2CREA

Solution structure of rsgi ruh-036, an sh3 domain from human cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
b'GSSGSSGLLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGLAPANRLQILSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEF-like protein
molecule tags Structural genomics, unknown function
source organism Homo sapiens
publication title Solution structure of RSGI RUH-036, an SH3 domain from human cDNA
rcsb
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2creA00
2LQNA 1GFCA 1M3BA 2LMJA 4DEXA 2CDTA 1MV3A 3I35A 1K1ZA 2DL3A 2YDLA 1VA7A 3UF4A 1M8MA 1BB9A 1UTIA 2CT3A 2JTEA 2J6FA 3H0HA 1X6BA 4AFQC 1ZX6A 2DYBA 2LNHB 2AZVA 1OPLA 2FPFA 1UJ0A 4CC4B 1HD3A 4WCIA 3VRZA 1KSWA 2JT4A 2GTJA 2AKLA 2DF6A 3A98A 4RTXA 3TSZA 1YP5A 5IXBA 3R6NA 2DRMA 1WDXA 1H92A 2YUPA 1ZUKA 3ZL7C 2EVRA 2EPDA 3PVQA 2EYXA 1JU5C 1WXUA 3KFVA 2EYZA 3TVTA 2K9GA 1U3OA 3GBQA 3PVLA 1UJYA 1HJDA 4RTZA 2K79A 2F2XA 2VVKA 2X3XD 2A28A 4CC3A 2EGEA 2EGCA 1E6HA 2YSQA 1U06A 1T0JA 1X27A 3PE0A 3VS7A 1AWJA 2A08A 5GJVB 1GBRA 2DJQA 1W6XA 4F16A 1BK2A 1YWPA 2KROA 2HDAA 2DA9A 4OMLA 2CH4A 3SEMA 3M0SA 4LE9A 2KNBB 2LJ1A 1WIEA 3NHNA 2RQVA 4JJBA 1KFZA 2XMFA 2DMOA 2J05A 1B3QA 2SEMA 2JM9A 3UATA 2J6OA 2LQWA 1K0XA 1QKXA 1W1FA 1W70A 3TSWA 2P4RA 3M0TA 3ULRB 2YUOA 4HCKA 1JEGA 4JJCA 4AFZC 1AZEA 2EKHA 4IIMA 3VS4A 1ZSGA 4RTWA 2EYYA 2D0NA 1B07A 5IXFA 1WX6A 2IIMA 2ROLA 2KRNA 2DILA 3VS1A 2JS0A 1ZUYA 1T3SA 2RQWA 4LN2A 3EG1A 4GLMA 4DEYA 1PRMC 2JMCA 2W0ZA 1RLPC 4D8DA 2PNIA 3NMZC 1SEMA 3VRYA 2MOXA 1WA7A 4F14A 2ROTA 3QWXX 2RQUA 1K9AA 2JM8A 1FYNA 2DL8A 1SRLA 2NWMA 4OMOA 3C0CA 1T0HA 2RMOA 2A36A 1QCFA 2VWFA 2ED1A 3NPFA 2LJ0A 1OPKA 4FSSA 1ARKA 3EHRA 2ECZA 2BZYA 4QT7A 2DLPA 1YWOA 4A63B 1SHGA 2O9VA 5EC7A 3VS5A 1NLPC 1UUEA 2GQIA 3U23A 3CQTA 1QWEA 4RTUA 5IH2A 3M0QA 1J3TA 4JZ3A 2RNAA 3FJ5A 3UA7A 1VYUA 2CSIA 2JMAA 1GL5A 1UGVA 2H8HA 5IHNA 1WLPB 1NEBA 1LCKA 2O88A 1CKAA 2SRCA 5L23A 1AWWA 2BTTA 2DL5A 2CREA 4Y92A 1I0CA 1RI9A 2YT6A 4J9HA 4HVWA 1KJWA 1M3AA 4HXJA 1ABQA 2BZ8A 2LX7A 2GNCA 2DBKA 1VYTA 2KYBA 2M0YA 2RN8A 2DRKA 3H0IA 2L3QA 4IIOA 1PKTA 1TUDA 2DL7A 1GCQA 2O2OA 4CC7A 2O31A 2L3SA 1RLQC 4Z89A 2BZXA 5FWBA 1G83A 2FRWA 2RQRA 4Z88A 2AZSA 1GCPA 4OMQA 4J9EA 1GCQC 1JXMA 2DE0X 2AKKA 1OEBA 1UDLA 1AEYA 1G2BA 2KXDA 1ZLMA 3EHQA 5IHKA 1JQQA 1UECA 2ESWA 3I5RA 2JS2A 2AK5A 2JXBA 2PTKA 4AG2C 2HBWA 2HEQA 1IO6A 1OV3A 2V1RA 2KRMA 3UA6A 3EG0A 4AG1C 1Y57A 2W10A 2RPNA 2CSQA 2EYWA 2F2VA 5FWCA 4AFSC 1K76A 1PRLC 2D1XA 1QWFA 2C0IA 2DNUA 4LNPA 4KRTA 1I07A 2KE9A 2CUBA 1ZBJA 2D8HA 4HVVA 2LJ3A 4GBQA 3QWYA 2CUDA 4J9IA 4RTTA 1BU1A 4RUGA 1PNJA 1AWXA 2EGAA 1I1JA 1ZUUA 2A37A 2F2WA 4R0KA 1CKBA 2EQIA 2HSPA 2JW4A 2NUZA 