3ZL7C

Bace2 fynomer complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
VTLFVALYDYEARPNRPLDLSFHKGEKFQILNWWHVRGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3zl7C00
3I35A 1YWPA 4CC7A 2YUOA 3UATA 4DEXA 2KGTA 3VRZA 1U06A 1X43A 4AFZC 1T3LA 3H41A 3IQLA 2LZ6B 4OMPA 3UF4A 1NEBA 1I1JA 2J7IA 2JS0A 4J9HA 4LUEA 2XMFA 2LX7A 1N5ZA 1M3CA 2EGAA 1X27A 2DBMA 1QKXA 2F2WA 1KIKA 1WA7A 3A98A 2D1XA 1OPLA 1B3QA 2DL4A 2ESWA 2LP5A 2YT6A 2YDLA 2GTJA 5IHKA 4AFSC 1M27C 4IIOA 2RMOA 2OI3A 2NWMA 1YNZA 2ABLA 2K2MA 2YUQA 3VS5A 3REBB 4JZ4A 1JXOA 4HCKA 5IH2A 3M0PA 4HXJA 1GRIA 1MV0B 1H92A 3EG2A 4Z8AA 2C0IA 2D8HA 2DL7A 2L0AA 3REAB 2CDTA 3M0SA 2FPFA 2VWFA 5IXBA 4DEYA 1K4US 2ENMA 1OV3A 3M0UA 2M0YA 4RUGA 2KRSA 1RI9A 2RNAA 1K0SA 1YN8A 2CH4W 2KT1A 1UUEA 5FW9A 2DJQA 4OMQA 2KYBA 2RQRA 1VYVA 2VKNA 1GFDA 1IO6A 1LCKA 3TSZA 3I5RA 1U5SA 2CREA 1ARKA 1HJDA 2PTKA 2JMAA 1AVZC 2YSQA 1GFCA 1Z9ZA 4IIMA 2A36A 2H8HA 2W0ZA 2GNCA 1ZUUA 4J9CA 1RLQC 1X6GA 1UHCA 1HD3A 2K6DA 1W6XA 4FSSA 1GBQA 4OMOA 1SHGA 2K79A 2ED0A 1JO8A 2GTOA 1AZEA 1GCQC 1KSWA 3EHQA 2D0NA 1ZUKA 2LQNA 2X3XD 1JXMA 1MV3A 5L23A 1G2BA 3LH5A 3NPFA 1KFZA 2JXBA 4AG2C 2ED1A 1FMKA 2GBQA 4RTZA 1M8MA 1SEMA 4X1VA 4ZNXA 1FYNA 3QWXX 3ZL7C 2MIOA 4WCIA 2O31A 2DNUA 4D8DA 1E6HA 4RTUA 1AWXA 2KR3A 1WIEA 1NG2A 2LJ0A 1WI7A 4J9DA 2KROA 3M0QA 2EGCA 5I22A 3O5ZA 3QWYA 4HVWA 4F17A 2KEAA 1UDLA 4LNPA 1NEGA 2EGEA 2OAWA 1SRMA 2QDLA 4RTXA 1QWFA 1TUDA 4LUDA 2CT4A 2D8JA 1ABOA 3PVQA 4F16A 1Y0MA 2SEMA 1OEBA 2ECZA 4JZ3A 1UJYA 1GL5A 2DMOA 3UA6A 2O9SA 1AOJA 3ULRB 3VS6A 1X6BA 3VS7A 4KRTA 1AWWA 4QT7A 2KNBB 3TSWA 1H3HA 1Y57A 4RTWA 1X69A 1QCFA 2HDAA 3THKA 1T3SA 2JS2A 4OMLA 2LJ1A 2X3WD 2YUPA 2DL5A 2KRNA 3C0CA 1B07A 1S1NA 1PRMC 4CC2A 1V1CA 1M3BA 2GGRA 3VS3A 1X2KA 1SPKA 4JJBA 3U23A 4Z88A 2LNHB 4AG1C 2BTTA 3EG1A 2K7AA 4RTVA 3VS4A 1VYUA 4JPBW 3VS2A 4GBQA 1E6GA 3VS1A 2C0TA 2DA9A 3FJ5A 2ROLA 2L3QA 3VS0A 4HVVA 1NYGA 1UTIA 1AWOA 1UECA 2J6OA 2AZSA 1WLPB 5GJVB 1AWJA 2V1RA 2HCKA 1VYTA 3JV3A 3I5SA 3EGUA 4ESRA 2DF6A 2PZ1A 3EG3A 4GLMA 2LJ3A 2FO0A 1Z9QA 2OJ2A 4D8KA 2J6KA 1G83A 2K9GA 2V1QA 4LN2A 2KXDA 1UJ0A 2W10A 1JQQA 1PRLC 2JM9A 1HSQA 4OMMA 4ORZA 2EYWA 1JEGA 1SRLA 1MUZA 2E5KA 2LCSA 1EFNA 2ROTA 4J9BA 2DL8A 1ZBJA 2A28A 2DRMA 2EYZA 2F2XA 1XOVA 1T0HA 3TVTA 2CH4A 1GBRA 2A08A 1U3OA 2RQVA 1E7OA 4JJDA 2J6FA 3RNJA 1UE9A 2L3PA 1A0NB 4F14A 2DVJA 2FG0A 1BK2A 2RQTA 1WXBA 4CC4B 3NHNA 1ABQA 3R6NA 2KT8A 4LE9A 1NM7A 2DM1A 3SEMA 2FEIA 3NGPA 2AKKA 3H0IA 2VVKA 1OOTA 2EPDA 2EKHA 1GCQA 3VRYA 4Z89A 2PNIA 2RN8A 1AZGB 1X2QA 1W70A 1UHFA 3CQTA 2EVRA 2FPDA 2LMJA 5FWCA 2CSIA 1H8KA 2KBTA 2O9VA 1OPKA 2DILA 1WXTA 4RTTA 2O2OA 3GBQA 4JJCA 2B86A 1T0JA 4A63B 3SHWA 1BBZA 2IIMA 2A37A 1BB9A 3EG0A 1WYXA 4J9EA 1NLOC 2EW3A 1YWOA 2M51A 1NLPC 1QLYA 2RF0A 1VA7A 2RQUA 3KFVA 2F2VA 2O88A 2KE9A 1BU1A 2EBPA 5IXFA 2DRKA 2EYXA 1SSHA 2KRMA 3H0FA 3PE0A 2CUDA 2FRWA 1CSKA 2HSPA 1RLPC 2DLPA 1UFFA 1NYFA 2EQIA 2SRCA 2GQIA 4K11A 4E6RA 1K1ZA 1GCPA 1ZSGA 2L3SA 1RUWA 1W1FA 4OMNA 3EHRA 5HCKA 1K76A 2J06A 3NMZC 5I11A 3H0HA 1TUCA 2L2PA 1WDXA 2NUZA 2G6FX 2I0NA 1JU5C 2FPEA 2KYMA 1M3AA 2EYYA 2AKLA 2DBKA 2DL3A 1YCSB 5ECAA 5GJWB 4J9FA 1WFWA 2BZ8A 2RQWA 5IHIA 1M30A 4HVUA 2HBWA 4AFQC 1QKWA 2DX1A 1CKBA 1SHFA 1QWEA 2CT3A 2AZVA 2DE0X 2MCNA 1AEYA 1PWTA 1ZLMA 4AFUC 1AD5A 3UA7A 4Y92A 2J05A 2KXCA 3RBBB 1UGVA 1ZUYA 1WXUA 2JT4A 2RPNA 1CKAA 1I07A 4CC3A 1PNJA 2LQWA 5FWBA 3PVLA 2CSQA 2CUBA 2AK5A 2HEQA 1KJWA 2FRYA 1UG1A 2JMCA 2YUNA 2JM8A 2JW4A 2K3BA 2C0OA 1I0CA 1PKTA 3I9QA 3M0RA 2BZYA 2JTEA 4R0KA 4EIKA 1J3TA 1K0XA 4J9GA 4RTYA 1ZX6A 2MOXA 2DYBA 3M0TA 5IHNA 1WX6A 4M4ZA 5EC7A 2P4RA 1TG0A 1PHTA 1K9AA 1YP5A 2BZXA 1PKSA 4J9IA
chains in the Genus database with same CATH superfamily
3EG9A 2NUTA 2XDDA 1WNLA 1U06A 2LNVA 1T3LA 3H41A 1MMGA 3QO3A 4OMPA 2D9TA 4QKUA 3P8DA 4LUEA 3CCEQ 1UEBA 3VV0A 2DBMA 5GAN7 2F2WA 2DZCA 2HKQB 2NLUA 3LGFA 1B3QA 3NTHA 2AIRB 1M90C 4M7DC 3I55T 2F1LA 1M90U 1W4SA 1TU0B 3REBB 4HCKA 2JUFA 5IH2A 3M0PA 4M7DD 4Z8AA 2D8HA 5GAMj 2CDTA 3M0SA 1VQNT 3G4SA 3QYHB 2ENMA 2PUKB 1B7TA 3QPHA 4RUGA 1RI9A 1YITQ 1N27A 2LCLA 1YN8A 4DBFA 2CH4W 4RG8A 3M53A 5FW9A 4OMQA 1LJOA 3M54A 2H3EB 2O4XA 2KYBA 1JRIA 1WQWA 2RQRA 4ME7A 4EMHA 1N8RR 3TSZA 2OAUA 3JCMb 3HRTA 3HP9A 2DTIA 2JMAA 1UGSB 1Q86C 1NE8A 1Z9ZA 1BI0A 2W0ZA 4Y28E 3J80E 4JRIA 1RLQC 1M1KR 3OYAA 3QG1A 4J5YA 2K79A 2ED0A 3LYIA 2DO3A 4A4KA 1VQLT 1VQ4A 3A8LB 3MEVA 1KSWA 1PM3A 4RCBA 2D0NA 3J81E 2LQNA 1JXMA 2RHYA 4X34A 1MV3A 2E64A 3NPFA 4C8QE 5HK0A 4PJOF 3HSBA 2GBQA 4BI4A 3G4SQ 3ZFJA 2CGHA 3UWNA 1FYNA 4J6XA 1WHMA 5GANf 1AWXA 3OBYA 5GMKi 2K5IA 2X35A 2DFUA 2COWA 5M9OA 2QK0A 4OP0A 3OYNA 2ZGWA 4NL2A 1VUBA 2EGCA 4M75A 4RCCA 2G3RA 3QWYA 5FU6C 4C5GA 1NEGA 4JS5A 3OYBA 3S3OA 3CMAA 1BI2A 4HCZA 2OAWA 4KBMB 2OTJT 1SRMA 1RL2A 1BI3A 4BI8B 1TUDA 2HBPA 3HRSA 3QBYA 4LUDA 1WZOA 2LDMA 1Y0MA 3X28B 1BKBA 1OEBA 1UJYA 3OYYA 1GL5A 1X6BA 3VS7A 1AWWA 2CP5A 3PIOA 5CO7A 1YJWA 3SFMA 3JRZA 1H3HA 1Y57A 1D1CA 1VQ4Q 4RTWA 1QCFA 2XIDA 3FLGA 1OI1A 1IB8A 1NPPA 1T3SA 1D3BA 5CR2A 1R77A 5DY9A 2JJ9A 1QCNA 3QJ6A 2KRNA 5L8RE 1PRMC 1V1CA 2X51A 3RUXA 3VS3A 2XKOC 1WGSA 1GXIE 5J39A 4FU6A 3QYGB 4BDYA 2RM4A 4HKEA 3CCMT 4RTVA 3TREA 1QVGP 2VXFA 2LRQA 3VS2A 1TWBA 4NL3A 3RMSA 2HQHA 3JB9G 3H6ZA 5IAYA 3C95A 1C1AA 1WPYA 5KH6A 2L3QA 3C4SA 4ANJA 4R55A 3JCMJ 1VQMT 1H3ZA 3CMAQ 1TUGB 1X01A 2DKGA 1Q81U 4M75F 3H9NA 3CPWP 4M78E 3UPUA 5AT1B 1BIAA 3I5SA 4ESRA 3CCET 4FYVB 2A7YA 4C0ZA 1YJWQ 2IG0A 2M0OA 2KXDA 1UJ0A 2QA4T 2CYZB 2JM9A 2QG9B 4OMMA 4LDWA 1IGQA 2HSEB 2EYZA 3OS2A 1FMWA 2E4HA 4IURA 4JRKA 4J6WA 3TQ7P 1TSFA 2RQVA 2F69A 1D1BA 5GAOq 3JB9I 2AHJB 1G8XA 4IKFA 1UE9A 2M9UA 1A0NB 4OMFB 4F14A 1BK2A 1QCOA 3JCMd 5GAMd 5KE2A 2RQTA 2RI3A 2CP3A 5CKDA 4C5HA 2RD1A 1PG5B 2VVKA 1KD1U 3QSUA 2EPDA 2JN0A 2EKHA 2MMPA 4LDVA 1VQPT 4M7AE 3GF5A 1X2QA 3L2UA 1BCOA 1UHFA 2BUDA 2ZZDA 1VQ8T 5FWCA 1NBEB 3OSSC 4DQ2A 2PVGB 3M55A 2QEXT 3EG0A 4J9EA 2EW3A 2MWOA 4KUDK 4VUBA 2RQUA 2DXUA 4OB0B 3I55A 3JSCA 2E6NA 4KH1B 3WVDB 3CBPA 4PKCC 5IXFA 2DD5A 5HKCA 1H641 1RLPC 1WHJA 2DLPA 3F70A 1NYFA 2VYTA 3HHTB 2SRCA 1TOVA 2GQIA 4ZGJB 4M7DA 1K1ZA 1GCPA 3URGA 4L59A 