1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
1IO6A 2H8HA 2DM1A 4Y92A 2K6DA 2KT1A 4DEYA 1PRLC 2KRSA 5GJVB 4D8KA 2KE9A 2ROTA 3EHQA 3PE0A 1RI9A 1AZEA 1GFDA 1GCPA 4OMNA 1T3LA 2EGCA 5HCKA 2L3QA 2OAWA 1WXTA 1JQQA 4GBQA 4AFUC 2J7IA 2V1RA 2JMCA 4E6RA 4CC3A 3H0FA 2RQUA 2CT3A 2DBMA 3UA6A 1ARKA 3EG0A 3TSZA 5EC7A 1WXBA 1AEYA 4LUDA 1K0SA 2EQIA 2KRNA 2KBTA 1OEBA 2DLPA 2GNCA 2FRYA 3UATA 1V1CA 3M0RA 3I5SA 4R0KA 2KYBA 2CH4A 3R6NA 2BTTA 2JT4A 2EYZA 2KGTA 2DX1A 1GBQA 2J6FA 1B3QA 2RQTA 5IHKA 2MIOA 3QWXX 1M8MA 1UGVA 1TUCA 2KNBB 3FJ5A 2EGEA 2O9VA 1RUWA 2JS0A 2GTOA 2K7AA 1KSWA 2KROA 2M51A 1SHGA 2DJQA 2MOXA 1G83A 2C0OA 2HEQA 4J9EA 2DNUA 1T0HA 3QWYA 1UFFA 1B07A 1K1ZA 1UHFA 1JXOA 2ABLA 4OMLA 1UTIA 2F2WA 2JW4A 1AWJA 1ZX6A 1K9AA 2D0NA 2YDLA 1ZUUA 2DA9A 1CSKA 2YUQA 2A37A 1QLYA 2JXBA 3VRZA 3PVQA 4JJCA 3IQLA 4J9DA 2J06A 1T3SA 2BZYA 1N5ZA 2X3WD 4Z89A 3VS2A 4WCIA 3KFVA 1AWWA 2EKHA 5GJWB 4J9IA 2CSQA 4AG2C 2PZ1A 2LJ1A 2LCSA 2FPDA 3VS6A 3H41A 1GCQA 2EGAA 3EHRA 3VS1A 2FG0A 2YSQA 1PRMC 2EYXA 5IXFA 4LN2A 1NYFA 1Y57A 2RN8A 5I11A 1X6GA 1QWEA 2MCNA 4AFZC 3EG2A 1M30A 1E7OA 2LQNA 3PVLA 1MV0B 1GRIA 3M0TA 1M3AA 2BZ8A 3M0PA 2W10A 1M3CA 2K9GA 2RQVA 2PTKA 1QWFA 2SRCA 3RNJA 1RLPC 3M0UA 2AK5A 4OMOA 5FWBA 1SSHA 1SEMA 2HCKA 1JEGA 4OMPA 1MV3A 5L23A 1OPKA 1PKSA 2EBPA 1AWOA 1BBZA 2JM9A 1JU5C 4HVWA 1OV3A 2ED1A 4IIMA 3UF4A 4RUGA 1VYVA 2DL5A 4M4ZA 3NPFA 4J9GA 4EIKA 2GTJA 2CUDA 1A0NB 2AZSA 2AKKA 1U06A 1WYXA 2DMOA 3VS0A 4DEXA 2AZVA 1E6HA 2YUPA 2DL8A 1AD5A 1GCQC 3M0QA 1FMKA 3H0IA 1ZSGA 4D8DA 2ESWA 2QDLA 1HSQA 4F17A 4J9CA 2DL7A 3VRYA 4IIOA 2NWMA 4GLMA 4X1VA 4CC2A 2LJ3A 3ULRB 2LZ6B 2JM8A 1I0CA 1WX6A 2L2PA 1X2KA 3EGUA 2JS2A 4J9FA 4RTVA 2HSPA 1VA7A 2LJ0A 4RTUA 1ZUKA 2OJ2A 4Z88A 4CC4B 2ECZA 1UE9A 1UHCA 2LQWA 2C0TA 2RNAA 5IXBA 2YUOA 1CKAA 3ZL7C 4AFQC 4JZ3A 3RBBB 2K2MA 2LNHB 2KXDA 2DVJA 1CKBA 3I9QA 1LCKA 1TG0A 3REBB 2O88A 1ABOA 3M0SA 1H3HA 2FEIA 2IIMA 1WFWA 2A08A 1YN8A 2BZXA 1PNJA 2O2OA 2DL3A 2A28A 1YCSB 2XMFA 2HDAA 4HXJA 1M3BA 1SHFA 3CQTA 4OMMA 3O5ZA 4JZ4A 4JJDA 1T0JA 1M27C 2L3SA 2DF6A 2FO0A 2D1XA 4HVVA 2LMJA 1K4US 1G2BA 1ZBJA 5FW9A 1ABQA 2D8HA 2LX7A 2K79A 3UA7A 2O31A 1Y0MA 2DE0X 1VYUA 1W6XA 2M0YA 1EFNA 2L0AA 1KJWA 2EW3A 1YWOA 1ZUYA 3U23A 4QT7A 1GBRA 2EVRA 4J9HA 3I35A 2AKLA 2DL4A 3GBQA 4JJBA 1BU1A 1QCFA 1NG2A 2P4RA 3H0HA 4RTYA 3VS3A 1I07A 2VWFA 2RQWA 3LH5A 1H8KA 1UJYA 2GQIA 3TSWA 1XOVA 3VS7A 2A36A 2KR3A 3EG1A 1RLQC 1JXMA 1YWPA 1NEGA 1SPKA 1X6BA 1OOTA 1UG1A 2GGRA 2ENMA 2YT6A 1S1NA 5IHIA 3JV3A 5ECAA 2YUNA 2KYMA 2J6KA 1BK2A 2L3PA 2ROLA 2RPNA 1WI7A 5I22A 2FRWA 1HJDA 2I0NA 3SEMA 3NHNA 4AG1C 3A98A 1UDLA 4ORZA 2RMOA 1SRLA 2CSIA 1AZGB 1YNZA 4K11A 1KIKA 1NM7A 4Z8AA 4JPBW 3NMZC 1NLOC 1WA7A 2OI3A 4LE9A 2C0IA 1NYGA 2EPDA 1W70A 4ESRA 2E5KA 3I5RA 2EYYA 1BB9A 2DRKA 1TUDA 2SEMA 4A63B 2RF0A 2V1QA 1AOJA 2X3XD 1U5SA 1E6GA 2CH4W 2CREA 4AFSC 1X43A 4HVUA 2KRMA 2ED0A 1X2QA 1K76A 2J6OA 4CC7A 3VS5A 2FPEA 2PNIA 2W0ZA 1UECA 2DBKA 2G6FX 2KT8A 2D8JA 1GL5A 1W1FA 4LNPA 2CT4A 2RQRA 1NEBA 3THKA 2VVKA 1PWTA 1AWXA 2DILA 1WDXA 1WLPB 4F16A 2KEAA 1UJ0A 4KRTA 1ZLMA 1H92A 1QKWA 2JTEA 5IHNA 2VKNA 1QKXA 1Z9ZA 2F2XA 3EG3A 4RTWA 3TVTA 2JMAA 2DRMA 5IH2A 2HBWA 1X69A 4J9BA 1WIEA 2CUBA 4HCKA 1NLPC 1U3OA 4RTXA 3C0CA 2O9SA 3SHWA 1I1JA 1K0XA 1WXUA 3VS4A 1Z9QA 2KXCA 1UUEA 2NUZA 1FYNA 2CDTA 4OMQA 5FWCA 1HD3A 4F14A 1PHTA 1X27A 2B86A 1OPLA 4FSSA 1J3TA 1SRMA 3NGPA 4RTTA 4LUEA 1MUZA 1YP5A 3REAB 4RTZA 1PKTA 2EYWA 4ZNXA 1VYTA 1AVZC 2F2VA 2K3BA 2FPFA 1KFZA 2GBQA 2LP5A 2J05A 1JO8A 1GFCA 2DYBA
chains in the Genus database with same CATH superfamily
3L2QA 2E1HA 5FRNA 1PRLC 3TQ7P 2KE9A 2ROTA 5GMKj 1QVFP 4BY6B 5HCKA 1T3LA 1Y71A 1QMCA 5GAMd 4BACA 4PNOA 1WXTA 4GBQA 3CXCA 2DXCA 5CKEA 4ANJA 2J7IA 2RHUA 4ME7A 1G5VA 4E6RA 2DXTA 2IPOB 2RQUA 1VQ7T 3EG0A 3TSZA 2VGNA 3NFCA 4LUDA 2V8IA 3CCQT 1AEYA 2Z0WA 4Q5WA 4PJOC 3META 3G1JA 2KBTA 1TU0B 1ZA2B 2X4JA 3RERA 2YHTA 2RM4A 5KYXB 2HQHA 2EYZA 1D0YA 4C92D 2J6FA 5A0GA 3HFOA 2RQTA 1I81A 3QWXX 1M8MA 2JZ2A 4QQGA 1NJIR 1BI2A 1WGSA 2AT1B 3VYGA 3C4SA 1YHQT 1PM3A 2ZPBB 2EGEA 3FJ5A 5CQXA 4E7ZA 4FT2A 5CO7A 1RUWA 2JS0A 2K3YA 4ELYC 1VQNA 2GTOA 3FRNA 4MDXA 4M75F 5GANe 2C0OA 4JRKA 2P4TA 4M78D 3FEOA 1K1ZA 1UHFA 4OB2B 2ABLA 3P8BB 5HK3A 1K9AA 3HRTA 1M4ZA 1M8VA 1KD1C 4M78C 1RI0A 1TH7A 2DPPB 2L5QA 4IKFA 2J06A 1T3SA 4PJOA 4OF1A 4KUIA 3FC3A 4E7HA 3G4ST 2XG8D 4WCIA 2JNGA 2L8DA 2H3EB 3PMTA 2VUBA 1WJRA 3JCMX 1OZ2A 3VS1A 2RJDA 4A53A 2VGMA 1R0CB 2FZCB 3D7SB 1O75A 1NYFA 2RN8A 3EGXA 3VYHB 1WHMA 1QWEA 1M30A 1E7OA 3VJPA 3M0TA 4F7UB 1M90U 5KYNA 4N4IA 5GAN5 2BZ8A 2W10A 1M3CA 2DTIA 1QWFA 3BW1A 4M78E 3M0UA 3EFOB 5FWBA 4F04B 3HFNA 3X20B 1JEGA 4X34A 1ZQ1A 3LW5E 2EBPA 4YTLA 5GAMg 1BBZA 2L3RA 4HKEA 4LDWA 2Y4XA 1OV3A 2NUPA 3OS0A 2F5KA 2DL5A 2YRVA 3M57A 3NPFA 1KD1U 4XU0A 2AKKA 1VQ4T 2CGHA 5D6YA 3CCJQ 2DMOA 2X51A 1B34A 2IVWA 3M4YA 1ZSGA 2YRDA 3CCLA 1VQ4A 4UC4A 4HCBA 1GXIE 3A8LB 4BE0A 3TEEA 4J9CA 2ZZDA 1HXDA 1XQHA 4CC2A 4M77G 3CCET 1QVPA 1X2KA 8ATCB 3RUXA 3EGXB 2QA4A 2DXBA 3WVDB 4HCZA 2E10A 1K73R 2QAZA 2RNAA 1H641 2RJEA 2ZPFB 4E7IA 2HL3A 4JZ3A 1G3WA 1S72Q 1IHWA 2DIQA 2I2LA 1ABOA 1H3HA 4MZMA 4QKUA 5LJ3e 2FEIA 3EFSA 2DAQA 2OTJT 2QQAA 4PFPA 3JCMb 3URGA 2ZAEA 3QKJA 1LJOA 1PNJA 2ZCFB 1PD1A 4MMKA 5IAYA 5D7UA 2VYTA 1QCNA 3SWNA 4C8QA 2XMFA 2HDAA 4C0DB 3PTAA 1WZOA 5KYUA 3HRUA 1BI1A 3MCAB 1M1KU 5CKHA 4QVZA 1IGUA 2OX7A 1R77A 1BI3A 2DF6A 4RG8A 2FO0A 2D1XA 1D3BA 1OU8A 2NUTB 3G7ZA 4E7JA 2KQWA 1ABQA 3I56T 2OTJQ 3OYEA 5GMKl 1WQ7A 4BI4A 1ZSZA 2DE0X 1UGSB 1YWOA 2X35A 3CCMQ 1ZUYA 5GANh 4PJOB 4J9HA 2R57A 4XU1A 4E7KA 1M2OA 4JJBA 1BU1A 1PCXA 2RHYA 1OULA 2CZ0B 3JB9G 2VWFA 2RQWA 3N5BB 4LDUA 1UJYA 2GQIA 3EFRA 1YJ9T 3S6WA 1XOVA 1UGRB 4EMKA 2KVQG 1D3BB 4Y91A 3OB9A 2KR3A 3EG1A 3HPWA 1RLQC 4OP0A 1YJWT 5A0LA 1JXMA 1SPKA 3JCMh 2DEUA 2GGRA 2EQKA 5LJ3j 1AHJB 2ENMA 2YT6A 2KAFA 3LWIA 3QJ6A 2EAYA 5CCAA 3JV3A 5FU7C 1LNXA 3ER0A 3VU3C 4ZTJA 4M78A 4JJNK 2L3PA 3ZFJA 3JCMd 5GAN4 1Q81R 2CS7A 2GF7A 3A98A 1YJ9Q 3J7AF 4ORZA 4N4HA 2RMOA 1SRLA 2CSIA 4K11A 1KIKA 2RHIA 1NM7A 1VIEA 2VASA 3A8GB 2EYYA 3QYHB 2EQJA 2DKGA 1TUDA 2EKOA 