1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
b'HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
3VS6A 1AOJA 4OMLA 1MV3A 4Y92A 1JEGA 3TVTA 2L3QA 2V1QA 3PVQA 3I9QA 2HDAA 5FWCA 2ECZA 3RBBB 4AFZC 4JJCA 2EYYA 4OMOA 2CH4W 1NEBA 2K2MA 1H8KA 2CUDA 4ESRA 2G6FX 4J9FA 2O31A 4RTTA 1QCFA 3CQTA 2NWMA 1QWEA 1OPLA 3M0RA 2LNHB 1T0HA 3NHNA 1NG2A 3M0QA 1S1NA 2KYBA 2C0IA 1VYTA 1GFDA 1PNJA 2VKNA 4RTXA 4K11A 2JS2A 1UGVA 4DEYA 1ZUUA 2BZXA 1NEGA 2RQWA 1RLQC 2ED1A 2V1RA 2JS0A 1TUCA 1QKXA 1PKSA 1SHGA 3UA6A 2HBWA 2E5KA 2B86A 1JXOA 1UDLA 1WDXA 1PKTA 3THKA 3I5RA 1VA7A 4OMMA 1MV0B 2KT1A 4WCIA 1KJWA 2KNBB 4RUGA 1WIEA 2I0NA 2M0YA 4M4ZA 4AG1C 2CREA 4D8KA 1BB9A 4F17A 1M8MA 1WXBA 2D8JA 3KFVA 1T3SA 1U06A 4A63B 2KT8A 4E6RA 2DRMA 2K6DA 1K76A 1Z9ZA 2YSQA 1K4US 1RI9A 1ZUYA 4RTZA 2DL5A 1OEBA 1AZEA 2ABLA 2HEQA 1M3CA 1WI7A 2C0TA 3EGUA 3H41A 2EYZA 1WX6A 2RQVA 2BTTA 2NUZA 4OMQA 5IHNA 2RN8A 2EGCA 3H0IA 4IIOA 2LP5A 1M3AA 1ABOA 4HXJA 3EHRA 4J9DA 2EPDA 2LMJA 2GBQA 1I0CA 3QWXX 2EW3A 3SHWA 1T0JA 1YNZA 2KXDA 2RF0A 4OMPA 4HVUA 3GBQA 3EG1A 3NPFA 1A0NB 1X43A 2EQIA 2ESWA 3VS5A 3A98A 4HVWA 4CC3A 1N5ZA 2J06A 4LN2A 4ORZA 2YDLA 2SEMA 1AD5A 5L23A 2KRNA 2AKKA 3JV3A 5GJVB 2DL7A 1FYNA 1NYGA 5IXFA 5IHIA 2DM1A 2DLPA 4Z89A 2L2PA 1E7OA 2KE9A 2QDLA 2JMCA 4JJBA 5I22A 3REAB 4J9HA 2LJ1A 1K0XA 1H3HA 1OOTA 3UA7A 2CT4A 2K7AA 4D8DA 1HJDA 2AZVA 2CDTA 1SSHA 3M0PA 3VS1A 1ABQA 2KEAA 2FPEA 3VS7A 1ARKA 4EIKA 1I1JA 2DL8A 2GGRA 3PE0A 2SRCA 1H92A 2GTJA 2DL3A 2MIOA 2EKHA 2KYMA 2KGTA 3VS4A 3ZL7C 1RLPC 1ZBJA 2GNCA 2LZ6B 2D0NA 1X69A 1BK2A 1SEMA 1OV3A 3ULRB 1K1ZA 4ZNXA 2MCNA 3TSWA 1X6GA 2A08A 4KRTA 1EFNA 1T3LA 2DL4A 2FEIA 1M3BA 2JM8A 2EVRA 1YWOA 2O9SA 3H0HA 2RPNA 4JJDA 1QLYA 1SHFA 4RTUA 1VYVA 2AZSA 2HSPA 2K79A 3C0CA 1CKAA 2EGAA 1RUWA 1UE9A 2KBTA 3I35A 5EC7A 1M27C 4IIMA 2CUBA 4AFUC 1YP5A 2RMOA 1AWXA 2DF6A 2OI3A 1AWWA 5IHKA 2O9VA 3EG2A 2D1XA 4J9EA 1W1FA 2GTOA 2DBMA 2X3WD 5FWBA 3VS0A 1GBRA 2OAWA 4JZ3A 5GJWB 4HVVA 1XOVA 2DA9A 2CT3A 1K0SA 1M30A 1VYUA 4LUEA 1E6GA 1UHCA 2DX1A 1WFWA 3TSZA 1Z9QA 2ENMA 4LNPA 4CC7A 4JPBW 1AVZC 2C0OA 2VVKA 1AEYA 1GCPA 2FPDA 2EBPA 4GLMA 5FW9A 2YUOA 2F2VA 4J9BA 1NYFA 1GBQA 3EG3A 4RTYA 2FO0A 2DYBA 2FG0A 2J6OA 4J9IA 2L0AA 2OJ2A 3LH5A 1TUDA 2FPFA 4JZ4A 2EYXA 4Z8AA 2LJ3A 1JQQA 2J05A 2BZYA 2DNUA 3R6NA 1W70A 2F2XA 4AG2C 2VWFA 2JM9A 2KXCA 2RQRA 1ZSGA 3VRYA 2O88A 1PRLC 1X27A 1KFZA 1U3OA 1TG0A 5IH2A 2PZ1A 4Z88A 3EG0A 1GFCA 2MOXA 1ZUKA 1SRMA 2JMAA 1B3QA 1YCSB 1GCQC 1UJ0A 1QKWA 2JTEA 2DVJA 4LE9A 3M0TA 2KROA 1MUZA 2H8HA 2KRSA 1SPKA 1WYXA 4RTWA 1YN8A 2ROLA 4QT7A 2LCSA 2W10A 1UTIA 4CC4B 1UJYA 1KSWA 1QWFA 3EHQA 2CH4A 5I11A 2KRMA 2RNAA 1PWTA 1FMKA 1X2QA 2L3PA 2PTKA 1Y57A 1PHTA 2YUPA 2DE0X 4OMNA 3QWYA 1ZLMA 2P4RA 5HCKA 3I5SA 4FSSA 2J7IA 3UF4A 1KIKA 1W6XA 2XMFA 2RQTA 4F16A 3VS3A 1G83A 2EYWA 2LQNA 1AWJA 2FRWA 3IQLA 4GBQA 2LQWA 3M0SA 3SEMA 2K9GA 1OPKA 2PNIA 1V1CA 1UHFA 1NLPC 2K3BA 1JO8A 2LX7A 1HSQA 1WA7A 2X3XD 2IIMA 4J9GA 2DJQA 1AZGB 1X6BA 1ZX6A 2CSQA 3H0FA 1LCKA 1NM7A 2YUQA 1NLOC 1JXMA 2JW4A 2ROTA 4J9CA 1BBZA 1I07A 1UG1A 2DBKA 2F2WA 1WLPB 2A36A 2KR3A 4X1VA 3REBB 1CKBA 1UFFA 2A37A 2ED0A 2YT6A 3RNJA 1E6HA 1G2BA 1BU1A 2JT4A 3UATA 3U23A 1X2KA 1Y0MA 3PVLA 4R0KA 2CSIA 1PRMC 2GQIA 1AWOA 4AFSC 2EGEA 1YWPA 1HD3A 4CC2A 4F14A 2LJ0A 2RQUA 3VS2A 2AK5A 1J3TA 1GRIA 2D8HA 3NMZC 3NGPA 1CSKA 1JU5C 5ECAA 2W0ZA 1SRLA 3VRZA 1UUEA 1WXUA 2A28A 1B07A 2BZ8A 2AKLA 2YUNA 5IXBA 4LUDA 1GCQA 4DEXA 4HCKA 2M51A 2J6FA 2DILA 3FJ5A 2DRKA 2O2OA 4AFQC 1UECA 2DMOA 3O5ZA 3M0UA 1GL5A 4RTVA 1IO6A 1K9AA 2JXBA 2L3SA 1U5SA 2FRYA 1WXTA 2J6KA 2HCKA
chains in the Genus database with same CATH superfamily
3VS6A 3CPWS 1AOJA 1LPLA 3A8HB 4KH0B 1MV3A 1D0YA 4Y92A 3TVTA 4M78B 4IUPA 3PVQA 3L42A 1MNDA 2HDAA 1VQOA 3L2ZA 4A54A 2JJ9A 5LJ5h 3OYJA 3A1PA 3M9QA 1H8KA 1Y96A 1YCYA 2K5IA 2A7YA 2EQJA 5J39A 1EX4A 3OYNA 1BI1A 1OPLA 3OS2A 3M55A 3H6ZA 1B34A 5GANg 3MJXA 3CC4A 3EFOA 3CC7A 4XTZA 3M0QA 2LNVA 1S1NA 2DEQA 1VQ4T 4C5IA 5GAMd 3I56A 2DXUA 4M7AF 1OZ2A 3LGLA 1MHNA 4RTXA 1M8VA 2QGGA 2JS2A 2ZAEA 2GF7A 1UGVA 4A4HA 4XU3A 2HSEB 2WSFE 4KGZB 3CCUA 1PD1A 2HBWA 3RMQA 2VB6A 3X20B 1VUBA 4E7KA 3CCRQ 2OX7A 3QJYA 1VA7A 5CKFA 2NUPB 2KNBB 1M1GA 4RCCA 4OB3B 3S3NA 4JJNK 2RK2A 1D0XA 1VQ9Q 3CMAA 1SSFA 4QQ6A 2CP5A 3PGGA 1T3SA 4A63B 4PJOC 2QXFA 1Z9ZA 2YSQA 1RI9A 1ZUYA 3PIPA 4RTZA 4OB1B 1AZEA 2HEQA 2C0TA 4BD3A 3ZFJA 3H41A 3I55T 2YXYA 3HTRA 1UB4A 4C0GA 1YJ9A 3H0IA 3OYDA 4HXJA 4J9DA 3CC2A 2G3RA 2LMJA 1I0CA 4L6V5 4LDUA 1G5VA 2YWWA 3AHUA 1M2VB 2QG9B 1A0NB 2VYTA 1YI2Q 1TTHB 1VIFA 3VS5A 1KHCA 2J06A 4NOYA 3QKJA 2YDLA 3CCEQ 1JRIA 2KRNA 2K2VA 4BDZA 2CGHA 5IHIA 1OU9A 2DLPA 2KMTA 2RHZA 4Z89A 1E7OA 2LRQA 3M4YA 2CZ6B 3LWIA 4A4FA 3JB9J 2COYA 3GNFB 3SFMA 1V29B 2RJFA 4EDUA 1ABQA 2F1LA 3VUBA 1IXDA 4QVDA 3E19A 1M90C 3VS7A 5CK9A 3M5AA 2X4JA 1KQ1A 3GPLA 1H92A 4A4GA 1W4SA 4FIBA 2X51A 2FL7A 3FLGA 3V8KA 2DZCA 2COWA 1RLPC 2QGFB 5KCHA 4KULA 8AT1B 2ZPEB 1X69A 2QI2A 1BK2A 5KYNA 4PJNA 1WQ7A 3ULRB 1S72Q 2X9HA 1X6GA 2QQAA 4BY6C 1EFNA 1ZSZB 3X24B 2I2LA 5GAOn 5CCAA 3G7ZA 2RPNA 3JCMQ 4PJOA 2YLCA 1D1AA 1IHVA 2AZSA 3C0CA 3CCST 5GAOl 2FB7A 3N5BB 3DB4A 1Q86R 2V8KA 3TREA 1M4ZA 5GAN6 1IHWA 5IHKA 5C6SA 1QVGA 3CC7T 1YJWA 4J9EA 1QVGS 3VS0A 5FWBA 3EFSA 3V7RA 4HVVA 1K0SA 3QHSA 4LUEA 1E6GA 4JRPA 4MDWA 4UC4A 2RHXA 4V2SA 3CCUT 2EBPA 4B6MA 3MEUA 2QEXT 4P5NA 4KUIA 4LD9K 1WHHA 1H3ZA 2CZ1B 4PJJA 2FHDA 4PFOA 3LW5E 2DYBA 1WJRA 4KUDK 3OA6A 2E3IA 1OU8A 4ZGJB 4RKUE 3OYBA 3OB9A 4Z8AA 1OULA 4C8QG 1YI2A 3GF5A 3QDFA 3HP9A 3OW2A 1VQ4Q 3CMAT 3OW2S 3NTHA 1RAHB 3MP6A 1X27A 2RA2A 2PZ1A 1BCMA 2RHUA 1GFCA 5D6YA 3J7AF 1KC8R 2E12A 4MZTA 1YCSB 1GCQC 2XICA 1QKWA 4FT2A 4XTVA 1QW1A 1YJ9T 1Q86C 3P8HA 4FW2A 1U1TA 4F7UB 1WYXA 4RTWA 5D7UA 3HSBA 2HQEA 4QQDA 2HNIA 3CC2T 5KYYB 3UWNA 1N6AA 5GAN3 3VV0A 1VQ5T 2KQWA 1KQ2A 2CH4A 2KRMA 5FRNA 1JJ2S 4M7AG 5KE3A 1TS9A 3QWYA 4M75B 4MZMA 1Q7YR 3X28B 3CD6T 3I55Q 1W6XA 4M77C 5I21A 4JRQA 4BI4A 5DM7R 1G83A 3M4GA 3DLLA 1AWJA 2FRWA 1WJSA 4M7AB 3M0SA 4IUUA 5GAMe 1NLPC 4IKFA 2LX7A 1HYOA 1N9SA 2MMPA 4R55A 1WA7A 4M75D 1C0MA 4J9GA 3G1JA 5HK0A 1NLOC 3CCMA 3OY9A 4FYVB 