1RUWA 4C8QG 5C6SA 3A8GB 2EAYA 2WSFE 1K76A 3GP8A 2J06A 3DLMA 2EQUA 2RJEA 3JCMV 3G71A 4MZMA 3TEEA 2EJFA 4C92E 3JB9H 4LD9K 1M8VA 5LJ3e 1KQSS 3SWNC 2DL3A 4OVAA 2ATCB 3JB9J 2HQEA 4HVUA 2R5MA 5FU7B 1YHQT 5J3BA 5LJ5f 3I56T 2AZVA 4IUUA 4C8QB 2MCNA 1V76A 1WJSA 3SB2A 9ATCB 5KCHA 5GAOm 3I55Q 2OTLT 3V8JA 2J05A 4M75C 2M16A 1UGVA 1K9MC 2X4JA 2I2LA 5CVIA 3PT9A 2CSQA 3RR6A 3CCLT 3P8HA 1KJWA 1G3YA 2YUNA 2JW4A 4RMOA 2C0OA 1PKTA 3M0RA 2BZYA 2JTEA 1WHLA 4C5EA 1VQOT 1VQKT 2V8KA 2KDSA 8ATCB 2QI2A 3M0TA 3M58A 5IHNA 4M7DF 1YJ9A 1FMVA 2QGFB 2P4RA 1PHTA 3JB9D 1YP5A 3G71Q 4XU0A 4CC7A 1RAFB 4DEXA 4PJOE 3OW2A 4FYWB 1TTHB 2LZ6B 5GANh 2OTJA 2NUPA 4PFPA 4E7LA 1NZ9A 1PSFA 2HNIA 2IVWA 1Q81R 5CQYA 2JS0A 3PGGA 1M3CA 3LLRA 1X27A 5GAN2 5GANg 1Y07A 2XDPA 1OPLA 4M78G 3PNWC 2ESWA 2YT6A 2YDLA 1Q82C 1P92A 1RI0A 5IHKA 4AFSC 5CAIA 2OI3A 2NWMA 3LWIA 1G3SA 2K2MA 1VQ7T 5CCAA 2QGGA 3X26B 4HXJA 2DIQA 4B6MA 3CCRA 1H92A 5IN1A 3ZBDA 1YI2A 2DL7A 3JCMX 5KYYB 5IXBA 4DEYA 3VU3C 1OV3A 4BUGA 3CCMA 2KRSA 1AT1B 4CI0C 3QXEB 4M78B 4F7UF 1YJ9Q 3TU4K 4PFOA 5I2SA 2RH2A 4KH0B 1Q7YU 3E19A 1FX7A 2E12A 1LCKA 1VQMA 4J8OA 3M9QA 1U8RA 1OZ3A 2CREA 2OTJQ 2WSEE 1ARKA 3M59A 1D0XA 2A3LA 1KD1R 4XAXB 2YSQA 1GFCA 3JAME 4BE1A 4IIMA 5DM7R 4R56A 1ZUUA 4J9CA 4QQ6A 5LL6S 4M7AG 2MPXC 4IUVA 1HD3A 1OU8A 4RKUE 1SHGA 1KC8C 2QA4A 4M75E 2QQSA 1K8AC 1JO8A 3OSVA 2ZPHB 2P0PA 2GFAA 3MCAB 4RG2A 2V26A 1ZUKA 2VGMA 3CCRQ 5L23A 1YI2Q 4ZN1A 1W2BS 3Q1JA 4JS4A 1QW1A 4HT9A 1NJIC 1SEMA 4ZNXA 3QWXX 3HRUA 3MP8A 2MIOA 4FCYA 4WCIA 4D8DA 4M7AB 3CCMQ 3OQ5A 1MMNA 1NJIU 4J83A 2DTOA 4C0DB 3M0QA 3M5AA 4BE0A 4PJLA 3INZA 3O5ZA 5GMKh 1VQMQ 2YHTA 1YFNA 2VXEA 2VB6A 2CP6A 1VQPA 3BFMA 1M2OA 3OMCA 3SDZA 1G3TA 3RKYA 1OULA 2DIGA 1VQ8A 2FZCB 2YRVA 1LNXA 2CT4A 2D8JA 3PVQA 5GAN4 2SEMA 1N6AA 3L2WA 4L6V5 1IREB 1N9SA 2DMOA 3UA6A 2O9SA 3VS6A 4QVDA 2QEXA 4QT7A 2QA4Q 4C92G 1QVGS 3TSWA 3OS0A 1QVFP 1X69A 2HDAA 2PUOB 4ZTFA 4XTZA 3EAEA 3OYJA 2YUPA 1W2BA 4A4GA 4ZN3A 3C0CA 1S1NA 1I8FA 4DOWA 4KGZB 3FEOA 3MEWA 1DJ7B 3G7ZA 3E9GA 1OU9A 1ACMB 4A4EA 1K73C 3H8ZA 2BTTA 2K7AA 3T9NA 2HL3A 1QMCA 4JPBW 4C92B 4GBQA 1E6GA 3OYIA 2KVQG 2C0TA 3MJXA 3JCMQ 4HCBA 4JRPA 3G71T 2ROLA 5GMKj 4FYXB 1VQPQ 2MYSA 4HVVA 1UGPB 2RO0A 4XTWA 3R6OA 4ATOA 1OYXA 2K5FA 1UECA 1KK7A 2AZSA 1VQ8Q 1AWJA 1ZSZB 2HZYA 4WTOB 3HPWA 1Q86U 3KUFA 3EGDB 4BDZA 3D7SB 1Y96A 3GNFB 3CBOA 4B9XA 5EG2A 2LJ3A 1YHQA 3MO8A 2QEXQ 5KE3A 1C0MA 1Z9QA 4LDYA 3VYHB 3I56A 4J7IA 1QVGA 2E3IA 4PJOG 2K9GA 2V1QA 2L5QA 1JQQA 3M4YA 3A8HB 1SRLA 5GMKl 1MUZA 3C12A 2LCSA 3SWNA 1RAAB 4FSXA 1IZ6A 2DL8A 2A28A 4M78D 2OTLA 2CP2A 2DRMA 3EFRA 3BE3A 2JTFA 5IT9E 4M77C 5HY6A 3PMIA 2LT4A 2ZPFB 1XQHA 2BKDN 3BDUA 5KYWB 4XTUA 5LJ5h 3CCLA 2L3PA 4M77D 2FG0A 4X9DA 5DLOA 3EH1A 2EYQA 2XICA 4WF2A 1YJ9T 2LCCA 4CC4B 3NHNA 1ABQA 4PJOB 1VQOA 3X25B 1VQKA 1MNDA 2DXBA 2CZ6B 2GCXA 7AT1B 1OOTA 3CXCS 1JJ2S 1GCQA 2E65A 1HK9A 2PNIA 2RN8A 4BI3A 4EPCA 1W70A 1Q7YR 2F5TX 3FRNA 1LOJA 3M56A 1WXTA 4RTTA 5GANd 3L2ZA 3SD4A 1YHQQ 4FL6A 4FT4A 4JJCA 2O4XB 4V2SA 3I56Q 4DBRA 2RHUA 3RIRA 2IIMA 4M7DE 3HFOA 2MAMA 1MNEA 1NLPC 2OTLQ 2ZPIB 1EX4A 3CCRT 1YI2T 4BD3A 4JRQA 4Q5WA 3JCMe 5GAMe 3AHUA 3ASKA 3DKMA 1VQ7A 2KMTA 2EYXA 3H0FA 3CCLQ 3PE0A 1CSKA 4MDWA 2XDBA 1UFFA 1Y71A 2V8JA 3CC2A 2X4YA 1VQOQ 1VQKQ 2L3RA 3BY7A 1ZSGA 2L3SA 4XQ3A 3CXCA 4ZGDB 1JJ2A 4OMNA 3EHRA 5GMKe 1NJIR 1I5OB 1EIFA 1WDXA 2G6FX 2I0NA 1JU5C 2K5LA 1I81A 4UC4A 5I21A 1QP2A 5KYXB 1S72T 1YCSB 2LQ8A 4JDSA 5GJWB 4E7SA 4J9FA 1WFWA 2RQWA 2JVVA 2YRCA 4F7UE 2CP7A 4Z02A 4QQDA 2ZCFB 1AEYA 3CCST 1VQ5T 3FIFA 4AFUC 3RBBB 4C92D 1WXUA 2JT4A 2RPNA 1IXDA 1VQ7Q 2RJDA 1M90R 1PNJA 4FM4B 3X20B 1RADB 3PVLA 2CUBA 2DTHA 2JMCA 2K3BA 1I0CA 3CCJT 3CC2Q 4BY6B 1JB0E 4FYYB 2DYIA 2YLCA 1D3BB 3MHXA 5GAOn 4A4HA 1K0XA 2MOXA 4XTVA 1ZA1B 4AMCA 5CIUA 1K9AA 1PKSA 2DK3A 5KYNA 3I35A 1YWPA 2YUOA 2KGTA 1RAHB 1X43A 4AFZC 3IQLA 5CQXA 4PLIA 5A0GA 2RK1A 1PSEA 3UDCA 4N0AA 1BCMA 1NEBA 1M9SA 4B9WA 3OYEA 2X9HA 3EFOB 4TVRA 1I1JA 2J7IA 2Y4XA 2XMFA 3NTKA 1N5ZA 2EGAA 4PFZA 1QKXA 5FRNA 1KIKA 1WA7A 1Q86R 2D1XA 3P8BB 5GAN3 2F5KA 4E7KA 4PJOD 3MP6A 1D0ZA 1KHCA 4YTLA 1YNZA 1MMDA 1WJRA 2D6FA 2ABLA 5HK3A 3VS5A 4JZ4A 2FYKA 4E7JA 3EG2A 2C0IA 2L0AA 3REAB 4XTXA 5CKEA 2FPFA 2VWFA 4KULA 5A0DA 1K4US 2M0YA 5KCOA 1LPLA 2DJQA 3CC7A 1U1SA 1VYVA 1BI1A 3RKWA 3J7AF 2P0QA 3MEUA 3I5RA 2DEUA 1BYMA 2BE9B 2PTKA 1MHNA 1AVZC 4L5GA 2DJZA 2H8HA 2DD4A 1VIEA 2GNCA 5D6YA 3CMET 1X6GA 1UHCA 4A54A 3HKSA 2K6DA 2QQRA 2VC8A 2K2VA 4FIBA 1UGRB 4OMOA 1G3WA 2VGNA 4JLIA 1XNIA 4EMKB 3EGXB 1AZEA 3S3NA 1GCQC 3JCMc 5KYYA 3OB9A 1K9MU 1IHWA 3MKDA 1G2BA 1M4ZA 4N4GA 1KFZA 3L1AA 4M7DG 2RI2A 2E6ZA 4BACA 2JXBA 4AG2C 2ED1A 4LDXA 2VASA 4RTZA 1M8MA 4X1VA 3ZL7C 5LJ5d 2DNUA 1E6HA 4RTUA 4BE2A 4ZTJA 1WIEA 5LJ3f 2QASA 2LJ0A 3QZ5B 1X6OA 3CC7Q 2KROA 4M77A 2EWNA 1KQSA 4HVWA 4F17A 1MGQA 2GFUA 1UDLA 3UT1A 5AYFA 1IGUA 3LH0A 4M7DB 2YLBA 1M1KC 3L2RA 3PTAA 2QDLA 3G1JA 4E7HA 2X4XA 1VQ6T 2LTOA 2QYZA 1AOJA 3QZ9B 3ULRB 3MP1A 4KRTA 2KNBB 2DAQA 2RJCA 3DB3A 4NS5A 2JZ2A 1Q82U 1PCXA 1LVKA 2R5AA 3THKA 2EIFA 2JS2A 2V8IA 2L8DA 4OMLA 4E47A 4F7UG 3OYKA 4CC2A 1M3BA 3CC2T 2GGRA 1UGQB 1X2KA 2BIVA 1SPKA 1B34A 3VKIA 3U23A 4J7FA 1OX8A 4DA4A 3VS4A 1KQ2A 2FVUA 4N4HA 3FJPA 5C0MA 4KUIA 3OS5A 3LX7A 1NYGA 1AHJB 1UTIA 1MMAA 2XI9A 4M77F 5GANj 4F7UB 2J6OA 4AT1B 2QTVA 2XHCA 3ER0A 2V1RA 1YCYA 1S72A 2HCKA 3WVEB 1VYTA 3JV3A 1O75A 3EGUA 2RHIA 2DF6A 2PZ1A 2EFIA 3EG3A 4GLMA 2E3HA 5GAOl 2OJ2A 2XK0A 4D8KA 2GF7A 1G83A 4LN2A 2W10A 1KC8U 4O6JA 4ORZA 4Y91A 4JUVA 1TXQA 3CCSA 1JEGA 1K8AU 4LXCA 3QDFA 2E5KA 3L2VA 1VQ5A 1EFNA 2QQAA 4ZGEB 2XG8D 2F2XA 1XOVA 1T0HA 3LWHA 2HD0A 2CH4A 1SF9A 5FU6B 4QVCA 1E7OA 2KY9A 2EJ9A 2HQXA 5FU7C 3ZEHA 2J6FA 3OW2P 4C92A 4N0AC 2DVJA 2QQBA 4PJNA 3CCJA 4ELZC 4C8QC 2K3YA 2A0FB 2EQMA 1ZA2B 1WXBA 2KT8A 4LE9A 1NM7A 3SEMA 1SG5A 4PK4A 2AKKA 4C8QD 3GLXA 1YBYA 4Z89A 2DPPB 2YWWA 3V7RA 2Z0WA 2D0QB 2WSCE 4KT0E 5CKHA 4MZTA 1S72Q 2FPDA 2RJFA 2CSIA 3V8LA 1H8KA 1UB4A 1OPKA 3A8OB 3V7CA 2DILA 1XJWB 1G5VA 3NTIA 2B86A 1T0JA 3SHWA 2IPOB 1EZZB 1WYXA 1YIJA 1NLOC 1VQ9T 3CCQT 2M51A 4DBHA 3CCSQ 1QLYA 1VQ5Q 5FLXE 1VA7A 3META 2F2VA 2O88A 1M1GA 