1OU9A

Structure of sspb, a aaa+ protease delivery protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYDELNIEPDTEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou9A00
1YFNA 2QASA 1ZSZA 1ZSZC 1ZSZB 1TWBA 1OX8A 2NYSA 1OULA 1OU8A 1OU9A 1OX9A 2QAZA
chains in the Genus database with same CATH superfamily
4D8KA 1AVZC 5GAOp 5FWCA 1W70A 3CCQT 1ABOA 4DOVA 1Q81U 4GBQA 2K3BA 4OMLA 3VS3A 4JS4A 4HCCA 4M7DE 4PJLA 4JS5A 2KGTA 2MCNA 2HAXA 2J6FA 4FU6A 5CQYA 3SHWA 2HMAA 5KYUA 1X69A 1OZ3A 2K2VA 3CCRT 1UUEA 4EMGA 3OS1A 3CBOA 4CRIA 2LTOA 2MI6A 3H0FA 2GFUA 2LQ8A 4E7JA 3CCSQ 1M3AA 3CMAA 3VS4A 2QK0A 4LDUA 2M0YA 1M8MA 2CP2A 1G5VA 4WCIA 3TSWA 1W2BA 2DXUA 1D3BB 3HFNA 5FU7C 3FIFA 4C0GA 5D7UA 2VYTA 4J83A 3G71A 1M1KC 1YITA 4LD6A 3A8LB 1T3SA 4FL6A 2A3LA 1KHIA 4RG2A 1D1AA 2CKKA 4F17A 1FWZA 2G6FX 4RTZA 4PFOA 4B9XA 1PCXA 3GIBA 2YUQA 2BIVA 3NGPA 2NUZA 3RR6A 3F70A 1VQ4T 2QASA 2CP0A 2HZYA 2COZA 1KHCA 1QVGS 1QVGP 2VC8A 2BE7D 2QQBA 1U3OA 2K9GA 1MV3A 1VQ6Q 2RI2A 3MEUA 3ULRB 1I8FA 2GTOA 5GAN6 2EGAA 2DIGA 1K8AR 3JCMd 1Q86R 1R8OB 1YI2T 3KFVA 2KVQG 4ME7A 2D0NA 1TS9A 4PJMA 3EFOB 4MMLA 1QWEA 2JJ9A 2QXFA 5GAMj 4JRKA 2EW3A 3QDRB 4J9EA 2ZPGB 2RD1A 3J7AF 3L2ZA 1AWOA 1UECA 1K0XA 2RB6A 3MP8A 2DEUA 2QDYB 3GP8A 4N0AA 3J81E 3CCVQ 2DFUA 4C0FA 2MPXC 2CSIA 1X01A 1T3LA 3Q1JA 1QLYA 4M7AA 1H3HA 2ROTA 4R55A 1NEGA 1Y7XA 3CC4T 3G7ZA 4AG1C 3CBMA 4ZN1A 3L2QA 3UA7A 4DQ2A 3LGFA 4M78E 4C0DB 2E1HA 2QI2A 3MJXA 2G3RA 3I35A 1QKWA 3VRZA 4JUVA 2ZPEB 3EHQA 3CCMQ 3VKIA 3HFOA 1YJ9A 1D0ZA 3U23A 3EGXA 2DL7A 1P92A 1W2BS 1FMWA 3V7RA 1U1SA 5LJ5e 2XHCA 3QYGB 3N5BB 2CSQA 2GCXA 2DZ9A 3HRUA 4XTVA 3OSSC 1X2QA 3QG1A 2XKOC 1TSFA 2DBMA 3DB4A 3MKDA 5GAN7 3SWNC 4N0AC 2YHTA 3OYJA 1GFCA 1V76A 2QQRA 4OMFB 2F1LA 5LJ5g 1KC8C 2LCSA 5LJ3j 4OVAA 2VGMA 2LT1A 2K7AA 1PNJA 1NBEB 1WNLA 2NUPA 1N8RU 3CMEQ 4M7AF 2R5MA 2DK3A 3I5RA 4M75A 3CMAT 2HQHA 2O4XB 1TWBA 5GJWB 3C0CA 3V8LA 3RKWA 4J9GA 4M7DB 1MUZA 1WJQA 3EG3A 4IKFA 2OX7A 1KQ2A 2QTVA 3G71T 1G3TA 5GANj 1BI3A 3FB9A 4EMKC 3CD6A 1IRXA 2GF7A 3CXCS 1UJ0A 2QYZA 3CXCP 3JCMP 4KULA 5GAOr 2E70A 5I22A 2XIDA 2KK4A 3RUXA 2E5KA 1KSWA 4B6MA 5HY6A 3EGDA 1VUBA 4XTXA 1VQPQ 1I0CA 3OYMA 3G6EQ 1WFWA 2RHZA 2DVEA 1X27A 3S3OA 4N4HA 3OYLA 1QVFA 5FU6C 3M54A 5KYNA 2DXBA 2ZGWA 2KRSA 4KGVB 2RK2A 4HT9A 3OBYA 2DTHA 1PRLC 4JRQA 2LNHB 3QZ5B 4DEXA 4M75F 1NYGA 4LDYA 1LPLA 1YN8A 4OMQA 2F2XA 2DIQA 1M30A 3PE0A 4OMPA 2EJ9A 4F7UA 4J7IA 4E7ZA 2C06A 4C5HA 2Z0WA 3GBQA 1AHJB 4JJBA 3OA6A 1SRLA 1KQ1A 3G1JA 5KYWB 1BIAA 3FJ5A 2DD5A 4FM4B 1RUWA 2EQMA 1KQSA 2E41A 3VUZA 1UG1A 1YJNQ 1VQ9Q 2WSCE 3OW2A 4J8OA 2ZPIB 1WQ7A 1QVPA 4KRTA 4M7DD 1XQHA 3ZBDA 2RJDA 2BE9B 3M59A 4CC2A 3HRSA 1IGQA 1YIJA 2BZYA 2RK1A 1PHTA 3CCQQ 1GCPA 4PK4A 2MAMA 3VV0A 4A53A 3JCMW 1YJ9T 2XDPA 2RO0A 1K9MR 3MEWA 3NTIA 3M0PA 3QWYA 2LCLA 2RA2A 3PVLA 2EPDA 1BU1A 5GAMf 3CCRQ 5GAMh 2LX9A 4M77A 4M78B 3VS2A 1M8VA 1SHFA 4JRIA 4Z88A 2RQTA 3KUFA 4KUIA 4E6RA 4C5GA 3WVEB 4BI8B 4C5EA 1LOJA 1TUDA 1UE9A 2LC4A 3L2UA 2A0FB 3HTRA 3INZA 2KT8A 2ZPFB 1QVFS 2COWA 1XOVA 1RAFB 3X25B 2K2MA 3PMIA 3LW5E 3GPLA 2K5FA 1G3YA 4EMHA 1ZBJA 2DZCA 3CC2A 4JJCA 3OYKA 5GAOq 3SDZA 3CD6T 4M7DG 3GOXA 5KYXB 3MEVA 1VQ4Q 1WYXA 3NPFA 4RTXA 4M77C 2EJGA 1MMDA 4OGEA 3OSVA 2DPPB 3VS6A 4K11A 2O01E 2JNGA 4FCYA 1LNXA 4PLLA 5LJ3f 5LJ3h 2FPDA 1RLQC 5I2MA 1KQSS 4KGXB 2LP5A 4C8QA 4RG8A 1KQSP 1R0CB 1VQKA 1N5ZA 1YI2Q 2DVJA 4PNOA 3OYBA 1SEMA 4Y92A 2XDDA 3A8OB 1GBRA 2P4TA 1UB4A 1RADB 4J6YA 2RQVA 4OMMA 4ZTFA 2X4JA 1FYNA 2MWOA 4MZPA 2DLPA 3SB2A 4CI0C 3VRYA 3A98A 4M78D 4LUDA 2WSFE 3E1SA 1ARKA 5GANf 3X20B 5GANh 5EC7A 3MCAB 2NUTB 2KYBA 4XTYA 2RHXA 2RHYA 3CC4Q 4MDXA 4OP0A 4BY6C 1GCQA 3A8HB 1Q82U 2RQRA 4AFUC 2E10A 1H92A 1UHFA 5CO7A 2YDLA 1D1BA 4E7KA 2DAQA 5L23A 1VYUA 2P0QA 1S72A 4BDYA 3JSCA 1YIJT 1C0MA 4XU1A 1W6XA 2E65A 2X9HA 1B7TA 3D7SB 5J3BA 4C92E 2ZCFB 3CCJA 2FEIA 4IURA 1IHWA 2L3QA 3NTKA 5CAIA 2VUBA 3SFMA 2YRDA 3EAEA 2LRQA 2FHDA 3EG0A 2YUOA 4A4EA 3OS5A 2PQWA 2LQKA 2DL8A 1K8AU 3OQ5A 4RTVA 1B34B 