3SFMA

Novel crystallization conditions for tandem variant r67 dhfr yields wild-type crystal structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
DATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
publication title Novel crystallization conditions for tandem variant R67 DHFR yield a wild-type crystal structure.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3sfmA00
2VV5A 3UDCA 3T9NA 3SFMA 1VIEA 2RK2A 2RK1A 2GQVA 2RH2A 2P4TA 1VIFA 2OAUA
chains in the Genus database with same CATH superfamily
1N9RA 1VQ4Q 2Z0WA 4L5GA 8ATCB 5KCOA 2X4JA 2L3QA 3SD4A 2E6NA 2EFIA 2EQKA 3G71A 2DVEA 3PIOA 3M0RA 3OYYA 1YJNT 3A98A 2F2WA 2J05A 5GAOn 5GAN6 2OI3A 1VIEA 1U3OA 1T3SA 2J6KA 2V8IA 3TU4K 2W10A 2E6ZA 1TUGB 2KRNA 1VQ8Q 3JCMQ 4QT7A 2RI3A 4E7IA 3VV0A 4PLIA 3EH2A 3L2VA 3JCMe 3SB2A 3L2UA 3E9FA 4E2FB 2KMTA 5FRNA 1G3YA 3BW1A 2D6FA 5KCHA 2J06A 2D1XA 1FXXA 3EG1A 1RAHB 4R56A 1BBZA 4RMOA 2QK0A 1MUZA 3OSVA 1D3BB 2JTFA 2NUTB 3EGUA 2DE0X 3J81E 4JS4A 1SSFA 4MZMA 2H3JA 1MMDA 1Y71A 3GNFB 4LDWA 1D1AA 2PVOB 2FZGB 3CCVA 4OGCA 3G4ST 2XU8A 5GAN2 3RIRA 3THKA 3SWNA 3LWHA 2A37A 3CMET 4KULA 3CPFA 2LP5A 5LJ3g 3HFNA 1UEBA 5EG2A 4JJDA 3VS2A 4A4FA 1WQ7A 3X20B 2B86A 2E5QA 3S3MA 3E19A 1PSFA 3SHWA 2RPNA 2VC8A 4N4HA 4O5VA 4QQGA 3EG9B 4ZN1A 3V8LA 1VQLQ 2K3YA 2DXUA 4II1A 1Q81R 3M0PA 5GAMf 1BI3A 3CCLA 2KQWA 2YRDA 1AD5A 1Z9ZA 2CYZB 1NG2A 1XOVA 2GQIA 2RM4A 3AT1B 1QLYA 3BY7A 2A0FB 1TG0A 2YUOA 3SEMA 1ZBJA 5LJ3h 1K0XA 1OZ2A 1R8OB 1D0YA 1WDXA 1ZX6A 1TXQA 2FPFA 3VS1A 1ABQA 4M75C 1M1GA 4XTWA 4X9CA 1UB4A 3FDRA 3JB9I 3EHQA 1QKWA 2E5KA 2PNIA 2XICA 3MEUA 1I81A 2M02A 5GAOp 2IIMA 2YSQA 4QKUA 4E6RA 2HD0A 2EJFA 2D0NA 4J9GA 2OTJT 2O9VA 4M78E 2K7AA 2DIQA 1PWTA 1R77A 1TSFA 3M0TA 2O01E 3M5AA 1PNJA 4M7DF 1YFNA 3RDVA 3G71Q 5HCKA 1SEMA 1X27A 1TUDA 4J83A 3ER0A 2LQWA 2A7YA 3H9NA 4DBRA 2QDLA 2M9UA 3RKXA 2WSCE 1ZQ1A 2XDBA 3CCUQ 1QVFA 2JM8A 1QP3A 3CC7Q 4JLGA 4Z8AA 2VWFA 3H41A 1BKBA 3X28B 4XTZA 3MKDA 2RH2A 4PFPA 2PTKA 4EMKC 2KYMA 3CCMT 2EGCA 3SDZA 2DNUA 5IH2A 1H3ZA 2DYBA 1QWFA 4MZTA 1OEBA 3LGFA 2C0TA 2HL5C 2LNHB 3ZL7C 3OYLA 2DBMA 1W70A 1JO8A 1KHIA 1ZBXA 3FJPA 3HRTA 3JCMW 1V76A 1VQ5Q 2KROA 3MCAB 3CCVQ 4HXJA 2F69A 5HK3A 3OW2S 2ATCB 3M55A 1UGVA 4JJCA 4HT8A 1SRMA 4ZGDB 4LDYA 1WXUA 2VV5A 2DLPA 3CCRT 2DAQA 2KNBB 1MGQA 4CC3A 4M7AC 1QVGA 3NGPA 4M75A 2LX7A 4A63B 1PG5B 3VS3A 4J6XA 5LJ3e 1Q81U 2KY9A 3H0FA 1NZ9A 4E7ZA 2HL3A 3CCLQ 1SHFA 5GANj 1ZSZB 2HMAA 4FT2A 3NPFA 2CP0A 2O2OA 2ZPHB 1NLPC 1PD1A 2KSSA 1WNLA 2ZPGB 5AYFA 1AOJA 4Y28E 4X1VA 4BUGA 4PJNA 2EJGA 4AG2C 1AZEA 1Q7YR 2V8JA 4A54A 2QQ9A 1PHTA 1DJ7B 4EPCA 4PFZA 1EFNA 4RTYA 4ZN3A 2DVJA 2MI6A 2RJFA 4KBMB 3P8HA 1UECA 1Q7YC 1I1JA 2QTXA 1ZUUA 4IUTA 4BACA 1NM7A 4C5EA 3OS5A 2GQVA 1AWJA 2EW3A 4M75G 5GAOr 2LX9A 1Y7XA 1KQ1A 4EMKA 3CCEA 5DY9A 2LNVA 3CPWA 1WA7A 3MJXA 2IVWA 3JV3A 4WF2A 4PKCC 2AZSA 1U1SA 1K1ZA 1RL2A 2ZPEB 4M7DA 4OB1B 4PL6A 1WLPB 3UA7A 2FPDA 1HXDA 2DTHA 4KGZB 1RAAB 1VQ7A 3FJ5A 1BCMA 1X6OA 4JDSA 4CC2A 3CCJA 3KUFA 2DTIA 1A0NB 2P84A 1X6GA 5CK9A 3OYKA 1VQMT 1BIBA 2E64A 3R6OA 2P4TA 1SRLA 1KQSP 4QQDA 2DBKA 4D6WA 5CKFA 2A36A 4LN2A 4XU2A 4J5YA 4RTTA 4M7AA 4OMLA 4FT4A 3VUZA 4M75B 2DERA 2ZPFB 4BE1A 3IQLA 1HK9A 5IT9E 3MHXA 4KH0B 4BD3A 2W0ZA 5DM7R 1OZ3A 8AT1B 4OMMA 3CCRA 4XAXB 3I5RA 1YHQQ 2BZYA 3T9NA 4GLKA 1S72A 2RQTA 3GLXA 3CC4A 2DILA 4Z02A 4AFSC 4DBFA 3JAME 3JCMJ 2EGAA 1WHKA 2EYZA 5I2MA 9ATCB 1I5OB 2XKOC 3EGDA 2RN8A 2KEAA 2EKOA 1Q82R 2MMPA 3M58A 1C1AA 2AIRB 2KRSA 4J9EA 3DB3A 3JSCA 3I5SA 4HCCA 2V1QA 4RCCA 2RQVA 1CKAA 4M7AG 3JCMh 1QW1A 2QQSA 1G3WA 1M5Q1 3V8JA 4LDUA 3RESA 4EMKB 2ROLA 2ESWA 2Y90A 3LLRA 2WSEE 2GF7A 1OU9A 1WGSA 4YTLA 1H8KA 1I5LA 5C6SA 4M4ZA 2LQNA 3A5ZB 3HP9A 1WX6A 1GCPA 2JUFA 4M7DB 2QTVA 2DMOA 1ABOA 2C0IA 2FVUA 3QSUA 3ZFJA 5KYYA 3A8OB 2EAYA 1JU5C 3M4GA 4C92C 3MO8A 2E65A 2K3BA 1M1KR 4GBQA 1VQ9A 1M30A 3CBOA 2KAFA 4J9CA 3CCSA 2HAXA 3CCEQ 4ATOA 1YN8A 1QQJA 2EYQA 3I55A 4RTWA 1YJWA 4ZTJA 4JZ4A 2DK3A 2DZ9A 4TVRA 3EG0A 5GAMg 4M7AB 2QQBA 3HHTB 2LDMA 5GANf 2QAZA 2DL4A 2LQKA 2CZ1B 2Y4XA 3NHNA 5KYWA 2FO0A 2CP5A 2L3RA 3UF4A 4WTOB 2M0OA 4E47A 1VQ7Q 2CT4A 2DRKA 3PNWC 1NYGA 1H641 1G2BA 5LJ5g 3UDCA 4M7DD 3CCJQ 2DL5A 3JCMd 1PKTA 4HKEA 1BCOA 2DZCA 1UGSB 3OW2P 1YITT 1QKXA 1LJOA 1BB9A 3CD6T 1YWOA 3M54A 5CVIA 2QASA 5IHNA 5GAMh 1JB0E 1VA7A 1IB8A 1FX7A 3QUIA 4LD9K 2DL3A 3LW5E 2V26A 1M2OA 2AHJB 1I4K1 2EQIA 1LPLA 2F5TX 5LJ5h 1IZ6A 4J8OA 4M7AD 3VS5A 4JJBA 2OJ2A 1PRMC 2HNIA 2YDLA 3FIFA 1S72Q 3VS7A 3SFMA 3CC4Q 1HD3A 4JJNK 2X3WD 2K5LA 1E7OA 5GMKh 2HKNA 2CP2A 1VQ6T 2O9SA 1WIEA 1D1BA 2DEUA 4EMGA 3OYEA 3ZBDA 2PVDB 4ESRA 2E4HA 3JCMX 4WCIA 1JJ2P 3DB4A 2MAMA 2YLBA 1M2VB 4B9XA 3M0UA 1BK2A 1UG1A 2H8HA 3RUXA 1Q82U 5LL6S 4C5HA 1U1TA 1OOTA 5FU6C 2AKKA 2GTOA 3E1SA 2MWOA 2C0OA 4BY6C 1LVKA 3L2ZA 1Z9QA 2BE7D 3QYHB 3U23A 1FMWA 1UHFA 1IRXA 5KYYB 2DL8A 3MEAA 1X75C 2JXBA 3OMGA 4C92A 3JCMP 4OMPA 3O8VA 2CGHA 2XHCA 4KGXB 2XMFA 4D8KA 1NJIU 1T0JA 2DD5A 2CREA 1KQ2A 2DYIA 2VVKA 4DBHA 5FU7B 1KK7A 2ZAEA 4MZPA 1RLPC 5KYUA 3MEVA 3QO3A 3LYIA 5L8RE 3TREA 5KYWB 4M75F 3TSZA 5FWCA 1QVFS 2RMOA 3S6WA 1M1KU 2WACA 1IO6A 2OTLT 2NUPA 4C0DC 1WPYA 1VQ9Q 1XJWB 2D8JA 3REAB 3CCSQ 1OQKA 4KUIA 1QMCA 4NS5A 2LCSA 1D0XA 1PSEA 4RG8A 3M9QA 1UGRB 3I55Q 4ELYC 4BE0A 2EPDA 2JTEA 4ZNXA 4IUUA 1YJWQ 1GL5A 4FM4B 1NE8A 3OMCA 4FSXA 3C95A 2Y4YA 2FRYA 1YWPA 4C92G 2KI7A 2MIOA 4BE2A 3VYHB 1GFCA 2AKLA 3OS1A 3CCQT 1Q81C 3ME9A 3JCMc 2FG0A 4OP0A 3M59A 1YITA 3GIBA 3NTKA 2CKKA 5GAMe 3I56T 3CXCS 1G8XA 3E9GA 3OYMA 6AT1B 1JRIA 1VQKT 5KE2A 1GXIE 3VKIA 3HKSA 1YI2T 1AWXA 5LJ5e 3RKYA 1RI9A 5FW9A 1ZUYA 4ANJA 2P4RA 1WQWA 3EHRA 5FWBA 1QVGS 4DQ2A 3JB9G 5GAN8 5GMKe 2H3EB 2DA9A 2MYSA 2P0KA 4JRQA 1YJNA 1U8RA 2FRWA 2JMCA 3H0IA 3GP8A 3NTIA 1SPKA 4M7DE 3LH5A 1VQNT 1OPLA 4BI4A 1PCXA 2JJ9A 4C92B 2NYSA 4OVAA 4XTVA 3QJYA 1N5ZA 2KRMA 3CBMA 3VS0A 4MDWA 4D8DA 3RKWA 2JW4A 1KHCA 3ZEHA 1VQOT 4RTUA 4AG1C 1BIAA 2VKNA 2R58A 2D0QB 3X25B 2DXCA 3G1JA 4FIBA 4PJOC 1VQPT 1D09B 4ME7A 2YXYA 3NTHA 2QQRA 5LJ3d 3CEYA 1KQSA 3LWIA 5KYUB 4J9IA 2VGNA 3SWNB 4M7AE 1K9AA 3G6ET 4M7AF 1X2QA 1M3AA 2GNCA 4XTYA 1RAEB 2FEIA 2K5FA 4CI0C 3OYNA 1KC8U 4DEYA 4ZGEB 2HEQA 3RERA 1YJ9T 4JUVA 4Y91A 1MNEA 3F70A 