5KYWA 3PIPA 5CKFA 3O8VA 5KYUB 3NFCA 1M2VB 1R0BG 3CPWS 2EBPA 2DRKA 1SSHA 4PJOA 2CUDA 2FRWA 2DXTA 4HA8A 1QQJA 1OX9A 3CCJQ 3A5ZB 4DOVA 8AT1B 3CC4A 1K9MR 2LT1A 4D6WA 1K73U 4K11A 4C92F 2R58A 3CC7T 5A2QE 3KXTA 4PJMA 4EDUA 1W1FA 2HKNA 5HCKA 1YJNT 2CZ7B 3NMZC 1IHVA 3H0HA 3G6ET 3TCJA 1D09B 5GANe 2FPEA 2KYMA 2EYYA 4QVZA 1SKUB 2DBKA 5ECAA 3HFNA 4MMLA 2E1HA 5IHIA 1M30A 2NUTB 3EG9B 3X24B 4M78C 1QKWA 3N5BB 1YIJQ 4O5VA 3JCMW 1CKBA 3CMEA 4F04B 2ZPBB 1ZLMA 1X75C 4Y92A 3CD6A 1ZUYA 2HMAA 3CPWA 3JCMP 1CKAA 3E2UA 2LC4A 4CC3A 5FWBA 1Q82R 3ME9A 3CC4Q 2HEQA 3E1SA 2JM8A 3CCVA 3I9QA 3FDRA 5LJ5g 2XU8A 4J9GA 2DYBA 2RB6A 4QW2A 2Y4YA 2OX7A 5KYXA 2BZXA 3FB9A 3UATA 4MDXA 1R8OB 1I5LA 2DZ9A 3CPFA 3VRZA 1IRXA 2EQJA 3VJPA 2O01E 3M4GA 4A53A 4M7AC 4JLGA 1W2BP 3UF4A 1OZ2A 4OGEA 5LJ3h 4DBQA 4C0DC 4J9HA 4XU2A 3CMEQ 2LX7A 2DERA 4M7AD 2YRDA 1VQ6A 3CCUA 3A98A 3QHSA 3M57A 5D7UA 3L2QA 2DL4A 2PVDB 2LP5A 4NOYA 5LJ3g 3CD6Q 2GTJA 4C0FA 1M27C 4IIOA 2RMOA 2KAFA 1Y96B 4C0GA 6AT1B 4XTYA 3BW1A 1ZHIA 5CK9A 5LJ5j 1NPRA 2YUQA 3CBMA 3OY9A 1JBMA 1VOMA 1JXOA 1KC8R 1SSFA 2KSSA 1D1AA 1GRIA 5D6XA 4M75G 1MV0B 4A4FA 1K8AR 3CCVQ 4PJJA 1HYOA 1KHIA 3PMTA 1KQ1A 4E7IA 3QDRB 3EFSA 1FWZA 4LDUA 1PD0A 2LQKA 3SWNB 2EJGA 2QDYB 3M0UA 4FW1A 4FT2A 5FROA 2RI5A 2RNAA 1K0SA 2B8AA 2KT1A 1FXXA 1UUEA 3LGLA 1ZBXA 5GAOp 3PFSA 2VKNA 1GFDA 1IO6A 1Q81C 1U1TA 3EFOA 2MF2A 1VIFA 1U5SA 4M75B 4QQGA 1HJDA 3VUBA 3JB9F 1V29B 3DB4A 2A36A 4P5NA 5LJ3j 2BE7D 4C92C 2DVEA 1VQ6Q 3CCUQ 3JCMf 5GAMf 4MZPA 1W6XA 4FSSA 1GBQA 2R57A 4M77E 2FL7A 3RERA 3HL8A 2M02A 2GTOA 1Y7XA 1ZSZC 3OYMA 3EHQA 3QIIA 5GAN5 1N9RA 2X3XD 3LH5A 3GNGA 5GAOr 1FMKA 3RMQA 3QKJA 2O31A 4KGVB 2KR3A 4C5IA 1NG2A 1PD1A 1WI7A 1YITT 4J9DA 2LX9A 4CRIA 1WQ7A 5I22A 1K73R 3VYGA 1KD1C 3GPLA 2AT1B 2KEAA 1OQKA 4LNPA 2EGEA 4IUQA 2CKKA 3HTRA 5D6WA 1RABB 4GY5A 4C8QA 3GOXA 2Y90A 4RTXA 1QWFA 2MI6A 3BDLA 2E10A 1YIJT 4PJOC 1ABOA 4FW2A 4F16A 2GQVA 4OB1B 2ECZA 4JZ3A 4EMKA 3EGXA 2H3JA 1TH7A 2PVOB 1VQ9A 3A1PA 3E9FA 3CCQA 2K3XA 5GAN8 1RAEB 4OB3B 3CXCP 2VUBA 1KG1A 1JJ2P 2E70A 2LJ1A 2X3WD 5LJ5e 5J26A 2DL5A 3CC4T 1B07A 4XU3A 2ZPEB 4JJBA 3G4ST 5CKBA 4Z88A 2LNHB 3CEYA 4AG1C 3EG1A 3OYLA 1VYUA 2JOYA 2CZ0B 1VQNA 1M1FA 3VS1A 3OMGA 2RK2A 2QQ9A 2K4YA 2DA9A 3FJ5A 3OYFA 4OB2B 3VS0A 1YJNA 1QVPA 2VV5A 4E7ZA 3G6EA 1AWOA 2HAXA 1RAGB 2EQKA 1WLPB 1ZQ1A 5GJVB 2P0KA 2MWPA 4C8QF 1R0CB 3OW2S 2KK4A 2FO0A 1VQ9Q 2J6KA 3CCQQ 2CP0A 3CD6T 2PQWA 1WHHA 2ZAEA 1PRLC 1HSQA 1D0YA 2KI7A 2EYWA 1VQ4T 4OF1A 5DLQE 2ROTA 4J9BA 1ZBJA 3AT1B 1C6VX 3TVTA 1GBRA 3CCVT 2A08A 2C06A 4M78A 1U3OA 4IUPA 1BIBA 1VQLA 4JJDA 3RNJA 1N8RC 4BB7A 4XU1A 2ZPGB 2E41A 4M75D 3QUIA 2P4TA 1N8RU 2NYSA 1VQNQ 3R6NA 4MMKA 2DM1A 4F7UA 2FEIA 3NGPA 3OS1A 1QVFS 1F1BB 2LVMA 3H0IA 1YJNQ 4PL6A 4ELYC 1I4K1 2RA2A 3G6EQ 1WJQA 3VRYA 3C94A 2QTXA 3L42A 4XK8E 5A0LA 3CMAT 1AZGB 2QXFA 3CQTA 2EVRA 1M1KU 2LMJA 4GLKA 2WACA 4BY6C 2KBTA 3RKXA 2O9VA 4E2FB 3CCUT 2O2OA 3GBQA 3KBGA 4A63B 2QAZA 4IUTA 1BBZA 5LJ3d 2A37A 1BB9A 2DXCA 2YXYA 1YJWT 2DEQA 2P84A 4LD6A 1YWOA 4JJNK 1PC0A 2M1HA 2RF0A 3KFVA 3WXMB 3A8MB 4M7AA 1VQLQ 2KE9A 1BU1A 1QP3A 4X9CA 5GAN6 4EMGA 2KRMA 4KGXB 4HT8A 4HCCA 2HSPA 4M78F 4OGCA 2FZGB 3V8KA 4M77G 1XTDA 2JNGA 2E5QA 2K57A 2EQIA 3OYDA 1RAIB 4E6RA 2CZ1B 3OYGA 3MEAA 1QVFA 1Q7YC 3RDVA 2MK5A 1WHGA 2COZA 2FB7A 2RHZA 5I11A 1TUCA 2L2PA 2NUZA 2XD0A 1M3AA 1M5Q1 1O9SA 1WHKA 2FZKB 2AKLA 3GIBA 3OYCA 4M77B 4II1A 2BZ8A 4PNOA 2HBWA 4AFQC 2HL5C 2DX1A 3RESA 1SHFA 2NUPB 4J6YA 1QWEA 2CT3A 2DE0X 5KYUA 3CCEA 2FHDA 4N4IA 1M2VA 2L89A 1PWTA 3LW5E 1AD5A 3UA7A 2KXCA 3OBWA 3S3MA 2COYA 2CS7A 5FRMA 1KQSP 2JTMA 1RACB 1I07A 4M7AF 5GMKm 2RHXA 2LQWA 3OYHA 3QJYA 1HXDA 2AK5A 3S6WA 2FRYA 2KQWA 1UG1A 3JCMh 5GAMh 1Q95G 3DLLA 3FC3A 4R0KA 5I2MA 3V7SA 1TS9A 4EIKA 1J3TA 3EH2A 4RTYA 2X4WA 1ZX6A 4PLLA 4EMKC 2DETA 1ZSZA 3JCMg 5GAMg 2EKOA 2PU9B 1WX6A 3EGDA 4M4ZA 3VUZA 1YITA 5EC7A 1TG0A 1B34B 3MPUB 3OA6A 4J9IA
chains in the Genus database with same CATH topology
3I35A 1YWPA 4CC7A 2YUOA 3UATA 4DEXA 2KGTA 3VRZA 1U06A 1X43A 4AFZC 1T3LA 3H41A 3IQLA 2LZ6B 4OMPA 3UF4A 1NEBA 1I1JA 2J7IA 2JS0A 4J9HA 4LUEA 2XMFA 2LX7A 1N5ZA 1M3CA 2EGAA 1X27A 2DBMA 1QKXA 2F2WA 1KIKA 1WA7A 3A98A 2D1XA 1OPLA 1B3QA 2DL4A 2ESWA 2LP5A 2YT6A 2YDLA 2GTJA 5IHKA 4AFSC 1M27C 4IIOA 2RMOA 2OI3A 2NWMA 1YNZA 2ABLA 2K2MA 2YUQA 3VS5A 3REBB 4JZ4A 1JXOA 4HCKA 5IH2A 3M0PA 4HXJA 1GRIA 1MV0B 1H92A 3EG2A 4Z8AA 2C0IA 2D8HA 2DL7A 2L0AA 3REAB 2CDTA 3M0SA 2FPFA 2VWFA 5IXBA 4DEYA 1K4US 2ENMA 1OV3A 3M0UA 2M0YA 4RUGA 2KRSA 1RI9A 2RNAA 1K0SA 1YN8A 2CH4W 2KT1A 1UUEA 5FW9A 2DJQA 4OMQA 2KYBA 2RQRA 1VYVA 2VKNA 1GFDA 1IO6A 1LCKA 3TSZA 3I5RA 1U5SA 2CREA 1ARKA 1HJDA 2PTKA 2JMAA 1AVZC 2YSQA 1GFCA 1Z9ZA 4IIMA 2A36A 2H8HA 2W0ZA 2GNCA 1ZUUA 4J9CA 1RLQC 1X6GA 1UHCA 1HD3A 2K6DA 1W6XA 4FSSA 1GBQA 4OMOA 1SHGA 2K79A 2ED0A 1JO8A 2GTOA 1AZEA 1GCQC 1KSWA 3EHQA 2D0NA 1ZUKA 2LQNA 2X3XD 1JXMA 1MV3A 5L23A 1G2BA 3LH5A 3NPFA 1KFZA 2JXBA 4AG2C 2ED1A 1FMKA 2GBQA 4RTZA 1M8MA 1SEMA 4X1VA 4ZNXA 1FYNA 3QWXX 3ZL7C 2MIOA 4WCIA 2O31A 2DNUA 4D8DA 1E6HA 4RTUA 1AWXA 2KR3A 1WIEA 1NG2A 2LJ0A 1WI7A 4J9DA 2KROA 3M0QA 2EGCA 5I22A 3O5ZA 3QWYA 4HVWA 4F17A 2KEAA 1UDLA 4LNPA 1NEGA 2EGEA 2OAWA 1SRMA 2QDLA 4RTXA 1QWFA 1TUDA 4LUDA 2CT4A 2D8JA 1ABOA 3PVQA 4F16A 1Y0MA 2SEMA 1OEBA 2ECZA 4JZ3A 1UJYA 1GL5A 2DMOA 3UA6A 2O9SA 1AOJA 3ULRB 3VS6A 1X6BA 3VS7A 4KRTA 1AWWA 4QT7A 2KNBB 3TSWA 1H3HA 1Y57A 4RTWA 1X69A 1QCFA 2HDAA 3THKA 1T3SA 2JS2A 4OMLA 2LJ1A 2X3WD 2YUPA 2DL5A 2KRNA 3C0CA 1B07A 1S1NA 1PRMC 4CC2A 1V1CA 1M3BA 2GGRA 3VS3A 1X2KA 1SPKA 4JJBA 3U23A 4Z88A 2LNHB 4AG1C 2BTTA 3EG1A 2K7AA 4RTVA 3VS4A 1VYUA 4JPBW 3VS2A 4GBQA 1E6GA 3VS1A 2C0TA 2DA9A 3FJ5A 2ROLA 2L3QA 3VS0A 4HVVA 1NYGA 1UTIA 1AWOA 1UECA 2J6OA 2AZSA 1WLPB 5GJVB 1AWJA 2V1RA 2HCKA 1VYTA 3JV3A 3I5SA 3EGUA 4ESRA 2DF6A 2PZ1A 3EG3A 4GLMA 2LJ3A 2FO0A 1Z9QA 2OJ2A 4D8KA 2J6KA 1G83A 2K9GA 2V1QA 4LN2A 2KXDA 1UJ0A 2W10A 1JQQA 1PRLC 2JM9A 1HSQA 4OMMA 4ORZA 2EYWA 1JEGA 1SRLA 1MUZA 2E5KA 2LCSA 1EFNA 2ROTA 4J9BA 2DL8A 1ZBJA 2A28A 2DRMA 2EYZA 2F2XA 1XOVA 1T0HA 3TVTA 2CH4A 1GBRA 2A08A 1U3OA 2RQVA 1E7OA 4JJDA 2J6FA 3RNJA 1UE9A 2L3PA 