2OI3A 1PKSA 1BBZA 1WXBA 1JO8A 2GBQA 1T3LA 1OOTA 1UFFA 1YCSB 4Z8AA 1H8KA 4K11A 1E7OA 1H3HA 1PWTA 2YUQA 2CT4A 2J7IA 1XOVA 3I9QA 4LUDA 1A0NB 2HCKA 1V1CA 2L2PA 4J9DA 1PHTA 1JXOA 5HCKA 3EG2A 1E6GA 1X2QA 4JZ4A 4X1VA 2LZ6B 4J9BA 1GFDA 1YNZA 3JV3A 2KEAA 1FMKA 1NM7A 2KT8A 1TUCA 3VS0A 2YUNA 3M0PA 4J9FA 1X2KA 1UE9A 4J9GA 2KBTA 4AFUC 2KXCA 2L0AA 4E6RA 3VS6A 1KIKA 2FG0A 5GJWB 1TG0A 1U5SA 2MCNA 3H0FA 1ABOA 3RBBB 2LCSA 2ED0A 1MV0B 1MUZA 1WFWA 2B86A 1M30A 1AZGB 2D8JA 2KGTA 3I5SA 5IHIA 2KT1A 2VKNA 3RNJA 2RQTA 1SPKA 2EW3A 2ENMA 1EFNA 1AWOA 2GTOA 1X6GA 1Z9ZA 1QKWA 1UHCA 2OAWA 3NGPA 1Y0MA 5I22A 1QLYA 1YN8A 2PZ1A 2O9SA 3SHWA 4HVUA 1NG2A 1K0SA 1NLOC 4D8KA 2I0NA 2DBMA 1M27C 2OJ2A 1WI7A 4ORZA 1N5ZA 2K7AA 5FW9A 2CH4W 4M4ZA 2K3BA 1X69A 2MIOA 4LUEA 1AD5A 1WYXA 4CC2A 2J6KA 3M0UA 2EBPA 3REBB 1AVZC 2V1QA 2J06A 1NEGA 2FPEA 4OMNA 3O5ZA 3EGUA 1NYFA 3H41A 2X3WD 1AOJA 2C0OA 2LP5A 3VS2A 1SRMA 1UG1A 2L3PA 2FPDA 1Z9QA 4EIKA 2DM1A 3THKA 2K2MA 2M51A 4F17A 2E5KA 1GRIA 4RTVA 1VYVA 3IQLA 1SSHA 2C0TA 2G6FX 2GGRA 1X43A 2FO0A 2DX1A 2K6DA 4J9CA 2DL4A 2FEIA 5ECAA 3EG3A 1S1NA 4ESRA 1M3CA 4OMMA 4JJDA 2KRSA 2ABLA 2KYMA 1HSQA 4RTYA 2FRYA 1WXTA 3VS3A 1UHFA 2DVJA 4ZNXA 3M0RA 4JPBW 1GBQA 2QDLA 1CSKA 1K4US 1RUWA 1SHFA 2KR3A 3LH5A 5I11A 3REAB 4OMPA 1NYGA 2RF0A
chains in the Genus database with same CATH superfamily
3CEYA 3OQ5A 4DOWA 1MV3A 1WHGA 3C4SA 3JCMd 4N0AA 4M7DG 1M8MA 2MYSA 2CT3A 2V8IA 2PVOB 1ZX6A 1C0MA 4XTVA 1LJOA 2FHDA 2HL3A 1UJ0A 4ATOA 3LWHA 3DLMA 2V8KA 3VRZA 3CMET 2MMPA 2GTJA 2WSEE 3A98A 2E1HA 4RTXA 3TSZA 2EFIA 3R6NA 1PC0A 4E7ZA 3OA6A 2RJEA 1H92A 1SSFA 1ZUKA 4F7UB 2EVRA 1JU5C 1YJ9A 1RADB 3KFVA 4X34A 3JSCA 2VV5A 2K4YA 3BFMA 3HTRA 4A4EA 4C92G 1SF9A 3FDRA 1UJYA 5GAOl 1VIFA 4RTZA 1HXDA 1M4ZA 3CCSA 2CZ7B 2P0QA 2VVKA 2X3XD 2A28A 3JCMV 4CI0C 2A3LA 3GNGA 2EGEA 4M78F 3OYLA 4DBFA 4KULA 4MMLA 1N8RR 2YSQA 2KAFA 2RK1A 1AWJA 2A08A 2QQBA 4XAXB 4M75A 3V8KA 4M7AE 1YWPA 3CMEA 2DA9A 3MEUA 4M7DD 4OMLA 4FSXA 2JNGA 2XD0A 4LE9A 2RQVA 4JJBA 1KFZA 2DMOA 3PNWC 5FU7B 4EMGA 1WQ7A 2JM9A 2J6OA 1IB8A 3L2UA 3KXTA 3L1AA 2BIVA 4A54A 2LQWA 2RJDA 5C6SA 3PIPA 1QKXA 2CP0A 3CCSQ 2CZ6B 3J80E 2EQMA 5GAMj 1D3BA 1AZEA 4IIMA 1VQPQ 1ZSGA 4RTWA 2EYYA 2M0OA 1UGSB 2KRNA 2DILA 1U1SA 2FVUA 1HYOA 2RQWA 4LN2A 1KC8C 2OX7A 4M78C 4D8DA 4BDYA 3OYCA 3M56A 4XK8E 4KH1B 3SWNB 3M55A 5HKCA 1WA7A 2MI6A 3CPFA 2QEXA 2XU8A 2E64A 3QWXX 3E2UA 2RQUA 1S72T 3TQ7P 1VQ5A 2JM8A 4PJLA 2MWOA 5CR2A 4MDWA 2RMOA 3HKSA 2A36A 3OYDA 3A8LB 4OGCA 1YJNT 1UGRB 1SHGA 5EC7A 3VS5A 1XJWB 2KVQG 1EIFA 9ATCB 3U23A 1QWEA 1XQHA 1VQOA 1NJIU 4C5IA 3FJ5A 3UA7A 4XU1A 1VYUA 1AT1B 1M9SA 1TH7A 2JMAA 2H8HA 3V8LA 1WLPB 1YCYA 2DKGA 1LCKA 2O88A 2COZA 1ZHIA 2BTTA 