3HTRA

Crystal structure of prc-barrel domain protein from rhodopseudomonas palustris
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
PETNETLKLIGSDKVQGTAVYGPDGEKIGSIERVMIEKVSGRVSYAVLSFGGFLGIGDDHYPLPWPALKYNVELGGYQVMVTVDQLERAPKYGPGSEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized PRC-barrel Domain Protein
publication title Crystal Structure of PRC-barrel Domain Protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
total genus 16
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3htrA00
2QGGA 2DYIA 1PM3A 3A1PA 2F1LA 3H9NA 3HTRA
chains in the Genus database with same CATH superfamily
3OYEA 1JJ2S 4II1A 1BI0A 1YI2T 4RKUE 4RTWA 4XTWA 4ZN3A 3CCJT 1Y0MA 2E3IA 2QGFB 1NLOC 2CH4W 1MNEA 1WX6A 1JBMA 1VQ5T 3SDZA 1CKBA 4AFQC 1GCQA 3DB3A 3I56T 1UHCA 5A0DA 1YITA 3RKYA 2ROTA 1WIEA 4MMLA 3I9QA 4F17A 1VQMT 2JZ2A 2D8JA 4HVVA 2ATCB 3NTIA 2IIMA 3A8MB 2M0YA 3CBOA 1H3ZA 2DZ9A 4M78C 3X20B 4FL6A 2QDYB 4DBHA 4KGXB 1GBRA 1M8MA 1R8OB 4M7AF 2EGAA 1BBZA 4GBQA 2XHCA 4DOWA 1GFDA 3G6EQ 2CUDA 2ZCFB 4R56A 3QUIA 4HXJA 4HCZA 2E12A 4QVZA 2M16A 4C5EA 1AWXA 2SEMA 3C4SA 1Q86C 2MF2A 2NUTA 2EJFA 5FRMA 3X28B 2QG9B 4J8OA 3CCUT 5GANd 4C8QC 4IURA 1EZZB 4FYXB 1D0XA 2RQVA 3JCMJ 4F7UE 3FB9A 4BDYA 2COWA 3A8OB 4JDSA 2MK5A 3PE0A 4M75B 4M77G 3QDRB 2DERA 4FSSA 4PJLA 3G6EA 5KYXA 1WHLA 2DPPB 4M78A 4WF2A 1I07A 3MEVA 3EGDB 2QQSA 1M3AA 4PJOC 4ME7A 2RI2A 3RBBB 3PGGA 5LJ3h 3CPWS 2EPDA 4XTYA 2JUFA 3JCMW 3VS0A 2FEIA 1AHJB 1YCSB 4K11A 1IB8A 1WNLA 2VGMA 2RPNA 2YUPA 2KY9A 3QWYA 2JM8A 2DKGA 1F1BB 1JJ2P 3LYIA 4EMKB 5J39A 3KXTA 1BIAA 1VIFA 2FVUA 4C8QA 1UECA 1MMAA 3PIPA 1VQLT 4MDXA 3CCRT 2XI9A 3CMEQ 5LJ5f 5D6WA 1YBYA 1SEMA 1ACMB 3JB9H 3UWNA 5DY9A 4J6XA 1K0SA 1KSWA 3RUXA 4ZGDB 2EKOA 3HPWA 2E6NA 3A8GB 4PJOA 4LDYA 3JCMP 2QQ9A 2DD5A 3ZFJA 1OU9A 2V8IA 3CCET 1VQPQ 1QVGA 2MWPA 2DL7A 3E1SA 2ABLA 2MPXC 2GTJA 3U23A 3CMEA 3OS2A 4LNPA 3C94A 2L8DA 2HQXA 3VS6A 3EG0A 2QTXA 4HKEA 1HXDA 2CUBA 4FU6A 3DLLA 1TXQA 2GFAA 1Y7XA 3L2VA 4XTUA 2DZCA 4L6V5 4PJJA 2ZZDA 5LJ5j 3A5ZB 4M77B 2J6KA 4IUTA 5FWBA 5A0LA 4M75E 4WCIA 5GAOr 2DF6A 4JZ3A 3E9FA 1D1CA 1N9SA 3GNGA 2EYWA 2K5FA 1KC8C 1BI1A 4J7FA 3DLMA 4JS4A 1OX8A 3HTRA 1I4K1 3T9NA 1WHGA 3CQTA 1V29B 1C1AA 1Z9QA 3EFOA 2KK4A 2JS0A 3M56A 4PK4A 2JTEA 1UFFA 3CD6Q 4J6YA 3I35A 2FO0A 3GP8A 1K76A 3CPWP 3VJPA 3OYDA 3HHTB 1QQJA 1DJ7B 3EHQA 3EH1A 4HT9A 1I5LA 5ECAA 3VS4A 2LT1A 4M7AD 2DBMA 3PNWC 1UB4A 2JXBA 3OYBA 2O88A 1Q7YC 2KYBA 2BE7D 3FJ5A 3OYFA 2L3PA 1KC8U 1VQ9Q 2NUTB 3CD6A 4J7IA 2C06A 1BCMA 1M3BA 4FT4A 1WQ7A 5IAYA 2CZ0B 1B34A 1WI7A 2P0PA 4QVDA 2DTOA 4BDZA 4Q5WA 3PT9A 2AKKA 2E64A 2QA4T 5KYXB 3ZBDA 2FL7A 1K73C 1KC8R 2RJFA 3QXEB 2XKOC 3JRZA 4IIOA 2OI3A 2EFIA 4RMOA 1VQ9A 1LVKA 2L89A 4ATOA 4RG2A 2K6DA 3VS7A 2ED1A 3LWIA 3EG9A 3NPFA 1IRXA 2FPDA 5LJ3g 3JCMV 4FSXA 5CIUA 5I2SA 2EQKA 5KYYB 4FT2A 1S72T 1WHJA 2VKNA 3E2UA 4E7JA 4IUPA 4M77E 2PTKA 3ER0A 4ANJA 2AHJB 1HYOA 2MOXA 2R5MA 4B9XA 1X75C 3GLXA 1U3OA 3VYGA 1VYVA 1QKWA 2LQWA 4C92D 5IXBA 1G3YA 4N4GA 3BY7A 2RQRA 4JRPA 3LX7A 2DEQA 4KGZB 2AZSA 1LPLA 4C8QB 2E41A 2JMAA 3RMQA 4XTVA 2CP0A 1M5Q1 3QO3A 2LQNA 4QQ6A 2CZ6B 2Y90A 4JS5A 1IHVA 4OMOA 2KXCA 2KVQG 3JCMQ 4PNOA 1JJ2A 1KFZA 1AWJA 2E6ZA 3RDVA 1WHMA 3CCJQ 4MDWA 2XMFA 2O9SA 4OMQA 3CCVT 3BW1A 4Z89A 5LJ3j 4PJOB 1VQ5Q 2VXEA 1YFNA 2K4YA 1IO6A 3I5SA 1NJIC 3I56Q 2DAQA 2E3HA 4BE0A 1VQMQ 4ZTJA 1K73R 3META 1X6GA 3NFCA 3RESA 4OMPA 1RL2A 3E9GA 2HMAA 1VQOT 2I0NA 4J9HA 3CCJA 4XTZA 4B9WA 1VQ6T 4MMKA 1OPLA 1JQQA 2KI7A 2L2PA 2MMPA 3VV0A 4IUQA 1VQ5A 1UEBA 4EMHA 4A54A 2HZYA 3JB9F 3I56A 1YIJT 3UA7A 5IHIA 4M7AC 2JJ9A 2E4HA 3L42A 2RHXA 2ENMA 1VQMA 2KT1A 3S3MA 2IVWA 2DILA 3BDLA 1PHTA 2YUNA 2LQKA 1B07A 2L3QA 3LGFA 4FYYB 1QCNA 4J6WA 1NJIU 1QW1A 3CCUQ 2PVGB 3KBGA 5GAMd 4CRIA 3UF4A 4Y91A 4FIBA 3EFOB 2AK5A 2A0FB 2RQTA 1PSEA 3M58A 1R0BG 4N0AC 4ESRA 2EAYA 2EKHA 2F1LA 3CC2T 3TQ7P 1X27A 3JSCA 5KH6A 2R57A 3P8BB 3M0UA 4ELYC 2BIVA 4C8QE 1X6BA 2DA9A 1NJIR 3H9NA 5KE2A 2LX7A 1G83A 1PC0A 3OSVA 2QDLA 1ZA2B 3CCUA 1OX9A 