1A0NB 4F14A 2DVJA 2FG0A 1BK2A 2RQTA 1WXBA 4CC4B 3NHNA 1ABQA 3R6NA 2KT8A 4LE9A 1NM7A 2DM1A 3SEMA 2FEIA 3NGPA 2AKKA 3H0IA 2VVKA 1OOTA 2EPDA 2EKHA 1GCQA 3VRYA 4Z89A 2PNIA 2RN8A 1AZGB 1X2QA 1W70A 1UHFA 3CQTA 2EVRA 2FPDA 2LMJA 5FWCA 2CSIA 1H8KA 2KBTA 2O9VA 1OPKA 2DILA 1WXTA 4RTTA 2O2OA 3GBQA 4JJCA 2B86A 1T0JA 4A63B 3SHWA 1BBZA 2IIMA 2A37A 1BB9A 3EG0A 1WYXA 4J9EA 1NLOC 2EW3A 1YWOA 2M51A 1NLPC 1QLYA 2RF0A 1VA7A 2RQUA 3KFVA 2F2VA 2O88A 2KE9A 1BU1A 2EBPA 5IXFA 2DRKA 2EYXA 1SSHA 2KRMA 3H0FA 3PE0A 2CUDA 2FRWA 1CSKA 2HSPA 1RLPC 2DLPA 1UFFA 1NYFA 2EQIA 2SRCA 2GQIA 4K11A 4E6RA 1K1ZA 1GCPA 1ZSGA 2L3SA 1RUWA 1W1FA 4OMNA 3EHRA 5HCKA 1K76A 2J06A 3NMZC 5I11A 3H0HA 1TUCA 2L2PA 1WDXA 2NUZA 2G6FX 2I0NA 1JU5C 2FPEA 2KYMA 1M3AA 2EYYA 2AKLA 2DBKA 2DL3A 1YCSB 5ECAA 5GJWB 4J9FA 1WFWA 2BZ8A 2RQWA 5IHIA 1M30A 4HVUA 2HBWA 4AFQC 1QKWA 2DX1A 1CKBA 1SHFA 1QWEA 2CT3A 2AZVA 2DE0X 2MCNA 1AEYA 1PWTA 1ZLMA 4AFUC 1AD5A 3UA7A 4Y92A 2J05A 2KXCA 3RBBB 1UGVA 1ZUYA 1WXUA 2JT4A 2RPNA 1CKAA 1I07A 4CC3A 1PNJA 2LQWA 5FWBA 3PVLA 2CSQA 2CUBA 2AK5A 2HEQA 1KJWA 2FRYA 1UG1A 2JMCA 2YUNA 2JM8A 2JW4A 2K3BA 2C0OA 1I0CA 1PKTA 3I9QA 3M0RA 2BZYA 2JTEA 4R0KA 4EIKA 1J3TA 1K0XA 4J9GA 4RTYA 1ZX6A 2MOXA 2DYBA 3M0TA 5IHNA 1WX6A 4M4ZA 5EC7A 2P4RA 1TG0A 1PHTA 1K9AA 1YP5A 2BZXA 1PKSA 4J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I35 A;  1YWP A;  4CC7 A;  2YUO A;  3UAT A;  4DEX A;  2KGT A;  3VRZ A;  1U06 A;  1X43 A;  4AFZ C;  1T3L A;  3H41 A;  3IQL A;  2LZ6 B;  4OMP A;  3UF4 A;  1NEB A;  1I1J A;  2J7I A;  2JS0 A;  4J9H A;  4LUE A;  2XMF A;  2LX7 A;  1N5Z A;  1M3C A;  2EGA A;  1X27 A;  2DBM A;  1QKX A;  2F2W A;  1KIK A;  1WA7 A;  3A98 A;  2D1X A;  1OPL A;  1B3Q A;  2DL4 A;  2ESW A;  2LP5 A;  2YT6 A;  2YDL A;  2GTJ A;  5IHK A;  4AFS C;  1M27 C;  4IIO A;  2RMO A;  2OI3 A;  2NWM A;  1YNZ A;  2ABL A;  2K2M A;  2YUQ A;  3VS5 A;  3REB B;  4JZ4 A;  1JXO A;  4HCK A;  5IH2 A;  3M0P A;  4HXJ A;  1GRI A;  1MV0 B;  1H92 A;  3EG2 A;  4Z8A A;  2C0I A;  2D8H A;  2DL7 A;  2L0A A;  3REA B;  2CDT A;  3M0S A;  2FPF A;  2VWF A;  5IXB A;  4DEY A;  1K4U S;  2ENM A;  1OV3 A;  3M0U A;  2M0Y A;  4RUG A;  2KRS A;  1RI9 A;  2RNA A;  1K0S A;  1YN8 A;  2CH4 W;  2KT1 A;  1UUE A;  5FW9 A;  2DJQ A;  4OMQ A;  2KYB A;  2RQR A;  1VYV A;  2VKN A;  1GFD A;  1IO6 A;  1LCK A;  3TSZ A;  3I5R A;  1U5S A;  2CRE A;  1ARK A;  1HJD A;  2PTK A;  2JMA A;  1AVZ C;  2YSQ A;  1GFC A;  1Z9Z A;  4IIM A;  2A36 A;  2H8H A;  2W0Z A;  2GNC A;  1ZUU A;  4J9C A;  1RLQ C;  1X6G A;  1UHC A;  1HD3 A;  2K6D A;  1W6X A;  4FSS A;  1GBQ A;  4OMO A;  1SHG A;  2K79 A;  2ED0 A;  1JO8 A;  2GTO A;  1AZE A;  1GCQ C;  1KSW A;  3EHQ A;  2D0N A;  1ZUK A;  2LQN A;  2X3X D;  1JXM A;  1MV3 A;  5L23 A;  1G2B A;  3LH5 A;  3NPF A;  1KFZ A;  2JXB A;  4AG2 C;  2ED1 A;  1FMK A;  2GBQ A;  4RTZ A;  1M8M A;  1SEM A;  4X1V A;  4ZNX A;  1FYN A;  3QWX X;  3ZL7 C;  2MIO A;  4WCI A;  2O31 A;  2DNU A;  4D8D A;  1E6H A;  4RTU A;  1AWX A;  2KR3 A;  1WIE A;  1NG2 A;  2LJ0 A;  1WI7 A;  4J9D A;  2KRO A;  3M0Q A;  2EGC A;  5I22 A;  3O5Z A;  3QWY A;  4HVW A;  4F17 A;  2KEA A;  1UDL A;  4LNP A;  1NEG A;  2EGE A;  2OAW A;  1SRM A;  2QDL A;  4RTX A;  1QWF A;  1TUD A;  4LUD A;  2CT4 A;  2D8J A;  1ABO A;  3PVQ A;  4F16 A;  1Y0M A;  2SEM A;  1OEB A;  2ECZ A;  4JZ3 A;  1UJY A;  1GL5 A;  2DMO A;  3UA6 A;  2O9S A;  1AOJ A;  3ULR B;  3VS6 A;  1X6B A;  3VS7 A;  4KRT A;  1AWW A;  4QT7 A;  2KNB B;  3TSW A;  1H3H A;  1Y57 A;  4RTW A;  1X69 A;  1QCF A;  2HDA A;  3THK A;  1T3S A;  2JS2 A;  4OML A;  2LJ1 A;  2X3W D;  2YUP A;  2DL5 A;  2KRN A;  3C0C A;  1B07 A;  1S1N A;  1PRM C;  4CC2 A;  1V1C A;  1M3B A;  2GGR A;  3VS3 A;  1X2K A;  1SPK A;  4JJB A;  3U23 A;  4Z88 A;  2LNH B;  4AG1 C;  2BTT A;  3EG1 A;  2K7A A;  4RTV A;  3VS4 A;  1VYU A;  4JPB W;  3VS2 A;  4GBQ A;  1E6G A;  3VS1 A;  2C0T A;  2DA9 A;  3FJ5 A;  2ROL A;  2L3Q A;  3VS0 A;  4HVV A;  1NYG A;  1UTI A;  1AWO A;  1UEC A;  2J6O A;  2AZS A;  1WLP B;  5GJV B;  1AWJ A;  2V1R A;  2HCK A;  1VYT A;  3JV3 A;  3I5S A;  3EGU A;  4ESR A;  2DF6 A;  2PZ1 A;  3EG3 A;  4GLM A;  2LJ3 A;  2FO0 A;  1Z9Q A;  2OJ2 A;  4D8K A;  2J6K A;  1G83 A;  2K9G A;  2V1Q A;  4LN2 A;  2KXD A;  1UJ0 A;  2W10 A;  1JQQ A;  1PRL C;  2JM9 A;  1HSQ A;  4OMM A;  4ORZ A;  2EYW A;  1JEG A;  1SRL A;  1MUZ A;  2E5K A;  2LCS A;  1EFN A;  2ROT A;  4J9B A;  2DL8 A;  1ZBJ A;  2A28 A;  2DRM A;  2EYZ A;  2F2X A;  1XOV A;  1T0H A;  3TVT A;  2CH4 A;  1GBR A;  2A08 A;  1U3O A;  2RQV A;  1E7O A;  4JJD A;  2J6F A;  3RNJ A;  1UE9 A;  2L3P A;  1A0N B;  4F14 A;  2DVJ A;  2FG0 A;  1BK2 A;  2RQT A;  1WXB A;  4CC4 B;  3NHN A;  1ABQ A;  3R6N A;  2KT8 A;  4LE9 A;  1NM7 A;  2DM1 A;  3SEM A;  2FEI A;  3NGP A;  2AKK A;  3H0I A;  2VVK A;  1OOT A;  2EPD A;  2EKH A;  1GCQ A;  3VRY A;  4Z89 A;  2PNI A;  2RN8 A;  1AZG B;  1X2Q A;  1W70 A;  1UHF A;  3CQT A;  2EVR A;  2FPD A;  2LMJ A;  5FWC A;  2CSI A;  1H8K A;  2KBT A;  2O9V A;  1OPK A;  2DIL A;  1WXT A;  4RTT A;  2O2O A;  3GBQ A;  4JJC A;  2B86 A;  1T0J A;  4A63 B;  3SHW A;  1BBZ A;  2IIM A;  2A37 A;  1BB9 A;  3EG0 A;  1WYX A;  4J9E A;  1NLO C;  2EW3 A;  1YWO A;  2M51 A;  1NLP C;  1QLY A;  2RF0 A;  1VA7 A;  2RQU A;  3KFV A;  2F2V A;  2O88 A;  2KE9 A;  1BU1 A;  2EBP A;  5IXF A;  2DRK A;  2EYX A;  1SSH A;  2KRM A;  3H0F A;  3PE0 A;  2CUD A;  2FRW A;  1CSK A;  2HSP A;  1RLP C;  2DLP A;  1UFF A;  1NYF A;  2EQI A;  2SRC A;  2GQI A;  4K11 A;  4E6R A;  1K1Z A;  1GCP A;  1ZSG A;  2L3S A;  1RUW A;  1W1F A;  4OMN A;  3EHR A;  5HCK A;  1K76 A;  2J06 A;  3NMZ C;  5I11 A;  3H0H A;  1TUC A;  2L2P A;  1WDX A;  2NUZ A;  2G6F X;  2I0N A;  1JU5 C;  2FPE A;  2KYM A;  1M3A A;  2EYY A;  2AKL A;  2DBK A;  2DL3 A;  1YCS B;  5ECA A;  5GJW B;  4J9F A;  1WFW A;  2BZ8 A;  2RQW A;  5IHI A;  1M30 A;  4HVU A;  2HBW A;  4AFQ C;  1QKW A;  2DX1 A;  1CKB A;  1SHF A;  1QWE A;  2CT3 A;  2AZV A;  2DE0 X;  2MCN A;  1AEY A;  1PWT A;  1ZLM A;  4AFU C;  1AD5 A;  3UA7 A;  4Y92 A;  2J05 A;  2KXC A;  3RBB B;  1UGV A;  1ZUY A;  1WXU A;  2JT4 A;  2RPN A;  1CKA A;  1I07 A;  4CC3 A;  1PNJ A;  2LQW A;  5FWB A;  3PVL A;  2CSQ A;  2CUB A;  2AK5 A;  2HEQ A;  1KJW A;  2FRY A;  1UG1 A;  2JMC A;  2YUN A;  2JM8 A;  2JW4 A;  2K3B A;  2C0O A;  1I0C A;  1PKT A;  3I9Q A;  3M0R A;  2BZY A;  2JTE A;  4R0K A;  4EIK A;  1J3T A;  1K0X A;  4J9G A;  4RTY A;  1ZX6 A;  2MOX A;  2DYB A;  3M0T A;  5IHN A;  1WX6 A;  4M4Z A;  5EC7 A;  2P4R A;  1TG0 A;  1PHT A;  1K9A A;  1YP5 A;  2BZX A;  1PKS A;  4J9I A; 
