2K5F A;  3H0H A;  2QYZ A;  4X1V A;  4C8Q C;  1IZ6 A;  1VQ5 A;  2K3B A;  1H8K A;  4M7D E;  3JB9 F;  1YJ9 T;  5I11 A;  1Y96 A;  1YCY A;  1T0H A;  2YRC A;  4NOY A;  2LJ0 A;  1MND A;  4C92 E;  1UEC A;  5GAM d;  1GBQ A;  2KQW A;  2NUP B;  3CPF A;  1EZZ B;  2COZ A;  4FYW B;  4C0F A;  2JMA A;  3REA B;  2JTF A;  2QEX A;  2JOY A;  1GCP A;  2EJG A;  2CUD A;  5LJ3 d;  3NMZ C;  4XTX A;  5GMK i;  2FHD A;  1PSE A;  4A4G A;  2AK5 A;  3QXE B;  3L1A A;  1ZLM A;  1X6O A;  3JB9 G;  3MEA A;  3I55 A;  1U06 A;  3HRT A;  3R6N A;  4E7J A;  2A36 A;  1VQ7 Q;  5J39 A;  3QSU A;  4M75 G;  1YJ9 A;  3A1P A;  4Y28 E;  2KEA A;  3VJP A;  1YP5 A;  1S72 A;  1NEG A;  2LC4 A;  2EQI A;  5EC7 A;  2I2L A;  1W6X A;  2HBW A;  3SDZ A;  1YJN A;  2MI6 A;  2RH2 A;  2DPP B;  2EKH A;  2X9H A;  2L0A A;  1GCQ A;  1SSH A;  4OVA A;  4YTL A;  3CME T;  2E3I A;  1U1S A;  2DTH A;  3MKD A;  4E7Z A;  3VS0 A;  3PGG A;  1Q82 R;  3QUI A;  4M75 F;  4PKC C;  2WSC E;  2K3X A;  3V8K A;  2DVE A;  2CP0 A;  2PNI A;  3CCU T;  1AHJ B;  2M16 A;  4NL2 A;  2X4W A;  4FT2 A;  3A8G B;  5DM7 R;  2BUD A;  3CXC S;  3M4G A;  1K8A C;  2MAM A;  3DB3 A;  3I35 A;  2JZ2 A;  1YN8 A;  4M7A B;  1GBR A;  1B34 B;  1QVF A;  1SKU B;  4JZ4 A;  4N0A C;  3URG A;  3GLX A;  3CCS A;  4M77 C;  1OPL A;  4BDY A;  2KI7 A;  1JQQ A;  2LT1 A;  4JS5 A;  2ROL A;  3CCQ T;  1WHJ A;  3UF4 A;  1W4S A;  1HYO A;  3G4S Q;  1FX7 A;  4MML A;  3OYL A;  3AT1 B;  3EGD A;  2JW4 A;  2FPF A;  4KRT A;  2RHZ A;  1Q82 C;  1NE8 A;  5FW9 A;  1JJ2 S;  1WXU A;  3CCR T;  2OTJ T;  4LDW A;  3GF5 A;  4M77 G;  2OTL T;  1VQM T;  1V29 B;  4C8Q G;  3CCU Q;  2CZ1 B;  1JBM A;  2EVR A;  4JLG A;  4PJO D;  2DL3 A;  4DBR A;  2LCC A;  1YJW A;  3A8H B;  1HSQ A;  1X6G A;  1AWJ A;  2D0Q B;  5HY6 A;  2VKN A;  2W0Z A;  8ATC B;  2ZPE B;  4J9I A;  4M7D F;  4JRP A;  3MJX A;  4QVC A;  3QDR B;  2DF6 A;  2ZPI B;  1UGS B;  2LNH B;  2VWF A;  3TSW A;  1WQ7 A;  2L89 A;  1U8R A;  3CCM T;  2E6Z A;  1B3Q A;  4KGV B;  2K9G A;  4C8Q B;  4DA4 A;  3FLG A;  4M7A C;  2L3R A;  4M7D D;  4EMH A;  3LLR A;  4R0K A;  1W1F A;  2Z0W A;  3OYK A;  1KQS P;  3CCR Q;  2F2W A;  1KC8 U;  3L2U A;  5A2Q E;  1UE9 A;  1E6G A;  1YIJ A;  4ZNX A;  3M0U A;  3NTI A;  2KYB A;  1Q7Y C;  4KGZ B;  5GAM f;  2DKG A;  2KRN A;  1KQS A;  4M77 A;  1R8O B;  1WJQ A;  2QDY B;  3OS5 A;  4M78 C;  1GFC A;  2V1Q A;  2ZPF B;  2K4Y A;  5KYU A;  2RNA A;  2P0Q A;  2KE9 A;  1K76 A;  1JJ2 P;  1HK9 A;  3ER0 A;  2P0K A;  4R56 A;  3AHU A;  4QVZ A;  2YSQ A;  2KK4 A;  3MP6 A;  1MV0 B;  1VQ8 A;  3X28 B;  1QVF P;  2RF0 A;  4D6W A;  2F1L A;  1UHC A;  1QW1 A;  1X69 A;  2CT3 A;  3ASK A;  3QBY A;  4C92 A;  2HSP A;  2RI2 A;  4AFU C;  1AZG B;  2AZS A;  4FM4 B;  1TTH B;  2XMF A;  1M1K C;  4E7S A;  4ZGE B;  1NLO C;  1B34 A;  3E2U A;  3NHN A;  2XU8 A;  4EIK A;  2DK3 A;  2QQS A;  1AVZ C;  3M53 A;  4IUV A;  1EIF A;  1BI3 A;  1M2V B;  2E65 A;  2E64 A;  2WAC A;  1KQS S;  5M9O A;  3CCJ T;  3WVE B;  4M75 B;  2L5Q A;  4F14 A;  1YIJ T;  1BYM A;  2KGT A;  4KGX B;  4E7I A;  1KC8 R;  2DBK A;  4OMN A;  4B6M A;  1IB8 A;  4RCC A;  3JCM h;  6AT1 B;  1G3S A;  1YJ9 Q;  4ZN1 A;  2K2V A;  3EH2 A;  3A8L B;  2EGE A;  1NPP A;  1N9R A;  3SWN