1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
4CC7A 2BZ8A 2CUBA 3VS5A 1PNJA 4J9BA 2KR3A 4IIMA 4AFSC 2JM9A 2YUOA 5I22A 1ZLMA 5I11A 1AWJA 1SRMA 2M51A 1S1NA 2VWFA 4OMPA 1AOJA 2KNBB 4ESRA 1WDXA 2JT4A 3RNJA 2QDLA 1K9AA 4HVVA 2CH4W 1PWTA 1JU5C 1G83A 1GCPA 2JS0A 2DL5A 1WI7A 2EYWA 1T0HA 4J9HA 3KFVA 3IQLA 2DA9A 2AKLA 2KROA 2DYBA 2DJQA 1M30A 2BZYA 1I0CA 3H0FA 5FWCA 1XOVA 1AWXA 1BB9A 2ESWA 1ZSGA 1ARKA 2JTEA 2K6DA 4GBQA 2EYYA 1T3LA 2J06A 1KJWA 1T0JA 3M0UA 2B86A 1HSQA 1PHTA 3M0TA 2RF0A 1NEGA 3A98A 4OMNA 2J6FA 3UF4A 1YCSB 2GGRA 1JXMA 2EGAA 5IHKA 1SHGA 4R0KA 3EHQA 2JM8A 3NHNA 1GFCA 1Y0MA 3VRZA 2LQNA 4JJCA 2CUDA 2RQTA 2DF6A 1AWWA 1VA7A 4CC2A 4JJDA 4LN2A 1GBQA 1B3QA 1VYVA 1G2BA 2CSIA 3LH5A 1YNZA 2GBQA 1WXTA 2GTJA 1NEBA 3NMZC 2KE9A 2EPDA 1RLQC 4E6RA 2AZVA 1MUZA 4DEXA 4J9DA 2ENMA 2LMJA 1AVZC 2FPEA 4RTWA 1X43A 3NPFA 1JQQA 2FPDA 3I9QA 1YWPA 1NG2A 2L3PA 2X3XD 1E7OA 4DEYA 2OI3A 4OMOA 2YUQA 4OMMA 2LX7A 3I5SA 4KRTA 2EYXA 2BTTA 1OEBA 2DILA 1X6GA 1SHFA 1ABOA 1GL5A 4RTXA 1JO8A 2D1XA 2SRCA 4J9FA 4Z88A 2PTKA 1FYNA 1U5SA 2VKNA 4J9CA 2BZXA 1K1ZA 2K9GA 2RQUA 1BBZA 1N5ZA 2FEIA 4Y92A 2CSQA 2KYBA 2HCKA 2H8HA 1GBRA 1EFNA 2MOXA 1VYUA 4AFUC 2YT6A 2CT3A 2RQRA 1CSKA 4GLMA 1J3TA 1QLYA 4FSSA 2AKKA 1WXBA 2RQWA 1YN8A 3UA7A 1T3SA 2ED0A 4Z89A 1CKAA 1ZBJA 4J9GA 3VS7A 1X27A 4HXJA 3QWXX 3VS1A 4F17A 1WX6A 2EBPA 3M0PA 2EVRA 2C0TA 1Z9ZA 2OAWA 4M4ZA 1HD3A 2EW3A 1X2QA 2DNUA 1AZGB 2KXDA 2DBKA 1W1FA 3REAB 4HVUA 3VS0A 4A63B 1KSWA 1QWEA 2DLPA 2P4RA 2KT8A 4LE9A 1M8MA 3VRYA 2EKHA 2F2VA 2PNIA 1WA7A 2LNHB 2MIOA 2KRMA 2VVKA 4HCKA 2HDAA 2V1RA 4LUDA 2YUPA 1AZEA 2EGCA 1VYTA 2J6OA 3QWYA 4RTZA 1M27C 2CH4A 2YDLA 3H0HA 2C0OA 5IHNA 1GRIA 1AEYA 2KGTA 1SRLA 2DL7A 2DM1A 2C0IA 1PRMC 1NM7A 1WYXA 1OV3A 1U3OA 1OPKA 3SEMA 1Y57A 2RN8A 4WCIA 1TG0A 4RTTA 2DX1A 2LJ0A 1H92A 2CDTA 3EG2A 5IXFA 1NYGA 2A28A 1E6HA 1Z9QA 2LQWA 2ROLA 4OMQA 2EGEA 2ROTA 1KFZA 2W0ZA 2AZSA 2J05A 1QKWA 4QT7A 1QWFA 2K79A 2FRWA 1W70A 1UHCA 4F14A 1B07A 2D8JA 2DL3A 2GQIA 1SSHA 2YUNA 5IXBA 1KIKA 2K7AA 1RUWA 1UHFA 2OJ2A 2L3SA 2O9VA 2RQVA 3ULRB 4AG2C 2JXBA 2J6KA 4JPBW 1X2KA 1RLPC 2CREA 3EG0A 2DVJA 3EG1A 2O9SA 3PE0A 2DBMA 1PKSA 1WLPB 1H8KA 3VS4A 4X1VA 1ZUKA 2EQIA 1UDLA 3C0CA 1WFWA 1UTIA 2GTOA 2F2WA 2RPNA 2KYMA 2XMFA 4ZNXA 1PKTA 1I07A 2FPFA 3EHRA 3M0QA 1OOTA 1M3CA 2NWMA 2NUZA 2ABLA 1WXUA 4JZ3A 2A08A 1WIEA 4JJBA 4K11A 3RBBB 2PZ1A 1JXOA 1PRLC 1AWOA 1UFFA 2JMAA 5GJWB 2LJ3A 2IIMA 4F16A 2RNAA 2D0NA 5IH2A 2J7IA 2KT1A 2A36A 5IHIA 2DMOA 2DE0X 1M3AA 1K0XA 3TVTA 4Z8AA 1RI9A 3THKA 1JEGA 4IIOA 2GNCA 2EYZA 2FO0A 1LCKA 3ZL7C 3JV3A 5HCKA 2LCSA 4CC3A 2FRYA 5GJVB 4OMLA 2LZ6B 2K2MA 2L2PA 2HEQA 2MCNA 1HJDA 3H41A 1K4US 3UA6A 3PVQA 1UUEA 4CC4B 1A0NB 1QCFA 4AFZC 4LNPA 1NYFA 1YP5A 2O2OA 2YSQA 3TSWA 1I1JA 2X3WD 3M0RA 2DRKA 1W6XA 1SPKA 4EIKA 4RTUA 1NLOC 1UJYA 2HBWA 2KXCA 1OPLA 3I35A 2DL8A 3CQTA 3EGUA 1AD5A 1UGVA 2DRMA 1K0SA 2LP5A 4AG1C 1TUCA 4LUEA 2O31A 1FMKA 1ZUYA 1GCQA 4J9IA 1BK2A 3REBB 2W10A 1UJ0A 2AK5A 2L0AA 1CKBA 4J9EA 2FG0A 1U06A 2KBTA 3GBQA 2D8HA 3FJ5A 4RTYA 1UE9A 2CT4A 3H0IA 4D8KA 1X6BA 2G6FX 2I0NA 3VS3A 2F2XA 2JS2A 2A37A 4HVWA 3SHWA 1GCQC 4AFQC 3R6NA 5L23A 2DL4A 3PVLA 3M0SA 2HSPA 1BU1A 3NGPA 2K3BA 3TSZA 2M0YA 1M3BA 1SEMA 3I5RA 1IO6A 1MV0B 4JZ4A 5FWBA 3U23A 2V1QA 1ZUUA 4D8DA 3VS6A 1E6GA 1UECA 2KRSA 2O88A 5FW9A 3EG3A 5ECAA 4RTVA 2RMOA 2ECZA 1UG1A 1ABQA 2JW4A 2KRNA 2SEMA 1H3HA 1MV3A 1TUDA 3UATA 1QKXA 1V1CA 2LJ1A 4ORZA 2E5KA 1YWOA 2L3QA 4RUGA 5EC7A 2KEAA 1GFDA 3VS2A 1K76A 1NLPC 3O5ZA 2JMCA 1X69A 2ED1A 1ZX6A
chains in the Genus database with same CATH superfamily
3HRUA 2VGNA 1QP3A 5I22A 1UGQB 2E6NA 1BKBA 1AWJA 4OMPA 2KNBB 3CCET 5GANe 3JB9J 1WDXA 2JT4A 3RNJA 2E12A 2QDLA 1YHQT 3J81E 4HVVA 3MP6A 2HAXA 3NFCA 2VXFA 4J6YA 2DL5A 1G5VA 1T0HA 4J9HA 4KT0E 3KFVA 2AKLA 4PFOA 2KROA 4E47A 5LJ5j 3EFOA 2HZYA 1M30A 2HQEA 1UGSB 3H0FA 2YLBA 1XOVA 3CCSQ 1ZSGA 1G8XA 3CXCS 2J06A 1T3LA 3KBGA 1K8AU 3OYMA 1WZOA 1HSQA 4X9CA 2DEUA 3CC2T 1NEGA 4M77B 2OTLA 4J6WA 1D0ZA 1VQNT 1KD1C 1TU0B 1GFCA 2COZA 2LQNA 4PL6A 2RQTA 1KQSP 5KCOA 5DY9A 1X6OA 2CSIA 5GAN8 3BDLA 2GBQA 2QGFB 4PJOC 2XHCA 2ZPIB 3OYDA 4R55A 1G3TA 2EPDA 4E6RA 2AZVA 2RK1A 2XD0A 1D09B 4O5VA 2F1LA 3INZA 2XK0A 2ENMA 2FPEA 4RTWA 4E7KA 1VIEA 1ACMB 5HY6A 1NZ9A 2ZPBB 3JCMW 1WHLA 3MEAA 3S3MA 2L3PA 1E7OA 4DEYA 4VUBA 4CI0C 1VQOQ 2OI3A 1I81A 1FMVA 4XTZA 1IXDA 1IGQA 2LX7A 4OMMA 4M7DA 3G6EQ 4BACA 2EYXA 4C8QD 2DILA 4BE2A 3QJYA 2ZAEA 3HFNA 3TREA 4RTXA 4FYXB 2BUDA 4ZGEB 3AHUA 3QYGB 2X51A 2JJ9A 2FEIA 3OBWA 3OYJA 2H8HA 1GBRA 1Q81R 1M90U 1YJWT 1CSKA 4GLMA 3SB2A 4QQDA 1LJOA 1S72T 1WXBA 4GY5A 1M2OA 1I4K1 1CKAA 2DIGA 3CC7T 1H641 3CEYA 3QDRB 5D6XA 4N4IA 1HD3A 2E3HA 2EW3A 4MDXA 3BDUA 3L2VA 4PLIA 4KGXB 2E65A 2RH2A 2RK2A 2JVVA 4A63B 1W4SA 2P4RA 1K73C 3VRYA 1Q7YU 1MMAA 4C8QF 1IGUA 4M7DB 2VVKA 4JDSA 1YCYA 1AZEA 4DBQA 2CH4A 2KQWA 4C92E 5GAOq 6AT1B 1OX8A 4M7DE 1TS9A 3GOXA 1AEYA 3OBYA 1C0MA 2DM1A 2PVDB 3CC7A 3VKIA 1VQ5T 1OZ2A 1YITA 3RERA 2PUOB 4WCIA 4L6V5 2LJ0A 4RTTA 1PSFA 1OI1A 5IXFA 2D6FA 2ROLA 2LQWA 2ROTA 3G4SA 1QVFS 3JAME 1QKWA 2A0FB 4QT7A 1RAIB 1UHCA 1B07A 3V8JA 4XQ3A 5GANd 2COYA 2OJ2A 2JTFA 4IUQA 2L3SA 3JB9D 2RQVA 3ULRB 4AG2C 2CP0A 2HQXA 2J6KA 4JPBW 2R5MA 3P8BB 4M75B 2XKOC 1D3BB 3I56Q 1SF9A 4DQ2A 3G6EA 3CCSA 3VS4A 1ZUKA 4EMHA 3HRSA 3OYCA 1D0XA 1ZA2B 3C0CA 4HKEA 3CCJA 1WFWA 4A4KA 3Q1JA 1UTIA 5KYNA 3HRTA 2VGMA 4FT2A 4QQ6A 4HT8A 3OS5A 4KUDK 2F2WA 1WPYA 4LXCA 2V8JA 3CMEQ 1VQKA 3A8GB 1PKTA 3JCMV 1YIJT 5GMKm 1MMNA 3QIIA 4JZ3A 2KI7A 4O6JA 2BIVA 2PZ1A 2LVMA 3A8LB 4XTUA 3CCRT 1PRLC 1UFFA 1KQSA 2RJCA 5GJWB 2LJ3A 2PUKB 2RHYA 4X9DA 2D0NA 3CCRQ 3CMAA 3H8ZA 4C0DC 2A36A 5IHIA 2DMOA 4F7UG 2MK5A 1B7TA 1TXQA 4PFZA 3TVTA 4Z8AA 1WHHA 5EG2A 1I5LA 2KK4A 5KYWB 1YI2A 1RL2A 4OP0A 1JEGA 2HNIA 3QPHA 3OSSC 5LJ5d 3HPWA 2DIQA 2ZPHB 1QVPA 5HCKA 1R8OB 2FRYA 4M77E 2G3RA 4OMLA 3CCMQ 3RKXA 2HEQA 5GMKi 2WACA 4M75A 4F7UF 1UUEA 1D1CA 3CBPA 2QA4T 2ZGWA 4AFZC 4LNPA 1YJ9A 2O01E 5GAMd 3JCMc 2YSQA 5FU7B 1OQKA 3M4GA 1BCMA 3M58A 1SPKA 5LJ3g 5CKDA 2M9UA 1NLOC 2HBWA 4IURA 3P8DA 4FYYB 1K0SA 1VQPQ 3HSBA 3FIFA 3HP9A 2O31A 1NE8A 