3VYGA

Crystal structure of thiocyanate hydrolase mutant r136w
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
b'KPVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase subunit alpha
molecule tags Hydrolase
source organism Thiobacillus thioparus
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
total genus 26
structure length 120
sequence length 120
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vygA00
2DD4A 4Y28E 2PUKB 4FM4B 1JB0E 4RKUE 1V29B 2CZ1B 3VYGA 3A8GB 3QYGB 1GXIE 3VYHB 2PVDB 4KT0E 1QP2A 1PSFA 2CZ0B 2DD5A 3HHTB 2CYZB 2O01E 2ZPFB 2WSFE 2PVOB 3A8LB 3X24B 3QYHB 3X28B 2CZ6B 4ZGDB 1UGQB 2ZPHB 3WVDB 4OB2B 4XK8E 1UGRB 2PU9B 4ZGJB 4OB3B 2WSCE 2ZCFB 2ZPBB 1QP3A 2ZPIB 3A8HB 3QZ5B 3QXEB 3QZ9B 2ZPGB 2AHJB 1PSEA 3A8MB 4OB1B 2ZZDA 4ZGEB 1UGSB 1DJ7B 4L6V5 2PUOB 2CZ7B 1AHJB 2DPPB 2PVGB 2D0QB 2WSEE 2ZPEB 1IREB 3A8OB 4OB0B 5L8RE 2DXBA 3X20B 3X25B 2DXCA 3X26B 3LW5E 3WVEB 1UGPB 2QDYB
chains in the Genus database with same CATH superfamily
3PTAA 4M78E 1MV3A 2G6FX 2A28A 2QQ9A 2GGRA 1G2BA 1D09B 3V7SA 1VQ6A 2DKGA 3EAEA 2IVWA 3I56Q 2J6FA 2W0ZA 4F7UA 3GIBA 1PKSA 1TSFA 2E4HA 2RQVA 1MMGA 2DXBA 2FZGB 5I11A 2KY9A 1YBYA 3EGXB 2KXCA 3EGDB 3GP8A 2XHCA 5IHKA 4ATOA 4HT8A 1EZZB 3EGXA 3G1JA 4QVDA 4C0FA 5I22A 3H9NA 2LJ0A 2YXYA 1I07A 2QA4A 1QQJA 4HA8A 2HDAA 2F2WA 3UATA 3MJXA 3VS7A 4WCIA 3SFMA 4E6RA 4IUTA 2OX7A 2RD1A 4D8DA 1BI3A 2AKKA 2FL7A 2RQRA 4MZMA 4IKFA 1UG1A 2BZ8A 4DBFA 3NTKA 1HYOA 2HMAA 4X34A 1U8RA 1IREB 2EYXA 2RNAA 2MI6A 2H8HA 5FWCA 1SG5A 4OMOA 3GPLA 3MP8A 4AFUC 3KUFA 2BE9B 3ULRB 1V29B 1M1KU 1QVPA 2ROLA 5CR2A 4TVRA 3CCJT 3CCQA 3JCMf 1J3TA 2QYZA 2RF0A 4HT9A 4M7DG 1TTHB 2HZYA 1JJ2P 5J26A 2HBWA 1CKAA 5HK0A 2EGEA 1HJDA 1WI7A 4DBRA 2CUBA 4KH1B 2LCLA 4MZPA 4Y28E 4RKUE 3JCMQ 3A8GB 1Q81R 3CEYA 3QJ6A 1PC0A 2E3HA 4XTWA 1KFZA 1UE9A 3ZEHA 1VQ8Q 2J05A 3CCVT 2L0AA 3BDLA 4Q5WA 3EFOB 9ATCB 4IIOA 1I0CA 2HEQA 3I55T 1QKWA 1WA7A 5KE3A 2HQEA 4C5HA 2RHUA 3JCMX 3D7SB 4DOVA 3QKJA 3L1AA 3JSCA 3QG1A 5KE2A 3H8ZA 1FXXA 1RI0A 4M75C 1KQSS 2KE9A 3MPUB 2PZ1A 4QQ6A 2F2XA 5CAIA 3CCVA 3I56T 4M78A 2LX9A 2DZCA 1VQ9A 1N9RA 1K9MU 4MZTA 3OYKA 4CRIA 2J6KA 1OOTA 2JOYA 4JRPA 4HCCA 1QVGS 5KYXB 4OMPA 1WXTA 2XDDA 1JJ2S 3SB2A 2B86A 3DB4A 3JCMV 2JTFA 1RI9A 1YJ9Q 3RKXA 5IHIA 1EIFA 4J9GA 3BY7A 3J7AF 4OB1B 2XD0A 1VYTA 2F2VA 2EAYA 1SSFA 4EIKA 1K4US 2G3RA 2RJEA 3LYIA 5KYUB 1Q95G 1RL2A 4ZN3A 4C8QE 3RNJA 3LH0A 4HVVA 2V1RA 3OYDA 5A0GA 1W70A 2K79A 5FU7C 4FT4A 4LDYA 1Q82U 2E5KA 3OSVA 2M0OA 5AT1B 2L3PA 5GANf 1JO8A 4C8QB 3X26B 1OPKA 2PTKA 4PFPA 4C92A 4MMKA 1ARKA 2E64A 3G4ST 2K2MA 3M55A 2X4XA 1S72Q 1NEGA 1F1BB 1Y07A 2DJZA 1KK7A 2FRWA 2GQIA 5CQXA 2KMTA 2LTOA 3GF5A 2L8DA 2KI7A 1VUBA 3OYBA 4OMFB 2JUFA 4RTWA 4M7AC 3VS0A 1X27A 1PWTA 4AT1B 5FU6C 3CC4T 1Y96A 4F7UB 1XNIA 4BY6B 3JCMb 4A4GA 2DL5A 2DTHA 3LGLA 1ZLMA 2CP5A 4PLLA 1OU9A 2CH4A 3CC7T 4KUIA 1OZ3A 3EGDA 1ZBXA 1MMAA 4O6JA 4M7AF 1W4SA 2ROTA 4M77F 4CC7A 3JB9F 1N8RU 4OP0A 4X1VA 1UTIA 3PVQA 3LWIA 1FMVA 4PJOF 1VQKQ 1JJ2A 4BDZA 3J81E 1G5VA 3QUIA 2A0FB 4LXCA 1BKBA 4E7ZA 1OYXA 3PFSA 4M77E 2HQHA 2ZZDA 1RLPC 1O9SA 1WXBA 4RTYA 2JVVA 5LJ3d 2NWMA 2YUPA 3L2UA 2AK5A 4B9XA 4PFZA 1PHTA 1WPYA 2F5KA 2FO0A 2COYA 3M4GA 2ZGWA 1KQSA 2VXFA 2EW3A 3CCEA 2AKLA 1UGSB 5IT9E 4PJJA 1K73U 5IXBA 1YI2T 2YDLA 3EG2A 4KGZB 3VJPA 1YIJQ 4KGVB 4JUVA 3REBB 4M78D 2KSSA 1IO6A 3HP9A 2I0NA 2CZ0B 1FWZA 4BE1A 1VQNT 2HNIA 3URGA 4C92E 1QWEA 1QWFA 4PJLA 2LQWA 3FRNA 3CD6T 1TXQA 3LH5A 2LC4A 1WFWA 2FHDA 5C6SA 2E3IA 3JAME 3FIFA 4J83A 3RIRA 4DEYA 1NJIU 4LD6A 2RA2A 2RK2A 3VYGA 3M4YA 1M3CA 4QQDA 4RTVA 3JCMJ 3A8LB 1KD1R 4CC4B 3G71T 1NEBA 4D8KA 4XQ3A 2ZPBB 2ZPIB 2NUTA 3RESA 3RUXA 4PJOG 1H8KA 3VS4A 1U5SA 1G3SA 3M56A 1AEYA 1WHGA 1Z9ZA 3OS1A 2C0IA 4FYXB 3CC2T 3M0QA 5FWBA 1JQQA 2C0TA 4FU6A 5GANj 2ZPFB 5LJ3e 2CH4W 4ELYC 5LJ3h 2OTJA 4K11A 1QP3A 1I1JA 3S3MA 2DO3A 3CMAT 2D0QB 2VASA 4M7DC 3EHQA 3OMCA 1G8XA 3RMQA 2CDTA 4OMQA 2YRDA 5GANd 4PJNA 4NS5A 2HKQB 3CMAA 6AT1B 2X51A 3R6OA 1VQ9T 1X01A 1ZSZC 2CYZB 4KGXB 3M0PA 1E7OA 3PIPA 2CZ6B 5DLQE 1UGRB 4EMKA 1BI2A 4AG1C 2CP6A 5D6YA 2HAXA 3E9FA 1D0XA 2LQNA 2P0KA 2R5AA 5DLOA 4M7DF 2WACA 2J7IA 1TWBA 2SRCA 5GAOq 4E7KA 2RHZA 1BBZA 4PLIA 1U06A 2DYBA 1SF9A 3VKIA 1IRXA 3C12A 4FM4B 4EDUA 3OYJA 2PVOB 3OA6A 2EKHA 1X2KA 2VWFA 4JJCA 2PVGB 1VQLT 1VQOA 1UJ0A 3M57A 4XU1A 4J8OA 3EFSA 2JZ2A 1JBMA 1K0XA 2O4XA 1W2BS 2X4WA 3ER0A 1NBEB 3CD6A 1PCXA 1IGQA 1NPPA 3TEEA 3X24B 4N0AC 4XK8E 5FLXE 3WXMB 2QQBA 4IUUA 3LLRA 2M16A 4ZGJB 2DYIA 2ENMA 3TREA 5GAN6 4KH0B 1KC8C 2K2VA 4C8QD 4EMHA 5CQYA 5CKEA 3SEMA 3VS3A 1IB8A 2VGMA 2QDLA 3QYHB 2L3SA 3EH1A 2ECZA 2QXFA 4PFOA 2M1HA 1S1NA 4L6V5 2BE7D 1UEBA 4EMKC 5LJ3j 2FG0A 4OVAA 2VUBA 3JCMc 1UECA 4BE2A 4HVUA 1M27C 2LNHB 1JEGA 2F5TX 4DBQA 1QVFS 1Q82R 1M2VA 1MUZA 4JLIA 2WSCE 4M7AD 3THKA 2PNIA 1PSEA 4C0ZA 3L2QA 3F70A 3M0UA 2DETA 2AZVA 1PD1A 4BY6C 1OPLA 1U3OA 1ABQA 1BIAA 4GLMA 3RERA 2A7YA 2DL3A 2JTEA 1U1TA 5L23A 5KH6A 2BTTA 4EPCA 4OGEA 5GMKe 2EYWA 2D8JA 2DVJA 2LT1A 2DEQA 3TSWA 3G4SA 2ED0A 1M9SA 2KXDA 5I2MA 3WVEB 3NTHA 1YITA 1MV0B 5ECAA 2A08A 1ZUKA 2DZ9A 4AFSC 1KC8R 1YJ9T 2V1QA 1YIJT 1VIEA 1S72A 4AFZC 1D1CA 1K8AU 3VS2A 3CCVQ 1VQMQ 4LUDA 2JXBA 1D1BA 2LMJA 4FW1A 2COWA 3MHXA 3I55Q 3CMET 2NUTB 2JT4A 4M77G 2DEUA 3L2RA 2CGHA 3S3NA 5D6WA 4F7UG 2LVMA 3TSZA 1QCNA 1PM3A 2KVQG 3OYMA 3PVLA 1NLOC 1AZGB 1K0SA 1ZQ1A 3C94A 3QPHA 4NOYA 3S6WA 2YT6A 1UUEA 1GRIA 3CCUQ 1MMNA 2I2LA 1D0YA 2FPFA 4AFQC 1NJIR 2LJ3A 2K3BA 1MHNA 4XTZA 1MGQA 2OTJQ 3ASKA 5KYUA 1E6HA 3TQ7P 4LDUA 5HCKA 2QQRA 3CC4Q 5CO7A 4QVCA 4XU3A 1SSHA 4DA4A 2DIGA 1YITQ 4CC2A 3JCMd 3CMAQ 4L5GA 2OAUA 2RN8A 2QDYB 1E6GA 4M7DB 4M75B 1Q81U 3QHSA 3OW2S 2K5IA 4II1A 1H3HA 2DD5A 5C0MA 1IHWA 4IURA 3ZL7C 1Y96B 4VUBA 4XU2A 4J7FA 2PQWA 4F7UF 4ZGEB 1WJRA 4R56A 2EQKA 1K9AA 3GNFB 5IXFA 3M59A 2DK3A 3INZA 4PJOC 2DA9A 4BE0A 2EGCA 2DE0X 2RJDA 5GAMh 1IGUA 3M9QA 5GJVB 1YI2A 3DB3A 1VQPA 2RHYA 4RTUA 2MWOA 4M77D 2CSQA 4FYYB 2QAZA 3E1SA 4PJOD 5LJ5h 2IIMA 4JZ4A 1BCMA 2IG0A 5GAN2 2PVDB 3PT9A 3EG9B 4J9EA 3MEWA 4HVWA 4J9CA 1UJYA 3JCMh 3HPWA 1K1ZA 2GFUA 4OMMA 4A53A 1GFDA 1R8OB 1NM7A 3SWNC 1FYNA 3META 5GAOl 3CCET 3P8DA 5GAMj 3S3OA 2ED1A 1RABB 3J80E 4Z8AA 4ESRA 5CKHA 3HFNA 1ZA1B 3M5AA 1VYUA 2GQVA 2NUPA 2DL4A 2P4RA 3SHWA 1YJNQ 5FROA 3BDUA 2NUZA 1M1FA 1WGSA 2VKNA 4F16A 2JS2A 1GCQC 1N27A 