1YCYA 4NOYA 2HKQB 3CC2T 1ZA1B 4M78C 3G4SA 3MP6A 1VUBA 2CH4A 1WFWA 4J6YA 1ZSGA 3OYDA 2LT1A 2DTOA 3CMEA 4KH1B 3JRZA 2EGEA 3OS0A 1QCOA 5I2SA 1JBMA 4R0KA 1D0ZA 4Z89A 3CMAT 3EFSA 2PUKB 2ED0A 1RACB 7AT1B 2ZCFB 4XTXA 1Y0MA 1TUCA 4K11A 4RG2A 2EBPA 3X24B 5IN1A 2FYKA 2O88A 3LH0A 1YIJT 1QWEA 2HDAA 1VQ4T 1UJ0A 5IHKA 2BE9B 2FPEA 2JS0A 1PM3A 3OS2A 4LXCA 1EZZB 1YNZA 2BKDN 2QGFB 3EG3A 3A1PA 2OAWA 1TH7A 2KBTA 3JB9D 2AK5A 3C0CA 2MF2A 2XDPA 2DO3A 1T3LA 1MMGA 3BDUA 4BI3A 2E10A 4AFQC 1I8FA 2RO0A 4N4IA 3V7CA 2LTOA 5FU6B 3L2WA 5FROA 5CCAA 2L8DA 4XU0A 4BY6B 2X51A 1YI2A 4JS5A 1KFZA 2PU9B 1RI0A 3I35A 2CP6A 1PD0A 2OTJA 3L2QA 3R6NA 2DKGA 4AFZC 4BDYA 1M4ZA 4BDZA 1N8RU 1MNDA 1WHHA 4Q5WA 2CP3A 3QWXX 2D8HA 2X9HA 4A4GA 4OB0B 3BFMA 5DLOA 4RTZA 2CSQA 4PJOA 4QVCA 4ZGJB 2EQJA 2R5MA 2RI2A 1RABB 2EVRA 1YJNQ 3PE0A 3UA6A 2DETA 2KR3A 2RHIA 5GAN4 1RLQC 4HVVA 3PIPA 4HT9A 4PJJA 2DX1A 4EDUA 2AZVA 2DD4A 2IPOB 3HFOA 3INZA 2L0AA 4C0DB 4RTXA 1VQPA 2A3LA 2FL7A 1BI2A 4J7FA 4HVWA 2CSIA 4M78A 2DRMA 5GANg 2C06A 1W2BS 5D6WA 2KK4A 2E3HA 3CCMA 3G6EA 5C0MA 4RKUE 1OULA 1JXMA 4RTVA 3OW2A 1MMNA 1BI0A 1RAFB 2E3IA 1R0BG 4A4HA 3FRNA 3NFCA 2VB6A 3HRUA 1WHJA 4LUEA 4VUBA 1B3QA 3QJ6A 3CC2A 4RUGA 1SHGA 2PQWA 2YHTA 3FLGA 3S3OA 1GBRA 2LJ1A 1B34A 3KBGA 4XK8E 4PJOG 1KD1R 3G4SQ 3GPLA 1OX8A 1RAGB 5GANh 2L3SA 1OU8A 5AT1B 2RJDA 1Y96A 3CMEQ 1H92A 2CUDA 3H0HA 4OF1A 2RK1A 3EFOA 2KGTA 3PT9A 2DF6A 2WSFE 1F1BB 3FC3A 1QP2A 2K2MA 1GRIA 5GAN7 2G6FX 3PFSA 1HYOA 1XTDA 2DXTA 1JJ2A 2JT4A 5I11A 3M4YA 4FCYA 2MK5A 1WJQA 2GCXA 4M78G 5A0DA 3UT1A 3EFRA 1ARKA 5KE3A 2G3RA 4FYVB 2BZ8A 2X4WA 3CXCP 3EG2A 1MV3A 3QG1A 3TQ7P 1M1FA 5CKBA 2EJ9A 5IXBA 2JNGA 3QYGB 4C92E 4C92F 4M77C 4M75D 1U06A 1K8AR 1V29B 4QQ6A 2F1LA 2F2VA 2CT3A 1G3SA 1UDLA 3DLMA 5HKCA 2LCLA 4PJOB 1SF9A 4C8QC 3CCUT 3WVDB 1Q82C 5KYNA 4LD6A 3CC7T 2K2VA 3P8DA 5GJVB 1OX9A 1VOMA 1NJIR 2ZZDA 1E6GA 1YI2Q 1X01A 3OYAA 4OGEA 2XK0A 2DXBA 2K57A 4J9FA 5J26A 5LJ5j 2X35A 2OTJQ 1WZOA 1K9MU 2FB7A 3OYIA 2QDYB 1NJIC 3VJPA 3JB9F 2RB6A 3OA6A 4M78B 3OYGA 1K73U 5L23A 5GMKj 1SKUB 1AWOA 2M0YA 4JRPA 4X34A 5KYXA 4FW2A 2HQXA 1TS9A 5CR2A 2LT4A 4QVDA 1VQ5T 3CCVT 5IAYA 1M90R 2EYWA 1MV0B 2NUZA 1WYXA 1M1KC 4JLIA 4PJOD 2FHDA 3TSWA 4J9HA 4HCBA 1B34B 4E7SA 2K6DA 3C4SA 4XU1A 3EGXA 4ZTFA 2QG9B 2IG0A 2YRCA 2LRQA 2COYA 1JXOA 4OB3B 1Q86R 2RQUA 3CCMQ 4IIMA 3FB9A 1VQMA 1AVZC 1X2KA 1O9SA 2RF0A 2B8AA 1ACMB 2V1RA 2ZGWA 4A53A 2DJZA 4CC7A 5GANe 4F14A 3M57A 1N6AA 2KVQG 3CC2Q 4AMCA 2A08A 3LX7A 3ULRB 2RNAA 5GAN3 5HK0A 1KD1U 4FYWB 3H6ZA 4F7UA 3EGDB 1UFFA 2PUOB 4MMLA 2COZA 1UTIA 1C0MA 3C94A 4XTUA 1NPRA 5M9OA 2K79A 2QYZA 4M77A 3CCRQ 2HCKA 3TVTA 2L89A 1I0CA 4JZ3A 1FMKA 1VYUA 1IGQA 4C8QA 4ELZC 2GGRA 1M3BA 1G3TA 2ED1A 3RR6A 4C0GA 3L2RA 2R57A 2E70A 1XQHA 3MP8A 2GFUA 5LJ3j 1LOJA 3JCMf 1AEYA 1IXDA 4KRTA 4PK4A 4KT0E 1W4SA 1PC0A 4FW1A 1YP5A 2CH4W 4J7IA 2RHXA 3RMQA 1ZSZC 4EIKA 3CCUA 3GNGA 3OSSC 5GAN5 1K8AU 4L6V5 1U5SA 2V8KA 3CC7A 2RJCA 4JRIA 5KYXB 2KT8A 5J3BA 2EWNA 1KC8R 3MP1A 2EYYA 4A4EA 3QHSA 4F7UG 1FWZA 1EX4A 2EYXA 4C0ZA 4IUQA 2DPPB 2ENMA 1JQQA 5GAMd 2QA4T 2M1HA 1CKBA 4M77G 5CAIA 1KC8C 5A2QE 4NL3A 3BE3A 2X4YA 1EIFA 3MEWA 3EGXB 2DL7A 1S1NA 4OMFB 4C8QG 1BU1A 4M75E 5LJ5d 2VYTA 3OYHA 3GOXA 4KUDK 1AHJB 1WHMA 5D6XA 3OYFA 2HZYA 5GMKi 2J7IA 2P0QA 2JZ2A 3A8MB 1W2BP 1AWWA 5FLXE 1VQ5A 2RD1A 2QEXT 3LGLA 5DLQE 3JB9J 4IUPA 2EIFA 2GBQA 4E7HA 3AHUA 2I0NA 1RADB 1M90U 4PNOA 2ABLA 4OMNA 1WXTA 1KQSS 1GBQA 2HQHA 1ZHIA 2QI2A 1W1FA 3Q1JA 4GY5A 2MWPA 4OMOA 3S3NA 1YHQT 4AT1B 3JCMV 3EAEA 3UWNA 2NLUA 3A8GB 3J80E 5FRMA 1UE9A 3I9QA 4F7UB 1ZA2B 1Q86U 1N9SA 4PLLA 4AFUC 3TEEA 1FMVA 1VQMQ 5J39A 2XG8D 4M77B 3CD6A 2X3XD 2VASA 4F04B 4HA8A 4IKFA 1YBYA 3VUBA 3HSBA 3V7RA 2FZKB 3HRSA 1B07A 4C8QB 4PJOE 4PJOF 3URGA 5LJ5f 5A0GA 1N8RR 4N4GA 3QKJA 1VYVA 4DOVA 2BUDA 2QQAA 2LCCA 1M3CA 3PGGA 3OY9A 2NWMA 4CRIA 3MPUB 1IREB 2PZ1A 3WVEB 3A8LB 1N8RC 2QXFA 4LUDA 2ZPIB 3REBB 4B9WA 1ZSZA 4FL6A 1HJDA 1VQ6A 3C12A 2X4XA 4QVZA 1IGUA 4M78F 4ORZA 2JTMA 4C5GA 3PVQA 1X6BA 1BI1A 3VS4A 1LCKA 2VXFA 4JRKA 1GFDA 4J6WA 1WXBA 4M77D 3DLLA 3QIIA 4X9DA 1M8MA 5GMKm 1TTHB 3KFVA 1KIKA 3OBWA 2DM1A 1K0SA 1VIFA 1GCQC 2LJ3A 2RQRA 3CCET 5CIUA 2M51A 4C8QD 1IHWA 5GAOq 5CKEA 4PJLA 3OBYA 3P8BB 3OYBA 1MMAA 4FU6A 1QCNA 3L42A 2K3XA 3X26B 2YT6A 5A0LA 4RCBA 2CZ6B 2HBPA 2NUPB 3O5ZA 1PKSA 2CUBA 5CKHA 2QA4A 4IIOA 1T0HA 1VQ7T 3M0QA 3HL8A 1KSWA 2LJ0A 2EQUA 2BZXA 3CPWS 3CCJT 2O31A 4C92D 3RBBB 4F17A 4M7DC 3GF5A 2OX7A 3VRYA 1QCFA 1HSQA 2R5AA 3A8HB 3V7SA 5I22A 1RAIB 2RA2A 2OTLA 1FYNA 2QEXA 5D7UA 2ROTA 2MOXA 4DBQA 3CXCA 1RUWA 3M56A 3KXTA 5GAOm 5CQXA 1TOVA 3GBQA 2YUQA 3E2UA 1JEGA 1SSHA 1X43A 4FSSA 5LJ3f 1YHQA 1OPKA 1UGQB 1WHLA 3QDRB 2E41A 2F2XA 3CCQA 1LNXA 3NMZC 4Z88A 1S72T 4KGVB 2XDDA 1W6XA 3CC4T 1R0CB 1WHGA 4J9DA 3I56A 3JB9H 2KDSA 1VQ8T 3FEOA 3ASKA 1VQKA 1YITQ 3CD6Q 1AT1B 4E7JA 1P92A 2COWA 2KXCA 2DIGA 2RK2A 1V1CA 4UC4A 3H8ZA 1M9SA 1C6VX 2D9TA 2BIVA 1Q95G 2CZ0B 2E1HA 3UATA 2P0PA 1K9MR 4MMKA 2VUBA 3PVLA 4IURA 1JJ2S 3OYCA 1K73R 2RQWA 4N0AC 3PMIA 2DEQA 1VQNA 4FYYB 1GCQA 1MHNA 1ZLMA 3M53A 1K9MC 2RHYA 2XIDA 2VXEA 2RHZA 1NEGA 1VQ6Q 1TWBA 1K73C 3QZ9B 2EKHA 3N5BB 2CP7A 1SG5A 1VQOA 3M0SA 4P5NA 1AZGB 2E12A 1OV3A 3QDFA 3OQ5A 3D7SB 4DA4A 5CKDA 1KJWA 1VQ9T 2L3PA 2SEMA 3JCMb 3BDLA 3CCST 4LE9A 2FZCB 1M8VA 4EMHA 2CS7A 3I55T 5IXFA 1VQLT 2LC4A 4BB7A 4E7KA 4JPBW 1YJWT 1YJ9A 3UPUA 3CBPA 1G5VA 4F7UE 4F7UF 3HPWA 3V8KA 1QVFP 4MDXA 4DEXA 4XU3A 1G83A 2QA4Q 3QBYA 4M77E 4M77F 3VU3C 5HY6A 3PTAA 4C0FA 4J9BA 1KG1A 2HBWA 5IHIA 2XD0A 3J7AF 3EH1A 2MCNA 2XI9A 5ECAA 2JS2A 4C8QE 1OYXA 4C8QF 3CMAA 2ZPBB 5FU7C 1E6HA 1O75A 1KD1C 2KXDA 1UHCA 2OTLQ 4FYXB 3WXMB 2DJQA 2QEXQ 4NL2A 2ECZA 1YIJA 1IHVA 4DOWA 4C5IA 1VQ4A 5GJWB 4GLMA 1I07A 3QXEB 1H3HA 1XNIA 4IUVA 1M27C 2JOYA 2YUPA 3TCJA 1CSKA 1NEBA 3META 4O6JA 4M7DG 5GMKl 3JCMg 3G71T 4V2SA 1YCSB 2VGMA 1NBEB 2YLCA 2HQEA 2O4XA 2GFAA 4QW2A 1ZUKA 3CCQQ 2CZ7B 2QGGA 1VQ8A 3VRZA 3RMSA 1UGPB 5CQYA 4BI8B 1D1CA 5D6YA 4N0AA 3I56Q 2J6OA 1QVGP 5GAMj 2YRVA 4Y92A 4LDVA 1VQKQ 2M16A 1B7TA 1UJYA 3DKMA 2HSPA 5EC7A 1K8AC 2LMJA 2EQMA 4HCZA 1WJSA 2PVGB 2LVMA 1VYTA 5GANd 1K4US 1W2BA 1WJRA 3L1AA 2JVVA 1Q7YU 4XQ3A 2K9GA 1M2VA 1QVPA 4F16A 1N27A 2AT1B 1VQNQ 1K76A 4A4KA 1J3TA 4OMQA 2KE9A 4PFOA 5GAOl 2L5QA 2DFUA 2L2PA 2LZ6B 2RI5A 1VQOQ 4OB2B 1BYMA 3QZ5B 5CO7A 2J6FA 1D3BA 1Y57A 2NUTA 3VS6A 1VQPQ 3G7ZA 3VYGA 2JN0A 2SRCA 2LQ8A 4HCKA 1M90C 4B6MA 5I21A 4PJMA 1VQLA 1Y96B 2YWWA 4L59A 3G6EQ 3RNJA 1TU0B 4LNPA 3CPWP 2MPXC 2K5IA 3EFOB 2BTTA 2HSEB 2RJEA 3PMTA 4LDXA 3SWNC 1YJ9Q 5KH6A 4M78D 2OAUA 3CCLT 2KT1A 3HTRA 2F5KA 4HVUA 2KYBA 1Q86C 2GTJA 3CQTA 1NLOC 1PRLC 1NPPA 2I2LA 3QWYA 4R55A 1OI1A 2A28A 1WI7A 2JMAA 2CDTA 3EG9A 2K4YA 3OYJA 1Y07A 1X69A 2YUNA 3QPHA 2O4XB 3CMAQ 1NYFA 3OB9A 2RHUA 4E7LA 4CC4B 2JM9A 1UUEA 1YIJQ
