1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
1PHTA 3EG0A 4J9GA 1JO8A 2C0IA 4AFZC 1M8MA 1Y57A 1QKXA 4LUDA 4Z88A 1GCQC 1U06A 4AFSC 1ABQA 1JXMA 2L3QA 2P4RA 2EYYA 5I11A 1ZX6A 1GFCA 4J9HA 4F14A 4QT7A 1OEBA 2RPNA 5IH2A 2OJ2A 3H0HA 4RUGA 2EPDA 1SRMA 1PRLC 1WFWA 3QWYA 4M4ZA 2O9VA 2L3PA 2KRMA 1WXBA 1VYUA 5FWBA 1BBZA 2K2MA 1AWWA 2H8HA 2ESWA 2AZSA 1W70A 1ZSGA 1W1FA 3O5ZA 2J6FA 3GBQA 1QLYA 2EQIA 2YUOA 2KXDA 5GJVB 2DILA 2PNIA 2JS2A 1X43A 4GLMA 1GL5A 2G6FX 1AOJA 3VS7A 1GBRA 4J9EA 1KIKA 1NLOC 4OMOA 1PKTA 4JZ3A 1NYFA 2KT8A 4AG2C 1RLQC 1T3SA 2DVJA 4OMMA 2J6KA 3H0FA 1PKSA 2JW4A 1MV0B 1HJDA 3VS0A 1K9AA 2HBWA 3EHQA 1B07A 1JEGA 2A37A 3EG1A 2L3SA 1TG0A 2GBQA 1NM7A 2VVKA 1QWEA 2VWFA 4J9IA 2KE9A 2W10A 4LN2A 1I07A 2KR3A 4D8DA 2IIMA 2KXCA 2ECZA 2YUPA 4OMPA 2CUBA 2MCNA 2EYZA 4HXJA 1H92A 4HVWA 4WCIA 2HCKA 2LJ1A 1SHGA 4AFUC 1NEBA 1U3OA 2K79A 1WLPB 2DYBA 2DX1A 2MOXA 1JQQA 1PNJA 2DL4A 4K11A 1ZUKA 4JZ4A 1CSKA 4RTXA 2CT4A 2F2XA 3REAB 4F16A 2EYXA 1H3HA 2CSQA 1GCPA 1E7OA 1W6XA 3VS4A 4CC2A 2EBPA 2RQWA 4HCKA 2BTTA 1OV3A 1HSQA 2DRMA 2DNUA 1SPKA 1WIEA 2LQNA 2ED0A 3M0RA 2EKHA 2EGEA 1UECA 2AKLA 1G83A 1K0SA 1SHFA 2KROA 2D8JA 2RN8A 3QWXX 4RTUA 4JJBA 2DLPA 2DL3A 3H41A 4Z8AA 2PTKA 4RTTA 2KEAA 1U5SA 1Z9QA 2AZVA 1AWOA 1AD5A 4JPBW 2ROLA 3VRYA 3NGPA 2KT1A 2F2WA 1E6GA 1X6BA 1SRLA 2JMAA 1YN8A 2DM1A 2CSIA 2A28A 4D8KA 4ESRA 1OOTA 3UATA 2O9SA 1I1JA 2K3BA 4A63B 2D8HA 1AZGB 1Z9ZA 1VYVA 1LCKA 2V1QA 2KYBA 2ABLA 1GRIA 3PE0A 4X1VA 3ZL7C 2C0TA 2FO0A 1QCFA 2EGCA 4J9FA 3VS6A 2NUZA 1A0NB 2O88A 2OAWA 1M30A 2YDLA 2J6OA 1K76A 2B86A 1ARKA 4CC4B 5HCKA 4Z89A 2XMFA 3EHRA 1M3CA 3TSWA 3VS5A 1AEYA 2JT4A 4DEXA 1PRMC 1M3AA 5IHIA 2LQWA 1AWJA 1T0JA 5ECAA 1X2KA 1K0XA 4RTYA 1EFNA 4AFQC 3UF4A 2X3WD 3TVTA 2DMOA 2J06A 3NHNA 2RMOA 4LE9A 3I9QA 2BZXA 3EG3A 1WXUA 2FPDA 4F17A 3U23A 4AG1C 5EC7A 1M3BA 1UG1A 4LUEA 1GBQA 3M0PA 1J3TA 2V1RA 4OMLA 4ZNXA 2DA9A 5IXFA 1GCQA 2J7IA 3JV3A 1B3QA 2CUDA 1SSHA 1MUZA 1AZEA 2RF0A 5I22A 1G2BA 2DL8A 2ED1A 1X27A 1FYNA 1VA7A 2GQIA 1I0CA 4IIOA 2HEQA 1AVZC 1AWXA 2LX7A 1OPLA 3NPFA 1PWTA 3TSZA 3I35A 1OPKA 5L23A 4EIKA 1XOVA 2LZ6B 1E6HA 3H0IA 1NLPC 4OMNA 4IIMA 2KRSA 3M0TA 1KSWA 1BB9A 1T0HA 1IO6A 2E5KA 1UDLA 4LNPA 2JMCA 4CC3A 1UGVA 5IXBA 1ZBJA 2C0OA 1UJ0A 1KFZA 1UHFA 1RI9A 4HVVA 1UFFA 2CT3A 1UE9A 3M0UA 1T3LA 1K1ZA 2VKNA 3I5RA 2FG0A 2FPFA 1JXOA 1NEGA 1UJYA 1BK2A 2DBKA 3SHWA 2JS0A 4RTZA 1NYGA 4ORZA 1WA7A 2CH4W 4JJCA 2GNCA 2RQUA 3IQLA 4DEYA 2W0ZA 2K6DA 3SEMA 1YP5A 1CKAA 1ZUUA 2YT6A 2EW3A 2HSPA 2CH4A 2D1XA 2EGAA 2F2VA 2DBMA 2JXBA 3PVLA 4E6RA 3REBB 1S1NA 2AKKA 1CKBA 1H8KA 2D0NA 4OMQA 2KGTA 1BU1A 2LMJA 1QKWA 2DL5A 1HD3A 5GJWB 2J05A 2M0YA 1UUEA 1SEMA 2NWMA 2LP5A 2GGRA 3ULRB 3VS1A 2LJ3A 4HVUA 3RBBB 1M27C 2CREA 4J9BA 2OI3A 2DE0X 2L2PA 2JM9A 3VRZA 2A36A 2RQVA 1TUCA 2CDTA 1WI7A 2O2OA 3I5SA 1YWPA 3R6NA 1WX6A 4R0KA 2RQTA 2YUNA 3LH5A 2QDLA 2ENMA 1JU5C 3EGUA 2GTOA 4RTVA 2KYMA 3CQTA 4KRTA 1YNZA 3RNJA 4Y92A 1N5ZA 1RUWA 2BZYA 1VYTA 3PVQA 2YSQA 3UA7A 1Y0MA 2A08A 2DRKA 1ABOA 1RLPC 1KJWA 1X6GA 2L0AA 2I0NA 3UA6A 3A98A 2LJ0A 2EVRA 2X3XD 1ZLMA 2SRCA 4GBQA 3THKA 2LCSA 1TUDA 1ZUYA 4J9DA 2FPEA 1MV3A 2RQRA 2DJQA 2PZ1A 2K9GA 3FJ5A 5IHKA 1K4US 1FMKA 2AK5A 2GTJA 3C0CA 1QWFA 3VS3A 5FW9A 4FSSA 1GFDA 4JJDA 2JM8A 3EG2A 2SEMA 2EYWA 1UHCA 2FEIA 2FRWA 2M51A 2FRYA 2KRNA 3VS2A 1WXTA 3M0SA 2K7AA 3KFVA 1V1CA 2ROTA 2HDAA 4J9CA 1X69A 2JTEA 1WYXA 3M0QA 1YWOA 1NG2A 2LNHB 4CC7A 5IHNA 1YCSB 2RNAA 2DL7A 4RTWA 2DF6A 1WDXA 2O31A 2MIOA 5FWCA 3NMZC 1X2QA 2KNBB 2BZ8A 1UTIA 2YUQA 2KBTA
chains in the Genus database with same CATH superfamily
3EG0A 4J9GA 5HY6A 1WGSA 3SWNB 4L6V5 1W2BA 1QKXA 1IRXA 2P4RA 2EYYA 4J9HA 2LQKA 4E2FB 5IH2A 1V76A 4J8OA 4JRQA 1YITQ 4M4ZA 1Q86C 1VYUA 1PSFA 1BBZA 3PGGA 3EGDB 1AWWA 1YI2Q 4M7AB 2ESWA 1W4SA 2J6FA 1KQSA 1QLYA 3A1PA 3JCMf 2QASA 2DILA 4RG8A 4C8QG 2X4XA 4ZGDB 1AOJA 2F69A 4EMGA 1ZA2B 1NYFA 1YJNA 3KBGA 1MV0B 1HJDA 3JCMc 1D09B 2A37A 3EG1A 3OSVA 3PT9A 2IG0A 5GAOn 1TG0A 2FVUA 4IUVA 2VVKA 1QWEA 3BFMA 2KE9A 3CPWP 4ZN1A 2MYSA 4Z02A 4GLKA 1BI2A 2IIMA 2KXCA 2RH2A 2ECZA 3PMIA 2CUBA 1QCOA 2NLUA 4M77E 1U1SA 1LPLA 4FW1A 1V29B 3RDVA 5CCAA 4HVWA 4WCIA 3M4GA 4ATOA 4M7DC 7AT1B 5GMKl 4AFUC 1NEBA 1VQPT 2OTJT 1PNJA 2DL4A 4E7LA 3CMAA 1K73U 1RACB 4C92E 3CCEA 2QQBA 1M90C 2NUTA 3HRTA 1WZOA 4HCKA 5KYYA 1B34A 1G3YA 1OV3A 5CVIA 1SPKA 1WIEA 3AT1B 3S3OA 4ZN3A 5GAMf 4JS5A 2LCLA 1TWBA 1UECA 2AKLA 1D0YA 1K0SA 3A8LB 1QVPA 2KROA 5A0DA 2D8JA 2LQ8A 3QWXX 3GNFB 4MMLA 2L3RA 3GP8A 2PTKA 4RTTA 5KYWB 3TEEA 2HAXA 2AZVA 3PIOA 4KGXB 2K5LA 2X4YA 4BI4A 4C8QF 3NGPA 2JMAA 1Q86R 1VQ6A 3X25B 4ESRA 1OOTA 1JRIA 1I1JA 2M1HA 3P8HA 4M77D 2V1QA 1GRIA 3AHUA 2RJCA 3HSBA 5FU6C 3OBWA 4J9FA 2DXUA 3DKMA 2NUZA 1A0NB 1C1AA 4M75D 2B86A 3JCMV 2DJZA 3QJ6A 3CBMA 3TSWA 1VQ9Q 1QP2A 5IHIA 2X4WA 1AWJA 1YJWA 2XU8A 2ZZDA 4JLGA 1VUBA 2HNIA 2X3WD 4J6WA 2J06A 1K8AU 3NHNA 4BD3A 1WXUA 2FPDA 4M7AF 2EYQA 3OS0A 3U23A 2QEXA 3H9NA 4AG1C 4YTLA 3JAME 1KD1U 2VGMA 4M78G 3FRNA 1M3BA 1MGQA 1PSEA 5LJ5h 2CZ7B 2CUDA 1SSHA 3CC4Q 1Y7XA 1SF9A 4MMKA 3JCMe 1B7TA 3QPHA 2XG8D 1M90R 1AT1B 1ZQ1A 4XU3A 3L2VA 2EJGA 3G4SA 1VQNA 2GQIA 1WHKA 1AVZC 2LX7A 2RO0A 3A5ZB 3TSZA 3LWIA 2V8IA 1RAHB 4EIKA 1FWZA 1X75C 3P8BB 2KMTA 1XOVA 2PVDB 2MPXC 2DTIA 4A4EA 5GANe 1NLPC 4BB7A 4FT4A 4IIMA 2P84A 3N5BB 3M0TA 1KSWA 3EH1A 1UDLA 1HXDA 4E7ZA 4FT2A 1R8OB 1UHFA 4HVVA 1UFFA 3MP6A 2QK0A 2CP3A 1UE9A 3WVEB 2CP0A 1K1ZA 2VKNA 1QVFP 1NEGA 3OYFA 2DIQA 4BI8B 1TUGB 5GANh 3CMEQ 1WJQA 2CH4W 3EFSA 1K9MU 2X4JA 4PJOE 2ZPBB 1VQOQ 1ZUUA 3PIPA 1BCMA 1ZHIA 3QIIA 1DJ7B 2FZGB 2D1XA 2EGAA 2DBMA 2CKKA 4E6RA 1IHVA 2QI2A 1WQWA 2LRQA 8AT1B 1S1NA 2JTFA 1KC8U 2D0NA 3J80E 1ZBXA 3BDUA 3CCMQ 1OX9A 5GJWB 4JLIA 2HL5C 2CYZB 1UUEA 3V7SA 4CI0C 3CCLQ 4DBQA 2OAUA 4M77B 3QYHB 1IREB 1D0ZA 2M0OA 1WHGA 2QQRA 3TREA 3JB9F 3LX7A 5C6SA 1Q7YC 2R5MA 1KQ2A 1G3SA 1YWPA 2KAFA 2YUNA 4C92B 4OGCA 3CC7Q 2GTOA 2E12A 2ZAEA 2I2LA 5CAIA 2K57A 3O8VA 3OSSC 5KE2A 3OYHA 3PVQA 4LDUA 1VQPA 2OTJA 3EG9B 4IUQA 5LJ5g 5CIUA 3OW2S 3VYHB 5LJ3j 2DRKA 1ABOA 2RB6A 5CKEA 2QA4T 3EFRA 2L0AA 2JZ2A 2O01E 3JCMP 3VUZA 2LJ0A 2HMAA 4FYVB 