1Q86U 4PJOA 2J6KA 4AFQC 3BDLA 2WSEE 3CMAQ 4M78G 2D1XA 2ENMA 2FRYA 1I4K1 2F69A 1SSHA 1D09B 4ZGEB 2RJEA 3JCMe 2FL7A 2M02A 3G71Q 1JXOA 2Y4YA 2I2LA 3M9QA 2EYWA 1YP5A 3CC2T 3UATA 1J3TA 4HCKA 5C6SA 1RAEB 1Y71A 3FEOA 2KMTA 1ZA1B 2ESWA 3CQTA 1KD1C 5D6WA 1M5Q1 1YCSB 2FVUA 4HXJA 3RNJA 4Z89A 1OULA 1WHGA 3R6OA 1V29B 2LMJA 1H8KA 2PZ1A 4FW1A 2CREA 2E5QA 3ER0A 3QIIA 3OYYA 2KE9A 3RKYA 2CZ0B 4CC4B 2HBWA 2AT1B 4A4FA 2DF6A 5KH6A 5C0MA 3JCMQ 3QXEB 3TU4K 5ECAA 2DILA 1VQKT 4GLMA 2DBKA 2PU9B 4DBFA 4JPBW 3L2WA 2RMOA 2PUKB 4TVRA 2XK0A 2JTEA 4A63B 4BDZA 1VIEA 1D1CA 2IVWA 3CCUA 5LJ5j 4YTLA 4ANJA 1AD5A 2OAUA 4M7DF 3E9FA 2CH4A 5CKFA 3VUBA 3ZEHA 2OJ2A 2LQWA 3TSZA 5GMKl 3GF5A 2KAFA 4JRPA 1SG5A 2E4HA 1N9RA 3LX7A 3RDVA 2RJFA 2KXDA 2XICA 2YRVA 2YXYA 1HYOA 2V1QA 3C94A 3HKSA 4PJJA 5KYWA 1M27C 3X26B 2KRNA 2LJ1A 4VUBA 3KXTA 1UGSB 4RCCA 1Y0MA 4LDWA 1AOJA 2DRKA 1RACB 3OS0A 3QPHA 2FZCB 1BCOA 2JTMA 4ELZC 1VQ8T 3X28B 3A5ZB 4HVVA 5IT9E 3IQLA 1YJ9Q 1LVKA 1CSKA 5GJVB 1KFZA 1ZSZA 4XTUA 2E12A 2QEXA 5KYYB 2D9TA 2DXCA 1ZUYA 1NEBA 5FWBA 3V8JA 3CCJT 4JZ3A 2FO0A 2IPOB 3URGA 3FJPA 1UDLA 3O8VA 1PWTA 2DO3A 3VS5A 2QDLA 1M1KR 4XAXB 4LDXA 1HSQA 2M16A 3RIRA 1TH7A 2ZPBB 1Q82C 4F14A 4JJNK 4OB1B 4C92B 4E47A 2R5AA 1JO8A 2RQUA 1M2VB 2JXBA 1WGSA 5DY9A 4OB2B 1ZSZC 3H0IA 3FDRA 2OAWA 3CD6Q 2HSEB 5DLQE 3META 3C12A 3G4SA 5IHNA 3OMCA 1OZ2A 4DBRA 4FSXA 5A0GA 1WHKA 4Y91A 1PKSA 2JVVA 1Y96B 4QT7A 1WXBA 2DMOA 2AIRB 1VQ7A 2KDSA 1YWPA 2CP3A 1WXUA 3BY7A 1I07A 5IXBA 1AZEA 1SSFA 3RMQA 1X6GA 4M78F 4B9WA 4J9CA 2EKOA 3VJPA 1K9MU 1K73R 3UWNA 2L5QA 2HD0A 2YLCA 3CC7T 2EQUA 3A1PA 2IIMA 4O5VA 1F1BB 4A54A 1VQ5A 2KR3A 3EG1A 1W4SA 1I5LA 2CZ6B 3QBYA 3CCUT 1AWWA 2AHJB 4XU0A 3M58A 2F2WA 3NHNA 4BACA 2MMPA 5LL6S 2HQEA 1UEBA 3BDUA 2DTIA 2V26A 2W10A 2DERA 1EIFA 2CZ7B 1YWOA 8AT1B 4A4GA 1NLPC 4C92D 1W2BP 2ZAEA 2W0ZA 4KGZB 1D0YA 2F2VA 1M90R 1IZ6A 3BE3A 1FMVA 1YHQA 1RAGB 1WQWA 1YIJQ 2XD0A 4NS5A 4M7AC 1KC8R 1VQLA 2CUBA 2DRMA 1MNEA 2GGRA 3MPUB 4BI4A 4E7LA 1FX7A 2YWWA 4JLGA 2QEXT 1EX4A 4LN2A 3TCJA 1AT1B 3VS7A 4HCZA 2EYQA 1NYFA 1QP2A 2K57A 5I2SA 3I56A 3GNFB 1NZ9A 1UHCA 3M4YA 5LJ5f 2CH4W 1LCKA 5GMKi 5LJ5h 1RAAB 2LJ0A 4ZN3A 1YITT 1FXXA 1Q81C 5L8RE 5CCAA 2DX1A 4PKCC 1KG1A 4JJDA 4RMOA 2VASA 3BW1A 5GAN4 3NMZC 1NPPA 5KCHA 3S3NA 5CIUA 3AT1B 4M7AE 4FW2A 1X75C 4ATOA 3CC2Q 4N4GA 1M1GA 1WXTA 4C92G 2CP6A 2JTFA 4M75C 2DKGA 1Q7YR 3L1AA 2EKHA 3G4ST 4GY5A 4BD3A 3TREA 2L3PA 3M0RA 3VS0A 5GAN5 2X35A 1TU0B 1VQ7T 1RI0A 3QKJA 8ATCB 4FYYB 5J26A 1QP3A 4QW2A 4NL2A 3I9QA 4X9CA 1I1JA 5IH2A 3THKA 3L2RA 3PIOA 2YLBA 5IHKA 1VQKQ 3NTHA 1FMKA 2DJQA 1VA7A 3MEAA 2KEAA 1K1ZA 4OF1A 3RERA 2A08A 3QHSA 3H9NA 4IUQA 5FU7B 2EYXA 3LLRA 2ABLA 3EH1A 3TVTA 2YRCA 1KJWA 3HP9A 1VQ5T 1GRIA 2EQKA 4HVWA 4M75E 2JZ2A 2GTJA 1MV0B 2CP7A 4AT1B 5AYFA 5CK9A 2AK5A 1U5SA 2DA9A 2OTLA 5KYUB 2DM1A 1ACMB 2EIFA 2AKKA 1BB9A 1M4ZA 3CBPA 1GXIE 1BYMA 3GLXA 1VQ8Q 4C5IA 1YHQT 7AT1B 4FYWB 5KE2A 3ZL7C 1VQLT 4ORZA 2E3IA 2DE0X 1W1FA 2IG0A 2DXTA 4GLKA 4LNPA 4IUUA 2LDMA 3P8HA 2L3SA 4F04B 3CCJQ 1JBMA 1QCNA 2LVMA 1X6OA 3RMSA 3E19A 5KYYA 1QVFP 2P4RA 2DL4A 5HK0A 3FLGA 1UTIA 4LUEA 3I56T 1D3BA 3JCMb 1K0SA 4OGCA 2YSQA 2X4XA 2ED1A 5KCOA 3H6ZA 4QVZA 1RI9A 2CT3A 2RHUA 4DOWA 1T0HA 4JZ4A 4F7UE 2SEMA 1WHLA 1IO6A 2O9VA 2DD4A 3KBGA 1N27A 3M0UA 2VV5A 1OOTA 1BCMA 1G3WA 4J9IA 1XNIA 3M57A 4FT2A 1NJIU 1AWJA 4IIMA 2ED0A 3EFSA 3S6WA 2QQAA 4RCBA 2PVGB 1N8RC 2HNIA 4RUGA 2HBPA 2RNAA 2CT4A 2DYBA 2J06A 3DLLA 3V7CA 3OW2S 1KIKA 3OW2P 4M4ZA 1GL5A 1OPLA 1BI1A 3O5ZA 3SWNB 3JB9H 2KY9A 2H3EB 4AMCA 4UC4A 3EFOA 2ECZA 4M7AB 4RTYA 5AT1B 3H0HA 3CPWA 3CCLA 1SHGA 1OU9A 4RTWA 2ATCB 4XTWA 1QQJA 5FLXE 1AZGB 3CC7Q 5GAOm 1VQ9A 4M77E 2A28A 2O88A 1G3SA 2HL3A 4RTUA 2J6OA 3OYCA 2WACA 5D6XA 2EQJA 2HQXA 3M0SA 4C92F 4C8QC 2VXEA 2VKNA 2CGHA 5IN1A 2E6NA 4EMKB 3M5AA 3JB9D 3MHXA 1WHJA 2XU8A 3UPUA 5GMKe 1OQKA 1MNDA 3C95A 2OTLT 2KQWA 2RH2A 5GMKm 2RF0A 4FT4A 1O75A 2NUPB 5GAMd 1E7OA 4J9HA 5FU6B 1OEBA 3OYDA 4WF2A 1RL2A 2NLUA 1GCQC 3LGLA 5HCKA 3TEEA 