3HTRA

Crystal structure of prc-barrel domain protein from rhodopseudomonas palustris
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
b'PETNETLKLIGSDKVQGTAVYGPDGEKIGSIERVMIEKVSGRVSYAVLSFGGFLGIGDDHYPLPWPALKYNVELGGYQVMVTVDQLERAPKYGPGSEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized PRC-barrel Domain Protein
publication title Crystal Structure of PRC-barrel Domain Protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 16
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3htrA00
1PM3A 3A1PA 3HTRA 2DYIA 2F1LA 3H9NA 2QGGA
chains in the Genus database with same CATH superfamily
1YJ9T 3M58A 4OMOA 4PJOE 2DM1A 4Z89A 4FU6A 2QA4Q 1SG5A 1IB8A 5CQXA 4BI4A 1KQSA 1GCQC 5GAN3 3O5ZA 3UWNA 3LWIA 4RTVA 3LH0A 2YHTA 2QEXT 1CSKA 1WA7A 2YLBA 2KSSA 2PVDB 3RESA 5KYXA 1VYUA 2JTEA 4HKEA 2XDDA 4QVDA 4OGEA 1U1TA 5KYWB 1I5LA 3TSZA 1SPKA 1JJ2S 4TVRA 1UHFA 1VQ7Q 1WDXA 2QQSA 1K9AA 4C92G 2CP0A 1D1AA 2RHXA 2CP6A 2KT8A 2NUTA 2DKGA 2VWFA 4HCCA 3UA7A 2EPDA 2KDSA 4RG2A 1QVGS 4XTZA 2SRCA 3NPFA 4HT8A 5GAMg 4ZN1A 2GFAA 1X01A 3NHNA 1KD1R 3G71T 4DBFA 1AZEA 3O8VA 4QQ6A 1JXOA 2K2VA 1M9SA 2RK2A 1WHLA 3CCRQ 2BE7D 1M3AA 2EIFA 4BE1A 2D6FA 1MHNA 1IO6A 4N0AC 1A0NB 2E70A 2LVMA 2JN0A 2QQRA 2M9UA 3LX7A 2O2OA 4IKFA 1C1AA 4AMCA 2DXUA 1AEYA 2E5QA 1JO8A 2LJ0A 3ZEHA 3EHRA 4JLGA 1VQLQ 3RMSA 2MAMA 4M7DG 3A8LB 3NTKA 4FL6A 4R56A 2V26A 2YDLA 1CKAA 3EG2A 1Q7YR 2PUKB 4M7DE 4CRIA 1VQNQ 2RPNA 2XU8A 2JTMA 4F7UA 2RQTA 1MGQA 2F5KA 1OX9A 3M59A 5D6WA 4N4GA 1KC8C 3G4SQ 3HFNA 5CKBA 1I8FA 5KYXB 3BDLA 2YUOA 3SWNA 1QMCA 4A63B 2DX1A 1YIJQ 2ESWA 1IREB 4RTUA 3OMCA 2RF0A 2JZ2A 3DLLA 4FYYB 3CCLQ 4B9WA 3VS0A 1XTDA 4XU1A 3JCMb 4D6WA 4MDXA 3PT9A 2RQWA 5AT1B 3M0PA 3OBYA 4M77D 2NUTB 1K8AR 2HBPA 3CCVT 2DPPB 1J3TA 2ZPEB 2VYTA 1UGVA 3TCJA 4DEXA 1VQ9Q 4M75E 2ZAEA 2G3RA 2EYYA 4M7AG 2JS0A 1KFZA 5GANd 3UDCA 1NPPA 2EGCA 2LP5A 2ZCFB 2DTIA 4LD9K 2D8HA 4OMMA 1I5OB 1KG1A 1PKSA 3V7SA 2PTKA 4MZPA 3M0RA 4RTTA 1VQ8A 2CYZB 1UB4A 1IXDA 3ZFJA 1VQ5T 3TVTA 1RAAB 4BUGA 4PFOA 1R0CB 4K11A 1VOMA 4J9CA 3D7SB 2FZCB 3CC4Q 2YRVA 4ELZC 4Z8AA 4RTZA 2LQWA 2KROA 4C92F 1G3WA 4LDWA 3BFMA 3C12A 2DEUA 2EW3A 2LX7A 4ZNXA 4JUVA 3CCQA 2RJEA 1TSFA 2DETA 3C0CA 4M4ZA 4AFQC 1E6HA 4PJOD 2KYMA 4PFPA 3VS2A 1TWBA 2DA9A 1QVPA 5KYYA 3I5RA 2J6OA 1K73C 2YSQA 5J26A 4C5GA 2QDYB 5GMKi 1V76A 2YUPA 3EGUA 2V8IA 1NJIR 1SRLA 4M77A 5I11A 4BI3A 1Q82R 2MMPA 1GBQA 3C95A 1Q81U 1VQNT 2QASA 3PFSA 5A0LA 1PWTA 4RTYA 2RJDA 3JB9G 3CCJA 1SF9A 1V1CA 1KJWA 1Z9ZA 3RKYA 4KH0B 2E5KA 3PGGA 4AT1B 2DBMA 2OI3A 5FU7C 1K4US 1NEBA 1RAFB 3CCUT 2XMFA 2Z0WA 5I21A 5LJ3d 1M8VA 4M7DF 1Y96A 4FSSA 2RK1A 3OMGA 2FEIA 1B3QA 1ZA2B 3CCLT 4XTVA 3OY9A 2DO3A 3CCQQ 4FW1A 3JB9H 2X51A 2E1HA 5CCAA 3CMEA 2LT1A 3GBQA 4X9DA 3QJYA 3A8GB 2OTJA 2BTTA 2OTLT 4KGZB 3I5SA 2KE9A 5GMKe 2YUNA 1YNZA 3TU4K 2D1XA 2GFUA 3M57A 4KUIA 5FLXE 2EKOA 2ABLA 2R58A 2EKHA 1QW1A 5FU7B 3H0FA 5I22A 4F16A 5CKHA 4JDSA 3LH5A 1M90U 4WCIA 5CR2A 3A1PA 1BU1A 2AZVA 2FPEA 4Q5WA 3JAME 1JJ2A 1UG1A 4M7DD 2IVWA 2HL5C 1HXDA 1N9RA 1N27A 4FYWB 3CC4T 4M7AF 1CKBA 5KYYB 2P84A 1WHMA 2O31A 4LD6A 2EBPA 1IRXA 1BB9A 3ZBDA 2EAYA 3OYHA 4Z02A 1QVGA 1T0HA 5LJ5g 5GANj 1M1KU 3OQ5A 1X75C 2A28A 1JB0E 1B34A 1ZUKA 6AT1B 1TS9A 4C92A 3GP8A 1UJYA 1K0SA 4M78G 5HY6A 3KUFA 4KGXB 1VIEA 5D6YA 3H9NA 2FZGB 2DYBA 2V8KA 3M55A 1B07A 5IXFA 2VXEA 1ZLMA 4WTOB 3CCMA 1QWFA 1MNEA 4M75D 1KD1C 4J9BA 3OYJA 3E2UA 1YWPA 1BIBA 4BI8B 1JEGA 3SFMA 4A4KA 1HYOA 4J83A 2YUQA 5IAYA 4OMPA 1K9MU 2E12A 2M0OA 3FIFA 4XU0A 1RLPC 1X6BA 3QBYA 5I2SA 3EG3A 2CZ1B 4C92C 2DIQA 1YJWA 2KRNA 1VQ4T 3EHQA 1NYGA 2GTOA 1LCKA 5GAMe 3CCQT 2DERA 3JB9F 4AFSC 4M7DA 5CVIA 2R57A 1FX7A 1KHCA 1VQOA 3CPWS 8ATCB 3M0QA 2E64A 2CP3A 1F1BB 1NBEB 2CSIA 4J8OA 2HEQA 5DY9A 1Q7YC 2P0KA 1BIAA 1NZ9A 1VYTA 4PLLA 2E6ZA 1AWJA 4JRPA 3I55A 1OU8A 2YRCA 2D9TA 3FJ5A 1RI9A 1WXBA 2RH2A 3META 1IGQA 1W4SA 4CC7A 2XD0A 1NG2A 2XICA 2VUBA 1M27C 2XIDA 4C92B 5KYNA 2XK0A 2NLUA 2DAQA 3QPHA 5A0GA 3CD6A 3QO3A 2OX7A 2XDPA 2M02A 4M7DC 4L6V5 3OYDA 