1OU9A

Structure of sspb, a aaa+ protease delivery protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYDELNIEPDTEQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou9A00
1OX9A 2NYSA 2QASA 1ZSZB 1OU9A 1TWBA 1ZSZA 2QAZA 1OU8A 1OULA 1OX8A 1YFNA 1ZSZC
chains in the Genus database with same CATH superfamily
2EGEA 1M27C 4CI0C 2A08A 1V29B 4GLMA 3P8DA 3LW5E 4RKUE 1KSWA 3P8BB 3NGPA 2EFIA 1YJWQ 3RKYA 1WQWA 2J6OA 1QKXA 1QVGP 4IKFA 1RAIB 2QQ9A 3CCJT 4J9BA 3V7SA 3V8LA 1IHVA 2LC4A 4C92A 2ZCFB 4A4FA 4C5IA 2DM1A 3M0SA 5CR2A 5A0LA 3GNGA 4JRQA 4NL3A 4AFQC 2KR3A 1OEBA 2CP3A 1UG1A 5D6WA 3WVEB 1K9MC 4DA4A 1MMDA 1M1KU 1QWEA 1X6OA 1UJYA 3A8HB 3NTHA 4IUUA 1I8FA 2DRKA 1LNXA 2K5IA 1CSKA 3QIIA 4RCCA 2VC8A 2O4XB 1BI3A 2AKLA 3TREA 2QTVA 4B6MA 3I55Q 1VQMA 1VQOA 1AOJA 4E7IA 4PFPA 1F1BB 5GAN6 3LWHA 1NZ9A 3VS6A 1ZSZA 1WJQA 4HCCA 2L0AA 5HY6A 3I5RA 1Q7YC 1ZUUA 1K0SA 1G3YA 1KHCA 2EQIA 3I56A 3UA6A 1K9MR 2EKHA 1ZHIA 2EQKA 4BUGA 3EG1A 2FPDA 2LT4A 5KYWB 1EFNA 3SDZA 4BB7A 3RBBB 2FG0A 3M57A 2HAXA 4ZTFA 3TU4K 3CEYA 2R5AA 1PC0A 1K73U 3G71A 3OMGA 2A0FB 4ZN1A 4BI3A 1WQ7A 1QCFA 2DXUA 2HQXA 4ATOA 4EDUA 5CKBA 2EJ9A 3JCMf 1M30A 2L89A 3SEMA 2QG9B 3DB3A 4XTXA 4CC4B 1KD1U 1VQ5T 5J3BA 2D8HA 2QXFA 2DL5A 4LE9A 1M2VA 3CCMT 1Q7YR 1Q82U 2XKOC 3JB9J 5LJ3f 2DPPB 3CPFA 3AHUA 3CCSA 2F5TX 5CO7A 3I9QA 3HRUA 2KQWA 3O8VA 2E6ZA 2OTLQ 2DL8A 2JTFA 2L3QA 3VS5A 3V8JA 4J9HA 2O88A 2GGRA 1T3SA 2NUPB 2KEAA 4R0KA 1GXIE 2PVOB 2JNGA 5A2QE 4N0AA 3HHTB 2NUZA 1IB8A 1TG0A 2F1LA 3CD6A 1GL5A 5I22A 1S72Q 1RAGB 2CH4A 4JJDA 1W70A 2HD0A 3KFVA 3CCRQ 1W2BP 4EPCA 1FMKA 2DZ9A 2EJGA 3M54A 4M7DB 3ZL7C 4OMQA 2XI9A 3URGA 1LOJA 1K0XA 2OX7A 1PRMC 2MWOA 1BYMA 3BDLA 5GAMf 3OYLA 2JS0A 3JCMJ 3VS7A 2DIQA 5KYXA 4AG1C 3L2UA 1AZEA 2A7YA 2CP7A 1WI7A 2GBQA 1R77A 3VKIA 4D8KA 1YWPA 1CKBA 1D0XA 4BDZA 4LDUA 1VA7A 5D6XA 1VQ4Q 2FVUA 2RMOA 2VXFA 2YSQA 1G3TA 3KBGA 2DILA 2JMCA 1LJOA 2RK2A 3RKWA 1M90U 1X43A 3HFOA 4A4KA 3L2WA 2O31A 2M0YA 3M59A 1BCMA 3JAME 1BK2A 1YCSB 2E10A 1JRIA 3WVDB 1JJ2P 3MO8A 5CQYA 3CCVA 2C0TA 1FYNA 1ARKA 1MMGA 2GQVA 3QSUA 4JDSA 3CC4T 4A4HA 3MEVA 3QWYA 2YUNA 3REBB 4IIMA 3PE0A 1I0CA 2RJFA 5DY9A 2RN8A 2OJ2A 3CC2Q 2E65A 1RLQC 4QQDA 3OS1A 3C0CA 1YN8A 4MZMA 2RHIA 2Y4YA 2EVRA 5GAOn 1C6VX 3ZBDA 2OI3A 2ZPGB 3X20B 1E7OA 2RD1A 3CCEQ 4KH0B 4OB3B 2J6KA 1JBMA 1Q81U 1FMWA 5CKDA 3UATA 2JN0A 3EG9A 1CKAA 4OB0B 3PVQA 1QVFA 1T0HA 2XMFA 5HCKA 1VQKA 2KXDA 2V1RA 1T3LA 1WXTA 1YJ9A 4DQ2A 2XG8D 3WXMB 4OMOA 3JCMQ 3F70A 2CP2A 2KYMA 2YWWA 1Q95G 1NYFA 3LH0A 3JCMV 4RUGA 3SWNB 3CCLA 3CMAA 4FSXA 3KUFA 1QCOA 4VUBA 1D3BA 1KQSP 2M9UA 5LJ5e 4KH1B 2DL3A 2ZPHB 2F2XA 3FDRA 3V8KA 1M1GA 5KYUA 1X75C 2DFUA 4KULA 2EPDA 2DVJA 2ROLA 3G4ST 2PU9B 4PL6A 1B3QA 3R6OA 1VQ6Q 4FL6A 3CCJA 3EHRA 4F7UG 1Y96B 3QZ5B 4FU6A 5J39A 3VJPA 1IRXA 3FJ5A 1QMCA 4F16A 1YHQT 1GBRA 5FW9A 2DXBA 2F69A 2RO0A 2C06A 4AG2C 4X34A 3OYKA 3RIRA 1SF9A 2LCCA 4J6YA 1VQNT 4M7DD 5LJ5d 1RAAB 3JCMP 1K9MU 4JJBA 4LNPA 2K57A 5GMKh 5CK9A 2YLCA 2PQWA 3GBQA 4CC2A 3BFMA 2CZ0B 2K2MA 2ED1A 1KK7A 1I5LA 1I81A 1P92A 3MP6A 2FZGB 4MZPA 4JLIA 5GANf 1U1TA 3VS1A 2DJZA 2O4XA 1XJWB 2EWNA 1PKSA 3OYMA 3TSWA 3O5ZA 2VXEA 1WJSA 3LYIA 2AT1B 3OYBA 1VQ7Q 1E6HA 3OYAA 3UA7A 4PJMA 4JUVA 2DTOA 2D8JA 2YUPA 2QEXQ 4F7UF 3NHNA 3HP9A 2E1HA 2O01E 2E5QA 3M0RA 5EG2A 1JO8A 1Q7YU 4JRKA 5IN1A 1SPKA 3CCUT 3CMEA 1YIJT 3MCAB 2GNCA 3CCQQ 4IUVA 2LT1A 3EGDB 1R0CB 2V1QA 3PIPA 1ABQA 4XQ3A 3CBMA 4M78B 1TUGB 2DMOA 4J9DA 4EMKB 3OB9A 1YJWT 4M78F 1K1ZA 2KE9A 2K5LA 2E3IA 5LJ5j 2JTMA 2LQ8A 1ZBXA 3I5SA 2GTJA 1VQ5A 2RJEA 1M4ZA 5C6SA 2DNUA 3CCMA 1AZGB 2IPOB 3JCMe 4X9DA 4MDWA 4Z8AA 2RI2A 4RTWA 3FRNA 2G3RA 2KYBA 5A0DA 4F7UE 1V1CA 3PIOA 4Z89A 3OMCA 5LJ3e 1OZ3A 2KT1A 2BKDN 3CXCA 1X01A 1I5OB 3S3NA 1NEGA 2DD5A 3HTRA 1M5Q1 1UGQB 4PJOB 4C5EA 1QW1A 3RMQA 3I55T 4O6JA 1SRMA 2JJ9A 1PRLC 3E9FA 4JRIA 4M78E 4ELZC 4FCYA 3QG1A 3OS2A 4AMCA 4D8DA 4QVDA 4IUTA 1M8VA 3I56Q 2YRDA 3JCMd 4IURA 1PWTA 2QGFB 2FRYA 2RI3A 5C0MA 4C8QD 3A5ZB 2XK0A 1WYXA 5J26A 2RB6A 