1HJDA 2QEXQ 2L89A 2QGFB 5A2QE 4O6JA 1MHNA 3OYNA 3QUIA 1ZLMA 4C8QE 2B8AA 3I55A 1AWXA 3HHTB 1TOVA 2O4XA 1G8XA 4FYXB 1YITQ 1NM7A 4M7DA 2DL5A 5I21A 3EGDB 4PLIA 2FG0A 4LXCA 3JCMg 5GAN8 2PVDB 1K73U 1TUGB 2FZKB 3PTAA 2HKQB 4XK8E 1YNZA 1KD1R 1NPRA 1VQOA 1E6GA 3A8MB 3JB9G 2COYA 1IGUA 1QCFA 2C0OA 3M0TA 4J6WA 1JU5C 3CPWS 3CPWP 2JT4A 3QJYA 1RLPC 2O2OA 4F16A 4NL3A 3LWIA 3H41A 4PJOC 1SKUB 3UA6A 1SRMA 3EG2A 5LJ3d 1PC0A 3QSUA 3JCMf 5I11A 2GBQA 2OTJA 2VVKA 3G4SQ 2JS2A 3E2UA 4F7UB 5FRMA 2L0AA 2AZSA 2EFIA 2QQSA 1OPKA 3LH0A 1HD3A 2J7IA 1VQ7Q 1ZUKA 1UGRB 1WHMA 4X9DA 1M90U 2YUPA 4HKEA 2FB7A 1QVGA 4PJNA 2ZPHB 2A7YA 4J9FA 3RESA 5IAYA 2ROLA 2HKNA 2BZ8A 4KBMB 4IUPA 2KSSA 2QTXA 5GANd 3CCLT 1PG5B 1VQMA 1H3ZA 1TUCA 1SPKA 1JQQA 1VQ9T 4M7AG 3I5SA 2DYIA 1NJIC 5FROA 2LCCA 1I5OB 3CCEA 3AHUA 1UGPB 1EFNA 3A8GB 3EG9B 1VQ5Q 4PJOE 1K4US 1NG2A 5CQXA 3EGUA 2LNVA 5CKEA 4A4KA 1JB0E 5IHIA 1HXDA 1D0XA 4ZTJA 4AFZC 1S72T 2HCKA 2JM9A 3JAME 2LT4A 1B3QA 1UJYA 2V1RA 4M77B 4PFPA 9ATCB 2DNUA 2L3RA 3M53A 4XU3A 5GAN3 1XJWB 2KYMA 3REBB 1YHQQ 3LH5A 1BK2A 2Y90A 1VQLQ 3V8KA 1VQNA 1Q7YU 1WJRA 1MGQA 2KROA 3M0QA 3HSBA 4M78A 1N6AA 1IB8A 4FYVB 1Q82R 1WIEA 3PMTA 2D0QB 1OV3A 2NYSA 4BE1A 4M75G 3JCMX 1YJWA 2CYZB 4KUDK 1OI1A 3X24B 1S1NA 2GQIA 4MZTA 1DJ7B 3I56Q 2JM8A 3I55T 1RAIB 1M3BA 2JOYA 5DM7R 1M1FA 1BKBA 5FW9A 1ZA2B 3S3MA 2D8HA 2EVRA 4BY6B 5KYXA 1JEGA 1ZBXA 5CKBA 3UT1A 2EBPA 1UFFA 1VQOT 2EJFA 6AT1B 2F5TX 1M3CA 1IREB 4C8QB 2X3WD 2JN0A 4M78C 4Z02A 2E3HA 2BTTA 1K8AC 1AEYA 1K76A 2EQIA 1Q86C 3CXCA 4JLIA 2P0KA 2RHIA 4Y28E 2RN8A 2VGNA 1Y07A 2OTJT 4JDSA 4M77D 2QA4A 4OB0B 4KH1B 4LD9K 2CP5A 2K79A 4OMNA 3OYIA 4MDWA 4F7UG 3SWNA 1WLPB 1XTDA 1K9AA 4XU2A 2EYYA 1KK7A 1K73C 2HDAA 3QYHB 1ZHIA 1QCOA 4J7FA 4ELYC 1VQMT 2DETA 3JB9F 1NE8A 2HL5C 3M4GA 1ZQ1A 2M51A 1O9SA 4A4HA 2NUTA 5J39A 4EPCA 5HKCA 3QDFA 2D8JA 2R58A 4D8DA 3CCET 3VYHB 2C0IA 2JMCA 3OYAA 1RABB 2B86A 3OY9A 4J5YA 3CCSA 1WX6A 3SD4A 4EMKA 1Z9ZA 2BZXA 2OTLQ 4DEYA 2RI5A 4HVUA 4ZNXA 1M90C 3TQ7P 3RBBB 4BB7A 4C8QD 1X2KA 1R77A 3DLMA 3PVQA 4PJOB 2K3YA 4M77G 1ABQA 4J9DA 1PD0A 2LX7A 4V2SA 2K4YA 1Q81R 1VQNT 3PGGA 2MF2A 2KNBB 2EYZA 1QWFA 4FIBA 3VYGA 2FZGB 2RJCA 3VS1A 4E7SA 4BE0A 1OX9A 1B34A 1Y57A 1PM3A 3L42A 2SRCA 3OYFA 2E6ZA 1YJWT 3PT9A 5D6YA 2BKDN 4AFSC 1JRIA 1MMAA 4QVDA 1VQ6A 3LWHA 1TTHB 3EFRA 1TXQA 2X51A 4N4IA 5KE3A 1GBQA 2AKLA 2KI7A 2F5KA 1JXMA 4Q5WA 4MMKA 1A0NB 3HRTA 3FRNA 4P5NA 1U8RA 1WPYA 3C4SA 2RI3A 1TG0A 4E2FB 4QVCA 1C1AA 2QG9B 2M0OA 1Q7YC 5GAN2 3CCVA 2KXCA 4MZMA 2XG8D 3SEMA 2QAZA 3OYEA 5CKHA 4C8QG 1WA7A 4KT0E 4IUTA 3PNWC 2VWFA 1SF9A 4R0KA 2FYKA 1C6VX 3M56A 2I0NA 4R56A 2QA4T 1WHHA 4C0ZA 5GMKj 2GFAA 1EZZB 4J9BA 3QO3A 2CZ1B 2MOXA 2L2PA 4PJOD 1U1TA 2M9UA 1N9SA 3CCLQ 3CCMA 3CPFA 1R0BG 5DLOA 3OYGA 5GAMe 1PKTA 1I81A 1OX8A 2XI9A 3OYHA 2FPFA 3P8DA 1VIFA 4BUGA 5GAMg 2JMAA 1JJ2A 4D6WA 2GNCA 3BFMA 1ZSZB 3EG9A 1GFDA 2CUDA 5CR2A 2K5LA 3NFCA 1S72Q 3M55A 3JCMc 1K9MC 3CMEA 2YT6A 2EGEA 2PVOB 3CCST 3JCMV 1KD1U 2RM4A 1WJSA 4F7UF 4PFZA 1X43A 2JUFA 3HPWA 4FSSA 4CC3A 2VXFA 3OBWA 5EG2A 1M9SA 3JB9I 5A0LA 1ZUUA 4BI3A 5LJ5d 1PRMC 3DKMA 3QZ9B 1VYTA 2O31A 2HSPA 2A37A 4Z8AA 2AZVA 1BI2A 2ZZDA 5M9OA 1VQPA 4PJOG 3G6EA 2QQ9A 3LYIA 5LJ3e 1YFNA 1CKBA 3OS2A 2EWNA 4II1A 1V1CA 3I55Q 1LJOA 1WI7A 1B07A 2XMFA 4HA8A 2X4YA 4KH0B 4IUVA 4ESRA 1G2BA 4XTZA 4C92A 2J05A 5LJ3g 3PIPA 1UGVA 4HCBA 1VQ6T 1M2VA 2MIOA 1N8RR 4NOYA 4OB3B 2XDBA 3JV3A 2E64A 1IHVA 4PL6A 2KBTA 3MP6A 5GANe 3OB9A 2EGCA 1VQOQ 1BI0A 2R57A 3FC3A 2VB6A 3REAB 4DBQA 2V8JA 4M77F 3P8BB 2LQNA 2DL3A 1Y96A 5GANg 1M2OA 3WXMB 3CCVT 3UF4A 2OTJQ 3JB9J 5IXFA 1YJNA 1BBZA 4DBHA 4C92C 2O9SA 4RKUE 1T0JA 2DTOA 1JJ2S 1JJ2P 2YUNA 4AG2C 2MWPA 2D6FA 3T9NA 5HK3A 5GAOn 1NLOC 2V8IA 5A0DA 3CCUQ 2DJZA 1CKAA 2K6DA 4RTTA 3GNGA 3EGXB 1M1KU 3CCQA 2JS0A 4J6XA 3JCMJ 3PFSA 2K5IA 2NWMA 3CCMT 1VQMQ 1IXDA 1E6HA 3L2VA 5FRNA 1PSEA 4E7IA 2HEQA 1YCYA 2EAYA 4X34A 2PUOB 2RPNA 1WZOA 3CCEQ 1ZSGA 3CCRA 1VQ8A 4ZGDB 1G83A 2CDTA 1UGQB 4XQ3A 3QJ6A 2X4WA 2L8DA 