3L2VA 3URGA 4M75A 1VQ8Q 2JNGA 4BD3A 4RMOA 2KQWA 2BE9B 2K2MA 3NFCA 4IUQA 2DLPA 3QJ6A 1U06A 4LN2A 2FHDA 1YFNA 1VQ6Q 4Z88A 4BY6C 3CC7T 3OSVA 2J05A 2AT1B 1X6GA 3P8HA 2DMOA 2DF6A 2H3EB 2HSPA 3V8LA 2F2XA 1Y0MA 4JRQA 1VQKA 2XI9A 2ENMA 4DEYA 3E19A 1O9SA 2RI3A 3M0TA 1NPRA 4BDZA 1OV3A 1VQMA 1Q95G 2EWNA 3MHXA 3JV3A 3GOXA 3SD4A 3QSUA 4M75C 1I81A 4MDWA 5DM7R 2JVVA 2OJ2A 4OF1A 5L8RE 2NYSA 1LJOA 4M78F 3CCJQ 3PE0A 3M9QA 3EGDA 4M7AC 2JJ9A 1N8RR 3OYIA 1FYNA 4E7KA 4E7SA 3CCEA 4BY6B 1G3TA 3M0SA 1RAGB 2CUBA 5AYFA 1OPLA 4J9GA 4MZTA 1T3LA 1NJIC 2X3WD 4X34A 4BE0A 5GMKm 1YITA 1Q82C 1QKWA 1ZBJA 1BYMA 1ZBXA 2OAWA 2LRQA 4PL6A 3JCMX 1ZSZC 4J6XA 4J9DA 1ZQ1A 2ECZA 4QVZA 2MIOA 2OTJQ 4RCCA 1FMKA 2X9HA 3G7ZA 1UECA 2DL7A 1W2BP 4E47A 4PK4A 2K79A 2F2VA 4DBRA 4M7AB 4A4GA 1WPYA 3S3NA 4XK8E 4PJJA 2AZSA 2EYZA 1YI2T 1WHJA 2CH4W 5KH6A 4J9IA 1WLPB 3F70A 4N0AA 4ZTFA 3RKXA 4GLKA 2CZ7B 4HXJA 4EDUA 1BI1A 4EPCA 2QG9B 3INZA 4C5HA 1NEGA 1LOJA 1ZSZB 2C0IA 3HHTB 3VS3A 2C0OA 2P0PA 1IHVA 5GMKl 1OQKA 4C92E 3NMZC 3FRNA 2HQHA 1M1KR 4JJBA 2KT1A 2LCLA 1BBZA 2MPXC 4HA8A 2M1HA 5GANh 2EQIA 1MNDA 3EGDB 3VU3C 2K7AA 2HD0A 4IUTA 3VJPA 4HCBA 3MP8A 4YTLA 3OYAA 3KXTA 3CEYA 4FT2A 3J81E 2A36A 4JJDA 1WYXA 2RMOA 3BDUA 1MUZA 1Q86U 5CK9A 3CCJT 1BI2A 2L89A 3L2ZA 1NLPC 3CCMQ 4D8DA 2IIMA 2DD4A 3PTAA 3FLGA 1XQHA 2J7IA 1OI1A 1YHQA 9ATCB 2JM9A 1JBMA 2CSQA 2MCNA 1WI7A 2RB6A 1YCYA 4J5YA 1GRIA 5LJ5d 3PNWC 2X35A 4KGVB 1NE8A 3SDZA 2LCCA 1TG0A 1YJNA 1YJWQ 4HVVA 1WNLA 3DKMA 2QTXA 2RHZA 5LJ5e 2ZPFB 3CMET 2XHCA 1KHIA 1VQOQ 1KC8U 2V1RA 4F14A 3CPWP 2VKNA 4IUPA 3JCMf 2EFIA 3OYEA 4MZMA 2F1LA 3REBB 3CPWA 1WHHA 1B7TA 5GAN2 3H8ZA 5C0MA 1M3CA 2QA4T 3BY7A 8AT1B 2C0TA 3JCMP 1M1GA 2COWA 4M78C 2IG0A 2LQNA 3I55Q 3MEWA 5FU6C 5CKFA 2XG8D 4ATOA 3GNGA 1G5VA 5D6XA 5LJ3h 4IIMA 5LL6S 2EJ9A 2E3IA 2QK0A 5IHKA 1SRMA 2MWPA 2HDAA 5GAN7 3CD6Q 1IGUA 1VQ7T 4F17A 2RM4A 4N4IA 4EMHA 2DTOA 1D0ZA 1VYVA 1WJSA 3M4YA 1U8RA 4M7AE 2QI2A 3EG1A 3EFSA 2V1QA 3QZ9B 3CCSA 2X4WA 1YWOA 1G3SA 2NWMA 2HNIA 1IZ6A 3OYFA 4DOVA 1YJ9A 3HPWA 2QQBA 3UA6A 5C6SA 1UEBA 2LJ3A 4Y28E 2EYWA 1X69A 2DL5A 4HVUA 4M78B 2MI6A 3CCRT 1H3HA 1DJ7B 1QCFA 5FU6B 3I35A 2QEXA 1VQ6A 1VQKQ 5GJWB 2MF2A 2WSEE 4KRTA 3PVQA 2CH4A 5FWCA 1X2KA 3J7AF 4C0ZA 3CCMT 1VQMQ 3GIBA 1AZGB 4QQDA 1MV0B 1N6AA 5FRMA 1JXMA 2DL4A 3H41A 1W1FA 2O88A 2QDLA 1PCXA 1VQLT 4E7LA 4IUVA 1I4K1 5A2QE 1K73U 1PG5B 2HSEB 1YBYA 1Y7XA 2FRYA 3RMQA 3ASKA 1WJRA 5GAOr 4XAXB 2CZ6B 4J9HA 3PMIA 5GAOm 2PVGB 3QIIA 2RHUA 1V29B 3CCEQ 1WZOA 4QT7A 1ZHIA 2HBWA 1ZX6A 2LNVA 3S3MA 4BDYA 1WJQA 3EFRA 3R6OA 1Y57A 1VQOT 3G4ST 1RABB 2B86A 3PMTA 1K0XA 2FVUA 2ZZDA 1YITQ 2FO0A 1YIJT 3CC2A 4HVWA 3GLXA 4C92D 4FCYA 2J6KA 4ZTJA 1H641 3FB9A 5GAOp 2R5MA 1N8RC 2D8JA 1C6VX 2DZCA 1X27A 2MOXA 2K6DA 2PQWA 2DE0X 2ED0A 2KI7A 5GAOq 3HL8A 3EG0A 3MO8A 1G83A 1AHJB 1BKBA 1VQ9T 3VRZA 1W2BS 1QP3A 3V7RA 2KGTA 1WQ7A 5HK0A 2QQ9A 3X26B 2DVJA 2JT4A 4C0GA 4JLIA 1G2BA 1OYXA 3OS1A 5GAOl 2R5AA 3RIRA 1UJ0A 4ANJA 4MMKA 2JW4A 1HD3A 2DIGA 2RI5A 1FXXA 4A4EA 2AK5A 1UGQB 4OB2B 1QQJA 5KCOA 2L3QA 1M3BA 2LDMA 5GANf 3G6EA 3EFOB 1HSQA 5L23A 4OP0A 3VV0A 4MMLA 1VQKT 2RQVA 1WHGA 5FROA 2O9VA 2GQIA 3CCVA 1D0XA 3JB9I 3AT1B 2HAXA 2B8AA 2DJQA 4OMLA 1RUWA 2KRSA 2ZPHB 5HCKA 3RKWA 2DXTA 3M56A 1LNXA 4M78E 2LMJA 2BKDN 3MEAA 4J7IA 1M1KC 5IN1A 2QGGA 1YHQQ 3LYIA 2K9GA 3QWYA 4LE9A 2X4YA 2DXBA 3L2QA 4C8QG 4FYXB 3LGFA 2P0QA 1KD1U 1VQ5A 4ZGJB 4ZGDB 4F04B 2LQKA 1WIEA 4C8QE 2KXCA 7AT1B 1X6OA 2BUDA 2WSFE 4LDUA 5GAMd 3OYBA 1YJNQ 2L3RA 1XOVA 4JS5A 4M7AD 3QUIA 5J3BA 2RO0A 3M54A 2CREA 2Y4YA 3EG9B 4PFZA 1D09B 5I2MA 4F7UG 4BE2A 4E7HA 1T0JA 2DJZA 4GY5A 2DILA 3RBBB 2GCXA 4OMFB 2FPDA 2YWWA 2BZ8A 1G3YA 1TTHB 3UF4A 4JPBW 2DK3A 1UGPB 4L5GA 1K9MC 1PD0A 3JRZA 3HKSA 2X4XA 3FC3A 4LDYA 1M4ZA 4BACA 1Q7YU 1WQWA 5LJ3f 3L1AA 3AHUA 3CQTA 1SEMA 4B6MA 1QCOA 2D0NA 3JCMh 3G1JA 2F69A 4FSXA 5GAOn 1U5SA 2EQKA 5GANg 2O01E 3RUXA 2VGMA 5LJ3j 1TUGB 2KK4A 1VQPA 3HFOA 4OMNA 5GAN8 2V8JA 1Y07A 3CCUA 3A8HB 5FRNA 5IHIA 5GMKj 1PSEA 2KY9A 2GBQA 3PIPA 4E2FB 