4AT1B 1KC8C 3DLMA 1VQKT 2QTXA 2RK1A 3CCLA 4X1VA 3REBB 3PTAA 2ED0A 2YT6A 3QIIA 2E6ZA 1G2BA 4QVCA 1BU1A 3UATA 3KXTA 1X2KA 1Y0MA 3PVLA 2CSIA 2KY9A 1PRMC 5CR2A 1AWOA 4CC2A 4X34A 1SF9A 2XDDA 2LJ0A 3C94A 2BUDA 1PSEA 1K9MU 2E10A 1GRIA 5LJ3g 3H9NA 4J83A 4KGVB 1Q7YC 1UEBA 2DFUA 4AMCA 3QPHA 3NTKA 1VQLT 2RJEA 2HD0A 2AKLA 5GAN5 1GCQA 4DEXA 2FZGB 2ZPBB 4HCKA 2JNGA 2DILA 2QQRA 3FJ5A 1YJWT 1R77A 3M0UA 4C8QC 1VOMA 1C1AA 3GLXA 2PU9B 2L3SA 2FRYA 1YITA 1X75C 4WTOB 5GMKm 2HAXA 3SB2A 2L3QA 5EG2A 4JUVA 4BI8B 2LCLA 2GQVA 3RBBB 5GANe 5FU6C 2DK3A 4ZGEB 2M1HA 3CCSQ 4OMOA 2DKGA 1I8FA 4GY5A 4RG2A 3M56A 4KGXB 4M77A 2CH4W 1NEBA 1VQ8T 2EQUA 5GAMh 4J9FA 3RMSA 4RTTA 2NWMA 3CC7Q 3M0RA 4BDYA 2LT1A 3OYAA 4ZN1A 1T0HA 3TCJA 2C0IA 3I55A 1TH7A 1VQMT 4C92C 4F7UE 4QW2A 3CCUQ 4DEYA 1ZUUA 2BZXA 1NEGA 2QEXQ 2RQWA 4J5YA 4XU1A 2C06A 1K9MR 1TUCA 1QKXA 1SHGA 3UA6A 3MPUB 2FYKA 4BACA 1XTDA 3P8DA 1JXOA 2ZPHB 1UDLA 4C0DB 4M75E 3CXCP 5HK3A 3MEVA 3F70A 5LJ3d 1MV0B 1WZOA 3G6EA 3PMIA 4RUGA 3CMAQ 9ATCB 4AG1C 3G71A 2CREA 3CPWP 3S6WA 3GIBA 1WXBA 3HPWA 3BDUA 1U06A 3EGDA 3URGA 2DRMA 4PJMA 2GCXA 2M02A 1OEBA 2ABLA 4LDVA 1M3CA 1YJ9Q 2RQVA 1MNEA 2D6FA 3WVDB 1M5Q1 4HA8A 1NPPA 4HT8A 2NUZA 2VUBA 5LL6S 5IHNA 3CC2Q 4IIOA 3MKDA 2CP7A 4FM4B 1ABOA 1VQ5Q 3EHRA 1PM3A 2GBQA 2DTHA 1SG5A 3QYGB 1WHKA 4QQGA 1T0JA 1YNZA 1N27A 1YJNA 2IPOB 4FYWB 4C8QA 4M7DB 2KXDA 2RF0A 5GANh 5LJ3f 3CCMT 1XNIA 3GBQA 3NPFA 3CD6Q 1IB8A 3SWNB 2YRVA 3A98A 2NUTB 4CC3A 2R57A 3CCLT 1W2BA 4IUVA 4E7LA 4DA4A 1C6VX 1M90U 2P0KA 4ORZA 1W2BS 4ATOA 4F04B 4F7UF 5L23A 3ZEHA 4DBFA 4NL3A 2HQHA 1WHJA 2KK4A 5KYXA 2E70A 3NFCA 1TXQA 1FYNA 3CBPA 4PJOD 2LC4A 3META 5GAOr 1JB0E 2KE9A 5C0MA 4M7DD 1VIEA 5KYUA 1QCOA 2JMCA 3X26B 4J6YA 1K0XA 4FYXB 3HHTB 1H3HA 4M75F 3CCSA 2CT4A 4E7JA 1HJDA 2CDTA 3PIOA 1KD1C 3M0PA 1RAAB 4C92A 3KBGA 1G3YA 1VQKQ 2V8IA 3VJPA 1I1JA 2DL8A 1QCNA 4GLKA 2JVVA 3OYFA 4XTXA 5AT1B 2KGTA 2VC8A 2O4XB 3ZBDA 1ZBJA 2GNCA 2CYZB 3RDVA 1MGQA 2ZPGB 2QEXA 1KK7A 2QAZA 4ZNXA 1YITT 4XU0A 4KRTA 4EMKB 1UGRB 1RAEB 2DL4A 2Y4YA 2EVRA 1VQLQ 3H0HA 2YLBA 1BIBA 2HBPA 1RADB 4A53A 2EGAA 2JTMA 2KBTA 3I35A 2CZ7B 4IIMA 3QUIA 2CUBA 5GMKe 4AFUC 1YJWQ 1AWXA 3MCAB 1M90R 5LJ5g 3OYCA 3EG2A 2GTOA 5GAMf 2X3WD 5FROA 1GBRA 5GJWB 2DA9A 4LXCA 1PC0A 1M30A 1VYUA 4JLIA 2E41A 2HKQB 1NZ9A 4JPBW 1AVZC 2DTOA 2C0OA 3EGXB 2VVKA 1AEYA 5GAMj 4GLMA 2YUOA 2FZCB 1VQ5A 1NYFA 3EG3A 3CMEA 5D6WA 2FO0A 1OI1A 4J9IA 5M9OA 4EMHA 1VQ8Q 1EIFA 3SWNC 4FW1A 2AIRB 2FPFA 1Q86U 3G6ET 3QYHB 1JQQA 5FU7B 3G71T 2XK0A 1NBEB 2QQ9A 3CD6A 4BI3A 5GAN4 1Q81R 3JCMV 1VQMQ 4AG2C 5GANd 2VWFA 3R6OA 2KXCA 2VXEA 4M78C 5CKDA 2O88A 4PK4A 1PD0A 1TG0A 3TEEA 1VQ6A 3UT1A 3EG0A 2FVUA 1ZUKA 4PJOE 2DXTA 3OYYA 4A4EA 2LTOA 3HKSA 1D3BA 4BE1A 4M7DE 2JTEA 2DVJA 1YIJA 3L2QA 3M0TA 2H8HA 3M53A 1SPKA 1YN8A 3LWHA 2LCSA 1OX8A 2W10A 1U8RA 1FMWA 2RI5A 1QVGP 1YJNT 1VQKA 1PCXA 1PWTA 1X2QA 1LJOA 2PTKA 2ATCB 3CBOA 1D1BA 2DJZA 3FIFA 4N4GA 4X9CA 3A8LB 1ZA1B 1R0BG 2J7IA 5GANf 5GMKh 1KIKA 2QQSA 4JS5A 1KC8U 4PFPA 1M9SA 3CCQT 2VGNA 2OTJA 2MYSA 2QTVA 3OYGA 3MEWA 5GANj 2RJDA 4XK8E 1V1CA 1Q81C 1VQLA 5A0DA 3T9NA 1HSQA 2P0PA 3BW1A 3TU4K 3A8GB 2IIMA 3PT9A 1FMVA 2CP0A 1ZX6A 3CCMQ 4FT4A 2YUQA 4QVZA 1WJQA 2E6NA 2JW4A 3CCLQ 4PLLA 4J9CA 1Q7YU 4QKUA 2DBKA 2F2WA 4BE2A 4ZGDB 5LJ3e 1K8AR 2L3RA 4LD6A 4MMKA 3U23A 4PJOF 2GQIA 2WACA 3V7CA 2HKNA 2EGEA 1JJ2P 4M7DF 2EWNA 4M77D 5GAOm 3G4ST 3RKYA 1WHLA 2RQUA 3VS2A 2AK5A 1J3TA 4B9XA 3CEYA 4XTYA 2VV5A 1VQ8A 1EZZB 4M78A 4RMOA 2D8HA 3JB9H 1AT1B 1Q95G 1JU5C 3EFRA 1TWBA 2RJCA 3OS1A 4F7UG 3VRZA 1UUEA 1O9SA 2K4YA 1VQMA 1IGUA 3QDRB 4LDXA 3EG9B 3FRNA 3QSUA 3WXMB 2F5KA 2O2OA 2EQKA 2PUOB 1YITQ 4WF2A 2JXBA 1U5SA 4M75G 3JCMP 1OX9A 2J6KA 4Q5WA 3E9GA 4XAXB 2HCKA 1IZ6A 1F1BB 4OMLA 3RESA 1G3SA 1VQNT 4ZN3A 1JEGA 3OYKA 5CQYA 4YTLA 2V1QA 4OVAA 4DQ2A 5FWCA 2ECZA 4AFZC 3CMET 5DLOA 1BIAA 3NTIA 4IUTA 3SDZA 4NL2A 1K8AC 1YFNA 2K2MA 2CUDA 4ESRA 3JCMg 2G6FX 1ACMB 2O31A 3C95A 1UGSB 2NUPA 4C5GA 3HFNA 3L2WA 4KH1B 1ZSZC 3NHNA 1NG2A 1OQKA 2KYBA 1D1CA 4JDSA 1VYTA 1M1FA 1GFDA 1PNJA 2VKNA 4PLIA 1VQ6T 2KDSA 1BI2A 2DPPB 3L2UA 8ATCB 1IREB 1BI3A 5LJ3h 3J81E 2A0FB 1RLQC 2DXCA 4BUGA 2R58A 1YIJT 3JRZA 1IRXA 2E5KA 1MMGA 2QK0A 1WDXA 3UDCA 1M2OA 4DBQA 3G6EQ 3AT1B 1Y96B 2DEUA 1PKTA 3I5RA 3G71Q 2HL5C 4DOWA 4WCIA 1KJWA 1B34B 2EKOA 2M0YA 1MMDA 4DBRA 1Y71A 1I5OB 4JS4A 3EFOB 3QO3A 1BB9A 5CAIA 1Y07A 3KUFA 4F17A 1M8MA 1M2VA 3KFVA 5J3BA 1QP2A 2KT8A 4E6RA 2K6DA 1K4US 1I81A 3FJPA 2DL5A 2H3EB 1OYXA 1WI7A 2KAFA 2EAYA 2OTJT 4OMQA 4C92D 4J6WA 2EGCA 2K5FA 2LP5A 1YHQA 4Z02A 1M3AA 2EPDA 2PVDB 1YJNQ 1X01A 2X4YA 3EH2A 5DY9A 1RAFB 2P84A 4KT0E 3OYHA 5GMKj 3JCMX 1DJ7B 1KQSA 4OMPA 4O6JA 2HQXA 3EG1A 5I2SA 1X43A 1KQSS 2M9UA 2ESWA 4BB7A 3JCMd 2DD4A 1KD1U 1ZBXA 4HVWA 1N5ZA 2K3YA 4LN2A 5CKEA 2RO0A 1Q82R 2SEMA 1VQPA 1KG1A 1AD5A 4EMGA 3CCJT 3CCQQ 1PSFA 2NYSA 5GJVB 2DL7A 4HKEA 3JB9D 2VGMA 5IXFA 5CO7A 2L2PA 4N4HA 2QDLA 4ZTFA 4J9HA 2LJ1A 1TU0B 4M75C 3RUXA 1ZSZA 1VQ7A 1QVPA 1SSHA 3JCMc 3PNWC 1AHJB 2GGRA 2SRCA 2DL3A 2MIOA 3QG1A 3VS4A 4M7AC 2MWPA 4PJLA 3QXEB 2RM4A 4JRKA 3FB9A 3JCMf 4IURA 1SEMA 3C4SA 1OV3A 4XQ3A 2ZCFB 3G4SQ 4J7FA 2M0OA 3UPUA 4M77F 2MWOA 1T3LA 1M1KC 3ME9A 4C5EA 2JM8A 1N9RA 3VYHB 1YWOA 2O9SA 4BE0A 3Q1JA 2QA4T 4RTUA 1Q82C 2LT4A 1RUWA 1UE9A 2OTLT 2DD5A 5IN1A 1M27C 2JTFA 4PJOG 3OYLA 1KD1R 2RMOA 1ZA2B 4M7DG 1TUGB 2O9VA 2X4WA 2D1XA 1W1FA 2DBMA 5AYFA 5HY6A 1Z9QA 1K73R 4CC7A 5CIUA 2JOYA 2XKOC 4C92E 1GCPA 2MI6A 3CMEQ 3MP8A 4PJOB 4J8OA 4J9BA 1GBQA 3E2UA 4E7ZA 2FG0A 2Z0WA 2L0AA 4OGEA 4XTWA 1HK9A 4F7UA 3RKXA 2MF2A 1GXIE 5KYYA 2R5MA 2EYQA 3R6NA 4HCBA 2H3JA 1QVFA 2E64A 4EPCA 4J7IA 4CRIA 2JM9A 2RQRA 2V26A 5LJ3j 3VRYA 1QVFS 1PRLC 5I2MA 1VQ6Q 1RL2A 2E3HA 1U3OA 1MMNA 4M75A 1LOJA 3CXCA 3CCQA 2DTIA 3MHXA 1FWZA 3RIRA 4PNOA 4N0AC 1YIJQ 1G3TA 1SRMA 2WSEE 1NE8A 4J6XA 1YHQT 3LH0A 1MUZA 2KRSA 4D6WA 4E7SA 5IAYA 4M7AA 4XTUA 3CBMA 1UJYA 1NJIR 1KSWA 2QQBA 2QYZA 3EHQA 3TQ7P 2R5AA 4C0FA 5I11A 2RNAA 3E1SA 3OMGA 1Y57A 1PHTA 1Q81U 2YUPA 4OMNA 4OP0A 5FLXE 1K73C 1N8RR 3I5SA 3CCVT 2VASA 5IT9E 2HMAA 3LGFA 4HCCA 3UF4A 1VQPT 2XMFA 3OMCA 4C0DC 7AT1B 3DB3A 4LDYA 