2E3IA

Crystal structure of the clip-170 cap-gly domain 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
78
Chain Sequence
DDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQATTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 78
sequence length 86
ec nomenclature
pdb deposition date 2006-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e3iA00
1TOVA 3TQ7P 2MPXC 2CP5A 1LPLA 1WHHA 2COZA 1WHGA 1IXDA 1WHLA 2E4HA 2E3HA 2HL3A 2HKQB 3RDVA 2COWA 2CP0A 2CP3A 2CP7A 2HL5C 2E3IA 3E2UA 2CP6A 2HQHA 1WHMA 2M02A 2CP2A 1WHJA 1WHKA 1TXQA 2HKNA 2Z0WA 2QK0A 4B6MA 2COYA
chains in the Genus database with same CATH superfamily
2P4TA 1CSKA 3NTIA 2QTXA 4DEXA 3CCLQ 1VQ6T 2DL8A 1D09B 3VRYA 1YJNT 2FPDA 1Y96B 3BDUA 2RQVA 3EFOA 3L2UA 2VASA 3OW2P 3UA7A 3VS5A 4UC4A 2KK4A 2DD4A 4JRKA 2JNGA 1PKSA 1KIKA 3I55A 2M51A 1Q7YU 2QDYB 2K6DA 1ZUUA 1FMKA 2EYZA 2H3EB 3CCRT 4ZN3A 2HKQB 2OAUA 2DYBA 2EGCA 2EVRA 3JCMd 2J05A 5I22A 1N9RA 3A8HB 1R77A 2W0ZA 3OYGA 1MNEA 1YIJQ 1MV0B 2EYQA 2XI9A 4KGVB 4AFQC 4ZGEB 1KQSP 2X35A 4ME7A 1H641 2P0KA 3QSUA 3QO3A 1NJIC 2PVDB 1AWXA 2OI3A 4LUDA 3CCQQ 1KJWA 1NLOC 2VGNA 4LE9A 2D1XA 2EGEA 2F2XA 1X27A 3CXCS 2G3RA 3RKWA 5KH6A 3NMZC 4YTLA 4RMOA 4JRIA 2NWMA 3SFMA 3UPUA 2HNIA 4J5YA 3URGA 3KBGA 4PFPA 4R56A 3EG3A 2RHUA 3M54A 4XTWA 3R6NA 1W6XA 2PUKB 1JB0E 2QAZA 3UF4A 1YIJA 4OMOA 1P92A 3I56Q 1TUDA 3I55T 1H3HA 2EBPA 1OX9A 1KQSS 4HVUA 4EMKC 1G2BA 2BUDA 2CS7A 2ATCB 1AD5A 4WTOB 2EQJA 1X2KA 1IHWA 4C0ZA 3BY7A 3CCQA 2HAXA 2RH2A 3TQ7P 3A5ZB 3HPWA 3VKIA 3EG2A 3REAB 1XQHA 5GAMe 4ORZA 2KT8A 3VU3C 4PJMA 2RF0A 4GLMA 5FU6C 3CCLT 1T3LA 1BYMA 5J26A 1HK9A 2RNAA 2RPNA 1K4US 4QVDA 2PVOB 2RN8A 1D0ZA 1TOVA 5CKBA 1UTIA 2R5AA 4F04B 2RQWA 3A1PA 5GAMj 3CQTA 1QMCA 1R0CB 2DL7A 2HZYA 2GFUA 3I56A 4Q5WA 1ARKA 1VQ4A 4N0AA 4HA8A 1M90R 4BE1A 2HBWA 2IIMA 4PFZA 2ESWA 2L3QA 1U1SA 3I35A 3CBPA 1MV3A 3RMQA 2EIFA 3NGPA 3OBWA 3JB9D 3HHTB 1N8RR 1WYXA 1W70A 5GMKe 3OYDA 1I07A 3EG1A 4KRTA 3QZ9B 3EG0A 4PJOB 1YIJT 1K8AU 1HJDA 1SG5A 1K1ZA 4M75D 2QQAA 2XDDA 1LCKA 2YRVA 1E6GA 2RHZA 4OMPA 1SKUB 5D7UA 4IUQA 2Y4XA 1TTHB 3QXEB 2KI7A 4TVRA 3SWNA 2C06A 2AKLA 1QKWA 5KYYA 1QVFP 4RKUE 4RTVA 4R55A 5KYXA 3CCQT 5GMKj 4HCBA 3MEVA 4XU0A 2LC4A 1ZQ1A 4M7AC 5GAN5 1PSFA 5LJ5e 4LDUA 4RCBA 4A53A 2V8JA 4QQGA 2DVEA 4FSSA 4F16A 4B9XA 1VIEA 2JS2A 1W1FA 3OW2A 1K0XA 3TEEA 1RLQC 2K4YA 4M75A 4J9GA 3CXCA 1Q82R 3JB9F 2YUNA 4F7UE 5LJ5j 4C5GA 3FJPA 3QKJA 1Q7YC 3I56T 1X75C 1M27C 4M75F 2G6FX 3OS1A 3CPWP 3M9QA 4BY6B 3PVLA 2LT1A 3JCMh 5D6YA 1NEBA 1RAAB 2F69A 5GANe 5CCAA 2WSCE 3THKA 1WPYA 1N8RC 4AFZC 2L5QA 4P5NA 4B9WA 3PVQA 2LVMA 4LDWA 4PLLA 1OZ3A 1IHVA 2HQHA 1KQSA 2L3PA 3P8DA 3SHWA 4A54A 3JCMf 2GFAA 4EMKB 2K2MA 2K3BA 2VUBA 2RQTA 1M9SA 2E6NA 1MGQA 1KHIA 2XD0A 5GANj 2AIRB 3LGFA 4DBQA 1SSFA 2DIGA 3EH2A 4LUEA 1UGQB 4MZPA 2DXCA 5C0MA 3SB2A 1G5VA 1B34A 3KFVA 3TREA 1K9MU 2DILA 3OBYA 5LL6S 1KK7A 2DTIA 2JTFA 4BE0A 2HKNA 3ZL7C 1UUEA 2HSPA 1YJWQ 1NPPA 3VJPA 3G6EQ 2DXBA 4AG2C 4IKFA 4FYWB 1N6AA 1VQOQ 3TSWA 5HY6A 3R6OA 4RG8A 2FO0A 3C12A 1QWEA 1NBEB 4M75G 3CMAQ 2JMAA 1YP5A 2CYZB 4FW2A 3FLGA 2JUFA 2M9UA 1VQLQ 4M78F 1C1AA 2EQUA 3TVTA 2MWPA 3VS4A 1ZHIA 5GAOl 3QYHB 4KUDK 3VRZA 3QPHA 1I8FA 3EHRA 2NUTB 2DO3A 3L1AA 2COYA 1TWBA 3VYHB 1E7OA 2CP5A 1OQKA 3JSCA 2F2WA 2CDTA 3G6EA 4JJDA 2DEQA 3JB9I 3PIPA 3M58A 1M30A 3CCMQ 1HSQA 2ZPEB 1VQOA 1GXIE 4MMLA 4M7AB 1QP3A 1SPKA 5A0GA 1VQKQ 2L3RA 4HCCA 2R58A 2LQWA 2DEUA 3CMEQ 2NUPB 3HRTA 3CMAA 4E7ZA 3ZEHA 1JBMA 1D1BA 3S3OA 5LJ3h 1T0HA 4PNOA 1VQLA 1SHFA 3OYMA 4X9DA 4M75E 4FCYA 1FYNA 1M8VA 3MP6A 4V2SA 5GAOm 1MUZA 3WVDB 2J6FA 4XAXB 4L5GA 4XU2A 1K8AC 1T0JA 3VS0A 4J9BA 5GAOq 4K11A 3V8JA 2LJ1A 5KCOA 2PNIA 5IN1A 3X26B 4X1VA 2A08A 4M78G 2CZ7B 1E6HA 1M3BA 3H6ZA 2OX7A 2EW3A 4BDZA 1BK2A 4HT8A 2CP0A 1XJWB 2DRMA 2DZCA 2DL5A 1WXBA 1GCQC 4KT0E 4NL3A 2GQVA 4HCKA 5J39A 2FB7A 4KULA 4N4GA 1WHGA 3A8GB 3QIIA 3CMEA 2MAMA 4XU1A 3M4GA 1YJWT 2LQNA 4C8QC 3HP9A 3G6ET 2OTLQ 3ZFJA 4OGEA 2X51A 4M77C 3ME9A 2D8HA 1VQOT 4II1A 5IHIA 4GBQA 2QQSA 2E5QA 1VQNQ 1RL2A 2EAYA 2RJCA 4C92A 2OJ2A 4JPBW 1IGUA 3EGDA 2EQKA 3CMAT 1X6OA 