3CCSQ 2JOYA 1BI0A 1IHWA 1M30A 3OW2S 1RL2A 1YJ9Q 2EQJA 3HRTA 1K8AU 3OS2A 1O75A 1RI0A 3JB9D 2DRKA 1QCNA 2QYZA 2AKKA 3QHSA 2VXFA 2A08A 3MEUA 1WX6A 4M7AA 2K3BA 2ROLA 2OTLA 1D0YA 2CT4A 1MMGA 3A8OB 1HK9A 2QEXQ 5GJVB 4DOWA 5CAIA 1YN8A 4E6RA 1JRIA 1M2OA 1GXIE 1ACMB 3J80E 2LJ1A 2FB7A 3M5AA 1YHQT 2HQXA 1TH7A 2L3SA 1K1ZA 3JB9J 1T3SA 1OULA 5KYUA 1QLYA 2ZPIB 2COYA 1ZSZA 2MK5A 2JUFA 5CO7A 2E6NA 5DLOA 1WXUA 1RAEB 4M77G 3REAB 1Q81R 1PSFA 1ZUYA 1QP2A 2K3XA 2C06A 3JCMW 3VS4A 2DZ9A 1QVFP 2DFUA 5LJ3g 1AOJA 1XJWB 4X9CA 3FJPA 4PKCC 1KQ1A 4C8QF 3CC2Q 4RTXA 2DNUA 2NUZA 4ZN3A 1U1SA 3QYHB 1NJIU 2KXDA 4PJLA 2AIRB 1Q82U 3OS0A 2FYKA 3EAEA 3JCMV 4LUDA 1EFNA 2AKLA 5J39A 4NL2A 4F7UF 4ESRA 1PRMC 4KUDK 2XDBA 3LLRA 1GFDA 1SHFA 1AWOA 4EMKA 3CMAA 4OB3B 1UGSB 4M78D 1W2BA 2KR3A 5FWBA 1GBRA 2O9SA 3VYGA 5KCHA 3CCST 2VV5A 1M90R 2RD1A 3HTRA 1VQ4A 4PJOG 2BIVA 2CKKA 4V2SA 1VQ8T 2HL3A 4HCZA 2J6FA 1YP5A 1KQSP 2L2PA 3M4GA 4C8QD 2EJGA 2FRWA 2EYXA 3VRYA 2EJFA 3G6EQ 1GCPA 3L2UA 3BE3A 2LX9A 1WXTA 2DBKA 1VQ6T 5KYUB 3A5ZB 1RAIB 2PVOB 4LDVA 3CCVQ 4JRKA 1PHTA 4OVAA 3QZ5B 1R8OB 1TOVA 1W70A 2M0YA 1PD1A 4EMKC 4LXCA 2K3YA 2GQVA 3UT1A 2EGEA 2QGFB 3WXMB 2BZXA 2BZYA 4RTWA 4RKUE 4CC3A 3DLMA 1UHCA 2EVRA 2I2LA 3V8JA 4A4FA 1X43A 3OYKA 2QTVA 4DQ2A 4AFUC 4E7ZA 2F5TX 1ABQA 4C0FA 2H3JA 1MMNA 4J6YA 2K5IA 4J7FA 2YXYA 2A0FB 4JZ3A 1VQ5Q 4KULA 1KK7A 3P8DA 3MCAB 2K4YA 2LT4A 4M78A 3JCMJ 2JMAA 3QYGB 3CC7A 3CC2T 1K9MR 1FMWA 1OZ3A 1S72A 1K76A 2HMAA 2RQUA 4ZGEB 1Q86C 3UPUA 1OX8A 1ZUUA 1G8XA 1XNIA 5CKDA 2RN8A 4DBHA 4EMKB 1ABOA 4M77F 1QKXA 4ME7A 4C8QA 4GLMA 4Y91A 2RI2A 3S3OA 3I56A 2KBTA 2OTJT 2DYIA 4WF2A 4A54A 4C5IA 4XTYA 5CIUA 1OZ2A 3RR6A 4Y92A 2RJFA 2HKNA 5ECAA 4C0DC 5CQYA 2GF7A 1D1BA 2A7YA 2FZKB 3ER0A 2ZPBB 1PKTA 2L5QA 1M2VA 1PC0A 4QVCA 4J9FA 1VQPQ 2WACA 3E9FA 2CS7A 3TREA 2X3XD 3V7CA 3CCUQ 1MV3A 4QW2A 2HZYA 1VUBA 2Y4XA 5HK3A 1R77A 3CXCS 3SEMA 1VIFA 2KYBA 5IT9E 2ZPGB 3LWHA 4C8QC 2M16A 2JMCA 5GMKh 3CBOA 3G6ET 2FL7A 5FW9A 3VYHB 3VS7A 3OW2P 1N5ZA 1UUEA 4M75G 1PNJA 1RADB 4P5NA 3OW2A 2HCKA 1H8KA 4B9XA 3LW5E 3MP1A 3P8BB 3C94A 1AT1B 4OB1B 4PJOF 2OTLQ 3VS6A 3KBGA 1I07A 3M0UA 4FYVB 1QWEA 4C0DB 3RNJA 4JJNK 1TXQA 1RLQC 1RAHB 1TU0B 1YI2A 2EYQA 2G6FX 3SWNC 2L0AA 1SSHA 5CKEA 2P4TA 5GANe 3ME9A 3CBPA 1D1CA 1Z9QA 2RHYA 2MYSA 4JS4A 4BB7A 4C8QB 5IHNA 2PZ1A 3MKDA 1N9SA 3DB4A 2MWOA 2VB6A 4LDXA 4NL3A 3EFOA 2LZ6B 5GAN5 2JTFA 3TQ7P 2DRMA 4N4HA 1ARKA 4HT9A 4RUGA 3JCMg 2K5LA 4VUBA 2COZA 2PNIA 4FT4A 1I0CA 3E9GA 4F7UB 1YJWT 2NUPA 5IXBA 2YT6A 1QVFS 4RCBA 5A0DA 3L2WA 3GNFB 2X4JA 4R55A 3JCMc 4D8KA 1M2VB 3G71A 2FPFA 4O6JA 2VVKA 3FDRA 2LNHB 2DTHA 2LTOA 4HCKA 3SWNB 1ZSGA 2WSCE 3CBMA 5LJ5f 3N5BB 1U3OA 3KFVA 3EGXA 2DXCA 2CP5A 1Q81C 1S1NA 2CP7A 2A3LA 3NTHA 5LJ5j 3PIOA 4C5EA 1N8RU 5GAMh 3I55T 2LC4A 1VQPT 2CUDA 1BCMA 1OOTA 4J9EA 1OPKA 3CMAQ 4PJNA 2RHIA 4XTUA 3A8MB 3EG9A 3MP6A 3MPUB 2QXFA 1W6XA 4OB0B 3EH1A 4QKUA 3VS5A 1VQ4Q 3CD6T 4JZ4A 3UATA 3VKIA 3X24B 4UC4A 5M9OA 1M8MA 2JS2A 3OYYA 3H0IA 5LJ3e 4XU3A 3NTIA 3HRSA 4OGCA 4M77C 4E7IA 2AHJB 3Q1JA 3QKJA 1C0MA 4JRIA 4O5VA 1PM3A 4ELYC 1KQSS 3E1SA 2H8HA 2QA4A 2XKOC 2E10A 2O4XA 4NS5A 4PJOA 3ULRB 2E41A 3HRUA 1M90C 1UGRB 2HQEA 1RACB 2W0ZA 5DLQE 3MEVA 1P92A 1HJDA 4M75F 1JJ2P 3PVLA 5EC7A 2CT3A 2I0NA 1VQMT 3X20B 2KRMA 3VUZA 1WFWA 2NUPB 4QQGA 1EZZB 3WVEB 4OMQA 3X28B 3L42A 1WGSA 1VQ7A 1JU5C 3QG1A 1Q86R 2JM8A 1QVGP 3QDRB 3TSWA 4M77B 3CPFA 3SHWA 2E65A 2K57A 4IURA 2L8DA 2KVQG 4IIOA 2YRDA 3A98A 3X25B 3EGXB 4LNPA 2OAUA 1EX4A 4R0KA 2GNCA 3CCET 1OU9A 4PJMA 3CC7Q 5KE3A 4KBMB 1S72Q 1OEBA 4PJOC 1H92A 1VA7A 3V8KA 3CCRA 4A4HA 4XTXA 1YITT 4AFZC 1BI3A 1Y96B 3HSBA 2KAFA 2E4HA 4LUEA 1SHGA 2QAZA 1KC8R 4E7JA 3I56Q 2EQUA 4F7UE 3M53A 1TUCA 3L2RA 3OYMA 1VQLA 2J06A 1AWXA 3CMAT 1NYFA 3THKA 2GTJA 1LVKA 2D0QB 2GGRA 2EGAA 2YLCA 2VGNA 2F2WA 5IH2A 1NM7A 3JCMQ 5GAN6 4XQ3A 3MJXA 1VQNA 3NGPA 2Y90A 4KH1B 2PU9B 1SKUB 4DA4A 2O4XB 2W10A 3WVDB 4PJOB 1LPLA 1R0BG 3H0HA 1D3BA 3OYNA 3DB3A 3G4SA 4IUUA 4EIKA 1UTIA 1AWWA 1KIKA 3CXCP 3GF5A 3S6WA 