5LJ3d 1NLOC 5CKEA 4UC4A 2ENMA 3L2QA 1JXOA 4N4GA 3E1SA 3QJYA 4QVZA 2LX7A 2PVDB 1JJ2S 3OW2P 1GRIA 3RUXA 3OYHA 4AFUC 3J7AF 1M8MA 3INZA 3E19A 2DETA 2BE9B 2RQVA 2DXCA 4EMGA 1QVPA 5KYNA 2M51A 1HJDA 1B7TA 3BW1A 3SD4A 2LJ1A 4HVVA 1SG5A 5IT9E 1MNDA 2LX9A 4HT9A 2ABLA 4XK8E 3GF5A 1NBEB 2P4TA 2EIFA 4RTZA 2AIRB 1WNLA 1WDXA 2OTLT 1TUCA 1GBQA 2QAZA 4LXCA 4RTTA 4Y92A 2X9HA 2R5MA 3M0QA 4DOVA 4QQGA 3VRYA 4OMNA 1B34B 4M78C 5GAMd 4BI4A 2M02A 4EMKC 2BZ8A 3CD6Q 1RAHB 5LJ3j 2MIOA 4A4EA 2K3XA 3RERA 2K3YA 4XU2A 5GAN5 3H0HA 1S72T 3TSZA 1UE9A 5CCAA 3MEAA 3HRTA 3CBPA 3PFSA 2E41A 2LCLA 4X1VA 2COZA 3TVTA 2A37A 4IUPA 3JRZA 3CCRT 1UGSB 3NMZC 3L1AA 4QKUA 4K11A 5GAN8 4A63B 2DAQA 1UDLA 2V26A 4M78D 2YT6A 3E2UA 3D7SB 1PNJA 1YITQ 1PSEA 1ZUKA 2ATCB 1HXDA 4M77D 2EKOA 5GMKe 4V2SA 1XOVA 3JB9H 4KBMB 3RESA 1IXDA 3CQTA 1Z9QA 3LGFA 5LL6S 4HCZA 1MUZA 5LJ5h 1B07A 3DKMA 4HCBA 5FU7B 2ZPEB 4ZNXA 3I35A 3VRZA 1JEGA 4JRPA 3JB9F 1U3OA 2LQWA 3TCJA 4J6WA 5GAMj 1U1SA 3CXCS 3G4SA 3CCVQ 3CPWA 3EAEA 2FZCB 4FT2A 4FM4B 3G6EQ 4PJOD 4F17A 2DTIA 4OVAA 4EMHA 1YHQA 2HBPA 4A4GA 1WJRA 4MDXA 4E7LA 1U5SA 2LDMA 2FPEA 3CC2T 4DEYA 4CC3A 1N9RA 1Z9ZA 4XTWA 1VQNA 4PLIA 4RTXA 1YBYA 4M7DG 1RAEB 5CAIA 2QDLA 2XHCA 2A28A 1VQLQ 2DL7A 3CCET 3X28B 3PVLA 4BE0A 4B9XA 3HPWA 4E7HA 1VQKQ 5KCHA 2KRMA 1WFWA 2CH4W 3L2VA 1K4US 1ZQ1A 2HSPA 4OMMA 3LWIA 2PTKA 2EJFA 5GANe 2DX1A 2VB6A 3CCLQ 2RJCA 3NTIA 3UDCA 1OYXA 2JM9A 1RL2A 4E47A 1N9SA 1SSHA 4JJNK 2ESWA 3M58A 4F7UA 1LCKA 2KK4A 1LVKA 4Y28E 5DM7R 3OYNA 3ASKA 2EYXA 2RA2A 1ACMB 1C1AA 1X6BA 1YJNA 2GCXA 2W10A 5GMKj 1G3SA 4PK4A 2ZZDA 4C0FA 2D9TA 1YJWA 1Y07A 1D09B 4M7DF 1ZUYA 1OU8A 3EGDA 1UHFA 1BU1A 2VGNA 1K8AU 1PD0A 1TU0B 3LGLA 3VUZA 4E7JA 1VQ9A 2DYIA 1VQPQ 1VQ6T 4M78A 4WCIA 3LLRA 4J9IA 5GAN4 4EMKA 3JCMh 4KGZB 4BI8B 1M3BA 2CT4A 4JLGA 5GANd 2FYKA 2DLPA 2DBMA 4J7IA 1IGUA 2DE0X 4Q5WA 3EG3A 4F14A 2LQKA 1ZX6A 5LJ3h 4FW1A 2E4HA 2ZPIB 3OY9A 2D0QB 2VYTA 1KC8C 1RADB 5LJ5g 2KI7A 2NYSA 4B9WA 1VQ8Q 1TS9A 3I55A 2JOYA 1U8RA 4M7DE 3M4GA 2CP5A 3S3MA 4C5GA 2Y4XA 3OYYA 2NUTB 2EQJA 4L5GA 4O5VA 2JTEA 4YTLA 2C0OA 2E3HA 4PFOA 3TQ7P 4M75B 4DBRA 3BE3A 2IVWA 1MV0B 2RHUA 1HK9A 3JB9D 1VQ7T 2HKQB 5GAOp 2BE7D 4C8QG 1G2BA 5FROA 1X69A 2YRVA 2QEXT 3CMEQ 5AT1B 4LDXA 5HKCA 1KC8R 1V76A 3GIBA 3CPWS 5GANj 4AFSC 2X4WA 2HBWA 2CT3A 3CCQT 5GAMh 1O9SA 1X6GA 1SKUB 1S1NA 4C92B 1W2BA 4E6RA 2QYZA 1AEYA 2QA4A 5A0GA 1XNIA 2QDYB 3HL8A 3VS3A 4R55A 1NPRA 2QGGA 1M9SA 1ZA2B 2M1HA 3OSSC 2HEQA 1PCXA 3THKA 3OQ5A 1BI1A 1QVGS 2AZSA 1O75A 2OTJT 2MPXC 1GCPA 3QWXX 2YDLA 1RAFB 3SHWA 3M4YA 2R58A 4J7FA 2OTLA 1PSFA 1WHJA 4C8QB 1KFZA 2EYZA 1VOMA 2LNHB 4C8QF 4J6XA 2XICA 1FX7A 4M7DC 4CRIA 4ZGJB 5KCOA 1FXXA 2ECZA 1X27A 2QK0A 1G8XA 3MPUB 1YI2Q 1UB4A 3U23A 1JJ2A 3DLMA 2RQTA 1N6AA 3OYGA 1B34A 4A53A 1OULA 1KIKA 1M3AA 4TVRA 5KYYB 2L5QA 2E64A 4PNOA 2XDBA 2CS7A 3I56T 4Z88A 2QI2A 3EG0A 2VV5A 2P84A 3JCMg 5DLOA 4BY6B 1UUEA 4FT4A 4RCBA 4M78G 4PJNA 2DERA 2MCNA 3CC7Q 1RLPC 3M55A 1UGPB 1H8KA 3VUBA 4C0GA 1AD5A 5LJ3g 4C8QE 2FPFA 1I1JA 3IQLA 2XU8A 2LCSA 1EX4A 3EHQA 2ROTA 5FWCA 2CZ7B 2B8AA 4LUEA 1Q82C 2WSFE 4J9FA 4BD3A 2A3LA 2EAYA 3META 2DBKA 5I2MA 3FB9A 3X24B 4OMLA 1BKBA 3QO3A 2K6DA 2HSEB 2LZ6B 4JS4A 2JUFA 2KRNA 3UWNA 1NG2A 1MGQA 1ABOA 4M7AD 2EBPA 2EQUA 2CGHA 4OGEA 1PG5B 3OYIA 1KQSA 2F2WA 4PJOG 3GOXA 1K76A 2IG0A 2E12A 2HL5C 2PUKB 2WACA 4GY5A 5KYWA 1WIEA 1Q82R 2PNIA 2RHYA 1KQ1A 4M75D 1UGVA 4C5HA 1UHCA 4ME7A 4IUQA 1WX6A 1AWWA 4M77B 3CD6T 2ZPBB 5GAMg 2BIVA 2LJ3A 1E6GA 4M77F 1WA7A 4BE2A 1ZA1B 2RHZA 2BZXA 4XU1A 3VS2A 1WXBA 2E5KA 1I07A 2MOXA 2MWPA 2DK3A 3M0TA 3SWNC 3OYEA 1WHHA 1WHLA 5KYXB 2EGCA 2EYWA 1AWXA 1G83A 2VKNA 4L6V5 4C92D 4BDYA 1NYGA 1W2BS 4KUDK 4C8QC 2P0QA 2FO0A 5GANh 2DEUA 3HFNA 1VQMQ 3E9GA 1VQOQ 3QXEB 2RQUA 2A36A 1YITT 2K7AA 1WZOA 1MV3A 1VYTA 2LMJA 2QTXA 4PJOF 3AT1B 4LUDA 2KBTA 1PD1A 2NUPA 2WSCE 3RMSA 5CIUA 5GAOr 2X3WD 1H641 3PMIA 2CREA 4M77E 1UEBA 1GFDA 2KT8A 2MI6A 1ZLMA 2JVVA 4LN2A 4RG2A 2VVKA 2BTTA 2L3SA 3CCVT 2L3RA 3A8OB 4BY6C 1AWOA 