2CREA

Solution structure of rsgi ruh-036, an sh3 domain from human cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGLLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGLAPANRLQILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HEF-like protein
publication title Solution structure of RSGI RUH-036, an SH3 domain from human cDNA
rcsb
source organism Homo sapiens
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2creA00
1SPKA 1WYXA 2K2MA 4RTUA 1UGVA 1QKWA 2G6FX 2MIOA 1M3AA 5IHNA 1T3SA 1BB9A 2RF0A 2QDLA 3CQTA 2EGEA 2YUQA 2VVKA 2KNBB 3VRYA 1BU1A 1M30A 1N5ZA 2W10A 2EKHA 5I22A 2HSPA 2JS2A 2P4RA 2DMOA 1MUZA 3VS4A 5GJVB 1UECA 3REBB 1YWPA 2NWMA 2CUBA 1E6HA 2JT4A 2MOXA 2DILA 2KYBA 2V1RA 5IHIA 4JJBA 1HSQA 1ZSGA 4RTXA 1NLOC 2L2PA 1GL5A 1AWWA 2DBMA 1ARKA 2W0ZA 2KXDA 4ZNXA 2KRMA 1OEBA 2HBWA 1M3CA 2OI3A 2ED1A 3VS2A 1IO6A 2F2VA 1ZLMA 1PRLC 2L3QA 3I9QA 2LZ6B 2LCSA 3IQLA 1X2QA 2BZXA 2X3XD 1OPLA 3PVQA 2YUPA 4AFQC 4J9EA 4R0KA 1WXTA 3H0IA 1RI9A 2K7AA 2LMJA 2YUNA 2YUOA 2E5KA 1B07A 1M8MA 2LJ3A 1ABOA 4AFSC 4F17A 1Z9QA 3M0PA 2O9VA 2ENMA 3NMZC 1WA7A 1I1JA 1Z9ZA 2RQWA 2X3WD 4IIOA 2C0OA 1JO8A 1ABQA 4RTZA 1GFDA 4JZ3A 2HEQA 4AG1C 4GLMA 1YCSB 4OMPA 4RTVA 5L23A 2OAWA 3I5SA 1WXBA 1PNJA 4J9DA 1BK2A 3TSWA 3VS7A 1KIKA 3I35A 2RQRA 1WLPB 2J7IA 1SEMA 1GCQA 2J05A 2GTJA 3JV3A 2VKNA 4Z8AA 3LH5A 2KT8A 4JZ4A 4RTTA 4Z89A 1WI7A 4HVWA 2LX7A 4J9FA 4OMNA 1W1FA 4F14A 1AEYA 1K9AA 1X6BA 4E6RA 2CREA 2ECZA 2FO0A 2CT3A 1WFWA 2F2WA 2J06A 2O2OA 2DL7A 3H0HA 1V1CA 1MV3A 2ROTA 2K9GA 1VYVA 1NEGA 1U5SA 2JW4A 2GGRA 1JEGA 3PE0A 1ZX6A 1GFCA 2BZYA 1YP5A 2FEIA 1QLYA 1LCKA 1OPKA 1BBZA 2IIMA 2ROLA 4J9HA 2J6KA 2LJ0A 4OMQA 2O31A 1PKSA 4OMOA 1AZEA 5IH2A 1U3OA 4LUEA 1NLPC 1WIEA 2O9SA 1WX6A 4FSSA 4RTYA 4D8DA 1Y57A 2RN8A 4GBQA 2GNCA 1T0HA 2L3SA 1M3BA 1ZUKA 2DYBA 1YNZA 1YWOA 1T0JA 1SHFA 1QKXA 4LNPA 3THKA 5FWCA 3QWYA 3M0RA 2LJ1A 4JPBW 2KEAA 2OJ2A 2C0IA 1KJWA 2RQTA 2KGTA 2FPDA 3H0FA 1WXUA 5EC7A 2CSQA 2EVRA 1VYUA 2JTEA 2DF6A 3FJ5A 2EYYA 1HD3A 4QT7A 3C0CA 2DL4A 4LE9A 3TSZA 4CC3A 2HCKA 1E7OA 2J6OA 3SHWA 2O88A 1NG2A 1UJ0A 1YN8A 2KROA 1A0NB 2LP5A 2YSQA 2C0TA 4Y92A 3VS3A 4ESRA 1S1NA 1GCPA 1ZBJA 2DA9A 3U23A 4AFZC 1H8KA 5IXFA 4LUDA 3NGPA 2L0AA 1AD5A 3VS6A 1VA7A 4M4ZA 1CKAA 3I5RA 2RQVA 2KBTA 1UDLA 2AZVA 2J6FA 2EYWA 2RPNA 4JJCA 2JM8A 1CKBA 2CH4A 2JMCA 2DE0X 2EW3A 4X1VA 2MCNA 1AWOA 4F16A 2DLPA 4CC4B 1E6GA 1OOTA 1H3HA 1GCQC 2K6DA 1K0SA 1GBQA 1UHFA 3RNJA 4HXJA 1AOJA 3VS1A 1X6GA 2EYXA 2RNAA 2YT6A 1GBRA 2D1XA 2DNUA 2FPEA 3EG3A 1JQQA 1OV3A 1ZUUA 2A37A 4DEYA 2EGCA 3NPFA 2A36A 5ECAA 1FMKA 2KXCA 2SRCA 1CSKA 3PVLA 2DRMA 2I0NA 3RBBB 3UF4A 1W6XA 2DJQA 1PWTA 1TUDA 1PRMC 1WDXA 2DL8A 2YDLA 2AZSA 1UFFA 3EGUA 1KSWA 4AFUC 1PKTA 1G83A 1G2BA 2NUZA 1SRLA 1W70A 2EQIA 2DL5A 1EFNA 1QCFA 2D8JA 2FPFA 2D8HA 3EG2A 1UHCA 2KE9A 2KYMA 4Z88A 4J9IA 4AG2C 2JM9A 2CUDA 1PHTA 1K0XA 1I07A 4OMMA 1NYGA 1TUCA 2ESWA 3KFVA 2JMAA 2DBKA 2BTTA 5IHKA 1T3LA 1AWXA 1I0CA 2EYZA 2LQWA 3REAB 2EGAA 1J3TA 5IXBA 2A28A 2FRYA 2RMOA 2RQUA 2SEMA 3O5ZA 4IIMA 4ORZA 1B3QA 2KRSA 5HCKA 2AKLA 1AVZC 3TVTA 2H8HA 4WCIA 1TG0A 1AWJA 4KRTA 1M27C 2V1QA 4EIKA 3VS5A 3EG0A 5I11A 2CSIA 5FW9A 4HVUA 2M51A 1SHGA 1QWEA 3M0SA 1UG1A 1X43A 3UA7A 2PNIA 3EG1A 3H41A 3NHNA 1ZUYA 2A08A 1X27A 2JS0A 2CDTA 2GTOA 2FRWA 3UA6A 1RLPC 2L3PA 2K3BA 4RTWA 2PZ1A 4DEXA 2LNHB 1VYTA 2CT4A 5GJWB 3EHQA 2LQNA 2DRKA 4LN2A 5FWBA 4A63B 2D0NA 2AKKA 1UUEA 4J9GA 3A98A 1K1ZA 1U06A 2HDAA 2ABLA 4HVVA 2B86A 1GRIA 4OMLA 1SSHA 3SEMA 1NYFA 1AZGB 2DX1A 3M0UA 4JJDA 3R6NA 1UE9A 1SRMA 4J9CA 2BZ8A 2GBQA 1KFZA 2M0YA 1NEBA 1K76A 2KRNA 2ED0A 3QWXX 3VS0A 1QWFA 2KT1A 1JU5C 1UTIA 4CC2A 2F2XA 4D8KA 2K79A 2EPDA 2GQIA 1FYNA 3VRZA 2CH4W 2FG0A 1UJYA 4J9BA 3M0TA 2DM1A 2PTKA 1X2KA 2DVJA 2JXBA 1NM7A 1RUWA 3ZL7C 1X69A 1HJDA 3UATA 1RLQC 1Y0MA 1H92A 1MV0B 2DL3A 1JXOA 2EBPA 3EHRA 1XOVA 2XMFA 3GBQA 3ULRB 4CC7A 4HCKA 2VWFA 1K4US 3M0QA 4K11A 1JXMA 2AK5A 2KR3A 4RUGA
chains in the Genus database with same CATH superfamily
2IVWA 4DOWA 1SPKA 2K2MA 3BFMA 1PD1A 2E4HA 1QKWA 2G6FX 2MIOA 1M3AA 2EIFA 3CC7Q 2YHTA 1T3SA 2XDPA 1BB9A 2RF0A 2D6FA 3CQTA 2EGEA 1N27A 4C5GA 2VVKA 3VRYA 3S3OA 2HD0A 2YLCA 4M7AF 1IREB 1IGQA 1LNXA 4FU6A 3HKSA 1Y96B 3CCRT 3VS4A 2LT1A 5GJVB 4M7DG 3REBB 3PIOA 4M75B 3NTIA 4C8QC 2JT4A 1VQLA 4LD6A 4PL6A 1NLOC 3M57A 2K3XA 3BDLA 1JRIA 2QEXA 2XHCA 4QVZA 8ATCB 2M16A 4WF2A 4ZNXA 3RESA 1OEBA 3S3MA 1MHNA 2R5AA 3HTRA 4FYYB 1ZLMA 4C92A 1RAFB 1YJWA 4MZTA 2A0FB 2LCSA 2DPPB 1OU8A 1LVKA 3PVQA 1VQOT 4M77A 2QQSA 4J5YA 4R56A 3H0IA 3R6OA 1YI2A 3JCMJ 2AIRB 3G4SA 1B07A 3JSCA 4JRKA 4BI8B 3OYHA 5CCAA 3M0PA 4N0AC 1HK9A 1WA7A 2X3WD 4HA8A 4M7DA 4C92B 4ELZC 1ABQA 4RTZA 2QI2A 4JZ3A 3CCSA 4VUBA 2HEQA 4AG1C 1IHWA 3G1JA 1YCSB 1K9MU 2DZ9A 5L23A 4E7JA 1VQ5Q 4J9DA 4M77B 4B6MA 2P4TA 4IUQA 1VQLT 2J7IA 4E2FB 3JV3A 4M75F 1O75A 4QW2A 2QEXT 2QQBA 4RTTA 2GFUA 4ATOA 2O4XA 4HVWA 3MP8A 2FHDA 2F5TX 4JUVA 4PJOE 2DZCA 3OYNA 4E6RA 1YJWT 4C5EA 1IZ6A 5LJ5e 3L2RA 2O2OA 2DL7A 5C6SA 1U1TA 1MV3A 2K9GA 4BB7A 1BIBA 1NPRA 1NEGA 3OS2A 1Q7YR 2EJFA 3CC4A 2RJDA 3A8MB 4LD9K 3ME9A 1YI2T 1LCKA 3URGA 3G4ST 4B9XA 3MP1A 3CD6Q 3CCQA 5CR2A 2YRCA 2O4XB 3PT9A 1NLPC 1WIEA 2O9SA 1IRXA 3OW2S 1Y57A 2IG0A 4J83A 5GAOm 2GNCA 1T0HA 3UWNA 5LJ5h 3JB9D 5GANf 4C92F 2QQ9A 4BY6B 2OX7A 4N4IA 1PCXA 2RQTA 2KGTA 5FROA 3OYAA 2FPDA 2LX9A 1NE8A 1Q81C 4KGXB 4M77F 3V7CA 2H3JA 5EC7A 1K8AU 2QQAA 3HRUA 4M78G 3INZA 5FU6B 5GMKe 2LCCA 3CBMA 3FB9A 3SB2A 3FJ5A 1PC0A 3NTKA 1E7OA 2O88A 2GQVA 2KROA 3T9NA 4M7DF 4IKFA 2LP5A 1R0BG 1S1NA 1GCPA 3CC4T 2GFAA 4PJNA 3OBYA 5IXFA 2L0AA 4C0ZA 2RB6A 4M4ZA 5GAMe 3JCMW 4DOVA 1UDLA 2BE9B 2KQWA 3CCQT 3OYLA 2RPNA 2JM8A 3P8HA 3C12A 2CP6A 2NLUA 1NJIC 4F16A 4E7IA 1OOTA 4PFOA 3RERA 1PD0A 4C8QE 2PVDB 1AOJA 1VQNQ 2JTMA 1F1BB 4JDSA 3G6EA 3EG9A 2LQKA 2WACA 3A8OB 4C0DB 2EYXA 3I55A 3S3NA 2RNAA 4M78A 2KK4A 1QVPA 5GAMh 2VXEA 2A37A 4DEYA 2EGCA 1G3SA 2AHJB 1KD1C 3ZFJA 1FMKA 2B8AA 1VQLQ 2KXCA 2SRCA 3OYBA 1CSKA 1D0XA 3PVLA 2DRMA 5CAIA 2QEXQ 2QGFB 3UF4A 1JBMA 4AT1B 3ASKA 1TUDA 3EG9B 2VYTA 2NUZA 5LL6S 2EQIA 2DL5A 1EFNA 5GAN6 1UHCA 5FU7B 3H8ZA 1G3WA 3JCMV 1I07A 1NYGA 1TUCA 5DLOA 5A2QE 3KFVA 