3OSSC 2LCSA 2WSFE 5GAMd 3LWIA 2D0QB 5FROA 1X01A 1GL5A 5I21A 1VQLT 4C92F 1IZ6A 4LD6A 7AT1B 2B86A 1YFNA 1HXDA 4J6YA 1QLYA 2JM9A 5I2MA 3NTKA 1MMAA 4M78E 4OB2B 5GAOp 4JZ3A 2BE9B 2M16A 2MYSA 2PQWA 2DTHA 2MI6A 1B07A 4JDSA 4NOYA 4IURA 2R57A 1RI0A 3FDRA 3HL8A 5KYWB 3OYBA 2HBPA 3M59A 3CCRA 2AZSA 5GAOn 1BB9A 3GPLA 1GBRA 2X4YA 3GBQA 1OU8A 2X4JA 3UDCA 2J7IA 3FC3A 3CCMT 1SSHA 1V76A 3C4SA 1I81A 4C5EA 2LRQA 1BBZA 4WF2A 2K9GA 1OZ2A 1AWWA 1TUGB 2JJ9A 1K9MC 2LJ0A 1VQKT 3PNWC 1PKTA 4PL6A 3DKMA 3CMET 2JOYA 1Y96A 4FL6A 4C8QD 2MK5A 2BKDN 2GCXA 3TCJA 2DERA 4M77D 2DFUA 3PGGA 4DOVA 4J83A 2HCKA 2RHXA 3A8OB 1UB4A 2V8KA 5IAYA 2HQEA 1MHNA 2XDPA 5L23A 3RMSA 1WHLA 2SEMA 2IG0A 2ROTA 2K7AA 1YJ9Q 2QXFA 4CI0C 1EIFA 5ECAA 4C92G 5LJ5d 2JW4A 1VYVA 2KRSA 4KBMB 1WHJA 2BIVA 2LTOA 1FX7A 1YI2Q 1TS9A 3CXCP 1G3SA 1M8MA 3G7ZA 4PJOC 5DM7R 2L8DA 2KY9A 1BIBA 5DY9A 1VQ5Q 2EKHA 1OULA 2E3HA 4M7DG 1WLPB 1D0YA 4Z89A 1M90U 1YN8A 1QCNA 1AOJA 2XG8D 3VUZA 1VQMQ 3QDFA 4AG1C 1RACB 3LGLA 1MNDA 4ZNXA 3A8LB 2OTLT 1VYUA 1N8RU 4EMGA 4M4ZA 1VQNT 2ROLA 2A37A 3META 4QVZA 1N9SA 4Y92A 3CCLA 4FM4B 2YLBA 2O31A 4E7KA 4L6V5 1WQWA 4Z02A 3QJYA 4OF1A 2JVVA 2RI3A 1YJ9A 4C8QB 4X9CA 3QUIA 1ZSZB 1ZLMA 2O88A 4N4HA 2IVWA 1J3TA 4M77B 4E7SA 4XTXA 2GQIA 2YT6A 3MKDA 5FW9A 4JRQA 2DJZA 1EZZB 1YI2A 3VS2A 2FPEA 4C92E 1WIEA 3JCMQ 2E4HA 2RJFA 1OYXA 4RTYA 3RDVA 3H8ZA 2P0PA 3CBOA 2O9VA 2R5MA 3JCMW 4BY6C 3VUBA 5FWCA 1VQMA 4ELYC 2EYYA 4MMKA 2RK2A 1YNZA 3SDZA 1YCYA 4M7DE 5GAN7 1JJ2S 2YUQA 2KGTA 2RHYA 1WI7A 1Q82U 4F14A 4PJOD 2E64A 3G71Q 2NLUA 2VGMA 5DLQE 1XTDA 2DLPA 3CEYA 3HKSA 2EFIA 2CZ1B 2X3XD 4AT1B 1Y57A 2VV5A 2LX7A 2DD5A 4RTWA 3WVEB 3AHUA 1O75A 1U5SA 2FL7A 1Y7XA 2DAQA 1OOTA 2KE9A 1VIFA 2CT3A 3L2RA 2QEXQ 4F7UB 8AT1B 2QQ9A 2FRYA 5A2QE 4FYYB 5GAMh 1QVPA 3E1SA 4J9DA 1VQ8Q 3G4SQ 1Q95G 3CC4Q 4IIOA 1YJ9T 4J8OA 1W2BP 2A3LA 3VS3A 3OYFA 1VOMA 3PFSA 1WZOA 2E70A 4C5IA 5CR2A 1KQ1A 4OVAA 2GTOA 3CCEQ 1YI2T 1UECA 2MF2A 1C0MA 4PJOA 4QQDA 1PM3A 2VC8A 5GAMf 1CKAA 3MCAB 5CO7A 2K5FA 1VQ5T 3G71A 2EJGA 4PJOF 5IHKA 4JS5A 2KMTA 2X9HA 1B3QA 4AFUC 2YWWA 1XNIA 1NZ9A 1VQMT 2K57A 5LJ3d 2JTEA 4FT2A 1IO6A 5D6WA 4VUBA 5KYUB 1ABQA 3H0HA 3QWYA 4F17A 1AZEA 4LDVA 2KRMA 2QEXA 3SEMA 5GMKh 2CP7A 1KD1R 2BZ8A 2K3XA 3EAEA 2HQXA 1VQ8A 3G4SA 3OYYA 1W2BS 4L59A 4A4HA 4QT7A 1LPLA 2COZA 1NLPC 3D7SB 1YHQQ 3QG1A 4AMCA 4EMHA 4GLKA 2RJDA 2WACA 1M2VB 2HD0A 1VUBA 4IUUA 1K73R 4LDYA 2D6FA 1ACMB 1TXQA 1Q81U 5LJ5h 3S6WA 1UEBA 2RJEA 3IQLA 5GJVB 2EKOA 5FWBA 1NPRA 4HCZA 3PIOA 1V1CA 1ZUYA 3L2WA 4A4KA 2J6OA 1A0NB 3M57A 2DXTA 1AVZC 1UHCA 2K5LA 5GAN4 2COWA 3S3NA 3M56A 2EGAA 4JS4A 5LJ5f 4D8KA 1LJOA 4EMKA 3G71T 5CKDA 1CKBA 5CQXA 3EGXB 4PKCC 1EX4A 4DOWA 1M90C 5GAMg 3LX7A 5IHNA 3O8VA 2F5TX 1JJ2A 3M0SA 1GRIA 3MEUA 1S72Q 3QWXX 1BCOA 2HDAA 1YHQA 2AZVA 5GANh 3HFOA 5AT1B 1KG1A 2QEXT 2F5KA 4OMFB 2L0AA 2L89A 1GFCA 3QJ6A 4FYVB 2LZ6B 1VQ8T 3G4ST 3LYIA 2QG9B 2KXCA 1G83A 3GNFB 4ANJA 3CC4T 2AT1B 5I2SA 4BD3A 3G1JA 3MEAA 1W4SA 4ZTJA 4ZGJB 4DQ2A 1MMNA 1T3SA 5FU7B 3CCET 3NTHA 2GTJA 2K2VA 4BUGA 2QA4Q 2K79A 4PJLA 4M7AD 5IT9E 2CP2A 3FJ5A 1PWTA 2CGHA 4R0KA 5IXBA 1IRXA 1FXXA 2A7YA 1K73C 1AHJB 4OB3B 2OTJQ 4DEYA 4BB7A 3V8KA 1UJ0A 1QQJA 4MDXA 5CKHA 1UGSB 1RAGB 4RUGA 3X20B 3JB9G 4JJCA 1SEMA 1QVGP 1Q82C 2DBMA 2NUTA 2Y4YA 2CUBA 4BACA 3M55A 5FRNA 3GIBA 2VB6A 4XTUA 1KSWA 5HK0A 2DPPB 5A0LA 3BE3A 1ZBJA 2VKNA 3C0CA 4XU3A 3L2VA 1YWPA 4FU6A 1KQ2A 4OP0A 4M7AA 1YHQT 3I5SA 5CQYA 2DTOA 2QA4A 2YRDA 3TU4K 3OS5A 4O6JA 1U1TA 1Q81R 4E6RA 2ED1A 2NUPA 6AT1B 1BCMA 1BI2A 4M7AF 2YHTA 2KQWA 2LX9A 1W2BA 3I9QA 2HSEB 2DK3A 2GF7A 2OTJA 2BZYA 1YJWA 2V26A 5CIUA 2MWOA 2QGFB 2A0FB 5GMKi 1KC8R 4A4EA 3JCMg 1H8KA 2K5IA 3L2QA 3MHXA 3HFNA 2V8IA 1QVGS 3OMCA 4CRIA 1PRLC 1N5ZA 1RAIB 1QWFA 3Q1JA 3X28B 3L42A 4ELZC 4JUVA 5D6XA 4PK4A 1ZX6A 2A36A 1S72T 2DYIA 3ER0A 2M0OA 2KBTA 4KUIA 4ATOA 1BI0A 1H92A 1PCXA 4RTZA 4C0FA 3V7RA 1DJ7B 1M3AA 2JZ2A 2X4WA 1JEGA 2X4XA 5LJ3f 3OYLA 1QKXA 2P0QA 4PFOA 4FIBA 1Q86R 4CC3A 3CCJQ 5FLXE 4JRPA 1X2QA 1M1FA 3P8HA 2K3YA 1B7TA 3FIFA 2CP6A 3CCMA 1GFDA 4FSXA 3PE0A 1VQ7Q 1PNJA 4CC2A 1VQKA 2KAFA 2QA4T 1M1KR 2YXYA 