2K7AA 2FPFA 3V7SA 4RG8A 1AD5A 5GANf 4M7AA 4M78D 4QQDA 1JO8A 1SHGA 3KUFA 1E7OA 1HJDA 1N8RC 4X9DA 2ED0A 2BUDA 1N27A 4PJOE 3X25B 1B34B 3M59A 1YWOA 1VOMA 2CP3A 2O2OA 2LRQA 4JLGA 5AT1B 1K9MC 3OYIA 1VQLQ 2PNIA 2GF7A 2LJ3A 2I2LA 3CCRQ 3MP1A 3SFMA 3RIRA 3EHRA 4N0AA 1X69A 2RHUA 2YSQA 3FDRA 3R6NA 3DB4A 1N9RA 4BUGA 1EFNA 4C8QD 4CC2A 1FMVA 1JB0E 1M4ZA 3L1AA 2DXTA 3P8HA 1YJ9T 5KCOA 4KBMB 1PCXA 2J6FA 1GL5A 2CT3A 1ABQA 4PJMA 1VYTA 5GANj 3JB9J 2HBWA 2LJ0A 2VVKA 5GMKm 3CCEQ 1CKAA 4F7UF 4HVUA 3QZ9B 3C95A 1VQLA 1MMNA 4JRQA 3RKXA 1N8RU 2A37A 3CCRA 3HFOA 1IGQA 1OOTA 3L2RA 4PJOD 3G71T 1ABOA 2X4YA 3OYMA 2D6FA 2RB6A 3P8DA 3LGLA 4RTXA 1K9MU 4DBFA 2HEQA 3NTKA 1IZ6A 1Q95G 4X9CA 2P4TA 5KCHA 4F16A 3CPFA 2CP7A 3ME9A 3TREA 2GQVA 1N8RR 1O9SA 5L23A 3CCEA 4BI3A 1C0MA 2HQEA 2ROLA 4AMCA 4DOVA 3EGUA 3EGXA 1VQNT 4C0ZA 3PMTA 4C0GA 1K9MR 1TWBA 2Y4XA 3M4YA 1PD1A 3H0FA 5DLOA 4JPBW 4MZPA 3VS3A 3MPUB 2CZ7B 2A7YA 1HD3A 2JVVA 1G8XA 1SRLA 4M7DF 1YNZA 5GMKh 3OYGA 1IREB 4PLIA 3WVEB 1RAHB 4IIMA 3QIIA 3PVLA 4J9CA 2YDLA 4J9EA 5GAMh 1ZUKA 4FW1A 1X01A 2JTMA 1KD1U 4C92G 1CSKA 2FB7A 2X4JA 1B7TA 2WSFE 4J9GA 3OY9A 4FCYA 2M1HA 3URGA 2EW3A 2KR3A 2DE0X 3V8JA 1NBEB 2R58A 3L2ZA 2HD0A 2QA4Q 1V1CA 4M75F 5KYNA 2LJ1A 4E2FB 3JCMe 1U8RA 3IQLA 3L2QA 5CKEA 3OYJA 1KD1R 1MV0B 1TS9A 1R0CB 1BIBA 5GAN7 4FYWB 3MP6A 1Y96A 2LCLA 1RAAB 1I5OB 5CKBA 4KULA 1FMKA 3L2WA 1NYFA 3G1JA 3JCMc 3MEUA 3VRYA 1S72Q 4M7AB 4Z02A 4QQGA 2E70A 1VYUA 2PUOB 5FU6C 2DXBA 2GNCA 2KQWA 4O6JA 4LD6A 1ZSZC 2HAXA 2F69A 2AT1B 2QA4A 1FYNA 3R6OA 3M4GA 3RNJA 2D1XA 4A53A 5IHNA 1VQ8T 3OYKA 4RTZA 1S72A 2JTFA 4Y92A 3G4ST 1ZLMA 2KT8A 3RERA 1RACB 3QYGB 4OGCA 1I8FA 3CCVQ 1JXMA 4KUIA 1ZBXA 4HCCA 2HDAA 1K1ZA 2LP5A 2KMTA 3EFSA 4LUEA 1Y07A 2DYIA 1ZBJA 2J6OA 5EG2A 1GXIE 1MV3A 5GAN2 1UGRB 2QGGA 1RLPC 2HKQB 4M4ZA 5LJ5g 2FRYA 1C6VX 1X2QA 3CXCS 4RTUA 2KEAA 1ZSZA 4C92B 1VQOQ 1U1SA 2CT4A 1QLYA 2OX7A 2B8AA 3V7RA 3OBYA 1VQ6Q 2F5TX 2DX1A 2YRVA 1GRIA 3CCVA 2D0NA 4Y28E 1W2BS 1RI9A 4J9BA 2LX9A 2RMOA 1G2BA 3I55T 4LN2A 1YIJQ 3MEAA 4X34A 5CVIA 2GGRA 4M77F 2V1QA 4M78G 2DLPA 4ORZA 3EGXB 5KE3A 2DK3A 2ECZA 2EYQA 1YWPA 3VRZA 3TCJA 4BI4A 4ELZC 1M8VA 3M0SA 2CP6A 1VQOA 1VQ4T 4ZN1A 1QWEA 1U5SA 2MYSA 1K8AC 4M7AE 1M2VA 1VQPA 1M90C 1I0CA 4CI0C 5GMKi 2JMCA 3GF5A 2C0TA 1K9AA 1YIJA 1AEYA 3CC2Q 4DQ2A 3O8VA 2DBKA 1NYGA 1QVPA 2OAWA 5D6YA 2ESWA 2M0OA 4QVCA 4Z88A 5IT9E 1OYXA 1YP5A 1XNIA 4C8QG 1X43A 1WXTA 4C5HA 5CKDA 2YLCA 3FJPA 5HK3A 5C6SA 2WACA 2OTLT 1YITT 2NYSA 3M57A 3HRTA 2QAZA 4NL3A 1PKTA 2AZVA 1TH7A 1FX7A 2LCSA 5GAMf 2A36A 2E10A 1NG2A 3OS1A 2RJDA 3NMZC 4HVWA 1YJNT 2Y4YA 3CC2A 4PJOG 1TUDA 4VUBA 2EVRA 3JV3A 3VS2A 3QKJA 4WTOB 3O5ZA 1K8AU 2QK0A 1M90U 5FU7C 1UJ0A 5GANh 4CC3A 2YRDA 5A0GA 5L8RE 3VS5A 2DJQA 3NGPA 1D1AA 1WXUA 5GMKj 4F14A 4C92E 2VB6A 2RA2A 4EDUA 1XOVA 4NOYA 3CC4T 2JT4A 4XK8E 2RK1A 1Y96B 2LZ6B 1YJ9Q 1K4US 2K5LA 3CXCP 1K8AR 3OYYA 1AZEA 4IUUA 1XTDA 1M90R 2DETA 5GAMj 3QPHA 2OAUA 4AG1C 1Q82U 2GCXA 4M78B 2RD1A 1MNDA 2G3RA 4LDWA 3C0CA 5LJ5e 2AIRB 1W2BP 2SRCA 2KNBB 5GMKl 3JAME 4R55A 3G71Q 1TU0B 2RI5A 2R5AA 2DEUA 1MHNA 2X35A 2V1RA 1OQKA 1QVFS 2L3SA 2JN0A 5M9OA 1YJ9A 2LNHB 1MMGA 1T0HA 1Q82R 4E7KA 3QBYA 4RTVA 4OB1B 1AWWA 4ZGJB 1UE9A 4F04B 4ZNXA 3MCAB 2EYZA 1VQ7T 5IN1A 5GAOn 2K2VA 5IHKA 3G71A 5IH2A 2V8JA 2EJ9A 1QCFA 2CKKA 3LWHA 4LDUA 1D3BA 1YI2Q 5FU6B 1KHIA 1OULA 3M55A 2MAMA 3REAB 3TEEA 2DJZA 4BY6C 2RQUA 4GLKA 1ZSZB 4D6WA 1ARKA 1G3WA 4F7UA 2WSEE 1BCOA 2HCKA 1T0JA 5GMKe 1U1TA 3PFSA 3NTHA 4M7DC 1P92A 4LDXA 3BFMA 4OF1A 3SHWA 3EH2A 4C5IA 3HP9A 1QP2A 2COZA 1M1FA 3MKDA 4LD9K 4LDVA 1YI2A 2K9GA 2CP5A 3QWXX 1SPKA 3GPLA 8AT1B 1H8KA 1QWFA 1Y71A 1X2KA 4RCCA 1YHQT 1W4SA 3JB9I 1M2VB 3S3NA 2DL4A 2EQUA 2EQJA 1WHKA 4M78E 2L3RA 3FC3A 1NE8A 3EG2A 7AT1B 1K0XA 4PFOA 1UG1A 3LH0A 2O01E 5I21A 3MO8A 2GQIA 4TVRA 2KRNA 2EYYA 4M7DA 2EYXA 1QMCA 1M2OA 2C0OA 1KQSS 4EMGA 3NHNA 1AZGB 4AG2C 1QVFP 3EAEA 2DL5A 2XDBA 4J9FA 2LTOA 2HSEB 1JEGA 2F2WA 1SKUB 3I5RA 3H6ZA 3ZEHA 2YXYA 4A4KA 5J26A 3UATA 1H3HA 5LJ3e 4PJNA 2ZPHB 