2JMAA 5CKFA 2DBKA 4ZTFA 3J80E 3REAB 2MK5A 5IXBA 1YI2Q 1I5OB 3WVDB 1VIEA 2KY9A 9ATCB 2RQUA 4Z02A 3QDRB 4IIMA 5AYFA 3LYIA 3TVTA 2QA4A 1Q86C 1TG0A 1WHJA 2QAZA 5KYWA 3VU3C 3DLLA 3G6ET 3EGDA 2RI3A 1K9MR 2GF7A 1N9RA 3PFSA 3S6WA 2M51A 5GMKi 2F69A 1WHHA 2PNIA 3H41A 2A08A 1X27A 1I4K1 2QYZA 4RG2A 5DM7R 3OMGA 1YJNA 2VGNA 3E9FA 1S72A 3UA6A 1N6AA 2K3BA 4RTWA 4DEXA 3OMCA 2PUKB 2CKKA 2ZPGB 3PGGA 5GAN8 2D0NA 3NTHA 4ME7A 2NYSA 2WSEE 1K1ZA 3FDRA 5KYWB 4HVVA 5D7UA 3M4YA 1Y07A 3CPWS 3M0UA 4JJDA 3M9QA 3R6NA 3DB4A 2BZ8A 2GBQA 3TREA 5FRNA 3CCVA 4L6V5 3CCJQ 4M78F 4M7AG 2KT1A 2DJZA 2F2XA 3OYEA 2GQIA 3TQ7P 1TXQA 2RHXA 4B9WA 4DQ2A 2FZKB 4JS5A 3CCQQ 1D1AA 1KK7A 3ZL7C 2QA4T 4LDYA 3HRTA 4KBMB 4FCYA 3TEEA 4EMKB 2X35A 3OYJA 1C6VX 1K73C 3X20B 2E3IA 3J7AF 2RJFA 3OS1A 1JXMA 3QG1A 1WYXA 2JVVA 1UGQB 1UGVA 4EPCA 1YJNT 5IHNA 1D0YA 1GXIE 2AT1B 1K8AR 1U1SA 1VQPQ 2E1HA 3SWNC 3JCMf 3KXTA 4XU0A 4C5IA 3OB9A 1M30A 1N5ZA 3UT1A 2W10A 1TUGB 2EKHA 3L42A 5KH6A 2JS2A 2DMOA 4FW1A 1BKBA 3CMEQ 1UECA 1D1BA 2MOXA 2K3YA 5IHIA 1FWZA 5GANe 4M7AC 4ANJA 2L2PA 3CCUT 4UC4A 4MDWA 3CCVT 1GL5A 5CKEA 4E7ZA 1D3BA 3V7SA 4RCBA 2W0ZA 1TOVA 2KXDA 4A4HA 3JCMP 2NUPA 3A8LB 2X51A 3VS2A 2ZPIB 2E41A 4PJOA 2K57A 3L2WA 2CZ6B 2ZZDA 3GP8A 4M75G 3RKYA 2LZ6B 3IQLA 4L59A 1OPLA 1MGQA 5GANh 3G71Q 1UGRB 4J9EA 3RKXA 4FYVB 2DIQA 2LMJA 2YUOA 1ZSZA 3G6EQ 2D9TA 4XQ3A 1M1KC 1UGPB 4IUTA 1D3BB 2V26A 5LJ3f 1KQSP 2XI9A 2MMPA 2O9VA 3GOXA 1Z9ZA 1I1JA 2RQWA 2EQMA 4IIOA 2NUPB 3EH2A 2C0OA 5GMKm 2PVOB 3F70A 4PJOB 4WTOB 4D6WA 4ZN1A 5GAMj 3J81E 3RKWA 4ZTJA 4OMPA 1KG1A 1VQ8A 1QP3A 2OAWA 4OMFB 1M9SA 5CQXA 1YFNA 5GAN7 3HSBA 4KGVB 3I35A 2RQRA 1WLPB 3G7ZA 1GCQA 2J05A 2VKNA 3QXEB 3C4SA 2VUBA 1ZA1B 3LH5A 2KT8A 1O9SA 1LPLA 3OYIA 1YHQA 5CVIA 3SD4A 2PQWA 3LLRA 1KC8C 3AT1B 1AEYA 3CC2A 1K9AA 1TWBA 4ZN3A 1X6BA 4XTZA 1M8VA 3X25B 4XU2A 2HL3A 5D6XA 3EFOA 2F2WA 3EAEA 3H0HA 1Q82C 1V1CA 4M77G 4MDXA 1UGSB 2KI7A 2BE7D 1M90U 4EMGA 2LQ8A 3EGXA 2YLBA 4PKCC 4FM4B 1JEGA 3OYMA 2F5KA 2BZYA 1YP5A 2OTLA 1BBZA 2ROLA 1YJ9Q 4QQ6A 1AT1B 4R55A 2I2LA 1PKSA 4OMOA 1AZEA 1XNIA 1U3OA 4LUEA 3RMQA 4A54A 2VV5A 4FSSA 1WX6A 4RTYA 1LOJA 1YITA 1M3BA 2DYBA 3PMIA 1T0JA 2LNVA 4J6XA 1QKXA 3C94A 3EFOB 2CZ0B 2Z0WA 3NFCA 4PJOF 1PSEA 2LJ1A 1OZ2A 2A7YA 4JPBW 3X26B 1VQ8T 2E70A 4C8QA 1OU9A 1DJ7B 3QSUA 2JNGA 4L5GA 3EGXB 3HP9A 4MZMA 3H0FA 2L5QA 4OVAA 4BI4A 2EQJA 1W2BS 4C92C 1WXUA 2CSQA 3SFMA 1WQWA 3GLXA 1VYUA 2RH2A 2E5QA 3CCUQ 4KH0B 2E10A 2EYYA 2DXUA 1HD3A 2K2VA 1TSFA 1BI2A 2CGHA 3PTAA 3CC2T 3RR6A 5KE2A 1B34B 2LT4A 1ZHIA 2HCKA 2ZPHB 2J6OA 3QBYA 2COZA 5GAN5 1IXDA 1UJ0A 2RK2A 1G3TA 4Y92A 4ESRA 4C8QB 1ZBJA 2DA9A 5CKHA 1VQKA 1VQ7Q 3CMAA 3U23A 4OB1B 4AFZC 2JTFA 4XTYA 1JB0E 1V76A 4M7DC 2Y4XA 2CP5A 2KBTA 2AZVA 2J6FA 3H6ZA 2LCLA 2P0PA 2LC4A 2PU9B 4X1VA 4X9CA 2MCNA 2DLPA 2OTJA 3CPWA 4IUPA 3HRSA 4CC4B 1E6GA 2DAQA 1X6OA 4J6WA 1N8RU 1K0SA 1GBQA 1UHFA 4NOYA 2CZ7B 3MJXA 1WGSA 1H641 1YCYA 2D1XA 2DNUA 3RMSA 4P5NA 2QGGA 1ZUUA 3GIBA 3L1AA 2YWWA 2A36A 5ECAA 1JJ2P 2RHYA 2ZGWA 4PNOA 3CCMA 3E1SA 3Q1JA 4FSXA 1VQ6Q 2I0NA 2X4YA 3I56Q 1FX7A 1W6XA 1PWTA 2CS7A 5M9OA 2YDLA 3LGFA 2AZSA 4ELYC 1RL2A 4J8OA 4FYXB 1RAEB 1KSWA 2DEUA 4AFUC 3JCMe 3M56A 2P0KA 1G2BA 3HFNA 1VQKT 3CMAT 5LJ5g 3EG2A 4C8QF 2JM9A 1PHTA 1Q7YC 3BY7A 3CCST 3C95A 1K0XA 2XD0A 2ESWA 2DFUA 1MNEA 5IHKA 2EGAA 1J3TA 2A28A 1QMCA 2ZPFB 4PK4A 4QQDA 3L2QA 5KYXA 3CXCS 2RMOA 5D6WA 3CCRQ 2KRSA 5EG2A 2OTJT 4HCCA 2NUTA 1AWJA 2WSCE 3JCMh 2X9HA 3EG0A 1QCOA 3VUZA 5I11A 4J6YA 4QQGA 4RCCA 1QWEA 1MMAA 4BACA 2HKNA 1VQ8Q 4JRIA 2JS0A 1I5LA 3CCMT 1VQ9A 2VASA 4C0DC 2QTXA 1VYTA 2KSSA 5KYXB 3OYCA 3FC3A 3JB9G 2CT4A 3EHQA 2LQNA 5LJ3e 1EIFA 2AKKA 2NUTB 5GMKh 1VQOQ 2B86A 4E7KA 4BE2A 2EWNA 1AZGB 3V8JA 3X24B 2MYSA 1UE9A 2VXFA 4J9CA 3UPUA 1M90R 1RACB 1G3YA 1HYOA 2M0YA 1NPPA 1NEBA 2ED0A 3QWXX 3VS0A 1QWFA 2V8JA 2DK3A 1Y7XA 4KGZB 3PNWC 4X34A 1QVFA 3MEWA 4HCZA 2DM1A 4A4KA 1X2KA 2DVJA 4M78C 5LJ3h 5GAMg 1NM7A 3UATA 1ZQ1A 1Y0MA 2DTOA 1H92A 5IAYA 3JCMb 4FYWB 3CCEA 1ACMB 2HNIA 1XOVA 5LJ5d 1QVGS 3PIPA 2XMFA 2CP7A 3GBQA 3ULRB 3OYDA 2VWFA 1K4US 4K11A 3JB9J 1OULA 4RUGA 2FVUA 1YIJA 1D09B 4RTUA 2RK1A 5L8RE 1YJWQ 3OYGA 1H3ZA 2QDLA 1VQ9T 2DD5A 1X01A 2GCXA 4A4GA 1BU1A 1MMNA 1M2VA 1RADB 4FL6A 5IN1A 2VB6A 2O01E 2HSPA 1PSFA 1MUZA 3DLMA 2P0QA 4F7UE 4A4FA 2ZPEB 4Y28E 4DA4A 1YWPA 2NWMA 4M7DE 1E6HA 3G4SQ 1RAHB 4N4GA 3GNGA 2KYBA 1VQMA 3JCMQ 3L2VA 2EFIA 1C1AA 4JLIA 3D7SB 3M53A 3CCLA 2DERA 3L2ZA 2KRMA 2RHIA 3I55T 2HBWA 2MAMA 2H3EB 2EAYA 4PLIA 3QYGB 4PLLA 2OI3A 3GF5A 4XTWA 1R8OB 1Q95G 3CCSQ 2F2VA 3CC7A 3QHSA 3JB9I 3LWIA 1M2VB 2L3QA 1OYXA 1FXXA 4QVCA 2BZXA 1OQKA 3E19A 4M7AD 2CZ1B 3CCET 2QASA 5HK0A 1W2BA 1N8RR 2FZGB 2V8IA 4IURA 3PMTA 2K7AA 2YUNA 2HKQB 2E5KA 1M8MA 1ABOA 4F17A 1Z9QA 1K9MC 1YIJT 4DBQA 2QXFA 1BYMA 4EMKA 2HBPA 2R5MA 2ENMA 3NMZC 3MP6A 5GAMd 4BDZA 5CO7A 4FW2A 2XDBA 3GPLA 1JO8A 2YXYA 3OYKA 2E6ZA 2EYQA 4II1A 4XTUA 4GLMA 2JN0A 5FLXE 3CC4Q 3KUFA 4MMKA 4RTVA 3LWHA 2JOYA 3VJPA 1PNJA 2LVMA 1KQSS 3TSWA 4J7IA 1VQMT 1SEMA 2GTJA 4Z8AA 1BI3A 2RD1A 4IUUA 1VQ4A 1BIAA 4Z89A 3CCLT 4PJOG 4XU1A 1W1FA 3JB9F 2P84A 3HHTB 4OF1A 2RHUA 3CC7T 2FO0A 4BDYA 5HY6A 1WZOA 5LJ5j 1QCNA 3GNFB 2QTVA 4E7HA 1VYVA 4RMOA 2E6NA 4Q5WA 1S72T 5KYUA 2EJGA 2GGRA 3M5AA 2E3HA 1WHLA 1GFCA 2FEIA 1VQ5A 1QLYA 4E7LA 2IIMA 4PFZA 4J9HA 2J6KA 3BE3A 2XG8D 4LDVA 5KYNA 2LJ0A 2MWPA 2OAUA 2O31A 4M75D 4XK8E 5IH2A 5IT9E 3SWNA 2YRDA 1M1FA 2A3LA 3H9NA 4GBQA 2L3SA 1UEBA 2HQXA 1YNZA 2L89A 1YWOA 3FJPA 5GAN2 4YTLA 3OW2A 4LNPA 1K8AC 1PM3A 1VQ9Q 3JB9H 3M0RA 2C06A 8AT1B 2KEAA 4DBRA 5KYUB 2C0IA 2DETA 4TVRA 5GAN4 5HKCA 3CXCA 1VQ4T 2EVRA 1W4SA 5GMKj 4M78E 2DF6A 3QJYA 3SWNB 3CD6A 3OYFA 5GANg 1WHGA 3OA6A 4KUDK 3C0CA 4J7FA 3QJ6A 4LE9A 2DD4A 1Q81U 2BUDA 1NG2A 3I55Q 1ZSZC 3CPWP 1A0NB 1WPYA 2YSQA 2C0TA 3VS3A 4C92D 2XU8A 4KH1B 4BI3A 1H8KA 4V2SA 3P8DA 3NGPA 1AD5A 4QVDA 3VS6A 4X9DA 1NBEB 3CCEQ 2EJ9A 1CKAA 5LJ3j 2EYWA 3MPUB 4M77D 4JJCA 1CKBA 2JMCA 2EW3A 2F1LA 1PG5B 5GAOn 1AWOA 4C8QG 1GCQC 4OB2B 3VS1A 2YT6A 2MPXC 4M7DD 3WVEB 2LDMA 4M75C 2E12A 5FRMA 1NJIU 3MHXA 1JQQA 4NL3A 2HL5C 4OGEA 3NPFA 1MNDA 3OS5A 1VQMQ 2JZ2A 3CD6T 2QA4Q 4RG8A 1G8XA 1QVGA 4ZGDB 2DJQA 5J26A 2IPOB 