1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
2K3BA 3EHQA 2GNCA 3EG1A 1RLPC 2DL8A 4HCKA 2GTJA 3NHNA 4Y92A 1WYXA 2FPFA 3SEMA 3RNJA 3IQLA 3PE0A 1H92A 1UGVA 1XOVA 3H0IA 1X6GA 2W0ZA 2X3WD 3C0CA 2DBMA 2F2VA 2JTEA 2EKHA 1SRLA 2EVRA 2CREA 4HVUA 1SEMA 1K76A 2CH4W 4J9EA 4D8KA 2G6FX 1GCQA 1UG1A 1YWPA 4LUDA 4K11A 2E5KA 2YDLA 2J06A 2JT4A 2KRMA 5IHIA 1T3SA 3TVTA 3R6NA 1ABOA 2MCNA 2DJQA 2H8HA 4JJDA 5FW9A 3I9QA 5GJWB 2ENMA 1SSHA 3O5ZA 3VS5A 2LX7A 5IXFA 1QCFA 2ROLA 2VKNA 2K7AA 1PKTA 1G83A 2LJ3A 1HD3A 1N5ZA 1PRLC 3M0UA 1AVZC 1RI9A 1U3OA 1UUEA 1U5SA 4AG2C 1QWFA 2CT3A 2DYBA 2JMCA 1BBZA 4IIMA 2EYXA 3EG3A 4RTXA 4GBQA 1UHFA 1A0NB 2LQNA 2L3SA 2CUBA 1Z9QA 2O9SA 2GTOA 5GJVB 1W70A 4FSSA 2A36A 4HVWA 3UF4A 4R0KA 1E7OA 1NLPC 4CC4B 1X2QA 1H8KA 2DL4A 2ED1A 2D1XA 2FRWA 2EYWA 4HXJA 3VS1A 1AZEA 2VVKA 2EQIA 2L2PA 2KXCA 1BK2A 2FG0A 1W6XA 1UJYA 1WA7A 3NMZC 2D8HA 1M3CA 3VRZA 2KRSA 1X27A 1GBRA 4LN2A 1KIKA 2GGRA 3KFVA 1VYTA 5IHNA 4JZ4A 4EIKA 1UDLA 1GFCA 1FMKA 1PNJA 1X2KA 1V1CA 4DEXA 5IHKA 1PKSA 1JO8A 5EC7A 3EG2A 1NG2A 4J9DA 1HSQA 2BZ8A 2O31A 1PRMC 2L0AA 3H0HA 4JZ3A 1AZGB 4RTUA 1RLQC 4CC2A 1Y0MA 2X3XD 2DMOA 2W10A 2J6OA 1UE9A 4J9HA 2D8JA 1M30A 1T3LA 2AKKA 2JMAA 1PHTA 1UJ0A 2V1RA 2EYYA 1NM7A 1Z9ZA 4Z88A 1X43A 1JXMA 2DRMA 2KGTA 1ARKA 2O88A 1ZLMA 1WIEA 1W1FA 4OMOA 1K0XA 2JW4A 1IO6A 1I07A 2EBPA 4AFUC 2XMFA 1T0JA 1Y57A 2EGCA 1BB9A 1MUZA 1B07A 2KYBA 3I35A 1GFDA 1WX6A 1AOJA 2FPEA 2MOXA 4AFZC 1H3HA 3U23A 2DL3A 1SRMA 4ORZA 4IIOA 2CUDA 1NYGA 3PVQA 3M0SA 3M0PA 2LQWA 3NGPA 1CSKA 1K9AA 2KXDA 4OMNA 2ECZA 1HJDA 5IXBA 3H0FA 1OV3A 3UA6A 2FPDA 2AZVA 1FYNA 1KJWA 2C0OA 3RBBB 1OOTA 4J9BA 2ABLA 2RN8A 2VWFA 4CC3A 1J3TA 1U06A 1GCQC 3QWYA 2RQVA 4JJCA 2DM1A 2O2OA 4D8DA 2SRCA 2RPNA 1UFFA 2A37A 1UECA 2M0YA 2I0NA 5ECAA 4X1VA 2YUQA 4AG1C 4OMPA 2KT8A 1SHFA 1M3AA 1CKBA 1T0HA 4CC7A 1ZUUA 4J9FA 1JU5C 1SHGA 4DEYA 2HEQA 1JXOA 3M0RA 1NEBA 2EGEA 3H41A 2DNUA 4ESRA 3JV3A 5FWBA 2OAWA 4OMMA 1ABQA 2K79A 1K1ZA 1OEBA 4F17A 2OJ2A 2YUPA 4E6RA 1GCPA 3VS2A 1LCKA 1MV3A 5I11A 2OI3A 1GL5A 2AKLA 1ZUKA 2LJ1A 4RTWA 3VS7A 2YT6A 4A63B 1OPKA 1M8MA 2F2XA 3THKA 3VS3A 2JM9A 2KROA 1UTIA 1YWOA 2KNBB 5HCKA 5FWCA 1ZUYA 2K6DA 2DLPA 4GLMA 1K0SA 4J9CA 2RQUA 1AEYA 3PVLA 3TSWA 2B86A 2J7IA 2O9VA 5L23A 2P4RA 2NUZA 3A98A 1VA7A 2L3QA 2RQRA 2CSIA 1WXTA 2DE0X 1PWTA 1ZBJA 2AZSA 4OMQA 2KBTA 1GRIA 2JS0A 1TUCA 2RMOA 1E6GA 3UA7A 2IIMA 2J05A 1G2BA 1MV0B 5IH2A 3EGUA 2YUNA 4WCIA 3VS6A 2V1QA 3EHRA 2EW3A 2FRYA 3LH5A 1TG0A 3I5SA 2BTTA 2DBKA 2LZ6B 1SPKA 4RTYA 2EPDA 2NWMA 2C0TA 1E6HA 1QKWA 1NYFA 2KR3A 3ZL7C 2HSPA 1EFNA 2HCKA 2YUOA 2LNHB 2ED0A 3NPFA 2YSQA 2BZXA 1QKXA 2DVJA 4RTTA 1AD5A 2EGAA 2M51A 4M4ZA 1OPLA 2LCSA 2HBWA 2RQTA 4JJBA 1WDXA 1YN8A 1QLYA 2HDAA 1ZSGA 2MIOA 2ROTA 2EYZA 1K4US 4J9IA 2LP5A 3SHWA 2DILA 5I22A 1TUDA 1AWJA 2KYMA 3FJ5A 2J6FA 1KFZA 2KE9A 2A28A 1WLPB 2DF6A 4ZNXA 3TSZA 2DL7A 4AFSC 1M3BA 2QDLA 1VYUA 3CQTA 1I0CA 1S1NA 2RQWA 1VYVA 4LE9A 2RF0A 1RUWA 4QT7A 2JM8A 3M0QA 4LUEA 1WFWA 3GBQA 1X69A 1CKAA 4AFQC 1X6BA 4F16A 2A08A 2SEMA 2GBQA 4J9GA 1UHCA 3VRYA 1WXBA 3M0TA 4Z89A 4HVVA 1KSWA 4OMLA 2D0NA 2DRKA 1WI7A 4Z8AA 2LMJA 3VS0A 1GBQA 2BZYA 3EG0A 1AWWA 1JQQA 1YCSB 3QWXX 2RNAA 2L3PA 1JEGA 2K2MA 2C0IA 1AWOA 2DX1A 2JS2A 3REBB 3I5RA 1YNZA 2FO0A 2DA9A 2KRNA 2PZ1A 2JXBA 3ULRB 1AWXA 1NLOC 1NEGA 1ZX6A 3VS4A 4RTVA 2PTKA 1QWEA 3UATA 4JPBW 2LJ0A 2PNIA 2CDTA 4F14A 2CT4A 2K9GA 4KRTA 1I1JA 1WXUA 2AK5A 1YP5A 2F2WA 2DL5A 2KEAA 4RTZA 2KT1A 4RUGA 1B3QA 2GQIA 1M27C 2CH4A 4LNPA 2J6KA 2CSQA 3REAB 1BU1A 2FEIA 2ESWA
chains in the Genus database with same CATH superfamily
5GAOm 1M90C 4M7AA 5D6YA 3QKJA 2VUBA 4BE1A 4M78B 2X51A 3PE0A 4OB1B 1X6GA 4FCYA 4RMOA 1WQ7A 3GNGA 2EVRA 1VQNQ 2KDSA 1SEMA 8AT1B 5GMKm 2QGFB 1UG1A 2DTIA 2E5KA 3OSSC 2YDLA 2YXYA 3DKMA 4BUGA 2KRMA 1T3SA 5CKFA 3INZA 2VC8A 1TOVA 3L1AA 3NTHA 3OYGA 2WACA 1I81A 2ENMA 1OQKA 3CBPA 3O5ZA 3L2UA 5IXFA 5KE3A 1QCFA 5GANg 1VQKQ 1PRLC 1RI9A 2DIQA 1U5SA 4AG2C 1JB0E 2RD1A 1VQ7Q 4BDYA 3SD4A 1EX4A 4XTZA 3G6ET 4XAXB 4ZN1A 1C1AA 1JBMA 1M4ZA 2E4HA 1KHCA 2LQNA 2EQKA 3GP8A 4IURA 5D7UA 3JB9F 2K5FA 2DTHA 2X4WA 4FSSA 1IZ6A 2ZPFB 2GQVA 2CGHA 2NUTB 3V7CA 4BY6C 3G1JA 2XD0A 1VQLT 4M7DE 3EFRA 2G3RA 2LQ8A 2E41A 5GAOp 2D1XA 2FRWA 5KYYB 2XIDA 4DBRA 3VS1A 4RKUE 1AZEA 1VQ5T 1BK2A 3CCVT 1W6XA 1VUBA 2E70A 1UJYA 4BI4A 2D8HA 1S72T 1M3CA 3VRZA 3SWNC 4LN2A 3VYHB 1D0XA 1UGPB 5IHNA 2AIRB 4EIKA 4BD3A 4F7UA 3I55Q 3OYCA 1YI2A 3JB9H 2HSEB 3EG2A 2A7YA 4F04B 3RMQA 1YIJQ 4JS5A 1AZGB 4RTUA 3OB9A 5KYUA 2QYZA 2W10A 4J9HA 1UE9A 3CCRA 3OYLA 1T3LA 4M7DC 4PKCC 4XTYA 4Z88A 2AT1B 1JXMA 4A53A 5IAYA 3NTIA 3CCET 1WIEA 4BI8B 4BE2A 4OMOA 1ZBXA 1K0XA 3OSVA 1G3YA 1IO6A 1I07A 3CC4A 1Y57A 4UC4A 1HK9A 3OYAA 4ZGEB 2RHZA 2HQXA 2QEXA 2KYBA 2NUPB 1WX6A 3M57A 2FPEA 2MOXA 4CI0C 2DZCA 4MDXA 3OA6A 1NBEB 1V29B 1SRMA 4ORZA 3GLXA 4IIOA 5GAN6 3PVQA 3M0SA 4JRIA 4M7AB 1TU0B 2MYSA 4LD6A 4RCCA 4M78G 3UA6A 2AZVA 1RAGB 3HP9A 1HXDA 3RBBB 2DERA 5GANd 5LJ3g 2ABLA 3S6WA 2RN8A 2COZA 1J3TA 1X01A 4FYVB 4A4EA 3PFSA 2RQVA 1ZA2B 3E2UA 5GAN5 1UECA 5GAN7 1PM3A 1M3AA 1JU5C 4DEYA 1Q82R 1NEBA 5A0GA 3I56Q 2DYIA 3JB9G 2OAWA 4OMMA 1KHIA 2DIGA 1K1ZA 1OEBA 1ZSZA 1YI2T 3EG9A 5J3BA 3FC3A 4E6RA 3VS2A 1LCKA 1YITT 1X6OA 1NPRA 2OI3A 4LDXA 1RADB 3E19A 3M5AA 2AKLA 1QVGP 1RL2A 5I2SA 4RTWA 1ZHIA 4OP0A 1Q81R 4A63B 5LJ5g 3J80E 3CCMA 1PCXA 1UEBA 4M77G 3OBYA 4XU0A 3CCJT 3CCRT 1UTIA 5J26A 1N9SA 2CYZB 3F70A 5FWCA 4V2SA 4B6MA 4VUBA 4A4FA 2MWOA 1VQLQ 1R8OB 1WHLA 3HFOA 4J7FA 3TSWA 2BE7D 3CC4T 1FX7A 4RG8A 4C0ZA 1SKUB 2EFIA 3QYGB 4QQ6A 1Q82C 3V8KA 2DE0X 2QEXT 1VQ8Q 1GRIA 1K8AC 1S72Q 2JS0A 1RAFB 2DZ9A 1TUCA 2RMOA 3FRNA 2IIMA 1G2BA 1D0YA 2QXFA 3GOXA 3RESA 2FRYA 1D1BA 3OYKA 2ZPIB 5CKBA 1TG0A 3I5SA 1UB4A 1BIAA 1WNLA 4QQDA 1BCMA 5KYUB 1AT1B 3ZL7C 1EFNA 1WHMA 2YUOA 3G4SA 5CR2A 3PTAA 2DD5A 2BZXA 1QKXA 3OS0A 4B9WA 2ZGWA 1KD1U 1OPLA 2LCSA 2HBWA 1YN8A 2ROTA 1KC8R 4HT9A 1SF9A 1K4US 2LP5A 5I22A 1TUDA 4M7DD 5LJ3d 2YHTA 1Q7YC 3CXCP 5CAIA 4JLIA 2DF6A 5J39A 4AFSC 5FU6C 2QDLA 3CCQT 1I0CA 1VYVA 4LE9A 2GCXA 4X34A 5HK0A 3QO3A 3EH2A 4LUEA 2E5QA 1CKAA 3SWNA 1YFNA 4M7AG 1YJ9A 