1VQ6A 3A8GB 4M7DA 4X9CA 3G6ET 2DIGA 3G71Q 2MF2A 4XTUA 4XTYA 5IXBA 2PUOB 2XDDA 5GAMe 5GMKi 2KROA 4RMOA 5HK3A 1NEBA 1UJ0A 1N5ZA 2V8KA 4PJOE 4HCKA 2YRCA 5L8RE 3V7CA 3GP8A 1N27A 2P0PA 4OB1B 2K79A 1WLPB 1WHMA 3EG9B 2J6FA 4C0DB 2JMAA 3NPFA 1HD3A 1D1BA 2RK1A 2CZ6B 3CCSQ 3RDVA 1VQLT 2K9GA 3QJ6A 1BBZA 1Q86C 7AT1B 2EYYA 4NOYA 5IAYA 4II1A 5GJWB 1VQKT 2DO3A 3H0IA 3CC4A 1QQJA 1J3TA 4FYVB 1Y7XA 1D3BB 2HDAA 2FZKB 3Q1JA 2VASA 2NUTA 3CCLT 8AT1B 3G1JA 4MZTA 3JB9G 3EG2A 5GMKm 3VS0A 4FSSA 1D1CA 1NJIC 1OU9A 2K2VA 4RG8A 4M77C 3SFMA 5KE3A 3UF4A 1IGQA 1YJNQ 3KXTA 2DF6A 3H6ZA 1YP5A 2KNBB 1Q86R 1YFNA 3CCQA 2OAWA 3JCMX 1KQSS 3A1PA 2O9VA 5GAN7 3C12A 1RABB 1VQ9Q 1M1FA 4E2FB 2RQWA 3OYCA 2KY9A 1H92A 1SEMA 2DZCA 3EGXB 2QQBA 3JSCA 3QYHB 3V7RA 1VQPT 1MMNA 5IHIA 1GFCA 3QHSA 2CSIA 2OTJA 4PJOC 3T9NA 3OW2A 1UGRB 2I2LA 2LVMA 1NJIR 2ED0A 2AHJB 3C95A 5GANg 1BI2A 4ZGDB 4LDWA 3J81E 2LNVA 1X2KA 2DJQA 2RQRA 5GAN3 3SWNA 1AT1B 1VQ4T 2J7IA 4LDYA 4ELYC 2OAUA 3MKDA 2LTOA 3MP1A 4DBHA 5GAOq 2PVGB 2NLUA 1VYUA 1YNZA 2GF7A 4C8QA 2CSQA 1WHKA 2QQAA 2CUDA 1VQ8T 1OV3A 1HYOA 1OX8A 2P0KA 3CBOA 2KGTA 3S6WA 3FEOA 1QKWA 2RI5A 4N4HA 1R8OB 3GNFB 4DBFA 1Y96A 5GJVB 4ZGEB 2FHDA 3VU3C 4JS5A 3RKXA 2DKGA 5KYYA 1QVGA 3EFSA 3ER0A 5IXFA 4C0DC 3CMET 1Y57A 2K4YA 1AWJA 3NFCA 3EFOB 5FLXE 3MJXA 2VWFA 4OMFB 3MHXA 1QCNA 4HXJA 2KVQG 2JM8A 4AT1B 2QA4Q 3RNJA 4AFZC 1YJ9Q 3OA6A 5FRNA 3QDFA 3GPLA 3M9QA 5FU6B 1PHTA 2H8HA 3BY7A 1W1FA 3CMAQ 2H3EB 4OP0A 1TH7A 2LRQA 2RJDA 4E7ZA 2J05A 4HVWA 3H41A 5I2SA 1OZ2A 5DLQE 4M7AG 2X51A 1OX9A 4F04B 1BIBA 2L8DA 3M53A 2R57A 2K3BA 3CCUA 1YIJA 1SHGA 3NTKA 1N8RC 1G5VA 2DRMA 2KRSA 2CP0A 3OBYA 1EIFA 1OQKA 1EZZB 3OYDA 2FL7A 3ULRB 3CCJQ 3QPHA 1IZ6A 2KMTA 4QQ6A 1TTHB 4M75G 1PM3A 2M0OA 1YI2T 2E6NA 2GQIA 3OS0A 4NL2A 3QYGB 2HCKA 1NM7A 4QW2A 4FW2A 3H9NA 3MEUA 3M0PA 3OS5A 4M77A 5L23A 2DTHA 1RI0A 2MK5A 4FIBA 3TEEA 1QVFP 4XAXB 4OMPA 2KDSA 4MMLA 1BIAA 3QZ9B 1M2OA 4R56A 5FU7C 2VUBA 1N8RR 2I0NA 4C92G 2F2VA 3JCMc 4M7AB 3UT1A 2VGMA 4GBQA 4L59A 1R0BG 3CC7T 4M7AF 2JS2A 2P4RA 1YITA 1KG1A 3FC3A 2O9SA 3FJPA 2X4YA 5KH6A 1YCYA 2DA9A 4Y91A 2FB7A 4LDVA 2EQMA 4PJOA 4FYXB 1HSQA 3OW2S 5FWBA 3PTAA 2MAMA 3VV0A 3HSBA 5ECAA 2XIDA 1VIEA 1W6XA 4HT8A 4KT0E 4M75F 4P5NA 1QP2A 1FWZA 2RH2A 1MNEA 2GTOA 4N4IA 5CVIA 3HRSA 2D6FA 2X4XA 2K5FA 4J9EA 1SRLA 6AT1B 2RF0A 4J9GA 3DB4A 4CC7A 4OF1A 3QKJA 3G6EA 3OSVA 3EFRA 3QUIA 2B86A 9ATCB 2AKKA 4M7AE 1XTDA 1Y71A 5GAOm 2W0ZA 2JT4A 3OYFA 2SEMA 1TUDA 2SRCA 1OPKA 4XU3A 4C92F 1VQ5Q 2D0NA 3CCMQ 1RI9A 3OBWA 2DXTA 4MMKA 3QBYA 5FU6C 2XDPA 5KE2A 1H3HA 2QQSA 5M9OA 1VQLA 2YLBA 2HMAA 1M1KC 3SB2A 1QLYA 3R6NA 3L42A 4ZN3A 2ZAEA 4M75E 2JW4A 2HL3A 1UFFA 2M16A 3REAB 2G6FX 2CP6A 2GFAA 1H3ZA 2AZVA 2COWA 3PGGA 4E7KA 1NE8A 1FMVA 5GMKl 4PJJA 1Q86U 2V8IA 5HK0A 2HZYA 3A8LB 4PFZA 1GCQC 4ESRA 4OGCA 4XTVA 1TWBA 4RTYA 4IIOA 1VQMT 1VQOT 4XTZA 1ZSZB 3M56A 2QQRA 4WF2A 1JU5C 3M5AA 4C92E 2WSEE 2C0IA 1KJWA 4PLLA 2KAFA 4XU0A 1M1KR 1S72A 1D1AA 2DEQA 4LD9K 1NJIU 2X4JA 2BZYA 4JPBW 1IO6A 2EGAA 3CCRA 2DYBA 1T0JA 2RPNA 1K73C 4BACA 2EW3A 1JQQA 2X35A 2V8JA 2FRWA 4E7SA 3X25B 3VS4A 4RTVA 4WTOB 4M7AC 1VQPA 1X2QA 3FIFA 3G71T 1K9AA 1VYVA 4FYWB 4M77G 1KD1C 2HKNA 1BI0A 1WHGA 1M2VB 4ANJA 3EGXA 3C4SA 5D7UA 4GLKA 4J9CA 3CXCP 1VUBA 1M3CA 2HNIA 3LH5A 1VQ4A 3S3OA 2ZGWA 3PMTA 1RUWA 4M75C 3M0UA 1WGSA 4J83A 1C0MA 3G7ZA 3EGUA 3CCST 1QWFA 5IHKA 1KHIA 1D0YA 1K73R 4JZ4A 2DL4A 1JB0E 5IH2A 2JXBA 3CC4Q 3FLGA 3VYGA 1VQ8A 1UTIA 4KRTA 3L2RA 1U06A 2LQNA 5AYFA 5CQXA 2X3XD 1NLPC 2CDTA 2CUBA 1KD1R 4F7UB 2RNAA 3A8MB 3DLLA 3ME9A 5I21A 4J8OA 4C92C 1WXUA 4KUIA 1QP3A 1ZBJA 3CC2A 5EC7A 2KXCA 3VYHB 1WPYA 2LP5A 8ATCB 3JCMW 2DVEA 1YWOA 2YHTA 2CYZB 3CCEA 2ZPFB 4HA8A 3GLXA 1YJNT 1K8AC 3JV3A 2J06A 4J5YA 2F5KA 4RTUA 3P8HA 3UPUA 5IHNA 3EFOA 4KGVB 1A0NB 1BCOA 3L2ZA 2CZ1B 1TXQA 1XQHA 1VQ9T 2GFUA 1PKTA 2EYQA 1G3WA 2OTJQ 5CKFA 3LX7A 1OPLA 3H8ZA 1ZSGA 1D0ZA 2HQEA 4KGXB 3MP8A 5D6YA 3PT9A 1M90C 3ZEHA 1ZSZC 2MMPA 2HQHA 2H3JA 4NS5A 2JZ2A 2O2OA 4QT7A 3MEWA 