1PSEA 1FMKA 5GMKh 1GCQA 1TH7A 1BK2A 3REBB 2W10A 2Y4YA 1TTHB 2LCLA 5LJ5e 1N6AA 1UJ0A 2AK5A 4J9EA 3LH0A 3QHSA 4ZN3A 2CT4A 4KH1B 1VQ4T 1WHGA 2I0NA 1WGSA 3CCLA 4AFQC 3SHWA 3I56A 3GPLA 4XU0A 2DL4A 1OU8A 1X75C 3J7AF 2OTJA 3FB9A 4RMOA 3TQ7P 4EMKB 2R5AA 3AT1B 1EIFA 3JB9G 4KGVB 1BU1A 2K3BA 1R0BG 3QUIA 3OYYA 2RB6A 4M7AD 2XG8D 1M3BA 4DBHA 4JZ4A 5FWBA 5FU6B 3G4SQ 2PVOB 2V1QA 4D8DA 5LJ3j 1WJSA 3HHTB 1QW1A 1TUGB 3HTRA 4MMLA 2NYSA 3H9NA 4V2SA 1H3HA 2MMPA 1TUDA 4QVDA 1QKXA 1VQ4A 4HCZA 4FIBA 4OB2B 5GAOp 2LJ1A 1V29B 1YWOA 3FRNA 1IRXA 3CCJQ 3OYKA 4HCBA 2KEAA 4KH0B 2QQBA 3EG9B 1R0CB 2JMCA 4JRPA 1X69A 5D6WA 4MZPA 1VOMA 1M1FA 1ZX6A 4ANJA 3JRZA 1JJ2P 2CUBA 2QEXT 3VS5A 1PNJA 1JJ2A 1YIJA 1MHNA 4IIMA 4AFSC 5A2QE 1RAHB 4C0ZA 2YUOA 4FYWB 8ATCB 5I11A 2QEXQ 2M51A 2VWFA 2EQJA 1KD1R 3MKDA 1K9AA 3EH2A 4IUVA 4C5GA 1PWTA 4J83A 3OQ5A 1XNIA 2HBPA 1GCPA 1QCNA 3BE3A 3CPWS 3IQLA 3C95A 2DYBA 2DJQA 3OB9A 5FWCA 1AWXA 1BB9A 5GAN6 2YWWA 1PD0A 2EYYA 5I2SA 1T0JA 3M0UA 2O4XB 1Q86U 2P0QA 1AT1B 1AHJB 2RF0A 4OMNA 3UF4A 4FU6A 2GGRA 1JXMA 5IHKA 1N8RU 1SHGA 3OSVA 4M78C 4PJLA 2V8IA 4A4GA 4BY6C 3RMSA 2CUDA 5M9OA 1AWWA 1VA7A 5D6YA 2CS7A 1G3YA 3E2UA 3LH5A 4E7IA 1YNZA 1WXTA 3S6WA 4CRIA 2KE9A 4J7IA 2E3IA 1VQPT 4M7AE 4DEXA 4J9DA 4Y28E 1XTDA 1AVZC 2GFUA 1X43A 3NPFA 1JQQA 2D0QB 4II1A 3I9QA 1YWPA 4C92G 4L5GA 4XU3A 2QASA 1NPPA 1NG2A 2KVQG 2NLUA 2X3XD 3MO8A 1YJNA 1Q81U 2DJZA 2YUQA 4C0DB 2A3LA 4HA8A 4KRTA 2BTTA 1X6GA 3LGLA 2QTXA 1QVGS 1RI0A 2SRCA 4Z88A 1ZBXA 3CBMA 1WQ7A 2K5IA 2BZXA 3V8KA 4JLGA 2K9GA 4XK8E 1KHCA 2KYBA 1WJQA 2HCKA 1M4ZA 2OTJT 5CK9A 3E9GA 5DM7R 3GNGA 2CT3A 2RQRA 1QLYA 2RHXA 3NTIA 5CQYA 1YN8A 4ELYC 2ED0A 1JJ2S 2EWNA 3OS0A 3QWXX 3NTHA 2M0OA 4F17A 1WX6A 5I2MA 2EVRA 2V26A 2C0TA 4N0AA 4C92A 2OAWA 3G71A 2IG0A 1X2QA 3UPUA 1AZGB 5CCAA 2X4WA 4WF2A 3VYGA 3MEVA 3M56A 1KSWA 2X4XA 3M59A 5J3BA 4LE9A 2F2VA 3P8HA 2LNHB 1TSFA 2KRMA 4HCKA 3RR6A 4BD3A 4A4HA 1VYTA 1I5OB 3A8HB 4ATOA 2C0OA 5IHNA 5GAN7 1GRIA 1SRLA 2DL7A 1YHQA 1D0YA 4MDWA 2E10A 2C0IA 4PJOE 1IREB 3JCMP 1TWBA 3D7SB 5KYXB 1WYXA 1OPKA 3SEMA 1Y57A 3L2UA 2RHUA 1TG0A 2DXTA 1VQ7T 4EMGA 1H92A 1OX9A 2BKDN 2CDTA 2K3YA 5DLOA 2A28A 1E6HA 1Z9QA 2XICA 1IHVA 2EGEA 4OMQA 4C8QA 4KBMB 2J05A 5GMKj 3SWNA 1YITT 4LD9K 2K79A 1LPLA 2K7AA 2E5QA 3CCEA 5GAMe 1Y71A 2VASA 1YJ9T 2EYQA 5KYUA 2O9VA 3H6ZA 3QYHB 1X2KA 2CP7A 2F5KA 2DVJA 2XDBA 4KULA 2YRVA 3PE0A 9ATCB 1PM3A 2JTMA 2DBMA 2WSFE 1WLPB 3EGXB 4X1VA 2EQIA 3KUFA 2XDDA 2DZ9A 2R58A 1QVFP 4C92B 2OTLQ 2RPNA 1YIJQ 2AT1B 4GLKA 4FW2A 1I07A 3CCJT 1M3CA 2QXFA 3CCQQ 2ABLA 1WXUA 2DERA 2M02A 1WIEA 2VYTA 3R6OA 4N4HA 1PG5B 3PMIA 3V7CA 1BI0A 4OF1A 4BI3A 4M7DF 5C0MA 2IIMA 3QG1A 4M7DC 2RNAA 2RM4A 1K9MU 2DVEA 5GAOr 2ZPGB 3M54A 3JB9H 2LCCA 2XU8A 3THKA 3UWNA 3LWIA 4IIOA 5GMKl 3OYFA 2QTVA 2K5FA 3CCMT 2EJGA 3JV3A 2LCSA 4CC3A 3M5AA 4QW2A 2K2VA 1VQ8T 1MNEA 1HJDA 2MCNA 4M77D 2YHTA 3GF5A 3QBYA 4IUUA 4DBRA 3JCMh 8AT1B 5GANg 4PJOF 2LNVA 2O2OA 2QEXA 3TSWA 5LJ5h 5LL6S 2KDSA 2H3EB 4PJOA 2QA4A 2COWA 3L2ZA 3OYEA 1OPLA 1S72A 3I35A 3SDZA 1M8VA 3CMET 1UGVA 1K9MC 1W2BA 1W2BP 5KYYA 3RESA 4BI8B 4C8QE 1TUCA 4A4FA 1KC8U 2HQHA 1WJRA 5AT1B 3ZEHA 1CKBA 1U06A 3GBQA 4LDWA 2D8HA 3PMTA 1UE9A 2DKGA 2MF2A 3H0IA 1W2BS 2G6FX 1GCQC 4DBFA 3PVLA 3OMGA 1KC8R 5IAYA 1RADB 1VQMT 2DXUA 2CP5A 4QVZA 1YITQ 4PJOD 3LX7A 2IVWA 3M53A 5CIUA 3I55A 4AT1B 3CCLT 1YJ9Q 3KXTA 1SEMA 2FHDA 1MV0B 3TU4K 3A1PA 1K8AC 4BDYA 3CCLQ 1SKUB 3DB4A 1UECA 3CCST 2QA4Q 5ECAA 1SSFA 3X24B 3SWNB 1ABQA 1D1AA 2JW4A 4RG2A 2CGHA 4C8QC 1Q95G 4PK4A 1MV3A 3BW1A 5FRMA 4IUPA 4A4EA 3CPWP 1VQ6Q 1UGRB 4R56A 4M7AF 3CBOA 1KQ1A 1M1KU 2L3QA 2CKKA 2B8AA 1MMDA 1K76A 3O5ZA 4PNOA 4LD6A 2EJFA 1MNDA 2DFUA 4J9BA 4JS5A 4ME7A 2JM9A 2QAZA 4M7AG 1ZLMA 3A5ZB 1SRMA 2R57A 2RI2A 1S1NA 4ESRA 3MHXA 4C5EA 1Q7YC 2DXCA 2RJEA 4M7DG 2CH4W 3A8OB 2AIRB 2JS0A 3NTKA 1WI7A 2EYWA 1FWZA 3OA6A 3M9QA 4LDYA 4C92C 1NJIC 1K9MR 1I0CA 2OX7A 2ESWA 4OB0B 1ARKA 2K6DA 3PT9A 1YBYA 4QKUA 1S72Q 1ZSZA 1PHTA 3M0TA 3ME9A 5KYWA 3DLLA 3MP1A 1BI1A 3A98A 3OS1A 2J6FA 3OYHA 5A0DA 1YCSB 4HCCA 3G71T 1OZ3A 1RAGB 3EHQA 2JOYA 5FU6C 2QI2A 2DZCA 5J39A 3CD6A 2E41A 3ZFJA 3NHNA 5DLQE 5CKHA 1Y0MA 4C92F 4XTYA 2NUTB 1FXXA 2DD4A 4CC2A 1ZSZB 1NPRA 1G2BA 1N8RR 4M7AB 4FT4A 1RLQC 1BI2A 1MUZA 1N27A 3S3OA 2FPDA 2LDMA 5GANh 5LJ3d 4BE0A 2BE9B 3FC3A 3BY7A 2HKQB 1U1SA 1Y07A 3PIOA 4IKFA 3A8MB 4X34A 3ER0A 3I5SA 3OMCA 1YHQQ 1SHFA 4PJOG 1GL5A 4ZN1A 4TVRA 3JCMe 3HFOA 1ZA1B 2L89A 5C6SA 3PTAA 1U5SA 2VKNA 3C4SA 4J9CA 1K1ZA 1BBZA 1N5ZA 3WXMB 1Q82C 4Y92A 3EAEA 3QZ5B 1VQ7Q 4UC4A 2RJFA 2XI9A 1VYUA 4AFUC 1Q81C 1VQMA 3CCVT 2DXBA 4M78G 4BY6B 4M75D 4E7SA 2VC8A 2RQWA 3I56T 1T3SA 4Z89A 1ZBJA 3EGDA 5KH6A 2EQMA 1X27A 2E1HA 4HXJA 3VS1A 1YJNQ 3JSCA 2EKOA 2EBPA 4ZTFA 1G3WA 1HK9A 4M4ZA 2CP2A 2DNUA 1RABB 2X9HA 2KXDA 4Q5WA 1PCXA 1QWEA 2DLPA 2FL7A 2FB7A 3CCQA 3X28B 1M8MA 2EKHA 2PNIA 4XTWA 1GXIE 3PGGA 3QJ6A 2MIOA 5LJ3h 3JCMd 4EDUA 3VUZA 2HDAA 2M1HA 2V1RA 4EMKA 1VQOT 2YUPA 4M77C 3META 2J6OA 3QWYA 5GANf 4RTZA 5AYFA 3OYLA 3H0HA 3QSUA 4JUVA 2KGTA 3EG9A 2WSEE 3MCAB 4EPCA 1PRMC 3DLMA 2NUTA 4B6MA 3S3NA 2RI3A 1VQLQ 4E7ZA 1Y96A 1OV3A 2RN8A 4PLLA 3X25B 4Y91A 3OW2S 2DX1A 3QXEB 3MPUB 3G6ET 4M77A 1NYGA 4A54A 3QZ9B 4NL3A 1KFZA 2W0ZA 1ZHIA 2AZSA 1QWFA 2OAUA 2FRWA 3UT1A 4RG8A 5KYYB 1KD1U 1W70A 2YUNA 2D8JA 3CC7Q 3JCMQ 5CKEA 1UHFA 2EFIA 2DAQA 3CMEA 2EIFA 1O9SA 2JXBA 3JCMb 4OMFB 2GCXA 4NOYA 1RLPC 1XJWB 2CREA 3G71Q 3C12A 3QKJA 4E2FB 1KHIA 3G7ZA 3EH1A 1PKSA 3L1AA 4FSXA 3V8LA 1JBMA 1H8KA 1TOVA 5GAN5 3CXCP 5LJ5f 1K8AR 1Q86C 2CZ7B 2GTOA 3L2RA 3CCUA 4FYVB 1R77A 2KYMA 3VU3C 4XAXB 5GAOm 2YRCA 3F70A 2XMFA 4XTXA 3OW2P 4F7UB 1VQPA 4ZNXA 1PC0A 1MGQA 3M0QA 3EGXA 1OOTA 2NWMA 2NUZA 4NL2A 4QVCA 1C6VX 3M57A 4K11A 1JXOA 1P92A 2DTHA 2JMAA 3HKSA 4N4GA 1KC8C 3I55T 1WHKA 2DEQA 1SG5A 3OYAA 1BYMA 2E64A 5J26A 2J7IA 3RDVA 4OGCA 1VQKQ 3SWNC 2DE0X 1M3AA 1K0XA 3TEEA 2DK3A 3FJPA 2K3XA 3HL8A 2RD1A 3N5BB 2GNCA 2EYZA 1LCKA 4LDXA 2E70A 4B9WA 5GJVB 2LZ6B 4JRKA 3CC4T 4BI4A 2KY9A 1NJIR 1A0NB 1NBEB 2X4YA 4D6WA 3JCMX 2A7YA 3JCMf 3CC4Q 5KCHA 1I1JA 2X3WD 1M90R 2HMAA 1M90C 4A53A 1VQ8A 3M0RA 4BB7A 1W6XA 4J7FA 