3X25B 2QA4Q 4M7DE 4M75E 3PGGA 1W6XA 1SHGA 2QEXQ 1K76A 4X9CA 3JB9D 3L2VA 4QVZA 3A98A 2DXTA 5GAOp 4N4HA 1RLQC 1KQSP 3A8HB 1Y7XA 1I5OB 1TUDA 4ZTFA 4XTUA 4BB7A 2P84A 4ME7A 2KROA 3EFOA 5CIUA 3RKYA 4XU0A 2CP2A 2H3JA 3VS5A 1JB0E 3H6ZA 4A54A 4C92F 2O31A 3IQLA 1VQ7Q 4C8QG 1OX9A 1Y57A 4O5VA 1OEBA 2DNUA 4Z88A 2CP0A 4BDYA 3PMTA 1RAIB 2JN0A 2YSQA 2CT3A 1WJSA 1VQ5A 2DVEA 2VVKA 1RAEB 1OI1A 2K3XA 2GTJA 1WYXA 1KD1U 1TUGB 2LP5A 2QK0A 4Z02A 3G7ZA 1X2QA 4C92C 1H3ZA 2DILA 2BUDA 1M3BA 1X6BA 3QDRB 3CXCA 2CSIA 4RTZA 1M8VA 4JRIA 2V8JA 2CP3A 2A3LA 5GAN8 2YLCA 1I8FA 4RTTA 3EGUA 2FYKA 5GMKi 4FYVB 2RQWA 4EMGA 1X6OA 1PSFA 3QDFA 4N4GA 1D1AA 4MDWA 1N5ZA 1ZUYA 2MPXC 1RAAB 4JJBA 1AZEA 2OJ2A 2OTLA 3M0RA 4IUVA 2KK4A 1ZSGA 5GAMg 5IH2A 4HCKA 4X9DA 2COZA 1UB4A 2KQWA 3P8HA 2GCXA 4JRQA 1TUCA 1QVFA 4C8QA 3CQTA 2FZKB 1VQ7T 2LDMA 4C92B 1NYGA 2RI2A 4DBHA 1YWPA 1R0BG 4M75A 1P92A 2M0YA 2J6OA 3G6EQ 3RBBB 1VQ6Q 3ZFJA 1N6AA 2KGTA 4IUQA 2OTJT 1WQ7A 1OULA 4KULA 5GAN7 3I56A 2KNBB 1VQKT 1ZX6A 2RPNA 2OAWA 1IXDA 2E12A 1G3TA 4J6WA 2X35A 2EQUA 4XTVA 4E7HA 3MEVA 2LQ8A 2IPOB 3VS1A 2O4XB 2DTIA 1AVZC 4M7AA 4LUEA 5KCOA 1QVGP 1YCSB 4MDXA 2KRMA 3MEAA 2X9HA 1RUWA 3NPFA 1LOJA 4LDWA 3CXCS 3KXTA 2DAQA 5GAN3 2A36A 3CC2A 1V76A 1GL5A 2OI3A 4A63B 2EQMA 2JS0A 3HTRA 1H92A 4FSSA 1ZUUA 3FDRA 3PMIA 4OB3B 1SKUB 4RTXA 1NLPC 2MWPA 1AWOA 3FJ5A 2R5MA 3Q1JA 1OV3A 5L8RE 2QGGA 1VQMA 1MNEA 2E70A 2DXCA 4FCYA 2MMPA 1GBQA 3FB9A 5D7UA 4M75G 2QEXA 1RACB 4OGCA 1SRMA 3QO3A 3DKMA 1LNXA 3G6EA 1YNZA 4M75D 1QVFP 1QKXA 3FEOA 2QI2A 4C8QF 2JW4A 1T3SA 2LCSA 5GAN4 2JNGA 1T3LA 1C0MA 2KDSA 3E9GA 3GNGA 1A0NB 3OYGA 5GAOm 4RG8A 3SDZA 1KD1C 2QG9B 2E6NA 3QBYA 1HSQA 1VQ8A 3QWXX 2D9TA 1LVKA 1CSKA 3EH2A 1Q7YR 1BB9A 4P5NA 1PKTA 3JB9J 1JXMA 3MP6A 1WQWA 3M53A 1X69A 2DERA 1VQ5T 1ZA2B 2RQTA 2LJ1A 5GAMe 3CC2Q 3CPFA 3H0FA 4KRTA 1Q7YC 4PK4A 3GOXA 3T9NA 3GBQA 1XQHA 1B7TA 3L2WA 3JCMP 2QASA 1YFNA 1PG5B 5DM7R 4R0KA 5GMKj 3L2ZA 3VU3C 2XG8D 2EGAA 2FPEA 4M75F 2EQIA 4JJNK 3BFMA 4J5YA 2DTOA 3QSUA 1BU1A 2JTMA 5D6XA 1M90U 1K8AC 3L42A 1ZBJA 5M9OA 5KYXA 1I5LA 3P8BB 2HBPA 4BUGA 2K3YA 1WX6A 2DF6A 4J7IA 1VQ9Q 2DMOA 4Z89A 1M30A 5CK9A 2ATCB 1NJIC 1QMCA 3CBOA 5KYYB 2XDBA 1K8AR 2PU9B 2EJFA 2K5FA 3R6NA 2EBPA 2EPDA 4J9HA 4E2FB 1YI2Q 3QXEB 5LJ5f 4V2SA 5KYYA 1NPRA 5LJ5g 4B6MA 2OTLQ 1Z9QA 1YHQQ 4AMCA 4PJMA 5IN1A 2MOXA 2RI5A 1VQ8T 3GLXA 1WDXA 1PRLC 3SWNB 5GANg 3FC3A 2L89A 2QTXA 1NG2A 3OYEA 4OF1A 3KBGA 3UWNA 4PJOB 4XAXB 2LT4A 3OS5A 3QWYA 4M7DA 3UA7A 5FU6B 3X20B 4M77B 3RR6A 4PJOA 1GFCA 5KCHA 1VQOT 3ZBDA 3QYGB 1UHCA 1JU5C 2VV5A 1D3BB 5GMKh 4F04B 2BIVA 1ABOA 5GAOn 1BCOA 3JB9G 2ZCFB 5DY9A 4RUGA 1VQ4Q 3CCLA 2LNVA 4C8QC 2DFUA 3REAB 2RJCA 1Q86C 3HSBA 2C06A 3JV3A 3CPWA 1FX7A 2DXUA 1TU0B 2V26A 1QW1A 2FPDA 2KRSA 2XKOC 2P0QA 1KC8U 4KUDK 1G3YA 2E5QA 3TU4K 1N8RC 4IIMA 2H3EB 5GANh 2HSEB 2SEMA 5FW9A 1B34B 2RMOA 3EG1A 3OS0A 1YHQT 3EG0A 1DJ7B 5CCAA 2YUNA 3CBMA 1M3AA 2FVUA 1UGPB 1BK2A 1BIBA 4JDSA 1YJNT 3PE0A 2MYSA 2K9GA 2RQUA 4J9BA 2QQSA 1SHFA 3OYHA 4JS4A 2HKNA 3QIIA 2LCCA 3HRUA 3A8MB 3JCMg 3VRYA 5FU7B 1GXIE 2D0NA 1KHCA 4A4HA 2DD4A 2D1XA 2EVRA 4DEXA 2FZCB 4E7IA 4LD9K 5J3BA 2V8IA 2JMAA 1PRMC 4PL6A 4Y92A 2O9SA 4N4IA 3OMGA 1EFNA 1N9SA 4FL6A 5IHNA 3CCJA 3CCQT 1WHJA 3NGPA 5GJWB 3E19A 5KYWB 4CC3A 2F69A 2HSPA 4CI0C 1PNJA 3CCSQ 2KBTA 1XJWB 3OYFA 3CC7Q 3VUBA 3OYNA 4M78F 2AIRB 5KYWA 3HHTB 3JRZA 2CT4A 2F1LA 4J9DA 3X28B 1YJ9A 2FRYA 3V8LA 1YJWT 2XDPA 1VOMA 3UA6A 5GAMf 4XTXA 2P4TA 1WHLA 1NE8A 1X43A 4RG2A 3DLMA 3MKDA 2KYMA 3CCMA 3HRSA 3SD4A 2CUDA 2RM4A 2YRVA 2LQKA 1LPLA 2CZ1B 1K9MR 3V7RA 2LRQA 1M1KR 3HFOA 4M7DD 1S72T 1TH7A 2X4YA 2X3WD 2AHJB 3VRZA 1I4K1 3LGFA 5LJ5j 3U23A 2M51A 5EG2A 1SEMA 3LX7A 1VQ5Q 1B07A 2DRKA 2MAMA 1VQ4T 2CKKA 4OMLA 2A37A 3CBPA 1XTDA 1OX8A 2ABLA 2GTOA 4L59A 1M5Q1 2MF2A 3OSSC 2O01E 3NTIA 2RO0A 2O2OA 2XI9A 2JM8A 4KBMB 1K73C 4UC4A 3NFCA 3H0HA 1GBRA 1HXDA 1QVGA 4ANJA 3CCST 4FSXA 3CCSA 2E6ZA 4J9FA 4HXJA 2R58A 1QCOA 1TOVA 2Y4YA 4EMKB 1VQNQ 2KYBA 1OZ2A 2MIOA 2LZ6B 3VYHB 4KT0E 1MMDA 4LNPA 2XMFA 4PNOA 2ZAEA 3SWNA 2GBQA 4XTYA 3C4SA 3VUZA 2GF7A 1M90R 4C92D 4LDXA 3CCLQ 1VQ4A 1M8MA 1D3BA 2KT1A 3OS2A 1WHHA 1PD0A 3G71Q 4FT2A 2FEIA 4M77A 3BW1A 4F17A 2M9UA 1U1SA 1G83A 2YUQA 5GAN5 1VQPT 4QT7A 1I81A 1VQLA 4ORZA 3CXCP 2EYYA 3ME9A 4B9WA 3EFRA 4J9IA 2D6FA 3PNWC 1N8RR 4ZGDB 3CCUA 1AWXA 2HL3A 1ZSZB 2HQXA 2CP7A 1QP2A 1HD3A 1WNLA 2L3QA 3CCRT 4ZNXA 3EHRA 5FRMA 1C1AA 1Q86U 3CCEQ 4DQ2A 3QZ5B 4PKCC 2YLBA 2W10A 1YJWQ 3M54A 3G6ET 2EFIA 4M7AB 4JRKA 1AWWA 4MMLA 2J06A 4IUPA 1XOVA 4HCBA 4JZ3A 1W1FA 1TG0A 3MO8A 2YHTA 4C0DB 2HCKA 1WHKA 1OQKA 1YN8A 5LL6S 3MCAB 2L2PA 1W2BA 2CS7A 2M02A 1R0CB 1IHVA 1QCFA 5HK3A 3M0TA 3QJYA 1KG1A 2DL7A 2WSEE 2ZPEB 1UFFA 2EJ9A 5GAMd 1X75C 2X3XD 3M58A 5CKDA 3G71A 5FRNA 1FMKA 5EC7A 1AWJA 3E2UA 4E7LA 2BZXA 2BZYA 1VIFA 4C5EA 1RADB 1C6VX 1KQ1A 2B8AA 2NLUA 1VQLQ 1G3WA 1YWOA 2RHXA 4M77C 2DL8A 2VB6A 1R77A 5A0DA 2E41A 2K5LA 4E7JA 1B3QA 1BI0A 2VC8A 1CKBA 2R57A 2QTVA 2L5QA 5I21A 4HKEA 2L3RA 1JRIA 3CCUT 4GLKA 3PIOA 1IZ6A 2KRNA 3NHNA 2K57A 1BI1A 3FJPA 2VXEA 2HL5C 1WZOA 3CCJQ 3QZ9B 3H41A 3I5SA 4OB0B 4F7UE 2AZSA 1AT1B 4BI4A 1RAHB 2DX1A 4WF2A 1KIKA 4R55A 3CCLT 2D8HA 2CREA 2MK5A 3V7CA 1YITT 5HKCA 3HKSA 3AT1B 4NL2A 2XU8A 1Q7YU 4RCBA 3UPUA 4M78B 8AT1B 5GMKl 1M90C 2OTLT 2E1HA 4J6XA 4AG2C 2BKDN 4M7AE 4A4EA 4C0GA 4E7SA 1W2BP 3RKWA 4LDVA 4BACA 1UHFA 1YIJA 2QGFB 1X6GA 4FYWB 4FW2A 2FB7A 3WVDB 2EQJA 5GMKm 1YP5A 3JB9I 1HK9A 3HL8A 3DLLA 5J39A 1H641 3CCRQ 1T0HA 5AYFA 5LJ5e 1VQOQ 2EYZA 3A8OB 2KR3A 2GNCA 4C5IA 3OB9A 1GCQA 3MP1A 2GFAA 2MCNA 2QQAA 4J6YA 1UGVA 3C0CA 3LWHA 5GANe 4OMNA 1VQ6T 1LJOA 1AOJA 2DLPA 3CPWP 1EX4A 3CC4A 2DBKA 2P0PA 2YWWA 2DBMA 4JPBW 3OYYA 3VS6A 3AHUA 1YCYA 4JLGA 2PUOB 1K73R 5LJ3g 4BD3A 1SRLA 3OY9A 5LJ3f 3JCMW 1M1KC 3RDVA 3I9QA 5CKFA 2WSFE 1NZ9A 4QQGA 3OQ5A 5CKBA 4M78G 4RMOA 2Y4XA 3C95A 2RHIA 2Z0WA 4LE9A 4GY5A 4JJDA 3V8JA 3A1PA 1V1CA 3OYLA 4N0AA 2CZ7B 1KSWA 2DPPB 1WIEA 5I2SA 1YJWA 4C0DC 2YRCA 1ZSZA 5A2QE 3OBWA 1O75A 4M78C 2KAFA 3I5RA 2DIQA 3CC7A 3RMSA 2DJQA 2QEXT 2RJFA 2JM9A 3OBYA 4RCCA 3OW2P 2LX7A 1SPKA 2JJ9A 5HY6A 1M1GA 1LCKA 1AHJB 3UDCA 3CCMT 1UDLA 3OW2A 4YTLA 4DOWA 1KHIA 1B34A 2E65A 5A0LA 1ACMB 3EG3A 3HRTA 3A5ZB 2XICA 1T0JA 3TCJA 5CVIA 1JXOA 3CCQQ 4GBQA 1Y71A 2XIDA 3EG9A 1M4ZA 2EIFA 2NUPB 1VQMT 1Q81C 1AD5A 1M2VB 2RI3A 1Q82C 2PUKB 1BYMA 2ESWA 3O5ZA 3CMEQ 1YJNA 3TVTA 4M4ZA 3CD6Q 2KEAA 2EKOA 1M2OA 2HD0A 3MEUA 5GAOr 2XK0A 1VYVA 3I55A 3UT1A 1WLPB 2C0OA 3JCMe 1RAGB 3CPWS 4C92G 3JB9H 4LN2A 2RH2A 1GCPA 2K6DA 4C5GA 1Y0MA 1K9MC 4A4KA 1UGQB 4JS5A 2EJGA 3CCMQ 2YUOA 8ATCB 2E10A 1WJQA 1YHQA 4D6WA 4ZTJA 1VQKA 4QW2A 3FLGA 2DRMA 3OYAA 2V8KA 4M7AG 4OB2B 4PJOE 5IAYA 1D0ZA 3M0SA 1Q86R 1VQ7A 4WTOB 4FIBA 1NYFA 3CCRA 2O88A 2RB6A 3O8VA 4BI3A 2DM1A 3CMEA 2Y90A 4HCZA 3I35A 3KFVA 4E47A 3N5BB 2K7AA 2X4JA 4Y91A 5KYNA 4NL3A 2VYTA 4F14A 2AT1B 7AT1B 2QA4T 1RAFB 1QLYA 3V8KA 1KQ2A 2VGNA 3G4SQ 3OYIA 1WXUA 1TS9A 3LW5E 1VQNA 2EYQA 1KJWA 2K4YA 2O9VA 1WHMA 3BE3A 4A4FA 3H0IA 2NYSA 3UF4A 2RK1A 2ZPHB 1VQPQ 3VV0A 2EWNA 4BI8B 2KT8A 1FMWA 4ELZC 5LJ5d 3NMZC 2ZPGB 1MNDA 1OU8A 2JMCA 3OYCA 4ZN1A 1VA7A 1ZHIA 4QKUA
