3HTRA

Crystal structure of prc-barrel domain protein from rhodopseudomonas palustris
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
PETNETLKLIGSDKVQGTAVYGPDGEKIGSIERVMIEKVSGRVSYAVLSFGGFLGIGDDHYPLPWPALKYNVELGGYQVMVTVDQLERAPKYGPGSEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized PRC-barrel Domain Protein
publication title Crystal Structure of PRC-barrel Domain Protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 16
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3htrA00
3HTRA 2DYIA 3H9NA 2QGGA 2F1LA 1PM3A 3A1PA
chains in the Genus database with same CATH superfamily
1V76A 1D1BA 2EYZA 1MHNA 2FVUA 2RK2A 4ME7A 1K76A 4X1VA 1GL5A 1U1TA 3JB9J 4DEXA 2EQUA 4UC4A 3HL8A 1W2BS 4O6JA 3KFVA 2QK0A 2GFUA 5M9OA 1PM3A 4RUGA 2DZCA 2KI7A 4HXJA 4J9BA 4J6YA 1YIJQ 1YFNA 2DVJA 3X28B 5GAN6 4PJOA 4L6V5 2CGHA 2OTLT 3CCST 1AVZC 2VWFA 2XHCA 2E3IA 2YRDA 3M0QA 5GAOr 4RG2A 3CCMA 1S72A 3VKIA 2CZ6B 1BCMA 3PIOA 2KR3A 2NLUA 1VQPT 2MF2A 1QVGP 3CC2T 1WHHA 4C0GA 1KD1C 5IN1A 2ED1A 4XQ3A 3REBB 3CPFA 2O01E 2DXCA 4ZGJB 1JJ2P 4EMGA 3HFNA 2KT8A 1VQKQ 3E2UA 1G5VA 2EGEA 2HEQA 2DETA 3URGA 2MPXC 1UECA 1VQ6T 1VQ6Q 1SF9A 4A4GA 5LJ5f 2E3HA 1NPPA 2COWA 5GMKj 2JXBA 1D09B 3JB9D 1YJWT 3PTAA 2IIMA 3OS0A 4C92B 3LX7A 3JAME 1JRIA 4PFZA 4IKFA 3PMIA 2M02A 3SWNA 1AWJA 3OYGA 2LP5A 1IHWA 9ATCB 4IIOA 1RI0A 2EPDA 2KYBA 4C5GA 1NJIC 1CSKA 1K9AA 4FW1A 3M9QA 4E6RA 2KT1A 4B9XA 1PKSA 2FZCB 3JV3A 3CEYA 2YLCA 2C0TA 4PJOF 2EYWA 3PT9A 3TSWA 4LD6A 4OMFB 1GCQC 4M7DB 2DO3A 3MP1A 3BE3A 1H3HA 3AT1B 4BDZA 1I81A 3VS4A 1U1SA 2IPOB 2E12A 4A63B 1OULA 4IUQA 2QI2A 1WFWA 1YHQT 4F16A 1LNXA 2OTLA 3CCSA 2QTVA 2DAQA 2X4JA 4M7AA 1ZHIA 2RA2A 2AHJB 4EMHA 2DIQA 1AZEA 2FB7A 3JCMc 5GAMe 4RTUA 3CCVT 5LJ3h 4ELZC 3QO3A 1Q81R 4J83A 1MNEA 3LYIA 1VQPA 2MWOA 3CC2A 1XTDA 1WYXA 3GPLA 2F5TX 3CCJQ 7AT1B 1WXUA 3SWNC 2F2XA 3JCMg 2EGCA 3H0FA 2JM9A 1KQ2A 4JRQA 1Q81C 1VQ6A 2P0PA 4GY5A 5GANh 3PVLA 3RESA 2RHIA 1HXDA 2DBKA 2KAFA 3M55A 4FSSA 4RTVA 4FT4A 3H0IA 4J9HA 3G4SQ 1VQOT 4QQDA 2FPDA 2JW4A 3DB4A 4AT1B 4E7ZA 3L2VA 1Z9ZA 3M4GA 3OYAA 4RTTA 3M0SA 2RJFA 5DLOA 5GAOp 2JTFA 3MP8A 4M75B 1NLOC 3E19A 2GBQA 1RI9A 4OF1A 4A4FA 1ZSZB 2R5AA 2DRKA 2H3JA 3OQ5A 3SDZA 1M1GA 4C0FA 4M7AF 4K11A 5KYYB 3CCET 1X6OA 4IUUA 5FWCA 2AIRB 3EFOB 2L3SA 4OGEA 1KQSP 2HCKA 5CR2A 1WGSA 3H6ZA 2DFUA 1YBYA 4C8QA 3CCVA 2LZ6B 5EG2A 5LJ3j 2RNAA 4JLIA 4D8DA 2EYXA 3FEOA 4JRPA 5KYWA 2NYSA 1RAHB 2XU8A 2XK0A 1M2VA 5LJ5h 4PJMA 3CCRQ 2CZ0B 4D6WA 2DK3A 2DEUA 5HK0A 4F7UB 1MMGA 4XTWA 3OYNA 2QEXQ 2EYYA 1B7TA 2RI3A 3G71T 1TUDA 3MEAA 3I55T 2YLBA 3A8OB 2RHXA 1ZUUA 4CRIA 2KBTA 5GANj 4LUDA 2NUTA 4KH0B 1YJ9T 4C92E 4QW2A 1FMWA 2NUPA 3E9FA 3G4SA 2BZYA 2YWWA 5GAOq 1KQSS 1X69A 1PSFA 4DBHA 4AFUC 2ED0A 1UTIA 1VYVA 3QDFA 2RH2A 2W10A 2RHUA 4E7KA 1UHFA 1WXTA 2YHTA 4EMKB 1QKWA 2KXCA 4FW2A 4N0AA 1NBEB 1UFFA 2KDSA 2PU9B 4PK4A 2DILA 4M75C 1K73C 1K8AU 4M7DE 3JB9H 2L0AA 3CCEA 3JCMP 1NLPC 4C8QF 2DL8A 1AHJB 4QVZA 5GAMf 4RTYA 1ZSZC 2YUQA 3EFRA 2DLPA 3A5ZB 4OMMA 3KXTA 4JJBA 5IXBA 2CUBA 3VS5A 3S3NA 3TREA 4BE2A 4GLKA 2ABLA 3RNJA 1OI1A 5HY6A 5AYFA 2AT1B 3A8HB 1MGQA 4C92G 4PNOA 2MCNA 3X24B 5ECAA 3VS7A 1VQ7Q 3JCMd 3OYBA 2K7AA 3RIRA 3G6EQ 4RTWA 5LJ5j 2JUFA 3OB9A 5I11A 4XTYA 2EJGA 4M77B 3JCMJ 2QEXA 1D3BB 2EVRA 4DOVA 3FLGA 1VOMA 3UATA 3TSZA 3CPWP 3I55A 1KQ1A 6AT1B 1E6GA 1B34A 2BKDN 4KUIA 3CCUQ 3GNGA 2OTJQ 1KC8U 3RMQA 1LJOA 5L23A 1OZ3A 1SKUB 1Q7YU 4M7DG 4ZGDB 1YJ9A 1VQ9T 1VQ9Q 2CZ1B 1D0XA 3X20B 3V8KA 1T0JA 2JS2A 1VQNT 4PLIA 1M3AA 1M4ZA 1G8XA 2O31A 1PCXA 2DXBA 2D8HA 4DA4A 1PD0A 4FYWB 4BY6C 4M75E 1MNDA 2DJZA 2EYQA 3SEMA 1BIBA 1UB4A 2PZ1A 3MP6A 4JPBW 2KK4A 2QGFB 2X9HA 4J7IA 1UGQB 3H0HA 4AFSC 2XD0A 2FZGB 3OS2A 1AWOA 1JU5C 3P8HA 1HSQA 4WF2A 1Q86R 1I5LA 2KQWA 5GAOm 3CD6T 3CD6Q 1Y96B 1NEGA 4EMKC 1K0SA 1YI2T 1E7OA 3I5SA 4ELYC 1O9SA 3CPWS 3CC4Q 2LCSA 2XICA 2JN0A 1EZZB 2K5FA 2X4YA 1NPRA 1Y07A 4LDXA 2E70A 1VQ7A 3EHRA 2ZPGB 1Q86C 1E6HA 4AFZC 2HNIA 2GCXA 5FW9A 2A37A 2OAUA 2HQEA 2M0OA 3FJPA 1U3OA 2RQUA 3EGXA 