C;  3CCM A;  4DEY A;  1G8X A;  1Q95 G;  5GAM g;  1M3A A;  1MUZ A;  5GAM e;  3JCM c;  1WHK A;  3E9F A;  1D3B A;  1D3B B;  1WIE A;  2RJF A;  2MOX A;  4FSS A;  4N4H A;  1SEM A;  2HBP A;  4OML A;  4AT1 B;  2GGR A;  3SD4 A;  1ZSG A;  2DIQ A;  4CC3 A;  3JCM d;  2M1H A;  2ZCF B;  2VV5 A;  1WXB A;  2DRK A;  2JTM A;  2E3H A;  2OTL A;  2KXD A;  4GLK A;  1LCK A;  2DXT A;  2XI9 A;  3MEU A;  1W70 A;  1N27 A;  3CC2 Q;  4ZTF A;  3L2W A;  4J9C A;  5D6Y A;  1VQO Q;  4OB2 B;  3ZEH A;  5KYY A;  4NL3 A;  2MF2 A;  4BE2 A;  4OGC A;  1IRE B;  5FU7 C;  2HCK A;  4M78 E;  4XU3 A;  2JM9 A;  3GOX A;  4C92 G;  2KT1 A;  2CRE A;  5FLX E;  2AHJ B;  4IIM A;  3EGX A;  2OJ2 A;  2EWN A;  3G7Z A;  3VUB A;  1B7T A;  4F7U E;  2DYB A;  4R55 A;  1ZUK A;  2VGM A;  1OI1 A;  1ZHI A;  4F17 A;  4LDV A;  2QXF A;  2A37 A;  4HCZ A;  3PFS A;  3O5Z A;  3CPW A;  3X24 B;  2DO3 A;  2DZC A;  1KQ2 A;  1M2V A;  2JUF A;  2JNG A;  1SG5 A;  2P84 A;  1G83 A;  4RG2 A;  4LDU A;  2HQX A;  5LL6 S;  3CBM A;  4QW2 A;  2WSF E;  1M3C A;  2V8K A;  2BZY A;  2DM1 A;  1QVG P;  4OP0 A;  2PUK B;  4PJO F;  5GAN g;  3JCM X;  1QKW A;  1X2K A;  4XTV A;  2YLC A;  3M4Y A;  3QHS A;  5C6S A;  2D1X A;  1N8R C;  4NS5 A;  3LX7 A;  5GAO l;  2DJQ A;  2JTE A;  2M51 A;  1E6H A;  2DVJ A;  1D1B A;  4C5E A;  4QT7 A;  4M7D B;  1QP3 A;  4A53 A;  5LJ3 j;  1OPK A;  2C0T A;  2VVK A;  5FRN A;  2EYZ A;  2CT4 A;  2CP7 A;  3OYC A;  1KQ1 A;  2VC8 A;  4CI0 C;  4KBM B;  1M30 A;  3T9N A;  5EG2 A;  4LDY A;  3HRS A;  3RES A;  2M0Y A;  3CPW S;  3GNG A;  2K57 A;  3V8L A;  2AT1 B;  2NLU A;  1OX9 A;  2XHC A;  1LNX A;  1TOV A;  3CXC P;  1Q82 U;  2E12 A;  2PVD B;  1GRI A;  3SEM A;  4M4Z A;  2GFA A;  3C94 A;  3OW2 S;  3OYB A;  2HQH A;  2HL5 C;  1KIK A;  3VV0 A;  2KDS A;  1M2O A;  2FG0 A;  2LQK A;  1TS9 A;  1VQ8 Q;  3VYG A;  3ZL7 C;  3MO8 A;  2K5I A;  2DX1 A;  3CCV Q;  5HKC A;  2VUB A;  1D0Z A;  3CBP A;  2CKK A;  2DFU A;  1VQN A;  3CCL T;  4XAX B;  1TUD A;  1A0N B;  3LWH A;  2DBM A;  2QDL A;  1XQH A;  4OB0 B;  5GAN 7;  2HDA A;  2IIM A;  1RUW A;  1N5Z A;  2V1R A;  3RBB B;  2PVG B;  1VIF A;  4M7A D;  3QJ6 A;  2A0F B;  3M57 A;  1VQP T;  4OF1 A;  1K73 C;  3J80 E;  1PRL C;  5GMK l;  1NJI C;  2K7A A;  2O9V A;  1NYF A;  2QQB A;  1Q81 R;  2NUZ A;  2RQT A;  2F2V A;  2QAS A;  1WI7 A;  3EFS A;  2LMJ A;  3WXM B;  2RHY A;  4B9X A;  3L42 A;  2EQJ A;  2JT4 A;  3VS6 A;  3OA6 A;  3VS1 A;  2KRM A;  2B8A A;  3TRE A;  3RMS A;  4JUV A;  1BBZ A;  4J6Y A;  2CH4 A;  1VQ9 A;  3LH0 A;  3EHQ A;  2KT8 A;  1OYX A;  3A8O B;  3LWI A;  2NWM A;  3H9N A;  3CC4 T;  2MPX C;  2V26 A;  4RTV A;  1K9M U;  4EMK A;  2LQW A;  4HCK A;  4OMO A;  4ZGD B;  2FPD A;  1MNE A;  4B9W A;  3RKX A;  3ZFJ A;  3H41 A;  3A8M B;  4N4G A;  3VRY A;  2KAF A;  2RB6 A;  2OX7 A;  5LJ5 e;  1BIA A;  4FCY A;  3R6O A;  2DTI A;  3C95 A;  3G71 Q;  4PJO A;  2HSE B;  1T3L A;  3J81 E;  4PJN A;  3CC4 A;  1VQ7 A;  3VS4 A;  1X43 A;  3BDU A;  4F7U A;  4F7U B;  1N6A A;  1QCN A;  3FC3 A;  1X01 A;  4PJL A;  1OZ3 A;  2BE7 D;  3VYH B;  2EQM A;  1MMN A;  2KSS A;  4M75 D;  4PFO A;  3CC2 T;  2COY A;  2ZPG B;  4XTW A;  5GAN 5;  4DBH A;  4M77 B;  2E4H A;  1VQ6 Q;  3FJP A;  2OTJ A;  2O4X B;  5GAM