4F16A 2OTJQ 4M78D 3G4SA 2LQNA 1WHGA 3HL8A 3IQLA 4C92F 3SEMA 2K9GA 5GAOq 2PNIA 1UHFA 2K3BA 5CKHA 2X3XD 1VQ7T 3VU3C 2DJQA 1AZGB 1X6BA 2LVMA 1LCKA 2CP2A 4BY6B 5A0GA 2CKKA 2IG0A 1BBZA 2MPXC 1UG1A 2PVOB 3WVEB 3CCJQ 2DVEA 1WLPB 2KR3A 4FYYB 3VKIA 2A37A 1I4K1 3QBYA 1NJIC 3JB9F 3BE3A 2JT4A 4ELYC 1VQNA 5CQXA 1RAGB 2RI3A 4R0KA 4M7DC 2XDPA 2DYIA 3OBYA 1HD3A 1Y7XA 2DERA 4F14A 2PQWA 2BE9B 4E47A 2IVWA 1N8RC 3J80E 1TOVA 1WGSA 3NMZC 3OSSC 3NGPA 4XU2A 4TVRA 5CVIA 3BFMA 1BYMA 1B07A 4N0AA 2BZ8A 4MMLA 1I5LA 2YUNA 3MEAA 5GAN8 1WQWA 3LYIA 2RI2A 2M51A 2J6FA 3QJ6A 1K8AU 3FEOA 4AFQC 1UECA 1FX7A 2DIQA 2EJGA 2D9TA 1GL5A 4RTVA 1IO6A 3OQ5A 1K9AA 3L1AA 1V76A 2K3XA 2E4HA 1TSFA 3JCMe 2QA4Q 3LLRA 3I9QA 2NLUA 2WSCE 4JJCA 1R0CB 2EJ9A 2EYYA 5GAN2 2OTLQ 3V7SA 1XQHA 4PL6A 3D7SB 4LDWA 1RI0A 3A8OB 3HFOA 3QZ5B 3SD4A 1QCFA 3CQTA 1QWEA 4EMKC 3C12A 2LNHB 4DBHA 3S3MA 5LJ5d 4M77G 4RCBA 4B9WA 4C0ZA 2PVGB 2XI9A 2LDMA 1WNLA 2KSSA 2K5LA 2O01E 4K11A 3HRSA 4M78E 3OS5A 4FL6A 3JAME 5KYWB 3GNGA 2KVQG 1ZQ1A 2JS0A 2V1RA 3OW2P 1BI0A 4JLGA 1PKSA 1UGQB 2B86A 3BY7A 4M77B 4JRIA 1LNXA 3THKA 2DO3A 4OMMA 1VQOT 2KT1A 2XU8A 3CCRA 3EH1A 1SKUB 1WIEA 2I0NA 4M4ZA 4M7DA 4D8KA 2RHIA 3CCJA 2D8JA 2VXFA 1VQ9A 2XIDA 1JBMA 3SWNA 1K76A 2MK5A 2NUTA 5LJ5f 3H8ZA 3CC4T 2ZGWA 3EGUA 3INZA 2XHCA 2EYZA 1WX6A 3VYGA 2BTTA 2P4TA 3I56T 1IGQA 2E65A 1YHQQ 4HT9A 6AT1B 2RN8A 5FU7C 1R8OB 5LJ5j 2LCCA 3M58A 3ASKA 3QWXX 3JCMh 2EW3A 3SHWA 3MO8A 4OF1A 3ER0A 3E9FA 3CCVQ 4HVUA 1BCOA 3EGDB 2EQIA 1NPRA 1ZHIA 2YHTA 4E7HA 2L5QA 1VQPQ 3PFSA 4ANJA 2O4XA 2AKKA 2CZ0B 2XG8D 3JV3A 4M78F 3RR6A 2X4XA 3CCEA 1NYGA 2XDBA 2Y4XA 4CI0C 2DM1A 5GAN7 3M54A 3OBWA 1G8XA 4JJBA 5I22A 2QA4A 3REAB 1VQ7Q 4EMKA 1OOTA 3UA7A 4C8QB 4PKCC 2K7AA 4D8DA 4NS5A 2OTLA 4FSXA 2AZVA 1P92A 3FC3A 3VS1A 2KEAA 4VUBA 2FPEA 2HZYA 1BKBA 3QZ9B 4EIKA 3GP8A 1M1KU 1ARKA 1O75A 2JZ2A 3PE0A 1JJ2A 1RABB 3OS0A 2GTJA 2RH2A 1XJWB 2EKHA 3BDLA 2KYMA 1G3WA 2F69A 3ZL7C 5FU6B 4C92G 3RKWA 1Q82U 5KYXB 2ZPIB 2L89A 2LZ6B 2CS7A 4X9DA 4OGCA 2D0NA 2LQKA 4C8QD 3DKMA 5KYUB 1D0ZA 1YBYA 1OZ3A 5KH6A 1K1ZA 4OMFB 2MCNA 2K57A 3TSWA 3V8JA 4DOVA 2XD0A 2A08A 1S72A 2FEIA 1M3BA 1KQSP 3EGXA 4C92B 4JJDA 2JN0A 1QLYA 1SHFA 2EFIA 1VYVA 2HSPA 2K79A 2HL3A 2P0QA 1CKAA 5EC7A 1B7TA 3JB9G 1YP5A 5A0LA 2YRCA 3VUZA 2DAQA 3S3OA 2DF6A 2OI3A 1AWWA 3JCMb 5HKCA 3O8VA 2BIVA 3M57A 2CP6A 2OAWA 4JZ3A 1H641 2DETA 3FDRA 1XOVA 2DIGA 2CT3A 4M7AD 1KHIA 3A8MB 1UHCA 4II1A 2DX1A 4M77E 2EQMA 1WFWA 3TSZA 4C5HA 3A5ZB 2ENMA 4LNPA 2MAMA 2COZA 4N4IA 3PMTA 2GFUA 2FPDA 5FW9A 2RD1A 3JB9I 5GAOp 2F2VA 3OYIA 4RTYA 2EIFA 2J6OA 4Y28E 2OJ2A 3LH5A 5GMKl 1TUDA 1M1KR 4ME7A 4Y91A 1RAIB 4JZ4A 2EYXA 3CCRT 2LJ3A 3CCVA 1QP3A 2BKDN 2J05A 2BZYA 2E5QA 2QDYB 2DNUA 1W70A 2F2XA 2BE7D 1ZSGA 2AHJB 5GMKi 1VQ4A 1VQ9T 2L8DA 3L2RA 4FU6A 1KFZA 3LX7A 4A4KA 3HRUA 5IH2A 3CPFA 4Z88A 1K73U 2LX9A 2MOXA 5D6XA 2PUKB 2JMAA 1B3QA 4PFZA 1UJ0A 2EJFA 3P8BB 4LE9A 2KROA 3RERA 2ROLA 3M59A 4QT7A 1UTIA 4CC4B 3GOXA 1VQOQ 1QWFA 3JCMJ 1LVKA 5KYWA 3MP1A 2Y90A 2E1HA 1FMKA 2L3PA 2DE0X 2KI7A 5HCKA 1ZLMA 2P4RA 2B8AA 4OB2B 3CC4Q 1YI2T 1U1SA 4FSSA 4HCZA 2DXBA 3I56Q 1PG5B 5KE2A 2GFAA 2DZ9A 2RQTA 4KBMB 1D3BB 4C8QE 3VS3A 4MDXA 4FCYA 3CCET 2OAUA 2EYWA 1RACB 2ZPFB 4GBQA 5L8RE 2LQWA 5LJ5e 1OPKA 1NJIU 1X6OA 1W2BP 1JO8A 1QVFP 2ZZDA 5CKBA 2X35A 2CSQA 3H0FA 1NM7A 3JCMW 1N8RU 1JXMA 4L5GA 1WHMA 2D0QB 2F5TX 2ROTA 3V8LA 3JSCA 2FZKB 1I07A 5GAMg 3OYMA 1FXXA 1WPYA 2A36A 3HRTA 5KCOA 1VQNQ 1CKBA 1UFFA 4L59A 4OB0B 3RNJA 3EG9A 1E6HA 4E7IA 3OYEA 4M7AE 5A2QE 2V8JA 3X25B 2RHYA 2AT1B 3EAEA 2JUFA 4AFSC 2LQ8A 1YWPA 4RG8A 4E2FB 3OSVA 1HXDA 5DLQE 5FRMA 1S72T 4ELZC 1MMAA 2CP3A 1UGPB 1CSKA 1D09B 5ECAA 2W0ZA 1SRLA 1WXUA 2M16A 2A28A 5J26A 4ZTJA 2RB6A 4M78G 1QQJA 5IXBA 4LUDA 2YRDA 4MZPA 1QMCA 3CXCS 4IUQA 2DRKA 3O5ZA 2DMOA 2QASA 1K9MC 4C8QF 3L2VA 4O5VA 3CPWA 1WXTA 4R56A 2A3LA 2ED1A
chains in the Genus database with same CATH topology
3VS6A 1AOJA 4OMLA 1MV3A 4Y92A 1JEGA 3TVTA 2L3QA 2V1QA 3PVQA 3I9QA 2HDAA 5FWCA 2ECZA 3RBBB 4AFZC 4JJCA 2EYYA 4OMOA 2CH4W 1NEBA 2K2MA 1H8KA 2CUDA 4ESRA 2G6FX 4J9FA 2O31A 4RTTA 1QCFA 3CQTA 2NWMA 1QWEA 1OPLA 3M0RA 2LNHB 1T0HA 3NHNA 1NG2A 3M0QA 1S1NA 2KYBA 2C0IA 1VYTA 1GFDA 1PNJA 2VKNA 4RTXA 4K11A 2JS2A 1UGVA 4DEYA 1ZUUA 2BZXA 1NEGA 2RQWA 1RLQC 2ED1A 2V1RA 2JS0A 1TUCA 1QKXA 1PKSA 1SHGA 3UA6A 2HBWA 2E5KA 2B86A 1JXOA 1UDLA 1WDXA 1PKTA 3THKA 3I5RA 1VA7A 4OMMA 1MV0B 2KT1A 4WCIA 1KJWA 2KNBB 4RUGA 1WIEA 2I0NA 2M0YA 4M4ZA 4AG1C 2CREA 4D8KA 1BB9A 4F17A 1M8MA 1WXBA 2D8JA 3KFVA 1T3SA 1U06A 4A63B 2KT8A 4E6RA 2DRMA 2K6DA 1K76A 1Z9ZA 2YSQA 1K4US 1RI9A 1ZUYA 4RTZA 2DL5A 1OEBA 1AZEA 2ABLA 2HEQA 1M3CA 1WI7A 2C0TA 3EGUA 3H41A 2EYZA 1WX6A 2RQVA 2BTTA 2NUZA 4OMQA 5IHNA 2RN8A 2EGCA 3H0IA 4IIOA 2LP5A 1M3AA 1ABOA 4HXJA 3EHRA 4J9DA 2EPDA 2LMJA 2GBQA 1I0CA 3QWXX 2EW3A 3SHWA 1T0JA 1YNZA 2KXDA 2RF0A 4OMPA 4HVUA 3GBQA 3EG1A 3NPFA 1A0NB 1X43A 2EQIA 2ESWA 3VS5A 3A98A 4HVWA 4CC3A 1N5ZA 2J06A 4LN2A 4ORZA 2YDLA 2SEMA 1AD5A 5L23A 2KRNA 2AKKA 3JV3A 5GJVB 2DL7A 1FYNA 1NYGA 5IXFA 5IHIA 2DM1A 2DLPA 4Z89A 2L2PA 1E7OA 2KE9A 2QDLA 2JMCA 4JJBA 5I22A 3REAB 4J9HA 2LJ1A 1K0XA 1H3HA 1OOTA 3UA7A 2CT4A 2K7AA 4D8DA 1HJDA 2AZVA 2CDTA 1SSHA 3M0PA 3VS1A 1ABQA 2KEAA 2FPEA 3VS7A 1ARKA 4EIKA 1I1JA 2DL8A 2GGRA 3PE0A 2SRCA 1H92A 2GTJA 2DL3A 2MIOA 2EKHA 2KYMA 2KGTA 3VS4A 3ZL7C 1RLPC 1ZBJA 2GNCA 2LZ6B 2D0NA 1X69A 1BK2A 1SEMA 1OV3A 3ULRB 1K1ZA 4ZNXA 2MCNA 3TSWA 1X6GA 2A08A 4KRTA 1EFNA 1T3LA 2DL4A 2FEIA 1M3BA 2JM8A 2EVRA 1YWOA 2O9SA 3H0HA 2RPNA 4JJDA 1QLYA 1SHFA 4RTUA 1VYVA 2AZSA 2HSPA 2K79A 3C0CA 1CKAA 2EGAA 1RUWA 1UE9A 2KBTA 3I35A 5EC7A 1M27C 4IIMA 2CUBA 4AFUC 1YP5A 2RMOA 1AWXA 2DF6A 2OI3A 1AWWA 5IHKA 2O9VA 3EG2A 2D1XA 4J9EA 1W1FA 2GTOA 2DBMA 2X3WD 5FWBA 3VS0A 1GBRA 2OAWA 4JZ3A 5GJWB 4HVVA 1XOVA 2DA9A 2CT3A 1K0SA 1M30A 1VYUA 4LUEA 1E6GA 1UHCA 2DX1A 1WFWA 3TSZA 1Z9QA 2ENMA 4LNPA 4CC7A 4JPBW 1AVZC 2C0OA 2VVKA 1AEYA 1GCPA 2FPDA 2EBPA 4GLMA 5FW9A 2YUOA 2F2VA 4J9BA 1NYFA 1GBQA 3EG3A 4RTYA 2FO0A 2DYBA 2FG0A 2J6OA 4J9IA 2L0AA 2OJ2A 3LH5A 1TUDA 2FPFA 4JZ4A 2EYXA 4Z8AA 2LJ3A 1JQQA 2J05A 2BZYA 2DNUA 3R6NA 1W70A 