3DB4A 5FRMA 2KXDA 4M7AG 3C94A 1H3ZA 1Q81C 1O9SA 1LVKA 1YWOA 3VS1A 1TG0A 1QW1A 3H0IA 4RTXA 2OTJT 1VA7A 2H3JA 1ZSZC 2KYMA 3C95A 1WNLA 2PVGB 1QCOA 4HKEA 1MMDA 2E1HA 3SD4A 1UGRB 4XTYA 1WXUA 1X6GA 2I2LA 5KYWA 1VQPQ 3JCMP 4EIKA 3A98A 3CCJA 2DVJA 1AT1B 2CKKA 3U23A 2E6ZA 1Z9QA 9ATCB 2DZ9A 2XHCA 2O01E 1Y07A 2LP5A 2JTMA 1RLPC 3GOXA 1QP2A 3CCSQ 3X24B 2YSQA 2XIDA 2O4XB 3M0PA 2DX1A 3V7CA 3JRZA 4XTVA 4ESRA 3ZBDA 1WQ7A 3H9NA 3MP1A 1FMWA 4BI8B 2E10A 1WA7A 2CP3A 1WJQA 3HRUA 4Y91A 1GCPA 4HVVA 4QQ6A 3CD6Q 2OTLA 1M2OA 5GJWB 4N4IA 5LJ3g 1K9AA 4X34A 5GAN6 1ZA2B 1VQNA 2QTVA 1F1BB 1M5Q1 3GLXA 3EG9B 4ZN1A 4IUTA 2DM1A 2NUZA 2YUPA 3I5RA 1OEBA 1VYTA 4O5VA 3JCMX 3V7SA 4M7DB 2FZKB 2QGGA 1QVGA 1Y0MA 1PC0A 3CCSA 3X25B 5CKFA 1D3BB 2LMJA 1AEYA 2QQRA 2F1LA 4J7FA 1D1AA 1NJIR 3VYGA 2LNVA 2V1RA 2NYSA 1M1GA 1NYGA 3M0RA 2E3IA 3OYKA 3CCJT 2DF6A 1PRMC 4E7LA 2WSEE 1TSFA 2M02A 1GCQA 4FYXB 3QHSA 1FMVA 4DA4A 3CD6A 3OQ5A 1ZSGA 1JO8A 1VQ7T 1G8XA 5KCHA 4J7IA 5AYFA 3OS2A 4IUVA 4A63B 4LXCA 4C8QA 4EDUA 2KROA 4LDXA 1I5OB 1UGPB 2KR3A 1ZSZA 1G3WA 4M77A 4BI3A 1YITQ 4JJBA 1JJ2P 4RG2A 1R8OB 5M9OA 2GBQA 2JT4A 4C8QF 1PD1A 3HRSA 1LOJA 3MJXA 4XQ3A 2BZXA 2CSQA 1PD0A 4M77F 2JN0A 2FRWA 1Y71A 1WJSA 1BIAA 4N0AC 5GANd 1ZUKA 1OU9A 2ZCFB 1KD1U 4C5HA 2AK5A 1EFNA 1VQPT 4CC4B 1D0XA 3EFOB 1UDLA 2BTTA 2VYTA 2KT1A 2YLCA 3INZA 3LLRA 1K76A 1JXOA 2ZPBB 5GAN3 1WDXA 3CCST 4XTZA 2LT4A 1WX6A 3J80E 2QQBA 3OY9A 2RHIA 1ZA1B 3T9NA 3CPFA 5DLOA 1VQ5A 1K73U 1OI1A 4LD9K 4C0DB 3SWNC 1WJRA 1PG5B 2JM8A 2EJ9A 4IUPA 2QK0A 3OW2S 1M3CA 1PSEA 1YITA 4MZTA 2DL3A 3CD6T 1NG2A 4E7HA 3LWHA 2H8HA 4OB0B 2YRCA 4F7UA 2E12A 1G3YA 2KYBA 3FRNA 4JJNK 3KUFA 4F7UF 2VVKA 2V1QA 1GBQA 2FYKA 2EYXA 2DETA 1SF9A 4C8QG 2EYWA 2XU8A 1NEGA 1WHHA 4M75C 3PTAA 1VQ4Q 3F70A 2XK0A 2DNUA 3OYJA 4M77G 4QVCA 3EGUA 4BDYA 4HVWA 1TU0B 3QDRB 5FU7C 1AWOA 2MCNA 1VQ9Q 1OPKA 1TUCA 2DE0X 3M53A 4OB1B 1MMGA 2W10A 3LW5E 1HYOA 3J7AF 1RUWA 4JZ4A 2DIQA 2C0IA 4A4FA 4XK8E 1R0BG 1X69A 1UJYA 2ZPHB 5KYUA 1U3OA 2LCCA 1SRLA 3CC7Q 2CT4A 1IB8A 4PJNA 5EG2A 2I0NA 4IIMA 2FG0A 1QCFA 3RBBB 1C6VX 4FT4A 2EPDA 2GGRA 5GAN2 1RI9A 2X3WD 1YITT 2HEQA 3EHQA 2RB6A 2CREA 2M0YA 4ZTFA 2DRKA 1Q7YR 4HXJA 2KVQG 3CCUQ 4EPCA 2RA2A 1M2VA 4NS5A 2DMOA 4C8QE 4JLIA 1VQ9A 3DLLA 1RAFB 3EFSA 4F7UG 4M77E 2KNBB 3CC4A 1I4K1 2FPFA 5GAOr 2CZ0B 3VS7A 3JCMV 1U8RA 1IXDA 1BKBA 1WFWA 3DB3A 3PT9A 2KEAA 1OPLA 2LCLA 3CCEA 2QDLA 3UATA 3CC7A 3FEOA 2EQMA 2YUOA 4M78C 1ABOA 2RM4A 1XOVA 3RIRA 2KSSA 3P8BB 2QYZA 3J81E 3OYIA 1WHKA 4WCIA 5CAIA 3EGXA 3BDLA 2QASA 3CBMA 4D8DA 2LNHB 3JAME 1PHTA 1UHFA 3PMTA 3RUXA 2CH4W 3ULRB 4J9IA 1V29B 1KC8U 2D0NA 8ATCB 3CCUA 1IGQA 4FW1A 2E65A 3HSBA 3OYHA 2PUOB 1I5LA 4PJOG 2DL4A 2MOXA 3SWNB 2CUDA 1YBYA 3CC2Q 1Z9ZA 5KYYB 3LH5A 2P4RA 5KYXB 5KYNA 2P84A 3H0FA 3REBB 5HCKA 3M0QA 2MMPA 2RMOA 1VQ4T 2C0TA 3JCMe 5HK3A 2F2VA 1SHGA 3GF5A 5GAN8 1VQ9T 1RADB 1KD1C 4B6MA 2XKOC 1WGSA 4QKUA 1NM7A 1I1JA 2CH4A 2DXUA 1Q86U 1QVFS 2RO0A 3MPUB 3O5ZA 5GANf 1LNXA 4M75B 2RI5A 4LNPA 3LH0A 1WXTA 3CC7T 4Z8AA 4M78D 4MDWA 3CCVQ 4E7IA 1BU1A 1AZGB 2ABLA 1M1KU 2LDMA 2DBKA 1X6BA 2RD1A 2MPXC 2DA9A 3CC2A 1KHCA 3L2ZA 4J9EA 1FWZA 1N27A 3M0UA 1UE9A 2ED0A 4PJOE 1S72A 2DKGA 4C0GA 2A28A 3UA6A 5FU6B 3CCUT 3DLMA 1UGVA 2O9SA 1M4ZA 2LQKA 2CZ6B 3OYCA 3CPWS 3KXTA 4J9CA 2VWFA 3AT1B 5LJ5g 3RNJA 1K8AR 2RQRA 5I11A 1NYFA 5GMKl 2RQUA 1UG1A 1B34B 1ZBXA 4OMMA 4M78A 3OA6A 3RESA 2FEIA 3M0TA 2BE7D 4C92C 3CCVA 2E5KA 2FHDA 3MO8A 2RI2A 2PTKA 1I0CA 1JQQA 3RKXA 3E9GA 1RABB 2LJ3A 2RK1A 4OMQA 2SRCA 3E2UA 2M1HA 3NHNA 4M7DC 4M78B 2PZ1A 3OMGA 2Z0WA 2DJQA 3H41A 5A0DA 3QYGB 5GANg 2VXEA 3EH1A 2ZPFB 2JXBA 3UWNA 2FZGB 3VV0A 1D1CA 4E7JA 3CC2T 1YCSB 1TH7A 4JLGA 5IXFA 3QZ5B 4KGXB 1KFZA 5EC7A 2LQ8A 2JS0A 4QW2A 5GMKm 2XDBA 1K0SA 1RAHB 4BI4A 4OGCA 4J9FA 1OV3A 5LJ3e 3PMIA 1G3TA 3BFMA 2J06A 4OMLA 3NFCA 1NJIU 3GNGA 3RKYA 3ASKA 2ECZA 2VXFA 3E9FA 1JXMA 2ZGWA 5CKEA 2QI2A 2D9TA 2ZPGB 3BW1A 5CK9A 3VS6A 1VQ6Q 4AFSC 5LJ3j 4C92D 4ZGDB 3CCVT 2KDSA 2XMFA 1YJNQ 4J9HA 2CSIA 3JB9H 1HD3A 3N5BB 4E47A 3OYNA 1QVFA 4MZMA 5CVIA 2HL3A 2YDLA 2HL5C 5L8RE 1BI1A 3OB9A 1K9MR 3JCMb 2PU9B 3FB9A 