3EGUA 1KD1U 1M4ZA 2DTIA 3FLGA 4OB3B 2M0OA 5GAOp 1SRLA 1JJ2S 4PJJA 1VQNA 3LGLA 2FL7A 4PJLA 4NS5A 4F04B 1QCFA 2D8JA 2FPFA 3A8GB 2D8HA 1B34A 1G5VA 4J9IA 1YJNQ 2CUDA 1S72Q 2HQHA 3ZEHA 5GANd 4E7SA 4F7UG 1TS9A 2VC8A 3JRZA 3META 1M5Q1 1RAAB 1T3LA 1AWXA 1I0CA 2BKDN 2EYZA 3QZ5B 2HAXA 2RI5A 2SEMA 5KE3A 3O5ZA 1Y71A 1BI1A 4ORZA 5HCKA 2AKLA 1AVZC 5HK3A 1FMWA 2PUOB 4EIKA 1YHQT 2R58A 3CEYA 3CCVQ 2CSIA 1SHGA 4M77C 4XU3A 1X43A 3UA7A 2KVQG 3EG1A 3OYYA 3NHNA 1ZUYA 7AT1B 1Q86U 1KQ2A 2CDTA 2FRWA 2Y90A 1RLPC 2L3PA 2M9UA 2PZ1A 4BUGA 2LNHB 4JS4A 1VQ4Q 1QVFP 5GMKl 2DRKA 2OTLT 4N0AA 1I81A 2E64A 1UUEA 3FEOA 1U06A 3L2UA 1GRIA 3M59A 2ATCB 1NYFA 2MF2A 3V8LA 3JAME 4F7UA 2DX1A 5I2MA 1VQNT 1KHIA 5DLQE 1SRMA 1YITT 4CRIA 1KFZA 4N4HA 4CC2A 4D8KA 2QG9B 2CYZB 5I2SA 4LDXA 3OBWA 4M7AE 2K4YA 3OS0A 2FG0A 3QZ9B 1R77A 2RJEA 3M54A 4J9BA 3HPWA 2PTKA 3M0TA 4A53A 3X28B 2JXBA 4ZGEB 1BCOA 1RUWA 4HKEA 1X69A 1KQSA 3DKMA 1MV0B 3EFRA 4BY6C 1IHVA 4HT9A 4HCKA 4FIBA 4F7UB 3QDFA 3M0QA 3VYHB 4M7DB 1MMDA 1LJOA 2JUFA 3A8HB 3P8BB 3RUXA 2G3RA 3CCJA 5FU6C 4M78D 5KYYA 2ZCFB 1K73U 2YUQA 2E65A 1U8RA 2KNBB 6AT1B 3QIIA 3LX7A 3OSSC 5I22A 2P4RA 3AHUA 1Q81R 2FYKA 4BE0A 2K5LA 2CUBA 2DILA 3LW5E 1W2BP 2V1RA 4JJBA 5GANj 1HSQA 1ZSGA 4RTXA 2RA2A 3QO3A 3JCMX 3RDVA 1AWWA 1N9SA 1OZ3A 2DBMA 1ARKA 2Y4YA 2M02A 3JCMg 3KBGA 5KYYB 1M3CA 2QQRA 2ED1A 1IO6A 1PRLC 1VQPA 3I9QA 4M75E 1X2QA 2X3XD 2PVGB 2COYA 2YUPA 1SG5A 4AFQC 4LDUA 4R0KA 1WXTA 3OY9A 3CMEA 1RI9A 3V8KA 2KDSA 4HCBA 3OSVA 1WNLA 4F7UF 1YHQQ 2LJ3A 4AFSC 2VGMA 1YBYA 4MMLA 1NJIR 3CC2Q 4QKUA 3CCJT 1M1GA 2M1HA 1OX9A 3E9GA 1XQHA 3MKDA 5A0GA 1GFDA 1SF9A 3MEVA 4JLGA 3QYHB 1M1KU 3VUBA 3EH1A 4RKUE 3I5SA 2EQKA 3FRNA 1WXBA 2OTLQ 3N5BB 4O5VA 1XJWB 1KD1R 1BK2A 3VS7A 1KIKA 1MMGA 5LJ3g 2HMAA 3G71A 5FU7C 1P92A 3SDZA 5GAOr 2XDDA 4JZ4A 4CI0C 1WI7A 3UDCA 1M90C 2LX7A 4J9FA 1YITQ 4OMNA 4C92E 4F14A 5I21A 2FZCB 2CREA 2DKGA 2ECZA 3MEUA 4JJNK 2CT3A 4KULA 1WFWA 1VQPT 2J06A 1VIFA 1SSFA 1TU0B 2ROTA 3OW2P 5C0MA 4M77E 1U5SA 2JW4A 1WHMA 2RHZA 1KC8U 4FT4A 2ZPBB 3PE0A 4FT2A 1ZX6A 3CMET 1TH7A 1HXDA 3JCMd 1OPKA 5GAOl 4BE1A 4C0GA 5A0DA 4EDUA 4OMQA 2X4WA 5CKDA 1Q82U 1VUBA 2DXBA 3HFOA 3CXCP 5CQYA 3M55A 1Q86R 4D8DA 2ZAEA 2DXCA 2RN8A 4M78B 3CBOA 1ZUKA 1IGUA 1SHFA 1JJ2A 3VV0A 1QQJA 3THKA 4JRQA 3V7RA 1BCMA 1NZ9A 3QWYA 5FWCA 1VQKQ 3CMAQ 3HL8A 5KCHA 2DO3A 2OJ2A 2MWOA 1KJWA 4OB0B 2DXTA 3G71T 3A1PA 4HT8A 3BDUA 3VKIA 2KMTA 1YJ9A 3M4GA 2JTEA 5GAN3 2OTJQ 3ZBDA 3O8VA 4QT7A 2DVEA 2DL4A 5DY9A 3TSZA 4CC3A 3VYGA 3SHWA 1V29B 1YN8A 2X4JA 5LJ3d 4EMKC 2K5IA 5KCOA 3JCMc 4PJOD 2YRVA 1X75C 3CBPA 1D1CA 4KT0E 4LUDA 1VA7A 1OX8A 1N8RC 3CCMQ 3I5RA 2RQVA 1XTDA 4KUIA 1D0ZA 5GAOq 4PFPA 3MEAA 2DEQA 4LXCA 2RJCA 3A5ZB 3EGDB 2CH4A 1WJQA 2WSFE 2DE0X 5CIUA 1C0MA 3CCUA 1K73R 2V8KA 4NL2A 1VOMA 1H3HA 1QVGP 2K6DA 2JJ9A 4IUVA 1QP2A 3RNJA 4HXJA 2COWA 1TTHB 4Y91A 1X6GA 3RIRA 2MI6A 3OQ5A 1GBRA 4A4EA 4PJMA 5J39A 1SKUB 2FPEA 3CPFA 3EG3A 1OV3A 2L3RA 1VQ7A 2CP3A 1IB8A 3M58A 5LJ5f 2BIVA 4XTVA 1YJ9T 3QUIA 4ZGJB 1RAGB 1WJSA 1UB4A 1RAIB 3ER0A 3RBBB 2RI2A 1PRMC 1WDXA 2DL8A 1ZA2B 4GLKA 1UFFA 2DIGA 1PKTA 2XICA 1B7TA 1R0CB 1G83A 4OGCA 2XK0A 1W70A 3TCJA 4JRPA 1WHKA 5J3BA 2R57A 2K5FA 4Z88A 2KE9A 2KYMA 4AG2C 1EZZB 4EMHA 3FIFA 2QK0A 2RO0A 3DB3A 4OP0A 4OMMA 2QDYB 2HZYA 2BTTA 2LQWA 4M7AA 2FRYA 1I8FA 1FMVA 1KHCA 1RABB 2XIDA 3BW1A 1B3QA 3TU4K 1AHJB 1VQ6A 2L8DA 1Q7YU 4PJOC 5CKBA 4BD3A 2H8HA 4WCIA 1WJRA 3I56A 4KRTA 4XTXA 1M27C 2V1QA 3VS5A 2HSEB 2RM4A 3LH0A 4LDWA 2EQUA 4E47A 1M1KR 5D6YA 5FW9A 4HVUA 4DBFA 2CP2A 2D0QB 1M2OA 3M0SA 1UG1A 2HQEA 1VQ7T 4C8QD 3WXMB 2GTOA 3QKJA 4M7AB 4GY5A 5GJWB 1VQ5T 3EFSA 4LN2A 5FWBA 4A63B 2LTOA 4C5HA 4J9GA 3CCRA 3A98A 4C0FA 2HDAA 2ABLA 5GAMf 4DBHA 4OMLA 1SSHA 5AT1B 3SEMA 1YIJQ 3MO8A 1KC8R 1K76A 2KRNA 1QW1A 1JU5C 1UTIA 4O6JA 2K79A 1QVFS 2EPDA 1FYNA 3VRZA 3MCAB 2CH4W 2DTHA 1Q82R 1UJYA 4MZPA 1OI1A 1KQ1A 1BI0A 5A0LA 2FB7A 1ZSZB 1HJDA 1VQ6T 1RLQC 2XKOC 1Y96A 5CK9A 2DL3A 1JXOA 4AMCA 3I56T 2EBPA 2LRQA 1ZBXA 3EHRA 2DYIA 4C92G 1VQOA 2X4XA 2EKOA 4M75A 1EX4A 3QPHA 4XAXB 4CC7A 1RI0A 1WQ7A 2AK5A 2CP0A 3E2UA 3CCLQ 2KR3A 2KAFA
chains in the Genus database with same CATH topology
1SPKA 1WYXA 2K2MA 4RTUA 1UGVA 1QKWA 2G6FX 2MIOA 1M3AA 5IHNA 1T3SA 1BB9A 2RF0A 2QDLA 3CQTA 2EGEA 2YUQA 2VVKA 2KNBB 3VRYA 1BU1A 1M30A 1N5ZA 2W10A 2EKHA 5I22A 2HSPA 2JS2A 2P4RA 2DMOA 1MUZA 3VS4A 5GJVB 1UECA 3REBB 1YWPA 2NWMA 2CUBA 1E6HA 2JT4A 2MOXA 2DILA 2KYBA 2V1RA 5IHIA 4JJBA 1HSQA 1ZSGA 4RTXA 1NLOC 2L2PA 1GL5A 1AWWA 2DBMA 1ARKA 2W0ZA 2KXDA 4ZNXA 2KRMA 1OEBA 2HBWA 1M3CA 2OI3A 2ED1A 3VS2A 1IO6A 2F2VA 1ZLMA 1PRLC 2L3QA 3I9QA 2LZ6B 2LCSA 3IQLA 1X2QA 2BZXA 2X3XD 1OPLA 3PVQA 2YUPA 4AFQC 4J9EA 4R0KA 1WXTA 3H0IA 1RI9A 2K7AA 2LMJA 2YUNA 2YUOA 2E5KA 1B07A 1M8MA 2LJ3A 1ABOA 4AFSC 4F17A 1Z9QA 3M0PA 2O9VA 2ENMA 3NMZC 1WA7A 1I1JA 1Z9ZA 2RQWA 2X3WD 4IIOA 2C0OA 1JO8A 1ABQA 4RTZA 1GFDA 4JZ3A 2HEQA 4AG1C 4GLMA 1YCSB 4OMPA 4RTVA 5L23A 2OAWA 3I5SA 1WXBA 1PNJA 4J9DA 1BK2A 3TSWA 3VS7A 1KIKA 3I35A 2RQRA 1WLPB 2J7IA 1SEMA 1GCQA 2J05A 2GTJA 3JV3A 2VKNA 4Z8AA 3LH5A 2KT8A 4JZ4A 4RTTA 4Z89A 1WI7A 4HVWA 2LX7A 4J9FA 4OMNA 1W1FA 4F14A 1AEYA 1K9AA 1X6BA 4E6RA 2CREA 2ECZA 2FO0A 2CT3A 1WFWA 2F2WA 2J06A 2O2OA 2DL7A 3H0HA 1V1CA 1MV3A 2ROTA 2K9GA 1VYVA 1NEGA 1U5SA 2JW4A 2GGRA 1JEGA 3PE0A 1ZX6A 1GFCA 2BZYA 1YP5A 2FEIA 1QLYA 1LCKA 1OPKA 1BBZA 2IIMA 2ROLA 4J9HA 2J6KA 2LJ0A 4OMQA 2O31A 1PKSA 4OMOA 1AZEA 5IH2A 1U3OA 4LUEA 1NLPC 1WIEA 2O9SA 1WX6A 4FSSA 4RTYA 4D8DA 1Y57A 2RN8A 4GBQA 2GNCA 1T0HA 2L3SA 1M3BA 1ZUKA 2DYBA 1YNZA 1YWOA 1T0JA 1SHFA 1QKXA 4LNPA 3THKA 5FWCA 3QWYA 3M0RA 2LJ1A 4JPBW 2KEAA 2OJ2A 2C0IA 1KJWA 2RQTA 2KGTA 2FPDA 3H0FA 1WXUA 5EC7A 2CSQA 2EVRA 1VYUA 2JTEA 2DF6A 3FJ5A 2EYYA 1HD3A 4QT7A 3C0CA 2DL4A 4LE9A 3TSZA 4CC3A 2HCKA 1E7OA 2J6OA 3SHWA 2O88A 1NG2A 1UJ0A 1YN8A 2KROA 1A0NB 2LP5A 2YSQA 2C0TA 4Y92A 3VS3A 4ESRA 1S1NA 1GCPA 1ZBJA 2DA9A 3U23A 4AFZC 1H8KA 5IXFA 4LUDA 3NGPA 2L0AA 1AD5A 3VS6A 1VA7A 4M4ZA 1CKAA 3I5RA 2RQVA 2KBTA 1UDLA 2AZVA 2J6FA 2EYWA 2RPNA 4JJCA 2JM8A 1CKBA 2CH4A 2JMCA 2DE0X 2EW3A 4X1VA 2MCNA 1AWOA 4F16A 2DLPA 4CC4B 1E6GA 1OOTA 1H3HA 1GCQC 2K6DA 1K0SA 1GBQA 1UHFA 