2F2XA 4AG2C 2VWFA 2JM9A 2KXCA 2RQRA 1ZSGA 3VRYA 2O88A 1PRLC 1X27A 1KFZA 1U3OA 1TG0A 5IH2A 2PZ1A 4Z88A 3EG0A 1GFCA 2MOXA 1ZUKA 1SRMA 2JMAA 1B3QA 1YCSB 1GCQC 1UJ0A 1QKWA 2JTEA 2DVJA 4LE9A 3M0TA 2KROA 1MUZA 2H8HA 2KRSA 1SPKA 1WYXA 4RTWA 1YN8A 2ROLA 4QT7A 2LCSA 2W10A 1UTIA 4CC4B 1UJYA 1KSWA 1QWFA 3EHQA 2CH4A 5I11A 2KRMA 2RNAA 1PWTA 1FMKA 1X2QA 2L3PA 2PTKA 1Y57A 1PHTA 2YUPA 2DE0X 4OMNA 3QWYA 1ZLMA 2P4RA 5HCKA 3I5SA 4FSSA 2J7IA 3UF4A 1KIKA 1W6XA 2XMFA 2RQTA 4F16A 3VS3A 1G83A 2EYWA 2LQNA 1AWJA 2FRWA 3IQLA 4GBQA 2LQWA 3M0SA 3SEMA 2K9GA 1OPKA 2PNIA 1V1CA 1UHFA 1NLPC 2K3BA 1JO8A 2LX7A 1HSQA 1WA7A 2X3XD 2IIMA 4J9GA 2DJQA 1AZGB 1X6BA 1ZX6A 2CSQA 3H0FA 1LCKA 1NM7A 2YUQA 1NLOC 1JXMA 2JW4A 2ROTA 4J9CA 1BBZA 1I07A 1UG1A 2DBKA 2F2WA 1WLPB 2A36A 2KR3A 4X1VA 3REBB 1CKBA 1UFFA 2A37A 2ED0A 2YT6A 3RNJA 1E6HA 1G2BA 1BU1A 2JT4A 3UATA 3U23A 1X2KA 1Y0MA 3PVLA 4R0KA 2CSIA 1PRMC 2GQIA 1AWOA 4AFSC 2EGEA 1YWPA 1HD3A 4CC2A 4F14A 2LJ0A 2RQUA 3VS2A 2AK5A 1J3TA 1GRIA 2D8HA 3NMZC 3NGPA 1CSKA 1JU5C 5ECAA 2W0ZA 1SRLA 3VRZA 1UUEA 1WXUA 2A28A 1B07A 2BZ8A 2AKLA 2YUNA 5IXBA 4LUDA 1GCQA 4DEXA 4HCKA 2M51A 2J6FA 2DILA 3FJ5A 2DRKA 2O2OA 4AFQC 1UECA 2DMOA 3O5ZA 3M0UA 1GL5A 4RTVA 1IO6A 1K9AA 2JXBA 2L3SA 1U5SA 2FRYA 1WXTA 2J6KA 2HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  1AOJ A;  4OML A;  1MV3 A;  4Y92 A;  1JEG A;  3TVT A;  2L3Q A;  2V1Q A;  3PVQ A;  3I9Q A;  2HDA A;  5FWC A;  2ECZ A;  3RBB B;  4AFZ C;  4JJC A;  2EYY A;  4OMO A;  2CH4 W;  1NEB A;  2K2M A;  1H8K A;  2CUD A;  4ESR A;  2G6F X;  4J9F A;  2O31 A;  4RTT A;  1QCF A;  3CQT A;  2NWM A;  1QWE A;  1OPL A;  3M0R A;  2LNH B;  1T0H A;  3NHN A;  1NG2 A;  3M0Q A;  1S1N A;  2KYB A;  2C0I A;  1VYT A;  1GFD A;  1PNJ A;  2VKN A;  4RTX A;  4K11 A;  2JS2 A;  1UGV A;  4DEY A;  1ZUU A;  2BZX A;  1NEG A;  2RQW A;  1RLQ C;  2ED1 A;  2V1R A;  2JS0 A;  1TUC A;  1QKX A;  1PKS A;  1SHG A;  3UA6 A;  2HBW A;  2E5K A;  2B86 A;  1JXO A;  1UDL A;  1WDX A;  1PKT A;  3THK A;  3I5R A;  1VA7 A;  4OMM A;  1MV0 B;  2KT1 A;  4WCI A;  1KJW A;  2KNB B;  4RUG A;  1WIE A;  2I0N A;  2M0Y A;  4M4Z A;  4AG1 C;  2CRE A;  4D8K A;  1BB9 A;  4F17 A;  1M8M A;  1WXB A;  2D8J A;  3KFV A;  1T3S A;  1U06 A;  4A63 B;  2KT8 A;  4E6R A;  2DRM A;  2K6D A;  1K76 A;  1Z9Z A;  2YSQ A;  1K4U S;  1RI9 A;  1ZUY A;  4RTZ A;  2DL5 A;  1OEB A;  1AZE A;  2ABL A;  2HEQ A;  1M3C A;  1WI7 A;  2C0T A;  3EGU A;  3H41 A;  2EYZ A;  1WX6 A;  2RQV A;  2BTT A;  2NUZ A;  4OMQ A;  5IHN A;  2RN8 A;  2EGC A;  3H0I A;  4IIO A;  2LP5 A;  1M3A A;  1ABO A;  4HXJ A;  3EHR A;  4J9D A;  2EPD A;  2LMJ A;  2GBQ A;  1I0C A;  3QWX X;  2EW3 A;  3SHW A;  1T0J A;  1YNZ A;  2KXD A;  2RF0 A;  4OMP A;  4HVU A;  3GBQ A;  3EG1 A;  3NPF A;  1A0N B;  1X43 A;  2EQI A;  2ESW A;  3VS5 A;  3A98 A;  4HVW A;  4CC3 A;  1N5Z A;  2J06 A;  4LN2 A;  4ORZ A;  2YDL A;  2SEM A;  1AD5 A;  5L23 A;  2KRN A;  2AKK A;  3JV3 A;  5GJV B;  2DL7 A;  1FYN A;  1NYG A;  5IXF A;  5IHI A;  2DM1 A;  2DLP A;  4Z89 A;  2L2P A;  1E7O A;  2KE9 A;  2QDL A;  2JMC A;  4JJB A;  5I22 A;  3REA B;  4J9H A;  2LJ1 A;  1K0X A;  1H3H A;  1OOT A;  3UA7 A;  2CT4 A;  2K7A A;  4D8D A;  1HJD A;  2AZV A;  2CDT A;  1SSH A;  3M0P A;  3VS1 A;  1ABQ A;  2KEA A;  2FPE A;  3VS7 A;  1ARK A;  4EIK A;  1I1J A;  2DL8 A;  2GGR A;  3PE0 A;  2SRC A;  1H92 A;  2GTJ A;  2DL3 A;  2MIO A;  2EKH A;  2KYM A;  2KGT A;  3VS4 A;  3ZL7 C;  1RLP C;  1ZBJ A;  2GNC A;  2LZ6 B;  2D0N A;  1X69 A;  1BK2 A;  1SEM A;  1OV3 A;  3ULR B;  1K1Z A;  4ZNX A;  2MCN A;  3TSW A;  1X6G A;  2A08 A;  4KRT A;  1EFN A;  1T3L A;  2DL4 A;  2FEI A;  1M3B A;  2JM8 A;  2EVR A;  1YWO A;  2O9S A;  3H0H A;  2RPN A;  4JJD A;  1QLY A;  1SHF A;  4RTU A;  1VYV A;  2AZS A;  2HSP A;  2K79 A;  3C0C A;  1CKA A;  2EGA A;  1RUW A;  1UE9 A;  2KBT A;  3I35 A;  5EC7 A;  1M27 C;  4IIM A;  2CUB A;  4AFU C;  1YP5 A;  2RMO A;  1AWX A;  2DF6 A;  2OI3 A;  1AWW A;  5IHK A;  2O9V A;  3EG2 A;  2D1X A;  4J9E A;  1W1F A;  2GTO A;  2DBM A;  2X3W D;  5FWB A;  3VS0 A;  1GBR A;  2OAW A;  4JZ3 A;  5GJW B;  4HVV A;  1XOV A;  2DA9 A;  2CT3 A;  1K0S A;  1M30 A;  1VYU A;  4LUE A;  1E6G A;  1UHC A;  2DX1 A;  1WFW A;  3TSZ A;  1Z9Q A;  2ENM A;  4LNP A;  4CC7 A;  4JPB W;  1AVZ C;  2C0O A;  2VVK A;  1AEY A;  1GCP A;  2FPD A;  2EBP A;  4GLM A;  5FW9 A;  2YUO A;  2F2V A;  4J9B A;  1NYF A;  1GBQ A;  3EG3 A;  4RTY A;  2FO0 A;  2DYB A;  2FG0 A;  2J6O A;  4J9I A;  2L0A A;  2OJ2 A;  3LH5 A;  1TUD A;  2FPF A;  4JZ4 A;  2EYX A;  4Z8A A;  2LJ3 A;  1JQQ A;  2J05 A;  2BZY A;  2DNU A;  3R6N A;  1W70 A;  2F2X A;  4AG2 C;  2VWF A;  2JM9 A;  2KXC A;  2RQR A;  1ZSG A;  3VRY A;  2O88 A;  1PRL C;  1X27 A;  1KFZ A;  1U3O A;  1TG0 A;  5IH2 A;  2PZ1 A;  4Z88 A;  3EG0 A;  1GFC A;  2MOX A;  1ZUK A;  1SRM A;  2JMA A;  1B3Q A;  1YCS B;  1GCQ C;  1UJ0 A;  1QKW A;  2JTE A;  2DVJ A;  4LE9 A;  3M0T A;  2KRO A;  1MUZ A;  2H8H A;  2KRS A;  1SPK A;  1WYX A;  4RTW A;  1YN8 A;  2ROL A;  4QT7 A;  2LCS A;  2W10 A;  1UTI A;  4CC4 B;  1UJY A;  1KSW A;  1QWF A;  3EHQ A;  2CH4 A;  5I11 A;  2KRM A;  2RNA A;  1PWT A;  1FMK A;  1X2Q A;  2L3P A;  2PTK A;  1Y57 A;  1PHT A;  2YUP A;  2DE0 X;  4OMN A;  3QWY A;  1ZLM A;  2P4R A;  5HCK A;  3I5S A;  4FSS A;  2J7I A;  3UF4 A;  1KIK A;  1W6X A;  2XMF A;  2RQT A;  4F16 A;  3VS3 A;  1G83 A;  2EYW A;  2LQN A;  1AWJ A;  2FRW A;  3IQL A;  4GBQ A;  2LQW A;  3M0S A;  3SEM A;  2K9G A;  1OPK A;  2PNI A;  1V1C A;  1UHF A;  1NLP C;  2K3B A;  1JO8 A;  2LX7 A;  1HSQ A;  1WA7 A;  2X3X D;  2IIM A;  4J9G A;  2DJQ A;  1AZG B;  1X6B A;  1ZX6 A;  2CSQ A;  3H0F A;  1LCK A;  1NM7 A;  2YUQ A;  1NLO C;  1JXM A;  2JW4 A;  2ROT A;  4J9C A;  1BBZ A;  1I07 A;  1UG1 A;  2DBK A;  2F2W A;  1WLP B;  2A36 A;  2KR3 A;  4X1V A;  3REB B;  1CKB A;  1UFF A;  2A37 A;  2ED0 A;  2YT6 A;  3RNJ A;  1E6H A;  1G2B A;  1BU1 A;  2JT4 A;  3UAT A;  3U23 A;  1X2K A;  1Y0M A;  3PVL A;  4R0K A;  2CSI A;  1PRM C;  2GQI A;  1AWO A;  4AFS C;  2EGE A;  1YWP A;  1HD3 A;  4CC2 A;  4F14 A;  2LJ0 A;  2RQU A;  3VS2 A;  2AK5 A;  1J3T A;  1GRI A;  2D8H A;  3NMZ C;  3NGP A;  1CSK A;  1JU5 C;  5ECA A;  2W0Z A;  1SRL A;  3VRZ A;  1UUE A;  1WXU A;  2A28 A;  1B07 A;  2BZ8 A;  2AKL A;  2YUN A;  5IXB A;  4LUD A;  1GCQ A;  4DEX A;  4HCK A;  2M51 A;  2J6F A;  2DIL A;  3FJ5 A;  2DRK A;  2O2O A;  4AFQ C;  1UEC A;  2DMO A;  3O5Z A;  3M0U A;  1GL5 A;  4RTV A;  1IO6 A;  1K9A A;  2JXB A;  2L3S A;  1U5S A;  2FRY A;  1WXT A;  2J6K A;  2HCK A; 