#chains in the Genus database with same CATH topology
 3EG9 A;  2NUT A;  2XDD A;  1WNL A;  1U06 A;  2LNV A;  1T3L A;  3H41 A;  1MMG A;  3QO3 A;  4OMP A;  2D9T A;  4QKU A;  3P8D A;  4LUE A;  3CCE Q;  1UEB A;  3VV0 A;  2DBM A;  5GAN 7;  2F2W A;  2DZC A;  2HKQ B;  2NLU A;  3LGF A;  1B3Q A;  3NTH A;  2AIR B;  1M90 C;  4M7D C;  3I55 T;  2F1L A;  1M90 U;  1W4S A;  1TU0 B;  3REB B;  4HCK A;  2JUF A;  5IH2 A;  3M0P A;  4M7D D;  4Z8A A;  2D8H A;  5GAM j;  2CDT A;  3M0S A;  1VQN T;  3G4S A;  3QYH B;  2ENM A;  2PUK B;  1B7T A;  3QPH A;  4RUG A;  1RI9 A;  1YIT Q;  1N27 A;  2LCL A;  1YN8 A;  4DBF A;  2CH4 W;  4RG8 A;  3M53 A;  5FW9 A;  4OMQ A;  1LJO A;  3M54 A;  2H3E B;  2O4X A;  2KYB A;  1JRI A;  1WQW A;  2RQR A;  4ME7 A;  4EMH A;  1N8R R;  3TSZ A;  2OAU A;  3JCM b;  3HRT A;  3HP9 A;  2DTI A;  2JMA A;  1UGS B;  1Q86 C;  1NE8 A;  1Z9Z A;  1BI0 A;  2W0Z A;  4Y28 E;  3J80 E;  4JRI A;  1RLQ C;  1M1K R;  3OYA A;  3QG1 A;  4J5Y A;  2K79 A;  2ED0 A;  3LYI A;  2DO3 A;  4A4K A;  1VQL T;  1VQ4 A;  3A8L B;  3MEV A;  1KSW A;  1PM3 A;  4RCB A;  2D0N A;  3J81 E;  2LQN A;  1JXM A;  2RHY A;  4X34 A;  1MV3 A;  2E64 A;  3NPF A;  4C8Q E;  5HK0 A;  4PJO F;  3HSB A;  2GBQ A;  4BI4 A;  3G4S Q;  3ZFJ A;  2CGH A;  3UWN A;  1FYN A;  4J6X A;  1WHM A;  5GAN f;  1AWX A;  3OBY A;  5GMK i;  2K5I A;  2X35 A;  2DFU A;  2COW A;  5M9O A;  2QK0 A;  4OP0 A;  3OYN A;  2ZGW A;  4NL2 A;  1VUB A;  2EGC A;  4M75 A;  4RCC A;  2G3R A;  3QWY A;  5FU6 C;  4C5G A;  1NEG A;  4JS5 A;  3OYB A;  3S3O A;  3CMA A;  1BI2 A;  4HCZ A;  2OAW A;  4KBM B;  2OTJ T;  1SRM A;  1RL2 A;  1BI3 A;  4BI8 B;  1TUD A;  2HBP A;  3HRS A;  3QBY A;  4LUD A;  1WZO A;  2LDM A;  1Y0M A;  3X28 B;  1BKB A;  1OEB A;  1UJY A;  3OYY A;  1GL5 A;  1X6B A;  3VS7 A;  1AWW A;  2CP5 A;  3PIO A;  5CO7 A;  1YJW A;  3SFM A;  3JRZ A;  1H3H A;  1Y57 A;  1D1C A;  1VQ4 Q;  4RTW A;  1QCF A;  2XID A;  3FLG A;  1OI1 A;  1IB8 A;  1NPP A;  1T3S A;  1D3B A;  5CR2 A;  1R77 A;  5DY9 A;  2JJ9 A;  1QCN A;  3QJ6 A;  2KRN A;  5L8R E;  1PRM C;  1V1C A;  2X51 A;  3RUX A;  3VS3 A;  2XKO C;  1WGS A;  1GXI E;  5J39 A;  4FU6 A;  3QYG B;  4BDY A;  2RM4 A;  4HKE A;  3CCM T;  4RTV A;  3TRE A;  1QVG P;  2VXF A;  2LRQ A;  3VS2 A;  1TWB A;  4NL3 A;  3RMS A;  2HQH A;  3JB9 G;  3H6Z A;  5IAY A;  3C95 A;  1C1A A;  1WPY A;  5KH6 A;  2L3Q A;  3C4S A;  4ANJ A;  4R55 A;  3JCM J;  1VQM T;  1H3Z A;  3CMA Q;  1TUG B;  1X01 A;  2DKG A;  1Q81 U;  4M75 F;  3H9N A;  3CPW P;  4M78 E;  3UPU A;  5AT1 B;  1BIA A;  3I5S A;  4ESR A;  3CCE T;  4FYV B;  2A7Y A;  4C0Z A;  1YJW Q;  2IG0 A;  2M0O A;  2KXD A;  1UJ0 A;  2QA4 T;  2CYZ B;  2JM9 A;  2QG9 B;  4OMM A;  4LDW A;  1IGQ A;  2HSE B;  2EYZ A;  3OS2 A;  1FMW A;  2E4H A;  4IUR A;  4JRK A;  4J6W A;  3TQ7 P;  1TSF A;  2RQV A;  2F69 A;  1D1B A;  5GAO q;  3JB9 I;  2AHJ B;  1G8X A;  4IKF A;  1UE9 A;  2M9U A;  1A0N B;  4OMF B;  4F14 A;  1BK2 A;  1QCO A;  3JCM d;  5GAM d;  5KE2 A;  2RQT A;  2RI3 A;  2CP3 A;  5CKD A;  4C5H A;  2RD1 A;  1PG5 B;  2VVK A;  1KD1 U;  3QSU A;  2EPD A;  2JN0 A;  2EKH A;  2MMP A;  4LDV A;  1VQP T;  4M7A E;  3GF5 A;  1X2Q A;  3L2U A;  1BCO A;  1UHF A;  2BUD A;  2ZZD A;  1VQ8 T;  5FWC A;  1NBE B;  3OSS C;  4DQ2 A;  2PVG B;  3M55 A;  2QEX T;  3EG0 A;  4J9E A;  2EW3 A;  2MWO A;  4KUD K;  4VUB A;  2RQU A;  2DXU A;  4OB0 B;  3I55 A;  3JSC A;  2E6N A;  4KH1 B;  3WVD B;  3CBP A;  4PKC C;  5IXF A;  2DD5 A;  5HKC A;  1H64 1;  1RLP C;  1WHJ A;  2DLP A;  3F70 A;  1NYF A;  2VYT A;  3HHT B;  2SRC A;  1TOV A;  2GQI A;  4ZGJ B;  4M7D A;  1K1Z A;  1GCP A;  3URG A;  4L59 A;  1RUW A;  4C8Q G;  5C6S A;  3A8G B;  2EAY A;  2WSF E;  1K76 A;  3GP8 A;  2J06 A;  3DLM A;  2EQU A;  2RJE A;  3JCM V;  3G71 A;  4MZM A;  3TEE A;  2EJF A;  4C92 E;  3JB9 H;  4LD9 K;  1M8V A;  5LJ3 e;  1KQS S;  3SWN C;  2DL3 A;  4OVA A;  2ATC B;  3JB9 J;  2HQE A;  4HVU A;  2R5M A;  5FU7 B;  1YHQ T;  5J3B A;  5LJ5 f;  3I56 T;  2AZV A;  4IUU A;  4C8Q B;  2MCN A;  1V76 A;  1WJS A;  3SB2 A;  9ATC B;  5KCH A;  5GAO m;  3I55 Q;  2OTL T;  3V8J A;  2J05 A;  4M75 C;  2M16 A;  1UGV A;  1K9M C;  2X4J A;  2I2L A;  5CVI A;  3PT9 A;  2CSQ A;  3RR6 A;  3CCL T;  3P8H A;  1KJW A;  1G3Y A;  2YUN A;  2JW4 A;  4RMO A;  2C0O A;  1PKT A;  3M0R A;  2BZY A;  2JTE A;  1WHL A;  4C5E A;  1VQO T;  1VQK T;  2V8K A;  2KDS A;  8ATC B;  2QI2 A;  3M0T A;  3M58 A;  5IHN A;  4M7D F;  1YJ9 A;  1FMV A;  2QGF B;  2P4R A;  1PHT A;  3JB9 D;  1YP5 A;  3G71 Q;  4XU0 A;  4CC7 A;  1RAF B;  4DEX A;  4PJO E;  3OW2 A;  4FYW B;  1TTH B;  2LZ6 B;  5GAN h;  2OTJ A;  2NUP A;  4PFP A;  4E7L A;  1NZ9 A;  1PSF A;  2HNI A;  2IVW A;  1Q81 R;  5CQY A;  2JS0 A;  3PGG A;  1M3C A;  3LLR A;  1X27 A;  5GAN 2;  5GAN g;  1Y07 A;  2XDP A;  1OPL A;  4M78 G;  3PNW C;  2ESW A;  2YT6 A;  2YDL A;  1Q82 C;  1P92 A;  1RI0 A;  5IHK A;  4AFS C;  5CAI A;  2OI3 A;  2NWM A;  3LWI A;  1G3S A;  2K2M A;  1VQ7 T;  5CCA A;  2QGG A;  3X26 B;  4HXJ A;  2DIQ A;  4B6M A;  3CCR A;  1H92 A;  5IN1 A;  3ZBD A;  1YI2 A;  2DL7 A;  3JCM X;  5KYY B;  5IXB A;  4DEY A;  3VU3 C;  1OV3 A;  4BUG A;  3CCM A;  2KRS A;  1AT1 B;  4CI0 C;  3QXE B;  4M78 B;  4F7U F;  1YJ9 Q;  3TU4 K;  4PFO A;  5I2S A;  2RH2 A;  4KH0 B;  1Q7Y U;  3E19 A;  1FX7 A;  2E12 A;  1LCK A;  1VQM A;  4J8O A;  3M9Q A;  1U8R A;  1OZ3 A;  2CRE A;  2OTJ Q;  2WSE E;  1ARK A;  3M59 A;  1D0X A;  2A3L A;  1KD1 R;  4XAX B;  2YSQ A;  1GFC A;  3JAM E;  4BE1 A;  4IIM A;  5DM7 R;  4R56 A;  1ZUU A;  4J9C A;  4QQ6 A;  5LL6 S;  4M7A G;  2MPX C;  4IUV A;  1HD3 A;  1OU8 A;  4RKU E;  1SHG A;  1KC8 C;  2QA4 A;  