3RNJA 4HXJA 1AOJA 3VS1A 1X6GA 2EYXA 2RNAA 2YT6A 1GBRA 2D1XA 2DNUA 2FPEA 3EG3A 1JQQA 1OV3A 1ZUUA 2A37A 4DEYA 2EGCA 3NPFA 2A36A 5ECAA 1FMKA 2KXCA 2SRCA 1CSKA 3PVLA 2DRMA 2I0NA 3RBBB 3UF4A 1W6XA 2DJQA 1PWTA 1TUDA 1PRMC 1WDXA 2DL8A 2YDLA 2AZSA 1UFFA 3EGUA 1KSWA 4AFUC 1PKTA 1G83A 1G2BA 2NUZA 1SRLA 1W70A 2EQIA 2DL5A 1EFNA 1QCFA 2D8JA 2FPFA 2D8HA 3EG2A 1UHCA 2KE9A 2KYMA 4Z88A 4J9IA 4AG2C 2JM9A 2CUDA 1PHTA 1K0XA 1I07A 4OMMA 1NYGA 1TUCA 2ESWA 3KFVA 2JMAA 2DBKA 2BTTA 5IHKA 1T3LA 1AWXA 1I0CA 2EYZA 2LQWA 3REAB 2EGAA 1J3TA 5IXBA 2A28A 2FRYA 2RMOA 2RQUA 2SEMA 3O5ZA 4IIMA 4ORZA 1B3QA 2KRSA 5HCKA 2AKLA 1AVZC 3TVTA 2H8HA 4WCIA 1TG0A 1AWJA 4KRTA 1M27C 2V1QA 4EIKA 3VS5A 3EG0A 5I11A 2CSIA 5FW9A 4HVUA 2M51A 1SHGA 1QWEA 3M0SA 1UG1A 1X43A 3UA7A 2PNIA 3EG1A 3H41A 3NHNA 1ZUYA 2A08A 1X27A 2JS0A 2CDTA 2GTOA 2FRWA 3UA6A 1RLPC 2L3PA 2K3BA 4RTWA 2PZ1A 4DEXA 2LNHB 1VYTA 2CT4A 5GJWB 3EHQA 2LQNA 2DRKA 4LN2A 5FWBA 4A63B 2D0NA 2AKKA 1UUEA 4J9GA 3A98A 1K1ZA 1U06A 2HDAA 2ABLA 4HVVA 2B86A 1GRIA 4OMLA 1SSHA 3SEMA 1NYFA 1AZGB 2DX1A 3M0UA 4JJDA 3R6NA 1UE9A 1SRMA 4J9CA 2BZ8A 2GBQA 1KFZA 2M0YA 1NEBA 1K76A 2KRNA 2ED0A 3QWXX 3VS0A 1QWFA 2KT1A 1JU5C 1UTIA 4CC2A 2F2XA 4D8KA 2K79A 2EPDA 2GQIA 1FYNA 3VRZA 2CH4W 2FG0A 1UJYA 4J9BA 3M0TA 2DM1A 2PTKA 1X2KA 2DVJA 2JXBA 1NM7A 1RUWA 3ZL7C 1X69A 1HJDA 3UATA 1RLQC 1Y0MA 1H92A 1MV0B 2DL3A 1JXOA 2EBPA 3EHRA 1XOVA 2XMFA 3GBQA 3ULRB 4CC7A 4HCKA 2VWFA 1K4US 3M0QA 4K11A 1JXMA 2AK5A 2KR3A 4RUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPK A;  1WYX A;  2K2M A;  4RTU A;  1UGV A;  1QKW A;  2G6F X;  2MIO A;  1M3A A;  5IHN A;  1T3S A;  1BB9 A;  2RF0 A;  2QDL A;  3CQT A;  2EGE A;  2YUQ A;  2VVK A;  2KNB B;  3VRY A;  1BU1 A;  1M30 A;  1N5Z A;  2W10 A;  2EKH A;  5I22 A;  2HSP A;  2JS2 A;  2P4R A;  2DMO A;  1MUZ A;  3VS4 A;  5GJV B;  1UEC A;  3REB B;  1YWP A;  2NWM A;  2CUB A;  1E6H A;  2JT4 A;  2MOX A;  2DIL A;  2KYB A;  2V1R A;  5IHI A;  4JJB A;  1HSQ A;  1ZSG A;  4RTX A;  1NLO C;  2L2P A;  1GL5 A;  1AWW A;  2DBM A;  1ARK A;  2W0Z A;  2KXD A;  4ZNX A;  2KRM A;  1OEB A;  2HBW A;  1M3C A;  2OI3 A;  2ED1 A;  3VS2 A;  1IO6 A;  2F2V A;  1ZLM A;  1PRL C;  2L3Q A;  3I9Q A;  2LZ6 B;  2LCS A;  3IQL A;  1X2Q A;  2BZX A;  2X3X D;  1OPL A;  3PVQ A;  2YUP A;  4AFQ C;  4J9E A;  4R0K A;  1WXT A;  3H0I A;  1RI9 A;  2K7A A;  2LMJ A;  2YUN A;  2YUO A;  2E5K A;  1B07 A;  1M8M A;  2LJ3 A;  1ABO A;  4AFS C;  4F17 A;  1Z9Q A;  3M0P A;  2O9V A;  2ENM A;  3NMZ C;  1WA7 A;  1I1J A;  1Z9Z A;  2RQW A;  2X3W D;  4IIO A;  2C0O A;  1JO8 A;  1ABQ A;  4RTZ A;  1GFD A;  4JZ3 A;  2HEQ A;  4AG1 C;  4GLM A;  1YCS B;  4OMP A;  4RTV A;  5L23 A;  2OAW A;  3I5S A;  1WXB A;  1PNJ A;  4J9D A;  1BK2 A;  3TSW A;  3VS7 A;  1KIK A;  3I35 A;  2RQR A;  1WLP B;  2J7I A;  1SEM A;  1GCQ A;  2J05 A;  2GTJ A;  3JV3 A;  2VKN A;  4Z8A A;  3LH5 A;  2KT8 A;  4JZ4 A;  4RTT A;  4Z89 A;  1WI7 A;  4HVW A;  2LX7 A;  4J9F A;  4OMN A;  1W1F A;  4F14 A;  1AEY A;  1K9A A;  1X6B A;  4E6R A;  2CRE A;  2ECZ A;  2FO0 A;  2CT3 A;  1WFW A;  2F2W A;  2J06 A;  2O2O A;  2DL7 A;  3H0H A;  1V1C A;  1MV3 A;  2ROT A;  2K9G A;  1VYV A;  1NEG A;  1U5S A;  2JW4 A;  2GGR A;  1JEG A;  3PE0 A;  1ZX6 A;  1GFC A;  2BZY A;  1YP5 A;  2FEI A;  1QLY A;  1LCK A;  1OPK A;  1BBZ A;  2IIM A;  2ROL A;  4J9H A;  2J6K A;  2LJ0 A;  4OMQ A;  2O31 A;  1PKS A;  4OMO A;  1AZE A;  5IH2 A;  1U3O A;  4LUE A;  1NLP C;  1WIE A;  2O9S A;  1WX6 A;  4FSS A;  4RTY A;  4D8D A;  1Y57 A;  2RN8 A;  4GBQ A;  2GNC A;  1T0H A;  2L3S A;  1M3B A;  1ZUK A;  2DYB A;  1YNZ A;  1YWO A;  1T0J A;  1SHF A;  1QKX A;  4LNP A;  3THK A;  5FWC A;  3QWY A;  3M0R A;  2LJ1 A;  4JPB W;  2KEA A;  2OJ2 A;  2C0I A;  1KJW A;  2RQT A;  2KGT A;  2FPD A;  3H0F A;  1WXU A;  5EC7 A;  2CSQ A;  2EVR A;  1VYU A;  2JTE A;  2DF6 A;  3FJ5 A;  2EYY A;  1HD3 A;  4QT7 A;  3C0C A;  2DL4 A;  4LE9 A;  3TSZ A;  4CC3 A;  2HCK A;  1E7O A;  2J6O A;  3SHW A;  2O88 A;  1NG2 A;  1UJ0 A;  1YN8 A;  2KRO A;  1A0N B;  2LP5 A;  2YSQ A;  2C0T A;  4Y92 A;  3VS3 A;  4ESR A;  1S1N A;  1GCP A;  1ZBJ A;  2DA9 A;  3U23 A;  4AFZ C;  1H8K A;  5IXF A;  4LUD A;  3NGP A;  2L0A A;  1AD5 A;  3VS6 A;  1VA7 A;  4M4Z A;  1CKA A;  3I5R A;  2RQV A;  2KBT A;  1UDL A;  2AZV A;  2J6F A;  2EYW A;  2RPN A;  4JJC A;  2JM8 A;  1CKB A;  2CH4 A;  2JMC A;  2DE0 X;  2EW3 A;  4X1V A;  2MCN A;  1AWO A;  4F16 A;  2DLP A;  4CC4 B;  1E6G A;  1OOT A;  1H3H A;  1GCQ C;  2K6D A;  1K0S A;  1GBQ A;  1UHF A;  3RNJ A;  4HXJ A;  1AOJ A;  3VS1 A;  1X6G A;  2EYX A;  2RNA A;  2YT6 A;  1GBR A;  2D1X A;  2DNU A;  2FPE A;  3EG3 A;  1JQQ A;  1OV3 A;  1ZUU A;  2A37 A;  4DEY A;  2EGC A;  3NPF A;  2A36 A;  5ECA A;  1FMK A;  2KXC A;  2SRC A;  1CSK A;  3PVL A;  2DRM A;  2I0N A;  3RBB B;  3UF4 A;  1W6X A;  2DJQ A;  1PWT A;  1TUD A;  1PRM C;  1WDX A;  2DL8 A;  2YDL A;  2AZS A;  1UFF A;  3EGU A;  1KSW A;  4AFU C;  1PKT A;  1G83 A;  1G2B A;  2NUZ A;  1SRL A;  1W70 A;  2EQI A;  2DL5 A;  1EFN A;  1QCF A;  2D8J A;  2FPF A;  2D8H A;  3EG2 A;  1UHC A;  2KE9 A;  2KYM A;  4Z88 A;  4J9I A;  4AG2 C;  2JM9 A;  2CUD A;  1PHT A;  1K0X A;  1I07 A;  4OMM A;  1NYG A;  1TUC A;  2ESW A;  3KFV A;  2JMA A;  2DBK A;  2BTT A;  5IHK A;  1T3L A;  1AWX A;  1I0C A;  2EYZ A;  2LQW A;  3REA B;  2EGA A;  1J3T A;  5IXB A;  2A28 A;  2FRY A;  2RMO A;  2RQU A;  2SEM A;  3O5Z A;  4IIM A;  4ORZ A;  1B3Q A;  2KRS A;  5HCK A;  2AKL A;  1AVZ C;  3TVT A;  2H8H A;  4WCI A;  1TG0 A;  1AWJ A;  4KRT A;  1M27 C;  2V1Q A;  4EIK A;  3VS5 A;  3EG0 A;  5I11 A;  2CSI A;  5FW9 A;  4HVU A;  2M51 A;  1SHG A;  1QWE A;  3M0S A;  1UG1 A;  1X43 A;  3UA7 A;  2PNI A;  3EG1 A;  3H41 A;  3NHN A;  1ZUY A;  2A08 A;  1X27 A;  2JS0 A;  2CDT A;  2GTO A;  2FRW A;  3UA6 A;  1RLP C;  2L3P A;  2K3B A;  4RTW A;  2PZ1 A;  4DEX A;  2LNH B;  1VYT A;  2CT4 A;  5GJW B;  3EHQ A;  2LQN A;  2DRK A;  4LN2 A;  5FWB A;  4A63 B;  2D0N A;  2AKK A;  1UUE A;  4J9G A;  3A98 A;  1K1Z A;  1U06 A;  2HDA A;  2ABL A;  4HVV A;  2B86 A;  1GRI A;  4OML A;  1SSH A;  3SEM A;  1NYF A;  1AZG B;  2DX1 A;  3M0U A;  4JJD A;  3R6N A;  1UE9 A;  1SRM A;  4J9C A;  2BZ8 A;  2GBQ A;  1KFZ A;  2M0Y A;  1NEB A;  1K76 A;  2KRN A;  2ED0 A;  3QWX X;  3VS0 A;  1QWF A;  2KT1 A;  1JU5 C;  1UTI A;  4CC2 A;  2F2X A;  4D8K A;  2K79 A;  2EPD A;  2GQI A;  1FYN A;  3VRZ A;  2CH4 W;  2FG0 A;  1UJY A;  4J9B A;  3M0T A;  2DM1 A;  2PTK A;  1X2K A;  2DVJ A;  2JXB A;  1NM7 A;  1RUW A;  3ZL7 C;  1X69 A;  1HJD A;  3UAT A;  1RLQ C;  1Y0M A;  1H92 A;  1MV0 B;  2DL3 A;  1JXO A;  2EBP A;  3EHR A;  1XOV A;  2XMF A;  3GBQ A;  3ULR B;  4CC7 A;  4HCK A;  2VWF A;  1K4U S;  3M0Q A;  4K11 A;  1JXM A;  2AK5 A;  2KR3 A;  4RUG A; 