#chains in the Genus database with same CATH topology
 3VS6 A;  3CPW S;  1AOJ A;  1LPL A;  3A8H B;  4KH0 B;  1MV3 A;  1D0Y A;  4Y92 A;  3TVT A;  4M78 B;  4IUP A;  3PVQ A;  3L42 A;  1MND A;  2HDA A;  1VQO A;  3L2Z A;  4A54 A;  2JJ9 A;  5LJ5 h;  3OYJ A;  3A1P A;  3M9Q A;  1H8K A;  1Y96 A;  1YCY A;  2K5I A;  2A7Y A;  2EQJ A;  5J39 A;  1EX4 A;  3OYN A;  1BI1 A;  1OPL A;  3OS2 A;  3M55 A;  3H6Z A;  1B34 A;  5GAN g;  3MJX A;  3CC4 A;  3EFO A;  3CC7 A;  4XTZ A;  3M0Q A;  2LNV A;  1S1N A;  2DEQ A;  1VQ4 T;  4C5I A;  5GAM d;  3I56 A;  2DXU A;  4M7A F;  1OZ2 A;  3LGL A;  1MHN A;  4RTX A;  1M8V A;  2QGG A;  2JS2 A;  2ZAE A;  2GF7 A;  1UGV A;  4A4H A;  4XU3 A;  2HSE B;  2WSF E;  4KGZ B;  3CCU A;  1PD1 A;  2HBW A;  3RMQ A;  2VB6 A;  3X20 B;  1VUB A;  4E7K A;  3CCR Q;  2OX7 A;  3QJY A;  1VA7 A;  5CKF A;  2NUP B;  2KNB B;  1M1G A;  4RCC A;  4OB3 B;  3S3N A;  4JJN K;  2RK2 A;  1D0X A;  1VQ9 Q;  3CMA A;  1SSF A;  4QQ6 A;  2CP5 A;  3PGG A;  1T3S A;  4A63 B;  4PJO C;  2QXF A;  1Z9Z A;  2YSQ A;  1RI9 A;  1ZUY A;  3PIP A;  4RTZ A;  4OB1 B;  1AZE A;  2HEQ A;  2C0T A;  4BD3 A;  3ZFJ A;  3H41 A;  3I55 T;  2YXY A;  3HTR A;  1UB4 A;  4C0G A;  1YJ9 A;  3H0I A;  3OYD A;  4HXJ A;  4J9D A;  3CC2 A;  2G3R A;  2LMJ A;  1I0C A;  4L6V 5;  4LDU A;  1G5V A;  2YWW A;  3AHU A;  1M2V B;  2QG9 B;  1A0N B;  2VYT A;  1YI2 Q;  1TTH B;  1VIF A;  3VS5 A;  1KHC A;  2J06 A;  4NOY A;  3QKJ A;  2YDL A;  3CCE Q;  1JRI A;  2KRN A;  2K2V A;  4BDZ A;  2CGH A;  5IHI A;  1OU9 A;  2DLP A;  2KMT A;  2RHZ A;  4Z89 A;  1E7O A;  2LRQ A;  3M4Y A;  2CZ6 B;  3LWI A;  4A4F A;  3JB9 J;  2COY A;  3GNF B;  3SFM A;  1V29 B;  2RJF A;  4EDU A;  1ABQ A;  2F1L A;  3VUB A;  1IXD A;  4QVD A;  3E19 A;  1M90 C;  3VS7 A;  5CK9 A;  3M5A A;  2X4J A;  1KQ1 A;  3GPL A;  1H92 A;  4A4G A;  1W4S A;  4FIB A;  2X51 A;  2FL7 A;  3FLG A;  3V8K A;  2DZC A;  2COW A;  1RLP C;  2QGF B;  5KCH A;  4KUL A;  8AT1 B;  2ZPE B;  1X69 A;  2QI2 A;  1BK2 A;  5KYN A;  4PJN A;  1WQ7 A;  3ULR B;  1S72 Q;  2X9H A;  1X6G A;  2QQA A;  4BY6 C;  1EFN A;  1ZSZ B;  3X24 B;  2I2L A;  5GAO n;  5CCA A;  3G7Z A;  2RPN A;  3JCM Q;  4PJO A;  2YLC A;  1D1A A;  1IHV A;  2AZS A;  3C0C A;  3CCS T;  5GAO l;  2FB7 A;  3N5B B;  3DB4 A;  1Q86 R;  2V8K A;  3TRE A;  1M4Z A;  5GAN 6;  1IHW A;  5IHK A;  5C6S A;  1QVG A;  3CC7 T;  1YJW A;  4J9E A;  1QVG S;  3VS0 A;  5FWB A;  3EFS A;  3V7R A;  4HVV A;  1K0S A;  3QHS A;  4LUE A;  1E6G A;  4JRP A;  4MDW A;  4UC4 A;  2RHX A;  4V2S A;  3CCU T;  2EBP A;  4B6M A;  3MEU A;  2QEX T;  4P5N A;  4KUI A;  4LD9 K;  1WHH A;  1H3Z A;  2CZ1 B;  4PJJ A;  2FHD A;  4PFO A;  3LW5 E;  2DYB A;  1WJR A;  4KUD K;  3OA6 A;  2E3I A;  1OU8 A;  4ZGJ B;  4RKU E;  3OYB A;  3OB9 A;  4Z8A A;  1OUL A;  4C8Q G;  1YI2 A;  3GF5 A;  3QDF A;  3HP9 A;  3OW2 A;  1VQ4 Q;  3CMA T;  3OW2 S;  3NTH A;  1RAH B;  3MP6 A;  1X27 A;  2RA2 A;  2PZ1 A;  1BCM A;  2RHU A;  1GFC A;  5D6Y A;  3J7A F;  1KC8 R;  2E12 A;  4MZT A;  1YCS B;  1GCQ C;  2XIC A;  1QKW A;  4FT2 A;  4XTV A;  1QW1 A;  1YJ9 T;  1Q86 C;  3P8H A;  4FW2 A;  1U1T A;  4F7U B;  1WYX A;  4RTW A;  5D7U A;  3HSB A;  2HQE A;  4QQD A;  2HNI A;  3CC2 T;  5KYY B;  3UWN A;  1N6A A;  5GAN 3;  3VV0 A;  1VQ5 T;  2KQW A;  1KQ2 A;  2CH4 A;  2KRM A;  5FRN A;  1JJ2 S;  4M7A G;  5KE3 A;  1TS9 A;  3QWY A;  4M75 B;  4MZM A;  1Q7Y R;  3X28 B;  3CD6 T;  3I55 Q;  1W6X A;  4M77 C;  5I21 A;  4JRQ A;  4BI4 A;  5DM7 R;  1G83 A;  3M4G A;  3DLL A;  1AWJ A;  2FRW A;  1WJS A;  4M7A B;  3M0S A;  4IUU A;  5GAM e;  1NLP C;  4IKF A;  2LX7 A;  1HYO A;  1N9S A;  2MMP A;  4R55 A;  1WA7 A;  4M75 D;  1C0M A;  4J9G A;  3G1J A;  5HK0 A;  1NLO C;  3CCM A;  3OY9 A;  4FYV B;  4AT1 B;  1KC8 C;  3DLM A;  1VQK T;  2QTX A;  2RK1 A;  3CCL A;  4X1V A;  3REB B;  3PTA A;  2ED0 A;  2YT6 A;  3QII A;  2E6Z A;  1G2B A;  4QVC A;  1BU1 A;  3UAT A;  3KXT A;  1X2K A;  1Y0M A;  3PVL A;  2CSI A;  2KY9 A;  1PRM C;  5CR2 A;  1AWO A;  4CC2 A;  4X34 A;  1SF9 A;  2XDD A;  2LJ0 A;  3C94 A;  2BUD A;  1PSE A;  1K9M U;  2E10 A;  1GRI A;  5LJ3 g;  3H9N A;  4J83 A;  4KGV B;  1Q7Y C;  1UEB A;  2DFU A;  4AMC A;  3QPH A;  3NTK A;  1VQL T;  2RJE A;  2HD0 A;  2AKL A;  5GAN 5;  1GCQ A;  4DEX A;  2FZG B;  2ZPB B;  4HCK A;  2JNG A;  2DIL A;  2QQR A;  3FJ5 A;  1YJW T;  1R77 A;  3M0U A;  4C8Q C;  1VOM A;  1C1A A;  3GLX A;  2PU9 B;  2L3S A;  2FRY A;  1YIT A;  1X75 C;  4WTO B;  5GMK m;  2HAX A;  3SB2 A;  2L3Q A;  5EG2 A;  4JUV A;  4BI8 B;  2LCL A;  2GQV A;  3RBB B;  5GAN e;  5FU6 C;  2DK3 A;  4ZGE B;  2M1H A;  3CCS Q;  4OMO A;  2DKG A;  1I8F A;  4GY5 A;  4RG2 A;  3M56 A;  4KGX B;  4M77 A;  2CH4 W;  1NEB A;  1VQ8 T;  2EQU A;  5GAM h;  4J9F A;  3RMS A;  4RTT A;  2NWM A;  3CC7 Q;  3M0R A;  4BDY A;  2LT1 A;  3OYA A;  4ZN1 A;  1T0H A;  3TCJ A;  2C0I A;  3I55 A;  1TH7 A;  1VQM T;  4C92 C;  4F7U E;  4QW2 A;  3CCU Q;  4DEY A;  1ZUU A;  2BZX A;  1NEG A;  2QEX Q;  2RQW A;  4J5Y A;  4XU1 A;  2C06 A;  1K9M R;  1TUC A;  1QKX A;  1SHG A;  3UA6 A;  3MPU B;  2FYK A;  4BAC A;  1XTD A;  3P8D A;  1JXO A;  2ZPH B;  1UDL A;  4C0D B;  4M75 E;  3CXC P;  5HK3 A;  3MEV A;  3F70 A;  5LJ3 d;  1MV0 B;  1WZO A;  3G6E A;  3PMI A;  4RUG A;  3CMA Q;  9ATC B;  4AG1 C;  3G71 A;  2CRE A;  3CPW P;  3S6W A;  3GIB A;  1WXB A;  3HPW A;  3BDU A;  1U06 A;  3EGD A;  3URG A;  2DRM A;  4PJM A;  2GCX A;  2M02 A;  1OEB A;  2ABL A;  4LDV A;  1M3C A;  1YJ9 Q;  2RQV A;  1MNE A;  2D6F A;  3WVD B;  1M5Q 1;  4HA8 A;  1NPP A;  4HT8 A;  2NUZ A;  2VUB A;  5LL6 S;  5IHN A;  3CC2 Q;  4IIO A;  3MKD A;  2CP7 A;  4FM4 B;  1ABO A;  1VQ5 Q;  3EHR A;  1PM3 A;  2GBQ A;  