2E3IA

Crystal structure of the clip-170 cap-gly domain 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
78
Chain Sequence
DDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQATTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 17
structure length 78
sequence length 86
ec nomenclature
pdb deposition date 2006-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e3iA00
1WHHA 2CP2A 2CP3A 1TXQA 1WHGA 4B6MA 2HKQB 3E2UA 2E3HA 1IXDA 2COWA 3RDVA 2COZA 2Z0WA 1TOVA 1WHLA 1WHMA 2CP7A 2HL5C 1WHKA 2HL3A 2M02A 2MPXC 2CP5A 1LPLA 2HKNA 2E4HA 2E3IA 2HQHA 2CP0A 2CP6A 1WHJA 3TQ7P 2QK0A 2COYA
chains in the Genus database with same CATH superfamily
3GPLA 2L8DA 1YCYA 3OYAA 1JO8A 2COZA 2CZ0B 3HFOA 4KT0E 2EYYA 3CPWP 3OMCA 4FSXA 4C0DB 2O88A 4BI4A 4MDWA 2BZYA 2MPXC 4RTUA 1WDXA 5KYUB 2H8HA 3HRTA 1N6AA 4HXJA 4C5IA 4M77E 5GAN2 2DTIA 3CMAA 2I2LA 1HYOA 3H9NA 2GF7A 1NJIR 1WLPB 3QYHB 4RG8A 2LP5A 3CCJA 3MHXA 4J9CA 3JCMe 2DEQA 4V2SA 1MHNA 5CIUA 4HCBA 1NZ9A 1PKSA 2JTMA 4FYXB 4F04B 2HAXA 4BI3A 1QWFA 1X2QA 3URGA 1JJ2P 3FEOA 1OQKA 4O5VA 3QXEB 3VYGA 7AT1B 2EYZA 3OS0A 3GP8A 3TEEA 2MOXA 2HL3A 2SEMA 4PJOE 4C8QD 4C92B 2AT1B 3OYLA 1XTDA 4E7ZA 2FPDA 2HEQA 1VQ4T 3M4GA 2RM4A 3EFOB 2VXEA 2PQWA 5ECAA 1PM3A 3MP8A 4J9BA 1WX6A 2LVMA 2EJGA 3JCMh 1YJNQ 1C1AA 1VQ5Q 4N0AA 1VQ8A 3EG1A 2KT8A 2JOYA 2CZ1B 2EPDA 3V7SA 3BFMA 1YN8A 4PJOG 3SWNC 1RLQC 2JTEA 2X35A 4IIOA 4EMKB 4CI0C 1RACB 4J7IA 3JCMV 1OYXA 1K76A 5KYYA 1WXTA 3TVTA 3HKSA 4JLIA 2QEXQ 1YJ9A 3DLMA 5GAOp 2DA9A 4FW1A 3E1SA 4FYWB 4Z02A 4AFSC 1KC8C 4OB1B 1KC8U 4DBHA 4N4GA 1EX4A 2RI2A 1UE9A 1M90U 2C0IA 1M2VA 1HXDA 2JS2A 2CP3A 1KQSS 2X4JA 2D8HA 1K0XA 9ATCB 1BIBA 1VIFA 1VQMT 4PNOA 1KG1A 3GOXA 4FCYA 1GL5A 2DXBA 4F7UF 3VS7A 4ZTFA 2FPFA 2JM9A 3CCRA 2M02A 4LDXA 4XK8E 1FYNA 1K1ZA 4PJJA 2DEUA 2RJEA 4M77B 4LDWA 4B6MA 1VQLT 2YSQA 2DXUA 1EIFA 3L2ZA 4M7DB 1D0ZA 4C5EA 2LC4A 4MZTA 4ZN1A 1HD3A 2F2XA 1KSWA 4M4ZA 1MV3A 2K79A 3QJ6A 3NTIA 1YI2T 2PTKA 2FVUA 1MGQA 5GANf 2YLCA 3JSCA 2LCCA 3KFVA 3CC2A 2LTOA 1BIAA 5KE3A 3WXMB 3C4SA 4A4HA 2QQSA 1RADB 3FC3A 2O4XA 2QQAA 3VS1A 3I56Q 1P92A 4OMNA 3MJXA 1Y0MA 2LCLA 3M0TA 5FW9A 1WXBA 1U8RA 1S72Q 2G3RA 2P0PA 2C0TA 1K4US 3CD6A 4M78D 4PJOB 2X4WA 3OS2A 5HK3A 1NBEB 2OAWA 3CMAT 2RMOA 2AKLA 1JXOA 5J26A 4PJLA 2DL8A 2LJ1A 5IHIA 2F5KA 5GAMj 2OTLQ 2VASA 1GRIA 1WHGA 1FMWA 1YIJQ 2A36A 3PMIA 1UJYA 2L3RA 1AVZC 3CCJT 3CCLQ 3A5ZB 1FMKA 1K9AA 4E7SA 1WGSA 3EFSA 3I5RA 1WJQA 3CCVQ 1OOTA 3P8HA 2DJZA 3A8OB 3ER0A 1Y96A 2KK4A 2QK0A 2JM8A 3X26B 1V76A 3META 1QMCA 2HNIA 1XNIA 2FPEA 2JUFA 3OW2A 4OP0A 3VS2A 2LDMA 4KGXB 3OYYA 3OYNA 2ROLA 3DKMA 2DL3A 2KSSA 3PT9A 2HQHA 2RQWA 4M75E 3LWHA 1VQNQ 2ESWA 2QA4A 2AIRB 1SRMA 2XI9A 4HVVA 3M4YA 4AFUC 5GAN3 1VQ8T 4X34A 5GAMd 2RJDA 1ZUUA 3SEMA 2D9TA 4C8QC 2ENMA 1VUBA 1JEGA 2FRWA 3H8ZA 2EQMA 1PNJA 3O5ZA 1X27A 2EAYA 2HZYA 1YITA 4C92F 2HQXA 3EFOA 1N9RA 1BBZA 4PLIA 3QHSA 2MI6A 2YRCA 3CPWS 1YJ9T 2EQKA 3G4SA 5CK9A 5D6XA 4QQGA 3CCMQ 2J05A 2LT1A 3FB9A 3QYGB 3JCMb 3V7RA 3JB9H 3CBPA 3MKDA 3CBOA 4NL3A 1JBMA 5D7UA 1RAAB 4L59A 1RI9A 3JCMP 5D6YA 4M7AF 4Z8AA 1LNXA 4GLMA 3RMSA 2DF6A 2OTJA 3CCRT 1WNLA 4JLGA 2M0YA 3FIFA 3MO8A 2IG0A 3CC7A 3S3OA 1PKTA 4QT7A 1K9MC 2RF0A 2RH2A 1K9MU 1QW1A 4F7UE 1Z9ZA 3BW1A 1WI7A 4CC7A 4LD9K 1IGQA 4L5GA 3SD4A 2CKKA 4O6JA 3FJPA 3CC2T 3CMEQ 1GBQA 1SPKA 3EGDA 1G2BA 2P4RA 3OBYA 5LJ5f 4M77A 1NLOC 3JCMc 2KEAA 4JJBA 1FXXA 1X69A 4J9GA 2GQVA 3OBWA 4OGCA 4M77F 2AHJB 4F7UG 3QG1A 1PSFA 1AWOA 5IHNA 3CD6T 1J3TA 1KC8R 1OU8A 2RNAA 5GAN8 1K8AR 1M90R 1QLYA 1PD1A 4M7DF 1JRIA 4JDSA 5I11A 4P5NA 5A0LA 1AEYA 5HY6A 3E19A 4M75B 2XIDA 2NLUA 4E2FB 3NFCA 4D6WA 3G71A 1TOVA 1W4SA 4D8KA 2CP7A 5EG2A 5FU7C 4AG2C 4BDYA 2DVJA 1BCOA 4J9HA 2DD4A 4A53A 4HCZA 4PJOA 4JZ3A 1N27A 4MDXA 3JCMf 1VQ6Q 1MMAA 2WSEE 1B3QA 2V1RA 2MAMA 3DB4A 4PJOF 2IVWA 4J6XA 2LQ8A 3A98A 2H3EB 4RKUE 2L3SA 1ZSZB 4BY6B 1VYVA 2EGAA 1TG0A 2D0NA 2K2VA 1YHQA 2JZ2A 1W6XA 1H92A 2QA4T 1XJWB 2EIFA 3HPWA 1R0CB 2P0QA 4KULA 2FG0A 4DOVA 2NUTB 5CR2A 2FB7A 1O9SA 3PTAA 2R57A 3G6EA 2JMCA 3H0IA 2DKGA 2CUBA 1YITT 4XTUA 4B9XA 2A7YA 1M8MA 2ECZA 3P8BB 2DVEA 