5GANg 1IGUA 1JXOA 1NZ9A 1ZUYA 3Q1JA 4XU3A 1VQ8Q 1IXDA 3VS1A 3ULRB 3J7AF 1M1KC 2QXFA 2BZXA 3M53A 3G4SQ 5GAN6 1MMDA 4GY5A 4A4HA 3S3OA 2XDDA 3M5AA 2E65A 2O9VA 1YCYA 1NPPA 2RK2A 5CQYA 1MUZA 2P0QA 2FYKA 5GAN5 2IPOB 3OYCA 4B6MA 2BZ8A 1X6OA 3H0IA 3WXMB 2FZGB 3OMCA 4AFSC 2DNUA 3CXCA 1VQ8A 3EG9B 3CC7T 1RABB 4DBQA 4BI8B 3G4SA 4FW2A 1B3QA 1KK7A 4D8KA 5EC7A 3OW2S 3M0QA 5FU7B 1AOJA 1W2BA 3I55Q 4OMFB 2DL3A 1M1KU 5FW9A 4E7LA 4HA8A 1WJRA 3UPUA 2L5QA 1LOJA 2RJCA 5KYUA 1S1NA 2W0ZA 5CKHA 2HKNA 1SHFA 4M77C 3M0TA 3CCST 3H0HA 2HBPA 4XU1A 4XAXB 4CC7A 3CMAT 2XU8A 3FEOA 1VQ4Q 5KYWA 5J3BA 1D3BB 3GNFB 4LE9A 1H641 5GAN4 2QQAA 4M7AG 2DIQA 1M1KR 1BI3A 1YJWT 5I2MA 3A1PA 3I55A 2CP2A 2MI6A 1NEBA 3J81E 1NLPC 3ASKA 2EQMA 2OTJT 1KD1C 2DXCA 1KQSP 2EGCA 4JLIA 4ZTFA 1TTHB 4IUVA 3HSBA 3AT1B 1R77A 2AKLA 3FLGA 3QYHB 2OTLQ 1Q81C 3C12A 2EJGA 1VQ4A 3CCMT 4E7ZA 1W70A 3QJ6A 2M02A 3N5BB 2K3XA 2DIGA 2CYZB 2O31A 4J9IA 1YJNQ 2QEXT 4RCBA 3UT1A 5FLXE 1QKXA 4M77A 2KRSA 2KBTA 2XICA 4A4FA 2RHYA 4HCBA 4JJBA 2W10A 2X3WD 3V8KA 1T3LA 3JB9D 2BE9B 4BY6B 3CCQT 3OYAA 2RQWA 2OTLA 5GANe 4NS5A 2G6FX 2K2MA 1ZSGA 3DKMA 3RMSA 1PRMC 2O4XA 2M51A 1OV3A 3CC4Q 3FRNA 1YJNA 9ATCB 2FRWA 5CO7A 4M7DB 4X1VA 1Q81U 2FHDA 4OVAA 1G3TA 1KQ1A 3TVTA 4E7HA 3OBWA 2EGEA 1G5VA 4OMLA 1BU1A 2RHIA 4RTTA 1GBQA 2VYTA 2YLBA 3OW2P 2DVEA 2NUPA 4PFZA 5FRNA 4UC4A 4R0KA 3OMGA 2CDTA 4HCKA 2FZKB 3CC4A 1Q81R 3WVDB 1UDLA 3GIBA 1PM3A 2X51A 1QVFA 2CS7A 2HL3A 2DYBA 2ZPFB 2EQIA 2DXUA 2DM1A 1TUGB 4EIKA 4JJCA 2EWNA 2A28A 2V8KA 1VQ7Q 5CR2A 2MWOA 1VQKT 4D8DA 4EPCA 2E5QA 1GFCA 1M1GA 5DLQE 2H8HA 1JRIA 5I11A 2ZAEA 1RAEB 2GFUA 3REBB 4JRIA 2RM4A 1RAFB 2FPEA 3JCMd 3CBMA 2MCNA 4BE1A 4KGVB 5HKCA 2XG8D 3HL8A 4ZGEB 1BK2A 5CAIA 5KYYA 2E1HA 1AWOA 2QTVA 4LXCA 4KUDK 1LCKA 3MEWA 4C92F 1NEGA 1E6GA 1Q86U 3SWNC 1VQ7A 3V8LA 2HQHA 1OPKA 3OYLA 3M0RA 2VGNA 2XD0A 3OYHA 4FM4B 2E5KA 2QYZA 2J7IA 3BE3A 3THKA 4JRKA 3CCLT 2LT4A 5KYUB 2K3BA 2RHZA 4KH1B 1GCPA 3A8HB 1AT1B 1KJWA 5KYWB 3PIOA 1Q86R 4M7DE 1OZ3A 1BKBA 4JJDA 1YHQQ 4LUDA 1SG5A 4Z8AA 5D7UA 2YUOA 2YWWA 1M9SA 3QSUA 4BE2A 3HFNA 1RI0A 2A08A 2DTIA 3QZ5B 5FROA 1UGVA 1LJOA 2P84A 1FMWA 4C0DC 1SSHA 1WGSA 1VQ6A 1RAGB 2PZ1A 3INZA 3A98A 3SWNA 1WQWA 3UDCA 2KROA 1SF9A 2HNIA 1YHQA 2JS2A 3OB9A 4O5VA 3OA6A 4A4EA 2LQ8A 1KQSA 1OU8A 4OP0A 2B86A 2KAFA 4C5GA 1TG0A 5IXFA 2KE9A 4OB3B 1PD0A 2DRMA 3FIFA 4AFUC 2CREA 2BKDN 1BB9A 4M7DD 4E6RA 2VUBA 4JUVA 1J3TA 1T3SA 1M27C 1AVZC 1EX4A 3MHXA 1IHWA 2ZPEB 2EBPA 1W1FA 2QI2A 4NL2A 5GAMg 1Q82C 1PNJA 2X9HA 2O4XB 2IG0A 4XTXA 3UA6A 2M9UA 3KFVA 4A4GA 2RN8A 2DD4A 1RADB 1XQHA 3A8LB 4OB2B 3AHUA 1UGPB 1D0ZA 1UTIA 1ZQ1A 2COYA 2FZCB 1I81A 5A2QE 1JU5C 2D8HA 1M30A 2CGHA 5DM7R 2L0AA 3GBQA 2LVMA 2V26A 2XDPA 2NUPB 2PUKB 4M78F 4M75D 2K79A 3S6WA 3CC7Q 2F2VA 3LH5A 3SB2A 4AT1B 4KH0B 2JOYA 1OZ2A 3TSWA 3OW2A 1EIFA 2QQBA 2LDMA 5GAOl 4P5NA 3SD4A 2CH4A 1BI2A 5GJVB 1ZX6A 4PFPA 5CCAA 2K57A 1WHHA 4DA4A 3CEYA 2P4RA 3G6ET 1RUWA 1TSFA 2DFUA 1QP3A 1V76A 2JNGA 1NPRA 4C8QF 2F5KA 3H8ZA 3JCMh 3TU4K 3CCSQ 3CC7A 3CMAQ 1D09B 3VUBA 1VIEA 4OGEA 1HSQA 2RF0A 4XU0A 2QASA 3JB9G 1UHFA 2YUQA 1YJWQ 5LJ3f 1E6HA 3X24B 2ZPGB 5AYFA 2J05A 1WZOA 5I22A 2VWFA 1Q7YU 1VQNQ 4RTYA 1QCOA 4BACA 1Z9ZA 4MZTA 2KSSA 2OTJQ 4PJOF 1N6AA 3D7SB 4E7SA 1WA7A 1UUEA 3EFRA 4DBRA 4E7IA 1ZUUA 3G7ZA 3CCSA 2KDSA 2Z0WA 3QG1A 3LLRA 3CMAA 5LJ5d 1MGQA 1U06A 3CCMQ 3E19A 2WSCE 3H41A 2K3YA 1FWZA 1VUBA 1PWTA 1YJWA 2C0IA 1Q7YR 2D0QB 2J06A 3VYHB 2QEXQ 1SRMA 1TOVA 1YN8A 1K73U 1VQNA 4XQ3A 3GOXA 4QKUA 2K5IA 2GBQA 3QDFA 4RUGA 2QQRA 5HCKA 2OTJA 4QW2A 1KIKA 1PSFA 1D0YA 2VV5A 1N5ZA 4MZMA 4JZ4A 2H3JA 3OYNA 2PQWA 1OI1A 8ATCB 3CCQQ 3QJYA 2RJEA 1PRLC 5GAMe 3CCMA 4KRTA 4M77D 5GAN3 3CMET 1XJWB 3PVQA 6AT1B 1A0NB 3BDUA 1PKSA 2XIDA 2KGTA 3SWNB 1OEBA 2QEXA 5HY6A 2NUZA 2LC4A 3EG3A 4PL6A 3OQ5A 5CK9A 2YT6A 3J80E 1M3CA 2X3XD 4L59A 1WYXA 1QVGS 2RNAA 1VQPT 2YRCA 1I1JA 3CCQA 1KG1A 4QT7A 1WDXA 4E47A 4DEYA 4M75C 2YHTA 4J83A 5GJWB 4L5GA 3V7CA 2NLUA 3QHSA 4N4HA 1RLQC 1LNXA 2MIOA 1UGSB 4C0FA 2DTHA 4J5YA 