2KVQG 4F7UE 4M75G 1UGRB 3EG1A 1SRMA 4M78A 2NWMA 3A1PA 3CBOA 2K5IA 1OU8A 3CCUA 3CCQT 2OTJA 4M77C 3HRTA 5KCHA 2ZGWA 3VU3C 2DRMA 4ZGEB 2FO0A 2ZPHB 1S1NA 2HSEB 1VQ9A 1QVFP 5GAOl 2M51A 3PMTA 2KRNA 4M78D 2OJ2A 4N4HA 3EG2A 3CMEQ 3CMET 4C0ZA 1IREB 3TQ7P 2EJFA 5KYUA 1KD1U 2X4XA 4MZPA 1IXDA 1S72Q 5GAMh 2E10A 3G1JA 2A08A 1OOTA 2KYMA 1WHMA 3EFSA 3M0UA 3VS0A 3SFMA 1M90C 3FJ5A 4LDVA 2DKGA 2M9UA 4F7UG 1VQ5Q 3CD6A 2EKHA 2LT1A 2VYTA 1UGPB 4OMNA 4F14A 2DM1A 3JSCA 2EBPA 3KBGA 3CC4A 1KFZA 1BIAA 2CSQA 3C94A 2LT4A 1YCSB 2RMOA 1LPLA 4NOYA 2HMAA 5FRMA 3VS3A 1QVFS 2BTTA 3LH5A 5LL6S 1LCKA 3RKWA 1NJIU 3KUFA 2R57A 1XOVA 3V7SA 1GXIE 2RI5A 1C1AA 3C0CA 2Y4XA 2XI9A 1MUZA 4Q5WA 2AZVA 4M77E 2FPFA 3P8DA 4RG8A 1QP2A 4Z02A 1F1BB 5HCKA 5FU6B 1OX9A 4E47A 2JZ2A 3OYEA 3GLXA 3OYIA 5DLQE 1UEBA 2A36A 2OI3A 3V7RA 1BI2A 1UE9A 5CVIA 3P8BB 4PFOA 4JZ4A 1KHIA 3CMEA 2BUDA 2XDPA 1JXOA 2OTLQ 3CCSQ 2L89A 1TUCA 4Z88A 4MMKA 3TCJA 4FYYB 2J6KA 1D0YA 4RTZA 3CXCA 1AWXA 2DXUA 4MDXA 4N4IA 2OAWA 2JOYA 2XIDA 1U5SA 5GAMj 3SWNB 1VQPQ 1Q82R 4LDYA 4PJOD 3CC2Q 3QBYA 4CC2A 2C0IA 1VYTA 3M57A 2DE0X 2A3LA 3JCMb 3OYKA 4LDWA 4M77G 4BI8B 4R56A 2DD4A 1VQ5A 1W2BA 4OB0B 1UJYA 3PVQA 4ESRA 3JCMX 2MIOA 2RQTA 3M59A 2ZCFB 2E5QA 2J06A 5I22A 2LDMA 3E1SA 3OYFA 2M1HA 4N4GA 2CT3A 2DTHA 1YJWQ 4RCBA 5IAYA 3L2WA 4PJLA 3PFSA 3L2RA 2RJCA 2XDDA 4DQ2A 3UA7A 2EKOA 1UGVA 1SSHA 4F04B 2JJ9A 1ZX6A 3NTHA 1T3SA 1GFDA 1IB8A 3V7CA 2HL5C 4FL6A 3H9NA 2CT4A 3VYHB 3DLMA 3OYCA 2ZPEB 1ZBJA 2JVVA 2CP5A 3ASKA 2RF0A 4IUPA 4PJOC 4RMOA 3ZL7C 1OPKA 2E64A 5IXFA 4FT2A 1Y57A 1LVKA 1P92A 4OB2B 4F17A 4C5EA 4HCCA 1QVGS 1Y7XA 4JRIA 3CBPA 1X43A 4P5NA 2LX7A 5CAIA 2VB6A 1JJ2S 1RAEB 5FU6C 2D1XA 1RACB 2VKNA 1SPKA 3O8VA 2DYBA 4QQGA 1YHQQ 5DY9A 2F2VA 3META 3OYLA 1PRLC 4BE1A 1WQWA 3RERA 2XKOC 2ROTA 2VGNA 2YXYA 3M58A 3RKXA 4JLGA 1UJ0A 3CCVQ 2EW3A 2O9SA 1G3TA 2EQMA 4FM4B 1OX8A 4RTXA 4CI0C 3HRUA 1RAFB 1ACMB 2XDBA 2E5KA 2E4HA 4XAXB 5C6SA 1X2QA 5LJ3g 1FYNA 1PC0A 3EG0A 1DJ7B 3UA6A 2CH4A 4WCIA 4M7AD 2ZPIB 2W0ZA 2O88A 2ESWA 5A2QE 3QHSA 5D7UA 5CCAA 3MPUB 4MDWA 3MEWA 4OMQA 4E7SA 1RL2A 2L3RA 1M30A 2DZ9A 2HKNA 2RHZA 4J8OA 2I0NA 1YJWA 3EGUA 4FCYA 4BUGA 5KH6A 1VQMT 3HTRA 4LE9A 1C6VX 1U06A 5GANg 2DD5A 3THKA 4HCBA 2F1LA 1PHTA 1VQOQ 2RD1A 3L1AA 5GMKe 4LNPA 4LXCA 1SG5A 4C8QB 2QYZA 4EPCA 2PVGB 2KMTA 4TVRA 2GTJA 3OW2P 1K73U 3PNWC 3CBMA 2E6NA 4M7AC 5KYWB 2COYA 1M2VB 1OU9A 5EC7A 2RPNA 3QSUA 1M3BA 2ATCB 3C95A 2KE9A 3VS6A 3QWXX 3CCEQ 2VVKA 3DB3A 4FIBA 1NG2A 1V29B 1YHQA 4C92F 1OEBA 2NUTB 1CKAA 3LWHA 4J9DA 4QKUA 2NUPB 4BE0A 2CS7A 1MV0B 4J9IA 3QZ5B 4XTUA 3QJ6A 5GAOn 1ABQA 1IGUA 1KJWA 2K4YA 3CC7T 1K9MU 1WLPB 1GBRA 1IZ6A 2GGRA 1Y71A 3A8MB 3A8GB 3ULRB 3UT1A 2QDLA 1D1AA 2FYKA 2H8HA 4C8QD 4GBQA 3OBYA 3OS5A 5LJ5g 3OW2S 3G71Q 4M7DF 1LOJA 3HFOA 1YJNT 3I55Q 2D0NA 2QA4T 4GLMA 1AZGB 1QVPA 1OV3A 2FRYA 1RAIB 3JB9G 1G3YA 4LDUA 3E9GA 1YJ9Q 1N8RU 3LWIA 4BY6B 2J7IA 4EDUA 1VQMA 2LTOA 2I2LA 2V8KA 1YWPA 2QQAA 5CK9A 1VQOA 3QYGB 3VRZA 3S3MA 1WHJA 5FRNA 4JJDA 3OYJA 1HD3A 1ZQ1A 2K6DA 2K57A 1QKXA 5IHIA 3G7ZA 1XJWB 1X01A 1NYFA 2Z0WA 5CKBA 4OMLA 1WHLA 1W1FA 1VQ4T 2KEAA 4C8QC 2CKKA 3F70A 1VQ4Q 2P4RA 5IT9E 1QWFA 2FG0A 3O5ZA 3MCAB 1WHGA 2RJEA 3M4YA 2XMFA 1AT1B 2K9GA 4Y28E 1WJRA 1ZUKA 4M4ZA 1M3CA 1B34B 1VQLT 1I5OB 5LJ3d 2GF7A 4OGCA 2PQWA 1RLQC 1KQSA 4ZTFA 3HKSA 1RABB 1MMNA 4J9EA 2CUDA 2HZYA 3X25B 2MK5A 2DF6A 5A0DA 4M75F 3CC7A 3H41A 2QQBA 3QIIA 3QXEB 2ZZDA 1I07A 3X26B 2RO0A 4XTZA 3ZBDA 1VQ8T 4OB3B 3G71A 3N5BB 5GANd 1TG0A 2VXFA 2QA4A 3JCMe 3REAB 1BI0A 1M1KU 1UGSB 2R58A 2JTEA 2RB6A 4ZTJA 4HT8A 3L2ZA 4JS4A 1EX4A 3MJXA 2G6FX 2QXFA 4N0AC 4Y91A 3M0PA 1VQNQ 5GMKi 4C8QE 4AMCA 4J9CA 3UF4A 4OMPA 3TVTA 3EHQA 3EG9A 5FROA 2YUOA 2DL4A 2L2PA 1EFNA 5GAN3 1M90U 2E41A 3BDUA 4ZNXA 2CP2A 3DKMA 5I2SA 4F7UF 1VQ4A 2X4WA 4QT7A 2MYSA 3EGXB 1JXMA 1R0CB 1QW1A 2J6OA 1BYMA 4M78B 2L5QA 5CQYA 3OS1A 2EFIA 2LCLA 2AZSA 1K8AR 1WJSA 1YI2Q 1D3BA 1N5ZA 1YITT 2E1HA 1VQLA 1W70A 2O4XB 3UWNA 2VGMA 2P0QA 1BK2A 2WSEE 3CMAT 2YRCA 2ZPBB 4XTVA 3FB9A 