chains in the Genus database with same CATH topology
3PTAA 4FM4B 3C12A 4EDUA 1QVFA 4FT2A 4M78E 4C8QA 3OYJA 1VQ7T 2QQ9A 2LDMA 4C92B 4M77A 2PVOB 3BW1A 2RI2A 3OA6A 3V7SA 2M9UA 2DKGA 1U1SA 1VQ6A 3EAEA 1P92A 4M75A 2IVWA 3ZFJA 1N6AA 4IUQA 4F7UA 5GAN5 1WQ7A 2OTJT 4KULA 5GAN7 3I56A 1VQPT 1I81A 1VQLA 3GIBA 2PVGB 1VQLT 1VQKT 3ME9A 2DXBA 4B9WA 3EFRA 1VQOA 2D6FA 2KY9A 4XU1A 3M57A 3PNWC 4J8OA 4ZGDB 1YBYA 2E12A 3EFSA 2JZ2A 1JBMA 1G3TA 3CCUA 2O4XA 4J6WA 1W2BS 2X4WA 3ER0A 3GP8A 2X35A 2XHCA 3CD6A 2HQXA 1QP2A 1NPPA 1WNLA 2EQUA 4XTVA 3TEEA 3X24B 4E7HA 3MEVA 4ATOA 3CCRT 4HT8A 4N0AC 2LQ8A 5FRMA 4XK8E 2O4XB 2DTIA 5FLXE 3WXMB 2QQBA 1Q86U 4IUUA 4DQ2A 4QVDA 5KCOA 4M7AA 3QZ5B 4PKCC 4C0FA 2YLBA 3LLRA 4MDXA 3M54A 2QA4A 3MEAA 3G6ET 4HA8A 2M16A 4ZGJB 1LOJA 4LDWA 3CXCS 2EFIA 4M7AB 3TREA 3KXTA 4JRKA 4MMLA 5GAN6 2DAQA 5GAN3 1KC8C 4IUPA 1XOVA 4HCBA 2K2VA 3CC2A 3SFMA 3MO8A 4IUTA 2YHTA 4C0DB 4C8QD 5CQYA 4EMHA 5CKEA 2EQMA 2RD1A 2VGMA 1BI3A 5LL6S 3FDRA 3QYHB 3MCAB 1W2BA 2FL7A 3PMIA 4MZMA 2CS7A 4OB3B 2QXFA 4IKFA 2MWPA 3NTKA 5HK3A 2R5MA 4X34A 2M1HA 3Q1JA 3QJYA 4L6V5 1U8RA 1KG1A 2WSEE 1UEBA 5L8RE 2ZPEB 1IREB 2EJ9A 1VQMA 5GAMd 2E70A 4EMKC 2DXCA 2MI6A 1X75C 5LJ3j 3M58A 2MMPA 4OVAA 2VUBA 5CKDA 3G71A 5FRNA 3JCMc 3GPLA 3MP8A 4BE2A 3KUFA 3FB9A 4E7LA 1V29B 4M75G 1M1KU 1QVPA 1VIFA 4C5EA 5CR2A 4M7DF 2QEXA 4OGCA 4TVRA 2F5TX 3CCJT 3CCQA 3QO3A 3DKMA 1LNXA 3JCMf 3G6EA 1QVFS 4JLIA 4M75D 1KQ1A 2WSCE 4M7AD 2B8AA 2NLUA 4HT9A 4M7DG 3FEOA 1G3WA 1PSEA 2RHXA 4C0ZA 2QI2A 4M77C 3L2QA 3F70A 4C8QF 5J26A 5GAN4 5HK0A 2JNGA 4BY6C 5A0DA 2KDSA 3E9GA 2E41A 3GNGA 2K5LA 4E7JA 1BI0A 3OYGA 5GAOm 4RG8A 2LCLA 2VC8A 2R57A 4MZPA 4Y28E 3SDZA 4RKUE 2L5QA 5I21A 1KD1C 1BIAA 2L3RA 1JRIA 3A8GB 4HKEA 2E6NA 3CEYA 3JCMQ 3CCUT 3QJ6A 3QBYA 3RERA 2A7YA 1VQ8A 4GLKA 4XTWA 1U1TA 3PIOA 2D9TA 3ZEHA 1IZ6A 5KH6A 3CCVT 4P5NA 4EPCA 2K57A 1BI1A 3BDLA 3FJPA 4OGEA 2VXEA 4Q5WA 5GMKe 3JB9J 2LT1A 3MP6A 2DEQA 3QZ9B 3I55T 1WQWA 3M53A 3G4SA 1VQ5T 1M9SA 4OB0B 5I2MA 4F7UE 5KE3A 2HQEA 4C5HA 2RHUA 3JCMX 4BI4A 5GAMe 3WVEB 3CPFA 3NTHA 1YITA 4WF2A 4DOVA 1Q7YC 4R55A 3CCLT 3GOXA 3T9NA 3QKJA 3V7CA 1YITT 2DZ9A 3L1AA 3HKSA 1XQHA 5HKCA 3JSCA 1YJ9T 3QG1A 4NL2A 1YIJT 5KE2A 1VIEA 1S72A 2XU8A 3H8ZA 3L2WA 1Q7YU 3JCMP 1FXXA 1RI0A 4RCBA 3UPUA 4M75C 4M78B 5GMKl 5DM7R 1K8AU 1KQSS 5GMKj 1M90C 3L2ZA 3VU3C 2OTLT 2XG8D 4JJNK 4M75F 2E1HA 3BFMA 4QQ6A 4J6XA 2DTOA 4J5YA 3QSUA 2JTMA 2BKDN 5D6XA 1M90U 5CAIA 1K8AC 4A4EA 4M7AE 3L42A 4C0GA 3CCVA 3I56T 3RKWA 4M78A 2LX9A 5M9OA 3MHXA 2DZCA 1I5LA 1VQ9A 4LDVA 3P8BB 2HBPA 1N9RA 3CMET 4M77G 4BUGA 2K3YA 4J7IA 1K9MU 4MZTA 3L2RA 4BACA 3OYKA 4CRIA 2JOYA 1YIJA 2CGHA 4JRPA 5CK9A 3S3NA 4HCCA 1QVGS 1NJIC 5D6WA 4F7UG 2LVMA 2XDDA 3CBOA 1JJ2S 3SB2A 2XDBA 2FB7A 3DB4A 2EQJA 2KVQG 3JCMV 3WVDB 5GMKm 2JTFA 2PU9B 2EJFA 1HK9A 2K5FA 3RKXA 3JB9I 3HL8A 1EIFA 3DLLA 5J39A 3OYMA 1H641 3QXEB 3BY7A 3J7AF 5LJ5f 4OB1B 2XD0A 4V2SA 5AYFA 1ZQ1A 5LJ5e 3C94A 3QPHA 1NPRA 2EAYA 3A8OB 4NOYA 3S6WA 5LJ5g 1SSFA 4C5IA 3OB9A 2G3RA 3MP1A 2RJEA 5IN1A 3LYIA 2I2LA 2GFAA 1RL2A 4ZN3A 2QQAA 4C8QE 4J6YA 2RI5A 3LH0A 1VQ8T 3OYDA 1MHNA 5A0GA 3GLXA 4XTZA 3LWHA 5FU7C 5GANe 3SWNB 4FT4A 5GANg 1MGQA 4LDYA 3FC3A 1VQ6T 1Q82U 1LJOA 3OSVA 2L89A 3ASKA 2M0OA 2QTXA 3CC4A 4LDUA 2P0PA 3OYEA 4OF1A 2QQRA 3KBGA 3UWNA 4PJOB 3OYYA 4XAXB 5CO7A 2LT4A 5GANf 3OS5A 4QVCA 1YCYA 4JLGA 4XU3A 3AHUA 4M7DA 2PUOB 5FU6B 4C8QB 3X26B 3X20B 4DA4A 2DIGA 4C92A 5LJ3g 4BD3A 4M77B 4MMKA 3JCMd 2E64A 3OY9A 5LJ3f 4L5GA 5KCHA 2OAUA 3G4ST 2QDYB 3JCMW 1VQOT 1M1KC 4PJOA 4M7DB 3M55A 3ZBDA 4M75B 1Q81U 2X4XA 3QYGB 3QHSA 2VV5A 2K5IA 4II1A 3OW2S 1Y07A 1D3BB 2DJZA 2DD5A 5CQXA 5GMKh 2KMTA 2BIVA 5CKFA 2WSFE 5C0MA 4IURA 5GAOn 2LTOA 1NZ9A 3GF5A 4QQGA 3JB9G 3OQ5A 5CKBA 4M78G 2L8DA 4RMOA 2Y4XA 2ZCFB 3C95A 1VUBA 1Y96B 2RHIA 4VUBA 3OYBA 4OMFB 2JUFA 4XU2A 4GY5A 3V8JA 4J7FA 5DY9A 4M7AC 2PQWA 4F7UF 4ZGEB 3CCLA 1WJRA 4R56A 2LNVA 5FU6C 4N0AA 2CZ7B 2DPPB 2EQKA 3GNFB 4C8QC 5I2SA 3OYLA 1YJWA 4C0DC 2RJCA 1Q86C 3M59A 2DK3A 3CC4T 5A2QE 1Y96A 3INZA 3HSBA 2C06A 4PJOC 4F7UB 3CPWA 3OBWA 1FX7A 2DXUA 1XNIA 1QW1A 4BY6B 2XKOC 3JCMb 4A4GA 2P0QA 1KC8U 4BE0A 1O75A 4M78C 1G3YA 2KAFA 2DTHA 3LGLA 2E5QA 4KUDK 2DIQA 3TU4K 4PLLA 3CC7A 1N8RC 2RJDA 3RMSA 5GAMh 2QEXT 2RJFA 3M9QA 3CC7T 1YI2A 4KUIA 3DB3A 1OZ3A 3OBYA 5GANh 1ZBXA 4RCCA 1VQPA 2RHYA 4O6JA 1B34B 4M7AF 1W4SA 3OS0A 2MWOA 1YHQT 4M77D 5HY6A 1M1GA 1DJ7B 4M77F 5CCAA 3JB9F 1AHJB 3UDCA 3CCMT 1N8RU 3CBMA 3OW2A 4OP0A 4YTLA 4DOWA 1KHIA 1B34A 2E65A 2FVUA 5A0LA 1UGPB 3E1SA 3LWIA 5LJ5h 4PJOD 4JDSA 1BIBA 4PJOF 1YJNT 1JJ2A 3HRTA 2IG0A 3A5ZB 4BDZA 3J81E 5GAN2 2PVDB 2XICA 1G5VA 3QUIA 3PT9A 1BKBA 2QQSA 3MEWA 3TCJA 5CVIA 3OYHA 3JCMh 1OYXA 3HPWA 4JS4A 3PFSA 3QIIA 2LCCA 2GFUA 1Y71A 4A53A 1R8OB 3HRUA 4M77E 3A8MB 2XIDA 2ZZDA 3JCMg 3SWNC 5FU7B 3META 5GAOl 3CCET 3P8DA 5GAMj 1M4ZA 3S3OA 1GXIE 1KHCA 1O9SA 2EIFA 3J80E 2JVVA 5LJ3d 1VQMT 4A4HA 1Q81C 2RI3A 2DD4A 1Q82C 5CKHA 2PUKB 1BYMA 3HFNA 3L2UA 3M5AA 4B9XA 1YJNA 2GQVA 4E7IA 4LD9K 5J3BA 1WPYA 2F5KA 2V8IA 5FROA 2EKOA 3BDUA 4PL6A 3M4GA 2ZGWA 1M1FA 1WGSA 2HD0A 3MEUA 1KQSA 2VXFA 4N4IA 3OMGA 5GAOr 3CCEA 2XK0A 1ZHIA 1N9SA 1UGSB 4FL6A 3I55A 3CCJA 3CCQT 5IT9E 1K73U 3UT1A 3E19A 1YI2T 3JCMe 1N27A 3X25B 4M7DE 4M75E 3VJPA 3PGGA 3CPWS 2F69A 4CI0C 4JUVA 4C92G 3JB9H 3OYFA 4X9CA 4M78D 2KSSA 2RH2A 3VUBA 3OYNA 3JB9D 3HP9A 4M78F 3L2VA 4QVZA 2CZ0B 3HHTB 3JRZA 4C5GA 2DXTA 3X28B 1YJ9A 1FWZA 5GAOp 4BE1A 1VQNT 2HNIA 4A4KA 1UGQB 1K9MC 4N4HA 3URGA 3V8LA 1YJWT 2XDPA 5GAMf 4C92E 4JS5A 4XTXA 2EJGA 