4XU2A 3CXCA 2P4RA 1YIJA 3OBWA 1EIFA 2DL8A 1GFCA 3C4SA 3ZL7C 2RJCA 2QQAA 5GAN4 3OSSC 3CCLA 1MMDA 4FW2A 2CZ0B 3T9NA 3QWXX 4L59A 3RDVA 2RQRA 3QDFA 1AVZC 2RNAA 4JJCA 2LQ8A 3QXEB 1UE9A 1ZA1B 1B34B 2DEQA 3H6ZA 3VUBA 1VQ9A 1YI2Q 3GPLA 3IQLA 3TEEA 2KEAA 1KSWA 3RERA 2M51A 4AG1C 4CC4B 3OB9A 1FMVA 1K8AC 3BW1A 2A37A 1KQ2A 4DBQA 4J6WA 4CI0C 3OYLA 1I1JA 4RG8A 1YCSB 2ZGWA 1FWZA 2L3PA 4EMGA 3EH2A 1K73R 2EQMA 2VC8A 4KT0E 2CP2A 1NLOC 1S72T 1SSFA 2CDTA 2CGHA 4NOYA 3CC4A 3OS5A 1Y71A 1JQQA 3JSCA 4FM4B 1AD5A 1YJNT 5KE2A 3LGLA 2JXBA 5KYWA 1BCOA 4ORZA 4PLIA 1E6GA 3G71Q 4XTWA 4M77E 4PNOA 1TUDA 2VASA 1QVFA 3I56T 5EG2A 3HP9A 2ED1A 1GL5A 2KNBB 3U23A 4M7DB 1E7OA 4CC2A 2DL3A 2KMTA 1D3BB 2SEMA 1M1FA 4X1VA 1X2QA 5GAMf 1MMAA 3FEOA 3VS1A 3R6NA 2K5FA 2LCSA 1GCQA 4GBQA 1H3ZA 5LJ5h 3OA6A 5GAMj 3JCMd 2FG0A 2RA2A 3SB2A 2E3HA 2IPOB 1M5Q1 2ATCB 4AG2C 2ROTA 3I9QA 1WHKA 4FIBA 2PUOB 3OYGA 2DVEA 4A53A 3CMEQ 3JCMe 3OYCA 5HKCA 1BK2A 2DD5A 1PRLC 1UFFA 4II1A 1UDLA 4M75B 2HKQB 5D7UA
chains in the Genus database with same CATH topology
1PM3A 3A1PA 3HTRA 2DYIA 2F1LA 3H9NA 2QGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM3 A;  3A1P A;  3HTR A;  2DYI A;  2F1L A;  3H9N A;  2QGG A; 
#chains in the Genus database with same CATH topology
 1YJ9 T;  3M58 A;  4OMO A;  4PJO E;  2DM1 A;  4Z89 A;  4FU6 A;  2QA4 Q;  1SG5 A;  1IB8 A;  5CQX A;  4BI4 A;  1KQS A;  1GCQ C;  5GAN 3;  3O5Z A;  3UWN A;  3LWI A;  4RTV A;  3LH0 A;  2YHT A;  2QEX T;  1CSK A;  1WA7 A;  2YLB A;  2KSS A;  2PVD B;  3RES A;  5KYX A;  1VYU A;  2JTE A;  4HKE A;  2XDD A;  4QVD A;  4OGE A;  1U1T A;  5KYW B;  1I5L A;  3TSZ A;  1SPK A;  1JJ2 S;  4TVR A;  1UHF A;  1VQ7 Q;  1WDX A;  2QQS A;  1K9A A;  4C92 G;  2CP0 A;  1D1A A;  2RHX A;  2CP6 A;  2KT8 A;  2NUT A;  2DKG A;  2VWF A;  4HCC A;  3UA7 A;  2EPD A;  2KDS A;  4RG2 A;  1QVG S;  4XTZ A;  2SRC A;  3NPF A;  4HT8 A;  5GAM g;  4ZN1 A;  2GFA A;  1X01 A;  3NHN A;  1KD1 R;  3G71 T;  4DBF A;  1AZE A;  3O8V A;  4QQ6 A;  1JXO A;  2K2V A;  1M9S A;  2RK2 A;  1WHL A;  3CCR Q;  2BE7 D;  1M3A A;  2EIF A;  4BE1 A;  2D6F A;  1MHN A;  1IO6 A;  4N0A C;  1A0N B;  2E70 A;  2LVM A;  2JN0 A;  2QQR A;  2M9U A;  3LX7 A;  2O2O A;  4IKF A;  1C1A A;  4AMC A;  2DXU A;  1AEY A;  2E5Q A;  1JO8 A;  2LJ0 A;  3ZEH A;  3EHR A;  4JLG A;  1VQL Q;  3RMS A;  2MAM A;  4M7D G;  3A8L B;  3NTK A;  4FL6 A;  4R56 A;  2V26 A;  2YDL A;  1CKA A;  3EG2 A;  1Q7Y R;  2PUK B;  4M7D E;  4CRI A;  1VQN Q;  2RPN A;  2XU8 A;  2JTM A;  4F7U A;  2RQT A;  1MGQ A;  2F5K A;  1OX9 A;  3M59 A;  5D6W A;  4N4G A;  1KC8 C;  3G4S Q;  3HFN A;  5CKB A;  1I8F A;  5KYX B;  3BDL A;  2YUO A;  3SWN A;  1QMC A;  4A63 B;  2DX1 A;  1YIJ Q;  2ESW A;  1IRE B;  4RTU A;  3OMC A;  2RF0 A;  2JZ2 A;  3DLL A;  4FYY B;  3CCL Q;  4B9W A;  3VS0 A;  1XTD A;  4XU1 A;  3JCM b;  4D6W A;  4MDX A;  3PT9 A;  2RQW A;  5AT1 B;  3M0P A;  3OBY A;  4M77 D;  2NUT B;  1K8A R;  2HBP A;  3CCV T;  2DPP B;  1J3T A;  2ZPE B;  2VYT A;  1UGV A;  3TCJ A;  4DEX A;  1VQ9 Q;  4M75 E;  2ZAE A;  2G3R A;  2EYY A;  4M7A G;  2JS0 A;  1KFZ A;  5GAN d;  3UDC A;  1NPP A;  2EGC A;  2LP5 A;  2ZCF B;  2DTI A;  4LD9 K;  2D8H A;  4OMM A;  1I5O B;  1KG1 A;  1PKS A;  3V7S A;  2PTK A;  4MZP A;  3M0R A;  4RTT A;  1VQ8 A;  2CYZ B;  1UB4 A;  1IXD A;  3ZFJ A;  1VQ5 T;  3TVT A;  1RAA B;  4BUG A;  4PFO A;  1R0C B;  4K11 A;  1VOM A;  4J9C A;  3D7S B;  2FZC B;  3CC4 Q;  2YRV A;  4ELZ C;  4Z8A A;  4RTZ A;  2LQW A;  2KRO A;  4C92 F;  1G3W A;  4LDW A;  3BFM A;  3C12 A;  2DEU A;  2EW3 A;  2LX7 A;  4ZNX A;  4JUV A;  3CCQ A;  2RJE A;  1TSF A;  2DET A;  3C0C A;  4M4Z A;  4AFQ C;  1E6H A;  4PJO D;  2KYM A;  4PFP A;  3VS2 A;  1TWB A;  2DA9 A;  1QVP A;  5KYY A;  3I5R A;  2J6O A;  1K73 C;  2YSQ A;  5J26 A;  4C5G A;  2QDY B;  5GMK i;  1V76 A;  2YUP A;  3EGU A;  2V8I A;  1NJI R;  1SRL A;  4M77 A;  5I11 A;  4BI3 A;  1Q82 R;  2MMP A;  1GBQ A;  3C95 A;  1Q81 U;  1VQN T;  2QAS A;  3PFS A;  5A0L A;  1PWT A;  4RTY A;  