3E19A 1KC8C 4M7DD 2O4XA 4PJJA 4PLIA 3M4YA 3CCRQ 3JCMJ 2ZZDA 1IREB 3MP8A 1BI3A 1RAEB 4RTUA 2AHJB 3GP8A 3WXMB 2D8JA 4C0DC 5HKCA 3S3MA 5C6SA 2ZPIB 5IH2A 4RTTA 3JV3A 5KE2A 3M5AA 2EJFA 2C0OA 1VQ6A 3V8LA 4DBRA 1VQ7A 3CPWA 2AKKA 3EG9A 4GY5A 4RCCA 4CC7A 2J6KA 4BE2A 1YJNA 1U06A 2JMCA 1OX8A 4OMNA 1Q86C 1WHMA 2GNCA 2FVUA 2HMAA 4E2FB 4M7AE 3RERA 4M7DA 3OYAA 3MEWA 3JCMc 3A8MB 2EQIA 3QBYA 2L2PA 1D3BA 2ZAEA 4Y28E 2EWNA 4C92B 4KGZB 3EGDB 4M7DF 4NL2A 2ENMA 1M1KC 3OYEA 4KH0B 2MIOA 4D6WA 1VQPA 4LN2A 2B8AA 3OS0A 3UT1A 2Y90A 4Z88A 4DBFA 1SRMA 3OSVA 5KE3A 3NPFA 1UFFA 4KH1B 4HT9A 1NE8A 3I55Q 1AWJA 2OAWA 5J3BA 1S1NA 2KRNA 1JRIA 2IPOB 3EFRA 2E41A 3HTRA 3RR6A 2O2OA 4A4GA 2L3SA 4J6XA 3JB9J 1JU5C 1X43A 3TSZA 4J6WA 4DBHA 2XICA 2FZCB
chains in the Genus database with same CATH topology
1TOVA 3TQ7P 2MPXC 2CP5A 1LPLA 1WHHA 2COZA 1WHGA 1IXDA 1WHLA 2E4HA 2E3HA 2HL3A 2HKQB 3RDVA 2COWA 2CP0A 2CP3A 2CP7A 2HL5C 2E3IA 3E2UA 2CP6A 2HQHA 1WHMA 2M02A 2CP2A 1WHJA 1WHKA 1TXQA 2HKNA 2Z0WA 2QK0A 4B6MA 2COYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOV A;  3TQ7 P;  2MPX C;  2CP5 A;  1LPL A;  1WHH A;  2COZ A;  1WHG A;  1IXD A;  1WHL A;  2E4H A;  2E3H A;  2HL3 A;  2HKQ B;  3RDV A;  2COW A;  2CP0 A;  2CP3 A;  2CP7 A;  2HL5 C;  2E3I A;  3E2U A;  2CP6 A;  2HQH A;  1WHM A;  2M02 A;  2CP2 A;  1WHJ A;  1WHK A;  1TXQ A;  2HKN A;  2Z0W A;  2QK0 A;  4B6M A;  2COY A; 
#chains in the Genus database with same CATH topology
 2P4T A;  1CSK A;  3NTI A;  2QTX A;  4DEX A;  3CCL Q;  1VQ6 T;  2DL8 A;  1D09 B;  3VRY A;  1YJN T;  2FPD A;  1Y96 B;  3BDU A;  2RQV A;  3EFO A;  3L2U A;  2VAS A;  3OW2 P;  3UA7 A;  3VS5 A;  4UC4 A;  2KK4 A;  2DD4 A;  4JRK A;  2JNG A;  1PKS A;  1KIK A;  3I55 A;  2M51 A;  1Q7Y U;  2QDY B;  2K6D A;  1ZUU A;  1FMK A;  2EYZ A;  2H3E B;  3CCR T;  4ZN3 A;  2HKQ B;  2OAU A;  2DYB A;  2EGC A;  2EVR A;  3JCM d;  2J05 A;  5I22 A;  1N9R A;  3A8H B;  1R77 A;  2W0Z A;  3OYG A;  1MNE A;  1YIJ Q;  1MV0 B;  2EYQ A;  2XI9 A;  4KGV B;  4AFQ C;  4ZGE B;  1KQS P;  2X35 A;  4ME7 A;  1H64 1;  2P0K A;  3QSU A;  3QO3 A;  1NJI C;  2PVD B;  1AWX A;  2OI3 A;  4LUD A;  3CCQ Q;  1KJW A;  1NLO C;  2VGN A;  4LE9 A;  2D1X A;  2EGE A;  2F2X A;  1X27 A;  3CXC S;  2G3R A;  3RKW A;  5KH6 A;  3NMZ C;  4YTL A;  4RMO A;  4JRI A;  2NWM A;  3SFM A;  3UPU A;  2HNI A;  4J5Y A;  3URG A;  3KBG A;  4PFP A;  4R56 A;  3EG3 A;  2RHU A;  3M54 A;  4XTW A;  3R6N A;  1W6X A;  2PUK B;  1JB0 E;  2QAZ A;  3UF4 A;  1YIJ A;  4OMO A;  1P92 A;  3I56 Q;  1TUD A;  3I55 T;  1H3H A;  2EBP A;  1OX9 A;  1KQS S;  4HVU A;  4EMK C;  1G2B A;  2BUD A;  2CS7 A;  2ATC B;  1AD5 A;  4WTO B;  2EQJ A;  1X2K A;  1IHW A;  4C0Z A;  3BY7 A;  3CCQ A;  2HAX A;  2RH2 A;  3TQ7 P;  3A5Z B;  3HPW A;  3VKI A;  3EG2 A;  3REA B;  1XQH A;  5GAM e;  4ORZ A;  2KT8 A;  3VU3 C;  4PJM A;  2RF0 A;  4GLM A;  5FU6 C;  3CCL T;  1T3L A;  1BYM A;  5J26 A;  1HK9 A;  2RNA A;  2RPN A;  1K4U S;  4QVD A;  2PVO B;  2RN8 A;  1D0Z A;  1TOV A;  5CKB A;  1UTI A;  2R5A A;  4F04 B;  2RQW A;  3A1P A;  5GAM j;  3CQT A;  1QMC A;  1R0C B;  2DL7 A;  2HZY A;  2GFU A;  3I56 A;  4Q5W A;  1ARK A;  1VQ4 A;  4N0A A;  4HA8 A;  1M90 R;  4BE1 A;  2HBW A;  2IIM A;  4PFZ A;  2ESW A;  2L3Q A;  1U1S A;  3I35 A;  3CBP A;  1MV3 A;  3RMQ A;  2EIF A;  3NGP A;  3OBW A;  3JB9 D;  3HHT B;  1N8R R;  1WYX A;  1W70 A;  5GMK e;  3OYD A;  1I07 A;  3EG1 A;  4KRT A;  3QZ9 B;  3EG0 A;  4PJO B;  1YIJ T;  1K8A U;  1HJD A;  1SG5 A;  1K1Z A;  4M75 D;  2QQA A;  2XDD A;  1LCK A;  2YRV A;  1E6G A;  2RHZ A;  4OMP A;  1SKU B;  5D7U A;  4IUQ A;  2Y4X A;  1TTH B;  3QXE B;  2KI7 A;  4TVR A;  3SWN A;  2C06 A;  2AKL A;  1QKW A;  5KYY A;  1QVF P;  4RKU E;  4RTV A;  4R55 A;  5KYX A;  3CCQ T;  5GMK j;  4HCB A;  3MEV A;  4XU0 A;  2LC4 A;  1ZQ1 A;  4M7A C;  5GAN 5;  1PSF A;  5LJ5 e;  4LDU A;  4RCB A;  4A53 A;  2V8J A;  4QQG A;  2DVE A;  4FSS A;  4F16 A;  4B9X A;  1VIE A;  2JS2 A;  1W1F A;  3OW2 A;  1K0X A;  3TEE A;  1RLQ C;  2K4Y A;  4M75 A;  4J9G A;  3CXC A;  1Q82 R;  3JB9 F;  2YUN A;  4F7U E;  5LJ5 j;  