2P4TA 3A8HB 1NE8A 3FRNA 1Y7XA 3CD6T 4RG2A 2E10A 3DLMA 3CCMA 4ZTFA 2LC4A 2FHDA 5C6SA 4XTUA 1WJQA 4BB7A 3FIFA 3JAME 1YHQA 3HRSA 3SD4A 4J83A 3RIRA 4ME7A 1NJIU 2RM4A 4D6WA 4ZTJA 5CIUA 1VQKA 4LD6A 3RKYA 4XU0A 2RA2A 2H3JA 2LQKA 2RK2A 2YRVA 1JB0E 2CZ1B 3VYGA 3M4YA 4QQDA 4QW2A 3V7RA 3FLGA 3OYAA 2LRQA 3JCMJ 2V8KA 3A8LB 3HFOA 3H6ZA 4M7DD 4M7AG 3G71T 4A54A 4C92F 4OB2B 1S72T 4PJOE 1TH7A 4C8QG 4XQ3A 2X4YA 2ZPBB 5IAYA 2ZPIB 1VQ7A 3RESA 3RUXA 4PJOG 2AHJB 4O5VA 1I4K1 4FIBA 3CCRA 3LGFA 5LJ5j 5EG2A 4BDYA 1G3SA 3PMTA 3LX7A 2RB6A 3M56A 2JN0A 3O8VA 2MAMA 1VQ4T 2CKKA 4BI3A 1WJSA 1VQ5A 2DVEA 3CBPA 3CMEA 1XTDA 2Y90A 3OS1A 1OI1A 2K3XA 4HCZA 3CC2T 4L59A 1M5Q1 2MF2A 4FU6A 1KD1U 3OSSC 5GANj 2O01E 3NTIA 2RO0A 2ZPFB 3N5BB 3G7ZA 4Z02A 4C92C 4E47A 5LJ3e 2X4JA 4Y91A 1H3ZA 2XI9A 4ELYC 5LJ3h 2OTJA 4NL3A 4KBMB 2VYTA 2BUDA 1QP3A 3S3MA 1K73C 2QA4T 2DO3A 3QDRB 4UC4A 3CXCA 3V8KA 3CMAT 1KQ2A 2VGNA 3NFCA 1M8VA 1HXDA 2D0QB 4JRIA 3OYIA 3CCST 3OMCA 4FSXA 1QVGA 4M7DC 2V8JA 3RMQA 2A3LA 5GAN8 2YLCA 1I8FA 3LW5E 3CCSA 5GANd 1VQNA 2E6ZA 2EYQA 4NS5A 2R58A 2Y4YA 3CMAA 4EMKB 2FYKA 5GMKi 1OZ2A 3VYHB 2K4YA 4EMGA 1X6OA 3R6OA 1PSFA 4KT0E 4A4FA 1X01A 1VQ9T 2CYZB 3PIPA 2CZ6B 4N4GA 2RK1A 2ZPHB 4MDWA 3VV0A 2EWNA 5DLQE 1UGRB 4BI8B 4EMKA 1BI2A 4PNOA 5D6YA 4ELZC 5LJ5d 2HAXA 3E9FA 2ZPGB 2OTLA 3SWNA 4XTYA 2P0KA 4IUVA 3C4SA 3VUZA 2KK4A 2R5AA 5DLOA 3OYCA 2WACA 5GAMg 2GF7A 4ZN1A 4C92D 4LDXA 1VQ4A 4X9DA 1D3BA 1UB4A 2KQWA 5GAOq 4E7KA 3P8HA 3OS2A 2RHZA 2GCXA 4PLIA 3VKIA 4JRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD4 A;  4Y28 E;  2PUK B;  4FM4 B;  1JB0 E;  4RKU E;  1V29 B;  2CZ1 B;  3VYG A;  3A8G B;  3QYG B;  1GXI E;  3VYH B;  2PVD B;  4KT0 E;  1QP2 A;  1PSF A;  2CZ0 B;  2DD5 A;  3HHT B;  2CYZ B;  2O01 E;  2ZPF B;  2WSF E;  2PVO B;  3A8L B;  3X24 B;  3QYH B;  3X28 B;  2CZ6 B;  4ZGD B;  1UGQ B;  2ZPH B;  3WVD B;  4OB2 B;  4XK8 E;  1UGR B;  2PU9 B;  4ZGJ B;  4OB3 B;  2WSC E;  2ZCF B;  2ZPB B;  1QP3 A;  2ZPI B;  3A8H B;  3QZ5 B;  3QXE B;  3QZ9 B;  2ZPG B;  2AHJ B;  1PSE A;  3A8M B;  4OB1 B;  2ZZD A;  4ZGE B;  1UGS B;  1DJ7 B;  4L6V 5;  2PUO B;  2CZ7 B;  1AHJ B;  2DPP B;  2PVG B;  2D0Q B;  2WSE E;  2ZPE B;  1IRE B;  3A8O B;  4OB0 B;  5L8R E;  2DXB A;  3X20 B;  3X25 B;  2DXC A;  3X26 B;  3LW5 E;  3WVE B;  1UGP B;  2QDY B; 
#chains in the Genus database with same CATH topology
 3PTA A;  4M78 E;  1MV3 A;  2G6F X;  2A28 A;  2QQ9 A;  2GGR A;  1G2B A;  1D09 B;  3V7S A;  1VQ6 A;  2DKG A;  3EAE A;  2IVW A;  3I56 Q;  2J6F A;  2W0Z A;  4F7U A;  3GIB A;  1PKS A;  1TSF A;  2E4H A;  2RQV A;  1MMG A;  2DXB A;  2FZG B;  5I11 A;  2KY9 A;  1YBY A;  3EGX B;  2KXC A;  3EGD B;  3GP8 A;  2XHC A;  5IHK A;  4ATO A;  4HT8 A;  1EZZ B;  3EGX A;  3G1J A;  4QVD A;  4C0F A;  5I22 A;  3H9N A;  2LJ0 A;  2YXY A;  1I07 A;  2QA4 A;  1QQJ A;  4HA8 A;  2HDA A;  2F2W A;  3UAT A;  3MJX A;  3VS7 A;  4WCI A;  3SFM A;  4E6R A;  4IUT A;  2OX7 A;  2RD1 A;  4D8D A;  1BI3 A;  2AKK A;  2FL7 A;  2RQR A;  4MZM A;  4IKF A;  1UG1 A;  2BZ8 A;  4DBF A;  3NTK A;  1HYO A;  2HMA A;  4X34 A;  1U8R A;  1IRE B;  2EYX A;  2RNA A;  2MI6 A;  2H8H A;  5FWC A;  1SG5 A;  4OMO A;  3GPL A;  3MP8 A;  4AFU C;  3KUF A;  2BE9 B;  3ULR B;  1V29 B;  1M1K U;  1QVP A;  2ROL A;  5CR2 A;  4TVR A;  3CCJ T;  3CCQ A;  3JCM f;  1J3T A;  2QYZ A;  2RF0 A;  4HT9 A;  4M7D G;  1TTH B;  2HZY A;  1JJ2 P;  5J26 A;  2HBW A;  1CKA A;  5HK0 A;  2EGE A;  1HJD A;  1WI7 A;  4DBR A;  2CUB A;  4KH1 B;  2LCL A;  4MZP A;  4Y28 E;  4RKU E;  3JCM Q;  3A8G B;  1Q81 R;  3CEY A;  3QJ6 A;  1PC0 A;  2E3H A;  4XTW A;  1KFZ A;  1UE9 A;  3ZEH A;  1VQ8 Q;  2J05 A;  3CCV T;  2L0A A;  3BDL A;  4Q5W A;  3EFO B;  9ATC B;  4IIO A;  1I0C A;  2HEQ A;  3I55 T;  1QKW A;  1WA7 A;  5KE3 A;  2HQE A;  4C5H A;  2RHU A;  3JCM X;  3D7S B;  4DOV A;  3QKJ A;  3L1A A;  3JSC A;  3QG1 A;  5KE2 A;  3H8Z A;  1FXX A;  1RI0 A;  4M75 C;  1KQS S;  2KE9 A;  3MPU B;  2PZ1 A;  4QQ6 A;  2F2X A;  5CAI A;  3CCV A;  3I56 T;  4M78 A;  2LX9 A;  2DZC A;  1VQ9 A;  1N9R A;  1K9M U;  4MZT A;  3OYK A;  4CRI A;  2J6K A;  1OOT A;  2JOY A;  4JRP A;  4HCC A;  1QVG S;  5KYX B;  4OMP A;  1WXT A;  2XDD A;  1JJ2 S;  3SB2 A;  2B86 A;  3DB4 A;  3JCM V;  2JTF A;  1RI9 A;  1YJ9 Q;  3RKX A;  5IHI A;  1EIF A;  4J9G A;  3BY7 A;  3J7A F;  4OB1 B;  2XD0 A;  1VYT A;  2F2V A;  2EAY A;  1SSF A;  4EIK A;  1K4U S;  2G3R A;  2RJE A;  3LYI A;  5KYU B;  1Q95 G;  1RL2 A;  4ZN3 A;  4C8Q E;  3RNJ A;  3LH0 A;  4HVV A;  2V1R A;  3OYD A;  5A0G A;  1W70 A;  2K79 A;  5FU7 C;  4FT4 A;  4LDY A;  1Q82 U;  2E5K A;  3OSV A;  2M0O A;  5AT1 B;  2L3P A;  5GAN f;  1JO8 A;  4C8Q B;  3X26 B;  1OPK A;  2PTK A;  4PFP A;  4C92 A;  4MMK A;  1ARK A;  2E64 A;  3G4S T;  2K2M A;  3M55 A;  2X4X A;  1S72 Q;  1NEG A;  1F1B B;  1Y07 A;  2DJZ A;  1KK7 A;  2FRW A;  2GQI A;  5CQX A;  2KMT A;  2LTO A;  3GF5 A;  2L8D A;  2KI7 A;  1VUB A;  3OYB A;  4OMF B;  2JUF A;  4RTW A;  4M7A C;  3VS0 A;  1X27 A;  1PWT A;  4AT1 B;  5FU6 C;  3CC4 T;  1Y96 A;  4F7U B;  1XNI A;  4BY6 B;  3JCM b;  4A4G A;  2DL5 A;  2DTH A;  3LGL A;  1ZLM A;  2CP5 A;  4PLL A;  1OU9 A;  2CH4 A;  3CC7 T;  4KUI A;  1OZ3 A;  3EGD A;  1ZBX A;  1MMA A;  4O6J A;  4M7A F;  1W4S A;  2ROT A;  4M77 F;  4CC7 A;  3JB9 F;  1N8R U;  4OP0 A;  4X1V A;  1UTI A;  3PVQ A;  3LWI A;  1FMV A;  4PJO F;  1VQK Q;  1JJ2 A;  4BDZ A;  3J81 E;  1G5V A;  3QUI A;  2A0F B;  4LXC A;  1BKB A;  4E7Z A;  1OYX A;  3PFS A;  4M77 E;  2HQH A;  2ZZD A;  1RLP C;  1O9S A;  1WXB A;  4RTY A;  2JVV A;  5LJ3 d;  2NWM A;  2YUP A;  3L2U A;  2AK5 A;  4B9X A;  4PFZ A;  1PHT A;  1WPY A;  2F5K A;  2FO0 A;  2COY A;  3M4G A;  2ZGW A;  1KQS A;  2VXF A;  2EW3 A;  3CCE A;  2AKL A;  1UGS B;  5IT9 E;  4PJJ A;  1K73 U;  5IXB A;  1YI2 T;  2YDL A;  3EG2 A;  4KGZ B;  3VJP A;  1YIJ Q;  4KGV B;  4JUV A;  3REB B;  4M78 D;  2KSS A;  1IO6 A;  3HP9 A;  2I0N A;  2CZ0 B;  1FWZ A;  4BE1 A;  1VQN T;  2HNI A;  3URG A;  4C92 E;  1QWE A;  1QWF A;  4PJL A;  2LQW A;  3FRN A;  3CD6 T;  1TXQ A;  3LH5 A;  2LC4 A;  1WFW A;  2FHD A;  5C6S A;  2E3I A;  3JAM E;  3FIF A;  4J83 A;  3RIR A;  4DEY A;  1NJI U;  4LD6 A;  2RA2 A;  2RK2 A;  3VYG A;  3M4Y A;  1M3C A;  4QQD A;  4RTV A;  3JCM J;  3A8L B;  1KD1 R;  4CC4 B;  3G71 T;  1NEB A;  4D8K A;  