1KFZA

Solution structure of c-terminal sem-5 sh3 domain (ensemble of 16 structures)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1kfzA00
3JV3A 2LX7A 1CKAA 1ZSGA 1WXUA 3PVLA 1ZLMA 3UA7A 2BTTA 4K11A 3PE0A 1WFWA 4OMMA 2DYBA 2J06A 1UJ0A 1PHTA 2NUZA 1T0JA 2ED0A 3M0SA 4RTXA 2KE9A 3I35A 2EGAA 2L3SA 4F16A 4DEXA 2SRCA 2DX1A 1S1NA 1AWJA 1NM7A 3ZL7C 2VKNA 3EG2A 3EGUA 1NLOC 2HBWA 1WIEA 3RNJA 1K1ZA 2DRMA 3VS5A 3RBBB 2JS2A 1UUEA 1M3BA 2OJ2A 4FSSA 1AWOA 3EHRA 3O5ZA 2EYYA 1T3LA 1X43A 2A36A 1GL5A 4M4ZA 3EHQA 1WLPB 4HXJA 3UA6A 3TSZA 1JU5C 2KYBA 2KT1A 1WXBA 2DL7A 1BBZA 2CH4A 2PTKA 3M0TA 1MV3A 4ORZA 2JM8A 4Z89A 2D8JA 1BU1A 1UG1A 2KYMA 3U23A 2RQRA 4CC4B 1E6HA 2CSIA 5I11A 2O88A 5ECAA 3UF4A 2ED1A 1K4US 1W6XA 2LJ1A 1YWPA 5IXFA 4HVUA 4F17A 1WX6A 1WYXA 1QCFA 2J6FA 1KIKA 4JJCA 2D1XA 1K0XA 3QWYA 2P4RA 2L0AA 4JJBA 1PWTA 1UDLA 2CSQA 1K0SA 3H0FA 2KR3A 2D0NA 2YUNA 1GFDA 1E6GA 1AEYA 2DL3A 1VYTA 2FEIA 2DBMA 1GFCA 2KROA 3REBB 4LN2A 2DF6A 4RTTA 4LUDA 1PRLC 2BZ8A 3GBQA 1PKSA 1A0NB 1ZUUA 2JTEA 3IQLA 2MIOA 3REAB 2AZSA 1B3QA 4DEYA 2X3XD 4OMLA 2H8HA 2RN8A 2B86A 1Z9QA 1UHFA 3VS1A 3LH5A 2LMJA 2JT4A 1QWEA 1Z9ZA 1NEGA 1BK2A 4E6RA 2YUPA 1UHCA 1V1CA 2F2XA 1G2BA 1SRLA 1WA7A 2LNHB 2FPDA 3CQTA 2C0TA 3H0IA 4RTYA 4AFUC 1SSHA 2RPNA 5HCKA 5GJWB 1TUCA 4ZNXA 1B07A 1M8MA 4JPBW 1SHFA 1TG0A 3EG3A 1KSWA 2LJ0A 1PNJA 2DNUA 2YUQA 1X27A 2I0NA 2GNCA 2FG0A 2HSPA 5IXBA 3M0RA 2LJ3A 1GBRA 1SPKA 2LQNA 1AZEA 1ABOA 4F14A 1QWFA 1ABQA 2EKHA 1RI9A 2FRWA 4X1VA 1HJDA 3I9QA 5FW9A 4J9IA 2O31A 5IHIA 1SHGA 2K9GA 4IIOA 3KFVA 1RLPC 1AWWA 2DL5A 2JW4A 1IO6A 1YP5A 4A63B 2JM9A 4CC7A 2HEQA 1TUDA 4J9HA 4HCKA 2DVJA 2JMCA 3VS2A 2EYZA 4D8KA 1M27C 2V1RA 2JXBA 2V1QA 1X2KA 4HVVA 2EW3A 2LQWA 2RF0A 2MCNA 1NYFA 2GBQA 1X6GA 4KRTA 4RTUA 2FPEA 3C0CA 2CT3A 1H8KA 2GGRA 4J9GA 1OPLA 2YDLA 1J3TA 1Y57A 4OMQA 2YT6A 2EPDA 3A98A 1QLYA 1GCPA 5L23A 3M0QA 1HD3A 3TSWA 4LNPA 3NMZC 1PRMC 4AFZC 4AG2C 3QWXX 1M30A 2KNBB 1YNZA 1X6BA 1GBQA 2J6OA 4AFSC 4RTVA 3EG0A 3TVTA 1ZUYA 5IH2A 4HVWA 2NWMA 3VS3A 2C0IA 2KRNA 2DE0X 2HDAA 1JO8A 1K9AA 2OAWA 2DJQA 5IHKA 2AKLA 2A28A 2MOXA 1VYUA 2DILA 2ECZA 2IIMA 3NHNA 1NEBA 5FWCA 2W0ZA 1SRMA 1OPKA 4OMNA 1PKTA 2RQWA 2KBTA 1GRIA 2AK5A 2AKKA 2GQIA 1VA7A 1WDXA 4JZ3A 1K76A 3NPFA 2X3WD 2ESWA 1NG2A 2CDTA 2GTOA 2GTJA 2RMOA 1BB9A 1H92A 1UECA 1AD5A 2K6DA 2QDLA 1E7OA 3R6NA 2LP5A 1JEGA 1JXOA 2EYWA 1HSQA 1ZX6A 2FPFA 5FWBA 3VRZA 4CC3A 2RQTA 1I0CA 2EGEA 1QKXA 3I5RA 2E5KA 2K3BA 1FMKA 4Z88A 2DA9A 1UE9A 1MUZA 4J9CA 2ABLA 2DL8A 1NLPC 1T0HA 1KFZA 2L3QA 2O2OA 4WCIA 1EFNA 2XMFA 2DMOA 2YSQA 2DLPA 1U5SA 1WI7A 1ARKA 2CREA 3I5SA 4QT7A 3VRYA 1VYVA 2RNAA 1U06A 2M51A 2VWFA 3M0UA 5EC7A 2C0OA 2KXCA 2KRSA 2G6FX 2LCSA 1LCKA 2EBPA 2W10A 1GCQC 2HCKA 4OMPA 1RUWA 4R0KA 3THKA 3UATA 1MV0B 1AVZC 4JZ4A 4LE9A 4J9DA 1UTIA 1H3HA 2FRYA 2PNIA 2ENMA 1SEMA 2K7AA 4RUGA 1YWOA 2M0YA 3H0HA 4D8DA 1X69A 1AOJA 1QKWA 2EQIA 1W70A 1ZUKA 1W1FA 2EYXA 4J9FA 4Y92A 3VS0A 2RQUA 4IIMA 1T3SA 4EIKA 1X2QA 4GBQA 3NGPA 2J05A 1UFFA 4AFQC 1FYNA 3VS7A 2A08A 4JJDA 4J9BA 1KJWA 2JMAA 2O9SA 1XOVA 2F2VA 2J6KA 1I07A 4OMOA 4Z8AA 3H41A 2J7IA 3VS4A 1NYGA 4RTWA 1OV3A 4CC2A 2F2WA 3FJ5A 2VVKA 2ROLA 2BZYA 1CKBA 1I1JA 1GCQA 5GJVB 4LUEA 2K79A 1Y0MA 1UGVA 2L2PA 4RTZA 1U3OA 4ESRA 1OOTA 2DBKA 1G83A 2YUOA 3M0PA 2CUDA 2A37A 1YCSB 2DRKA 2CUBA 3EG1A 2OI3A 3SEMA 2BZXA 2K2MA 2DM1A 3VS6A 2D8HA 2LZ6B 2RQVA 1AWXA 1M3AA 4GLMA 4AG1C 1WXTA 2EGCA 2CH4W 2CT4A 4J9EA 3SHWA 1N5ZA 1YN8A 1CSKA 2AZVA 2FO0A 2JS0A 2PZ1A 1OEBA 2EVRA 2KT8A 1JQQA 2DL4A 2SEMA 2KGTA 1JXMA 1AZGB 1RLQC 2ROTA 2L3PA 1M3CA 5IHNA 1UJYA 2KEAA 2O9VA 2KXDA 2KRMA 1ZBJA 3PVQA 3ULRB 5I22A
chains in the Genus database with same CATH superfamily
2DO3A 3JV3A 2LX7A 3OYCA 3J80E 3OS2A 1ZSGA 5FRMA 5CVIA 3PVLA 1V76A 2HQHA 4JRIA 4QQGA 5HK0A 3EGXA 2DYBA 2XKOC 2WSCE 1PHTA 3CC2A 3HFOA 4RTXA 4C5HA 1WHJA 3GP8A 2EFIA 1WHKA 6AT1B 2KE9A 1VQMQ 2QI2A 5I2MA 1YHQA 3E9FA 3QXEB 1AWJA 3ZL7C 4M7DA 2MWOA 1S72A 2DRMA 3EG9B 2RJCA 1YJNA 1KHIA 2DVEA 1Q86U 4M4ZA 2E12A 1WQWA 2KT1A 1VQ4T 2CH4A 3G71Q 4ORZA 2D8JA 2FYKA 2RQRA 3NFCA 2JTFA 1C6VX 3PTAA 1X6OA 2O88A 3OW2A 3GOXA 5LJ3e 5ECAA 1JJ2P 1W6XA 3AT1B 1WYXA 2P84A 2XDDA 2J6FA 2YLBA 1MMNA 2DXCA 4JJBA 5GAMj 3JCMP 2WSEE 1I81A 3VYGA 4MMLA 4V2SA 2V8JA 4J7FA 1IREB 1LVKA 2DL3A 2C06A 1GFCA 4EMKB 1YFNA 2XD0A 5CKDA 3M9QA 3BW1A 2Y90A 2CP5A 5IAYA 1ZSZB 2BZ8A 1D09B 1YJ9Q 4F7UA 2JTEA 3OY9A 1WHLA 1D3BB 2HL5C 3M4GA 2X3XD 4PJJA 1AHJB 1M5Q1 2AT1B 1QCOA 4XTXA 1ZA1B 2K2VA 3E19A 3EFSA 3VYHB 2LNHB 2F69A 2FPDA 3CQTA 2ZGWA 1EX4A 4Y28E 1WJRA 1TUCA 1OI1A 2CKKA 2PVGB 3MCAB 1Q82C 1PNJA 3HTRA 2I0NA 1QVFA 2FG0A 4OB1B 1IHVA 5IXBA 3M0RA 2RHXA 4BD3A 4B9WA 2LJ3A 4RG8A 1QMCA 1SPKA 2LQNA 4LD6A 2QASA 1ABOA 5AYFA 4F14A 4N0AC 4X1VA 3OYEA 1PSFA 3CCJA 5LJ3d 1KQSA 3CPWS 2PQWA 1TWBA 5IHIA 3MEAA 5GAN8 2YLCA 4RMOA 3CC7Q 3C12A 3KFVA 3FB9A 1RLPC 2X9HA 3JCMQ 5GAN7 2JW4A 1IO6A 3JCMJ 3QDFA 3LWIA 1M2VB 2BIVA 3CMAQ 1YITA 4M7AF 2V1RA 2QAZA 4QW2A 4AMCA 3QDRB 2RHZA 3C4SA 3RKYA 4MDWA 2EW3A 3MJXA 1MMDA 1G5VA 4LDUA 2FPEA 2CT3A 4OMFB 5LJ5d 2GGRA 2M9UA 3CC4Q 1WHHA 2KDSA 4J9GA 2YDLA 1WGSA 3D7SB 1GCPA 1HD3A 4QQDA 5GAOn 1Q81R 4XK8E 2JOYA 3ZEHA 4AG2C 5L8RE 1VQMA 2E64A 1M30A 2KNBB 3OYGA 4M7AB 2JZ2A 3CC2T 3JB9D 4A4FA 2IG0A 2XDBA 3OBWA 2C0IA 1C1AA 4OP0A 1PG5B 2VC8A 2DJQA 3PFSA 1KD1C 2GQVA 3NHNA 1YHQT 4OMNA 1BYMA 5FROA 1HK9A 1AT1B 5CKBA 4QVDA 2QQSA 4EMKA 4FYYB 4JZ3A 4E7SA 2RA2A 1NJIR 2P0PA 2COZA 4ANJA 1Y96A 3X24B 2CDTA 1YJNT 3NTHA 2GTJA 2WACA 1BB9A 3QIIA 4PKCC 4BUGA 1ZSZA 1UECA 4KT0E 4B6MA 5GMKh 3J81E 2LP5A 3MKDA 4FT4A 1ZX6A 4PJOD 1I4K1 5FWBA 2RQTA 2EGEA 1QKXA 2MI6A 3I5RA 2K3BA 2YRDA 4ZGEB 2DA9A 1QVGS 3QPHA 4J9CA 3RKXA 1T0HA 5GAN5 1EFNA 4M78D 4M7AG 1KQ1A 3OYLA 1JJ2S 4C92F 5HKCA 2HD0A 3V7SA 3CXCS 1VQLQ 3MO8A 4L59A 4E7JA 3QJ6A 2YWWA 3CCEQ 3FEOA 2C0OA 2A7YA 1KC8U 4IUPA 2LCSA 1LCKA 3S3OA 2DK3A 1RUWA 1M9SA 5GAOq 1AVZC 3C94A 2DTOA 4ZTFA 3PMTA 3QZ5B 4JZ4A 3CCVQ 4LE9A 4J9DA 3CD6Q 1EZZB 2GCXA 1KHCA 2M0YA 4BI3A 1JBMA 2EJ9A 1VUBA 1TH7A 3MEWA 1X69A 2EJGA 2JVVA 4N4IA 4C92B 2XHCA 1M1GA 1W1FA 4J9FA 5FU7C 1M2VA 2GFAA 4NL3A 3G4SQ 5A0LA 1UFFA 4JS5A 4JUVA 