3OSSC 4F7UG 1RAIB 1TUCA 2VXFA 3LW5E 4JJNK 2DO3A 4C0DB 1WFWA 2CSIA 4V2SA 1WXBA 2KXDA 1VQKQ 3OS0A 4OB0B 2PU9B 4OMNA 5D6XA 2BZYA 3PTAA 4EMKC 1KHCA 3X26B 3OS5A 2HL5C 4BD3A 1ZHIA 2BTTA 4XU2A 2F2XA 3RKWA 1WJSA 5CKFA 3EG1A 3CPWA 5LL6S 3CD6T 2HSPA 3L2UA 2RI3A 4M75A 3M54A 4GLMA 4A63B 2P0KA 1O75A 1VQKA 2FG0A 5GAOq 3EGDA 1PG5B 4C92C 4IKFA 2OJ2A 5HK0A 2CZ1B 3TSZA 4BB7A 4AFZC 1UGQB 4DEXA 3HRSA 4J9DA 4KT0E 3CCLQ 3ZL7C 1HK9A 3HKSA 3PMIA 2A3LA 2XK0A 1W6XA 5GAOm 2LMJA 1VQ9T 3JCMf 5LJ3d 2JW4A 3JCMg 2DVJA 4FYVB 1D1BA 3MJXA 4PLLA 4M7DG 4PKCC 2D9TA 3MP8A 2CSQA 3M9QA 2DMOA 5CQXA 3RR6A 4EMKA 5FWCA 2PVDB 2NWMA 1WLPB 1Y57A 5GAN8 2RH2A 4OMMA 1G3SA 3CCLA 2VC8A 5LJ5h 2RO0A 2KRMA 1QVGP 1KQ2A 2KYMA 1SSFA 2GTOA 2LNVA 2JM9A 2X4WA 2ZPBB 3HRUA 1GCQC 3SEMA 1VA7A 4N4IA 2X4XA 4CC4B 4C92A 4HT8A 4F7UB 3JCMX 2PVOB 1WJQA 2DRKA 1BYMA 2ZGWA 1NM7A 1FXXA 2H3EB 3VU3C 4M75G 3F70A 3CBPA 2DL8A 2LCCA 1YITQ 1WPYA 3VKIA 1ZA1B 2ZPIB 1H92A 3JCMb 5C0MA 2VASA 3VUZA 4YTLA 3M0PA 2EIFA 5GAOp 1UJYA
chains in the Genus database with same CATH topology
2QGGA 2DYIA 1PM3A 3A1PA 2F1LA 3H9NA 3HTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGG A;  2DYI A;  1PM3 A;  3A1P A;  2F1L A;  3H9N A;  3HTR A; 
#chains in the Genus database with same CATH topology
 3OYE A;  1JJ2 S;  4II1 A;  1BI0 A;  1YI2 T;  4RKU E;  4RTW A;  4XTW A;  4ZN3 A;  3CCJ T;  1Y0M A;  2E3I A;  2QGF B;  1NLO C;  2CH4 W;  1MNE A;  1WX6 A;  1JBM A;  1VQ5 T;  3SDZ A;  1CKB A;  4AFQ C;  1GCQ A;  3DB3 A;  3I56 T;  1UHC A;  5A0D A;  1YIT A;  3RKY A;  2ROT A;  1WIE A;  4MML A;  3I9Q A;  4F17 A;  1VQM T;  2JZ2 A;  2D8J A;  4HVV A;  2ATC B;  3NTI A;  2IIM A;  3A8M B;  2M0Y A;  3CBO A;  1H3Z A;  2DZ9 A;  4M78 C;  3X20 B;  4FL6 A;  2QDY B;  4DBH A;  4KGX B;  1GBR A;  1M8M A;  1R8O B;  4M7A F;  2EGA A;  1BBZ A;  4GBQ A;  2XHC A;  4DOW A;  1GFD A;  3G6E Q;  2CUD A;  2ZCF B;  4R56 A;  3QUI A;  4HXJ A;  4HCZ A;  2E12 A;  4QVZ A;  2M16 A;  4C5E A;  1AWX A;  2SEM A;  3C4S A;  1Q86 C;  2MF2 A;  2NUT A;  2EJF A;  5FRM A;  3X28 B;  2QG9 B;  4J8O A;  3CCU T;  5GAN d;  4C8Q C;  4IUR A;  1EZZ B;  4FYX B;  1D0X A;  2RQV A;  3JCM J;  4F7U E;  3FB9 A;  4BDY A;  2COW A;  3A8O B;  4JDS A;  2MK5 A;  3PE0 A;  4M75 B;  4M77 G;  3QDR B;  2DER A;  4FSS A;  4PJL A;  3G6E A;  5KYX A;  1WHL A;  2DPP B;  4M78 A;  4WF2 A;  1I07 A;  3MEV A;  3EGD B;  2QQS A;  1M3A A;  4PJO C;  4ME7 A;  2RI2 A;  3RBB B;  3PGG A;  5LJ3 h;  3CPW S;  2EPD A;  4XTY A;  2JUF A;  3JCM W;  3VS0 A;  2FEI A;  1AHJ B;  1YCS B;  4K11 A;  1IB8 A;  1WNL A;  2VGM A;  2RPN A;  2YUP A;  2KY9 A;  3QWY A;  2JM8 A;  2DKG A;  1F1B B;  1JJ2 P;  3LYI A;  4EMK B;  5J39 A;  3KXT A;  1BIA A;  1VIF A;  2FVU A;  4C8Q A;  1UEC A;  1MMA A;  3PIP A;  1VQL T;  4MDX A;  3CCR T;  2XI9 A;  3CME Q;  5LJ5 f;  5D6W A;  1YBY A;  1SEM A;  1ACM B;  3JB9 H;  3UWN A;  5DY9 A;  4J6X A;  1K0S A;  1KSW A;  3RUX A;  4ZGD B;  2EKO A;  3HPW A;  2E6N A;  3A8G B;  4PJO A;  4LDY A;  3JCM P;  2QQ9 A;  2DD5 A;  3ZFJ A;  1OU9 A;  2V8I A;  3CCE T;  1VQP Q;  1QVG A;  2MWP A;  2DL7 A;  3E1S A;  2ABL A;  2MPX C;  2GTJ A;  3U23 A;  3CME A;  3OS2 A;  4LNP A;  3C94 A;  2L8D A;  2HQX A;  3VS6 A;  3EG0 A;  2QTX A;  4HKE A;  1HXD A;  2CUB A;  4FU6 A;  3DLL A;  1TXQ A;  2GFA A;  1Y7X A;  3L2V A;  4XTU A;  2DZC A;  4L6V 5;  4PJJ A;  2ZZD A;  5LJ5 j;  3A5Z B;  4M77 B;  2J6K A;  4IUT A;  5FWB A;  5A0L A;  4M75 E;  4WCI A;  5GAO r;  2DF6 A;  4JZ3 A;  3E9F A;  1D1C A;  1N9S A;  3GNG A;  2EYW A;  2K5F A;  1KC8 C;  1BI1 A;  4J7F A;  3DLM A;  4JS4 A;  1OX8 A;  3HTR A;  1I4K 1;  3T9N A;  1WHG A;  3CQT A;  1V29 B;  1C1A A;  1Z9Q A;  3EFO A;  2KK4 A;  2JS0 A;  3M56 A;  4PK4 A;  2JTE A;  1UFF A;  3CD6 Q;  4J6Y A;  3I35 A;  2FO0 A;  3GP8 A;  1K76 A;  3CPW P;  3VJP A;  3OYD A;  3HHT B;  1QQJ A;  1DJ7 B;  3EHQ A;  3EH1 A;  4HT9 A;  1I5L A;  5ECA A;  3VS4 A;  2LT1 A;  4M7A D;  2DBM A;  3PNW C;  1UB4 A;  2JXB A;  3OYB A;  2O88 A;  1Q7Y C;  2KYB A;  