h;  1HXD A;  3ME9 A;  5IHN A;  3FJ5 A;  2L2P A;  2NUP A;  2L3Q A;  1YI2 T;  3CBO A;  1YHQ Q;  4DEX A;  3CC2 A;  2DJZ A;  2KY9 A;  1E7O A;  2JJ9 A;  2ROT A;  1VQP A;  5CKE A;  2QA4 A;  3ULR B;  2J6F A;  2PU9 B;  3BDL A;  4XTY A;  3NTH A;  3HP9 A;  2JXB A;  4M7D G;  4IUP A;  5CIU A;  2ZZD A;  3S3N A;  2E10 A;  4XTZ A;  1M1G A;  2QG9 B;  1PG5 B;  2J05 A;  5IAY A;  3FB9 A;  4PJO C;  3SHW A;  1UGQ B;  1Y71 A;  1VQ4 T;  1D1A A;  1YFN A;  3QZ5 B;  2GF7 A;  3CD6 A;  5CKH A;  4A4E A;  2DYI A;  4OMM A;  1V1C A;  2K5L A;  1W2B S;  3EGU A;  3OYG A;  1VA7 A;  3C0C A;  1FYN A;  3CCE A;  4A54 A;  2F2X A;  2X3X D;  4FIB A;  4ESR A;  2MMP A;  1M1F A;  3JCM V;  4C0D B;  4Z8A A;  2PTK A;  3BE3 A;  4FL6 A;  4XK8 E;  2MYS A;  3TU4 K;  1UTI A;  1K73 R;  1MMG A;  4M77 D;  3L2V A;  3CCJ A;  3UWN A;  1NJI R;  2E6N A;  5GAN d;  4BE0 A;  4E7L A;  2DL8 A;  2BE9 B;  1OX8 A;  2ED1 A;  2FVU A;  1AWO A;  3FEO A;  1YBY A;  2KYM A;  1IHW A;  2RM4 A;  4M7A A;  3RMQ A;  4PLI A;  5KYU B;  3G71 T;  5CO7 A;  4OMP A;  4L6V 5;  2RK1 A;  2MCN A;  4RMO A;  1VQK T;  4ORZ A;  2L8D A;  1J3T A;  2YHT A;  3CPW P;  1YJW T;  2JVV A;  4GBQ A;  4J9G A;  3LH5 A;  1KG1 A;  2QEX T;  2FZK B;  1WYX A;  3M0P A;  1K4U S;  2EJ9 A;  4M75 C;  1UGR B;  5GJV B;  2XDD A;  1QVG A;  2XKO C;  1LJO A;  5FU6 C;  2DIL A;  4J6X A;  1YIJ Q;  4M7A G;  3G4S T;  3H8Z A;  4CC7 A;  3CME Q;  1UGV A;  3MEW A;  2ECZ A;  3CCQ Q;  2H3J A;  2C06 A;  2HQE A;  2M02 A;  3QPH A;  2L3S A;  3DLL A;  4DBQ A;  1M8M A;  2O4X A;  3JAM E;  2EYQ A;  2LX9 A;  1UDL A;  2LDM A;  4F7U G;  3HFN A;  2DNU A;  2XID A;  3EHR A;  3LW5 E;  5KE2 A;  3KFV A;  3UAT A;  3HHT B;  4IUT A;  2ED0 A;  5GAM j;  3THK A;  4XTU A;  4Z02 A;  3SFM A;  2KVQ G;  3PIP A;  4BY6 C;  3EAE A;  3EG1 A;  4EMK C;  5CCA A;  2YUQ A;  2QK0 A;  2J7I A;  4PFP A;  1RAG B;  2CS7 A;  2CZ6 B;  3M54 A;  1TU0 B;  2LCS A;  2G3R A;  2LCL A;  1TUG B;  3QYH B;  4RTW A;  1I5L A;  2AKK A;  2ENM A;  1ZSZ A;  1VQP Q;  3WVD B;  4HVW A;  2QA4 Q;  1PHT A;  5GAO q;  3QJY A;  1VQM Q;  2F5T X;  1XNI A;  2GQV A;  4AFZ C;  1ABO A;  1EFN A;  4J9F A;  4DOV A;  3G4S A;  1VYV A;  3QWX X;  1M3B A;  2R57 A;  3QG1 A;  2GTJ A;  2QGF B;  2JN0 A;  4HXJ A;  4BI8 B;  3VUZ A;  5HK3 A;  1RAI B;  1ARK A;  1BKB A;  5AT1 B;  2YLB A;  2ESW A;  4JJC A;  3PMT A;  3CCS Q;  4RTU A;  3DLM A;  2KRS A;  1BI0 A;  3E19 A;  2VXE A;  3I56 T;  5CAI A;  4PLL A;  4Z88 A;  2SRC A;  4GLM A;  3OSS C;  2M9U A;  1Q81 C;  4F16 A;  1I5O B;  2YXY A;  3V7C A;  2KMT A;  3G6E A;  1UFF A;  3I56 A;  4HT9 A;  4JRI A;  5D7U A;  1KD1 C;  3RDV A;  2RHU A;  1ZQ1 A;  2YDL A;  4KUL A;  3EGX B;  1H3Z A;  1SSF A;  3C4S A;  1VQ6 A;  3P8H A;  5GAO m;  2X4J A;  1M90 C;  5FRM A;  5GAO r;  1WFW A;  3JCM e;  2HKN A;  3QII A;  2DEQ A;  4X34 A;  1JU5 C;  2LZ6 B;  2YUO A;  2RHI A;  1NLP C;  4C8Q A;  3SB2 A;  3VS3 A;  3CC7 Q;  1UJY A;  3OQ5 A;  1JRI A;  1P92 A;  1M27 C;  4FU6 A;  4N0A A;  4Y92 A;  3MPU B;  3CEY A;  2FO0 A;  4M78 G;  2DZ9 A;  3FDR A;  1VQ8 T;  4IUR A;  1Q86 U;  4E47 A;  3EG0 A;  4PJO E;  3CXC A;  1ZSZ B;  1I81 A;  1PSF A;  1RAC B;  2JS0 A;  4MMK A;  2EYY A;  4J5Y A;  2K2M A;  3G1J A;  2WSE E;  