1BB9A 2RM4A 1K8AR 5CKHA 2XD0A 1I4K1 1MMAA 1QVFS 3OYJA 3G4SQ 2Y90A 2AK5A 1TOVA 3C94A 4BE1A 3X26B 2BUDA 1IHWA 1AVZC 1MHNA 3H0FA 1N8RU 1IREB 1GCQA 1SHFA 1YI2A 1YHQQ 4PJLA 2Z0WA 1UECA 3JB9I 3PNWC 3A98A 2KSSA 4C0ZA 4FYYB 2DD4A 1M90R 4DEXA 1JXMA 1LPLA 4HVUA 3QDRB 3J80E 1Q81C 1VIFA 4ZTJA 4JJCA 1VQNQ 1RACB 3RR6A 2NWMA 1OOTA 2LJ0A 1SSFA 3JCMb 4A54A 1Y0MA 3EH2A 3CC7A 2IIMA 1W4SA 5I11A 4DOWA 2CKKA 4ORZA 4M4ZA 2YXYA 4PKCC 2YUOA 2L2PA 4M7AA 4QVCA 2QA4T 1KC8U 1TSFA 1AHJB 5FRMA 2COYA 4D6WA 4EIKA 1YJ9T 3ZFJA 2L3PA 4DBQA 2D1XA 4HKEA 4N0AC 3HKSA 2RHXA 4OB2B 4Z02A 2YUQA 4LD6A 1DJ7B 5LJ5f 1NPPA 1Q81R 2PZ1A 3CMAT 3CPWP 1VQ7A 3N5BB 2FEIA 3BDUA 5KYUB 3EH1A 4M75A 1KQ2A 5GAN2 2QEXA 2QASA 1OI1A 3CCUQ 5GAOl 2E70A 1YIJQ 4JZ3A 2MYSA
chains in the Genus database with same CATH topology
1OX9A 2NYSA 2QASA 1ZSZB 1OU9A 1TWBA 1ZSZA 2QAZA 1OU8A 1OULA 1OX8A 1YFNA 1ZSZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX9 A;  2NYS A;  2QAS A;  1ZSZ B;  1OU9 A;  1TWB A;  1ZSZ A;  2QAZ A;  1OU8 A;  1OUL A;  1OX8 A;  1YFN A;  1ZSZ C; 
#chains in the Genus database with same CATH topology
 2EGE A;  1M27 C;  4CI0 C;  2A08 A;  1V29 B;  4GLM A;  3P8D A;  3LW5 E;  4RKU E;  1KSW A;  3P8B B;  3NGP A;  2EFI A;  1YJW Q;  3RKY A;  1WQW A;  2J6O A;  1QKX A;  1QVG P;  4IKF A;  1RAI B;  2QQ9 A;  3CCJ T;  4J9B A;  3V7S A;  3V8L A;  1IHV A;  2LC4 A;  4C92 A;  2ZCF B;  4A4F A;  4C5I A;  2DM1 A;  3M0S A;  5CR2 A;  5A0L A;  3GNG A;  4JRQ A;  4NL3 A;  4AFQ C;  2KR3 A;  1OEB A;  2CP3 A;  1UG1 A;  5D6W A;  3WVE B;  1K9M C;  4DA4 A;  1MMD A;  1M1K U;  1QWE A;  1X6O A;  1UJY A;  3A8H B;  3NTH A;  4IUU A;  1I8F A;  2DRK A;  1LNX A;  2K5I A;  1CSK A;  3QII A;  4RCC A;  2VC8 A;  2O4X B;  1BI3 A;  2AKL A;  3TRE A;  2QTV A;  4B6M A;  3I55 Q;  1VQM A;  1VQO A;  1AOJ A;  4E7I A;  4PFP A;  1F1B B;  5GAN 6;  3LWH A;  1NZ9 A;  3VS6 A;  1ZSZ A;  1WJQ A;  4HCC A;  2L0A A;  5HY6 A;  3I5R A;  1Q7Y C;  1ZUU A;  1K0S A;  1G3Y A;  1KHC A;  2EQI A;  3I56 A;  3UA6 A;  1K9M R;  2EKH A;  1ZHI A;  2EQK A;  4BUG A;  3EG1 A;  2FPD A;  2LT4 A;  5KYW B;  1EFN A;  3SDZ A;  4BB7 A;  3RBB B;  2FG0 A;  3M57 A;  2HAX A;  4ZTF A;  3TU4 K;  3CEY A;  2R5A A;  1PC0 A;  1K73 U;  3G71 A;  3OMG A;  2A0F B;  4ZN1 A;  4BI3 A;  1WQ7 A;  1QCF A;  2DXU A;  2HQX A;  4ATO A;  4EDU A;  5CKB A;  2EJ9 A;  3JCM f;  1M30 A;  2L89 A;  3SEM A;  2QG9 B;  3DB3 A;  4XTX A;  4CC4 B;  1KD1 U;  1VQ5 T;  5J3B A;  2D8H A;  2QXF A;  2DL5 A;  4LE9 A;  1M2V A;  3CCM T;  1Q7Y R;  1Q82 U;  2XKO C;  3JB9 J;  5LJ3 f;  2DPP B;  3CPF A;  3AHU A;  3CCS A;  2F5T X;  5CO7 A;  3I9Q A;  3HRU A;  2KQW A;  3O8V A;  2E6Z A;  2OTL Q;  2DL8 A;  2JTF A;  2L3Q A;  3VS5 A;  3V8J A;  4J9H A;  2O88 A;  2GGR A;  1T3S A;  2NUP B;  2KEA A;  4R0K A;  1GXI E;  2PVO B;  2JNG A;  5A2Q E;  4N0A A;  3HHT B;  2NUZ A;  1IB8 A;  1TG0 A;  2F1L A;  3CD6 A;  1GL5 A;  5I22 A;  1S72 Q;  1RAG B;  2CH4 A;  4JJD A;  1W70 A;  2HD0 A;  3KFV A;  3CCR Q;  1W2B P;  4EPC A;  1FMK A;  2DZ9 A;  2EJG A;  3M54 A;  4M7D B;  3ZL7 C;  4OMQ A;  2XI9 A;  3URG A;  1LOJ A;  1K0X A;  2OX7 A;  1PRM C;  2MWO A;  1BYM A;  3BDL A;  5GAM f;  3OYL A;  2JS0 A;  3JCM J;  3VS7 A;  2DIQ A;  5KYX A;  4AG1 C;  3L2U A;  1AZE A;  2A7Y A;  2CP7 A;  1WI7 A;  2GBQ A;  1R77 A;  3VKI A;  4D8K A;  1YWP A;  1CKB A;  1D0X A;  4BDZ A;  4LDU A;  1VA7 A;  5D6X A;  1VQ4 Q;  2FVU A;  2RMO A;  2VXF A;  2YSQ A;  1G3T A;  3KBG A;  2DIL A;  2JMC A;  1LJO A;  2RK2 A;  3RKW A;  1M90 U;  1X43 A;  3HFO A;  4A4K A;  3L2W A;  2O31 A;  2M0Y A;  3M59 A;  1BCM A;  3JAM E;  1BK2 A;  1YCS B;  2E10 A;  1JRI A;  3WVD B;  1JJ2 P;  3MO8 A;  5CQY A;  3CCV A;  2C0T A;  1FYN A;  1ARK A;  1MMG A;  2GQV A;  3QSU A;  4JDS A;  3CC4 T;  4A4H A;  3MEV A;  3QWY A;  2YUN A;  3REB B;  4IIM A;  3PE0 A;  1I0C A;  2RJF A;  5DY9 A;  2RN8 A;  2OJ2 A;  3CC2 Q;  2E65 A;  1RLQ C;  4QQD A;  3OS1 A;  3C0C A;  1YN8 A;  4MZM A;  2RHI A;  2Y4Y A;  2EVR