2KROA 4R0KA 1M1KR 4RTYA 3G4ST 3BY7A 3CC4A 2LT4A 3BDLA 1R0BG 4NOYA 3IQLA 1MV0B 4XU1A 2BE9B 2EGEA 2OAUA 1ZBXA 4C92E 1Q95G 1IB8A 3GNGA 4J9DA 3EFRA 2AKKA 4E7JA 3CEYA 4GLKA 3OYFA 2KAFA 2H3JA 3OYGA 1M3AA 1VOMA 4DA4A 2GTJA 2GBQA 5CKBA 4KUIA 2OTJT 3QDFA 2DBKA 1WHKA 4EMGA 4FW2A 2EKOA 4BY6C 3CC7T 5IAYA 2HDAA 2QYZA 1HSQA 5LJ3j 4JJNK 2QGFB 3M58A 4N0AC 1QVFA 4M7AE 3M0SA 4C92G 3LWIA 1I1JA 4GBQA 3VS0A 1YJNA 1U5SA 3GIBA 3VS6A 1KHCA 1SHFA 3QWYA 1VQ5A 4RTVA 5GAN6 3UT1A 2RA2A 2C06A 2YXYA 1OV3A 1NYFA 4AMCA 2QQBA 2K57A 3LH5A 1WYXA 5LJ5e 1G3SA 3KBGA 2VV5A 4WCIA 2NUPB 4C5HA 5GAOn 2ZPHB 2CSIA 3G1JA 1VQ7Q 1KJWA 1X75C 2A28A 1NPRA 4M7AG 2QDLA 2QEXA 4XQ3A 2YHTA 2DRKA 3EHQA 5A2QE 4HCKA 3OSVA 3M0UA 1TWBA 1PSEA 3FRNA 4L6V5 1BI1A 2FZGB 4QVCA 1Q7YC 1XOVA 3D7SB 1Q81C 1Q81U 4DQ2A 5A0DA 4CC2A 1UG1A 4WF2A 3G71T 4ELYC 1QVGA 3MPUB 5LJ3d 5DLOA 4M7DE 3A8HB 5I22A 2RK1A 4QQ6A 3CCEQ 2DLPA 2ZPFB 2VC8A 5LJ5h 2DRMA 2O9SA 2QXFA 3REBB 2FEIA 2PNIA 2W0ZA 4A4EA 2CSQA 2J6FA 2R5MA 4M75A 1TXQA 5CQXA 4M77G 3M55A 1VYUA 3HP9A 5KE2A 1X43A 4ZNXA 3MCAB 4M75F 4RCCA 3V8LA 3M59A 1QVFP 4M7DG 2F69A 3M54A 3R6OA 4OB3B 1RAFB 4A4KA 1YHQT 1TH7A 5IN1A 2DL4A 3I56A 4PJOD 1OPLA 3QIIA 3CCQA 2DETA 2NWMA 1U3OA 1S72A 2YT6A 5D6WA 2QASA 4BE2A 1T3SA 1UB4A 2MYSA 6AT1B 1ZSZA 4KH0B 3G6ET 4XAXB 2XDBA 4BE1A 1VQMQ 1OI1A 4C0DC 2DYIA 4ME7A 3VV0A 2A08A 5KYXB 1YIJA 2DFUA 2CP6A 4M7AB 3TQ7P 3EAEA 1VIEA 3OS5A 3GNFB 3CC4T 1UJ0A 1Z9QA 2W10A 4UC4A 2LNHB 1AHJB 2K5IA 2NUTA 1KIKA 4JRQA 3CCVA 3QPHA 3I5SA 1X6OA 1EZZB 2KBTA 4OB2B 3LW5E 4PFZA 1QVGP 1YI2Q 2RI5A 4ATOA 4XTYA 5IXBA 4J7FA 3BE3A 2DZCA 4F7UA 2JMAA 1WIEA 2EW3A 4II1A 3PE0A 2EQUA 5FU6B 4LDYA 5GANj 4XTVA 2FO0A 4OMPA 1YBYA 2BZ8A 1VQNA 2DL7A 3OY9A 1UEBA 4C92C 4D8DA 1YJNT 4X9CA 1VQ5T 1NYGA 2YRVA 3VYHB 2KQWA 1D1CA 3FDRA 2X4YA 1YJWA 1O75A 3PVLA 1AWWA 1M1FA 3UA7A 3L42A 4QVZA 1I81A 2BIVA 4E6RA 3KXTA 2QDYB 1YP5A 1AD5A 3OYEA 2FZKB 2ED0A 3VRZA 4OMLA 1KD1C 2LQWA 1ABOA 1D3BB 1KD1U 4CC4B 2QEXT 1FWZA 2CH4W 3OS1A 4M7AC 4HT9A 4EDUA 1SKUB 3F70A 4EMKC 1ZUKA 4J8OA 3AT1B 3CCMA 1GXIE 3M0PA 2E6ZA 1G3WA 2JS0A 1IO6A 4RG2A 3OYCA 3C0CA 1W2BS 1IHVA 1ZX6A 2V1QA 1RI0A 1Q86C 2NUPA 1PC0A 2MWOA 1Q86U 1SRLA 2RD1A 3MEUA 5GANd 2HKQB 3JB9F 1ZA1B 4FYYB 2F1LA 5GMKj 4MZPA 4DBRA 3I55A 1M5Q1 2WSCE 2M9UA 3VS5A 4PFOA 1NEBA 1VYTA 2AZSA 4JRKA 1QVPA 1SSFA 2ZPIB 2RPNA 1TSFA 5FU6C 3CXCS 1GBRA 4Z88A 3KUFA 1YFNA 5KYUA 5KH6A 1M4ZA 2CP0A 1LVKA 4ESRA 3CBMA 3A8GB 2L5QA 2M51A 1BU1A 4F16A 2EGCA 2FZCB 5CAIA 4M77C 4LE9A 2R5AA 4DEYA 3CCSQ 2KR3A 2Y4YA 3EG3A 5A0GA 1WHLA 1BI0A 4JRPA 2KVQG 2ZPEB 1YCSB 2K5LA 2HL5C 4M7DC 1YNZA 2JJ9A 2L3PA 3QKJA 4KH1B 1N5ZA 3I56T 4FT2A 2NUZA 2E5KA 2OJ2A 3CCQT 1M8VA 2DZ9A 4LDUA 2K6DA 1S72T 4OMMA 3UA6A 2LQNA 2P4TA 1X2KA 1VA7A 2ZZDA 2EQJA 1LCKA 2RB6A 2CP5A 1YIJT 2AZVA 2KRMA 4C92A 3CCRQ 3PVQA 4PJOC 1K73C 2KDSA 1OX9A 2COYA 4BUGA 1Q82C 1K73U 2ZPBB 2ED1A 1B07A 2KNBB 3M57A 1WJSA 2ZGWA 4M75G 4FT4A 3CCVT 2V26A 1SG5A 2V8IA 4FIBA 1VQ6A 3UATA 2JVVA 2WSFE 1E6GA 4RTXA 2JXBA 1C6VX 2E3IA 5KYXA 1VQPQ 1N8RC 4M7AA 1ZSGA 4EMKA 1QQJA 1VQKA 2ROTA 1H8KA 1WHMA 2HSPA 1NE8A 1U1SA 1KQSA 2E12A 2YUNA 3UWNA 3OA6A 2VYTA 2WACA 1VQNT 4J9FA 1IRXA 1JU5C 3QZ5B 5CQYA 1BI3A 1NEGA 1RAHB 2HQEA 2DXTA 2K4YA 4J5YA 3OW2P 1JJ2S 2MMPA 4Y28E 2CZ6B 2A3LA 2DMOA 3INZA 1YJWT 3RDVA 4M78B 1NJIC 1B34B 2X3WD 1NJIU 5GAOm 1F1BB 1VQ9Q 1NM7A 1FX7A 2KYBA 3GLXA 2DYBA 4B9WA 5GAMg 1BKBA 3HTRA 3C95A 3CCUA 2GFAA 2Y4XA 3OYKA 1IREB 3CCMT 1D0YA 4M7DA 2K3YA 4BB7A 3MP1A 2CT4A 2E6NA 5HCKA 4JRIA 3M9QA 2RHZA 4KBMB 2GQIA 2RJCA 2MCNA 2HBPA 2PUKB 2VB6A 2O31A 1AWXA 1QCFA 2HD0A 1D1AA 4VUBA 1AWJA 4KGZB 3I55T 4A54A 4PFPA 4OGEA 2QA4Q 1G8XA 2LNVA 2DK3A 2RN8A 5KCHA 5GAOl 2KXDA 2HBWA 1B7TA 1QVGS 1TUDA 1XQHA 3RNJA 4E7LA 1CKAA 1KQSP 2L89A 1YITQ 3OB9A 3M0RA 5DM7R 2YDLA 1AZEA 1TUCA 2RQRA 3G4SQ 4PL6A 2CUDA 2DIGA 2GGRA 1UGRB 1KK7A 3J7AF 2E64A 1GCPA 2DNUA 2GFUA 2HKNA 5FROA 4AFQC 4EMHA 1KD1R 1VQ7A 2EFIA 4J6WA 3MEWA 2VWFA 4C0ZA 4WTOB 3JB9G 1H3HA 2CP2A 2HCKA 4DEXA 4IURA 1VQOQ 4JPBW 3JCMd 1OU9A 4BDZA 3LX7A 1QKXA 2M0OA 3J81E 2DO3A 3PNWC 4FU6A 2XICA 2X3XD 4JUVA 3V8KA 1CSKA 4JJCA 3MP6A 