chains in the Genus database with same CATH topology
1N9RA 2BUDA 3JCMJ 4BI3A 2QQAA 2E10A 1I8FA 2RO0A 4L5GA 5KCOA 2LCCA 4N4IA 2X4JA 5I2MA 3PGGA 3OY9A 3SD4A 2E6NA 2XKOC 3V7CA 2LTOA 2EFIA 5FU6B 3L2WA 5FROA 4CRIA 5CCAA 2EKOA 2EQKA 2DVEA 2L8DA 1IREB 4XU0A 4BY6B 3G71A 3WVEB 3PIOA 3A8LB 1YI2A 2MMPA 1N8RC 3M58A 3OYYA 4JS5A 1YJNT 2QXFA 2PU9B 3DB3A 2ZPIB 1RI0A 4B9WA 5GAOn 4FL6A 3JSCA 5GAN6 3L2QA 1VQ6A 2DKGA 4HCCA 3C12A 2OTJA 1VIEA 2X4XA 4QVZA 4BDYA 1M4ZA 4BDZA 1N8RU 2V8IA 3TU4K 4M78F 4RCCA 2E6ZA 2JTMA 4M7AG 3JCMh 4C5GA 3JCMQ 1BI1A 1QW1A 2QQSA 4Q5WA 1VQPA 1G3WA 2RI3A 2VXFA 4JRKA 1M5Q1 4E7IA 3V8JA 4LDUA 3VV0A 4A4GA 4J6WA 4OB0B 4PLIA 3RESA 3BFMA 5DLOA 4EMKB 4M77D 3L2VA 3DLLA 4PJOA 4QVCA 3JCMe 3QIIA 4X9DA 5GMKm 4LDXA 4ZGJB 2Y90A 3SB2A 2EQJA 2R5MA 2RI2A 3LLRA 2WSEE 3L2UA 2GF7A 1WGSA 3E9FA 3OBWA 4YTLA 2KMTA 2RHIA 1G3YA 1I5LA 5FRNA 5C6SA 1VIFA 3BW1A 5GAN4 2D6FA 3CCET 3A5ZB 5CIUA 3HP9A 4C8QD 5KCHA 3PIPA 5GAOq 2JUFA 4HT9A 4M7DB 5CKEA 3OBYA 4EDUA 1FXXA 3P8BB 2DD4A 4R56A 4RMOA 3HFOA 3OYBA 3INZA 3OSVA 1D3BB 2JTFA 2FVUA 4C0DB 4FU6A 3QSUA 3ZFJA 3J81E 3L42A 2K3XA 4JS4A 3A8OB 2EAYA 3M4GA 1SSFA 3X26B 4C92C 2A3LA 3MO8A 4RCBA 2CZ6B 2E65A 2FL7A 2HBPA 1BI2A 4J7FA 5A0LA 5GANg 4M78A 4MZMA 2C06A 2H3JA 1VQ9A 1W2BS 5CKHA 5D6WA 2QA4A 2KK4A 3CBOA 2KAFA 1Y71A 3GNFB 3CCSA 3CCMA 2HAXA 4LDWA 3G6EA 5C0MA 4ATOA 2PVOB 4RKUE 3OW2A 1VQ7T 3CCVA 2EYQA 4OGCA 3I55A 3G4ST 3HL8A 2XU8A 1BI0A 5GAN2 3CCJT 2EQUA 3RIRA 3CPWS 1YJWA 4A4HA 3FRNA 4ZTJA 4C92D 3SWNA 2DK3A 2DZ9A 3LWHA 3CMET 3NFCA 4KULA 4TVRA 3CPFA 4M7DC 3HRUA 5LJ3g 3GF5A 5GAMg 4M7AB 2QQBA 3HFNA 4VUBA 3HHTB 3QJ6A 3CC2A 2LDMA 1UEBA 2R5AA 3A8HB 5EG2A 2PQWA 3V7SA 5GANf 2YHTA 2RA2A 3FLGA 1WQ7A 3X20B 4A4FA 2OTLA 2QEXA 3S3OA 2LQKA 2CZ1B 2Y4XA 2E5QA 1B34A 3S3MA 3KBGA 3E19A 2L3RA 1PSFA 2VC8A 4N4HA 2M0OA 4E47A 3CXCA 4XK8E 3M56A 4O5VA 4QQGA 4PJOG 5CQXA 5GAOm 3KXTA 3PNWC 1H641 4ZN1A 3V8LA 5LJ5g 3GPLA 5GANh 3UDCA 4M7DD 2K3YA 3JCMd 2DXUA 2RJDA 4II1A 1Y96A 4HKEA 2DZCA 1UGSB 5LJ3f 5GAMf 1YHQA 1BI3A 1YITT 3CCLA 1UGQB 2KQWA 1LJOA 4OF1A 2RK1A 2CYZB 3CD6T 3M54A 3QDRB 2E41A 1XOVA 3PT9A 5CVIA 2WSFE 2RM4A 3FC3A 1QP2A 5GAN7 3CCQA 1LNXA 3BY7A 5LJ3h 5GAMh 1S72T 1JB0E 3PFSA 1OZ2A 1XTDA 2DXTA 2XDDA 3CC4T 1JJ2A 3M4YA 1FX7A 3QUIA 1R8OB 4LD9K 1WJQA 2GCXA 4M78G 5A0DA 3UT1A 3I56A 3EFRA 3JB9H 3LW5E 5KE3A 2KDSA 2AHJB 3FEOA 1VQ8T 2G3RA 2X4WA 4M75C 1M1GA 3ASKA 4XTWA 1VQKA 4X9CA 1UB4A 1I4K1 3FDRA 3JB9I 2F5TX 5LJ5h 3QG1A 1IZ6A 4J8OA 1M1FA 4M7AD 4E7JA 5CKBA 2EJ9A 1P92A 2XICA 2JNGA 3QYGB 2HNIA 4C92E 3MEUA 1I81A 4C92F 2DIGA 2RK2A 3FIFA 4UC4A 5GAOp 4M77C 3H8ZA 1M9SA 2D9TA 3SFMA 2HD0A 4JJNK 2K5LA 2EJFA 2BIVA 5GMKh 2CZ0B 2E1HA 4M75D 2P0PA 2OTJT 1VQ6T 1V29B 4M78E 4QQ6A 4MMKA 2VUBA 1G3SA 3DLMA 4EMGA 5HKCA 3OYEA 2LCLA 3ZBDA 2PVDB 4IURA 2DIQA 4C8QC 3CCUT 1JJ2S 3WVDB 4PJOB 1Q82C 3OYCA 3JCMX 3DB4A 4LD6A 3CC7T 2MAMA 2YLBA 2O01E 4N0AC 4B9XA 3M5AA 3PMIA 2DEQA 2K2VA 3P8DA 4M7DF 1VQNA 1MHNA 3RUXA 2ZZDA 1Q82U 3M53A 5LL6S 4J83A 1X01A 3ER0A 4C5HA 1K9MC 1U1TA 3OYAA 5FU6C 4OGEA 2RHYA 2XIDA 2XK0A 2VXEA 2A7YA 2DXBA 2MWOA 3E1SA 2RHZA 2K57A 4BY6C 5J26A 5LJ5j 3L2ZA 2X35A 2M9UA 3RKXA 2WSCE 1K73C 3QYHB 3QZ9B 1K9MU 2FB7A 1ZQ1A 3OYIA 3N5BB 2QDYB 2XDBA 1VQOA 1QVFA 3MEAA 1NJIC 4P5NA 1X75C 3OMGA 2RB6A 3VJPA 4C92A 2E12A 1QP3A 3OA6A 3JB9F 4M78B 3OYGA 1K73U 3JCMP 3O8VA 2CGHA 4JLGA 5GMKj 2XHCA 4DOVA 3OQ5A 4JRPA 4X34A 1NJIU 2HQXA 1BKBA 2DD5A 4XTZA 3X28B 4DA4A 5CKDA 1KQ2A 2RH2A 5CR2A 1VQ9T 2LT4A 3JCMb 4EMKC 3BDLA 3CCST 3CCMT 4QVDA 1VQ5T 1M8VA 4EMHA 2CS7A 3CCVT 3SDZA 5FU7B 3I55T 1VQLT 5IAYA 2LC4A 1H3ZA 4MZPA 4BB7A 4E7KA 4MZTA 3LGFA 3MEVA 4JLIA 3QO3A 2FHDA 3LYIA 1YJ9A 1YJWT 1M1KC 4PJOD 5L8RE 4HCBA 3TREA 3UPUA 1B34B 3CBPA 4M75F 1G5VA 4F7UE 3OYLA 3C4SA 4F7UF 1QVFS 3S6WA 4XU1A 3HPWA 4ZTFA 3V8KA 1KHIA 2WACA 1M1KU 2IG0A 1ZBXA 4MDXA 2LRQA 2OTLT 4C0DC 1WPYA 4XU3A 4OB3B 3FJPA 3QBYA 4M77E 3HRTA 4M77F 4KUIA 4NS5A 3JCMW 3FB9A 3MCAB 1VQMA 1PSEA 4RG8A 3M9QA 1UGRB 3VU3C 4ELYC 4BE0A 5HY6A 3PTAA 2F69A 1O9SA 4C0FA 1KG1A 5HK3A 4IUUA 2B8AA 2XD0A 3OW2S 3J7AF 2ZGWA 3M55A 2XI9A 4A53A 2DJZA 4HT8A 4C8QE 1OYXA 4C8QF 4FM4B 5GANe 4ZGDB 3CMAA 1NE8A 2ZPBB 3M57A 3OMCA 4FSXA 4LDYA 5FU7C 3C95A 1N6AA 2VV5A 2Y4YA 2KVQG 3CCRT 2DAQA 1O75A 1KD1C 3LX7A 4C92G 4BE2A 3WXMB 1MGQA 4NL2A 3VYHB 3OS1A 4M7AC 1YIJA 5GAN3 1QVGA 4DOWA 3CCQT 4C5IA 1Q81C 3ME9A 1VQ4A 5HK0A 1KD1U 3QXEB 3JCMc 1XNIA 4M75A 4IUVA 3H6ZA 4OP0A 4F7UA 3M59A 1YITA 2JOYA 3GIBA 2PUOB 3NTKA 2CKKA 4MMLA 4J6XA 5GAMe 5LJ3e 3I56T 3TCJA 3CXCS 3C94A 1Q81U 2KY9A 4XTUA 1NPRA 5M9OA 3E9GA 3OYMA 1NZ9A 3META 1JRIA 1VQKT 4M77A 4O6JA 5GANj 4M7DG 5GMKl 3JCMg 5KE2A 4FT2A 3G71T 1GXIE 4V2SA 3VKIA 2VGMA 2YLCA 2HQEA 2L89A 2O4XA 2ZPHB 3HKSA 2GFAA 1YI2T 5LJ5e 4QW2A 3RKYA 2KSSA 2CZ7B 1WNLA 2ZPGB 5AYFA 1VQ8A 4Y28E 3RMSA 4C8QA 1UGPB 4ELZC 1G3TA 5CQYA 4BUGA 4BI8B 4C0GA 1WQWA 2E70A 2R57A 4N0AA 5D6YA 3L2RA 1QVGS 1XQHA 4DQ2A 3JB9G 3MP8A 2EJGA 2GFUA 5GMKe 5LJ3j 5GAMj 5GAN8 2YRVA 1LOJA 2P0KA 4JRQA 2V8JA 4LDVA 1YJNA 1U8RA 4A54A 3GP8A 3JCMf 2M16A 3NTIA 2QQ9A 4M7DE 1DJ7B 4KT0E 3DKMA 1K8AC 4EPCA 1VQNT 2EQMA 4ZN3A 1W4SA 2MI6A 4BI4A 4J7IA 2RJFA 4HCZA 1WJSA 2PVGB 2LVMA 2RHXA 4KBMB 3RMQA 3CCUA 4C92B 3GNGA 3OSSC 4OVAA 3P8HA 3QJYA 4L6V5 4XTVA 5GAN5 1Q7YC 5GANd 2V8KA 3CBMA 3CC7A 2RJCA 2QTXA 4MDWA 1W2BA 4JRIA 3RKWA 1KHCA 5J3BA 3ZEHA 2EWNA 1VQOT 1WJRA 3MP1A 1BIAA 4IUTA 3L1AA 4BACA 2JVVA 2R58A 1Q7YU 2D0QB 3OS5A 2DXCA 2GQVA 4XQ3A 3X25B 4C5EA 4M75G 4A4EA 3QHSA 5GAOr 4F7UG 2LX9A 4FIBA 1QVPA 1Y7XA 1FWZA 1KQ1A 4EMKA 3CCEA 4PJOC 4C0ZA 1N27A 5DY9A 2LNVA 3CPWA 4IUQA 