3PMTA 1ZLMA 2SRCA 4QW2A 1ZUYA 5KYUB 4UC4A 5LL6S 5D6YA 1MV3A 3FJ5A 4DOVA 4N4GA 3LYIA 2R57A 2GTJA 3RIRA 1N9RA 3VS3A 1AHJB 5CKHA 2HKQB 4JJDA 2GCXA 5FU7C 3CXCS 4A54A 2EYWA 1UHCA 3GNGA 2M51A 1MNEA 5GAN7 2JVVA 2FRYA 1VQ7T 4WF2A 3EFOB 3KFVA 1C0MA 1HYOA 1V1CA 1TH7A 2L8DA 2RJEA 4CC7A 5IHNA 4BE0A 1QVGS 1G8XA 3ME9A 4HA8A 4RTWA 6AT1B 1VQ4T 2PQWA 1WDXA 2O31A 3DLMA 4M75G 3EGXA 4PFZA 3CC2T 3NTKA 3NMZC 1NJIC 3OQ5A 4MDXA 2BZ8A 3M57A 1IXDA 1YJWQ 2RK2A 1JO8A 4M7AD 4AFZC 4F7UA 3CCSQ 1M8MA 1Y57A 4LUDA 2DPPB 4DQ2A 2L3QA 3HHTB 5I11A 1GFCA 1XQHA 1OEBA 3OYGA 2EPDA 1SRMA 1PRLC 1OU8A 1WFWA 2CP2A 2O9VA 4N0AC 4QQ6A 2CP6A 1M1KU 5KYXA 3JRZA 2E65A 4KH1B 3OW2P 1M1GA 2HZYA 2M02A 4J6YA 3GBQA 5I2SA 2QQSA 4GY5A 1Q7YR 2EQIA 2YRCA 4XQ3A 1X43A 4OB3B 3A8HB 4GLMA 4BE2A 3G4SQ 2KQWA 1BIAA 1OULA 2RI5A 4C8QC 2XI9A 1NLOC 3VYGA 4JZ3A 4C92A 4KGVB 1RLQC 1T3SA 2DVJA 4OMMA 2J6KA 1F1BB 1PKSA 2E6NA 2HBWA 1YBYA 1WJRA 1B07A 3A8GB 2GBQA 3M56A 2VWFA 3OA6A 3G6EQ 4TVRA 3JCMd 5GMKj 3MEWA 4M77F 1MNDA 4WTOB 3DB3A 3OYLA 1WHJA 4R55A 1NE8A 4HXJA 1H92A 2RJFA 2DTOA 2LJ1A 1SHGA 2OTLQ 4M75F 3BDLA 5GANd 2K79A 1WLPB 4K11A 4PJOB 4LDWA 2NUTB 2DETA 4J7IA 5KYYB 1B34B 5GAMj 2EYXA 3FDRA 1PC0A 1Q82C 3CPWS 3I55Q 3LLRA 2BTTA 5FROA 3CCUT 5KCOA 2EKHA 2VASA 5GMKi 3JB9D 1YIJA 1NJIR 5CQYA 2HSEB 4RTUA 1RAEB 2DLPA 3OBYA 1WHMA 1WPYA 3H41A 4LXCA 4Z8AA 3E9GA 1U5SA 1YJ9Q 1Z9QA 4OP0A 3A8MB 1I5LA 3BE3A 4JPBW 3FIFA 2GF7A 2E4HA 2F2WA 3ASKA 1C6VX 1X6BA 1SRLA 1YN8A 3CCQQ 2A28A 5FRNA 3FLGA 3I56Q 4Q5WA 4EMKC 1GXIE 5LJ5f 5J26A 1RL2A 3MO8A 3PE0A 3E2UA 3QDFA 3GLXA 3RKYA 3ZBDA 3VS6A 4FIBA 1R0BG 1Q81C 2OAWA 2VXFA 2YDLA 4LDXA 1S72Q 1MMAA 1UEBA 4Z89A 4F7UE 4EMHA 3EHRA 2GFAA 3MEAA 4X9CA 3VS5A 2DZCA 1PRMC 1M3AA 2QA4A 1JJ2P 5ECAA 1T0JA 1X2KA 5D7UA 4VUBA 2NUPA 2DMOA 2RJDA 2JN0A 3MKDA 1WQ7A 1MHNA 2BZXA 3EG3A 1VQLT 5GAOp 1PG5B 4DA4A 3L2QA 3CD6T 1TXQA 2ATCB 2V1RA 4OMLA 4ZNXA 2YRVA 5IXFA 1MMNA 2J7IA 1M2VA 3JV3A 2VC8A 4M78C 3KXTA 1VQ7A 4XTVA 2DEUA 1AZEA 2RF0A 3OW2A 5I22A 4QQGA 2RHUA 1G2BA 1BCOA 4N0AA 4A4KA 1X27A 2XHCA 3QBYA 4M7AG 3SDZA 4PJOA 4BUGA 1Q82R 1FYNA 1WHLA 2FZCB 1VQ4A 2EQMA 1OPLA 3MCAB 3EAEA 2Y4XA 3CC2A 3JCMX 1NPRA 3QSUA 1YI2T 4C5HA 3R6OA 1QP3A 3CXCA 2KRSA 2VV5A 3X28B 4E47A 4LNPA 4X34A 4CC3A 1ZBJA 3LH0A 1UJ0A 3OYYA 1KFZA 2CT3A 2QGFB 4C0DC 2P0KA 4ANJA 5LJ3e 1KHIA 4LDVA 1QVGA 1JXOA 1BK2A 2DBKA 2JS0A 4J5YA 2GNCA 4DEYA 5HK3A 3WVDB 1YP5A 2YT6A 2JXBA 3PVLA 1VQKQ 4PJJA 1VQMT 2RHZA 2DZ9A 3FJPA 1Q86U 2P0PA 4JRKA 1Q81R 2KGTA 1QKWA 1VQ5Q 4C92D 1O9SA 1HD3A 3ZFJA 1WHHA 1SEMA 2LP5A 3ULRB 3CCRA 2QTXA 3OYBA 2LJ3A 4HVUA 3TQ7P 5FLXE 3RBBB 5GAOl 1M27C 1QVFS 2OI3A 4PJLA 3VRZA 2A36A 3JB9J 1X01A 3QUIA 1M1FA 3CCVQ 2O2OA 3M9QA 3I5SA 3M59A 4MZMA 2E70A 3C95A 4A4FA 3G71T 3R6NA 1WX6A 3LH5A 3NTIA 1OZ2A 4C0ZA 2QDLA 4KBMB 3QJYA 3EGUA 2EIFA 3CQTA 4KRTA 2HQEA 2IPOB 4PLIA 1PD1A 1VYTA 8ATCB 1YIJQ 3CCJQ 2JNGA 4A4HA 3UA7A 3CBOA 3JB9G 1N27A 1U1TA 1M8VA 4C5EA 3A98A 3OS2A 3META 3CCUA 1M9SA 2DFUA 1YHQT 5FU6B 1ACMB 2KSSA 2CP7A 5FW9A 1GFDA 4KH0B 5IT9E 2JM8A 1M90U 2FEIA 1M2OA 3JCMh 2F5TX 1RI0A 2R5AA 3VS2A 4OB2B 3QXEB 3C94A 5GAOq 2YWWA 4OVAA 3SB2A 1X69A 4MDWA 1YWOA 2K5IA 2HBPA 2LDMA 2C06A 1YCSB 2RNAA 3CPWA 2DL7A 4FYYB 3EGXB 4N4HA 3MEVA 2MIOA 1IB8A 1YJNQ 5GMKe 1N8RC 4O5VA 3S3MA 4IURA 1X2QA 4BI3A 1VQ9T 1G5VA 5CKFA 4M75C 4F7UB 1PHTA 1SG5A 2C0IA 3G7ZA 2XICA 1ZX6A 3RR6A 3MJXA 3QZ5B 2DEQA 4M78A 2RPNA 2OJ2A 4M7DA 1WJSA 5KYXB 1QMCA 4JJNK 2L3PA 4OGEA 4C8QE 1WXBA 5FWBA 5CO7A 5GAMe 2H8HA 3GPLA 1W70A 3CC4T 3O5ZA 2DKGA 1ZSZC 2EKOA 4JRIA 4C0FA 2YUOA 2KXDA 5GJVB 2PNIA 3CMAQ 1VQLA 3V8LA 2JS2A 4KGZB 3CCEQ 2DIGA 2Z0WA 3CD6A 5FRMA 2BIVA 3J81E 3VS7A 1KIKA 4XU1A 5GAMh 1I81A 2E5QA 2KT8A 4AG2C 2JW4A 2QDYB 4IUPA 2XIDA 5GMKm 1K9AA 3EHQA 1JEGA 2A3LA 4FW2A 2CGHA 3E19A 1PD0A 2Y4YA 1P92A 2W10A 1FXXA 2ZPHB 4ZGJB 1I07A 2BKDN 4PJOD 1UGRB 4XTZA 1VIFA 2YUPA 1BIBA 2V8KA 1TOVA 2FL7A 3J7AF 4IUUA 2MCNA 2EYZA 4HT9A 1EZZB 2E41A 3GOXA 1YI2A 3CMET 1VQ6Q 3OYNA 4Y28E 1R77A 3OMCA 4PFOA 1Y96A 1VQOT 4C0GA 4L5GA 3F70A 4E7HA 3QKJA 2DX1A 1ZUKA 2A7YA 4ELZC 3OYMA 3PNWC 2EAYA 4M77G 4BY6C 3QHSA 1CSKA 2D0QB 1D1BA 4RTXA 3REAB 4F16A 1H3HA 1GCPA 1W6XA 5D6XA 3VS4A 4CC2A 2RQWA 5LJ3d 4P5NA 2HQHA 2DNUA 3CCMT 5J39A 2LQNA 4JRPA 3V7CA 1KQSP 3M0RA 1N8RR 4C92G 3CCRQ 1FMVA 4FU6A 3CCLT 2RM4A 5GANg 3Q1JA 1BKBA 2RN8A 3E9FA 3RMSA 2XDDA 2K2VA 1VQMA 4HCCA 1KQ1A 4NOYA 1N8RU 1NPPA 2ZPGB 5KE3A 5GAOr 2HQXA 3T9NA 3CPFA 5LJ5j 3CC7T 1X6OA 5DM7R 2ROLA 2QEXQ 2PVOB 2DYIA 3OYEA 2DM1A 2ZPEB 1LVKA 3M58A 4C5IA 3UATA 1UGPB 2D8HA 1VYVA 4PL6A 2KYBA 2ABLA 5I2MA 3ZL7C 2C0TA 3C4SA 4FYXB 5AYFA 3G71A 4BDZA 1TTHB 5FU7B 2V8JA 3LWHA 2QQ9A 3HL8A 3CCUQ 2EQKA 1VQ8T 1Q95G 4F7UF 1VQNQ 3KUFA 3MPUB 5HKCA 1JBMA 1OQKA 1K76A 5HCKA 1Q7YU 2XMFA 3V7RA 3OYCA 2JT4A 4DEXA 1QVFA 2LQWA 2BE9B 4M78E 2NUPB 1K0XA 3OYDA 1VIEA 4M7DE 4RTYA 3UDCA 3L1AA 1N6AA 4N4IA 2RMOA 4LE9A 3I9QA 1R0CB 2EJFA 3X20B 2K5FA 1YHQA 3E1SA 2PUKB 5EC7A 5CKBA 2JJ9A 5J3BA 1M2VB 1J3TA 3SWNC 1XJWB 2DD4A 3OYAA 1MUZA 3FC3A 3HP9A 4C92F 4HCBA 2DL8A 2ED1A 3CCST 4PKCC 1JJ2S 1XNIA 2LVMA 5GAN3 1TU0B 2AT1B 1VA7A 5GAN2 4JS4A 4IIOA 2QAZA 4D6WA 1K73C 4M7AC 1AWXA 1ZSZA 2RHIA 3I35A 2KK4A 4J6XA 4DBFA 1OPKA 2LX9A 2YXYA 3MP1A 1VQ9A 5C0MA 2QYZA 3OYIA 3MHXA 4ZTFA 4C8QB 3S3NA 4B9WA 3M54A 4OMNA 1BB9A 1IO6A 3M55A 2JMCA 2MWPA 3JB9I 1UGVA 3L42A 1BI1A 2LNVA 2K3YA 2E3HA 2X35A 4M7DD 4KULA 1NJIU 2L5QA 4ORZA 4JJCA 5GAMd 3INZA 3CC4A 2CP5A 1M5Q1 2W0ZA 1RAIB 2DVEA 1VQPQ 2OTJQ 4FM4B 3V8KA 1EIFA 1PCXA 2D6FA 2EW3A 3G6ET 2ZCFB 4EPCA 5EG2A 3REBB 1VOMA 4QVCA 2QG9B 2AKKA 4PJOG 4OMQA 1BU1A 2DL5A 2J05A 2EFIA 4MZTA 2M0YA 2NWMA 1QCNA 2GGRA 4OMFB 2VYTA 4ZGEB 3VS1A 2CREA 1FX7A 2DE0X 2OTLT 2L2PA 5KCHA 2JM9A 1H3ZA 3ZEHA 3WXMB 1FMWA 1TUCA 2RI2A 1G3TA 4J7FA 1NBEB 4E7KA 1I4K1 1WNLA 2P0QA 2KVQG 2RI3A 2ENMA 3RERA 4AMCA 1JU5C 3I55T 1QQJA 3DB4A 1KHCA 1YNZA 4R56A 1K8AC 4Y92A 3G1JA 1N5ZA 3CMEA 2LC4A 1VQOA 2RA2A 5GANf 4JUVA 1Y0MA 1KD1C 5AT1B 1X6GA 1VQMQ 1YCYA 3GF5A 4EMKB 2EQUA 3UA6A 2X3XD 4B6MA 2DD5A 3THKA 2LCSA 1TUDA 1YJ9T 4J9DA 2KY9A 2A0FB 3RMQA 1K73R 1LNXA 3CCMA 2PZ1A 2K9GA 5IHKA 3M5AA 1FMKA 2PUOB 