4Y92A 4QQ6A 3INZA 3CCVT 1I0CA 1KJWA 3I56T 5CKBA 2P4TA 4JUVA 3RESA 4LD9K 3FEOA 2DBKA 5KYNA 1K9MU 4ZGJB 1BIBA 2GFUA 5CIUA 5LJ5d 2KYBA 4M78E 1WNLA 2DRKA 3H0IA 3X25B 1YITT 2M1HA 2M16A 3C12A 2DO3A 3JB9I 4HCBA 2O31A 2D0QB 5LJ3f 1X75C 1WZOA 1BCOA 1OULA 1G83A 2RQRA 2PQWA 4OMQA 4J9EA 2PVGB 2HMAA 3CMAT 4M7DB 1AEYA 2KXDA 3RKXA 3CCQQ 3CC4Q 3OMGA 1Y96A 1QP3A 2GQVA 3KUFA 1WHJA 1OV3A 3CC7T 4Z02A 3UA6A 2DTOA 2W10A 4AFSC 3RUXA 1RAEB 1MMDA 5GAOr 4KRTA 4P5NA 4RG8A 5GANd 1I07A 1YHQT 4GLKA 1ZBJA 1D1BA 2E10A 2WSCE 3QZ9B 4XTXA 1K73C 5GANj 1QVFS 2HQEA 2EQUA 4PJOB 1ZUUA 1Y07A 5FU6B 3L2RA 2EQIA 2HSPA 2OI3A 3JCMf 1PKSA 1BBZA 4KUDK 4MZMA 3NTKA 1QVGA 2CT4A 2J7IA 2EQJA 5LJ3g 5IT9E 1V1CA 4E7KA 1UGPB 2EJ9A 2YRCA 1E6GA 4J9BA 2LQ8A 3JV3A 3BDUA 1NM7A 5I2SA 4M78D 2QG9B 1VQLA 3AHUA 1UE9A 3JCMQ 4J9GA 2KBTA 2FG0A 1U5SA 2LCSA 1OU8A 3N5BB 4PJOC 1G3TA 1C1AA 4LXCA 1M30A 2KT1A 1RAHB 2RQTA 3CCRT 1PSFA 1UHCA 2DFUA 3VYHB 2X4JA 3M57A 4WTOB 5GMKi 1G3YA 3FIFA 3I56A 4C0DB 1K0SA 2E41A 1NZ9A 1VOMA 4D8KA 3OSVA 3QKJA 2OJ2A 5J3BA 1WI7A 5FW9A 1WGSA 2H3EB 4KGZB 1VQ4T 4LUEA 2F5KA 2X51A 2RJCA 1RAAB 3RDVA 2L8DA 3REBB 3VUBA 3M4GA 2J06A 3A8GB 2RJFA 4O6JA 1AOJA 5GMKm 2LP5A 5KYYB 1SRMA 2JN0A 4PKCC 3AT1B 2FPDA 2L3PA 5GAOp 5GAMd 2OTLA 4PFZA 2XKOC 2DM1A 4CRIA 4F17A 2DXBA 3IQLA 4II1A 2C0TA 5KYYA 4FU6A 2K6DA 3OS2A 3RIRA 3CXCA 1W4SA 2FEIA 3EG3A 3CCLT 4OMMA 2DD4A 4C5GA 1HSQA 2FRYA 2DXTA 2HQXA 1RABB 2CP6A 1QP2A 2QDLA 4B9XA 5DLQE 5AYFA 1K4US 1WJSA 5GANg 1SHFA 2KR3A 2VGMA 4FM4B 3JCMP 5I11A 4NS5A 1NYGA 4M77D 4XTZA 3JB9G 1VQ7A 3P8HA 1M3BA 2JTMA 3I35A 4E7IA 1K1ZA 3CD6A 1VQ8Q 1VQNT 3CBPA 4J6WA 2HAXA 2YDLA 1X6OA 1K9MC 3JCMW 5GAN6 1UTIA 4JLGA 2J6FA 4J6YA 2DXUA 1I5OB 3H0HA 3HPWA 2LNHB 2RA2A 3J81E 1VQ5Q 1BI0A 3RMQA 3E9FA 3OYYA 2LNVA 4LDWA 2E5QA 1HD3A 2JVVA 4E7JA 3M58A 2HBPA 4WCIA 1SKUB 2JT4A 2A7YA 2YXYA 3CC2A 2AKLA 3PGGA 4X9DA 4VUBA 3MKDA 2LC4A 1TS9A 4KGVB 4N4IA 2O4XA 2DRMA 2PUOB 5LJ3h 2YUPA 1QVGP 4QVZA 3OYNA 2EPDA 1YJ9T 3EFOA 3CMAQ 1YITA 3SFMA 3CCVA 2DERA 5LJ3e 1R77A 3PVLA 5LJ5j 4ZTFA 4L59A 1IZ6A 1IGUA 3CCUQ 4M7AG 2QQRA 2HL5C 2HNIA 1K9MR 3VS7A 1YITQ 4PJOG 2DJQA 2JJ9A 1VQ9Q 3V7CA 1VQMT 1BK2A 4A4FA 5GMKe 3EH2A 2NUTA 1I81A 2CGHA 3QYHB 3M0SA 3OYFA 2LJ1A 1WIEA 3NHNA 1Q86U 1VQ6Q 1B3QA 1M1KR 2E4HA 5GMKh 5FU7C 1MMGA 1VQ5T 3FB9A 2DAQA 1F1BB 4GY5A 5KH6A 1R0BG 4HCZA 3JB9F 5GAN7 3VUZA 4PFOA 3VKIA 4AFZC 2QYZA 4RMOA 4LDYA 2EKHA 1YIJQ 1TTHB 3CCRQ 6AT1B 3RERA 5IXFA 1WX6A 2RB6A 3EG1A 4DEYA 1VQ6T 1PRMC 2W0ZA 1RLPC 3JCMX 3GNFB 3NMZC 3HRTA 3CC7Q 1SEMA 1V29B 2GCXA 3VRYA 2XDDA 2M02A 5L8RE 3OYAA 1LNXA 1K9AA 2DXCA 4E2FB 5FU6C 4BE2A 1U8RA 1SRLA 2QQ9A 1T0HA 1YJWT 1QCFA 1YBYA 2LJ0A 1OPKA 3CCUA 4PJOE 2LT4A 2Y4YA 3EHRA 