4EIKA 4RTUA 3E1SA 3EGDB 1QVGP 4JLIA 5CR2A 3CQTA 4F7UA 2I2LA 1O75A 4KUIA 1HXDA 4M75F 1NJIU 3C94A 2Y4XA 2DRMA 4AG1C 2L8DA 1IB8A 3LLRA 4LUEA 4QQGA 3JB9F 2K5LA 1M2VA 1ZUYA 4J9IA 4OB1B 1OULA 2MWOA 4B9XA 2X35A 3TCJA 3CCEQ 3CC4A 2L0AA 2FG0A 2KBTA 3LYIA 2VV5A 1LVKA 4D8KA 1X6BA 4PJJA 3L2WA 2F2XA 4HVWA 5A0LA 3R6NA 2M16A 1VQ9A 1VIFA 1KQ2A 1WNLA 3M0SA 4BUGA 3EFOB 5FRNA 2RJDA 4PFPA 4E7HA 1UGPB 3OY9A 5KE2A 1ZUUA 1QVGA 1E6GA 2O88A 2HL5C 3EG3A 4RTVA 3CMAQ 1N8RC 2RMOA 4J6XA 1UG1A 1WHJA 4ZGDB 1Y7XA 1QQJA 2LQKA 4JS4A 1Q7YR 2GQVA 1N9SA 3MEWA 3UATA 5GAMj 2MI6A 4NS5A 4C8QG 3CCUQ 4HT9A 2ATCB 4P5NA 4LDVA 4M75C 2PU9B 4OGEA 4ORZA 2E5KA 3M55A 3SFMA 2Y90A 4RUGA 5EC7A 1GFDA 5CQXA 2KAFA 4JJNK 3DB3A 4CC7A 2BZ8A 1ZSZC 1VQ4Q 2KR3A 1K73R 1F1BB 4C8QB 1M1GA 1AOJA 1M1KR 4M7AC 1LOJA 4LDUA 3LW5E 2XIDA 2JZ2A 2V8KA 1JU5C 1G83A 1OU9A 1EX4A 4C0FA 4RKUE 3WVEB 2DA9A 3JCMJ 3CCVA 1VQMQ 3OYGA 2BZYA 4M75G 4WTOB 2X4JA 2P0KA 3ASKA 4L59A 3SD4A 2JTEA 2HL3A 2ZPEB 4GBQA 1KJWA 4PJOB 3E19A 1LNXA 2B86A 4DOWA 3FLGA 2FYKA 4ZGJB 2EGAA 3VV0A 2LTOA 4R0KA 2AHJB 2JM8A 4J8OA 1BI3A 3MJXA 4YTLA 3X20B 3VRZA 1C1AA 2LT4A 4JJCA 5KYXA 2NUPA 2DF6A 4FM4B 3GP8A 4JJDA 1YJNT 1Q86R 1UEBA 4LN2A 1GBQA 3EFSA 1B3QA 1VYVA 4KGZB 1B34B 1VQ6T 2KSSA 2MAMA 2GTJA 2HSEB 1NEBA 2FZCB 1UB4A 4JRQA 3NMZC 2K4YA 5GAOn 2GFAA 4DA4A 7AT1B 5GANj 5GAMg 2LX9A 2YXYA 3V7RA 3CD6Q 2QQRA 5FLXE 5FROA 2LMJA 4XU1A 4FCYA 4J5YA 2FZGB 5GAN4 2H3JA 4C92D 5LJ5g 3VUBA 3GNFB 2WSCE 2XDPA 2ZCFB 5CAIA 4OMOA 1X01A 1OEBA 2MWPA 2QYZA 2VUBA 2QQ9A 1ABOA 5I21A 5IT9E 4EMKC 1DJ7B 1JO8A 2D1XA 4M75E 4J9FA 2P4TA 2PTKA 3OW2A 1FYNA 2DO3A 5L8RE 3VYHB 4F04B 2RQUA 3CC2Q 2CSQA 2E4HA 2C06A 1EFNA 4M78E 2MOXA 3ZBDA 1BIBA 2YT6A 1J3TA 4FSSA 2AKKA 2NUPB 2DTIA 4Z02A 3UA7A 1RAAB 1YFNA 1IZ6A 2CP3A 4J9GA 2ZZDA 3VS7A 1KG1A 4RCCA 3M0PA 3CC2A 2EQKA 2F69A 1OYXA 1Z9ZA 4FW1A 2F5TX 2DBKA 2JNGA 1W1FA 2L3RA 2YRDA 3REAB 4MZMA 4HVUA 1G3SA 3VS0A 2MYSA 3OYBA 2KT8A 3V7SA 5HK0A 2QK0A 1FX7A 2HKNA 5LJ3f 2OTLT 4PJNA 1WA7A 4F7UE 1VQ5A 3OS2A 1RAEB 2RI5A 4M77F 4LUDA 1HYOA 2EGCA 4JRIA 1M27C 2QQSA 2YDLA 3OYNA 1WQWA 1VQLT 5CKBA 2RHZA 3CCQT 4M78B 1NM7A 4OB3B 2VXEA 2GF7A 1VQOA 4MZTA 1U3OA 2FZKB 3I55Q 2OTJQ 3EG2A 1QMCA 1VUBA 2PQWA 1JB0E 5GMKe 2CZ6B 2JUFA 5IN1A 1RACB 3MEUA 4F14A 2GQIA 5IXBA 2DL3A 2RO0A 1SSHA 1KIKA 3PIPA 1RUWA 4M78F 4C5HA 3CPWA 3PFSA 3RKWA 3CCVQ 3EG0A 3EG1A 2O9SA 1VQNQ 1YJWA 1V76A 4N0AC 5GAN2 4XU2A 1VQLA 1VQ8Q 3CXCA 1UDLA 1KQSS 1ZQ1A 4BE1A 2IPOB 3G1JA 3FEOA 1K73U 2FPFA 3EHRA 2PVGB 1PD1A 3RKYA 3CD6T 4AMCA 2A08A 2DPPB 4FL6A 4JJBA 3RBBB 5CKFA 1YI2Q 1AWOA 4IUTA 1IHWA 2LQ8A 4F16A 2CYZB 5IH2A 4E7JA 1YI2T 1U8RA 1JRIA 1Y96B 2KT1A 1QP2A 1BIAA 4M78D 4ZTJA 3QDFA 5CO7A 1I8FA 2DTOA 2DETA 2O4XA 3CPFA 3EFRA 3RUXA 1RI9A 3VJPA 1Q82R 1M1KC 5GAMh 4ELZC 2FO0A 2L5QA 2MPXC 1FMWA 3ZL7C 1M9SA 1WHMA 1YJWQ 2CZ0B 3G4ST 1QVFA 1VQNA 5GAOl 2DD5A 2HD0A 2K2MA 2L2PA 1N9RA 2P84A 2YLCA 3H41A 1K4US 3UA6A 3PVQA 4CC4B 2FVUA 1KK7A 1QCFA 2QG9B 1Q82U 1NYFA 1YP5A 2LRQA 3QO3A 2E6ZA 2DRKA 4RCBA 3UDCA 1M5Q1 3CCMA 1UJYA 4PKCC 2KXCA 2QQAA 2QDYB 2DL8A 3EGUA 1AD5A 2EAYA 4OVAA 2CP6A 4MMKA 2LC4A 3M4YA 2LP5A 2Z0WA 2D9TA 3URGA 1EZZB 2EQUA 2LT1A 3LGFA 4BDZA 3L2QA 5HKCA 3J80E 2K57A 1VQ5Q 5HK3A 3FJ5A 4RTYA 3T9NA 3CCRA 2DYIA 3E9FA 5KYUB 1VQKT 3VS3A 2JS2A 2A37A 5L23A 2RA2A 5LJ3e 2QGGA 3JCMg 3BFMA 4C5IA 1D3BA 1B34A 3RMQA 5GAMf 3WVDB 1QCOA 2EJ9A 1RAFB 2HSPA 4E7LA 5A0GA 3NGPA 3GIBA 4XTVA 3FDRA 5FU7C 3TSZA 2M0YA 3I5RA 1IO6A 1VQ9T 4M7AA 1U1TA 3GLXA 1VQ6A 2ZPFB 3CMAT 1D1BA 3U23A 1BCOA 3VS6A 1VQ9Q 2KRSA 5FW9A 3OYIA 3DKMA 4M7DD 4PJMA 2CZ1B 3MP8A 3X26B 2ECZA 5D7UA 3PNWC 2RHIA 3CCUT 2KRNA 2SEMA 5KE3A 2JN0A 1H3ZA 4M77G 3LWHA 4C0GA 1V1CA 1XQHA 5CVIA 1M2VB 1MMGA 2P0PA 3L42A 3JB9I 4M78A 3VS2A 1NLPC 5GAN3 2VB6A 2KMTA 3O8VA 1VQ7A 2BE7D 3RIRA 4DOVA 2ED1A
chains in the Genus database with same CATH topology
4CC7A 2BZ8A 2CUBA 3VS5A 1PNJA 4J9BA 2KR3A 4IIMA 4AFSC 2JM9A 2YUOA 5I22A 1ZLMA 5I11A 1AWJA 1SRMA 2M51A 1S1NA 2VWFA 4OMPA 1AOJA 2KNBB 4ESRA 1WDXA 2JT4A 3RNJA 2QDLA 1K9AA 4HVVA 2CH4W 1PWTA 1JU5C 1G83A 1GCPA 2JS0A 2DL5A 1WI7A 2EYWA 1T0HA 4J9HA 3KFVA 3IQLA 2DA9A 2AKLA 2KROA 2DYBA 2DJQA 1M30A 2BZYA 1I0CA 3H0FA 5FWCA 1XOVA 1AWXA 1BB9A 2ESWA 1ZSGA 1ARKA 2JTEA 2K6DA 4GBQA 2EYYA 1T3LA 2J06A 1KJWA 1T0JA 3M0UA 2B86A 1HSQA 1PHTA 3M0TA 2RF0A 1NEGA 3A98A 4OMNA 2J6FA 3UF4A 1YCSB 2GGRA 1JXMA 2EGAA 5IHKA 1SHGA 4R0KA 3EHQA 2JM8A 3NHNA 1GFCA 1Y0MA 3VRZA 2LQNA 4JJCA 2CUDA 2RQTA 2DF6A 1AWWA 1VA7A 4CC2A 4JJDA 4LN2A 1GBQA 1B3QA 1VYVA 1G2BA 2CSIA 3LH5A 1YNZA 2GBQA 1WXTA 2GTJA 1NEBA 3NMZC 2KE9A 2EPDA 1RLQC 4E6RA 2AZVA 1MUZA 4DEXA 4J9DA 2ENMA 2LMJA 1AVZC 2FPEA 4RTWA 1X43A 3NPFA 1JQQA 2FPDA 3I9QA 1YWPA 1NG2A 2L3PA 2X3XD 1E7OA 4DEYA 2OI3A 4OMOA 2YUQA 4OMMA 2LX7A 3I5SA 4KRTA 2EYXA 2BTTA 1OEBA 2DILA 1X6GA 1SHFA 1ABOA 1GL5A 4RTXA 1JO8A 2D1XA 2SRCA 4J9FA 4Z88A 2PTKA 1FYNA 1U5SA 2VKNA 4J9CA 2BZXA 1K1ZA 2K9GA 2RQUA 1BBZA 1N5ZA 2FEIA 4Y92A 2CSQA 2KYBA 2HCKA 2H8HA 1GBRA 1EFNA 2MOXA 1VYUA 4AFUC 2YT6A 2CT3A 2RQRA 1CSKA 4GLMA 1J3TA 1QLYA 4FSSA 2AKKA 1WXBA 2RQWA 1YN8A 3UA7A 1T3SA 2ED0A 4Z89A 1CKAA 1ZBJA 4J9GA 3VS7A 1X27A 4HXJA 3QWXX 3VS1A 4F17A 1WX6A 2EBPA 3M0PA 2EVRA 2C0TA 1Z9ZA 2OAWA 4M4ZA 1HD3A 2EW3A 1X2QA 2DNUA 1AZGB 2KXDA 2DBKA 1W1FA 3REAB 4HVUA 3VS0A 4A63B 1KSWA 1QWEA 2DLPA 2P4RA 2KT8A 4LE9A 1M8MA 3VRYA 2EKHA 2F2VA 2PNIA 1WA7A 2LNHB 2MIOA 2KRMA 2VVKA 4HCKA 2HDAA 2V1RA 4LUDA 2YUPA 1AZEA 2EGCA 1VYTA 2J6OA 3QWYA 4RTZA 1M27C 2CH4A 2YDLA 3H0HA 2C0OA 5IHNA 1GRIA 1AEYA 2KGTA 1SRLA 2DL7A 2DM1A 2C0IA 1PRMC 1NM7A 1WYXA 1OV3A 1U3OA 1OPKA 3SEMA 1Y57A 2RN8A 4WCIA 1TG0A 4RTTA 2DX1A 2LJ0A 1H92A 2CDTA 3EG2A 5IXFA 1NYGA 2A28A 1E6HA 1Z9QA 2LQWA 2ROLA 4OMQA 2EGEA 2ROTA 1KFZA 2W0ZA 2AZSA 2J05A 1QKWA 4QT7A 1QWFA 2K79A 2FRWA 1W70A 1UHCA 4F14A 1B07A 2D8JA 2DL3A 2GQIA 1SSHA 2YUNA 5IXBA 1KIKA 2K7AA 1RUWA 1UHFA 2OJ2A 2L3SA 2O9VA 2RQVA 3ULRB 4AG2C 2JXBA 2J6KA 4JPBW 1X2KA 1RLPC 2CREA 3EG0A 2DVJA 3EG1A 2O9SA 3PE0A 2DBMA 1PKSA 1WLPB 1H8KA 3VS4A 4X1VA 1ZUKA 2EQIA 1UDLA 3C0CA 1WFWA 1UTIA 2GTOA 2F2WA 2RPNA 2KYMA 2XMFA 4ZNXA 1PKTA 1I07A 2FPFA 3EHRA 