3EH2A 1WDXA 5CVIA 4C8QF 5CKDA 1HK9A 4CC7A 2Y4XA 4M75B 1YBYA 4LE9A 2P0PA 3CMET 3E9GA 3J80E 4BE2A 1MMGA 3OMGA 3R6NA 4QQDA 3RKXA 4DA4A 1QKXA 3MP1A 4C0DC 2P84A 5GMKh 2PTKA 1X6BA 3VU3C 3CEYA 4M7AD 3EHRA 1ZX6A 1PSFA 1VQNQ 2FPEA 3HL8A 1PD1A 3WVDB 3MO8A 2BUDA 4QKUA 1VQ4A 4LDVA 3ASKA 4QQ6A 4X1VA 3V7SA 1QMCA 2X3XD 1VQPT 3G6ET 1YJWQ 1H641 2DEQA 1Q95G 1VYVA 4QQGA 2JW4A 2LZ6B 2RQWA 4OMOA 4L5GA 2V8KA 2PNIA 2H8HA 2FRWA 3UDCA 1YI2A 3ME9A 4L59A 3H8ZA 1MMNA 2QGGA 3JCMh 2CS7A 1OYXA 4ZGJB 2GQVA 1U06A 2C0TA 4L6V5 4WTOB 2M1HA 4EDUA 1RAHB 1Z9QA 4M7DC 5GAOl 2MYSA 2LJ3A 4E7HA 3QWXX 3ZFJA 1KC8U 1VOMA 4M75D 3CC7A 2A36A 2KT1A 4PJOF 1BIBA 3CC4A 3JRZA 4EIKA 4IIOA 1QW1A 1YJNT 2QA4Q 1OU8A 3DB3A 2K3XA 2H3JA 1NJIR 2MK5A 2OI3A 4HT8A 2KRMA
chains in the Genus database with same CATH topology
1YFNA 2QASA 1ZSZA 1ZSZC 1ZSZB 1TWBA 1OX8A 2NYSA 1OULA 1OU8A 1OU9A 1OX9A 2QAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFN A;  2QAS A;  1ZSZ A;  1ZSZ C;  1ZSZ B;  1TWB A;  1OX8 A;  2NYS A;  1OUL A;  1OU8 A;  1OU9 A;  1OX9 A;  2QAZ A; 
#chains in the Genus database with same CATH topology
 4D8K A;  1AVZ C;  5GAO p;  5FWC A;  1W70 A;  3CCQ T;  1ABO A;  4DOV A;  1Q81 U;  4GBQ A;  2K3B A;  4OML A;  3VS3 A;  4JS4 A;  4HCC A;  4M7D E;  4PJL A;  4JS5 A;  2KGT A;  2MCN A;  2HAX A;  2J6F A;  4FU6 A;  5CQY A;  3SHW A;  2HMA A;  5KYU A;  1X69 A;  1OZ3 A;  2K2V A;  3CCR T;  1UUE A;  4EMG A;  3OS1 A;  3CBO A;  4CRI A;  2LTO A;  2MI6 A;  3H0F A;  2GFU A;  2LQ8 A;  4E7J A;  3CCS Q;  1M3A A;  3CMA A;  3VS4 A;  2QK0 A;  4LDU A;  2M0Y A;  1M8M A;  2CP2 A;  1G5V A;  4WCI A;  3TSW A;  1W2B A;  2DXU A;  1D3B B;  3HFN A;  5FU7 C;  3FIF A;  4C0G A;  5D7U A;  2VYT A;  4J83 A;  3G71 A;  1M1K C;  1YIT A;  4LD6 A;  3A8L B;  1T3S A;  4FL6 A;  2A3L A;  1KHI A;  4RG2 A;  1D1A A;  2CKK A;  4F17 A;  1FWZ A;  2G6F X;  4RTZ A;  4PFO A;  4B9X A;  1PCX A;  3GIB A;  2YUQ A;  2BIV A;  3NGP A;  2NUZ A;  3RR6 A;  3F70 A;  1VQ4 T;  2QAS A;  2CP0 A;  2HZY A;  2COZ A;  1KHC A;  1QVG S;  1QVG P;  2VC8 A;  2BE7 D;  2QQB A;  1U3O A;  2K9G A;  1MV3 A;  1VQ6 Q;  2RI2 A;  3MEU A;  3ULR B;  1I8F A;  2GTO A;  5GAN 6;  2EGA A;  2DIG A;  1K8A R;  3JCM d;  1Q86 R;  1R8O B;  1YI2 T;  3KFV A;  2KVQ G;  4ME7 A;  2D0N A;  1TS9 A;  4PJM A;  3EFO B;  4MML A;  1QWE A;  2JJ9 A;  2QXF A;  5GAM j;  4JRK A;  2EW3 A;  3QDR B;  4J9E A;  2ZPG B;  2RD1 A;  3J7A F;  3L2Z A;  1AWO A;  1UEC A;  1K0X A;  2RB6 A;  3MP8 A;  2DEU A;  2QDY B;  3GP8 A;  4N0A A;  3J81 E;  3CCV Q;  2DFU A;  4C0F A;  2MPX C;  2CSI A;  1X01 A;  1T3L A;  3Q1J A;  1QLY A;  4M7A A;  1H3H A;  2ROT A;  4R55 A;  1NEG A;  1Y7X A;  3CC4 T;  3G7Z A;  4AG1 C;  3CBM A;  4ZN1 A;  3L2Q A;  3UA7 A;  4DQ2 A;  3LGF A;  4M78 E;  4C0D B;  2E1H A;  2QI2 A;  3MJX A;  2G3R A;  3I35 A;  1QKW A;  3VRZ A;  4JUV A;  2ZPE B;  3EHQ A;  3CCM Q;  3VKI A;  3HFO A;  1YJ9 A;  1D0Z A;  3U23 A;  3EGX A;  2DL7 A;  1P92 A;  1W2B S;  1FMW A;  3V7R A;  1U1S A;  5LJ5 e;  2XHC A;  3QYG B;  3N5B B;  2CSQ A;  2GCX A;  2DZ9 A;  3HRU A;  4XTV A;  3OSS C;  1X2Q A;  3QG1 A;  2XKO C;  1TSF A;  2DBM A;  3DB4 A;  3MKD A;  5GAN 7;  3SWN C;  4N0A C;  2YHT A;  3OYJ A;  1GFC A;  1V76 A;  2QQR A;  4OMF B;  2F1L A;  5LJ5 g;  1KC8 C;  2LCS A;  5LJ3 j;  4OVA A;  2VGM A;  2LT1 A;  2K7A A;  1PNJ A;  1NBE B;  1WNL A;  2NUP A;  1N8R U;  3CME Q;  4M7A F;  2R5M A;  2DK3 A;  3I5R A;  4M75 A;  3CMA T;  2HQH A;  2O4X B;  1TWB A;  5GJW B;  3C0C A;  3V8L A;  3RKW A;  4J9G A;  4M7D B;  1MUZ A;  1WJQ A;  3EG3 A;  4IKF A;  2OX7 A;  1KQ2 A;  2QTV A;  3G71 T;  1G3T A;  5GAN j;  1BI3 A;  3FB9 A;  4EMK C;  3CD6 A;  1IRX A;  2GF7 A;  3CXC S;  1UJ0 A;  2QYZ A;  3CXC P;  3JCM P;  4KUL A;  5GAO r;  2E70 A;  5I22 A;  2XID A;  2KK4 A;  3RUX A;  2E5K A;  1KSW A;  4B6M A;  5HY6 A;  3EGD A;  1VUB A;  4XTX A;  1VQP Q;  1I0C A;  3OYM A;  3G6E Q;  1WFW A;  2RHZ A;  2DVE A;  1X27 A;  3S3O A;  4N4H A;  3OYL A;  1QVF A;  5FU6 