4XTXA 4E7JA 2AK5A 2DO3A 5D6WA 3CCLA 3HFOA 1YITT 3CCQT 2YRDA 5IN1A 3HTRA 4FSSA 4XTYA 2HL3A 3I56T 3VV0A 3EG2A 2SEMA 2FRWA 2CS7A 3V8JA 2COWA 1Q82U 2KRNA 3M4YA 4IKFA 4M75E 3M0SA 2O4XA 3G71Q 2LT4A 4C8QA 2ROTA 2HDAA 4J9CA 4E7SA 3CC7A 4JDSA 1NG2A 5KH6A 5GAN4 3P8DA 4HT8A 2DF6A 4HCZA 4J83A 1S72T 3OYKA 4PJOF 3OMGA 3NFCA 1D1CA 2EWNA 4ZTJA 2YUQA 2KBTA 4AT1B 2DXBA 3URGA 2DTHA 2B8AA 5GAN6 4XTUA 1QW1A 4NL3A 4Z88A 1K9MC 4M78B 1GCQC 2MMPA 1U06A 3CEYA 4AFSC 1ABQA 1JXMA 2WSCE 3L2ZA 3X24B 3SWNA 1VQ8A 3GIBA 4M7DB 4F14A 5LJ3h 2HD0A 3BW1A 4QT7A 1RAFB 1YHQQ 3H0HA 2QGGA 4RUGA 5CKDA 3C12A 5L8RE 1U8RA 3QWYA 1SKUB 4DBHA 2KRMA 2D9TA 2K2MA 1KC8C 3QZ9B 4QVDA 2AZSA 1ZSGA 3EGDA 3CBPA 1W1FA 3PTAA 4M7AA 4KT0E 1Q81U 2XDBA 5A0GA 2WACA 1GL5A 2G6FX 3UPUA 4RCBA 1GBRA 4J9EA 2VUBA 3H6ZA 4OMOA 1K8AR 1PKTA 4V2SA 2VXEA 4QVZA 3JCMb 3HFNA 3H0FA 3HPWA 1OU9A 3VS0A 4C0DB 1KD1R 2XKOC 2L3SA 5LJ5e 4XU2A 2RHYA 1NM7A 3L2UA 4J9IA 2M9UA 3CCSA 4X9DA 5DLQE 4LN2A 2KR3A 1N9SA 4D8DA 2X9HA 3RKWA 2XD0A 1D1AA 4RMOA 4EMKA 3QO3A 3JCMQ 4OMPA 5CK9A 4M7DG 2ZPFB 4FCYA 1Y96B 3TU4K 1IGUA 3OS5A 2HCKA 2DAQA 4XU0A 1RABB 3RESA 1U3OA 2DXCA 2DYBA 2FZKB 1JQQA 2MOXA 2F1LA 4BACA 2E6ZA 4JZ4A 5DY9A 1VQKT 2CT4A 2F2XA 1JJ2A 4FYWB 1OZ3A 3SD4A 2CSQA 1E7OA 2EBPA 4M77C 1HSQA 2DRMA 2H3JA 3OY9A 3X26B 3VJPA 1VQ5T 2ED0A 2QTVA 2EGEA 1BYMA 3TCJA 3RKXA 1G83A 4PJNA 1SHFA 1H641 2MF2A 2QXFA 4C92C 4KUDK 2QA4Q 3G6EA 9ATCB 1W2BS 1XTDA 4JJBA 2DL3A 3CCVT 1K9MR 2HKNA 2KEAA 3H8ZA 1LJOA 5IAYA 2COYA 1AWOA 5KYWA 5LJ3g 1AD5A 3VRYA 1OX8A 1IZ6A 5GMKh 2KT1A 1E6GA 2E10A 2GQVA 2CSIA 4D8KA 2NYSA 1KC8R 2O9SA 3DLLA 2K3BA 4A63B 1YIJT 2OTLA 3CCJT 1AZGB 1Z9ZA 1I5OB 3HKSA 1KQSS 1LCKA 2MK5A 1VQ7Q 3L2WA 2XK0A 4X1VA 1M1KC 4XTWA 5A0LA 2FO0A 1QCFA 2BE7D 2EGCA 3QYGB 4QKUA 3I55A 2O88A 4DBRA 1M30A 1VQ4Q 2J6OA 2R58A 3FEOA 4ELYC 2FB7A 2QQAA 1ARKA 4CC4B 3CC2Q 4M78F 3HRSA 2KI7A 1M3CA 4M7DF 1AEYA 4CRIA 4RG2A 4IUTA 2F5KA 4KUIA 4PNOA 4AFQC 1EFNA 3UF4A 3TVTA 1EX4A 1YJ9A 4MZPA 2AIRB 4OB0B 4ME7A 3LGLA 4DOWA 4M75B 4NL2A 4F7UG 4F17A 1OI1A 2IVWA 2JTMA 2YLBA 5DLOA 1UB4A 2KDSA 1BI0A 3PFSA 1YITA 1UG1A 2DK3A 4LUEA 1Y71A 3CCQA 4M7AE 1GBQA 3M0PA 4PK4A 5KYNA 2XDPA 2JOYA 2DA9A 3I56A 3RUXA 1YJNT 1GCQA 5CQXA 2MI6A 2RHXA 4LD6A 1B3QA 1W2BP 5M9OA 2WSFE 2ZGWA 3BY7A 3MEUA 2CZ0B 4C8QD 1UGQB 2VGNA 1TS9A 3JCMg 3VUBA 1VQ8Q 4RCCA 2RD1A 4NS5A 1ZSZB 1KK7A 2H3EB 3MP8A 2BUDA 1I0CA 2YHTA 2HEQA 1S72A 3NPFA 1PWTA 4QQDA 3UWNA 5L23A 2M16A 3L2RA 4FSXA 2EQJA 1MMGA 2MAMA 4EDUA 2LT1A 3S6WA 2PU9B 2LZ6B 1E6HA 3H0IA 3LGFA 2DERA 4PJMA 1KG1A 1RAGB 2LCCA 3JCMW 1T0HA 1D3BB 2E5KA 1MMDA 3CMAT 5IXBA 4XAXB 2C0OA 3CCET 1RI9A 1I8FA 3M0UA 4Y91A 1T3LA 2MWOA 2CZ1B 2RK1A 3I5RA 2FG0A 2FPFA 3NTHA 1UJYA 1IGQA 2E1HA 2ZPIB 3SHWA 2X51A 3LW5E 4RTZA 1NYGA 1WA7A 1RAAB 5GAOm 2E64A 2RQUA 3IQLA 5CR2A 3A8OB 2K6DA 4PLLA 3SEMA 1PM3A 4OF1A 1CKAA 1M1KR 2HSPA 2CH4A 2F2VA 1JB0E 4FL6A 2VB6A 5I21A 4O6JA 3VKIA 1YFNA 4II1A 3OB9A 1CKBA 1H8KA 1BI3A 2LMJA 2AHJB 1RADB 4BY6B 3JB9H 5A2QE 4LD9K 4PJOC 5GAMg 2G3RA 3JCMJ 1VQ6T 4J9BA 1HK9A 5LJ5d 4M77A 2E3IA 2FYKA 2RQVA 2K3XA 4F04B 2CDTA 2JUFA 1WI7A 1M4ZA 4XK8E 4A4GA 4R0KA 2RQTA 3UT1A 2K4YA 3QDRB 4C5GA 5GANj 5GAN8 2DXTA 4RTVA 1ZA1B 2KYMA 2COZA 4L59A 2LTOA 3RNJA 4M75A 3CXCP 1RUWA 2BZYA 4LDYA 4RKUE 3HRUA 2L89A 1D0XA 3CCRT 2YSQA 1IHWA 4BDYA 2FHDA 2A08A 3EG9A 1RLPC 3D7SB 4BE1A 1KJWA 2CZ6B 1YJWT 1VQKA 2I0NA 3FB9A 1TSFA 2P4TA 3OS1A 1QVGP 2EVRA 1Y07A 2V26A 4GBQA 4E7IA 2FPEA 2OX7A 5LJ3f 3EH2A 2YLCA 2RQRA 4B9XA 2DJQA 1VQ5A 4OB1B 1K4US 5KYUA 1OYXA 2QEXT 3OYJA 2WSEE 3C0CA 1QWFA 3M53A 4HKEA 4PFPA 1O75A 2PVGB 2O4XB 3QG1A 2Y90A 3CCVA 5HK0A 1WXTA 2K7AA 2EJ9A 5GAN5 1VQLQ 2JTEA 3JSCA 1WYXA 3M0QA 3EFOA 3ER0A 2LNHB 4A53A 4M78D 1D3BA 3CD6Q 1SSFA 3G4ST 1VQNT 3VU3C 1LOJA 5FWCA 3CCJA 1G3WA 1UGSB 3SFMA 2KNBB 1UTIA 1NZ9A 2GFUA
chains in the Genus database with same CATH topology
1PHTA 3EG0A 4J9GA 1JO8A 2C0IA 4AFZC 1M8MA 1Y57A 1QKXA 4LUDA 4Z88A 1GCQC 1U06A 4AFSC 1ABQA 1JXMA 2L3QA 2P4RA 2EYYA 5I11A 1ZX6A 1GFCA 4J9HA 4F14A 4QT7A 1OEBA 2RPNA 5IH2A 2OJ2A 3H0HA 4RUGA 2EPDA 1SRMA 1PRLC 1WFWA 3QWYA 4M4ZA 2O9VA 2L3PA 2KRMA 1WXBA 1VYUA 5FWBA 1BBZA 2K2MA 1AWWA 2H8HA 2ESWA 2AZSA 1W70A 1ZSGA 1W1FA 3O5ZA 2J6FA 3GBQA 1QLYA 2EQIA 2YUOA 2KXDA 5GJVB 2DILA 2PNIA 2JS2A 1X43A 4GLMA 1GL5A 2G6FX 1AOJA 3VS7A 1GBRA 4J9EA 1KIKA 1NLOC 4OMOA 1PKTA 4JZ3A 1NYFA 2KT8A 4AG2C 1RLQC 1T3SA 2DVJA 4OMMA 2J6KA 3H0FA 1PKSA 2JW4A 1MV0B 1HJDA 3VS0A 1K9AA 2HBWA 3EHQA 1B07A 1JEGA 2A37A 3EG1A 2L3SA 1TG0A 2GBQA 1NM7A 2VVKA 1QWEA 2VWFA 4J9IA 2KE9A 2W10A 4LN2A 1I07A 2KR3A 4D8DA 2IIMA 2KXCA 2ECZA 2YUPA 4OMPA 2CUBA 2MCNA 2EYZA 4HXJA 1H92A 4HVWA 4WCIA 2HCKA 2LJ1A 1SHGA 4AFUC 1NEBA 1U3OA 2K79A 1WLPB 2DYBA 2DX1A 2MOXA 1JQQA 1PNJA 2DL4A 4K11A 1ZUKA 4JZ4A 1CSKA 4RTXA 2CT4A 2F2XA 3REAB 4F16A 2EYXA 1H3HA 2CSQA 1GCPA 1E7OA 1W6XA 3VS4A 4CC2A 2EBPA 2RQWA 4HCKA 2BTTA 1OV3A 1HSQA 2DRMA 2DNUA 1SPKA 1WIEA 2LQNA 2ED0A 3M0RA 2EKHA 2EGEA 1UECA 2AKLA 1G83A 1K0SA 1SHFA 2KROA 2D8JA 2RN8A 3QWXX 4RTUA 4JJBA 2DLPA 2DL3A 3H41A 4Z8AA 2PTKA 4RTTA 2KEAA 1U5SA 1Z9QA 2AZVA 1AWOA 1AD5A 4JPBW 2ROLA 3VRYA 3NGPA 2KT1A 2F2WA 1E6GA 1X6BA 1SRLA 2JMAA 1YN8A 2DM1A 2CSIA 2A28A 4D8KA 4ESRA 1OOTA 3UATA 2O9SA 1I1JA 2K3BA 4A63B 2D8HA 1AZGB 1Z9ZA 1VYVA 1LCKA 2V1QA 2KYBA 2ABLA 1GRIA 3PE0A 4X1VA 3ZL7C 2C0TA 2FO0A 1QCFA 2EGCA 4J9FA 3VS6A 2NUZA 1A0NB 2O88A 2OAWA 1M30A 2YDLA 2J6OA 1K76A 2B86A 1ARKA 4CC4B 5HCKA 4Z89A 2XMFA 3EHRA 1M3CA 3TSWA 3VS5A 1AEYA 2JT4A 4DEXA 1PRMC 1M3AA 5IHIA 2LQWA 1AWJA 1T0JA 5ECAA 1X2KA 1K0XA 4RTYA 1EFNA 4AFQC 3UF4A 2X3WD 3TVTA 2DMOA 2J06A 3NHNA 2RMOA 4LE9A 3I9QA 2BZXA 3EG3A 1WXUA 2FPDA 4F17A 3U23A 4AG1C 5EC7A 1M3BA 1UG1A 4LUEA 1GBQA 3M0PA 1J3TA 2V1RA 4OMLA 4ZNXA 2DA9A 5IXFA 1GCQA 2J7IA 3JV3A 1B3QA 2CUDA 1SSHA 1MUZA 1AZEA 2RF0A 5I22A 1G2BA 2DL8A 2ED1A 1X27A 1FYNA 1VA7A 2GQIA 1I0CA 4IIOA 2HEQA 1AVZC 1AWXA 2LX7A 1OPLA 3NPFA 1PWTA 3TSZA 3I35A 1OPKA 5L23A 4EIKA 1XOVA 2LZ6B 1E6HA 3H0IA 1NLPC 4OMNA 4IIMA 2KRSA 3M0TA 1KSWA 1BB9A 1T0HA 1IO6A 2E5KA 1UDLA 4LNPA 2JMCA 4CC3A 1UGVA 5IXBA 1ZBJA 2C0OA 1UJ0A 1KFZA 1UHFA 1RI9A 4HVVA 1UFFA 