1Y57A 2LQKA 2E4HA 2JN0A 4LXCA 2DD5A 2LJ3A 4AG1C 1Y7XA 3RMQA 1I0CA 2YUPA 3CCEA 3RBBB 4XU0A 5KYYB 4M75C 4E7HA 1NG2A 2D1XA 5GAOq 1QKWA 1VQ6T 4DBQA 3V8JA 1SF9A 2L3QA 4R55A 3CPWA 5GAMh 2BZXA 2J6OA 3NMZC 4JZ4A 2D8JA 2EQIA 4C92D 3OYJA 1D09B 3CPFA 3JB9J 2O2OA 4DOWA 1M30A 2EWNA 1VQKT 2L2PA 5CKEA 1IHWA 2CYZB 4ZN3A 3JV3A 2QG9B 4HA8A 4XTWA 1MMGA 2YWWA 3H0FA 5CKHA 1K0SA 2EBPA 2PU9B 1ZSZC 1GCQA 3OYIA 4IKFA 1UUEA 2DX1A 2IIMA 2BKDN 1G5VA 4IUTA 4M7AD 1Y71A 2JW4A 2LJ0A 3Q1JA 2RHYA 2EKHA 1ARKA 4E47A 1QCOA 2B8AA 1KHIA 3G71Q 3LLRA 1H641 4QVDA 3CCUT 1WA7A 2ABLA 2M16A 1QWEA 4YTLA 1K73R 2K2MA 3A1PA 1OULA 3VJPA 3NGPA 2PVDB 5AYFA 3N5BB 4IUQA 1SHGA 3WVEB 2BUDA 1KQ2A 3SFMA 1FMVA 1OZ2A 1B34A 1UTIA 5L23A 2E41A 5IH2A 5LJ3f 4KGVB 4M78F 1Q7YU 2GTOA 4QKUA 1YHQQ 1BYMA 4MZMA 3L2WA 4M77D 2E3HA 4Y91A 3NTKA 2Z0WA 1WQ7A 5IHKA 2RO0A 2RI3A 1BI2A 3NHNA 1VQ4Q 4QQDA 2MWPA 1X6GA 4RUGA 1ZA2B 1UGVA 4M7DD 1V1CA 1WZOA 4RMOA 3SWNB 2X9HA 2QGGA 1D0XA 4KUDK 1K9MR 2DTHA 5KYWB 1Y96B 3G6EQ 3I35A 4PJMA 2JNGA 1RAIB 3PIPA 5I21A 4ZGDB 1M2OA 2GNCA 3CC4Q 1OPKA 3V7CA 4MMKA 1C0MA 1I4K1 2XDPA 3O8VA 4EIKA 1JQQA 1ZBJA 3OMGA 1VQ7T 1JB0E 3QSUA 2BE7D 2K7AA 3OW2S 3EG2A 3CQTA 2KMTA 4TVRA 5CKDA 2DXCA 3E9FA 3X28B 1JXMA 5AT1B 3ZL7C 3LYIA 3M5AA 4HT8A 2R58A 4C8QE 3U23A 4OMFB 2RQTA 1HJDA 2KXCA 5GJVB 2EJ9A 1X6BA 1R77A 2OTLA 2KYMA 1CKBA 5L8RE 2M1HA 2LX7A 2ATCB 3CCET 1IZ6A 4IUPA 3CCLA 4GY5A 1G3TA 1VQLQ 5HKCA 3OSSC 5LJ3g 2EJFA 2LMJA 1GFCA 4C8QG 3L2QA 4JS4A 3ME9A 3HL8A 2E5QA 4FSSA 3PGGA 4N4HA 4Q5WA 1X01A 3CCSA 1S1NA 4A4GA 1GFDA 1H3ZA 1IXDA 2RJFA 5IT9E 2CDTA 4HVUA 2LCSA 1A0NB 2X4XA 1UGPB 3JAME 1UHCA 3RUXA 1N9SA 2YUOA 2LX9A 1LPLA 1R8OB 1ZQ1A 2SRCA 1K8AC 1M90C 2MF2A 2VXFA 2Y90A 1UFFA 3VKIA 1K8AU 4CC3A 4Y92A 5FWBA 3R6NA 2KGTA 5KYNA 3CMAQ 1NLPC 5FWCA 4X9DA 2OX7A 2VGNA 3SB2A 2XD0A 3ZEHA 1HK9A 3JCMW 2DE0X 3UPUA 2PZ1A 1AZGB 5C6SA 4LD6A 1G3YA 3QJYA 3LGLA 3CCJQ 3EGDB 3MEAA 1WHJA 4KRTA 1NPPA 4BI8B 2VUBA 3G7ZA 2J7IA 4CRIA 3J80E 5DLQE 1W70A 3I9QA 1SEMA 2CREA 2QAZA 4AT1B 1QCNA 2KRNA 3L1AA 1VQPA 2DJQA 5LJ3e 3OQ5A 4C0GA 3PMTA 3PIOA 3EH1A 2KRSA 4HCCA 3EGXB 3VS3A 3S3MA 1OZ3A 3HRUA 3QWXX 3CCQQ 3TSWA 2XK0A 4M78E 4C8QB 2O01E 2K9GA 1PCXA 1T3LA 4LN2A 5GMKm 2QTXA 1I8FA 4MMLA 2PVGB 2QTVA 3QDRB 3VRYA 1VQ8Q 1BB9A 4J83A 1M1KC 2DAQA 3C12A 1VQ9A 1M1KU 1QP3A 2D0QB 4E7IA 1RAGB 5LJ3h 3RERA 1RLPC 3TREA 4N4IA 3CMEA 2RK2A 5CO7A 4ORZA 4M78G 3SWNA 1YJ9Q 1PHTA 2HMAA 3X24B 5GMKi 4ZGEB 5KYWA 2KE9A 2E1HA 3HFNA 1PG5B 4BACA 4A63B 1M27C 2E65A 5GAMf 2CH4A 2FHDA 5FLXE 4M75D 4IIMA 2F2VA 3QBYA 1RL2A 3BDUA 5GMKl 2BTTA 2F5TX 5GAN5 1V29B 2P84A 2IPOB 3VUBA 1Q7YR 2OTLT 1RUWA 4RTWA 5GAN4 1Q81R 4K11A 1W1FA 3A8LB 3S6WA 1E7OA 4ELZC 3ZBDA 1ZHIA 4HKEA 1ACMB 3UDCA 3CCLT 4PK4A 3EG9B 1WXUA 2D6FA 3E2UA 4C5GA 4A4FA 1Q82U 4JS5A 2DM1A 1WPYA 1BCMA 2J6KA 2VKNA 3OYMA 5GANg 1RAEB 5GJWB 1LJOA 2HSEB 4PKCC 1UGQB 1YJWQ 3VU3C 5GAOr 2EVRA 1WFWA 1ABQA 3LH0A 2RQVA 1DJ7B 2QQRA 5J39A 2CZ7B 2RQUA 4AFZC 1WQWA 4RCBA 2DPPB 3CCST 2VVKA 2RHIA 4R56A 2O9VA 2PUOB 8AT1B 2YRDA 3CC2Q 1N8RU 3T9NA 1KFZA 2EYQA 1UHFA 1T0JA 2CS7A 2JT4A 5M9OA 3P8DA 5CKFA 5EC7A 3HRSA 3QUIA 1BK2A 4C0FA 3ZFJA 1YWPA 3UF4A 2G6FX 1VQOA 3CD6Q 2MIOA 5LJ5j 1MMDA 3AHUA 1WHHA 1PD0A 5FU7B 5CVIA 1M3CA 2AK5A 1U1TA 3SDZA 5IXFA 1TUGB 4XU2A 3RR6A 3I55Q 1QVFS 2DERA 2A0FB 2V8JA 3JCMQ 3PFSA 2QQ9A 4OMOA 2JTFA 1AT1B 2KI7A 3RKYA 4EPCA 3RKWA 2XU8A 1VQPT 5GANe 4J9EA 2GCXA 4OB0B 3JB9I 4LUDA 2FL7A 4ZTJA 4QW2A 1GCQC 5LL6S 1TS9A 4FYVB 3NTHA 1D3BA 1W2BA 3OYBA 3LGFA 2COWA 1AOJA 1SSHA 5LJ5d 1OEBA 1D1BA 2YLBA 3TSZA 2L0AA 5C0MA 2XHCA 4J9IA 2E10A 2XKOC 4RTZA 2CT3A 4IUVA 4Z89A 3H0HA 2DBMA 3WVDB 3JB9D 3E9GA 3EGXA 3SHWA 3CXCA 1VQ9T 1PRMC 2DL5A 1WJRA 1M1GA 5GANh 4X1VA 3CMET 4C8QA 3HSBA 4ANJA 4BE0A 3TCJA 4M78C 4OVAA 4XTXA 2B86A 4BD3A 4ZGJB 3L2VA 4C8QF 2DILA 2FYKA 2RHXA 3VUZA 1MNDA 5GAMe 1G83A 1MUZA 1ZUYA 2LZ6B 1PRLC 4NS5A 4RTTA 4FM4B 5GMKe 2XMFA 1MMNA 5FRNA 4F14A 1I07A 3DB3A 3H6ZA 2K3BA 2MK5A 3X25B 3ULRB 1VQKQ 2CGHA 3A8MB 2EYWA 2VGMA 1EFNA 3NPFA 2YUQA 2OTJQ 3TU4K 4F17A 3QO3A 1Y07A 1Q86R 3EGUA 5CCAA 1TU0B 2LRQA 2RHUA 3CC7Q 1KQ1A 3ASKA 4JJDA 