4ME7A 1VQPT 4A4KA 2DPPB 3NTHA 2IVWA 2QQRA 5LJ3d 5GAMd 4WF2A 2QA4T 3CEYA 4PKCC 1KQSA 3LWIA 2M1HA 4M77G 2VGNA 3SWNB 5CAIA 5GAOl 1U1SA 5A2QE 3G6ET 1KC8C 4M7AE 4M7AF 2L5QA 1RL2A 2ZPEB 4NL3A 4M7DA 4CI0C 4OB1B 2K5FA 4PL6A 4XTYA 2RI5A 3OYNA 2X4YA 4OB2B 1EIFA 3MEWA 1HXDA 2DTHA 1KC8U 1BYMA 4ZGEB 4OMFB 3QZ5B 5CO7A 4C8QG 1YJ9T 3RERA 4M75E 1D3BA 4JUVA 2VYTA 4Y91A 5LJ5d 3OYHA 3F70A 1AHJB 3GOXA 5D6XA 1YCYA 3OYFA 4KUDK 4NOYA 3CC2T 3G7ZA 2P0QA 3A8MB 2JN0A 2JZ2A 3VYGA 5GMKi 1VQ7A 5FLXE 1VQ5A 4M78C 3G4SA 1X6OA 2LQ8A 4JDSA 2RD1A 2QEXT 3MP6A 1VUBA 1M90C 5I21A 3CCJA 1VQLA 4J6YA 3LGLA 5DLQE 3JB9J 3KUFA 1Y96B 2DTIA 4IUPA 3OYDA 4L59A 2EIFA 2LT1A 2DTOA 3CMEA 4E7HA 3AHUA 3JRZA 5CK9A 3OYKA 1VQMT 1M90U 1BIBA 2E64A 3R6OA 4PNOA 2K5IA 2P4TA 3OS0A 1KQSS 2RJEA 1ZHIA 3PMTA 4QQDA 2QI2A 3Q1JA 4GY5A 3SWNC 4D6WA 2MWPA 5CKFA 5I2SA 1JBMA 5KH6A 4M78D 4XU2A 3S3NA 1YHQT 2OAUA 4J5YA 3CMAT 3EFSA 3CCLT 2PUKB 2F5KA 3EAEA 3JCMV 3UWNA 2ZCFB 1Q86C 2NLUA 4M7AA 3A8GB 3J80E 4FT4A 5FRMA 3VUZA 4XTXA 4M75B 2ZPFB 4RG2A 4F7UB 4BE1A 3X24B 1NPPA 5IN1A 2FYKA 2I2LA 1HK9A 1Q86U 4R55A 3LH0A 1N9SA 1YIJT 4PLLA 5IT9E 1OI1A 1VQ4T 3TEEA 3MHXA 4BD3A 2K4YA 5J39A 2XG8D 1OZ3A 4M77B 5DM7R 3OYJA 3CD6A 1Y07A 3CCRA 4XAXB 3OS2A 4HA8A 4IKFA 3QPHA 1K8AU 2O4XB 3T9NA 1YBYA 4GLKA 3VUBA 3HSBA 3V7RA 1S72A 2BKDN 3GLXA 3OB9A 2RHUA 1TH7A 3HRSA 3JB9D 4Z02A 4C8QB 3CC4A 4E7LA 4PJOE 4PJOF 3URGA 5LJ5f 2MF2A 5A0GA 2XDPA 4N4GA 2DO3A 3QKJA 3JAME 3BDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV5 A;  3UDC A;  3T9N A;  3SFM A;  1VIE A;  2RK2 A;  2RK1 A;  2GQV A;  2RH2 A;  2P4T A;  1VIF A;  2OAU A; 
#chains in the Genus database with same CATH topology
 1N9R A;  1VQ4 Q;  2Z0W A;  4L5G A;  8ATC B;  5KCO A;  2X4J A;  2L3Q A;  3SD4 A;  2E6N A;  2EFI A;  2EQK A;  3G71 A;  2DVE A;  3PIO A;  3M0R A;  3OYY A;  1YJN T;  3A98 A;  2F2W A;  2J05 A;  5GAO n;  5GAN 6;  2OI3 A;  1VIE A;  1U3O A;  1T3S A;  2J6K A;  2V8I A;  3TU4 K;  2W10 A;  2E6Z A;  1TUG B;  2KRN A;  1VQ8 Q;  3JCM Q;  4QT7 A;  2RI3 A;  4E7I A;  3VV0 A;  4PLI A;  3EH2 A;  3L2V A;  3JCM e;  3SB2 A;  3L2U A;  3E9F A;  4E2F B;  2KMT A;  5FRN A;  1G3Y A;  3BW1 A;  2D6F A;  5KCH A;  2J06 A;  2D1X A;  1FXX A;  3EG1 A;  1RAH B;  4R56 A;  1BBZ A;  4RMO A;  2QK0 A;  1MUZ A;  3OSV A;  1D3B B;  2JTF A;  2NUT B;  3EGU A;  2DE0 X;  3J81 E;  4JS4 A;  1SSF A;  4MZM A;  2H3J A;  1MMD A;  1Y71 A;  3GNF B;  4LDW A;  1D1A A;  2PVO B;  2FZG B;  3CCV A;  4OGC A;  3G4S T;  2XU8 A;  5GAN 2;  3RIR A;  3THK A;  3SWN A;  3LWH A;  2A37 A;  3CME T;  4KUL A;  3CPF A;  2LP5 A;  5LJ3 g;  3HFN A;  1UEB A;  5EG2 A;  4JJD A;  3VS2 A;  4A4F A;  1WQ7 A;  3X20 B;  2B86 A;  2E5Q A;  3S3M A;  3E19 A;  1PSF A;  3SHW A;  2RPN A;  2VC8 A;  4N4H A;  4O5V A;  4QQG A;  3EG9 B;  4ZN1 A;  3V8L A;  1VQL Q;  2K3Y A;  2DXU A;  4II1 A;  1Q81 R;  3M0P A;  5GAM f;  1BI3 A;  3CCL A;  2KQW A;  2YRD A;  1AD5 A;  1Z9Z A;  2CYZ B;  1NG2 A;  1XOV A;  2GQI A;  2RM4 A;  3AT1 B;  1QLY A;  3BY7 A;  2A0F B;  1TG0 A;  2YUO A;  3SEM A;  1ZBJ A;  5LJ3 h;  1K0X A;  1OZ2 A;  1R8O B;  1D0Y A;  1WDX A;  1ZX6 A;  1TXQ A;  2FPF A;  3VS1 A;  1ABQ A;  4M75 C;  1M1G A;  4XTW A;  4X9C A;  1UB4 A;  3FDR A;  3JB9 I;  3EHQ A;  1QKW A;  2E5K A;  2PNI A;  2XIC A;  3MEU A;  1I81 A;  2M02 A;  5GAO p;  2IIM A;  2YSQ A;  4QKU A;  4E6R A;  2HD0 A;  2EJF A;  2D0N A;  4J9G A;  2OTJ T;  2O9V A;  4M78 E;  2K7A A;  2DIQ A;  1PWT A;  1R77 A;  1TSF A;  3M0T A;  2O01 E;  3M5A A;  1PNJ A;  4M7D F;  1YFN A;  3RDV A;  3G71 Q;  5HCK A;  1SEM A;  1X27 A;  1TUD A;  4J83 A;  3ER0 A;  2LQW A;  2A7Y A;  3H9N A;  4DBR A;  2QDL A;  2M9U A;  3RKX A;  2WSC E;  1ZQ1 A;  2XDB A;  3CCU Q;  1QVF A;  2JM8 A;  1QP3 A;  3CC7 Q;  4JLG A;  4Z8A A;  2VWF A;  3H41 A;  1BKB A;  3X28 B;  4XTZ A;  3MKD A;  2RH2 A;  4PFP A;  2PTK A;  4EMK C;  2KYM A;  3CCM T;  2EGC A;  3SDZ A;  2DNU A;  5IH2 A;  1H3Z A;  2DYB A;  1QWF A;  4MZT A;  1OEB A;  3LGF A;  2C0T A;  2HL5 C;  2LNH B;  3ZL7 C;  3OYL A;  2DBM A;  1W70 A;  1JO8 A;  1KHI A;  1ZBX A;  3FJP A;  3HRT A;  3JCM W;  1V76 A;  1VQ5 Q;  2KRO A;  3MCA B;  3CCV Q;  4HXJ A;  2F69 A;  5HK3 A;  3OW2 S;  2ATC B;  3M55 A;  1UGV A;  4JJC A;  4HT8 A;  1SRM A;  4ZGD B;  4LDY A;  1WXU A;  2VV5 A;  2DLP A;  3CCR T;  2DAQ A;  2KNB B;  1MGQ A;  4CC3 A;  4M7A C;  1QVG A;  3NGP A;  4M75 A;  2LX7 A;  4A63 B;  1PG5 B;  3VS3 A;  4J6X A;  5LJ3 e;  1Q81 U;  2KY9 A;  3H0F A;  1NZ9 A;  4E7Z A;  2HL3 A;  3CCL Q;  1SHF A;  5GAN j;  1ZSZ B;  2HMA A;  4FT2 A;  3NPF A;  2CP0 A;  2O2O A;  2ZPH B;  1NLP C;  1PD1 A;  2KSS A;  1WNL A;  2ZPG B;  5AYF A;  1AOJ A;  4Y28 E;  4X1V A;  4BUG A;  4PJN A;  2EJG A;  4AG2 C;  1AZE A;  1Q7Y R;  2V8J A;  4A54 A;  2QQ9 A;  1PHT A;  1DJ7 B;  4EPC A;  4PFZ A;  1EFN A;  4RTY A;  4ZN3 A;  2DVJ A;  2MI6 A;  2RJF A;  4KBM B;  3P8H A;  1UEC A;  1Q7Y C;  1I1J A;  2QTX A;  1ZUU A;  4IUT A;  4BAC A;  1NM7 A;  4C5E A;  3OS5 A;  2GQV A;  1AWJ A;  2EW3 A;  4M75 G;  5GAO r;  2LX9 A;  1Y7X A;  1KQ1 A;  4EMK A;  3CCE A;  5DY9 A;  2LNV A;  3CPW A;  1WA7 A;  3MJX A;  2IVW A;  3JV3 A;  4WF2 A;  4PKC C;  2AZS A;  1U1S A;  1K1Z A;  1RL2 A;  2ZPE B;  4M7D A;  4OB1 B;  4PL6 A;  1WLP B;  3UA7 A;  2FPD A;  1HXD A;  2DTH A;  4KGZ B;  1RAA B;  1VQ7 A;  3FJ5 A;  1BCM A;  1X6O A;  4JDS A;  4CC2 A;  3CCJ A;  3KUF A;  2DTI A;  1A0N B;  2P84 A;  1X6G A;  5CK9 A;  3OYK A;  1VQM T;  1BIB A;  2E64 A;  3R6O A;  2P4T A;  1SRL A;  1KQS P;  4QQD A;  2DBK A;  4D6W A;  5CKF A;  2A36 A;  4LN2 A;  4XU2 A;  4J5Y A;  4RTT A;  4M7A A;  4OML A;  4FT4 A;  3VUZ A;  4M75 B;  2DER A;  2ZPF B;  4BE1 A;  3IQL A;  1HK9 A;  5IT9 E;  3MHX A;  4KH0 B;  4BD3 A;  2W0Z A;  5DM7 R;  1OZ3 A;  8AT1 B;  4OMM A;  3CCR A;  4XAX B;  3I5R A;  1YHQ Q;  2BZY A;  3T9N A;  4GLK A;  1S72 A;  2RQT A;  3GLX A;  3CC4 A;  2DIL A;  4Z02 A;  4AFS C;  4DBF A;  3JAM E;  3JCM J;  2EGA A;  1WHK A;  2EYZ A;  5I2M A;  9ATC B;  1I5O B;  2XKO C;  3EGD A;  2RN8 A;  2KEA A;  2EKO A;  1Q82 R;  2MMP A;  3M58 A;  1C1A A;  2AIR B;  2KRS A;  4J9E A;  3DB3 A;  3JSC A;  3I5S A;  4HCC A;  2V1Q A;  4RCC A;  2RQV A;  1CKA