1D1CA 4J9BA 3A8GB 1MHNA 4QVZA 1UB4A 2RHIA 2JMAA 1RAAB 4J8OA 4WF2A 4EPCA 1I07A 4Z8AA 2J7IA 3SFMA 4J6YA 3JB9J 2XG8D 1GCQA 1FMVA 1M90R 1BIBA 4JJNK 1XTDA 2L2PA 1XNIA 4OB2B 2YUOA 5FU7B 3CMEQ 3CC7A 4M77D 4OGEA 2MK5A 2A37A 1YCSB 3M57A 2EQUA 3V7CA 3JB9I 2RHYA 5AT1B 2COWA 5DM7R 1VQ9A 3CCJT 4BY6B 4M7AA 4XTWA 2HAXA 2D8HA 1DJ7B 3VKIA 2RQVA 1M3AA 3V8JA 1WXTA 4C92G 3CMAA 2GF7A 3WVEB 2CH4W 2CT4A 4J9EA 3FLGA 1N5ZA 1VQ5Q 2XICA 5KYNA 3PNWC 1U8RA 4M7DC 1M8VA 4KUDK 1PD0A 2EVRA 3EFOB 4ZN3A 2KGTA 1VQOQ 1JXMA 4PFPA 3X26B 3F70A 2KMTA 4M75C 1YITT 2ROTA 2L3PA 2X51A 5IHNA 2KEAA 2OTLT 1SSFA 1ZHIA 2KRMA 1WXUA 1M4ZA 2NUTB 3ULRB 5LJ3j 5I22A 2RI2A 2EYQA 4FYXB 3PT9A 4HT8A 1KK7A 3PE0A 3CCUA 1BKBA 1T0JA 4GLKA 2ED0A 1VQ8Q 3MEVA 5GAN6 3V8LA 1YI2Q 5GMKi 4HCBA 2DD5A 2LRQA 3HP9A 4F16A 4PNOA 3L2RA 3CCQA 5GAN3 2OAUA 5GAMf 5GAOr 3E2UA 2VKNA 4O6JA 5LJ5j 3EG2A 2NLUA 4C8QF 2HBWA 3HRSA 1WIEA 1KD1R 4M7DE 3JCMf 3VS5A 1K73R 3RBBB 1M3BA 2OJ2A 2P0KA 4FSSA 2EYYA 1T3LA 1PM3A 2A36A 4M75E 2OTJA 1GL5A 1TUGB 3X28B 4IURA 2MWPA 3UA6A 2KYBA 2DL7A 4Z02A 2EQKA 5CO7A 3M0TA 3EFRA 1N8RC 2PUKB 4C92A 2KYMA 4CC4B 4ELYC 1E6HA 3I56Q 2ZPIB 4DBHA 3CCMA 1RABB 1M1KC 4QVCA 3UF4A 5CKFA 4R55A 5IXFA 1Q82U 1QCFA 4C8QB 3OS1A 2DETA 2RJEA 1VQ6A 4JJCA 3CCEA 3CPWP 1D1AA 2R5MA 2CZ7B 3I55Q 1PWTA 1UDLA 4JRKA 3M59A 1VQPQ 4F7UB 2QG9B 1PC0A 3CD6A 4O5VA 4XTUA 4LN2A 2CGHA 2E4HA 2DF6A 4RTTA 4LUDA 4JS4A 3LX7A 4OF1A 3CCRQ 4A53A 2MIOA 4II1A 5GAMh 4KULA 2BE7D 4OMLA 2RN8A 2X35A 4HCCA 4BI8B 1Z9QA 3G4SA 4F7UE 5KCHA 4LDVA 2JT4A 1QWEA 1WNLA 4C5EA 2YUPA 3JCMh 1G2BA 2D9TA 2QA4Q 2E3IA 4OB3B 2E6NA 3H0IA 3EFOA 1YJWQ 4Q5WA 3OYIA 1G8XA 4AFUC 3OS0A 1Q81C 2ZCFB 4C8QG 4ZNXA 1RAIB 2EQMA 3EG3A 1BI1A 3S6WA 2DNUA 3QJYA 1X27A 2QQRA 2DZCA 2GNCA 3DB4A 1W2BP 4J7IA 2NUTA 3SWNB 1GBRA 4F7UG 3CMEA 1BCMA 2QK0A 1QWFA 3KBGA 1ABQA 2EKHA 2FRWA 3RIRA 1OU8A 1R0BG 1VQ7A 1HJDA 2K4YA 2QQ9A 2L5QA 3X20B 1FXXA 3OYYA 4NOYA 1SHGA 3CCLQ 5M9OA 3CC7T 4IIOA 2EJFA 1VIFA 3HRUA 1NJIC 4A63B 2CP0A 1VQ9T 1N9SA 3LYIA 4HCZA 2JM9A 4J5YA 5FRNA 1TUDA 1X01A 2DVJA 2PVOB 3QUIA 3CMAT 2V26A 5CKEA 4D8KA 2PU9B 4KGXB 2O4XB 1X2KA 3RDVA 2LQWA 2RF0A 4LXCA 4EMKC 1QVGP 2CZ0B 2AIRB 3OMGA 3E9GA 1KG1A 4RTUA 2E3HA 5GANe 4RCCA 3CXCP 1WHGA 2MF2A 1OPLA 1J3TA 4JDSA 1ZSZC 4OMQA 1OYXA 4ZN1A 4HKEA 4LNPA 1TS9A 3G7ZA 1XQHA 2DTHA 1VQ8A 4KH1B 5CQXA 5KYUB 4AFZC 1G3YA 3M54A 1YNZA 3CCUT 1QVFS 1GBQA 2J6OA 4AFSC 3EG0A 2F1LA 1BCOA 3TVTA 2QGGA 4C8QA 4HVWA 1K9MR 2VYTA 3MHXA 1UGPB 3MP1A 1G3TA 1Y96B 1JO8A 1K9AA 2OAWA 1LJOA 4JRPA 8AT1B 5LJ5e 2AKLA 1NPRA 1VYUA 2DILA 2ECZA 2IIMA 3CCQT 2W0ZA 1SRMA 4E7ZA 1KQSS 2RQWA 2KBTA 2LT4A 3WXMB 4A4KA 5GAMg 3HSBA 2QEXQ 4R56A 2VASA 2GQIA 1WDXA 4XQ3A 2LC4A 2P0QA 1K76A 1U1TA 2L3RA 3NPFA 4PL6A 2ESWA 2LX9A 1BIAA 3JCMg 5KE3A 3PMIA 2F5KA 2OTJT 1AD5A 2QDLA 1E7OA 2QDYB 2YXYA 5D7UA 1JEGA 1JXOA 3M56A 1HSQA 4CC3A 3VRZA 3OYHA 2EKOA 1N8RR 2M1HA 3GNGA 2E5KA 3FJPA 1M90C 1UE9A 1NLPC 1Q7YU 4X9DA 5KH6A 1MNEA 2NUPB 2XMFA 1M1KR 3CCMT 1U5SA 3V7RA 1WI7A 1ARKA 3QSUA 1RAGB 2E1HA 1VYVA 1N27A 2VWFA 5J3BA 5EC7A 1VQ6T 2O01E 3QBYA 2KRSA 5GANd 3OYDA 3GPLA 2EBPA 2W10A 1BI0A 3SWNA 1GCQC 3THKA 2CP2A 2VB6A 3OQ5A 3CCRA 1N9RA 2FRYA 2FZGB 2K7AA 1SEMA 5DLQE 3H0HA 2HBPA 1QKWA 4XU3A 4M7AC 2HKNA 1H641 1W70A 1B7TA 3EAEA 1XJWB 4EIKA 4ZTJA 3G4ST 4N4GA 4IUVA 3O8VA 4AFQC 1VQ4Q 2O4XA 2QTVA 2J6KA 3CEYA 3H41A 2I2LA 1OV3A 1JRIA 2ZPHB 2F2WA 2FHDA 3HL8A 5LJ3f 2L8DA 2ROLA 2BZYA 1I1JA 2KQWA 1W2BS 1ZQ1A 3R6OA 3HFNA 1Y0MA 1UGVA 1U3OA 4ESRA 1WHMA 2DBKA 3CCLA 3CPWA 2CUDA 4E7HA 3Q1JA 3C95A 3OYNA 5KYUA 2DRKA 1K73C 1VQ7T 2HQXA 4EMGA 2BZXA 2KSSA 4F04B 3VS6A 2FZCB 2LZ6B 5I21A 1AWXA 1PCXA 1S72T 2EGCA 4M7AE 3SHWA 3TU4K 4KUIA 2XIDA 5HK3A 2VV5A 3G71A 5LJ5f 2K5FA 2PZ1A 3INZA 3J7AF 1JQQA 5D6YA 1Q86C 4NL2A 2V8IA 1GXIE 1TOVA 1AZGB 4ELZC 5KYYB 3ZFJA 1M3CA 2LCLA 2O9VA 4M7DD 1YIJQ 3QYGB 2A3LA 1ZLMA 4M75D 2XK0A 3SD4A 4K11A 4C92C 3FIFA 1UJ0A 2R58A 1QW1A 2NUZA 4E7LA 5CKHA 1ZA2B 3M0SA 3LH0A 2LT1A 3FC3A 2NUPA 4IKFA 1I5OB 2DPPB 3L1AA 2EGAA 4PFZA 5LJ3h 2X4WA 4A4EA 2SRCA 4DBRA 1YJ9A 2DX1A 1FMWA 3UT1A 4XAXB 2DIGA 3G1JA 1ZBXA 3EGUA 1Y07A 3CBOA 2ZPBB 3JB9H 2RK2A 2E10A 4PLIA 1X43A 2MAMA 1WLPB 2RH2A 1WXBA 9ATCB 4X34A 4BY6C 2PTKA 1MV3A 4FM4B 3MPUB 3TQ7P 1UG1A 1LNXA 5LJ5h 3HPWA 1Q81U 3OW2P 2LTOA 2PVDB 4C92E 5I11A 1TU0B 2VUBA 2JNGA 2DTIA 2LJ1A 1JJ2A 4HVUA 2B8AA 3JB9F 1WX6A 2DXBA 3CXCA 1KIKA 2D1XA 2RM4A 5HY6A 2LCCA 3QKJA 1W4SA 4A54A 2CP3A 1FX7A 2P4RA 3CBPA 4QQ6A 2HZYA 2DXTA 3H0FA 2DEQA 1K8AR 3GIBA 2YUNA 1GFDA 3NTKA 1E6GA 3OA6A 1R8OB 2FEIA 4FW2A 3CC2Q 2KROA 3OB9A 4EDUA 1IHWA 3JAME 1NJIU 4C0DB 2D6FA 2Z0WA 1PRLC 1VOMA 3GBQA 3OSVA 2ZAEA 1VQKQ 1A0NB 1ZUUA 3REAB 3EH1A 4PJOF 4DEYA 2K57A 3VUBA 3CC4A 1UHFA 2LMJA 4ME7A 1Z9ZA 1NEGA 3A8OB 1UHCA 1TSFA 1V1CA 3LGLA 1SRLA 1YJNQ 4M78F 5GANj 2C0TA 4RTYA 2ATCB 4M75F 1M2OA 5HCKA 5GJWB 3M4YA 3DLMA 2K3XA 5GAN2 1M8MA 2EWNA 3EGDB 3OMCA 4JPBW 5KYYA 4AT1B 1QVFP 3GF5A 1OU9A 2LJ0A 3HKSA 2RD1A 3A5ZB 2HSPA 2R5AA 4PJMA 3ASKA 2IVWA 1K9MC 1VQMT 4PJOB 3DLLA 5LJ3g 4C5GA 2K5LA 4FCYA 3I9QA 5A2QE 1KQSP 4PK4A 2FB7A 4J9IA 2O31A 3CCLT 2K9GA 1MGQA 4CRIA 1R0CB 3JB9G 4C8QC 2CZ1B 4MZMA 1V29B 4JRQA 1OX9A 4CC7A 5DY9A 2HEQA 4HCKA 3VS2A 2EYZA 3HRTA 1M27C 4HT9A 3G71T 2CP7A 1Q86R 5D6XA 1YIJA 4HA8A 5LJ5g 2JN0A 2QTXA 1X6GA 1SKUB 1VQLA 2LNVA 5CQYA 3OBYA 1Y57A 2YT6A 1QLYA 1LPLA 1M90U 4ATOA 3M0QA 3VUZA 1IRXA 2M0OA 4PJOG 4M77F 7AT1B 4E47A 5KYXB 3G6EQ 3OYJA 1RAEB 2K5IA 3OSSC 3QWXX 5GAOl 3CCVA 4CI0C 3ER0A 2ZPFB 3VS3A 4C8QE 2DE0X 2HDAA 4E7IA 2MOXA 4FT2A 1NEBA 2E65A 1YJ9T 4KH0B 3E1SA 1PKTA 3SWNC 1GRIA 3CCJQ 3H8ZA 2JTMA 2HSEB 2AKKA 5CR2A 3V8KA 4M77B 4BI4A 5CCAA 2EAYA 4EMHA 4DQ2A 1WQ7A 3RESA 1PD1A 5FU6B 3L2WA 2L89A 3BDLA 1VQNQ 4LD9K 2QQBA 3P8BB 2RO0A 1YITQ 2EYWA 2FPFA 1HYOA 1I0CA 2DERA 4DOVA 1FMKA 4Z88A 4KBMB 3X25B 2OTLQ 1MUZA 2ABLA 2DL8A 3L2ZA 2KI7A 2L3QA 3OYAA 1O9SA 3ME9A 3OW2S 3CPFA 3M5AA 1WJSA 2DLPA 1OULA 1OZ2A 4OVAA 2KVQG 3VRYA 5C0MA 3M58A 5GAOp 1U06A 3EGDA 2M51A 1N6AA 3M0UA 1UEBA 2KXCA 1Q7YR 2VGMA 3SB2A 1SG5A 2ZPEB 4OMPA 1VQ5A 4R0KA 1KD1U 3UATA 1H3ZA 1MV0B 1K73U 3M55A 4J6WA 4PJOA 2V8KA 5GMKe 1KQ2A 1H3HA 4M77G 1VQKA 