4OMQA 5I2MA 1IGUA 1VQ4A 2DTOA 3FLGA 5HK0A 1E6HA 1QP2A 1LOJA 2X51A 3THKA 3MEVA 5LJ5g 3GF5A 3C94A 1UECA 5J3BA 3M56A 2I0NA 1W2BP 4E7KA 4HVWA 4OF1A 5GMKh 1M2VB 3CCUQ 5I2SA 1T0HA 2C0OA 2FRYA 3X20B 3OYDA 4F7UB 3EG9A 3OYHA 3RIRA 4DBFA 3S3NA 2J06A 5FRMA 1ZLMA 1TTHB 3GBQA 4IUUA 2EYXA 2KY9A 1I5LA 2ZCFB 1VQOT 4LNPA 3RESA 3CXCP 2DIQA 1RABB 1I5OB 1OX8A 3REAB 4XTZA 4NL2A 2V8KA 1M3BA 3EHRA 3DLLA 1M9SA 3EH2A 1UGSB 3L2RA 4FL6A 4LUEA 1JJ2A 3L2UA 3JCMX 4LDVA 3JCMg 1PWTA 3H41A 1VQMA 3QZ9B 3M53A 3JCMJ 2PVOB 2NYSA 3FJ5A 2F2WA 1Q82R 2OI3A 1YWOA 2O4XB 1MNEA 2K3XA 2E70A 2A37A 2K5FA 2ZAEA 1VQLA 5DY9A 4XU3A 4J6YA 2XG8D 4PLLA 3JRZA 8ATCB 3VS4A 4M78A 5KCOA 3EG0A 1UDLA 3M0QA 2XDDA 1U06A 5GAN7 3RKXA 2QI2A 2ZPGB 2KT1A 1YI2A 1N8RR 3HHTB 4PJNA 2P0KA
chains in the Genus database with same CATH topology
1WHHA 2CP2A 2CP3A 1TXQA 1WHGA 4B6MA 2HKQB 3E2UA 2E3HA 1IXDA 2COWA 3RDVA 2COZA 2Z0WA 1TOVA 1WHLA 1WHMA 2CP7A 2HL5C 1WHKA 2HL3A 2M02A 2MPXC 2CP5A 1LPLA 2HKNA 2E4HA 2E3IA 2HQHA 2CP0A 2CP6A 1WHJA 3TQ7P 2QK0A 2COYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHH A;  2CP2 A;  2CP3 A;  1TXQ A;  1WHG A;  4B6M A;  2HKQ B;  3E2U A;  2E3H A;  1IXD A;  2COW A;  3RDV A;  2COZ A;  2Z0W A;  1TOV A;  1WHL A;  1WHM A;  2CP7 A;  2HL5 C;  1WHK A;  2HL3 A;  2M02 A;  2MPX C;  2CP5 A;  1LPL A;  2HKN A;  2E4H A;  2E3I A;  2HQH A;  2CP0 A;  2CP6 A;  1WHJ A;  3TQ7 P;  2QK0 A;  2COY A; 
#chains in the Genus database with same CATH topology
 3GPL A;  2L8D A;  1YCY A;  3OYA A;  1JO8 A;  2COZ A;  2CZ0 B;  3HFO A;  4KT0 E;  2EYY A;  3CPW P;  3OMC A;  4FSX A;  4C0D B;  2O88 A;  4BI4 A;  4MDW A;  2BZY A;  2MPX C;  4RTU A;  1WDX A;  5KYU B;  2H8H A;  3HRT A;  1N6A A;  4HXJ A;  4C5I A;  4M77 E;  5GAN 2;  2DTI A;  3CMA A;  2I2L A;  1HYO A;  3H9N A;  2GF7 A;  1NJI R;  1WLP B;  3QYH B;  4RG8 A;  2LP5 A;  3CCJ A;  3MHX A;  4J9C A;  3JCM e;  2DEQ A;  4V2S A;  1MHN A;  5CIU A;  4HCB A;  1NZ9 A;  1PKS A;  2JTM A;  4FYX B;  4F04 B;  2HAX A;  4BI3 A;  1QWF A;  1X2Q A;  3URG A;  1JJ2 P;  3FEO A;  1OQK A;  4O5V A;  3QXE B;  3VYG A;  7AT1 B;  2EYZ A;  3OS0 A;  3GP8 A;  3TEE A;  2MOX A;  2HL3 A;  2SEM A;  4PJO E;  4C8Q D;  4C92 B;  2AT1 B;  3OYL A;  1XTD A;  4E7Z A;  2FPD A;  2HEQ A;  1VQ4 T;  3M4G A;  2RM4 A;  3EFO B;  2VXE A;  2PQW A;  5ECA A;  1PM3 A;  3MP8 A;  4J9B A;  1WX6 A;  2LVM A;  2EJG A;  3JCM h;  1YJN Q;  1C1A A;  1VQ5 Q;  4N0A A;  1VQ8 A;  3EG1 A;  2KT8 A;  2JOY A;  2CZ1 B;  2EPD A;  3V7S A;  3BFM A;  1YN8 A;  4PJO G;  3SWN C;  1RLQ C;  2JTE A;  2X35 A;  4IIO A;  4EMK B;  4CI0 C;  1RAC B;  4J7I A;  3JCM V;  1OYX A;  1K76 A;  5KYY A;  1WXT A;  3TVT A;  3HKS A;  4JLI A;  2QEX Q;  1YJ9 A;  3DLM A;  5GAO p;  2DA9 A;  4FW1 A;  3E1S A;  4FYW B;  4Z02 A;  4AFS C;  1KC8 C;  4OB1 B;  1KC8 U;  4DBH A;  4N4G A;  1EX4 A;  2RI2 A;  1UE9 A;  1M90 U;  2C0I A;  1M2V A;  1HXD A;  2JS2 A;  2CP3 A;  1KQS S;  2X4J A;  2D8H A;  1K0X A;  9ATC B;  1BIB A;  1VIF A;  1VQM T;  4PNO A;  1KG1 A;  3GOX A;  4FCY A;  1GL5 A;  2DXB A;  4F7U F;  3VS7 A;  4ZTF A;  2FPF A;  2JM9 A;  3CCR A;  2M02 A;  4LDX A;  4XK8 E;  1FYN A;  1K1Z A;  4PJJ A;  2DEU A;  2RJE A;  4M77 B;  4LDW A;  4B6M A;  1VQL T;  2YSQ A;  2DXU A;  1EIF A;  3L2Z A;  4M7D B;  1D0Z A;  4C5E A;  2LC4 A;  4MZT A;  4ZN1 A;  1HD3 A;  2F2X A;  1KSW A;  4M4Z A;  1MV3 A;  2K79 A;  3QJ6 A;  3NTI A;  1YI2 T;  2PTK A;  2FVU A;  1MGQ A;  5GAN f;  2YLC A;  3JSC A;  2LCC A;  3KFV A;  3CC2 A;  2LTO A;  1BIA A;  5KE3 A;  3WXM B;  3C4S A;  4A4H A;  2QQS A;  1RAD B;  3FC3 A;  2O4X A;  2QQA A;  3VS1 A;  3I56 Q;  1P92 A;  4OMN A;  3MJX A;  1Y0M A;  2LCL A;  3M0T A;  5FW9 A;  1WXB A;  1U8R A;  1S72 Q;  2G3R A;  2P0P A;  2C0T A;  1K4U S;  3CD6 A;  4M78 D;  4PJO B;  2X4W A;  3OS2 A;  5HK3 A;  1NBE B;  2OAW A;  3CMA T;  2RMO A;  2AKL A;  1JXO A;  5J26 A;  4PJL A;  2DL8 A;  2LJ1 A;  5IHI A;  2F5K A;  5GAM j;  2OTL Q;  2VAS A;  1GRI A;  1WHG A;  1FMW A;  1YIJ Q;  2A36 A;  3PMI A;  1UJY A;  2L3R A;  1AVZ C;  3CCJ T;  3CCL Q;  3A5Z B;  1FMK A;  1K9A A;  4E7S A;  1WGS