3M0QA 1OOTA 1M3CA 2NWMA 2NUZA 2ABLA 1WXUA 4JZ3A 2A08A 1WIEA 4JJBA 4K11A 3RBBB 2PZ1A 1JXOA 1PRLC 1AWOA 1UFFA 2JMAA 5GJWB 2LJ3A 2IIMA 4F16A 2RNAA 2D0NA 5IH2A 2J7IA 2KT1A 2A36A 5IHIA 2DMOA 2DE0X 1M3AA 1K0XA 3TVTA 4Z8AA 1RI9A 3THKA 1JEGA 4IIOA 2GNCA 2EYZA 2FO0A 1LCKA 3ZL7C 3JV3A 5HCKA 2LCSA 4CC3A 2FRYA 5GJVB 4OMLA 2LZ6B 2K2MA 2L2PA 2HEQA 2MCNA 1HJDA 3H41A 1K4US 3UA6A 3PVQA 1UUEA 4CC4B 1A0NB 1QCFA 4AFZC 4LNPA 1NYFA 1YP5A 2O2OA 2YSQA 3TSWA 1I1JA 2X3WD 3M0RA 2DRKA 1W6XA 1SPKA 4EIKA 4RTUA 1NLOC 1UJYA 2HBWA 2KXCA 1OPLA 3I35A 2DL8A 3CQTA 3EGUA 1AD5A 1UGVA 2DRMA 1K0SA 2LP5A 4AG1C 1TUCA 4LUEA 2O31A 1FMKA 1ZUYA 1GCQA 4J9IA 1BK2A 3REBB 2W10A 1UJ0A 2AK5A 2L0AA 1CKBA 4J9EA 2FG0A 1U06A 2KBTA 3GBQA 2D8HA 3FJ5A 4RTYA 1UE9A 2CT4A 3H0IA 4D8KA 1X6BA 2G6FX 2I0NA 3VS3A 2F2XA 2JS2A 2A37A 4HVWA 3SHWA 1GCQC 4AFQC 3R6NA 5L23A 2DL4A 3PVLA 3M0SA 2HSPA 1BU1A 3NGPA 2K3BA 3TSZA 2M0YA 1M3BA 1SEMA 3I5RA 1IO6A 1MV0B 4JZ4A 5FWBA 3U23A 2V1QA 1ZUUA 4D8DA 3VS6A 1E6GA 1UECA 2KRSA 2O88A 5FW9A 3EG3A 5ECAA 4RTVA 2RMOA 2ECZA 1UG1A 1ABQA 2JW4A 2KRNA 2SEMA 1H3HA 1MV3A 1TUDA 3UATA 1QKXA 1V1CA 2LJ1A 4ORZA 2E5KA 1YWOA 2L3QA 4RUGA 5EC7A 2KEAA 1GFDA 3VS2A 1K76A 1NLPC 3O5ZA 2JMCA 1X69A 2ED1A 1ZX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC7 A;  2BZ8 A;  2CUB A;  3VS5 A;  1PNJ A;  4J9B A;  2KR3 A;  4IIM A;  4AFS C;  2JM9 A;  2YUO A;  5I22 A;  1ZLM A;  5I11 A;  1AWJ A;  1SRM A;  2M51 A;  1S1N A;  2VWF A;  4OMP A;  1AOJ A;  2KNB B;  4ESR A;  1WDX A;  2JT4 A;  3RNJ A;  2QDL A;  1K9A A;  4HVV A;  2CH4 W;  1PWT A;  1JU5 C;  1G83 A;  1GCP A;  2JS0 A;  2DL5 A;  1WI7 A;  2EYW A;  1T0H A;  4J9H A;  3KFV A;  3IQL A;  2DA9 A;  2AKL A;  2KRO A;  2DYB A;  2DJQ A;  1M30 A;  2BZY A;  1I0C A;  3H0F A;  5FWC A;  1XOV A;  1AWX A;  1BB9 A;  2ESW A;  1ZSG A;  1ARK A;  2JTE A;  2K6D A;  4GBQ A;  2EYY A;  1T3L A;  2J06 A;  1KJW A;  1T0J A;  3M0U A;  2B86 A;  1HSQ A;  1PHT A;  3M0T A;  2RF0 A;  1NEG A;  3A98 A;  4OMN A;  2J6F A;  3UF4 A;  1YCS B;  2GGR A;  1JXM A;  2EGA A;  5IHK A;  1SHG A;  4R0K A;  3EHQ A;  2JM8 A;  3NHN A;  1GFC A;  1Y0M A;  3VRZ A;  2LQN A;  4JJC A;  2CUD A;  2RQT A;  2DF6 A;  1AWW A;  1VA7 A;  4CC2 A;  4JJD A;  4LN2 A;  1GBQ A;  1B3Q A;  1VYV A;  1G2B A;  2CSI A;  3LH5 A;  1YNZ A;  2GBQ A;  1WXT A;  2GTJ A;  1NEB A;  3NMZ C;  2KE9 A;  2EPD A;  1RLQ C;  4E6R A;  2AZV A;  1MUZ A;  4DEX A;  4J9D A;  2ENM A;  2LMJ A;  1AVZ C;  2FPE A;  4RTW A;  1X43 A;  3NPF A;  1JQQ A;  2FPD A;  3I9Q A;  1YWP A;  1NG2 A;  2L3P A;  2X3X D;  1E7O A;  4DEY A;  2OI3 A;  4OMO A;  2YUQ A;  4OMM A;  2LX7 A;  3I5S A;  4KRT A;  2EYX A;  2BTT A;  1OEB A;  2DIL A;  1X6G A;  1SHF A;  1ABO A;  1GL5 A;  4RTX A;  1JO8 A;  2D1X A;  2SRC A;  4J9F A;  4Z88 A;  2PTK A;  1FYN A;  1U5S A;  2VKN A;  4J9C A;  2BZX A;  1K1Z A;  2K9G A;  2RQU A;  1BBZ A;  1N5Z A;  2FEI A;  4Y92 A;  2CSQ A;  2KYB A;  2HCK A;  2H8H A;  1GBR A;  1EFN A;  2MOX A;  1VYU A;  4AFU C;  2YT6 A;  2CT3 A;  2RQR A;  1CSK A;  4GLM A;  1J3T A;  1QLY A;  4FSS A;  2AKK A;  1WXB A;  2RQW A;  1YN8 A;  3UA7 A;  1T3S A;  2ED0 A;  4Z89 A;  1CKA A;  1ZBJ A;  4J9G A;  3VS7 A;  1X27 A;  4HXJ A;  3QWX X;  3VS1 A;  4F17 A;  1WX6 A;  2EBP A;  3M0P A;  2EVR A;  2C0T A;  1Z9Z A;  2OAW A;  4M4Z A;  1HD3 A;  2EW3 A;  1X2Q A;  2DNU A;  1AZG B;  2KXD A;  2DBK A;  1W1F A;  3REA B;  4HVU A;  3VS0 A;  4A63 B;  1KSW A;  1QWE A;  2DLP A;  2P4R A;  2KT8 A;  4LE9 A;  1M8M A;  3VRY A;  2EKH A;  2F2V A;  2PNI A;  1WA7 A;  2LNH B;  2MIO A;  2KRM A;  2VVK A;  4HCK A;  2HDA A;  2V1R A;  4LUD A;  2YUP A;  1AZE A;  2EGC A;  1VYT A;  2J6O A;  3QWY A;  4RTZ A;  1M27 C;  2CH4 A;  2YDL A;  3H0H A;  2C0O A;  5IHN A;  1GRI A;  1AEY A;  2KGT A;  1SRL A;  2DL7 A;  2DM1 A;  2C0I A;  1PRM C;  1NM7 A;  1WYX A;  1OV3 A;  1U3O A;  1OPK A;  3SEM A;  1Y57 A;  2RN8 A;  4WCI A;  1TG0 A;  4RTT A;  2DX1 A;  2LJ0 A;  1H92 A;  2CDT A;  3EG2 A;  5IXF A;  1NYG A;  2A28 A;  1E6H A;  1Z9Q A;  2LQW A;  2ROL A;  4OMQ A;  2EGE A;  2ROT A;  1KFZ A;  2W0Z A;  2AZS A;  2J05 A;  1QKW A;  4QT7 A;  1QWF A;  2K79 A;  2FRW A;  1W70 A;  1UHC A;  4F14 A;  1B07 A;  2D8J A;  2DL3 A;  2GQI A;  1SSH A;  2YUN A;  5IXB A;  1KIK A;  2K7A A;  1RUW A;  1UHF A;  2OJ2 A;  2L3S A;  2O9V A;  2RQV A;  3ULR B;  4AG2 C;  2JXB A;  2J6K A;  4JPB W;  1X2K A;  1RLP C;  2CRE A;  3EG0 A;  2DVJ A;  3EG1 A;  2O9S A;  3PE0 A;  2DBM A;  1PKS A;  1WLP B;  1H8K A;  3VS4 A;  4X1V A;  1ZUK A;  2EQI A;  1UDL A;  3C0C A;  1WFW A;  1UTI A;  2GTO A;  2F2W A;  2RPN A;  2KYM A;  2XMF A;  4ZNX A;  1PKT A;  1I07 A;  2FPF A;  3EHR A;  3M0Q A;  1OOT A;  1M3C A;  2NWM A;  2NUZ A;  2ABL A;  1WXU A;  4JZ3 A;  2A08 A;  1WIE A;  4JJB A;  4K11 A;  3RBB B;  2PZ1 A;  1JXO A;  1PRL C;  1AWO A;  1UFF A;  2JMA A;  5GJW B;  2LJ3 A;  2IIM A;  4F16 A;  2RNA A;  2D0N A;  5IH2 A;  2J7I A;  2KT1 A;  2A36 A;  5IHI A;  2DMO A;  2DE0 X;  1M3A A;  1K0X A;  3TVT A;  4Z8A A;  1RI9 A;  3THK A;  1JEG A;  4IIO A;  2GNC A;  2EYZ A;  2FO0 A;  1LCK A;  3ZL7 C;  3JV3 A;  5HCK A;  2LCS A;  4CC3 A;  2FRY A;  5GJV B;  4OML A;  2LZ6 B;  2K2M A;  2L2P A;  2HEQ A;  2MCN A;  1HJD A;  3H41 A;  1K4U S;  3UA6 A;  3PVQ A;  1UUE A;  4CC4 B;  1A0N B;  1QCF A;  4AFZ C;  4LNP A;  1NYF A;  1YP5 A;  2O2O A;  2YSQ A;  3TSW A;  1I1J A;  2X3W D;  3M0R A;  2DRK A;  1W6X A;  1SPK A;  4EIK A;  4RTU A;  1NLO C;  1UJY A;  2HBW A;  2KXC A;  1OPL A;  3I35 A;  2DL8 A;  3CQT A;  3EGU A;  1AD5 A;  1UGV A;  2DRM A;  1K0S A;  2LP5 A;  4AG1 C;  1TUC A;  4LUE A;  2O31 A;  1FMK A;  1ZUY A;  1GCQ A;  4J9I A;  1BK2 A;  3REB B;  2W10 A;  1UJ0 A;  2AK5 A;  2L0A A;  1CKB A;  4J9E A;  2FG0 A;  1U06 A;  2KBT A;  3GBQ A;  2D8H A;  3FJ5 A;  4RTY A;  1UE9 A;  2CT4 A;  3H0I A;  4D8K A;  1X6B A;  2G6F X;  2I0N A;  3VS3 A;  2F2X A;  2JS2 A;  2A37 A;  4HVW A;  3SHW A;  1GCQ C;  4AFQ C;  3R6N A;  5L23 A;  2DL4 A;  3PVL A;  3M0S A;  2HSP A;  1BU1 A;  3NGP A;  2K3B A;  3TSZ A;  2M0Y A;  1M3B A;  1SEM A;  3I5R A;  1IO6 A;  1MV0 B;  4JZ4 A;  5FWB A;  3U23 A;  2V1Q A;  1ZUU A;  4D8D A;  3VS6 A;  1E6G A;  1UEC A;  2KRS A;  2O88 A;  5FW9 A;  3EG3 A;  5ECA A;  4RTV A;  2RMO A;  2ECZ A;  1UG1 A;  1ABQ A;  2JW4 A;  2KRN A;  2SEM A;  1H3H A;  1MV3 A;  1TUD A;  3UAT A;  1QKX A;  1V1C A;  2LJ1 A;  4ORZ A;  2E5K A;  1YWO A;  2L3Q A;  4RUG A;  5EC7 A;  2KEA A;  1GFD A;  3VS2 A;  1K76 A;  1NLP C;  3O5Z A;  2JMC A;  1X69 A;  2ED1 A;  1ZX6 A; 