2CYZB 2ENMA 1VQOA 3VV0A 4RUGA 1IGUA 4ZGDB 2M02A 1MMAA 3RMSA 4M78A 2MMPA 5LL6S 3OS5A 2EQIA 4M75A 5CIUA 2FZKB 3PGGA 3FDRA 1ZUKA 4X9CA 3CCSQ 2DD4A 1Y7XA 2EYXA 4Y92A 4MDXA 4KGVB 3CC4T 1X2QA 4N4HA 3NGPA 1VIEA 2A08A 4JJDA 4M7AD 4GY5A 4L6V5 1LOJA 2H3EB 5A0GA 2O9SA 1XOVA 3GNFB 2F2VA 1YI2A 1NYGA 4RTWA 2QQAA 1D0YA 3L2UA 5GJVB 4LUEA 5CK9A 2K79A 2DZ9A 5IN1A 2XU8A 4RTZA 4E7KA 2EIFA 2BUDA 5KYXA 4L5GA 1I5LA 5EG2A 3EG1A 2OI3A 2K2MA 2QYZA 2DM1A 2QXFA 4C0ZA 2RJDA 4AG1C 1RL2A 2A0FB 3RMQA 2E5QA 3QZ9B 4PFOA 2AZVA 2JS0A 1OEBA 2KT8A 2YRCA 2DL4A 2SEMA 2FVUA 3I56A 3MP6A 5FLXE 1OZ3A 4DBQA 4M77A 1UJYA 2PUOB 3FRNA 2KXDA 1YIJT 1F1BB 3G6EA 3JCMW 3I55A 1CKAA 4RKUE 1QP3A 3UA7A 1VQLT 3S3NA 3OYFA 2BTTA 1VQPA 3P8HA 3JCMb 1WFWA 4OMMA 2J06A 3CCET 5IT9E 1K8AC 2X4XA 2DYIA 3JCMX 4OB0B 1BI3A 4PJNA 3JCMc 3I35A 1OQKA 2DKGA 3QO3A 3CCVT 2L3SA 4C92D 4DEXA 3CD6T 2ZPGB 1S1NA 4IUTA 1KC8R 4FIBA 1NM7A 3L2QA 3PIPA 1B34B 3RNJA 1NLOC 2RJFA 1K1ZA 2JS2A 1UUEA 1JB0E 3KUFA 5CAIA 1PSEA 1AWOA 2QA4A 3JRZA 2HMAA 3N5BB 3EHRA 1VQ9Q 3O5ZA 1YJWA 1VQNA 4XU1A 2VXFA 2JUFA 2RB6A 2RHUA 2BKDN 3EHQA 4HXJA 3OYKA 5A0DA 3TSZA 1JU5C 1BBZA 1OX8A 4IUUA 2F5TX 2JM8A 3EG9A 4Z89A 2OTLA 1BU1A 4IUQA 3LGFA 1RAFB 3U23A 2CSIA 2DEUA 2E70A 4WTOB 3QYHB 5GANf 1MNDA 2ED1A 1K4US 1YWPA 3H6ZA 2AHJB 2G3RA 4YTLA 4F17A 3GLXA 4XU0A 1K0XA 1IGQA 3LW5E 3CMET 1UGRB 3QWYA 1K9MU 2IPOB 2L0AA 2KY9A 2CSQA 1K0SA 2KR3A 2D0NA 2KAFA 3CCUQ 1AEYA 1VYTA 2LDMA 2VXEA 3UWNA 2DBMA 3REBB 3BE3A 2NYSA 1VQ5T 3MEUA 2X4YA 2Y4XA 3RKWA 3ZBDA 4DBFA 4B9XA 1PKSA 3CCQQ 1VQKT 2FL7A 3CCSA 3IQLA 1VQOT 3DB3A 3JSCA 2AZSA 1B3QA 4XTVA 2H8HA 3RERA 4BE0A 4QKUA 4XU2A 8ATCB 1RADB 1TXQA 2B86A 3VS1A 3LH5A 1BK2A 4E6RA 1N8RU 1I8FA 2F2XA 1WA7A 4C0FA 4DOWA 3AHUA 1QQJA 4XTYA 2OTJQ 4RCBA 1SSHA 2RPNA 1M1KU 2MPXC 1D3BA 1B07A 3UDCA 4UC4A 1SHFA 1TG0A 1KSWA 2YUQA 3L2VA 5GMKm 3EH2A 1VQ8T 1W2BA 2M16A 1YI2T 1AZEA 4PLLA 3CCMQ 1RI9A 4PJLA 5GANh 5GAMe 5J39A 2GFUA 5FW9A 1VQ6Q 2QEXA 1MMGA 4BDYA 1WPYA 3CBMA 3JCMe 2XI9A 1AWWA 1X75C 2DL5A 1YP5A 1UGQB 4BB7A 4JLIA 3M53A 5GAOm 4J9HA 1P92A 2JMCA 2DIQA 1B34A 2JXBA 2V1QA 1BI2A 4BDZA 1G3WA 4HVVA 1QVPA 4C8QD 1NZ9A 2MCNA 1NYFA 2GBQA 1QVGA 3I56T 4KRTA 1QCNA 3C0CA 1H8KA 4C0DC 3VU3C 2HKQB 2LVMA 2BE9B 3MP8A 1G3SA 2EPDA 3A98A 4P5NA 5L23A 4N0AA 1IXDA 3TSWA 3G6ET 4BACA 3NMZC 2Y4YA 3I55T 1Q7YC 1PRMC 4BE1A 3A8LB 1SF9A 1VQPT 1Q82R 1YBYA 1X6BA 4RTVA 3TEEA 3TCJA 2EQJA 1ZUYA 5IH2A 1U1SA 2NWMA 2DAQA 5GMKj 1RI0A 2KRNA 4KGZB 2COYA 2ZZDA 5IHKA 2A28A 4MZPA 4LDYA 3TREA 4XTZA 2YHTA 1YHQQ 5FWCA 1VQ7Q 3CCRT 2VGNA 1OPKA 4FL6A 3META 5J26A 5KYWB 2AK5A 1VA7A 3HHTB 4PJOC 1S72Q 5GAMd 4M7DF 2X3WD 2E6ZA 1NG2A 3UPUA 1VQ4A 1WJQA 2GTOA 2QA4T 2RMOA 1YJWT 1H92A 1VQNT 3JCMd 4M78C 2K6DA 4MZTA 3SDZA 3R6NA 4RG2A 1QP2A 3EGXB 3OYMA 3NTIA 4E2FB 4LDWA 3OYBA 1RAHB 4J6XA 3DKMA 5C6SA 4FYWB 1KFZA 2O2OA 4WCIA 3PIOA 2DMOA 2YSQA 2CP6A 2DXUA 2CREA 3LLRA 3I5SA 4QT7A 1NBEB 1D0ZA 5GANg 1IB8A 2RNAA 1D1BA 2QGFB 4M7DB 1ACMB 2G6FX 2R57A 1IZ6A 1NE8A 4M78B 2WSFE 3RUXA 4FSXA 2RI5A 4D6WA 3S3MA 2HCKA 4M75B 2D0QB 1RACB 4ZGJB 1TTHB 4A4HA 2P4TA 2DFUA 1UTIA 3P8DA 5KE2A 2DJZA 2PNIA 2X4JA 4PJOE 3URGA 1YWOA 2OX7A 4D8DA 1YCYA 3BY7A 1AOJA 2MYSA 4DA4A 1D0XA 3WVDB 5GMKl 2CZ6B 3A1PA 1EIFA 4M78E 4TVRA 2E41A 3L42A 3CCST 4J83A 4OGCA 4FW1A 3VS0A 5GAN4 2RQUA 4IIMA 1T3SA 4NS5A 4GBQA 4F7UF 2J05A 3LWHA 3RR6A 5D6WA 1FYNA 2KK4A 3VS7A 2XDPA 1Q95G 3T9NA 4FYVB 1KJWA 1Y71A 2RI3A 1M1FA 5I2SA 4OMOA 4M77C 3VS4A 2H3JA 4M7DG 2RK1A 4CC2A 4FU6A 3FJ5A 3BDUA 4C5IA 2HQEA 2VVKA 4MMKA 2CS7A 1CKBA 4M78G 5FU6C 2HL3A 1K8AU 1C0MA 2LQ8A 1FWZA 4M75G 4VUBA 3JCMV 2HNIA 1KC8C 1OOTA 1G83A 3M0PA 3KXTA 4BE2A 3A8MB 5KCOA 1WZOA 2CUBA 2K3YA 3SEMA 3H9NA 2QEXT 1R77A 4GLMA 1UGSB 1YN8A 4JLGA 4A4GA 3QG1A 4Y91A 1CSKA 2FO0A 2YRVA 3BFMA 1O75A 4LDXA 3VJPA 2LQKA 5KYWA 1RLQC 2JJ9A 4C0GA 3QHSA 1HXDA 5DLOA 1NPPA 1ZBJA 3PVQA 4M77E 3A8HB
chains in the Genus database with same CATH topology
3JV3A 2LX7A 1CKAA 1ZSGA 1WXUA 3PVLA 1ZLMA 3UA7A 2BTTA 4K11A 3PE0A 1WFWA 4OMMA 2DYBA 2J06A 1UJ0A 1PHTA 2NUZA 1T0JA 2ED0A 3M0SA 4RTXA 2KE9A 3I35A 2EGAA 2L3SA 4F16A 4DEXA 2SRCA 2DX1A 1S1NA 1AWJA 1NM7A 3ZL7C 2VKNA 3EG2A 3EGUA 1NLOC 2HBWA 1WIEA 3RNJA 1K1ZA 2DRMA 3VS5A 3RBBB 2JS2A 1UUEA 1M3BA 2OJ2A 4FSSA 1AWOA 3EHRA 3O5ZA 2EYYA 1T3LA 1X43A 2A36A 1GL5A 4M4ZA 3EHQA 1WLPB 4HXJA 3UA6A 3TSZA 1JU5C 2KYBA 2KT1A 1WXBA 2DL7A 1BBZA 2CH4A 2PTKA 3M0TA 1MV3A 4ORZA 2JM8A 4Z89A 2D8JA 1BU1A 1UG1A 2KYMA 3U23A 2RQRA 4CC4B 1E6HA 2CSIA 5I11A 2O88A 5ECAA 3UF4A 2ED1A 1K4US 1W6XA 2LJ1A 1YWPA 5IXFA 4HVUA 4F17A 1WX6A 1WYXA 1QCFA 2J6FA 1KIKA 4JJCA 2D1XA 1K0XA 3QWYA 2P4RA 2L0AA 4JJBA 1PWTA 1UDLA 2CSQA 1K0SA 3H0FA 2KR3A 2D0NA 2YUNA 1GFDA 1E6GA 1AEYA 2DL3A 1VYTA 2FEIA 2DBMA 1GFCA 2KROA 3REBB 4LN2A 2DF6A 4RTTA 4LUDA 1PRLC 2BZ8A 3GBQA 1PKSA 1A0NB 1ZUUA 2JTEA 3IQLA 2MIOA 3REAB 2AZSA 1B3QA 4DEYA 2X3XD 4OMLA 2H8HA 2RN8A 2B86A 1Z9QA 1UHFA 3VS1A 3LH5A 2LMJA 2JT4A 1QWEA 1Z9ZA 1NEGA 1BK2A 4E6RA 2YUPA 1UHCA 1V1CA 2F2XA 1G2BA 1SRLA 1WA7A 2LNHB 2FPDA 3CQTA 2C0TA 3H0IA 4RTYA 4AFUC 1SSHA 2RPNA 5HCKA 5GJWB 1TUCA 4ZNXA 1B07A 1M8MA 4JPBW 1SHFA 1TG0A 3EG3A 1KSWA 2LJ0A 1PNJA 2DNUA 2YUQA 1X27A 2I0NA 2GNCA 2FG0A 2HSPA 5IXBA 3M0RA 2LJ3A 1GBRA 1SPKA 2LQNA 1AZEA 1ABOA 4F14A 1QWFA 1ABQA 2EKHA 1RI9A 2FRWA 4X1VA 1HJDA 3I9QA 5FW9A 4J9IA 2O31A 5IHIA 1SHGA 2K9GA 4IIOA 3KFVA 1RLPC 1AWWA 2DL5A 2JW4A 1IO6A 1YP5A 4A63B 2JM9A 4CC7A 2HEQA 1TUDA 4J9HA 4HCKA 2DVJA 2JMCA 3VS2A 2EYZA 4D8KA 1M27C 2V1RA 2JXBA 2V1QA 1X2KA 4HVVA 2EW3A 2LQWA 2RF0A 2MCNA 1NYFA 2GBQA 1X6GA 4KRTA 4RTUA 2FPEA 3C0CA 2CT3A 1H8KA 2GGRA 4J9GA 1OPLA 2YDLA 1J3TA 1Y57A 4OMQA 2YT6A 2EPDA 3A98A 1QLYA 1GCPA 5L23A 3M0QA 1HD3A 3TSWA 4LNPA 3NMZC 1PRMC 4AFZC 4AG2C 3QWXX 1M30A 2KNBB 1YNZA 1X6BA 1GBQA 2J6OA 4AFSC 4RTVA 3EG0A 3TVTA 1ZUYA 5IH2A 4HVWA 2NWMA 3VS3A 2C0IA 2KRNA 2DE0X 2HDAA 1JO8A 1K9AA 2OAWA 2DJQA 5IHKA 2AKLA 2A28A 2MOXA 1VYUA 2DILA 2ECZA 2IIMA 3NHNA 1NEBA 5FWCA 2W0ZA 1SRMA 1OPKA 4OMNA 1PKTA 2RQWA 2KBTA 1GRIA 2AK5A 2AKKA 2GQIA 1VA7A 1WDXA 4JZ3A 1K76A 3NPFA 2X3WD 2ESWA 1NG2A 2CDTA 2GTOA 2GTJA 2RMOA 1BB9A 1H92A 1UECA 1AD5A 2K6DA 