C;  3M54 A;  5KYN A;  2DXB A;  2ZGW A;  2KRS A;  4KGV B;  2RK2 A;  4HT9 A;  3OBY A;  2DTH A;  1PRL C;  4JRQ A;  2LNH B;  3QZ5 B;  4DEX A;  4M75 F;  1NYG A;  4LDY A;  1LPL A;  1YN8 A;  4OMQ A;  2F2X A;  2DIQ A;  1M30 A;  3PE0 A;  4OMP A;  2EJ9 A;  4F7U A;  4J7I A;  4E7Z A;  2C06 A;  4C5H A;  2Z0W A;  3GBQ A;  1AHJ B;  4JJB A;  3OA6 A;  1SRL A;  1KQ1 A;  3G1J A;  5KYW B;  1BIA A;  3FJ5 A;  2DD5 A;  4FM4 B;  1RUW A;  2EQM A;  1KQS A;  2E41 A;  3VUZ A;  1UG1 A;  1YJN Q;  1VQ9 Q;  2WSC E;  3OW2 A;  4J8O A;  2ZPI B;  1WQ7 A;  1QVP A;  4KRT A;  4M7D D;  1XQH A;  3ZBD A;  2RJD A;  2BE9 B;  3M59 A;  4CC2 A;  3HRS A;  1IGQ A;  1YIJ A;  2BZY A;  2RK1 A;  1PHT A;  3CCQ Q;  1GCP A;  4PK4 A;  2MAM A;  3VV0 A;  4A53 A;  3JCM W;  1YJ9 T;  2XDP A;  2RO0 A;  1K9M R;  3MEW A;  3NTI A;  3M0P A;  3QWY A;  2LCL A;  2RA2 A;  3PVL A;  2EPD A;  1BU1 A;  5GAM f;  3CCR Q;  5GAM h;  2LX9 A;  4M77 A;  4M78 B;  3VS2 A;  1M8V A;  1SHF A;  4JRI A;  4Z88 A;  2RQT A;  3KUF A;  4KUI A;  4E6R A;  4C5G A;  3WVE B;  4BI8 B;  4C5E A;  1LOJ A;  1TUD A;  1UE9 A;  2LC4 A;  3L2U A;  2A0F B;  3HTR A;  3INZ A;  2KT8 A;  2ZPF B;  1QVF S;  2COW A;  1XOV A;  1RAF B;  3X25 B;  2K2M A;  3PMI A;  3LW5 E;  3GPL A;  2K5F A;  1G3Y A;  4EMH A;  1ZBJ A;  2DZC A;  3CC2 A;  4JJC A;  3OYK A;  5GAO q;  3SDZ A;  3CD6 T;  4M7D G;  3GOX A;  5KYX B;  3MEV A;  1VQ4 Q;  1WYX A;  3NPF A;  4RTX A;  4M77 C;  2EJG A;  1MMD A;  4OGE A;  3OSV A;  2DPP B;  3VS6 A;  4K11 A;  2O01 E;  2JNG A;  4FCY A;  1LNX A;  4PLL A;  5LJ3 f;  5LJ3 h;  2FPD A;  1RLQ C;  5I2M A;  1KQS S;  4KGX B;  2LP5 A;  4C8Q A;  4RG8 A;  1KQS P;  1R0C B;  1VQK A;  1N5Z A;  1YI2 Q;  2DVJ A;  4PNO A;  3OYB A;  1SEM A;  4Y92 A;  2XDD A;  3A8O B;  1GBR A;  2P4T A;  1UB4 A;  1RAD B;  4J6Y A;  2RQV A;  4OMM A;  4ZTF A;  2X4J A;  1FYN A;  2MWO A;  4MZP A;  2DLP A;  3SB2 A;  4CI0 C;  3VRY A;  3A98 A;  4M78 D;  4LUD A;  2WSF E;  3E1S A;  1ARK A;  5GAN f;  3X20 B;  5GAN h;  5EC7 A;  3MCA B;  2NUT B;  2KYB A;  4XTY A;  2RHX A;  2RHY A;  3CC4 Q;  4MDX A;  4OP0 A;  4BY6 C;  1GCQ A;  3A8H B;  1Q82 U;  2RQR A;  4AFU C;  2E10 A;  1H92 A;  1UHF A;  5CO7 A;  2YDL A;  1D1B A;  4E7K A;  2DAQ A;  5L23 A;  1VYU A;  2P0Q A;  1S72 A;  4BDY A;  3JSC A;  1YIJ T;  1C0M A;  4XU1 A;  1W6X A;  2E65 A;  2X9H A;  1B7T A;  3D7S B;  5J3B A;  4C92 E;  2ZCF B;  3CCJ A;  2FEI A;  4IUR A;  1IHW A;  2L3Q A;  3NTK A;  5CAI A;  2VUB A;  3SFM A;  2YRD A;  3EAE A;  2LRQ A;  2FHD A;  3EG0 A;  2YUO A;  4A4E A;  3OS5 A;  2PQW A;  2LQK A;  2DL8 A;  1K8A U;  3OQ5 A;  4RTV A;  1B34 B;  1Q86 U;  4PJO A;  2J6K A;  4AFQ C;  3BDL A;  2WSE E;  3CMA Q;  4M78 G;  2D1X A;  2ENM A;  2FRY A;  1I4K 1;  2F69 A;  1SSH A;  1D09 B;  4ZGE B;  2RJE A;  3JCM e;  2FL7 A;  2M02 A;  3G71 Q;  1JXO A;  2Y4Y A;  2I2L A;  3M9Q A;  2EYW A;  1YP5 A;  3CC2 T;  3UAT A;  1J3T A;  4HCK A;  5C6S A;  1RAE B;  1Y71 A;  3FEO A;  2KMT A;  1ZA1 B;  2ESW A;  3CQT A;  1KD1 C;  5D6W A;  1M5Q 1;  1YCS B;  2FVU A;  4HXJ A;  3RNJ A;  4Z89 A;  1OUL A;  1WHG A;  3R6O A;  1V29 B;  2LMJ A;  1H8K A;  2PZ1 A;  4FW1 A;  2CRE A;  2E5Q A;  3ER0 A;  3QII A;  3OYY A;  2KE9 A;  3RKY A;  2CZ0 B;  4CC4 B;  2HBW A;  2AT1 B;  4A4F A;  2DF6 A;  5KH6 A;  5C0M A;  3JCM Q;  3QXE B;  3TU4 K;  5ECA A;  2DIL A;  1VQK T;  4GLM A;  2DBK A;  2PU9 B;  4DBF A;  4JPB W;  3L2W A;  2RMO A;  2PUK B;  4TVR A;  2XK0 A;  2JTE A;  4A63 B;  4BDZ A;  1VIE A;  1D1C A;  2IVW A;  3CCU A;  5LJ5 j;  4YTL A;  4ANJ A;  1AD5 A;  2OAU A;  4M7D F;  3E9F A;  2CH4 A;  5CKF A;  3VUB A;  3ZEH A;  2OJ2 A;  2LQW A;  3TSZ A;  5GMK l;  3GF5 A;  2KAF A;  4JRP A;  1SG5 A;  2E4H A;  1N9R A;  3LX7 A;  3RDV A;  2RJF A;  2KXD A;  2XIC A;  2YRV A;  2YXY A;  1HYO A;  2V1Q A;  3C94 A;  3HKS A;  4PJJ A;  5KYW A;  1M27 C;  3X26 B;  2KRN A;  2LJ1 A;  4VUB A;  3KXT A;  1UGS B;  4RCC A;  1Y0M A;  4LDW A;  1AOJ A;  2DRK A;  1RAC B;  3OS0 A;  3QPH A;  2FZC B;  1BCO