A;  5GAO n;  1C6V X;  3ZBD A;  2OI3 A;  2ZPG B;  3X20 B;  1E7O A;  2RD1 A;  3CCE Q;  4KH0 B;  4OB3 B;  2J6K A;  1JBM A;  1Q81 U;  1FMW A;  5CKD A;  3UAT A;  2JN0 A;  3EG9 A;  1CKA A;  4OB0 B;  3PVQ A;  1QVF A;  1T0H A;  2XMF A;  5HCK A;  1VQK A;  2KXD A;  2V1R A;  1T3L A;  1WXT A;  1YJ9 A;  4DQ2 A;  2XG8 D;  3WXM B;  4OMO A;  3JCM Q;  3F70 A;  2CP2 A;  2KYM A;  2YWW A;  1Q95 G;  1NYF A;  3LH0 A;  3JCM V;  4RUG A;  3SWN B;  3CCL A;  3CMA A;  4FSX A;  3KUF A;  1QCO A;  4VUB A;  1D3B A;  1KQS P;  2M9U A;  5LJ5 e;  4KH1 B;  2DL3 A;  2ZPH B;  2F2X A;  3FDR A;  3V8K A;  1M1G A;  5KYU A;  1X75 C;  2DFU A;  4KUL A;  2EPD A;  2DVJ A;  2ROL A;  3G4S T;  2PU9 B;  4PL6 A;  1B3Q A;  3R6O A;  1VQ6 Q;  4FL6 A;  3CCJ A;  3EHR A;  4F7U G;  1Y96 B;  3QZ5 B;  4FU6 A;  5J39 A;  3VJP A;  1IRX A;  3FJ5 A;  1QMC A;  4F16 A;  1YHQ T;  1GBR A;  5FW9 A;  2DXB A;  2F69 A;  2RO0 A;  2C06 A;  4AG2 C;  4X34 A;  3OYK A;  3RIR A;  1SF9 A;  2LCC A;  4J6Y A;  1VQN T;  4M7D D;  5LJ5 d;  1RAA B;  3JCM P;  1K9M U;  4JJB A;  4LNP A;  2K57 A;  5GMK h;  5CK9 A;  2YLC A;  2PQW A;  3GBQ A;  4CC2 A;  3BFM A;  2CZ0 B;  2K2M A;  2ED1 A;  1KK7 A;  1I5L A;  1I81 A;  1P92 A;  3MP6 A;  2FZG B;  4MZP A;  4JLI A;  5GAN f;  1U1T A;  3VS1 A;  2DJZ A;  2O4X A;  1XJW B;  2EWN A;  1PKS A;  3OYM A;  3TSW A;  3O5Z A;  2VXE A;  1WJS A;  3LYI A;  2AT1 B;  3OYB A;  1VQ7 Q;  1E6H A;  3OYA A;  3UA7 A;  4PJM A;  4JUV A;  2DTO A;  2D8J A;  2YUP A;  2QEX Q;  4F7U F;  3NHN A;  3HP9 A;  2E1H A;  2O01 E;  2E5Q A;  3M0R A;  5EG2 A;  1JO8 A;  1Q7Y U;  4JRK A;  5IN1 A;  1SPK A;  3CCU T;  3CME A;  1YIJ T;  3MCA B;  2GNC A;  3CCQ Q;  4IUV A;  2LT1 A;  3EGD B;  1R0C B;  2V1Q A;  3PIP A;  1ABQ A;  4XQ3 A;  3CBM A;  4M78 B;  1TUG B;  2DMO A;  4J9D A;  4EMK B;  3OB9 A;  1YJW T;  4M78 F;  1K1Z A;  2KE9 A;  2K5L A;  2E3I A;  5LJ5 j;  2JTM A;  2LQ8 A;  1ZBX A;  3I5S A;  2GTJ A;  1VQ5 A;  2RJE A;  1M4Z A;  5C6S A;  2DNU A;  3CCM A;  1AZG B;  2IPO B;  3JCM e;  4X9D A;  4MDW A;  4Z8A A;  2RI2 A;  4RTW A;  3FRN A;  2G3R A;  2KYB A;  5A0D A;  4F7U E;  1V1C A;  3PIO A;  4Z89 A;  3OMC A;  5LJ3 e;  1OZ3 A;  2KT1 A;  2BKD N;  3CXC A;  1X01 A;  1I5O B;  3S3N A;  1NEG A;  2DD5 A;  3HTR A;  1M5Q 1;  1UGQ B;  4PJO B;  4C5E A;  1QW1 A;  3RMQ A;  3I55 T;  4O6J A;  1SRM A;  2JJ9 A;  1PRL C;  3E9F A;  4JRI A;  4M78 E;  4ELZ C;  4FCY A;  3QG1 A;  3OS2 A;  4AMC A;  4D8D A;  4QVD A;  4IUT A;  1M8V A;  3I56 Q;  2YRD A;  3JCM d;  4IUR A;  1PWT A;  2QGF B;  2FRY A;  2RI3 A;  5C0M A;  4C8Q D;  3A5Z B;  2XK0 A;  1WYX A;  5J26 A;  2RB6 A;  5LJ3 d;  1NLO C;  5CKE A;  4UC4 A;  2ENM A;  3L2Q A;  1JXO A;  4N4G A;  3E1S A;  3QJY A;  4QVZ A;  2LX7 A;  2PVD B;  1JJ2 S;  3OW2 P;  1GRI A;  3RUX A;  3OYH A;  4AFU C;  3J7A F;  1M8M A;  3INZ A;  3E19 A;  2DET A;  2BE9 B;  2RQV A;  2DXC A;  4EMG A;  1QVP A;  5KYN A;  2M51 A;  1HJD A;  1B7T A;  3BW1 A;  3SD4 A;  2LJ1 A;  4HVV A;  1SG5 A;  5IT9 E;  1MND A;  2LX9 A;  4HT9 A;  2ABL A;  4XK8 E;  3GF5 A;  1NBE B;  2P4T A;  2EIF A;  4RTZ A;  2AIR B;  1WNL A;  1WDX A;  2OTL T;  1TUC A;  1GBQ A;  2QAZ A;  4LXC A;  4RTT A;  4Y92 A;  2X9H A;  2R5M A;  3M0Q A;  4DOV A;  4QQG A;  3VRY A;  4OMN A;  1B34 B;  4M78 C;  5GAM d;  4BI4 A;  2M02 A;  4EMK C;  2BZ8 A;  3CD6 Q;  1RAH B;  5LJ3 j;  2MIO A;  4A4E A;  2K3X A;  3RER A;  2K3Y A;  4XU2 A;  5GAN 5;  3H0H A;  1S72 T;  3TSZ A;  1UE9 A;  5CCA A;  3MEA A;  3HRT A;  3CBP A;  3PFS A;  2E41 A;  2LCL A;  4X1V A;  2COZ A;  3TVT A;  2A37 A;  4IUP A;  3JRZ A;  3CCR T;  1UGS B;  3NMZ C;  3L1A A;  4QKU A;  4K11 A;  5GAN 8;  4A63 B;  2DAQ A;  1UDL A;  2V26 A;  4M78 D;  2YT6 A;  3E2U A;  3D7S B;  1PNJ A;  1YIT Q;  1PSE A;  1ZUK A;  2ATC B;  1HXD A;  4M77 D;  2EKO A;  5GMK e;  4V2S A;  1XOV A;  3JB9 H;  4KBM B;  3RES A;  1IXD A;  3CQT A;  1Z9Q A;  3LGF A;  5LL6 S;  4HCZ A;  1MUZ A;  5LJ5 h;  1B07 A;  3DKM A;  4HCB A;  5FU7 B;  2ZPE B;  4ZNX A;  3I35 