2RJD A;  3JB9 G;  3CCJ A;  1SF9 A;  1V1C A;  1KJW A;  1Z9Z A;  3RKY A;  4KH0 B;  2E5K A;  3PGG A;  4AT1 B;  2DBM A;  2OI3 A;  5FU7 C;  1K4U S;  1NEB A;  1RAF B;  3CCU T;  2XMF A;  2Z0W A;  5I21 A;  5LJ3 d;  1M8V A;  4M7D F;  1Y96 A;  4FSS A;  2RK1 A;  3OMG A;  2FEI A;  1B3Q A;  1ZA2 B;  3CCL T;  4XTV A;  3OY9 A;  2DO3 A;  3CCQ Q;  4FW1 A;  3JB9 H;  2X51 A;  2E1H A;  5CCA A;  3CME A;  2LT1 A;  3GBQ A;  4X9D A;  3QJY A;  3A8G B;  2OTJ A;  2BTT A;  2OTL T;  4KGZ B;  3I5S A;  2KE9 A;  5GMK e;  2YUN A;  1YNZ A;  3TU4 K;  2D1X A;  2GFU A;  3M57 A;  4KUI A;  5FLX E;  2EKO A;  2ABL A;  2R58 A;  2EKH A;  1QW1 A;  5FU7 B;  3H0F A;  5I22 A;  4F16 A;  5CKH A;  4JDS A;  3LH5 A;  1M90 U;  4WCI A;  5CR2 A;  3A1P A;  1BU1 A;  2AZV A;  2FPE A;  4Q5W A;  3JAM E;  1JJ2 A;  1UG1 A;  4M7D D;  2IVW A;  2HL5 C;  1HXD A;  1N9R A;  1N27 A;  4FYW B;  3CC4 T;  4M7A F;  1CKB A;  5KYY B;  2P84 A;  1WHM A;  2O31 A;  4LD6 A;  2EBP A;  1IRX A;  1BB9 A;  3ZBD A;  2EAY A;  3OYH A;  4Z02 A;  1QVG A;  1T0H A;  5LJ5 g;  5GAN j;  1M1K U;  3OQ5 A;  1X75 C;  2A28 A;  1JB0 E;  1B34 A;  1ZUK A;  6AT1 B;  1TS9 A;  4C92 A;  3GP8 A;  1UJY A;  1K0S A;  4M78 G;  5HY6 A;  3KUF A;  4KGX B;  1VIE A;  5D6Y A;  3H9N A;  2FZG B;  2DYB A;  2V8K A;  3M55 A;  1B07 A;  5IXF A;  2VXE A;  1ZLM A;  4WTO B;  3CCM A;  1QWF A;  1MNE A;  4M75 D;  1KD1 C;  4J9B A;  3OYJ A;  3E2U A;  1YWP A;  1BIB A;  4BI8 B;  1JEG A;  3SFM A;  4A4K A;  1HYO A;  4J83 A;  2YUQ A;  5IAY A;  4OMP A;  1K9M U;  2E12 A;  2M0O A;  3FIF A;  4XU0 A;  1RLP C;  1X6B A;  3QBY A;  5I2S A;  3EG3 A;  2CZ1 B;  4C92 C;  2DIQ A;  1YJW A;  2KRN A;  1VQ4 T;  3EHQ A;  1NYG A;  2GTO A;  1LCK A;  5GAM e;  3CCQ T;  2DER A;  3JB9 F;  4AFS C;  4M7D A;  5CVI A;  2R57 A;  1FX7 A;  1KHC A;  1VQO A;  3CPW S;  8ATC B;  3M0Q A;  2E64 A;  2CP3 A;  1F1B B;  1NBE B;  2CSI A;  4J8O A;  2HEQ A;  5DY9 A;  1Q7Y C;  2P0K A;  1BIA A;  1NZ9 A;  1VYT A;  4PLL A;  2E6Z A;  1AWJ A;  4JRP A;  3I55 A;  1OU8 A;  2YRC A;  2D9T A;  3FJ5 A;  1RI9 A;  1WXB A;  2RH2 A;  3MET A;  1IGQ A;  1W4S A;  4CC7 A;  2XD0 A;  1NG2 A;  2XIC A;  2VUB A;  1M27 C;  2XID A;  4C92 B;  5KYN A;  2XK0 A;  2NLU A;  2DAQ A;  3QPH A;  5A0G A;  3CD6 A;  3QO3 A;  2OX7 A;  2XDP A;  2M02 A;  4M7D C;  4L6V 5;  3OYD A;  3L2V A;  3URG A;  4M75 A;  1VQ8 Q;  2JNG A;  4BD3 A;  4RMO A;  2KQW A;  2BE9 B;  2K2M A;  3NFC A;  4IUQ A;  2DLP A;  3QJ6 A;  1U06 A;  4LN2 A;  2FHD A;  1YFN A;  1VQ6 Q;  4Z88 A;  4BY6 C;  3CC7 T;  3OSV A;  2J05 A;  2AT1 B;  1X6G A;  3P8H A;  2DMO A;  2DF6 A;  2H3E B;  2HSP A;  3V8L A;  2F2X A;  1Y0M A;  4JRQ A;  1VQK A;  2XI9 A;  2ENM A;  4DEY A;  3E19 A;  1O9S A;  2RI3 A;  3M0T A;  1NPR A;  4BDZ A;  1OV3 A;  1VQM A;  1Q95 G;  2EWN A;  3MHX A;  3JV3 A;  3GOX A;  3SD4 A;  3QSU A;  4M75 C;  1I81 A;  4MDW A;  5DM7 R;  2JVV A;  2OJ2 A;  4OF1 A;  5L8R E;  2NYS A;  1LJO A;  4M78 F;  3CCJ Q;  3PE0 A;  3M9Q A;  3EGD A;  4M7A C;  2JJ9 A;  1N8R R;  3OYI A;  1FYN A;  4E7K A;  4E7S A;  3CCE A;  4BY6 B;  1G3T A;  3M0S A;  1RAG B;  2CUB A;  5AYF A;  1OPL A;  4J9G A;  4MZT A;  1T3L A;  1NJI C;  2X3W D;  4X34 A;  4BE0 A;  5GMK m;  1YIT A;  1Q82 C;  1QKW A;  1ZBJ A;  1BYM A;  1ZBX A;  2OAW A;  2LRQ A;  4PL6 A;  3JCM X;  1ZSZ C;  4J6X A;  4J9D A;  1ZQ1 A;  2ECZ A;  4QVZ A;  2MIO A;  2OTJ Q;  4RCC A;  1FMK A;  2X9H A;  3G7Z A;  1UEC A;  2DL7 A;  1W2B P;  4E47 A;  4PK4 A;  2K79 A;  2F2V A;  4DBR A;  4M7A B;  4A4G A;  1WPY A;  3S3N A;  4XK8 E;  4PJJ A;  2AZS A;  2EYZ A;  1YI2 T;  1WHJ A;  2CH4 W;  5KH6 A;  4J9I A;  1WLP B;  3F70 A;  4N0A A;  4ZTF A;  3RKX A;  4GLK A;  2CZ7 B;  4HXJ A;  4EDU A;  1BI1 A;  4EPC A;  2QG9 B;  3INZ A;  4C5H A;  1NEG A;  1LOJ A;  1ZSZ B;  2C0I A;  3HHT B;  3VS3 A;  2C0O A;  2P0P A;  1IHV A;  5GMK l;  1OQK A;  4C92 E;  3NMZ C;  3FRN A;  2HQH A;  1M1K R;  4JJB A;  2KT1 A;  2LCL A;  1BBZ A;  2MPX C;  4HA8 A;  2M1H A;  5GAN h;  2EQI A;  1MND A;  3EGD B;  3VU3 C;  