#chains in the Genus database with same CATH topology
 3HRU A;  2VGN A;  1QP3 A;  5I22 A;  1UGQ B;  2E6N A;  1BKB A;  1AWJ A;  4OMP A;  2KNB B;  3CCE T;  5GAN e;  3JB9 J;  1WDX A;  2JT4 A;  3RNJ A;  2E12 A;  2QDL A;  1YHQ T;  3J81 E;  4HVV A;  3MP6 A;  2HAX A;  3NFC A;  2VXF A;  4J6Y A;  2DL5 A;  1G5V A;  1T0H A;  4J9H A;  4KT0 E;  3KFV A;  2AKL A;  4PFO A;  2KRO A;  4E47 A;  5LJ5 j;  3EFO A;  2HZY A;  1M30 A;  2HQE A;  1UGS B;  3H0F A;  2YLB A;  1XOV A;  3CCS Q;  1ZSG A;  1G8X A;  3CXC S;  2J06 A;  1T3L A;  3KBG A;  1K8A U;  3OYM A;  1WZO A;  1HSQ A;  4X9C A;  2DEU A;  3CC2 T;  1NEG A;  4M77 B;  2OTL A;  4J6W A;  1D0Z A;  1VQN T;  1KD1 C;  1TU0 B;  1GFC A;  2COZ A;  2LQN A;  4PL6 A;  2RQT A;  1KQS P;  5KCO A;  5DY9 A;  1X6O A;  2CSI A;  5GAN 8;  3BDL A;  2GBQ A;  2QGF B;  4PJO C;  2XHC A;  2ZPI B;  3OYD A;  4R55 A;  1G3T A;  2EPD A;  4E6R A;  2AZV A;  2RK1 A;  2XD0 A;  1D09 B;  4O5V A;  2F1L A;  3INZ A;  2XK0 A;  2ENM A;  2FPE A;  4RTW A;  4E7K A;  1VIE A;  1ACM B;  5HY6 A;  1NZ9 A;  2ZPB B;  3JCM W;  1WHL A;  3MEA A;  3S3M A;  2L3P A;  1E7O A;  4DEY A;  4VUB A;  4CI0 C;  1VQO Q;  2OI3 A;  1I81 A;  1FMV A;  4XTZ A;  1IXD A;  1IGQ A;  2LX7 A;  4OMM A;  4M7D A;  3G6E Q;  4BAC A;  2EYX A;  4C8Q D;  2DIL A;  4BE2 A;  3QJY A;  2ZAE A;  3HFN A;  3TRE A;  4RTX A;  4FYX B;  2BUD A;  4ZGE B;  3AHU A;  3QYG B;  2X51 A;  2JJ9 A;  2FEI A;  3OBW A;  3OYJ A;  2H8H A;  1GBR A;  1Q81 R;  1M90 U;  1YJW T;  1CSK A;  4GLM A;  3SB2 A;  4QQD A;  1LJO A;  1S72 T;  1WXB A;  4GY5 A;  1M2O A;  1I4K 1;  1CKA A;  2DIG A;  3CC7 T;  1H64 1;  3CEY A;  3QDR B;  5D6X A;  4N4I A;  1HD3 A;  2E3H A;  2EW3 A;  4MDX A;  3BDU A;  3L2V A;  4PLI A;  4KGX B;  2E65 A;  2RH2 A;  2RK2 A;  2JVV A;  4A63 B;  1W4S A;  2P4R A;  1K73 C;  3VRY A;  1Q7Y U;  1MMA A;  4C8Q F;  1IGU A;  4M7D B;  2VVK A;  4JDS A;  1YCY A;  1AZE A;  4DBQ A;  2CH4 A;  2KQW A;  4C92 E;  5GAO q;  6AT1 B;  1OX8 A;  4M7D E;  1TS9 A;  3GOX A;  1AEY A;  3OBY A;  1C0M A;  2DM1 A;  2PVD B;  3CC7 A;  3VKI A;  1VQ5 T;  1OZ2 A;  1YIT A;  3RER A;  2PUO B;  4WCI A;  4L6V 5;  2LJ0 A;  4RTT A;  1PSF A;  1OI1 A;  5IXF A;  2D6F A;  2ROL A;  2LQW A;  2ROT A;  3G4S A;  1QVF S;  3JAM E;  1QKW A;  2A0F B;  4QT7 A;  1RAI B;  1UHC A;  1B07 A;  3V8J A;  4XQ3 A;  5GAN d;  2COY A;  2OJ2 A;  2JTF A;  4IUQ A;  2L3S A;  3JB9 D;  2RQV A;  3ULR B;  4AG2 C;  2CP0 A;  2HQX A;  2J6K A;  4JPB W;  2R5M A;  3P8B B;  4M75 B;  2XKO C;  1D3B B;  3I56 Q;  1SF9 A;  4DQ2 A;  3G6E A;  3CCS A;  3VS4 A;  1ZUK A;  4EMH A;  3HRS A;  3OYC A;  1D0X A;  1ZA2 B;  3C0C A;  4HKE A;  3CCJ A;  1WFW A;  4A4K A;  3Q1J A;  1UTI A;  5KYN A;  3HRT A;  2VGM A;  4FT2 A;  4QQ6 A;  4HT8 A;  3OS5 A;  4KUD K;  2F2W A;  1WPY A;  4LXC A;  2V8J A;  3CME Q;  1VQK A;  3A8G B;  1PKT A;  3JCM V;  1YIJ T;  5GMK m;  1MMN A;  3QII A;  4JZ3 A;  2KI7 A;  4O6J A;  2BIV A;  2PZ1 A;  2LVM A;  3A8L B;  4XTU A;  3CCR T;  1PRL C;  1UFF A;  1KQS A;  2RJC A;  5GJW B;  2LJ3 A;  2PUK B;  2RHY A;  4X9D A;  2D0N A;  3CCR Q;  3CMA A;  3H8Z A;  4C0D C;  2A36 A;  5IHI A;  2DMO A;  4F7U G;  2MK5 A;  1B7T A;  1TXQ A;  4PFZ A;  3TVT A;  4Z8A A;  1WHH A;  5EG2 A;  1I5L A;  2KK4 A;  5KYW B;  1YI2 A;  1RL2 A;  4OP0 A;  1JEG A;  2HNI A;  3QPH A;  3OSS C;  5LJ5 d;  3HPW A;  2DIQ A;  2ZPH B;  1QVP A;  5HCK A;  1R8O B;  2FRY A;  4M77 E;  2G3R A;  4OML A;  3CCM Q;  3RKX A;  2HEQ A;  5GMK i;  2WAC A;  4M75 A;  4F7U F;  1UUE A;  1D1C A;  3CBP A;  2QA4 T;  2ZGW A;  4AFZ C;  4LNP A;  1YJ9 A;  2O01 E;  5GAM d;  3JCM c;  2YSQ A;  5FU7 B;  1OQK A;  3M4G A;  1BCM A;  3M58 A;  1SPK A;  5LJ3 g;  5CKD A;  2M9U A;  1NLO C;  2HBW A;  4IUR A;  3P8D A;  4FYY B;  1K0S A;  1VQP Q;  3HSB A;  3FIF A;  3HP9 A;  2O31 A;  1NE8 A;  1PSE A;  1FMK A;  5GMK h;  1GCQ A;  1TH7 A;  1BK2 A;  3REB B;  2W10 A;  2Y4Y A;  1TTH B;  2LCL A;  5LJ5 e;  1N6A A;  1UJ0 A;  2AK5 A;  4J9E A;  3LH0 A;  3QHS A;  4ZN3 A;  2CT4 A;  4KH1 B;  1VQ4 T;  1WHG A;  2I0N A;  1WGS A;  3CCL A;  4AFQ C;  3SHW A;  3I56 A;  3GPL A;  4XU0 A;  2DL4 A;  1OU8 A;  1X75 C;  3J7A F;  2OTJ A;  3FB9 A;  4RMO A;  3TQ7 P;  4EMK B;  2R5A A;  3AT1 B;  1EIF A;  3JB9 G;  4KGV B;  1BU1 A;  2K3B A;  1R0B G;  3QUI A;  3OYY A;  2RB6 A;  4M7A D;  2XG8 D;  1M3B A;  4DBH A;  4JZ4 A;  5FWB A;  5FU6 B;  3G4S Q;  2PVO B;  2V1Q A;  4D8D A;  5LJ3 j;  1WJS A;  3HHT B;  1QW1 A;  1TUG B;  3HTR A;  4MML A;  2NYS A;  3H9N A;  4V2S A;  1H3H A;  2MMP A;  1TUD A;  4QVD A;  1QKX A;  1VQ4 A;  4HCZ A;  4FIB A;  4OB2 B;  5GAO p;  2LJ1 A;  1V29 B;  1YWO A;  3FRN A;  1IRX A;  3CCJ Q;  3OYK A;  4HCB A;  2KEA A;  4KH0 B;  2QQB A;  3EG9 B;  1R0C B;  2JMC A;  4JRP A;  1X69 A;  5D6W A;  4MZP A;  1VOM A;  1M1F A;  1ZX6 A;  4ANJ A;  3JRZ A;  1JJ2 P;  2CUB A;  2QEX T;  3VS5 A;  1PNJ A;  1JJ2 A;  1YIJ A;  1MHN A;  4IIM A;  4AFS C;  5A2Q E;  1RAH B;  4C0Z A;  2YUO A;  4FYW B;  8ATC B;  5I11 A;  2QEX Q;  2M51 A;  2VWF A;  2EQJ A;  1KD1 R;  3MKD A;  1K9A A;  3EH2 A;  4IUV A;  4C5G A;  1PWT A;  4J83 A;  3OQ5 A;  1XNI A;  2HBP A;  1GCP A;  1QCN A;  3BE3 A;  3CPW S;  3IQL A;  3C95 A;  2DYB A;  2DJQ A;  3OB9 A;  5FWC A;  1AWX A;  1BB9 A;  5GAN 6;  2YWW A;  1PD0 A;  2EYY A;  5I2S A;  1T0J A;  3M0U A;  2O4X B;  1Q86 U;  2P0Q A;  1AT1 B;  1AHJ B;  2RF0 A;  4OMN A;  3UF4 A;  4FU6 A;  2GGR A;  1JXM A;  5IHK A;  1N8R U;  1SHG A;  3OSV A;  4M78 C;  4PJL A;  2V8I A;  4A4G A;  4BY6 C;  3RMS A;  2CUD A;  5M9O A;  1AWW A;  1VA7 A;  5D6Y A;  2CS7 A;  1G3Y A;  3E2U A;  3LH5 A;  4E7I A;  1YNZ A;  1WXT A;  3S6W A;  4CRI A;  2KE9 A;  4J7I A;  2E3I A;  1VQP T;  4M7A E;  4DEX A;  4J9D