2RHZA 4JS4A 3LLRA 4NL3A 5IN1A 1KHIA 1PM3A 2DLPA 2KQWA 4LD6A 4A63B 1TUGB 3CCJT 3JCMc 1NLPC 2KK4A 3SD4A 5IH2A 1ZSZB 4ELZC 1VQ8A 3OBYA 1NJIC 2HZYA 2CSIA 2LDMA 1PSEA 7AT1B 4IUQA 4N4GA 1KK7A 1CKAA 2XICA 5L23A 2RHYA 4IUUA 1M90R 3SWNC 3R6OA 2YT6A 2EWNA 4HVWA 1M3AA 2BZ8A 5CKFA 2GNCA 3FRNA 4DBQA 2DEUA 2C06A 1VQ9T 2YLBA 5GAMe 2RI3A 1Q81C 1VQMQ 4C0GA 3OS5A 4FT4A 4KT0E 3H9NA 2HKNA 4DOVA 2M0YA 5GAOn 2RN8A 1D09B 2RHUA 2ZPHB 3MJXA 1B34A 1FX7A 5AT1B 4IIOA 4IKFA 2YLCA 4FL6A 3CCJQ 2VUBA 1PCXA 4Z89A 2BZXA 5FRNA 1FMVA 4F7UG 4Z88A 4DQ2A 2AZSA 5LJ3d 1GCPA 1XTDA 1GCQC 1JXMA 1VQNA 1NPPA 1YJ9Q 1YIJT 1ZLMA 2VXEA 2XHCA 2YWWA 5C0MA 3OYJA 5IHKA 3HFNA 2DTIA 1IRXA 2ESWA 2AK5A 2JXBA 2PTKA 2RI5A 2KRMA 1KHCA 3EG0A 1Y57A 5KE2A 1YHQA 2F2VA 1M1GA 3ASKA 4BE0A 2OTLQ 2ZPEB 1ZSZA 2CUBA 3MHXA 4HVVA 3S6WA 2LJ3A 4GBQA 4M75G 3QWYA 3L2VA 3QDRB 2QI2A 4J9IA 4RTTA 5LL6S 1AHJB 1BU1A 2CZ0B 3GOXA 5GAOm 1IHWA 2EGAA 3G71T 1LOJA 1T3LA 1OOTA 1UFFA 3HL8A 3ZBDA 4DA4A 2X4YA 1H8KA 1E7OA 3CMAA 2YUQA 1O75A 1BI1A 4TVRA 1XOVA 4M7AB 3SDZA 1A0NB 2R58A 2XI9A 3CD6Q 1OZ2A 1PHTA 4F04B 4PJMA 1YJWQ 1BKBA 5GANh 3VU3C 3QIIA 2E70A 2FB7A 1TUCA 2EIFA 3VV0A 3FJPA 2YUNA 5A2QE 1YI2A 4E7HA 2G3RA 3CCJA 5GANe 3CCQA 1VQOQ 3VS6A 2MF2A 4C8QC 3H0FA 1MNDA 3RBBB 3OYEA 2ED0A 3JB9J 5D7UA 3BY7A 4HCCA 1VUBA 1Q86R 5D6YA 3CD6T 3CCEA 5GAMg 4D6WA 2VKNA 3RNJA 2V8JA 4FYXB 4BD3A 1SPKA 2EW3A 4OVAA 2NUPB 1EFNA 2X9HA 1Z9ZA 1QKWA 1KQ1A 3D7SB 3NGPA 4R55A 2HD0A 2PZ1A 1JJ2A 3A1PA 4IURA 3CCEQ 2KI7A 1YHQQ 2K7AA 4M4ZA 2HQHA 5CKEA 3QO3A 2P84A 2XDBA 1WYXA 1P92A 3TEEA 3UDCA 3G71Q 2XIDA 4V2SA 3QG1A 4OMNA 2QGFB 4DBRA 3EGUA 2ZPBB 5DM7R 3ER0A 4BY6C 3URGA 2F1LA 1VQ4A 2E65A 1EZZB 3S3OA 4FIBA 1UG1A 1C6VX 4J7FA 1Z9QA 3A5ZB 3G1JA 1OYXA 1Q86C 1M90U 2EJGA 4OB1B 1Q82R 2X35A 2K2MA 2E5KA 2GFAA 4FYWB 1VYVA 4PL6A 5KYUB 3G4SQ 2CZ1B 3CCMQ 4C0DC 1B34B 4UC4A 2DL4A 4O5VA 2L3RA 4J8OA 2DD5A 3LH0A 4JRIA 3G6EA 2EAYA 3QHSA 1GXIE 3VS3A 5GAN2 1JJ2P 2DVJA 4ZNXA 1CSKA 1QCNA 5HY6A 4BY6B 3I56Q 4IUVA 3CC7A 4C92F 1RUWA 5CQYA 3LH5A 4XTWA 1ACMB 2VYTA 5FLXE 4OMPA 1YI2T 3LX7A 2LQNA 1OI1A 4A4HA 4DEXA 2CDTA 3GIBA 2LQKA 4J83A 3UF4A 2E12A 4BDZA 4PJOF 4MZPA 1H641 4C8QE 1Q82U 2AZVA 1OPLA 3CPWS 3C95A 1D1CA 5I2MA 1KSWA 1ZBXA 4RKUE 1WQWA 2DF6A 2VGNA 4C8QD 1YP5A 5GAN3 1KD1C 4EPCA 2XDPA 5LJ3j 1WDXA 5KYXA 2OTJA 2XK0A 2EYXA 3PVQA 1WXUA 1I4K1 4BE1A 3TVTA 2K9GA 2ZPGB 1U3OA 3GBQA 4KBMB 3OYKA 2YRVA 1R8OB 2K5IA 3WXMB 3EFRA 2K79A 3CCMA 2F2XA 4FT2A 3X20B 4CC3A 4QW2A 2EGCA 1M1KU 1U06A 3X26B 1X27A 4BB7A 3OYHA 5GJVB 1GBRA 5GAN4 3ZEHA 1IHVA 1OX9A 5FRMA 1W6XA 1WPYA 3I55Q 2BE7D 2KROA 1YJNA 2HDAA 5A0GA 1G3WA 2EYQA 3EGDB 4M77A 2CKKA 2COYA 2E3IA 2SEMA 3UATA 1QMCA 1S72A 2CP3A 4MMKA 2QEXT 3GP8A 