2QDLA 1E7OA 3R6NA 2LP5A 1JEGA 1JXOA 2EYWA 1HSQA 1ZX6A 2FPFA 5FWBA 3VRZA 4CC3A 2RQTA 1I0CA 2EGEA 1QKXA 3I5RA 2E5KA 2K3BA 1FMKA 4Z88A 2DA9A 1UE9A 1MUZA 4J9CA 2ABLA 2DL8A 1NLPC 1T0HA 1KFZA 2L3QA 2O2OA 4WCIA 1EFNA 2XMFA 2DMOA 2YSQA 2DLPA 1U5SA 1WI7A 1ARKA 2CREA 3I5SA 4QT7A 3VRYA 1VYVA 2RNAA 1U06A 2M51A 2VWFA 3M0UA 5EC7A 2C0OA 2KXCA 2KRSA 2G6FX 2LCSA 1LCKA 2EBPA 2W10A 1GCQC 2HCKA 4OMPA 1RUWA 4R0KA 3THKA 3UATA 1MV0B 1AVZC 4JZ4A 4LE9A 4J9DA 1UTIA 1H3HA 2FRYA 2PNIA 2ENMA 1SEMA 2K7AA 4RUGA 1YWOA 2M0YA 3H0HA 4D8DA 1X69A 1AOJA 1QKWA 2EQIA 1W70A 1ZUKA 1W1FA 2EYXA 4J9FA 4Y92A 3VS0A 2RQUA 4IIMA 1T3SA 4EIKA 1X2QA 4GBQA 3NGPA 2J05A 1UFFA 4AFQC 1FYNA 3VS7A 2A08A 4JJDA 4J9BA 1KJWA 2JMAA 2O9SA 1XOVA 2F2VA 2J6KA 1I07A 4OMOA 4Z8AA 3H41A 2J7IA 3VS4A 1NYGA 4RTWA 1OV3A 4CC2A 2F2WA 3FJ5A 2VVKA 2ROLA 2BZYA 1CKBA 1I1JA 1GCQA 5GJVB 4LUEA 2K79A 1Y0MA 1UGVA 2L2PA 4RTZA 1U3OA 4ESRA 1OOTA 2DBKA 1G83A 2YUOA 3M0PA 2CUDA 2A37A 1YCSB 2DRKA 2CUBA 3EG1A 2OI3A 3SEMA 2BZXA 2K2MA 2DM1A 3VS6A 2D8HA 2LZ6B 2RQVA 1AWXA 1M3AA 4GLMA 4AG1C 1WXTA 2EGCA 2CH4W 2CT4A 4J9EA 3SHWA 1N5ZA 1YN8A 1CSKA 2AZVA 2FO0A 2JS0A 2PZ1A 1OEBA 2EVRA 2KT8A 1JQQA 2DL4A 2SEMA 2KGTA 1JXMA 1AZGB 1RLQC 2ROTA 2L3PA 1M3CA 5IHNA 1UJYA 2KEAA 2O9VA 2KXDA 2KRMA 1ZBJA 3PVQA 3ULRB 5I22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV3 A;  2LX7 A;  1CKA A;  1ZSG A;  1WXU A;  3PVL A;  1ZLM A;  3UA7 A;  2BTT A;  4K11 A;  3PE0 A;  1WFW A;  4OMM A;  2DYB A;  2J06 A;  1UJ0 A;  1PHT A;  2NUZ A;  1T0J A;  2ED0 A;  3M0S A;  4RTX A;  2KE9 A;  3I35 A;  2EGA A;  2L3S A;  4F16 A;  4DEX A;  2SRC A;  2DX1 A;  1S1N A;  1AWJ A;  1NM7 A;  3ZL7 C;  2VKN A;  3EG2 A;  3EGU A;  1NLO C;  2HBW A;  1WIE A;  3RNJ A;  1K1Z A;  2DRM A;  3VS5 A;  3RBB B;  2JS2 A;  1UUE A;  1M3B A;  2OJ2 A;  4FSS A;  1AWO A;  3EHR A;  3O5Z A;  2EYY A;  1T3L A;  1X43 A;  2A36 A;  1GL5 A;  4M4Z A;  3EHQ A;  1WLP B;  4HXJ A;  3UA6 A;  3TSZ A;  1JU5 C;  2KYB A;  2KT1 A;  1WXB A;  2DL7 A;  1BBZ A;  2CH4 A;  2PTK A;  3M0T A;  1MV3 A;  4ORZ A;  2JM8 A;  4Z89 A;  2D8J A;  1BU1 A;  1UG1 A;  2KYM A;  3U23 A;  2RQR A;  4CC4 B;  1E6H A;  2CSI A;  5I11 A;  2O88 A;  5ECA A;  3UF4 A;  2ED1 A;  1K4U S;  1W6X A;  2LJ1 A;  1YWP A;  5IXF A;  4HVU A;  4F17 A;  1WX6 A;  1WYX A;  1QCF A;  2J6F A;  1KIK A;  4JJC A;  2D1X A;  1K0X A;  3QWY A;  2P4R A;  2L0A A;  4JJB A;  1PWT A;  1UDL A;  2CSQ A;  1K0S A;  3H0F A;  2KR3 A;  2D0N A;  2YUN A;  1GFD A;  1E6G A;  1AEY A;  2DL3 A;  1VYT A;  2FEI A;  2DBM A;  1GFC A;  2KRO A;  3REB B;  4LN2 A;  2DF6 A;  4RTT A;  4LUD A;  1PRL C;  2BZ8 A;  3GBQ A;  1PKS A;  1A0N B;  1ZUU A;  2JTE A;  3IQL A;  2MIO A;  3REA B;  2AZS A;  1B3Q A;  4DEY A;  2X3X D;  4OML A;  2H8H A;  2RN8 A;  2B86 A;  1Z9Q A;  1UHF A;  3VS1 A;  3LH5 A;  2LMJ A;  2JT4 A;  1QWE A;  1Z9Z A;  1NEG A;  1BK2 A;  4E6R A;  2YUP A;  1UHC A;  1V1C A;  2F2X A;  1G2B A;  1SRL A;  1WA7 A;  2LNH B;  2FPD A;  3CQT A;  2C0T A;  3H0I A;  4RTY A;  4AFU C;  1SSH A;  2RPN A;  5HCK A;  5GJW B;  1TUC A;  4ZNX A;  1B07 A;  1M8M A;  4JPB W;  1SHF A;  1TG0 A;  3EG3 A;  1KSW A;  2LJ0 A;  1PNJ A;  2DNU A;  2YUQ A;  1X27 A;  2I0N A;  2GNC A;  2FG0 A;  2HSP A;  5IXB A;  3M0R A;  2LJ3 A;  1GBR A;  1SPK A;  2LQN A;  1AZE A;  1ABO A;  4F14 A;  1QWF A;  1ABQ A;  2EKH A;  1RI9 A;  2FRW A;  4X1V A;  1HJD A;  3I9Q A;  5FW9 A;  4J9I A;  2O31 A;  5IHI A;  1SHG A;  2K9G A;  4IIO A;  3KFV A;  1RLP C;  1AWW A;  2DL5 A;  2JW4 A;  1IO6 A;  1YP5 A;  4A63 B;  2JM9 A;  4CC7 A;  2HEQ A;  1TUD A;  4J9H A;  4HCK A;  2DVJ A;  2JMC A;  3VS2 A;  2EYZ A;  4D8K A;  1M27 C;  2V1R A;  2JXB A;  2V1Q A;  1X2K A;  4HVV A;  2EW3 A;  2LQW A;  2RF0 A;  2MCN A;  1NYF A;  2GBQ A;  1X6G A;  4KRT A;  4RTU A;  2FPE A;  3C0C A;  2CT3 A;  1H8K A;  2GGR A;  4J9G A;  1OPL A;  2YDL A;  1J3T A;  1Y57 A;  4OMQ A;  2YT6 A;  2EPD A;  3A98 A;  1QLY A;  1GCP A;  5L23 A;  3M0Q A;  1HD3 A;  3TSW A;  4LNP A;  3NMZ C;  1PRM C;  4AFZ C;  4AG2 C;  3QWX X;  1M30 A;  2KNB B;  1YNZ A;  1X6B A;  1GBQ A;  2J6O A;  4AFS C;  4RTV A;  3EG0 A;  3TVT A;  1ZUY A;  5IH2 A;  4HVW A;  2NWM A;  3VS3 A;  2C0I A;  2KRN A;  2DE0 X;  2HDA A;  1JO8 A;  1K9A A;  2OAW A;  2DJQ A;  5IHK A;  2AKL A;  2A28 A;  2MOX A;  1VYU A;  2DIL A;  2ECZ A;  2IIM A;  3NHN A;  1NEB A;  5FWC A;  2W0Z A;  1SRM A;  1OPK A;  4OMN A;  1PKT A;  2RQW A;  2KBT A;  1GRI A;  2AK5 A;  2AKK A;  2GQI A;  1VA7 A;  1WDX A;  4JZ3 A;  1K76 A;  3NPF A;  2X3W D;  2ESW A;  1NG2 A;  2CDT A;  2GTO A;  2GTJ A;  2RMO A;  1BB9 A;  1H92 A;  1UEC A;  1AD5 A;  2K6D A;  2QDL A;  1E7O A;  3R6N A;  2LP5 A;  1JEG A;  1JXO A;  2EYW A;  1HSQ A;  1ZX6 A;  2FPF A;  5FWB A;  3VRZ A;  4CC3 A;  2RQT A;  1I0C A;  2EGE A;  1QKX A;  3I5R A;  2E5K A;  2K3B A;  1FMK A;  4Z88 A;  2DA9 A;  1UE9 A;  1MUZ A;  4J9C A;  2ABL A;  2DL8 A;  1NLP C;  1T0H A;  1KFZ A;  2L3Q A;  2O2O A;  4WCI A;  1EFN A;  2XMF A;  2DMO A;  2YSQ A;  2DLP A;  1U5S A;  1WI7 A;  1ARK A;  2CRE A;  3I5S A;  4QT7 A;  3VRY A;  1VYV A;  2RNA A;  1U06 A;  2M51 A;  2VWF A;  3M0U A;  5EC7 A;  2C0O A;  2KXC A;  2KRS A;  2G6F X;  2LCS A;  1LCK A;  2EBP A;  2W10 A;  1GCQ C;  2HCK A;  4OMP A;  1RUW A;  4R0K A;  3THK A;  3UAT A;  1MV0 B;  1AVZ C;  4JZ4 A;  4LE9 A;  4J9D A;  1UTI A;  1H3H A;  2FRY A;  2PNI A;  2ENM A;  1SEM A;  2K7A A;  4RUG A;  1YWO A;  2M0Y A;  3H0H A;  4D8D A;  1X69 A;  1AOJ A;  1QKW A;  2EQI A;  1W70 A;  1ZUK A;  1W1F A;  2EYX A;  4J9F A;  4Y92 A;  3VS0 A;  2RQU A;  4IIM A;  1T3S A;  4EIK A;  1X2Q A;  4GBQ A;  3NGP A;  2J05 A;  1UFF A;  4AFQ C;  1FYN A;  3VS7 A;  2A08 A;  4JJD A;  4J9B A;  1KJW A;  2JMA A;  2O9S A;  1XOV A;  2F2V A;  2J6K A;  1I07 A;  4OMO A;  4Z8A A;  3H41 A;  2J7I A;  3VS4 A;  1NYG A;  4RTW A;  1OV3 A;  4CC2 A;  2F2W A;  3FJ5 A;  2VVK A;  2ROL A;  2BZY A;  1CKB A;  1I1J A;  1GCQ A;  5GJV B;  4LUE A;  2K79 A;  1Y0M A;  1UGV A;  2L2P A;  4RTZ A;  1U3O A;  4ESR A;  1OOT A;  2DBK A;  1G83 A;  2YUO A;  3M0P A;  2CUD A;  2A37 A;  1YCS B;  2DRK A;  2CUB A;  3EG1 A;  2OI3 A;  3SEM A;  2BZX A;  2K2M A;  2DM1 A;  3VS6 A;  2D8H A;  2LZ6 B;  2RQV A;  1AWX A;  1M3A A;  4GLM A;  4AG1 C;  1WXT A;  2EGC A;  2CH4 W;  2CT4 A;  4J9E A;  3SHW A;  1N5Z A;  1YN8 A;  1CSK A;  2AZV A;  2FO0 A;  2JS0 A;  2PZ1 A;  1OEB A;  2EVR A;  2KT8 A;  1JQQ A;  2DL4 A;  2SEM A;  2KGT A;  1JXM A;  1AZG B;  1RLQ C;  2ROT A;  2L3P A;  1M3C A;  5IHN A;  1UJY A;  2KEA A;  2O9V A;  2KXD A;  2KRM A;  1ZBJ A;  3PVQ A;  3ULR B;  5I22 A; 