1VQLA 3CBMA 4C92A 1Q95G 4Z02A 2V1QA 2ZGWA 1VQ9Q 1E6GA 3C95A 3EGDB 5FROA 4M7DC 1ACMB 1KC8U 1OX8A 2E65A 2KT8A 4QVCA 1GL5A 4N0AC 4A4HA 1M2VA 3THKA 4RMOA 1PWTA 3BFMA 4C8QD 5AT1B 4LD6A 1YITA 3OS5A 4F16A 4PJMA 2XKOC 2DERA 2AHJB 2V26A 4C0FA 1QKWA 3C12A 3JCMJ 1Z9ZA 2Y90A 2JMAA 4HT8A 4ZN3A 4PL6A 3DB3A 4ZGEB 1Q7YC 5GAOp 2CP0A 4C92G 4X9CA 3V8LA 1NLPC 3V8KA 3SHWA 3S3MA 1LPLA 3G71T 2K3XA 2M16A 5LJ5f 1Z9QA 2KXCA 3SD4A 3ZBDA 5I2SA 1FYNA 2CDTA 4OMQA 3QSUA 1SF9A 4F14A 1X27A 2B86A 4RTTA 3PT9A 3REAB 4M75B 3JCMQ 4WF2A 2EYQA 5LJ5h 4C5IA 3HSBA 1VQPQ 2LP5A 2J05A 5GJVB 3T9NA 3EGDA 1IO6A 2H8HA 1JB0E 4IUTA 4Y92A 5CQYA 2DD5A 4DEYA 2KT1A 4D8KA 2HL5C 1AZEA 1BIAA 5GAOm 1WJSA 4C92E 1VQPA 4F7UG 1K9MU 1Y96A 5J39A 2L3QA 4IURA 1U8RA 2MI6A 1K73C 2OAWA 4AFUC 1I5LA 2V1RA 4LXCA 4F7UF 1WHHA 1IXDA 4FW2A 1VQPT 2DBMA 4NOYA 1S72T 1KHIA 2QASA 3UT1A 1WXBA 5KYYA 4J7IA 1XTDA 2EQIA 4BD3A 3OYHA 1VQ4Q 1QVFS 3CCLQ 1OEBA 2GNCA 2EFIA 3UATA 3M0RA 2RI2A 3CBPA 4R0KA 2KYBA 3RIRA 1Q86U 3OYFA 5DLOA 4XAXB 2DX1A 1GBQA 4RG2A 1Y96B 1B3QA 1VUBA 2CZ7B 2K57A 2HD0A 1V76A 1ZSZC 4O5VA 1IZ6A 2HBPA 3X26B 4DBRA 2K7AA 1KSWA 2DTHA 2KROA 4BE1A 3DLMA 3TCJA 2XHCA 2HEQA 1WHGA 2JJ9A 1VQNQ 1RABB 1UFFA 2LX9A 3HRSA 1N9SA 1JXOA 1QQJA 3MEAA 2F2WA 3JCMc 2NUPB 1RAIB 2YLCA 2YDLA 2DA9A 1CSKA 2A37A 4JS4A 3CCMA 3JCMg 1EZZB 3IQLA 1TWBA 3P8DA 5KYWA 4J9DA 4PJOD 2CP2A 5J26A 1VQLQ 2BZYA 2DZ9A 4M75E 1N5ZA 2KI7A 4NL3A 3CD6Q 3CCUQ 1VQ6Q 4KULA 5CKBA 2WSFE 3CMAT 1Q82R 3CC4T 1JBMA 5GJWB 1VQ7A 3CPWS 2QDYB 3S3OA 2CSQA 4AG2C 2PZ1A 3L1AA 4JS5A 2DIGA 3VV0A 4XTZA 3M5AA 2EGAA 2QQ9A 2FG0A 2FYKA 4FYVB 3JCMf 3WXMB 1QP3A 3RKXA 5I11A 4LDXA 1X6GA 1QVGP 2VXEA 3PVLA 1MV0B 2MMPA 1KQ1A 3JB9J 2OAUA 2PVOB 3L2VA 1KQSA 2RQVA 3UDCA 1MMAA 2E3HA 2RI5A 3CC2T 5KH6A 2SRCA 3A5ZB 2AK5A 4FYYB 1IRXA 1Y07A 1YCYA 4J83A 4DBQA 1N6AA 2RK1A 2GQVA 2B8AA 4KUDK 3NTHA 5L23A 1OPKA 4M7AE 2E3IA 2JM9A 1SG5A 2ED1A 3PFSA 3UF4A 4RUGA 1VYVA 4KT0E 4M4ZA 3GIBA 3L2ZA 2GTJA 2CZ1B 2ZPEB 2AZSA 1FXXA 3VS0A 2EJGA 2QXFA 4F7UA 4MZPA 5LJ5e 2PUOB 3M0QA 1FMKA 1KQSP 3H0IA 1WHLA 3VUBA 1RAFB 2LC4A 2QDLA 3OYDA 2F1LA 2DL7A 3VRYA 3INZA 4A4KA 1Q82U 1Q7YR 5CKDA 3ULRB 5GAN3 1IHVA 2L2PA 2BIVA 4J9FA 4BY6C 2OJ2A 4Z88A 2HZYA 3MPUB 4CC4B 1UE9A 2C0TA 2LQWA 3EG9A 1JJ2S 4LDVA 2COZA 2YUOA 1R8OB 1CKAA 3CPFA 2AIRB 2LT1A 3RBBB 2KXDA 2DVJA 5GAMh 3I9QA 5A0DA 3JB9D 3RMQA 3OYBA 4FT4A 2IIMA 3G6EA 2KY9A 1N8RR 1RL2A 4NS5A 1YBYA 4IUQA 4C92C 2YXYA 2DL3A 2A28A 4BI3A 3CCRA 3CQTA 4M7DA 1YJNT 1K9MC 2FL7A 3O5ZA 4JZ4A 1FWZA 1M27C 1M5Q1 4HVVA 2LMJA 3MHXA 1MMGA 2LX7A 1D1AA 2K79A 1N8RC 1N9RA 2VXFA 2RJCA 4JLIA 1WHJA 1OU9A 1KJWA 4XU2A 4XU3A 3U23A 2QQBA 1BIBA 1K8AU 4CRIA 1GBRA 3MEWA 1OQKA 4WTOB 3GBQA 2DETA 3CC7Q 3CEYA 3SWNB 3E2UA 1M1GA 2XK0A 1YI2Q 4PLLA 5CAIA 3OYMA 3TSWA 2KMTA 1PSEA 1I8FA 1M2VB 2NUTA 3JAME 3FB9A 5GMKm 1YWPA 2QYZA 1NEGA 4BB7A 1X6BA 1OOTA 3M56A 1PD0A 1G3TA 3AT1B 4C0ZA 1U1SA 3I55T 3OSVA 3QO3A 4JUVA 1S1NA 2RH2A 1KC8R 2P0KA 1VQNT 1YI2T 3A8HB 2J6KA 1BK2A 2RPNA 4XTVA 1JRIA 1HJDA 2FRWA 4QQ6A 4JDSA 3SEMA 3NHNA 3OMGA 4FYXB 3CC4A 3HTRA 1UDLA 3KXTA 3I56Q 1AZGB 1D0XA 5FLXE 3LGFA 4Z8AA 2X4YA 3NMZC 1NLOC 4EMKB 1WA7A 1RAAB 3OS2A 1NYGA 2E5KA 3I5RA 4MZTA 3CD6T 1VQ5Q 1BB9A 2DRKA 2SEMA 4A63B 2BE7D 2QI2A 1SSFA 1AOJA 3MP6A 2X3XD 2CP6A 5GAOl 1Q7YU 2CREA 2P0QA 4CC7A 4HCCA 5LJ3f 2CP3A 2ATCB 2ZPIB 3L42A 3QZ9B 4C5HA 2E41A 3FJPA 3SFMA 1VQ8Q 5FU6C 1VQKT 1YI2A 2RQRA 1MGQA 2E6ZA 2XICA 1BKBA 5HKCA 3QYGB 4J5YA 3EH1A 1NJIU 3CCEA 2KEAA 3O8VA 1UJ0A 4KRTA 2LQKA 3E9FA 1VQKA 1PG5B 1QP2A 2DEQA 2NLUA 5IHNA 4BDZA 4KBMB 2F2XA 2DK3A 4RTWA 1Q81C 1VOMA 4MDWA 2HBWA 4JRPA 3RMSA 1VQ8T 1X69A 1D09B 1WIEA 1MHNA 4O6JA 3CPWP 4ZN1A 1N8RU 2O9SA 3GPLA 2XU8A 1I1JA 1KQSS 3CCEQ 1M1FA 4FCYA 4D6WA 3VS4A 2L89A 2DVEA 3HHTB 4M78G 1UUEA 3OS1A 2CP7A 2E6NA 2NUZA 5FWCA 4M7AB 3R6OA 1OPLA 3Q1JA 1J3TA 1SRMA 3NGPA 4LUEA 3MO8A 1YJWA 4E7SA 1PKTA 2EYWA 3KUFA 1AVZC 5D6WA 2F2VA 2K3BA 5GAOq 3CC2A 1JO8A 1GFCA 3QIIA 2DYBA 2QEXT 4DBFA 2XDDA 4XQ3A 2KRSA 3OYAA 3EHQA 3PE0A 3CC2Q 1GCPA 1G3SA 2EGCA 2YWWA 4KH0B 4N4GA 5KYWB 1JQQA 3GLXA 3P8HA 1MMDA 4M78B 4KGXB 3OYLA 4CC3A 4B9WA 2R5MA 4A4FA 4DBHA 1UGQB 3OYYA 1ARKA 3LLRA 1K0SA 5LJ3d 3QG1A 4B9XA 2KRNA 4OGEA 5LJ5g 3A1PA 3PGGA 1QW1A 1YFNA 2FRYA 4PJOG 2QGGA 2VV5A 3R6NA 2JT4A 2QQSA 3PIPA 1VQ9T 1I4K1 5C0MA 1KD1R 3VKIA 4DA4A 2CP5A 3X24B 5IHKA 4BDYA 3V7CA 2MIOA 1UGVA 1TUCA 5LJ5j 4M75D 3CXCS 3LGLA 3VUZA 5M9OA 2F5TX 4M77B 4M7AA 1LOJA 1I5OB 2M51A 2DZCA 1SHGA 2MOXA 1G83A 2RK2A 4V2SA 3DKMA 1T0HA 5FU7B 5GAN7 3CCVQ 2HQEA 2DO3A 4OMLA 1UTIA 2D0NA 1ZUUA 2YUQA 3GP8A 1OYXA 1QLYA 3I55A 2JXBA 2DFUA 3PVQA 3VRZA 4IUPA 2P0PA 1NJIC 1VQ5A 4LD9K 3X25B 4NL2A 3VS2A 3NTKA 3KFVA 1AWWA 4FYWB 4J9IA 3BY7A 2LJ1A 2LCSA 2FPDA 5GMKh 2C06A 3VS6A 3I56A 3H41A 2LVMA 1MNDA 3FDRA 3QDFA 1D0ZA 4BUGA 3HL8A 3H8ZA 3CCUA 1VQ6A 3CD6A 2YSQA 4LN2A 4TVRA 4M75A 5I21A 2VB6A 4AFZC 2MCNA 4DOVA 1O9SA 2MYSA 3M0PA 1X6OA 2RHZA 5GAOn 3PIOA 1RAGB 1TTHB 1D1CA 2K9GA 2PTKA 3X28B 4AMCA 4M77A 4DQ2A 1RLPC 2PUKB 3G71A 3OYNA 3CMEA 3LYIA 1YHQQ 1JU5C 4HVWA 4M7AD 1M9SA 4JLGA 1IREB 1TXQA 2K5FA 3CCMT 2CUDA 3RDVA 3A8OB 2JTFA 2JOYA 3DLLA 1U06A 4C5EA 4DEXA 1NE8A 1E6HA 2YUPA 1AD5A 2FZKB 2QQRA 5LJ3h 2OTLQ 1W2BA 1M90C 4D8DA 2ESWA 3OYCA 1HSQA 3CCRQ 3HKSA 3M59A 2M1HA 2VC8A 1QVFA 4P5NA 1NBEB 2NWMA 2HKQB 4X1VA 3QBYA 2LZ6B 2JM8A 5KCOA 1I0CA 1WX6A 3EGUA 1WQWA 2HSPA 2LJ0A 4RTUA 1DJ7B 1MNEA 1UHCA 4N0AA 2XI9A 2DYIA 3ZL7C 4AFQC 1ZBXA 3CCST 1VQ9A 1BCOA 1CKBA 5AYFA 2CKKA 1LCKA 3REBB 3M0SA 2RA2A 3V7RA 1AT1B 4PK4A 2A08A 5GAN2 1X75C 1YN8A 2BZXA 3OYGA 2QEXQ 1W4SA 3QUIA 1G3YA 2O2OA 4J6WA 1N27A 5CVIA 1VQOT 5GAN6 1YCSB 5GAOr 2E64A 4ZTFA 4M77D 4HXJA 1VQMQ 1M3BA 5EG2A 2ZPHB 1SHFA 3G4SA 3QZ5B 4OVAA 4OMMA 3SWNC 3PMIA 4C8QC 4M7AG 3JCMV 4JJDA 1TOVA 2KK4A 2L3SA 2RO0A 3EG9B 1K4US 1G2BA 2D8HA 1WNLA 2DJZA 1Y0MA 1VYUA 2M0YA 2L0AA 3E19A 1XJWB 3OYJA 4EDUA 2EVRA 2AKLA 1R0BG 5I2MA 2JTMA 1NG2A 2P4RA 4QW2A 3VS3A 1I07A 2BKDN 2XIDA 3QXEB 5LL6S 3OY9A 1BCMA 3LH5A 3EFOA 2V8KA 4M75G 3L2RA 1K8AC 3GNGA 5DM7R 5CIUA 2R5AA 3CMAA 1KK7A 2EQUA 3VS7A 4R55A 1PSFA 2A36A 5D6XA 2PVDB 4OB3B 4M7DE 3M9QA 1EIFA 