A;  3EFS A;  3I5R A;  1WJQ A;  3CCV Q;  1OOT A;  3P8H A;  2DJZ A;  3A8O B;  3ER0 A;  1Y96 A;  2KK4 A;  2QK0 A;  2JM8 A;  3X26 B;  1V76 A;  3MET A;  1QMC A;  2HNI A;  1XNI A;  2FPE A;  2JUF A;  3OW2 A;  4OP0 A;  3VS2 A;  2LDM A;  4KGX B;  3OYY A;  3OYN A;  2ROL A;  3DKM A;  2DL3 A;  2KSS A;  3PT9 A;  2HQH A;  2RQW A;  4M75 E;  3LWH A;  1VQN Q;  2ESW A;  2QA4 A;  2AIR B;  1SRM A;  2XI9 A;  4HVV A;  3M4Y A;  4AFU C;  5GAN 3;  1VQ8 T;  4X34 A;  5GAM d;  2RJD A;  1ZUU A;  3SEM A;  2D9T A;  4C8Q C;  2ENM A;  1VUB A;  1JEG A;  2FRW A;  3H8Z A;  2EQM A;  1PNJ A;  3O5Z A;  1X27 A;  2EAY A;  2HZY A;  1YIT A;  4C92 F;  2HQX A;  3EFO A;  1N9R A;  1BBZ A;  4PLI A;  3QHS A;  2MI6 A;  2YRC A;  3CPW S;  1YJ9 T;  2EQK A;  3G4S A;  5CK9 A;  5D6X A;  4QQG A;  3CCM Q;  2J05 A;  2LT1 A;  3FB9 A;  3QYG B;  3JCM b;  3V7R A;  3JB9 H;  3CBP A;  3MKD A;  3CBO A;  4NL3 A;  1JBM A;  5D7U A;  1RAA B;  4L59 A;  1RI9 A;  3JCM P;  5D6Y A;  4M7A F;  4Z8A A;  1LNX A;  4GLM A;  3RMS A;  2DF6 A;  2OTJ A;  3CCR T;  1WNL A;  4JLG A;  2M0Y A;  3FIF A;  3MO8 A;  2IG0 A;  3CC7 A;  3S3O A;  1PKT A;  4QT7 A;  1K9M C;  2RF0 A;  2RH2 A;  1K9M U;  1QW1 A;  4F7U E;  1Z9Z A;  3BW1 A;  1WI7 A;  4CC7 A;  4LD9 K;  1IGQ A;  4L5G A;  3SD4 A;  2CKK A;  4O6J A;  3FJP A;  3CC2 T;  3CME Q;  1GBQ A;  1SPK A;  3EGD A;  1G2B A;  2P4R A;  3OBY A;  5LJ5 f;  4M77 A;  1NLO C;  3JCM c;  2KEA A;  4JJB A;  1FXX A;  1X69 A;  4J9G A;  2GQV A;  3OBW A;  4OGC A;  4M77 F;  2AHJ B;  4F7U G;  3QG1 A;  1PSF A;  1AWO A;  5IHN A;  3CD6 T;  1J3T A;  1KC8 R;  1OU8 A;  2RNA A;  5GAN 8;  1K8A R;  1M90 R;  1QLY A;  1PD1 A;  4M7D F;  1JRI A;  4JDS A;  5I11 A;  4P5N A;  5A0L A;  1AEY A;  5HY6 A;  3E19 A;  4M75 B;  2XID A;  2NLU A;  4E2F B;  3NFC A;  4D6W A;  3G71 A;  1TOV A;  1W4S A;  4D8K A;  2CP7 A;  5EG2 A;  5FU7 C;  4AG2 C;  4BDY A;  2DVJ A;  1BCO A;  4J9H A;  2DD4 A;  4A53 A;  4HCZ A;  4PJO A;  4JZ3 A;  1N27 A;  4MDX A;  3JCM f;  1VQ6 Q;  1MMA A;  2WSE E;  1B3Q A;  2V1R A;  2MAM A;  3DB4 A;  4PJO F;  2IVW A;  4J6X A;  2LQ8 A;  3A98 A;  2H3E B;  4RKU E;  2L3S A;  1ZSZ B;  4BY6 B;  1VYV A;  2EGA A;  1TG0 A;  2D0N A;  2K2V A;  1YHQ A;  2JZ2 A;  1W6X A;  1H92 A;  2QA4 T;  1XJW B;  2EIF A;  3HPW A;  1R0C B;  2P0Q A;  4KUL A;  2FG0 A;  4DOV A;  2NUT B;  5CR2 A;  2FB7 A;  1O9S A;  3PTA A;  2R57 A;  3G6E A;  2JMC A;  3H0I A;  2DKG A;  2CUB A;  1YIT T;  4XTU A;  4B9X A;  2A7Y A;  1M8M A;  2ECZ A;  3P8B B;  2DVE A;  2KRO A;  4R0K A;  1M1K R;  4RTY A;  3G4S T;  3BY7 A;  3CC4 A;  2LT4 A;  3BDL A;  1R0B G;  4NOY A;  3IQL A;  1MV0 B;  4XU1 A;  2BE9 B;  2EGE A;  2OAU A;  1ZBX A;  4C92 E;  1Q95 G;  1IB8 A;  3GNG A;  4J9D A;  3EFR A;  2AKK A;  4E7J A;  3CEY A;  4GLK A;  3OYF A;  2KAF A;  2H3J A;  3OYG A;  1M3A A;  1VOM A;  4DA4 A;  2GTJ A;  2GBQ A;  5CKB A;  4KUI A;  2OTJ T;  3QDF A;  2DBK A;  1WHK A;  4EMG A;  4FW2 A;  2EKO A;  4BY6 C;  3CC7 T;  5IAY A;  2HDA A;  2QYZ A;  1HSQ A;  5LJ3 j;  4JJN K;  2QGF B;  3M58 A;  4N0A C;  1QVF A;  4M7A E;  3M0S A;  4C92 G;  3LWI A;  1I1J A;  4GBQ A;  3VS0 A;  1YJN A;  1U5S A;  3GIB A;  3VS6 A;  1KHC A;  1SHF A;  3QWY A;  1VQ5 A;  4RTV A;  5GAN 6;  3UT1 A;  2RA2 A;  2C06 A;  2YXY A;  1OV3 A;  1NYF A;  4AMC A;  2QQB A;  2K57 A;  3LH5 A;  1WYX A;  5LJ5 e;  1G3S A;  3KBG A;  2VV5 A;  4WCI A;  2NUP B;  4C5H A;  5GAO n;  2ZPH B;  2CSI A;  3G1J A;  1VQ7 Q;  1KJW A;  1X75 C;  2A28 A;  1NPR A;  4M7A G;  2QDL A;  2QEX A;  4XQ3 A;  2YHT A;  2DRK A;  3EHQ A;  5A2Q E;  4HCK A;  3OSV A;  3M0U A;  1TWB A;  1PSE A;  3FRN A;  4L6V 5;  1BI1 A;  2FZG B;  4QVC A;  1Q7Y C;  1XOV A;  3D7S B;  1Q81 C;  1Q81 U;  4DQ2 A;  5A0D A;  4CC2 A;  1UG1 A;  4WF2 A;  3G71 T;  4ELY C;  1QVG A;  3MPU B;  5LJ3 d;  5DLO A;  4M7D E;  3A8H B;  5I22 A;  2RK1 A;  4QQ6 A;  3CCE Q;  2DLP A;  2ZPF B;  2VC8 A;  5LJ5 h;  2DRM A;  2O9S A;  2QXF A;  3REB B;  2FEI A;  2PNI A;  2W0Z A;  4A4E A;  2CSQ A;  2J6F A;  2R5M A;  4M75 A;  1TXQ A;  5CQX A;  4M77 G;  3M55 A;  1VYU A;  3HP9 A;  5KE2 A;  1X43 A;  4ZNX A;  3MCA