#chains in the Genus database with same CATH topology
 2DO3 A;  3JV3 A;  2LX7 A;  3OYC A;  3J80 E;  3OS2 A;  1ZSG A;  5FRM A;  5CVI A;  3PVL A;  1V76 A;  2HQH A;  4JRI A;  4QQG A;  5HK0 A;  3EGX A;  2DYB A;  2XKO C;  2WSC E;  1PHT A;  3CC2 A;  3HFO A;  4RTX A;  4C5H A;  1WHJ A;  3GP8 A;  2EFI A;  1WHK A;  6AT1 B;  2KE9 A;  1VQM Q;  2QI2 A;  5I2M A;  1YHQ A;  3E9F A;  3QXE B;  1AWJ A;  3ZL7 C;  4M7D A;  2MWO A;  1S72 A;  2DRM A;  3EG9 B;  2RJC A;  1YJN A;  1KHI A;  2DVE A;  1Q86 U;  4M4Z A;  2E12 A;  1WQW A;  2KT1 A;  1VQ4 T;  2CH4 A;  3G71 Q;  4ORZ A;  2D8J A;  2FYK A;  2RQR A;  3NFC A;  2JTF A;  1C6V X;  3PTA A;  1X6O A;  2O88 A;  3OW2 A;  3GOX A;  5LJ3 e;  5ECA A;  1JJ2 P;  1W6X A;  3AT1 B;  1WYX A;  2P84 A;  2XDD A;  2J6F A;  2YLB A;  1MMN A;  2DXC A;  4JJB A;  5GAM j;  3JCM P;  2WSE E;  1I81 A;  3VYG A;  4MML A;  4V2S A;  2V8J A;  4J7F A;  1IRE B;  1LVK A;  2DL3 A;  2C06 A;  1GFC A;  4EMK B;  1YFN A;  2XD0 A;  5CKD A;  3M9Q A;  3BW1 A;  2Y90 A;  2CP5 A;  5IAY A;  1ZSZ B;  2BZ8 A;  1D09 B;  1YJ9 Q;  4F7U A;  2JTE A;  3OY9 A;  1WHL A;  1D3B B;  2HL5 C;  3M4G A;  2X3X D;  4PJJ A;  1AHJ B;  1M5Q 1;  2AT1 B;  1QCO A;  4XTX A;  1ZA1 B;  2K2V A;  3E19 A;  3EFS A;  3VYH B;  2LNH B;  2F69 A;  2FPD A;  3CQT A;  2ZGW A;  1EX4 A;  4Y28 E;  1WJR A;  1TUC A;  1OI1 A;  2CKK A;  2PVG B;  3MCA B;  1Q82 C;  1PNJ A;  3HTR A;  2I0N A;  1QVF A;  2FG0 A;  4OB1 B;  1IHV A;  5IXB A;  3M0R A;  2RHX A;  4BD3 A;  4B9W A;  2LJ3 A;  4RG8 A;  1QMC A;  1SPK A;  2LQN A;  4LD6 A;  2QAS A;  1ABO A;  5AYF A;  4F14 A;  4N0A C;  4X1V A;  3OYE A;  1PSF A;  3CCJ A;  5LJ3 d;  1KQS A;  3CPW S;  2PQW A;  1TWB A;  5IHI A;  3MEA A;  5GAN 8;  2YLC A;  4RMO A;  3CC7 Q;  3C12 A;  3KFV A;  3FB9 A;  1RLP C;  2X9H A;  3JCM Q;  5GAN 7;  2JW4 A;  1IO6 A;  3JCM J;  3QDF A;  3LWI A;  1M2V B;  2BIV A;  3CMA Q;  1YIT A;  4M7A F;  2V1R A;  2QAZ A;  4QW2 A;  4AMC A;  3QDR B;  2RHZ A;  3C4S A;  3RKY A;  4MDW A;  2EW3 A;  3MJX A;  1MMD A;  1G5V A;  4LDU A;  2FPE A;  2CT3 A;  4OMF B;  5LJ5 d;  2GGR A;  2M9U A;  3CC4 Q;  1WHH A;  2KDS A;  4J9G A;  2YDL A;  1WGS A;  3D7S B;  1GCP A;  1HD3 A;  4QQD A;  5GAO n;  1Q81 R;  4XK8 E;  2JOY A;  3ZEH A;  4AG2 C;  5L8R E;  1VQM A;  2E64 A;  1M30 A;  2KNB B;  3OYG A;  4M7A B;  2JZ2 A;  3CC2 T;  3JB9 D;  4A4F A;  2IG0 A;  2XDB A;  3OBW A;  2C0I A;  1C1A A;  4OP0 A;  1PG5 B;  2VC8 A;  2DJQ A;  3PFS A;  1KD1 C;  2GQV A;  3NHN A;  1YHQ T;  4OMN A;  1BYM A;  5FRO A;  1HK9 A;  1AT1 B;  5CKB A;  4QVD A;  2QQS A;  4EMK A;  4FYY B;  4JZ3 A;  4E7S A;  2RA2 A;  1NJI R;  2P0P A;  2COZ A;  4ANJ A;  1Y96 A;  3X24 B;  2CDT A;  1YJN T;  3NTH A;  2GTJ A;  2WAC A;  1BB9 A;  3QII A;  4PKC C;  4BUG A;  1ZSZ A;  1UEC A;  4KT0 E;  4B6M A;  5GMK h;  3J81 E;  2LP5 A;  3MKD A;  4FT4 A;  1ZX6 A;  4PJO D;  1I4K 1;  5FWB A;  2RQT A;  2EGE A;  1QKX A;  2MI6 A;  3I5R A;  2K3B A;  2YRD A;  4ZGE B;  2DA9 A;  1QVG S;  3QPH A;  4J9C A;  3RKX A;  1T0H A;  5GAN 5;  1EFN A;  4M78 D;  4M7A G;  1KQ1 A;  3OYL A;  1JJ2 S;  4C92 F;  5HKC A;  2HD0 A;  3V7S A;  3CXC S;  1VQL Q;  3MO8 A;  4L59 A;  4E7J A;  3QJ6 A;  2YWW A;  3CCE Q;  3FEO A;  2C0O A;  2A7Y A;  1KC8 U;  4IUP A;  2LCS A;  1LCK A;  3S3O A;  2DK3 A;  1RUW A;  1M9S A;  5GAO q;  1AVZ C;  3C94 A;  2DTO A;  4ZTF A;  3PMT A;  3QZ5 B;  4JZ4 A;  3CCV Q;  4LE9 A;  4J9D A;  3CD6 Q;  1EZZ B;  2GCX A;  1KHC A;  2M0Y A;  4BI3 A;  1JBM A;  2EJ9 A;  1VUB A;  1TH7 A;  3MEW A;  1X69 A;  2EJG A;  2JVV A;  4N4I A;  4C92 B;  2XHC A;  1M1G A;  1W1F A;  4J9F A;  5FU7 C;  1M2V A;  2GFA A;  4NL3 A;  3G4S Q;  5A0L A;  1UFF A;  4JS5 A;  4JUV A;  1D1C A;  4J9B A;  3A8G B;  1MHN A;  4QVZ A;  1UB4 A;  2RHI A;  2JMA A;  1RAA B;  4J8O A;  4WF2 A;  4EPC A;  1I07 A;  4Z8A A;  2J7I A;  3SFM A;  4J6Y A;  3JB9 J;  2XG8 D;  1GCQ A;  1FMV A;  1M90 R;  1BIB A;  4JJN K;  1XTD A;  2L2P A;  1XNI A;  4OB2 B;  2YUO A;  5FU7 B;  3CME Q;  3CC7 A;  4M77 D;  4OGE A;  2MK5 A;  2A37 A;  1YCS B;  3M57 A;  2EQU A;  3V7C A;  3JB9 I;  2RHY A;  5AT1 B;  2COW A;  5DM7 R;  1VQ9 A;  3CCJ T;  4BY6 B;  4M7A A;  4XTW A;  2HAX A;  2D8H A;  1DJ7 B;  3VKI A;  2RQV A;  1M3A A;  3V8J A;  1WXT A;  4C92 G;  3CMA A;  2GF7 A;  3WVE B;  2CH4 W;  2CT4 A;  4J9E A;  3FLG A;  1N5Z A;  1VQ5 Q;  2XIC A;  5KYN A;  3PNW C;  1U8R A;  4M7D C;  1M8V A;  4KUD K;  1PD0 A;  2EVR A;  3EFO B;  4ZN3 A;  2KGT A;  1VQO Q;  1JXM A;  4PFP A;  3X26 B;  3F70 A;  2KMT A;  4M75 C;  1YIT T;  2ROT A;  2L3P A;  2X51 A;  5IHN A;  2KEA A;  2OTL T;  1SSF A;  1ZHI A;  2KRM A;  1WXU A;  1M4Z A;  2NUT B;  3ULR B;  5LJ3 j;  5I22 A;  2RI2 A;  2EYQ A;  4FYX B;  3PT9 A;  4HT8 A;  1KK7 A;  3PE0 A;  3CCU A;  1BKB A;  1T0J A;  4GLK A;  2ED0 A;  1VQ8 Q;  3MEV A;  5GAN 6;  3V8L A;  1YI2 Q;  5GMK i;  4HCB A;  2DD5 A;  2LRQ A;  3HP9 A;  4F16 A;  4PNO A;  3L2R A;  3CCQ A;  5GAN 3;  2OAU A;  5GAM f;  5GAO r;  3E2U A;  2VKN A;  4O6J A;  5LJ5 j;  3EG2 A;  2NLU A;  4C8Q F;  2HBW A;  3HRS A;  1WIE A;  1KD1 R;  4M7D E;  3JCM f;  3VS5 A;  1K73 R;  3RBB B;  1M3B A;  2OJ2 A;  2P0K A;  4FSS A;  2EYY A;  1T3L A;  1PM3 A;  2A36 A;  4M75 E;  2OTJ A;  1GL5 A;  1TUG B;  3X28 B;  4IUR A;  2MWP A;  3UA6 A;  2KYB A;  2DL7 A;  4Z02 A;  2EQK A;  5CO7 A;  3M0T A;  3EFR A;  1N8R C;  2PUK B;  4C92 A;  2KYM A;  4CC4 B;  4ELY C;  1E6H A;  3I56 Q;  2ZPI B;  4DBH A;  3CCM A;  1RAB B;  1M1K C;  4QVC A;  3UF4 A;  5CKF A;  4R55 A;  5IXF A;  1Q82 U;  1QCF A;  4C8Q B;  3OS1 A;  2DET A;  2RJE A;  1VQ6 A;  4JJC A;  3CCE A;  3CPW P;  1D1A A;  2R5M A;  2CZ7 B;  3I55 Q;  1PWT A;  1UDL A;  4JRK