4C5G A;  3FJP A;  3QKJ A;  1Q7Y C;  3I56 T;  1X75 C;  1M27 C;  4M75 F;  2G6F X;  3OS1 A;  3CPW P;  3M9Q A;  4BY6 B;  3PVL A;  2LT1 A;  3JCM h;  5D6Y A;  1NEB A;  1RAA B;  2F69 A;  5GAN e;  5CCA A;  2WSC E;  3THK A;  1WPY A;  1N8R C;  4AFZ C;  2L5Q A;  4P5N A;  4B9W A;  3PVQ A;  2LVM A;  4LDW A;  4PLL A;  1OZ3 A;  1IHV A;  2HQH A;  1KQS A;  2L3P A;  3P8D A;  3SHW A;  4A54 A;  3JCM f;  2GFA A;  4EMK B;  2K2M A;  2K3B A;  2VUB A;  2RQT A;  1M9S A;  2E6N A;  1MGQ A;  1KHI A;  2XD0 A;  5GAN j;  2AIR B;  3LGF A;  4DBQ A;  1SSF A;  2DIG A;  3EH2 A;  4LUE A;  1UGQ B;  4MZP A;  2DXC A;  5C0M A;  3SB2 A;  1G5V A;  1B34 A;  3KFV A;  3TRE A;  1K9M U;  2DIL A;  3OBY A;  5LL6 S;  1KK7 A;  2DTI A;  2JTF A;  4BE0 A;  2HKN A;  3ZL7 C;  1UUE A;  2HSP A;  1YJW Q;  1NPP A;  3VJP A;  3G6E Q;  2DXB A;  4AG2 C;  4IKF A;  4FYW B;  1N6A A;  1VQO Q;  3TSW A;  5HY6 A;  3R6O A;  4RG8 A;  2FO0 A;  3C12 A;  1QWE A;  1NBE B;  4M75 G;  3CMA Q;  2JMA A;  1YP5 A;  2CYZ B;  4FW2 A;  3FLG A;  2JUF A;  2M9U A;  1VQL Q;  4M78 F;  1C1A A;  2EQU A;  3TVT A;  2MWP A;  3VS4 A;  1ZHI A;  5GAO l;  3QYH B;  4KUD K;  3VRZ A;  3QPH A;  1I8F A;  3EHR A;  2NUT B;  2DO3 A;  3L1A A;  2COY A;  1TWB A;  3VYH B;  1E7O A;  2CP5 A;  1OQK A;  3JSC A;  2F2W A;  2CDT A;  3G6E A;  4JJD A;  2DEQ A;  3JB9 I;  3PIP A;  3M58 A;  1M30 A;  3CCM Q;  1HSQ A;  2ZPE B;  1VQO A;  1GXI E;  4MML A;  4M7A B;  1QP3 A;  1SPK A;  5A0G A;  1VQK Q;  2L3R A;  4HCC A;  2R58 A;  2LQW A;  2DEU A;  3CME Q;  2NUP B;  3HRT A;  3CMA A;  4E7Z A;  3ZEH A;  1JBM A;  1D1B A;  3S3O A;  5LJ3 h;  1T0H A;  4PNO A;  1VQL A;  1SHF A;  3OYM A;  4X9D A;  4M75 E;  4FCY A;  1FYN A;  1M8V A;  3MP6 A;  4V2S A;  5GAO m;  1MUZ A;  3WVD B;  2J6F A;  4XAX B;  4L5G A;  4XU2 A;  1K8A C;  1T0J A;  3VS0 A;  4J9B A;  5GAO q;  4K11 A;  3V8J A;  2LJ1 A;  5KCO A;  2PNI A;  5IN1 A;  3X26 B;  4X1V A;  2A08 A;  4M78 G;  2CZ7 B;  1E6H A;  1M3B A;  3H6Z A;  2OX7 A;  2EW3 A;  4BDZ A;  1BK2 A;  4HT8 A;  2CP0 A;  1XJW B;  2DRM A;  2DZC A;  2DL5 A;  1WXB A;  1GCQ C;  4KT0 E;  4NL3 A;  2GQV A;  4HCK A;  5J39 A;  2FB7 A;  4KUL A;  4N4G A;  1WHG A;  3A8G B;  3QII A;  3CME A;  2MAM A;  4XU1 A;  3M4G A;  1YJW T;  2LQN A;  4C8Q C;  3HP9 A;  3G6E T;  2OTL Q;  3ZFJ A;  4OGE A;  2X51 A;  4M77 C;  3ME9 A;  2D8H A;  1VQO T;  4II1 A;  5IHI A;  4GBQ A;  2QQS A;  2E5Q A;  1VQN Q;  1RL2 A;  2EAY A;  2RJC A;  4C92 A;  2OJ2 A;  4JPB W;  1IGU A;  3EGD A;  2EQK A;  3CMA T;  1X6O A;  3OSS C;  2LCS A;  2WSF E;  5GAM d;  3LWI A;  2D0Q B;  5FRO A;  1X01 A;  1GL5 A;  5I21 A;  1VQL T;  4C92 F;  1IZ6 A;  4LD6 A;  7AT1 B;  2B86 A;  1YFN A;  1HXD A;  4J6Y A;  1QLY A;  2JM9 A;  5I2M A;  3NTK A;  1MMA A;  4M78 E;  4OB2 B;  5GAO p;  4JZ3 A;  2BE9 B;  2M16 A;  2MYS A;  2PQW A;  2DTH A;  2MI6 A;  1B07 A;  4JDS A;  4NOY A;  4IUR A;  2R57 A;  1RI0 A;  3FDR A;  3HL8 A;  5KYW B;  3OYB A;  2HBP A;  3M59 A;  3CCR A;  2AZS A;  5GAO n;  1BB9 A;  3GPL A;  1GBR A;  2X4Y A;  3GBQ A;  1OU8 A;  2X4J A;  3UDC A;  2J7I A;  3FC3 A;  3CCM T;  1SSH A;  1V76 A;  3C4S A;  1I81 A;  4C5E A;  2LRQ A;  1BBZ A;  4WF2 A;  2K9G A;  1OZ2 A;  1AWW A;  1TUG B;  2JJ9 A;  1K9M C;  2LJ0 A;  1VQK T;  3PNW C;  1PKT A;  4PL6 A;  3DKM A;  3CME T;  2JOY A;  1Y96 A;  4FL6 A;  4C8Q D;  2MK5 A;  2BKD N;  2GCX A;  3TCJ A;  2DER A;  4M77 D;  2DFU A;  3PGG A;  4DOV A;  4J83 A;  2HCK A;  2RHX A;  3A8O B;  1UB4 A;  2V8K A;  5IAY A;  2HQE A;  1MHN A;  2XDP A;  5L23 A;  3RMS A;  1WHL A;  2SEM A;  2IG0 A;  2ROT A;  2K7A A;  1YJ9 Q;  2QXF A;  4CI0 C;  1EIF A;  5ECA A;  4C92 G;  5LJ5 d;  2JW4 A;  1VYV A;  2KRS A;  4KBM B;  1WHJ A;  2BIV A;  2LTO A;  1FX7 A;  1YI2 Q;  1TS9 A;  3CXC P;  1G3S A;  1M8M A;  3G7Z A;  4PJO C;  5DM7 R;  2L8D A;  2KY9 A;  1BIB A;  5DY9 A;  1VQ5 Q;  2EKH A;  1OUL A;  2E3H A;  4M7D G;  1WLP B;  1D0Y A;  4Z89 A;  1M90 U;  1YN8 A;  1QCN A;  1AOJ A;  2XG8 D;  3VUZ A;  1VQM Q;  3QDF A;  4AG1 C;  1RAC B;  3LGL A;  1MND A;  4ZNX A;  3A8L B;  2OTL T;  1VYU A;  1N8R U;  4EMG A;  4M4Z A;  1VQN