A;  4M7A G;  3JCM h;  1QW1 A;  2QQS A;  1G3W A;  1M5Q 1;  3V8J A;  4LDU A;  3RES A;  4EMK B;  2ROL A;  2ESW A;  2Y90 A;  3LLR A;  2WSE E;  2GF7 A;  1OU9 A;  1WGS A;  4YTL A;  1H8K A;  1I5L A;  5C6S A;  4M4Z A;  2LQN A;  3A5Z B;  3HP9 A;  1WX6 A;  1GCP A;  2JUF A;  4M7D B;  2QTV A;  2DMO A;  1ABO A;  2C0I A;  2FVU A;  3QSU A;  3ZFJ A;  5KYY A;  3A8O B;  2EAY A;  1JU5 C;  3M4G A;  4C92 C;  3MO8 A;  2E65 A;  2K3B A;  1M1K R;  4GBQ A;  1VQ9 A;  1M30 A;  3CBO A;  2KAF A;  4J9C A;  3CCS A;  2HAX A;  3CCE Q;  4ATO A;  1YN8 A;  1QQJ A;  2EYQ A;  3I55 A;  4RTW A;  1YJW A;  4ZTJ A;  4JZ4 A;  2DK3 A;  2DZ9 A;  4TVR A;  3EG0 A;  5GAM g;  4M7A B;  2QQB A;  3HHT B;  2LDM A;  5GAN f;  2QAZ A;  2DL4 A;  2LQK A;  2CZ1 B;  2Y4X A;  3NHN A;  5KYW A;  2FO0 A;  2CP5 A;  2L3R A;  3UF4 A;  4WTO B;  2M0O A;  4E47 A;  1VQ7 Q;  2CT4 A;  2DRK A;  3PNW C;  1NYG A;  1H64 1;  1G2B A;  5LJ5 g;  3UDC A;  4M7D D;  3CCJ Q;  2DL5 A;  3JCM d;  1PKT A;  4HKE A;  1BCO A;  2DZC A;  1UGS B;  3OW2 P;  1YIT T;  1QKX A;  1LJO A;  1BB9 A;  3CD6 T;  1YWO A;  3M54 A;  5CVI A;  2QAS A;  5IHN A;  5GAM h;  1JB0 E;  1VA7 A;  1IB8 A;  1FX7 A;  3QUI A;  4LD9 K;  2DL3 A;  3LW5 E;  2V26 A;  1M2O A;  2AHJ B;  1I4K 1;  2EQI A;  1LPL A;  2F5T X;  5LJ5 h;  1IZ6 A;  4J8O A;  4M7A D;  3VS5 A;  4JJB A;  2OJ2 A;  1PRM C;  2HNI A;  2YDL A;  3FIF A;  1S72 Q;  3VS7 A;  3SFM A;  3CC4 Q;  1HD3 A;  4JJN K;  2X3W D;  2K5L A;  1E7O A;  5GMK h;  2HKN A;  2CP2 A;  1VQ6 T;  2O9S A;  1WIE A;  1D1B A;  2DEU A;  4EMG A;  3OYE A;  3ZBD A;  2PVD B;  4ESR A;  2E4H A;  3JCM X;  4WCI A;  1JJ2 P;  3DB4 A;  2MAM A;  2YLB A;  1M2V B;  4B9X A;  3M0U A;  1BK2 A;  1UG1 A;  2H8H A;  3RUX A;  1Q82 U;  5LL6 S;  4C5H A;  1U1T A;  1OOT A;  5FU6 C;  2AKK A;  2GTO A;  3E1S A;  2MWO A;  2C0O A;  4BY6 C;  1LVK A;  3L2Z A;  1Z9Q A;  2BE7 D;  3QYH B;  3U23 A;  1FMW A;  1UHF A;  1IRX A;  5KYY B;  2DL8 A;  3MEA A;  1X75 C;  2JXB A;  3OMG A;  4C92 A;  3JCM P;  4OMP A;  3O8V A;  2CGH A;  2XHC A;  4KGX B;  2XMF A;  4D8K A;  1NJI U;  1T0J A;  2DD5 A;  2CRE A;  1KQ2 A;  2DYI A;  2VVK A;  4DBH A;  5FU7 B;  1KK7 A;  2ZAE A;  4MZP A;  1RLP C;  5KYU A;  3MEV A;  3QO3 A;  3LYI A;  5L8R E;  3TRE A;  5KYW B;  4M75 F;  3TSZ A;  5FWC A;  1QVF S;  2RMO A;  3S6W A;  1M1K U;  2WAC A;  1IO6 A;  2OTL T;  2NUP A;  4C0D C;  1WPY A;  1VQ9 Q;  1XJW B;  2D8J A;  3REA B;  3CCS Q;  1OQK A;  4KUI A;  1QMC A;  4NS5 A;  2LCS A;  1D0X A;  1PSE A;  4RG8 A;  3M9Q A;  1UGR B;  3I55 Q;  4ELY C;  4BE0 A;  2EPD A;  2JTE A;  4ZNX A;  4IUU A;  1YJW Q;  1GL5 A;  4FM4 B;  1NE8 A;  3OMC A;  4FSX A;  3C95 A;  2Y4Y A;  2FRY A;  1YWP A;  4C92 G;  2KI7 A;  2MIO A;  4BE2 A;  3VYH B;  1GFC A;  2AKL A;  3OS1 A;  3CCQ T;  1Q81 C;  3ME9 A;  3JCM c;  2FG0 A;  4OP0 A;  3M59 A;  1YIT A;  3GIB A;  3NTK A;  2CKK A;  5GAM e;  3I56 T;  3CXC S;  1G8X A;  3E9G A;  3OYM A;  6AT1 B;  1JRI A;  1VQK T;  5KE2 A;  1GXI E;  3VKI A;  3HKS A;  1YI2 T;  1AWX A;  5LJ5 e;  3RKY A;  1RI9 A;  5FW9 A;  1ZUY A;  4ANJ A;  2P4R A;  1WQW A;  3EHR A;  5FWB A;  1QVG S;  4DQ2 A;  3JB9 G;  5GAN 8;  5GMK e;  2H3E B;  2DA9 A;  2MYS A;  2P0K A;  4JRQ A;  1YJN A;  1U8R A;  2FRW A;  2JMC A;  3H0I A;  3GP8 A;  3NTI A;  1SPK A;  4M7D E;  3LH5 A;  1VQN T;  1OPL A;  4BI4 A;  1PCX A;  2JJ9 A;  4C92 B;  2NYS A;  4OVA A;  4XTV A;  3QJY A;  1N5Z A;  2KRM A;  3CBM A;  3VS0 A;  4MDW A;  4D8D A;  3RKW A;  2JW4 A;  1KHC A;  3ZEH A;  1VQO T;  4RTU A;  4AG1 C;  1BIA A;  2VKN A;  2R58 A;  2D0Q B;  3X25 B;  2DXC A;  3G1J A;  4FIB A;  4PJO C;  1VQP T;  1D09 B;  4ME7 A;  2YXY A;  3NTH A;  2QQR A;  5LJ3 d;  3CEY A;  1KQS A;  3LWI A;  5KYU B;  4J9I A;  2VGN A;  3SWN B;  4M7A E;  1K9A A;  3G6E T;  4M7A F;  1X2Q A;  1M3A A;  2GNC A;  4XTY A;  1RAE B;  2FEI A;  2K5F A;  4CI0 C;  3OYN A;  1KC8 U;  4DEY A;  4ZGE B;  2HEQ A;  3RER A;  1YJ9 T;  4JUV A;  4Y91 A;  1MNE A;  3F70 A;  1YCY A;  4NOY A;  2HKQ B;  3CC2 T;  1ZA1 B;  4M78 C;  3G4S A;  3MP6 A;  1VUB A;  2CH4 A;  1WFW A;  4J6Y A;  1ZSG A;  3OYD A;  2LT1 A;  2DTO A;  3CME A;  4KH1 B;  3JRZ A;  2EGE A;  3OS0 A;  1QCO A;  5I2S A;  1JBM A;  4R0K A;  1D0Z A;  4Z89 A;  3CMA T;  3EFS A;  2PUK B;  2ED0 A;  1RAC B;  7AT1 B;  2ZCF B;  4XTX A;  1Y0M A;  1TUC A;  4K11 A;  4RG2 A;  2EBP A;  3X24 B;  5IN1 A;  2FYK A;  2O88 A;  3LH0 A;  1YIJ T;  1QWE A;  2HDA A;  1VQ4 T;  1UJ0 A;  5IHK A;  2BE9 B;  2FPE A;  2JS0 A;  1PM3 A;  3OS2 A;  4LXC A;  1EZZ B;  1YNZ A;  2BKD N;  2QGF B;  3EG3 A;  3A1P A;  2OAW A;  1TH7 A;  2KBT A;  3JB9 D;  2AK5 A;  3C0C A;  2MF2 A;  2XDP A;  2DO3 A;  1T3L A;  1MMG A;  3BDU A;  4BI3 A;  2E10 A;  4AFQ C;  1I8F A;  2RO0 A;  4N4I A;  3V7C A;  2LTO A;  5FU6 B;  3L2W A;  5FRO A;  5CCA A;  2L8D A;  4XU0 A;  4BY6 B;  2X51 A;  1YI2 A;  4JS5 A;  1KFZ A;  2PU9 B;  1RI0 A;  3I35 A;  2CP6 A;  1PD0 A;  2OTJ A;  3L2Q A;  3R6N A;  2DKG A;  4AFZ C;  4BDY A;  1M4Z A;  4BDZ A;  1N8R U;  1MND A;  1WHH A;  4Q5W A;  2CP3 A;  3QWX X;  2D8H A;  2X9H A;  4A4G A;  4OB0 B;  3BFM A;  5DLO A;  4RTZ A;  2CSQ A;  4PJO A;  4QVC A;  4ZGJ B;  2EQJ A;  2R5M A;  2RI2 A;  1RAB B;  2EVR A;  1YJN Q;  3PE0 A;  3UA6 A;  2DET A;  2KR3 A;  2RHI A;  5GAN 4;  1RLQ C;  4HVV A;  3PIP A;  4HT9 A;  4PJJ A;  2DX1 A;  4EDU A;  2AZV A;  2DD4 A;  2IPO B;  3HFO A;  3INZ A;  2L0A A;  4C0D B;  4RTX A;  1VQP A;  2A3L A;  2FL7 A;  1BI2 A;  4J7F A;  4HVW A;  2CSI A;  4M78 A;  2DRM A;  5GAN g;  2C06 A;  1W2B S;  5D6W A;  2KK4 A;  2E3H A;  3CCM A;  3G6E A;  5C0M A;  4RKU E;  1OUL A;  1JXM A;  4RTV A;  3OW2 A;  1MMN A;  1BI0 A;  1RAF B;  2E3I A;  1R0B G;  4A4H A;  3FRN A;  3NFC A;  2VB6 A;  3HRU A;  1WHJ A;  4LUE A;  4VUB A;  1B3Q A;  3QJ6 A;  3CC2 A;  4RUG A;  1SHG A;  2PQW A;  2YHT A;  3FLG A;  3S3O A;  1GBR A;  2LJ1 A;  1B34 A;  3KBG A;  4XK8 E;  4PJO G;  1KD1 R;  3G4S Q;  3GPL A;  1OX8 A;  1RAG B;  5GAN h;  2L3S A;  1OU8 A;  5AT1 B;  2RJD A;  1Y96 A;  3CME Q;  1H92 A;  2CUD A;  3H0H A;  4OF1 A;  2RK1 A;  3EFO A;  2KGT A;  3PT9 A;  2DF6 A;  2WSF E;  1F1B B;  3FC3 A;  1QP2 A;  2K2M A;  1GRI A;  5GAN 7;  2G6F X;  3PFS A;  