3JCMf 3MEWA 2HL3A 5AT1B 4IUUA 1NJIC 4KH0B 3PNWC 1KSWA 1OU8A 3JCMJ 3CBOA 2DRKA 4Q5WA 2OX7A 1GBQA 3E1SA 2L89A 2JUFA 1N9RA 4E7ZA 3QWXX 2K2MA 1KC8C 1PG5B 2CP0A 2FO0A 2QGGA 2KRNA 4NOYA 4WF2A 1R0CB 5LJ5d 3QPHA 2JOYA 1TSFA 1ZX6A 1R77A 1QQJA 3RR6A 2XDDA 2LJ0A 1BCOA 2K5LA 4F14A 3OYHA 5C6SA 3RKYA 1WXUA 4C5HA 3CC7Q 1VQ6A 1ZSZB 3SB2A 4C0DB 4RUGA 3P8HA 1YI2Q 3QIIA 1B3QA 3OYEA 1BKBA 1M27C 5KYNA 1RABB 4L5GA 1RLPC 1KG1A 4NS5A 4KGXB 3KUFA 2GTJA 4R55A 3AT1B 3O8VA 3IQLA 3SFMA 5I21A 1H92A 1XOVA 3CCRQ 2HBPA 2OTLA 1UGQB 3CPFA 3OW2S 1JJ2A 3ER0A 1MNEA 2F2VA 2EKHA 2CREA 1D3BA 1K76A 3V8LA 4LUDA 2NYSA 4FYYB 3QJ6A 1TUGB 3HHTB 2JT4A 3LYIA 4OVAA 1U1TA 3CMET 2QEXQ 1DJ7B 2EQJA 3A5ZB 2H8HA 4JJDA 4LDWA 5I2MA 3L2VA 5FU7C 2KVQG 2VV5A 2MK5A 3VS5A 1YJ9T 2ROLA 2K7AA 1PKTA 1G83A 4EMHA 5HY6A 3H8ZA 5KYXA 2CT3A 5HK3A 1OZ2A 2JMCA 5GAOq 1BBZA 2CP6A 3CCSA 2EYXA 3M55A 4RTXA 1OI1A 1UHFA 1A0NB 2E3IA 4FW1A 2L3SA 2CUBA 3MJXA 1LJOA 1W70A 3UF4A 3PMIA 4PJOD 3OYMA 4R0KA 2VASA 3G6EA 1E7OA 3J7AF 5CO7A 1X2QA 1H8KA 2DL4A 2ED1A 2EYWA 4BY6B 4XU1A 2FHDA 4FT2A 1K73U 2M02A 2VVKA 2FG0A 2ZCFB 1FXXA 3HL8A 2EIFA 3NMZC 1QW1A 1XTDA 2KSSA 1X27A 5LL6S 3QDRB 1GBRA 1VYTA 1M90U 3A8LB 1LOJA 3SWNB 1GFCA 1FMKA 2PUKB 1VQ5A 1X2KA 2E6NA 3QUIA 5IHKA 4M75D 1PKSA 3CCVA 1JO8A 3MCAB 2NUPA 3CCMQ 1HSQA 2BZ8A 2O31A 3WVDB 2YLCA 1PRMC 4E7IA 2K3YA 1WQWA 1IXDA 4DQ2A 1BI3A 3CD6A 1OX8A 1FWZA 5KCOA 5FLXE 1Y0MA 2CS7A 2DMOA 3VU3C 2RK2A 2J6OA 2D8JA 2L8DA 1M30A 4C5IA 2AKKA 3H9NA 5KCHA 6AT1B 4BDZA 2A3LA 2V1RA 2EYYA 1Z9ZA 2WSCE 3M4GA 3JCMc 3CXCS 1XQHA 3LX7A 3MO8A 4M7DB 2DRMA 2KGTA 2O88A 3QHSA 4OB2B 2EBPA 4AFUC 3P8DA 2DKGA 4PJNA 4KGZB 1BB9A 3M53A 1MUZA 4J6XA 4D6WA 1GFDA 3JCMW 4Z02A 4AFZC 3CCEA 3JCMX 2DL3A 4M7DF 2RJDA 1NYGA 5C0MA 3CCST 3EFOB 2MF2A 2CP7A 2DTOA 3L2ZA 1HJDA 3PMTA 2O01E 3G4SQ 1FYNA 2C0OA 2EJGA 3CC2T 2Z0WA 1KQSP 2XHCA 4J9BA 1SSFA 4JRQA 1D3BB 1D0ZA 1M2VA 3HKSA 3QWYA 2FZCB 2O2OA 4D8DA 1UFFA 2A37A 2CP5A 2VGNA 4XTXA 2QQ9A 1YJNT 3X26B 4C92D 1WJQA 2KT8A 1SHFA 1SHGA 2HEQA 4ESRA 1WHKA 1NPPA 4J5YA 1TH7A 2AHJB 3RKWA 1YJ9Q 2JN0A 4AMCA 3CCUT 4Y91A 2FZGB 1GCPA 2RO0A 4LD9K 5KYXB 5I11A 1QVFS 3UDCA 1GL5A 3OYNA 1H641 3CD6T 4LDUA 3TU4K 1QVFA 3VS3A 2RB6A 3QG1A 5GMKi 3TCJA 4FIBA 1YITA 2HNIA 1WHJA 2KNBB 2FL7A 2HMAA 2E10A 1VQ9T 1ZUYA 4J7IA 2PU9B 4J9CA 4FSXA 4OGEA 1AEYA 4C8QD 2OAUA 3QZ5B 2J7IA 3CCJA 1GXIE 2P4RA 3A98A 1WHHA 2IVWA 2RQRA 5GAN2 4LDYA 2D0QB 3CPWP 4E7LA 3JB9I 1TTHB 1VQ6Q 3S3OA 5DY9A 1R0BG 3MP1A 2DXUA 2J05A 1KQ2A 3M59A 3VV0A 2YUNA 4M77E 4JRKA 5GAMe 2DBKA 4RTYA 2NWMA 2YRDA 1N27A 1Q86R 2V26A 1E6HA 3OQ5A 2OTLQ 1B7TA 1NYFA 2HSPA 2YWWA 2HCKA 3J81E 5GAMf 2EQUA 2HKQB 3VJPA 2PUOB 4QQGA 2EGAA 3MKDA 1YBYA 3LH0A 4M7DG 2M0OA 2QQBA 3EGDB 1VQMT 2RQTA 4JJBA 1P92A 1WDXA 2HDAA 1IHWA 4ZGJB 1QCNA 3QDFA 2LNVA 4EPCA 3MP8A 1YJWT 4PJOF 2M16A 3TSZA 3CQTA 2XDBA 3V7SA 1IGUA 5CKEA 3L2QA 5FU6B 3A8HB 3M0QA 3GBQA 4M77C 4BI3A 3E9GA 2YLBA 1X6BA 4F16A 2A08A 3CCSQ 1U8RA 2SEMA 1Q86C 4J9GA 3VRYA 4OB0B 2C06A 1C0MA 3CCQA 3RUXA 4IKFA 1B34A 4L6V5 4OGCA 4OMLA 1YHQT 2LMJA 3G6EQ 3X24B 4XTVA 4ZN3A 4ME7A 1AWWA 2HQEA 1M2VB 1YCSB 4M75F 1UGSB 4PJOE 2RNAA 1JEGA 1W2BP 1AWOA 1EZZB 2CZ0B 1OULA 1Q82U 2ZAEA 5GAN8 3JB9J 3GIBA 1K8AU 5LJ3e 3CBMA 2PTKA 2PNIA 3QSUA 2CT4A 1V76A 1I4K1 4M7AE 2LDMA 4MZMA 1TXQA 4RTZA 1VQ5Q 1MHNA 2GQIA 2CH4A 2RHXA 3CCVQ 3OMGA 2CSQA 2FEIA 2ESWA 4OF1A 2DFUA 2K3BA 4M75E 3EHQA 1KQSS 2EJ9A 3EG1A 2DL8A 2DVEA 4IUVA 2Y4XA 3EFSA 4HCKA 3NHNA 1RAIB 3SEMA 1WGSA 5A0DA 3RNJA 1Q81C 3WVEB 1IB8A 4PNOA 3H0IA 3JCMV 3JCMg 2LCCA 2OTJT 3C0CA 2DBMA 4PJOC 2CZ1B 2JTEA 1SRLA 4HVUA 4OB3B 5GAMh 2CP3A 2QTXA 3ZEHA 2KMTA 2CH4W 1KD1R 1Q7YU 2KY9A 2MI6A 1AHJB 2E3HA 4FT4A 1VQ4T 5IHIA 2JVVA 3L2RA 3TVTA 3BFMA 4FW2A 2V8IA 3N5BB 2RI5A 2MCNA 1Y07A 3QJYA 5FW9A 3I9QA 3V7RA 2GFAA 4N0AC 3CCEQ 1RAHB 4ZTFA 5GJWB 1SSHA 2LX7A 3TEEA 2YRCA 2VKNA 1VQ7A 2PVDB 4MMLA 4C92F 3CMAA 2LJ3A 5FU7B 3M0UA 2K57A 3HTRA 4WTOB 4M75C 1U3OA 1NJIU 1UUEA 3CMEA 4IIMA 3OYIA 1NE8A 4M78D 2CKKA 1I5OB 3HRUA 5FROA 3A1PA 1Z9QA 2O9SA 4BE0A 2GTOA 5DLQE 2RHIA 3KBGA 4PLIA 1IHVA 3VUBA 2WSEE 4DBHA 1LVKA 3JRZA 2VXEA 1I5LA 3CPWS 3BE3A 3EGXB 4KGVB 4HXJA 3OS2A 3LWHA 2F69A 1OZ3A 4F7UE 4C92E 2L2PA 2KXCA 2LRQA 3MEUA 2EYQA 4FYWB 5KYWB 2DJZA 1WA7A 3JB9D 2XG8D 5CK9A 4C0FA 4M7DA 1N6AA 2DD4A 1H3ZA 4A4GA 2KRSA 2P0PA 4C8QF 1WHGA 5LJ3h 4QW2A 3H6ZA 1PNJA 4DEXA 2P0QA 4ELYC 2DO3A 4E7SA 5EC7A 1NG2A 1M1KR 1B34B 2LTOA 4IUPA 3T9NA 2XDPA 4M77D 3GPLA 1YITQ 1VQNT 1N8RR 2HAXA 3OY9A 4JZ3A 3LWIA 3EFOA 4KT0E 1PSEA 4KUDK 1Y96B 1VIFA 3VYGA 2JMAA 3OS1A 3M58A 1NM7A 3CCJQ 4JS4A 4EDUA 3C12A 4C8QE 2FYKA 4GLKA 1ZLMA 3X20B 5GANj 4C92C 2JW4A 3JCMd 2XMFA 2H3JA 1T0JA 3OW2A 4A4HA 1PSFA 1VQKT 4PL6A 3CC4Q 2F5KA 2QG9B 1VQ7T 1B07A 3I35A 3CMAT 2COYA 1AOJA 2K2VA 4FYXB 1H3HA 2LVMA 2X9HA 2LC4A 3VUZA 4QKUA 1M1KC 4IUTA 2CUDA 4EMKC 5GAN3 4KULA 3G71A 3M0PA 2VXFA 2LQWA 1QVGS 2RK1A 1JRIA 3GNFB 1N8RC 2KXDA 4OMNA 2ECZA 5IXBA 2JJ9A 1OV3A 1W2BS 1K9MR 3DLLA 1KJWA 3PGGA 1ZQ1A 1VQOA 2K5IA 2VWFA 1GCQC 4X9CA 2E12A 2FZKB 5GAMj 2KI7A 2RPNA 1RACB 4C8QC 2M0YA 3X25B 2I0NA 5KH6A 2H3EB 5ECAA 4BB7A 4NL2A 3CC2A 4X1VA 2YUQA 7AT1B 5AYFA 1K73R 2BKDN 1T0HA 2DXCA 4MZTA 5EG2A 3M0RA 4HA8A 2P4TA 2EGEA 3I55T 3H41A 2DNUA 5CQYA 5FWBA 4JUVA 1BI0A 2OJ2A 1YJNA 2YUPA 4QVCA 3OBWA 4HCCA 4M7AD 2XI9A 1OU9A 4A54A 1MV3A 1W4SA 3CCQQ 4ATOA 2QASA 1ZUKA 2GFUA 2LJ1A 1C6VX 3BW1A 3RIRA 1K9MC 3KXTA 2EQMA 2RJCA 4IUQA 5DM7R 3JCMb 1OPKA 1M8MA 2F2XA 4TVRA 3THKA 4KBMB 3CCUA 5IT9E 1YWOA 2ZPBB 5HCKA 4E7JA 2DLPA 2RH2A 2E1HA 1WJRA 1BI1A 4PJOA 4HCZA 1ZSZC 4HCBA 2FB7A 2B86A 2O9VA 5L23A 1ZA1B 2PVOB 4XU3A 2L3QA 1UGRB 2RHYA 2CSIA 1WXTA 2MMPA 1PWTA 4OMFB 1VQ9A 3R6OA 2LT4A 4JLGA 4J83A 1SG5A 3EGDA 3V8JA 1IGQA 1E6GA 2E64A 3CXCA 1G5VA 3UWNA 1MV0B 5D6WA 2R5MA 3G71T 4N0AA 4E47A 3EGUA 5LJ3j 3VS6A 4A4KA 2V1QA 3LH5A 2EW3A 4KUIA 1I8FA 3CCLA 3NTKA 2EPDA 4M75A 1VQOT 1TS9A 1BYMA 2HZYA 1QKWA 5CCAA 3C94A 3LGFA 2KK4A 2LNHB 3S3NA 4RTTA 1AD5A 1XNIA 4XK8E 4X9DA 4M78F 2K3XA 3TQ7P 4C5EA 1QLYA 1OYXA 4N4IA 1G3WA 2MIOA 3I56T 4J9IA 2DILA 1AWJA 8ATCB 2KYMA 3BY7A 4N4GA 1KFZA 2KE9A 4ZNXA 2LX9A 4YTLA 2NLUA 5LJ5j 