A;  2JTM A;  4ELZ C;  1VQ8 T;  3X28 B;  3A5Z B;  4HVV A;  5IT9 E;  3IQL A;  1YJ9 Q;  1LVK A;  1CSK A;  5GJV B;  1KFZ A;  1ZSZ A;  4XTU A;  2E12 A;  2QEX A;  5KYY B;  2D9T A;  2DXC A;  1ZUY A;  1NEB A;  5FWB A;  3V8J A;  3CCJ T;  4JZ3 A;  2FO0 A;  2IPO B;  3URG A;  3FJP A;  1UDL A;  3O8V A;  1PWT A;  2DO3 A;  3VS5 A;  2QDL A;  1M1K R;  4XAX B;  4LDX A;  1HSQ A;  2M16 A;  3RIR A;  1TH7 A;  2ZPB B;  1Q82 C;  4F14 A;  4JJN K;  4OB1 B;  4C92 B;  4E47 A;  2R5A A;  1JO8 A;  2RQU A;  1M2V B;  2JXB A;  1WGS A;  5DY9 A;  4OB2 B;  1ZSZ C;  3H0I A;  3FDR A;  2OAW A;  3CD6 Q;  2HSE B;  5DLQ E;  3MET A;  3C12 A;  3G4S A;  5IHN A;  3OMC A;  1OZ2 A;  4DBR A;  4FSX A;  5A0G A;  1WHK A;  4Y91 A;  1PKS A;  2JVV A;  1Y96 B;  4QT7 A;  1WXB A;  2DMO A;  2AIR B;  1VQ7 A;  2KDS A;  1YWP A;  2CP3 A;  1WXU A;  3BY7 A;  1I07 A;  5IXB A;  1AZE A;  1SSF A;  3RMQ A;  1X6G A;  4M78 F;  4B9W A;  4J9C A;  2EKO A;  3VJP A;  1K9M U;  1K73 R;  3UWN A;  2L5Q A;  2HD0 A;  2YLC A;  3CC7 T;  2EQU A;  3A1P A;  2IIM A;  4O5V A;  1F1B B;  4A54 A;  1VQ5 A;  2KR3 A;  3EG1 A;  1W4S A;  1I5L A;  2CZ6 B;  3QBY A;  3CCU T;  1AWW A;  2AHJ B;  4XU0 A;  3M58 A;  2F2W A;  3NHN A;  4BAC A;  2MMP A;  5LL6 S;  2HQE A;  1UEB A;  3BDU A;  2DTI A;  2V26 A;  2W10 A;  2DER A;  1EIF A;  2CZ7 B;  1YWO A;  8AT1 B;  4A4G A;  1NLP C;  4C92 D;  1W2B P;  2ZAE A;  2W0Z A;  4KGZ B;  1D0Y A;  2F2V A;  1M90 R;  1IZ6 A;  3BE3 A;  1FMV A;  1YHQ A;  1RAG B;  1WQW A;  1YIJ Q;  2XD0 A;  4NS5 A;  4M7A C;  1KC8 R;  1VQL A;  2CUB A;  2DRM A;  1MNE A;  2GGR A;  3MPU B;  4BI4 A;  4E7L A;  1FX7 A;  2YWW A;  4JLG A;  2QEX T;  1EX4 A;  4LN2 A;  3TCJ A;  1AT1 B;  3VS7 A;  4HCZ A;  2EYQ A;  1NYF A;  1QP2 A;  2K57 A;  5I2S A;  3I56 A;  3GNF B;  1NZ9 A;  1UHC A;  3M4Y A;  5LJ5 f;  2CH4 W;  1LCK A;  5GMK i;  5LJ5 h;  1RAA B;  2LJ0 A;  4ZN3 A;  1YIT T;  1FXX A;  1Q81 C;  5L8R E;  5CCA A;  2DX1 A;  4PKC C;  1KG1 A;  4JJD A;  4RMO A;  2VAS A;  3BW1 A;  5GAN 4;  3NMZ C;  1NPP A;  5KCH A;  3S3N A;  5CIU A;  3AT1 B;  4M7A E;  4FW2 A;  1X75 C;  4ATO A;  3CC2 Q;  4N4G A;  1M1G A;  1WXT A;  4C92 G;  2CP6 A;  2JTF A;  4M75 C;  2DKG A;  1Q7Y R;  3L1A A;  2EKH A;  3G4S T;  4GY5 A;  4BD3 A;  3TRE A;  2L3P A;  3M0R A;  3VS0 A;  5GAN 5;  2X35 A;  1TU0 B;  1VQ7 T;  1RI0 A;  3QKJ A;  8ATC B;  4FYY B;  5J26 A;  1QP3 A;  4QW2 A;  4NL2 A;  3I9Q A;  4X9C A;  1I1J A;  5IH2 A;  3THK A;  3L2R A;  3PIO A;  2YLB A;  5IHK A;  1VQK Q;  3NTH A;  1FMK A;  2DJQ A;  1VA7 A;  3MEA A;  2KEA A;  1K1Z A;  4OF1 A;  3RER A;  2A08 A;  3QHS A;  3H9N A;  4IUQ A;  5FU7 B;  2EYX A;  3LLR A;  2ABL A;  3EH1 A;  3TVT A;  2YRC A;  1KJW A;  3HP9 A;  1VQ5 T;  1GRI A;  2EQK A;  4HVW A;  4M75 E;  2JZ2 A;  2GTJ A;  1MV0 B;  2CP7 A;  4AT1 B;  5AYF A;  5CK9 A;  2AK5 A;  1U5S A;  2DA9 A;  2OTL A;  5KYU B;  2DM1 A;  1ACM B;  2EIF A;  2AKK A;  1BB9 A;  1M4Z A;  3CBP A;  1GXI E;  1BYM A;  3GLX A;  1VQ8 Q;  4C5I A;  1YHQ T;  7AT1 B;  4FYW B;  5KE2 A;  3ZL7 C;  1VQL T;  4ORZ A;  2E3I A;  2DE0 X;  1W1F A;  2IG0 A;  2DXT A;  4GLK A;  4LNP A;  4IUU A;  2LDM A;  3P8H A;  2L3S A;  4F04 B;  3CCJ Q;  1JBM A;  1QCN A;  2LVM A;  1X6O A;  3RMS A;  3E19 A;  5KYY A;  1QVF P;  2P4R A;  2DL4 A;  5HK0 A;  3FLG A;  1UTI A;  4LUE A;  3I56 T;  1D3B A;  3JCM b;  1K0S A;  4OGC A;  2YSQ A;  2X4X A;  2ED1 A;  5KCO A;  3H6Z A;  4QVZ A;  1RI9 A;  2CT3 A;  2RHU A;  4DOW A;  1T0H A;  4JZ4 A;  4F7U E;  2SEM A;  1WHL A;  1IO6 A;  2O9V A;  2DD4 A;  3KBG A;  1N27 A;  3M0U A;  2VV5 A;  1OOT A;  1BCM A;  1G3W A;  4J9I A;  1XNI A;  3M57 A;  4FT2 A;  1NJI U;  1AWJ A;  4IIM A;  2ED0 A;  3EFS A;  3S6W A;  2QQA A;  4RCB A;  2PVG B;  1N8R C;  2HNI A;  4RUG A;  2HBP A;  2RNA A;  2CT4 A;  2DYB A;  2J06 A;  3DLL A;  3V7C A;  3OW2 S;  1KIK A;  3OW2 P;  4M4Z A;  1GL5 A;  1OPL A;  1BI1 A;  3O5Z A;  3SWN B;  3JB9 H;  2KY9 A;  2H3E B;  4AMC A;  4UC4 A;  3EFO A;  2ECZ A;  4M7A B;  4RTY A;  5AT1 B;  3H0H A;  3CPW A;  3CCL A;  1SHG A;  1OU9 A;  4RTW A;  2ATC B;  4XTW A;  1QQJ A;  5FLX E;  1AZG B;  3CC7 Q;  5GAO m;  1VQ9 A;  4M77 E;  2A28 A;  2O88 A;  1G3S A;  2HL3 A;  4RTU A;  2J6O A;  3OYC A;  2WAC A;  5D6X A;  2EQJ A;  2HQX A;  3M0S A;  4C92 F;  4C8Q C;  2VXE A;  2VKN A;  2CGH A;  5IN1 A;  2E6N A;  4EMK B;  3M5A A;  3JB9 D;  3MHX A;  1WHJ A;  2XU8 A;  3UPU A;  5GMK e;  1OQK A;  1MND A;  3C95 A;  2OTL T;  2KQW A;  2RH2 A;  5GMK m;  2RF0 A;  4FT4 A;  1O75 A;  2NUP B;  5GAM d;  1E7O A;  4J9H A;  5FU6 B;  1OEB A;  3OYD A;  4WF2 A;  1RL2 A;  2NLU A;  1GCQ C;  3LGL A;  5HCK A;  3TEE A;  1HJD A;  2QEX Q;  2L89 A;  2QGF B;  5A2Q E;  4O6J A;  1MHN A;  3OYN A;  3QUI A;  1ZLM A;  4C8Q E;  2B8A A;  3I55 A;  1AWX A;  3HHT B;  1TOV A;  2O4X A;  1G8X A;  4FYX B;  1YIT Q;  1NM7 A;  4M7D A;  2DL5 A;  5I21 A;  3EGD B;  4PLI A;  2FG0 A;  4LXC A;  3JCM g;  5GAN 8;  2PVD B;  1K73 U;  1TUG B;  2FZK B;  3PTA A;  2HKQ B;  4XK8 E;  1YNZ A;  1KD1 R;  1NPR A;  1VQO A;  1E6G A;  3A8M B;  3JB9 G;  2COY A;  1IGU A;  1QCF A;  2C0O A;  3M0T A;  4J6W A;  1JU5 C;  3CPW S;  3CPW P;  2JT4 A;  3QJY A;  1RLP C;  2O2O A;  4F16 A;  4NL3 A;  3LWI A;  3H41 A;  4PJO C;  1SKU B;  3UA6 A;  1SRM A;  3EG2 A;  5LJ3 d;  1PC0 A;  3QSU A;  3JCM f;  5I11 A;  2GBQ A;  2OTJ A;  2VVK A;  3G4S Q;  2JS2 A;  3E2U A;  4F7U B;  5FRM A;  2L0A A;  2AZS A;  2EFI A;  2QQS A;  1OPK A;  3LH0 A;  1HD3 A;  2J7I A;  1VQ7 Q;  1ZUK A;  1UGR B;  1WHM A;  4X9D A;  1M90 U;  2YUP A;  4HKE A;  2FB7 A;  1QVG A;  4PJN A;  2ZPH B;  2A7Y A;  4J9F A;  3RES A;  5IAY A;  2ROL A;  2HKN A;  2BZ8 A;  4KBM B;  4IUP A;  2KSS A;  2QTX A;  5GAN d;  3CCL T;  1PG5 B;  1VQM A;  1H3Z A;  1TUC A;  1SPK A;  1JQQ A;  1VQ9 T;  4M7A G;  3I5S A;  2DYI A;  1NJI C;  5FRO A;  2LCC A;  1I5O B;  3CCE A;  3AHU A;  1UGP B;  1EFN A;  3A8G B;  3EG9 B;  1VQ5 Q;  4PJO E;  1K4U S;  1NG2 A;  5CQX A;  3EGU A;  2LNV A;  5CKE A;  4A4K A;  1JB0 E;  5IHI A;  1HXD A;  1D0X A;  4ZTJ A;  4AFZ C;  1S72 T;  2HCK A;  2JM9 A;  3JAM E;  2LT4 A;  1B3Q A;  1UJY A;  2V1R A;  4M77 B;  4PFP A;  9ATC B;  2DNU A;  2L3R A;  3M53 A;  4XU3 A;  5GAN 3;  1XJW B;  2KYM A;  3REB B;  1YHQ Q;  3LH5 A;  1BK2 A;  2Y90 A;  1VQL Q;  3V8K A;  1VQN A;  1Q7Y U;  1WJR A;  1MGQ A;  2KRO A;  3M0Q A;  3HSB A;  4M78 A;  1N6A A;  1IB8 A;  4FYV B;  1Q82 R;  1WIE A;  3PMT A;  2D0Q B;  1OV3 A;  2NYS A;  4BE1 A;  4M75 G;  3JCM X;  1YJW A;  2CYZ B;  4KUD K;  1OI1 A;  3X24 B;  1S1N A;  2GQI A;  4MZT A;  1DJ7 B;  3I56 Q;  2JM8 A;  3I55 T;  1RAI B;  1M3B A;  2JOY A;  5DM7 R;  1M1F A;  1BKB A;  5FW9 A;  1ZA2 B;  3S3M A;  2D8H A;  2EVR A;  4BY6 B;  5KYX A;  1JEG A;  1ZBX A;  5CKB A;  3UT1 A;  2EBP A;  1UFF A;  1VQO T;  2EJF A;  6AT1 B;  2F5T X;  1M3C A;  1IRE B;  4C8Q B;  2X3W D;  2JN0 A;  4M78 C;  4Z02 A;  2E3H A;  2BTT A;  1K8A C;  1AEY A;  1K76 A;  2EQI A;  1Q86 C;  3CXC A;  4JLI A;  2P0K A;  2RHI A;  4Y28 E;  2RN8 A;  2VGN A;  1Y07 A;  2OTJ T;  4JDS A;  4M77 D;  2QA4 A;  4OB0 B;  4KH1 B;  4LD9 K;  2CP5 A;  2K79 A;  4OMN A;  3OYI A;  4MDW A;  4F7U G;  3SWN A;  1WLP B;  1XTD A;  1K9A A;  4XU2 A;  2EYY A;  1KK7 A;  1K73 C;  2HDA A;  3QYH B;  1ZHI A;  1QCO A;  4J7F A;  4ELY C;  1VQM T;  2DET A;  3JB9 F;  1NE8 A;  2HL5 C;  3M4G A;  1ZQ1 A;  2M51 A;  1O9S A;  4A4H A;  2NUT A;  5J39 A;  4EPC A;  5HKC A;  3QDF A;  2D8J A;  2R58 A;  4D8D A;  3CCE T;  3VYH B;  2C0I A;  2JMC A;  3OYA A;  1RAB B;  2B86 A;  3OY9 A;  4J5Y A;  3CCS A;  1WX6 A;  3SD4 A;  4EMK A;  1Z9Z A;  2BZX A;  2OTL Q;  4DEY A;  2RI5 A;  4HVU A;  4ZNX A;  1M90 C;  3TQ7 P;  3RBB B;  4BB7 A;  4C8Q D;  1X2K A;  1R77 A;  3DLM A;  3PVQ A;  4PJO B;  2K3Y A;  4M77 G;  1ABQ A;  4J9D A;  1PD0 A;  2LX7 A;  4V2S A;  2K4Y A;  1Q81 R;  1VQN T;  3PGG A;  2MF2 A;  2KNB B;  2EYZ A;  1QWF A;  4FIB A;  3VYG A;  2FZG B;  2RJC A;  3VS1 A;  4E7S A;  4BE0 A;  1OX9 A;  1B34 A;  1Y57 A;  1PM3 A;  3L42 A;  2SRC A;  3OYF