1HYO A;  1XTD A;  2DXT A;  1JJ2 A;  2JT4 A;  5I11 A;  3M4Y A;  4FCY A;  2MK5 A;  1WJQ A;  2GCX A;  4M78 G;  5A0D A;  3UT1 A;  3EFR A;  1ARK A;  5KE3 A;  2G3R A;  4FYV B;  2BZ8 A;  2X4W A;  3CXC P;  3EG2 A;  1MV3 A;  3QG1 A;  3TQ7 P;  1M1F A;  5CKB A;  2EJ9 A;  5IXB A;  2JNG A;  3QYG B;  4C92 E;  4C92 F;  4M77 C;  4M75 D;  1U06 A;  1K8A R;  1V29 B;  4QQ6 A;  2F1L A;  2F2V A;  2CT3 A;  1G3S A;  1UDL A;  3DLM A;  5HKC A;  2LCL A;  4PJO B;  1SF9 A;  4C8Q C;  3CCU T;  3WVD B;  1Q82 C;  5KYN A;  4LD6 A;  3CC7 T;  2K2V A;  3P8D A;  5GJV B;  1OX9 A;  1VOM A;  1NJI R;  2ZZD A;  1E6G A;  1YI2 Q;  1X01 A;  3OYA A;  4OGE A;  2XK0 A;  2DXB A;  2K57 A;  4J9F A;  5J26 A;  5LJ5 j;  2X35 A;  2OTJ Q;  1WZO A;  1K9M U;  2FB7 A;  3OYI A;  2QDY B;  1NJI C;  3VJP A;  3JB9 F;  2RB6 A;  3OA6 A;  4M78 B;  3OYG A;  1K73 U;  5L23 A;  5GMK j;  1SKU B;  1AWO A;  2M0Y A;  4JRP A;  4X34 A;  5KYX A;  4FW2 A;  2HQX A;  1TS9 A;  5CR2 A;  2LT4 A;  4QVD A;  1VQ5 T;  3CCV T;  5IAY A;  1M90 R;  2EYW A;  1MV0 B;  2NUZ A;  1WYX A;  1M1K C;  4JLI A;  4PJO D;  2FHD A;  3TSW A;  4J9H A;  4HCB A;  1B34 B;  4E7S A;  2K6D A;  3C4S A;  4XU1 A;  3EGX A;  4ZTF A;  2QG9 B;  2IG0 A;  2YRC A;  2LRQ A;  2COY A;  1JXO A;  4OB3 B;  1Q86 R;  2RQU A;  3CCM Q;  4IIM A;  3FB9 A;  1VQM A;  1AVZ C;  1X2K A;  1O9S A;  2RF0 A;  2B8A A;  1ACM B;  2V1R A;  2ZGW A;  4A53 A;  2DJZ A;  4CC7 A;  5GAN e;  4F14 A;  3M57 A;  1N6A A;  2KVQ G;  3CC2 Q;  4AMC A;  2A08 A;  3LX7 A;  3ULR B;  2RNA A;  5GAN 3;  5HK0 A;  1KD1 U;  4FYW B;  3H6Z A;  4F7U A;  3EGD B;  1UFF A;  2PUO B;  4MML A;  2COZ A;  1UTI A;  1C0M A;  3C94 A;  4XTU A;  1NPR A;  5M9O A;  2K79 A;  2QYZ A;  4M77 A;  3CCR Q;  2HCK A;  3TVT A;  2L89 A;  1I0C A;  4JZ3 A;  1FMK A;  1VYU A;  1IGQ A;  4C8Q A;  4ELZ C;  2GGR A;  1M3B A;  1G3T A;  2ED1 A;  3RR6 A;  4C0G A;  3L2R A;  2R57 A;  2E70 A;  1XQH A;  3MP8 A;  2GFU A;  5LJ3 j;  1LOJ A;  3JCM f;  1AEY A;  1IXD A;  4KRT A;  4PK4 A;  4KT0 E;  1W4S A;  1PC0 A;  4FW1 A;  1YP5 A;  2CH4 W;  4J7I A;  2RHX A;  3RMQ A;  1ZSZ C;  4EIK A;  3CCU A;  3GNG A;  3OSS C;  5GAN 5;  1K8A U;  4L6V 5;  1U5S A;  2V8K A;  3CC7 A;  2RJC A;  4JRI A;  5KYX B;  2KT8 A;  5J3B A;  2EWN A;  1KC8 R;  3MP1 A;  2EYY A;  4A4E A;  3QHS A;  4F7U G;  1FWZ A;  1EX4 A;  2EYX A;  4C0Z A;  4IUQ A;  2DPP B;  2ENM A;  1JQQ A;  5GAM d;  2QA4 T;  2M1H A;  1CKB A;  4M77 G;  5CAI A;  1KC8 C;  5A2Q E;  4NL3 A;  3BE3 A;  2X4Y A;  1EIF A;  3MEW A;  3EGX B;  2DL7 A;  1S1N A;  4OMF B;  4C8Q G;  1BU1 A;  4M75 E;  5LJ5 d;  2VYT A;  3OYH A;  3GOX A;  4KUD K;  1AHJ B;  1WHM A;  5D6X A;  3OYF A;  2HZY A;  5GMK i;  2J7I A;  2P0Q A;  2JZ2 A;  3A8M B;  1W2B P;  1AWW A;  5FLX E;  1VQ5 A;  2RD1 A;  2QEX T;  3LGL A;  5DLQ E;  3JB9 J;  4IUP A;  2EIF A;  2GBQ A;  4E7H A;  3AHU A;  2I0N A;  1RAD B;  1M90 U;  4PNO A;  2ABL A;  4OMN A;  1WXT A;  1KQS S;  1GBQ A;  2HQH A;  1ZHI A;  2QI2 A;  1W1F A;  3Q1J A;  4GY5 A;  2MWP A;  4OMO A;  3S3N A;  1YHQ T;  4AT1 B;  3JCM V;  3EAE A;  3UWN A;  2NLU A;  3A8G B;  3J80 E;  5FRM A;  1UE9 A;  3I9Q A;  4F7U B;  1ZA2 B;  1Q86 U;  1N9S A;  4PLL A;  4AFU C;  3TEE A;  1FMV A;  1VQM Q;  5J39 A;  2XG8 D;  4M77 B;  3CD6 A;  2X3X D;  2VAS A;  4F04 B;  4HA8 A;  4IKF A;  1YBY A;  3VUB A;  3HSB A;  3V7R A;  2FZK B;  3HRS A;  1B07 A;  4C8Q B;  4PJO E;  4PJO F;  3URG A;  5LJ5 f;  5A0G A;  1N8R R;  4N4G A;  3QKJ A;  1VYV A;  4DOV A;  2BUD A;  2QQA A;  2LCC A;  1M3C A;  3PGG A;  3OY9 A;  2NWM A;  4CRI A;  3MPU B;  1IRE B;  2PZ1 A;  3WVE B;  3A8L B;  1N8R C;  2QXF A;  4LUD A;  2ZPI B;  3REB B;  4B9W A;  1ZSZ A;  4FL6 A;  1HJD A;  1VQ6 A;  3C12 A;  2X4X A;  4QVZ A;  1IGU A;  4M78 F;  4ORZ A;  2JTM A;  4C5G A;  3PVQ A;  1X6B A;  1BI1 A;  3VS4 A;  1LCK A;  2VXF A;  4JRK A;  1GFD A;  4J6W A;  1WXB A;  4M77 D;  3DLL A;  3QII A;  4X9D A;  1M8M A;  5GMK m;  1TTH B;  3KFV A;  1KIK A;  3OBW A;  2DM1 A;  1K0S A;  1VIF A;  1GCQ C;  2LJ3 A;  2RQR A;  3CCE T;  5CIU A;  2M51 A;  4C8Q D;  1IHW A;  5GAO q;  5CKE A;  4PJL A;  3OBY A;  3P8B B;  3OYB A;  1MMA A;  4FU6 A;  1QCN A;  3L42 A;  2K3X A;  3X26 B;  2YT6 A;  5A0L A;  4RCB A;  2CZ6 B;  2HBP A;  2NUP B;  3O5Z A;  1PKS A;  2CUB A;  5CKH A;  2QA4 A;  4IIO A;  1T0H A;  1VQ7 T;  3M0Q A;  3HL8 A;  1KSW A;  2LJ0 A;  2EQU A;  2BZX A;  3CPW S;  3CCJ T;  2O31 A;  4C92 D;  3RBB B;  4F17 A;  4M7D C;  3GF5 A;  2OX7 A;  3VRY A;  1QCF A;  1HSQ A;  2R5A A;  3A8H B;  3V7S A;  5I22 A;  1RAI B;  2RA2 A;  2OTL A;  1FYN A;  2QEX A;  5D7U A;  2ROT A;  2MOX A;  4DBQ A;  3CXC A;  1RUW A;  3M56 A;  3KXT A;  5GAO m;  5CQX A;  1TOV A;  3GBQ A;  2YUQ A;  3E2U A;  1JEG A;  1SSH A;  1X43 A;  4FSS A;  5LJ3 f;  1YHQ A;  1OPK A;  1UGQ B;  1WHL A;  3QDR B;  2E41 A;  2F2X A;  3CCQ A;  1LNX A;  3NMZ C;  4Z88 A;  1S72 T;  4KGV B;  2XDD A;  1W6X A;  3CC4 T;  1R0C B;  1WHG A;  4J9D A;  3I56 A;  3JB9 H;  2KDS A;  1VQ8 T;  3FEO A;  3ASK A;  1VQK A;  1YIT Q;  3CD6 Q;  1AT1 B;  4E7J A;  1P92 A;  2COW A;  2KXC A;  2DIG A;  2RK2 A;  1V1C A;  4UC4 A;  3H8Z A;  1M9S A;  1C6V X;  2D9T A;  2BIV A;  1Q95 G;  2CZ0 B;  2E1H A;  3UAT A;  2P0P A;  1K9M R;  4MMK A;  2VUB A;  3PVL A;  4IUR A;  1JJ2 S;  3OYC A;  1K73 R;  2RQW A;  4N0A C;  3PMI A;  2DEQ A;  1VQN A;  4FYY B;  1GCQ A;  1MHN A;  1ZLM A;  3M53 A;  1K9M C;  2RHY A;  2XID A;  2VXE A;  2RHZ A;  1NEG A;  1VQ6 Q;  1TWB A;  1K73 C;  3QZ9 B;  2EKH A;  3N5B B;  2CP7 A;  1SG5 A;  1VQO A;  3M0S A;  4P5N A;  1AZG B;  2E12 A;  1OV3 A;  3QDF A;  3OQ5 A;  3D7S B;  4DA4 A;  5CKD A;  1KJW A;  1VQ9 T;  2L3P A;  2SEM A;  3JCM b;  3BDL A;  3CCS T;  4LE9 A;  2FZC B;  1M8V A;  4EMH A;  2CS7 A;  3I55 T;  5IXF A;  1VQL T;  2LC4 A;  4BB7 A;  4E7K A;  4JPB W;  1YJW T;  1YJ9 A;  3UPU A;  3CBP A;  1G5V A;  4F7U E;  4F7U F;  3HPW A;  3V8K A;  1QVF P;  4MDX A;  4DEX A;  4XU3 A;  1G83 A;  2QA4 Q;  3QBY A;  4M77 E;  4M77 F;  3VU3 C;  5HY6 A;  3PTA A;  4C0F A;  4J9B A;  1KG1 A;  2HBW A;  5IHI A;  2XD0 A;  3J7A F;  3EH1 A;  2MCN A;  2XI9 A;  5ECA A;  2JS2 A;  4C8Q E;  1OYX A;  4C8Q F;  3CMA A;  2ZPB B;  5FU7 C;  1E6H