2HL3 A;  1VQN T;  4E7K A;  3CCE Q;  3OS1 A;  4RUG A;  5CQY A;  4QKU A;  1CKB A;  4M7A E;  4DOW A;  2QQA A;  1QVF S;  4HCC A;  4C92 B;  3CD6 Q;  2X3W D;  3FIF A;  2O2O A;  4FYV B;  3QZ9 B;  5KCH A;  2YUN A;  1PC0 A;  2L3P A;  2LJ1 A;  3QKJ A;  1YI2 A;  1FMW A;  1K0S A;  3VS5 A;  1WPY A;  1QWF A;  3JCM W;  3OYN A;  1VQO T;  4AG2 C;  3JB9 D;  3MET A;  1ZA2 B;  2DEU A;  1G2B A;  2CP2 A;  2O01 E;  5KH6 A;  1TUC A;  2KR3 A;  1Z9Z A;  3UA7 A;  3M59 A;  5GAN j;  3D7S B;  1QP2 A;  1NJI U;  3RR6 A;  3HRU A;  3PE0 A;  3JCM Q;  5L8R E;  2DRM A;  5KYX A;  5CKB A;  2EYX A;  4M7A F;  4BE1 A;  4C92 D;  4BI3 A;  5GAN 4;  1VQ4 A;  4LUE A;  4FSX A;  4CRI A;  4ZGJ B;  1OV3 A;  1XTD A;  2RI3 A;  2VAS A;  1VQ5 Q;  1PM3 A;  4AMC A;  3OMG A;  5DLQ E;  4Q5W A;  4M78 F;  2AIR B;  5LJ3 g;  2P4R A;  4LNP A;  4Z89 A;  5LJ3 e;  4J7F A;  3CC7 T;  1N8R R;  1AOJ A;  3H0I A;  5I2M A;  3PTA A;  2QEX Q;  2HMA A;  3JCM J;  1Q86 C;  2VB6 A;  2XK0 A;  5A0L A;  3GNF B;  4MZM A;  3CCQ A;  1PKT A;  2NUT A;  1K9A A;  1H92 A;  2LX7 A;  1UHF A;  3NPF A;  2E5K A;  2QQ9 A;  4XU1 A;  3M0S A;  2GTO A;  3I5S A;  3M0R A;  2CP6 A;  2KBT A;  5HK0 A;  2XD0 A;  1VQ6 T;  3OB9 A;  4UC4 A;  1SRM A;  1WDX A;  1IGU A;  1X27 A;  1X6B A;  4BDZ A;  2K79 A;  3M0Q A;  3C12 A;  1Y96 B;  1I1J A;  3BFM A;  3VU3 C;  1DJ7 B;  4BD3 A;  4ZN3 A;  1KHC A;  4M75 A;  1VQ7 T;  1KD1 U;  3PVQ A;  1JEG A;  2D0N A;  4J9B A;  2LQ8 A;  2ZPB B;  2QI2 A;  4DQ2 A;  3N5B B;  1AWX A;  2YUP A;  1YIT T;  1ZBJ A;  2EIF A;  2EKO A;  1KJW A;  2E5Q A;  1WQW A;  1VQ9 T;  1YCS B;  1FWZ A;  3SWN B;  4J9H A;  2RMO A;  3UT1 A;  2RD1 A;  1BB9 A;  4LD6 A;  2OAU A;  1ZX6 A;  5CR2 A;  4QQD A;  1JJ2 A;  1MMA A;  3Q1J A;  3I55 Q;  2JS2 A;  3HFO A;  3OW2 P;  4PJM A;  1Q7Y U;  1AT1 B;  3MCA B;  1OU9 A;  2VGN A;  3M58 A;  4PJO G;  5KCO A;  2EQU A;  5ECA A;  2CSI A;  4E6R A;  4OB1 B;  1PKS A;  4C8Q D;  3JB9 H;  1S72 Q;  4JPB W;  4WF2 A;  1FMV A;  2QTV A;  4ANJ A;  1CKA A;  4D8D A;  3VS2 A;  1Q81 U;  4C8Q E;  2Y4X A;  1LOJ A;  4M77 E;  1FMK A;  1WHL A;  4J8O A;  5GAN 6;  5CKD A;  3P8D A;  1VOM A;  5IXF A;  3JCM g;  2C0I A;  4JRK A;  1KSW A;  4IUQ A;  3I56 Q;  2EJF A;  3KXT A;  3EH1 A;  2DL5 A;  1M9S A;  3EG9 A;  1K73 U;  1R0B G;  5DLO A;  2LJ3 A;  1G3Y A;  3UDC A;  4PJO B;  2FRY A;  1K8A R;  2NYS A;  1AD5 A;  4BY6 B;  4KH0 B;  5KYW B;  2MK5 A;  2EGC A;  1I4K 1;  2OTJ Q;  4X9C A;  1M1K R;  4BI4 A;  1ZUU A;  4AG1 C;  4FYY B;  7AT1 B;  3LGL A;  4HCB A;  3CC7 A;  2HD0 A;  5LJ3 f;  2PUO B;  1K8A U;  3UPU A;  1NYG A;  2CDT A;  1SRL A;  1BCM A;  4J7I A;  4PJJ A;  2DXC A;  2PVO B;  3TSZ A;  3J7A F;  3EG9 B;  4FW1 A;  1WLP B;  2LRQ A;  1PCX A;  1D09 B;  1IO6 A;  1I0C A;  2I0N A;  1HD3 A;  2R5A A;  5CQX A;  3KUF A;  2H3E B;  4ELY C;  2PQW A;  2OI3 A;  2RQU A;  4Y91 A;  5KYX B;  3V7S A;  4II1 A;  2A08 A;  2A7Y A;  2LT4 A;  1RAB B;  1YWO A;  2SEM A;  2DIG A;  2KNB B;  1KD1 R;  1PD0 A;  1R77 A;  2GFU A;  2G6F X;  3EG3 A;  4KUD K;  2Y4Y A;  2ATC B;  2VXF A;  2EW3 A;  1ZUY A;  3CCV A;  3QYG B;  3PIO A;  5KYY B;  2DAQ A;  2O9S A;  3NTK A;  4WCI A;  3EGD B;  1YI2 Q;  3M0T A;  4J83 A;  5GAN 3;  3OSV A;  4N4I A;  3JCM P;  