A;  3VRZ A;  1JEG A;  4JRP A;  3JB9 F;  1U3O A;  2LQW A;  3TCJ A;  4J6W A;  5GAM j;  1U1S A;  3CXC S;  3G4S A;  3CCV Q;  3CPW A;  3EAE A;  2FZC B;  4FT2 A;  4FM4 B;  3G6E Q;  4PJO D;  4F17 A;  2DTI A;  4OVA A;  4EMH A;  1YHQ A;  2HBP A;  4A4G A;  1WJR A;  4MDX A;  4E7L A;  1U5S A;  2LDM A;  2FPE A;  3CC2 T;  4DEY A;  4CC3 A;  1N9R A;  1Z9Z A;  4XTW A;  1VQN A;  4PLI A;  4RTX A;  1YBY A;  4M7D G;  1RAE B;  5CAI A;  2QDL A;  2XHC A;  2A28 A;  1VQL Q;  2DL7 A;  3CCE T;  3X28 B;  3PVL A;  4BE0 A;  4B9X A;  3HPW A;  4E7H A;  1VQK Q;  5KCH A;  2KRM A;  1WFW A;  2CH4 W;  3L2V A;  1K4U S;  1ZQ1 A;  2HSP A;  4OMM A;  3LWI A;  2PTK A;  2EJF A;  5GAN e;  2DX1 A;  2VB6 A;  3CCL Q;  2RJC A;  3NTI A;  3UDC A;  1OYX A;  2JM9 A;  1RL2 A;  4E47 A;  1N9S A;  1SSH A;  4JJN K;  2ESW A;  3M58 A;  4F7U A;  1LCK A;  2KK4 A;  1LVK A;  4Y28 E;  5DM7 R;  3OYN A;  3ASK A;  2EYX A;  2RA2 A;  1ACM B;  1C1A A;  1X6B A;  1YJN A;  2GCX A;  2W10 A;  5GMK j;  1G3S A;  4PK4 A;  2ZZD A;  4C0F A;  2D9T A;  1YJW A;  1Y07 A;  1D09 B;  4M7D F;  1ZUY A;  1OU8 A;  3EGD A;  1UHF A;  1BU1 A;  2VGN A;  1K8A U;  1PD0 A;  1TU0 B;  3LGL A;  3VUZ A;  4E7J A;  1VQ9 A;  2DYI A;  1VQP Q;  1VQ6 T;  4M78 A;  4WCI A;  3LLR A;  4J9I A;  5GAN 4;  4EMK A;  3JCM h;  4KGZ B;  4BI8 B;  1M3B A;  2CT4 A;  4JLG A;  5GAN d;  2FYK A;  2DLP A;  2DBM A;  4J7I A;  1IGU A;  2DE0 X;  4Q5W A;  3EG3 A;  4F14 A;  2LQK A;  1ZX6 A;  5LJ3 h;  4FW1 A;  2E4H A;  2ZPI B;  3OY9 A;  2D0Q B;  2VYT A;  1KC8 C;  1RAD B;  5LJ5 g;  2KI7 A;  2NYS A;  4B9W A;  1VQ8 Q;  1TS9 A;  3I55 A;  2JOY A;  1U8R A;  4M7D E;  3M4G A;  2CP5 A;  3S3M A;  4C5G A;  2Y4X A;  3OYY A;  2NUT B;  2EQJ A;  4L5G A;  4O5V A;  2JTE A;  4YTL A;  2C0O A;  2E3H A;  4PFO A;  3TQ7 P;  4M75 B;  4DBR A;  3BE3 A;  2IVW A;  1MV0 B;  2RHU A;  1HK9 A;  3JB9 D;  1VQ7 T;  2HKQ B;  5GAO p;  2BE7 D;  4C8Q G;  1G2B A;  5FRO A;  1X69 A;  2YRV A;  2QEX T;  3CME Q;  5AT1 B;  4LDX A;  5HKC A;  1KC8 R;  1V76 A;  3GIB A;  3CPW S;  5GAN j;  4AFS C;  2X4W A;  2HBW A;  2CT3 A;  3CCQ T;  5GAM h;  1O9S A;  1X6G A;  1SKU B;  1S1N A;  4C92 B;  1W2B A;  4E6R A;  2QYZ A;  1AEY A;  2QA4 A;  5A0G A;  1XNI A;  2QDY B;  3HL8 A;  3VS3 A;  4R55 A;  1NPR A;  2QGG A;  1M9S A;  1ZA2 B;  2M1H A;  3OSS C;  2HEQ A;  1PCX A;  3THK A;  3OQ5 A;  1BI1 A;  1QVG S;  2AZS A;  1O75 A;  2OTJ T;  2MPX C;  1GCP A;  3QWX X;  2YDL A;  1RAF B;  3SHW A;  3M4Y A;  2R58 A;  4J7F A;  2OTL A;  1PSF A;  1WHJ A;  4C8Q B;  1KFZ A;  2EYZ A;  1VOM A;  2LNH B;  4C8Q F;  4J6X A;  2XIC A;  1FX7 A;  4M7D C;  4CRI A;  4ZGJ B;  5KCO A;  1FXX A;  2ECZ A;  1X27 A;  2QK0 A;  1G8X A;  3MPU B;  1YI2 Q;  1UB4 A;  3U23 A;  1JJ2 A;  3DLM A;  2RQT A;  1N6A A;  3OYG A;  1B34 A;  4A53 A;  1OUL A;  1KIK A;  1M3A A;  4TVR A;  5KYY B;  2L5Q A;  2E64 A;  4PNO A;  2XDB A;  2CS7 A;  3I56 T;  4Z88 A;  2QI2 A;  3EG0 A;  2VV5 A;  2P84 A;  3JCM g;  5DLO A;  4BY6 B;  1UUE A;  4FT4 A;  4RCB A;  4M78 G;  4PJN A;  2DER A;  2MCN A;  3CC7 Q;  1RLP C;  3M55 A;  1UGP B;  1H8K A;  3VUB A;  4C0G A;  1AD5 A;  5LJ3 g;  4C8Q E;  2FPF A;  1I1J A;  3IQL A;  2XU8 A;  2LCS A;  1EX4 A;  3EHQ A;  2ROT A;  5FWC A;  2CZ7 B;  2B8A A;  4LUE A;  1Q82 C;  2WSF E;  4J9F A;  4BD3 A;  2A3L A;  2EAY A;  3MET A;  2DBK A;  5I2M A;  3FB9 A;  3X24 B;  4OML A;  1BKB A;  3QO3 A;  2K6D A;  2HSE B;  2LZ6 B;  4JS4 A;  2JUF A;  2KRN A;  3UWN A;  1NG2 A;  1MGQ A;  1ABO A;  4M7A D;  2EBP A;  2EQU A;  2CGH A;  4OGE A;  1PG5 B;  3OYI A;  1KQS A;  2F2W A;  4PJO G;  3GOX A;  1K76 A;  2IG0 A;  2E12 A;  2HL5 C;  2PUK B;  2WAC A;  4GY5 A;  5KYW A;  1WIE A;  1Q82 R;  2PNI A;  2RHY A;  1KQ1 A;  4M75 D;  1UGV A;  4C5H A;  1UHC A;  4ME7 A;  4IUQ A;  1WX6 A;  1AWW A;  4M77 B;  3CD6 T;  2ZPB B;  5GAM g;  2BIV A;  2LJ3 A;  1E6G A;  4M77 F;  1WA7 A;  4BE2 A;  1ZA1 B;  2RHZ A;  2BZX A;  4XU1 A;  3VS2 A;  1WXB A;  2E5K A;  1I07 A;  2MOX A;  2MWP A;  2DK3 A;  3M0T