A;  1O75 A;  1KD1 C;  2KXD A;  1UHC A;  2OTL Q;  4FYX B;  3WXM B;  2DJQ A;  2QEX Q;  4NL2 A;  2ECZ A;  1YIJ A;  1IHV A;  4DOW A;  4C5I A;  1VQ4 A;  5GJW B;  4GLM A;  1I07 A;  3QXE B;  1H3H A;  1XNI A;  4IUV A;  1M27 C;  2JOY A;  2YUP A;  3TCJ A;  1CSK A;  1NEB A;  3MET A;  4O6J A;  4M7D G;  5GMK l;  3JCM g;  3G71 T;  4V2S A;  1YCS B;  2VGM A;  1NBE B;  2YLC A;  2HQE A;  2O4X A;  2GFA A;  4QW2 A;  1ZUK A;  3CCQ Q;  2CZ7 B;  2QGG A;  1VQ8 A;  3VRZ A;  3RMS A;  1UGP B;  5CQY A;  4BI8 B;  1D1C A;  5D6Y A;  4N0A A;  3I56 Q;  2J6O A;  1QVG P;  5GAM j;  2YRV A;  4Y92 A;  4LDV A;  1VQK Q;  2M16 A;  1B7T A;  1UJY A;  3DKM A;  2HSP A;  5EC7 A;  1K8A C;  2LMJ A;  2EQM A;  4HCZ A;  1WJS A;  2PVG B;  2LVM A;  1VYT A;  5GAN d;  1K4U S;  1W2B A;  1WJR A;  3L1A A;  2JVV A;  1Q7Y U;  4XQ3 A;  2K9G A;  1M2V A;  1QVP A;  4F16 A;  1N27 A;  2AT1 B;  1VQN Q;  1K76 A;  4A4K A;  1J3T A;  4OMQ A;  2KE9 A;  4PFO A;  5GAO l;  2L5Q A;  2DFU A;  2L2P A;  2LZ6 B;  2RI5 A;  1VQO Q;  4OB2 B;  1BYM A;  3QZ5 B;  5CO7 A;  2J6F A;  1D3B A;  1Y57 A;  2NUT A;  3VS6 A;  1VQP Q;  3G7Z A;  3VYG A;  2JN0 A;  2SRC A;  2LQ8 A;  4HCK A;  1M90 C;  4B6M A;  5I21 A;  4PJM A;  1VQL A;  1Y96 B;  2YWW A;  4L59 A;  3G6E Q;  3RNJ A;  1TU0 B;  4LNP A;  3CPW P;  2MPX C;  2K5I A;  3EFO B;  2BTT A;  2HSE B;  2RJE A;  3PMT A;  4LDX A;  3SWN C;  1YJ9 Q;  5KH6 A;  4M78 D;  2OAU A;  3CCL T;  2KT1 A;  3HTR A;  2F5K A;  4HVU A;  2KYB A;  1Q86 C;  2GTJ A;  3CQT A;  1NLO C;  1PRL C;  1NPP A;  2I2L A;  3QWY A;  4R55 A;  1OI1 A;  2A28 A;  1WI7 A;  2JMA A;  2CDT A;  3EG9 A;  2K4Y A;  3OYJ A;  1Y07 A;  1X69 A;  2YUN A;  3QPH A;  2O4X B;  3CMA Q;  1NYF A;  3OB9 A;  2RHU A;  4E7L A;  4CC4 B;  2JM9 A;  1UUE A;  1YIJ Q; 
#chains in the Genus database with same CATH homology
 1N9R A;  2BUD A;  3JCM J;  4BI3 A;  2QQA A;  2E10 A;  1I8F A;  2RO0 A;  4L5G A;  5KCO A;  2LCC A;  4N4I A;  2X4J A;  5I2M A;  3PGG A;  3OY9 A;  3SD4 A;  2E6N A;  2XKO C;  3V7C A;  2LTO A;  2EFI A;  5FU6 B;  3L2W A;  5FRO A;  4CRI A;  5CCA A;  2EKO A;  2EQK A;  2DVE A;  2L8D A;  1IRE B;  4XU0 A;  4BY6 B;  3G71 A;  3WVE B;  3PIO A;  3A8L B;  1YI2 A;  2MMP A;  1N8R C;  3M58 A;  3OYY A;  4JS5 A;  1YJN T;  2QXF A;  2PU9 B;  3DB3 A;  2ZPI B;  1RI0 A;  4B9W A;  5GAO n;  4FL6 A;  3JSC A;  5GAN 6;  3L2Q A;  1VQ6 A;  2DKG A;  4HCC A;  3C12 A;  2OTJ A;  1VIE A;  2X4X A;  4QVZ A;  4BDY A;  1M4Z A;  4BDZ A;  1N8R U;  2V8I A;  3TU4 K;  4M78 F;  4RCC A;  2E6Z A;  2JTM A;  4M7A G;  3JCM h;  4C5G A;  3JCM Q;  1BI1 A;  1QW1 A;  2QQS A;  4Q5W A;  1VQP A;  1G3W A;  2RI3 A;  2VXF A;  4JRK A;  1M5Q 1;  4E7I A;  3V8J A;  4LDU A;  3VV0 A;  4A4G A;  4J6W A;  4OB0 B;  4PLI A;  3RES A;  3BFM A;  5DLO A;  4EMK B;  4M77 D;  3L2V A;  3DLL A;  4PJO A;  4QVC A;  3JCM e;  3QII A;  4X9D A;  5GMK m;  4LDX A;  4ZGJ B;  2Y90 A;  3SB2 A;  2EQJ A;  2R5M A;  2RI2 A;  3LLR A;  2WSE E;  3L2U A;  2GF7 A;  1WGS A;  3E9F A;  3OBW A;  4YTL A;  2KMT A;  2RHI A;  1G3Y A;  1I5L A;  5FRN A;  5C6S A;  1VIF A;  3BW1 A;  5GAN 4;  2D6F A;  3CCE T;  3A5Z B;  5CIU A;  3HP9 A;  4C8Q D;  5KCH A;  3PIP A;  5GAO q;  2JUF A;  4HT9 A;  4M7D B;  5CKE A;  3OBY A;  4EDU A;  1FXX A;  3P8B B;  2DD4 A;  4R56 A;  4RMO A;  3HFO A;  3OYB A;  3INZ A;  3OSV A;  1D3B B;  2JTF A;  2FVU A;  4C0D B;  4FU6 A;  3QSU A;  3ZFJ A;  3J81 E;  3L42 A;  2K3X A;  4JS4 A;  3A8O B;  2EAY A;  3M4G A;  1SSF A;  3X26 B;  4C92 C;  2A3L A;  3MO8 A;  4RCB A;  2CZ6 B;  2E65 A;  2FL7 A;  2HBP A;  1BI2 A;  4J7F A;  5A0L A;  5GAN g;  4M78 A;  4MZM A;  2C06 A;  2H3J A;  1VQ9 A;  1W2B S;  5CKH A;  5D6W A;  2QA4 A;  2KK4 A;  3CBO A;  2KAF A;  1Y71 A;  3GNF B;  3CCS A;  3CCM A;  2HAX A;  4LDW A;  3G6E A;  5C0M A;  4ATO A;  2PVO B;  4RKU E;  3OW2 A;  1VQ7 T;  3CCV A;  2EYQ A;  4OGC A;  3I55 A;  3G4S T;  3HL8 A;  2XU8 A;  1BI0 A;  5GAN 2;  3CCJ T;  2EQU A;  3RIR A;  3CPW S;  1YJW A;  4A4H A;  3FRN A;  4ZTJ A;  4C92 D;  3SWN A;  2DK3 A;  2DZ9 A;  3LWH A;  3CME T;  3NFC A;  4KUL A;  4TVR A;  3CPF A;  4M7D C;  3HRU A;  5LJ3 g;  3GF5 A;  5GAM g;  4M7A B;  2QQB A;  3HFN A;  4VUB A;  3HHT B;  3QJ6 A;  3CC2 A;  2LDM A;  1UEB A;  2R5A A;  3A8H B;  5EG2 A;  2PQW A;  3V7S A;  5GAN f;  2YHT A;  2RA2 A;  3FLG A;  1WQ7 A;  3X20 B;  4A4F A;  2OTL A;  2QEX A;  3S3O A;  2LQK A;  2CZ1 B;  2Y4X A;  2E5Q A;  1B34 A;  3S3M A;  3KBG A;  3E19 A;  2L3R A;  1PSF A;  2VC8 A;  4N4H A;  2M0O A;  4E47 A;  3CXC A;  4XK8 E;  3M56 A;  4O5V A;  4QQG A;  4PJO G;  5CQX A;  5GAO m;  3KXT A;  3PNW C;  1H64 1;  4ZN1 A;  3V8L A;  5LJ5 g;  3GPL A;  5GAN h;  3UDC A;  4M7D D;  2K3Y A;  3JCM d;  2DXU A;  2RJD A;  4II1 A;  1Y96 A;  4HKE A;  2DZC A;  1UGS B;  5LJ3 f;  5GAM f;  1YHQ A;  1BI3 A;  1YIT T;  3CCL A;  1UGQ B;  2KQW A;  1LJO A;  4OF1 A;  2RK1 A;  2CYZ B;  3CD6 T;  3M54 A;  3QDR B;  2E41 A;  1XOV A;  3PT9 A;  5CVI A;  2WSF E;  2RM4 A;  3FC3 A;  1QP2 A;  5GAN 7;  3CCQ A;  1LNX A;  3BY7 A;  5LJ3 h;  5GAM h;  1S72 T;  1JB0 E;  3PFS A;  1OZ2 A;  1XTD A;  2DXT A;  2XDD A;  3CC4 T;  1JJ2 A;  3M4Y A;  1FX7 A;  3QUI A;  1R8O B;  4LD9 K;  1WJQ A;  2GCX A;  4M78 G;  5A0D A;  3UT1 A;  3I56 A;  3EFR A;  3JB9 H;  3LW5 E;  5KE3 A;  2KDS A;  2AHJ B;  3FEO A;  1VQ8 T;  2G3R A;  2X4W A;  4M75 C;  1M1G A;  3ASK A;  4XTW A;  1VQK A;  4X9C A;  1UB4 A;  1I4K 1;  3FDR A;  3JB9 I;  2F5T X;  5LJ5 h;  3QG1 A;  1IZ6 A;  4J8O A;  1M1F A;  4M7A D;  4E7J A;  5CKB A;  2EJ9 A;  1P92 A;  2XIC A;  2JNG A;  3QYG B;  2HNI A;  4C92 E;  3MEU A;  1I81 A;  4C92 F;  2DIG A;  2RK2 A;  3FIF A;  4UC4 A;  5GAO p;  4M77 C;  3H8Z A;  1M9S A;  2D9T A;  3SFM A;  2HD0 A;  4JJN K;  2K5L A;  2EJF A;  2BIV A;  5GMK h;  2CZ0 B;  2E1H A;  4M75 D;  2P0P A;  2OTJ T;  1VQ6 T;  1V29 B;  4M78 E;  4QQ6 A;  4MMK A;  2VUB A;  1G3S A;  3DLM A;  4EMG A;  5HKC A;  3OYE A;  2LCL A;  3ZBD A;  2PVD B;  4IUR A;  2DIQ A;  4C8Q C;  3CCU T;  1JJ2 S;  3WVD B;  4PJO B;  1Q82 C;  3OYC A;  3JCM X;  3DB4 A;  4LD6 A;  3CC7 T;  2MAM A;  2YLB A;  2O01 E;  4N0A C;  4B9X A;  3M5A A;  3PMI A;  2DEQ A;  2K2V A;  3P8D A;  4M7D F;  1VQN A;  