A;  4Y28 E;  1XTD A;  1AVZ C;  2GFU A;  1X43 A;  3NPF A;  1JQQ A;  2D0Q B;  4II1 A;  3I9Q A;  1YWP A;  4C92 G;  4L5G A;  4XU3 A;  2QAS A;  1NPP A;  1NG2 A;  2KVQ G;  2NLU A;  2X3X D;  3MO8 A;  1YJN A;  1Q81 U;  2DJZ A;  2YUQ A;  4C0D B;  2A3L A;  4HA8 A;  4KRT A;  2BTT A;  1X6G A;  3LGL A;  2QTX A;  1QVG S;  1RI0 A;  2SRC A;  4Z88 A;  1ZBX A;  3CBM A;  1WQ7 A;  2K5I A;  2BZX A;  3V8K A;  4JLG A;  2K9G A;  4XK8 E;  1KHC A;  2KYB A;  1WJQ A;  2HCK A;  1M4Z A;  2OTJ T;  5CK9 A;  3E9G A;  5DM7 R;  3GNG A;  2CT3 A;  2RQR A;  1QLY A;  2RHX A;  3NTI A;  5CQY A;  1YN8 A;  4ELY C;  2ED0 A;  1JJ2 S;  2EWN A;  3OS0 A;  3QWX X;  3NTH A;  2M0O A;  4F17 A;  1WX6 A;  5I2M A;  2EVR A;  2V26 A;  2C0T A;  4N0A A;  4C92 A;  2OAW A;  3G71 A;  2IG0 A;  1X2Q A;  3UPU A;  1AZG B;  5CCA A;  2X4W A;  4WF2 A;  3VYG A;  3MEV A;  3M56 A;  1KSW A;  2X4X A;  3M59 A;  5J3B A;  4LE9 A;  2F2V A;  3P8H A;  2LNH B;  1TSF A;  2KRM A;  4HCK A;  3RR6 A;  4BD3 A;  4A4H A;  1VYT A;  1I5O B;  3A8H B;  4ATO A;  2C0O A;  5IHN A;  5GAN 7;  1GRI A;  1SRL A;  2DL7 A;  1YHQ A;  1D0Y A;  4MDW A;  2E10 A;  2C0I A;  4PJO E;  1IRE B;  3JCM P;  1TWB A;  3D7S B;  5KYX B;  1WYX A;  1OPK A;  3SEM A;  1Y57 A;  3L2U A;  2RHU A;  1TG0 A;  2DXT A;  1VQ7 T;  4EMG A;  1H92 A;  1OX9 A;  2BKD N;  2CDT A;  2K3Y A;  5DLO A;  2A28 A;  1E6H A;  1Z9Q A;  2XIC A;  1IHV A;  2EGE A;  4OMQ A;  4C8Q A;  4KBM B;  2J05 A;  5GMK j;  3SWN A;  1YIT T;  4LD9 K;  2K79 A;  1LPL A;  2K7A A;  2E5Q A;  3CCE A;  5GAM e;  1Y71 A;  2VAS A;  1YJ9 T;  2EYQ A;  5KYU A;  2O9V A;  3H6Z A;  3QYH B;  1X2K A;  2CP7 A;  2F5K A;  2DVJ A;  2XDB A;  4KUL A;  2YRV A;  3PE0 A;  9ATC B;  1PM3 A;  2JTM A;  2DBM A;  2WSF E;  1WLP B;  3EGX B;  4X1V A;  2EQI A;  3KUF A;  2XDD A;  2DZ9 A;  2R58 A;  1QVF P;  4C92 B;  2OTL Q;  2RPN A;  1YIJ Q;  2AT1 B;  4GLK A;  4FW2 A;  1I07 A;  3CCJ T;  1M3C A;  2QXF A;  3CCQ Q;  2ABL A;  1WXU A;  2DER A;  2M02 A;  1WIE A;  2VYT A;  3R6O A;  4N4H A;  1PG5 B;  3PMI A;  3V7C A;  1BI0 A;  4OF1 A;  4BI3 A;  4M7D F;  5C0M A;  2IIM A;  3QG1 A;  4M7D C;  2RNA A;  2RM4 A;  1K9M U;  2DVE A;  5GAO r;  2ZPG B;  3M54 A;  3JB9 H;  2LCC A;  2XU8 A;  3THK A;  3UWN A;  3LWI A;  4IIO A;  5GMK l;  3OYF A;  2QTV A;  2K5F A;  3CCM T;  2EJG A;  3JV3 A;  2LCS A;  4CC3 A;  3M5A A;  4QW2 A;  2K2V A;  1VQ8 T;  1MNE A;  1HJD A;  2MCN A;  4M77 D;  2YHT A;  3GF5 A;  3QBY A;  4IUU A;  4DBR A;  3JCM h;  8AT1 B;  5GAN g;  4PJO F;  2LNV A;  2O2O A;  2QEX A;  3TSW A;  5LJ5 h;  5LL6 S;  2KDS A;  2H3E B;  4PJO A;  2QA4 A;  2COW A;  3L2Z A;  3OYE A;  1OPL A;  1S72 A;  3I35 A;  3SDZ A;  1M8V A;  3CME T;  1UGV A;  1K9M C;  1W2B A;  1W2B P;  5KYY A;  3RES A;  4BI8 B;  4C8Q E;  1TUC A;  4A4F A;  1KC8 U;  2HQH A;  1WJR A;  5AT1 B;  3ZEH A;  1CKB A;  1U06 A;  3GBQ A;  4LDW A;  2D8H A;  3PMT A;  1UE9 A;  2DKG A;  2MF2 A;  3H0I A;  1W2B S;  2G6F X;  1GCQ C;  4DBF A;  3PVL A;  3OMG A;  1KC8 R;  5IAY A;  1RAD B;  1VQM T;  2DXU A;  2CP5 A;  4QVZ A;  1YIT Q;  4PJO D;  3LX7 A;  2IVW A;  3M53 A;  5CIU A;  3I55 A;  4AT1 B;  3CCL T;  1YJ9 Q;  3KXT A;  1SEM A;  2FHD A;  1MV0 B;  3TU4 K;  3A1P A;  1K8A C;  4BDY A;  3CCL Q;  1SKU B;  3DB4 A;  1UEC A;  3CCS T;  2QA4 Q;  5ECA A;  1SSF A;  3X24 B;  3SWN B;  1ABQ A;  1D1A A;  2JW4 A;  4RG2 A;  2CGH A;  4C8Q C;  1Q95 G;  4PK4 A;  1MV3 A;  3BW1 A;  5FRM A;  4IUP A;  4A4E A;  3CPW P;  1VQ6 Q;  1UGR B;  4R56 A;  4M7A F;  3CBO A;  1KQ1 A;  1M1K U;  2L3Q A;  2CKK A;  2B8A A;  1MMD A;  1K76 A;  3O5Z A;  4PNO A;  4LD6 A;  2EJF A;  1MND A;  2DFU A;  4J9B A;  4JS5 A;  4ME7 A;  2JM9 A;  2QAZ A;  4M7A G;  1ZLM A;  3A5Z B;  1SRM A;  2R57 A;  2RI2 A;  1S1N A;  4ESR A;  3MHX A;  4C5E A;  1Q7Y C;  2DXC A;  2RJE A;  4M7D G;  2CH4 W;  3A8O B;  2AIR B;  2JS0 A;  3NTK A;  1WI7 A;  2EYW A;  1FWZ A;  3OA6 A;  3M9Q A;  4LDY A;  4C92 C;  1NJI C;  1K9M R;  1I0C A;  2OX7 A;  2ESW A;  4OB0 B;  1ARK A;  2K6D A;  3PT9 A;  1YBY A;  4QKU A;  1S72 Q;  1ZSZ A;  1PHT A;  3M0T A;  3ME9 A;  5KYW A;  3DLL A;  3MP1 A;  1BI1 A;  3A98 A;  3OS1 A;  2J6F A;  3OYH A;  5A0D A;  1YCS B;  4HCC A;  3G71 T;  1OZ3 A;  1RAG B;  3EHQ A;  2JOY A;  5FU6 C;  2QI2 A;  2DZC A;  5J39 A;  3CD6 A;  2E41 A;  3ZFJ A;  3NHN A;  5DLQ E;  5CKH A;  1Y0M A;  4C92 F;  4XTY A;  2NUT B;  1FXX A;  2DD4 A;  4CC2 A;  1ZSZ B;  1NPR A;  1G2B A;  1N8R R;  4M7A B;  4FT4 A;  1RLQ C;  1BI2 A;  1MUZ A;  1N27 A;  3S3O A;  2FPD A;  2LDM A;  5GAN h;  5LJ3 d;  4BE0 A;  2BE9 B;  3FC3 A;  3BY7 A;  2HKQ B;  1U1S A;  1Y07 A;  3PIO A;  4IKF A;  3A8M B;  4X34 A;  3ER0 A;  3I5S A;  3OMC A;  1YHQ Q;  1SHF A;  4PJO G;  1GL5 A;  4ZN1 A;  4TVR A;  3JCM e;  3HFO A;  1ZA1 B;  2L89 A;  5C6S A;  3PTA A;  1U5S A;  2VKN A;  3C4S A;  4J9C A;  1K1Z A;  1BBZ A;  1N5Z A;  3WXM B;  1Q82 C;  4Y92 A;  3EAE A;  3QZ5 B;  1VQ7 Q;  4UC4 A;  2RJF A;  2XI9 A;  1VYU A;  4AFU C;  1Q81 C;  1VQM A;  3CCV T;  2DXB A;  4M78 G;  4BY6 B;  4M75 D;  4E7S A;  2VC8 A;  2RQW A;  3I56 T;  1T3S A;  4Z89 A;  1ZBJ A;  3EGD A;  5KH6 A;  2EQM A;  1X27 A;  2E1H A;  4HXJ A;  3VS1 A;  1YJN Q;  3JSC A;  2EKO A;  2EBP A;  4ZTF A;  1G3W A;  1HK9 A;  4M4Z A;  2CP2 A;  2DNU A;  1RAB B;  2X9H A;  2KXD A;  4Q5W A;  1PCX A;  1QWE A;  2DLP A;  2FL7 A;  2FB7 A;  3CCQ A;  3X28 B;  1M8M A;  2EKH A;  2PNI A;  4XTW A;  1GXI E;  3PGG A;  3QJ6 A;  2MIO A;  5LJ3 h;  3JCM d;  4EDU A;  3VUZ A;  2HDA A;  2M1H A;  2V1R A;  4EMK A;  1VQO T;  2YUP A;  4M77 C;  3MET A;  2J6O A;  3QWY A;  5GAN f;  4RTZ A;  5AYF A;  3OYL A;  3H0H A;  3QSU A;  4JUV A;  2KGT A;  3EG9 A;  2WSE E;  3MCA B;  4EPC A;  1PRM C;  3DLM A;  2NUT A;  4B6M A;  3S3N A;  2RI3 A;  1VQL Q;  4E7Z A;  1Y96 A;  1OV3 A;  2RN8 A;  4PLL A;  3X25 B;  4Y91 A;  3OW2 S;  2DX1 A;  3QXE B;  3MPU B;  3G6E T;  4M77 A;  1NYG A;  4A54 A;  3QZ9 B;  4NL3 A;  1KFZ A;  2W0Z A;  1ZHI A;  2AZS A;  1QWF A;  2OAU A;  2FRW A;  3UT1 A;  4RG8 A;  5KYY B;  1KD1 U;  1W70 A;  2YUN A;  2D8J A;  3CC7 Q;  3JCM Q;  5CKE A;  1UHF A;  2EFI A;  2DAQ A;  