A;  3M59 A;  1VQP Q;  4F7U B;  2QG9 B;  1PC0 A;  3CD6 A;  4O5V A;  4XTU A;  4LN2 A;  2CGH A;  2E4H A;  2DF6 A;  4RTT A;  4LUD A;  4JS4 A;  3LX7 A;  4OF1 A;  3CCR Q;  4A53 A;  2MIO A;  4II1 A;  5GAM h;  4KUL A;  2BE7 D;  4OML A;  2RN8 A;  2X35 A;  4HCC A;  4BI8 B;  1Z9Q A;  3G4S A;  4F7U E;  5KCH A;  4LDV A;  2JT4 A;  1QWE A;  1WNL A;  4C5E A;  2YUP A;  3JCM h;  1G2B A;  2D9T A;  2QA4 Q;  2E3I A;  4OB3 B;  2E6N A;  3H0I A;  3EFO A;  1YJW Q;  4Q5W A;  3OYI A;  1G8X A;  4AFU C;  3OS0 A;  1Q81 C;  2ZCF B;  4C8Q G;  4ZNX A;  1RAI B;  2EQM A;  3EG3 A;  1BI1 A;  3S6W A;  2DNU A;  3QJY A;  1X27 A;  2QQR A;  2DZC A;  2GNC A;  3DB4 A;  1W2B P;  4J7I A;  2NUT A;  3SWN B;  1GBR A;  4F7U G;  3CME A;  1BCM A;  2QK0 A;  1QWF A;  3KBG A;  1ABQ A;  2EKH A;  2FRW A;  3RIR A;  1OU8 A;  1R0B G;  1VQ7 A;  1HJD A;  2K4Y A;  2QQ9 A;  2L5Q A;  3X20 B;  1FXX A;  3OYY A;  4NOY A;  1SHG A;  3CCL Q;  5M9O A;  3CC7 T;  4IIO A;  2EJF A;  1VIF A;  3HRU A;  1NJI C;  4A63 B;  2CP0 A;  1VQ9 T;  1N9S A;  3LYI A;  4HCZ A;  2JM9 A;  4J5Y A;  5FRN A;  1TUD A;  1X01 A;  2DVJ A;  2PVO B;  3QUI A;  3CMA T;  2V26 A;  5CKE A;  4D8K A;  2PU9 B;  4KGX B;  2O4X B;  1X2K A;  3RDV A;  2LQW A;  2RF0 A;  4LXC A;  4EMK C;  1QVG P;  2CZ0 B;  2AIR B;  3OMG A;  3E9G A;  1KG1 A;  4RTU A;  2E3H A;  5GAN e;  4RCC A;  3CXC P;  1WHG A;  2MF2 A;  1OPL A;  1J3T A;  4JDS A;  1ZSZ C;  4OMQ A;  1OYX A;  4ZN1 A;  4HKE A;  4LNP A;  1TS9 A;  3G7Z A;  1XQH A;  2DTH A;  1VQ8 A;  4KH1 B;  5CQX A;  5KYU B;  4AFZ C;  1G3Y A;  3M54 A;  1YNZ A;  3CCU T;  1QVF S;  1GBQ A;  2J6O A;  4AFS C;  3EG0 A;  2F1L A;  1BCO A;  3TVT A;  2QGG A;  4C8Q A;  4HVW A;  1K9M R;  2VYT A;  3MHX A;  1UGP B;  3MP1 A;  1G3T A;  1Y96 B;  1JO8 A;  1K9A A;  2OAW A;  1LJO A;  4JRP A;  8AT1 B;  5LJ5 e;  2AKL A;  1NPR A;  1VYU A;  2DIL A;  2ECZ A;  2IIM A;  3CCQ T;  2W0Z A;  1SRM A;  4E7Z A;  1KQS S;  2RQW A;  2KBT A;  2LT4 A;  3WXM B;  4A4K A;  5GAM g;  3HSB A;  2QEX Q;  4R56 A;  2VAS A;  2GQI A;  1WDX A;  4XQ3 A;  2LC4 A;  2P0Q A;  1K76 A;  1U1T A;  2L3R A;  3NPF A;  4PL6 A;  2ESW A;  2LX9 A;  1BIA A;  3JCM g;  5KE3 A;  3PMI A;  2F5K A;  2OTJ T;  1AD5 A;  2QDL A;  1E7O A;  2QDY B;  2YXY A;  5D7U A;  1JEG A;  1JXO A;  3M56 A;  1HSQ A;  4CC3 A;  3VRZ A;  3OYH A;  2EKO A;  1N8R R;  2M1H A;  3GNG A;  2E5K A;  3FJP A;  1M90 C;  1UE9 A;  1NLP C;  1Q7Y U;  4X9D A;  5KH6 A;  1MNE A;  2NUP B;  2XMF A;  1M1K R;  3CCM T;  1U5S A;  3V7R A;  1WI7 A;  1ARK A;  3QSU A;  1RAG B;  2E1H A;  1VYV A;  1N27 A;  2VWF A;  5J3B A;  5EC7 A;  1VQ6 T;  2O01 E;  3QBY A;  2KRS A;  5GAN d;  3OYD A;  3GPL A;  2EBP A;  2W10 A;  1BI0 A;  3SWN A;  1GCQ C;  3THK A;  2CP2 A;  2VB6 A;  3OQ5 A;  3CCR A;  1N9R A;  2FRY A;  2FZG B;  2K7A A;  1SEM A;  5DLQ E;  3H0H A;  2HBP A;  1QKW A;  4XU3 A;  4M7A C;  2HKN A;  1H64 1;  1W70 A;  1B7T A;  3EAE A;  1XJW B;  4EIK A;  4ZTJ A;  3G4S T;  4N4G A;  4IUV A;  3O8V A;  4AFQ C;  1VQ4 Q;  2O4X A;  2QTV A;  2J6K A;  3CEY A;  3H41 A;  2I2L A;  1OV3 A;  1JRI A;  2ZPH B;  2F2W A;  2FHD A;  3HL8 A;  5LJ3 f;  2L8D A;  2ROL A;  2BZY A;  1I1J A;  2KQW A;  1W2B S;  1ZQ1 A;  3R6O A;  3HFN A;  1Y0M A;  1UGV A;  1U3O A;  4ESR A;  1WHM A;  2DBK A;  3CCL A;  3CPW A;  2CUD A;  4E7H A;  3Q1J A;  3C95 A;  3OYN A;  5KYU A;  2DRK A;  1K73 C;  1VQ7 T;  2HQX A;  4EMG A;  2BZX A;  2KSS A;  4F04 B;  3VS6 A;  2FZC B;  2LZ6 B;  5I21 A;  1AWX A;  1PCX A;  1S72 T;  2EGC A;  4M7A E;  3SHW A;  3TU4 K;  4KUI A;  2XID A;  5HK3 A;  2VV5 A;  3G71 A;  5LJ5 f;  2K5F A;  2PZ1 A;  3INZ A;  3J7A F;  1JQQ A;  5D6Y A;  1Q86 C;  4NL2 A;  2V8I A;  1GXI E;  1TOV A;  1AZG B;  4ELZ C;  5KYY B;  3ZFJ A;  1M3C A;  2LCL A;  2O9V A;  4M7D D;  1YIJ Q;  3QYG B;  2A3L A;  1ZLM A;  4M75 D;  2XK0 A;  3SD4 A;  4K11 A;  4C92 C;  3FIF A;  1UJ0 A;  2R58 A;  1QW1 A;  2NUZ A;  4E7L A;  5CKH A;  1ZA2 B;  3M0S A;  3LH0 A;  2LT1 A;  3FC3 A;  2NUP A;  4IKF A;  1I5O B;  2DPP B;  3L1A A;  2EGA A;  4PFZ A;  5LJ3 h;  2X4W A;  4A4E A;  2SRC A;  4DBR A;  1YJ9 A;  2DX1 A;  1FMW A;  3UT1 A;  4XAX B;  2DIG A;  3G1J A;  1ZBX A;  3EGU A;  1Y07 A;  3CBO A;  2ZPB B;  3JB9 H;  2RK2 A;  2E10 A;  4PLI A;  1X43 A;  2MAM A;  1WLP B;  2RH2 A;  1WXB A;  9ATC B;  4X34 A;  4BY6 C;  2PTK A;  1MV3 A;  4FM4 B;  3MPU B;  3TQ7 P;  1UG1 A;  1LNX A;  5LJ5 h;  3HPW A;  1Q81 U;  3OW2 P;  2LTO A;  2PVD B;  4C92 E;  5I11 A;  1TU0 B;  2VUB A;  2JNG A;  2DTI A;  2LJ1 A;  1JJ2 A;  4HVU A;  2B8A A;  3JB9 F;  1WX6 A;  2DXB A;  3CXC A;  1KIK A;  2D1X A;  2RM4 A;  5HY6 A;  2LCC A;  3QKJ A;  1W4S A;  4A54 A;  2CP3 A;  1FX7 A;  2P4R A;  3CBP A;  4QQ6 A;  2HZY A;  2DXT A;  3H0F A;  2DEQ A;  1K8A R;  3GIB A;  2YUN A;  1GFD A;  3NTK A;  1E6G A;  3OA6 A;  1R8O B;  2FEI A;  4FW2 A;  3CC2 Q;  2KRO A;  3OB9 A;  4EDU A;  1IHW A;  3JAM E;  1NJI U;  4C0D B;  2D6F A;  2Z0W A;  1PRL C;  1VOM A;  3GBQ A;  3OSV A;  2ZAE A;  1VQK Q;  1A0N B;  1ZUU A;  3REA B;  3EH1 A;  4PJO F;  4DEY A;  2K57 A;  3VUB A;  3CC4 A;  1UHF A;  2LMJ A;  4ME7 A;  1Z9Z A;  1NEG A;  3A8O B;  1UHC A;  1TSF A;  1V1C A;  3LGL A;  1SRL A;  1YJN Q;  4M78 F;  5GAN j;  2C0T A;  4RTY A;  2ATC B;  4M75 F;  1M2O A;  5HCK A;  5GJW B;  3M4Y A;  3DLM A;  2K3X A;  5GAN 2;  1M8M A;  2EWN A;  3EGD B;  3OMC A;  4JPB W;  5KYY A;  4AT1 B;  1QVF P;  3GF5 A;  1OU9 A;  2LJ0 A;  3HKS A;  2RD1 A;  3A5Z B;  2HSP A;  2R5A A;  4PJM A;  3ASK A;  2IVW A;  1K9M C;  1VQM T;  4PJO B;  3DLL A;  5LJ3 g;  4C5G A;  2K5L A;  4FCY A;  3I9Q A;  5A2Q E;  1KQS P;  4PK4 A;  2FB7 A;  4J9I A;  2O31 A;  3CCL T;  2K9G A;  1MGQ A;  4CRI A;  1R0C B;  3JB9 G;  4C8Q C;  2CZ1 B;  4MZM A;  1V29 B;  4JRQ A;  1OX9 A;  4CC7 A;  5DY9 A;  2HEQ A;  4HCK A;  3VS2 A;  2EYZ A;  3HRT A;  1M27 C;  4HT9 A;  3G71 T;  2CP7 A;  1Q86 R;  5D6X A;  1YIJ A;  4HA8 A;  5LJ5 g;  2JN0 A;  2QTX A;  1X6G A;  1SKU B;  1VQL A;  2LNV A;  5CQY A;  3OBY A;  1Y57 A;  2YT6 A;  1QLY A;  1LPL A;  1M90 U;  4ATO A;  3M0Q A;  3VUZ A;  1IRX A;  2M0O A;  4PJO G;  4M77 F;  7AT1 B;  4E47 A;  5KYX