1MHN A;  3RUX A;  2ZZD A;  1Q82 U;  3M53 A;  5LL6 S;  4J83 A;  1X01 A;  3ER0 A;  4C5H A;  1K9M C;  1U1T A;  3OYA A;  5FU6 C;  4OGE A;  2RHY A;  2XID A;  2XK0 A;  2VXE A;  2A7Y A;  2DXB A;  2MWO A;  3E1S A;  2RHZ A;  2K57 A;  4BY6 C;  5J26 A;  5LJ5 j;  3L2Z A;  2X35 A;  2M9U A;  3RKX A;  2WSC E;  1K73 C;  3QYH B;  3QZ9 B;  1K9M U;  2FB7 A;  1ZQ1 A;  3OYI A;  3N5B B;  2QDY B;  2XDB A;  1VQO A;  1QVF A;  3MEA A;  1NJI C;  4P5N A;  1X75 C;  3OMG A;  2RB6 A;  3VJP A;  4C92 A;  2E12 A;  1QP3 A;  3OA6 A;  3JB9 F;  4M78 B;  3OYG A;  1K73 U;  3JCM P;  3O8V A;  2CGH A;  4JLG A;  5GMK j;  2XHC A;  4DOV A;  3OQ5 A;  4JRP A;  4X34 A;  1NJI U;  2HQX A;  1BKB A;  2DD5 A;  4XTZ A;  3X28 B;  4DA4 A;  5CKD A;  1KQ2 A;  2RH2 A;  5CR2 A;  1VQ9 T;  2LT4 A;  3JCM b;  4EMK C;  3BDL A;  3CCS T;  3CCM T;  4QVD A;  1VQ5 T;  1M8V A;  4EMH A;  2CS7 A;  3CCV T;  3SDZ A;  5FU7 B;  3I55 T;  1VQL T;  5IAY A;  2LC4 A;  1H3Z A;  4MZP A;  4BB7 A;  4E7K A;  4MZT A;  3LGF A;  3MEV A;  4JLI A;  3QO3 A;  2FHD A;  3LYI A;  1YJ9 A;  1YJW T;  1M1K C;  4PJO D;  5L8R E;  4HCB A;  3TRE A;  3UPU A;  1B34 B;  3CBP A;  4M75 F;  1G5V A;  4F7U E;  3OYL A;  3C4S A;  4F7U F;  1QVF S;  3S6W A;  4XU1 A;  3HPW A;  4ZTF A;  3V8K A;  1KHI A;  2WAC A;  1M1K U;  2IG0 A;  1ZBX A;  4MDX A;  2LRQ A;  2OTL T;  4C0D C;  1WPY A;  4XU3 A;  4OB3 B;  3FJP A;  3QBY A;  4M77 E;  3HRT A;  4M77 F;  4KUI A;  4NS5 A;  3JCM W;  3FB9 A;  3MCA B;  1VQM A;  1PSE A;  4RG8 A;  3M9Q A;  1UGR B;  3VU3 C;  4ELY C;  4BE0 A;  5HY6 A;  3PTA A;  2F69 A;  1O9S A;  4C0F A;  1KG1 A;  5HK3 A;  4IUU A;  2B8A A;  2XD0 A;  3OW2 S;  3J7A F;  2ZGW A;  3M55 A;  2XI9 A;  4A53 A;  2DJZ A;  4HT8 A;  4C8Q E;  1OYX A;  4C8Q F;  4FM4 B;  5GAN e;  4ZGD B;  3CMA A;  1NE8 A;  2ZPB B;  3M57 A;  3OMC A;  4FSX A;  4LDY A;  5FU7 C;  3C95 A;  1N6A A;  2VV5 A;  2Y4Y A;  2KVQ G;  3CCR T;  2DAQ A;  1O75 A;  1KD1 C;  3LX7 A;  4C92 G;  4BE2 A;  3WXM B;  1MGQ A;  4NL2 A;  3VYH B;  3OS1 A;  4M7A C;  1YIJ A;  5GAN 3;  1QVG A;  4DOW A;  3CCQ T;  4C5I A;  1Q81 C;  3ME9 A;  1VQ4 A;  5HK0 A;  1KD1 U;  3QXE B;  3JCM c;  1XNI A;  4M75 A;  4IUV A;  3H6Z A;  4OP0 A;  4F7U A;  3M59 A;  1YIT A;  2JOY A;  3GIB A;  2PUO B;  3NTK A;  2CKK A;  4MML A;  4J6X A;  5GAM e;  5LJ3 e;  3I56 T;  3TCJ A;  3CXC S;  3C94 A;  1Q81 U;  2KY9 A;  4XTU A;  1NPR A;  5M9O A;  3E9G A;  3OYM A;  1NZ9 A;  3MET A;  1JRI A;  1VQK T;  4M77 A;  4O6J A;  5GAN j;  4M7D G;  5GMK l;  3JCM g;  5KE2 A;  4FT2 A;  3G71 T;  1GXI E;  4V2S A;  3VKI A;  2VGM A;  2YLC A;  2HQE A;  2L89 A;  2O4X A;  2ZPH B;  3HKS A;  2GFA A;  1YI2 T;  5LJ5 e;  4QW2 A;  3RKY A;  2KSS A;  2CZ7 B;  1WNL A;  2ZPG B;  5AYF A;  1VQ8 A;  4Y28 E;  3RMS A;  4C8Q A;  1UGP B;  4ELZ C;  1G3T A;  5CQY A;  4BUG A;  4BI8 B;  4C0G A;  1WQW A;  2E70 A;  2R57 A;  4N0A A;  5D6Y A;  3L2R A;  1QVG S;  1XQH A;  4DQ2 A;  3JB9 G;  3MP8 A;  2EJG A;  2GFU A;  5GMK e;  5LJ3 j;  5GAM j;  5GAN 8;  2YRV A;  1LOJ A;  2P0K A;  4JRQ A;  2V8J A;  4LDV A;  1YJN A;  1U8R A;  4A54 A;  3GP8 A;  3JCM f;  2M16 A;  3NTI A;  2QQ9 A;  4M7D E;  1DJ7 B;  4KT0 E;  3DKM A;  1K8A C;  4EPC A;  1VQN T;  2EQM A;  4ZN3 A;  1W4S A;  2MI6 A;  4BI4 A;  4J7I A;  2RJF A;  4HCZ A;  1WJS A;  2PVG B;  2LVM A;  2RHX A;  4KBM B;  3RMQ A;  3CCU A;  4C92 B;  3GNG A;  3OSS C;  4OVA A;  3P8H A;  3QJY A;  4L6V 5;  4XTV A;  5GAN 5;  1Q7Y C;  5GAN d;  2V8K A;  3CBM A;  3CC7 A;  2RJC A;  2QTX A;  4MDW A;  1W2B A;  4JRI A;  3RKW A;  1KHC A;  5J3B A;  3ZEH A;  2EWN A;  1VQO T;  1WJR A;  3MP1 A;  1BIA A;  4IUT A;  3L1A A;  4BAC A;  2JVV A;  2R58 A;  1Q7Y U;  2D0Q B;  3OS5 A;  2DXC A;  2GQV A;  4XQ3 A;  3X25 B;  4C5E A;  4M75 G;  4A4E A;  3QHS A;  5GAO r;  4F7U G;  2LX9 A;  4FIB A;  1QVP A;  1Y7X A;  1FWZ A;  1KQ1 A;  4EMK A;  3CCE A;  4PJO C;  4C0Z A;  1N27 A;  5DY9 A;  2LNV A;  3CPW A;  4IUQ A;  4ME7 A;  1VQP T;  4A4K A;  2DPP B;  3NTH A;  2IVW A;  2QQR A;  5LJ3 d;  5GAM d;  4WF2 A;  2QA4 T;  3CEY A;  4PKC C;  1KQS A;  3LWI A;  2M1H A;  4M77 G;  2VGN A;  3SWN B;  5CAI A;  5GAO l;  1U1S A;  5A2Q E;  3G6E T;  1KC8 C;  4M7A E;  4M7A F;  2L5Q A;  1RL2 A;  2ZPE B;  4NL3 A;  4M7D A;  4CI0 C;  4OB1 B;  2K5F A;  4PL6 A;  4XTY A;  2RI5 A;  3OYN A;  2X4Y A;  4OB2 B;  1EIF A;  3MEW A;  1HXD A;  2DTH A;  1KC8 U;  1BYM A;  4ZGE B;  4OMF B;  3QZ5 B;  5CO7 A;  4C8Q G;  1YJ9 T;  3RER A;  4M75 E;  1D3B A;  4JUV A;  2VYT A;  4Y91 A;  5LJ5 d;  3OYH A;  3F70 A;  1AHJ B;  3GOX A;  5D6X A;  1YCY A;  3OYF A;  4KUD K;  4NOY A;  3CC2 T;  3G7Z A;  2P0Q A;  3A8M B;  2JN0 A;  2JZ2 A;  3VYG A;  5GMK i;  1VQ7 A;  5FLX E;  1VQ5 A;  4M78 C;  3G4S A;  1X6O A;  2LQ8 A;  4JDS A;  2RD1 A;  2QEX T;  3MP6 A;  1VUB A;  1M90 C;  5I21 A;  3CCJ A;  1VQL A;  4J6Y A;  3LGL A;  5DLQ E;  3JB9 J;  3KUF A;  1Y96 B;  2DTI A;  4IUP A;  3OYD A;  4L59 A;  2EIF A;  2LT1 A;  2DTO A;  3CME A;  4E7H A;  3AHU A;  3JRZ A;  5CK9 A;  3OYK A;  1VQM T;  1M90 U;  1BIB A;  2E64 A;  3R6O A;  4PNO A;  2K5I A;  2P4T A;  3OS0 A;  1KQS S;  2RJE A;  1ZHI A;  3PMT A;  4QQD A;  2QI2 A;  3Q1J A;  4GY5 A;  3SWN C;  4D6W A;  2MWP A;  5CKF A;  5I2S A;  1JBM A;  5KH6 A;  4M78 D;  4XU2 A;  3S3N A;  1YHQ T;  2OAU A;  4J5Y A;  3CMA T;  3EFS A;  3CCL T;  2PUK B;  2F5K A;  3EAE A;  3JCM V;  3UWN A;  2ZCF B;  1Q86 C;  2NLU A;  4M7A A;  3A8G B;  3J80 E;  4FT4 A;  5FRM A;  3VUZ A;  4XTX A;  4M75 B;  2ZPF B;  4RG2 A;  4F7U B;  4BE1 A;  3X24 B;  1NPP A;  5IN1 A;  2FYK A;  2I2L A;  1HK9 A;  1Q86 U;  4R55 A;  3LH0 A;  1N9S A;  1YIJ T;  4PLL A;  5IT9 E;  1OI1 A;  1VQ4 T;  3TEE A;  3MHX A;  4BD3 A;  2K4Y A;  5J39 A;  2XG8 D;  1OZ3 A;  4M77 B;  5DM7 R;  3OYJ A;  3CD6 A;  1Y07 A;  3CCR A;  4XAX B;  3OS2 A;  4HA8 A;  4IKF A;  3QPH A;  1K8A U;  2O4X B;  3T9N A;  1YBY A;  4GLK A;  3VUB A;  3HSB A;  3V7R A;  1S72 A;  2BKD N;  3GLX A;  3OB9 A;  2RHU A;  1TH7 A;  3HRS A;  3JB9 D;  4Z02 A;  4C8Q B;  3CC4 A;  4E7L A;  4PJO E;  4PJO F;  3URG A;  5LJ5 f;  2MF2 A;  5A0G A;  2XDP A;  4N4G A;  2DO3 A;  3QKJ A;  3JAM E;  3BDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...