4XQ3 A;  2ZPB B;  2ZPI B;  2NUT A;  3RES A;  3RUX A;  4PJO G;  1H8K A;  3VS4 A;  1U5S A;  1G3S A;  3M56 A;  1AEY A;  1WHG A;  1Z9Z A;  3OS1 A;  2C0I A;  4FYX B;  3CC2 T;  3M0Q A;  5FWB A;  1JQQ A;  2C0T A;  4FU6 A;  5GAN j;  2ZPF B;  5LJ3 e;  2CH4 W;  4ELY C;  5LJ3 h;  2OTJ A;  4K11 A;  1QP3 A;  1I1J A;  3S3M A;  2DO3 A;  3CMA T;  2D0Q B;  2VAS A;  4M7D C;  3EHQ A;  3OMC A;  1G8X A;  3RMQ A;  2CDT A;  4OMQ A;  2YRD A;  5GAN d;  4PJN A;  4NS5 A;  2HKQ B;  3CMA A;  6AT1 B;  2X51 A;  3R6O A;  1VQ9 T;  1X01 A;  1ZSZ C;  2CYZ B;  4KGX B;  3M0P A;  1E7O A;  3PIP A;  2CZ6 B;  5DLQ E;  1UGR B;  4EMK A;  1BI2 A;  4AG1 C;  2CP6 A;  5D6Y A;  2HAX A;  3E9F A;  1D0X A;  2LQN A;  2P0K A;  2R5A A;  5DLO A;  4M7D F;  2WAC A;  2J7I A;  1TWB A;  2SRC A;  5GAO q;  4E7K A;  2RHZ A;  1BBZ A;  4PLI A;  1U06 A;  2DYB A;  1SF9 A;  3VKI A;  1IRX A;  3C12 A;  4FM4 B;  4EDU A;  3OYJ A;  2PVO B;  3OA6 A;  2EKH A;  1X2K A;  2VWF A;  4JJC A;  2PVG B;  1VQL T;  1VQO A;  1UJ0 A;  3M57 A;  4XU1 A;  4J8O A;  3EFS A;  2JZ2 A;  1JBM A;  1K0X A;  2O4X A;  1W2B S;  2X4W A;  3ER0 A;  1NBE B;  3CD6 A;  1PCX A;  1IGQ A;  1NPP A;  3TEE A;  3X24 B;  4N0A C;  4XK8 E;  5FLX E;  3WXM B;  2QQB A;  4IUU A;  3LLR A;  2M16 A;  4ZGJ B;  2DYI A;  2ENM A;  3TRE A;  5GAN 6;  4KH0 B;  1KC8 C;  2K2V A;  4C8Q D;  4EMH A;  5CQY A;  5CKE A;  3SEM A;  3VS3 A;  1IB8 A;  2VGM A;  2QDL A;  3QYH B;  2L3S A;  3EH1 A;  2ECZ A;  2QXF A;  4PFO A;  2M1H A;  1S1N A;  4L6V 5;  2BE7 D;  1UEB A;  4EMK C;  5LJ3 j;  2FG0 A;  4OVA A;  2VUB A;  3JCM c;  1UEC A;  4BE2 A;  4HVU A;  1M27 C;  2LNH B;  1JEG A;  2F5T X;  4DBQ A;  1QVF S;  1Q82 R;  1M2V A;  1MUZ A;  4JLI A;  2WSC E;  4M7A D;  3THK A;  2PNI A;  1PSE A;  4C0Z A;  3L2Q A;  3F70 A;  3M0U A;  2DET A;  2AZV A;  1PD1 A;  4BY6 C;  1OPL A;  1U3O A;  1ABQ A;  1BIA A;  4GLM A;  3RER A;  2A7Y A;  2DL3 A;  2JTE A;  1U1T A;  5L23 A;  5KH6 A;  2BTT A;  4EPC A;  4OGE A;  5GMK e;  2EYW A;  2D8J A;  2DVJ A;  2LT1 A;  2DEQ A;  3TSW A;  3G4S A;  2ED0 A;  1M9S A;  2KXD A;  5I2M A;  3WVE B;  3NTH A;  1YIT A;  1MV0 B;  5ECA A;  2A08 A;  1ZUK A;  2DZ9 A;  4AFS C;  1KC8 R;  1YJ9 T;  2V1Q A;  1YIJ T;  1VIE A;  1S72 A;  4AFZ C;  1D1C A;  1K8A U;  3VS2 A;  3CCV Q;  1VQM Q;  4LUD A;  2JXB A;  1D1B A;  2LMJ A;  4FW1 A;  2COW A;  3MHX A;  3I55 Q;  3CME T;  2NUT B;  2JT4 A;  4M77 G;  2DEU A;  3L2R A;  2CGH A;  3S3N A;  5D6W A;  4F7U G;  2LVM A;  3TSZ A;  1QCN A;  1PM3 A;  2KVQ G;  3OYM A;  3PVL A;  1NLO C;  1AZG B;  1K0S A;  1ZQ1 A;  3C94 A;  3QPH A;  4NOY A;  3S6W A;  2YT6 A;  1UUE A;  1GRI A;  3CCU Q;  1MMN A;  2I2L A;  1D0Y A;  2FPF A;  4AFQ C;  1NJI R;  2LJ3 A;  2K3B A;  1MHN A;  4XTZ A;  1MGQ A;  2OTJ Q;  3ASK A;  5KYU A;  1E6H A;  3TQ7 P;  4LDU A;  5HCK A;  2QQR A;  3CC4 Q;  5CO7 A;  4QVC A;  4XU3 A;  1SSH A;  4DA4 A;  2DIG A;  1YIT Q;  4CC2 A;  3JCM d;  3CMA Q;  4L5G A;  2OAU A;  2RN8 A;  2QDY B;  1E6G A;  4M7D B;  4M75 B;  1Q81 U;  3QHS A;  3OW2 S;  2K5I A;  4II1 A;  1H3H A;  2DD5 A;  5C0M A;  1IHW A;  4IUR A;  3ZL7 C;  1Y96 B;  4VUB A;  4XU2 A;  4J7F A;  2PQW A;  4F7U F;  4ZGE B;  1WJR A;  4R56 A;  2EQK A;  1K9A A;  3GNF B;  5IXF A;  3M59 A;  2DK3 A;  3INZ A;  4PJO C;  2DA9 A;  4BE0 A;  2EGC A;  2DE0 X;  2RJD A;  5GAM h;  1IGU A;  3M9Q A;  5GJV B;  1YI2 A;  3DB3 A;  1VQP A;  2RHY A;  4RTU A;  2MWO A;  4M77 D;  2CSQ A;  4FYY B;  2QAZ A;  3E1S A;  4PJO D;  5LJ5 h;  2IIM A;  4JZ4 A;  1BCM A;  2IG0 A;  5GAN 2;  2PVD B;  3PT9 A;  3EG9 B;  4J9E A;  3MEW A;  4HVW A;  4J9C A;  1UJY A;  3JCM h;  3HPW A;  1K1Z A;  2GFU A;  4OMM A;  4A53 A;  1GFD A;  1R8O B;  1NM7 A;  3SWN C;  1FYN A;  3MET A;  5GAO l;  3CCE T;  3P8D A;  5GAM j;  3S3O A;  2ED1 A;  1RAB B;  3J80 E;  4Z8A A;  4ESR A;  5CKH A;  3HFN A;  1ZA1 B;  3M5A A;  1VYU A;  2GQV A;  2NUP A;  2DL4 A;  2P4R A;  3SHW A;  1YJN Q;  5FRO A;  3BDU A;  2NUZ A;  1M1F A;  1WGS A;  2VKN A;  4F16 A;  2JS2 A;  1GCQ C;  1N27 A;  3X25 B;  2QA4 Q;  4M7D E;  4M75 E;  3PGG A;  1W6X A;  1SHG A;  2QEX Q;  1K76 A;  4X9C A;  3JB9 D;  3L2V A;  4QVZ A;  3A98 A;  2DXT A;  5GAO p;  4N4H A;  1RLQ C;  1KQS P;  3A8H B;  1Y7X A;  1I5O B;  1TUD A;  4ZTF A;  4XTU A;  4BB7 A;  2P84 A;  4ME7 A;  2KRO A;  3EFO A;  5CIU A;  3RKY A;  4XU0 A;  2CP2 A;  2H3J A;  3VS5 A;  1JB0 E;  3H6Z A;  4A54 A;  4C92 F;  2O31 A;  3IQL A;  1VQ7 Q;  4C8Q G;  1OX9 A;  1Y57 A;  4O5V A;  1OEB A;  2DNU A;  4Z88 A;  2CP0 A;  4BDY A;  3PMT A;  1RAI B;  2JN0 A;  2YSQ A;  2CT3 A;  1WJS A;  1VQ5 A;  2DVE A;  2VVK A;  1RAE B;  1OI1 A;  2K3X A;  2GTJ A;  1WYX A;  1KD1 U;  1TUG B;  2LP5 A;  2QK0 A;  4Z02 A;  3G7Z A;  1X2Q A;  4C92 C;  1H3Z A;  2DIL A;  2BUD A;  1M3B A;  1X6B A;  3QDR B;  3CXC A;  2CSI A;  4RTZ A;  1M8V A;  4JRI A;  2V8J A;  2CP3 A;  2A3L A;  5GAN 8;  2YLC A;  1I8F A;  4RTT A;  3EGU A;  2FYK A;  5GMK i;  4FYV B;  2RQW A;  4EMG A;  1X6O A;  1PSF A;  3QDF A;  4N4G A;  1D1A A;  4MDW A;  1N5Z A;  1ZUY A;  2MPX C;  1RAA B;  4JJB A;  1AZE A;  2OJ2 A;  2OTL A;  3M0R A;  4IUV A;  2KK4 A;  1ZSG A;  5GAM g;  5IH2 A;  4HCK A;  4X9D A;  2COZ A;  1UB4 A;  2KQW A;  3P8H A;  2GCX A;  4JRQ A;  1TUC A;  1QVF A;  4C8Q A;  3CQT A;  2FZK B;  1VQ7 T;  2LDM A;  4C92 B;  1NYG A;  2RI2 A;  4DBH A;  1YWP A;  1R0B G;  4M75 A;  1P92 A;  2M0Y A;  2J6O A;  3G6E Q;  3RBB B;  1VQ6 Q;  3ZFJ A;  1N6A A;  2KGT A;  4IUQ A;  2OTJ T;  1WQ7 A;  1OUL A;  4KUL A;  5GAN 7;  3I56 A;  2KNB B;  1VQK T;  1ZX6 A;  2RPN A;  2OAW A;  1IXD A;  2E12 A;  1G3T A;  4J6W A;  2X35 A;  2EQU A;  4XTV A;  4E7H A;  3MEV A;  2LQ8 A;  2IPO B;  3VS1 A;  2O4X B;  2DTI A;  1AVZ C;  4M7A A;  4LUE A;  5KCO A;  1QVG P;  1YCS B;  4MDX A;  2KRM A;  3MEA A;  2X9H A;  1RUW A;  3NPF A;  1LOJ A;  4LDW A;  3CXC S;  3KXT A;  2DAQ A;  5GAN 3;  2A36 A;  3CC2 A;  1V76 A;  1GL5 A;  2OI3 A;  4A63 B;  2EQM A;  2JS0 A;  3HTR A;  1H92 A;  4FSS A;  1ZUU A;  3FDR A;  3PMI A;  4OB3 B;  1SKU B;  4RTX A;  1NLP C;  2MWP A;  1AWO A;  3FJ5 A;  2R5M A;  3Q1J A;  1OV3 A;  5L8R E;  2QGG A;  1VQM A;  1MNE A;  2E70 A;  2DXC A;  4FCY A;  2MMP A;  1GBQ A;  3FB9 A;  5D7U A;  4M75 G;  2QEX A;  1RAC B;  4OGC A;  1SRM A;  3QO3 A;  3DKM A;  1LNX A;  3G6E A;  1YNZ A;  4M75 D;  1QVF P;  1QKX A;  