2CT3A 1UE9A 3M0UA 1T3LA 1K1ZA 2VKNA 3I5RA 2FG0A 2FPFA 1JXOA 1NEGA 1UJYA 1BK2A 2DBKA 3SHWA 2JS0A 4RTZA 1NYGA 4ORZA 1WA7A 2CH4W 4JJCA 2GNCA 2RQUA 3IQLA 4DEYA 2W0ZA 2K6DA 3SEMA 1YP5A 1CKAA 1ZUUA 2YT6A 2EW3A 2HSPA 2CH4A 2D1XA 2EGAA 2F2VA 2DBMA 2JXBA 3PVLA 4E6RA 3REBB 1S1NA 2AKKA 1CKBA 1H8KA 2D0NA 4OMQA 2KGTA 1BU1A 2LMJA 1QKWA 2DL5A 1HD3A 5GJWB 2J05A 2M0YA 1UUEA 1SEMA 2NWMA 2LP5A 2GGRA 3ULRB 3VS1A 2LJ3A 4HVUA 3RBBB 1M27C 2CREA 4J9BA 2OI3A 2DE0X 2L2PA 2JM9A 3VRZA 2A36A 2RQVA 1TUCA 2CDTA 1WI7A 2O2OA 3I5SA 1YWPA 3R6NA 1WX6A 4R0KA 2RQTA 2YUNA 3LH5A 2QDLA 2ENMA 1JU5C 3EGUA 2GTOA 4RTVA 2KYMA 3CQTA 4KRTA 1YNZA 3RNJA 4Y92A 1N5ZA 1RUWA 2BZYA 1VYTA 3PVQA 2YSQA 3UA7A 1Y0MA 2A08A 2DRKA 1ABOA 1RLPC 1KJWA 1X6GA 2L0AA 2I0NA 3UA6A 3A98A 2LJ0A 2EVRA 2X3XD 1ZLMA 2SRCA 4GBQA 3THKA 2LCSA 1TUDA 1ZUYA 4J9DA 2FPEA 1MV3A 2RQRA 2DJQA 2PZ1A 2K9GA 3FJ5A 5IHKA 1K4US 1FMKA 2AK5A 2GTJA 3C0CA 1QWFA 3VS3A 5FW9A 4FSSA 1GFDA 4JJDA 2JM8A 3EG2A 2SEMA 2EYWA 1UHCA 2FEIA 2FRWA 2M51A 2FRYA 2KRNA 3VS2A 1WXTA 3M0SA 2K7AA 3KFVA 1V1CA 2ROTA 2HDAA 4J9CA 1X69A 2JTEA 1WYXA 3M0QA 1YWOA 1NG2A 2LNHB 4CC7A 5IHNA 1YCSB 2RNAA 2DL7A 4RTWA 2DF6A 1WDXA 2O31A 2MIOA 5FWCA 3NMZC 1X2QA 2KNBB 2BZ8A 1UTIA 2YUQA 2KBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHT A;  3EG0 A;  4J9G A;  1JO8 A;  2C0I A;  4AFZ C;  1M8M A;  1Y57 A;  1QKX A;  4LUD A;  4Z88 A;  1GCQ C;  1U06 A;  4AFS C;  1ABQ A;  1JXM A;  2L3Q A;  2P4R A;  2EYY A;  5I11 A;  1ZX6 A;  1GFC A;  4J9H A;  4F14 A;  4QT7 A;  1OEB A;  2RPN A;  5IH2 A;  2OJ2 A;  3H0H A;  4RUG A;  2EPD A;  1SRM A;  1PRL C;  1WFW A;  3QWY A;  4M4Z A;  2O9V A;  2L3P A;  2KRM A;  1WXB A;  1VYU A;  5FWB A;  1BBZ A;  2K2M A;  1AWW A;  2H8H A;  2ESW A;  2AZS A;  1W70 A;  1ZSG A;  1W1F A;  3O5Z A;  2J6F A;  3GBQ A;  1QLY A;  2EQI A;  2YUO A;  2KXD A;  5GJV B;  2DIL A;  2PNI A;  2JS2 A;  1X43 A;  4GLM A;  1GL5 A;  2G6F X;  1AOJ A;  3VS7 A;  1GBR A;  4J9E A;  1KIK A;  1NLO C;  4OMO A;  1PKT A;  4JZ3 A;  1NYF A;  2KT8 A;  4AG2 C;  1RLQ C;  1T3S A;  2DVJ A;  4OMM A;  2J6K A;  3H0F A;  1PKS A;  2JW4 A;  1MV0 B;  1HJD A;  3VS0 A;  1K9A A;  2HBW A;  3EHQ A;  1B07 A;  1JEG A;  2A37 A;  3EG1 A;  2L3S A;  1TG0 A;  2GBQ A;  1NM7 A;  2VVK A;  1QWE A;  2VWF A;  4J9I A;  2KE9 A;  2W10 A;  4LN2 A;  1I07 A;  2KR3 A;  4D8D A;  2IIM A;  2KXC A;  2ECZ A;  2YUP A;  4OMP A;  2CUB A;  2MCN A;  2EYZ A;  4HXJ A;  1H92 A;  4HVW A;  4WCI A;  2HCK A;  2LJ1 A;  1SHG A;  4AFU C;  1NEB A;  1U3O A;  2K79 A;  1WLP B;  2DYB A;  2DX1 A;  2MOX A;  1JQQ A;  1PNJ A;  2DL4 A;  4K11 A;  1ZUK A;  4JZ4 A;  1CSK A;  4RTX A;  2CT4 A;  2F2X A;  3REA B;  4F16 A;  2EYX A;  1H3H A;  2CSQ A;  1GCP A;  1E7O A;  1W6X A;  3VS4 A;  4CC2 A;  2EBP A;  2RQW A;  4HCK A;  2BTT A;  1OV3 A;  1HSQ A;  2DRM A;  2DNU A;  1SPK A;  1WIE A;  2LQN A;  2ED0 A;  3M0R A;  2EKH A;  2EGE A;  1UEC A;  2AKL A;  1G83 A;  1K0S A;  1SHF A;  2KRO A;  2D8J A;  2RN8 A;  3QWX X;  4RTU A;  4JJB A;  2DLP A;  2DL3 A;  3H41 A;  4Z8A A;  2PTK A;  4RTT A;  2KEA A;  1U5S A;  1Z9Q A;  2AZV A;  1AWO A;  1AD5 A;  4JPB W;  2ROL A;  3VRY A;  3NGP A;  2KT1 A;  2F2W A;  1E6G A;  1X6B A;  1SRL A;  2JMA A;  1YN8 A;  2DM1 A;  2CSI A;  2A28 A;  4D8K A;  4ESR A;  1OOT A;  3UAT A;  2O9S A;  1I1J A;  2K3B A;  4A63 B;  2D8H A;  1AZG B;  1Z9Z A;  1VYV A;  1LCK A;  2V1Q A;  2KYB A;  2ABL A;  1GRI A;  3PE0 A;  4X1V A;  3ZL7 C;  2C0T A;  2FO0 A;  1QCF A;  2EGC A;  4J9F A;  3VS6 A;  2NUZ A;  1A0N B;  2O88 A;  2OAW A;  1M30 A;  2YDL A;  2J6O A;  1K76 A;  2B86 A;  1ARK A;  4CC4 B;  5HCK A;  4Z89 A;  2XMF A;  3EHR A;  1M3C A;  3TSW A;  3VS5 A;  1AEY A;  2JT4 A;  4DEX A;  1PRM C;  1M3A A;  5IHI A;  2LQW A;  1AWJ A;  1T0J A;  5ECA A;  1X2K A;  1K0X A;  4RTY A;  1EFN A;  4AFQ C;  3UF4 A;  2X3W D;  3TVT A;  2DMO A;  2J06 A;  3NHN A;  2RMO A;  4LE9 A;  3I9Q A;  2BZX A;  3EG3 A;  1WXU A;  2FPD A;  4F17 A;  3U23 A;  4AG1 C;  5EC7 A;  1M3B A;  1UG1 A;  4LUE A;  1GBQ A;  3M0P A;  1J3T A;  2V1R A;  4OML A;  4ZNX A;  2DA9 A;  5IXF A;  1GCQ A;  2J7I A;  3JV3 A;  1B3Q A;  2CUD A;  1SSH A;  1MUZ A;  1AZE A;  2RF0 A;  5I22 A;  1G2B A;  2DL8 A;  2ED1 A;  1X27 A;  1FYN A;  1VA7 A;  2GQI A;  1I0C A;  4IIO A;  2HEQ A;  1AVZ C;  1AWX A;  2LX7 A;  1OPL A;  3NPF A;  1PWT A;  3TSZ A;  3I35 A;  1OPK A;  5L23 A;  4EIK A;  1XOV A;  2LZ6 B;  1E6H A;  3H0I A;  1NLP C;  4OMN A;  4IIM A;  2KRS A;  3M0T A;  1KSW A;  1BB9 A;  1T0H A;  1IO6 A;  2E5K A;  1UDL A;  4LNP A;  2JMC A;  4CC3 A;  1UGV A;  5IXB A;  1ZBJ A;  2C0O A;  1UJ0 A;  1KFZ A;  1UHF A;  1RI9 A;  4HVV A;  1UFF A;  2CT3 A;  1UE9 A;  3M0U A;  1T3L A;  1K1Z A;  2VKN A;  3I5R A;  2FG0 A;  2FPF A;  1JXO A;  1NEG A;  1UJY A;  1BK2 A;  2DBK A;  3SHW A;  2JS0 A;  4RTZ A;  1NYG A;  4ORZ A;  1WA7 A;  2CH4 W;  4JJC A;  2GNC A;  2RQU A;  3IQL A;  4DEY A;  2W0Z A;  2K6D A;  3SEM A;  1YP5 A;  1CKA A;  1ZUU A;  2YT6 A;  2EW3 A;  2HSP A;  2CH4 A;  2D1X A;  2EGA A;  2F2V A;  2DBM A;  2JXB A;  3PVL A;  4E6R A;  3REB B;  1S1N A;  2AKK A;  1CKB A;  1H8K A;  2D0N A;  4OMQ A;  2KGT A;  1BU1 A;  2LMJ A;  1QKW A;  2DL5 A;  1HD3 A;  5GJW B;  2J05 A;  2M0Y A;  1UUE A;  1SEM A;  2NWM A;  2LP5 A;  2GGR A;  3ULR B;  3VS1 A;  2LJ3 A;  4HVU A;  3RBB B;  1M27 C;  2CRE A;  4J9B A;  2OI3 A;  2DE0 X;  2L2P A;  2JM9 A;  3VRZ A;  2A36 A;  2RQV A;  1TUC A;  2CDT A;  1WI7 A;  2O2O A;  3I5S A;  1YWP A;  3R6N A;  1WX6 A;  4R0K A;  2RQT A;  2YUN A;  3LH5 A;  2QDL A;  2ENM A;  1JU5 C;  3EGU A;  2GTO A;  4RTV A;  2KYM A;  3CQT A;  4KRT A;  1YNZ A;  3RNJ A;  4Y92 A;  1N5Z A;  1RUW A;  2BZY A;  1VYT A;  3PVQ A;  2YSQ A;  3UA7 A;  1Y0M A;  2A08 A;  2DRK A;  1ABO A;  1RLP C;  1KJW A;  1X6G A;  2L0A A;  2I0N A;  3UA6 A;  3A98 A;  2LJ0 A;  2EVR A;  2X3X D;  1ZLM A;  2SRC A;  4GBQ A;  3THK A;  2LCS A;  1TUD A;  1ZUY A;  4J9D A;  2FPE A;  1MV3 A;  2RQR A;  2DJQ A;  2PZ1 A;  2K9G A;  3FJ5 A;  5IHK A;  1K4U S;  1FMK A;  2AK5 A;  2GTJ A;  3C0C A;  1QWF A;  3VS3 A;  5FW9 A;  4FSS A;  1GFD A;  4JJD A;  2JM8 A;  