2RQWA 1VQMA 3ZBDA 3CMAQ 2RF0A 2A0FB 2IG0A 2JM8A 3CMEQ 2LT1A 2E6ZA 1X69A 1YJWA 1WJSA 1PD1A 4O6JA 2QQAA 5L8RE 1EIFA 3L42A 4M77B 1UHCA 3PIPA 2BE9B 4O5VA 1IREB 3M0TA 2KQWA 4M78E 1M9SA 4NL3A 2EWNA 3HPWA 2D0NA 2ZZDA 2B8AA 2X4JA 3DB3A 2WSFE 4J6YA 2ZPEB 1G8XA 5GMKj 3MEVA 3FJPA 1JQQA 2L3PA 4JDSA 2C0IA 2K4YA 2JS2A 3REBB 1YNZA 5GANe 3WXMB 2DA9A 2RI3A 1PC0A 4M77F 2QAZA 1VQ8T 3LGLA 3HRSA 3ULRB 1AWXA 1NLOC 1NEGA 3VS4A 4ANJA 4RTVA 5HKCA 5GAMg 4R56A 2Y4YA 1VQPA 1YHQA 2ATCB 3PT9A 2KAFA 1QVPA 5GANf 5D6XA 1RAAB 3CC7A 1D1AA 3FEOA 2CDTA 2K9GA 4KRTA 4PLLA 4C92A 1BIBA 3M56A 3ME9A 1YP5A 3OYDA 2DL5A 2KT1A 5CQXA 3CCLT 4LNPA 3BDUA 3OMCA 2DEQA 2GNCA 4JJNK 4N4HA 4FL6A 4M78C 3MP6A 4PJMA 3HRTA 1WYXA 2FPFA 4Y92A 4EMKA 1UGVA 3QBYA 2W0ZA 2X3WD 3A8GB 1YCYA 5A2QE 2M9UA 3QXEB 9ATCB 2JTFA 2DAQA 4PJOB 2QI2A 4J9EA 4D8KA 2G6FX 1GCQA 1YWPA 4K11A 4PJLA 3OYYA 1NZ9A 3FB9A 2J06A 3VKIA 1RAEB 1MMGA 2OTJA 4C8QA 3R6NA 4PFPA 1ABOA 1PD0A 1VIEA 1MNDA 4JRPA 2DJQA 3EGXA 2VGMA 1QP3A 4P5NA 2HKNA 2XICA 3EH1A 2MWPA 1Q86U 2R5AA 2R57A 3G71Q 1VQ4A 1KQ1A 4RG2A 2JTMA 1HD3A 1N5ZA 5KYWA 1AVZC 4AT1B 1QWFA 3LLRA 2DYBA 1Q95G 2RJEA 3M9QA 4M75B 1FMVA 4DBFA 4J6WA 3EG3A 2QQRA 4GBQA 1VQOQ 1JJ2P 2LCLA 1Y71A 4ZTJA 3S3MA 5KE2A 1M1FA 4M7AF 5GJVB 3EAEA 1U1SA 2BIVA 2A36A 4HVWA 3OYFA 3OW2P 3URGA 5IN1A 2RJFA 1M5Q1 1NLPC 4CC4B 3CC2Q 1VQPT 4E7HA 3JSCA 2DEUA 3GF5A 2DK3A 2X4YA 1M8VA 1Y96A 1MGQA 3CC7T 3SDZA 2EQIA 2O4XA 1K8AR 2DPPB 1YJNQ 5GANh 2JZ2A 3TREA 3DB4A 5CVIA 1KIKA 4MDWA 2GGRA 3KFVA 2QA4A 5GAMd 4JZ4A 1UDLA 2R58A 1V1CA 4LXCA 1Q81U 5LJ3f 1OX9A 4ELZC 4J9DA 3X28B 3G7ZA 3CCUQ 4MMKA 2L0AA 2VYTA 3H0HA 3P8BB 2COWA 1RLQC 4CC2A 4EMGA 1MMAA 3E9FA 3Q1JA 2X3XD 2HL5C 3CD6Q 3RERA 2VB6A 2XKOC 3JCMQ 1PHTA 1UJ0A 1KQSA 5FRNA 4PK4A 1X43A 4J8OA 1VQNA 1X75C 1ARKA 1Q7YR 4KH1B 1VQ9Q 4GY5A 1W1FA 3DLMA 3JAME 1Y7XA 3ZFJA 5LJ5e 1D09B 1QMCA 4F7UB 4C92B 5GAOn 2F1LA 2EGCA 4PFOA 4C5GA 4HT8A 3U23A 5LJ5f 4M7AC 3CCLQ 3M4YA 3FDRA 2F5TX 1NJIR 1VQKA 3NGPA 1CSKA 2LQKA 3ASKA 3QZ9B 4EMKB 1K9AA 3AHUA 2MAMA 3JCMP 4F7UF 2IPOB 5GMKe 3H0FA 2FPDA 1MMDA 4DOVA 3OYJA 2GF7A 1OOTA 2ZPHB 2D6FA 4CC3A 1U06A 4PJOG 4JJCA 2DM1A 2SRCA 1KC8U 4XTWA 3JCMe 4B9XA 4AG1C 1KD1C 4C8QB 4OMPA 1CKBA 4CC7A 1ZUUA 4J9FA 1JXOA 2DXBA 1VQMQ 2QA4T 3JV3A 3META 1QP2A 1ABQA 2K79A 3CPWA 1YJWQ 1HYOA 4F17A 3CCMT 3MPUB 3A8MB 2DXTA 3D7SB 5DLOA 3I55A 4M75G 3VS7A 2D9TA 1F1BB 3MEAA 2YT6A 2PVGB 2PQWA 2JM9A 2KROA 4M78A 2EJFA 4PJJA 1O9SA 1YIJA 3L2WA 2I2LA 4FM4B 1G3SA 2K6DA 4GLMA 1K0SA 5FRMA 4DA4A 1YHQQ 1M2OA 2RQUA 1IRXA 1VQPQ 4BACA 5CKHA 3PVLA 3C95A 2NUZA 2O4XB 1VA7A 3HSBA 5A0LA 1RI0A 2RM4A 3EG9B 1VOMA 1ZBJA 2AZSA 4OMQA 2KBTA 3PIOA 4CRIA 1M1KU 3UA7A 2HD0A 4C0GA 2QTVA 5IH2A 4L59A 4PFZA 2RA2A 1N8RU 3G4ST 1JJ2S 1WZOA 4WCIA 3EHRA 5LJ5h 1G3TA 2RI2A 1QVFP 2QQSA 2BTTA 5GAN4 2CZ7B 1FMWA 4LDVA 2LZ6B 1SPKA 2HQHA 2C0TA 3BDLA 2E65A 2YRVA 2KR3A 4XTUA 2EAYA 2XK0A 2ED0A 5GAOr 3NPFA 4M77A 5CIUA 2YSQA 3LW5E 2DVJA 1XJWB 2NUTA 3UT1A 1QVGA 2M51A 4QVZA 4M4ZA 3CEYA 5GMKh 2OTJQ 4MZPA 5M9OA 1ZSGA 2BUDA 4HKEA 1W2BA 2EYZA 5KYYA 3UPUA 2XU8A 3HFNA 3C4SA 3SHWA 4XU2A 2X35A 3FJ5A 2QDYB 4F7UG 4C92G 2J6FA 2Y90A 2A28A 1WLPB 2DL7A 2RHUA 1M3BA 1VYUA 1VQ4Q 1S1NA 3RDVA 1RUWA 4FU6A 3QYHB 4QT7A 1BI2A 2P0KA 3RKXA 3JCMh 3I56A 1K9MU 1WFWA 3FLGA 2M1HA 1LPLA 2X4XA 1QCOA 4AFQC 2P84A 3NFCA 2CZ6B 4II1A 4ZGDB 5GAOl 2GBQA 3M54A 1WXBA 4Z89A 4DOWA 1M1GA 4HVVA 2L3RA 2EKOA 1M90R 1YIJT 4E7KA 3FIFA 4Y28E 4Z8AA 1WI7A 3VS0A 4DBQA 2BZYA 3EG0A 1D1CA 1MMNA 3A8OB 3MHXA 3OYBA 2CP2A 2JNGA 2DX1A 2MPXC 3I5RA 3OS5A 2PZ1A 1KK7A 5GMKl 1VQ6T 2FVUA 2JXBA 1VQLA 2ZPGB 4C8QG 1LNXA 4XQ3A 1QWEA 3UATA 4JPBW 4C0DC 1K73C 3RMSA 5CKDA 2QA4Q 1WPYA 1I1JA 4E2FB 4RCBA 2V8JA 2AK5A 2F2WA 2KEAA 2V8KA 1TWBA 1VQ8A 1ACMB 1S72A 2DETA 2J6KA 3REAB 2L5QA 1BU1A 2OTLT 2QK0A 4QVDA 1O75A
chains in the Genus database with same CATH topology
2K3BA 3EHQA 2GNCA 3EG1A 1RLPC 2DL8A 4HCKA 2GTJA 3NHNA 4Y92A 1WYXA 2FPFA 3SEMA 3RNJA 3IQLA 3PE0A 1H92A 1UGVA 1XOVA 3H0IA 1X6GA 2W0ZA 2X3WD 3C0CA 2DBMA 2F2VA 2JTEA 2EKHA 1SRLA 2EVRA 2CREA 4HVUA 1SEMA 1K76A 2CH4W 4J9EA 4D8KA 2G6FX 1GCQA 1UG1A 1YWPA 4LUDA 4K11A 2E5KA 2YDLA 2J06A 2JT4A 2KRMA 5IHIA 1T3SA 3TVTA 3R6NA 1ABOA 2MCNA 2DJQA 2H8HA 4JJDA 5FW9A 3I9QA 5GJWB 2ENMA 1SSHA 3O5ZA 3VS5A 2LX7A 5IXFA 1QCFA 2ROLA 2VKNA 2K7AA 1PKTA 1G83A 2LJ3A 1HD3A 1N5ZA 1PRLC 3M0UA 1AVZC 1RI9A 1U3OA 1UUEA 1U5SA 4AG2C 1QWFA 2CT3A 2DYBA 2JMCA 1BBZA 4IIMA 2EYXA 3EG3A 4RTXA 4GBQA 1UHFA 1A0NB 2LQNA 2L3SA 2CUBA 1Z9QA 2O9SA 2GTOA 5GJVB 1W70A 4FSSA 2A36A 4HVWA 3UF4A 4R0KA 1E7OA 1NLPC 4CC4B 1X2QA 1H8KA 2DL4A 2ED1A 2D1XA 2FRWA 2EYWA 4HXJA 3VS1A 1AZEA 2VVKA 2EQIA 2L2PA 2KXCA 1BK2A 2FG0A 1W6XA 1UJYA 1WA7A 3NMZC 2D8HA 1M3CA 3VRZA 2KRSA 1X27A 1GBRA 4LN2A 1KIKA 2GGRA 3KFVA 1VYTA 5IHNA 4JZ4A 4EIKA 1UDLA 1GFCA 1FMKA 1PNJA 1X2KA 1V1CA 4DEXA 5IHKA 1PKSA 1JO8A 5EC7A 3EG2A 1NG2A 4J9DA 1HSQA 2BZ8A 2O31A 1PRMC 2L0AA 3H0HA 4JZ3A 1AZGB 4RTUA 1RLQC 4CC2A 1Y0MA 2X3XD 2DMOA 2W10A 2J6OA 1UE9A 4J9HA 2D8JA 1M30A 1T3LA 2AKKA 2JMAA 1PHTA 1UJ0A 2V1RA 2EYYA 1NM7A 1Z9ZA 4Z88A 1X43A 1JXMA 2DRMA 2KGTA 1ARKA 2O88A 1ZLMA 1WIEA 1W1FA 4OMOA 1K0XA 2JW4A 1IO6A 1I07A 2EBPA 4AFUC 2XMFA 1T0JA 1Y57A 2EGCA 1BB9A 1MUZA 1B07A 2KYBA 3I35A 1GFDA 1WX6A 1AOJA 2FPEA 2MOXA 4AFZC 1H3HA 3U23A 2DL3A 1SRMA 4ORZA 4IIOA 2CUDA 1NYGA 3PVQA 3M0SA 3M0PA 2LQWA 3NGPA 1CSKA 1K9AA 2KXDA 4OMNA 2ECZA 1HJDA 5IXBA 3H0FA 1OV3A 3UA6A 2FPDA 2AZVA 1FYNA 1KJWA 2C0OA 3RBBB 1OOTA 4J9BA 2ABLA 2RN8A 2VWFA 4CC3A 1J3TA 1U06A 1GCQC 3QWYA 2RQVA 4JJCA 2DM1A 2O2OA 4D8DA 2SRCA 2RPNA 1UFFA 2A37A 1UECA 2M0YA 2I0NA 5ECAA 4X1VA 2YUQA 4AG1C 4OMPA 2KT8A 1SHFA 1M3AA 1CKBA 1T0HA 4CC7A 1ZUUA 4J9FA 1JU5C 1SHGA 4DEYA 2HEQA 1JXOA 3M0RA 1NEBA 2EGEA 3H41A 2DNUA 4ESRA 3JV3A 5FWBA 2OAWA 4OMMA 1ABQA 2K79A 1K1ZA 1OEBA 4F17A 2OJ2A 2YUPA 4E6RA 1GCPA 3VS2A 1LCKA 1MV3A 5I11A 2OI3A 1GL5A 2AKLA 1ZUKA 2LJ1A 4RTWA 3VS7A 2YT6A 4A63B 1OPKA 1M8MA 2F2XA 3THKA 3VS3A 2JM9A 2KROA 1UTIA 1YWOA 2KNBB 5HCKA 5FWCA 1ZUYA 2K6DA 2DLPA 4GLMA 1K0SA 4J9CA 2RQUA 1AEYA 3PVLA 3TSWA 2B86A 2J7IA 2O9VA 5L23A 2P4RA 2NUZA 3A98A 1VA7A 2L3QA 