T;  2ROL A;  2A37 A;  3MET A;  4QVZ A;  1N9S A;  4Y92 A;  3CCL A;  4FM4 B;  2YLB A;  2O31 A;  4E7K A;  4L6V 5;  1WQW A;  4Z02 A;  3QJY A;  4OF1 A;  2JVV A;  2RI3 A;  1YJ9 A;  4C8Q B;  4X9C A;  3QUI A;  1ZSZ B;  1ZLM A;  2O88 A;  4N4H A;  2IVW A;  1J3T A;  4M77 B;  4E7S A;  4XTX A;  2GQI A;  2YT6 A;  3MKD A;  5FW9 A;  4JRQ A;  2DJZ A;  1EZZ B;  1YI2 A;  3VS2 A;  2FPE A;  4C92 E;  1WIE A;  3JCM Q;  2E4H A;  2RJF A;  1OYX A;  4RTY A;  3RDV A;  3H8Z A;  2P0P A;  3CBO A;  2O9V A;  2R5M A;  3JCM W;  4BY6 C;  3VUB A;  5FWC A;  1VQM A;  4ELY C;  2EYY A;  4MMK A;  2RK2 A;  1YNZ A;  3SDZ A;  1YCY A;  4M7D E;  5GAN 7;  1JJ2 S;  2YUQ A;  2KGT A;  2RHY A;  1WI7 A;  1Q82 U;  4F14 A;  4PJO D;  2E64 A;  3G71 Q;  2NLU A;  2VGM A;  5DLQ E;  1XTD A;  2DLP A;  3CEY A;  3HKS A;  2EFI A;  2CZ1 B;  2X3X D;  4AT1 B;  1Y57 A;  2VV5 A;  2LX7 A;  2DD5 A;  4RTW A;  3WVE B;  3AHU A;  1O75 A;  1U5S A;  2FL7 A;  1Y7X A;  2DAQ A;  1OOT A;  2KE9 A;  1VIF A;  2CT3 A;  3L2R A;  2QEX Q;  4F7U B;  8AT1 B;  2QQ9 A;  2FRY A;  5A2Q E;  4FYY B;  5GAM h;  1QVP A;  3E1S A;  4J9D A;  1VQ8 Q;  3G4S Q;  1Q95 G;  3CC4 Q;  4IIO A;  1YJ9 T;  4J8O A;  1W2B P;  2A3L A;  3VS3 A;  3OYF A;  1VOM A;  3PFS A;  1WZO A;  2E70 A;  4C5I A;  5CR2 A;  1KQ1 A;  4OVA A;  2GTO A;  3CCE Q;  1YI2 T;  1UEC A;  2MF2 A;  1C0M A;  4PJO A;  4QQD A;  1PM3 A;  2VC8 A;  5GAM f;  1CKA A;  3MCA B;  5CO7 A;  2K5F A;  1VQ5 T;  3G71 A;  2EJG A;  4PJO F;  5IHK A;  4JS5 A;  2KMT A;  2X9H A;  1B3Q A;  4AFU C;  2YWW A;  1XNI A;  1NZ9 A;  1VQM T;  2K57 A;  5LJ3 d;  2JTE A;  4FT2 A;  1IO6 A;  5D6W A;  4VUB A;  5KYU B;  1ABQ A;  3H0H A;  3QWY A;  4F17 A;  1AZE A;  4LDV A;  2KRM A;  2QEX A;  3SEM A;  5GMK h;  2CP7 A;  1KD1 R;  2BZ8 A;  2K3X A;  3EAE A;  2HQX A;  1VQ8 A;  3G4S A;  3OYY A;  1W2B S;  4L59 A;  4A4H A;  4QT7 A;  1LPL A;  2COZ A;  1NLP C;  3D7S B;  1YHQ Q;  3QG1 A;  4AMC A;  4EMH A;  4GLK A;  2RJD A;  2WAC A;  1M2V B;  2HD0 A;  1VUB A;  4IUU A;  1K73 R;  4LDY A;  2D6F A;  1ACM B;  1TXQ A;  1Q81 U;  5LJ5 h;  3S6W A;  1UEB A;  2RJE A;  3IQL A;  5GJV B;  2EKO A;  5FWB A;  1NPR A;  4HCZ A;  3PIO A;  1V1C A;  1ZUY A;  3L2W A;  4A4K A;  2J6O A;  1A0N B;  3M57 A;  2DXT A;  1AVZ C;  1UHC A;  2K5L A;  5GAN 4;  2COW A;  3S3N A;  3M56 A;  2EGA A;  4JS4 A;  5LJ5 f;  4D8K A;  1LJO A;  4EMK A;  3G71 T;  5CKD A;  1CKB A;  5CQX A;  3EGX B;  4PKC C;  1EX4 A;  4DOW A;  1M90 C;  5GAM g;  3LX7 A;  5IHN A;  3O8V A;  2F5T X;  1JJ2 A;  3M0S A;  1GRI A;  3MEU A;  1S72 Q;  3QWX X;  1BCO A;  2HDA A;  1YHQ A;  2AZV A;  5GAN h;  3HFO A;  5AT1 B;  1KG1 A;  2QEX T;  2F5K A;  4OMF B;  2L0A A;  2L89 A;  1GFC A;  3QJ6 A;  4FYV B;  2LZ6 B;  1VQ8 T;  3G4S T;  3LYI A;  2QG9 B;  2KXC A;  1G83 A;  3GNF B;  4ANJ A;  3CC4 T;  2AT1 B;  5I2S A;  4BD3 A;  3G1J A;  3MEA A;  1W4S A;  4ZTJ A;  4ZGJ B;  4DQ2 A;  1MMN A;  1T3S A;  5FU7 B;  3CCE T;  3NTH A;  2GTJ A;  2K2V A;  4BUG A;  2QA4 Q;  2K79 A;  4PJL A;  4M7A D;  5IT9 E;  2CP2 A;  3FJ5 A;  1PWT A;  2CGH A;  4R0K A;  5IXB A;  1IRX A;  1FXX A;  2A7Y A;  1K73 C;  1AHJ B;  4OB3 B;  2OTJ Q;  4DEY A;  4BB7 A;  3V8K A;  1UJ0 A;  1QQJ A;  4MDX A;  5CKH A;  1UGS B;  1RAG B;  4RUG A;  3X20 B;  3JB9 G;  4JJC A;  1SEM A;  1QVG P;  1Q82 C;  2DBM A;  2NUT A;  2Y4Y A;  2CUB A;  4BAC A;  3M55 A;  5FRN A;  3GIB A;  2VB6 A;  4XTU A;  1KSW A;  5HK0 A;  2DPP B;  5A0L A;  3BE3 A;  1ZBJ A;  2VKN A;  3C0C A;  4XU3 A;  3L2V A;  1YWP A;  4FU6 A;  1KQ2 A;  4OP0 A;  4M7A A;  1YHQ T;  3I5S A;  5CQY A;  2DTO A;  2QA4 A;  2YRD A;  3TU4 K;  3OS5 A;  4O6J A;  1U1T A;  1Q81 R;  4E6R A;  2ED1 A;  2NUP A;  6AT1 B;  1BCM A;  1BI2 A;  4M7A F;  2YHT A;  2KQW A;  2LX9 A;  1W2B A;  3I9Q A;  2HSE B;  2DK3 A;  2GF7 A;  2OTJ A;  2BZY A;  1YJW A;  2V26 A;  5CIU A;  2MWO A;  2QGF B;  2A0F B;  5GMK i;  1KC8 R;  4A4E A;  3JCM g;  1H8K A;  2K5I A;  3L2Q A;  3MHX A;  3HFN A;  2V8I A;  1QVG S;  3OMC A;  4CRI A;  1PRL C;  1N5Z A;  1RAI B;  1QWF A;  3Q1J A;  3X28 B;  3L42 A;  4ELZ C;  4JUV A;  5D6X A;  4PK4 A;  1ZX6 A;  2A36 