4M75 E;  2QQS A;  1K8A C;  1JO8 A;  3OSV A;  2ZPH B;  2P0P A;  2GFA A;  3MCA B;  4RG2 A;  2V26 A;  1ZUK A;  2VGM A;  3CCR Q;  5L23 A;  1YI2 Q;  4ZN1 A;  1W2B S;  3Q1J A;  4JS4 A;  1QW1 A;  4HT9 A;  1NJI C;  1SEM A;  4ZNX A;  3QWX X;  3HRU A;  3MP8 A;  2MIO A;  4FCY A;  4WCI A;  4D8D A;  4M7A B;  3CCM Q;  3OQ5 A;  1MMN A;  1NJI U;  4J83 A;  2DTO A;  4C0D B;  3M0Q A;  3M5A A;  4BE0 A;  4PJL A;  3INZ A;  3O5Z A;  5GMK h;  1VQM Q;  2YHT A;  1YFN A;  2VXE A;  2VB6 A;  2CP6 A;  1VQP A;  3BFM A;  1M2O A;  3OMC A;  3SDZ A;  1G3T A;  3RKY A;  1OUL A;  2DIG A;  1VQ8 A;  2FZC B;  2YRV A;  1LNX A;  2CT4 A;  2D8J A;  3PVQ A;  5GAN 4;  2SEM A;  1N6A A;  3L2W A;  4L6V 5;  1IRE B;  1N9S A;  2DMO A;  3UA6 A;  2O9S A;  3VS6 A;  4QVD A;  2QEX A;  4QT7 A;  2QA4 Q;  4C92 G;  1QVG S;  3TSW A;  3OS0 A;  1QVF P;  1X69 A;  2HDA A;  2PUO B;  4ZTF A;  4XTZ A;  3EAE A;  3OYJ A;  2YUP A;  1W2B A;  4A4G A;  4ZN3 A;  3C0C A;  1S1N A;  1I8F A;  4DOW A;  4KGZ B;  3FEO A;  3MEW A;  1DJ7 B;  3G7Z A;  3E9G A;  1OU9 A;  1ACM B;  4A4E A;  1K73 C;  3H8Z A;  2BTT A;  2K7A A;  3T9N A;  2HL3 A;  1QMC A;  4JPB W;  4C92 B;  4GBQ A;  1E6G A;  3OYI A;  2KVQ G;  2C0T A;  3MJX A;  3JCM Q;  4HCB A;  4JRP A;  3G71 T;  2ROL A;  5GMK j;  4FYX B;  1VQP Q;  2MYS A;  4HVV A;  1UGP B;  2RO0 A;  4XTW A;  3R6O A;  4ATO A;  1OYX A;  2K5F A;  1UEC A;  1KK7 A;  2AZS A;  1VQ8 Q;  1AWJ A;  1ZSZ B;  2HZY A;  4WTO B;  3HPW A;  1Q86 U;  3KUF A;  3EGD B;  4BDZ A;  3D7S B;  1Y96 A;  3GNF B;  3CBO A;  4B9X A;  5EG2 A;  2LJ3 A;  1YHQ A;  3MO8 A;  2QEX Q;  5KE3 A;  1C0M A;  1Z9Q A;  4LDY A;  3VYH B;  3I56 A;  4J7I A;  1QVG A;  2E3I A;  4PJO G;  2K9G A;  2V1Q A;  2L5Q A;  1JQQ A;  3M4Y A;  3A8H B;  1SRL A;  5GMK l;  1MUZ A;  3C12 A;  2LCS A;  3SWN A;  1RAA B;  4FSX A;  1IZ6 A;  2DL8 A;  2A28 A;  4M78 D;  2OTL A;  2CP2 A;  2DRM A;  3EFR A;  3BE3 A;  2JTF A;  5IT9 E;  4M77 C;  5HY6 A;  3PMI A;  2LT4 A;  2ZPF B;  1XQH A;  2BKD N;  3BDU A;  5KYW B;  4XTU A;  5LJ5 h;  3CCL A;  2L3P A;  4M77 D;  2FG0 A;  4X9D A;  5DLO A;  3EH1 A;  2EYQ A;  2XIC A;  4WF2 A;  1YJ9 T;  2LCC A;  4CC4 B;  3NHN A;  1ABQ A;  4PJO B;  1VQO A;  3X25 B;  1VQK A;  1MND A;  2DXB A;  2CZ6 B;  2GCX A;  7AT1 B;  1OOT A;  3CXC S;  1JJ2 S;  1GCQ A;  2E65 A;  1HK9 A;  2PNI A;  2RN8 A;  4BI3 A;  4EPC A;  1W70 A;  1Q7Y R;  2F5T X;  3FRN A;  1LOJ A;  3M56 A;  1WXT A;  4RTT A;  5GAN d;  3L2Z A;  3SD4 A;  1YHQ Q;  4FL6 A;  4FT4 A;  4JJC A;  2O4X B;  4V2S A;  3I56 Q;  4DBR A;  2RHU A;  3RIR A;  2IIM A;  4M7D E;  3HFO A;  2MAM A;  1MNE A;  1NLP C;  2OTL Q;  2ZPI B;  1EX4 A;  3CCR T;  1YI2 T;  4BD3 A;  4JRQ A;  4Q5W A;  3JCM e;  5GAM e;  3AHU A;  3ASK A;  3DKM A;  1VQ7 A;  2KMT A;  2EYX A;  3H0F A;  3CCL Q;  3PE0 A;  1CSK A;  4MDW A;  2XDB A;  1UFF A;  1Y71 A;  2V8J A;  3CC2 A;  2X4Y A;  1VQO Q;  1VQK Q;  2L3R A;  3BY7 A;  1ZSG A;  2L3S A;  4XQ3 A;  3CXC A;  4ZGD B;  1JJ2 A;  4OMN A;  3EHR A;  5GMK e;  1NJI R;  1I5O B;  1EIF A;  1WDX A;  2G6F X;  2I0N A;  1JU5 C;  2K5L A;  1I81 A;  4UC4 A;  5I21 A;  1QP2 A;  5KYX B;  1S72 T;  1YCS B;  2LQ8 A;  4JDS A;  5GJW B;  4E7S A;  4J9F A;  1WFW A;  2RQW A;  2JVV A;  2YRC A;  4F7U E;  2CP7 A;  4Z02 A;  4QQD A;  2ZCF B;  1AEY A;  3CCS T;  1VQ5 T;  3FIF A;  4AFU C;  3RBB B;  4C92 D;  1WXU A;  2JT4 A;  2RPN A;  1IXD A;  1VQ7 Q;  2RJD A;  1M90 R;  1PNJ A;  4FM4 B;  3X20 B;  1RAD B;  3PVL A;  2CUB A;  2DTH A;  2JMC A;  2K3B A;  1I0C A;  3CCJ T;  3CC2 Q;  4BY6 B;  1JB0 E;  4FYY B;  2DYI A;  2YLC A;  1D3B B;  3MHX A;  5GAO n;  4A4H A;  1K0X A;  2MOX A;  4XTV A;  1ZA1 B;  4AMC A;  5CIU A;  1K9A A;  1PKS A;  2DK3 A;  5KYN A;  3I35 A;  1YWP A;  2YUO A;  2KGT A;  1RAH B;  1X43 A;  4AFZ C;  3IQL A;  5CQX A;  4PLI A;  5A0G A;  2RK1 A;  1PSE A;  3UDC A;  4N0A A;  1BCM A;  1NEB A;  1M9S A;  4B9W A;  3OYE A;  2X9H A;  3EFO B;  4TVR A;  1I1J A;  2J7I A;  2Y4X A;  2XMF A;  3NTK A;  1N5Z A;  2EGA A;  4PFZ A;  1QKX A;  5FRN A;  1KIK A;  1WA7 A;  1Q86 R;  2D1X A;  3P8B B;  5GAN 3;  2F5K A;  4E7K A;  4PJO D;  3MP6 A;  1D0Z A;  1KHC A;  4YTL A;  1YNZ A;  1MMD A;  1WJR A;  2D6F A;  2ABL A;  5HK3 A;  3VS5 A;  4JZ4 A;  2FYK A;  4E7J A;  3EG2 A;  2C0I A;  2L0A A;  3REA B;  4XTX A;  5CKE A;  2FPF A;  2VWF A;  4KUL A;  5A0D A;  1K4U S;  2M0Y A;  5KCO A;  1LPL A;  2DJQ A;  3CC7 A;  1U1S A;  1VYV A;  1BI1 A;  3RKW A;  3J7A F;  2P0Q A;  3MEU A;  3I5R A;  2DEU A;  1BYM A;  2BE9 B;  2PTK A;  1MHN A;  1AVZ C;  4L5G A;  2DJZ A;  2H8H A;  2DD4 A;  1VIE A;  2GNC A;  5D6Y A;  3CME T;  1X6G A;  1UHC A;  4A54 A;  3HKS A;  2K6D A;  2QQR A;  2VC8 A;  2K2V A;  4FIB A;  1UGR B;  4OMO A;  1G3W A;  2VGN A;  4JLI A;  1XNI A;  4EMK B;  3EGX B;  1AZE A;  3S3N A;  1GCQ C;  3JCM c;  5KYY A;  3OB9 A;  1K9M U;  1IHW A;  3MKD A;  1G2B A;  1M4Z A;  4N4G A;  1KFZ A;  3L1A A;  4M7D G;  2RI2 A;  2E6Z A;  4BAC A;  2JXB A;  4AG2 C;  2ED1 A;  4LDX A;  2VAS A;  4RTZ A;  1M8M A;  4X1V A;  3ZL7 C;  5LJ5 d;  2DNU A;  1E6H A;  4RTU A;  4BE2 A;  4ZTJ A;  1WIE A;  5LJ3 f;  2QAS A;  2LJ0 A;  3QZ5 B;  1X6O A;  3CC7 Q;  2KRO A;  4M77 A;  2EWN A;  1KQS A;  4HVW A;  4F17 A;  1MGQ A;  2GFU A;  1UDL A;  3UT1 A;  5AYF A;  1IGU A;  3LH0 A;  4M7D B;  2YLB A;  1M1K C;  3L2R A;  3PTA A;  2QDL A;  3G1J A;  4E7H A;  2X4X A;  1VQ6 T;  2LTO A;  2QYZ A;  1AOJ A;  3QZ9 B;  3ULR B;  3MP1 A;  4KRT A;  2KNB B;  2DAQ A;  2RJC A;  3DB3 A;  4NS5 A;  2JZ2 A;  1Q82 U;  1PCX A;  1LVK A;  2R5A A;  3THK A;  2EIF A;  2JS2 A;  2V8I A;  2L8D A;  4OML A;  4E47 A;  4F7U G;  3OYK A;  4CC2 A;  1M3B A;  3CC2 T;  2GGR A;  1UGQ B;  1X2K A;  2BIV A;  1SPK A;  1B34 A;  3VKI A;  3U23 A;  4J7F A;  1OX8 A;  4DA4 A;  3VS4 A;  1KQ2 A;  2FVU A;  4N4H A;  3FJP A;  5C0M A;  4KUI A;  3OS5 A;  3LX7 A;  1NYG A;  1AHJ B;  1UTI A;  1MMA A;  2XI9 A;  4M77 F;  5GAN j;  4F7U B;  2J6O A;  4AT1 B;  2QTV A;  2XHC A;  3ER0 A;  2V1R A;  1YCY A;  1S72 A;  2HCK A;  3WVE B;  1VYT A;  3JV3 A;  1O75 A;  3EGU A;  2RHI A;  2DF6 A;  2PZ1 A;  2EFI A;  3EG3 A;  4GLM A;  2E3H A;  5GAO