#chains in the Genus database with same CATH topology
 2IVW A;  4DOW A;  1SPK A;  2K2M A;  3BFM A;  1PD1 A;  2E4H A;  1QKW A;  2G6F X;  2MIO A;  1M3A A;  2EIF A;  3CC7 Q;  2YHT A;  1T3S A;  2XDP A;  1BB9 A;  2RF0 A;  2D6F A;  3CQT A;  2EGE A;  1N27 A;  4C5G A;  2VVK A;  3VRY A;  3S3O A;  2HD0 A;  2YLC A;  4M7A F;  1IRE B;  1IGQ A;  1LNX A;  4FU6 A;  3HKS A;  1Y96 B;  3CCR T;  3VS4 A;  2LT1 A;  5GJV B;  4M7D G;  3REB B;  3PIO A;  4M75 B;  3NTI A;  4C8Q C;  2JT4 A;  1VQL A;  4LD6 A;  4PL6 A;  1NLO C;  3M57 A;  2K3X A;  3BDL A;  1JRI A;  2QEX A;  2XHC A;  4QVZ A;  8ATC B;  2M16 A;  4WF2 A;  4ZNX A;  3RES A;  1OEB A;  3S3M A;  1MHN A;  2R5A A;  3HTR A;  4FYY B;  1ZLM A;  4C92 A;  1RAF B;  1YJW A;  4MZT A;  2A0F B;  2LCS A;  2DPP B;  1OU8 A;  1LVK A;  3PVQ A;  1VQO T;  4M77 A;  2QQS A;  4J5Y A;  4R56 A;  3H0I A;  3R6O A;  1YI2 A;  3JCM J;  2AIR B;  3G4S A;  1B07 A;  3JSC A;  4JRK A;  4BI8 B;  3OYH A;  5CCA A;  3M0P A;  4N0A C;  1HK9 A;  1WA7 A;  2X3W D;  4HA8 A;  4M7D A;  4C92 B;  4ELZ C;  1ABQ A;  4RTZ A;  2QI2 A;  4JZ3 A;  3CCS A;  4VUB A;  2HEQ A;  4AG1 C;  1IHW A;  3G1J A;  1YCS B;  1K9M U;  2DZ9 A;  5L23 A;  4E7J A;  1VQ5 Q;  4J9D A;  4M77 B;  4B6M A;  2P4T A;  4IUQ A;  1VQL T;  2J7I A;  4E2F B;  3JV3 A;  4M75 F;  1O75 A;  4QW2 A;  2QEX T;  2QQB A;  4RTT A;  2GFU A;  4ATO A;  2O4X A;  4HVW A;  3MP8 A;  2FHD A;  2F5T X;  4JUV A;  4PJO E;  2DZC A;  3OYN A;  4E6R A;  1YJW T;  4C5E A;  1IZ6 A;  5LJ5 e;  3L2R A;  2O2O A;  2DL7 A;  5C6S A;  1U1T A;  1MV3 A;  2K9G A;  4BB7 A;  1BIB A;  1NPR A;  1NEG A;  3OS2 A;  1Q7Y R;  2EJF A;  3CC4 A;  2RJD A;  3A8M B;  4LD9 K;  3ME9 A;  1YI2 T;  1LCK A;  3URG A;  3G4S T;  4B9X A;  3MP1 A;  3CD6 Q;  3CCQ A;  5CR2 A;  2YRC A;  2O4X B;  3PT9 A;  1NLP C;  1WIE A;  2O9S A;  1IRX A;  3OW2 S;  1Y57 A;  2IG0 A;  4J83 A;  5GAO m;  2GNC A;  1T0H A;  3UWN A;  5LJ5 h;  3JB9 D;  5GAN f;  4C92 F;  2QQ9 A;  4BY6 B;  2OX7 A;  4N4I A;  1PCX A;  2RQT A;  2KGT A;  5FRO A;  3OYA A;  2FPD A;  2LX9 A;  1NE8 A;  1Q81 C;  4KGX B;  4M77 F;  3V7C A;  2H3J A;  5EC7 A;  1K8A U;  2QQA A;  3HRU A;  4M78 G;  3INZ A;  5FU6 B;  5GMK e;  2LCC A;  3CBM A;  3FB9 A;  3SB2 A;  3FJ5 A;  1PC0 A;  3NTK A;  1E7O A;  2O88 A;  2GQV A;  2KRO A;  3T9N A;  4M7D F;  4IKF A;  2LP5 A;  1R0B G;  1S1N A;  1GCP A;  3CC4 T;  2GFA A;  4PJN A;  3OBY A;  5IXF A;  2L0A A;  4C0Z A;  2RB6 A;  4M4Z A;  5GAM e;  3JCM W;  4DOV A;  1UDL A;  2BE9 B;  2KQW A;  3CCQ T;  3OYL A;  2RPN A;  2JM8 A;  3P8H A;  3C12 A;  2CP6 A;  2NLU A;  1NJI C;  4F16 A;  4E7I A;  1OOT A;  4PFO A;  3RER A;  1PD0 A;  4C8Q E;  2PVD B;  1AOJ A;  1VQN Q;  2JTM A;  1F1B B;  4JDS A;  3G6E A;  3EG9 A;  2LQK A;  2WAC A;  3A8O B;  4C0D B;  2EYX A;  3I55 A;  3S3N A;  2RNA A;  4M78 A;  2KK4 A;  1QVP A;  5GAM h;  2VXE A;  2A37 A;  4DEY A;  2EGC A;  1G3S A;  2AHJ B;  1KD1 C;  3ZFJ A;  1FMK A;  2B8A A;  1VQL Q;  2KXC A;  2SRC A;  3OYB A;  1CSK A;  1D0X A;  3PVL A;  2DRM A;  5CAI A;  2QEX Q;  2QGF B;  3UF4 A;  1JBM A;  4AT1 B;  3ASK A;  1TUD A;  3EG9 B;  2VYT A;  2NUZ A;  5LL6 S;  2EQI A;  2DL5 A;  1EFN A;  5GAN 6;  1UHC A;  5FU7 B;  3H8Z A;  1G3W A;  3JCM V;  1I07 A;  1NYG A;  1TUC A;  5DLO A;  5A2Q E;  3KFV A;  2JMA A;  5CKF A;  2DBK A;  4ZTF A;  3J80 E;  3REA B;  2MK5 A;  5IXB A;  1YI2 Q;  1I5O B;  3WVD B;  1VIE A;  2KY9 A;  9ATC B;  2RQU A;  4Z02 A;  3QDR B;  4IIM A;  5AYF A;  3LYI A;  3TVT A;  2QA4 A;  1Q86 C;  1TG0 A;  1WHJ A;  2QAZ A;  5KYW A;  3VU3 C;  3DLL A;  3G6E T;  3EGD A;  2RI3 A;  1K9M R;  2GF7 A;  1N9R A;  3PFS A;  3S6W A;  2M51 A;  5GMK i;  2F69 A;  1WHH A;  2PNI A;  3H41 A;  2A08 A;  1X27 A;  1I4K 1;  2QYZ A;  4RG2 A;  5DM7 R;  3OMG A;  1YJN A;  2VGN A;  3E9F A;  1S72 A;  3UA6 A;  1N6A A;  2K3B A;  4RTW A;  4DEX A;  3OMC A;  2PUK B;  2CKK A;  2ZPG B;  3PGG A;  5GAN 8;  2D0N A;  3NTH A;  4ME7 A;  2NYS A;  2WSE E;  1K1Z A;  3FDR A;  5KYW B;  4HVV A;  5D7U A;  3M4Y A;  1Y07 A;  3CPW S;  3M0U A;  4JJD A;  3M9Q A;  3R6N A;  3DB4 A;  2BZ8 A;  2GBQ A;  3TRE A;  5FRN A;  3CCV A;  4L6V 5;  3CCJ Q;  4M78 F;  4M7A G;  2KT1 A;  2DJZ A;  2F2X A;  3OYE A;  2GQI A;  3TQ7 P;  1TXQ A;  2RHX A;  4B9W A;  4DQ2 A;  2FZK B;  4JS5 A;  3CCQ Q;  1D1A A;  1KK7 A;  3ZL7 C;  2QA4 T;  4LDY A;  3HRT A;  4KBM B;  4FCY A;  3TEE A;  4EMK B;  2X35 A;  3OYJ A;  1C6V X;  1K73 C;  3X20 B;  2E3I A;  3J7A F;  2RJF A;  3OS1 A;  1JXM A;  3QG1 A;  1WYX A;  2JVV A;  1UGQ B;  1UGV A;  4EPC A;  1YJN T;  5IHN A;  1D0Y A;  1GXI E;  2AT1 B;  1K8A R;  1U1S A;  1VQP Q;  2E1H A;  3SWN C;  3JCM f;  3KXT A;  4XU0 A;  4C5I A;  3OB9 A;  1M30 A;  1N5Z A;  3UT1 A;  2W10 A;  1TUG B;  2EKH A;  3L42 A;  5KH6 A;  2JS2 A;  2DMO A;  4FW1 A;  1BKB A;  3CME Q;  1UEC A;  1D1B A;  2MOX A;  2K3Y A;  5IHI A;  1FWZ A;  5GAN e;  4M7A C;  4ANJ A;  2L2P A;  3CCU T;  4UC4 A;  4MDW A;  3CCV T;  1GL5 A;  5CKE A;  4E7Z A;  1D3B A;  3V7S A;  4RCB A;  2W0Z A;  1TOV A;  2KXD A;  4A4H A;  3JCM P;  2NUP A;  3A8L B;  2X51 A;  3VS2 A;  2ZPI B;  2E41 A;  4PJO A;  2K57 A;  3L2W A;  2CZ6 B;  2ZZD A;  3GP8 A;  4M75 G;  3RKY A;  2LZ6 B;  3IQL A;  4L59 A;  1OPL A;  1MGQ A;  5GAN h;  3G71 Q;  1UGR B;  4J9E A;  3RKX A;  4FYV B;  2DIQ A;  2LMJ A;  2YUO A;  1ZSZ A;  3G6E Q;  2D9T A;  4XQ3 A;  1M1K C;  1UGP B;  4IUT A;  1D3B B;  2V26 A;  5LJ3 f;  1KQS P;  2XI9 A;  2MMP A;  2O9V A;  3GOX A;  1Z9Z A;  1I1J A;  2RQW A;  2EQM A;  4IIO A;  2NUP B;  3EH2 A;  2C0O A;  5GMK m;  2PVO B;  3F70 