1WJQA 1UG1A 2DD4A 1NPPA 1NPRA 2PVGB 4A54A 5ECAA 2YUNA 2OTJA 2FZGB 2MK5A 4FM4B 2ROLA 3ME9A 1WI7A 2I0NA 3CPWA 5CK9A 1YIJA 1TUGB 4C0GA 2YLBA 3G4SQ 5GAMj 1W2BP 2NYSA 1VQ7Q 4FSXA 1YJNA 3BDUA 1YIJQ 2E5QA 2ZPGB 5FU6B 2EPDA 4PLIA 4MMLA 1Y7XA 2QTVA 5KYXA 3EAEA 2MAMA 3GF5A 3HP9A 2LDMA 5C6SA 1U5SA 4M75C 4AFSC 2CH4W 4GY5A 1X43A 2ED0A 2H3JA 2HMAA 1K76A 2J6OA 3M54A 2BE9B 4R56A 2PNIA 2W0ZA 3JCMe 2QA4Q 2G6FX 8AT1B 2D8JA 4J6XA 5L8RE 1KG1A 2LCLA 3DB4A 4M7DD 2CT4A 1SKUB 3MJXA 1NEBA 4F7UE 2DILA 1AWXA 4OB1B 2LTOA 2O01E 1H92A 1QCOA 1ZLMA 2KSSA 3FIFA 1XNIA 1QKXA 2HNIA 3EG3A 5KE2A 1Q86C 2JUFA 3KBGA 2FB7A 1OZ3A 3OW2P 4DOWA 4OGCA 2QA4T 1C0MA 1JJ2P 4ATOA 1BI0A 3CBOA 2COWA 1RAEB 4J6YA 4C8QF 1JJ2A 4L59A 1K0XA 4E2FB 1WXUA 2RB6A 3RESA 1YHQA 5LJ5d 4C8QE 3CMEQ 1M90R 4CI0C 1Q86R 4M77F 1PHTA 1OX9A 1MUZA 1YP5A 4ZNXA 1VYTA 4M7DB 3MEVA 1PC0A 1KFZA 4KGVB 2EWNA 2O4XB 2DM1A 2R58A 2K6DA 1KC8C 2LCCA 1RI9A 1GFDA 4OMNA 6AT1B 2MWPA 4L5GA 2FVUA 2LRQA 3OQ5A 4QQDA 3RKYA 2XD0A 2EJFA 2D6FA 2GFAA 1ZHIA 1IGQA 3TREA 2JMCA 1YJNQ 3H0FA 2CT3A 3UA6A 5EC7A 1YITT 5FRMA 3NTIA 4ELZC 2XDPA 3MEUA 2LT4A 3JB9F 3M58A 2DLPA 2LNVA 1V1CA 3I5SA 4B6MA 2CH4A 2OTLT 2BTTA 2CZ6B 3SDZA 5KCHA 3CCJT 4XK8E 2KGTA 2JVVA 4FU6A 5DLQE 1YITQ 2BUDA 2KNBB 2D9TA 3CCUT 1VQ6T 2O9VA 3LH0A 3CMAQ 4M7AF 2PQWA 3F70A 2DJQA 5KYUB 3LWHA 3UPUA 4VUBA 1HYOA 4XTUA 4J9EA 2DNUA 3QWYA 4PKCC 1B07A 1QVGA 2QK0A 4RKUE 2JW4A 1AWJA 1ZX6A 4EPCA 4HT9A 3JB9I 2F69A 3JCMP 5GANd 4JJCA 4EMGA 2QGFB 2QG9B 1WHKA 1FX7A 3SB2A 4E47A 2X3WD 4Z89A 2MWOA 2EKHA 1U1TA 2V8JA 4XTWA 2FHDA 1KHCA 5KE3A 1VQ5T 1YJ9A 3E1SA 1GCQA 2HKNA 3EHRA 2E12A 3V8JA 4LDYA 2MPXC 2QEXA 1PRMC 2EYXA 5IXFA 1Y57A 5HK0A 5GMKe 1ZSZB 4PJOE 2A3LA 3EG2A 4M78F 5GAN8 3J81E 2LQNA 4EMKC 1ZA1B 4Y28E 3A8MB 1GRIA 4JRQA 1C1AA 1M3AA 3QPHA 5DY9A 4GLKA 2IG0A 3AHUA 1HK9A 1Q82C 3QJYA 3RNJA 5GANj 4OMOA 2X4WA 1BYMA 1SSHA 4ZGDB 1FMWA 1SEMA 2HCKA 4OMPA 2KDSA 1MV3A 1AWOA 1PKSA 3OBWA 5GANg 2WSEE 1KQ2A 4PFOA 4IIMA 1WPYA 1EX4A 1W2BS 4C92B 3CCQQ 3C94A 4J9GA 3TU4K 4EIKA 5IT9E 1A0NB 4AT1B 4IUUA 5CR2A 1WYXA 4C0DC 3JRZA 3LX7A 2AZVA 3S3NA 2DL8A 1GCQC 1C6VX 4OB0B 2O4XA 1VIFA 1TS9A 4FL6A 2EJ9A 5A2QE 2K2VA 4F17A 3H9NA 1TSFA 1VQMA 2K5IA 2M9UA 4L6V5 4IIOA 4GLMA 3BE3A 2GCXA 2LJ3A 1D1BA 1P92A 4HA8A 4KGZB 3G71Q 4RTVA 2JS2A 1VQ8A 3BDLA 4M77E 1VA7A 2E70A 2X9HA 3GNFB 1IB8A 4BE2A 2WACA 1ZUKA 4IUVA 4J7FA 2A7YA 2ECZA 1S72A 1LVKA 5IXBA 2X4XA 5LJ3g 2K2MA 2LNHB 5GMKi 4JRIA 1TG0A 2RD1A 3MP1A 1QVGS 2O88A 4FIBA 3PNWC 2WSCE 2CYZB 1WFWA 1YJWQ 3OSSC 2DTOA 2HQXA 3CC7T 5CKFA 2K4YA 4ZGJB 1V29B 3MP8A 5GAMe 3RKWA 4C8QG 2Y4YA 1T0JA 2P84A 1B34B 3OBYA 1ZBJA 5FW9A 2OTLA 1UB4A 2LQ8A 3UA7A 2O31A 3CCJA 1W6XA 1EFNA 4BI8B 2EW3A 3I55Q 3EH2A 4QT7A 3CXCP 3OMCA 4A4GA 3OW2S 3I35A 2G3RA 2DL4A 3OW2A 2EIFA 1RADB 1QCFA 3CMET 4RTYA 3H0HA 2XDBA 3H6ZA 1X01A 2DXUA 3M53A 5GANf 1H8KA 3OYIA 3M55A 3OA6A 3JCMW 3CC7A 2HSEB 4RCCA 2JN0A 3CCSA 4M77C 4E7LA 3L2WA 1G8XA 3QHSA 3RR6A 5IHIA 5IN1A 3G6ET 2KYMA 1VQMT 4M7DF 5I22A 3OYKA 2A0FB 4AG1C 4C8QB 1UEBA 5J3BA 4RCBA 5KYYB 1B7TA 2RJFA 1YNZA 1K73U 4X9DA 4JPBW 3CC4Q 2RHXA 2OI3A 4LE9A 3JB9H 2C0IA 4PJJA 1W70A 4ESRA 1Q81U 3E9GA 2HAXA 2RI3A 4PJLA 3M4GA 3G6EQ 2RF0A 4PJNA 2E4HA 2QTXA 9ATCB 4II1A 1K9MR 2COYA 3CCSQ 4PJOF 4HVUA 2KRMA 3ASKA 1X2QA 1RAHB 3FLGA 1H3ZA 1FMVA 1MMNA 3CCVA 2K5LA 3VS5A 2FPEA 2M0OA 2MF2A 1UECA 2DBKA 3MKDA 3UWNA 4M7DG 3J80E 1W1FA 1VQOQ 4LNPA 2YRCA 4FW1A 4PFZA 2VVKA 3QDRB 4QVDA 2GFUA 3WVEB 1WDXA 1WLPB 4J8OA 4OMFB 5HY6A 2JTEA 2VKNA 4C92F 4M7AC 3TVTA 2DRMA 5IH2A 1OI1A 1M1KC 1F1BB 2PU9B 3CCRT 1NZ9A 1UGPB 2EQMA 4J9BA 2CUBA 1VQLT 3CCLT 4HCKA 4C5GA 4A4EA 1YIJT 1U3OA 4RTXA 3C0CA 5GAMf 3CCQA 4XTXA 1VQKQ 3V7SA 4KH1B 3JSCA 3GOXA 3CCVT 1K8AR 7AT1B 3L2UA 1HD3A 1VQOA 4FSSA 2D0QB 1RACB 1M1KR 4RTZA 3ZEHA 4XTYA 4EMHA 2M02A 2FPFA 2GBQA
chains in the Genus database with same CATH topology
1IO6A 2H8HA 2DM1A 4Y92A 2K6DA 2KT1A 4DEYA 1PRLC 2KRSA 5GJVB 4D8KA 2KE9A 2ROTA 3EHQA 3PE0A 1RI9A 1AZEA 1GFDA 1GCPA 4OMNA 1T3LA 2EGCA 5HCKA 2L3QA 2OAWA 1WXTA 1JQQA 4GBQA 4AFUC 2J7IA 2V1RA 2JMCA 4E6RA 4CC3A 3H0FA 2RQUA 2CT3A 2DBMA 3UA6A 1ARKA 3EG0A 3TSZA 5EC7A 1WXBA 1AEYA 4LUDA 1K0SA 2EQIA 2KRNA 2KBTA 1OEBA 2DLPA 2GNCA 2FRYA 3UATA 1V1CA 3M0RA 3I5SA 4R0KA 2KYBA 2CH4A 3R6NA 2BTTA 2JT4A 2EYZA 2KGTA 2DX1A 1GBQA 2J6FA 1B3QA 2RQTA 5IHKA 2MIOA 3QWXX 1M8MA 1UGVA 1TUCA 2KNBB 3FJ5A 2EGEA 2O9VA 1RUWA 2JS0A 2GTOA 2K7AA 1KSWA 2KROA 2M51A 1SHGA 2DJQA 2MOXA 1G83A 2C0OA 2HEQA 4J9EA 2DNUA 1T0HA 3QWYA 1UFFA 1B07A 1K1ZA 1UHFA 1JXOA 2ABLA 4OMLA 1UTIA 2F2WA 2JW4A 1AWJA 1ZX6A 1K9AA 2D0NA 2YDLA 1ZUUA 2DA9A 1CSKA 2YUQA 2A37A 1QLYA 2JXBA 3VRZA 3PVQA 4JJCA 3IQLA 4J9DA 2J06A 1T3SA 2BZYA 1N5ZA 2X3WD 4Z89A 3VS2A 4WCIA 3KFVA 1AWWA 2EKHA 5GJWB 4J9IA 2CSQA 4AG2C 2PZ1A 2LJ1A 2LCSA 2FPDA 3VS6A 3H41A 1GCQA 2EGAA 3EHRA 3VS1A 2FG0A 2YSQA 1PRMC 2EYXA 5IXFA 4LN2A 1NYFA 1Y57A 2RN8A 5I11A 1X6GA 1QWEA 2MCNA 4AFZC 3EG2A 1M30A 1E7OA 2LQNA 3PVLA 1MV0B 1GRIA 3M0TA 1M3AA 2BZ8A 3M0PA 2W10A 1M3CA 2K9GA 2RQVA 2PTKA 1QWFA 2SRCA 3RNJA 1RLPC 3M0UA 2AK5A 4OMOA 5FWBA 1SSHA 1SEMA 2HCKA 1JEGA 4OMPA 1MV3A 5L23A 1OPKA 1PKSA 2EBPA 1AWOA 1BBZA 2JM9A 1JU5C 4HVWA 1OV3A 2ED1A 4IIMA 3UF4A 4RUGA 1VYVA 2DL5A 4M4ZA 3NPFA 4J9GA 4EIKA 2GTJA 2CUDA 1A0NB 2AZSA 2AKKA 1U06A 1WYXA 2DMOA 3VS0A 4DEXA 2AZVA 1E6HA 2YUPA 2DL8A 1AD5A 1GCQC 3M0QA 1FMKA 3H0IA 1ZSGA 4D8DA 2ESWA 2QDLA 1HSQA 4F17A 4J9CA 2DL7A 3VRYA 4IIOA 2NWMA 4GLMA 4X1VA 4CC2A 2LJ3A 3ULRB 2LZ6B 2JM8A 1I0CA 1WX6A 2L2PA 1X2KA 3EGUA 2JS2A 4J9FA 4RTVA 2HSPA 1VA7A 2LJ0A 4RTUA 1ZUKA 2OJ2A 4Z88A 4CC4B 2ECZA 1UE9A 1UHCA 2LQWA 2C0TA 2RNAA 5IXBA 2YUOA 1CKAA 3ZL7C 4AFQC 4JZ3A 3RBBB 2K2MA 2LNHB 2KXDA 2DVJA 1CKBA 3I9QA 1LCKA 1TG0A 3REBB 2O88A 1ABOA 3M0SA 1H3HA 2FEIA 2IIMA 1WFWA 2A08A 1YN8A 2BZXA 1PNJA 2O2OA 2DL3A 2A28A 1YCSB 2XMFA 2HDAA 4HXJA 1M3BA 1SHFA 3CQTA 4OMMA 3O5ZA 4JZ4A 4JJDA 1T0JA 1M27C 2L3SA 2DF6A 2FO0A 2D1XA 4HVVA 2LMJA 1K4US 1G2BA 1ZBJA 5FW9A 1ABQA 2D8HA 2LX7A 2K79A 3UA7A 2O31A 1Y0MA 2DE0X 1VYUA 1W6XA 2M0YA 1EFNA 2L0AA 1KJWA 2EW3A 1YWOA 1ZUYA 3U23A 4QT7A 1GBRA 2EVRA 4J9HA 3I35A 2AKLA 2DL4A 