3L2QA 2LVMA 3RKYA 2E6ZA 2F69A 5LJ5d 5CIUA 2DTOA 2CP3A 1M27C 1CKBA 4PL6A 2DPPB 2L8DA 5KYUB 1K8AC 2X51A 4J6XA 1JB0E 2KGTA 5KYXA 2B8AA 3QYHB 5DM7R 4KBMB 4X9DA 1K4US 4OP0A 2V1RA 1VQ8A 4QVDA 5D6YA 3GP8A 1HYOA 1ZA2B 2RJDA 2HKQB 1QP3A 3CCQQ 2YT6A 3VJPA 3L2UA 3SHWA 2KXDA 3CPWA 2A7YA 3RR6A 4NL2A 3DLLA 1KC8R 2SEMA 3M53A 2Y90A 1Q7YR 5C0MA 4A4EA 5I21A 2K5LA 1VQNA 2QASA 4Z89A 1I1JA 1ZA1B 3QDRB 2O2OA 2RK1A 3NHNA 1PSEA 4J5YA 3BW1A 3I56T 1N9RA 1OPLA 3RUXA 1GBQA 4M77F 2CYZB 3H8ZA 2FPEA 3QJYA 3CXCP 2F2WA 5GAMg 2LQNA 2K3YA 2VASA 5CKDA 1I4K1 1X2KA 1H3ZA 2KSSA 3FIFA 3S6WA 2HDAA 1PNJA 1N6AA 2ROLA 3CCMT 4PLLA 2L3PA 1YI2A 2RQRA 1ABOA 4ATOA 3OA6A 4JZ3A 3M5AA 3CMAA 1W2BP 4M78C 1KSWA 4MZMA 1FWZA 2GTOA 3J81E 3EAEA 1M5Q1 4OMOA 3NTKA 2QQ9A 4PJOB 1QLYA 1KIKA 4V2SA 2HBPA 1TTHB 1PKTA 3RMSA 5GAN4 5GMKh 3FDRA 1IRXA 2RM4A 3JCMf 1RAAB 4CC4B 5GMKm 3JB9I 3M54A 2V1QA 2K2VA 5GAN7 1ZUYA 2LQKA 1PG5B 3OYHA 5AT1B 3CCQA 4II1A 5FU7C 2HQXA 4B6MA 4Z8AA 3V8LA 4JJCA 2HD0A 4JDSA 3WXMB 1QVFA 1NEBA 2F5KA 5CKHA 4DBFA 1G3WA 3EGDA 3I35A 2LRQA 4CC3A 2AKLA 1WX6A 1SSFA 2V26A 4Y92A 1X75C 1NM7A 4PKCC 1W4SA 1K1ZA 2K79A 1QMCA 3VS1A 3QUIA 1KD1R 3I56A 1N9SA 2J05A 1YIJT 3TEEA 2D9TA 1BU1A 2EAYA 1Q81U 1IGQA 4M78E 2JMCA 2BIVA 2PVDB 3ER0A 3LH0A 2GFAA 1GCQA 5GMKl 3R6OA 2DJQA 1GCPA 2PNIA 1AOJA 1X27A 1YP5A 3CCLQ 3CCLT 2M16A 1Q82C 4KT0E 4C0DC 4HVUA 4R0KA 2P0KA 1IHVA 2MWPA 4E7LA 2DYIA 1VQKT 3INZA 4KH1B 5KE3A 1WI7A 1B3QA 1X6BA 4M7AB 3TU4K 1M2OA 1NJIR 3JRZA 2CP7A 2DL5A 4AG2C 1R77A 5KCOA 1RADB 3JCMV 3OYYA 1Y0MA 2DVEA 1J3TA 2CDTA 3JCMW 2KY9A 1QCOA 3PIPA 2K3BA 4L59A 4M78G 4FSXA 5GAN8 1EIFA 4HA8A 1WJQA 3MKDA 1WQ7A 5A0LA 3S3OA 2IG0A 4A4KA 2DERA 5GAMd 2DL3A 1K0XA 3VS2A 3MO8A 2JTMA 1SEMA 4XU0A 1T0HA 4C92A 4HVWA 5A0GA 4QVCA 1YIJA 5J26A 3OYDA 1YNZA 1SHGA 2QGGA 1QVGA 1WA7A 4QQ6A 3RDVA 3JB9F 1JJ2A 4C92D 4J9GA 4HT9A 1RAGB 2C0OA 3OSSC 4E2FB 1JBMA 1FMVA 4WTOB 3CCLA 4XTXA 1UHCA 2RI2A 2QTXA 2KRSA 4C5HA 3JCMh 2JNGA 1MV3A 2V8IA 3CCJT 3NPFA 1R0BG 1M8MA 4M7DA 2MOXA 1VQMQ 1JQQA 4PJOE 1VQKA 1Q95G 2CZ7B 1H8KA 2WSCE 5KE2A 1QWEA 2BZXA 4KRTA 3WVDB 5HKCA 2RN8A 1WDXA 1TWBA 5L8RE 2D8JA 1NZ9A 1TS9A 4JJNK 4XU3A 4J9FA 2D6FA 4M7DD 2EJ9A 4LN2A 4PFPA 4B9WA 4BI4A 2O9VA 5D6WA 4FU6A 3FRNA 2LC4A 3G4ST 4ORZA 2CP6A 2EQJA 4E7IA 2QDYB 1VA7A 1HK9A 3VUZA 1D0ZA 2YUNA 3HRSA 3HPWA 1U8RA 4C92C 3GOXA 2X35A 2PVOB 4NL3A 2DMOA 4AFQC 2RHYA 4IUTA 3Q1JA 4DBRA 4RKUE 3BY7A 4BB7A 1I8FA 4PJJA 2NUZA 5KYNA 2EQIA 5I2MA 8ATCB 1TXQA 3BDLA 3M0TA 3T9NA 4PJOG 1MMAA 2BZ8A 4X9CA 3CC7Q 3BFMA 1UUEA 1WXBA 2VUBA 1BKBA 1OZ2A 2MI6A 2GQVA 1YWOA 3I5RA 4IURA 4X34A 4M7DC 4YTLA 1WZOA 2LNVA 1A0NB 4IUVA 4M75A 5GAN5 2VXEA 3MHXA 1YJNQ 2QA4Q 2A28A 2QQSA 2LQ8A 3LGFA 4KUDK 5FLXE 1ZSZA 1YCYA 2DA9A 2DTIA 5CKEA 3CCRT 2G3RA 3NTIA 1VUBA 3QWYA 3CCJA 2H3EB 2AK5A 2X3XD 3LW5E 5KYYA 2QEXT 2E65A 3ZFJA 4M75D 1MMDA 2YDLA 1ARKA 3EFOA 1UG1A 1AD5A 4M7AE 4KULA 1VIFA 2CP0A 2PUOB 4IIMA 2K3XA 1RLPC 4RCCA 2XG8D 2DEQA 3U23A 4AG1C 2QG9B 1VIEA 1K73R 2RQVA 3OW2A 3VV0A 1GRIA 3VYGA 1UDLA 2C06A 2YSQA 2LX9A 3OMCA 4ZN3A 1O75A 2FEIA 2CREA 3LLRA 2PUKB 3M56A 4F7UA 4EIKA 2JS0A 1HJDA 3JCMQ 3OYMA 1VQLQ 3OBWA 1H641 1WNLA 2D0QB 4J7FA 1Q86U 3MEVA 1QQJA 3OMGA 2DXTA 4KGVB 3PGGA 3J7AF 2DX1A 2HBWA 2HL3A 1AEYA 2CSIA 4M7AG 3EG9B 5D6XA 1RUWA 5IHNA 3QPHA 1K9MR 3QG1A 5LJ3e 3ME9A 2VC8A 5IHKA 1VQ8Q 1NE8A 1AWWA 4FYXB 2B86A 4OVAA 2L3QA 1VQ7T 1YJNA 2EIFA 3GF5A 2HSPA 4BI3A 1TOVA 2SRCA 2LQWA 3G6ET 2FZKB 1BI3A 4EMKA 4D8KA 1H92A 5FWBA 3CCRA 2YRVA 5CKFA 2QQRA 4A53A 1N27A 4DBQA 2ENMA 1BCOA 1K9MC 3NFCA 4XU1A 3EH2A 1N8RR 2BE9B 1WIEA 4ANJA 2VV5A 3A98A 1WHKA 3RBBB 5GANe 2A0FB 2ZAEA 4HCZA 3CCUT 1JO8A 2OTJT 1BBZA 1D1CA 3HP9A 3HSBA 4XU2A 4L5GA 3IQLA 3EG3A 2LCCA 1OYXA 2KRMA 2FHDA 4ZN1A 2P4TA 1X6GA 5IH2A 1PWTA 1G2BA 3C4SA 2MMPA 3C12A 2PTKA 3I9QA 5KYXB 3NMZC 1N8RC 2QAZA 4HCKA 1G3SA 2CH4W 2COZA 1KHCA 3UPUA 4JUVA 4M77A 3OSVA 2EWNA 2EQKA 1YITQ 3VRYA 2MAMA 4BD3A 1Z9QA 1JEGA 1FXXA 2LJ0A 2BE7D 3OY9A 3CMAQ 2WACA 3SD4A 2GQIA 5CQXA 4HVVA 2LJ1A 1WPYA 2YUPA 1QCFA 