3EG2 A;  2SEM A;  2EYW A;  1UHC A;  2FEI A;  2FRW A;  2M51 A;  2FRY A;  2KRN A;  3VS2 A;  1WXT A;  3M0S A;  2K7A A;  3KFV A;  1V1C A;  2ROT A;  2HDA A;  4J9C A;  1X69 A;  2JTE A;  1WYX A;  3M0Q A;  1YWO A;  1NG2 A;  2LNH B;  4CC7 A;  5IHN A;  1YCS B;  2RNA A;  2DL7 A;  4RTW A;  2DF6 A;  1WDX A;  2O31 A;  2MIO A;  5FWC A;  3NMZ C;  1X2Q A;  2KNB B;  2BZ8 A;  1UTI A;  2YUQ A;  2KBT A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  4J9G A;  5HY6 A;  1WGS A;  3SWN B;  4L6V 5;  1W2B A;  1QKX A;  1IRX A;  2P4R A;  2EYY A;  4J9H A;  2LQK A;  4E2F B;  5IH2 A;  1V76 A;  4J8O A;  4JRQ A;  1YIT Q;  4M4Z A;  1Q86 C;  1VYU A;  1PSF A;  1BBZ A;  3PGG A;  3EGD B;  1AWW A;  1YI2 Q;  4M7A B;  2ESW A;  1W4S A;  2J6F A;  1KQS A;  1QLY A;  3A1P A;  3JCM f;  2QAS A;  2DIL A;  4RG8 A;  4C8Q G;  2X4X A;  4ZGD B;  1AOJ A;  2F69 A;  4EMG A;  1ZA2 B;  1NYF A;  1YJN A;  3KBG A;  1MV0 B;  1HJD A;  3JCM c;  1D09 B;  2A37 A;  3EG1 A;  3OSV A;  3PT9 A;  2IG0 A;  5GAO n;  1TG0 A;  2FVU A;  4IUV A;  2VVK A;  1QWE A;  3BFM A;  2KE9 A;  3CPW P;  4ZN1 A;  2MYS A;  4Z02 A;  4GLK A;  1BI2 A;  2IIM A;  2KXC A;  2RH2 A;  2ECZ A;  3PMI A;  2CUB A;  1QCO A;  2NLU A;  4M77 E;  1U1S A;  1LPL A;  4FW1 A;  1V29 B;  3RDV A;  5CCA A;  4HVW A;  4WCI A;  3M4G A;  4ATO A;  4M7D C;  7AT1 B;  5GMK l;  4AFU C;  1NEB A;  1VQP T;  2OTJ T;  1PNJ A;  2DL4 A;  4E7L A;  3CMA A;  1K73 U;  1RAC B;  4C92 E;  3CCE A;  2QQB A;  1M90 C;  2NUT A;  3HRT A;  1WZO A;  4HCK A;  5KYY A;  1B34 A;  1G3Y A;  1OV3 A;  5CVI A;  1SPK A;  1WIE A;  3AT1 B;  3S3O A;  4ZN3 A;  5GAM f;  4JS5 A;  2LCL A;  1TWB A;  1UEC A;  2AKL A;  1D0Y A;  1K0S A;  3A8L B;  1QVP A;  2KRO A;  5A0D A;  2D8J A;  2LQ8 A;  3QWX X;  3GNF B;  4MML A;  2L3R A;  3GP8 A;  2PTK A;  4RTT A;  5KYW B;  3TEE A;  2HAX A;  2AZV A;  3PIO A;  4KGX B;  2K5L A;  2X4Y A;  4BI4 A;  4C8Q F;  3NGP A;  2JMA A;  1Q86 R;  1VQ6 A;  3X25 B;  4ESR A;  1OOT A;  1JRI A;  1I1J A;  2M1H A;  3P8H A;  4M77 D;  2V1Q A;  1GRI A;  3AHU A;  2RJC A;  3HSB A;  5FU6 C;  3OBW A;  4J9F A;  2DXU A;  3DKM A;  2NUZ A;  1A0N B;  1C1A A;  4M75 D;  2B86 A;  3JCM V;  2DJZ A;  3QJ6 A;  3CBM A;  3TSW A;  1VQ9 Q;  1QP2 A;  5IHI A;  2X4W A;  1AWJ A;  1YJW A;  2XU8 A;  2ZZD A;  4JLG A;  1VUB A;  2HNI A;  2X3W D;  4J6W A;  2J06 A;  1K8A U;  3NHN A;  4BD3 A;  1WXU A;  2FPD A;  4M7A F;  2EYQ A;  3OS0 A;  3U23 A;  2QEX A;  3H9N A;  4AG1 C;  4YTL A;  3JAM E;  1KD1 U;  2VGM A;  4M78 G;  3FRN A;  1M3B A;  1MGQ A;  1PSE A;  5LJ5 h;  2CZ7 B;  2CUD A;  1SSH A;  3CC4 Q;  1Y7X A;  1SF9 A;  4MMK A;  3JCM e;  1B7T A;  3QPH A;  2XG8 D;  1M90 R;  1AT1 B;  1ZQ1 A;  4XU3 A;  3L2V A;  2EJG A;  3G4S A;  1VQN A;  2GQI A;  1WHK A;  1AVZ C;  2LX7 A;  2RO0 A;  3A5Z B;  3TSZ A;  3LWI A;  2V8I A;  1RAH B;  4EIK A;  1FWZ A;  1X75 C;  3P8B B;  2KMT A;  1XOV A;  2PVD B;  2MPX C;  2DTI A;  4A4E A;  5GAN e;  1NLP C;  4BB7 A;  4FT4 A;  4IIM A;  2P84 A;  3N5B B;  3M0T A;  1KSW A;  3EH1 A;  1UDL A;  1HXD A;  4E7Z A;  4FT2 A;  1R8O B;  1UHF A;  4HVV A;  1UFF A;  3MP6 A;  2QK0 A;  2CP3 A;  1UE9 A;  3WVE B;  2CP0 A;  1K1Z A;  2VKN A;  1QVF P;  1NEG A;  3OYF A;  2DIQ A;  4BI8 B;  1TUG B;  5GAN h;  3CME Q;  1WJQ A;  2CH4 W;  3EFS A;  1K9M U;  2X4J A;  4PJO E;  2ZPB B;  1VQO Q;  1ZUU A;  3PIP A;  1BCM A;  1ZHI A;  3QII A;  1DJ7 B;  2FZG B;  2D1X A;  2EGA A;  2DBM A;  2CKK A;  4E6R A;  1IHV A;  2QI2 A;  1WQW A;  2LRQ A;  8AT1 B;  1S1N A;  2JTF A;  1KC8 U;  2D0N A;  3J80 E;  1ZBX A;  3BDU A;  3CCM Q;  1OX9 A;  5GJW B;  4JLI A;  2HL5 C;  2CYZ B;  1UUE A;  3V7S A;  4CI0 C;  3CCL Q;  4DBQ A;  2OAU A;  4M77 B;  3QYH B;  1IRE B;  1D0Z A;  2M0O A;  1WHG A;  2QQR A;  3TRE A;  3JB9 F;  3LX7 A;  5C6S A;  1Q7Y C;  2R5M A;  1KQ2 A;  1G3S A;  1YWP A;  2KAF A;  2YUN A;  4C92 B;  4OGC A;  3CC7 Q;  2GTO A;  2E12 A;  2ZAE A;  2I2L A;  5CAI A;  2K57 A;  3O8V A;  3OSS C;  5KE2 A;  3OYH A;  3PVQ A;  4LDU A;  1VQP A;  2OTJ A;  3EG9 B;  4IUQ A;  5LJ5 g;  5CIU A;  3OW2 S;  3VYH B;  5LJ3 j;  2DRK A;  1ABO A;  2RB6 A;  5CKE A;  2QA4 T;  3EFR A;  2L0A A;  2JZ2 A;  2O01 E;  3JCM P;  3VUZ A;  2LJ0 A;  2HMA A;  4FYV B;  3PMT A;  1ZLM A;  2SRC A;  4QW2 A;  1ZUY A;  5KYU B;  4UC4 A;  5LL6 S;  5D6Y A;  1MV3 A;  3FJ5 A;  4DOV A;  4N4G A;  3LYI A;  2R57 A;  2GTJ A;  3RIR A;  1N9R A;  3VS3 A;  1AHJ B;  5CKH A;  2HKQ B;  4JJD A;  2GCX A;  5FU7 C;  3CXC S;  4A54 A;  2EYW A;  1UHC A;  3GNG A;  2M51 A;  1MNE A;  5GAN 7;  2JVV A;  2FRY A;  1VQ7 T;  4WF2 A;  3EFO B;  3KFV A;  1C0M A;  1HYO A;  1V1C A;  1TH7 A;  2L8D A;  2RJE A;  4CC7 A;  5IHN A;  4BE0 A;  1QVG S;  1G8X A;  3ME9 A;  4HA8 A;  4RTW A;  6AT1 B;  1VQ4 T;  2PQW A;  1WDX A;  2O31 A;  3DLM A;  4M75 G;  3EGX A;  4PFZ A;  3CC2 T;  3NTK A;  3NMZ C;  1NJI C;  3OQ5 A;  4MDX A;  2BZ8 A;  3M57 A;  1IXD A;  1YJW Q;  2RK2 A;  1JO8 A;  4M7A D;  4AFZ C;  4F7U A;  3CCS Q;  1M8M A;  1Y57 A;  4LUD A;  2DPP B;  4DQ2 A;  2L3Q A;  3HHT B;  5I11 A;  1GFC A;  1XQH A;  1OEB A;  3OYG A;  2EPD A;  1SRM A;  1PRL C;  1OU8 A;  1WFW A;  2CP2 A;  2O9V A;  4N0A C;  4QQ6 A;  2CP6 A;  1M1K U;  5KYX A;  3JRZ A;  2E65 A;  4KH1 B;  3OW2 P;  1M1G A;  2HZY A;  2M02 A;  4J6Y A;  3GBQ A;  5I2S A;  2QQS A;  4GY5 A;  1Q7Y R;  2EQI A;  2YRC A;  4XQ3 A;  1X43 A;  4OB3 B;  3A8H B;  4GLM A;  4BE2 A;  3G4S Q;  2KQW A;  1BIA A;  1OUL A;  2RI5 A;  4C8Q C;  2XI9 A;  1NLO C;  3VYG A;  4JZ3 A;  4C92 A;  4KGV B;  1RLQ C;  1T3S A;  2DVJ A;  4OMM A;  2J6K A;  1F1B B;  1PKS A;  2E6N A;  2HBW A;  1YBY A;  1WJR A;  1B07 A;  3A8G B;  2GBQ A;  3M56 A;  2VWF A;  3OA6 A;  3G6E Q;  4TVR A;  3JCM d;  5GMK j;  3MEW A;  4M77 F;  1MND A;  4WTO B;  3DB3 A;  3OYL A;  1WHJ A;  4R55 A;  1NE8 A;  4HXJ A;  1H92 A;  2RJF A;  2DTO A;  2LJ1 A;  1SHG A;  2OTL Q;  4M75 F;  3BDL A;  5GAN d;  2K79 A;  1WLP B;  4K11 A;  4PJO B;  4LDW A;  2NUT B;  2DET A;  4J7I A;  5KYY B;  1B34 B;  5GAM j;  2EYX A;  3FDR A;  1PC0 A;  1Q82 C;  3CPW S;  3I55 Q;  3LLR A;  2BTT A;  5FRO A;  3CCU T;  5KCO A;  2EKH A;  