2BE7 D;  3FJ5 A;  3OYF A;  2L3P A;  1KC8 U;  1VQ9 Q;  2NUT B;  3CD6 A;  4J7I A;  2C06 A;  1BCM A;  1M3B A;  4FT4 A;  1WQ7 A;  5IAY A;  2CZ0 B;  1B34 A;  1WI7 A;  2P0P A;  4QVD A;  2DTO A;  4BDZ A;  4Q5W A;  3PT9 A;  2AKK A;  2E64 A;  2QA4 T;  5KYX B;  3ZBD A;  2FL7 A;  1K73 C;  1KC8 R;  2RJF A;  3QXE B;  2XKO C;  3JRZ A;  4IIO A;  2OI3 A;  2EFI A;  4RMO A;  1VQ9 A;  1LVK A;  2L89 A;  4ATO A;  4RG2 A;  2K6D A;  3VS7 A;  2ED1 A;  3LWI A;  3EG9 A;  3NPF A;  1IRX A;  2FPD A;  5LJ3 g;  3JCM V;  4FSX A;  5CIU A;  5I2S A;  2EQK A;  5KYY B;  4FT2 A;  1S72 T;  1WHJ A;  2VKN A;  3E2U A;  4E7J A;  4IUP A;  4M77 E;  2PTK A;  3ER0 A;  4ANJ A;  2AHJ B;  1HYO A;  2MOX A;  2R5M A;  4B9X A;  1X75 C;  3GLX A;  1U3O A;  3VYG A;  1VYV A;  1QKW A;  2LQW A;  4C92 D;  5IXB A;  1G3Y A;  4N4G A;  3BY7 A;  2RQR A;  4JRP A;  3LX7 A;  2DEQ A;  4KGZ B;  2AZS A;  1LPL A;  4C8Q B;  2E41 A;  2JMA A;  3RMQ A;  4XTV A;  2CP0 A;  1M5Q 1;  3QO3 A;  2LQN A;  4QQ6 A;  2CZ6 B;  2Y90 A;  4JS5 A;  1IHV A;  4OMO A;  2KXC A;  2KVQ G;  3JCM Q;  4PNO A;  1JJ2 A;  1KFZ A;  1AWJ A;  2E6Z A;  3RDV A;  1WHM A;  3CCJ Q;  4MDW A;  2XMF A;  2O9S A;  4OMQ A;  3CCV T;  3BW1 A;  4Z89 A;  5LJ3 j;  4PJO B;  1VQ5 Q;  2VXE A;  1YFN A;  2K4Y A;  1IO6 A;  3I5S A;  1NJI C;  3I56 Q;  2DAQ A;  2E3H A;  4BE0 A;  1VQM Q;  4ZTJ A;  1K73 R;  3MET A;  1X6G A;  3NFC A;  3RES A;  4OMP A;  1RL2 A;  3E9G A;  2HMA A;  1VQO T;  2I0N A;  4J9H A;  3CCJ A;  4XTZ A;  4B9W A;  1VQ6 T;  4MMK A;  1OPL A;  1JQQ A;  2KI7 A;  2L2P A;  2MMP A;  3VV0 A;  4IUQ A;  1VQ5 A;  1UEB A;  4EMH A;  4A54 A;  2HZY A;  3JB9 F;  3I56 A;  1YIJ T;  3UA7 A;  5IHI A;  4M7A C;  2JJ9 A;  2E4H A;  3L42 A;  2RHX A;  2ENM A;  1VQM A;  2KT1 A;  3S3M A;  2IVW A;  2DIL A;  3BDL A;  1PHT A;  2YUN A;  2LQK A;  1B07 A;  2L3Q A;  3LGF A;  4FYY B;  1QCN A;  4J6W A;  1NJI U;  1QW1 A;  3CCU Q;  2PVG B;  3KBG A;  5GAM d;  4CRI A;  3UF4 A;  4Y91 A;  4FIB A;  3EFO B;  2AK5 A;  2A0F B;  2RQT A;  1PSE A;  3M58 A;  1R0B G;  4N0A C;  4ESR A;  2EAY A;  2EKH A;  2F1L A;  3CC2 T;  3TQ7 P;  1X27 A;  3JSC A;  5KH6 A;  2R57 A;  3P8B B;  3M0U A;  4ELY C;  2BIV A;  4C8Q E;  1X6B A;  2DA9 A;  1NJI R;  3H9N A;  5KE2 A;  2LX7 A;  1G83 A;  1PC0 A;  3OSV A;  2QDL A;  1ZA2 B;  3CCU A;  1OX9 A;  2K7A A;  2FPF A;  3V7S A;  4RG8 A;  1AD5 A;  5GAN f;  4M7A A;  4M78 D;  4QQD A;  1JO8 A;  1SHG A;  3KUF A;  1E7O A;  1HJD A;  1N8R C;  4X9D A;  2ED0 A;  2BUD A;  1N27 A;  4PJO E;  3X25 B;  1B34 B;  3M59 A;  1YWO A;  1VOM A;  2CP3 A;  2O2O A;  2LRQ A;  4JLG A;  5AT1 B;  1K9M C;  3OYI A;  1VQL Q;  2PNI A;  2GF7 A;  2LJ3 A;  2I2L A;  3CCR Q;  3MP1 A;  3SFM A;  3RIR A;  3EHR A;  4N0A A;  1X69 A;  2RHU A;  2YSQ A;  3FDR A;  3R6N A;  3DB4 A;  1N9R A;  4BUG A;  1EFN A;  4C8Q D;  4CC2 A;  1FMV A;  1JB0 E;  1M4Z A;  3L1A A;  2DXT A;  3P8H A;  1YJ9 T;  5KCO A;  4KBM B;  1PCX A;  2J6F A;  1GL5 A;  2CT3 A;  1ABQ A;  4PJM A;  1VYT A;  5GAN j;  3JB9 J;  2HBW A;  2LJ0 A;  2VVK A;  5GMK m;  3CCE Q;  1CKA A;  4F7U F;  4HVU A;  3QZ9 B;  3C95 A;  1VQL A;  1MMN A;  4JRQ A;  3RKX A;  1N8R U;  2A37 A;  3CCR A;  3HFO A;  1IGQ A;  1OOT A;  3L2R A;  4PJO D;  3G71 T;  1ABO A;  2X4Y A;  3OYM A;  2D6F A;  2RB6 A;  3P8D A;  3LGL A;  4RTX A;  1K9M U;  4DBF A;  2HEQ A;  3NTK A;  1IZ6 A;  1Q95 G;  4X9C A;  2P4T A;  5KCH A;  4F16 A;  3CPF A;  2CP7 A;  3ME9 A;  3TRE A;  2GQV A;  1N8R R;  1O9S A;  5L23 A;  3CCE A;  4BI3 A;  1C0M A;  2HQE A;  2ROL A;  4AMC A;  4DOV A;  3EGU A;  3EGX A;  1VQN T;  4C0Z A;  3PMT A;  4C0G A;  1K9M R;  1TWB A;  2Y4X A;  3M4Y A;  1PD1 A;  3H0F A;  5DLO A;  4JPB W;  4MZP A;  3VS3 A;  3MPU B;  2CZ7 B;  2A7Y A;  1HD3 A;  2JVV A;  1G8X A;  1SRL A;  4M7D F;  1YNZ A;  5GMK h;  3OYG A;  1IRE B;  4PLI A;  3WVE B;  1RAH B;  4IIM A;  3QII A;  3PVL A;  4J9C A;  2YDL A;  4J9E A;  5GAM h;  1ZUK A;  4FW1 A;  1X01 A;  2JTM A;  1KD1 U;  4C92 G;  1CSK A;  2FB7 A;  2X4J A;  1B7T A;  2WSF E;  4J9G