3GBQA 4JJBA 1BU1A 1QCFA 1NG2A 2P4RA 3H0HA 4RTYA 3VS3A 1I07A 2VWFA 2RQWA 3LH5A 1H8KA 1UJYA 2GQIA 3TSWA 1XOVA 3VS7A 2A36A 2KR3A 3EG1A 1RLQC 1JXMA 1YWPA 1NEGA 1SPKA 1X6BA 1OOTA 1UG1A 2GGRA 2ENMA 2YT6A 1S1NA 5IHIA 3JV3A 5ECAA 2YUNA 2KYMA 2J6KA 1BK2A 2L3PA 2ROLA 2RPNA 1WI7A 5I22A 2FRWA 1HJDA 2I0NA 3SEMA 3NHNA 4AG1C 3A98A 1UDLA 4ORZA 2RMOA 1SRLA 2CSIA 1AZGB 1YNZA 4K11A 1KIKA 1NM7A 4Z8AA 4JPBW 3NMZC 1NLOC 1WA7A 2OI3A 4LE9A 2C0IA 1NYGA 2EPDA 1W70A 4ESRA 2E5KA 3I5RA 2EYYA 1BB9A 2DRKA 1TUDA 2SEMA 4A63B 2RF0A 2V1QA 1AOJA 2X3XD 1U5SA 1E6GA 2CH4W 2CREA 4AFSC 1X43A 4HVUA 2KRMA 2ED0A 1X2QA 1K76A 2J6OA 4CC7A 3VS5A 2FPEA 2PNIA 2W0ZA 1UECA 2DBKA 2G6FX 2KT8A 2D8JA 1GL5A 1W1FA 4LNPA 2CT4A 2RQRA 1NEBA 3THKA 2VVKA 1PWTA 1AWXA 2DILA 1WDXA 1WLPB 4F16A 2KEAA 1UJ0A 4KRTA 1ZLMA 1H92A 1QKWA 2JTEA 5IHNA 2VKNA 1QKXA 1Z9ZA 2F2XA 3EG3A 4RTWA 3TVTA 2JMAA 2DRMA 5IH2A 2HBWA 1X69A 4J9BA 1WIEA 2CUBA 4HCKA 1NLPC 1U3OA 4RTXA 3C0CA 2O9SA 3SHWA 1I1JA 1K0XA 1WXUA 3VS4A 1Z9QA 2KXCA 1UUEA 2NUZA 1FYNA 2CDTA 4OMQA 5FWCA 1HD3A 4F14A 1PHTA 1X27A 2B86A 1OPLA 4FSSA 1J3TA 1SRMA 3NGPA 4RTTA 4LUEA 1MUZA 1YP5A 3REAB 4RTZA 1PKTA 2EYWA 4ZNXA 1VYTA 1AVZC 2F2VA 2K3BA 2FPFA 1KFZA 2GBQA 2LP5A 2J05A 1JO8A 1GFCA 2DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  2H8H A;  2DM1 A;  4Y92 A;  2K6D A;  2KT1 A;  4DEY A;  1PRL C;  2KRS A;  5GJV B;  4D8K A;  2KE9 A;  2ROT A;  3EHQ A;  3PE0 A;  1RI9 A;  1AZE A;  1GFD A;  1GCP A;  4OMN A;  1T3L A;  2EGC A;  5HCK A;  2L3Q A;  2OAW A;  1WXT A;  1JQQ A;  4GBQ A;  4AFU C;  2J7I A;  2V1R A;  2JMC A;  4E6R A;  4CC3 A;  3H0F A;  2RQU A;  2CT3 A;  2DBM A;  3UA6 A;  1ARK A;  3EG0 A;  3TSZ A;  5EC7 A;  1WXB A;  1AEY A;  4LUD A;  1K0S A;  2EQI A;  2KRN A;  2KBT A;  1OEB A;  2DLP A;  2GNC A;  2FRY A;  3UAT A;  1V1C A;  3M0R A;  3I5S A;  4R0K A;  2KYB A;  2CH4 A;  3R6N A;  2BTT A;  2JT4 A;  2EYZ A;  2KGT A;  2DX1 A;  1GBQ A;  2J6F A;  1B3Q A;  2RQT A;  5IHK A;  2MIO A;  3QWX X;  1M8M A;  1UGV A;  1TUC A;  2KNB B;  3FJ5 A;  2EGE A;  2O9V A;  1RUW A;  2JS0 A;  2GTO A;  2K7A A;  1KSW A;  2KRO A;  2M51 A;  1SHG A;  2DJQ A;  2MOX A;  1G83 A;  2C0O A;  2HEQ A;  4J9E A;  2DNU A;  1T0H A;  3QWY A;  1UFF A;  1B07 A;  1K1Z A;  1UHF A;  1JXO A;  2ABL A;  4OML A;  1UTI A;  2F2W A;  2JW4 A;  1AWJ A;  1ZX6 A;  1K9A A;  2D0N A;  2YDL A;  1ZUU A;  2DA9 A;  1CSK A;  2YUQ A;  2A37 A;  1QLY A;  2JXB A;  3VRZ A;  3PVQ A;  4JJC A;  3IQL A;  4J9D A;  2J06 A;  1T3S A;  2BZY A;  1N5Z A;  2X3W D;  4Z89 A;  3VS2 A;  4WCI A;  3KFV A;  1AWW A;  2EKH A;  5GJW B;  4J9I A;  2CSQ A;  4AG2 C;  2PZ1 A;  2LJ1 A;  2LCS A;  2FPD A;  3VS6 A;  3H41 A;  1GCQ A;  2EGA A;  3EHR A;  3VS1 A;  2FG0 A;  2YSQ A;  1PRM C;  2EYX A;  5IXF A;  4LN2 A;  1NYF A;  1Y57 A;  2RN8 A;  5I11 A;  1X6G A;  1QWE A;  2MCN A;  4AFZ C;  3EG2 A;  1M30 A;  1E7O A;  2LQN A;  3PVL A;  1MV0 B;  1GRI A;  3M0T A;  1M3A A;  2BZ8 A;  3M0P A;  2W10 A;  1M3C A;  2K9G A;  2RQV A;  2PTK A;  1QWF A;  2SRC A;  3RNJ A;  1RLP C;  3M0U A;  2AK5 A;  4OMO A;  5FWB A;  1SSH A;  1SEM A;  2HCK A;  1JEG A;  4OMP A;  1MV3 A;  5L23 A;  1OPK A;  1PKS A;  2EBP A;  1AWO A;  1BBZ A;  2JM9 A;  1JU5 C;  4HVW A;  1OV3 A;  2ED1 A;  4IIM A;  3UF4 A;  4RUG A;  1VYV A;  2DL5 A;  4M4Z A;  3NPF A;  4J9G A;  4EIK A;  2GTJ A;  2CUD A;  1A0N B;  2AZS A;  2AKK A;  1U06 A;  1WYX A;  2DMO A;  3VS0 A;  4DEX A;  2AZV A;  1E6H A;  2YUP A;  2DL8 A;  1AD5 A;  1GCQ C;  3M0Q A;  1FMK A;  3H0I A;  1ZSG A;  4D8D A;  2ESW A;  2QDL A;  1HSQ A;  4F17 A;  4J9C A;  2DL7 A;  3VRY A;  4IIO A;  2NWM A;  4GLM A;  4X1V A;  4CC2 A;  2LJ3 A;  3ULR B;  2LZ6 B;  2JM8 A;  1I0C A;  1WX6 A;  2L2P A;  1X2K A;  3EGU A;  2JS2 A;  4J9F A;  4RTV A;  2HSP A;  1VA7 A;  2LJ0 A;  4RTU A;  1ZUK A;  2OJ2 A;  4Z88 A;  4CC4 B;  2ECZ A;  1UE9 A;  1UHC A;  2LQW A;  2C0T A;  2RNA A;  5IXB A;  2YUO A;  1CKA A;  3ZL7 C;  4AFQ C;  4JZ3 A;  3RBB B;  2K2M A;  2LNH B;  2KXD A;  2DVJ A;  1CKB A;  3I9Q A;  1LCK A;  1TG0 A;  3REB B;  2O88 A;  1ABO A;  3M0S A;  1H3H A;  2FEI A;  2IIM A;  1WFW A;  2A08 A;  1YN8 A;  2BZX A;  1PNJ A;  2O2O A;  2DL3 A;  2A28 A;  1YCS B;  2XMF A;  2HDA A;  4HXJ A;  1M3B A;  1SHF A;  3CQT A;  4OMM A;  3O5Z A;  4JZ4 A;  4JJD A;  1T0J A;  1M27 C;  2L3S A;  2DF6 A;  2FO0 A;  2D1X A;  4HVV A;  2LMJ A;  1K4U S;  1G2B A;  1ZBJ A;  5FW9 A;  1ABQ A;  2D8H A;  2LX7 A;  2K79 A;  3UA7 A;  2O31 A;  1Y0M A;  2DE0 X;  1VYU A;  1W6X A;  2M0Y A;  1EFN A;  2L0A A;  1KJW A;  2EW3 A;  1YWO A;  1ZUY A;  3U23 A;  4QT7 A;  1GBR A;  2EVR A;  4J9H A;  3I35 A;  2AKL A;  2DL4 A;  3GBQ A;  4JJB A;  1BU1 A;  1QCF A;  1NG2 A;  2P4R A;  3H0H A;  4RTY A;  3VS3 A;  1I07 A;  2VWF A;  2RQW A;  3LH5 A;  1H8K A;  1UJY A;  2GQI A;  3TSW A;  1XOV A;  3VS7 A;  2A36 A;  2KR3 A;  3EG1 A;  1RLQ C;  1JXM A;  1YWP A;  1NEG A;  1SPK A;  1X6B A;  1OOT A;  1UG1 A;  2GGR A;  2ENM A;  2YT6 A;  1S1N A;  5IHI A;  3JV3 A;  5ECA A;  2YUN A;  2KYM A;  2J6K A;  1BK2 A;  2L3P A;  2ROL A;  2RPN A;  1WI7 A;  5I22 A;  2FRW A;  1HJD A;  2I0N A;  3SEM A;  3NHN A;  4AG1 C;  3A98 A;  1UDL A;  4ORZ A;  2RMO A;  1SRL A;  2CSI A;  1AZG B;  1YNZ A;  4K11 A;  1KIK A;  1NM7 A;  4Z8A A;  4JPB W;  3NMZ C;  1NLO C;  1WA7 A;  2OI3 A;  4LE9 A;  2C0I A;  1NYG A;  2EPD A;  1W70 A;  4ESR A;  2E5K A;  3I5R A;  2EYY A;  1BB9 A;  2DRK A;  1TUD A;  2SEM A;  4A63 B;  2RF0 A;  2V1Q A;  1AOJ A;  2X3X D;  1U5S A;  1E6G A;  2CH4 W;  2CRE A;  4AFS C;  1X43 A;  4HVU A;  2KRM A;  2ED0 A;  1X2Q A;  1K76 A;  2J6O A;  4CC7 A;  3VS5 A;  2FPE A;  2PNI A;  2W0Z A;  1UEC A;  2DBK A;  2G6F X;  2KT8 A;  2D8J A;  1GL5 A;  1W1F A;  4LNP A;  2CT4 A;  2RQR A;  1NEB A;  3THK A;  2VVK A;  1PWT A;  1AWX A;  2DIL A;  1WDX A;  1WLP B;  4F16 A;  2KEA A;  1UJ0 A;  4KRT A;  1ZLM A;  1H92 A;  1QKW A;  2JTE A;  5IHN A;  2VKN A;  1QKX A;  1Z9Z A;  2F2X A;  3EG3 A;  4RTW A;  3TVT A;  2JMA A;  2DRM A;  5IH2 A;  2HBW A;  1X69 A;  4J9B A;  1WIE A;  2CUB A;  4HCK A;  1NLP C;  1U3O A;  4RTX A;  3C0C A;  2O9S A;  3SHW A;  1I1J A;  1K0X A;  1WXU A;  3VS4 A;  1Z9Q A;  2KXC A;  1UUE A;  2NUZ A;  1FYN A;  2CDT A;  4OMQ A;  5FWC A;  1HD3 A;  4F14 A;  1PHT A;  1X27 A;  2B86 A;  1OPL A;  4FSS A;  1J3T A;  1SRM A;  3NGP A;  4RTT A;  4LUE A;  1MUZ A;  1YP5 A;  3REA B;  4RTZ A;  1PKT A;  2EYW A;  4ZNX A;  1VYT A;  1AVZ C;  2F2V A;  2K3B A;  2FPF A;  1KFZ A;  2GBQ A;  2LP5 A;  2J05 A;  1JO8 A;  1GFC A;  2DYB A; 