2K7A A;  2HD0 A;  4IUT A;  3VJP A;  4HCB A;  3MP8 A;  4YTL A;  3OYA A;  3KXT A;  3CEY A;  4FT2 A;  3J81 E;  2A36 A;  4JJD A;  1WYX A;  2RMO A;  3BDU A;  1MUZ A;  1Q86 U;  5CK9 A;  3CCJ T;  1BI2 A;  2L89 A;  3L2Z A;  1NLP C;  3CCM Q;  4D8D A;  2IIM A;  2DD4 A;  3PTA A;  3FLG A;  1XQH A;  2J7I A;  1OI1 A;  1YHQ A;  9ATC B;  2JM9 A;  1JBM A;  2CSQ A;  2MCN A;  1WI7 A;  2RB6 A;  1YCY A;  4J5Y A;  1GRI A;  5LJ5 d;  3PNW C;  2X35 A;  4KGV B;  1NE8 A;  3SDZ A;  2LCC A;  1TG0 A;  1YJN A;  1YJW Q;  4HVV A;  1WNL A;  3DKM A;  2QTX A;  2RHZ A;  5LJ5 e;  2ZPF B;  3CME T;  2XHC A;  1KHI A;  1VQO Q;  1KC8 U;  2V1R A;  4F14 A;  3CPW P;  2VKN A;  4IUP A;  3JCM f;  2EFI A;  3OYE A;  4MZM A;  2F1L A;  3REB B;  3CPW A;  1WHH A;  1B7T A;  5GAN 2;  3H8Z A;  5C0M A;  1M3C A;  2QA4 T;  3BY7 A;  8AT1 B;  2C0T A;  3JCM P;  1M1G A;  2COW A;  4M78 C;  2IG0 A;  2LQN A;  3I55 Q;  3MEW A;  5FU6 C;  5CKF A;  2XG8 D;  4ATO A;  3GNG A;  1G5V A;  5D6X A;  5LJ3 h;  4IIM A;  5LL6 S;  2EJ9 A;  2E3I A;  2QK0 A;  5IHK A;  1SRM A;  2MWP A;  2HDA A;  5GAN 7;  3CD6 Q;  1IGU A;  1VQ7 T;  4F17 A;  2RM4 A;  4N4I A;  4EMH A;  2DTO A;  1D0Z A;  1VYV A;  1WJS A;  3M4Y A;  1U8R A;  4M7A E;  2QI2 A;  3EG1 A;  3EFS A;  2V1Q A;  3QZ9 B;  3CCS A;  2X4W A;  1YWO A;  1G3S A;  2NWM A;  2HNI A;  1IZ6 A;  3OYF A;  4DOV A;  1YJ9 A;  3HPW A;  2QQB A;  3UA6 A;  5C6S A;  1UEB A;  2LJ3 A;  4Y28 E;  2EYW A;  1X69 A;  2DL5 A;  4HVU A;  4M78 B;  2MI6 A;  3CCR T;  1H3H A;  1DJ7 B;  1QCF A;  5FU6 B;  3I35 A;  2QEX A;  1VQ6 A;  1VQK Q;  5GJW B;  2MF2 A;  2WSE E;  4KRT A;  3PVQ A;  2CH4 A;  5FWC A;  1X2K A;  3J7A F;  4C0Z A;  3CCM T;  1VQM Q;  3GIB A;  1AZG B;  4QQD A;  1MV0 B;  1N6A A;  5FRM A;  1JXM A;  2DL4 A;  3H41 A;  1W1F A;  2O88 A;  2QDL A;  1PCX A;  1VQL T;  4E7L A;  4IUV A;  1I4K 1;  5A2Q E;  1K73 U;  1PG5 B;  2HSE B;  1YBY A;  1Y7X A;  2FRY A;  3RMQ A;  3ASK A;  1WJR A;  5GAO r;  4XAX B;  2CZ6 B;  4J9H A;  3PMI A;  5GAO m;  2PVG B;  3QII A;  2RHU A;  1V29 B;  3CCE Q;  1WZO A;  4QT7 A;  1ZHI A;  2HBW A;  1ZX6 A;  2LNV A;  3S3M A;  4BDY A;  1WJQ A;  3EFR A;  3R6O A;  1Y57 A;  1VQO T;  3G4S T;  1RAB B;  2B86 A;  3PMT A;  1K0X A;  2FVU A;  2ZZD A;  1YIT Q;  2FO0 A;  1YIJ T;  3CC2 A;  4HVW A;  3GLX A;  4C92 D;  4FCY A;  2J6K A;  4ZTJ A;  1H64 1;  3FB9 A;  5GAO p;  2R5M A;  1N8R C;  2D8J A;  1C6V X;  2DZC A;  1X27 A;  2MOX A;  2K6D A;  2PQW A;  2DE0 X;  2ED0 A;  2KI7 A;  5GAO q;  3HL8 A;  3EG0 A;  3MO8 A;  1G83 A;  1AHJ B;  1BKB A;  1VQ9 T;  3VRZ A;  1W2B S;  1QP3 A;  3V7R A;  2KGT A;  1WQ7 A;  5HK0 A;  2QQ9 A;  3X26 B;  2DVJ A;  2JT4 A;  4C0G A;  4JLI A;  1G2B A;  1OYX A;  3OS1 A;  5GAO l;  2R5A A;  3RIR A;  1UJ0 A;  4ANJ A;  4MMK A;  2JW4 A;  1HD3 A;  2DIG A;  2RI5 A;  1FXX A;  4A4E A;  2AK5 A;  1UGQ B;  4OB2 B;  1QQJ A;  5KCO A;  2L3Q A;  1M3B A;  2LDM A;  5GAN f;  3G6E A;  3EFO B;  1HSQ A;  5L23 A;  4OP0 A;  3VV0 A;  4MML A;  1VQK T;  2RQV A;  1WHG A;  5FRO A;  2O9V A;  2GQI A;  3CCV A;  1D0X A;  3JB9 I;  3AT1 B;  2HAX A;  2B8A A;  2DJQ A;  4OML A;  1RUW A;  2KRS A;  2ZPH B;  5HCK A;  3RKW A;  2DXT A;  3M56 A;  1LNX A;  4M78 E;  2LMJ A;  2BKD N;  3MEA A;  4J7I A;  1M1K C;  5IN1 A;  2QGG A;  1YHQ Q;  3LYI A;  2K9G A;  3QWY A;  4LE9 A;  2X4Y A;  2DXB A;  3L2Q A;  4C8Q G;  4FYX B;  3LGF A;  2P0Q A;  1KD1 U;  1VQ5 A;  4ZGJ B;  4ZGD B;  4F04 B;  2LQK A;  1WIE A;  4C8Q E;  2KXC A;  7AT1 B;  1X6O A;  2BUD A;  2WSF E;  4LDU A;  5GAM d;  3OYB A;  1YJN Q;  2L3R A;  1XOV A;  4JS5 A;  4M7A D;  3QUI A;  5J3B A;  2RO0 A;  3M54 A;  2CRE A;  2Y4Y A;  3EG9 B;  4PFZ A;  1D09 B;  5I2M A;  4F7U G;  4BE2 A;  4E7H A;  1T0J A;  2DJZ A;  4GY5 A;  2DIL A;  3RBB B;  2GCX A;  4OMF B;  2FPD A;  2YWW A;  2BZ8 A;  1G3Y A;  1TTH B;  3UF4 A;  4JPB W;  2DK3 A;  1UGP B;  4L5G A;  1K9M C;  1PD0 A;  3JRZ A;  3HKS A;  2X4X A;  3FC3 A;  4LDY A;  1M4Z A;  4BAC A;  1Q7Y U;  1WQW A;  5LJ3 f;  3L1A A;  3AHU A;  3CQT