4M77D 1B07A 2V8JA 3QZ9B 3CQTA 1NYGA 2OX7A 4PJNA 4XK8E 3ZEHA 4C8QG 3MEUA 4OB1B 3CC4T 5GAN2 1TH7A 1TUGB 5FU7B 2HQHA 4VUBA 3UDCA 2FRWA 3D7SB 4O5VA 2KNBB 4A4HA 1SHFA 1G83A 3EH1A 5LJ5e 2AKKA 1TSFA 2JM8A 3G6EA 4BDYA 3HHTB 1C0MA 4LUEA 1V1CA 3M0RA 1SRLA 1XNIA 4DOWA 2DBMA 1M8VA 2ECZA 1FX7A 4C5IA 1M1KR 5HK3A 1ZSGA 1GFCA 1Y96A 2FL7A 4J6WA 3PE0A 4MMLA 1I0CA 1KK7A 1M1FA 3GNFB 2O4XA 4MZTA 4E7HA 4FYVB 2DNUA 5CO7A 2WSFE 1ZBXA 5GJVB 4JRKA 3WVEB 3LGLA 4A54A 3I56Q 2K2MA 4E7JA 1M90R 1M9SA 1KC8C 1T3LA 1M1KC 4CC7A 1Q7YC 4R55A 1ZLMA 4NS5A 2DL7A 5J39A 1QCNA 3J80E 3SB2A 3R6NA 2GNCA 4C0DB 1Q82U 4BACA 2J6FA 3CCMQ 1S72T 3A8LB 1YN8A 2LNHB 3NGPA 1FMKA 1YITA 5GJWB 4DEYA 1R8OB 2ZPFB 1KG1A 2DIGA 2KROA 2R5MA 4KGXB 5LJ3f 2M0YA 2LJ3A 1VQ5T 2P84A 3VUBA 1VYUA 2JMAA 4HKEA 1BI1A 2LMJA 2X3WD 3EGDB 5J3BA 3GBQA 1BB9A 2JT4A 4KGZB 3L42A 1W6XA 3FC3A 3QKJA 2Y4YA 1OQKA 3GIBA 2EGAA 1IO6A 1XQHA 8AT1B 3V8JA 1PRMC 2IVWA 4M78F 2HAXA 3AHUA 2RQWA 1PD1A 5GANf 3CXCS 1TU0B 4LD9K 4JS5A
chains in the Genus database with same CATH topology
3HTRA 2DYIA 3H9NA 2QGGA 2F1LA 1PM3A 3A1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTR A;  2DYI A;  3H9N A;  2QGG A;  2F1L A;  1PM3 A;  3A1P A; 
#chains in the Genus database with same CATH topology
 1V76 A;  1D1B A;  2EYZ A;  1MHN A;  2FVU A;  2RK2 A;  4ME7 A;  1K76 A;  4X1V A;  1GL5 A;  1U1T A;  3JB9 J;  4DEX A;  2EQU A;  4UC4 A;  3HL8 A;  1W2B S;  4O6J A;  3KFV A;  2QK0 A;  2GFU A;  5M9O A;  1PM3 A;  4RUG A;  2DZC A;  2KI7 A;  4HXJ A;  4J9B A;  4J6Y A;  1YIJ Q;  1YFN A;  2DVJ A;  3X28 B;  5GAN 6;  4PJO A;  4L6V 5;  2CGH A;  2OTL T;  3CCS T;  1AVZ C;  2VWF A;  2XHC A;  2E3I A;  2YRD A;  3M0Q A;  5GAO r;  4RG2 A;  3CCM A;  1S72 A;  3VKI A;  2CZ6 B;  1BCM A;  3PIO A;  2KR3 A;  2NLU A;  1VQP T;  2MF2 A;  1QVG P;  3CC2 T;  1WHH A;  4C0G A;  1KD1 C;  5IN1 A;  2ED1 A;  4XQ3 A;  3REB B;  3CPF A;  2O01 E;  2DXC A;  4ZGJ B;  1JJ2 P;  4EMG A;  3HFN A;  2KT8 A;  1VQK Q;  3E2U A;  1G5V A;  2EGE A;  2HEQ A;  2DET A;  3URG A;  2MPX C;  1UEC A;  1VQ6 T;  1VQ6 Q;  1SF9 A;  4A4G A;  5LJ5 f;  2E3H A;  1NPP A;  2COW A;  5GMK j;  2JXB A;  1D09 B;  3JB9 D;  1YJW T;  3PTA A;  2IIM A;  3OS0 A;  4C92 B;  3LX7 A;  3JAM E;  1JRI A;  4PFZ A;  4IKF A;  3PMI A;  2M02 A;  3SWN A;  1AWJ A;  3OYG A;  2LP5 A;  1IHW A;  9ATC B;  4IIO A;  1RI0 A;  2EPD A;  2KYB A;  4C5G A;  1NJI C;  1CSK A;  1K9A A;  4FW1 A;  3M9Q A;  4E6R A;  2KT1 A;  4B9X A;  1PKS A;  2FZC B;  3JV3 A;  3CEY A;  2YLC A;  2C0T A;  4PJO F;  2EYW A;  3PT9 A;  3TSW A;  4LD6 A;  4OMF B;  1GCQ C;  4M7D B;  2DO3 A;  3MP1 A;  3BE3 A;  1H3H A;  3AT1 B;  4BDZ A;  1I81 A;  3VS4 A;  1U1S A;  2IPO B;  2E12 A;  4A63 B;  1OUL A;  4IUQ A;  2QI2 A;  1WFW A;  1YHQ T;  4F16 A;  1LNX A;  2OTL A;  3CCS A;  2QTV A;  2DAQ A;  2X4J A;  4M7A A;  1ZHI A;  2RA2 A;  2AHJ B;  4EMH A;  2DIQ A;  1AZE A;  2FB7 A;  3JCM c;  5GAM e;  4RTU A;  3CCV T;  5LJ3 h;  4ELZ C;  3QO3 A;  1Q81 R;  4J83 A;  1MNE A;  3LYI A;  1VQP A;  2MWO A;  3CC2 A;  1XTD A;  1WYX A;  3GPL A;  2F5T X;  3CCJ Q;  7AT1 B;  1WXU A;  3SWN C;  2F2X A;  3JCM g;  2EGC A;  3H0F A;  2JM9 A;  1KQ2 A;  4JRQ A;  1Q81 C;  1VQ6 A;  2P0P A;  4GY5 A;  5GAN h;  3PVL A;  3RES A;  2RHI A;  1HXD A;  2DBK A;  2KAF A;  3M55 A;  4FSS A;  4RTV A;  4FT4 A;  3H0I A;  4J9H A;  3G4S Q;  1VQO T;  4QQD A;  2FPD A;  2JW4 A;  3DB4 A;  4AT1 B;  4E7Z A;  3L2V A;  1Z9Z A;  3M4G A;  3OYA A;  4RTT A;  3M0S A;  2RJF A;  5DLO A;  5GAO p;  2JTF A;  3MP8 A;  4M75 B;  1NLO C;  3E19 A;  2GBQ A;  1RI9 A;  4OF1 A;  4A4F A;  1ZSZ B;  2R5A A;  2DRK A;  2H3J A;  3OQ5 A;  3SDZ A;  1M1G A;  4C0F A;  4M7A F;  4K11 A;  5KYY B;  3CCE T;  1X6O A;  4IUU A;  5FWC A;  2AIR B;  3EFO B;  2L3S A;  4OGE A;  1KQS P;  2HCK A;  5CR2 A;  1WGS A;  3H6Z A;  2DFU A;  1YBY A;  4C8Q A;  3CCV A;  2LZ6 B;  5EG2 A;  5LJ3 j;  2RNA A;  4JLI A;  4D8D A;  2EYX A;  3FEO A;  4JRP A;  5KYW A;  2NYS A;  1RAH B;  2XU8 A;  2XK0 A;  1M2V A;  