A;  3SWN C;  3OYE A;  1WHH A;  1WHL A;  5KYX B;  2EGC A;  2EYW A;  1AWX A;  1G83 A;  2VKN A;  4L6V 5;  4C92 D;  4BDY A;  1NYG A;  1W2B S;  4KUD K;  4C8Q C;  2P0Q A;  2FO0 A;  5GAN h;  2DEU A;  3HFN A;  1VQM Q;  3E9G A;  1VQO Q;  3QXE B;  2RQU A;  2A36 A;  1YIT T;  2K7A A;  1WZO A;  1MV3 A;  1VYT A;  2LMJ A;  2QTX A;  4PJO F;  3AT1 B;  4LUD A;  2KBT A;  1PD1 A;  2NUP A;  2WSC E;  3RMS A;  5CIU A;  5GAO r;  2X3W D;  1H64 1;  3PMI A;  2CRE A;  4M77 E;  1UEB A;  1GFD A;  2KT8 A;  2MI6 A;  1ZLM A;  2JVV A;  4LN2 A;  4RG2 A;  2VVK A;  2BTT A;  2L3S A;  3CCV T;  2L3R A;  3A8O B;  4BY6 C;  1AWO A;  1VQ6 A;  3A8G B;  4M7D A;  4X9C A;  3G6E T;  2DIG A;  3G71 Q;  2MF2 A;  4XTU A;  4XTY A;  5IXB A;  2PUO B;  2XDD A;  5GAM e;  5GMK i;  2KRO A;  4RMO A;  5HK3 A;  1NEB A;  1UJ0 A;  1N5Z A;  2V8K A;  4PJO E;  4HCK A;  2YRC A;  5L8R E;  3V7C A;  3GP8 A;  1N27 A;  2P0P A;  4OB1 B;  2K79 A;  1WLP B;  1WHM A;  3EG9 B;  2J6F A;  4C0D B;  2JMA A;  3NPF A;  1HD3 A;  1D1B A;  2RK1 A;  2CZ6 B;  3CCS Q;  3RDV A;  1VQL T;  2K9G A;  3QJ6 A;  1BBZ A;  1Q86 C;  7AT1 B;  2EYY A;  4NOY A;  5IAY A;  4II1 A;  5GJW B;  1VQK T;  2DO3 A;  3H0I A;  3CC4 A;  1QQJ A;  1J3T A;  4FYV B;  1Y7X A;  1D3B B;  2HDA A;  2FZK B;  3Q1J A;  2VAS A;  2NUT A;  3CCL T;  8AT1 B;  3G1J A;  4MZT A;  3JB9 G;  3EG2 A;  5GMK m;  3VS0 A;  4FSS A;  1D1C A;  1NJI C;  1OU9 A;  2K2V A;  4RG8 A;  4M77 C;  3SFM A;  5KE3 A;  3UF4 A;  1IGQ A;  1YJN Q;  3KXT A;  2DF6 A;  3H6Z A;  1YP5 A;  2KNB B;  1Q86 R;  1YFN A;  3CCQ A;  2OAW A;  3JCM X;  1KQS S;  3A1P A;  2O9V A;  5GAN 7;  3C12 A;  1RAB B;  1VQ9 Q;  1M1F A;  4E2F B;  2RQW A;  3OYC A;  2KY9 A;  1H92 A;  1SEM A;  2DZC A;  3EGX B;  2QQB A;  3JSC A;  3QYH B;  3V7R A;  1VQP T;  1MMN A;  5IHI A;  1GFC A;  3QHS A;  2CSI A;  2OTJ A;  4PJO C;  3T9N A;  3OW2 A;  1UGR B;  2I2L A;  2LVM A;  1NJI R;  2ED0 A;  2AHJ B;  3C95 A;  5GAN g;  1BI2 A;  4ZGD B;  4LDW A;  3J81 E;  2LNV A;  1X2K A;  2DJQ A;  2RQR A;  5GAN 3;  3SWN A;  1AT1 B;  1VQ4 T;  2J7I A;  4LDY A;  4ELY C;  2OAU A;  3MKD A;  2LTO A;  3MP1 A;  4DBH A;  5GAO q;  2PVG B;  2NLU A;  1VYU A;  1YNZ A;  2GF7 A;  4C8Q A;  2CSQ A;  1WHK A;  2QQA A;  2CUD A;  1VQ8 T;  1OV3 A;  1HYO A;  1OX8 A;  2P0K A;  3CBO A;  2KGT A;  3S6W A;  3FEO A;  1QKW A;  2RI5 A;  4N4H A;  1R8O B;  3GNF B;  4DBF A;  1Y96 A;  5GJV B;  4ZGE B;  2FHD A;  3VU3 C;  4JS5 A;  3RKX A;  2DKG A;  5KYY A;  1QVG A;  3EFS A;  3ER0 A;  5IXF A;  4C0D C;  3CME T;  1Y57 A;  2K4Y A;  1AWJ A;  3NFC A;  3EFO B;  5FLX E;  3MJX A;  2VWF A;  4OMF B;  3MHX A;  1QCN A;  4HXJ A;  2KVQ G;  2JM8 A;  4AT1 B;  2QA4 Q;  3RNJ A;  4AFZ C;  1YJ9 Q;  3OA6 A;  5FRN A;  3QDF A;  3GPL A;  3M9Q A;  5FU6 B;  1PHT A;  2H8H A;  3BY7 A;  1W1F A;  3CMA Q;  2H3E B;  4OP0 A;  1TH7 A;  2LRQ A;  2RJD A;  4E7Z A;  2J05 A;  4HVW A;  3H41 A;  5I2S A;  1OZ2 A;  5DLQ E;  4M7A G;  2X51 A;  1OX9 A;  4F04 B;  1BIB A;  2L8D A;  3M53 A;  2R57 A;  2K3B A;  3CCU A;  1YIJ A;  1SHG A;  3NTK A;  1N8R C;  1G5V A;  2DRM A;  2KRS A;  2CP0 A;  3OBY A;  1EIF A;  1OQK A;  1EZZ B;  3OYD A;  2FL7 A;  3ULR B;  3CCJ Q;  3QPH A;  1IZ6 A;  2KMT A;  4QQ6 A;  1TTH B;  4M75 G;  1PM3 A;  2M0O A;  1YI2 T;  2E6N A;  2GQI A;  3OS0 A;  4NL2 A;  3QYG B;  2HCK A;  1NM7 A;  4QW2 A;  4FW2 A;  3H9N A;  3MEU A;  3M0P A;  3OS5 A;  4M77 A;  5L23 A;  2DTH A;  1RI0 A;  2MK5 A;  4FIB A;  3TEE A;  1QVF P;  4XAX B;  4OMP A;  2KDS A;  4MML A;  1BIA A;  3QZ9 B;  1M2O A;  4R56 A;  5FU7 C;  2VUB A;  1N8R R;  2I0N A;  4C92 G;  2F2V A;  3JCM c;  4M7A B;  3UT1 A;  2VGM A;  4GBQ A;  4L59 A;  1R0B G;  3CC7 T;  4M7A F;  2JS2 A;  2P4R A;  1YIT A;  1KG1 A;  3FC3 A;  2O9S A;  3FJP A;  2X4Y A;  5KH6 A;  1YCY A;  2DA9 A;  4Y91 A;  2FB7 A;  4LDV A;  2EQM A;  4PJO A;  4FYX B;  1HSQ A;  3OW2 S;  5FWB A;  3PTA A;  2MAM A;  3VV0 A;  3HSB A;  5ECA A;  2XID A;  1VIE A;  1W6X A;  4HT8 A;  4KT0 E;  4M75 F;  4P5N A;  1QP2 