2VAS A;  5GMK i;  3JB9 D;  1YIJ A;  1NJI R;  5CQY A;  2HSE B;  4RTU A;  1RAE B;  2DLP A;  3OBY A;  1WHM A;  1WPY A;  3H41 A;  4LXC A;  4Z8A A;  3E9G A;  1U5S A;  1YJ9 Q;  1Z9Q A;  4OP0 A;  3A8M B;  1I5L A;  3BE3 A;  4JPB W;  3FIF A;  2GF7 A;  2E4H A;  2F2W A;  3ASK A;  1C6V X;  1X6B A;  1SRL A;  1YN8 A;  3CCQ Q;  2A28 A;  5FRN A;  3FLG A;  3I56 Q;  4Q5W A;  4EMK C;  1GXI E;  5LJ5 f;  5J26 A;  1RL2 A;  3MO8 A;  3PE0 A;  3E2U A;  3QDF A;  3GLX A;  3RKY A;  3ZBD A;  3VS6 A;  4FIB A;  1R0B G;  1Q81 C;  2OAW A;  2VXF A;  2YDL A;  4LDX A;  1S72 Q;  1MMA A;  1UEB A;  4Z89 A;  4F7U E;  4EMH A;  3EHR A;  2GFA A;  3MEA A;  4X9C A;  3VS5 A;  2DZC A;  1PRM C;  1M3A A;  2QA4 A;  1JJ2 P;  5ECA A;  1T0J A;  1X2K A;  5D7U A;  4VUB A;  2NUP A;  2DMO A;  2RJD A;  2JN0 A;  3MKD A;  1WQ7 A;  1MHN A;  2BZX A;  3EG3 A;  1VQL T;  5GAO p;  1PG5 B;  4DA4 A;  3L2Q A;  3CD6 T;  1TXQ A;  2ATC B;  2V1R A;  4OML A;  4ZNX A;  2YRV A;  5IXF A;  1MMN A;  2J7I A;  1M2V A;  3JV3 A;  2VC8 A;  4M78 C;  3KXT A;  1VQ7 A;  4XTV A;  2DEU A;  1AZE A;  2RF0 A;  3OW2 A;  5I22 A;  4QQG A;  2RHU A;  1G2B A;  1BCO A;  4N0A A;  4A4K A;  1X27 A;  2XHC A;  3QBY A;  4M7A G;  3SDZ A;  4PJO A;  4BUG A;  1Q82 R;  1FYN A;  1WHL A;  2FZC B;  1VQ4 A;  2EQM A;  1OPL A;  3MCA B;  3EAE A;  2Y4X A;  3CC2 A;  3JCM X;  1NPR A;  3QSU A;  1YI2 T;  4C5H A;  3R6O A;  1QP3 A;  3CXC A;  2KRS A;  2VV5 A;  3X28 B;  4E47 A;  4LNP A;  4X34 A;  4CC3 A;  1ZBJ A;  3LH0 A;  1UJ0 A;  3OYY A;  1KFZ A;  2CT3 A;  2QGF B;  4C0D C;  2P0K A;  4ANJ A;  5LJ3 e;  1KHI A;  4LDV A;  1QVG A;  1JXO A;  1BK2 A;  2DBK A;  2JS0 A;  4J5Y A;  2GNC A;  4DEY A;  5HK3 A;  3WVD B;  1YP5 A;  2YT6 A;  2JXB A;  3PVL A;  1VQK Q;  4PJJ A;  1VQM T;  2RHZ A;  2DZ9 A;  3FJP A;  1Q86 U;  2P0P A;  4JRK A;  1Q81 R;  2KGT A;  1QKW A;  1VQ5 Q;  4C92 D;  1O9S A;  1HD3 A;  3ZFJ A;  1WHH A;  1SEM A;  2LP5 A;  3ULR B;  3CCR A;  2QTX A;  3OYB A;  2LJ3 A;  4HVU A;  3TQ7 P;  5FLX E;  3RBB B;  5GAO l;  1M27 C;  1QVF S;  2OI3 A;  4PJL A;  3VRZ A;  2A36 A;  3JB9 J;  1X01 A;  3QUI A;  1M1F A;  3CCV Q;  2O2O A;  3M9Q A;  3I5S A;  3M59 A;  4MZM A;  2E70 A;  3C95 A;  4A4F A;  3G71 T;  3R6N A;  1WX6 A;  3LH5 A;  3NTI A;  1OZ2 A;  4C0Z A;  2QDL A;  4KBM B;  3QJY A;  3EGU A;  2EIF A;  3CQT A;  4KRT A;  2HQE A;  2IPO B;  4PLI A;  1PD1 A;  1VYT A;  8ATC B;  1YIJ Q;  3CCJ Q;  2JNG A;  4A4H A;  3UA7 A;  3CBO A;  3JB9 G;  1N27 A;  1U1T A;  1M8V A;  4C5E A;  3A98 A;  3OS2 A;  3MET A;  3CCU A;  1M9S A;  2DFU A;  1YHQ T;  5FU6 B;  1ACM B;  2KSS A;  2CP7 A;  5FW9 A;  1GFD A;  4KH0 B;  5IT9 E;  2JM8 A;  1M90 U;  2FEI A;  1M2O A;  3JCM h;  2F5T X;  1RI0 A;  2R5A A;  3VS2 A;  4OB2 B;  3QXE B;  3C94 A;  5GAO q;  2YWW A;  4OVA A;  3SB2 A;  1X69 A;  4MDW A;  1YWO A;  2K5I A;  2HBP A;  2LDM A;  2C06 A;  1YCS B;  2RNA A;  3CPW A;  2DL7 A;  4FYY B;  3EGX B;  4N4H A;  3MEV A;  2MIO A;  1IB8 A;  1YJN Q;  5GMK e;  1N8R C;  4O5V A;  3S3M A;  4IUR A;  1X2Q A;  4BI3 A;  1VQ9 T;  1G5V A;  5CKF A;  4M75 C;  4F7U B;  1PHT A;  1SG5 A;  2C0I A;  3G7Z A;  2XIC A;  1ZX6 A;  3RR6 A;  3MJX A;  3QZ5 B;  2DEQ A;  4M78 A;  2RPN A;  2OJ2 A;  4M7D A;  1WJS A;  5KYX B;  1QMC A;  4JJN K;  2L3P A;  4OGE A;  4C8Q E;  1WXB A;  5FWB A;  5CO7 A;  5GAM e;  2H8H A;  3GPL A;  1W70 A;  3CC4 T;  3O5Z A;  2DKG A;  1ZSZ C;  2EKO A;  4JRI A;  4C0F A;  2YUO A;  2KXD A;  5GJV B;  2PNI A;  3CMA Q;  1VQL A;  3V8L A;  2JS2 A;  4KGZ B;  3CCE Q;  2DIG A;  2Z0W A;  3CD6 A;  5FRM A;  2BIV A;  3J81 E;  3VS7 A;  1KIK A;  4XU1 A;  5GAM h;  1I81 A;  2E5Q A;  2KT8 A;  4AG2 C;  2JW4 A;  2QDY B;  4IUP A;  2XID A;  5GMK m;  1K9A A;  3EHQ A;  1JEG A;  2A3L A;  4FW2 A;  2CGH A;  3E19 A;  1PD0 A;  2Y4Y A;  1P92 A;  2W10 A;  1FXX A;  2ZPH B;  4ZGJ B;  1I07 A;  2BKD N;  4PJO D;  1UGR B;  4XTZ A;  1VIF A;  2YUP A;  1BIB A;  2V8K A;  1TOV A;  2FL7 A;  3J7A F;  4IUU A;  2MCN A;  2EYZ A;  4HT9 A;  1EZZ B;  2E41 A;  3GOX A;  1YI2 A;  3CME T;  1VQ6 Q;  3OYN A;  4Y28 E;  1R77 A;  3OMC A;  4PFO A;  1Y96 A;  1VQO T;  4C0G A;  4L5G A;  3F70 A;  4E7H A;  3QKJ A;  2DX1 A;  1ZUK A;  2A7Y A;  4ELZ C;  3OYM A;  3PNW C;  2EAY A;  4M77 G;  4BY6 C;  3QHS A;  1CSK A;  2D0Q B;  1D1B A;  4RTX A;  3REA B;  4F16 A;  1H3H A;  1GCP A;  1W6X A;  5D6X A;  3VS4 A;  4CC2 A;  2RQW A;  5LJ3 d;  4P5N A;  2HQH A;  2DNU A;  3CCM T;  5J39 A;  2LQN A;  4JRP A;  3V7C A;  1KQS P;  3M0R A;  1N8R R;  4C92 G;  3CCR Q;  1FMV A;  4FU6 A;  3CCL T;  2RM4 A;  5GAN g;  3Q1J A;  1BKB A;  2RN8 A;  3E9F A;  3RMS A;  2XDD A;  2K2V A;  1VQM A;  4HCC A;  1KQ1 A;  4NOY A;  1N8R U;  1NPP A;  2ZPG B;  5KE3 A;  5GAO r;  2HQX A;  3T9N A;  3CPF A;  5LJ5 j;  3CC7 T;  1X6O A;  5DM7 R;  2ROL A;  2QEX Q;  2PVO B;  2DYI A;  3OYE A;  2DM1 A;  2ZPE B;  1LVK A;  3M58 A;  4C5I A;  3UAT A;  1UGP B;  2D8H A;  1VYV A;  4PL6 A;  2KYB A;  2ABL A;  5I2M A;  3ZL7 C;  2C0T A;  3C4S A;  4FYX B;  5AYF A;  3G71 A;  4BDZ A;  1TTH B;  5FU7 B;  2V8J A;  3LWH A;  2QQ9 A;  3HL8 A;  3CCU Q;  2EQK A;  1VQ8 T;  1Q95 G;  4F7U F;  1VQN Q;  3KUF A;  3MPU B;  5HKC A;  1JBM A;  1OQK A;  1K76 A;  5HCK A;  1Q7Y U;  2XMF A;  3V7R A;  3OYC A;  2JT4 A;  4DEX A;  1QVF A;  2LQW A;  2BE9 B;  4M78 E;  2NUP B;  1K0X A;  3OYD A;  1VIE A;  4M7D E;  4RTY A;  3UDC A;  3L1A A;  1N6A A;  4N4I A;  2RMO A;  4LE9 A;  3I9Q A;  1R0C B;  2EJF A;  3X20 B;  2K5F A;  1YHQ A;  3E1S A;  2PUK B;  5EC7 A;  5CKB A;  2JJ9 A;  5J3B A;  1M2V B;  1J3T A;  3SWN C;  1XJW B;  2DD4 A;  3OYA A;  1MUZ A;  3FC3 A;  3HP9 A;  4C92 F;  4HCB A;  2DL8 A;  2ED1 A;  3CCS T;  4PKC C;  1JJ2 S;  1XNI A;  2LVM A;  5GAN 3;  1TU0 B;  2AT1 B;  1VA7 A;  5GAN 2;  4JS4 A;  4IIO A;  2QAZ A;  4D6W A;  1K73 C;  4M7A C;  1AWX A;  1ZSZ A;  2RHI A;  3I35 A;  2KK4 A;  4J6X A;  4DBF A;  1OPK A;  2LX9 A;  2YXY A;  3MP1 A;  1VQ9 A;  5C0M A;  2QYZ A;  3OYI A;  3MHX A;  4ZTF A;  4C8Q B;  3S3N A;  4B9W A;  3M54 A;  4OMN A;  1BB9 A;  1IO6 A;  3M55 A;  2JMC A;  2MWP A;  3JB9 I;  1UGV A;  3L42 A;  1BI1 A;  2LNV