5LJ5 h;  4PJM A;  3CCR Q;  2CZ0 B;  4D6W A;  2DK3 A;  2DEU A;  5HK0 A;  4F7U B;  1MMG A;  4XTW A;  3OYN A;  2QEX Q;  2EYY A;  1B7T A;  2RI3 A;  3G71 T;  1TUD A;  3MEA A;  3I55 T;  2YLB A;  3A8O B;  2RHX A;  1ZUU A;  4CRI A;  2KBT A;  5GAN j;  4LUD A;  2NUT A;  4KH0 B;  1YJ9 T;  4C92 E;  4QW2 A;  1FMW A;  2NUP A;  3E9F A;  3G4S A;  2BZY A;  2YWW A;  5GAO q;  1KQS S;  1X69 A;  1PSF A;  4DBH A;  4AFU C;  2ED0 A;  1UTI A;  1VYV A;  3QDF A;  2RH2 A;  2W10 A;  2RHU A;  4E7K A;  1UHF A;  1WXT A;  2YHT A;  4EMK B;  1QKW A;  2KXC A;  4FW2 A;  4N0A A;  1NBE B;  1UFF A;  2KDS A;  2PU9 B;  4PK4 A;  2DIL A;  4M75 C;  1K73 C;  1K8A U;  4M7D E;  3JB9 H;  2L0A A;  3CCE A;  3JCM P;  1NLP C;  4C8Q F;  2DL8 A;  1AHJ B;  4QVZ A;  5GAM f;  4RTY A;  1ZSZ C;  2YUQ A;  3EFR A;  2DLP A;  3A5Z B;  4OMM A;  3KXT A;  4JJB A;  5IXB A;  2CUB A;  3VS5 A;  3S3N A;  3TRE A;  4BE2 A;  4GLK A;  2ABL A;  3RNJ A;  1OI1 A;  5HY6 A;  5AYF A;  2AT1 B;  3A8H B;  1MGQ A;  4C92 G;  4PNO A;  2MCN A;  3X24 B;  5ECA A;  3VS7 A;  1VQ7 Q;  3JCM d;  3OYB A;  2K7A A;  3RIR A;  3G6E Q;  4RTW A;  5LJ5 j;  2JUF A;  3OB9 A;  5I11 A;  4XTY A;  2EJG A;  4M77 B;  3JCM J;  2QEX A;  1D3B B;  2EVR A;  4DOV A;  3FLG A;  1VOM A;  3UAT A;  3TSZ A;  3CPW P;  3I55 A;  1KQ1 A;  6AT1 B;  1E6G A;  1B34 A;  2BKD N;  4KUI A;  3CCU Q;  3GNG A;  2OTJ Q;  1KC8 U;  3RMQ A;  1LJO A;  5L23 A;  1OZ3 A;  1SKU B;  1Q7Y U;  4M7D G;  4ZGD B;  1YJ9 A;  1VQ9 T;  1VQ9 Q;  2CZ1 B;  1D0X A;  3X20 B;  3V8K A;  1T0J A;  2JS2 A;  1VQN T;  4PLI A;  1M3A A;  1M4Z A;  1G8X A;  2O31 A;  1PCX A;  2DXB A;  2D8H A;  4DA4 A;  1PD0 A;  4FYW B;  4BY6 C;  4M75 E;  1MND A;  2DJZ A;  2EYQ A;  3SEM A;  1BIB A;  1UB4 A;  2PZ1 A;  3MP6 A;  4JPB W;  2KK4 A;  2QGF B;  2X9H A;  4J7I A;  1UGQ B;  3H0H A;  4AFS C;  2XD0 A;  2FZG B;  3OS2 A;  1AWO A;  1JU5 C;  3P8H A;  1HSQ A;  4WF2 A;  1Q86 R;  1I5L A;  2KQW A;  5GAO m;  3CD6 T;  3CD6 Q;  1Y96 B;  1NEG A;  4EMK C;  1K0S A;  1YI2 T;  1E7O A;  3I5S A;  4ELY C;  1O9S A;  3CPW S;  3CC4 Q;  2LCS A;  2XIC A;  2JN0 A;  1EZZ B;  2K5F A;  2X4Y A;  1NPR A;  1Y07 A;  4LDX A;  2E70 A;  1VQ7 A;  3EHR A;  2ZPG B;  1Q86 C;  1E6H A;  4AFZ C;  2HNI A;  2GCX A;  5FW9 A;  2A37 A;  2OAU A;  2HQE A;  2M0O A;  3FJP A;  1U3O A;  2RQU A;  3EGX A;  2KVQ G;  4F7U E;  4M75 G;  1UGR B;  3EG1 A;  1SRM A;  4M78 A;  2NWM A;  3A1P A;  3CBO A;  2K5I A;  1OU8 A;  3CCU A;  3CCQ T;  2OTJ A;  4M77 C;  3HRT A;  5KCH A;  2ZGW A;  3VU3 C;  2DRM A;  4ZGE B;  2FO0 A;  2ZPH B;  1S1N A;  2HSE B;  1VQ9 A;  1QVF P;  5GAO l;  2M51 A;  3PMT A;  2KRN A;  4M78 D;  2OJ2 A;  4N4H A;  3EG2 A;  3CME Q;  3CME T;  4C0Z A;  1IRE B;  3TQ7 P;  2EJF A;  5KYU A;  1KD1 U;  2X4X A;  4MZP A;  1IXD A;  1S72 Q;  5GAM h;  2E10 A;  3G1J A;  2A08 A;  1OOT A;  2KYM A;  1WHM A;  3EFS A;  3M0U A;  3VS0 A;  3SFM A;  1M90 C;  3FJ5 A;  4LDV A;  2DKG A;  2M9U A;  4F7U G;  1VQ5 Q;  3CD6 A;  2EKH A;  2LT1 A;  2VYT A;  1UGP B;  4OMN A;  4F14 A;  2DM1 A;  3JSC A;  2EBP A;  3KBG A;  3CC4 A;  1KFZ A;  1BIA A;  2CSQ A;  3C94 A;  2LT4 A;  1YCS B;  2RMO A;  1LPL A;  4NOY A;  2HMA A;  5FRM A;  3VS3 A;  1QVF S;  2BTT A;  3LH5 A;  5LL6 S;  1LCK A;  3RKW A;  1NJI U;  3KUF A;  2R57 A;  1XOV A;  3V7S A;  1GXI E;  2RI5 A;  1C1A A;  3C0C A;  2Y4X A;  2XI9 A;  1MUZ A;  4Q5W A;  2AZV A;  4M77 E;  2FPF A;  3P8D A;  4RG8 A;  1QP2 A;  4Z02 A;  1F1B B;  5HCK A;  5FU6 B;  1OX9 A;  4E47 A;  2JZ2 A;  3OYE A;  3GLX A;  3OYI A;  5DLQ E;  1UEB A;  2A36 A;  2OI3 A;  3V7R A;  1BI2 A;  1UE9 A;  5CVI A;  3P8B B;  4PFO A;  4JZ4 A;  1KHI A;  3CME A;  2BUD A;  2XDP A;  1JXO A;  2OTL Q;  3CCS Q;  2L89 A;  1TUC A;  4Z88 A;  4MMK A;  3TCJ A;  4FYY B;  2J6K A;  1D0Y A;  4RTZ A;  3CXC A;  1AWX A;  2DXU A;  4MDX A;  4N4I A;  2OAW A;  2JOY A;  2XID A;  1U5S A;  5GAM j;  3SWN B;  1VQP Q;  1Q82 R;  4LDY A;  4PJO D;  3CC2 Q;  3QBY A;  4CC2 A;  2C0I A;  1VYT A;  3M57 A;  2DE0 X;  2A3L A;  3JCM b;  