A;  4PJO B;  4WTO B;  4D6W A;  4ZN1 A;  5GAM j;  3J81 E;  3RKW A;  4ZTJ A;  4OMP A;  1KG1 A;  1VQ8 A;  1QP3 A;  2OAW A;  4OMF B;  1M9S A;  5CQX A;  1YFN A;  5GAN 7;  3HSB A;  4KGV B;  3I35 A;  2RQR A;  1WLP B;  3G7Z A;  1GCQ A;  2J05 A;  2VKN A;  3QXE B;  3C4S A;  2VUB A;  1ZA1 B;  3LH5 A;  2KT8 A;  1O9S A;  1LPL A;  3OYI A;  1YHQ A;  5CVI A;  3SD4 A;  2PQW A;  3LLR A;  1KC8 C;  3AT1 B;  1AEY A;  3CC2 A;  1K9A A;  1TWB A;  4ZN3 A;  1X6B A;  4XTZ A;  1M8V A;  3X25 B;  4XU2 A;  2HL3 A;  5D6X A;  3EFO A;  2F2W A;  3EAE A;  3H0H A;  1Q82 C;  1V1C A;  4M77 G;  4MDX A;  1UGS B;  2KI7 A;  2BE7 D;  1M90 U;  4EMG A;  2LQ8 A;  3EGX A;  2YLB A;  4PKC C;  4FM4 B;  1JEG A;  3OYM A;  2F5K A;  2BZY A;  1YP5 A;  2OTL A;  1BBZ A;  2ROL A;  1YJ9 Q;  4QQ6 A;  1AT1 B;  4R55 A;  2I2L A;  1PKS A;  4OMO A;  1AZE A;  1XNI A;  1U3O A;  4LUE A;  3RMQ A;  4A54 A;  2VV5 A;  4FSS A;  1WX6 A;  4RTY A;  1LOJ A;  1YIT A;  1M3B A;  2DYB A;  3PMI A;  1T0J A;  2LNV A;  4J6X A;  1QKX A;  3C94 A;  3EFO B;  2CZ0 B;  2Z0W A;  3NFC A;  4PJO F;  1PSE A;  2LJ1 A;  1OZ2 A;  2A7Y A;  4JPB W;  3X26 B;  1VQ8 T;  2E70 A;  4C8Q A;  1OU9 A;  1DJ7 B;  3QSU A;  2JNG A;  4L5G A;  3EGX B;  3HP9 A;  4MZM A;  3H0F A;  2L5Q A;  4OVA A;  4BI4 A;  2EQJ A;  1W2B S;  4C92 C;  1WXU A;  2CSQ A;  3SFM A;  1WQW A;  3GLX A;  1VYU A;  2RH2 A;  2E5Q A;  3CCU Q;  4KH0 B;  2E10 A;  2EYY A;  2DXU A;  1HD3 A;  2K2V A;  1TSF A;  1BI2 A;  2CGH A;  3PTA A;  3CC2 T;  3RR6 A;  5KE2 A;  1B34 B;  2LT4 A;  1ZHI A;  2HCK A;  2ZPH B;  2J6O A;  3QBY A;  2COZ A;  5GAN 5;  1IXD A;  1UJ0 A;  2RK2 A;  1G3T A;  4Y92 A;  4ESR A;  4C8Q B;  1ZBJ A;  2DA9 A;  5CKH A;  1VQK A;  1VQ7 Q;  3CMA A;  3U23 A;  4OB1 B;  4AFZ C;  2JTF A;  4XTY A;  1JB0 E;  1V76 A;  4M7D C;  2Y4X A;  2CP5 A;  2KBT A;  2AZV A;  2J6F A;  3H6Z A;  2LCL A;  2P0P A;  2LC4 A;  2PU9 B;  4X1V A;  4X9C A;  2MCN A;  2DLP A;  2OTJ A;  3CPW A;  4IUP A;  3HRS A;  4CC4 B;  1E6G A;  2DAQ A;  1X6O A;  4J6W A;  1N8R U;  1K0S A;  1GBQ A;  1UHF A;  4NOY A;  2CZ7 B;  3MJX A;  1WGS A;  1H64 1;  1YCY A;  2D1X A;  2DNU A;  3RMS A;  4P5N A;  2QGG A;  1ZUU A;  3GIB A;  3L1A A;  2YWW A;  2A36 A;  5ECA A;  1JJ2 P;  2RHY A;  2ZGW A;  4PNO A;  3CCM A;  3E1S A;  3Q1J A;  4FSX A;  1VQ6 Q;  2I0N A;  2X4Y A;  3I56 Q;  1FX7 A;  1W6X A;  1PWT A;  2CS7 A;  5M9O A;  2YDL A;  3LGF A;  2AZS A;  4ELY C;  1RL2 A;  4J8O A;  4FYX B;  1RAE B;  1KSW A;  2DEU A;  4AFU C;  3JCM e;  3M56 A;  2P0K A;  1G2B A;  3HFN A;  1VQK T;  3CMA T;  5LJ5 g;  3EG2 A;  4C8Q F;  2JM9 A;  1PHT A;  1Q7Y C;  3BY7 A;  3CCS T;  3C95 A;  1K0X A;  2XD0 A;  2ESW A;  2DFU A;  1MNE A;  5IHK A;  2EGA A;  1J3T A;  2A28 A;  1QMC A;  2ZPF B;  4PK4 A;  4QQD A;  3L2Q A;  5KYX A;  3CXC S;  2RMO A;  5D6W A;  3CCR Q;  2KRS A;  5EG2 A;  2OTJ T;  4HCC A;  2NUT A;  1AWJ A;  2WSC E;  3JCM h;  2X9H A;  3EG0 A;  1QCO A;  3VUZ A;  5I11 A;  4J6Y A;  4QQG A;  4RCC A;  1QWE A;  1MMA A;  4BAC A;  2HKN A;  1VQ8 Q;  4JRI A;  2JS0 A;  1I5L A;  3CCM T;  1VQ9 A;  2VAS A;  4C0D C;  2QTX A;  1VYT A;  2KSS A;  5KYX B;  3OYC A;  3FC3 A;  3JB9 G;  2CT4 A;  3EHQ A;  2LQN A;  5LJ3 e;  1EIF A;  2AKK A;  2NUT B;  5GMK h;  1VQO Q;  2B86 A;  4E7K A;  4BE2 A;  2EWN A;  1AZG B;  3V8J A;  3X24 B;  2MYS A;  1UE9 A;  2VXF A;  4J9C A;  3UPU A;  1M90 R;  1RAC B;  1G3Y A;  1HYO A;  2M0Y A;  1NPP A;  1NEB A;  2ED0 A;  3QWX X;  3VS0 A;  1QWF A;  2V8J A;  2DK3 A;  1Y7X A;  4KGZ B;  3PNW C;  4X34 A;  1QVF A;  3MEW A;  4HCZ A;  2DM1 A;  4A4K A;  1X2K A;  2DVJ A;  4M78 C;  5LJ3 h;  5GAM g;  1NM7 A;  3UAT A;  1ZQ1 A;  1Y0M A;  2DTO A;  1H92 A;  5IAY A;  3JCM b;  4FYW B;  3CCE A;  1ACM B;  2HNI A;  1XOV A;  5LJ5 d;  1QVG S;  3PIP A;  2XMF A;  2CP7 A;  3GBQ A;  3ULR B;  3OYD A;  2VWF A;  1K4U S;  4K11 A;  3JB9 J;  1OUL A;  4RUG A;  2FVU A;  1YIJ A;  1D09 B;  4RTU A;  2RK1 A;  5L8R E;  1YJW Q;  3OYG A;  1H3Z A;  2QDL A;  1VQ9 T;  2DD5 A;  1X01 A;  2GCX A;  4A4G A;  1BU1 A;  1MMN A;  1M2V A;  1RAD B;  4FL6 A;  5IN1 A;  2VB6 A;  2O01 E;  2HSP A;  1PSF A;  1MUZ A;  3DLM A;  2P0Q A;  4F7U E;  4A4F A;  2ZPE B;  4Y28 E;  4DA4 A;  1YWP A;  2NWM A;  4M7D E;  1E6H A;  3G4S Q;  1RAH B;  4N4G A;  3GNG A;  2KYB A;  1VQM A;  3JCM Q;  3L2V A;  2EFI A;  1C1A A;  4JLI A;  3D7S B;  3M53 A;  3CCL A;  2DER A;  3L2Z A;  2KRM A;  2RHI A;  3I55 T;  2HBW A;  2MAM A;  2H3E B;  2EAY A;  4PLI A;  3QYG B;  4PLL A;  2OI3 A;  3GF5 A;  4XTW A;  1R8O B;  1Q95 G;  3CCS Q;  2F2V A;  3CC7 A;  3QHS A;  3JB9 I;  3LWI A;  1M2V B;  2L3Q A;  1OYX A;  1FXX A;  4QVC A;  2BZX A;  1OQK A;  3E19 A;  4M7A D;  2CZ1 B;  3CCE T;  2QAS A;  5HK0 A;  1W2B A;  1N8R R;  2FZG B;  2V8I A;  4IUR A;  3PMT A;  2K7A A;  2YUN A;  2HKQ B;  2E5K A;  1M8M A;  1ABO A;  4F17 A;  1Z9Q A;  1K9M C;  1YIJ T;  4DBQ A;  2QXF A;  1BYM A;  4EMK A;  2HBP A;  2R5M A;  2ENM A;  3NMZ C;  3MP6 A;  5GAM d;  4BDZ A;  5CO7 A;  4FW2 A;  2XDB A;  3GPL A;  1JO8 A;  2YXY A;  3OYK A;  2E6Z A;  2EYQ A;  4II1 A;  4XTU A;  4GLM A;  2JN0 A;  5FLX E;  3CC4 Q;  3KUF A;  4MMK A;  4RTV A;  3LWH A;  2JOY A;  3VJP A;  1PNJ A;  2LVM A;  1KQS S;  3TSW A;  4J7I A;  1VQM T;  1SEM A;  2GTJ A;  4Z8A A;  1BI3 A;  2RD1 A;  4IUU A;  1VQ4 A;  1BIA A;  4Z89 A;  3CCL T;  4PJO G;  4XU1 A;  1W1F A;  3JB9 F;  2P84 A;  3HHT B;  4OF1 A;  2RHU A;  3CC7 T;  2FO0 A;  4BDY A;  5HY6 A;  1WZO A;  5LJ5 j;  1QCN A;  3GNF B;  2QTV A;  4E7H A;  1VYV A;  4RMO A;  2E6N A;  4Q5W A;  1S72 T;  5KYU A;  2EJG A;  2GGR A;  3M5A A;  2E3H A;  1WHL A;  1GFC A;  2FEI A;  1VQ5 A;  1QLY A;  4E7L A;  2IIM A;  4PFZ A;  4J9H A;  2J6K A;  3BE3 A;  2XG8 D;  4LDV A;  5KYN A;  2LJ0 A;  2MWP A;  2OAU A;  2O31 A;  4M75 D;  4XK8 E;  5IH2 A;  5IT9 E;  3SWN A;  2YRD A;  1M1F A;  2A3L A;  3H9N A;  4GBQ A;  2L3S A;  1UEB A;  2HQX A;  1YNZ A;  2L89 A;  1YWO A;  3FJP A;  5GAN 2;  4YTL A;  3OW2 A;  4LNP A;  1K8A C;  1PM3 A;  1VQ9 Q;  3JB9 H;  3M0R A;  2C06 A;  8AT1 B;  2KEA A;  4DBR A;  5KYU B;  2C0I A;  2DET A;  4TVR A;  5GAN 4;  5HKC A;  3CXC A;  1VQ4 T;  2EVR A;  1W4S A;  5GMK j;  4M78 