A;  1SEM A;  4B6M A;  1QCO A;  2D0N A;  3JCM h;  3G1J A;  2F69 A;  4FSX A;  5GAO n;  1U5S A;  2EQK A;  5GAN g;  2O01 E;  3RUX A;  2VGM A;  5LJ3 j;  1TUG B;  2KK4 A;  1VQP A;  3HFO A;  4OMN A;  5GAN 8;  2V8J A;  1Y07 A;  3CCU A;  3A8H B;  5FRN A;  5IHI A;  5GMK j;  1PSE A;  2KY9 A;  2GBQ A;  3PIP A;  4E2F B;  3CCS Q;  2JOY A;  1BI0 A;  1IHW A;  1M30 A;  3OW2 S;  1RL2 A;  1YJ9 Q;  2EQJ A;  3HRT A;  1K8A U;  3OS2 A;  1O75 A;  1RI0 A;  3JB9 D;  2DRK A;  1QCN A;  2QYZ A;  2AKK A;  3QHS A;  2VXF A;  2A08 A;  3MEU A;  1WX6 A;  4M7A A;  2K3B A;  2ROL A;  2OTL A;  1D0Y A;  2CT4 A;  1MMG A;  3A8O B;  1HK9 A;  2QEX Q;  5GJV B;  4DOW A;  5CAI A;  1YN8 A;  4E6R A;  1JRI A;  1M2O A;  1GXI E;  1ACM B;  3J80 E;  2LJ1 A;  2FB7 A;  3M5A A;  1YHQ T;  2HQX A;  1TH7 A;  2L3S A;  1K1Z A;  3JB9 J;  1T3S A;  1OUL A;  5KYU A;  1QLY A;  2ZPI B;  2COY A;  1ZSZ A;  2MK5 A;  2JUF A;  5CO7 A;  2E6N A;  5DLO A;  1WXU A;  1RAE B;  4M77 G;  3REA B;  1Q81 R;  1PSF A;  1ZUY A;  1QP2 A;  2K3X A;  2C06 A;  3JCM W;  3VS4 A;  2DZ9 A;  1QVF P;  2DFU A;  5LJ3 g;  1AOJ A;  1XJW B;  4X9C A;  3FJP A;  4PKC C;  1KQ1 A;  4C8Q F;  3CC2 Q;  4RTX A;  2DNU A;  2NUZ A;  4ZN3 A;  1U1S A;  3QYH B;  1NJI U;  2KXD A;  4PJL A;  2AIR B;  1Q82 U;  3OS0 A;  2FYK A;  3EAE A;  3JCM V;  4LUD A;  1EFN A;  2AKL A;  5J39 A;  4NL2 A;  4F7U F;  4ESR A;  1PRM C;  4KUD K;  2XDB A;  3LLR A;  1GFD A;  1SHF A;  1AWO A;  4EMK A;  3CMA A;  4OB3 B;  1UGS B;  4M78 D;  1W2B A;  2KR3 A;  5FWB A;  1GBR A;  2O9S A;  3VYG A;  5KCH A;  3CCS T;  2VV5 A;  1M90 R;  2RD1 A;  3HTR A;  1VQ4 A;  4PJO G;  2BIV A;  2CKK A;  4V2S A;  1VQ8 T;  2HL3 A;  4HCZ A;  2J6F A;  1YP5 A;  1KQS P;  2L2P A;  3M4G A;  4C8Q D;  2EJG A;  2FRW A;  2EYX A;  3VRY A;  2EJF A;  3G6E Q;  1GCP A;  3L2U A;  3BE3 A;  2LX9 A;  1WXT A;  2DBK A;  1VQ6 T;  5KYU B;  3A5Z B;  1RAI B;  2PVO B;  4LDV A;  3CCV Q;  4JRK A;  1PHT A;  4OVA A;  3QZ5 B;  1R8O B;  1TOV A;  1W70 A;  2M0Y A;  1PD1 A;  4EMK C;  4LXC A;  2K3Y A;  2GQV A;  3UT1 A;  2EGE A;  2QGF B;  3WXM B;  2BZX A;  2BZY A;  4RTW A;  4RKU E;  4CC3 A;  3DLM A;  1UHC A;  2EVR A;  2I2L A;  3V8J A;  4A4F A;  1X43 A;  3OYK A;  2QTV A;  4DQ2 A;  4AFU C;  4E7Z A;  2F5T X;  1ABQ A;  4C0F A;  2H3J A;  1MMN A;  4J6Y A;  2K5I A;  4J7F A;  2YXY A;  2A0F B;  4JZ3 A;  1VQ5 Q;  4KUL A;  1KK7 A;  3P8D A;  3MCA B;  2K4Y A;  2LT4 A;  4M78 A;  3JCM J;  2JMA A;  3QYG B;  3CC7 A;  3CC2 T;  1K9M R;  1FMW A;  1OZ3 A;  1S72 A;  1K76 A;  2HMA A;  2RQU A;  4ZGE B;  1Q86 C;  3UPU A;  1OX8 A;  1ZUU A;  1G8X A;  1XNI A;  5CKD A;  2RN8 A;  4DBH A;  4EMK B;  1ABO A;  4M77 F;  1QKX A;  4ME7 A;  4C8Q A;  4GLM A;  4Y91 A;  2RI2 A;  3S3O A;  3I56 A;  2KBT A;  2OTJ T;  2DYI A;  4WF2 A;  4A54 A;  4C5I A;  4XTY A;  5CIU A;  1OZ2 A;  3RR6 A;  4Y92 A;  2RJF A;  2HKN A;  5ECA A;  4C0D C;  5CQY A;  2GF7 A;  1D1B A;  2A7Y A;  2FZK B;  3ER0 A;  2ZPB B;  1PKT A;  2L5Q A;  1M2V A;  1PC0 A;  4QVC A;  4J9F A;  1VQP Q;  2WAC A;  3E9F A;  2CS7 A;  3TRE A;  2X3X D;  3V7C A;  3CCU Q;  1MV3 A;  4QW2 A;  2HZY A;  1VUB A;  2Y4X A;  5HK3 A;  1R77 A;  3CXC S;  3SEM A;  1VIF A;  2KYB A;  5IT9 E;  2ZPG B;  3LWH A;  4C8Q C;  2M16 A;  2JMC A;  5GMK h;  3CBO A;  3G6E T;  2FL7 A;  5FW9 A;  3VYH B;  3VS7 A;  3OW2 P;  1N5Z A;  1UUE A;  4M75 G;  1PNJ A;  1RAD B;  4P5N A;  3OW2 A;  2HCK A;  1H8K A;  4B9X A;  3LW5 E;  3MP1 A;  3P8B B;  3C94 A;  1AT1 B;  4OB1 B;  4PJO F;  2OTL Q;  3VS6 A;  3KBG A;  1I07 A;  3M0U A;  4FYV B;  1QWE A;  4C0D B;  3RNJ A;  4JJN K;  1TXQ A;  1RLQ C;  1RAH B;  1TU0 B;  1YI2 A;  2EYQ A;  2G6F X;  3SWN C;  2L0A A;  1SSH A;  5CKE A;  2P4T A;  5GAN e;  3ME9 A;  3CBP A;  1D1C A;  1Z9Q A;  2RHY A;  2MYS A;  4JS4 A;  4BB7 A;  4C8Q B;  5IHN A;  2PZ1 A;  3MKD A;  1N9S A;  3DB4 A;  2MWO A;  2VB6 A;  4LDX A;  4NL3 A;  3EFO A;  2LZ6 B;  5GAN 5;  2JTF A;  3TQ7 P;  2DRM A;  4N4H A;  1ARK A;  4HT9 A;  4RUG A;  3JCM g;  2K5L A;  4VUB A;  2COZ A;  2PNI A;  4FT4 A;  1I0C A;  3E9G A;  4F7U B;  1YJW T;  2NUP A;  5IXB A;  2YT6 A;  1QVF S;  4RCB A;  5A0D A;  3L2W A;  3GNF B;  2X4J A;  4R55 A;  3JCM c;  4D8K A;  1M2V B;  3G71 A;  2FPF A;  4O6J A;  2VVK A;  3FDR A;  2LNH B;  2DTH A;  2LTO A;  4HCK A;  3SWN B;  1ZSG A;  2WSC E;  3CBM A;  5LJ5 f;  3N5B B;  1U3O A;  3KFV A;  3EGX A;  2DXC A;  2CP5 A;  1Q81 C;  1S1N A;  2CP7 A;  2A3L A;  3NTH A;  5LJ5 j;  3PIO A;  4C5E A;  1N8R U;  5GAM h;  3I55 T;  2LC4 A;  1VQP T;  2CUD A;  1BCM A;  1OOT A;  4J9E A;  1OPK A;  3CMA Q;  4PJN A;  2RHI A;  4XTU A;  3A8M B;  3EG9 A;  3MP6 A;  3MPU B;  2QXF A;  1W6X A;  4OB0 B;  3EH1 A;  4QKU A;  3VS5 A;  1VQ4 Q;  3CD6 T;  4JZ4 A;  3UAT A;  3VKI A;  3X24 B;  4UC4 A;  5M9O A;  1M8M A;  2JS2 A;  3OYY A;  3H0I A;  5LJ3 e;  4XU3 A;  3NTI A;  3HRS A;  4OGC A;  4M77 C;  4E7I A;  2AHJ B;  3Q1J A;  3QKJ A;  1C0M A;  4JRI A;  4O5V A;  1PM3 A;  4ELY C;  1KQS S;  3E1S A;  2H8H A;  2QA4 A;  2XKO C;  2E10 A;  2O4X A;  4NS5 A;  4PJO A;  3ULR B;  2E41 A;  3HRU A;  1M90 C;  1UGR B;  2HQE A;  1RAC B;  2W0Z A;  5DLQ E;  3MEV A;  1P92 A;  1HJD A;  4M75 F;  1JJ2 P;  3PVL A;  5EC7 A;  2CT3 A;  2I0N A;  1VQM T;  3X20 B;  2KRM A;  3VUZ A;  1WFW A;  2NUP B;  4QQG A;  1EZZ B;  3WVE B;  4OMQ A;  3X28 B;  3L42 A;  1WGS A;  1VQ7 A;  1JU5 C;  3QG1 A;  1Q86 R;  2JM8 A;  1QVG P;  3QDR B;  3TSW A;  4M77 B;  3CPF A;  3SHW A;  2E65 A;  2K57 A;  4IUR A;  2L8D A;  2KVQ G;  4IIO A;  2YRD A;  3A98 A;  3X25 B;  3EGX B;  4LNP A;  2OAU A;  1EX4 A;  4R0K A;  2GNC A;  3CCE T;  1OU9 A;  4PJM A;  3CC7 Q;  5KE3 A;  4KBM B;  1S72 Q;  1OEB A;  4PJO C;  1H92 A;  1VA7 A;  3V8K A;  3CCR A;  4A4H A;  4XTX A;  1YIT T;  4AFZ C;  1BI3 A;  1Y96 B;  3HSB A;  2KAF A;  2E4H A;  4LUE A;  1SHG A;  2QAZ A;  1KC8 R;  4E7J A;  3I56 Q;  2EQU A;  4F7U E;  3M53 A;  1TUC A;  3L2R A;  3OYM A;  1VQL A;  2J06 A;  1AWX A;  3CMA T;  1NYF A;  3THK A;  2GTJ A;  1LVK A;  2D0Q B;  2GGR A;  2EGA A;  2YLC A;  2VGN A;  2F2W A;  5IH2 A;  1NM7 A;  3JCM Q;  5GAN 6;  4XQ3 A;  3MJX A;  1VQN A;  3NGP A;  2Y90 A;  4KH1 B;  2PU9 B;  1SKU B;  4DA4 A;  2O4X B;  2W10 A;  3WVD B;  4PJO B;  1LPL A;  1R0B G;  3H0H A;  1D3B A;  3OYN A;  3DB3 A;  3G4S A;  4IUU A;  4EIK A;  1UTI A;  1AWW A;  1KIK A;  3CXC P;  3GF5 A;  3S6W A;  4XU2 A;  3CXC A;  2P4R A;  1YIJ A;  3OBW A;  1EIF A;  2DL8 A;  1GFC A;  3C4S A;  3ZL7 C;  2RJC A;  2QQA A;  5GAN 4;  3OSS C;  3CCL A;  1MMD A;  4FW2 A;  2CZ0 B;  3T9N A;  3QWX X;  4L59 A;  3RDV A;  2RQR A;  3QDF A;  1AVZ C;  2RNA A;  4JJC A;  2LQ8 A;  3QXE B;  1UE9 A;  1ZA1 B;  1B34 B;  2DEQ A;  3H6Z A;  3VUB A;  1VQ9 A;  1YI2 Q;  3GPL A;  3IQL A;  3TEE A;  2KEA A;  1KSW A;  3RER A;  2M51 A;  4AG1 C;  4CC4 B;  3OB9 A;  1FMV A;  1K8A C;  3BW1 A;  2A37 A;  1KQ2 A;  4DBQ A;  4J6W A;  4CI0 C;  3OYL A;  1I1J A;  4RG8 A;  1YCS B;  2ZGW A;  1FWZ A;  2L3P A;  4EMG A;  3EH2 A;  1K73 R;  2EQM A;  2VC8 A;  4KT0 E;  2CP2 A;  1NLO C;  1S72 T;  1SSF A;  2CDT A;  2CGH A;  4NOY A;  3CC4 A;  3OS5 A;  1Y71 A;  1JQQ A;  3JSC A;  4FM4 B;  1AD5 A;  1YJN T;  5KE2 A;  3LGL A;  2JXB A;  5KYW A;  1BCO A;  4ORZ A;  4PLI A;  1E6G A;  3G71 Q;  4XTW A;  4M77 E;  4PNO A;  1TUD A;  2VAS A;  1QVF A;  3I56 T;  5EG2 A;  3HP9 A;  2ED1 A;  1GL5 A;  2KNB B;  3U23 A;  4M7D B;  1E7O A;  4CC2 A;  2DL3 A;  2KMT A;  1D3B B;  2SEM A;  1M1F A;  4X1V A;  1X2Q A;  5GAM f;  1MMA A;  3FEO A;  3VS1 A;  3R6N A;  2K5F A;  2LCS A;  1GCQ A;  4GBQ A;  1H3Z A;  5LJ5 h;  3OA6 A;  5GAM j;  3JCM d;  2FG0 A;  2RA2 A;  3SB2 A;  2E3H A;  2IPO B;  1M5Q 1;  2ATC B;  4AG2 C;  2ROT A;  3I9Q A;  1WHK A;  4FIB A;  2PUO B;  3OYG A;  2DVE A;  4A53 A;  3CME Q;  3JCM e;  3OYC A;  5HKC A;  1BK2 A;  2DD5 A;  1PRL C;  1UFF A;  4II1 A;  1UDL A;  4M75 B;  2HKQ B;  5D7U A; 
#chains in the Genus database with same CATH homology
 1PM3 A;  3A1P A;  3HTR A;  2DYI A;  2F1L A;  3H9N A;  2QGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...