l;  2OJ2 A;  2XK0 A;  4D8K A;  2GF7 A;  1G83 A;  4LN2 A;  2W10 A;  1KC8 U;  4O6J A;  4ORZ A;  4Y91 A;  4JUV A;  1TXQ A;  3CCS A;  1JEG A;  1K8A U;  4LXC A;  3QDF A;  2E5K A;  3L2V A;  1VQ5 A;  1EFN A;  2QQA A;  4ZGE B;  2XG8 D;  2F2X A;  1XOV A;  1T0H A;  3LWH A;  2HD0 A;  2CH4 A;  1SF9 A;  5FU6 B;  4QVC A;  1E7O A;  2KY9 A;  2EJ9 A;  2HQX A;  5FU7 C;  3ZEH A;  2J6F A;  3OW2 P;  4C92 A;  4N0A C;  2DVJ A;  2QQB A;  4PJN A;  3CCJ A;  4ELZ C;  4C8Q C;  2K3Y A;  2A0F B;  2EQM A;  1ZA2 B;  1WXB A;  2KT8 A;  4LE9 A;  1NM7 A;  3SEM A;  1SG5 A;  4PK4 A;  2AKK A;  4C8Q D;  3GLX A;  1YBY A;  4Z89 A;  2DPP B;  2YWW A;  3V7R A;  2Z0W A;  2D0Q B;  2WSC E;  4KT0 E;  5CKH A;  4MZT A;  1S72 Q;  2FPD A;  2RJF A;  2CSI A;  3V8L A;  1H8K A;  1UB4 A;  1OPK A;  3A8O B;  3V7C A;  2DIL A;  1XJW B;  1G5V A;  3NTI A;  2B86 A;  1T0J A;  3SHW A;  2IPO B;  1EZZ B;  1WYX A;  1YIJ A;  1NLO C;  1VQ9 T;  3CCQ T;  2M51 A;  4DBH A;  3CCS Q;  1QLY A;  1VQ5 Q;  5FLX E;  1VA7 A;  3MET A;  2F2V A;  2O88 A;  1M1G A;  5KYW A;  3PIP A;  5CKF A;  3O8V A;  5KYU B;  3NFC A;  1M2V B;  1R0B G;  3CPW S;  2EBP A;  2DRK A;  1SSH A;  4PJO A;  2CUD A;  2FRW A;  2DXT A;  4HA8 A;  1QQJ A;  1OX9 A;  3CCJ Q;  3A5Z B;  4DOV A;  8AT1 B;  3CC4 A;  1K9M R;  2LT1 A;  4D6W A;  1K73 U;  4K11 A;  4C92 F;  2R58 A;  3CC7 T;  5A2Q E;  3KXT A;  4PJM A;  4EDU A;  1W1F A;  2HKN A;  5HCK A;  1YJN T;  2CZ7 B;  3NMZ C;  1IHV A;  3H0H A;  3G6E T;  3TCJ A;  1D09 B;  5GAN e;  2FPE A;  2KYM A;  2EYY A;  4QVZ A;  1SKU B;  2DBK A;  5ECA A;  3HFN A;  4MML A;  2E1H A;  5IHI A;  1M30 A;  2NUT B;  3EG9 B;  3X24 B;  4M78 C;  1QKW A;  3N5B B;  1YIJ Q;  4O5V A;  3JCM W;  1CKB A;  3CME A;  4F04 B;  2ZPB B;  1ZLM A;  1X75 C;  4Y92 A;  3CD6 A;  1ZUY A;  2HMA A;  3CPW A;  3JCM P;  1CKA A;  3E2U A;  2LC4 A;  4CC3 A;  5FWB A;  1Q82 R;  3ME9 A;  3CC4 Q;  2HEQ A;  3E1S A;  2JM8 A;  3CCV A;  3I9Q A;  3FDR A;  5LJ5 g;  2XU8 A;  4J9G A;  2DYB A;  2RB6 A;  4QW2 A;  2Y4Y A;  2OX7 A;  5KYX A;  2BZX A;  3FB9 A;  3UAT A;  4MDX A;  1R8O B;  1I5L A;  2DZ9 A;  3CPF A;  3VRZ A;  1IRX A;  2EQJ A;  3VJP A;  2O01 E;  3M4G A;  4A53 A;  4M7A C;  4JLG A;  1W2B P;  3UF4 A;  1OZ2 A;  4OGE A;  5LJ3 h;  4DBQ A;  4C0D C;  4J9H A;  4XU2 A;  3CME Q;  2LX7 A;  2DER A;  4M7A D;  2YRD A;  1VQ6 A;  3CCU A;  3A98 A;  3QHS A;  3M57 A;  5D7U A;  3L2Q A;  2DL4 A;  2PVD B;  2LP5 A;  4NOY A;  5LJ3 g;  3CD6 Q;  2GTJ A;  4C0F A;  1M27 C;  4IIO A;  2RMO A;  2KAF A;  1Y96 B;  4C0G A;  6AT1 B;  4XTY A;  3BW1 A;  1ZHI A;  5CK9 A;  5LJ5 j;  1NPR A;  2YUQ A;  3CBM A;  3OY9 A;  1JBM A;  1VOM A;  1JXO A;  1KC8 R;  1SSF A;  2KSS A;  1D1A A;  1GRI A;  5D6X A;  4M75 G;  1MV0 B;  4A4F A;  1K8A R;  3CCV Q;  4PJJ A;  1HYO A;  1KHI A;  3PMT A;  1KQ1 A;  4E7I A;  3QDR B;  3EFS A;  1FWZ A;  4LDU A;  1PD0 A;  2LQK A;  3SWN B;  2EJG A;  2QDY B;  3M0U A;  4FW1 A;  4FT2 A;  5FRO A;  2RI5 A;  2RNA A;  1K0S A;  2B8A A;  2KT1 A;  1FXX A;  1UUE A;  3LGL A;  1ZBX A;  5GAO p;  3PFS A;  2VKN A;  1GFD A;  1IO6 A;  1Q81 C;  1U1T A;  3EFO A;  2MF2 A;  1VIF A;  1U5S A;  4M75 B;  4QQG A;  1HJD A;  3VUB A;  3JB9 F;  1V29 B;  3DB4 A;  2A36 A;  4P5N A;  5LJ3 j;  2BE7 D;  4C92 C;  2DVE A;  1VQ6 Q;  3CCU Q;  3JCM f;  5GAM f;  4MZP A;  1W6X A;  4FSS A;  1GBQ A;  2R57 A;  4M77 E;  2FL7 A;  3RER A;  3HL8 A;  2M02 A;  2GTO A;  1Y7X A;  1ZSZ C;  3OYM A;  3EHQ A;  3QII A;  5GAN 5;  1N9R A;  2X3X D;  3LH5 A;  3GNG A;  5GAO r;  1FMK A;  3RMQ A;  3QKJ A;  2O31 A;  4KGV B;  2KR3 A;  4C5I A;  1NG2 A;  1PD1 A;  1WI7 A;  1YIT T;  4J9D A;  2LX9 A;  4CRI A;  1WQ7 A;  5I22 A;  1K73 R;  3VYG A;  1KD1 C;  3GPL A;  2AT1 B;  2KEA A;  1OQK A;  4LNP A;  2EGE A;  4IUQ A;  2CKK A;  3HTR A;  5D6W A;  1RAB B;  4GY5 A;  4C8Q A;  3GOX A;  2Y90 A;  4RTX A;  1QWF A;  2MI6 A;  3BDL A;  2E10 A;  1YIJ T;  4PJO C;  1ABO A;  4FW2 A;  4F16 A;  2GQV A;  4OB1 B;  2ECZ A;  4JZ3 A;  4EMK A;  3EGX A;  2H3J A;  1TH7 A;  2PVO B;  1VQ9 A;  3A1P A;  3E9F A;  3CCQ A;  2K3X A;  5GAN 8;  1RAE B;  4OB3 B;  3CXC P;  2VUB A;  1KG1 A;  1JJ2 P;  2E70 A;  2LJ1 A;  2X3W D;  5LJ5 e;  5J26 A;  2DL5 A;  3CC4 T;  1B07 A;  4XU3 A;  2ZPE B;  4JJB A;  3G4S T;  5CKB A;  4Z88 A;  2LNH B;  3CEY A;  4AG1 C;  3EG1 A;  3OYL A;  1VYU A;  2JOY A;  2CZ0 B;  1VQN A;  1M1F A;  3VS1 A;  3OMG A;  2RK2 A;  2QQ9 A;  2K4Y A;  2DA9 A;  3FJ5 A;  3OYF A;  4OB2 B;  3VS0 A;  1YJN A;  1QVP A;  2VV5 A;  4E7Z A;  3G6E A;  1AWO A;  2HAX A;  1RAG B;  2EQK A;  1WLP B;  1ZQ1 A;  5GJV B;  2P0K A;  2MWP A;  4C8Q F;  1R0C B;  3OW2 S;  2KK4 A;  2FO0 A;  1VQ9 Q;  2J6K A;  3CCQ Q;  2CP0 A;  3CD6 T;  2PQW A;  1WHH A;  2ZAE A;  1PRL C;  1HSQ A;  1D0Y A;  2KI7 A;  2EYW A;  1VQ4 T;  4OF1 A;  5DLQ E;  2ROT A;  4J9B A;  1ZBJ A;  3AT1 B;  1C6V X;  3TVT A;  1GBR A;  3CCV T;  2A08 A;  2C06 A;  4M78 A;  1U3O A;  4IUP A;  1BIB A;  1VQL A;  4JJD A;  3RNJ A;  1N8R C;  4BB7 A;  4XU1 A;  2ZPG B;  2E41 A;  4M75 D;  3QUI A;  2P4T A;  1N8R U;  2NYS A;  1VQN Q;  3R6N A;  4MMK A;  2DM1 A;  4F7U A;  2FEI A;  3NGP A;  3OS1 A;  1QVF S;  1F1B B;  2LVM A;  3H0I A;  1YJN Q;  4PL6 A;  4ELY C;  1I4K 1;  2RA2 A;  3G6E Q;  1WJQ A;  3VRY A;  3C94 A;  2QTX A;  3L42 A;  4XK8 E;  5A0L A;  3CMA T;  1AZG B;  2QXF A;  3CQT A;  2EVR A;  1M1K U;  2LMJ A;  4GLK A;  2WAC A;  4BY6 C;  2KBT A;  3RKX A;  2O9V A;  4E2F B;  3CCU T;  2O2O A;  3GBQ A;  3KBG A;  4A63 B;  2QAZ A;  4IUT A;  1BBZ A;  5LJ3 d;  2A37 A;  1BB9 A;  2DXC A;  2YXY A;  1YJW T;  2DEQ A;  2P84 A;  4LD6 A;  1YWO A;  4JJN K;  1PC0 A;  2M1H A;  2RF0 A;  3KFV A;  3WXM B;  3A8M B;  4M7A A;  1VQL Q;  2KE9 A;  1BU1 A;  1QP3 A;  4X9C A;  5GAN 6;  4EMG A;  2KRM A;  4KGX B;  4HT8 A;  4HCC A;  2HSP A;  4M78 F;  4OGC A;  2FZG B;  3V8K A;  4M77 G;  1XTD A;  2JNG A;  2E5Q A;  2K57 A;  2EQI A;  3OYD A;  1RAI B;  4E6R A;  2CZ1 B;  3OYG A;  3MEA A;  1QVF A;  1Q7Y C;  3RDV A;  2MK5 A;  1WHG A;  2COZ A;  2FB7 A;  2RHZ A;  5I11 A;  1TUC A;  2L2P A;  2NUZ A;  2XD0 A;  1M3A A;  1M5Q 1;  1O9S A;  1WHK A;  2FZK B;  2AKL A;  3GIB A;  3OYC A;  4M77 B;  4II1 A;  2BZ8 A;  4PNO A;  2HBW A;  4AFQ C;  2HL5 C;  2DX1 A;  3RES A;  1SHF A;  2NUP B;  4J6Y A;  1QWE A;  2CT3 A;  2DE0 X;  5KYU A;  3CCE A;  2FHD A;  4N4I A;  1M2V A;  2L89 A;  1PWT A;  3LW5 E;  1AD5 A;  3UA7 A;  2KXC A;  3OBW A;  3S3M A;  2COY A;  2CS7 A;  5FRM A;  1KQS P;  2JTM A;  1RAC B;  1I07 A;  4M7A F;  5GMK m;  2RHX A;  2LQW A;  3OYH A;  3QJY A;  1HXD A;  2AK5 A;  3S6W A;  2FRY A;  2KQW A;  1UG1 A;  3JCM h;  5GAM h;  1Q95 G;  3DLL A;  3FC3 A;  4R0K A;  5I2M A;  3V7S A;  1TS9 A;  4EIK A;  1J3T A;  3EH2 A;  4RTY A;  2X4W A;  1ZX6 A;  4PLL A;  4EMK C;  2DET A;  1ZSZ A;  3JCM g;  5GAM g;  2EKO A;  2PU9 B;  1WX6 A;  3EGD A;  4M4Z A;  3VUZ A;  1YIT A;  5EC7 A;  1TG0 A;  1B34 B;  3MPU B;  3OA6 A;  4J9I A; 