A;  1S72 T;  2DYI A;  3ER0 A;  2M0O A;  2KBT A;  4KUI A;  4ATO A;  1BI0 A;  1H92 A;  1PCX A;  4RTZ A;  4C0F A;  3V7R A;  1DJ7 B;  1M3A A;  2JZ2 A;  2X4W A;  1JEG A;  2X4X A;  5LJ3 f;  3OYL A;  1QKX A;  2P0Q A;  4PFO A;  4FIB A;  1Q86 R;  4CC3 A;  3CCJ Q;  5FLX E;  4JRP A;  1X2Q A;  1M1F A;  3P8H A;  2K3Y A;  1B7T A;  3FIF A;  2CP6 A;  3CCM A;  1GFD A;  4FSX A;  3PE0 A;  1VQ7 Q;  1PNJ A;  4CC2 A;  1VQK A;  2KAF A;  2QA4 T;  1M1K R;  2YXY A;  3DB4 A;  5FRM A;  2KXD A;  4M7A G;  3C94 A;  1H3Z A;  1Q81 C;  1O9S A;  1LVK A;  1YWO A;  3VS1 A;  1TG0 A;  1QW1 A;  3H0I A;  4RTX A;  2OTJ T;  1VA7 A;  2H3J A;  1ZSZ C;  2KYM A;  3C95 A;  1WNL A;  2PVG B;  1QCO A;  4HKE A;  1MMD A;  2E1H A;  3SD4 A;  1UGR B;  4XTY A;  1WXU A;  1X6G A;  2I2L A;  5KYW A;  1VQP Q;  3JCM P;  4EIK A;  3A98 A;  3CCJ A;  2DVJ A;  1AT1 B;  2CKK A;  3U23 A;  2E6Z A;  1Z9Q A;  9ATC B;  2DZ9 A;  2XHC A;  2O01 E;  1Y07 A;  2LP5 A;  2JTM A;  1RLP C;  3GOX A;  1QP2 A;  3CCS Q;  3X24 B;  2YSQ A;  2XID A;  2O4X B;  3M0P A;  2DX1 A;  3V7C A;  3JRZ A;  4XTV A;  4ESR A;  3ZBD A;  1WQ7 A;  3H9N A;  3MP1 A;  1FMW A;  4BI8 B;  2E10 A;  1WA7 A;  2CP3 A;  1WJQ A;  3HRU A;  4Y91 A;  1GCP A;  4HVV A;  4QQ6 A;  3CD6 Q;  2OTL A;  1M2O A;  5GJW B;  4N4I A;  5LJ3 g;  1K9A A;  4X34 A;  5GAN 6;  1ZA2 B;  1VQN A;  2QTV A;  1F1B B;  1M5Q 1;  3GLX A;  3EG9 B;  4ZN1 A;  4IUT A;  2DM1 A;  2NUZ A;  2YUP A;  3I5R A;  1OEB A;  1VYT A;  4O5V A;  3JCM X;  3V7S A;  4M7D B;  2FZK B;  2QGG A;  1QVG A;  1Y0M A;  1PC0 A;  3CCS A;  3X25 B;  5CKF A;  1D3B B;  2LMJ A;  1AEY A;  2QQR A;  2F1L A;  4J7F A;  1D1A A;  1NJI R;  3VYG A;  2LNV A;  2V1R A;  2NYS A;  1M1G A;  1NYG A;  3M0R A;  2E3I A;  3OYK A;  3CCJ T;  2DF6 A;  1PRM C;  4E7L A;  2WSE E;  1TSF A;  2M02 A;  1GCQ A;  4FYX B;  3QHS A;  1FMV A;  4DA4 A;  3CD6 A;  3OQ5 A;  1ZSG A;  1JO8 A;  1VQ7 T;  1G8X A;  5KCH A;  4J7I A;  5AYF A;  3OS2 A;  4IUV A;  4A63 B;  4LXC A;  4C8Q A;  4EDU A;  2KRO A;  4LDX A;  1I5O B;  1UGP B;  2KR3 A;  1ZSZ A;  1G3W A;  4M77 A;  4BI3 A;  1YIT Q;  4JJB A;  1JJ2 P;  4RG2 A;  1R8O B;  5M9O A;  2GBQ A;  2JT4 A;  4C8Q F;  1PD1 A;  3HRS A;  1LOJ A;  3MJX A;  4XQ3 A;  2BZX A;  2CSQ A;  1PD0 A;  4M77 F;  2JN0 A;  2FRW A;  1Y71 A;  1WJS A;  1BIA A;  4N0A C;  5GAN d;  1ZUK A;  1OU9 A;  2ZCF B;  1KD1 U;  4C5H A;  2AK5 A;  1EFN A;  1VQP T;  4CC4 B;  1D0X A;  3EFO B;  1UDL A;  2BTT A;  2VYT A;  2KT1 A;  2YLC A;  3INZ A;  3LLR A;  1K76 A;  1JXO A;  2ZPB B;  5GAN 3;  1WDX A;  3CCS T;  4XTZ A;  2LT4 A;  1WX6 A;  3J80 E;  2QQB A;  3OY9 A;  2RHI A;  1ZA1 B;  3T9N A;  3CPF A;  5DLO A;  1VQ5 A;  1K73 U;  1OI1 A;  4LD9 K;  4C0D B;  3SWN C;  1WJR A;  1PG5 B;  2JM8 A;  2EJ9 A;  4IUP A;  2QK0 A;  3OW2 S;  1M3C A;  1PSE A;  1YIT A;  4MZT A;  2DL3 A;  3CD6 T;  1NG2 A;  4E7H A;  3LWH A;  2H8H A;  4OB0 B;  2YRC A;  4F7U A;  2E12 A;  1G3Y A;  2KYB A;  3FRN A;  4JJN K;  3KUF A;  4F7U F;  2VVK A;  2V1Q A;  1GBQ A;  2FYK A;  2EYX A;  2DET A;  1SF9 A;  4C8Q G;  2EYW A;  2XU8 A;  1NEG A;  1WHH A;  4M75 C;  3PTA A;  1VQ4 Q;  3F70 A;  2XK0 A;  2DNU A;  3OYJ A;  4M77 G;  4QVC A;  3EGU A;  4BDY A;  4HVW A;  1TU0 B;  3QDR B;  5FU7 C;  1AWO A;  2MCN A;  1VQ9 Q;  1OPK A;  1TUC A;  2DE0 X;  3M53 A;  4OB1 B;  1MMG A;  2W10 A;  3LW5 E;  1HYO A;  3J7A F;  1RUW A;  4JZ4 A;  2DIQ A;  2C0I A;  4A4F A;  4XK8 E;  1R0B G;  1X69 A;  1UJY A;  2ZPH B;  5KYU A;  1U3O A;  2LCC A;  1SRL A;  3CC7 Q;  2CT4 A;  1IB8 A;  4PJN A;  5EG2 A;  2I0N A;  4IIM A;  2FG0 A;  1QCF A;  3RBB B;  1C6V X;  4FT4 A;  2EPD A;  2GGR A;  5GAN 2;  1RI9 A;  2X3W D;  1YIT T;  2HEQ A;  3EHQ A;  2RB6 A;  2CRE A;  2M0Y A;  4ZTF A;  2DRK A;  1Q7Y R;  4HXJ A;  2KVQ G;  3CCU Q;  4EPC A;  2RA2 A;  1M2V A;  4NS5 A;  2DMO A;  4C8Q E;  4JLI A;  1VQ9 A;  3DLL A;  1RAF B;  3EFS A;  4F7U G;  4M77 E;  2KNB B;  3CC4 A;  1I4K 1;  2FPF A;  5GAO r;  2CZ0 B;  3VS7 A;  3JCM V;  1U8R A;  1IXD A;  1BKB A;  1WFW A;  3DB3 A;  3PT9 A;  2KEA A;  1OPL A;  2LCL A;  3CCE A;  2QDL A;  3UAT A;  3CC7 A;  3FEO A;  