E;  2DF6 A;  3QJY A;  3SWN B;  3CD6 A;  3OYF A;  5GAN g;  1WHG A;  3OA6 A;  4KUD K;  3C0C A;  4J7F A;  3QJ6 A;  4LE9 A;  2DD4 A;  1Q81 U;  2BUD A;  1NG2 A;  3I55 Q;  1ZSZ C;  3CPW P;  1A0N B;  1WPY A;  2YSQ A;  2C0T A;  3VS3 A;  4C92 D;  2XU8 A;  4KH1 B;  4BI3 A;  1H8K A;  4V2S A;  3P8D A;  3NGP A;  1AD5 A;  4QVD A;  3VS6 A;  4X9D A;  1NBE B;  3CCE Q;  2EJ9 A;  1CKA A;  5LJ3 j;  2EYW A;  3MPU B;  4M77 D;  4JJC A;  1CKB A;  2JMC A;  2EW3 A;  2F1L A;  1PG5 B;  5GAO n;  1AWO A;  4C8Q G;  1GCQ C;  4OB2 B;  3VS1 A;  2YT6 A;  2MPX C;  4M7D D;  3WVE B;  2LDM A;  4M75 C;  2E12 A;  5FRM A;  1NJI U;  3MHX A;  1JQQ A;  4NL3 A;  2HL5 C;  4OGE A;  3NPF A;  1MND A;  3OS5 A;  1VQM Q;  2JZ2 A;  3CD6 T;  2QA4 Q;  4RG8 A;  1G8X A;  1QVG A;  4ZGD B;  2DJQ A;  5J26 A;  2IPO B;  3EGU A;  1KD1 U;  1M4Z A;  2DTI A;  3FLG A;  4OB3 B;  2M0O A;  5GAO p;  1SRL A;  1JJ2 S;  4PJJ A;  1VQN A;  3LGL A;  2FL7 A;  4PJL A;  4NS5 A;  4F04 B;  1QCF A;  2D8J A;  2FPF A;  3A8G B;  2D8H A;  1B34 A;  1G5V A;  4J9I A;  1YJN Q;  2CUD A;  1S72 Q;  2HQH A;  3ZEH A;  5GAN d;  4E7S A;  4F7U G;  1TS9 A;  2VC8 A;  3JRZ A;  3MET A;  1M5Q 1;  1RAA B;  1T3L A;  1AWX A;  1I0C A;  2BKD N;  2EYZ A;  3QZ5 B;  2HAX A;  2RI5 A;  2SEM A;  5KE3 A;  3O5Z A;  1Y71 A;  1BI1 A;  4ORZ A;  5HCK A;  2AKL A;  1AVZ C;  5HK3 A;  1FMW A;  2PUO B;  4EIK A;  1YHQ T;  2R58 A;  3CEY A;  3CCV Q;  2CSI A;  1SHG A;  4M77 C;  4XU3 A;  1X43 A;  3UA7 A;  2KVQ G;  3EG1 A;  3OYY A;  3NHN A;  1ZUY A;  7AT1 B;  1Q86 U;  1KQ2 A;  2CDT A;  2FRW A;  2Y90 A;  1RLP C;  2L3P A;  2M9U A;  2PZ1 A;  4BUG A;  2LNH B;  4JS4 A;  1VQ4 Q;  1QVF P;  5GMK l;  2DRK A;  2OTL T;  4N0A A;  1I81 A;  2E64 A;  1UUE A;  3FEO A;  1U06 A;  3L2U A;  1GRI A;  3M59 A;  2ATC B;  1NYF A;  2MF2 A;  3V8L A;  3JAM E;  4F7U A;  2DX1 A;  5I2M A;  1VQN T;  1KHI A;  5DLQ E;  1SRM A;  1YIT T;  4CRI A;  1KFZ A;  4N4H A;  4CC2 A;  4D8K A;  2QG9 B;  2CYZ B;  5I2S A;  4LDX A;  3OBW A;  4M7A E;  2K4Y A;  3OS0 A;  2FG0 A;  3QZ9 B;  1R77 A;  2RJE A;  3M54 A;  4J9B A;  3HPW A;  2PTK A;  3M0T A;  4A53 A;  3X28 B;  2JXB A;  4ZGE B;  1BCO A;  1RUW A;  4HKE A;  1X69 A;  1KQS A;  3DKM A;  1MV0 B;  3EFR A;  4BY6 C;  1IHV A;  4HT9 A;  4HCK A;  4FIB A;  4F7U B;  3QDF A;  3M0Q A;  3VYH B;  4M7D B;  1MMD A;  1LJO A;  2JUF A;  3A8H B;  3P8B B;  3RUX A;  2G3R A;  3CCJ A;  5FU6 C;  4M78 D;  5KYY A;  2ZCF B;  1K73 U;  2YUQ A;  2E65 A;  1U8R A;  2KNB B;  6AT1 B;  3QII A;  3LX7 A;  3OSS C;  5I22 A;  2P4R A;  3AHU A;  1Q81 R;  2FYK A;  4BE0 A;  2K5L A;  2CUB A;  2DIL A;  3LW5 E;  1W2B P;  2V1R A;  4JJB A;  5GAN j;  1HSQ A;  1ZSG A;  4RTX A;  2RA2 A;  3QO3 A;  3JCM X;  3RDV A;  1AWW A;  1N9S A;  1OZ3 A;  2DBM A;  1ARK A;  2Y4Y A;  2M02 A;  3JCM g;  3KBG A;  5KYY B;  1M3C A;  2QQR A;  2ED1 A;  1IO6 A;  1PRL C;  1VQP A;  3I9Q A;  4M75 E;  1X2Q A;  2X3X D;  2PVG B;  2COY A;  2YUP A;  1SG5 A;  4AFQ C;  4LDU A;  4R0K A;  1WXT A;  3OY9 A;  3CME A;  1RI9 A;  3V8K A;  2KDS A;  4HCB A;  3OSV A;  1WNL A;  4F7U F;  1YHQ Q;  2LJ3 A;  4AFS C;  2VGM A;  1YBY A;  4MML A;  1NJI R;  3CC2 Q;  4QKU A;  3CCJ T;  1M1G A;  2M1H A;  1OX9 A;  3E9G A;  1XQH A;  3MKD A;  5A0G A;  1GFD A;  1SF9 A;  3MEV A;  4JLG A;  3QYH B;  1M1K U;  3VUB A;  3EH1 A;  4RKU E;  3I5S A;  2EQK A;  3FRN A;  1WXB A;  2OTL Q;  3N5B B;  4O5V A;  1XJW B;  1KD1 R;  1BK2 A;  3VS7 A;  1KIK A;  1MMG A;  5LJ3 g;  2HMA A;  3G71 A;  5FU7 C;  1P92 A;  3SDZ A;  5GAO r;  2XDD A;  4JZ4 A;  4CI0 C;  1WI7 A;  3UDC A;  1M90 C;  2LX7 A;  4J9F A;  1YIT Q;  4OMN A;  4C92 E;  4F14 A;  5I21 A;  2FZC B;  2CRE A;  2DKG A;  2ECZ A;  3MEU A;  4JJN K;  2CT3 A;  4KUL A;  1WFW A;  1VQP T;  2J06 A;  1VIF A;  1SSF A;  1TU0 B;  2ROT A;  3OW2 P;  5C0M A;  4M77 E;  1U5S A;  2JW4 A;  1WHM A;  2RHZ A;  1KC8 U;  4FT4 A;  2ZPB B;  3PE0 A;  4FT2 A;  1ZX6 A;  3CME T;  1TH7 A;  1HXD A;  3JCM d;  1OPK A;  5GAO l;  4BE1 A;  4C0G A;  5A0D A;  4EDU A;  4OMQ A;  2X4W A;  5CKD A;  1Q82 U;  1VUB A;  2DXB A;  3HFO A;  3CXC P;  5CQY A;  3M55 A;  1Q86 R;  4D8D A;  2ZAE A;  2DXC A;  2RN8 A;  4M78 B;  3CBO A;  1ZUK A;  1IGU A;  1SHF A;  1JJ2 A;  3VV0 A;  1QQJ A;  3THK A;  4JRQ A;  3V7R A;  1BCM A;  1NZ9 A;  3QWY A;  5FWC A;  1VQK Q;  3CMA Q;  3HL8 A;  5KCH A;  2DO3 A;  2OJ2 A;  2MWO A;  1KJW A;  4OB0 B;  2DXT A;  3G71 T;  3A1P A;  4HT8 A;  3BDU A;  3VKI A;  2KMT A;  1YJ9 A;  3M4G A;  2JTE A;  5GAN 3;  2OTJ Q;  3ZBD A;  3O8V A;  4QT7 A;  2DVE A;  2DL4 A;  5DY9 A;  3TSZ A;  4CC3 A;  3VYG A;  3SHW A;  1V29 B;  1YN8 A;  2X4J A;  5LJ3 d;  4EMK C;  2K5I A;  5KCO A;  3JCM c;  4PJO D;  2YRV A;  1X75 C;  3CBP A;  1D1C A;  4KT0 E;  4LUD A;  1VA7 A;  1OX8 A;  1N8R C;  3CCM Q;  3I5R A;  2RQV A;  1XTD A;  4KUI A;  1D0Z A;  5GAO q;  4PFP A;  3MEA A;  2DEQ A;  4LXC A;  2RJC A;  3A5Z B;  3EGD B;  2CH4 A;  1WJQ A;  2WSF E;  2DE0 X;  5CIU A;  1C0M A;  3CCU A;  1K73 R;  2V8K A;  4NL2 A;  1VOM A;  1H3H A;  1QVG P;  2K6D A;  2JJ9 A;  4IUV A;  1QP2 A;  3RNJ A;  4HXJ A;  2COW A;  1TTH B;  4Y91 A;  1X6G A;  3RIR A;  2MI6 A;  3OQ5 A;  1GBR A;  4A4E A;  4PJM A;  5J39 A;  1SKU B;  2FPE A;  3CPF A;  3EG3 A;  1OV3 A;  2L3R A;  1VQ7 A;  2CP3 A;  1IB8 A;  3M58 A;  5LJ5 f;  2BIV A;  4XTV A;  1YJ9 T;  3QUI A;  4ZGJ B;  1RAG B;  1WJS A;  1UB4 A;  1RAI B;  3ER0 A;  3RBB B;  2RI2 A;  1PRM C;  1WDX A;  2DL8 A;  1ZA2 B;  4GLK A;  1UFF A;  2DIG A;  1PKT A;  2XIC A;  1B7T A;  1R0C B;  1G83 A;  4OGC A;  2XK0 A;  1W70 A;  3TCJ A;  4JRP A;  1WHK A;  5J3B A;  2R57 A;  2K5F A;  4Z88 A;  2KE9 A;  2KYM A;  4AG2 C;  1EZZ B;  4EMH A;  3FIF A;  2QK0 A;  2RO0 A;  3DB3 A;  4OP0 A;  4OMM A;  2QDY B;  2HZY A;  2BTT A;  2LQW A;  4M7A A;  2FRY A;  1I8F A;  1FMV A;  1KHC A;  1RAB B;  2XID A;  3BW1 A;  1B3Q A;  3TU4 K;  1AHJ B;  1VQ6 A;  2L8D A;  1Q7Y U;  4PJO C;  5CKB A;  4BD3 A;  2H8H A;  4WCI A;  1WJR A;  3I56 A;  4KRT A;  4XTX A;  1M27 C;  2V1Q A;  3VS5 A;  2HSE B;  2RM4 A;  3LH0 A;  4LDW A;  2EQU A;  4E47 A;  1M1K R;  5D6Y A;  5FW9 A;  4HVU A;  4DBF A;  2CP2 A;  2D0Q B;  1M2O A;  3M0S A;  1UG1 A;  2HQE A;  1VQ7 T;  4C8Q D;  3WXM B;  2GTO A;  3QKJ A;  4M7A B;  4GY5 A;  5GJW B;  1VQ5 T;  3EFS A;  4LN2 A;  5FWB A;  4A63 B;  2LTO A;  4C5H A;  4J9G A;  3CCR A;  3A98 A;  4C0F A;  2HDA A;  2ABL A;  5GAM f;  4DBH A;  4OML A;  1SSH A;  5AT1 B;  3SEM A;  1YIJ Q;  3MO8 A;  1KC8 R;  1K76 A;  2KRN A;  1QW1 A;  1JU5 C;  1UTI A;  4O6J A;  2K79 A;  1QVF S;  2EPD A;  1FYN A;  3VRZ A;  3MCA B;  2CH4 W;  2DTH A;  1Q82 R;  1UJY A;  4MZP A;  1OI1 A;  1KQ1 A;  1BI0 A;  5A0L A;  2FB7 A;  1ZSZ B;  1HJD A;  1VQ6 T;  1RLQ C;  2XKO C;  1Y96 A;  5CK9 A;  2DL3 A;  1JXO A;  4AMC A;  3I56 T;  2EBP A;  2LRQ A;  1ZBX A;  3EHR A;  2DYI A;  4C92 G;  1VQO A;  2X4X A;  2EKO A;  4M75 A;  1EX4 A;  3QPH A;  4XAX B;  4CC7 A;  1RI0 A;  1WQ7 A;  2AK5 A;  2CP0 A;  3E2U A;  3CCL Q;  2KR3 A;  2KAF A; 