3CME A;  2EIF A;  1O9S A;  2JXB A;  3JCM b;  4OMF B;  2GCX A;  4NOY A;  1RLP C;  1XJW B;  2CRE A;  3G71 Q;  3C12 A;  3QKJ A;  4E2F B;  1KHI A;  3G7Z A;  3EH1 A;  1PKS A;  3L1A A;  4FSX A;  3V8L A;  1JBM A;  1H8K A;  1TOV A;  5GAN 5;  3CXC P;  5LJ5 f;  1K8A R;  1Q86 C;  2CZ7 B;  2GTO A;  3L2R A;  3CCU A;  4FYV B;  1R77 A;  2KYM A;  3VU3 C;  4XAX B;  5GAO m;  2YRC A;  3F70 A;  2XMF A;  4XTX A;  3OW2 P;  4F7U B;  1VQP A;  4ZNX A;  1PC0 A;  1MGQ A;  3M0Q A;  3EGX A;  1OOT A;  2NWM A;  2NUZ A;  4NL2 A;  4QVC A;  1C6V X;  3M57 A;  4K11 A;  1JXO A;  1P92 A;  2DTH A;  2JMA A;  3HKS A;  4N4G A;  1KC8 C;  3I55 T;  1WHK A;  2DEQ A;  1SG5 A;  3OYA A;  1BYM A;  2E64 A;  5J26 A;  2J7I A;  3RDV A;  4OGC A;  1VQK Q;  3SWN C;  2DE0 X;  1M3A A;  1K0X A;  3TEE A;  2DK3 A;  3FJP A;  2K3X A;  3HL8 A;  2RD1 A;  3N5B B;  2GNC A;  2EYZ A;  1LCK A;  4LDX A;  2E70 A;  4B9W A;  5GJV B;  2LZ6 B;  4JRK A;  3CC4 T;  4BI4 A;  2KY9 A;  1NJI R;  1A0N B;  1NBE B;  2X4Y A;  4D6W A;  3JCM X;  2A7Y A;  3JCM f;  3CC4 Q;  5KCH A;  1I1J A;  2X3W D;  1M90 R;  2HMA A;  1M90 C;  4A53 A;  1VQ8 A;  3M0R A;  4BB7 A;  1W6X A;  4J7F A;  4EIK A;  4RTU A;  3E1S A;  3EGD B;  1QVG P;  4JLI A;  5CR2 A;  3CQT A;  4F7U A;  2I2L A;  1O75 A;  4KUI A;  1HXD A;  4M75 F;  1NJI U;  3C94 A;  2Y4X A;  2DRM A;  4AG1 C;  2L8D A;  1IB8 A;  3LLR A;  4LUE A;  4QQG A;  3JB9 F;  2K5L A;  1M2V A;  1ZUY A;  4J9I A;  4OB1 B;  1OUL A;  2MWO A;  4B9X A;  2X35 A;  3TCJ A;  3CCE Q;  3CC4 A;  2L0A A;  2FG0 A;  2KBT A;  3LYI A;  2VV5 A;  1LVK A;  4D8K A;  1X6B A;  4PJJ A;  3L2W A;  2F2X A;  4HVW A;  5A0L A;  3R6N A;  2M16 A;  1VQ9 A;  1VIF A;  1KQ2 A;  1WNL A;  3M0S A;  4BUG A;  3EFO B;  5FRN A;  2RJD A;  4PFP A;  4E7H A;  1UGP B;  3OY9 A;  5KE2 A;  1ZUU A;  1QVG A;  1E6G A;  2O88 A;  2HL5 C;  3EG3 A;  4RTV A;  3CMA Q;  1N8R C;  2RMO A;  4J6X A;  1UG1 A;  1WHJ A;  4ZGD B;  1Y7X A;  1QQJ A;  2LQK A;  4JS4 A;  1Q7Y R;  2GQV A;  1N9S A;  3MEW A;  3UAT A;  5GAM j;  2MI6 A;  4NS5 A;  4C8Q G;  3CCU Q;  4HT9 A;  2ATC B;  4P5N A;  4LDV A;  4M75 C;  2PU9 B;  4OGE A;  4ORZ A;  2E5K A;  3M55 A;  3SFM A;  2Y90 A;  4RUG A;  5EC7 A;  1GFD A;  5CQX A;  2KAF A;  4JJN K;  3DB3 A;  4CC7 A;  2BZ8 A;  1ZSZ C;  1VQ4 Q;  2KR3 A;  1K73 R;  1F1B B;  4C8Q B;  1M1G A;  1AOJ A;  1M1K R;  4M7A C;  1LOJ A;  4LDU A;  3LW5 E;  2XID A;  2JZ2 A;  2V8K A;  1JU5 C;  1G83 A;  1OU9 A;  1EX4 A;  4C0F A;  4RKU E;  3WVE B;  2DA9 A;  3JCM J;  3CCV A;  1VQM Q;  3OYG A;  2BZY A;  4M75 G;  4WTO B;  2X4J A;  2P0K A;  3ASK A;  4L59 A;  3SD4 A;  2JTE A;  2HL3 A;  2ZPE B;  4GBQ A;  1KJW A;  4PJO B;  3E19 A;  1LNX A;  2B86 A;  4DOW A;  3FLG A;  2FYK A;  4ZGJ B;  2EGA A;  3VV0 A;  2LTO A;  4R0K A;  2AHJ B;  2JM8 A;  4J8O A;  1BI3 A;  3MJX A;  4YTL A;  3X20 B;  3VRZ A;  1C1A A;  2LT4 A;  4JJC A;  5KYX A;  2NUP A;  2DF6 A;  4FM4 B;  3GP8 A;  4JJD A;  1YJN T;  1Q86 R;  1UEB A;  4LN2 A;  1GBQ A;  3EFS A;  1B3Q A;  1VYV A;  4KGZ B;  1B34 B;  1VQ6 T;  2KSS A;  2MAM A;  2GTJ A;  2HSE B;  1NEB A;  2FZC B;  1UB4 A;  4JRQ A;  3NMZ C;  2K4Y A;  5GAO n;  2GFA A;  4DA4 A;  7AT1 B;  5GAN j;  5GAM g;  2LX9 A;  2YXY A;  3V7R A;  3CD6 Q;  2QQR A;  5FLX E;  5FRO A;  2LMJ A;  4XU1 A;  4FCY A;  4J5Y A;  2FZG B;  5GAN 4;  2H3J A;  4C92 D;  5LJ5 g;  3VUB A;  3GNF B;  2WSC E;  2XDP A;  2ZCF B;  5CAI A;  4OMO A;  1X01 A;  1OEB A;  2MWP A;  2QYZ A;  2VUB A;  2QQ9 A;  1ABO A;  5I21 A;  5IT9 E;  4EMK C;  1DJ7 B;  1JO8 A;  2D1X A;  4M75 E;  4J9F A;  2P4T A;  2PTK A;  3OW2 A;  1FYN A;  2DO3 A;  5L8R E;  3VYH B;  4F04 B;  2RQU A;  3CC2 Q;  2CSQ A;  2E4H A;  2C06 A;  1EFN A;  4M78 E;  2MOX A;  3ZBD A;  1BIB A;  2YT6 A;  1J3T A;  4FSS A;  2AKK A;  2NUP B;  2DTI A;  4Z02 A;  3UA7 A;  1RAA B;  1YFN A;  1IZ6 A;  2CP3 A;  4J9G A;  2ZZD A;  3VS7 A;  1KG1 A;  4RCC A;  3M0P A;  3CC2 A;  2EQK A;  2F69 A;  1OYX A;  1Z9Z A;  4FW1 A;  2F5T X;  2DBK A;  2JNG A;  1W1F A;  2L3R A;  2YRD A;  3REA B;  4MZM A;  4HVU A;  1G3S A;  3VS0 A;  2MYS A;  3OYB A;  2KT8 A;  3V7S A;  5HK0 A;  2QK0 A;  1FX7 A;  2HKN A;  5LJ3 f;  2OTL T;  4PJN A;  1WA7 A;  4F7U E;  1VQ5 A;  3OS2 A;  1RAE B;  2RI5 A;  4M77 F;  4LUD A;  1HYO A;  2EGC A;  4JRI A;  1M27 C;  2QQS A;  2YDL A;  3OYN A;  1WQW A;  1VQL T;  5CKB A;  2RHZ A;  3CCQ T;  4M78 B;  1NM7 A;  4OB3 B;  2VXE A;  2GF7 A;  1VQO A;  4MZT A;  1U3O A;  2FZK B;  3I55 Q;  2OTJ Q;  3EG2 A;  1QMC A;  1VUB A;  2PQW A;  1JB0 E;  5GMK e;  2CZ6 B;  2JUF A;  5IN1 A;  1RAC B;  3MEU A;  4F14 A;  2GQI A;  5IXB A;  2DL3 A;  2RO0 A;  1SSH A;  1KIK A;  3PIP A;  1RUW A;  4M78 F;  4C5H A;  3CPW A;  3PFS A;  3RKW A;  3CCV Q;  3EG0 A;  3EG1 A;  2O9S A;  1VQN Q;  1YJW A;  1V76 A;  4N0A C;  5GAN 2;  4XU2 A;  1VQL A;  1VQ8 Q;  3CXC A;  1UDL A;  1KQS S;  1ZQ1 A;  4BE1 A;  2IPO B;  3G1J A;  3FEO A;  1K73 U;  2FPF A;  3EHR A;  2PVG B;  1PD1 A;  3RKY A;  3CD6 T;  4AMC A;  2A08 A;  2DPP B;  4FL6 A;  4JJB A;  3RBB B;  5CKF A;  1YI2 Q;  1AWO A;  4IUT A;  1IHW A;  2LQ8 A;  4F16 A;  2CYZ B;  5IH2 A;  4E7J A;  1YI2 T;  1U8R A;  1JRI A;  1Y96 B;  2KT1 A;  1QP2 A;  1BIA A;  4M78 D;  4ZTJ A;  3QDF A;  5CO7 A;  1I8F A;  2DTO A;  2DET A;  2O4X A;  3CPF A;  3EFR A;  3RUX A;  1RI9 A;  3VJP A;  1Q82 R;  1M1K C;  5GAM h;  4ELZ C;  2FO0 A;  2L5Q A;  2MPX C;  1FMW A;  3ZL7 C;  1M9S A;  1WHM A;  1YJW Q;  2CZ0 B;  3G4S T;  1QVF A;  1VQN A;  5GAO l;  2DD5 A;  2HD0 A;  2K2M A;  2L2P A;  1N9R A;  2P84 A;  2YLC A;  3H41 A;  1K4U S;  3UA6 A;  3PVQ A;  4CC4 B;  2FVU A;  1KK7 A;  1QCF A;  2QG9 B;  1Q82 U;  1NYF A;  1YP5 A;  2LRQ A;  3QO3 A;  2E6Z A;  2DRK A;  4RCB A;  3UDC A;  1M5Q 1;  3CCM A;  1UJY A;  4PKC C;  2KXC A;  2QQA A;  2QDY B;  2DL8 A;  3EGU A;  1AD5 A;  2EAY A;  4OVA A;  2CP6 A;  4MMK A;  2LC4 A;  3M4Y A;  2LP5 A;  2Z0W A;  2D9T A;  3URG A;  1EZZ B;  2EQU A;  2LT1 A;  3LGF A;  4BDZ A;  3L2Q A;  5HKC A;  3J80 E;  2K57 A;  1VQ5 Q;  5HK3 A;  3FJ5 A;  4RTY A;  3T9N A;  3CCR A;  2DYI A;  3E9F A;  5KYU B;  1VQK T;  3VS3 A;  2JS2 A;  2A37 A;  5L23 A;  2RA2 A;  5LJ3 e;  2QGG A;  3JCM g;  3BFM A;  4C5I A;  1D3B A;  1B34 A;  3RMQ A;  5GAM f;  3WVD B;  1QCO A;  2EJ9 A;  1RAF B;  2HSP A;  4E7L A;  5A0G A;  3NGP A;  3GIB A;  4XTV A;  3FDR A;  5FU7 C;  3TSZ A;  2M0Y A;  3I5R A;  1IO6 A;  1VQ9 T;  4M7A A;  1U1T A;  3GLX A;  1VQ6 A;  2ZPF B;  3CMA T;  1D1B A;  3U23 A;  1BCO A;  3VS6 A;  1VQ9 Q;  2KRS A;  5FW9 A;  3OYI A;  3DKM A;  4M7D D;  4PJM A;  2CZ1 B;  3MP8 A;  3X26 B;  2ECZ A;  5D7U A;  3PNW C;  2RHI A;  3CCU T;  2KRN A;  2SEM A;  5KE3 A;  2JN0 A;  1H3Z A;  4M77 G;  3LWH A;  4C0G A;  1V1C A;  1XQH A;  5CVI A;  1M2V B;  1MMG A;  2P0P A;  3L42 A;  3JB9 I;  4M78 A;  3VS2 A;  1NLP C;  5GAN 3;  2VB6 A;  2KMT A;  3O8V A;  1VQ7 A;  2BE7 D;  3RIR A;  4DOV A;  2ED1 A; 