#chains in the Genus database with same CATH topology
 3L2Q A;  2E1H A;  5FRN A;  1PRL C;  3TQ7 P;  2KE9 A;  2ROT A;  5GMK j;  1QVF P;  4BY6 B;  5HCK A;  1T3L A;  1Y71 A;  1QMC A;  5GAM d;  4BAC A;  4PNO A;  1WXT A;  4GBQ A;  3CXC A;  2DXC A;  5CKE A;  4ANJ A;  2J7I A;  2RHU A;  4ME7 A;  1G5V A;  4E6R A;  2DXT A;  2IPO B;  2RQU A;  1VQ7 T;  3EG0 A;  3TSZ A;  2VGN A;  3NFC A;  4LUD A;  2V8I A;  3CCQ T;  1AEY A;  2Z0W A;  4Q5W A;  4PJO C;  3MET A;  3G1J A;  2KBT A;  1TU0 B;  1ZA2 B;  2X4J A;  3RER A;  2YHT A;  2RM4 A;  5KYX B;  2HQH A;  2EYZ A;  1D0Y A;  4C92 D;  2J6F A;  5A0G A;  3HFO A;  2RQT A;  1I81 A;  3QWX X;  1M8M A;  2JZ2 A;  4QQG A;  1NJI R;  1BI2 A;  1WGS A;  2AT1 B;  3VYG A;  3C4S A;  1YHQ T;  1PM3 A;  2ZPB B;  2EGE A;  3FJ5 A;  5CQX A;  4E7Z A;  4FT2 A;  5CO7 A;  1RUW A;  2JS0 A;  2K3Y A;  4ELY C;  1VQN A;  2GTO A;  3FRN A;  4MDX A;  4M75 F;  5GAN e;  2C0O A;  4JRK A;  2P4T A;  4M78 D;  3FEO A;  1K1Z A;  1UHF A;  4OB2 B;  2ABL A;  3P8B B;  5HK3 A;  1K9A A;  3HRT A;  1M4Z A;  1M8V A;  1KD1 C;  4M78 C;  1RI0 A;  1TH7 A;  2DPP B;  2L5Q A;  4IKF A;  2J06 A;  1T3S A;  4PJO A;  4OF1 A;  4KUI A;  3FC3 A;  4E7H A;  3G4S T;  2XG8 D;  4WCI A;  2JNG A;  2L8D A;  2H3E B;  3PMT A;  2VUB A;  1WJR A;  3JCM X;  1OZ2 A;  3VS1 A;  2RJD A;  4A53 A;  2VGM A;  1R0C B;  2FZC B;  3D7S B;  1O75 A;  1NYF A;  2RN8 A;  3EGX A;  3VYH B;  1WHM A;  1QWE A;  1M30 A;  1E7O A;  3VJP A;  3M0T A;  4F7U B;  1M90 U;  5KYN A;  4N4I A;  5GAN 5;  2BZ8 A;  2W10 A;  1M3C A;  2DTI A;  1QWF A;  3BW1 A;  4M78 E;  3M0U A;  3EFO B;  5FWB A;  4F04 B;  3HFN A;  3X20 B;  1JEG A;  4X34 A;  1ZQ1 A;  3LW5 E;  2EBP A;  4YTL A;  5GAM g;  1BBZ A;  2L3R A;  4HKE A;  4LDW A;  2Y4X A;  1OV3 A;  2NUP A;  3OS0 A;  2F5K A;  2DL5 A;  2YRV A;  3M57 A;  3NPF A;  1KD1 U;  4XU0 A;  2AKK A;  1VQ4 T;  2CGH A;  5D6Y A;  3CCJ Q;  2DMO A;  2X51 A;  1B34 A;  2IVW A;  3M4Y A;  1ZSG A;  2YRD A;  3CCL A;  1VQ4 A;  4UC4 A;  4HCB A;  1GXI E;  3A8L B;  4BE0 A;  3TEE A;  4J9C A;  2ZZD A;  1HXD A;  1XQH A;  4CC2 A;  4M77 G;  3CCE T;  1QVP A;  1X2K A;  8ATC B;  3RUX A;  3EGX B;  2QA4 A;  2DXB A;  3WVD B;  4HCZ A;  2E10 A;  1K73 R;  2QAZ A;  2RNA A;  1H64 1;  2RJE A;  2ZPF B;  4E7I A;  2HL3 A;  4JZ3 A;  1G3W A;  1S72 Q;  1IHW A;  2DIQ A;  2I2L A;  1ABO A;  1H3H A;  4MZM A;  4QKU A;  5LJ3 e;  2FEI A;  3EFS A;  2DAQ A;  2OTJ T;  2QQA A;  4PFP A;  3JCM b;  3URG A;  2ZAE A;  3QKJ A;  1LJO A;  1PNJ A;  2ZCF B;  1PD1 A;  4MMK A;  5IAY A;  5D7U A;  2VYT A;  1QCN A;  3SWN A;  4C8Q A;  2XMF A;  2HDA A;  4C0D B;  3PTA A;  1WZO A;  5KYU A;  3HRU A;  1BI1 A;  3MCA B;  1M1K U;  5CKH A;  4QVZ A;  1IGU A;  2OX7 A;  1R77 A;  1BI3 A;  2DF6 A;  4RG8 A;  2FO0 A;  2D1X A;  1D3B A;  1OU8 A;  2NUT B;  3G7Z A;  4E7J A;  2KQW A;  1ABQ A;  3I56 T;  2OTJ Q;  3OYE A;  5GMK l;  1WQ7 A;  4BI4 A;  1ZSZ A;  2DE0 X;  1UGS B;  1YWO A;  2X35 A;  3CCM Q;  1ZUY A;  5GAN h;  4PJO B;  4J9H A;  2R57 A;  4XU1 A;  4E7K A;  1M2O A;  4JJB A;  1BU1 A;  1PCX A;  2RHY A;  1OUL A;  2CZ0 B;  3JB9 G;  2VWF A;  2RQW A;  3N5B B;  4LDU A;  1UJY A;  2GQI A;  3EFR A;  1YJ9 T;  3S6W A;  1XOV A;  1UGR B;  4EMK A;  2KVQ G;  1D3B B;  4Y91 A;  3OB9 A;  2KR3 A;  3EG1 A;  3HPW A;  1RLQ C;  4OP0 A;  1YJW T;  5A0L A;  1JXM A;  1SPK A;  3JCM h;  2DEU A;  2GGR A;  2EQK A;  5LJ3 j;  1AHJ B;  2ENM A;  2YT6 A;  2KAF A;  3LWI A;  3QJ6 A;  2EAY A;  5CCA A;  3JV3 A;  5FU7 C;  1LNX A;  3ER0 A;  3VU3 C;  4ZTJ A;  4M78 A;  4JJN K;  2L3P A;  3ZFJ A;  3JCM d;  5GAN 4;  1Q81 R;  2CS7 A;  2GF7 A;  3A98 A;  1YJ9 Q;  3J7A F;  4ORZ A;  4N4H A;  2RMO A;  1SRL A;  2CSI A;  4K11 A;  1KIK A;  2RHI A;  1NM7 A;  1VIE A;  2VAS A;  3A8G B;  2EYY A;  3QYH B;  2EQJ A;  2DKG A;  1TUD A;  2EKO A;  1VQL A;  3CBM A;  4C92 A;  1Q95 G;  4Z02 A;  2V1Q A;  2ZGW A;  1VQ9 Q;  1E6G A;  3C95 A;  3EGD B;  5FRO A;  4M7D C;  1ACM B;  1KC8 U;  1OX8 A;  2E65 A;  2KT8 A;  4QVC A;  1GL5 A;  4N0A C;  4A4H A;  1M2V A;  3THK A;  4RMO A;  1PWT A;  3BFM A;  4C8Q D;  5AT1 B;  4LD6 A;  1YIT A;  3OS5 A;  4F16 A;  4PJM A;  2XKO C;  2DER A;  2AHJ B;  2V26 A;  4C0F A;  1QKW A;  3C12 A;  3JCM J;  1Z9Z A;  2Y90 A;  2JMA A;  4HT8 A;  4ZN3 A;  4PL6 A;  3DB3 A;  4ZGE B;  1Q7Y C;  5GAO p;  2CP0 A;  4C92 G;  4X9C A;  3V8L A;  1NLP C;  3V8K A;  3SHW A;  3S3M A;  1LPL A;  3G71 T;  2K3X A;  2M16 A;  5LJ5 f;  1Z9Q A;  2KXC A;  3SD4 A;  3ZBD A;  5I2S A;  1FYN A;  2CDT A;  4OMQ A;  3QSU A;  1SF9 A;  4F14 A;  1X27 A;  2B86 A;  4RTT A;  3PT9 A;  3REA B;  4M75 B;  3JCM Q;  4WF2 A;  2EYQ A;  5LJ5 h;  4C5I A;  3HSB A;  1VQP Q;  2LP5 A;  2J05 A;  5GJV B;  3T9N A;  3EGD A;  1IO6 A;  2H8H A;  1JB0 E;  4IUT A;  4Y92 A;  5CQY A;  2DD5 A;  4DEY A;  2KT1 A;  4D8K A;  2HL5 C;  1AZE A;  1BIA A;  5GAO m;  1WJS A;  4C92 E;  1VQP A;  4F7U G;  1K9M U;  1Y96 A;  5J39 A;  2L3Q A;  4IUR A;  1U8R A;  2MI6 A;  1K73 C;  2OAW A;  4AFU C;  1I5L A;  2V1R A;  4LXC A;  4F7U F;  1WHH A;  1IXD A;  4FW2 A;  1VQP T;  2DBM A;  4NOY A;  1S72 T;  1KHI A;  2QAS A;  3UT1 A;  1WXB A;  5KYY A;  4J7I A;  1XTD A;  2EQI A;  4BD3 A;  3OYH A;  1VQ4 Q;  1QVF S;  3CCL Q;  1OEB A;  2GNC A;  2EFI A;  3UAT A;  3M0R A;  2RI2 A;  3CBP A;  4R0K A;  2KYB A;  3RIR A;  1Q86 U;  3OYF A;  5DLO A;  4XAX B;  2DX1 A;  1GBQ A;  4RG2 A;  1Y96 B;  1B3Q A;  1VUB A;  2CZ7 B;  2K57 A;  2HD0 A;  1V76 A;  1ZSZ C;  4O5V A;  1IZ6 A;  2HBP A;  3X26 B;  4DBR A;  2K7A A;  1KSW A;  2DTH A;  2KRO A;  4BE1 A;  3DLM A;  3TCJ A;  2XHC A;  2HEQ A;  1WHG A;  2JJ9 A;  1VQN Q;  1RAB B;  1UFF A;  2LX9 A;  3HRS A;  1N9S A;  1JXO A;  1QQJ A;  3MEA A;  2F2W