B;  3G6E Q;  3OYJ A;  1RAE B;  2K5I A;  3OSS C;  3QWX X;  5GAO l;  3CCV A;  4CI0 C;  3ER0 A;  2ZPF B;  3VS3 A;  4C8Q E;  2DE0 X;  2HDA A;  4E7I A;  2MOX A;  4FT2 A;  1NEB A;  2E65 A;  1YJ9 T;  4KH0 B;  3E1S A;  1PKT A;  3SWN C;  1GRI A;  3CCJ Q;  3H8Z A;  2JTM A;  2HSE B;  2AKK A;  5CR2 A;  3V8K A;  4M77 B;  4BI4 A;  5CCA A;  2EAY A;  4EMH A;  4DQ2 A;  1WQ7 A;  3RES A;  1PD1 A;  5FU6 B;  3L2W A;  2L89 A;  3BDL A;  1VQN Q;  4LD9 K;  2QQB A;  3P8B B;  2RO0 A;  1YIT Q;  2EYW A;  2FPF A;  1HYO A;  1I0C A;  2DER A;  4DOV A;  1FMK A;  4Z88 A;  4KBM B;  3X25 B;  2OTL Q;  1MUZ A;  2ABL A;  2DL8 A;  3L2Z A;  2KI7 A;  2L3Q A;  3OYA A;  1O9S A;  3ME9 A;  3OW2 S;  3CPF A;  3M5A A;  1WJS A;  2DLP A;  1OUL A;  1OZ2 A;  4OVA A;  2KVQ G;  3VRY A;  5C0M A;  3M58 A;  5GAO p;  1U06 A;  3EGD A;  2M51 A;  1N6A A;  3M0U A;  1UEB A;  2KXC A;  1Q7Y R;  2VGM A;  3SB2 A;  1SG5 A;  2ZPE B;  4OMP A;  1VQ5 A;  4R0K A;  1KD1 U;  3UAT A;  1H3Z A;  1MV0 B;  1K73 U;  3M55 A;  4J6W A;  4PJO A;  2V8K A;  5GMK e;  1KQ2 A;  1H3H A;  4M77 G;  1VQK A;  2CYZ B;  2ENM A;  1VQO A;  3VV0 A;  4RUG A;  1IGU A;  4ZGD B;  2M02 A;  1MMA A;  3RMS A;  4M78 A;  2MMP A;  5LL6 S;  3OS5 A;  2EQI A;  4M75 A;  5CIU A;  2FZK B;  3PGG A;  3FDR A;  1ZUK A;  4X9C A;  3CCS Q;  2DD4 A;  1Y7X A;  2EYX A;  4Y92 A;  4MDX A;  4KGV B;  3CC4 T;  1X2Q A;  4N4H A;  3NGP A;  1VIE A;  2A08 A;  4JJD A;  4M7A D;  4GY5 A;  4L6V 5;  1LOJ A;  2H3E B;  5A0G A;  2O9S A;  1XOV A;  3GNF B;  2F2V A;  1YI2 A;  1NYG A;  4RTW A;  2QQA A;  1D0Y A;  3L2U A;  5GJV B;  4LUE A;  5CK9 A;  2K79 A;  2DZ9 A;  5IN1 A;  2XU8 A;  4RTZ A;  4E7K A;  2EIF A;  2BUD A;  5KYX A;  4L5G A;  1I5L A;  5EG2 A;  3EG1 A;  2OI3 A;  2K2M A;  2QYZ A;  2DM1 A;  2QXF A;  4C0Z A;  2RJD A;  4AG1 C;  1RL2 A;  2A0F B;  3RMQ A;  2E5Q A;  3QZ9 B;  4PFO A;  2AZV A;  2JS0 A;  1OEB A;  2KT8 A;  2YRC A;  2DL4 A;  2SEM A;  2FVU A;  3I56 A;  3MP6 A;  5FLX E;  1OZ3 A;  4DBQ A;  4M77 A;  1UJY A;  2PUO B;  3FRN A;  2KXD A;  1YIJ T;  1F1B B;  3G6E A;  3JCM W;  3I55 A;  1CKA A;  4RKU E;  1QP3 A;  3UA7 A;  1VQL T;  3S3N A;  3OYF A;  2BTT A;  1VQP A;  3P8H A;  3JCM b;  1WFW A;  4OMM A;  2J06 A;  3CCE T;  5IT9 E;  1K8A C;  2X4X A;  2DYI A;  3JCM X;  4OB0 B;  1BI3 A;  4PJN A;  3JCM c;  3I35 A;  1OQK A;  2DKG A;  3QO3 A;  3CCV T;  2L3S A;  4C92 D;  4DEX A;  3CD6 T;  2ZPG B;  1S1N A;  4IUT A;  1KC8 R;  4FIB A;  1NM7 A;  3L2Q A;  3PIP A;  1B34 B;  3RNJ A;  1NLO C;  2RJF A;  1K1Z A;  2JS2 A;  1UUE A;  1JB0 E;  3KUF A;  5CAI A;  1PSE A;  1AWO A;  2QA4 A;  3JRZ A;  2HMA A;  3N5B B;  3EHR A;  1VQ9 Q;  3O5Z A;  1YJW A;  1VQN A;  4XU1 A;  2VXF A;  2JUF A;  2RB6 A;  2RHU A;  2BKD N;  3EHQ A;  4HXJ A;  3OYK A;  5A0D A;  3TSZ A;  1JU5 C;  1BBZ A;  1OX8 A;  4IUU A;  2F5T X;  2JM8 A;  3EG9 A;  4Z89 A;  2OTL A;  1BU1 A;  4IUQ A;  3LGF A;  1RAF B;  3U23 A;  2CSI A;  2DEU A;  2E70 A;  4WTO B;  3QYH B;  5GAN f;  1MND A;  2ED1 A;  1K4U S;  1YWP A;  3H6Z A;  2AHJ B;  2G3R A;  4YTL A;  4F17 A;  3GLX A;  4XU0 A;  1K0X A;  1IGQ A;  3LW5 E;  3CME T;  1UGR B;  3QWY A;  1K9M U;  2IPO B;  2L0A A;  2KY9 A;  2CSQ A;  1K0S A;  2KR3 A;  2D0N A;  2KAF A;  3CCU Q;  1AEY A;  1VYT A;  2LDM A;  2VXE A;  3UWN A;  2DBM A;  3REB B;  3BE3 A;  2NYS A;  1VQ5 T;  3MEU A;  2X4Y A;  2Y4X A;  3RKW A;  3ZBD A;  4DBF A;  4B9X A;  1PKS A;  3CCQ Q;  1VQK T;  2FL7 A;  3CCS A;  3IQL A;  1VQO T;  3DB3 A;  3JSC A;  2AZS A;  1B3Q A;  4XTV A;  2H8H A;  3RER A;  4BE0 A;  4QKU A;  4XU2 A;  8ATC B;  1RAD B;  1TXQ A;  2B86 A;  3VS1 A;  3LH5 A;  1BK2 A;  4E6R A;  1N8R U;  1I8F A;  2F2X A;  1WA7 A;  4C0F A;  4DOW A;  3AHU A;  1QQJ A;  4XTY A;  2OTJ Q;  4RCB A;  1SSH A;  2RPN A;  1M1K U;  2MPX C;  1D3B A;  1B07 A;  3UDC A;  4UC4 A;  1SHF A;  1TG0 A;  1KSW A;  2YUQ A;  3L2V A;  5GMK m;  3EH2 A;  1VQ8 T;  1W2B A;  2M16 A;  1YI2 T;  1AZE A;  4PLL A;  3CCM Q;  1RI9 A;  4PJL A;  5GAN h;  5GAM e;  5J39 A;  2GFU A;  5FW9 A;  1VQ6 Q;  2QEX A;  1MMG A;  4BDY A;  1WPY A;  3CBM A;  3JCM e;  2XI9 A;  1AWW A;  1X75 C;  2DL5 A;  1YP5 A;  1UGQ B;  4BB7 A;  4JLI A;  3M53 A;  5GAO m;  4J9H A;  1P92 A;  2JMC A;  2DIQ A;  1B34 A;  2JXB A;  2V1Q A;  1BI2 A;  4BDZ A;  1G3W A;  4HVV A;  1QVP A;  4C8Q D;  1NZ9 A;  2MCN A;  1NYF A;  2GBQ A;  1QVG A;  3I56 T;  4KRT A;  1QCN A;  3C0C A;  1H8K A;  4C0D C;  3VU3 C;  2HKQ B;  2LVM A;  2BE9 B;  3MP8 A;  1G3S A;  2EPD A;  3A98 A;  4P5N A;  5L23 A;  4N0A A;  1IXD A;  3TSW A;  3G6E T;  4BAC A;  3NMZ C;  2Y4Y A;  3I55 T;  1Q7Y C;  1PRM C;  4BE1 A;  3A8L B;  1SF9 A;  1VQP T;  1Q82 R;  1YBY A;  1X6B A;  4RTV A;  3TEE A;  3TCJ A;  2EQJ A;  1ZUY A;  5IH2 A;  1U1S A;  2NWM A;  2DAQ A;  5GMK j;  1RI0 A;  2KRN A;  4KGZ B;  2COY A;  2ZZD A;  5IHK A;  2A28 A;  4MZP A;  4LDY A;  3TRE A;  4XTZ A;  2YHT A;  1YHQ Q;  5FWC A;  1VQ7 Q;  3CCR T;  2VGN A;  1OPK A;  4FL6 A;  3MET A;  5J26 A;  5KYW B;  2AK5 A;  1VA7 A;  3HHT B;  4PJO C;  1S72 Q;  5GAM d;  4M7D F;  2X3W D;  2E6Z A;  1NG2 A;  3UPU A;  1VQ4 A;  1WJQ A;  2GTO A;  2QA4 T;  2RMO A;  1YJW T;  1H92 A;  1VQN T;  3JCM d;  4M78 C;  2K6D A;  4MZT A;  3SDZ A;  3R6N A;  4RG2 A;  1QP2 A;  3EGX B;  3OYM A;  3NTI A;  4E2F B;  4LDW A;  3OYB A;  1RAH B;  4J6X A;  3DKM A;  5C6S A;  4FYW B;  1KFZ A;  2O2O A;  4WCI A;  3PIO A;  2DMO A;  2YSQ A;  2CP6 A;  2DXU A;  2CRE A;  3LLR A;  3I5S A;  4QT7 A;  1NBE B;  1D0Z A;  5GAN g;  1IB8 A;  2RNA A;  1D1B A;  2QGF B;  4M7D B;  1ACM B;  2G6F X;  2R57 A;  1IZ6 A;  1NE8 A;  4M78 B;  2WSF E;  3RUX A;  4FSX A;  2RI5 A;  4D6W A;  3S3M A;  2HCK A;  4M75 B;  2D0Q B;  1RAC B;  4ZGJ B;  1TTH B;  4A4H A;  2P4T A;  2DFU A;  1UTI A;  3P8D A;  5KE2 A;  2DJZ A;  2PNI A;  2X4J A;  4PJO E;  3URG A;  1YWO A;  2OX7 A;  4D8D A;  1YCY A;  3BY7 A;  1AOJ A;  2MYS A;  4DA4 A;  1D0X A;  3WVD B;  5GMK l;  2CZ6 B;  3A1P A;  1EIF A;  4M78 E;  4TVR A;  2E41 A;  3L42 A;  3CCS T;  4J83 A;  4OGC A;  4FW1 A;  3VS0 A;  5GAN 4;  2RQU A;  4IIM A;  1T3S A;  4NS5 A;  4GBQ A;  4F7U F;  2J05 A;  3LWH A;  3RR6 A;  5D6W A;  1FYN A;  2KK4 A;  3VS7 A;  2XDP A;  1Q95 G;  3T9N A;  4FYV B;  1KJW A;  1Y71 A;  2RI3 A;  1M1F A;  5I2S A;  4OMO A;  4M77 C;  3VS4 A;  2H3J A;  4M7D G;  2RK1 A;  4CC2 A;  4FU6 A;  3FJ5 A;  3BDU A;  4C5I A;  2HQE A;  2VVK A;  4MMK A;  2CS7 A;  1CKB A;  4M78 G;  5FU6 C;  2HL3 A;  1K8A U;  1C0M A;  2LQ8 A;  1FWZ A;  4M75 G;  4VUB A;  3JCM V;  2HNI A;  1KC8 C;  1OOT A;  1G83 A;  3M0P A;  3KXT A;  4BE2 A;  3A8M B;  5KCO A;  1WZO A;  2CUB A;  2K3Y A;  3SEM A;  3H9N A;  2QEX T;  1R77 A;  4GLM A;  1UGS B;  1YN8 A;  4JLG A;  4A4G A;  3QG1 A;  4Y91 A;  1CSK A;  2FO0 A;  2YRV A;  3BFM A;  1O75 A;  4LDX A;  3VJP A;  2LQK A;  5KYW A;  1RLQ C;  2JJ9 A;  4C0G A;  3QHS A;  1HXD A;  5DLO A;  1NPP A;  1ZBJ A;  3PVQ A;  4M77 E;  3A8H B; 