3OYK A;  4LDW A;  4M77 G;  4BI8 B;  4R56 A;  2DD4 A;  1VQ5 A;  1W2B A;  4OB0 B;  1UJY A;  3PVQ A;  4ESR A;  3JCM X;  2MIO A;  2RQT A;  3M59 A;  2ZCF B;  2E5Q A;  2J06 A;  5I22 A;  2LDM A;  3E1S A;  3OYF A;  2M1H A;  4N4G A;  2CT3 A;  2DTH A;  1YJW Q;  4RCB A;  5IAY A;  3L2W A;  4PJL A;  3PFS A;  3L2R A;  2RJC A;  2XDD A;  4DQ2 A;  3UA7 A;  2EKO A;  1UGV A;  1SSH A;  4F04 B;  2JJ9 A;  1ZX6 A;  3NTH A;  1T3S A;  1GFD A;  1IB8 A;  3V7C A;  2HL5 C;  4FL6 A;  3H9N A;  2CT4 A;  3VYH B;  3DLM A;  3OYC A;  2ZPE B;  1ZBJ A;  2JVV A;  2CP5 A;  3ASK A;  2RF0 A;  4IUP A;  4PJO C;  4RMO A;  3ZL7 C;  1OPK A;  2E64 A;  5IXF A;  4FT2 A;  1Y57 A;  1LVK A;  1P92 A;  4OB2 B;  4F17 A;  4C5E A;  4HCC A;  1QVG S;  1Y7X A;  4JRI A;  3CBP A;  1X43 A;  4P5N A;  2LX7 A;  5CAI A;  2VB6 A;  1JJ2 S;  1RAE B;  5FU6 C;  2D1X A;  1RAC B;  2VKN A;  1SPK A;  3O8V A;  2DYB A;  4QQG A;  1YHQ Q;  5DY9 A;  2F2V A;  3MET A;  3OYL A;  1PRL C;  4BE1 A;  1WQW A;  3RER A;  2XKO C;  2ROT A;  2VGN A;  2YXY A;  3M58 A;  3RKX A;  4JLG A;  1UJ0 A;  3CCV Q;  2EW3 A;  2O9S A;  1G3T A;  2EQM A;  4FM4 B;  1OX8 A;  4RTX A;  4CI0 C;  3HRU A;  1RAF B;  1ACM B;  2XDB A;  2E5K A;  2E4H A;  4XAX B;  5C6S A;  1X2Q A;  5LJ3 g;  1FYN A;  1PC0 A;  3EG0 A;  1DJ7 B;  3UA6 A;  2CH4 A;  4WCI A;  4M7A D;  2ZPI B;  2W0Z A;  2O88 A;  2ESW A;  5A2Q E;  3QHS A;  5D7U A;  5CCA A;  3MPU B;  4MDW A;  3MEW A;  4OMQ A;  4E7S A;  1RL2 A;  2L3R A;  1M30 A;  2DZ9 A;  2HKN A;  2RHZ A;  4J8O A;  2I0N A;  1YJW A;  3EGU A;  4FCY A;  4BUG A;  5KH6 A;  1VQM T;  3HTR A;  4LE9 A;  1C6V X;  1U06 A;  5GAN g;  2DD5 A;  3THK A;  4HCB A;  2F1L A;  1PHT A;  1VQO Q;  2RD1 A;  3L1A A;  5GMK e;  4LNP A;  4LXC A;  1SG5 A;  4C8Q B;  2QYZ A;  4EPC A;  2PVG B;  2KMT A;  4TVR A;  2GTJ A;  3OW2 P;  1K73 U;  3PNW C;  3CBM A;  2E6N A;  4M7A C;  5KYW B;  2COY A;  1M2V B;  1OU9 A;  5EC7 A;  2RPN A;  3QSU A;  1M3B A;  2ATC B;  3C95 A;  2KE9 A;  3VS6 A;  3QWX X;  3CCE Q;  2VVK A;  3DB3 A;  4FIB A;  1NG2 A;  1V29 B;  1YHQ A;  4C92 F;  1OEB A;  2NUT B;  1CKA A;  3LWH A;  4J9D A;  4QKU A;  2NUP B;  4BE0 A;  2CS7 A;  1MV0 B;  4J9I A;  3QZ5 B;  4XTU A;  3QJ6 A;  5GAO n;  1ABQ A;  1IGU A;  1KJW A;  2K4Y A;  3CC7 T;  1K9M U;  1WLP B;  1GBR A;  1IZ6 A;  2GGR A;  1Y71 A;  3A8M B;  3A8G B;  3ULR B;  3UT1 A;  2QDL A;  1D1A A;  2FYK A;  2H8H A;  4C8Q D;  4GBQ A;  3OBY A;  3OS5 A;  5LJ5 g;  3OW2 S;  3G71 Q;  4M7D F;  1LOJ A;  3HFO A;  1YJN T;  3I55 Q;  2D0N A;  2QA4 T;  4GLM A;  1AZG B;  1QVP A;  1OV3 A;  2FRY A;  1RAI B;  3JB9 G;  1G3Y A;  4LDU A;  3E9G A;  1YJ9 Q;  1N8R U;  3LWI A;  4BY6 B;  2J7I A;  4EDU A;  1VQM A;  2LTO A;  2I2L A;  2V8K A;  1YWP A;  2QQA A;  5CK9 A;  1VQO A;  3QYG B;  3VRZ A;  3S3M A;  1WHJ A;  5FRN A;  4JJD A;  3OYJ A;  1HD3 A;  1ZQ1 A;  2K6D A;  2K57 A;  1QKX A;  5IHI A;  3G7Z A;  1XJW B;  1X01 A;  1NYF A;  2Z0W A;  5CKB A;  4OML A;  1WHL A;  1W1F A;  1VQ4 T;  2KEA A;  4C8Q C;  2CKK A;  3F70 A;  1VQ4 Q;  2P4R A;  5IT9 E;  1QWF A;  2FG0 A;  3O5Z A;  3MCA B;  1WHG A;  2RJE A;  3M4Y A;  2XMF A;  1AT1 B;  2K9G A;  4Y28 E;  1WJR A;  1ZUK A;  4M4Z A;  1M3C A;  1B34 B;  1VQL T;  1I5O B;  5LJ3 d;  2GF7 A;  4OGC A;  2PQW A;  1RLQ C;  1KQS A;  4ZTF A;  3HKS A;  1RAB B;  1MMN A;  4J9E A;  2CUD A;  2HZY A;  3X25 B;  2MK5 A;  2DF6 A;  5A0D A;  4M75 F;  3CC7 A;  3H41 A;  2QQB A;  3QII A;  3QXE B;  2ZZD A;  1I07 A;  3X26 B;  2RO0 A;  4XTZ A;  3ZBD A;  1VQ8 T;  4OB3 B;  3G71 A;  3N5B B;  5GAN d;  1TG0 A;  2VXF A;  2QA4 A;  3JCM e;  3REA B;  1BI0 A;  1M1K U;  1UGS B;  2R58 A;  2JTE A;  2RB6 A;  4ZTJ A;  4HT8 A;  3L2Z A;  4JS4 A;  1EX4 A;  3MJX A;  2G6F X;  2QXF A;  4N0A C;  4Y91 A;  3M0P A;  1VQN Q;  5GMK i;  4C8Q E;  4AMC A;  4J9C A;  3UF4 A;  4OMP A;  3TVT A;  3EHQ A;  3EG9 A;  5FRO A;  2YUO A;  2DL4 A;  2L2P A;  1EFN A;  5GAN 3;  1M90 U;  2E41 A;  3BDU A;  4ZNX A;  2CP2 A;  3DKM A;  5I2S A;  4F7U F;  1VQ4 A;  2X4W A;  4QT7 A;  