2RQRA 2CSIA 1WXTA 2DE0X 1PWTA 1ZBJA 2AZSA 4OMQA 2KBTA 1GRIA 2JS0A 1TUCA 2RMOA 1E6GA 3UA7A 2IIMA 2J05A 1G2BA 1MV0B 5IH2A 3EGUA 2YUNA 4WCIA 3VS6A 2V1QA 3EHRA 2EW3A 2FRYA 3LH5A 1TG0A 3I5SA 2BTTA 2DBKA 2LZ6B 1SPKA 4RTYA 2EPDA 2NWMA 2C0TA 1E6HA 1QKWA 1NYFA 2KR3A 3ZL7C 2HSPA 1EFNA 2HCKA 2YUOA 2LNHB 2ED0A 3NPFA 2YSQA 2BZXA 1QKXA 2DVJA 4RTTA 1AD5A 2EGAA 2M51A 4M4ZA 1OPLA 2LCSA 2HBWA 2RQTA 4JJBA 1WDXA 1YN8A 1QLYA 2HDAA 1ZSGA 2MIOA 2ROTA 2EYZA 1K4US 4J9IA 2LP5A 3SHWA 2DILA 5I22A 1TUDA 1AWJA 2KYMA 3FJ5A 2J6FA 1KFZA 2KE9A 2A28A 1WLPB 2DF6A 4ZNXA 3TSZA 2DL7A 4AFSC 1M3BA 2QDLA 1VYUA 3CQTA 1I0CA 1S1NA 2RQWA 1VYVA 4LE9A 2RF0A 1RUWA 4QT7A 2JM8A 3M0QA 4LUEA 1WFWA 3GBQA 1X69A 1CKAA 4AFQC 1X6BA 4F16A 2A08A 2SEMA 2GBQA 4J9GA 1UHCA 3VRYA 1WXBA 3M0TA 4Z89A 4HVVA 1KSWA 4OMLA 2D0NA 2DRKA 1WI7A 4Z8AA 2LMJA 3VS0A 1GBQA 2BZYA 3EG0A 1AWWA 1JQQA 1YCSB 3QWXX 2RNAA 2L3PA 1JEGA 2K2MA 2C0IA 1AWOA 2DX1A 2JS2A 3REBB 3I5RA 1YNZA 2FO0A 2DA9A 2KRNA 2PZ1A 2JXBA 3ULRB 1AWXA 1NLOC 1NEGA 1ZX6A 3VS4A 4RTVA 2PTKA 1QWEA 3UATA 4JPBW 2LJ0A 2PNIA 2CDTA 4F14A 2CT4A 2K9GA 4KRTA 1I1JA 1WXUA 2AK5A 1YP5A 2F2WA 2DL5A 2KEAA 4RTZA 2KT1A 4RUGA 1B3QA 2GQIA 1M27C 2CH4A 4LNPA 2J6KA 2CSQA 3REAB 1BU1A 2FEIA 2ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3B A;  3EHQ A;  2GNC A;  3EG1 A;  1RLP C;  2DL8 A;  4HCK A;  2GTJ A;  3NHN A;  4Y92 A;  1WYX A;  2FPF A;  3SEM A;  3RNJ A;  3IQL A;  3PE0 A;  1H92 A;  1UGV A;  1XOV A;  3H0I A;  1X6G A;  2W0Z A;  2X3W D;  3C0C A;  2DBM A;  2F2V A;  2JTE A;  2EKH A;  1SRL A;  2EVR A;  2CRE A;  4HVU A;  1SEM A;  1K76 A;  2CH4 W;  4J9E A;  4D8K A;  2G6F X;  1GCQ A;  1UG1 A;  1YWP A;  4LUD A;  4K11 A;  2E5K A;  2YDL A;  2J06 A;  2JT4 A;  2KRM A;  5IHI A;  1T3S A;  3TVT A;  3R6N A;  1ABO A;  2MCN A;  2DJQ A;  2H8H A;  4JJD A;  5FW9 A;  3I9Q A;  5GJW B;  2ENM A;  1SSH A;  3O5Z A;  3VS5 A;  2LX7 A;  5IXF A;  1QCF A;  2ROL A;  2VKN A;  2K7A A;  1PKT A;  1G83 A;  2LJ3 A;  1HD3 A;  1N5Z A;  1PRL C;  3M0U A;  1AVZ C;  1RI9 A;  1U3O A;  1UUE A;  1U5S A;  4AG2 C;  1QWF A;  2CT3 A;  2DYB A;  2JMC A;  1BBZ A;  4IIM A;  2EYX A;  3EG3 A;  4RTX A;  4GBQ A;  1UHF A;  1A0N B;  2LQN A;  2L3S A;  2CUB A;  1Z9Q A;  2O9S A;  2GTO A;  5GJV B;  1W70 A;  4FSS A;  2A36 A;  4HVW A;  3UF4 A;  4R0K A;  1E7O A;  1NLP C;  4CC4 B;  1X2Q A;  1H8K A;  2DL4 A;  2ED1 A;  2D1X A;  2FRW A;  2EYW A;  4HXJ A;  3VS1 A;  1AZE A;  2VVK A;  2EQI A;  2L2P A;  2KXC A;  1BK2 A;  2FG0 A;  1W6X A;  1UJY A;  1WA7 A;  3NMZ C;  2D8H A;  1M3C A;  3VRZ A;  2KRS A;  1X27 A;  1GBR A;  4LN2 A;  1KIK A;  2GGR A;  3KFV A;  1VYT A;  5IHN A;  4JZ4 A;  4EIK A;  1UDL A;  1GFC A;  1FMK A;  1PNJ A;  1X2K A;  1V1C A;  4DEX A;  5IHK A;  1PKS A;  1JO8 A;  5EC7 A;  3EG2 A;  1NG2 A;  4J9D A;  1HSQ A;  2BZ8 A;  2O31 A;  1PRM C;  2L0A A;  3H0H A;  4JZ3 A;  1AZG B;  4RTU A;  1RLQ C;  4CC2 A;  1Y0M A;  2X3X D;  2DMO A;  2W10 A;  2J6O A;  1UE9 A;  4J9H A;  2D8J A;  1M30 A;  1T3L A;  2AKK A;  2JMA A;  1PHT A;  1UJ0 A;  2V1R A;  2EYY A;  1NM7 A;  1Z9Z A;  4Z88 A;  1X43 A;  1JXM A;  2DRM A;  2KGT A;  1ARK A;  2O88 A;  1ZLM A;  1WIE A;  1W1F A;  4OMO A;  1K0X A;  2JW4 A;  1IO6 A;  1I07 A;  2EBP A;  4AFU C;  2XMF A;  1T0J A;  1Y57 A;  2EGC A;  1BB9 A;  1MUZ A;  1B07 A;  2KYB A;  3I35 A;  1GFD A;  1WX6 A;  1AOJ A;  2FPE A;  2MOX A;  4AFZ C;  1H3H A;  3U23 A;  2DL3 A;  1SRM A;  4ORZ A;  4IIO A;  2CUD A;  1NYG A;  3PVQ A;  3M0S A;  3M0P A;  2LQW A;  3NGP A;  1CSK A;  1K9A A;  2KXD A;  4OMN A;  2ECZ A;  1HJD A;  5IXB A;  3H0F A;  1OV3 A;  3UA6 A;  2FPD A;  2AZV A;  1FYN A;  1KJW A;  2C0O A;  3RBB B;  1OOT A;  4J9B A;  2ABL A;  2RN8 A;  2VWF A;  4CC3 A;  1J3T A;  1U06 A;  1GCQ C;  3QWY A;  2RQV A;  4JJC A;  2DM1 A;  2O2O A;  4D8D A;  2SRC A;  2RPN A;  1UFF A;  2A37 A;  1UEC A;  2M0Y A;  2I0N A;  5ECA A;  4X1V A;  2YUQ A;  4AG1 C;  4OMP A;  2KT8 A;  1SHF A;  1M3A A;  1CKB A;  1T0H A;  4CC7 A;  1ZUU A;  4J9F A;  1JU5 C;  1SHG A;  4DEY A;  2HEQ A;  1JXO A;  3M0R A;  1NEB A;  2EGE A;  3H41 A;  2DNU A;  4ESR A;  3JV3 A;  5FWB A;  2OAW A;  4OMM A;  1ABQ A;  2K79 A;  1K1Z A;  1OEB A;  4F17 A;  2OJ2 A;  2YUP A;  4E6R A;  1GCP A;  3VS2 A;  1LCK A;  1MV3 A;  5I11 A;  2OI3 A;  1GL5 A;  2AKL A;  1ZUK A;  2LJ1 A;  4RTW A;  3VS7 A;  2YT6 A;  4A63 B;  1OPK A;  1M8M A;  2F2X A;  3THK A;  3VS3 A;  2JM9 A;  2KRO A;  1UTI A;  1YWO A;  2KNB B;  5HCK A;  5FWC A;  1ZUY A;  2K6D A;  2DLP A;  4GLM A;  1K0S A;  4J9C A;  2RQU A;  1AEY A;  3PVL A;  3TSW A;  2B86 A;  2J7I A;  2O9V A;  5L23 A;  2P4R A;  2NUZ A;  3A98 A;  1VA7 A;  2L3Q A;  2RQR A;  2CSI A;  1WXT A;  2DE0 X;  1PWT A;  1ZBJ A;  2AZS A;  4OMQ A;  2KBT A;  1GRI A;  2JS0 A;  1TUC A;  2RMO A;  1E6G A;  3UA7 A;  2IIM A;  2J05 A;  1G2B A;  1MV0 B;  5IH2 A;  3EGU A;  2YUN A;  4WCI A;  3VS6 A;  2V1Q A;  3EHR A;  2EW3 A;  2FRY A;  3LH5 A;  1TG0 A;  3I5S A;  2BTT A;  2DBK A;  2LZ6 B;  1SPK A;  4RTY A;  2EPD A;  2NWM A;  2C0T A;  1E6H A;  1QKW A;  1NYF A;  2KR3 A;  3ZL7 C;  2HSP A;  1EFN A;  2HCK A;  2YUO A;  2LNH B;  2ED0 A;  3NPF A;  2YSQ A;  2BZX A;  1QKX A;  2DVJ A;  4RTT A;  1AD5 A;  2EGA A;  2M51 A;  4M4Z A;  1OPL A;  2LCS A;  2HBW A;  2RQT A;  4JJB A;  1WDX A;  1YN8 A;  1QLY A;  2HDA A;  1ZSG A;  2MIO A;  2ROT A;  2EYZ A;  1K4U S;  4J9I A;  2LP5 A;  3SHW A;  2DIL A;  5I22 A;  1TUD A;  1AWJ A;  2KYM A;  3FJ5 A;  2J6F A;  1KFZ A;  2KE9 A;  2A28 A;  1WLP B;  2DF6 A;  4ZNX A;  3TSZ A;  2DL7 A;  4AFS C;  1M3B A;  2QDL A;  1VYU A;  3CQT A;  1I0C A;  1S1N A;  2RQW A;  1VYV A;  4LE9 A;  2RF0 A;  1RUW A;  4QT7 A;  2JM8 A;  3M0Q A;  4LUE A;  1WFW A;  3GBQ A;  1X69 A;  1CKA A;  4AFQ C;  1X6B A;  4F16 A;  2A08 A;  2SEM A;  2GBQ A;  4J9G A;  1UHC A;  3VRY A;  1WXB A;  3M0T A;  4Z89 A;  4HVV A;  1KSW A;  4OML A;  2D0N A;  2DRK A;  1WI7 A;  4Z8A A;  2LMJ A;  3VS0 A;  1GBQ A;  2BZY A;  3EG0 A;  1AWW A;  1JQQ A;  1YCS B;  3QWX X;  2RNA A;  2L3P A;  1JEG A;  2K2M A;  2C0I A;  1AWO A;  2DX1 A;  2JS2 A;  3REB B;  3I5R A;  1YNZ A;  2FO0 A;  2DA9 A;  2KRN A;  2PZ1 A;  2JXB A;  3ULR B;  1AWX A;  1NLO C;  1NEG A;  1ZX6 A;  3VS4 A;  4RTV A;  2PTK A;  1QWE A;  3UAT A;  4JPB W;  2LJ0 A;  2PNI A;  2CDT A;  4F14 A;  2CT4 A;  2K9G A;  4KRT A;  1I1J A;  1WXU A;  2AK5 A;  1YP5 A;  2F2W A;  2DL5 A;  2KEA A;  4RTZ A;  2KT1 A;  4RUG A;  1B3Q A;  2GQI A;  1M27 C;  2CH4 A;  4LNP A;  2J6K A;  2CSQ A;  3REA B;  1BU1 A;  2FEI A;  2ESW A; 