A;  2E6Z A;  1YJW T;  3PT9 A;  5D6Y A;  2BKD N;  4AFS C;  1JRI A;  1MMA A;  4QVD A;  1VQ6 A;  3LWH A;  1TTH B;  3EFR A;  1TXQ A;  2X51 A;  4N4I A;  5KE3 A;  1GBQ A;  2AKL A;  2KI7 A;  2F5K A;  1JXM A;  4Q5W A;  4MMK A;  1A0N B;  3HRT A;  3FRN A;  4P5N A;  1U8R A;  1WPY A;  3C4S A;  2RI3 A;  1TG0 A;  4E2F B;  4QVC A;  1C1A A;  2QG9 B;  2M0O A;  1Q7Y C;  5GAN 2;  3CCV A;  2KXC A;  4MZM A;  2XG8 D;  3SEM A;  2QAZ A;  3OYE A;  5CKH A;  4C8Q G;  1WA7 A;  4KT0 E;  4IUT A;  3PNW C;  2VWF A;  1SF9 A;  4R0K A;  2FYK A;  1C6V X;  3M56 A;  2I0N A;  4R56 A;  2QA4 T;  1WHH A;  4C0Z A;  5GMK j;  2GFA A;  1EZZ B;  4J9B A;  3QO3 A;  2CZ1 B;  2MOX A;  2L2P A;  4PJO D;  1U1T A;  2M9U A;  1N9S A;  3CCL Q;  3CCM A;  3CPF A;  1R0B G;  5DLO A;  3OYG A;  5GAM e;  1PKT A;  1I81 A;  1OX8 A;  2XI9 A;  3OYH A;  2FPF A;  3P8D A;  1VIF A;  4BUG A;  5GAM g;  2JMA A;  1JJ2 A;  4D6W A;  2GNC A;  3BFM A;  1ZSZ B;  3EG9 A;  1GFD A;  2CUD A;  5CR2 A;  2K5L A;  3NFC A;  1S72 Q;  3M55 A;  3JCM c;  1K9M C;  3CME A;  2YT6 A;  2EGE A;  2PVO B;  3CCS T;  3JCM V;  1KD1 U;  2RM4 A;  1WJS A;  4F7U F;  4PFZ A;  1X43 A;  2JUF A;  3HPW A;  4FSS A;  4CC3 A;  2VXF A;  3OBW A;  5EG2 A;  1M9S A;  3JB9 I;  5A0L A;  1ZUU A;  4BI3 A;  5LJ5 d;  1PRM C;  3DKM A;  3QZ9 B;  1VYT A;  2O31 A;  2HSP A;  2A37 A;  4Z8A A;  2AZV A;  1BI2 A;  2ZZD A;  5M9O A;  1VQP A;  4PJO G;  3G6E A;  2QQ9 A;  3LYI A;  5LJ3 e;  1YFN A;  1CKB A;  3OS2 A;  2EWN A;  4II1 A;  1V1C A;  3I55 Q;  1LJO A;  1WI7 A;  1B07 A;  2XMF A;  4HA8 A;  2X4Y A;  4KH0 B;  4IUV A;  4ESR A;  1G2B A;  4XTZ A;  4C92 A;  2J05 A;  5LJ3 g;  3PIP A;  1UGV A;  4HCB A;  1VQ6 T;  1M2V A;  2MIO A;  1N8R R;  4NOY A;  4OB3 B;  2XDB A;  3JV3 A;  2E64 A;  1IHV A;  4PL6 A;  2KBT A;  3MP6 A;  5GAN e;  3OB9 A;  2EGC A;  1VQO Q;  1BI0 A;  2R57 A;  3FC3 A;  2VB6 A;  3REA B;  4DBQ A;  2V8J A;  4M77 F;  3P8B B;  2LQN A;  2DL3 A;  1Y96 A;  5GAN g;  1M2O A;  3WXM B;  3CCV T;  3UF4 A;  2OTJ Q;  3JB9 J;  5IXF A;  1YJN A;  1BBZ A;  4DBH A;  4C92 C;  2O9S A;  4RKU E;  1T0J A;  2DTO A;  1JJ2 S;  1JJ2 P;  2YUN A;  4AG2 C;  2MWP A;  2D6F A;  3T9N A;  5HK3 A;  5GAO n;  1NLO C;  2V8I A;  5A0D A;  3CCU Q;  2DJZ A;  1CKA A;  2K6D A;  4RTT A;  3GNG A;  3EGX B;  1M1K U;  3CCQ A;  2JS0 A;  4J6X A;  3JCM J;  3PFS A;  2K5I A;  2NWM A;  3CCM T;  1VQM Q;  1IXD A;  1E6H A;  3L2V A;  5FRN A;  1PSE A;  4E7I A;  2HEQ A;  1YCY A;  2EAY A;  4X34 A;  2PUO B;  2RPN A;  1WZO A;  3CCE Q;  1ZSG A;  3CCR A;  1VQ8 A;  4ZGD B;  1G83 A;  2CDT A;  1UGQ B;  4XQ3 A;  3QJ6 A;  2X4W A;  2L8D A;  3EH2 A;  1WDX A;  5CVI A;  4C8Q F;  5CKD A;  1HK9 A;  4CC7 A;  2Y4X A;  4M75 B;  1YBY A;  4LE9 A;  2P0P A;  3CME T;  3E9G A;  3J80 E;  4BE2 A;  1MMG A;  3OMG A;  3R6N A;  4QQD A;  3RKX A;  4DA4 A;  1QKX A;  3MP1 A;  4C0D C;  2P84 A;  5GMK h;  2PTK A;  1X6B A;  3VU3 C;  3CEY A;  4M7A D;  3EHR A;  1ZX6 A;  1PSF A;  1VQN Q;  2FPE A;  3HL8 A;  1PD1 A;  3WVD B;  3MO8 A;  2BUD A;  4QKU A;  1VQ4 A;  4LDV A;  3ASK A;  4QQ6 A;  4X1V A;  3V7S A;  1QMC A;  2X3X D;  1VQP T;  3G6E T;  1YJW Q;  1H64 1;  2DEQ A;  1Q95 G;  1VYV A;  4QQG A;  2JW4 A;  2LZ6 B;  2RQW A;  4OMO A;  4L5G A;  2V8K A;  2PNI A;  2H8H A;  2FRW A;  3UDC A;  1YI2 A;  3ME9 A;  4L59 A;  3H8Z A;  1MMN A;  2QGG A;  3JCM h;  2CS7 A;  1OYX A;  4ZGJ B;  2GQV A;  1U06 A;  2C0T A;  4L6V 5;  4WTO B;  2M1H A;  4EDU A;  1RAH B;  1Z9Q A;  4M7D C;  5GAO l;  2MYS A;  2LJ3 A;  4E7H A;  3QWX X;  3ZFJ A;  1KC8 U;  1VOM A;  4M75 D;  3CC7 A;  2A36 A;  2KT1 A;  4PJO F;  1BIB A;  3CC4 A;  3JRZ A;  4EIK A;  4IIO A;  1QW1 A;  1YJN T;  2QA4 Q;  1OU8 A;  3DB3 A;  2K3X A;  2H3J A;  1NJI R;  2MK5 A;  2OI3 A;  4HT8 A;  2KRM A; 
#chains in the Genus database with same CATH homology
 1YFN A;  2QAS A;  1ZSZ A;  1ZSZ C;  1ZSZ B;  1TWB A;  1OX8 A;  2NYS A;  1OUL A;  1OU8 A;  1OU9 A;  1OX9 A;  2QAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...