A;  3OY9 A;  4FCY A;  2M1H A;  3URG A;  2EW3 A;  2KR3 A;  2DE0 X;  3V8J A;  1NBE B;  2R58 A;  3L2Z A;  2HD0 A;  2QA4 Q;  1V1C A;  4M75 F;  5KYN A;  2LJ1 A;  4E2F B;  3JCM e;  1U8R A;  3IQL A;  3L2Q A;  5CKE A;  3OYJ A;  1KD1 R;  1MV0 B;  1TS9 A;  1R0C B;  1BIB A;  5GAN 7;  4FYW B;  3MP6 A;  1Y96 A;  2LCL A;  1RAA B;  1I5O B;  5CKB A;  4KUL A;  1FMK A;  3L2W A;  1NYF A;  3G1J A;  3JCM c;  3MEU A;  3VRY A;  1S72 Q;  4M7A B;  4Z02 A;  4QQG A;  2E70 A;  1VYU A;  2PUO B;  5FU6 C;  2DXB A;  2GNC A;  2KQW A;  4O6J A;  4LD6 A;  1ZSZ C;  2HAX A;  2F69 A;  2AT1 B;  2QA4 A;  1FYN A;  3R6O A;  3M4G A;  3RNJ A;  2D1X A;  4A53 A;  5IHN A;  1VQ8 T;  3OYK A;  4RTZ A;  1S72 A;  2JTF A;  4Y92 A;  3G4S T;  1ZLM A;  2KT8 A;  3RER A;  1RAC B;  3QYG B;  4OGC A;  1I8F A;  3CCV Q;  1JXM A;  4KUI A;  1ZBX A;  4HCC A;  2HDA A;  1K1Z A;  2LP5 A;  2KMT A;  3EFS A;  4LUE A;  1Y07 A;  2DYI A;  1ZBJ A;  2J6O A;  5EG2 A;  1GXI E;  1MV3 A;  5GAN 2;  1UGR B;  2QGG A;  1RLP C;  2HKQ B;  4M4Z A;  5LJ5 g;  2FRY A;  1C6V X;  1X2Q A;  3CXC S;  4RTU A;  2KEA A;  1ZSZ A;  4C92 B;  1VQO Q;  1U1S A;  2CT4 A;  1QLY A;  2OX7 A;  2B8A A;  3V7R A;  3OBY A;  1VQ6 Q;  2F5T X;  2DX1 A;  2YRV A;  1GRI A;  3CCV A;  2D0N A;  4Y28 E;  1W2B S;  1RI9 A;  4J9B A;  2LX9 A;  2RMO A;  1G2B A;  3I55 T;  4LN2 A;  1YIJ Q;  3MEA A;  4X34 A;  5CVI A;  2GGR A;  4M77 F;  2V1Q A;  4M78 G;  2DLP A;  4ORZ A;  3EGX B;  5KE3 A;  2DK3 A;  2ECZ A;  2EYQ A;  1YWP A;  3VRZ A;  3TCJ A;  4BI4 A;  4ELZ C;  1M8V A;  3M0S A;  2CP6 A;  1VQO A;  1VQ4 T;  4ZN1 A;  1QWE A;  1U5S A;  2MYS A;  1K8A C;  4M7A E;  1M2V A;  1VQP A;  1M90 C;  1I0C A;  4CI0 C;  5GMK i;  2JMC A;  3GF5 A;  2C0T A;  1K9A A;  1YIJ A;  1AEY A;  3CC2 Q;  4DQ2 A;  3O8V A;  2DBK A;  1NYG A;  1QVP A;  2OAW A;  5D6Y A;  2ESW A;  2M0O A;  4QVC A;  4Z88 A;  5IT9 E;  1OYX A;  1YP5 A;  1XNI A;  4C8Q G;  1X43 A;  1WXT A;  4C5H A;  5CKD A;  2YLC A;  3FJP A;  5HK3 A;  5C6S A;  2WAC A;  2OTL T;  1YIT T;  2NYS A;  3M57 A;  3HRT A;  2QAZ A;  4NL3 A;  1PKT A;  2AZV A;  1TH7 A;  1FX7 A;  2LCS A;  5GAM f;  2A36 A;  2E10 A;  1NG2 A;  3OS1 A;  2RJD A;  3NMZ C;  4HVW A;  1YJN T;  2Y4Y A;  3CC2 A;  4PJO G;  1TUD A;  4VUB A;  2EVR A;  3JV3 A;  3VS2 A;  3QKJ A;  4WTO B;  3O5Z A;  1K8A U;  2QK0 A;  1M90 U;  5FU7 C;  1UJ0 A;  5GAN h;  4CC3 A;  2YRD A;  5A0G A;  5L8R E;  3VS5 A;  2DJQ A;  3NGP A;  1D1A A;  1WXU A;  5GMK j;  4F14 A;  4C92 E;  2VB6 A;  2RA2 A;  4EDU A;  1XOV A;  4NOY A;  3CC4 T;  2JT4 A;  4XK8 E;  2RK1 A;  1Y96 B;  2LZ6 B;  1YJ9 Q;  1K4U S;  2K5L A;  3CXC P;  1K8A R;  3OYY A;  1AZE A;  4IUU A;  1XTD A;  1M90 R;  2DET A;  5GAM j;  3QPH A;  2OAU A;  4AG1 C;  1Q82 U;  2GCX A;  4M78 B;  2RD1 A;  1MND A;  2G3R A;  4LDW A;  3C0C A;  5LJ5 e;  2AIR B;  1W2B P;  2SRC A;  2KNB B;  5GMK l;  3JAM E;  4R55 A;  3G71 Q;  1TU0 B;  2RI5 A;  2R5A A;  2DEU A;  1MHN A;  2X35 A;  2V1R A;  1OQK A;  1QVF S;  2L3S A;  2JN0 A;  5M9O A;  1YJ9 A;  2LNH B;  1MMG A;  1T0H A;  1Q82 R;  4E7K A;  3QBY A;  4RTV A;  4OB1 B;  1AWW A;  4ZGJ B;  1UE9 A;  4F04 B;  4ZNX A;  3MCA B;  2EYZ A;  1VQ7 T;  5IN1 A;  5GAO n;  2K2V A;  5IHK A;  3G71 A;  5IH2 A;  2V8J A;  2EJ9 A;  1QCF A;  2CKK A;  3LWH A;  4LDU A;  1D3B A;  1YI2 Q;  5FU6 B;  1KHI A;  1OUL A;  3M55 A;  2MAM A;  3REA B;  3TEE A;  2DJZ A;  4BY6 C;  2RQU A;  4GLK A;  1ZSZ B;  4D6W A;  1ARK A;  1G3W A;  4F7U A;  2WSE E;  1BCO A;  2HCK A;  1T0J A;  5GMK e;  1U1T A;  3PFS A;  3NTH A;  4M7D C;  1P92 A;  4LDX A;  3BFM A;  4OF1 A;  3SHW A;  3EH2 A;  4C5I A;  3HP9 A;  1QP2 A;  2COZ A;  1M1F A;  3MKD A;  4LD9 K;  4LDV A;  1YI2 A;  2K9G A;  2CP5 A;  3QWX X;  1SPK A;  3GPL A;  8AT1 B;  1H8K A;  1QWF A;  1Y71 A;  1X2K A;  4RCC A;  1YHQ T;  1W4S A;  3JB9 I;  1M2V B;  3S3N A;  2DL4 A;  2EQU A;  2EQJ A;  1WHK A;  4M78 E;  2L3R A;  3FC3 A;  1NE8 A;  3EG2 A;  7AT1 B;  1K0X A;  4PFO A;  1UG1 A;  3LH0 A;  2O01 E;  5I21 A;  3MO8 A;  2GQI A;  4TVR