#chains in the Genus database with same CATH topology
 5GAO m;  1M90 C;  4M7A A;  5D6Y A;  3QKJ A;  2VUB A;  4BE1 A;  4M78 B;  2X51 A;  3PE0 A;  4OB1 B;  1X6G A;  4FCY A;  4RMO A;  1WQ7 A;  3GNG A;  2EVR A;  1VQN Q;  2KDS A;  1SEM A;  8AT1 B;  5GMK m;  2QGF B;  1UG1 A;  2DTI A;  2E5K A;  3OSS C;  2YDL A;  2YXY A;  3DKM A;  4BUG A;  2KRM A;  1T3S A;  5CKF A;  3INZ A;  2VC8 A;  1TOV A;  3L1A A;  3NTH A;  3OYG A;  2WAC A;  1I81 A;  2ENM A;  1OQK A;  3CBP A;  3O5Z A;  3L2U A;  5IXF A;  5KE3 A;  1QCF A;  5GAN g;  1VQK Q;  1PRL C;  1RI9 A;  2DIQ A;  1U5S A;  4AG2 C;  1JB0 E;  2RD1 A;  1VQ7 Q;  4BDY A;  3SD4 A;  1EX4 A;  4XTZ A;  3G6E T;  4XAX B;  4ZN1 A;  1C1A A;  1JBM A;  1M4Z A;  2E4H A;  1KHC A;  2LQN A;  2EQK A;  3GP8 A;  4IUR A;  5D7U A;  3JB9 F;  2K5F A;  2DTH A;  2X4W A;  4FSS A;  1IZ6 A;  2ZPF B;  2GQV A;  2CGH A;  2NUT B;  3V7C A;  4BY6 C;  3G1J A;  2XD0 A;  1VQL T;  4M7D E;  3EFR A;  2G3R A;  2LQ8 A;  2E41 A;  5GAO p;  2D1X A;  2FRW A;  5KYY B;  2XID A;  4DBR A;  3VS1 A;  4RKU E;  1AZE A;  1VQ5 T;  1BK2 A;  3CCV T;  1W6X A;  1VUB A;  2E70 A;  1UJY A;  4BI4 A;  2D8H A;  1S72 T;  1M3C A;  3VRZ A;  3SWN C;  4LN2 A;  3VYH B;  1D0X A;  1UGP B;  5IHN A;  2AIR B;  4EIK A;  4BD3 A;  4F7U A;  3I55 Q;  3OYC A;  1YI2 A;  3JB9 H;  2HSE B;  3EG2 A;  2A7Y A;  4F04 B;  3RMQ A;  1YIJ Q;  4JS5 A;  1AZG B;  4RTU A;  3OB9 A;  5KYU A;  2QYZ A;  2W10 A;  4J9H A;  1UE9 A;  3CCR A;  3OYL A;  1T3L A;  4M7D C;  4PKC C;  4XTY A;  4Z88 A;  2AT1 B;  1JXM A;  4A53 A;  5IAY A;  3NTI A;  3CCE T;  1WIE A;  4BI8 B;  4BE2 A;  4OMO A;  1ZBX A;  1K0X A;  3OSV A;  1G3Y A;  1IO6 A;  1I07 A;  3CC4 A;  1Y57 A;  4UC4 A;  1HK9 A;  3OYA A;  4ZGE B;  2RHZ A;  2HQX A;  2QEX A;  2KYB A;  2NUP B;  1WX6 A;  3M57 A;  2FPE A;  2MOX A;  4CI0 C;  2DZC A;  4MDX A;  3OA6 A;  1NBE B;  1V29 B;  1SRM A;  4ORZ A;  3GLX A;  4IIO A;  5GAN 6;  3PVQ A;  3M0S A;  4JRI A;  4M7A B;  1TU0 B;  2MYS A;  4LD6 A;  4RCC A;  4M78 G;  3UA6 A;  2AZV A;  1RAG B;  3HP9 A;  1HXD A;  3RBB B;  2DER A;  5GAN d;  5LJ3 g;  2ABL A;  3S6W A;  2RN8 A;  2COZ A;  1J3T A;  1X01 A;  4FYV B;  4A4E A;  3PFS A;  2RQV A;  1ZA2 B;  3E2U A;  5GAN 5;  1UEC A;  5GAN 7;  1PM3 A;  1M3A A;  1JU5 C;  4DEY A;  1Q82 R;  1NEB A;  5A0G A;  3I56 Q;  2DYI A;  3JB9 G;  2OAW A;  4OMM A;  1KHI A;  2DIG A;  1K1Z A;  1OEB A;  1ZSZ A;  1YI2 T;  3EG9 A;  5J3B A;  3FC3 A;  4E6R A;  3VS2 A;  1LCK A;  1YIT T;  1X6O A;  1NPR A;  2OI3 A;  4LDX A;  1RAD B;  3E19 A;  3M5A A;  2AKL A;  1QVG P;  1RL2 A;  5I2S A;  4RTW A;  1ZHI A;  4OP0 A;  1Q81 R;  4A63 B;  5LJ5 g;  3J80 E;  3CCM A;  1PCX A;  1UEB A;  4M77 G;  3OBY A;  4XU0 A;  3CCJ T;  3CCR T;  1UTI A;  5J26 A;  1N9S A;  2CYZ B;  3F70 A;  5FWC A;  4V2S A;  4B6M A;  4VUB A;  4A4F A;  2MWO A;  1VQL Q;  1R8O B;  1WHL A;  3HFO A;  4J7F A;  3TSW A;  2BE7 D;  3CC4 T;  1FX7 A;  4RG8 A;  4C0Z A;  1SKU B;  2EFI A;  3QYG B;  4QQ6 A;  1Q82 C;  3V8K A;  2DE0 X;  2QEX T;  1VQ8 Q;  1GRI A;  1K8A C;  1S72 Q;  2JS0 A;  1RAF B;  2DZ9 A;  1TUC A;  2RMO A;  3FRN A;  2IIM A;  1G2B A;  1D0Y A;  2QXF A;  3GOX A;  3RES A;  2FRY A;  1D1B A;  3OYK A;  2ZPI B;  5CKB A;  1TG0 A;  3I5S A;  1UB4 A;  1BIA A;  1WNL A;  4QQD A;  1BCM A;  5KYU B;  1AT1 B;  3ZL7 C;  1EFN A;  1WHM A;  2YUO A;  3G4S A;  5CR2 A;  3PTA A;  2DD5 A;  2BZX A;  1QKX A;  3OS0 A;  4B9W A;  2ZGW A;  1KD1 U;  1OPL A;  2LCS A;  2HBW A;  1YN8 A;  2ROT A;  1KC8 R;  4HT9 A;  1SF9 A;  1K4U S;  2LP5 A;  5I22 A;  1TUD A;  4M7D D;  5LJ3 d;  2YHT A;  1Q7Y C;  3CXC P;  5CAI A;  4JLI A;  2DF6 A;  5J39 A;  4AFS C;  5FU6 C;  2QDL A;  3CCQ T;  1I0C A;  1VYV A;  4LE9 A;  2GCX A;  4X34 A;  5HK0 A;  3QO3 A;  3EH2 A;  4LUE A;  2E5Q A;  1CKA A;  3SWN A;  1YFN A;  4M7A G;  1YJ9 A;  3JCM f;  3MEW A;  2HL3 A;  5AT1 B;  4IUU A;  1NJI C;  4KH0 B;  3PNW C;  1KSW A;  1OU8 A;  3JCM J;  3CBO A;  2DRK A;  4Q5W A;  2OX7 A;  1GBQ A;  3E1S A;  2L89 A;  2JUF A;  1N9R A;  4E7Z A;  3QWX X;  2K2M A;  1KC8 C;  1PG5 B;  2CP0 A;  2FO0 A;  2QGG A;  2KRN A;  4NOY A;  4WF2 A;  1R0C B;  5LJ5 d;  3QPH A;  2JOY A;  1TSF A;  1ZX6 A;  1R77 A;  1QQJ A;  3RR6 A;  2XDD A;  2LJ0 A;  1BCO A;  2K5L A;  4F14 A;  3OYH A;  5C6S A;  3RKY A;  1WXU A;  4C5H A;  3CC7 Q;  1VQ6 A;  1ZSZ B;  3SB2 A;  4C0D B;  4RUG A;  3P8H A;  1YI2 Q;  3QII A;  1B3Q A;  3OYE A;  1BKB A;  1M27 C;  5KYN A;  1RAB B;  4L5G A;  1RLP C;  1KG1 A;  4NS5 A;  4KGX B;  3KUF A;  2GTJ A;  4R55 A;  3AT1 B;  3O8V A;  3IQL A;  3SFM A;  5I21 A;  1H92 A;  1XOV A;  3CCR Q;  2HBP A;  2OTL A;  1UGQ B;  3CPF A;  3OW2 S;  1JJ2 A;  3ER0 A;  1MNE A;  2F2V A;  2EKH A;  2CRE A;  1D3B A;  1K76 A;  3V8L A;  4LUD A;  2NYS A;  4FYY B;  3QJ6 A;  1TUG B;  3HHT B;  2JT4 A;  3LYI A;  4OVA A;  1U1T A;  3CME T;  2QEX Q;  1DJ7 B;  2EQJ A;  3A5Z B;  2H8H A;  4JJD A;  4LDW A;  5I2M A;  3L2V A;  5FU7 C;  2KVQ G;  2VV5 A;  2MK5 A;  3VS5 A;  1YJ9 T;  2ROL A;  2K7A A;  1PKT A;  1G83 A;  4EMH A;  5HY6 A;  3H8Z A;  5KYX A;  2CT3 A;  5HK3 A;  1OZ2 A;  2JMC A;  5GAO q;  1BBZ A;  2CP6 A;  3CCS A;  2EYX A;  3M55 A;  4RTX A;  1OI1 A;  1UHF A;  1A0N B;  2E3I A;  4FW1 A;  2L3S A;  2CUB A;  3MJX A;  1LJO A;  1W70 A;  3UF4 A;  3PMI A;  4PJO D;  3OYM A;  4R0K A;  2VAS A;  3G6E A;  1E7O A;  3J7A F;  5CO7 A;  1X2Q A;  1H8K A;  2DL4 A;  2ED1 A;  2EYW A;  4BY6 B;  4XU1 A;  2FHD A;  4FT2 A;  1K73 U;  2M02 A;  2VVK A;  2FG0 A;  2ZCF B;  1FXX A;  3HL8 A;  2EIF A;  3NMZ C;  1QW1 A;  1XTD A;  2KSS A;  1X27 A;  5LL6 S;  3QDR B;  1GBR A;  1VYT A;  1M90 U;  3A8L B;  1LOJ A;  3SWN B;  1GFC A;  1FMK A;  2PUK B;  1VQ5 A;  1X2K A;  2E6N A;  3QUI A;  5IHK