1W1FA 1QVFA 3ULRB 2YUOA 4HCKA 4M77B 1JEGA 1BCMA 4JJCA 3L2ZA 3KBGA 4OF1A 1XNIA 3LGFA 1VQNQ 4M78A 2E6ZA 5KCHA 1N6AA 1B07A 4YTLA 2ROLA 3VS1A 3I55A 2JS0A 4GLMA 2KSSA 2JMCA 3EG9A 2JTFA 4ANJA 2X4WA 3E9GA 3M5AA 4C92E 3TREA 4F14A 2ROTA 4PLLA 2PVDB 3CCQT 1S72Q 3JCMJ 3CCLQ 2CP5A 2PU9B 3RKWA 2P0KA 4QQGA 2NWMA 2D9TA 3NPFA 4FSSA 1ARKA 1FWZA 2KDSA 4NOYA 3FC3A 1W2BP 3H8ZA 4QT7A 4C8QF 3SB2A 2O9VA 1SG5A 4EMHA 1IXDA 4M7AD 5CKHA 3CQTA 3QYGB 4RTUA 3M0QA 1TWBA 3QXEB 3J7AF 3OW2P 4B9WA 2RNAA 1G8XA 4M7DA 3EFSA 3LWIA 4J5YA 2RO0A 4A53A 4QVDA 2QEXQ 5GMKl 2Y90A 4FW2A 1TXQA 2DL5A 2CREA 5GAMf 3BW1A 4N4HA 1VQ7Q 2FZKB 1RI9A 4F7UA 3CCVQ 2E3HA 4J9HA 3O8VA 2QDYB 2LX7A 2QA4Q 3G7ZA 1MHNA 3RKYA 2Y4XA 4EMKB 4AT1B 5EG2A 4ME7A 1VYTA 3X28B 2OAUA 2L3QA 1B7TA 1PKTA 1TUDA 3M59A 1K8AR 4CC7A 2R5MA 3M54A 3DKMA 2O4XB 1KC8U 2FRWA 3QUIA 3TU4K 3PMTA 2F69A 2DE0X 1OEBA 1I8FA 2BE9B 2DVEA 2FZCB 3EHQA 3L2QA 1KQSS 2CP7A 4ZN1A 3I5RA 2JS2A 3NTHA 5LJ5g 4AG2C 3CCST 2HEQA 1IO6A 2QA4T 5J26A 1M90C 1ZSZC 4M75E 3OW2A 4AG1C 2WSFE 2EYWA 5FWCA 1K76A 1PRLC 1IREB 5KYWB 2IG0A 1N8RC 1N27A 4HKEA 5A0DA 4XU0A 2Z0WA 1MMNA 4IUTA 2CUDA 2IPOB 4PK4A 1PD1A 4BI4A 5IAYA 4M7DC 4NL2A 1MGQA 4RUGA 4JS5A 1K8AU 4JRQA 2A37A 2EKOA 1N9RA 2X4XA 1H3ZA 2JW4A 3PT9A 3SWNA 2AT1B 4Z8AA 1TSFA 1YCSB 3TCJA 2ZPFB 4K11A 1H3HA 1PWTA 3I9QA 2QTXA 4LUDA 4XTYA 2DIQA 3GPLA 1PG5B 2L2PA 5FROA 4J9DA 3Q1JA 1JXOA 5HCKA 3CC2T 4C92B 3EG2A 2K57A 2DZ9A 1YNZA 4M78B 1YIJA 5KYUA 4MZTA 1FMKA 4C8QA 3JCMb 3VS0A 2GF7A 2K3YA 3DLLA 2JOYA 1FXXA 3CC4T 3M0PA 1M8VA 4J9FA 3UPUA 1X2KA 1NPRA 2KXCA 4AFUC 2RHXA 3F70A 4PLIA 4E6RA 4QQDA 1KIKA 1W2BS 3E19A 4E7LA 1TG0A 1MV0B 3OMCA 3PTAA 4C5EA 3CMEQ 2COWA 2JUFA 5IHIA 2RK2A 5CQXA 1RAFB 2ENMA 3OS1A 2GTOA 3OYIA 1LVKA 3OS0A 1M2OA 2EJFA 3V7RA 1VQ9A 5GAN8 5LJ5h 2OAWA 5I22A 1Y0MA 1YN8A 2WACA 3L42A 1KQ2A 4M7AC 1NG2A 2I0NA 4XU2A 1M27C 2OTLT 4KUIA 1N5ZA 4HA8A 3L2WA 4Y28E 1VIEA 3A8OB 2K5FA 4BACA 4XQ3A 1NBEB 4CC2A 3PIOA 5CVIA 1BI3A 3M0UA 2EBPA 4ZTJA 3HHTB 4FCYA 3ME9A 2X3WD 5KCOA 2C0OA 2PUKB 3MPUB 3LGLA 3LYIA 1LPLA 4C92D 3HFOA 3OW2S 2AHJB 1R0CB 2MK5A 2LVMA 3G4ST 3OBWA 1YJNQ 3THKA 2M51A 1GRIA 2O01E 4LDUA 4RTVA 2V26A 5DLOA 1QVGS 1WHLA 2GGRA 3EAEA 1X43A 1G5VA 3NTIA 1VQKQ 3JCMh 4J6XA 4ESRA 1BYMA 1D0XA 4JJDA 2YRDA 4RCCA 1HK9A 4RTYA 1W2BA 4BI3A 1VQKT 1ZA2B 2MAMA 4M77F 3BDLA 4QKUA 3M0RA 4JPBW 4M7AF 3EFOB 4XU3A 3M53A 2KY9A 1KG1A 1QQJA 3QDFA 3P8DA 4A4GA 2LCLA 2RH2A 3REAB 2ZGWA 1WHKA 3HRSA 3META 1GFCA 2LMJA 4C8QG 2DYIA 4WF2A 4F7UF 2DL3A 1VA7A 4M7AA 2L89A 1O9SA 1BB9A 2JTEA 2K3XA 3MEWA 4PJJA 1X6BA 2XG8D 4AFQC 2DYBA 1UEBA 2BUDA 2RI2A 3M9QA 4N0AC 1Q82C 2FPFA 1RL2A 4CC4B 1VQ7T 1D0ZA 2FYKA 2VASA 1JB0E 5GANf 4FYVB 1OU9A 2ZZDA 4E7SA 