A;  2K3Y A;  2E3H A;  2X35 A;  4M7D D;  4KUL A;  1NJI U;  2L5Q A;  4ORZ A;  4JJC A;  5GAM d;  3INZ A;  3CC4 A;  2CP5 A;  1M5Q 1;  2W0Z A;  1RAI B;  2DVE A;  1VQP Q;  2OTJ Q;  4FM4 B;  3V8K A;  1EIF A;  1PCX A;  2D6F A;  2EW3 A;  3G6E T;  2ZCF B;  4EPC A;  5EG2 A;  3REB B;  1VOM A;  4QVC A;  2QG9 B;  2AKK A;  4PJO G;  4OMQ A;  1BU1 A;  2DL5 A;  2J05 A;  2EFI A;  4MZT A;  2M0Y A;  2NWM A;  1QCN A;  2GGR A;  4OMF B;  2VYT A;  4ZGE B;  3VS1 A;  2CRE A;  1FX7 A;  2DE0 X;  2OTL T;  2L2P A;  5KCH A;  2JM9 A;  1H3Z A;  3ZEH A;  3WXM B;  1FMW A;  1TUC A;  2RI2 A;  1G3T A;  4J7F A;  1NBE B;  4E7K A;  1I4K 1;  1WNL A;  2P0Q A;  2KVQ G;  2RI3 A;  2ENM A;  3RER A;  4AMC A;  1JU5 C;  3I55 T;  1QQJ A;  3DB4 A;  1KHC A;  1YNZ A;  4R56 A;  1K8A C;  4Y92 A;  3G1J A;  1N5Z A;  3CME A;  2LC4 A;  1VQO A;  2RA2 A;  5GAN f;  4JUV A;  1Y0M A;  1KD1 C;  5AT1 B;  1X6G A;  1VQM Q;  1YCY A;  3GF5 A;  4EMK B;  2EQU A;  3UA6 A;  2X3X D;  4B6M A;  2DD5 A;  3THK A;  2LCS A;  1TUD A;  1YJ9 T;  4J9D A;  2KY9 A;  2A0F B;  3RMQ A;  1K73 R;  1LNX A;  3CCM A;  2PZ1 A;  2K9G A;  5IHK A;  3M5A A;  1FMK A;  2PUO B;  4XTX A;  4E7J A;  2AK5 A;  2DO3 A;  5D6W A;  3CCL A;  3HFO A;  1YIT T;  3CCQ T;  2YRD A;  5IN1 A;  3HTR A;  4FSS A;  4XTY A;  2HL3 A;  3I56 T;  3VV0 A;  3EG2 A;  2SEM A;  2FRW A;  2CS7 A;  3V8J A;  2COW A;  1Q82 U;  2KRN A;  3M4Y A;  4IKF A;  4M75 E;  3M0S A;  2O4X A;  3G71 Q;  2LT4 A;  4C8Q A;  2ROT A;  2HDA A;  4J9C A;  4E7S A;  3CC7 A;  4JDS A;  1NG2 A;  5KH6 A;  5GAN 4;  3P8D A;  4HT8 A;  2DF6 A;  4HCZ A;  4J83 A;  1S72 T;  3OYK A;  4PJO F;  3OMG A;  3NFC A;  1D1C A;  2EWN A;  4ZTJ A;  2YUQ A;  2KBT A;  4AT1 B;  2DXB A;  3URG A;  2DTH A;  2B8A A;  5GAN 6;  4XTU A;  1QW1 A;  4NL3 A;  4Z88 A;  1K9M C;  4M78 B;  1GCQ C;  2MMP A;  1U06 A;  3CEY A;  4AFS C;  1ABQ A;  1JXM A;  2WSC E;  3L2Z A;  3X24 B;  3SWN A;  1VQ8 A;  3GIB A;  4M7D B;  4F14 A;  5LJ3 h;  2HD0 A;  3BW1 A;  4QT7 A;  1RAF B;  1YHQ Q;  3H0H A;  2QGG A;  4RUG A;  5CKD A;  3C12 A;  5L8R E;  1U8R A;  3QWY A;  1SKU B;  4DBH A;  2KRM A;  2D9T A;  2K2M A;  1KC8 C;  3QZ9 B;  4QVD A;  2AZS A;  1ZSG A;  3EGD A;  3CBP A;  1W1F A;  3PTA A;  4M7A A;  4KT0 E;  1Q81 U;  2XDB A;  5A0G A;  2WAC A;  1GL5 A;  2G6F X;  3UPU A;  4RCB A;  1GBR A;  4J9E A;  2VUB A;  3H6Z A;  4OMO A;  1K8A R;  1PKT A;  4V2S A;  2VXE A;  4QVZ A;  3JCM b;  3HFN A;  3H0F A;  3HPW A;  1OU9 A;  3VS0 A;  4C0D B;  1KD1 R;  2XKO C;  2L3S A;  5LJ5 e;  4XU2 A;  2RHY A;  1NM7 A;  3L2U A;  4J9I A;  2M9U A;  3CCS A;  4X9D A;  5DLQ E;  4LN2 A;  2KR3 A;  1N9S A;  4D8D A;  2X9H A;  3RKW A;  2XD0 A;  1D1A A;  4RMO A;  4EMK A;  3QO3 A;  3JCM Q;  4OMP A;  5CK9 A;  4M7D G;  2ZPF B;  4FCY A;  1Y96 B;  3TU4 K;  1IGU A;  3OS5 A;  2HCK A;  2DAQ A;  4XU0 A;  1RAB B;  3RES A;  1U3O A;  2DXC A;  2DYB A;  2FZK B;  1JQQ A;  2MOX A;  2F1L A;  4BAC A;  2E6Z A;  4JZ4 A;  5DY9 A;  1VQK T;  2CT4 A;  2F2X A;  1JJ2 A;  4FYW B;  1OZ3 A;  3SD4 A;  2CSQ A;  1E7O A;  2EBP A;  4M77 C;  1HSQ A;  2DRM A;  2H3J A;  3OY9 A;  3X26 B;  3VJP A;  1VQ5 T;  2ED0 A;  2QTV A;  2EGE A;  1BYM A;  3TCJ A;  3RKX A;  1G83 A;  4PJN A;  1SHF A;  1H64 1;  2MF2 A;  2QXF A;  4C92 C;  4KUD K;  2QA4 Q;  3G6E A;  9ATC B;  1W2B S;  1XTD A;  4JJB A;  2DL3 A;  3CCV T;  1K9M R;  2HKN A;  2KEA A;  3H8Z A;  1LJO A;  5IAY A;  2COY A;  1AWO A;  5KYW A;  5LJ3 g;  1AD5 A;  3VRY A;  1OX8 A;  1IZ6 A;  5GMK h;  2KT1 A;  1E6G A;  2E10 A;  2GQV A;  2CSI A;  4D8K A;  2NYS A;  1KC8 R;  2O9S A;  3DLL A;  2K3B A;  4A63 B;  1YIJ T;  2OTL A;  3CCJ T;  1AZG B;  1Z9Z A;  1I5O B;  3HKS A;  1KQS S;  1LCK A;  2MK5 A;  1VQ7 Q;  3L2W A;  2XK0 A;  4X1V A;  1M1K C;  4XTW A;  5A0L A;  2FO0 A;  1QCF A;  2BE7 D;  2EGC A;  3QYG B;  4QKU A;  3I55 A;  2O88 A;  4DBR A;  1M30 A;  1VQ4 Q;  2J6O A;  2R58 A;  3FEO A;  4ELY C;  2FB7 A;  2QQA A;  1ARK A;  4CC4 B;  3CC2 Q;  4M78 F;  3HRS A;  2KI7 A;  1M3C A;  4M7D F;  1AEY A;  4CRI A;  4RG2 A;  4IUT A;  2F5K A;  4KUI A;  4PNO A;  4AFQ C;  1EFN A;  3UF4 A;  3TVT A;  1EX4 A;  1YJ9 A;  4MZP A;  2AIR B;  4OB0 B;  4ME7 A;  3LGL A;  4DOW A;  4M75 B;  4NL2 A;  4F7U G;  4F17 A;  1OI1 A;  2IVW A;  2JTM A;  2YLB A;  5DLO A;  1UB4 A;  2KDS A;  1BI0 A;  3PFS A;  1YIT A;  1UG1 A;  2DK3 A;  4LUE A;  1Y71 A;  3CCQ A;  4M7A E;  1GBQ A;  3M0P A;  4PK4 A;  5KYN A;  2XDP A;  2JOY A;  2DA9 A;  3I56 A;  3RUX A;  1YJN T;  1GCQ A;  5CQX A;  2MI6 A;  2RHX A;  4LD6 A;  1B3Q A;  1W2B P;  5M9O A;  2WSF E;  2ZGW A;  3BY7 A;  3MEU A;  2CZ0 B;  4C8Q D;  1UGQ B;  2VGN A;  1TS9 A;  3JCM g;  3VUB A;  1VQ8 Q;  4RCC A;  2RD1 A;  4NS5 A;  1ZSZ B;  1KK7 A;  2H3E B;  3MP8 A;  2BUD A;  1I0C A;  2YHT A;  2HEQ A;  1S72 A;  3NPF A;  1PWT A;  4QQD A;  3UWN A;  5L23 A;  2M16 A;  3L2R A;  4FSX A;  2EQJ A;  1MMG A;  2MAM A;  4EDU A;  2LT1 A;  3S6W A;  2PU9 B;  2LZ6 B;  1E6H A;  3H0I A;  3LGF A;  2DER A;  4PJM A;  1KG1 A;  1RAG B;  2LCC A;  3JCM W;  1T0H A;  1D3B B;  2E5K A;  1MMD A;  3CMA T;  5IXB A;  4XAX B;  2C0O A;  3CCE T;  1RI9 A;  1I8F A;  3M0U A;  4Y91 A;  1T3L A;  2MWO A;  2CZ1 B;  2RK1 A;  3I5R A;  2FG0 A;  2FPF A;  3NTH A;  1UJY A;  1IGQ A;  2E1H A;  2ZPI B;  3SHW A;  2X51 A;  3LW5 E;  4RTZ A;  1NYG A;  1WA7 A;  1RAA B;  5GAO m;  2E64 A;  2RQU A;  3IQL A;  5CR2 A;  3A8O B;  2K6D A;  4PLL A;  3SEM A;  1PM3 A;  4OF1 A;  1CKA A;  1M1K R;  2HSP A;  2CH4 A;  2F2V A;  1JB0 E;  4FL6 A;  2VB6 A;  5I21 A;  4O6J A;  3VKI A;  1YFN A;  4II1 A;  3OB9 A;  1CKB A;  1H8K A;  1BI3 A;  2LMJ A;  2AHJ B;  1RAD B;  4BY6 B;  3JB9 H;  5A2Q E;  4LD9 K;  4PJO C;  5GAM g;  2G3R A;  3JCM J;  1VQ6 T;  4J9B A;  1HK9 A;  5LJ5 d;  4M77 A;  2E3I A;  2FYK A;  2RQV A;  2K3X A;  4F04 B;  2CDT A;  2JUF A;  1WI7 A;  1M4Z A;  4XK8 E;  4A4G A;  4R0K A;  2RQT A;  3UT1 A;  2K4Y A;  3QDR B;  4C5G A;  5GAN j;  5GAN 8;  2DXT A;  4RTV A;  1ZA1 B;  2KYM A;  2COZ A;  4L59 A;  2LTO A;  3RNJ A;  4M75 A;  3CXC P;  1RUW A;  2BZY A;  4LDY A;  4RKU E;  3HRU A;  2L89 A;  1D0X A;  3CCR T;  2YSQ A;  1IHW A;  4BDY A;  2FHD A;  2A08 A;  3EG9 A;  1RLP C;  3D7S B;  4BE1 A;  1KJW A;  2CZ6 B;  1YJW T;  1VQK A;  2I0N A;  3FB9 A;  1TSF A;  2P4T A;  3OS1 A;  1QVG P;  2EVR A;  1Y07 A;  2V26 A;  4GBQ A;  4E7I A;  2FPE A;  2OX7 A;  5LJ3 f;  3EH2 A;  2YLC A;  2RQR A;  4B9X A;  2DJQ A;  1VQ5 A;  4OB1 B;  1K4U S;  5KYU A;  1OYX A;  2QEX T;  3OYJ A;  2WSE E;  3C0C A;  1QWF A;  3M53 A;  4HKE A;  4PFP A;  1O75 A;  2PVG B;  2O4X B;  3QG1 A;  2Y90 A;  3CCV A;  5HK0 A;  1WXT A;  2K7A A;  2EJ9 A;  5GAN 5;  1VQL Q;  2JTE A;  3JSC A;  1WYX A;  3M0Q A;  3EFO A;  3ER0 A;  2LNH B;  4A53 A;  4M78 D;  1D3B A;  3CD6 Q;  1SSF A;  3G4S T;  1VQN T;  3VU3 C;  1LOJ A;  5FWC A;  3CCJ A;  1G3W A;  1UGS B;  3SFM A;  2KNB B;  1UTI A;  1NZ9 A;  2GFU A; 