A;  4M75 D;  1PKS A;  3CCV A;  1JO8 A;  3MCA B;  2NUP A;  3CCM Q;  1HSQ A;  2BZ8 A;  2O31 A;  3WVD B;  2YLC A;  1PRM C;  4E7I A;  2K3Y A;  1WQW A;  1IXD A;  4DQ2 A;  1BI3 A;  3CD6 A;  1OX8 A;  1FWZ A;  5KCO A;  5FLX E;  1Y0M A;  2CS7 A;  2DMO A;  3VU3 C;  2RK2 A;  2J6O A;  2D8J A;  2L8D A;  1M30 A;  4C5I A;  2AKK A;  3H9N A;  5KCH A;  6AT1 B;  4BDZ A;  2A3L A;  2V1R A;  2EYY A;  1Z9Z A;  2WSC E;  3M4G A;  3JCM c;  3CXC S;  1XQH A;  3LX7 A;  3MO8 A;  4M7D B;  2DRM A;  2KGT A;  2O88 A;  3QHS A;  4OB2 B;  2EBP A;  4AFU C;  3P8D A;  2DKG A;  4PJN A;  4KGZ B;  1BB9 A;  3M53 A;  1MUZ A;  4J6X A;  4D6W A;  1GFD A;  3JCM W;  4Z02 A;  4AFZ C;  3CCE A;  3JCM X;  2DL3 A;  4M7D F;  2RJD A;  1NYG A;  5C0M A;  3CCS T;  3EFO B;  2MF2 A;  2CP7 A;  2DTO A;  3L2Z A;  1HJD A;  3PMT A;  2O01 E;  3G4S Q;  1FYN A;  2C0O A;  2EJG A;  3CC2 T;  2Z0W A;  1KQS P;  2XHC A;  4J9B A;  1SSF A;  4JRQ A;  1D3B B;  1D0Z A;  1M2V A;  3HKS A;  3QWY A;  2FZC B;  2O2O A;  4D8D A;  1UFF A;  2A37 A;  2CP5 A;  2VGN A;  4XTX A;  2QQ9 A;  1YJN T;  3X26 B;  4C92 D;  1WJQ A;  2KT8 A;  1SHF A;  1SHG A;  2HEQ A;  4ESR A;  1WHK A;  1NPP A;  4J5Y A;  1TH7 A;  2AHJ B;  3RKW A;  1YJ9 Q;  2JN0 A;  4AMC A;  3CCU T;  4Y91 A;  2FZG B;  1GCP A;  2RO0 A;  4LD9 K;  5KYX B;  5I11 A;  1QVF S;  3UDC A;  1GL5 A;  3OYN A;  1H64 1;  3CD6 T;  4LDU A;  3TU4 K;  1QVF A;  3VS3 A;  2RB6 A;  3QG1 A;  5GMK i;  3TCJ A;  4FIB A;  1YIT A;  2HNI A;  1WHJ A;  2KNB B;  2FL7 A;  2HMA A;  2E10 A;  1VQ9 T;  1ZUY A;  4J7I A;  2PU9 B;  4J9C A;  4FSX A;  4OGE A;  1AEY A;  4C8Q D;  2OAU A;  3QZ5 B;  2J7I A;  3CCJ A;  1GXI E;  2P4R A;  3A98 A;  1WHH A;  2IVW A;  2RQR A;  5GAN 2;  4LDY A;  2D0Q B;  3CPW P;  4E7L A;  3JB9 I;  1TTH B;  1VQ6 Q;  3S3O A;  5DY9 A;  1R0B G;  3MP1 A;  2DXU A;  2J05 A;  1KQ2 A;  3M59 A;  3VV0 A;  2YUN A;  4M77 E;  4JRK A;  5GAM e;  2DBK A;  4RTY A;  2NWM A;  2YRD A;  1N27 A;  1Q86 R;  2V26 A;  1E6H A;  3OQ5 A;  2OTL Q;  1B7T A;  1NYF A;  2HSP A;  2YWW A;  2HCK A;  3J81 E;  5GAM f;  2EQU A;  2HKQ B;  3VJP A;  2PUO B;  4QQG A;  2EGA A;  3MKD A;  1YBY A;  3LH0 A;  4M7D G;  2M0O A;  2QQB A;  3EGD B;  1VQM T;  2RQT A;  4JJB A;  1P92 A;  1WDX A;  2HDA A;  1IHW A;  4ZGJ B;  1QCN A;  3QDF A;  2LNV A;  4EPC A;  3MP8 A;  1YJW T;  4PJO F;  2M16 A;  3TSZ A;  3CQT A;  2XDB A;  3V7S A;  1IGU A;  5CKE A;  3L2Q A;  5FU6 B;  3A8H B;  3M0Q A;  3GBQ A;  4M77 C;  4BI3 A;  3E9G A;  2YLB A;  1X6B A;  4F16 A;  2A08 A;  3CCS Q;  1U8R A;  2SEM A;  1Q86 C;  4J9G A;  3VRY A;  4OB0 B;  2C06 A;  1C0M A;  3CCQ A;  3RUX A;  4IKF A;  1B34 A;  4L6V 5;  4OGC A;  4OML A;  1YHQ T;  2LMJ A;  3G6E Q;  3X24 B;  4XTV A;  4ZN3 A;  4ME7 A;  1AWW A;  2HQE A;  1M2V B;  1YCS B;  4M75 F;  1UGS B;  4PJO E;  2RNA A;  1JEG A;  1W2B P;  1AWO A;  1EZZ B;  2CZ0 B;  1OUL A;  1Q82 U;  2ZAE A;  5GAN 8;  3JB9 J;  3GIB A;  1K8A U;  5LJ3 e;  3CBM A;  2PTK A;  2PNI A;  3QSU A;  2CT4 A;  1V76 A;  1I4K 1;  4M7A E;  2LDM A;  4MZM A;  1TXQ A;  4RTZ A;  1VQ5 Q;  1MHN A;  2GQI A;  2CH4 A;  2RHX A;  3CCV Q;  3OMG A;  2CSQ A;  2FEI A;  2ESW A;  4OF1 A;  2DFU A;  2K3B A;  4M75 E;  3EHQ A;  1KQS S;  2EJ9 A;  3EG1 A;  2DL8 A;  2DVE A;  4IUV A;  2Y4X A;  3EFS A;  4HCK A;  3NHN A;  1RAI B;  3SEM A;  1WGS A;  5A0D A;  3RNJ A;  1Q81 C;  3WVE B;  1IB8 A;  4PNO A;  3H0I A;  3JCM V;  3JCM g;  2LCC A;  2OTJ T;  3C0C A;  2DBM A;  4PJO C;  2CZ1 B;  2JTE A;  1SRL A;  4HVU A;  4OB3 B;  5GAM h;  2CP3 A;  2QTX A;  3ZEH A;  2KMT A;  2CH4 W;  1KD1 R;  1Q7Y U;  2KY9 A;  2MI6 A;  1AHJ B;  2E3H A;  4FT4 A;  1VQ4 T;  5IHI A;  2JVV A;  3L2R A;  3TVT A;  3BFM A;  4FW2 A;  2V8I A;  3N5B B;  2RI5 A;  2MCN A;  1Y07 A;  3QJY A;  5FW9 A;  3I9Q A;  3V7R A;  2GFA A;  4N0A C;  3CCE Q;  1RAH B;  4ZTF A;  5GJW B;  1SSH A;  2LX7 A;  3TEE A;  2YRC A;  2VKN A;  1VQ7 A;  2PVD B;  4MML A;  4C92 F;  3CMA A;  2LJ3 A;  5FU7 B;  3M0U A;  2K57 A;  3HTR A;  4WTO B;  4M75 C;  1U3O A;  1NJI U;  1UUE A;  3CME A;  4IIM A;  3OYI A;  1NE8 A;  4M78 D;  2CKK A;  1I5O B;  3HRU A;  5FRO A;  3A1P A;  1Z9Q A;  2O9S A;  4BE0 A;  2GTO A;  5DLQ E;  2RHI A;  3KBG A;  4PLI A;  1IHV A;  3VUB A;  2WSE E;  4DBH A;  1LVK A;  3JRZ A;  2VXE A;  1I5L A;  3CPW S;  3BE3 A;  3EGX B;  4KGV B;  4HXJ A;  3OS2 A;  3LWH A;  2F69 A;  1OZ3 A;  4F7U E;  4C92 E;  2L2P A;  2KXC A;  2LRQ A;  3MEU A;  2EYQ A;  4FYW B;  5KYW B;  2DJZ A;  1WA7 A;  3JB9 D;  2XG8 D;  5CK9 A;  4C0F A;  4M7D A;  1N6A A;  2DD4 A;  1H3Z A;  4A4G A;  2KRS A;  2P0P A;  4C8Q F;  1WHG A;  5LJ3 h;  4QW2 A;  3H6Z A;  1PNJ A;  4DEX A;  2P0Q A;  4ELY C;  2DO3 A;  4E7S A;  5EC7 A;  1NG2 A;  1M1K R;  1B34 B;  2LTO A;  4IUP A;  3T9N A;  2XDP A;  4M77 D;  3GPL A;  1YIT Q;  1VQN T;  1N8R R;  2HAX A;  3OY9 A;  4JZ3 A;  3LWI A;  3EFO A;  4KT0 E;  1PSE A;  4KUD K;  1Y96 B;  1VIF A;  3VYG A;  2JMA A;  3OS1 A;  3M58 A;  1NM7 A;  3CCJ Q;  4JS4 A;  4EDU A;  3C12 A;  4C8Q E;  2FYK A;  4GLK A;  1ZLM A;  3X20 B;  5GAN j;  4C92 C;  2JW4 A;  3JCM d;  2XMF A;  2H3J A;  1T0J A;  3OW2 A;  4A4H A;  1PSF A;  1VQK T;  4PL6 A;  3CC4 Q;  2F5K A;  2QG9 B;  1VQ7 T;  1B07 A;  3I35 A;  3CMA T;  2COY A;  1AOJ A;  2K2V A;  4FYX B;  1H3H A;  2LVM A;  2X9H A;  2LC4 A;  3VUZ A;  4QKU A;  1M1K C;  4IUT A;  2CUD A;  4EMK C;  5GAN 3;  4KUL A;  3G71 A;  3M0P A;  2VXF A;  2LQW A;  1QVG S;  2RK1 A;  1JRI A;  3GNF B;  1N8R C;  2KXD A;  4OMN A;  2ECZ A;  5IXB A;  2JJ9 A;  1OV3 A;  1W2B S;  1K9M R;  3DLL A;  1KJW A;  3PGG A;  1ZQ1 A;  1VQO A;  2K5I A;  2VWF A;  1GCQ C;  4X9C A;  2E12 A;  2FZK B;  5GAM j;  2KI7 A;  2RPN A;  1RAC B;  4C8Q C;  2M0Y A;  3X25 B;  2I0N A;  5KH6 A;  2H3E B;  5ECA A;  4BB7 A;  4NL2 A;  3CC2 A;  4X1V A;  2YUQ A;  7AT1 B;  5AYF A;  1K73 R;  2BKD N;  1T0H A;  2DXC A;  4MZT A;  5EG2 A;  3M0R A;  4HA8 A;  2P4T A;  2EGE A;  3I55 T;  3H41 A;  2DNU A;  5CQY A;  5FWB A;  4JUV A;  1BI0 A;  2OJ2 A;  1YJN A;  2YUP A;  4QVC A;  3OBW A;  4HCC A;  4M7A D;  2XI9 A;  1OU9 A;  4A54 A;  1MV3 A;  1W4S A;  3CCQ Q;  4ATO A;  