3EGDA 5IXBA 4ZN3A 1KD1U 1TOVA 3HRUA 2QAZA 3X24B 3ZFJA 1JBMA 3ZL7C 2EYZA 2L5QA 3CCMT 1OX8A 4M77E 3MCAB 1HJDA 2MWPA 1DJ7B 1E6HA 1WHMA 2R5AA 4EMKC 1T0JA 3M4YA 3A8HB 3PE0A 4M7DF 1EX4A 3CCLA 4JRKA 4EDUA 2DJZA 4F16A 1X01A 2H3JA 5GAMh 2I2LA 3MP1A 2CH4A 4M75C 3SEMA 3EG9B 3OYBA 2KNBB 1VQ4Q 2NYSA 2XMFA 2J05A 1IGQA 5CK9A 4OB0B 4JRPA 8ATCB 8AT1B 1K0XA 4E47A 1KQSP 1W70A 1RI0A 3TSWA 2P4RA 3M0TA 5CCAA 2QTVA 4OMFB 3BE3A 1YFNA 1Q7YC 4C0FA 1Y71A 1TU0B 3H6ZA 3VS4A 2YHTA 2D0NA 3EH1A 2IIMA 2QQSA 2LT1A 4OP0A 1ZUYA 1T3SA 1N8RU 2PNIA 4M75B 1QVFP 3OYMA 2MOXA 1VQOT 5LJ5f 1KQSA 5GMKj 4M77G 3I55T 2LCCA 3QJYA 2K5LA 3EGXA 3T9NA 1FYNA 2DTHA 2DL8A 4OMOA 3C0CA 2RHIA 3V8JA 3LW5E 2DZCA 2DEQA 2VWFA 2ED1A 2DETA 1NJIR 4PNOA 2VXFA 1MNEA 2ECZA 1Q81R 2BZYA 4LDVA 5KE3A 5LJ5e 4EMKA 3MO8A 1KD1R 1YWOA 5J39A 1VQLT 1UUEA 2GQIA 4ZGDB 1VQPT 4AMCA 1J3TA 4JZ3A 4B6MA 1V76A 4HT9A 1GL5A 1UGVA 5IHNA 4M77C 2NUPA 1NEBA 5HK3A 2OTJQ 2SRCA 1AWWA 2LX9A 1QCOA 3EGXB 4HXJA 1ABQA 2OTJT 5A0LA 4HT8A 2ZAEA 3RR6A 2CS7A 2QXFA 4C5HA 3OSSC 4C92A 2QGGA 3VYGA 3CCRA 4L5GA 4PFPA 1UGQB 2P0PA 3JRZA 1FMWA 4DBHA 3RMSA 5KYWA 2DL7A 1GCQA 2K2VA 2O2OA 2QK0A 2L3SA 1D0YA 1RLQC 4M78G 2MPXC 4PJOA 5FWBA 1OQKA 5D6XA 5KYXB 2NUTB 2F5TX 2AKKA 3QSUA 3DB4A 3OY9A 1UDLA 1G2BA 1BIAA 1U1TA 1JQQA 1UECA 2HBWA 2V1RA 4FW1A 3UWNA 2RPNA 2CSQA 3WVDB 3JCMe 2BKDN 1JJ2S 2RD1A 1VQKA 1RAGB 2D1XA 5DY9A 1QWFA 2C0IA 2DNUA 4LNPA 1WJQA 2QQAA 4M75D 3S3MA 1I5LA 2KE9A 3JB9D 4PJNA 2D8HA 2RM4A 3VJPA 4QVCA 2A0FB 2DIGA 3QBYA 2QA4A 3CPWA 1PNJA 1AWXA 1I1JA 1N9SA 3PMIA 2F2WA 4R0KA 1CKBA 1K8AC 2NUZA 5GAOq 2HSEB 1VQ8T 1WXBA 1JO8A 3G6ET 4J7IA 3CXCS 1YI2Q 2GBQA 2VB6A 2FZGB 2DPPB 2D6FA 3C94A 4OGEA 2LRQA 4L6V5 1OZ3A 4FYYB 2HCKA 3HP9A 3CPWP 2KMTA 4JZ4A 1X2QA 4X1VA 4R56A 2LZ6B 4C92C 3S3NA 2VC8A 4Q5WA 1GFDA 3MEVA 3UT1A 2KEAA 2KT8A 1Q81U 2ZCFB 1VQPA 5I21A 2M9UA 4IUPA 4BUGA 1RACB 3CBMA 1QW1A 5CO7A 4F7UE 4OB3B 2L0AA 1K73R 5GJWB 4X9CA 2MCNA 1ABOA 3CC2Q 4C0ZA 1MUZA 1WFWA 2B86A 2R57A 4M75F 3WVEB 3NFCA 4BI8B 3OYGA 1AZGB 2D8JA 2KGTA 3I5SA 1M5Q1 3FLGA 2ZPIB 2HKQB 2QASA 1VQ6A 3DB3A 1AWOA 1Y96B 3CBOA 1X6GA 3QZ5B 1WHHA 1M2VB 3MP8A 2ATCB 1MMAA 2LTOA 1QLYA 3SHWA 2O9SA 1M1FA 4HVUA 1D1AA 4A4KA 1Q7YR 1NLOC 1ZA1B 2DBMA 4ORZA 1D3BB 4KH0B 2CH4W 4C8QB 3E1SA 2K3BA 5CAIA 1Y7XA 1BI2A 4M7DE 4Y91A 1X69A 2MIOA 1AD5A 1JRIA 2CP2A 5GAN5 3CXCP 3GF5A 2J6KA 3G6EQ 5HK0A 1AVZC 2V1QA 2FL7A 1NEGA 4JLIA 2FPEA 4XTUA 3CCET 2DK3A 3O5ZA 1NYFA 3G4SA 3H41A 3JB9H 3MEAA 3HSBA 1RAIB 4OB2B 4JJNK 1VQMA 3VS2A 2E6NA 1UB4A 1WJRA 4JDSA 1VQLQ 4KGXB 3CC4A 2B8AA 4ZGEB 5D6WA 1G3SA 4EIKA 4LDXA 3QJ6A 3A8MB 3CCUT 1QVPA 1M2VA 3G71A 3GLXA 5M9OA 1NE8A 2JZ2A 2IVWA 4ELYC 1YJWA 2NLUA 3OB9A 1ZQ1A 1SSHA 2G6FX 1M1KC 3P8BB 2FO0A 2DX1A 3JCMg 5CKDA 3V7SA 2CYZB 4J9CA 4PJOD 5ECAA 2EQKA 1KC8R 1S1NA 1M3CA 1Q7YU 1K73U 2KRSA 2AIRB 1Q95G 4RG2A 2ABLA 2KYMA 1WXTA 1PD0A 1UHFA 3MP6A 3PFSA 1GBQA 3QPHA 4RCBA 3JAME 4MDXA 2RF0A