2EQM A;  2YUO A;  4M78 C;  1ABO A;  2RM4 A;  1XOV A;  3RIR A;  2KSS A;  3P8B B;  2QYZ A;  3J81 E;  3OYI A;  1WHK A;  4WCI A;  5CAI A;  3EGX A;  3BDL A;  2QAS A;  3CBM A;  4D8D A;  2LNH B;  3JAM E;  1PHT A;  1UHF A;  3PMT A;  3RUX A;  2CH4 W;  3ULR B;  4J9I A;  1V29 B;  1KC8 U;  2D0N A;  8ATC B;  3CCU A;  1IGQ A;  4FW1 A;  2E65 A;  3HSB A;  3OYH A;  2PUO B;  1I5L A;  4PJO G;  2DL4 A;  2MOX A;  3SWN B;  2CUD A;  1YBY A;  3CC2 Q;  1Z9Z A;  5KYY B;  3LH5 A;  2P4R A;  5KYX B;  5KYN A;  2P84 A;  3H0F A;  3REB B;  5HCK A;  3M0Q A;  2MMP A;  2RMO A;  1VQ4 T;  2C0T A;  3JCM e;  5HK3 A;  2F2V A;  1SHG A;  3GF5 A;  5GAN 8;  1VQ9 T;  1RAD B;  1KD1 C;  4B6M A;  2XKO C;  1WGS A;  4QKU A;  1NM7 A;  1I1J A;  2CH4 A;  2DXU A;  1Q86 U;  1QVF S;  2RO0 A;  3MPU B;  3O5Z A;  5GAN f;  1LNX A;  4M75 B;  2RI5 A;  4LNP A;  3LH0 A;  1WXT A;  3CC7 T;  4Z8A A;  4M78 D;  4MDW A;  3CCV Q;  4E7I A;  1BU1 A;  1AZG B;  2ABL A;  1M1K U;  2LDM A;  2DBK A;  1X6B A;  2RD1 A;  2MPX C;  2DA9 A;  3CC2 A;  1KHC A;  3L2Z A;  4J9E A;  1FWZ A;  1N27 A;  3M0U A;  1UE9 A;  2ED0 A;  4PJO E;  1S72 A;  2DKG A;  4C0G A;  2A28 A;  3UA6 A;  5FU6 B;  3CCU T;  3DLM A;  1UGV A;  2O9S A;  1M4Z A;  2LQK A;  2CZ6 B;  3OYC A;  3CPW S;  3KXT A;  4J9C A;  2VWF A;  3AT1 B;  5LJ5 g;  3RNJ A;  1K8A R;  2RQR A;  5I11 A;  1NYF A;  5GMK l;  2RQU A;  1UG1 A;  1B34 B;  1ZBX A;  4OMM A;  4M78 A;  3OA6 A;  3RES A;  2FEI A;  3M0T A;  2BE7 D;  4C92 C;  3CCV A;  2E5K A;  2FHD A;  3MO8 A;  2RI2 A;  2PTK A;  1I0C A;  1JQQ A;  3RKX A;  3E9G A;  1RAB B;  2LJ3 A;  2RK1 A;  4OMQ A;  2SRC A;  3E2U A;  2M1H A;  3NHN A;  4M7D C;  4M78 B;  2PZ1 A;  3OMG A;  2Z0W A;  2DJQ A;  3H41 A;  5A0D A;  3QYG B;  5GAN g;  2VXE A;  3EH1 A;  2ZPF B;  2JXB A;  3UWN A;  2FZG B;  3VV0 A;  1D1C A;  4E7J A;  3CC2 T;  1YCS B;  1TH7 A;  4JLG A;  5IXF A;  3QZ5 B;  4KGX B;  1KFZ A;  5EC7 A;  2LQ8 A;  2JS0 A;  4QW2 A;  5GMK m;  2XDB A;  1K0S A;  1RAH B;  4BI4 A;  4OGC A;  4J9F A;  1OV3 A;  5LJ3 e;  3PMI A;  1G3T A;  3BFM A;  2J06 A;  4OML A;  3NFC A;  1NJI U;  3GNG A;  3RKY A;  3ASK A;  2ECZ A;  2VXF A;  3E9F A;  1JXM A;  2ZGW A;  5CKE A;  2QI2 A;  2D9T A;  2ZPG B;  3BW1 A;  5CK9 A;  3VS6 A;  1VQ6 Q;  4AFS C;  5LJ3 j;  4C92 D;  4ZGD B;  3CCV T;  2KDS A;  2XMF A;  1YJN Q;  4J9H A;  2CSI A;  3JB9 H;  1HD3 A;  3N5B B;  4E47 A;  3OYN A;  1QVF A;  4MZM A;  5CVI A;  2HL3 A;  2YDL A;  2HL5 C;  5L8R E;  1BI1 A;  3OB9 A;  1K9M R;  3JCM b;  2PU9 B;  3FB9 A;  3E19 A;  1KC8 C;  4M7D D;  2O4X A;  4PJJ A;  4PLI A;  3M4Y A;  3CCR Q;  3JCM J;  2ZZD A;  1IRE B;  3MP8 A;  1BI3 A;  1RAE B;  4RTU A;  2AHJ B;  3GP8 A;  3WXM B;  2D8J A;  4C0D C;  5HKC A;  3S3M A;  5C6S A;  2ZPI B;  5IH2 A;  4RTT A;  3JV3 A;  5KE2 A;  3M5A A;  2EJF A;  2C0O A;  1VQ6 A;  3V8L A;  4DBR A;  1VQ7 A;  3CPW A;  2AKK A;  3EG9 A;  4GY5 A;  4RCC A;  4CC7 A;  2J6K A;  4BE2 A;  1YJN A;  1U06 A;  2JMC A;  1OX8 A;  4OMN A;  1Q86 C;  1WHM A;  2GNC A;  2FVU A;  2HMA A;  4E2F B;  4M7A E;  3RER A;  4M7D A;  3OYA A;  3MEW A;  3JCM c;  3A8M B;  2EQI A;  3QBY A;  2L2P A;  1D3B A;  2ZAE A;  4Y28 E;  2EWN A;  4C92 B;  4KGZ B;  3EGD B;  4M7D F;  4NL2 A;  2ENM A;  1M1K C;  3OYE A;  4KH0 B;  2MIO A;  4D6W A;  1VQP A;  4LN2 A;  2B8A A;  3OS0 A;  3UT1 A;  2Y90 A;  4Z88 A;  4DBF A;  1SRM A;  3OSV A;  5KE3 A;  3NPF A;  1UFF A;  4KH1 B;  4HT9 A;  1NE8 A;  3I55 Q;  1AWJ A;  2OAW A;  5J3B A;  1S1N A;  2KRN A;  1JRI A;  2IPO B;  3EFR A;  2E41 A;  3HTR A;  3RR6 A;  2O2O A;  4A4G A;  2L3S A;  4J6X A;  3JB9 J;  1JU5 C;  1X43 A;  3TSZ A;  4J6W A;  4DBH A;  2XIC A;  2FZC B; 
#chains in the Genus database with same CATH homology
 1TOV A;  3TQ7 P;  2MPX C;  2CP5 A;  1LPL A;  1WHH A;  2COZ A;  1WHG A;  1IXD A;  1WHL A;  2E4H A;  2E3H A;  2HL3 A;  2HKQ B;  3RDV A;  2COW A;  2CP0 A;  2CP3 A;  2CP7 A;  2HL5 C;  2E3I A;  3E2U A;  2CP6 A;  2HQH A;  1WHM A;  2M02 A;  2CP2 A;  1WHJ A;  1WHK A;  1TXQ A;  2HKN A;  2Z0W A;  2QK0 A;  4B6M A;  2COY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...