A;  1FWZ A;  2RH2 A;  1MNE A;  2GTO A;  4N4I A;  5CVI A;  3HRS A;  2D6F A;  2X4X A;  2K5F A;  4J9E A;  1SRL A;  6AT1 B;  2RF0 A;  4J9G A;  3DB4 A;  4CC7 A;  4OF1 A;  3QKJ A;  3G6E A;  3OSV A;  3EFR A;  3QUI A;  2B86 A;  9ATC B;  2AKK A;  4M7A E;  1XTD A;  1Y71 A;  5GAO m;  2W0Z A;  2JT4 A;  3OYF A;  2SEM A;  1TUD A;  2SRC A;  1OPK A;  4XU3 A;  4C92 F;  1VQ5 Q;  2D0N A;  3CCM Q;  1RI9 A;  3OBW A;  2DXT A;  4MMK A;  3QBY A;  5FU6 C;  2XDP A;  5KE2 A;  1H3H A;  2QQS A;  5M9O A;  1VQL A;  2YLB A;  2HMA A;  1M1K C;  3SB2 A;  1QLY A;  3R6N A;  3L42 A;  4ZN3 A;  2ZAE A;  4M75 E;  2JW4 A;  2HL3 A;  1UFF A;  2M16 A;  3REA B;  2G6F X;  2CP6 A;  2GFA A;  1H3Z A;  2AZV A;  2COW A;  3PGG A;  4E7K A;  1NE8 A;  1FMV A;  5GMK l;  4PJJ A;  1Q86 U;  2V8I A;  5HK0 A;  2HZY A;  3A8L B;  4PFZ A;  1GCQ C;  4ESR A;  4OGC A;  4XTV A;  1TWB A;  4RTY A;  4IIO A;  1VQM T;  1VQO T;  4XTZ A;  1ZSZ B;  3M56 A;  2QQR A;  4WF2 A;  1JU5 C;  3M5A A;  4C92 E;  2WSE E;  2C0I A;  1KJW A;  4PLL A;  2KAF A;  4XU0 A;  1M1K R;  1S72 A;  1D1A A;  2DEQ A;  4LD9 K;  1NJI U;  2X4J A;  2BZY A;  4JPB W;  1IO6 A;  2EGA A;  3CCR A;  2DYB A;  1T0J A;  2RPN A;  1K73 C;  4BAC A;  2EW3 A;  1JQQ A;  2X35 A;  2V8J A;  2FRW A;  4E7S A;  3X25 B;  3VS4 A;  4RTV A;  4WTO B;  4M7A C;  1VQP A;  1X2Q A;  3FIF A;  3G71 T;  1K9A A;  1VYV A;  4FYW B;  4M77 G;  1KD1 C;  2HKN A;  1BI0 A;  1WHG A;  1M2V B;  4ANJ A;  3EGX A;  3C4S A;  5D7U A;  4GLK A;  4J9C A;  3CXC P;  1VUB A;  1M3C A;  2HNI A;  3LH5 A;  1VQ4 A;  3S3O A;  2ZGW A;  3PMT A;  1RUW A;  4M75 C;  3M0U A;  1WGS A;  4J83 A;  1C0M A;  3G7Z A;  3EGU A;  3CCS T;  1QWF A;  5IHK A;  1KHI A;  1D0Y A;  1K73 R;  4JZ4 A;  2DL4 A;  1JB0 E;  5IH2 A;  2JXB A;  3CC4 Q;  3FLG A;  3VYG A;  1VQ8 A;  1UTI A;  4KRT A;  3L2R A;  1U06 A;  2LQN A;  5AYF A;  5CQX A;  2X3X D;  1NLP C;  2CDT A;  2CUB A;  1KD1 R;  4F7U B;  2RNA A;  3A8M B;  3DLL A;  3ME9 A;  5I21 A;  4J8O A;  4C92 C;  1WXU A;  4KUI A;  1QP3 A;  1ZBJ A;  3CC2 A;  5EC7 A;  2KXC A;  3VYH B;  1WPY A;  2LP5 A;  8ATC B;  3JCM W;  2DVE A;  1YWO A;  2YHT A;  2CYZ B;  3CCE A;  2ZPF B;  4HA8 A;  3GLX A;  1YJN T;  1K8A C;  3JV3 A;  2J06 A;  4J5Y A;  2F5K A;  4RTU A;  3P8H A;  3UPU A;  5IHN A;  3EFO A;  4KGV B;  1A0N B;  1BCO A;  3L2Z A;  2CZ1 B;  1TXQ A;  1XQH A;  1VQ9 T;  2GFU A;  1PKT A;  2EYQ A;  1G3W A;  2OTJ Q;  5CKF A;  3LX7 A;  1OPL A;  3H8Z A;  1ZSG A;  1D0Z A;  2HQE A;  4KGX B;  3MP8 A;  5D6Y A;  3PT9 A;  1M90 C;  3ZEH A;  1ZSZ C;  2MMP A;  2HQH A;  2H3J A;  4NS5 A;  2JZ2 A;  2O2O A;  4QT7 A;  3MEW A;  1BB9 A;  2RM4 A;  1K8A R;  5CKH A;  2XD0 A;  1I4K 1;  1MMA A;  1QVF S;  3OYJ A;  3G4S Q;  2Y90 A;  2AK5 A;  1TOV A;  3C94 A;  4BE1 A;  3X26 B;  2BUD A;  1IHW A;  1AVZ C;  1MHN A;  3H0F A;  1N8R U;  1IRE B;  1GCQ A;  1SHF A;  1YI2 A;  1YHQ Q;  4PJL A;  2Z0W A;  1UEC A;  3JB9 I;  3PNW C;  3A98 A;  2KSS A;  4C0Z A;  4FYY B;  2DD4 A;  1M90 R;  4DEX A;  1JXM A;  1LPL A;  4HVU A;  3QDR B;  3J80 E;  1Q81 C;  1VIF A;  4ZTJ A;  4JJC A;  1VQN Q;  1RAC B;  3RR6 A;  2NWM A;  1OOT A;  2LJ0 A;  1SSF A;  3JCM b;  4A54 A;  1Y0M A;  3EH2 A;  3CC7 A;  2IIM A;  1W4S A;  5I11 A;  4DOW A;  2CKK A;  4ORZ A;  4M4Z A;  2YXY A;  4PKC C;  2YUO A;  2L2P A;  4M7A A;  4QVC A;  2QA4 T;  1KC8 U;  1TSF A;  1AHJ B;  5FRM A;  2COY A;  4D6W A;  4EIK A;  1YJ9 T;  3ZFJ A;  2L3P A;  4DBQ A;  2D1X A;  4HKE A;  4N0A C;  3HKS A;  2RHX A;  4OB2 B;  4Z02 A;  2YUQ A;  4LD6 A;  1DJ7 B;  5LJ5 f;  1NPP A;  1Q81 R;  2PZ1 A;  3CMA T;  3CPW P;  1VQ7 A;  3N5B B;  2FEI A;  3BDU A;  5KYU B;  3EH1 A;  4M75 A;  1KQ2 A;  5GAN 2;  2QEX A;  2QAS A;  1OI1 A;  3CCU Q;  5GAO l;  2E70 A;  1YIJ Q;  4JZ3 A;  2MYS A; 
#chains in the Genus database with same CATH homology
 1OX9 A;  2NYS A;  2QAS A;  1ZSZ B;  1OU9 A;  1TWB A;  1ZSZ A;  2QAZ A;  1OU8 A;  1OUL A;  1OX8 A;  1YFN A;  1ZSZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...