#chains in the Genus database with same CATH homology
 3I35 A;  1YWP A;  4CC7 A;  2YUO A;  3UAT A;  4DEX A;  2KGT A;  3VRZ A;  1U06 A;  1X43 A;  4AFZ C;  1T3L A;  3H41 A;  3IQL A;  2LZ6 B;  4OMP A;  3UF4 A;  1NEB A;  1I1J A;  2J7I A;  2JS0 A;  4J9H A;  4LUE A;  2XMF A;  2LX7 A;  1N5Z A;  1M3C A;  2EGA A;  1X27 A;  2DBM A;  1QKX A;  2F2W A;  1KIK A;  1WA7 A;  3A98 A;  2D1X A;  1OPL A;  1B3Q A;  2DL4 A;  2ESW A;  2LP5 A;  2YT6 A;  2YDL A;  2GTJ A;  5IHK A;  4AFS C;  1M27 C;  4IIO A;  2RMO A;  2OI3 A;  2NWM A;  1YNZ A;  2ABL A;  2K2M A;  2YUQ A;  3VS5 A;  3REB B;  4JZ4 A;  1JXO A;  4HCK A;  5IH2 A;  3M0P A;  4HXJ A;  1GRI A;  1MV0 B;  1H92 A;  3EG2 A;  4Z8A A;  2C0I A;  2D8H A;  2DL7 A;  2L0A A;  3REA B;  2CDT A;  3M0S A;  2FPF A;  2VWF A;  5IXB A;  4DEY A;  1K4U S;  2ENM A;  1OV3 A;  3M0U A;  2M0Y A;  4RUG A;  2KRS A;  1RI9 A;  2RNA A;  1K0S A;  1YN8 A;  2CH4 W;  2KT1 A;  1UUE A;  5FW9 A;  2DJQ A;  4OMQ A;  2KYB A;  2RQR A;  1VYV A;  2VKN A;  1GFD A;  1IO6 A;  1LCK A;  3TSZ A;  3I5R A;  1U5S A;  2CRE A;  1ARK A;  1HJD A;  2PTK A;  2JMA A;  1AVZ C;  2YSQ A;  1GFC A;  1Z9Z A;  4IIM A;  2A36 A;  2H8H A;  2W0Z A;  2GNC A;  1ZUU A;  4J9C A;  1RLQ C;  1X6G A;  1UHC A;  1HD3 A;  2K6D A;  1W6X A;  4FSS A;  1GBQ A;  4OMO A;  1SHG A;  2K79 A;  2ED0 A;  1JO8 A;  2GTO A;  1AZE A;  1GCQ C;  1KSW A;  3EHQ A;  2D0N A;  1ZUK A;  2LQN A;  2X3X D;  1JXM A;  1MV3 A;  5L23 A;  1G2B A;  3LH5 A;  3NPF A;  1KFZ A;  2JXB A;  4AG2 C;  2ED1 A;  1FMK A;  2GBQ A;  4RTZ A;  1M8M A;  1SEM A;  4X1V A;  4ZNX A;  1FYN A;  3QWX X;  3ZL7 C;  2MIO A;  4WCI A;  2O31 A;  2DNU A;  4D8D A;  1E6H A;  4RTU A;  1AWX A;  2KR3 A;  1WIE A;  1NG2 A;  2LJ0 A;  1WI7 A;  4J9D A;  2KRO A;  3M0Q A;  2EGC A;  5I22 A;  3O5Z A;  3QWY A;  4HVW A;  4F17 A;  2KEA A;  1UDL A;  4LNP A;  1NEG A;  2EGE A;  2OAW A;  1SRM A;  2QDL A;  4RTX A;  1QWF A;  1TUD A;  4LUD A;  2CT4 A;  2D8J A;  1ABO A;  3PVQ A;  4F16 A;  1Y0M A;  2SEM A;  1OEB A;  2ECZ A;  4JZ3 A;  1UJY A;  1GL5 A;  2DMO A;  3UA6 A;  2O9S A;  1AOJ A;  3ULR B;  3VS6 A;  1X6B A;  3VS7 A;  4KRT A;  1AWW A;  4QT7 A;  2KNB B;  3TSW A;  1H3H A;  1Y57 A;  4RTW A;  1X69 A;  1QCF A;  2HDA A;  3THK A;  1T3S A;  2JS2 A;  4OML A;  2LJ1 A;  2X3W D;  2YUP A;  2DL5 A;  2KRN A;  3C0C A;  1B07 A;  1S1N A;  1PRM C;  4CC2 A;  1V1C A;  1M3B A;  2GGR A;  3VS3 A;  1X2K A;  1SPK A;  4JJB A;  3U23 A;  4Z88 A;  2LNH B;  4AG1 C;  2BTT A;  3EG1 A;  2K7A A;  4RTV A;  3VS4 A;  1VYU A;  4JPB W;  3VS2 A;  4GBQ A;  1E6G A;  3VS1 A;  2C0T A;  2DA9 A;  3FJ5 A;  2ROL A;  2L3Q A;  3VS0 A;  4HVV A;  1NYG A;  1UTI A;  1AWO A;  1UEC A;  2J6O A;  2AZS A;  1WLP B;  5GJV B;  1AWJ A;  2V1R A;  2HCK A;  1VYT A;  3JV3 A;  3I5S A;  3EGU A;  4ESR A;  2DF6 A;  2PZ1 A;  3EG3 A;  4GLM A;  2LJ3 A;  2FO0 A;  1Z9Q A;  2OJ2 A;  4D8K A;  2J6K A;  1G83 A;  2K9G A;  2V1Q A;  4LN2 A;  2KXD A;  1UJ0 A;  2W10 A;  1JQQ A;  1PRL C;  2JM9 A;  1HSQ A;  4OMM A;  4ORZ A;  2EYW A;  1JEG A;  1SRL A;  1MUZ A;  2E5K A;  2LCS A;  1EFN A;  2ROT A;  4J9B A;  2DL8 A;  1ZBJ A;  2A28 A;  2DRM A;  2EYZ A;  2F2X A;  1XOV A;  1T0H A;  3TVT A;  2CH4 A;  1GBR A;  2A08 A;  1U3O A;  2RQV A;  1E7O A;  4JJD A;  2J6F A;  3RNJ A;  1UE9 A;  2L3P A;  1A0N B;  4F14 A;  2DVJ A;  2FG0 A;  1BK2 A;  2RQT A;  1WXB A;  4CC4 B;  3NHN A;  1ABQ A;  3R6N A;  2KT8 A;  4LE9 A;  1NM7 A;  2DM1 A;  3SEM A;  2FEI A;  3NGP A;  2AKK A;  3H0I A;  2VVK A;  1OOT A;  2EPD A;  2EKH A;  1GCQ A;  3VRY A;  4Z89 A;  2PNI A;  2RN8 A;  1AZG B;  1X2Q A;  1W70 A;  1UHF A;  3CQT A;  2EVR A;  2FPD A;  2LMJ A;  5FWC A;  2CSI A;  1H8K A;  2KBT A;  2O9V A;  1OPK A;  2DIL A;  1WXT A;  4RTT A;  2O2O A;  3GBQ A;  4JJC A;  2B86 A;  1T0J A;  4A63 B;  3SHW A;  1BBZ A;  2IIM A;  2A37 A;  1BB9 A;  3EG0 A;  1WYX A;  4J9E A;  1NLO C;  2EW3 A;  1YWO A;  2M51 A;  1NLP C;  1QLY A;  2RF0 A;  1VA7 A;  2RQU A;  3KFV A;  2F2V A;  2O88 A;  2KE9 A;  1BU1 A;  2EBP A;  5IXF A;  2DRK A;  2EYX A;  1SSH A;  2KRM A;  3H0F A;  3PE0 A;  2CUD A;  2FRW A;  1CSK A;  2HSP A;  1RLP C;  2DLP A;  1UFF A;  1NYF A;  2EQI A;  2SRC A;  2GQI A;  4K11 A;  4E6R A;  1K1Z A;  1GCP A;  1ZSG A;  2L3S A;  1RUW A;  1W1F A;  4OMN A;  3EHR A;  5HCK A;  1K76 A;  2J06 A;  3NMZ C;  5I11 A;  3H0H A;  1TUC A;  2L2P A;  1WDX A;  2NUZ A;  2G6F X;  2I0N A;  1JU5 C;  2FPE A;  2KYM A;  1M3A A;  2EYY A;  2AKL A;  2DBK A;  2DL3 A;  1YCS B;  5ECA A;  5GJW B;  4J9F A;  1WFW A;  2BZ8 A;  2RQW A;  5IHI A;  1M30 A;  4HVU A;  2HBW A;  4AFQ C;  1QKW A;  2DX1 A;  1CKB A;  1SHF A;  1QWE A;  2CT3 A;  2AZV A;  2DE0 X;  2MCN A;  1AEY A;  1PWT A;  1ZLM A;  4AFU C;  1AD5 A;  3UA7 A;  4Y92 A;  2J05 A;  2KXC A;  3RBB B;  1UGV A;  1ZUY A;  1WXU A;  2JT4 A;  2RPN A;  1CKA A;  1I07 A;  4CC3 A;  1PNJ A;  2LQW A;  5FWB A;  3PVL A;  2CSQ A;  2CUB A;  2AK5 A;  2HEQ A;  1KJW A;  2FRY A;  1UG1 A;  2JMC A;  2YUN A;  2JM8 A;  2JW4 A;  2K3B A;  2C0O A;  1I0C A;  1PKT A;  3I9Q A;  3M0R A;  2BZY A;  2JTE A;  4R0K A;  4EIK A;  1J3T A;  1K0X A;  4J9G A;  4RTY A;  1ZX6 A;  2MOX A;  2DYB A;  3M0T A;  5IHN A;  1WX6 A;  4M4Z A;  5EC7 A;  2P4R A;  1TG0 A;  1PHT A;  1K9A A;  1YP5 A;  2BZX A;  1PKS A;  4J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...