A;  2KRN A;  2EYY A;  4M7D A;  2EYX A;  1QMC A;  1M2O A;  2C0O A;  1KQS S;  4EMG A;  3NHN A;  1AZG B;  4AG2 C;  1QVF P;  3EAE A;  2DL5 A;  2XDB A;  4J9F A;  2LTO A;  2HSE B;  1JEG A;  2F2W A;  1SKU B;  3I5R A;  3H6Z A;  3ZEH A;  2YXY A;  4A4K A;  5J26 A;  3UAT A;  1H3H A;  5LJ3 e;  4PJN A;  2ZPH B;  5GAN g;  1IGU A;  1JXO A;  1NZ9 A;  1ZUY A;  3Q1J A;  4XU3 A;  1VQ8 Q;  1IXD A;  3VS1 A;  3ULR B;  3J7A F;  1M1K C;  2QXF A;  2BZX A;  3M53 A;  3G4S Q;  5GAN 6;  1MMD A;  4GY5 A;  4A4H A;  3S3O A;  2XDD A;  3M5A A;  2E65 A;  2O9V A;  1YCY A;  1NPP A;  2RK2 A;  5CQY A;  1MUZ A;  2P0Q A;  2FYK A;  5GAN 5;  2IPO B;  3OYC A;  4B6M A;  2BZ8 A;  1X6O A;  3H0I A;  3WXM B;  2FZG B;  3OMC A;  4AFS C;  2DNU A;  3CXC A;  1VQ8 A;  3EG9 B;  3CC7 T;  1RAB B;  4DBQ A;  4BI8 B;  3G4S A;  4FW2 A;  1B3Q A;  1KK7 A;  4D8K A;  5EC7 A;  3OW2 S;  3M0Q A;  5FU7 B;  1AOJ A;  1W2B A;  3I55 Q;  4OMF B;  2DL3 A;  1M1K U;  5FW9 A;  4E7L A;  4HA8 A;  1WJR A;  3UPU A;  2L5Q A;  1LOJ A;  2RJC A;  5KYU A;  1S1N A;  2W0Z A;  5CKH A;  2HKN A;  1SHF A;  4M77 C;  3M0T A;  3CCS T;  3H0H A;  2HBP A;  4XU1 A;  4XAX B;  4CC7 A;  3CMA T;  2XU8 A;  3FEO A;  1VQ4 Q;  5KYW A;  5J3B A;  1D3B B;  3GNF B;  4LE9 A;  1H64 1;  5GAN 4;  2QQA A;  4M7A G;  2DIQ A;  1M1K R;  1BI3 A;  1YJW T;  5I2M A;  3A1P A;  3I55 A;  2CP2 A;  2MI6 A;  1NEB A;  3J81 E;  1NLP C;  3ASK A;  2EQM A;  2OTJ T;  1KD1 C;  2DXC A;  1KQS P;  2EGC A;  4JLI A;  4ZTF A;  1TTH B;  4IUV A;  3HSB A;  3AT1 B;  1R77 A;  2AKL A;  3FLG A;  3QYH B;  2OTL Q;  1Q81 C;  3C12 A;  2EJG A;  1VQ4 A;  3CCM T;  4E7Z A;  1W70 A;  3QJ6 A;  2M02 A;  3N5B B;  2K3X A;  2DIG A;  2CYZ B;  2O31 A;  4J9I A;  1YJN Q;  2QEX T;  4RCB A;  3UT1 A;  5FLX E;  1QKX A;  4M77 A;  2KRS A;  2KBT A;  2XIC A;  4A4F A;  2RHY A;  4HCB A;  4JJB A;  2W10 A;  2X3W D;  3V8K A;  1T3L A;  3JB9 D;  2BE9 B;  4BY6 B;  3CCQ T;  3OYA A;  2RQW A;  2OTL A;  5GAN e;  4NS5 A;  2G6F X;  2K2M A;  1ZSG A;  3DKM A;  3RMS A;  1PRM C;  2O4X A;  2M51 A;  1OV3 A;  3CC4 Q;  3FRN A;  1YJN A;  9ATC B;  2FRW A;  5CO7 A;  4M7D B;  4X1V A;  1Q81 U;  2FHD A;  4OVA A;  1G3T A;  1KQ1 A;  3TVT A;  4E7H A;  3OBW A;  2EGE A;  1G5V A;  4OML A;  1BU1 A;  2RHI A;  4RTT A;  1GBQ A;  2VYT A;  2YLB A;  3OW2 P;  2DVE A;  2NUP A;  4PFZ A;  5FRN A;  4UC4 A;  4R0K A;  3OMG A;  2CDT A;  4HCK A;  2FZK B;  3CC4 A;  1Q81 R;  3WVD B;  1UDL A;  3GIB A;  1PM3 A;  2X51 A;  1QVF A;  2CS7 A;  2HL3 A;  2DYB A;  2ZPF B;  2EQI A;  2DXU A;  2DM1 A;  1TUG B;  4EIK A;  4JJC A;  2EWN A;  2A28 A;  2V8K A;  1VQ7 Q;  5CR2 A;  2MWO A;  1VQK T;  4D8D A;  4EPC A;  2E5Q A;  1GFC A;  1M1G A;  5DLQ E;  2H8H A;  1JRI A;  5I11 A;  2ZAE A;  1RAE B;  2GFU A;  3REB B;  4JRI A;  2RM4 A;  1RAF B;  2FPE A;  3JCM d;  3CBM A;  2MCN A;  4BE1 A;  4KGV B;  5HKC A;  2XG8 D;  3HL8 A;  4ZGE B;  1BK2 A;  5CAI A;  5KYY A;  2E1H A;  1AWO A;  2QTV A;  4LXC A;  4KUD K;  1LCK A;  3MEW A;  4C92 F;  1NEG A;  1E6G A;  1Q86 U;  3SWN C;  1VQ7 A;  3V8L A;  2HQH A;  1OPK A;  3OYL A;  3M0R A;  2VGN A;  2XD0 A;  3OYH A;  4FM4 B;  2E5K A;  2QYZ A;  2J7I A;  3BE3 A;  3THK A;  4JRK A;  3CCL T;  2LT4 A;  5KYU B;  2K3B A;  2RHZ A;  4KH1 B;  1GCP A;  3A8H B;  1AT1 B;  1KJW A;  5KYW B;  3PIO A;  1Q86 R;  4M7D E;  1OZ3 A;  1BKB A;  4JJD A;  1YHQ Q;  4LUD A;  1SG5 A;  4Z8A A;  5D7U A;  2YUO A;  2YWW A;  1M9S A;  3QSU A;  4BE2 A;  3HFN A;  1RI0 A;  2A08 A;  2DTI A;  3QZ5 B;  5FRO A;  1UGV A;  1LJO A;  2P84 A;  1FMW A;  4C0D C;  1SSH A;  1WGS A;  1VQ6 A;  1RAG B;  2PZ1 A;  3INZ A;  3A98 A;  3SWN A;  1WQW A;  3UDC A;  2KRO A;  1SF9 A;  2HNI A;  1YHQ A;  2JS2 A;  3OB9 A;  4O5V A;  3OA6 A;  4A4E A;  2LQ8 A;  1KQS A;  1OU8 A;  4OP0 A;  2B86 A;  2KAF A;  4C5G A;  1TG0 A;  5IXF A;  2KE9 A;  4OB3 B;  1PD0 A;  2DRM A;  3FIF A;  4AFU C;  2CRE A;  2BKD N;  1BB9 A;  4M7D D;  4E6R A;  2VUB A;  4JUV A;  1J3T A;  1T3S A;  1M27 C;  1AVZ C;  1EX4 A;  3MHX A;  1IHW A;  2ZPE