B;  4M75 F;  4RCC A;  3V8L A;  3M59 A;  1QVF P;  4M7D G;  2F69 A;  3M54 A;  3R6O A;  4OB3 B;  1RAF B;  4A4K A;  1YHQ T;  1TH7 A;  5IN1 A;  2DL4 A;  3I56 A;  4PJO D;  1OPL A;  3QII A;  3CCQ A;  2DET A;  2NWM A;  1U3O A;  1S72 A;  2YT6 A;  5D6W A;  2QAS A;  4BE2 A;  1T3S A;  1UB4 A;  2MYS A;  6AT1 B;  1ZSZ A;  4KH0 B;  3G6E T;  4XAX B;  2XDB A;  4BE1 A;  1VQM Q;  1OI1 A;  4C0D C;  2DYI A;  4ME7 A;  3VV0 A;  2A08 A;  5KYX B;  1YIJ A;  2DFU A;  2CP6 A;  4M7A B;  3TQ7 P;  3EAE A;  1VIE A;  3OS5 A;  3GNF B;  3CC4 T;  1UJ0 A;  1Z9Q A;  2W10 A;  4UC4 A;  2LNH B;  1AHJ B;  2K5I A;  2NUT A;  1KIK A;  4JRQ A;  3CCV A;  3QPH A;  3I5S A;  1X6O A;  1EZZ B;  2KBT A;  4OB2 B;  3LW5 E;  4PFZ A;  1QVG P;  1YI2 Q;  2RI5 A;  4ATO A;  4XTY A;  5IXB A;  4J7F A;  3BE3 A;  2DZC A;  4F7U A;  2JMA A;  1WIE A;  2EW3 A;  4II1 A;  3PE0 A;  2EQU A;  5FU6 B;  4LDY A;  5GAN j;  4XTV A;  2FO0 A;  4OMP A;  1YBY A;  2BZ8 A;  1VQN A;  2DL7 A;  3OY9 A;  1UEB A;  4C92 C;  4D8D A;  1YJN T;  4X9C A;  1VQ5 T;  1NYG A;  2YRV A;  3VYH B;  2KQW A;  1D1C A;  3FDR A;  2X4Y A;  1YJW A;  1O75 A;  3PVL A;  1AWW A;  1M1F A;  3UA7 A;  3L42 A;  4QVZ A;  1I81 A;  2BIV A;  4E6R A;  3KXT A;  2QDY B;  1YP5 A;  1AD5 A;  3OYE A;  2FZK B;  2ED0 A;  3VRZ A;  4OML A;  1KD1 C;  2LQW A;  1ABO A;  1D3B B;  1KD1 U;  4CC4 B;  2QEX T;  1FWZ A;  2CH4 W;  3OS1 A;  4M7A C;  4HT9 A;  4EDU A;  1SKU B;  3F70 A;  4EMK C;  1ZUK A;  4J8O A;  3AT1 B;  3CCM A;  1GXI E;  3M0P A;  2E6Z A;  1G3W A;  2JS0 A;  1IO6 A;  4RG2 A;  3OYC A;  3C0C A;  1W2B S;  1IHV A;  1ZX6 A;  2V1Q A;  1RI0 A;  1Q86 C;  2NUP A;  1PC0 A;  2MWO A;  1Q86 U;  1SRL A;  2RD1 A;  3MEU A;  5GAN d;  2HKQ B;  3JB9 F;  1ZA1 B;  4FYY B;  2F1L A;  5GMK j;  4MZP A;  4DBR A;  3I55 A;  1M5Q 1;  2WSC E;  2M9U A;  3VS5 A;  4PFO A;  1NEB A;  1VYT A;  2AZS A;  4JRK A;  1QVP A;  1SSF A;  2ZPI B;  2RPN A;  1TSF A;  5FU6 C;  3CXC S;  1GBR A;  4Z88 A;  3KUF A;  1YFN A;  5KYU A;  5KH6 A;  1M4Z A;  2CP0 A;  1LVK A;  4ESR A;  3CBM A;  3A8G B;  2L5Q A;  2M51 A;  1BU1 A;  4F16 A;  2EGC A;  2FZC B;  5CAI A;  4M77 C;  4LE9 A;  2R5A A;  4DEY A;  3CCS Q;  2KR3 A;  2Y4Y A;  3EG3 A;  5A0G A;  1WHL A;  1BI0 A;  4JRP A;  2KVQ G;  2ZPE B;  1YCS B;  2K5L A;  2HL5 C;  4M7D C;  1YNZ A;  2JJ9 A;  2L3P A;  3QKJ A;  4KH1 B;  1N5Z A;  3I56 T;  4FT2 A;  2NUZ A;  2E5K A;  2OJ2 A;  3CCQ T;  1M8V A;  2DZ9 A;  4LDU A;  2K6D A;  1S72 T;  4OMM A;  3UA6 A;  2LQN A;  2P4T A;  1X2K A;  1VA7 A;  2ZZD A;  2EQJ A;  1LCK A;  2RB6 A;  2CP5 A;  1YIJ T;  2AZV A;  2KRM A;  4C92 A;  3CCR Q;  3PVQ A;  4PJO C;  1K73 C;  2KDS A;  1OX9 A;  2COY A;  4BUG A;  1Q82 C;  1K73 U;  2ZPB B;  2ED1 A;  1B07 A;  2KNB B;  3M57 A;  1WJS A;  2ZGW A;  4M75 G;  4FT4 A;  3CCV T;  2V26 A;  1SG5 A;  2V8I A;  4FIB A;  1VQ6 A;  3UAT A;  2JVV A;  2WSF E;  1E6G A;  4RTX A;  2JXB A;  1C6V X;  2E3I A;  5KYX A;  1VQP Q;  1N8R C;  4M7A A;  1ZSG A;  4EMK A;  1QQJ A;  1VQK A;  2ROT A;  1H8K A;  1WHM A;  2HSP A;  1NE8 A;  1U1S A;  1KQS A;  2E12 A;  2YUN A;  3UWN A;  3OA6 A;  2VYT A;  2WAC A;  1VQN T;  4J9F A;  1IRX A;  1JU5 C;  3QZ5 B;  5CQY A;  1BI3 A;  1NEG A;  1RAH B;  2HQE A;  2DXT A;  2K4Y A;  4J5Y A;  3OW2 P;  1JJ2 S;  2MMP A;  4Y28 E;  2CZ6 B;  2A3L A;  2DMO A;  3INZ A;  1YJW T;  3RDV A;  4M78 B;  1NJI C;  1B34 B;  2X3W D;  1NJI U;  5GAO m;  1F1B B;  1VQ9 Q;  1NM7 A;  1FX7 A;  2KYB A;  3GLX A;  2DYB A;  4B9W A;  5GAM g;  1BKB A;  3HTR A;  3C95 A;  3CCU A;  2GFA A;  2Y4X A;  3OYK A;  1IRE B;  3CCM T;  1D0Y A;  4M7D A;  2K3Y A;  4BB7 A;  3MP1 A;  2CT4 A;  2E6N A;  5HCK A;  4JRI A;  3M9Q A;  2RHZ A;  4KBM B;  2GQI A;  2RJC A;  2MCN A;  2HBP A;  2PUK B;  2VB6 A;  2O31 A;  1AWX A;  1QCF A;  2HD0 A;  1D1A A;  4VUB A;  1AWJ A;  4KGZ B;  3I55 T;  4A54 A;  4PFP A;  4OGE A;  2QA4 Q;  1G8X A;  2LNV A;  2DK3 A;  2RN8 A;  5KCH A;  5GAO l;  2KXD A;  2HBW A;  1B7T A;  1QVG S;  1TUD A;  1XQH A;  3RNJ A;  4E7L A;  1CKA A;  1KQS P;  2L89 A;  1YIT Q;  3OB9 A;  3M0R A;  5DM7 R;  2YDL A;  1AZE A;  1TUC A;  2RQR A;  3G4S