3FEO A;  2QI2 A;  4C8Q F;  2JW4 A;  1T3S A;  2LCS A;  5GAN 4;  2JNG A;  1T3L A;  1C0M A;  2KDS A;  3E9G A;  3GNG A;  1A0N B;  3OYG A;  5GAO m;  4RG8 A;  3SDZ A;  1KD1 C;  2QG9 B;  2E6N A;  3QBY A;  1HSQ A;  1VQ8 A;  3QWX X;  2D9T A;  1LVK A;  1CSK A;  3EH2 A;  1Q7Y R;  1BB9 A;  4P5N A;  1PKT A;  3JB9 J;  1JXM A;  3MP6 A;  1WQW A;  3M53 A;  1X69 A;  2DER A;  1VQ5 T;  1ZA2 B;  2RQT A;  2LJ1 A;  5GAM e;  3CC2 Q;  3CPF A;  3H0F A;  4KRT A;  1Q7Y C;  4PK4 A;  3GOX A;  3T9N A;  3GBQ A;  1XQH A;  1B7T A;  3L2W A;  3JCM P;  2QAS A;  1YFN A;  1PG5 B;  5DM7 R;  4R0K A;  5GMK j;  3L2Z A;  3VU3 C;  2XG8 D;  2EGA A;  2FPE A;  4M75 F;  2EQI A;  4JJN K;  3BFM A;  4J5Y A;  2DTO A;  3QSU A;  1BU1 A;  2JTM A;  5D6X A;  1M90 U;  1K8A C;  3L42 A;  1ZBJ A;  5M9O A;  5KYX A;  1I5L A;  3P8B B;  2HBP A;  4BUG A;  2K3Y A;  1WX6 A;  2DF6 A;  4J7I A;  1VQ9 Q;  2DMO A;  4Z89 A;  1M30 A;  5CK9 A;  2ATC B;  1NJI C;  1QMC A;  3CBO A;  5KYY B;  2XDB A;  1K8A R;  2PU9 B;  2EJF A;  2K5F A;  3R6N A;  2EBP A;  2EPD A;  4J9H A;  4E2F B;  1YI2 Q;  3QXE B;  5LJ5 f;  4V2S A;  5KYY A;  1NPR A;  5LJ5 g;  4B6M A;  2OTL Q;  1Z9Q A;  1YHQ Q;  4AMC A;  4PJM A;  5IN1 A;  2MOX A;  2RI5 A;  1VQ8 T;  3GLX A;  1WDX A;  1PRL C;  3SWN B;  5GAN g;  3FC3 A;  2L89 A;  2QTX A;  1NG2 A;  3OYE A;  4OF1 A;  3KBG A;  3UWN A;  4PJO B;  4XAX B;  2LT4 A;  3OS5 A;  3QWY A;  4M7D A;  3UA7 A;  5FU6 B;  3X20 B;  4M77 B;  3RR6 A;  4PJO A;  1GFC A;  5KCH A;  1VQO T;  3ZBD A;  3QYG B;  1UHC A;  1JU5 C;  2VV5 A;  1D3B B;  5GMK h;  4F04 B;  2BIV A;  1ABO A;  5GAO n;  1BCO A;  3JB9 G;  2ZCF B;  5DY9 A;  4RUG A;  1VQ4 Q;  3CCL A;  2LNV A;  4C8Q C;  2DFU A;  3REA B;  2RJC A;  1Q86 C;  3HSB A;  2C06 A;  3JV3 A;  3CPW A;  1FX7 A;  2DXU A;  1TU0 B;  2V26 A;  1QW1 A;  2FPD A;  2KRS A;  2XKO C;  2P0Q A;  1KC8 U;  4KUD K;  1G3Y A;  2E5Q A;  3TU4 K;  1N8R C;  4IIM A;  2H3E B;  5GAN h;  2HSE B;  2SEM A;  5FW9 A;  1B34 B;  2RMO A;  3EG1 A;  3OS0 A;  1YHQ T;  3EG0 A;  1DJ7 B;  5CCA A;  2YUN A;  3CBM A;  1M3A A;  2FVU A;  1UGP B;  1BK2 A;  1BIB A;  4JDS A;  1YJN T;  3PE0 A;  2MYS A;  2K9G A;  2RQU A;  4J9B A;  2QQS A;  1SHF A;  3OYH A;  4JS4 A;  2HKN A;  3QII A;  2LCC A;  3HRU A;  3A8M B;  3JCM g;  3VRY A;  5FU7 B;  1GXI E;  2D0N A;  1KHC A;  4A4H A;  2DD4 A;  2D1X A;  2EVR A;  4DEX A;  2FZC B;  4E7I A;  4LD9 K;  5J3B A;  2V8I A;  2JMA A;  1PRM C;  4PL6 A;  4Y92 A;  2O9S A;  4N4I A;  3OMG A;  1EFN A;  1N9S A;  4FL6 A;  5IHN A;  3CCJ A;  3CCQ T;  1WHJ A;  3NGP A;  5GJW B;  3E19 A;  5KYW B;  4CC3 A;  2F69 A;  2HSP A;  4CI0 C;  1PNJ A;  3CCS Q;  2KBT A;  1XJW B;  3OYF A;  3CC7 Q;  3VUB A;  3OYN A;  4M78 F;  2AIR B;  5KYW A;  3HHT B;  3JRZ A;  2CT4 A;  2F1L A;  4J9D A;  3X28 B;  1YJ9 A;  2FRY A;  3V8L A;  1YJW T;  2XDP A;  1VOM A;  3UA6 A;  5GAM f;  4XTX A;  2P4T A;  1WHL A;  1NE8 A;  1X43 A;  4RG2 A;  3DLM A;  3MKD A;  2KYM A;  3CCM A;  3HRS A;  3SD4 A;  2CUD A;  2RM4 A;  2YRV A;  2LQK A;  1LPL A;  2CZ1 B;  1K9M R;  3V7R A;  2LRQ A;  1M1K R;  3HFO A;  4M7D D;  1S72 T;  1TH7 A;  2X4Y A;  2X3W D;  2AHJ B;  3VRZ A;  1I4K 1;  3LGF A;  5LJ5 j;  3U23 A;  2M51 A;  5EG2 A;  1SEM A;  3LX7 A;  1VQ5 Q;  1B07 A;  2DRK A;  2MAM A;  1VQ4 T;  2CKK A;  4OML A;  2A37 A;  3CBP A;  1XTD A;  1OX8 A;  2ABL A;  2GTO A;  4L59 A;  1M5Q 1;  2MF2 A;  3OSS C;  2O01 E;  3NTI A;  2RO0 A;  2O2O A;  2XI9 A;  2JM8 A;  4KBM B;  1K73 C;  4UC4 A;  3NFC A;  3H0H A;  1GBR A;  1HXD A;  1QVG A;  4ANJ A;  3CCS T;  4FSX A;  3CCS A;  2E6Z A;  4J9F A;  4HXJ A;  2R58 A;  1QCO A;  1TOV A;  2Y4Y A;  4EMK B;  1VQN Q;  2KYB A;  1OZ2 A;  2MIO A;  2LZ6 B;  3VYH B;  4KT0 E;  1MMD A;  4LNP A;  2XMF A;  4PNO A;  2ZAE A;  3SWN A;  2GBQ A;  4XTY A;  3C4S A;  3VUZ A;  2GF7 A;  1M90 R;  4C92 D;  4LDX A;  3CCL Q;  1VQ4 A;  1M8M A;  1D3B A;  2KT1 A;  3OS2 A;  1WHH A;  1PD0 A;  3G71 Q;  4FT2 A;  2FEI A;  4M77 A;  3BW1 A;  4F17 A;  2M9U A;  1U1S A;  1G83 A;  2YUQ A;  5GAN 5;  1VQP T;  4QT7 A;  1I81 A;  1VQL A;  4ORZ A;  3CXC P;  2EYY A;  3ME9 A;  4B9W A;  3EFR A;  4J9I A;  2D6F A;  3PNW C;  1N8R R;  4ZGD B;  3CCU A;  1AWX A;  2HL3 A;  1ZSZ B;  2HQX A;  2CP7 A;  1QP2 A;  1HD3 A;  1WNL A;  2L3Q A;  3CCR T;  4ZNX A;  3EHR A;  5FRM A;  1C1A A;  1Q86 U;  3CCE Q;  4DQ2 A;  3QZ5 B;  4PKC C;  2YLB A;  2W10 A;  1YJW Q;  3M54 A;  3G6E T;  2EFI A;  4M7A B;  4JRK A;  1AWW A;  4MML A;  2J06 A;  4IUP A;  1XOV A;  4HCB A;  4JZ3 A;  1W1F A;  1TG0 A;  3MO8 A;  2YHT A;  4C0D B;  2HCK A;  1WHK A;  1OQK A;  1YN8 A;  5LL6 S;  3MCA B;  2L2P A;  1W2B A;  2CS7 A;  2M02 A;  1R0C B;  1IHV A;  1QCF A;  5HK3 A;  3M0T A;  3QJY A;  1KG1 A;  2DL7 A;  2WSE E;  2ZPE B;  1UFF A;  2EJ9 A;  5GAM d;  1X75 C;  2X3X D;  3M58 A;  5CKD A;  3G71 A;  5FRN A;  1FMK A;  5EC7 A;  1AWJ A;  3E2U A;  4E7L A;  2BZX A;  2BZY A;  1VIF A;  4C5E A;  1RAD B;  1C6V X;  1KQ1 A;  2B8A A;  2NLU A;  1VQL Q;  1G3W A;  1YWO A;  2RHX A;  4M77 C;  2DL8 A;  2VB6 A;  1R77 A;  5A0D A;  2E41 A;  2K5L A;  4E7J A;  1B3Q A;  1BI0 A;  2VC8 A;  1CKB A;  2R57 A;  2QTV A;  2L5Q A;  5I21 A;  4HKE A;  2L3R A;  1JRI A;  3CCU T;  4GLK A;  3PIO A;  1IZ6 A;  2KRN A;  3NHN A;  2K57 A;  1BI1 A;  3FJP A;  2VXE A;  2HL5 C;  1WZO A;  3CCJ Q;  3QZ9 B;  3H41 A;  3I5S A;  4OB0 B;  4F7U E;  2AZS A;  1AT1 B;  4BI4 A;  1RAH B;  2DX1 A;  4WF2 A;  1KIK A;  4R55 A;  3CCL T;  2D8H A;  2CRE A;  2MK5 A;  3V7C A;  1YIT T;  5HKC A;  3HKS A;  3AT1 B;  4NL2 A;  2XU8 A;  1Q7Y U;  4RCB A;  3UPU A;  4M78 B;  8AT1 B;  5GMK l;  1M90 C;  2OTL T;  2E1H A;  4J6X A;  4AG2 C;  2BKD N;  4M7A E;  4A4E A;  4C0G A;  4E7S A;  1W2B P;  3RKW A;  4LDV A;  4BAC A;  1UHF A;  1YIJ A;  2QGF B;  1X6G A;  4FYW B;  4FW2 A;  2FB7 A;  3WVD B;  2EQJ A;  5GMK m;  1YP5 A;  3JB9 I;  1HK9 A;  3HL8 A;  3DLL A;  5J39 A;  1H64 1;  3CCR Q;  1T0H A;  5AYF A;  5LJ5 e;  1VQO Q;  2EYZ A;  3A8O B;  2KR3 A;  2GNC A;  4C5I A;  3OB9 A;  1GCQ A;  3MP1 A;  2GFA A;  2MCN A;  2QQA A;  4J6Y A;  1UGV A;  3C0C A;  3LWH A;  5GAN e;  4OMN A;  1VQ6 T;  1LJO A;  1AOJ A;  2DLP A;  3CPW P;  1EX4 A;  3CC4 A;  2DBK A;  2P0P A;  2YWW A;  2DBM A;  4JPB W;  3OYY A;  3VS6 A;  3AHU A;  1YCY A;  4JLG A;  2PUO B;  1K73 R;  5LJ3 g;  4BD3 A;  1SRL A;  3OY9 A;  