chains in the Genus database with same CATH topology
2LQNA 1GFCA 1M3BA 2LMJA 4DEXA 2CDTA 1MV3A 3I35A 1K1ZA 2DL3A 2YDLA 1VA7A 3UF4A 1M8MA 1BB9A 1UTIA 2CT3A 2JTEA 2J6FA 3H0HA 1X6BA 4AFQC 1ZX6A 2DYBA 2LNHB 2AZVA 1OPLA 2FPFA 1UJ0A 4CC4B 1HD3A 4WCIA 3VRZA 1KSWA 2JT4A 2GTJA 2AKLA 2DF6A 3A98A 4RTXA 3TSZA 1YP5A 5IXBA 3R6NA 2DRMA 1WDXA 1H92A 2YUPA 1ZUKA 3ZL7C 2EVRA 2EPDA 3PVQA 2EYXA 1JU5C 1WXUA 3KFVA 2EYZA 3TVTA 2K9GA 1U3OA 3GBQA 3PVLA 1UJYA 1HJDA 4RTZA 2K79A 2F2XA 2VVKA 2X3XD 2A28A 4CC3A 2EGEA 2EGCA 1E6HA 2YSQA 1U06A 1T0JA 1X27A 3PE0A 3VS7A 1AWJA 2A08A 5GJVB 1GBRA 2DJQA 1W6XA 4F16A 1BK2A 1YWPA 2KROA 2HDAA 2DA9A 4OMLA 2CH4A 3SEMA 3M0SA 4LE9A 2KNBB 2LJ1A 1WIEA 3NHNA 2RQVA 4JJBA 1KFZA 2XMFA 2DMOA 2J05A 1B3QA 2SEMA 2JM9A 3UATA 2J6OA 2LQWA 1K0XA 1QKXA 1W1FA 1W70A 3TSWA 2P4RA 3M0TA 3ULRB 2YUOA 4HCKA 1JEGA 4JJCA 4AFZC 1AZEA 2EKHA 4IIMA 3VS4A 1ZSGA 4RTWA 2EYYA 2D0NA 1B07A 5IXFA 1WX6A 2IIMA 2ROLA 2KRNA 2DILA 3VS1A 2JS0A 1ZUYA 1T3SA 2RQWA 4LN2A 3EG1A 4GLMA 4DEYA 1PRMC 2JMCA 2W0ZA 1RLPC 4D8DA 2PNIA 3NMZC 1SEMA 3VRYA 2MOXA 1WA7A 4F14A 2ROTA 3QWXX 2RQUA 1K9AA 2JM8A 1FYNA 2DL8A 1SRLA 2NWMA 4OMOA 3C0CA 1T0HA 2RMOA 2A36A 1QCFA 2VWFA 2ED1A 3NPFA 2LJ0A 1OPKA 4FSSA 1ARKA 3EHRA 2ECZA 2BZYA 4QT7A 2DLPA 1YWOA 4A63B 1SHGA 2O9VA 5EC7A 3VS5A 1NLPC 1UUEA 2GQIA 3U23A 3CQTA 1QWEA 4RTUA 5IH2A 3M0QA 1J3TA 4JZ3A 2RNAA 3FJ5A 3UA7A 1VYUA 2CSIA 2JMAA 1GL5A 1UGVA 2H8HA 5IHNA 1WLPB 1NEBA 1LCKA 2O88A 1CKAA 2SRCA 5L23A 1AWWA 2BTTA 2DL5A 2CREA 4Y92A 1I0CA 1RI9A 2YT6A 4J9HA 4HVWA 1KJWA 1M3AA 4HXJA 1ABQA 2BZ8A 2LX7A 2GNCA 2DBKA 1VYTA 2KYBA 2M0YA 2RN8A 2DRKA 3H0IA 2L3QA 4IIOA 1PKTA 1TUDA 2DL7A 1GCQA 2O2OA 4CC7A 2O31A 2L3SA 1RLQC 4Z89A 2BZXA 5FWBA 1G83A 2FRWA 2RQRA 4Z88A 2AZSA 1GCPA 4OMQA 4J9EA 1GCQC 1JXMA 2DE0X 2AKKA 1OEBA 1UDLA 1AEYA 1G2BA 2KXDA 1ZLMA 3EHQA 5IHKA 1JQQA 1UECA 2ESWA 3I5RA 2JS2A 2AK5A 2JXBA 2PTKA 4AG2C 2HBWA 2HEQA 1IO6A 1OV3A 2V1RA 2KRMA 3UA6A 3EG0A 4AG1C 1Y57A 2W10A 2RPNA 2CSQA 2EYWA 2F2VA 5FWCA 4AFSC 1K76A 1PRLC 2D1XA 1QWFA 2C0IA 2DNUA 4LNPA 4KRTA 1I07A 2KE9A 2CUBA 1ZBJA 2D8HA 4HVVA 2LJ3A 4GBQA 3QWYA 2CUDA 4J9IA 4RTTA 1BU1A 4RUGA 1PNJA 1AWXA 2EGAA 1I1JA 1ZUUA 2A37A 2F2WA 4R0KA 1CKBA 2EQIA 2HSPA 2JW4A 2NUZA 2OI3A 1PKSA 1BBZA 1WXBA 1JO8A 2GBQA 1T3LA 1OOTA 1UFFA 1YCSB 4Z8AA 1H8KA 4K11A 1E7OA 1H3HA 1PWTA 2YUQA 2CT4A 2J7IA 1XOVA 3I9QA 4LUDA 1A0NB 2HCKA 1V1CA 2L2PA 4J9DA 1PHTA 1JXOA 5HCKA 3EG2A 1E6GA 1X2QA 4JZ4A 4X1VA 2LZ6B 4J9BA 1GFDA 1YNZA 3JV3A 2KEAA 