#chains in the Genus database with same CATH homology
 1PHT A;  3EG0 A;  4J9G A;  1JO8 A;  2C0I A;  4AFZ C;  1M8M A;  1Y57 A;  1QKX A;  4LUD A;  4Z88 A;  1GCQ C;  1U06 A;  4AFS C;  1ABQ A;  1JXM A;  2L3Q A;  2P4R A;  2EYY A;  5I11 A;  1ZX6 A;  1GFC A;  4J9H A;  4F14 A;  4QT7 A;  1OEB A;  2RPN A;  5IH2 A;  2OJ2 A;  3H0H A;  4RUG A;  2EPD A;  1SRM A;  1PRL C;  1WFW A;  3QWY A;  4M4Z A;  2O9V A;  2L3P A;  2KRM A;  1WXB A;  1VYU A;  5FWB A;  1BBZ A;  2K2M A;  1AWW A;  2H8H A;  2ESW A;  2AZS A;  1W70 A;  1ZSG A;  1W1F A;  3O5Z A;  2J6F A;  3GBQ A;  1QLY A;  2EQI A;  2YUO A;  2KXD A;  5GJV B;  2DIL A;  2PNI A;  2JS2 A;  1X43 A;  4GLM A;  1GL5 A;  2G6F X;  1AOJ A;  3VS7 A;  1GBR A;  4J9E A;  1KIK A;  1NLO C;  4OMO A;  1PKT A;  4JZ3 A;  1NYF A;  2KT8 A;  4AG2 C;  1RLQ C;  1T3S A;  2DVJ A;  4OMM A;  2J6K A;  3H0F A;  1PKS A;  2JW4 A;  1MV0 B;  1HJD A;  3VS0 A;  1K9A A;  2HBW A;  3EHQ A;  1B07 A;  1JEG A;  2A37 A;  3EG1 A;  2L3S A;  1TG0 A;  2GBQ A;  1NM7 A;  2VVK A;  1QWE A;  2VWF A;  4J9I A;  2KE9 A;  2W10 A;  4LN2 A;  1I07 A;  2KR3 A;  4D8D A;  2IIM A;  2KXC A;  2ECZ A;  2YUP A;  4OMP A;  2CUB A;  2MCN A;  2EYZ A;  4HXJ A;  1H92 A;  4HVW A;  4WCI A;  2HCK A;  2LJ1 A;  1SHG A;  4AFU C;  1NEB A;  1U3O A;  2K79 A;  1WLP B;  2DYB A;  2DX1 A;  2MOX A;  1JQQ A;  1PNJ A;  2DL4 A;  4K11 A;  1ZUK A;  4JZ4 A;  1CSK A;  4RTX A;  2CT4 A;  2F2X A;  3REA B;  4F16 A;  2EYX A;  1H3H A;  2CSQ A;  1GCP A;  1E7O A;  1W6X A;  3VS4 A;  4CC2 A;  2EBP A;  2RQW A;  4HCK A;  2BTT A;  1OV3 A;  1HSQ A;  2DRM A;  2DNU A;  1SPK A;  1WIE A;  2LQN A;  2ED0 A;  3M0R A;  2EKH A;  2EGE A;  1UEC A;  2AKL A;  1G83 A;  1K0S A;  1SHF A;  2KRO A;  2D8J A;  2RN8 A;  3QWX X;  4RTU A;  4JJB A;  2DLP A;  2DL3 A;  3H41 A;  4Z8A A;  2PTK A;  4RTT A;  2KEA A;  1U5S A;  1Z9Q A;  2AZV A;  1AWO A;  1AD5 A;  4JPB W;  2ROL A;  3VRY A;  3NGP A;  2KT1 A;  2F2W A;  1E6G A;  1X6B A;  1SRL A;  2JMA A;  1YN8 A;  2DM1 A;  2CSI A;  2A28 A;  4D8K A;  4ESR A;  1OOT A;  3UAT A;  2O9S A;  1I1J A;  2K3B A;  4A63 B;  2D8H A;  1AZG B;  1Z9Z A;  1VYV A;  1LCK A;  2V1Q A;  2KYB A;  2ABL A;  1GRI A;  3PE0 A;  4X1V A;  3ZL7 C;  2C0T A;  2FO0 A;  1QCF A;  2EGC A;  4J9F A;  3VS6 A;  2NUZ A;  1A0N B;  2O88 A;  2OAW A;  1M30 A;  2YDL A;  2J6O A;  1K76 A;  2B86 A;  1ARK A;  4CC4 B;  5HCK A;  4Z89 A;  2XMF A;  3EHR A;  1M3C A;  3TSW A;  3VS5 A;  1AEY A;  2JT4 A;  4DEX A;  1PRM C;  1M3A A;  5IHI A;  2LQW A;  1AWJ A;  1T0J A;  5ECA A;  1X2K A;  1K0X A;  4RTY A;  1EFN A;  4AFQ C;  3UF4 A;  2X3W D;  3TVT A;  2DMO A;  2J06 A;  3NHN A;  2RMO A;  4LE9 A;  3I9Q A;  2BZX A;  3EG3 A;  1WXU A;  2FPD A;  4F17 A;  3U23 A;  4AG1 C;  5EC7 A;  1M3B A;  1UG1 A;  4LUE A;  1GBQ A;  3M0P A;  1J3T A;  2V1R A;  4OML A;  4ZNX A;  2DA9 A;  5IXF A;  1GCQ A;  2J7I A;  3JV3 A;  1B3Q A;  2CUD A;  1SSH A;  1MUZ A;  1AZE A;  2RF0 A;  5I22 A;  1G2B A;  2DL8 A;  2ED1 A;  1X27 A;  1FYN A;  1VA7 A;  2GQI A;  1I0C A;  4IIO A;  2HEQ A;  1AVZ C;  1AWX A;  2LX7 A;  1OPL A;  3NPF A;  1PWT A;  3TSZ A;  3I35 A;  1OPK A;  5L23 A;  4EIK A;  1XOV A;  2LZ6 B;  1E6H A;  3H0I A;  1NLP C;  4OMN A;  4IIM A;  2KRS A;  3M0T A;  1KSW A;  1BB9 A;  1T0H A;  1IO6 A;  2E5K A;  1UDL A;  4LNP A;  2JMC A;  4CC3 A;  1UGV A;  5IXB A;  1ZBJ A;  2C0O A;  1UJ0 A;  1KFZ A;  1UHF A;  1RI9 A;  4HVV A;  1UFF A;  2CT3 A;  1UE9 A;  3M0U A;  1T3L A;  1K1Z A;  2VKN A;  3I5R A;  2FG0 A;  2FPF A;  1JXO A;  1NEG A;  1UJY A;  1BK2 A;  2DBK A;  3SHW A;  2JS0 A;  4RTZ A;  1NYG A;  4ORZ A;  1WA7 A;  2CH4 W;  4JJC A;  2GNC A;  2RQU A;  3IQL A;  4DEY A;  2W0Z A;  2K6D A;  3SEM A;  1YP5 A;  1CKA A;  1ZUU A;  2YT6 A;  2EW3 A;  2HSP A;  2CH4 A;  2D1X A;  2EGA A;  2F2V A;  2DBM A;  2JXB A;  3PVL A;  4E6R A;  3REB B;  1S1N A;  2AKK A;  1CKB A;  1H8K A;  2D0N A;  4OMQ A;  2KGT A;  1BU1 A;  2LMJ A;  1QKW A;  2DL5 A;  1HD3 A;  5GJW B;  2J05 A;  2M0Y A;  1UUE A;  1SEM A;  2NWM A;  2LP5 A;  2GGR A;  3ULR B;  3VS1 A;  2LJ3 A;  4HVU A;  3RBB B;  1M27 C;  2CRE A;  4J9B A;  2OI3 A;  2DE0 X;  2L2P A;  2JM9 A;  3VRZ A;  2A36 A;  2RQV A;  1TUC A;  2CDT A;  1WI7 A;  2O2O A;  3I5S A;  1YWP A;  3R6N A;  1WX6 A;  4R0K A;  2RQT A;  2YUN A;  3LH5 A;  2QDL A;  2ENM A;  1JU5 C;  3EGU A;  2GTO A;  4RTV A;  2KYM A;  3CQT A;  4KRT A;  1YNZ A;  3RNJ A;  4Y92 A;  1N5Z A;  1RUW A;  2BZY A;  1VYT A;  3PVQ A;  2YSQ A;  3UA7 A;  1Y0M A;  2A08 A;  2DRK A;  1ABO A;  1RLP C;  1KJW A;  1X6G A;  2L0A A;  2I0N A;  3UA6 A;  3A98 A;  2LJ0 A;  2EVR A;  2X3X D;  1ZLM A;  2SRC A;  4GBQ A;  3THK A;  2LCS A;  1TUD A;  1ZUY A;  4J9D A;  2FPE A;  1MV3 A;  2RQR A;  2DJQ A;  2PZ1 A;  2K9G A;  3FJ5 A;  5IHK A;  1K4U S;  1FMK A;  2AK5 A;  2GTJ A;  3C0C A;  1QWF A;  3VS3 A;  5FW9 A;  4FSS A;  1GFD A;  4JJD A;  2JM8 A;  3EG2 A;  2SEM A;  2EYW A;  1UHC A;  2FEI A;  2FRW A;  2M51 A;  2FRY A;  2KRN A;  3VS2 A;  1WXT A;  3M0S A;  2K7A A;  3KFV A;  1V1C A;  2ROT A;  2HDA A;  4J9C A;  1X69 A;  2JTE A;  1WYX A;  3M0Q A;  1YWO A;  1NG2 A;  2LNH B;  4CC7 A;  5IHN A;  1YCS B;  2RNA A;  2DL7 A;  4RTW A;  2DF6 A;  1WDX A;  2O31 A;  2MIO A;  5FWC A;  3NMZ C;  1X2Q A;  2KNB B;  2BZ8 A;  1UTI A;  2YUQ A;  2KBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...