2QAS A;  1ZUK A;  2GFU A;  2LJ1 A;  1C6V X;  3BW1 A;  3RIR A;  1K9M C;  3KXT A;  2EQM A;  2RJC A;  4IUQ A;  5DM7 R;  3JCM b;  1OPK A;  1M8M A;  2F2X A;  4TVR A;  3THK A;  4KBM B;  3CCU A;  5IT9 E;  1YWO A;  2ZPB B;  5HCK A;  4E7J A;  2DLP A;  2RH2 A;  2E1H A;  1WJR A;  1BI1 A;  4PJO A;  4HCZ A;  1ZSZ C;  4HCB A;  2FB7 A;  2B86 A;  2O9V A;  5L23 A;  1ZA1 B;  2PVO B;  4XU3 A;  2L3Q A;  1UGR B;  2RHY A;  2CSI A;  1WXT A;  2MMP A;  1PWT A;  4OMF B;  1VQ9 A;  3R6O A;  2LT4 A;  4JLG A;  4J83 A;  1SG5 A;  3EGD A;  3V8J A;  1IGQ A;  1E6G A;  2E64 A;  3CXC A;  1G5V A;  3UWN A;  1MV0 B;  5D6W A;  2R5M A;  3G71 T;  4N0A A;  4E47 A;  3EGU A;  5LJ3 j;  3VS6 A;  4A4K A;  2V1Q A;  3LH5 A;  2EW3 A;  4KUI A;  1I8F A;  3CCL A;  3NTK A;  2EPD A;  4M75 A;  1VQO T;  1TS9 A;  1BYM A;  2HZY A;  1QKW A;  5CCA A;  3C94 A;  3LGF A;  2KK4 A;  2LNH B;  3S3N A;  4RTT A;  1AD5 A;  1XNI A;  4XK8 E;  4X9D A;  4M78 F;  2K3X A;  3TQ7 P;  4C5E A;  1QLY A;  1OYX A;  4N4I A;  1G3W A;  2MIO A;  3I56 T;  4J9I A;  2DIL A;  1AWJ A;  8ATC B;  2KYM A;  3BY7 A;  4N4G A;  1KFZ A;  2KE9 A;  4ZNX A;  2LX9 A;  4YTL A;  2NLU A;  5LJ5 j;  2RQW A;  1VQM A;  3ZBD A;  3CMA Q;  2RF0 A;  2A0F B;  2IG0 A;  2JM8 A;  3CME Q;  2LT1 A;  2E6Z A;  1X69 A;  1YJW A;  1WJS A;  1PD1 A;  4O6J A;  2QQA A;  5L8R E;  1EIF A;  3L42 A;  4M77 B;  1UHC A;  3PIP A;  2BE9 B;  4O5V A;  1IRE B;  3M0T A;  2KQW A;  4M78 E;  1M9S A;  4NL3 A;  2EWN A;  3HPW A;  2D0N A;  2ZZD A;  2B8A A;  2X4J A;  3DB3 A;  2WSF E;  4J6Y A;  2ZPE B;  1G8X A;  5GMK j;  3MEV A;  3FJP A;  1JQQ A;  2L3P A;  4JDS A;  2C0I A;  2K4Y A;  2JS2 A;  3REB B;  1YNZ A;  5GAN e;  3WXM B;  2DA9 A;  2RI3 A;  1PC0 A;  4M77 F;  2QAZ A;  1VQ8 T;  3LGL A;  3HRS A;  3ULR B;  1AWX A;  1NLO C;  1NEG A;  3VS4 A;  4ANJ A;  4RTV A;  5HKC A;  5GAM g;  4R56 A;  2Y4Y A;  1VQP A;  1YHQ A;  2ATC B;  3PT9 A;  2KAF A;  1QVP A;  5GAN f;  5D6X A;  1RAA B;  3CC7 A;  1D1A A;  3FEO A;  2CDT A;  2K9G A;  4KRT A;  4PLL A;  4C92 A;  1BIB A;  3M56 A;  3ME9 A;  1YP5 A;  3OYD A;  2DL5 A;  2KT1 A;  5CQX A;  3CCL T;  4LNP A;  3BDU A;  3OMC A;  2DEQ A;  2GNC A;  4JJN K;  4N4H A;  4FL6 A;  4M78 C;  3MP6 A;  4PJM A;  3HRT A;  1WYX A;  2FPF A;  4Y92 A;  4EMK A;  1UGV A;  3QBY A;  2W0Z A;  2X3W D;  3A8G B;  1YCY A;  5A2Q E;  2M9U A;  3QXE B;  9ATC B;  2JTF A;  2DAQ A;  4PJO B;  2QI2 A;  4J9E A;  4D8K A;  2G6F X;  1GCQ A;  1YWP A;  4K11 A;  4PJL A;  3OYY A;  1NZ9 A;  3FB9 A;  2J06 A;  3VKI A;  1RAE B;  1MMG A;  2OTJ A;  4C8Q A;  3R6N A;  4PFP A;  1ABO A;  1PD0 A;  1VIE A;  1MND A;  4JRP A;  2DJQ A;  3EGX A;  2VGM A;  1QP3 A;  4P5N A;  2HKN A;  2XIC A;  3EH1 A;  2MWP A;  1Q86 U;  2R5A A;  2R57 A;  3G71 Q;  1VQ4 A;  1KQ1 A;  4RG2 A;  2JTM A;  1HD3 A;  1N5Z A;  5KYW A;  1AVZ C;  4AT1 B;  1QWF A;  3LLR A;  2DYB A;  1Q95 G;  2RJE A;  3M9Q A;  4M75 B;  1FMV A;  4DBF A;  4J6W A;  3EG3 A;  2QQR A;  4GBQ A;  1VQO Q;  1JJ2 P;  2LCL A;  1Y71 A;  4ZTJ A;  3S3M A;  5KE2 A;  1M1F A;  4M7A F;  5GJV B;  3EAE A;  1U1S A;  2BIV A;  2A36 A;  4HVW A;  3OYF A;  3OW2 P;  3URG A;  5IN1 A;  2RJF A;  1M5Q 1;  1NLP C;  4CC4 B;  3CC2 Q;  1VQP T;  4E7H A;  3JSC A;  2DEU A;  3GF5 A;  2DK3 A;  2X4Y A;  1M8V A;  1Y96 A;  1MGQ A;  3CC7 T;  3SDZ A;  2EQI A;  2O4X A;  1K8A R;  2DPP B;  1YJN Q;  5GAN h;  2JZ2 A;  3TRE A;  3DB4 A;  5CVI A;  1KIK A;  4MDW A;  2GGR A;  3KFV A;  2QA4 A;  5GAM d;  4JZ4 A;  1UDL A;  2R58 A;  1V1C A;  4LXC A;  1Q81 U;  5LJ3 f;  1OX9 A;  4ELZ C;  4J9D A;  3X28 B;  3G7Z A;  3CCU Q;  4MMK A;  2L0A A;  2VYT A;  3H0H A;  3P8B B;  2COW A;  1RLQ C;  4CC2 A;  4EMG A;  1MMA A;  3E9F A;  3Q1J A;  2X3X D;  2HL5 C;  3CD6 Q;  3RER A;  2VB6 A;  2XKO C;  3JCM Q;  1PHT A;  1UJ0 A;  1KQS A;  5FRN A;  4PK4 A;  1X43 A;  4J8O A;  1VQN A;  1X75 C;  1ARK A;  1Q7Y R;  4KH1 B;  1VQ9 Q;  4GY5 A;  1W1F A;  3DLM A;  3JAM E;  1Y7X A;  3ZFJ A;  5LJ5 e;  1D09 B;  1QMC A;  4F7U B;  4C92 B;  5GAO n;  2F1L A;  2EGC A;  4PFO A;  4C5G A;  4HT8 A;  3U23 A;  5LJ5 f;  4M7A C;  3CCL Q;  3M4Y A;  3FDR A;  2F5T X;  1NJI R;  1VQK A;  3NGP A;  1CSK A;  2LQK A;  3ASK A;  3QZ9 B;  4EMK B;  1K9A A;  3AHU A;  2MAM A;  3JCM P;  4F7U F;  2IPO B;  5GMK e;  3H0F A;  2FPD A;  1MMD A;  4DOV A;  3OYJ A;  2GF7 A;  1OOT A;  2ZPH B;  2D6F A;  4CC3 A;  1U06 A;  4PJO G;  4JJC A;  2DM1 A;  2SRC A;  1KC8 U;  4XTW A;  3JCM e;  4B9X A;  4AG1 C;  1KD1 C;  4C8Q B;  4OMP A;  1CKB A;  4CC7 A;  1ZUU A;  4J9F A;  1JXO A;  2DXB A;  1VQM Q;  2QA4 T;  3JV3 A;  3MET A;  1QP2 A;  1ABQ A;  2K79 A;  3CPW A;  1YJW Q;  1HYO A;  4F17 A;  3CCM T;  3MPU B;  3A8M B;  2DXT A;  3D7S B;  5DLO A;  3I55 A;  4M75 G;  3VS7 A;  2D9T A;  1F1B B;  3MEA A;  2YT6 A;  2PVG B;  2PQW A;  2JM9 A;  2KRO A;  4M78 A;  2EJF A;  4PJJ A;  1O9S A;  1YIJ A;  3L2W A;  2I2L A;  4FM4 B;  1G3S A;  2K6D A;  4GLM A;  1K0S A;  5FRM A;  4DA4 A;  1YHQ Q;  1M2O A;  2RQU A;  1IRX A;  1VQP Q;  4BAC A;  5CKH A;  3PVL A;  3C95 A;  2NUZ A;  2O4X B;  1VA7 A;  3HSB A;  5A0L A;  1RI0 A;  2RM4 A;  3EG9 B;  1VOM A;  1ZBJ A;  2AZS A;  4OMQ A;  2KBT A;  3PIO A;  4CRI A;  1M1K U;  3UA7 A;  2HD0 A;  4C0G A;  2QTV A;  5IH2 A;  4L59 A;  4PFZ A;  2RA2 A;  1N8R U;  3G4S T;  1JJ2 S;  1WZO A;  4WCI A;  3EHR A;  5LJ5 h;  1G3T A;  2RI2 A;  1QVF P;  2QQS A;  2BTT A;  5GAN 4;  2CZ7 B;  1FMW A;  4LDV A;  2LZ6 B;  1SPK A;  2HQH A;  2C0T A;  3BDL A;  2E65 A;  2YRV A;  2KR3 A;  4XTU A;  2EAY A;  2XK0 A;  2ED0 A;  5GAO r;  3NPF A;  4M77 A;  5CIU A;  2YSQ A;  3LW5 E;  2DVJ A;  1XJW B;  2NUT A;  3UT1 A;  1QVG A;  2M51 A;  4QVZ A;  4M4Z A;  3CEY A;  5GMK h;  2OTJ Q;  4MZP A;  5M9O A;  1ZSG A;  2BUD A;  4HKE A;  1W2B A;  2EYZ A;  5KYY A;  3UPU A;  2XU8 A;  3HFN A;  3C4S A;  3SHW A;  4XU2 A;  2X35 A;  3FJ5 A;  2QDY B;  4F7U G;  4C92 G;  2J6F A;  2Y90 A;  2A28 A;  1WLP B;  2DL7 A;  2RHU A;  1M3B A;  1VYU A;  1VQ4 Q;  1S1N A;  3RDV A;  1RUW A;  4FU6 A;  3QYH B;  4QT7 A;  1BI2 A;  2P0K A;  3RKX A;  3JCM h;  3I56 A;  1K9M U;  1WFW A;  3FLG A;  2M1H A;  1LPL A;  2X4X A;  1QCO A;  4AFQ C;  2P84 A;  3NFC A;  2CZ6 B;  4II1 A;  4ZGD B;  5GAO l;  2GBQ A;  3M54 A;  1WXB A;  4Z89 A;  4DOW A;  1M1G A;  4HVV A;  2L3R A;  2EKO A;  1M90 R;  1YIJ T;  4E7K A;  3FIF A;  4Y28 E;  4Z8A A;  1WI7 A;  3VS0 A;  4DBQ A;  2BZY A;  3EG0 A;  1D1C A;  1MMN A;  3A8O B;  3MHX A;  3OYB A;  2CP2 A;  2JNG A;  2DX1 A;  2MPX C;  3I5R A;  3OS5 A;  2PZ1 A;  1KK7 A;  5GMK l;  1VQ6 T;  2FVU A;  2JXB A;  1VQL A;  2ZPG B;  4C8Q G;  1LNX A;  4XQ3 A;  1QWE A;  3UAT A;  4JPB W;  4C0D C;  1K73 C;  3RMS A;  5CKD A;  2QA4 Q;  1WPY A;  1I1J A;  4E2F B;  4RCB A;  2V8J A;  2AK5 A;  2F2W A;  2KEA A;  2V8K A;  1TWB A;  1VQ8 A;  1ACM B;  1S72 A;  2DET A;  2J6K A;  3REA B;  2L5Q A;  1BU1 A;  2OTL T;  2QK0 A;  4QVD A;  1O75 A; 