#chains in the Genus database with same CATH homology
 4CC7 A;  2BZ8 A;  2CUB A;  3VS5 A;  1PNJ A;  4J9B A;  2KR3 A;  4IIM A;  4AFS C;  2JM9 A;  2YUO A;  5I22 A;  1ZLM A;  5I11 A;  1AWJ A;  1SRM A;  2M51 A;  1S1N A;  2VWF A;  4OMP A;  1AOJ A;  2KNB B;  4ESR A;  1WDX A;  2JT4 A;  3RNJ A;  2QDL A;  1K9A A;  4HVV A;  2CH4 W;  1PWT A;  1JU5 C;  1G83 A;  1GCP A;  2JS0 A;  2DL5 A;  1WI7 A;  2EYW A;  1T0H A;  4J9H A;  3KFV A;  3IQL A;  2DA9 A;  2AKL A;  2KRO A;  2DYB A;  2DJQ A;  1M30 A;  2BZY A;  1I0C A;  3H0F A;  5FWC A;  1XOV A;  1AWX A;  1BB9 A;  2ESW A;  1ZSG A;  1ARK A;  2JTE A;  2K6D A;  4GBQ A;  2EYY A;  1T3L A;  2J06 A;  1KJW A;  1T0J A;  3M0U A;  2B86 A;  1HSQ A;  1PHT A;  3M0T A;  2RF0 A;  1NEG A;  3A98 A;  4OMN A;  2J6F A;  3UF4 A;  1YCS B;  2GGR A;  1JXM A;  2EGA A;  5IHK A;  1SHG A;  4R0K A;  3EHQ A;  2JM8 A;  3NHN A;  1GFC A;  1Y0M A;  3VRZ A;  2LQN A;  4JJC A;  2CUD A;  2RQT A;  2DF6 A;  1AWW A;  1VA7 A;  4CC2 A;  4JJD A;  4LN2 A;  1GBQ A;  1B3Q A;  1VYV A;  1G2B A;  2CSI A;  3LH5 A;  1YNZ A;  2GBQ A;  1WXT A;  2GTJ A;  1NEB A;  3NMZ C;  2KE9 A;  2EPD A;  1RLQ C;  4E6R A;  2AZV A;  1MUZ A;  4DEX A;  4J9D A;  2ENM A;  2LMJ A;  1AVZ C;  2FPE A;  4RTW A;  1X43 A;  3NPF A;  1JQQ A;  2FPD A;  3I9Q A;  1YWP A;  1NG2 A;  2L3P A;  2X3X D;  1E7O A;  4DEY A;  2OI3 A;  4OMO A;  2YUQ A;  4OMM A;  2LX7 A;  3I5S A;  4KRT A;  2EYX A;  2BTT A;  1OEB A;  2DIL A;  1X6G A;  1SHF A;  1ABO A;  1GL5 A;  4RTX A;  1JO8 A;  2D1X A;  2SRC A;  4J9F A;  4Z88 A;  2PTK A;  1FYN A;  1U5S A;  2VKN A;  4J9C A;  2BZX A;  1K1Z A;  2K9G A;  2RQU A;  1BBZ A;  1N5Z A;  2FEI A;  4Y92 A;  2CSQ A;  2KYB A;  2HCK A;  2H8H A;  1GBR A;  1EFN A;  2MOX A;  1VYU A;  4AFU C;  2YT6 A;  2CT3 A;  2RQR A;  1CSK A;  4GLM A;  1J3T A;  1QLY A;  4FSS A;  2AKK A;  1WXB A;  2RQW A;  1YN8 A;  3UA7 A;  1T3S A;  2ED0 A;  4Z89 A;  1CKA A;  1ZBJ A;  4J9G A;  3VS7 A;  1X27 A;  4HXJ A;  3QWX X;  3VS1 A;  4F17 A;  1WX6 A;  2EBP A;  3M0P A;  2EVR A;  2C0T A;  1Z9Z A;  2OAW A;  4M4Z A;  1HD3 A;  2EW3 A;  1X2Q A;  2DNU A;  1AZG B;  2KXD A;  2DBK A;  1W1F A;  3REA B;  4HVU A;  3VS0 A;  4A63 B;  1KSW A;  1QWE A;  2DLP A;  2P4R A;  2KT8 A;  4LE9 A;  1M8M A;  3VRY A;  2EKH A;  2F2V A;  2PNI A;  1WA7 A;  2LNH B;  2MIO A;  2KRM A;  2VVK A;  4HCK A;  2HDA A;  2V1R A;  4LUD A;  2YUP A;  1AZE A;  2EGC A;  1VYT A;  2J6O A;  3QWY A;  4RTZ A;  1M27 C;  2CH4 A;  2YDL A;  3H0H A;  2C0O A;  5IHN A;  1GRI A;  1AEY A;  2KGT A;  1SRL A;  2DL7 A;  2DM1 A;  2C0I A;  1PRM C;  1NM7 A;  1WYX A;  1OV3 A;  1U3O A;  1OPK A;  3SEM A;  1Y57 A;  2RN8 A;  4WCI A;  1TG0 A;  4RTT A;  2DX1 A;  2LJ0 A;  1H92 A;  2CDT A;  3EG2 A;  5IXF A;  1NYG A;  2A28 A;  1E6H A;  1Z9Q A;  2LQW A;  2ROL A;  4OMQ A;  2EGE A;  2ROT A;  1KFZ A;  2W0Z A;  2AZS A;  2J05 A;  1QKW A;  4QT7 A;  1QWF A;  2K79 A;  2FRW A;  1W70 A;  1UHC A;  4F14 A;  1B07 A;  2D8J A;  2DL3 A;  2GQI A;  1SSH A;  2YUN A;  5IXB A;  1KIK A;  2K7A A;  1RUW A;  1UHF A;  2OJ2 A;  2L3S A;  2O9V A;  2RQV A;  3ULR B;  4AG2 C;  2JXB A;  2J6K A;  4JPB W;  1X2K A;  1RLP C;  2CRE A;  3EG0 A;  2DVJ A;  3EG1 A;  2O9S A;  3PE0 A;  2DBM A;  1PKS A;  1WLP B;  1H8K A;  3VS4 A;  4X1V A;  1ZUK A;  2EQI A;  1UDL A;  3C0C A;  1WFW A;  1UTI A;  2GTO A;  2F2W A;  2RPN A;  2KYM A;  2XMF A;  4ZNX A;  1PKT A;  1I07 A;  2FPF A;  3EHR A;  3M0Q A;  1OOT A;  1M3C A;  2NWM A;  2NUZ A;  2ABL A;  1WXU A;  4JZ3 A;  2A08 A;  1WIE A;  4JJB A;  4K11 A;  3RBB B;  2PZ1 A;  1JXO A;  1PRL C;  1AWO A;  1UFF A;  2JMA A;  5GJW B;  2LJ3 A;  2IIM A;  4F16 A;  2RNA A;  2D0N A;  5IH2 A;  2J7I A;  2KT1 A;  2A36 A;  5IHI A;  2DMO A;  2DE0 X;  1M3A A;  1K0X A;  3TVT A;  4Z8A A;  1RI9 A;  3THK A;  1JEG A;  4IIO A;  2GNC A;  2EYZ A;  2FO0 A;  1LCK A;  3ZL7 C;  3JV3 A;  5HCK A;  2LCS A;  4CC3 A;  2FRY A;  5GJV B;  4OML A;  2LZ6 B;  2K2M A;  2L2P A;  2HEQ A;  2MCN A;  1HJD A;  3H41 A;  1K4U S;  3UA6 A;  3PVQ A;  1UUE A;  4CC4 B;  1A0N B;  1QCF A;  4AFZ C;  4LNP A;  1NYF A;  1YP5 A;  2O2O A;  2YSQ A;  3TSW A;  1I1J A;  2X3W D;  3M0R A;  2DRK A;  1W6X A;  1SPK A;  4EIK A;  4RTU A;  1NLO C;  1UJY A;  2HBW A;  2KXC A;  1OPL A;  3I35 A;  2DL8 A;  3CQT A;  3EGU A;  1AD5 A;  1UGV A;  2DRM A;  1K0S A;  2LP5 A;  4AG1 C;  1TUC A;  4LUE A;  2O31 A;  1FMK A;  1ZUY A;  1GCQ A;  4J9I A;  1BK2 A;  3REB B;  2W10 A;  1UJ0 A;  2AK5 A;  2L0A A;  1CKB A;  4J9E A;  2FG0 A;  1U06 A;  2KBT A;  3GBQ A;  2D8H A;  3FJ5 A;  4RTY A;  1UE9 A;  2CT4 A;  3H0I A;  4D8K A;  1X6B A;  2G6F X;  2I0N A;  3VS3 A;  2F2X A;  2JS2 A;  2A37 A;  4HVW A;  3SHW A;  1GCQ C;  4AFQ C;  3R6N A;  5L23 A;  2DL4 A;  3PVL A;  3M0S A;  2HSP A;  1BU1 A;  3NGP A;  2K3B A;  3TSZ A;  2M0Y A;  1M3B A;  1SEM A;  3I5R A;  1IO6 A;  1MV0 B;  4JZ4 A;  5FWB A;  3U23 A;  2V1Q A;  1ZUU A;  4D8D A;  3VS6 A;  1E6G A;  1UEC A;  2KRS A;  2O88 A;  5FW9 A;  3EG3 A;  5ECA A;  4RTV A;  2RMO A;  2ECZ A;  1UG1 A;  1ABQ A;  2JW4 A;  2KRN A;  2SEM A;  1H3H A;  1MV3 A;  1TUD A;  3UAT A;  1QKX A;  1V1C A;  2LJ1 A;  4ORZ A;  2E5K A;  1YWO A;  2L3Q A;  4RUG A;  5EC7 A;  2KEA A;  1GFD A;  3VS2 A;  1K76 A;  1NLP C;  3O5Z A;  2JMC A;  1X69 A;  2ED1 A;  1ZX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...