5LJ3 f;  3JCM W;  1M1K C;  3RDV A;  3I9Q A;  5CKF A;  2WSF E;  1NZ9 A;  4QQG A;  3OQ5 A;  5CKB A;  4M78 G;  4RMO A;  2Y4X A;  3C95 A;  2RHI A;  2Z0W A;  4LE9 A;  4GY5 A;  4JJD A;  3V8J A;  3A1P A;  1V1C A;  3OYL A;  4N0A A;  2CZ7 B;  1KSW A;  2DPP B;  1WIE A;  5I2S A;  1YJW A;  4C0D C;  2YRC A;  1ZSZ A;  5A2Q E;  3OBW A;  1O75 A;  4M78 C;  2KAF A;  3I5R A;  2DIQ A;  3CC7 A;  3RMS A;  2DJQ A;  2QEX T;  2RJF A;  2JM9 A;  3OBY A;  4RCC A;  3OW2 P;  2LX7 A;  1SPK A;  2JJ9 A;  5HY6 A;  1M1G A;  1LCK A;  1AHJ B;  3UDC A;  3CCM T;  1UDL A;  3OW2 A;  4YTL A;  4DOW A;  1KHI A;  1B34 A;  2E65 A;  5A0L A;  1ACM B;  3EG3 A;  3HRT A;  3A5Z B;  2XIC A;  1T0J A;  3TCJ A;  5CVI A;  1JXO A;  3CCQ Q;  4GBQ A;  1Y71 A;  2XID A;  3EG9 A;  1M4Z A;  2EIF A;  2NUP B;  1VQM T;  1Q81 C;  1AD5 A;  1M2V B;  2RI3 A;  1Q82 C;  2PUK B;  1BYM A;  2ESW A;  3O5Z A;  3CME Q;  1YJN A;  3TVT A;  4M4Z A;  3CD6 Q;  2KEA A;  2EKO A;  1M2O A;  2HD0 A;  3MEU A;  5GAO r;  2XK0 A;  1VYV A;  3I55 A;  3UT1 A;  1WLP B;  2C0O A;  3JCM e;  1RAG B;  3CPW S;  4C92 G;  3JB9 H;  4LN2 A;  2RH2 A;  1GCP A;  2K6D A;  4C5G A;  1Y0M A;  1K9M C;  4A4K A;  1UGQ B;  4JS5 A;  2EJG A;  3CCM Q;  2YUO A;  8ATC B;  2E10 A;  1WJQ A;  1YHQ A;  4D6W A;  4ZTJ A;  1VQK A;  4QW2 A;  3FLG A;  2DRM A;  3OYA A;  2V8K A;  4M7A G;  4OB2 B;  4PJO E;  5IAY A;  1D0Z A;  3M0S A;  1Q86 R;  1VQ7 A;  4WTO B;  4FIB A;  1NYF A;  3CCR A;  2O88 A;  2RB6 A;  3O8V A;  4BI3 A;  2DM1 A;  3CME A;  2Y90 A;  4HCZ A;  3I35 A;  3KFV A;  4E47 A;  3N5B B;  2K7A A;  2X4J A;  4Y91 A;  5KYN A;  4NL3 A;  2VYT A;  4F14 A;  2AT1 B;  7AT1 B;  2QA4 T;  1RAF B;  1QLY A;  3V8K A;  1KQ2 A;  2VGN A;  3G4S Q;  3OYI A;  1WXU A;  1TS9 A;  3LW5 E;  1VQN A;  2EYQ A;  1KJW A;  2K4Y A;  2O9V A;  1WHM A;  3BE3 A;  4A4F A;  3H0I A;  2NYS A;  3UF4 A;  2RK1 A;  2ZPH B;  1VQP Q;  3VV0 A;  2EWN A;  4BI8 B;  2KT8 A;  1FMW A;  4ELZ C;  5LJ5 d;  3NMZ C;  2ZPG B;  1MND A;  1OU8 A;  2JMC A;  3OYC A;  4ZN1 A;  1VA7 A;  1ZHI A;  4QKU A; 
#chains in the Genus database with same CATH homology
 3PTA A;  4FM4 B;  3C12 A;  4EDU A;  1QVF A;  4FT2 A;  4M78 E;  4C8Q A;  3OYJ A;  1VQ7 T;  2QQ9 A;  2LDM A;  4C92 B;  4M77 A;  2PVO B;  3BW1 A;  2RI2 A;  3OA6 A;  3V7S A;  2M9U A;  2DKG A;  1U1S A;  1VQ6 A;  3EAE A;  1P92 A;  4M75 A;  2IVW A;  3ZFJ A;  1N6A A;  4IUQ A;  4F7U A;  5GAN 5;  1WQ7 A;  2OTJ T;  4KUL A;  5GAN 7;  3I56 A;  1VQP T;  1I81 A;  1VQL A;  3GIB A;  2PVG B;  1VQL T;  1VQK T;  3ME9 A;  2DXB A;  4B9W A;  3EFR A;  1VQO A;  2D6F A;  2KY9 A;  4XU1 A;  3M57 A;  3PNW C;  4J8O A;  4ZGD B;  1YBY A;  2E12 A;  3EFS A;  2JZ2 A;  1JBM A;  1G3T A;  3CCU A;  2O4X A;  4J6W A;  1W2B S;  2X4W A;  3ER0 A;  3GP8 A;  2X35 A;  2XHC A;  3CD6 A;  2HQX A;  1QP2 A;  1NPP A;  1WNL A;  2EQU A;  4XTV A;  3TEE A;  3X24 B;  4E7H A;  3MEV A;  4ATO A;  3CCR T;  4HT8 A;  4N0A C;  2LQ8 A;  5FRM A;  4XK8 E;  2O4X B;  2DTI A;  5FLX E;  3WXM B;  2QQB A;  1Q86 U;  4IUU A;  4DQ2 A;  4QVD A;  5KCO A;  4M7A A;  3QZ5 B;  4PKC C;  4C0F A;  2YLB A;  3LLR A;  4MDX A;  3M54 A;  2QA4 A;  3MEA A;  3G6E T;  4HA8 A;  2M16 A;  4ZGJ B;  1LOJ A;  4LDW A;  3CXC S;  2EFI A;  4M7A B;  3TRE A;  3KXT A;  4JRK A;  4MML A;  5GAN 6;  2DAQ A;  5GAN 3;  1KC8 C;  4IUP A;  1XOV A;  4HCB A;  2K2V A;  3CC2 A;  3SFM A;  3MO8 A;  4IUT A;  2YHT A;  4C0D B;  4C8Q D;  5CQY A;  4EMH A;  5CKE A;  2EQM A;  2RD1 A;  2VGM A;  1BI3 A;  5LL6 S;  3FDR A;  3QYH B;  3MCA B;  1W2B A;  2FL7 A;  3PMI A;  4MZM A;  2CS7 A;  4OB3 B;  2QXF A;  4IKF A;  2MWP A;  3NTK A;  5HK3 A;  2R5M A;  4X34 A;  2M1H A;  3Q1J A;  3QJY A;  4L6V 5;  1U8R A;  1KG1 A;  2WSE E;  1UEB A;  5L8R E;  2ZPE B;  1IRE B;  2EJ9 A;  1VQM A;  5GAM d;  2E70 A;  4EMK C;  2DXC A;  2MI6 A;  1X75 C;  5LJ3 j;  3M58 A;  2MMP A;  4OVA A;  2VUB A;  5CKD A;  3G71 A;  5FRN A;  3JCM c;  3GPL A;  3MP8 A;  4BE2 A;  3KUF A;  3FB9 A;  4E7L A;  1V29 B;  4M75 G;  1M1K U;  1QVP A;  1VIF A;  4C5E A;  5CR2 A;  4M7D F;  2QEX A;  4OGC A;  4TVR A;  2F5T X;  3CCJ T;  3CCQ A;  3QO3 A;  3DKM A;  1LNX A;  3JCM f;  3G6E A;  1QVF S;  4JLI A;  4M75 D;  1KQ1 A;  2WSC E;  4M7A D;  2B8A A;  2NLU A;  4HT9 A;  4M7D G;  3FEO A;  1G3W A;  1PSE A;  2RHX A;  4C0Z A;  2QI2 A;  4M77 C;  3L2Q A;  3F70 A;  4C8Q F;  5J26 A;  5GAN 4;  5HK0 A;  2JNG A;  4BY6 C;  5A0D A;  2KDS A;  3E9G A;  2E41 A;  3GNG A;  2K5L A;  4E7J A;  1BI0 A;  3OYG A;  5GAO m;  4RG8 A;  2LCL A;  2VC8 A;  2R57 A;  4MZP A;  4Y28 E;  3SDZ A;  4RKU E;  2L5Q A;  5I21 A;  1KD1 C;  1BIA A;  2L3R A;  1JRI A;  3A8G B;  4HKE A;  2E6N A;  3CEY A;  3JCM Q;  3CCU T;  3QJ6 A;  3QBY A;  3RER A;  2A7Y A;  1VQ8 A;  4GLK A;  4XTW A;  1U1T A;  3PIO A;  2D9T A;  3ZEH A;  1IZ6 A;  5KH6 A;  3CCV T;  4P5N A;  4EPC A;  2K57 A;  1BI1 A;  3BDL A;  3FJP A;  4OGE A;  2VXE A;  4Q5W A;  5GMK e;  3JB9 J;  2LT1 A;  3MP6 A;  2DEQ A;  3QZ9 B;  3I55 T;  1WQW A;  3M53 A;  3G4S A;  1VQ5 T;  1M9S A;  4OB0 B;  5I2M A;  4F7U E;  5KE3 A;  2HQE A;  4C5H A;  2RHU A;  3JCM X;  4BI4 A;  5GAM e;  3WVE B;  3CPF A;  3NTH A;  1YIT A;  4WF2 A;  4DOV A;  1Q7Y C;  4R55 A;  3CCL T;  3GOX A;  3T9N A;  3QKJ A;  3V7C A;  1YIT T;  2DZ9 A;  3L1A A;  3HKS A;  1XQH A;  5HKC A;  3JSC A;  1YJ9 T;  3QG1 A;  4NL2 A;  1YIJ T;  5KE2 A;  1VIE A;  1S72 A;  2XU8 A;  3H8Z A;  3L2W A;  1Q7Y U;  3JCM P;  1FXX A;  1RI0 A;  4RCB A;  3UPU A;  4M75 C;  4M78 B;  5GMK l;  5DM7 R;  1K8A U;  1KQS S;  5GMK j;  1M90 C;  3L2Z A;  3VU3 C;  2OTL T;  2XG8 D;  4JJN K;  4M75 F;  2E1H A;  3BFM A;  4QQ6 A;  4J6X A;  2DTO A;  4J5Y A;  3QSU A;  2JTM A;  2BKD N;  5D6X A;  1M90 U;  5CAI A;  1K8A C;  4A4E A;  4M7A E;  3L42 A;  4C0G A;  3CCV A;  3I56 T;  3RKW A;  4M78 A;  2LX9 A;  5M9O A;  3MHX A;  2DZC A;  1I5L A;  1VQ9 A;  4LDV A;  3P8B B;  2HBP A;  1N9R A;  3CME T;  4M77 G;  4BUG A;  2K3Y A;  4J7I A;  1K9M U;  4MZT A;  3L2R A;  4BAC A;  3OYK A;  4CRI A;  2JOY A;  1YIJ A;  2CGH A;  4JRP A;  5CK9 A;  3S3N A;  4HCC A;  1QVG S;  1NJI C;  5D6W A;  4F7U G;  2LVM A;  2XDD A;  3CBO A;  1JJ2 S;  3SB2 A;  2XDB A;  2FB7 A;  3DB4 A;  2EQJ A;  2KVQ G;  3JCM V;  3WVD B;  5GMK m;  2JTF A;  2PU9 B;  2EJF A;  1HK9 A;  2K5F A;  3RKX A;  3JB9 I;  3HL8 A;  1EIF A;  3DLL A;  5J39 