A;  3JCM c;  2NUP B;  1RAI B;  2YLC A;  2YDL A;  2DA9 A;  1CSK A;  2A37 A;  4JS4 A;  3CCM A;  3JCM g;  1EZZ B;  3IQL A;  1TWB A;  3P8D A;  5KYW A;  4J9D A;  4PJO D;  2CP2 A;  5J26 A;  1VQL Q;  2BZY A;  2DZ9 A;  4M75 E;  1N5Z A;  2KI7 A;  4NL3 A;  3CD6 Q;  3CCU Q;  1VQ6 Q;  4KUL A;  5CKB A;  2WSF E;  3CMA T;  1Q82 R;  3CC4 T;  1JBM A;  5GJW B;  1VQ7 A;  3CPW S;  2QDY B;  3S3O A;  2CSQ A;  4AG2 C;  2PZ1 A;  3L1A A;  4JS5 A;  2DIG A;  3VV0 A;  4XTZ A;  3M5A A;  2EGA A;  2QQ9 A;  2FG0 A;  2FYK A;  4FYV B;  3JCM f;  3WXM B;  1QP3 A;  3RKX A;  5I11 A;  4LDX A;  1X6G A;  1QVG P;  2VXE A;  3PVL A;  1MV0 B;  2MMP A;  1KQ1 A;  3JB9 J;  2OAU A;  2PVO B;  3L2V A;  1KQS A;  2RQV A;  3UDC A;  1MMA A;  2E3H A;  2RI5 A;  3CC2 T;  5KH6 A;  2SRC A;  3A5Z B;  2AK5 A;  4FYY B;  1IRX A;  1Y07 A;  1YCY A;  4J83 A;  4DBQ A;  1N6A A;  2RK1 A;  2GQV A;  2B8A A;  4KUD K;  3NTH A;  5L23 A;  1OPK A;  4M7A E;  2E3I A;  2JM9 A;  1SG5 A;  2ED1 A;  3PFS A;  3UF4 A;  4RUG A;  1VYV A;  4KT0 E;  4M4Z A;  3GIB A;  3L2Z A;  2GTJ A;  2CZ1 B;  2ZPE B;  2AZS A;  1FXX A;  3VS0 A;  2EJG A;  2QXF A;  4F7U A;  4MZP A;  5LJ5 e;  2PUO B;  3M0Q A;  1FMK A;  1KQS P;  3H0I A;  1WHL A;  3VUB A;  1RAF B;  2LC4 A;  2QDL A;  3OYD A;  2F1L A;  2DL7 A;  3VRY A;  3INZ A;  4A4K A;  1Q82 U;  1Q7Y R;  5CKD A;  3ULR B;  5GAN 3;  1IHV A;  2L2P A;  2BIV A;  4J9F A;  4BY6 C;  2OJ2 A;  4Z88 A;  2HZY A;  3MPU B;  4CC4 B;  1UE9 A;  2C0T A;  2LQW A;  3EG9 A;  1JJ2 S;  4LDV A;  2COZ A;  2YUO A;  1R8O B;  1CKA A;  3CPF A;  2AIR B;  2LT1 A;  3RBB B;  2KXD A;  2DVJ A;  5GAM h;  3I9Q A;  5A0D A;  3JB9 D;  3RMQ A;  3OYB A;  4FT4 A;  2IIM A;  3G6E A;  2KY9 A;  1N8R R;  1RL2 A;  4NS5 A;  1YBY A;  4IUQ A;  4C92 C;  2YXY A;  2DL3 A;  2A28 A;  4BI3 A;  3CCR A;  3CQT A;  4M7D A;  1YJN T;  1K9M C;  2FL7 A;  3O5Z A;  4JZ4 A;  1FWZ A;  1M27 C;  1M5Q 1;  4HVV A;  2LMJ A;  3MHX A;  1MMG A;  2LX7 A;  1D1A A;  2K79 A;  1N8R C;  1N9R A;  2VXF A;  2RJC A;  4JLI A;  1WHJ A;  1OU9 A;  1KJW A;  4XU2 A;  4XU3 A;  3U23 A;  2QQB A;  1BIB A;  1K8A U;  4CRI A;  1GBR A;  3MEW A;  1OQK A;  4WTO B;  3GBQ A;  2DET A;  3CC7 Q;  3CEY A;  3SWN B;  3E2U A;  1M1G A;  2XK0 A;  1YI2 Q;  4PLL A;  5CAI A;  3OYM A;  3TSW A;  2KMT A;  1PSE A;  1I8F A;  1M2V B;  2NUT A;  3JAM E;  3FB9 A;  5GMK m;  1YWP A;  2QYZ A;  1NEG A;  4BB7 A;  1X6B A;  1OOT A;  3M56 A;  1PD0 A;  1G3T A;  3AT1 B;  4C0Z A;  1U1S A;  3I55 T;  3OSV A;  3QO3 A;  4JUV A;  1S1N A;  2RH2 A;  1KC8 R;  2P0K A;  1VQN T;  1YI2 T;  3A8H B;  2J6K A;  1BK2 A;  2RPN A;  4XTV A;  1JRI A;  1HJD A;  2FRW A;  4QQ6 A;  4JDS A;  3SEM A;  3NHN A;  3OMG A;  4FYX B;  3CC4 A;  3HTR A;  1UDL A;  3KXT A;  3I56 Q;  1AZG B;  1D0X A;  5FLX E;  3LGF A;  4Z8A A;  2X4Y A;  3NMZ C;  1NLO C;  4EMK B;  1WA7 A;  1RAA B;  3OS2 A;  1NYG A;  2E5K A;  3I5R A;  4MZT A;  3CD6 T;  1VQ5 Q;  1BB9 A;  2DRK A;  2SEM A;  4A63 B;  2BE7 D;  2QI2 A;  1SSF A;  1AOJ A;  3MP6 A;  2X3X D;  2CP6 A;  5GAO l;  1Q7Y U;  2CRE A;  2P0Q A;  4CC7 A;  4HCC A;  5LJ3 f;  2CP3 A;  2ATC B;  2ZPI B;  3L42 A;  3QZ9 B;  4C5H A;  2E41 A;  3FJP A;  3SFM A;  1VQ8 Q;  5FU6 C;  1VQK T;  1YI2 A;  2RQR A;  1MGQ A;  2E6Z A;  2XIC A;  1BKB A;  5HKC A;  3QYG B;  4J5Y A;  3EH1 A;  1NJI U;  3CCE A;  2KEA A;  3O8V A;  1UJ0 A;  4KRT A;  2LQK A;  3E9F A;  1VQK A;  1PG5 B;  1QP2 A;  2DEQ A;  2NLU A;  5IHN A;  4BDZ A;  4KBM B;  2F2X A;  2DK3 A;  4RTW A;  1Q81 C;  1VOM A;  4MDW A;  2HBW A;  4JRP A;  3RMS A;  1VQ8 T;  1X69 A;  1D09 B;  1WIE A;  1MHN A;  4O6J A;  3CPW P;  4ZN1 A;  1N8R U;  2O9S A;  3GPL A;  2XU8 A;  1I1J A;  1KQS S;  3CCE Q;  1M1F A;  4FCY A;  4D6W A;  3VS4 A;  2L89 A;  2DVE A;  3HHT B;  4M78 G;  1UUE A;  3OS1 A;  2CP7 A;  2E6N A;  2NUZ A;  5FWC A;  4M7A B;  3R6O A;  1OPL A;  3Q1J A;  1J3T A;  1SRM A;  3NGP A;  4LUE A;  3MO8 A;  1YJW A;  4E7S A;  1PKT A;  2EYW A;  3KUF A;  1AVZ C;  5D6W A;  2F2V A;  2K3B A;  5GAO q;  3CC2 A;  1JO8 A;  1GFC A;  3QII A;  2DYB A;  2QEX T;  4DBF A;  2XDD A;  4XQ3 A;  2KRS A;  3OYA A;  3EHQ A;  3PE0 A;  3CC2 Q;  1GCP A;  1G3S A;  2EGC A;  2YWW A;  4KH0 B;  4N4G A;  5KYW B;  1JQQ A;  3GLX A;  3P8H A;  1MMD A;  4M78 B;  4KGX B;  3OYL A;  4CC3 A;  4B9W A;  2R5M A;  4A4F A;  4DBH A;  1UGQ B;  3OYY A;  1ARK A;  3LLR A;  1K0S A;  5LJ3 d;  3QG1 A;  4B9X A;  2KRN A;  4OGE A;  5LJ5 g;  3A1P A;  3PGG A;  1QW1 A;  1YFN A;  2FRY A;  4PJO G;  2QGG A;  2VV5 A;  3R6N A;  2JT4 A;  2QQS A;  3PIP A;  1VQ9 T;  1I4K 1;  5C0M A;  1KD1 R;  3VKI A;  4DA4 A;  2CP5 A;  3X24 B;  5IHK A;  4BDY A;  3V7C A;  2MIO A;  1UGV A;  1TUC A;  5LJ5 j;  4M75 D;  3CXC S;  3LGL A;  3VUZ A;  5M9O A;  2F5T X;  4M77 B;  4M7A A;  1LOJ A;  1I5O B;  2M51 A;  2DZC A;  1SHG A;  2MOX A;  1G83 A;  2RK2 A;  4V2S A;  3DKM A;  1T0H A;  5FU7 B;  5GAN 7;  3CCV Q;  2HQE A;  2DO3 A;  4OML A;  1UTI A;  2D0N A;  1ZUU A;  2YUQ A;  3GP8 A;  1OYX A;  1QLY A;  3I55 A;  2JXB A;  2DFU A;  3PVQ A;  3VRZ A;  4IUP A;  2P0P A;  1NJI C;  1VQ5 A;  4LD9 K;  3X25 B;  4NL2 A;  3VS2 A;  3NTK A;  3KFV A;  1AWW A;  4FYW B;  4J9I A;  3BY7 A;  2LJ1 A;  2LCS A;  2FPD A;  5GMK h;  2C06 A;  3VS6 A;  3I56 A;  3H41 A;  2LVM A;  1MND A;  3FDR A;  3QDF A;  1D0Z A;  4BUG A;  3HL8 A;  3H8Z A;  3CCU A;  1VQ6 A;  3CD6 A;  2YSQ A;  4LN2 A;  4TVR A;  4M75 A;  5I21 A;  2VB6 A;  4AFZ C;  2MCN A;  4DOV A;  1O9S A;  2MYS A;  3M0P A;  1X6O A;  2RHZ A;  5GAO n;  3PIO A;  1RAG B;  1TTH B;  1D1C A;  2K9G A;  2PTK A;  3X28 B;  4AMC A;  4M77 A;  4DQ2 A;  1RLP C;  2PUK B;  3G71 A;  3OYN A;  3CME A;  3LYI A;  1YHQ Q;  1JU5 C;  4HVW A;  4M7A D;  1M9S A;  4JLG A;  1IRE B;  1TXQ A;  2K5F A;  3CCM T;  2CUD A;  3RDV A;  3A8O B;  2JTF A;  2JOY A;  3DLL A;  1U06 A;  4C5E A;  4DEX A;  1NE8 A;  1E6H A;  2YUP A;  1AD5 A;  2FZK B;  2QQR A;  5LJ3 h;  2OTL Q;  1W2B A;  1M90 C;  4D8D A;  2ESW A;  3OYC A;  1HSQ A;  3CCR Q;  3HKS A;  3M59 A;  2M1H A;  2VC8 A;  1QVF A;  4P5N A;  1NBE B;  2NWM A;  2HKQ B;  4X1V A;  3QBY A;  2LZ6 B;  2JM8 A;  5KCO A;  