2DTH A;  1SG5 A;  3QYG B;  1WHK A;  4QQG A;  1T0J A;  1YNZ A;  1N27 A;  1YJN A;  2IPO B;  4FYW B;  4C8Q A;  4M7D B;  2KXD A;  2RF0 A;  5GAN h;  5LJ3 f;  3CCM T;  1XNI A;  3GBQ A;  3NPF A;  3CD6 Q;  1IB8 A;  3SWN B;  2YRV A;  3A98 A;  2NUT B;  4CC3 A;  2R57 A;  3CCL T;  1W2B A;  4IUV A;  4E7L A;  4DA4 A;  1C6V X;  1M90 U;  2P0K A;  4ORZ A;  1W2B S;  4ATO A;  4F04 B;  4F7U F;  5L23 A;  3ZEH A;  4DBF A;  4NL3 A;  2HQH A;  1WHJ A;  2KK4 A;  5KYX A;  2E70 A;  3NFC A;  1TXQ A;  1FYN A;  3CBP A;  4PJO D;  2LC4 A;  3MET A;  5GAO r;  1JB0 E;  2KE9 A;  5C0M A;  4M7D D;  1VIE A;  5KYU A;  1QCO A;  2JMC A;  3X26 B;  4J6Y A;  1K0X A;  4FYX B;  3HHT B;  1H3H A;  4M75 F;  3CCS A;  2CT4 A;  4E7J A;  1HJD A;  2CDT A;  3PIO A;  1KD1 C;  3M0P A;  1RAA B;  4C92 A;  3KBG A;  1G3Y A;  1VQK Q;  2V8I A;  3VJP A;  1I1J A;  2DL8 A;  1QCN A;  4GLK A;  2JVV A;  3OYF A;  4XTX A;  5AT1 B;  2KGT A;  2VC8 A;  2O4X B;  3ZBD A;  1ZBJ A;  2GNC A;  2CYZ B;  3RDV A;  1MGQ A;  2ZPG B;  2QEX A;  1KK7 A;  2QAZ A;  4ZNX A;  1YIT T;  4XU0 A;  4KRT A;  4EMK B;  1UGR B;  1RAE B;  2DL4 A;  2Y4Y A;  2EVR A;  1VQL Q;  3H0H A;  2YLB A;  1BIB A;  2HBP A;  1RAD B;  4A53 A;  2EGA A;  2JTM A;  2KBT A;  3I35 A;  2CZ7 B;  4IIM A;  3QUI A;  2CUB A;  5GMK e;  4AFU C;  1YJW Q;  1AWX A;  3MCA B;  1M90 R;  5LJ5 g;  3OYC A;  3EG2 A;  2GTO A;  5GAM f;  2X3W D;  5FRO A;  1GBR A;  5GJW B;  2DA9 A;  4LXC A;  1PC0 A;  1M30 A;  1VYU A;  4JLI A;  2E41 A;  2HKQ B;  1NZ9 A;  4JPB W;  1AVZ C;  2DTO A;  2C0O A;  3EGX B;  2VVK A;  1AEY A;  5GAM j;  4GLM A;  2YUO A;  2FZC B;  1VQ5 A;  1NYF A;  3EG3 A;  3CME A;  5D6W A;  2FO0 A;  1OI1 A;  4J9I A;  5M9O A;  4EMH A;  1VQ8 Q;  1EIF A;  3SWN C;  4FW1 A;  2AIR B;  2FPF A;  1Q86 U;  3G6E T;  3QYH B;  1JQQ A;  5FU7 B;  3G71 T;  2XK0 A;  1NBE B;  2QQ9 A;  3CD6 A;  4BI3 A;  5GAN 4;  1Q81 R;  3JCM V;  1VQM Q;  4AG2 C;  5GAN d;  2VWF A;  3R6O A;  2KXC A;  2VXE A;  4M78 C;  5CKD A;  2O88 A;  4PK4 A;  1PD0 A;  1TG0 A;  3TEE A;  1VQ6 A;  3UT1 A;  3EG0 A;  2FVU A;  1ZUK A;  4PJO E;  2DXT A;  3OYY A;  4A4E A;  2LTO A;  3HKS A;  1D3B A;  4BE1 A;  4M7D E;  2JTE A;  2DVJ A;  1YIJ A;  3L2Q A;  3M0T A;  2H8H A;  3M53 A;  1SPK A;  1YN8 A;  3LWH A;  2LCS A;  1OX8 A;  2W10 A;  1U8R A;  1FMW A;  2RI5 A;  1QVG P;  1YJN T;  1VQK A;  1PCX A;  1PWT A;  1X2Q A;  1LJO A;  2PTK A;  2ATC B;  3CBO A;  1D1B A;  2DJZ A;  3FIF A;  4N4G A;  4X9C A;  3A8L B;  1ZA1 B;  1R0B G;  2J7I A;  5GAN f;  5GMK h;  1KIK A;  2QQS A;  4JS5 A;  1KC8 U;  4PFP A;  1M9S A;  3CCQ T;  2VGN A;  2OTJ A;  2MYS A;  2QTV A;  3OYG A;  3MEW A;  5GAN j;  2RJD A;  4XK8 E;  1V1C A;  1Q81 C;  1VQL A;  5A0D A;  3T9N A;  1HSQ A;  2P0P A;  3BW1 A;  3TU4 K;  3A8G B;  2IIM A;  3PT9 A;  1FMV A;  2CP0 A;  1ZX6 A;  3CCM Q;  4FT4 A;  2YUQ A;  4QVZ A;  1WJQ A;  2E6N A;  2JW4 A;  3CCL Q;  4PLL A;  4J9C A;  1Q7Y U;  4QKU A;  2DBK A;  2F2W A;  4BE2 A;  4ZGD B;  5LJ3 e;  1K8A R;  2L3R A;  4LD6 A;  4MMK A;  3U23 A;  4PJO F;  2GQI A;  2WAC A;  3V7C A;  2HKN A;  2EGE A;  1JJ2 P;  4M7D F;  2EWN A;  4M77 D;  5GAO m;  3G4S T;  3RKY A;  1WHL A;  2RQU A;  3VS2 A;  2AK5 A;  1J3T A;  4B9X A;  3CEY A;  4XTY A;  2VV5 A;  1VQ8 A;  1EZZ B;  4M78 A;  4RMO A;  2D8H A;  3JB9 H;  1AT1 B;  1Q95 G;  1JU5 C;  3EFR A;  1TWB A;  2RJC A;  3OS1 A;  4F7U G;  3VRZ A;  1UUE A;  1O9S A;  2K4Y A;  1VQM A;  1IGU A;  3QDR B;  4LDX A;  3EG9 B;  3FRN A;  3QSU A;  3WXM B;  2F5K A;  2O2O A;  2EQK A;  2PUO B;  1YIT Q;  4WF2 A;  2JXB A;  1U5S A;  4M75 G;  3JCM P;  1OX9 A;  2J6K A;  4Q5W A;  3E9G A;  4XAX B;  2HCK A;  1IZ6 A;  1F1B B;  4OML A;  3RES A;  1G3S A;  1VQN T;  4ZN3 A;  1JEG A;  3OYK A;  5CQY A;  4YTL A;  2V1Q A;  4OVA A;  4DQ2 A;  5FWC A;  2ECZ A;  4AFZ C;  3CME T;  5DLO A;  1BIA A;  3NTI A;  4IUT A;  3SDZ A;  4NL2 A;  1K8A C;  1YFN A;  2K2M A;  2CUD A;  4ESR A;  3JCM g;  2G6F X;  1ACM B;  2O31 A;  3C95 A;  1UGS B;  2NUP A;  4C5G A;  3HFN A;  3L2W A;  4KH1 B;  1ZSZ C;  3NHN A;  1NG2 A;  1OQK A;  2KYB A;  1D1C A;  4JDS A;  1VYT A;  1M1F A;  1GFD A;  1PNJ A;  2VKN A;  4PLI A;  1VQ6 T;  2KDS A;  1BI2 A;  2DPP B;  3L2U A;  8ATC B;  1IRE B;  1BI3 A;  5LJ3 h;  3J81 E;  2A0F B;  1RLQ C;  2DXC A;  4BUG A;  2R58 A;  1YIJ T;  3JRZ A;  1IRX A;  2E5K A;  1MMG A;  2QK0 A;  1WDX A;  3UDC A;  1M2O A;  4DBQ A;  3G6E Q;  3AT1 B;  1Y96 B;  2DEU A;  1PKT A;  3I5R A;  3G71 Q;  2HL5 C;  4DOW A;  4WCI A;  1KJW A;  1B34 B;  2EKO A;  2M0Y A;  1MMD A;  4DBR A;  1Y71 A;  1I5O B;  4JS4 A;  3EFO B;  3QO3 A;  1BB9 A;  5CAI A;  1Y07 A;  3KUF A;  4F17 A;  1M8M A;  1M2V A;  3KFV A;  5J3B A;  1QP2 A;  2KT8 A;  4E6R A;  2K6D A;  1K4U S;  1I81 A;  3FJP A;  2DL5 A;  2H3E B;  1OYX A;  1WI7 A;  2KAF A;  2EAY A;  2OTJ T;  4OMQ A;  4C92 D;  4J6W A;  2EGC A;  2K5F A;  2LP5 A;  1YHQ A;  4Z02 A;  1M3A A;  2EPD A;  2PVD B;  1YJN Q;  1X01 A;  2X4Y A;  3EH2 A;  5DY9 A;  1RAF B;  2P84 A;  4KT0 E;  3OYH A;  5GMK j;  3JCM X;  1DJ7 B;  1KQS A;  4OMP A;  4O6J A;  2HQX A;  3EG1 A;  5I2S A;  1X43 A;  1KQS S;  2M9U A;  2ESW A;  4BB7 A;  3JCM d;  2DD4 A;  1KD1 U;  1ZBX A;  4HVW A;  1N5Z A;  2K3Y A;  4LN2 A;  5CKE A;  2RO0 A;  1Q82 R;  2SEM A;  1VQP A;  1KG1 A;  1AD5 A;  4EMG A;  3CCJ T;  3CCQ Q;  1PSF A;  2NYS A;  5GJV B;  2DL7 A;  4HKE A;  3JB9 D;  2VGM A;  5IXF A;  5CO7 A;  2L2P A;  4N4H A;  2QDL A;  4ZTF A;  4J9H A;  2LJ1 A;  1TU0 B;  4M75 C;  3RUX A;  1ZSZ A;  1VQ7 A;  1QVP A;  1SSH A;  3JCM c;  3PNW C;  1AHJ B;  2GGR A;  2SRC A;  2DL3 A;  2MIO A;  3QG1 A;  3VS4 A;  4M7A C;  2MWP A;  4PJL A;  3QXE B;  2RM4 A;  4JRK A;  3FB9 A;  3JCM f;  4IUR A;  1SEM A;  3C4S A;  1OV3 A;  4XQ3 A;  2ZCF B;  3G4S Q;  4J7F A;  2M0O A;  3UPU A;  4M77 F;  2MWO A;  1T3L A;  1M1K C;  3ME9 A;  4C5E A;  2JM8 A;  1N9R A;  3VYH B;  1YWO A;  2O9S A;  4BE0 A;  3Q1J A;  2QA4 T;  4RTU A;  1Q82 C;  2LT4 A;  1RUW A;  1UE9 A;  2OTL T;  2DD5 A;  5IN1 A;  1M27 C;  2JTF A;  4PJO G;  3OYL A;  1KD1 R;  2RMO A;  1ZA2 B;  4M7D G;  1TUG B;  2O9V A;  2X4W A;  2D1X A;  1W1F A;  2DBM