2MYS A;  3EGX B;  1JXM A;  1R0C B;  1QW1 A;  2J6O A;  1BYM A;  4M78 B;  2L5Q A;  5CQY A;  3OS1 A;  2EFI A;  2LCL A;  2AZS A;  1K8A R;  1WJS A;  1YI2 Q;  1D3B A;  1N5Z A;  1YIT T;  2E1H A;  1VQL A;  1W70 A;  2O4X B;  3UWN A;  2VGM A;  2P0Q A;  1BK2 A;  2WSE E;  3CMA T;  2YRC A;  2ZPB B;  4XTV A;  3FB9 A;  3L2Q A;  2LVM A;  3RKY A;  2E6Z A;  2F69 A;  5LJ5 d;  5CIU A;  2DTO A;  2CP3 A;  1M27 C;  1CKB A;  4PL6 A;  2DPP B;  2L8D A;  5KYU B;  1K8A C;  2X51 A;  4J6X A;  1JB0 E;  2KGT A;  5KYX A;  2B8A A;  3QYH B;  5DM7 R;  4KBM B;  4X9D A;  1K4U S;  4OP0 A;  2V1R A;  1VQ8 A;  4QVD A;  5D6Y A;  3GP8 A;  1HYO A;  1ZA2 B;  2RJD A;  2HKQ B;  1QP3 A;  3CCQ Q;  2YT6 A;  3VJP A;  3L2U A;  3SHW A;  2KXD A;  3CPW A;  2A7Y A;  3RR6 A;  4NL2 A;  3DLL A;  1KC8 R;  2SEM A;  3M53 A;  2Y90 A;  1Q7Y R;  5C0M A;  4A4E A;  5I21 A;  2K5L A;  1VQN A;  2QAS A;  4Z89 A;  1I1J A;  1ZA1 B;  3QDR B;  2O2O A;  2RK1 A;  3NHN A;  1PSE A;  4J5Y A;  3BW1 A;  3I56 T;  1N9R A;  1OPL A;  3RUX A;  1GBQ A;  4M77 F;  2CYZ B;  3H8Z A;  2FPE A;  3QJY A;  3CXC P;  2F2W A;  5GAM g;  2LQN A;  2K3Y A;  2VAS A;  5CKD A;  1I4K 1;  1X2K A;  1H3Z A;  2KSS A;  3FIF A;  3S6W A;  2HDA A;  1PNJ A;  1N6A A;  2ROL A;  3CCM T;  4PLL A;  2L3P A;  1YI2 A;  2RQR A;  1ABO A;  4ATO A;  3OA6 A;  4JZ3 A;  3M5A A;  3CMA A;  1W2B P;  4M78 C;  1KSW A;  4MZM A;  1FWZ A;  2GTO A;  3J81 E;  3EAE A;  1M5Q 1;  4OMO A;  3NTK A;  2QQ9 A;  4PJO B;  1QLY A;  1KIK A;  4V2S A;  2HBP A;  1TTH B;  1PKT A;  3RMS A;  5GAN 4;  5GMK h;  3FDR A;  1IRX A;  2RM4 A;  3JCM f;  1RAA B;  4CC4 B;  5GMK m;  3JB9 I;  3M54 A;  2V1Q A;  2K2V A;  5GAN 7;  1ZUY A;  2LQK A;  1PG5 B;  3OYH A;  5AT1 B;  3CCQ A;  4II1 A;  5FU7 C;  2HQX A;  4B6M A;  4Z8A A;  3V8L A;  4JJC A;  2HD0 A;  4JDS A;  3WXM B;  1QVF A;  1NEB A;  2F5K A;  5CKH A;  4DBF A;  1G3W A;  3EGD A;  3I35 A;  2LRQ A;  4CC3 A;  2AKL A;  1WX6 A;  1SSF A;  2V26 A;  4Y92 A;  1X75 C;  1NM7 A;  4PKC C;  1W4S A;  1K1Z A;  2K79 A;  1QMC A;  3VS1 A;  3QUI A;  1KD1 R;  3I56 A;  1N9S A;  2J05 A;  1YIJ T;  3TEE A;  2D9T A;  1BU1 A;  2EAY A;  1Q81 U;  1IGQ A;  4M78 E;  2JMC A;  2BIV A;  2PVD B;  3ER0 A;  3LH0 A;  2GFA A;  1GCQ A;  5GMK l;  3R6O A;  2DJQ A;  1GCP A;  2PNI A;  1AOJ A;  1X27 A;  1YP5 A;  3CCL Q;  3CCL T;  2M16 A;  1Q82 C;  4KT0 E;  4C0D C;  4HVU A;  4R0K A;  2P0K A;  1IHV A;  2MWP A;  4E7L A;  2DYI A;  1VQK T;  3INZ A;  4KH1 B;  5KE3 A;  1WI7 A;  1B3Q A;  1X6B A;  4M7A B;  3TU4 K;  1M2O A;  1NJI R;  3JRZ A;  2CP7 A;  2DL5 A;  4AG2 C;  1R77 A;  5KCO A;  1RAD B;  3JCM V;  3OYY A;  1Y0M A;  2DVE A;  1J3T A;  2CDT A;  3JCM W;  2KY9 A;  1QCO A;  3PIP A;  2K3B A;  4L59 A;  4M78 G;  4FSX A;  5GAN 8;  1EIF A;  4HA8 A;  1WJQ A;  3MKD A;  1WQ7 A;  5A0L A;  3S3O A;  2IG0 A;  4A4K A;  2DER A;  5GAM d;  2DL3 A;  1K0X A;  3VS2 A;  3MO8 A;  2JTM A;  1SEM A;  4XU0 A;  1T0H A;  4C92 A;  4HVW A;  5A0G A;  4QVC A;  1YIJ A;  5J26 A;  3OYD A;  1YNZ A;  1SHG A;  2QGG A;  1QVG A;  1WA7 A;  4QQ6 A;  3RDV A;  3JB9 F;  1JJ2 A;  4C92 D;  4J9G A;  4HT9 A;  1RAG B;  2C0O A;  3OSS C;  4E2F B;  1JBM A;  1FMV A;  4WTO B;  3CCL A;  4XTX A;  1UHC A;  2RI2 A;  2QTX A;  2KRS A;  4C5H A;  3JCM h;  2JNG A;  1MV3 A;  2V8I A;  3CCJ T;  3NPF A;  1R0B G;  1M8M A;  4M7D A;  2MOX A;  1VQM Q;  1JQQ A;  4PJO E;  1VQK A;  1Q95 G;  2CZ7 B;  1H8K A;  2WSC E;  5KE2 A;  1QWE A;  2BZX A;  4KRT A;  3WVD B;  5HKC A;  2RN8 A;  1WDX A;  1TWB A;  5L8R E;  2D8J A;  1NZ9 A;  1TS9 A;  4JJN K;  4XU3 A;  4J9F A;  2D6F A;  4M7D D;  2EJ9 A;  4LN2 A;  4PFP A;  4B9W A;  4BI4 A;  2O9V A;  5D6W A;  4FU6 A;  3FRN A;  2LC4 A;  3G4S T;  4ORZ A;  2CP6 A;  2EQJ A;  4E7I A;  2QDY B;  1VA7 A;  1HK9 A;  3VUZ A;  1D0Z A;  2YUN A;  3HRS A;  3HPW A;  1U8R A;  4C92 C;  3GOX A;  2X35 A;  2PVO B;  4NL3 A;  2DMO A;  4AFQ C;  2RHY A;  4IUT A;  3Q1J A;  4DBR A;  4RKU E;  3BY7 A;  4BB7 A;  1I8F A;  4PJJ A;  2NUZ A;  5KYN A;  2EQI A;  5I2M