#chains in the Genus database with same CATH homology
 3JV3 A;  2LX7 A;  1CKA A;  1ZSG A;  1WXU A;  3PVL A;  1ZLM A;  3UA7 A;  2BTT A;  4K11 A;  3PE0 A;  1WFW A;  4OMM A;  2DYB A;  2J06 A;  1UJ0 A;  1PHT A;  2NUZ A;  1T0J A;  2ED0 A;  3M0S A;  4RTX A;  2KE9 A;  3I35 A;  2EGA A;  2L3S A;  4F16 A;  4DEX A;  2SRC A;  2DX1 A;  1S1N A;  1AWJ A;  1NM7 A;  3ZL7 C;  2VKN A;  3EG2 A;  3EGU A;  1NLO C;  2HBW A;  1WIE A;  3RNJ A;  1K1Z A;  2DRM A;  3VS5 A;  3RBB B;  2JS2 A;  1UUE A;  1M3B A;  2OJ2 A;  4FSS A;  1AWO A;  3EHR A;  3O5Z A;  2EYY A;  1T3L A;  1X43 A;  2A36 A;  1GL5 A;  4M4Z A;  3EHQ A;  1WLP B;  4HXJ A;  3UA6 A;  3TSZ A;  1JU5 C;  2KYB A;  2KT1 A;  1WXB A;  2DL7 A;  1BBZ A;  2CH4 A;  2PTK A;  3M0T A;  1MV3 A;  4ORZ A;  2JM8 A;  4Z89 A;  2D8J A;  1BU1 A;  1UG1 A;  2KYM A;  3U23 A;  2RQR A;  4CC4 B;  1E6H A;  2CSI A;  5I11 A;  2O88 A;  5ECA A;  3UF4 A;  2ED1 A;  1K4U S;  1W6X A;  2LJ1 A;  1YWP A;  5IXF A;  4HVU A;  4F17 A;  1WX6 A;  1WYX A;  1QCF A;  2J6F A;  1KIK A;  4JJC A;  2D1X A;  1K0X A;  3QWY A;  2P4R A;  2L0A A;  4JJB A;  1PWT A;  1UDL A;  2CSQ A;  1K0S A;  3H0F A;  2KR3 A;  2D0N A;  2YUN A;  1GFD A;  1E6G A;  1AEY A;  2DL3 A;  1VYT A;  2FEI A;  2DBM A;  1GFC A;  2KRO A;  3REB B;  4LN2 A;  2DF6 A;  4RTT A;  4LUD A;  1PRL C;  2BZ8 A;  3GBQ A;  1PKS A;  1A0N B;  1ZUU A;  2JTE A;  3IQL A;  2MIO A;  3REA B;  2AZS A;  1B3Q A;  4DEY A;  2X3X D;  4OML A;  2H8H A;  2RN8 A;  2B86 A;  1Z9Q A;  1UHF A;  3VS1 A;  3LH5 A;  2LMJ A;  2JT4 A;  1QWE A;  1Z9Z A;  1NEG A;  1BK2 A;  4E6R A;  2YUP A;  1UHC A;  1V1C A;  2F2X A;  1G2B A;  1SRL A;  1WA7 A;  2LNH B;  2FPD A;  3CQT A;  2C0T A;  3H0I A;  4RTY A;  4AFU C;  1SSH A;  2RPN A;  5HCK A;  5GJW B;  1TUC A;  4ZNX A;  1B07 A;  1M8M A;  4JPB W;  1SHF A;  1TG0 A;  3EG3 A;  1KSW A;  2LJ0 A;  1PNJ A;  2DNU A;  2YUQ A;  1X27 A;  2I0N A;  2GNC A;  2FG0 A;  2HSP A;  5IXB A;  3M0R A;  2LJ3 A;  1GBR A;  1SPK A;  2LQN A;  1AZE A;  1ABO A;  4F14 A;  1QWF A;  1ABQ A;  2EKH A;  1RI9 A;  2FRW A;  4X1V A;  1HJD A;  3I9Q A;  5FW9 A;  4J9I A;  2O31 A;  5IHI A;  1SHG A;  2K9G A;  4IIO A;  3KFV A;  1RLP C;  1AWW A;  2DL5 A;  2JW4 A;  1IO6 A;  1YP5 A;  4A63 B;  2JM9 A;  4CC7 A;  2HEQ A;  1TUD A;  4J9H A;  4HCK A;  2DVJ A;  2JMC A;  3VS2 A;  2EYZ A;  4D8K A;  1M27 C;  2V1R A;  2JXB A;  2V1Q A;  1X2K A;  4HVV A;  2EW3 A;  2LQW A;  2RF0 A;  2MCN A;  1NYF A;  2GBQ A;  1X6G A;  4KRT A;  4RTU A;  2FPE A;  3C0C A;  2CT3 A;  1H8K A;  2GGR A;  4J9G A;  1OPL A;  2YDL A;  1J3T A;  1Y57 A;  4OMQ A;  2YT6 A;  2EPD A;  3A98 A;  1QLY A;  1GCP A;  5L23 A;  3M0Q A;  1HD3 A;  3TSW A;  4LNP A;  3NMZ C;  1PRM C;  4AFZ C;  4AG2 C;  3QWX X;  1M30 A;  2KNB B;  1YNZ A;  1X6B A;  1GBQ A;  2J6O A;  4AFS C;  4RTV A;  3EG0 A;  3TVT A;  1ZUY A;  5IH2 A;  4HVW A;  2NWM A;  3VS3 A;  2C0I A;  2KRN A;  2DE0 X;  2HDA A;  1JO8 A;  1K9A A;  2OAW A;  2DJQ A;  5IHK A;  2AKL A;  2A28 A;  2MOX A;  1VYU A;  2DIL A;  2ECZ A;  2IIM A;  3NHN A;  1NEB A;  5FWC A;  2W0Z A;  1SRM A;  1OPK A;  4OMN A;  1PKT A;  2RQW A;  2KBT A;  1GRI A;  2AK5 A;  2AKK A;  2GQI A;  1VA7 A;  1WDX A;  4JZ3 A;  1K76 A;  3NPF A;  2X3W D;  2ESW A;  1NG2 A;  2CDT A;  2GTO A;  2GTJ A;  2RMO A;  1BB9 A;  1H92 A;  1UEC A;  1AD5 A;  2K6D A;  2QDL A;  1E7O A;  3R6N A;  2LP5 A;  1JEG A;  1JXO A;  2EYW A;  1HSQ A;  1ZX6 A;  2FPF A;  5FWB A;  3VRZ A;  4CC3 A;  2RQT A;  1I0C A;  2EGE A;  1QKX A;  3I5R A;  2E5K A;  2K3B A;  1FMK A;  4Z88 A;  2DA9 A;  1UE9 A;  1MUZ A;  4J9C A;  2ABL A;  2DL8 A;  1NLP C;  1T0H A;  1KFZ A;  2L3Q A;  2O2O A;  4WCI A;  1EFN A;  2XMF A;  2DMO A;  2YSQ A;  2DLP A;  1U5S A;  1WI7 A;  1ARK A;  2CRE A;  3I5S A;  4QT7 A;  3VRY A;  1VYV A;  2RNA A;  1U06 A;  2M51 A;  2VWF A;  3M0U A;  5EC7 A;  2C0O A;  2KXC A;  2KRS A;  2G6F X;  2LCS A;  1LCK A;  2EBP A;  2W10 A;  1GCQ C;  2HCK A;  4OMP A;  1RUW A;  4R0K A;  3THK A;  3UAT A;  1MV0 B;  1AVZ C;  4JZ4 A;  4LE9 A;  4J9D A;  1UTI A;  1H3H A;  2FRY A;  2PNI A;  2ENM A;  1SEM A;  2K7A A;  4RUG A;  1YWO A;  2M0Y A;  3H0H A;  4D8D A;  1X69 A;  1AOJ A;  1QKW A;  2EQI A;  1W70 A;  1ZUK A;  1W1F A;  2EYX A;  4J9F A;  4Y92 A;  3VS0 A;  2RQU A;  4IIM A;  1T3S A;  4EIK A;  1X2Q A;  4GBQ A;  3NGP A;  2J05 A;  1UFF A;  4AFQ C;  1FYN A;  3VS7 A;  2A08 A;  4JJD A;  4J9B A;  1KJW A;  2JMA A;  2O9S A;  1XOV A;  2F2V A;  2J6K A;  1I07 A;  4OMO A;  4Z8A A;  3H41 A;  2J7I A;  3VS4 A;  1NYG A;  4RTW A;  1OV3 A;  4CC2 A;  2F2W A;  3FJ5 A;  2VVK A;  2ROL A;  2BZY A;  1CKB A;  1I1J A;  1GCQ A;  5GJV B;  4LUE A;  2K79 A;  1Y0M A;  1UGV A;  2L2P A;  4RTZ A;  1U3O A;  4ESR A;  1OOT A;  2DBK A;  1G83 A;  2YUO A;  3M0P A;  2CUD A;  2A37 A;  1YCS B;  2DRK A;  2CUB A;  3EG1 A;  2OI3 A;  3SEM A;  2BZX A;  2K2M A;  2DM1 A;  3VS6 A;  2D8H A;  2LZ6 B;  2RQV A;  1AWX A;  1M3A A;  4GLM A;  4AG1 C;  1WXT A;  2EGC A;  2CH4 W;  2CT4 A;  4J9E A;  3SHW A;  1N5Z A;  1YN8 A;  1CSK A;  2AZV A;  2FO0 A;  2JS0 A;  2PZ1 A;  1OEB A;  2EVR A;  2KT8 A;  1JQQ A;  2DL4 A;  2SEM A;  2KGT A;  1JXM A;  1AZG B;  1RLQ C;  2ROT A;  2L3P A;  1M3C A;  5IHN A;  1UJY A;  2KEA A;  2O9V A;  2KXD A;  2KRM A;  1ZBJ A;  3PVQ A;  3ULR B;  5I22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...