4JJD A;  2YRD A;  1NEB A;  3EFO A;  3MP1 A;  5I21 A;  2F69 A;  3A98 A;  3VS7 A;  4P5N A;  1EX4 A;  4QQ6 A;  2D9T A;  1IRX A;  1RAH B;  5J26 A;  3INZ A;  3BY7 A;  1VQ4 Q;  3NGP A;  3MP8 A;  1N9S A;  2FEI A;  3M9Q A;  5GAO n;  1RL2 A;  1WZO A;  4LD9 K;  4EDU A;  3OBY A;  3OS0 A;  2D6F A;  1MMD A;  3MEV A;  1UUE A;  4KH1 B;  2DE0 X;  1F1B B;  3HL8 A;  1BK2 A;  4OMQ A;  4PK4 A;  4C92 F;  1LPL A;  3TCJ A;  1SF9 A;  2IPO B;  4J9E A;  2QAZ A;  2EFI A;  4FYX B;  1M5Q 1;  3G71 A;  3CCR A;  4J6W A;  2CZ7 B;  1C6V X;  3CME A;  2EBP A;  1MV3 A;  4E7H A;  3CCM Q;  4IUU A;  1UGP B;  2LQN A;  3GBQ A;  4C8Q F;  1UG1 A;  4BAC A;  1KK7 A;  1QCO A;  4F7U F;  1U3O A;  3RIR A;  1PRM C;  3EFR A;  2P0P A;  1M8V A;  3LYI A;  3HTR A;  1SHG A;  5IN1 A;  2DA9 A;  2HAX A;  5D6X A;  8AT1 B;  1NBE B;  5LJ5 d;  4D8K A;  1YJN T;  4LDX A;  5GAO p;  2P4T A;  1X75 C;  3A5Z B;  3QWY A;  1Y07 A;  2FRW A;  4EMK B;  5C0M A;  2ZAE A;  2K6D A;  1WHH A;  3CCV T;  4MZP A;  2OTL Q;  4DBF A;  3X25 B;  1OU8 A;  1K0X A;  1M1K U;  4J9D A;  5GAN h;  2YRV A;  2RA2 A;  2EQK A;  1WGS A;  2M0O A;  1IXD A;  2EPD A;  4RTY A;  1QQJ A;  2W10 A;  3OS2 A;  2QQR A;  2IVW A;  1M90 R;  2CYZ B;  1VQ9 Q;  3JB9 I;  1NM7 A;  1Q86 R;  4C0G A;  3SWN A;  3OYD A;  2HZY A;  4ZTJ A;  4K11 A;  3H6Z A;  3HPW A;  2JMC A;  1TH7 A;  4JJB A;  1QCF A;  4JDS A;  1VIE A;  4M78 D;  2MWO A;  1S1N A;  4QQG A;  3REB B;  3EFO B;  2O88 A;  3TQ7 P;  4MZT A;  4EPC A;  1NPR A;  4PL6 A;  2RI5 A;  3OMC A;  5IHI A;  1W2B P;  3S3M A;  3KBG A;  1RI9 A;  3I55 T;  1D0Y A;  1YNZ A;  2F5K A;  1HJD A;  2FZC B;  1Q7Y R;  3CCE T;  4HVV A;  1JB0 E;  4OMF B;  2MWP A;  2GQI A;  2D8J A;  1GL5 A;  2NUT B;  1S72 T;  5DY9 A;  2XDB A;  4FW2 A;  3UA6 A;  2RJD A;  3CD6 T;  1YJW Q;  4JS4 A;  1SHF A;  2YWW A;  1OOT A;  4C0D C;  5GJW B;  2IG0 A;  4FT4 A;  3OYH A;  4O5V A;  4TVR A;  1TSF A;  4HT8 A;  2RJE A;  2EAY A;  3DKM A;  2O31 A;  1VQL A;  4ME7 A;  5FRO A;  4M77 F;  4PNO A;  2CH4 W;  2ZPH B;  3CMA A;  2BIV A;  1QVP A;  1VQ5 T;  3L2Q A;  1G5V A;  1TG0 A;  2DLP A;  3E9G A;  1BIB A;  3CCL A;  1D1C A;  2CZ0 B;  4XQ3 A;  1VYU A;  3OW2 A;  1NZ9 A;  1Y7X A;  1X2Q A;  2E1H A;  5KYN A;  4JRQ A;  4V2S A;  4O6J A;  2V8J A;  5FU7 B;  2CUB A;  1I07 A;  3JV3 A;  1BI1 A;  4XU0 A;  1BI2 A;  2RK2 A; 
#chains in the Genus database with same CATH homology
 1B34 B;  3LH0 A;  5DLQ E;  1QVF A;  2X4X A;  4Q5W A;  3CMA T;  4M78 F;  1OYX A;  1ZBX A;  3A8O B;  5LJ3 g;  1U1T A;  5LJ3 h;  4N0A C;  4M7A B;  3URG A;  3LWI A;  3GLX A;  3CCS A;  3CCS T;  3JB9 J;  4M77 C;  4BDY A;  3GPL A;  3CC4 T;  4GY5 A;  3NFC A;  2LT1 A;  1K9M U;  4EMK A;  4JS5 A;  5LJ3 e;  4M7D A;  3PMI A;  1O9S A;  2E70 A;  4J7F A;  3CCQ T;  3CC7 T;  5I2M A;  3PTA A;  3OY9 A;  4ZGD B;  3JCM J;  1VUB A;  3P8B B;  3JCM f;  1Q86 C;  2XK0 A;  5LJ5 h;  2VYT A;  2ZGW A;  1W4S A;  2LNV A;  3RKX A;  4B9W A;  3ZFJ A;  5A0L A;  3OYA A;  3A8M B;  4N4G A;  3GP8 A;  1FX7 A;  4MML A;  2KAF A;  3GNF B;  3OYL A;  2RB6 A;  4A4H A;  3V7R A;  5LJ5 e;  1Q82 C;  2RHZ A;  4MZM A;  1BIA A;  1NE8 A;  3CCQ A;  1JJ2 S;  3R6O A;  3CCR T;  2DTI A;  3C95 A;  4PJO A;  2OTJ T;  4LDW A;  3GF5 