#chains in the Genus database with same CATH homology
 1SPK A;  1WYX A;  2K2M A;  4RTU A;  1UGV A;  1QKW A;  2G6F X;  2MIO A;  1M3A A;  5IHN A;  1T3S A;  1BB9 A;  2RF0 A;  2QDL A;  3CQT A;  2EGE A;  2YUQ A;  2VVK A;  2KNB B;  3VRY A;  1BU1 A;  1M30 A;  1N5Z A;  2W10 A;  2EKH A;  5I22 A;  2HSP A;  2JS2 A;  2P4R A;  2DMO A;  1MUZ A;  3VS4 A;  5GJV B;  1UEC A;  3REB B;  1YWP A;  2NWM A;  2CUB A;  1E6H A;  2JT4 A;  2MOX A;  2DIL A;  2KYB A;  2V1R A;  5IHI A;  4JJB A;  1HSQ A;  1ZSG A;  4RTX A;  1NLO C;  2L2P A;  1GL5 A;  1AWW A;  2DBM A;  1ARK A;  2W0Z A;  2KXD A;  4ZNX A;  2KRM A;  1OEB A;  2HBW A;  1M3C A;  2OI3 A;  2ED1 A;  3VS2 A;  1IO6 A;  2F2V A;  1ZLM A;  1PRL C;  2L3Q A;  3I9Q A;  2LZ6 B;  2LCS A;  3IQL A;  1X2Q A;  2BZX A;  2X3X D;  1OPL A;  3PVQ A;  2YUP A;  4AFQ C;  4J9E A;  4R0K A;  1WXT A;  3H0I A;  1RI9 A;  2K7A A;  2LMJ A;  2YUN A;  2YUO A;  2E5K A;  1B07 A;  1M8M A;  2LJ3 A;  1ABO A;  4AFS C;  4F17 A;  1Z9Q A;  3M0P A;  2O9V A;  2ENM A;  3NMZ C;  1WA7 A;  1I1J A;  1Z9Z A;  2RQW A;  2X3W D;  4IIO A;  2C0O A;  1JO8 A;  1ABQ A;  4RTZ A;  1GFD A;  4JZ3 A;  2HEQ A;  4AG1 C;  4GLM A;  1YCS B;  4OMP A;  4RTV A;  5L23 A;  2OAW A;  3I5S A;  1WXB A;  1PNJ A;  4J9D A;  1BK2 A;  3TSW A;  3VS7 A;  1KIK A;  3I35 A;  2RQR A;  1WLP B;  2J7I A;  1SEM A;  1GCQ A;  2J05 A;  2GTJ A;  3JV3 A;  2VKN A;  4Z8A A;  3LH5 A;  2KT8 A;  4JZ4 A;  4RTT A;  4Z89 A;  1WI7 A;  4HVW A;  2LX7 A;  4J9F A;  4OMN A;  1W1F A;  4F14 A;  1AEY A;  1K9A A;  1X6B A;  4E6R A;  2CRE A;  2ECZ A;  2FO0 A;  2CT3 A;  1WFW A;  2F2W A;  2J06 A;  2O2O A;  2DL7 A;  3H0H A;  1V1C A;  1MV3 A;  2ROT A;  2K9G A;  1VYV A;  1NEG A;  1U5S A;  2JW4 A;  2GGR A;  1JEG A;  3PE0 A;  1ZX6 A;  1GFC A;  2BZY A;  1YP5 A;  2FEI A;  1QLY A;  1LCK A;  1OPK A;  1BBZ A;  2IIM A;  2ROL A;  4J9H A;  2J6K A;  2LJ0 A;  4OMQ A;  2O31 A;  1PKS A;  4OMO A;  1AZE A;  5IH2 A;  1U3O A;  4LUE A;  1NLP C;  1WIE A;  2O9S A;  1WX6 A;  4FSS A;  4RTY A;  4D8D A;  1Y57 A;  2RN8 A;  4GBQ A;  2GNC A;  1T0H A;  2L3S A;  1M3B A;  1ZUK A;  2DYB A;  1YNZ A;  1YWO A;  1T0J A;  1SHF A;  1QKX A;  4LNP A;  3THK A;  5FWC A;  3QWY A;  3M0R A;  2LJ1 A;  4JPB W;  2KEA A;  2OJ2 A;  2C0I A;  1KJW A;  2RQT A;  2KGT A;  2FPD A;  3H0F A;  1WXU A;  5EC7 A;  2CSQ A;  2EVR A;  1VYU A;  2JTE A;  2DF6 A;  3FJ5 A;  2EYY A;  1HD3 A;  4QT7 A;  3C0C A;  2DL4 A;  4LE9 A;  3TSZ A;  4CC3 A;  2HCK A;  1E7O A;  2J6O A;  3SHW A;  2O88 A;  1NG2 A;  1UJ0 A;  1YN8 A;  2KRO A;  1A0N B;  2LP5 A;  2YSQ A;  2C0T A;  4Y92 A;  3VS3 A;  4ESR A;  1S1N A;  1GCP A;  1ZBJ A;  2DA9 A;  3U23 A;  4AFZ C;  1H8K A;  5IXF A;  4LUD A;  3NGP A;  2L0A A;  1AD5 A;  3VS6 A;  1VA7 A;  4M4Z A;  1CKA A;  3I5R A;  2RQV A;  2KBT A;  1UDL A;  2AZV A;  2J6F A;  2EYW A;  2RPN A;  4JJC A;  2JM8 A;  1CKB A;  2CH4 A;  2JMC A;  2DE0 X;  2EW3 A;  4X1V A;  2MCN A;  1AWO A;  4F16 A;  2DLP A;  4CC4 B;  1E6G A;  1OOT A;  1H3H A;  1GCQ C;  2K6D A;  1K0S A;  1GBQ A;  1UHF A;  3RNJ A;  4HXJ A;  1AOJ A;  3VS1 A;  1X6G A;  2EYX A;  2RNA A;  2YT6 A;  1GBR A;  2D1X A;  2DNU A;  2FPE A;  3EG3 A;  1JQQ A;  1OV3 A;  1ZUU A;  2A37 A;  4DEY A;  2EGC A;  3NPF A;  2A36 A;  5ECA A;  1FMK A;  2KXC A;  2SRC A;  1CSK A;  3PVL A;  2DRM A;  2I0N A;  3RBB B;  3UF4 A;  1W6X A;  2DJQ A;  1PWT A;  1TUD A;  1PRM C;  1WDX A;  2DL8 A;  2YDL A;  2AZS A;  1UFF A;  3EGU A;  1KSW A;  4AFU C;  1PKT A;  1G83 A;  1G2B A;  2NUZ A;  1SRL A;  1W70 A;  2EQI A;  2DL5 A;  1EFN A;  1QCF A;  2D8J A;  2FPF A;  2D8H A;  3EG2 A;  1UHC A;  2KE9 A;  2KYM A;  4Z88 A;  4J9I A;  4AG2 C;  2JM9 A;  2CUD A;  1PHT A;  1K0X A;  1I07 A;  4OMM A;  1NYG A;  1TUC A;  2ESW A;  3KFV A;  2JMA A;  2DBK A;  2BTT A;  5IHK A;  1T3L A;  1AWX A;  1I0C A;  2EYZ A;  2LQW A;  3REA B;  2EGA A;  1J3T A;  5IXB A;  2A28 A;  2FRY A;  2RMO A;  2RQU A;  2SEM A;  3O5Z A;  4IIM A;  4ORZ A;  1B3Q A;  2KRS A;  5HCK A;  2AKL A;  1AVZ C;  3TVT A;  2H8H A;  4WCI A;  1TG0 A;  1AWJ A;  4KRT A;  1M27 C;  2V1Q A;  4EIK A;  3VS5 A;  3EG0 A;  5I11 A;  2CSI A;  5FW9 A;  4HVU A;  2M51 A;  1SHG A;  1QWE A;  3M0S A;  1UG1 A;  1X43 A;  3UA7 A;  2PNI A;  3EG1 A;  3H41 A;  3NHN A;  1ZUY A;  2A08 A;  1X27 A;  2JS0 A;  2CDT A;  2GTO A;  2FRW A;  3UA6 A;  1RLP C;  2L3P A;  2K3B A;  4RTW A;  2PZ1 A;  4DEX A;  2LNH B;  1VYT A;  2CT4 A;  5GJW B;  3EHQ A;  2LQN A;  2DRK A;  4LN2 A;  5FWB A;  4A63 B;  2D0N A;  2AKK A;  1UUE A;  4J9G A;  3A98 A;  1K1Z A;  1U06 A;  2HDA A;  2ABL A;  4HVV A;  2B86 A;  1GRI A;  4OML A;  1SSH A;  3SEM A;  1NYF A;  1AZG B;  2DX1 A;  3M0U A;  4JJD A;  3R6N A;  1UE9 A;  1SRM A;  4J9C A;  2BZ8 A;  2GBQ A;  1KFZ A;  2M0Y A;  1NEB A;  1K76 A;  2KRN A;  2ED0 A;  3QWX X;  3VS0 A;  1QWF A;  2KT1 A;  1JU5 C;  1UTI A;  4CC2 A;  2F2X A;  4D8K A;  2K79 A;  2EPD A;  2GQI A;  1FYN A;  3VRZ A;  2CH4 W;  2FG0 A;  1UJY A;  4J9B A;  3M0T A;  2DM1 A;  2PTK A;  1X2K A;  2DVJ A;  2JXB A;  1NM7 A;  1RUW A;  3ZL7 C;  1X69 A;  1HJD A;  3UAT A;  1RLQ C;  1Y0M A;  1H92 A;  1MV0 B;  2DL3 A;  1JXO A;  2EBP A;  3EHR A;  1XOV A;  2XMF A;  3GBQ A;  3ULR B;  4CC7 A;  4HCK A;  2VWF A;  1K4U S;  3M0Q A;  4K11 A;  1JXM A;  2AK5 A;  2KR3 A;  4RUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...