1I0C A;  1WX6 A;  3EGU A;  1WQW A;  2HSP A;  2LJ0 A;  4RTU A;  1DJ7 B;  1MNE A;  1UHC A;  4N0A A;  2XI9 A;  2DYI A;  3ZL7 C;  4AFQ C;  1ZBX A;  3CCS T;  1VQ9 A;  1BCO A;  1CKB A;  5AYF A;  2CKK A;  1LCK A;  3REB B;  3M0S A;  2RA2 A;  3V7R A;  1AT1 B;  4PK4 A;  2A08 A;  5GAN 2;  1X75 C;  1YN8 A;  2BZX A;  3OYG A;  2QEX Q;  1W4S A;  3QUI A;  1G3Y A;  2O2O A;  4J6W A;  1N27 A;  5CVI A;  1VQO T;  5GAN 6;  1YCS B;  5GAO r;  2E64 A;  4ZTF A;  4M77 D;  4HXJ A;  1VQM Q;  1M3B A;  5EG2 A;  2ZPH B;  1SHF A;  3G4S A;  3QZ5 B;  4OVA A;  4OMM A;  3SWN C;  3PMI A;  4C8Q C;  4M7A G;  3JCM V;  4JJD A;  1TOV A;  2KK4 A;  2L3S A;  2RO0 A;  3EG9 B;  1K4U S;  1G2B A;  2D8H A;  1WNL A;  2DJZ A;  1Y0M A;  1VYU A;  2M0Y A;  2L0A A;  3E19 A;  1XJW B;  3OYJ A;  4EDU A;  2EVR A;  2AKL A;  1R0B G;  5I2M A;  2JTM A;  1NG2 A;  2P4R A;  4QW2 A;  3VS3 A;  1I07 A;  2BKD N;  2XID A;  3QXE B;  5LL6 S;  3OY9 A;  1BCM A;  3LH5 A;  3EFO A;  2V8K A;  4M75 G;  3L2R A;  1K8A C;  3GNG A;  5DM7 R;  5CIU A;  2R5A A;  3CMA A;  1KK7 A;  2EQU A;  3VS7 A;  4R55 A;  1PSF A;  2A36 A;  5D6X A;  2PVD B;  4OB3 B;  4M7D E;  3M9Q A;  1EIF A;  1WJQ A;  1UG1 A;  2DD4 A;  1NPP A;  1NPR A;  2PVG B;  4A54 A;  5ECA A;  2YUN A;  2OTJ A;  2FZG B;  2MK5 A;  4FM4 B;  2ROL A;  3ME9 A;  1WI7 A;  2I0N A;  3CPW A;  5CK9 A;  1YIJ A;  1TUG B;  4C0G A;  2YLB A;  3G4S Q;  5GAM j;  1W2B P;  2NYS A;  1VQ7 Q;  4FSX A;  1YJN A;  3BDU A;  1YIJ Q;  2E5Q A;  2ZPG B;  5FU6 B;  2EPD A;  4PLI A;  4MML A;  1Y7X A;  2QTV A;  5KYX A;  3EAE A;  2MAM A;  3GF5 A;  3HP9 A;  2LDM A;  5C6S A;  1U5S A;  4M75 C;  4AFS C;  2CH4 W;  4GY5 A;  1X43 A;  2ED0 A;  2H3J A;  2HMA A;  1K76 A;  2J6O A;  3M54 A;  2BE9 B;  4R56 A;  2PNI A;  2W0Z A;  3JCM e;  2QA4 Q;  2G6F X;  8AT1 B;  2D8J A;  4J6X A;  5L8R E;  1KG1 A;  2LCL A;  3DB4 A;  4M7D D;  2CT4 A;  1SKU B;  3MJX A;  1NEB A;  4F7U E;  2DIL A;  1AWX A;  4OB1 B;  2LTO A;  2O01 E;  1H92 A;  1QCO A;  1ZLM A;  2KSS A;  3FIF A;  1XNI A;  1QKX A;  2HNI A;  3EG3 A;  5KE2 A;  1Q86 C;  2JUF A;  3KBG A;  2FB7 A;  1OZ3 A;  3OW2 P;  4DOW A;  4OGC A;  2QA4 T;  1C0M A;  1JJ2 P;  4ATO A;  1BI0 A;  3CBO A;  2COW A;  1RAE B;  4J6Y A;  4C8Q F;  1JJ2 A;  4L59 A;  1K0X A;  4E2F B;  1WXU A;  2RB6 A;  3RES A;  1YHQ A;  5LJ5 d;  4C8Q E;  3CME Q;  1M90 R;  4CI0 C;  1Q86 R;  4M77 F;  1PHT A;  1OX9 A;  1MUZ A;  1YP5 A;  4ZNX A;  1VYT A;  4M7D B;  3MEV A;  1PC0 A;  1KFZ A;  4KGV B;  2EWN A;  2O4X B;  2DM1 A;  2R58 A;  2K6D A;  1KC8 C;  2LCC A;  1RI9 A;  1GFD A;  4OMN A;  6AT1 B;  2MWP A;  4L5G A;  2FVU A;  2LRQ A;  3OQ5 A;  4QQD A;  3RKY A;  2XD0 A;  2EJF A;  2D6F A;  2GFA A;  1ZHI A;  1IGQ A;  3TRE A;  2JMC A;  1YJN Q;  3H0F A;  2CT3 A;  3UA6 A;  5EC7 A;  1YIT T;  5FRM A;  3NTI A;  4ELZ C;  2XDP A;  3MEU A;  2LT4 A;  3JB9 F;  3M58 A;  2DLP A;  2LNV A;  1V1C A;  3I5S A;  4B6M A;  2CH4 A;  2OTL T;  2BTT A;  2CZ6 B;  3SDZ A;  5KCH A;  3CCJ T;  4XK8 E;  2KGT A;  2JVV A;  4FU6 A;  5DLQ E;  1YIT Q;  2BUD A;  2KNB B;  2D9T A;  3CCU T;  1VQ6 T;  2O9V A;  3LH0 A;  3CMA Q;  4M7A F;  2PQW A;  3F70 A;  2DJQ A;  5KYU B;  3LWH A;  3UPU A;  4VUB A;  1HYO A;  4XTU A;  4J9E A;  2DNU A;  3QWY A;  4PKC C;  1B07 A;  1QVG A;  2QK0 A;  4RKU E;  2JW4 A;  1AWJ A;  1ZX6 A;  4EPC A;  4HT9 A;  3JB9 I;  2F69 A;  3JCM P;  5GAN d;  4JJC A;  4EMG A;  2QGF B;  2QG9 B;  1WHK A;  1FX7 A;  3SB2 A;  4E47 A;  2X3W D;  4Z89 A;  2MWO A;  2EKH A;  1U1T A;  2V8J A;  4XTW A;  2FHD A;  1KHC A;  5KE3 A;  1VQ5 T;  1YJ9 A;  3E1S A;  1GCQ A;  2HKN A;  3EHR A;  2E12 A;  3V8J A;  4LDY A;  2MPX C;  2QEX A;  1PRM C;  2EYX A;  5IXF A;  1Y57 A;  5HK0 A;  5GMK e;  1ZSZ B;  4PJO E;  2A3L A;  3EG2 A;  4M78 F;  5GAN 8;  3J81 E;  2LQN A;  4EMK C;  1ZA1 B;  4Y28 E;  3A8M B;  1GRI A;  4JRQ A;  1C1A A;  1M3A A;  3QPH A;  5DY9 A;  4GLK A;  2IG0 A;  3AHU A;  1HK9 A;  1Q82 C;  3QJY A;  3RNJ A;  5GAN j;  4OMO A;  2X4W A;  1BYM A;  1SSH A;  4ZGD B;  1FMW A;  1SEM A;  2HCK A;  4OMP A;  2KDS A;  1MV3 A;  1AWO A;  1PKS A;  3OBW A;  5GAN g;  2WSE E;  1KQ2 A;  4PFO A;  4IIM A;  1WPY A;  1EX4 A;  1W2B S;  4C92 B;  3CCQ Q;  3C94 A;  4J9G A;  3TU4 K;  4EIK A;  5IT9 E;  1A0N B;  4AT1 B;  4IUU A;  5CR2 A;  1WYX A;  4C0D C;  3JRZ A;  3LX7 A;  2AZV A;  3S3N A;  2DL8 A;  1GCQ C;  1C6V X;  4OB0 B;  2O4X A;  1VIF A;  1TS9 A;  4FL6 A;  2EJ9 A;  5A2Q E;  2K2V A;  4F17 A;  3H9N A;  1TSF A;  1VQM A;  2K5I A;  2M9U A;  4L6V 5;  4IIO A;  4GLM A;  3BE3 A;  2GCX A;  2LJ3 A;  1D1B A;  1P92 A;  4HA8 A;  4KGZ B;  3G71 Q;  4RTV A;  2JS2 A;  1VQ8 A;  3BDL A;  4M77 E;  1VA7 A;  2E70 A;  2X9H A;  3GNF B;  1IB8 A;  4BE2 A;  2WAC A;  1ZUK A;  4IUV A;  4J7F A;  2A7Y A;  2ECZ A;  1S72 A;  1LVK A;  5IXB A;  2X4X A;  5LJ3 g;  2K2M A;  2LNH B;  5GMK i;  4JRI A;  1TG0 A;  2RD1 A;  3MP1 A;  1QVG S;  2O88 A;  4FIB A;  3PNW C;  2WSC E;  2CYZ B;  1WFW A;  1YJW Q;  3OSS C;  2DTO A;  2HQX A;  3CC7 T;  5CKF A;  2K4Y A;  4ZGJ B;  1V29 B;  3MP8 A;  5GAM e;  3RKW A;  4C8Q G;  2Y4Y A;  1T0J A;  2P84 A;  1B34 B;  3OBY A;  1ZBJ A;  5FW9 A;  2OTL A;  1UB4 A;  2LQ8 A;  3UA7 A;  2O31 A;  3CCJ A;  1W6X A;  1EFN A;  4BI8 B;  2EW3 A;  3I55 Q;  3EH2 A;  4QT7 A;  3CXC P;  3OMC A;  4A4G A;  3OW2 S;  3I35 A;  2G3R A;  2DL4 A;  3OW2 A;  2EIF A;  1RAD B;  1QCF A;  3CME T;  4RTY A;  3H0H A;  2XDB A;  3H6Z A;  1X01 A;  2DXU A;  3M53 A;  5GAN f;  1H8K A;  3OYI A;  3M55 A;  3OA6 A;  3JCM W;  3CC7 A;  2HSE B;  4RCC A;  2JN0 A;  3CCS A;  4M77 C;  4E7L A;  3L2W A;  1G8X A;  3QHS A;  3RR6 A;  5IHI A;  5IN1 A;  3G6E T;  2KYM A;  1VQM T;  4M7D F;  5I22 A;  3OYK A;  2A0F B;  4AG1 C;  4C8Q B;  1UEB A;  5J3B A;  4RCB A;  5KYY B;  1B7T A;  2RJF A;  1YNZ A;  1K73 U;  4X9D A;  4JPB W;  3CC4 Q;  2RHX A;  2OI3 A;  4LE9 A;  3JB9 H;  2C0I A;  4PJJ A;  1W70 A;  4ESR A;  1Q81 U;  3E9G A;  2HAX A;  2RI3 A;  4PJL A;  3M4G A;  3G6E Q;  2RF0 A;  4PJN A;  2E4H A;  2QTX A;  9ATC B;  4II1 A;  1K9M R;  2COY A;  3CCS Q;  4PJO F;  4HVU A;  2KRM A;  3ASK A;  1X2Q A;  1RAH B;  3FLG