A;  3J81 E;  3CC4 A;  4M77 G;  4C5H A;  2RO0 A;  1VQM T;  2QA4 T;  1VQ7 A;  2OTL T;  1V29 B;  4C8Q G;  3BDU A;  2CZ1 B;  1JBM A;  4F7U A;  4F7U B;  1W2B A;  1N6A A;  2QQ9 A;  4XU1 A;  3S3O A;  4JLG A;  4PJO D;  3FC3 A;  2LCC A;  3OW2 A;  5HK0 A;  3A8H B;  1X01 A;  1YJW A;  2XD0 A;  1VQ6 T;  3OB9 A;  1FXX A;  4UC4 A;  5AYF A;  1OZ3 A;  2D0Q B;  5HY6 A;  4KT0 E;  3VYH B;  3M5A A;  2EQM A;  4BDZ A;  2KSS A;  4M75 D;  3C12 A;  5LJ5 f;  1Y96 B;  4MDX A;  3CC2 T;  3BFM A;  2ZPG B;  4XTW A;  1DJ7 B;  3VU3 C;  2ZPE B;  4BD3 A;  5GAN 5;  4M77 B;  4M7D F;  3FJP A;  5GMK e;  4ZN3 A;  2OTJ A;  4JRP A;  4BUG A;  2O4X B;  1KHC A;  4QVC A;  3QDR B;  4M75 A;  1HXD A;  1I8F A;  3ME9 A;  5GAM h;  1VQM A;  1KD1 U;  1VQ7 T;  2ZPI B;  3X20 B;  1UGS B;  2XDP A;  1WQ7 A;  2LQ8 A;  3LGF A;  2L89 A;  1U8R A;  1YI2 T;  3CBO A;  3CCM T;  2ZPB B;  2E6Z A;  3CC2 A;  2QI2 A;  4DQ2 A;  3N5B B;  2DJZ A;  2KY9 A;  1YIT A;  1YIT T;  1VQP A;  5CKE A;  2QA4 A;  2EIF A;  4RCB A;  4C8Q B;  3FLG A;  4DA4 A;  4M7A C;  2EKO A;  2PU9 B;  2L3R A;  3BDL A;  4HA8 A;  2E5Q A;  1WQW A;  3LLR A;  3NTH A;  4XTY A;  3HP9 A;  4EMH A;  1VQ9 T;  1FWZ A;  4M7D G;  3OYK A;  3SWN B;  4IUP A;  3MHX A;  2ZZD A;  4VUB A;  5CIU A;  2E10 A;  3S3N A;  4XTZ A;  1KC8 U;  1M1G A;  3L2U A;  5A2Q E;  5IAY A;  3UT1 A;  2RD1 A;  3FB9 A;  5I2S A;  2XG8 D;  4LD6 A;  1YIJ A;  2OAU A;  4PJO C;  1OZ2 A;  3NTI A;  5CR2 A;  5CVI A;  1VQL T;  1UGQ B;  1Y71 A;  2LTO A;  4QQD A;  4C5G A;  3QO3 A;  1VQ4 T;  2BKD N;  1Q7Y C;  5GAM f;  2RJC A;  1JJ2 A;  2DKG A;  3QZ5 B;  3Q1J A;  3OBW A;  4C92 C;  2GF7 A;  1KQS A;  3CD6 A;  5CKH A;  3HFO A;  1M4Z A;  4M77 A;  4A4E A;  4BB7 A;  2XIC A;  1RI0 A;  1Q7Y U;  3MCA B;  2VGN A;  3M58 A;  4PJO G;  5KCO A;  1R8O B;  1VQK A;  1WJQ A;  2QDY B;  2DTO A;  2EQU A;  3OS5 A;  2K5L A;  1W2B S;  4OB1 B;  4M78 C;  3OYG A;  3CCE A;  4C8Q D;  3JB9 H;  4A54 A;  2ZPF B;  4FIB A;  2K4Y A;  3F70 A;  1WJS A;  2P0Q A;  1HK9 A;  4WF2 A;  3RKW A;  2MMP A;  1M1F A;  3ER0 A;  2P0K A;  4R56 A;  4KUI A;  3AHU A;  3JCM V;  4QVZ A;  4C0D B;  2Y90 A;  2R58 A;  2KK4 A;  1Q81 U;  1H64 1;  4C8Q E;  2Y4X A;  3MP6 A;  4FL6 A;  4XK8 E;  1LOJ A;  3TU4 K;  4M77 E;  5GAN 6;  5CKD A;  4J8O A;  1VQ8 A;  3P8D A;  3X28 B;  4M77 D;  3OYE A;  4D6W A;  3L2V A;  3CCJ A;  1QW1 A;  3ASK A;  3QBY A;  4JRK A;  3JCM g;  3UWN A;  4C92 A;  2RI2 A;  4IUQ A;  2EJF A;  2CGH A;  5IT9 E;  4M78 A;  3KXT A;  3RER A;  2DD5 A;  1M9S A;  1K73 U;  4FM4 B;  5DLO A;  3O8V A;  2E6N A;  5GAN d;  4BE0 A;  4E7L A;  3UDC A;  1G3Y A;  1VQO A;  1M1K C;  1M90 U;  4PJO B;  2FVU A;  4C0Z A;  5CKF A;  3FEO A;  4OB3 B;  1YBY A;  3JSC A;  4BY6 B;  4RG8 A;  3M55 A;  3RUX A;  5A0D A;  5J3B A;  2RM4 A;  4M7A A;  4ZGE B;  1B34 A;  3RMQ A;  4PLI A;  4L59 A;  1I4K 1;  3G71 T;  2XU8 A;  5CO7 A;  4X9C A;  2DK3 A;  4L6V 5;  4BI4 A;  2RK1 A;  4IKF A;  4RMO A;  2QQS A;  5LJ5 g;  1VQK T;  3M53 A;  3L2R A;  3LGL A;  4IUV A;  2L8D A;  1EIF A;  4HCB A;  1BI3 A;  2YHT A;  1KC8 C;  2K3Y A;  5GMK j;  3CC7 A;  4A4K A;  2HD0 A;  1YHQ A;  2E65 A;  2E64 A;  5GMK m;  2WAC A;  1KQS S;  3RKY A;  1YJW T;  4MDW A;  2JVV A;  5LJ3 f;  