A;  5AYF A;  5HY6 A;  1Z9Q A;  1K73 R;  4CC7 A;  5CIU A;  2JOY A;  2XKO C;  4C92 E;  1GCP A;  2MI6 A;  3CME Q;  3MP8 A;  4PJO B;  4J8O A;  4J9B A;  1GBQ A;  3E2U A;  4E7Z A;  2FG0 A;  2Z0W A;  2L0A A;  4OGE A;  4XTW A;  1HK9 A;  4F7U A;  3RKX A;  2MF2 A;  1GXI E;  5KYY A;  2R5M A;  2EYQ A;  3R6N A;  4HCB A;  2H3J A;  1QVF A;  2E64 A;  4EPC A;  4J7I A;  4CRI A;  2JM9 A;  2RQR A;  2V26 A;  5LJ3 j;  3VRY A;  1QVF S;  1PRL C;  5I2M A;  1VQ6 Q;  1RL2 A;  2E3H A;  1U3O A;  1MMN A;  4M75 A;  1LOJ A;  3CXC A;  3CCQ A;  2DTI A;  3MHX A;  1FWZ A;  3RIR A;  4PNO A;  4N0A C;  1YIJ Q;  1G3T A;  1SRM A;  2WSE E;  1NE8 A;  4J6X A;  1YHQ T;  3LH0 A;  1MUZ A;  2KRS A;  4D6W A;  4E7S A;  5IAY A;  4M7A A;  4XTU A;  3CBM A;  1UJY A;  1NJI R;  1KSW A;  2QQB A;  2QYZ A;  3EHQ A;  3TQ7 P;  2R5A A;  4C0F A;  5I11 A;  2RNA A;  3E1S A;  3OMG A;  1Y57 A;  1PHT A;  1Q81 U;  2YUP A;  4OMN A;  4OP0 A;  5FLX E;  1K73 C;  1N8R R;  3I5S A;  3CCV T;  2VAS A;  5IT9 E;  2HMA A;  3LGF A;  4HCC A;  3UF4 A;  1VQP T;  2XMF A;  3OMC A;  4C0D C;  7AT1 B;  3DB3 A;  4LDY A;  4F16 A;  2OTJ Q;  4M78 D;  3G4S A;  2LQN A;  1WHG A;  3HL8 A;  3IQL A;  4C92 F;  3SEM A;  2K9G A;  5GAO q;  2PNI A;  1UHF A;  2K3B A;  5CKH A;  2X3X D;  1VQ7 T;  3VU3 C;  2DJQ A;  1AZG B;  1X6B A;  2LVM A;  1LCK A;  2CP2 A;  4BY6 B;  5A0G A;  2CKK A;  2IG0 A;  1BBZ A;  2MPX C;  1UG1 A;  2PVO B;  3WVE B;  3CCJ Q;  2DVE A;  1WLP B;  2KR3 A;  4FYY B;  3VKI A;  2A37 A;  1I4K 1;  3QBY A;  1NJI C;  3JB9 F;  3BE3 A;  2JT4 A;  4ELY C;  1VQN A;  5CQX A;  1RAG B;  2RI3 A;  4R0K A;  4M7D C;  2XDP A;  2DYI A;  3OBY A;  1HD3 A;  1Y7X A;  2DER A;  4F14 A;  2PQW A;  2BE9 B;  4E47 A;  2IVW A;  1N8R C;  3J80 E;  1TOV A;  1WGS A;  3NMZ C;  3OSS C;  3NGP A;  4XU2 A;  4TVR A;  5CVI A;  3BFM A;  1BYM A;  1B07 A;  4N0A A;  2BZ8 A;  4MML A;  1I5L A;  2YUN A;  3MEA A;  5GAN 8;  1WQW A;  3LYI A;  2RI2 A;  2M51 A;  2J6F A;  3QJ6 A;  1K8A U;  3FEO A;  4AFQ C;  1UEC A;  1FX7 A;  2DIQ A;  2EJG A;  2D9T A;  1GL5 A;  4RTV A;  1IO6 A;  3OQ5 A;  1K9A A;  3L1A A;  1V76 A;  2K3X A;  2E4H A;  1TSF A;  3JCM e;  2QA4 Q;  3LLR A;  3I9Q A;  2NLU A;  2WSC E;  4JJC A;  1R0C B;  2EJ9 A;  2EYY A;  5GAN 2;  2OTL Q;  3V7S A;  1XQH A;  4PL6 A;  3D7S B;  4LDW A;  1RI0 A;  3A8O B;  3HFO A;  3QZ5 B;  3SD4 A;  1QCF A;  3CQT A;  1QWE A;  4EMK C;  3C12 A;  2LNH B;  4DBH A;  3S3M A;  5LJ5 d;  4M77 G;  4RCB A;  4B9W A;  4C0Z A;  2PVG B;  2XI9 A;  2LDM A;  1WNL A;  2KSS A;  2K5L A;  2O01 E;  4K11 A;  3HRS A;  4M78 E;  3OS5 A;  4FL6 A;  3JAM E;  5KYW B;  3GNG A;  2KVQ G;  1ZQ1 A;  2JS0 A;  2V1R A;  3OW2 P;  1BI0 A;  4JLG A;  1PKS A;  1UGQ B;  2B86 A;  3BY7 A;  4M77 B;  4JRI A;  1LNX A;  3THK A;  2DO3 A;  4OMM A;  1VQO T;  2KT1 A;  2XU8 A;  3CCR A;  3EH1 A;  1SKU B;  1WIE A;  2I0N A;  4M4Z A;  4M7D A;  4D8K A;  2RHI A;  3CCJ A;  2D8J A;  2VXF A;  1VQ9 A;  2XID A;  1JBM A;  3SWN A;  1K76 A;  2MK5 A;  2NUT A;  5LJ5 f;  3H8Z A;  3CC4 T;  2ZGW A;  3EGU A;  3INZ A;  2XHC A;  2EYZ A;  1WX6 A;  3VYG A;  2BTT A;  2P4T A;  3I56 T;  1IGQ A;  2E65 A;  1YHQ Q;  4HT9 A;  6AT1 B;  2RN8 A;  5FU7 C;  1R8O B;  5LJ5 j;  2LCC A;  3M58 A;  3ASK A;  3QWX X;  3JCM h;  2EW3 A;  3SHW A;  3MO8 A;  4OF1 A;  3ER0 A;  3E9F A;  3CCV Q;  4HVU A;  1BCO A;  3EGD B;  2EQI A;  1NPR A;  1ZHI A;  2YHT A;  4E7H A;  2L5Q A;  1VQP Q;  3PFS A;  4ANJ A;  2O4X A;  2AKK A;  2CZ0 B;  2XG8 D;  3JV3 A;  4M78 F;  3RR6 A;  2X4X A;  3CCE A;  1NYG A;  2XDB A;  2Y4X A;  4CI0 C;  2DM1 A;  5GAN 7;  3M54 A;  3OBW A;  1G8X A;  4JJB A;  5I22 A;  2QA4 A;  3REA B;  1VQ7 Q;  4EMK A;  1OOT A;  3UA7 A;  4C8Q B;  4PKC C;  2K7A A;  4D8D A;  4NS5 A;  2OTL A;  4FSX A;  2AZV A;  1P92 A;  3FC3 A;  3VS1 A;  2KEA A;  4VUB A;  2FPE A;  2HZY A;  1BKB A;  3QZ9 B;  4EIK A;  3GP8 A;  1M1K U;  1ARK A;  1O75 A;  2JZ2 A;  3PE0 A;  1JJ2 A;  1RAB B;  3OS0 A;  2GTJ A;  2RH2 A;  1XJW B;  2EKH A;  3BDL A;  2KYM A;  1G3W A;  2F69 A;  3ZL7 C;  5FU6 B;  4C92 G;  3RKW A;  1Q82 U;  5KYX B;  2ZPI B;  2L89 A;  2LZ6 B;  2CS7 A;  4X9D A;  4OGC A;  2D0N A;  2LQK A;  4C8Q D;  3DKM A;  5KYU B;  1D0Z A;  1YBY A;  1OZ3 A;  5KH6 A;  1K1Z A;  4OMF B;  2MCN A;  2K57 A;  3TSW A;  3V8J A;  4DOV A;  2XD0 A;  2A08 A;  1S72 A;  2FEI A;  1M3B A;  1KQS P;  3EGX A;  4C92 B;  4JJD A;  2JN0 A;  1QLY A;  1SHF A;  2EFI A;  1VYV A;  2HSP A;  2K79 A;  2HL3 A;  2P0Q A;  1CKA A;  5EC7 A;  1B7T A;  3JB9 G;  1YP5 A;  5A0L A;  2YRC A;  3VUZ A;  2DAQ A;  3S3O A;  2DF6 A;  2OI3 A;  1AWW A;  3JCM b;  5HKC A;  3O8V A;  2BIV A;  3M57 A;  2CP6 A;  2OAW A;  4JZ3 A;  1H64 1;  2DET A;  3FDR A;  1XOV A;  2DIG A;  2CT3 A;  4M7A D;  1KHI A;  3A8M B;  1UHC A;  4II1 A;  2DX1 A;  4M77 E;  2EQM A;  1WFW A;  3TSZ A;  4C5H A;  3A5Z B;  2ENM A;  4LNP A;  2MAM A;  2COZ A;  4N4I A;  3PMT A;  2GFU A;  2FPD A;  5FW9 A;  2RD1 A;  3JB9 I;  5GAO p;  2F2V A;  3OYI A;  4RTY A;  2EIF A;  2J6O A;  4Y28 E;  2OJ2 A;  3LH5 A;  5GMK l;  1TUD A;  1M1K R;  4ME7 A;  4Y91 A;  1RAI B;  4JZ4 A;  2EYX A;  3CCR T;  2LJ3 A;  3CCV A;  1QP3 A;  2BKD N;  2J05 A;  2BZY A;  2E5Q A;  2QDY B;  2DNU A;  1W70 A;  2F2X A;  2BE7 D;  1ZSG A;  2AHJ B;  5GMK i;  1VQ4 A;  1VQ9 T;  2L8D A;  3L2R A;  4FU6 A;  1KFZ A;  3LX7 A;  4A4K A;  3HRU A;  5IH2 A;  3CPF A;  4Z88 A;  1K73 U;  2LX9 A;  2MOX A;  5D6X A;  2PUK B;  2JMA A;  1B3Q A;  4PFZ A;  1UJ0 A;  2EJF A;  3P8B B;  4LE9 A;  2KRO A;  3RER A;  2ROL A;  3M59 A;  4QT7 A;  1UTI A;  4CC4 B;  3GOX A;  1VQO Q;  1QWF A;  3JCM J;  1LVK A;  5KYW A;  3MP1 A;  2Y90 A;  2E1H A;  1FMK A;  2L3P A;  2DE0 X;  2KI7 A;  5HCK A;  1ZLM A;  2P4R A;  2B8A A;  4OB2 B;  3CC4 Q;  1YI2 T;  1U1S A;  4FSS A;  4HCZ A;  2DXB A;  3I56 Q;  1PG5 B;  5KE2 A;  2GFA A;  2DZ9 A;  2RQT A;  4KBM B;  1D3B B;  4C8Q E;  3VS3 A;  4MDX A;  4FCY A;  3CCE T;  2OAU A;  2EYW A;  1RAC B;  2ZPF B;  4GBQ A;  5L8R E;  2LQW A;  5LJ5 e;  1OPK A;  1NJI U;  1X6O A;  1W2B P;  1JO8 A;  1QVF P;  2ZZD A;  5CKB A;  2X35 A;  2CSQ A;  3H0F A;  1NM7 A;  3JCM W;  1N8R U;  1JXM A;  4L5G A;  1WHM A;  2D0Q B;  2F5T X;  2ROT A;  3V8L A;  3JSC A;  2FZK B;  1I07 A;  5GAM g;  3OYM A;  1FXX A;  1WPY A;  2A36 A;  3HRT A;  5KCO A;  1VQN Q;  1CKB A;  1UFF A;  4L59 A;  4OB0 B;  3RNJ A;  3EG9 A;  1E6H A;  4E7I A;  3OYE A;  4M7A E;  5A2Q E;  2V8J A;  3X25 B;  2RHY A;  2AT1 B;  3EAE A;  2JUF A;  4AFS C;  2LQ8 A;  1YWP A;  4RG8 A;  4E2F B;  3OSV A;  1HXD A;  5DLQ E;  5FRM A;  1S72 T;  4ELZ C;  1MMA A;  2CP3 A;  1UGP B;  1CSK A;  1D09 B;  5ECA A;  2W0Z A;  1SRL A;  1WXU A;  2M16 A;  2A28 A;  5J26 A;  4ZTJ A;  2RB6 A;  4M78 G;  1QQJ A;  5IXB A;  4LUD A;  2YRD A;  4MZP A;  1QMC A;  3CXC S;  4IUQ A;  2DRK A;  3O5Z A;  2DMO A;  2QAS A;  1K9M C;  4C8Q F;  3L2V A;  4O5V A;  3CPW A;  1WXT A;  4R56 A;  2A3L A;  2ED1 A; 