#chains in the Genus database with same CATH homology
 2K3B A;  3EHQ A;  2GNC A;  3EG1 A;  1RLP C;  2DL8 A;  4HCK A;  2GTJ A;  3NHN A;  4Y92 A;  1WYX A;  2FPF A;  3SEM A;  3RNJ A;  3IQL A;  3PE0 A;  1H92 A;  1UGV A;  1XOV A;  3H0I A;  1X6G A;  2W0Z A;  2X3W D;  3C0C A;  2DBM A;  2F2V A;  2JTE A;  2EKH A;  1SRL A;  2EVR A;  2CRE A;  4HVU A;  1SEM A;  1K76 A;  2CH4 W;  4J9E A;  4D8K A;  2G6F X;  1GCQ A;  1UG1 A;  1YWP A;  4LUD A;  4K11 A;  2E5K A;  2YDL A;  2J06 A;  2JT4 A;  2KRM A;  5IHI A;  1T3S A;  3TVT A;  3R6N A;  1ABO A;  2MCN A;  2DJQ A;  2H8H A;  4JJD A;  5FW9 A;  3I9Q A;  5GJW B;  2ENM A;  1SSH A;  3O5Z A;  3VS5 A;  2LX7 A;  5IXF A;  1QCF A;  2ROL A;  2VKN A;  2K7A A;  1PKT A;  1G83 A;  2LJ3 A;  1HD3 A;  1N5Z A;  1PRL C;  3M0U A;  1AVZ C;  1RI9 A;  1U3O A;  1UUE A;  1U5S A;  4AG2 C;  1QWF A;  2CT3 A;  2DYB A;  2JMC A;  1BBZ A;  4IIM A;  2EYX A;  3EG3 A;  4RTX A;  4GBQ A;  1UHF A;  1A0N B;  2LQN A;  2L3S A;  2CUB A;  1Z9Q A;  2O9S A;  2GTO A;  5GJV B;  1W70 A;  4FSS A;  2A36 A;  4HVW A;  3UF4 A;  4R0K A;  1E7O A;  1NLP C;  4CC4 B;  1X2Q A;  1H8K A;  2DL4 A;  2ED1 A;  2D1X A;  2FRW A;  2EYW A;  4HXJ A;  3VS1 A;  1AZE A;  2VVK A;  2EQI A;  2L2P A;  2KXC A;  1BK2 A;  2FG0 A;  1W6X A;  1UJY A;  1WA7 A;  3NMZ C;  2D8H A;  1M3C A;  3VRZ A;  2KRS A;  1X27 A;  1GBR A;  4LN2 A;  1KIK A;  2GGR A;  3KFV A;  1VYT A;  5IHN A;  4JZ4 A;  4EIK A;  1UDL A;  1GFC A;  1FMK A;  1PNJ A;  1X2K A;  1V1C A;  4DEX A;  5IHK A;  1PKS A;  1JO8 A;  5EC7 A;  3EG2 A;  1NG2 A;  4J9D A;  1HSQ A;  2BZ8 A;  2O31 A;  1PRM C;  2L0A A;  3H0H A;  4JZ3 A;  1AZG B;  4RTU A;  1RLQ C;  4CC2 A;  1Y0M A;  2X3X D;  2DMO A;  2W10 A;  2J6O A;  1UE9 A;  4J9H A;  2D8J A;  1M30 A;  1T3L A;  2AKK A;  2JMA A;  1PHT A;  1UJ0 A;  2V1R A;  2EYY A;  1NM7 A;  1Z9Z A;  4Z88 A;  1X43 A;  1JXM A;  2DRM A;  2KGT A;  1ARK A;  2O88 A;  1ZLM A;  1WIE A;  1W1F A;  4OMO A;  1K0X A;  2JW4 A;  1IO6 A;  1I07 A;  2EBP A;  4AFU C;  2XMF A;  1T0J A;  1Y57 A;  2EGC A;  1BB9 A;  1MUZ A;  1B07 A;  2KYB A;  3I35 A;  1GFD A;  1WX6 A;  1AOJ A;  2FPE A;  2MOX A;  4AFZ C;  1H3H A;  3U23 A;  2DL3 A;  1SRM A;  4ORZ A;  4IIO A;  2CUD A;  1NYG A;  3PVQ A;  3M0S A;  3M0P A;  2LQW A;  3NGP A;  1CSK A;  1K9A A;  2KXD A;  4OMN A;  2ECZ A;  1HJD A;  5IXB A;  3H0F A;  1OV3 A;  3UA6 A;  2FPD A;  2AZV A;  1FYN A;  1KJW A;  2C0O A;  3RBB B;  1OOT A;  4J9B A;  2ABL A;  2RN8 A;  2VWF A;  4CC3 A;  1J3T A;  1U06 A;  1GCQ C;  3QWY A;  2RQV A;  4JJC A;  2DM1 A;  2O2O A;  4D8D A;  2SRC A;  2RPN A;  1UFF A;  2A37 A;  1UEC A;  2M0Y A;  2I0N A;  5ECA A;  4X1V A;  2YUQ A;  4AG1 C;  4OMP A;  2KT8 A;  1SHF A;  1M3A A;  1CKB A;  1T0H A;  4CC7 A;  1ZUU A;  4J9F A;  1JU5 C;  1SHG A;  4DEY A;  2HEQ A;  1JXO A;  3M0R A;  1NEB A;  2EGE A;  3H41 A;  2DNU A;  4ESR A;  3JV3 A;  5FWB A;  2OAW A;  4OMM A;  1ABQ A;  2K79 A;  1K1Z A;  1OEB A;  4F17 A;  2OJ2 A;  2YUP A;  4E6R A;  1GCP A;  3VS2 A;  1LCK A;  1MV3 A;  5I11 A;  2OI3 A;  1GL5 A;  2AKL A;  1ZUK A;  2LJ1 A;  4RTW A;  3VS7 A;  2YT6 A;  4A63 B;  1OPK A;  1M8M A;  2F2X A;  3THK A;  3VS3 A;  2JM9 A;  2KRO A;  1UTI A;  1YWO A;  2KNB B;  5HCK A;  5FWC A;  1ZUY A;  2K6D A;  2DLP A;  4GLM A;  1K0S A;  4J9C A;  2RQU A;  1AEY A;  3PVL A;  3TSW A;  2B86 A;  2J7I A;  2O9V A;  5L23 A;  2P4R A;  2NUZ A;  3A98 A;  1VA7 A;  2L3Q A;  2RQR A;  2CSI A;  1WXT A;  2DE0 X;  1PWT A;  1ZBJ A;  2AZS A;  4OMQ A;  2KBT A;  1GRI A;  2JS0 A;  1TUC A;  2RMO A;  1E6G A;  3UA7 A;  2IIM A;  2J05 A;  1G2B A;  1MV0 B;  5IH2 A;  3EGU A;  2YUN A;  4WCI A;  3VS6 A;  2V1Q A;  3EHR A;  2EW3 A;  2FRY A;  3LH5 A;  1TG0 A;  3I5S A;  2BTT A;  2DBK A;  2LZ6 B;  1SPK A;  4RTY A;  2EPD A;  2NWM A;  2C0T A;  1E6H A;  1QKW A;  1NYF A;  2KR3 A;  3ZL7 C;  2HSP A;  1EFN A;  2HCK A;  2YUO A;  2LNH B;  2ED0 A;  3NPF A;  2YSQ A;  2BZX A;  1QKX A;  2DVJ A;  4RTT A;  1AD5 A;  2EGA A;  2M51 A;  4M4Z A;  1OPL A;  2LCS A;  2HBW A;  2RQT A;  4JJB A;  1WDX A;  1YN8 A;  1QLY A;  2HDA A;  1ZSG A;  2MIO A;  2ROT A;  2EYZ A;  1K4U S;  4J9I A;  2LP5 A;  3SHW A;  2DIL A;  5I22 A;  1TUD A;  1AWJ A;  2KYM A;  3FJ5 A;  2J6F A;  1KFZ A;  2KE9 A;  2A28 A;  1WLP B;  2DF6 A;  4ZNX A;  3TSZ A;  2DL7 A;  4AFS C;  1M3B A;  2QDL A;  1VYU A;  3CQT A;  1I0C A;  1S1N A;  2RQW A;  1VYV A;  4LE9 A;  2RF0 A;  1RUW A;  4QT7 A;  2JM8 A;  3M0Q A;  4LUE A;  1WFW A;  3GBQ A;  1X69 A;  1CKA A;  4AFQ C;  1X6B A;  4F16 A;  2A08 A;  2SEM A;  2GBQ A;  4J9G A;  1UHC A;  3VRY A;  1WXB A;  3M0T A;  4Z89 A;  4HVV A;  1KSW A;  4OML A;  2D0N A;  2DRK A;  1WI7 A;  4Z8A A;  2LMJ A;  3VS0 A;  1GBQ A;  2BZY A;  3EG0 A;  1AWW A;  1JQQ A;  1YCS B;  3QWX X;  2RNA A;  2L3P A;  1JEG A;  2K2M A;  2C0I A;  1AWO A;  2DX1 A;  2JS2 A;  3REB B;  3I5R A;  1YNZ A;  2FO0 A;  2DA9 A;  2KRN A;  2PZ1 A;  2JXB A;  3ULR B;  1AWX A;  1NLO C;  1NEG A;  1ZX6 A;  3VS4 A;  4RTV A;  2PTK A;  1QWE A;  3UAT A;  4JPB W;  2LJ0 A;  2PNI A;  2CDT A;  4F14 A;  2CT4 A;  2K9G A;  4KRT A;  1I1J A;  1WXU A;  2AK5 A;  1YP5 A;  2F2W A;  2DL5 A;  2KEA A;  4RTZ A;  2KT1 A;  4RUG A;  1B3Q A;  2GQI A;  1M27 C;  2CH4 A;  4LNP A;  2J6K A;  2CSQ A;  3REA B;  1BU1 A;  2FEI A;  2ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...