Q;  4PL6 A;  2CUD A;  2DIG A;  2GGR A;  1UGR B;  1KK7 A;  3J7A F;  2E64 A;  1GCP A;  2DNU A;  2GFU A;  2HKN A;  5FRO A;  4AFQ C;  4EMH A;  1KD1 R;  1VQ7 A;  2EFI A;  4J6W A;  3MEW A;  2VWF A;  4C0Z A;  4WTO B;  3JB9 G;  1H3H A;  2CP2 A;  2HCK A;  4DEX A;  4IUR A;  1VQO Q;  4JPB W;  3JCM d;  1OU9 A;  4BDZ A;  3LX7 A;  1QKX A;  2M0O A;  3J81 E;  2DO3 A;  3PNW C;  4FU6 A;  2XIC A;  2X3X D;  4JUV A;  3V8K A;  1CSK A;  4JJC A;  3MP6 A;  1Y57 A;  2LQK A;  2E4H A;  2JN0 A;  4LXC A;  2DD5 A;  2LJ3 A;  4AG1 C;  1Y7X A;  3RMQ A;  1I0C A;  2YUP A;  3CCE A;  3RBB B;  4XU0 A;  5KYY B;  4M75 C;  4E7H A;  1NG2 A;  2D1X A;  5GAO q;  1QKW A;  1VQ6 T;  4DBQ A;  3V8J A;  1SF9 A;  2L3Q A;  4R55 A;  3CPW A;  5GAM h;  2BZX A;  2J6O A;  3NMZ C;  4JZ4 A;  2D8J A;  2EQI A;  4C92 D;  3OYJ A;  1D09 B;  3CPF A;  3JB9 J;  2O2O A;  4DOW A;  1M30 A;  2EWN A;  1VQK T;  2L2P A;  5CKE A;  1IHW A;  2CYZ B;  4ZN3 A;  3JV3 A;  2QG9 B;  4HA8 A;  4XTW A;  1MMG A;  2YWW A;  3H0F A;  5CKH A;  1K0S A;  2EBP A;  2PU9 B;  1ZSZ C;  1GCQ A;  3OYI A;  4IKF A;  1UUE A;  2DX1 A;  2IIM A;  2BKD N;  1G5V A;  4IUT A;  4M7A D;  1Y71 A;  2JW4 A;  2LJ0 A;  3Q1J A;  2RHY A;  2EKH A;  1ARK A;  4E47 A;  1QCO A;  2B8A A;  1KHI A;  3G71 Q;  3LLR A;  1H64 1;  4QVD A;  3CCU T;  1WA7 A;  2ABL A;  2M16 A;  1QWE A;  4YTL A;  1K73 R;  2K2M A;  3A1P A;  1OUL A;  3VJP A;  3NGP A;  2PVD B;  5AYF A;  3N5B B;  4IUQ A;  1SHG A;  3WVE B;  2BUD A;  1KQ2 A;  3SFM A;  1FMV A;  1OZ2 A;  1B34 A;  1UTI A;  5L23 A;  2E41 A;  5IH2 A;  5LJ3 f;  4KGV B;  4M78 F;  1Q7Y U;  2GTO A;  4QKU A;  1YHQ Q;  1BYM A;  4MZM A;  3L2W A;  4M77 D;  2E3H A;  4Y91 A;  3NTK A;  2Z0W A;  1WQ7 A;  5IHK A;  2RO0 A;  2RI3 A;  1BI2 A;  3NHN A;  1VQ4 Q;  4QQD A;  2MWP A;  1X6G A;  4RUG A;  1ZA2 B;  1UGV A;  4M7D D;  1V1C A;  1WZO A;  4RMO A;  3SWN B;  2X9H A;  2QGG A;  1D0X A;  4KUD K;  1K9M R;  2DTH A;  5KYW B;  1Y96 B;  3G6E Q;  3I35 A;  4PJM A;  2JNG A;  1RAI B;  3PIP A;  5I21 A;  4ZGD B;  1M2O A;  2GNC A;  3CC4 Q;  1OPK A;  3V7C A;  4MMK A;  1C0M A;  1I4K 1;  2XDP A;  3O8V A;  4EIK A;  1JQQ A;  1ZBJ A;  3OMG A;  1VQ7 T;  1JB0 E;  3QSU A;  2BE7 D;  2K7A A;  3OW2 S;  3EG2 A;  3CQT A;  2KMT A;  4TVR A;  5CKD A;  2DXC A;  3E9F A;  3X28 B;  1JXM A;  5AT1 B;  3ZL7 C;  3LYI A;  3M5A A;  4HT8 A;  2R58 A;  4C8Q E;  3U23 A;  4OMF B;  2RQT A;  1HJD A;  2KXC A;  5GJV B;  2EJ9 A;  1X6B A;  1R77 A;  2OTL A;  2KYM A;  1CKB A;  5L8R E;  2M1H A;  2LX7 A;  2ATC B;  3CCE T;  1IZ6 A;  4IUP A;  3CCL A;  4GY5 A;  1G3T A;  1VQL Q;  5HKC A;  3OSS C;  5LJ3 g;  2EJF A;  2LMJ A;  1GFC A;  4C8Q G;  3L2Q A;  4JS4 A;  3ME9 A;  3HL8 A;  2E5Q A;  4FSS A;  3PGG A;  4N4H A;  4Q5W A;  1X01 A;  3CCS A;  1S1N A;  4A4G A;  1GFD A;  1H3Z A;  1IXD A;  2RJF A;  5IT9 E;  2CDT A;  4HVU A;  2LCS A;  1A0N B;  2X4X A;  1UGP B;  3JAM E;  1UHC A;  3RUX A;  1N9S A;  2YUO A;  2LX9 A;  1LPL A;  1R8O B;  1ZQ1 A;  2SRC A;  1K8A C;  1M90 C;  2MF2 A;  2VXF A;  2Y90 A;  1UFF A;  3VKI A;  1K8A U;  4CC3 A;  4Y92 A;  5FWB A;  3R6N A;  2KGT A;  5KYN A;  3CMA Q;  1NLP C;  5FWC A;  4X9D A;  2OX7 A;  2VGN A;  3SB2 A;  2XD0 A;  3ZEH A;  1HK9 A;  3JCM W;  2DE0 X;  3UPU A;  2PZ1 A;  1AZG B;  5C6S A;  4LD6 A;  1G3Y A;  3QJY A;  3LGL A;  3CCJ Q;  3EGD B;  3MEA A;  1WHJ A;  4KRT A;  1NPP A;  4BI8 B;  2VUB A;  3G7Z A;  2J7I A;  4CRI A;  3J80 E;  5DLQ E;  1W70 A;  3I9Q A;  1SEM A;  2CRE A;  2QAZ A;  4AT1 B;  1QCN A;  2KRN A;  3L1A A;  1VQP A;  2DJQ A;  5LJ3 e;  3OQ5 A;  4C0G A;  3PMT A;  3PIO A;  3EH1 A;  2KRS A;  4HCC A;  3EGX B;  3VS3 A;  3S3M A;  1OZ3 A;  3HRU A;  3QWX X;  3CCQ Q;  3TSW A;  2XK0 A;  4M78 E;  4C8Q B;  2O01 E;  2K9G A;  1PCX A;  1T3L A;  4LN2 A;  5GMK m;  2QTX A;  1I8F A;  4MML A;  2PVG B;  2QTV A;  3QDR B;  3VRY A;  1VQ8 Q;  1BB9 A;  4J83 A;  1M1K C;  2DAQ A;  3C12 A;  1VQ9 A;  1M1K U;  1QP3 A;  2D0Q B;  4E7I A;  1RAG B;  5LJ3 h;  3RER A;  1RLP C;  3TRE A;  4N4I A;  3CME A;  2RK2 A;  5CO7 A;  4ORZ A;  4M78 G;  3SWN A;  1YJ9 Q;  1PHT A;  2HMA A;  3X24 B;  5GMK