#chains in the Genus database with same CATH homology
 3VS6 A;  1AOJ A;  4OML A;  1MV3 A;  4Y92 A;  1JEG A;  3TVT A;  2L3Q A;  2V1Q A;  3PVQ A;  3I9Q A;  2HDA A;  5FWC A;  2ECZ A;  3RBB B;  4AFZ C;  4JJC A;  2EYY A;  4OMO A;  2CH4 W;  1NEB A;  2K2M A;  1H8K A;  2CUD A;  4ESR A;  2G6F X;  4J9F A;  2O31 A;  4RTT A;  1QCF A;  3CQT A;  2NWM A;  1QWE A;  1OPL A;  3M0R A;  2LNH B;  1T0H A;  3NHN A;  1NG2 A;  3M0Q A;  1S1N A;  2KYB A;  2C0I A;  1VYT A;  1GFD A;  1PNJ A;  2VKN A;  4RTX A;  4K11 A;  2JS2 A;  1UGV A;  4DEY A;  1ZUU A;  2BZX A;  1NEG A;  2RQW A;  1RLQ C;  2ED1 A;  2V1R A;  2JS0 A;  1TUC A;  1QKX A;  1PKS A;  1SHG A;  3UA6 A;  2HBW A;  2E5K A;  2B86 A;  1JXO A;  1UDL A;  1WDX A;  1PKT A;  3THK A;  3I5R A;  1VA7 A;  4OMM A;  1MV0 B;  2KT1 A;  4WCI A;  1KJW A;  2KNB B;  4RUG A;  1WIE A;  2I0N A;  2M0Y A;  4M4Z A;  4AG1 C;  2CRE A;  4D8K A;  1BB9 A;  4F17 A;  1M8M A;  1WXB A;  2D8J A;  3KFV A;  1T3S A;  1U06 A;  4A63 B;  2KT8 A;  4E6R A;  2DRM A;  2K6D A;  1K76 A;  1Z9Z A;  2YSQ A;  1K4U S;  1RI9 A;  1ZUY A;  4RTZ A;  2DL5 A;  1OEB A;  1AZE A;  2ABL A;  2HEQ A;  1M3C A;  1WI7 A;  2C0T A;  3EGU A;  3H41 A;  2EYZ A;  1WX6 A;  2RQV A;  2BTT A;  2NUZ A;  4OMQ A;  5IHN A;  2RN8 A;  2EGC A;  3H0I A;  4IIO A;  2LP5 A;  1M3A A;  1ABO A;  4HXJ A;  3EHR A;  4J9D A;  2EPD A;  2LMJ A;  2GBQ A;  1I0C A;  3QWX X;  2EW3 A;  3SHW A;  1T0J A;  1YNZ A;  2KXD A;  2RF0 A;  4OMP A;  4HVU A;  3GBQ A;  3EG1 A;  3NPF A;  1A0N B;  1X43 A;  2EQI A;  2ESW A;  3VS5 A;  3A98 A;  4HVW A;  4CC3 A;  1N5Z A;  2J06 A;  4LN2 A;  4ORZ A;  2YDL A;  2SEM A;  1AD5 A;  5L23 A;  2KRN A;  2AKK A;  3JV3 A;  5GJV B;  2DL7 A;  1FYN A;  1NYG A;  5IXF A;  5IHI A;  2DM1 A;  2DLP A;  4Z89 A;  2L2P A;  1E7O A;  2KE9 A;  2QDL A;  2JMC A;  4JJB A;  5I22 A;  3REA B;  4J9H A;  2LJ1 A;  1K0X A;  1H3H A;  1OOT A;  3UA7 A;  2CT4 A;  2K7A A;  4D8D A;  1HJD A;  2AZV A;  2CDT A;  1SSH A;  3M0P A;  3VS1 A;  1ABQ A;  2KEA A;  2FPE A;  3VS7 A;  1ARK A;  4EIK A;  1I1J A;  2DL8 A;  2GGR A;  3PE0 A;  2SRC A;  1H92 A;  2GTJ A;  2DL3 A;  2MIO A;  2EKH A;  2KYM A;  2KGT A;  3VS4 A;  3ZL7 C;  1RLP C;  1ZBJ A;  2GNC A;  2LZ6 B;  2D0N A;  1X69 A;  1BK2 A;  1SEM A;  1OV3 A;  3ULR B;  1K1Z A;  4ZNX A;  2MCN A;  3TSW A;  1X6G A;  2A08 A;  4KRT A;  1EFN A;  1T3L A;  2DL4 A;  2FEI A;  1M3B A;  2JM8 A;  2EVR A;  1YWO A;  2O9S A;  3H0H A;  2RPN A;  4JJD A;  1QLY A;  1SHF A;  4RTU A;  1VYV A;  2AZS A;  2HSP A;  2K79 A;  3C0C A;  1CKA A;  2EGA A;  1RUW A;  1UE9 A;  2KBT A;  3I35 A;  5EC7 A;  1M27 C;  4IIM A;  2CUB A;  4AFU C;  1YP5 A;  2RMO A;  1AWX A;  2DF6 A;  2OI3 A;  1AWW A;  5IHK A;  2O9V A;  3EG2 A;  2D1X A;  4J9E A;  1W1F A;  2GTO A;  2DBM A;  2X3W D;  5FWB A;  3VS0 A;  1GBR A;  2OAW A;  4JZ3 A;  5GJW B;  4HVV A;  1XOV A;  2DA9 A;  2CT3 A;  1K0S A;  1M30 A;  1VYU A;  4LUE A;  1E6G A;  1UHC A;  2DX1 A;  1WFW A;  3TSZ A;  1Z9Q A;  2ENM A;  4LNP A;  4CC7 A;  4JPB W;  1AVZ C;  2C0O A;  2VVK A;  1AEY A;  1GCP A;  2FPD A;  2EBP A;  4GLM A;  5FW9 A;  2YUO A;  2F2V A;  4J9B A;  1NYF A;  1GBQ A;  3EG3 A;  4RTY A;  2FO0 A;  2DYB A;  2FG0 A;  2J6O A;  4J9I A;  2L0A A;  2OJ2 A;  3LH5 A;  1TUD A;  2FPF A;  4JZ4 A;  2EYX A;  4Z8A A;  2LJ3 A;  1JQQ A;  2J05 A;  2BZY A;  2DNU A;  3R6N A;  1W70 A;  2F2X A;  4AG2 C;  2VWF A;  2JM9 A;  2KXC A;  2RQR A;  1ZSG A;  3VRY A;  2O88 A;  1PRL C;  1X27 A;  1KFZ A;  1U3O A;  1TG0 A;  5IH2 A;  2PZ1 A;  4Z88 A;  3EG0 A;  1GFC A;  2MOX A;  1ZUK A;  1SRM A;  2JMA A;  1B3Q A;  1YCS B;  1GCQ C;  1UJ0 A;  1QKW A;  2JTE A;  2DVJ A;  4LE9 A;  3M0T A;  2KRO A;  1MUZ A;  2H8H A;  2KRS A;  1SPK A;  1WYX A;  4RTW A;  1YN8 A;  2ROL A;  4QT7 A;  2LCS A;  2W10 A;  1UTI A;  4CC4 B;  1UJY A;  1KSW A;  1QWF A;  3EHQ A;  2CH4 A;  5I11 A;  2KRM A;  2RNA A;  1PWT A;  1FMK A;  1X2Q A;  2L3P A;  2PTK A;  1Y57 A;  1PHT A;  2YUP A;  2DE0 X;  4OMN A;  3QWY A;  1ZLM A;  2P4R A;  5HCK A;  3I5S A;  4FSS A;  2J7I A;  3UF4 A;  1KIK A;  1W6X A;  2XMF A;  2RQT A;  4F16 A;  3VS3 A;  1G83 A;  2EYW A;  2LQN A;  1AWJ A;  2FRW A;  3IQL A;  4GBQ A;  2LQW A;  3M0S A;  3SEM A;  2K9G A;  1OPK A;  2PNI A;  1V1C A;  1UHF A;  1NLP C;  2K3B A;  1JO8 A;  2LX7 A;  1HSQ A;  1WA7 A;  2X3X D;  2IIM A;  4J9G A;  2DJQ A;  1AZG B;  1X6B A;  1ZX6 A;  2CSQ A;  3H0F A;  1LCK A;  1NM7 A;  2YUQ A;  1NLO C;  1JXM A;  2JW4 A;  2ROT A;  4J9C A;  1BBZ A;  1I07 A;  1UG1 A;  2DBK A;  2F2W A;  1WLP B;  2A36 A;  2KR3 A;  4X1V A;  3REB B;  1CKB A;  1UFF A;  2A37 A;  2ED0 A;  2YT6 A;  3RNJ A;  1E6H A;  1G2B A;  1BU1 A;  2JT4 A;  3UAT A;  3U23 A;  1X2K A;  1Y0M A;  3PVL A;  4R0K A;  2CSI A;  1PRM C;  2GQI A;  1AWO A;  4AFS C;  2EGE A;  1YWP A;  1HD3 A;  4CC2 A;  4F14 A;  2LJ0 A;  2RQU A;  3VS2 A;  2AK5 A;  1J3T A;  1GRI A;  2D8H A;  3NMZ C;  3NGP A;  1CSK A;  1JU5 C;  5ECA A;  2W0Z A;  1SRL A;  3VRZ A;  1UUE A;  1WXU A;  2A28 A;  1B07 A;  2BZ8 A;  2AKL A;  2YUN A;  5IXB A;  4LUD A;  1GCQ A;  4DEX A;  4HCK A;  2M51 A;  2J6F A;  2DIL A;  3FJ5 A;  2DRK A;  2O2O A;  4AFQ C;  1UEC A;  2DMO A;  3O5Z A;  3M0U A;  1GL5 A;  4RTV A;  1IO6 A;  1K9A A;  2JXB A;  2L3S A;  1U5S A;  2FRY A;  1WXT A;  2J6K A;  2HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...