A;  1H3Z A;  1FMV A;  1MMN A;  3CCV A;  2K5L A;  3VS5 A;  2FPE A;  2M0O A;  2MF2 A;  1UEC A;  2DBK A;  3MKD A;  3UWN A;  4M7D G;  3J80 E;  1W1F A;  1VQO Q;  4LNP A;  2YRC A;  4FW1 A;  4PFZ A;  2VVK A;  3QDR B;  4QVD A;  2GFU A;  3WVE B;  1WDX A;  1WLP B;  4J8O A;  4OMF B;  5HY6 A;  2JTE A;  2VKN A;  4C92 F;  4M7A C;  3TVT A;  2DRM A;  5IH2 A;  1OI1 A;  1M1K C;  1F1B B;  2PU9 B;  3CCR T;  1NZ9 A;  1UGP B;  2EQM A;  4J9B A;  2CUB A;  1VQL T;  3CCL T;  4HCK A;  4C5G A;  4A4E A;  1YIJ T;  1U3O A;  4RTX A;  3C0C A;  5GAM f;  3CCQ A;  4XTX A;  1VQK Q;  3V7S A;  4KH1 B;  3JSC A;  3GOX A;  3CCV T;  1K8A R;  7AT1 B;  3L2U A;  1HD3 A;  1VQO A;  4FSS A;  2D0Q B;  1RAC B;  1M1K R;  4RTZ A;  3ZEH A;  4XTY A;  4EMH A;  2M02 A;  2FPF A;  2GBQ A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  2H8H A;  2DM1 A;  4Y92 A;  2K6D A;  2KT1 A;  4DEY A;  1PRL C;  2KRS A;  5GJV B;  4D8K A;  2KE9 A;  2ROT A;  3EHQ A;  3PE0 A;  1RI9 A;  1AZE A;  1GFD A;  1GCP A;  4OMN A;  1T3L A;  2EGC A;  5HCK A;  2L3Q A;  2OAW A;  1WXT A;  1JQQ A;  4GBQ A;  4AFU C;  2J7I A;  2V1R A;  2JMC A;  4E6R A;  4CC3 A;  3H0F A;  2RQU A;  2CT3 A;  2DBM A;  3UA6 A;  1ARK A;  3EG0 A;  3TSZ A;  5EC7 A;  1WXB A;  1AEY A;  4LUD A;  1K0S A;  2EQI A;  2KRN A;  2KBT A;  1OEB A;  2DLP A;  2GNC A;  2FRY A;  3UAT A;  1V1C A;  3M0R A;  3I5S A;  4R0K A;  2KYB A;  2CH4 A;  3R6N A;  2BTT A;  2JT4 A;  2EYZ A;  2KGT A;  2DX1 A;  1GBQ A;  2J6F A;  1B3Q A;  2RQT A;  5IHK A;  2MIO A;  3QWX X;  1M8M A;  1UGV A;  1TUC A;  2KNB B;  3FJ5 A;  2EGE A;  2O9V A;  1RUW A;  2JS0 A;  2GTO A;  2K7A A;  1KSW A;  2KRO A;  2M51 A;  1SHG A;  2DJQ A;  2MOX A;  1G83 A;  2C0O A;  2HEQ A;  4J9E A;  2DNU A;  1T0H A;  3QWY A;  1UFF A;  1B07 A;  1K1Z A;  1UHF A;  1JXO A;  2ABL A;  4OML A;  1UTI A;  2F2W A;  2JW4 A;  1AWJ A;  1ZX6 A;  1K9A A;  2D0N A;  2YDL A;  1ZUU A;  2DA9 A;  1CSK A;  2YUQ A;  2A37 A;  1QLY A;  2JXB A;  3VRZ A;  3PVQ A;  4JJC A;  3IQL A;  4J9D A;  2J06 A;  1T3S A;  2BZY A;  1N5Z A;  2X3W D;  4Z89 A;  3VS2 A;  4WCI A;  3KFV A;  1AWW A;  2EKH A;  5GJW B;  4J9I A;  2CSQ A;  4AG2 C;  2PZ1 A;  2LJ1 A;  2LCS A;  2FPD A;  3VS6 A;  3H41 A;  1GCQ A;  2EGA A;  3EHR A;  3VS1 A;  2FG0 A;  2YSQ A;  1PRM C;  2EYX A;  5IXF A;  4LN2 A;  1NYF A;  1Y57 A;  2RN8 A;  5I11 A;  1X6G A;  1QWE A;  2MCN A;  4AFZ C;  3EG2 A;  1M30 A;  1E7O A;  2LQN A;  3PVL A;  1MV0 B;  1GRI A;  3M0T A;  1M3A A;  2BZ8 A;  3M0P A;  2W10 A;  1M3C A;  2K9G A;  2RQV A;  2PTK A;  1QWF A;  2SRC A;  3RNJ A;  1RLP C;  3M0U A;  2AK5 A;  4OMO A;  5FWB A;  1SSH A;  1SEM A;  2HCK A;  1JEG A;  4OMP A;  1MV3 A;  5L23 A;  1OPK A;  1PKS A;  2EBP A;  1AWO A;  1BBZ A;  2JM9 A;  1JU5 C;  4HVW A;  1OV3 A;  2ED1 A;  4IIM A;  3UF4 A;  4RUG A;  1VYV A;  2DL5 A;  4M4Z A;  3NPF A;  4J9G A;  4EIK A;  2GTJ A;  2CUD A;  1A0N B;  2AZS A;  2AKK A;  1U06 A;  1WYX A;  2DMO A;  3VS0 A;  4DEX A;  2AZV A;  1E6H A;  2YUP A;  2DL8 A;  1AD5 A;  1GCQ C;  3M0Q A;  1FMK A;  3H0I A;  1ZSG A;  4D8D A;  2ESW A;  2QDL A;  1HSQ A;  4F17 A;  4J9C A;  2DL7 A;  3VRY A;  4IIO A;  2NWM A;  4GLM A;  4X1V A;  4CC2 A;  2LJ3 A;  3ULR B;  2LZ6 B;  2JM8 A;  1I0C A;  1WX6 A;  2L2P A;  1X2K A;  3EGU A;  2JS2 A;  4J9F A;  4RTV A;  2HSP A;  1VA7 A;  2LJ0 A;  4RTU A;  1ZUK A;  2OJ2 A;  4Z88 A;  4CC4 B;  2ECZ A;  1UE9 A;  1UHC A;  2LQW A;  2C0T A;  2RNA A;  5IXB A;  2YUO A;  1CKA A;  3ZL7 C;  4AFQ C;  4JZ3 A;  3RBB B;  2K2M A;  2LNH B;  2KXD A;  2DVJ A;  1CKB A;  3I9Q A;  1LCK A;  1TG0 A;  3REB B;  2O88 A;  1ABO A;  3M0S A;  1H3H A;  2FEI A;  2IIM A;  1WFW A;  2A08 A;  1YN8 A;  2BZX A;  1PNJ A;  2O2O A;  2DL3 A;  2A28 A;  1YCS B;  2XMF A;  2HDA A;  4HXJ A;  1M3B A;  1SHF A;  3CQT A;  4OMM A;  3O5Z A;  4JZ4 A;  4JJD A;  1T0J A;  1M27 C;  2L3S A;  2DF6 A;  2FO0 A;  2D1X A;  4HVV A;  2LMJ A;  1K4U S;  1G2B A;  1ZBJ A;  5FW9 A;  1ABQ A;  2D8H A;  2LX7 A;  2K79 A;  3UA7 A;  2O31 A;  1Y0M A;  2DE0 X;  1VYU A;  1W6X A;  2M0Y A;  1EFN A;  2L0A A;  1KJW A;  2EW3 A;  1YWO A;  1ZUY A;  3U23 A;  4QT7 A;  1GBR A;  2EVR A;  4J9H A;  3I35 A;  2AKL A;  2DL4 A;  3GBQ A;  4JJB A;  1BU1 A;  1QCF A;  1NG2 A;  2P4R A;  3H0H A;  4RTY A;  3VS3 A;  1I07 A;  2VWF A;  2RQW A;  3LH5 A;  1H8K A;  1UJY A;  2GQI A;  3TSW A;  1XOV A;  3VS7 A;  2A36 A;  2KR3 A;  3EG1 A;  1RLQ C;  1JXM A;  1YWP A;  1NEG A;  1SPK A;  1X6B A;  1OOT A;  1UG1 A;  2GGR A;  2ENM A;  2YT6 A;  1S1N A;  5IHI A;  3JV3 A;  5ECA A;  2YUN A;  2KYM A;  2J6K A;  1BK2 A;  2L3P A;  2ROL A;  2RPN A;  1WI7 A;  5I22 A;  2FRW A;  1HJD A;  2I0N A;  3SEM A;  3NHN A;  4AG1 C;  3A98 A;  1UDL A;  4ORZ A;  2RMO A;  1SRL A;  2CSI A;  1AZG B;  1YNZ A;  4K11 A;  1KIK A;  1NM7 A;  4Z8A A;  4JPB W;  3NMZ C;  1NLO C;  1WA7 A;  2OI3 A;  4LE9 A;  2C0I A;  1NYG A;  2EPD A;  1W70 A;  4ESR A;  2E5K A;  3I5R A;  2EYY A;  1BB9 A;  2DRK A;  1TUD A;  2SEM A;  4A63 B;  2RF0 A;  2V1Q A;  1AOJ A;  2X3X D;  1U5S A;  1E6G A;  2CH4 W;  2CRE A;  4AFS C;  1X43 A;  4HVU A;  2KRM A;  2ED0 A;  1X2Q A;  1K76 A;  2J6O A;  4CC7 A;  3VS5 A;  2FPE A;  2PNI A;  2W0Z A;  1UEC A;  2DBK A;  2G6F X;  2KT8 A;  2D8J A;  1GL5 A;  1W1F A;  4LNP A;  2CT4 A;  2RQR A;  1NEB A;  3THK A;  2VVK A;  1PWT A;  1AWX A;  2DIL A;  1WDX A;  1WLP B;  4F16 A;  2KEA A;  1UJ0 A;  4KRT A;  1ZLM A;  1H92 A;  1QKW A;  2JTE A;  5IHN A;  2VKN A;  1QKX A;  1Z9Z A;  2F2X A;  3EG3 A;  4RTW A;  3TVT A;  2JMA A;  2DRM A;  5IH2 A;  2HBW A;  1X69 A;  4J9B A;  1WIE A;  2CUB A;  4HCK A;  1NLP C;  1U3O A;  4RTX A;  3C0C A;  2O9S A;  3SHW A;  1I1J A;  1K0X A;  1WXU A;  3VS4 A;  1Z9Q A;  2KXC A;  1UUE A;  2NUZ A;  1FYN A;  2CDT A;  4OMQ A;  5FWC A;  1HD3 A;  4F14 A;  1PHT A;  1X27 A;  2B86 A;  1OPL A;  4FSS A;  1J3T A;  1SRM A;  3NGP A;  4RTT A;  4LUE A;  1MUZ A;  1YP5 A;  3REA B;  4RTZ A;  1PKT A;  2EYW A;  4ZNX A;  1VYT A;  1AVZ C;  2F2V A;  2K3B A;  2FPF A;  1KFZ A;  2GBQ A;  2LP5 A;  2J05 A;  1JO8 A;  1GFC A;  2DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...