A;  3OYM A;  1H64 1;  3QXE B;  3BY7 A;  3J7A F;  5LJ5 f;  4OB1 B;  2XD0 A;  4V2S A;  5AYF A;  1ZQ1 A;  5LJ5 e;  3C94 A;  3QPH A;  1NPR A;  2EAY A;  3A8O B;  4NOY A;  3S6W A;  5LJ5 g;  1SSF A;  4C5I A;  3OB9 A;  2G3R A;  3MP1 A;  2RJE A;  5IN1 A;  3LYI A;  2I2L A;  2GFA A;  1RL2 A;  4ZN3 A;  2QQA A;  4C8Q E;  4J6Y A;  2RI5 A;  3LH0 A;  1VQ8 T;  3OYD A;  1MHN A;  5A0G A;  3GLX A;  4XTZ A;  3LWH A;  5FU7 C;  5GAN e;  3SWN B;  4FT4 A;  5GAN g;  1MGQ A;  4LDY A;  3FC3 A;  1VQ6 T;  1Q82 U;  1LJO A;  3OSV A;  2L89 A;  3ASK A;  2M0O A;  2QTX A;  3CC4 A;  4LDU A;  2P0P A;  3OYE A;  4OF1 A;  2QQR A;  3KBG A;  3UWN A;  4PJO B;  3OYY A;  4XAX B;  5CO7 A;  2LT4 A;  5GAN f;  3OS5 A;  4QVC A;  1YCY A;  4JLG A;  4XU3 A;  3AHU A;  4M7D A;  2PUO B;  5FU6 B;  4C8Q B;  3X26 B;  3X20 B;  4DA4 A;  2DIG A;  4C92 A;  5LJ3 g;  4BD3 A;  4M77 B;  4MMK A;  3JCM d;  2E64 A;  3OY9 A;  5LJ3 f;  4L5G A;  5KCH A;  2OAU A;  3G4S T;  2QDY B;  3JCM W;  1VQO T;  1M1K C;  4PJO A;  4M7D B;  3M55 A;  3ZBD A;  4M75 B;  1Q81 U;  2X4X A;  3QYG B;  3QHS A;  2VV5 A;  2K5I A;  4II1 A;  3OW2 S;  1Y07 A;  1D3B B;  2DJZ A;  2DD5 A;  5CQX A;  5GMK h;  2KMT A;  2BIV A;  5CKF A;  2WSF E;  5C0M A;  4IUR A;  5GAO n;  2LTO A;  1NZ9 A;  3GF5 A;  4QQG A;  3JB9 G;  3OQ5 A;  5CKB A;  4M78 G;  2L8D A;  4RMO A;  2Y4X A;  2ZCF B;  3C95 A;  1VUB A;  1Y96 B;  2RHI A;  4VUB A;  3OYB A;  4OMF B;  2JUF A;  4XU2 A;  4GY5 A;  3V8J A;  4J7F A;  5DY9 A;  4M7A C;  2PQW A;  4F7U F;  4ZGE B;  3CCL A;  1WJR A;  4R56 A;  2LNV A;  5FU6 C;  4N0A A;  2CZ7 B;  2DPP B;  2EQK A;  3GNF B;  4C8Q C;  5I2S A;  3OYL A;  1YJW A;  4C0D C;  2RJC A;  1Q86 C;  3M59 A;  2DK3 A;  3CC4 T;  5A2Q E;  1Y96 A;  3INZ A;  3HSB A;  2C06 A;  4PJO C;  4F7U B;  3CPW A;  3OBW A;  1FX7 A;  2DXU A;  1XNI A;  1QW1 A;  4BY6 B;  2XKO C;  3JCM b;  4A4G A;  2P0Q A;  1KC8 U;  4BE0 A;  1O75 A;  4M78 C;  1G3Y A;  2KAF A;  2DTH A;  3LGL A;  2E5Q A;  4KUD K;  2DIQ A;  3TU4 K;  4PLL A;  3CC7 A;  1N8R C;  2RJD A;  3RMS A;  5GAM h;  2QEX T;  2RJF A;  3M9Q A;  3CC7 T;  1YI2 A;  4KUI A;  3DB3 A;  1OZ3 A;  3OBY A;  5GAN h;  1ZBX A;  4RCC A;  1VQP A;  2RHY A;  4O6J A;  1B34 B;  4M7A F;  1W4S A;  3OS0 A;  2MWO A;  1YHQ T;  4M77 D;  5HY6 A;  1M1G A;  1DJ7 B;  4M77 F;  5CCA A;  3JB9 F;  1AHJ B;  3UDC A;  3CCM T;  1N8R U;  3CBM A;  3OW2 A;  4OP0 A;  4YTL A;  4DOW A;  1KHI A;  1B34 A;  2E65 A;  2FVU A;  5A0L A;  1UGP B;  3E1S A;  3LWI A;  5LJ5 h;  4PJO D;  4JDS A;  1BIB A;  4PJO F;  1YJN T;  1JJ2 A;  3HRT A;  2IG0 A;  3A5Z B;  4BDZ A;  3J81 E;  5GAN 2;  2PVD B;  2XIC A;  1G5V A;  3QUI A;  3PT9 A;  1BKB A;  2QQS A;  3MEW A;  3TCJ A;  5CVI A;  3OYH A;  3JCM h;  1OYX A;  3HPW A;  4JS4 A;  3PFS A;  3QII A;  2LCC A;  2GFU A;  1Y71 A;  4A53 A;  1R8O B;  3HRU A;  4M77 E;  3A8M B;  2XID A;  2ZZD A;  3JCM g;  3SWN C;  5FU7 B;  3MET A;  5GAO l;  3CCE T;  3P8D A;  5GAM j;  1M4Z A;  3S3O A;  1GXI E;  1KHC A;  1O9S A;  2EIF A;  3J80 E;  2JVV A;  5LJ3 d;  1VQM T;  4A4H A;  1Q81 C;  2RI3 A;  2DD4 A;  1Q82 C;  5CKH A;  2PUK B;  1BYM A;  3HFN A;  3L2U A;  3M5A A;  4B9X A;  1YJN A;  2GQV A;  4E7I A;  4LD9 K;  5J3B A;  1WPY A;  2F5K A;  2V8I A;  5FRO A;  2EKO A;  3BDU A;  4PL6 A;  3M4G A;  2ZGW A;  1M1F A;  1WGS A;  2HD0 A;  3MEU A;  1KQS A;  2VXF A;  4N4I A;  3OMG A;  5GAO r;  3CCE A;  2XK0 A;  1ZHI A;  1N9S A;  1UGS B;  4FL6 A;  3I55 A;  3CCJ A;  3CCQ T;  5IT9 E;  1K73 U;  3UT1 A;  3E19 A;  1YI2 T;  3JCM e;  1N27 A;  3X25 B;  4M7D E;  4M75 E;  3VJP A;  3PGG A;  3CPW S;  2F69 A;  4CI0 C;  4JUV A;  4C92 G;  3JB9 H;  3OYF A;  4X9C A;  4M78 D;  2KSS A;  2RH2 A;  3VUB A;  3OYN A;  3JB9 D;  3HP9 A;  4M78 F;  3L2V A;  4QVZ A;  2CZ0 B;  3HHT B;  3JRZ A;  4C5G A;  2DXT A;  3X28 B;  1YJ9 A;  1FWZ A;  5GAO p;  4BE1 A;  1VQN T;  2HNI A;  4A4K A;  1UGQ B;  1K9M C;  4N4H A;  3URG A;  3V8L A;  1YJW T;  2XDP A;  5GAM f;  4C92 E;  4JS5 A;  4XTX A;  2EJG A;  2P4T A;  3A8H B;  1NE8 A;  3FRN A;  1Y7X A;  3CD6 T;  4RG2 A;  2E10 A;  3DLM A;  3CCM A;  4ZTF A;  2LC4 A;  2FHD A;  5C6S A;  4XTU A;  1WJQ A;  4BB7 A;  3FIF A;  3JAM E;  1YHQ A;  3HRS A;  3SD4 A;  4J83 A;  3RIR A;  4ME7 A;  1NJI U;  2RM4 A;  4D6W A;  4ZTJ A;  5CIU A;  1VQK A;  4LD6 A;  3RKY A;  4XU0 A;  2RA2 A;  2H3J A;  2LQK A;  2RK2 A;  2YRV A;  1JB0 E;  2CZ1 B;  3VYG A;  3M4Y A;  4QQD A;  4QW2 A;  3V7R A;  3FLG A;  3OYA A;  2LRQ A;  3JCM J;  2V8K A;  3A8L B;  3HFO A;  3H6Z A;  4M7D D;  4M7A G;  3G71 T;  4A54 A;  4C92 F;  4OB2 B;  1S72 T;  4PJO E;  1TH7 A;  4C8Q G;  4XQ3 A;  2X4Y A;  2ZPB B;  5IAY A;  2ZPI B;  1VQ7 A;  3RES A;  3RUX A;  4PJO G;  2AHJ B;  4O5V A;  1I4K 1;  4FIB A;  3CCR A;  3LGF A;  5LJ5 j;  5EG2 A;  4BDY A;  1G3S A;  3PMT A;  3LX7 A;  2RB6 A;  3M56 A;  2JN0 A;  3O8V A;  2MAM A;  1VQ4 T;  2CKK A;  4BI3 A;  1WJS A;  1VQ5 A;  2DVE A;  3CBP A;  3CME A;  1XTD A;  2Y90 A;  3OS1 A;  1OI1 A;  2K3X A;  4HCZ A;  3CC2 T;  4L59 A;  1M5Q 1;  2MF2 A;  4FU6 A;  1KD1 U;  3OSS C;  5GAN j;  2O01 E;  3NTI A;  2RO0 A;  2ZPF B;  3N5B B;  3G7Z A;  4Z02 A;  4C92 C;  4E47 A;  5LJ3 e;  2X4J A;  4Y91 A;  1H3Z A;  2XI9 A;  4ELY C;  5LJ3 h;  2OTJ A;  4NL3 A;  4KBM B;  2VYT A;  2BUD A;  1QP3 A;  3S3M A;  1K73 C;  2QA4 T;  2DO3 A;  3QDR B;  4UC4 A;  3CXC A;  3V8K A;  3CMA T;  1KQ2 A;  2VGN A;  3NFC A;  1M8V A;  1HXD A;  2D0Q B;  4JRI A;  3OYI A;  3CCS T;  3OMC A;  4FSX A;  1QVG A;  4M7D C;  2V8J A;  3RMQ A;  2A3L A;  5GAN 8;  2YLC A;  1I8F A;  3LW5 E;  3CCS A;  5GAN d;  1VQN A;  2E6Z A;  2EYQ A;  4NS5 A;  2R58 A;  2Y4Y A;  3CMA A;  4EMK B;  2FYK A;  5GMK i;  1OZ2 A;  3VYH B;  2K4Y A;  4EMG A;  1X6O A;  3R6O A;  1PSF A;  4KT0 E;  4A4F A;  1X01 A;  1VQ9 T;  2CYZ B;  3PIP A;  2CZ6 B;  4N4G A;  2RK1 A;  2ZPH B;  4MDW A;  3VV0 A;  2EWN A;  5DLQ E;  1UGR B;  4BI8 B;  4EMK A;  1BI2 A;  4PNO A;  5D6Y A;  4ELZ C;  5LJ5 d;  2HAX A;  3E9F A;  2ZPG B;  2OTL A;  3SWN A;  4XTY A;  2P0K A;  4IUV A;  3C4S A;  3VUZ A;  2KK4 A;  2R5A A;  5DLO A;  3OYC A;  2WAC A;  5GAM g;  2GF7 A;  4ZN1 A;  4C92 D;  4LDX A;  1VQ4 A;  4X9D A;  1D3B A;  1UB4 A;  2KQW A;  5GAO q;  4E7K A;  3P8H A;  3OS2 A;  2RHZ A;  2GCX A;  4PLI A;  3VKI A;  4JRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...