A;  8ATC B;  1TXQ A;  3BDL A;  3M0T A;  3T9N A;  4PJO G;  1MMA A;  2BZ8 A;  4X9C A;  3CC7 Q;  3BFM A;  1UUE A;  1WXB A;  2VUB A;  1BKB A;  1OZ2 A;  2MI6 A;  2GQV A;  1YWO A;  3I5R A;  4IUR A;  4X34 A;  4M7D C;  4YTL A;  1WZO A;  2LNV A;  1A0N B;  4IUV A;  4M75 A;  5GAN 5;  2VXE A;  3MHX A;  1YJN Q;  2QA4 Q;  2A28 A;  2QQS A;  2LQ8 A;  3LGF A;  4KUD K;  5FLX E;  1ZSZ A;  1YCY A;  2DA9 A;  2DTI A;  5CKE A;  3CCR T;  2G3R A;  3NTI A;  1VUB A;  3QWY A;  3CCJ A;  2H3E B;  2AK5 A;  2X3X D;  3LW5 E;  5KYY A;  2QEX T;  2E65 A;  3ZFJ A;  4M75 D;  1MMD A;  2YDL A;  1ARK A;  3EFO A;  1UG1 A;  1AD5 A;  4M7A E;  4KUL A;  1VIF A;  2CP0 A;  2PUO B;  4IIM A;  2K3X A;  1RLP C;  4RCC A;  2XG8 D;  2DEQ A;  3U23 A;  4AG1 C;  2QG9 B;  1VIE A;  1K73 R;  2RQV A;  3OW2 A;  3VV0 A;  1GRI A;  3VYG A;  1UDL A;  2C06 A;  2YSQ A;  2LX9 A;  3OMC A;  4ZN3 A;  1O75 A;  2FEI A;  2CRE A;  3LLR A;  2PUK B;  3M56 A;  4F7U A;  4EIK A;  2JS0 A;  1HJD A;  3JCM Q;  3OYM A;  1VQL Q;  3OBW A;  1H64 1;  1WNL A;  2D0Q B;  4J7F A;  1Q86 U;  3MEV A;  1QQJ A;  3OMG A;  2DXT A;  4KGV B;  3PGG A;  3J7A F;  2DX1 A;  2HBW A;  2HL3 A;  1AEY A;  2CSI A;  4M7A G;  3EG9 B;  5D6X A;  1RUW A;  5IHN A;  3QPH A;  1K9M R;  3QG1 A;  5LJ3 e;  3ME9 A;  2VC8 A;  5IHK A;  1VQ8 Q;  1NE8 A;  1AWW A;  4FYX B;  2B86 A;  4OVA A;  2L3Q A;  1VQ7 T;  1YJN A;  2EIF A;  3GF5 A;  2HSP A;  4BI3 A;  1TOV A;  2SRC A;  2LQW A;  3G6E T;  2FZK B;  1BI3 A;  4EMK A;  4D8K A;  1H92 A;  5FWB A;  3CCR A;  2YRV A;  5CKF A;  2QQR A;  4A53 A;  1N27 A;  4DBQ A;  2ENM A;  1BCO A;  1K9M C;  3NFC A;  4XU1 A;  3EH2 A;  1N8R R;  2BE9 B;  1WIE A;  4ANJ A;  2VV5 A;  3A98 A;  1WHK A;  3RBB B;  5GAN e;  2A0F B;  2ZAE A;  4HCZ A;  3CCU T;  1JO8 A;  2OTJ T;  1BBZ A;  1D1C A;  3HP9 A;  3HSB A;  4XU2 A;  4L5G A;  3IQL A;  3EG3 A;  2LCC A;  1OYX A;  2KRM A;  2FHD A;  4ZN1 A;  2P4T A;  1X6G A;  5IH2 A;  1PWT A;  1G2B A;  3C4S A;  2MMP A;  3C12 A;  2PTK A;  3I9Q A;  5KYX B;  3NMZ C;  1N8R C;  2QAZ A;  4HCK A;  1G3S A;  2CH4 W;  2COZ A;  1KHC A;  3UPU A;  4JUV A;  4M77 A;  3OSV A;  2EWN A;  2EQK A;  1YIT Q;  3VRY A;  2MAM A;  4BD3 A;  1Z9Q A;  1JEG A;  1FXX A;  2LJ0 A;  2BE7 D;  3OY9 A;  3CMA Q;  2WAC A;  3SD4 A;  2GQI A;  5CQX A;  4HVV A;  2LJ1 A;  1WPY A;  2YUP A;  1QCF A;  4M77 D;  1B07 A;  2V8J A;  3QZ9 B;  3CQT A;  1NYG A;  2OX7 A;  4PJN A;  4XK8 E;  3ZEH A;  4C8Q G;  3MEU A;  4OB1 B;  3CC4 T;  5GAN 2;  1TH7 A;  1TUG B;  5FU7 B;  2HQH A;  4VUB A;  3UDC A;  2FRW A;  3D7S B;  4O5V A;  2KNB B;  4A4H A;  1SHF A;  1G83 A;  3EH1 A;  5LJ5 e;  2AKK A;  1TSF A;  2JM8 A;  3G6E A;  4BDY A;  3HHT B;  1C0M A;  4LUE A;  1V1C A;  3M0R A;  1SRL A;  1XNI A;  4DOW A;  2DBM A;  1M8V A;  2ECZ A;  1FX7 A;  4C5I A;  1M1K R;  5HK3 A;  1ZSG A;  1GFC A;  1Y96 A;  2FL7 A;  4J6W A;  3PE0 A;  4MML A;  1I0C A;  1KK7 A;  1M1F A;  3GNF B;  2O4X A;  4MZT A;  4E7H A;  4FYV B;  2DNU A;  5CO7 A;  2WSF E;  1ZBX A;  5GJV B;  4JRK A;  3WVE B;  3LGL A;  4A54 A;  3I56 Q;  2K2M A;  4E7J A;  1M90 R;  1M9S A;  1KC8 C;  1T3L A;  1M1K C;  4CC7 A;  1Q7Y C;  4R55 A;  1ZLM A;  4NS5 A;  2DL7 A;  5J39 A;  1QCN A;  3J80 E;  3SB2 A;  3R6N A;  2GNC A;  4C0D B;  1Q82 U;  4BAC A;  2J6F A;  3CCM Q;  1S72 T;  3A8L B;  1YN8 A;  2LNH B;  3NGP A;  1FMK A;  1YIT A;  5GJW B;  4DEY A;  1R8O B;  2ZPF B;  1KG1 A;  2DIG A;  2KRO A;  2R5M A;  4KGX B;  5LJ3 f;  2M0Y A;  2LJ3 A;  1VQ5 T;  2P84 A;  3VUB A;  1VYU A;  2JMA A;  4HKE A;  1BI1 A;  2LMJ A;  2X3W D;  3EGD B;  5J3B A;  3GBQ A;  1BB9 A;  2JT4 A;  4KGZ B;  3L42 A;  1W6X A;  3FC3 A;  3QKJ A;  2Y4Y A;  1OQK A;  3GIB A;  2EGA A;  1IO6 A;  1XQH A;  8AT1 B;  3V8J A;  1PRM C;  2IVW A;  4M78 F;  2HAX A;  3AHU A;  2RQW A;  1PD1 A;  5GAN f;  3CXC S;  1TU0 B;  4LD9 K;  4JS5 A; 
#chains in the Genus database with same CATH homology
 3HTR A;  2DYI A;  3H9N A;  2QGG A;  2F1L A;  1PM3 A;  3A1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...