5M9O A;  3CCJ T;  2V8I A;  2QEX T;  2GCX A;  1KG1 A;  2DXU A;  3WVE B;  2PUO B;  4M75 B;  1G3T A;  2L5Q A;  3UPU A;  1YIJ T;  1K8A U;  1BYM A;  2EJ9 A;  4M75 E;  3GIB A;  4M75 C;  5GAN 8;  1UGR B;  4J7I A;  4E7I A;  2DXC A;  2PVO B;  1KHI A;  1G3W A;  3J7A F;  3DB4 A;  2DXB A;  2XDD A;  4RCC A;  1QVG A;  2XKO C;  1LJO A;  2FL7 A;  5FU6 C;  4J6X A;  2LRQ A;  1O75 A;  3JCM h;  3G4S T;  4C5I A;  4M7A G;  1G3S A;  4JLI A;  3H8Z A;  2FB7 A;  5CQX A;  2R5A A;  4ZN1 A;  2K2V A;  3KUF A;  3MEW A;  3A8L B;  4ELY C;  2PQW A;  3JRZ A;  2H3J A;  1NPP A;  1N9R A;  2HQE A;  3SWN C;  4Y91 A;  3QPH A;  3CCM A;  2C06 A;  4QVD A;  3V7S A;  4II1 A;  1K9M C;  2A7Y A;  2LT4 A;  3DLL A;  2O4X A;  2DIG A;  3JAM E;  2EYQ A;  5GAM g;  2GFU A;  5GMK h;  3OYY A;  4KUD K;  2Y4Y A;  2LX9 A;  3JCM c;  5GAM e;  3E9F A;  2LDM A;  4HKE A;  1D3B A;  3HFN A;  4F7U G;  1D3B B;  2VXF A;  1GXI E;  2XID A;  2RJF A;  4N4H A;  2HBP A;  3CCV A;  3QYG B;  3PIO A;  3LW5 E;  5KE2 A;  1MGQ A;  3SD4 A;  2DAQ A;  4EMG A;  1MHN A;  3NTK A;  2DIQ A;  3JCM d;  2M1H A;  3HHT B;  2ZCF B;  4IUT A;  2VV5 A;  3S6W A;  5GAM j;  4XTU A;  2HNI A;  4Z02 A;  4ELZ C;  1WNL A;  3SFM A;  3V8J A;  3G6E T;  2KVQ G;  4J83 A;  3BW1 A;  3PIP A;  4BY6 C;  3EAE A;  3OSV A;  2JTM A;  4N4I A;  4X9D A;  5GAN 3;  3JCM P;  2OTL A;  4GLK A;  4EMK C;  2DXT A;  4ATO A;  4M7D C;  5CCA A;  2XI9 A;  3MEU A;  3MP1 A;  1N27 A;  5I21 A;  5KE3 A;  4ZTF A;  3L2W A;  2CS7 A;  2QTX A;  3PNW C;  2F69 A;  5D6Y A;  5GAN 2;  2DD4 A;  2CZ6 B;  3M54 A;  1WJR A;  4OB2 B;  4P5N A;  3ZEH A;  4XU2 A;  2MF2 A;  4NL3 A;  4BE2 A;  4OGC A;  4QQ6 A;  1IRE B;  5FU7 C;  2D9T A;  4OGE A;  5D6W A;  3OYI A;  4M78 E;  2G3R A;  4XU3 A;  5J26 A;  3INZ A;  3BY7 A;  4C92 G;  3OYF A;  3GOX A;  2LCL A;  3MP8 A;  1QVG S;  5FLX E;  2AHJ B;  1N9S A;  3QYH B;  1I5L A;  3M9Q A;  2EWN A;  3G7Z A;  3WVD B;  3VUB A;  5GAO n;  1RL2 A;  4LD9 K;  4F7U E;  5GAO q;  3E1S A;  3QJY A;  4R55 A;  2F5T X;  1XNI A;  2GQV A;  4EDU A;  3OBY A;  2VGM A;  3OS0 A;  3M56 A;  1OI1 A;  1ZHI A;  2D6F A;  3MEV A;  5LJ5 j;  4LDV A;  2QXF A;  2X35 A;  5CK9 A;  4HCZ A;  3HL8 A;  3PT9 A;  3PFS A;  4DOV A;  4M78 B;  3G4S A;  3OYM A;  2X4Y A;  4RKU E;  3X24 B;  2DO3 A;  3CPW A;  2DZC A;  4C92 F;  2R57 A;  3TCJ A;  1KQ2 A;  2JUF A;  1UB4 A;  2JNG A;  3QG1 A;  2JN0 A;  4BI8 B;  3VUZ A;  5HK3 A;  2EFI A;  1BKB A;  3L2Z A;  1M5Q 1;  2YLB A;  2FYK A;  4RG2 A;  3G71 A;  4LDU A;  2HQX A;  3CCR A;  4J6W A;  2CZ7 B;  3PMT A;  5LL6 S;  3CBM A;  3VKI A;  3CME A;  4QW2 A;  2WSF E;  3HSB A;  2V8K A;  3JCM b;  4E7H A;  3DLM A;  4A4F A;  1YHQ T;  4OP0 A;  2PUK B;  4IUU A;  1UGP B;  4PJO F;  5GAN g;  3JCM X;  1BI0 A;  4C8Q F;  5A0G A;  3E19 A;  4XTV A;  2VXE A;  2YLC A;  3I56 T;  5CAI A;  4BAC A;  3M4Y A;  3QHS A;  5C6S A;  4F7U F;  5GAN f;  4PLL A;  3RIR A;  3X26 B;  1N8R C;  3EFR A;  4NS5 A;  2P0P A;  3LX7 A;  3FRN A;  2A3L A;  5GAO l;  3CCU A;  1M8V A;  3LYI A;  3OSS C;  2M9U A;  1Q81 C;  5IN1 A;  1N8R U;  4JJN K;  2R5M A;  5D6X A;  3V7C A;  3HKS A;  2KMT A;  2HAX A;  3G6E A;  3I56 A;  4HT9 A;  4JRI A;  3ZBD A;  5LJ5 d;  4C5E A;  1YJN T;  1KD1 C;  5GAO p;  