i;  4ZGE B;  5KYW A;  2KE9 A;  2E1H A;  3HFN A;  1PG5 B;  4BAC A;  4A63 B;  1M27 C;  2E65 A;  5GAM f;  2CH4 A;  2FHD A;  5FLX E;  4M75 D;  4IIM A;  2F2V A;  3QBY A;  1RL2 A;  3BDU A;  5GMK l;  2BTT A;  2F5T X;  5GAN 5;  1V29 B;  2P84 A;  2IPO B;  3VUB A;  1Q7Y R;  2OTL T;  1RUW A;  4RTW A;  5GAN 4;  1Q81 R;  4K11 A;  1W1F A;  3A8L B;  3S6W A;  1E7O A;  4ELZ C;  3ZBD A;  1ZHI A;  4HKE A;  1ACM B;  3UDC A;  3CCL T;  4PK4 A;  3EG9 B;  1WXU A;  2D6F A;  3E2U A;  4C5G A;  4A4F A;  1Q82 U;  4JS5 A;  2DM1 A;  1WPY A;  1BCM A;  2J6K A;  2VKN A;  3OYM A;  5GAN g;  1RAE B;  5GJW B;  1LJO A;  2HSE B;  4PKC C;  1UGQ B;  1YJW Q;  3VU3 C;  5GAO r;  2EVR A;  1WFW A;  1ABQ A;  3LH0 A;  2RQV A;  1DJ7 B;  2QQR A;  5J39 A;  2CZ7 B;  2RQU A;  4AFZ C;  1WQW A;  4RCB A;  2DPP B;  3CCS T;  2VVK A;  2RHI A;  4R56 A;  2O9V A;  2PUO B;  8AT1 B;  2YRD A;  3CC2 Q;  1N8R U;  3T9N A;  1KFZ A;  2EYQ A;  1UHF A;  1T0J A;  2CS7 A;  2JT4 A;  5M9O A;  3P8D A;  5CKF A;  5EC7 A;  3HRS A;  3QUI A;  1BK2 A;  4C0F A;  3ZFJ A;  1YWP A;  3UF4 A;  2G6F X;  1VQO A;  3CD6 Q;  2MIO A;  5LJ5 j;  1MMD A;  3AHU A;  1WHH A;  1PD0 A;  5FU7 B;  5CVI A;  1M3C A;  2AK5 A;  1U1T A;  3SDZ A;  5IXF A;  1TUG B;  4XU2 A;  3RR6 A;  3I55 Q;  1QVF S;  2DER A;  2A0F B;  2V8J A;  3JCM Q;  3PFS A;  2QQ9 A;  4OMO A;  2JTF A;  1AT1 B;  2KI7 A;  3RKY A;  4EPC A;  3RKW A;  2XU8 A;  1VQP T;  5GAN e;  4J9E A;  2GCX A;  4OB0 B;  3JB9 I;  4LUD A;  2FL7 A;  4ZTJ A;  4QW2 A;  1GCQ C;  5LL6 S;  1TS9 A;  4FYV B;  3NTH A;  1D3B A;  1W2B A;  3OYB A;  3LGF A;  2COW A;  1AOJ A;  1SSH A;  5LJ5 d;  1OEB A;  1D1B A;  2YLB A;  3TSZ A;  2L0A A;  5C0M A;  2XHC A;  4J9I A;  2E10 A;  2XKO C;  4RTZ A;  2CT3 A;  4IUV A;  4Z89 A;  3H0H A;  2DBM A;  3WVD B;  3JB9 D;  3E9G A;  3EGX A;  3SHW A;  3CXC A;  1VQ9 T;  1PRM C;  2DL5 A;  1WJR A;  1M1G A;  5GAN h;  4X1V A;  3CME T;  4C8Q A;  3HSB A;  4ANJ A;  4BE0 A;  3TCJ A;  4M78 C;  4OVA A;  4XTX A;  2B86 A;  4BD3 A;  4ZGJ B;  3L2V A;  4C8Q F;  2DIL A;  2FYK A;  2RHX A;  3VUZ A;  1MND A;  5GAM e;  1G83 A;  1MUZ A;  1ZUY A;  2LZ6 B;  1PRL C;  4NS5 A;  4RTT A;  4FM4 B;  5GMK e;  2XMF A;  1MMN A;  5FRN A;  4F14 A;  1I07 A;  3DB3 A;  3H6Z A;  2K3B A;  2MK5 A;  3X25 B;  3ULR B;  1VQK Q;  2CGH A;  3A8M B;  2EYW A;  2VGM A;  1EFN A;  3NPF A;  2YUQ A;  2OTJ Q;  3TU4 K;  4F17 A;  3QO3 A;  1Y07 A;  1Q86 R;  3EGU A;  5CCA A;  1TU0 B;  2LRQ A;  2RHU A;  3CC7 Q;  1KQ1 A;  3ASK A;  4JJD A;  4OMQ A;  5I2M A;  1IGU A;  1VQ4 A;  2DTO A;  3FLG A;  5HK0 A;  1E6H A;  1QP2 A;  1LOJ A;  2X51 A;  3THK A;  3MEV A;  5LJ5 g;  3GF5 A;  3C94 A;  1UEC A;  5J3B A;  3M56 A;  2I0N A;  1W2B P;  4E7K A;  4HVW A;  4OF1 A;  5GMK h;  1M2V B;  3CCU Q;  5I2S A;  1T0H A;  2C0O A;  2FRY A;  3X20 B;  3OYD A;  4F7U B;  3EG9 A;  3OYH A;  3RIR A;  4DBF A;  3S3N A;  2J06 A;  5FRM A;  1ZLM A;  1TTH B;  3GBQ A;  4IUU A;  2EYX A;  2KY9 A;  1I5L A;  2ZCF B;  1VQO T;  4LNP A;  3RES A;  3CXC P;  2DIQ A;  1RAB B;  1I5O B;  1OX8 A;  3REA B;  4XTZ A;  4NL2 A;  2V8K A;  1M3B A;  3EHR A;  3DLL A;  1M9S A;  3EH2 A;  1UGS B;  3L2R A;  4FL6 A;  4LUE A;  1JJ2 A;  3L2U A;  3JCM X;  4LDV A;  3JCM g;  1PWT A;  3H41 A;  1VQM A;  3QZ9 B;  3M53 A;  3JCM J;  2PVO B;  2NYS A;  3FJ5 A;  2F2W A;  1Q82 R;  2OI3 A;  1YWO A;  2O4X B;  1MNE A;  2K3X A;  2E70 A;  2A37 A;  2K5F A;  2ZAE A;  1VQL A;  5DY9 A;  4XU3 A;  4J6Y A;  2XG8 D;  4PLL A;  3JRZ A;  8ATC B;  3VS4 A;  4M78 A;  5KCO A;  3EG0 A;  1UDL A;  3M0Q A;  2XDD A;  1U06 A;  5GAN 7;  3RKX A;  2QI2 A;  2ZPG B;  2KT1 A;  1YI2 A;  1N8R R;  3HHT B;  4PJN A;  2P0K A; 
#chains in the Genus database with same CATH homology
 1WHH A;  2CP2 A;  2CP3 A;  1TXQ A;  1WHG A;  4B6M A;  2HKQ B;  3E2U A;  2E3H A;  1IXD A;  2COW A;  3RDV A;  2COZ A;  2Z0W A;  1TOV A;  1WHL A;  1WHM A;  2CP7 A;  2HL5 C;  1WHK A;  2HL3 A;  2M02 A;  2MPX C;  2CP5 A;  1LPL A;  2HKN A;  2E4H A;  2E3I A;  2HQH A;  2CP0 A;  2CP6 A;  1WHJ A;  3TQ7 P;  2QK0 A;  2COY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...