B;  2EBP A;  1W1F A;  2QI2 A;  4NL2 A;  5GAM g;  1Q82 C;  1PNJ A;  2X9H A;  2O4X B;  2IG0 A;  4XTX A;  3UA6 A;  2M9U A;  3KFV A;  4A4G A;  2RN8 A;  2DD4 A;  1RAD B;  1XQH A;  3A8L B;  4OB2 B;  3AHU A;  1UGP B;  1D0Z A;  1UTI A;  1ZQ1 A;  2COY A;  2FZC B;  1I81 A;  5A2Q E;  1JU5 C;  2D8H A;  1M30 A;  2CGH A;  5DM7 R;  2L0A A;  3GBQ A;  2LVM A;  2V26 A;  2XDP A;  2NUP B;  2PUK B;  4M78 F;  4M75 D;  2K79 A;  3S6W A;  3CC7 Q;  2F2V A;  3LH5 A;  3SB2 A;  4AT1 B;  4KH0 B;  2JOY A;  1OZ2 A;  3TSW A;  3OW2 A;  1EIF A;  2QQB A;  2LDM A;  5GAO l;  4P5N A;  3SD4 A;  2CH4 A;  1BI2 A;  5GJV B;  1ZX6 A;  4PFP A;  5CCA A;  2K57 A;  1WHH A;  4DA4 A;  3CEY A;  2P4R A;  3G6E T;  1RUW A;  1TSF A;  2DFU A;  1QP3 A;  1V76 A;  2JNG A;  1NPR A;  4C8Q F;  2F5K A;  3H8Z A;  3JCM h;  3TU4 K;  3CCS Q;  3CC7 A;  3CMA Q;  1D09 B;  3VUB A;  1VIE A;  4OGE A;  1HSQ A;  2RF0 A;  4XU0 A;  2QAS A;  3JB9 G;  1UHF A;  2YUQ A;  1YJW Q;  5LJ3 f;  1E6H A;  3X24 B;  2ZPG B;  5AYF A;  2J05 A;  1WZO A;  5I22 A;  2VWF A;  1Q7Y U;  1VQN Q;  4RTY A;  1QCO A;  4BAC A;  1Z9Z A;  4MZT A;  2KSS A;  2OTJ Q;  4PJO F;  1N6A A;  3D7S B;  4E7S A;  1WA7 A;  1UUE A;  3EFR A;  4DBR A;  4E7I A;  1ZUU A;  3G7Z A;  3CCS A;  2KDS A;  2Z0W A;  3QG1 A;  3LLR A;  3CMA A;  5LJ5 d;  1MGQ A;  1U06 A;  3CCM Q;  3E19 A;  2WSC E;  3H41 A;  2K3Y A;  1FWZ A;  1VUB A;  1PWT A;  1YJW A;  2C0I A;  1Q7Y R;  2D0Q B;  2J06 A;  3VYH B;  2QEX Q;  1SRM A;  1TOV A;  1YN8 A;  1K73 U;  1VQN A;  4XQ3 A;  3GOX A;  4QKU A;  2K5I A;  2GBQ A;  3QDF A;  4RUG A;  2QQR A;  5HCK A;  2OTJ A;  4QW2 A;  1KIK A;  1PSF A;  1D0Y A;  2VV5 A;  1N5Z A;  4MZM A;  4JZ4 A;  2H3J A;  3OYN A;  2PQW A;  1OI1 A;  8ATC B;  3CCQ Q;  3QJY A;  2RJE A;  1PRL C;  5GAM e;  3CCM A;  4KRT A;  4M77 D;  5GAN 3;  3CME T;  1XJW B;  3PVQ A;  6AT1 B;  1A0N B;  3BDU A;  1PKS A;  2XID A;  2KGT A;  3SWN B;  1OEB A;  2QEX A;  5HY6 A;  2NUZ A;  2LC4 A;  3EG3 A;  4PL6 A;  3OQ5 A;  5CK9 A;  2YT6 A;  3J80 E;  1M3C A;  2X3X D;  4L59 A;  1WYX A;  1QVG S;  2RNA A;  1VQP T;  2YRC A;  1I1J A;  3CCQ A;  1KG1 A;  4QT7 A;  1WDX A;  4E47 A;  4DEY A;  4M75 C;  2YHT A;  4J83 A;  5GJW B;  4L5G A;  3V7C A;  2NLU A;  3QHS A;  4N4H A;  1RLQ C;  1LNX A;  2MIO A;  1UGS B;  4C0F A;  2DTH A;  4J5Y A;  3OSS C;  4F7U G;  1RAI B;  1TUC A;  2VXF A;  3LW5 E;  4JJN K;  2DO3 A;  4C0D B;  1WFW A;  2CSI A;  4V2S A;  1WXB A;  2KXD A;  1VQK Q;  3OS0 A;  4OB0 B;  2PU9 B;  4OMN A;  5D6X A;  2BZY A;  3PTA A;  4EMK C;  1KHC A;  3X26 B;  3OS5 A;  2HL5 C;  4BD3 A;  1ZHI A;  2BTT A;  4XU2 A;  2F2X A;  3RKW A;  1WJS A;  5CKF A;  3EG1 A;  3CPW A;  5LL6 S;  3CD6 T;  2HSP A;  3L2U A;  2RI3 A;  4M75 A;  3M54 A;  4GLM A;  4A63 B;  2P0K A;  1O75 A;  1VQK A;  2FG0 A;  5GAO q;  3EGD A;  1PG5 B;  4C92 C;  4IKF A;  2OJ2 A;  5HK0 A;  2CZ1 B;  3TSZ A;  4BB7 A;  4AFZ C;  1UGQ B;  4DEX A;  3HRS A;  4J9D A;  4KT0 E;  3CCL Q;  3ZL7 C;  1HK9 A;  3HKS A;  3PMI A;  2A3L A;  2XK0 A;  1W6X A;  5GAO m;  2LMJ A;  1VQ9 T;  3JCM f;  5LJ3 d;  2JW4 A;  3JCM g;  2DVJ A;  4FYV B;  1D1B A;  3MJX A;  4PLL A;  4M7D G;  4PKC C;  2D9T A;  3MP8 A;  2CSQ A;  3M9Q A;  2DMO A;  5CQX A;  3RR6 A;  4EMK A;  5FWC A;  2PVD B;  2NWM A;  1WLP B;  1Y57 A;  5GAN 8;  2RH2 A;  4OMM A;  1G3S A;  3CCL A;  2VC8 A;  5LJ5 h;  2RO0 A;  2KRM A;  1QVG P;  1KQ2 A;  2KYM A;  1SSF A;  2GTO A;  2LNV A;  2JM9 A;  2X4W A;  2ZPB B;  3HRU A;  1GCQ C;  3SEM A;  1VA7 A;  4N4I A;  2X4X A;  4CC4 B;  4C92 A;  4HT8 A;  4F7U B;  3JCM X;  2PVO B;  1WJQ A;  2DRK A;  1BYM A;  2ZGW A;  1NM7 A;  1FXX A;  2H3E B;  3VU3 C;  4M75 G;  3F70 A;  3CBP A;  2DL8 A;  2LCC A;  1YIT Q;  1WPY A;  3VKI A;  1ZA1 B;  2ZPI B;  1H92 A;  3JCM b;  5C0M A;  2VAS A;  3VUZ A;  4YTL A;  3M0P A;  2EIF A;  5GAO p;  1UJY A; 
#chains in the Genus database with same CATH homology
 2QGG A;  2DYI A;  1PM3 A;  3A1P A;  2F1L A;  3H9N A;  3HTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...