2E41 A;  1X75 C;  2P4T A;  3A5Z B;  2RHU A;  1ZQ1 A;  4LDX A;  1Y07 A;  3OYJ A;  4EMK B;  4KUL A;  1QP3 A;  3TEE A;  4A53 A;  5C0M A;  4M7D B;  1H3Z A;  1SSF A;  5LJ3 j;  3C4S A;  1XOV A;  3CCV T;  1VQ6 A;  3P8H A;  4L5G A;  2X4J A;  1UEB A;  4MZP A;  5FU6 B;  5GAO m;  2RHX A;  5GAN e;  3X25 B;  5FRN A;  2LVM A;  3OYC A;  1M90 C;  1M1K U;  1KQ1 A;  5FRM A;  5GAO r;  2K5F A;  3JCM e;  2VC8 A;  4C8Q C;  4CI0 C;  3QII A;  2DEQ A;  4X34 A;  4KBM B;  5GAN h;  2YRV A;  2RA2 A;  2EQK A;  1WGS A;  2M0O A;  5EG2 A;  4LDY A;  1IZ6 A;  3HRS A;  3T9N A;  3RES A;  1VQ5 A;  2RHI A;  3CPW S;  3GNG A;  2K57 A;  3V8L A;  3OS2 A;  2NLU A;  2QQR A;  2IVW A;  3SB2 A;  4C8Q A;  3JB9 F;  1YJ9 T;  2CYZ B;  4M7D E;  2XHC A;  1LNX A;  3JB9 I;  1Y96 A;  1YCY A;  3OQ5 A;  4C0G A;  1Q82 U;  1JRI A;  3SWN A;  1P92 A;  3OYD A;  2E12 A;  2PVD B;  4FU6 A;  4N0A A;  4ZTJ A;  4NOY A;  3CEY A;  3H6Z A;  3HPW A;  4C92 E;  1TH7 A;  5GAM d;  2KQW A;  4JDS A;  4M78 G;  3CPF A;  1VIE A;  2DZ9 A;  3FDR A;  2GFA A;  4M78 D;  2MWO A;  3C94 A;  4IUR A;  3OW2 S;  4C0F A;  3OYB A;  1Q86 U;  1VQ8 T;  4E47 A;  4PJO E;  3CXC A;  2JTF A;  4QQG A;  2QEX A;  1I81 A;  2JOY A;  1PSF A;  3VV0 A;  2KDS A;  2EJG A;  4MMK A;  4J5Y A;  4XTX A;  5LJ3 d;  5GMK i;  2FHD A;  2WSE E;  1PSE A;  4MZT A;  2LQK A;  4A4G A;  4EPC A;  4E7K A;  1NPR A;  1VQN T;  4PL6 A;  3OS1 A;  3VYG A;  3QXE B;  5CQY A;  3L1A A;  2RI5 A;  3OMC A;  4M7A E;  3MO8 A;  2K5I A;  2QQA A;  1X6O A;  4DOW A;  1QVF S;  3S3M A;  3KBG A;  4HCC A;  4C92 B;  5HKC A;  3I55 T;  3MEA A;  3JB9 G;  3I55 A;  2VUB A;  3CBP A;  2CKK A;  2F5K A;  3FIF A;  3HRT A;  4E7J A;  5J39 A;  3CCE T;  3QZ9 B;  5KCH A;  3QSU A;  1JB0 E;  2MWP A;  4M75 G;  4OMF B;  3QKJ A;  1YJ9 A;  3CCL T;  1VQN A;  4Y28 E;  1YI2 A;  3VJP A;  1S72 T;  4XAX B;  1S72 A;  5DY9 A;  2XDB A;  3LWH A;  1WPY A;  2RJD A;  3CD6 T;  3JCM W;  2LC4 A;  3OYN A;  1VQO T;  3JB9 D;  1XQH A;  4OB0 B;  3MET A;  4JS4 A;  5GAN 7;  2O01 E;  2I2L A;  3SDZ A;  5KH6 A;  1YJN A;  2MI6 A;  2RH2 A;  2PVG B;  4C0D C;  2DPP B;  2IG0 A;  1VIF A;  4FT4 A;  3OYH A;  4O5V A;  4M7A D;  3QJ6 A;  4TVR A;  4HT8 A;  3M59 A;  2RJE A;  4OVA A;  4YTL A;  3M57 A;  3CME T;  2EAY A;  5GAN j;  4OF1 A;  1VQP T;  3DKM A;  1QP2 A;  1U1S A;  2DTH A;  1NJI U;  3JCM Q;  3HRU A;  1K73 C;  4ME7 A;  5L8R E;  3J80 E;  5FRO A;  3PGG A;  4M77 F;  1VQL A;  3QUI A;  5CKB A;  5GMK l;  1NJI C;  4PNO A;  4M7A F;  4M75 F;  2ZPH B;  3CMA A;  4PKC C;  2WSC E;  4BE1 A;  2BIV A;  1QVP A;  2K3X A;  2QQB A;  3V8K A;  1VQ5 T;  2DVE A;  3L2Q A;  1G5V A;  4C92 D;  4M7D D;  4BI3 A;  3E9G A;  1BIB A;  5GAN 4;  3CCU T;  1AHJ B;  2M16 A;  4NL2 A;  1VQ4 A;  3CCL A;  2X4W A;  2CZ0 B;  3EFS A;  4FSX A;  3A8G B;  4FT2 A;  4XQ3 A;  4CRI A;  4ZGJ B;  3WXM B;  5DM7 R;  1NZ9 A;  2RHY A;  2BUD A;  1XTD A;  2RI3 A;  3L42 A;  3M4G A;  4B9X A;  3CXC S;  1Y7X A;  2EQJ A;  1K8A C;  2E1H A;  4JRQ A;  4V2S A;  2MAM A;  4O6J A;  3OA6 A;  2V8J A;  5FU7 B;  2B8A A;  3TRE A;  3DB3 A;  3OMG A;  4JUV A;  3RMS A;  1BI1 A;  2JZ2 A;  4J6Y A;  4XU0 A;  1BI2 A;  2RK2 A;  1VQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...