1FMKA 1NM7A 2KT8A 1TUCA 3VS0A 2YUNA 3M0PA 4J9FA 1X2KA 1UE9A 4J9GA 2KBTA 4AFUC 2KXCA 2L0AA 4E6RA 3VS6A 1KIKA 2FG0A 5GJWB 1TG0A 1U5SA 2MCNA 3H0FA 1ABOA 3RBBB 2LCSA 2ED0A 1MV0B 1MUZA 1WFWA 2B86A 1M30A 1AZGB 2D8JA 2KGTA 3I5SA 5IHIA 2KT1A 2VKNA 3RNJA 2RQTA 1SPKA 2EW3A 2ENMA 1EFNA 1AWOA 2GTOA 1X6GA 1Z9ZA 1QKWA 1UHCA 2OAWA 3NGPA 1Y0MA 5I22A 1QLYA 1YN8A 2PZ1A 2O9SA 3SHWA 4HVUA 1NG2A 1K0SA 1NLOC 4D8KA 2I0NA 2DBMA 1M27C 2OJ2A 1WI7A 4ORZA 1N5ZA 2K7AA 5FW9A 2CH4W 4M4ZA 2K3BA 1X69A 2MIOA 4LUEA 1AD5A 1WYXA 4CC2A 2J6KA 3M0UA 2EBPA 3REBB 1AVZC 2V1QA 2J06A 1NEGA 2FPEA 4OMNA 3O5ZA 3EGUA 1NYFA 3H41A 2X3WD 1AOJA 2C0OA 2LP5A 3VS2A 1SRMA 1UG1A 2L3PA 2FPDA 1Z9QA 4EIKA 2DM1A 3THKA 2K2MA 2M51A 4F17A 2E5KA 1GRIA 4RTVA 1VYVA 3IQLA 1SSHA 2C0TA 2G6FX 2GGRA 1X43A 2FO0A 2DX1A 2K6DA 4J9CA 2DL4A 2FEIA 5ECAA 3EG3A 1S1NA 4ESRA 1M3CA 4OMMA 4JJDA 2KRSA 2ABLA 2KYMA 1HSQA 4RTYA 2FRYA 1WXTA 3VS3A 1UHFA 2DVJA 4ZNXA 3M0RA 4JPBW 1GBQA 2QDLA 1CSKA 1K4US 1RUWA 1SHFA 2KR3A 3LH5A 5I11A 3REAB 4OMPA 1NYGA 2RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQN A;  1GFC A;  1M3B A;  2LMJ A;  4DEX A;  2CDT A;  1MV3 A;  3I35 A;  1K1Z A;  2DL3 A;  2YDL A;  1VA7 A;  3UF4 A;  1M8M A;  1BB9 A;  1UTI A;  2CT3 A;  2JTE A;  2J6F A;  3H0H A;  1X6B A;  4AFQ C;  1ZX6 A;  2DYB A;  2LNH B;  2AZV A;  1OPL A;  2FPF A;  1UJ0 A;  4CC4 B;  1HD3 A;  4WCI A;  3VRZ A;  1KSW A;  2JT4 A;  2GTJ A;  2AKL A;  2DF6 A;  3A98 A;  4RTX A;  3TSZ A;  1YP5 A;  5IXB A;  3R6N A;  2DRM A;  1WDX A;  1H92 A;  2YUP A;  1ZUK A;  3ZL7 C;  2EVR A;  2EPD A;  3PVQ A;  2EYX A;  1JU5 C;  1WXU A;  3KFV A;  2EYZ A;  3TVT A;  2K9G A;  1U3O A;  3GBQ A;  3PVL A;  1UJY A;  1HJD A;  4RTZ A;  2K79 A;  2F2X A;  2VVK A;  2X3X D;  2A28 A;  4CC3 A;  2EGE A;  2EGC A;  1E6H A;  2YSQ A;  1U06 A;  1T0J A;  1X27 A;  3PE0 A;  3VS7 A;  1AWJ A;  2A08 A;  5GJV B;  1GBR A;  2DJQ A;  1W6X A;  4F16 A;  1BK2 A;  1YWP A;  2KRO A;  2HDA A;  2DA9 A;  4OML A;  2CH4 A;  3SEM A;  3M0S A;  4LE9 A;  2KNB B;  2LJ1 A;  1WIE A;  3NHN A;  2RQV A;  4JJB A;  1KFZ A;  2XMF A;  2DMO A;  2J05 A;  1B3Q A;  2SEM A;  2JM9 A;  3UAT A;  2J6O A;  2LQW A;  1K0X A;  1QKX A;  1W1F A;  1W70 A;  3TSW A;  2P4R A;  3M0T A;  3ULR B;  2YUO A;  4HCK A;  1JEG A;  4JJC A;  4AFZ C;  1AZE A;  2EKH A;  4IIM A;  3VS4 A;  1ZSG A;  4RTW A;  2EYY A;  2D0N A;  1B07 A;  5IXF A;  1WX6 A;  2IIM A;  2ROL A;  2KRN A;  2DIL A;  3VS1 A;  2JS0 A;  1ZUY A;  1T3S A;  2RQW A;  4LN2 A;  3EG1 A;  4GLM A;  4DEY A;  1PRM C;  2JMC A;  2W0Z A;  1RLP C;  4D8D A;  2PNI A;  3NMZ C;  1SEM A;  3VRY A;  2MOX A;  1WA7 A;  4F14 A;  2ROT A;  3QWX X;  2RQU A;  1K9A A;  2JM8 A;  1FYN A;  2DL8 A;  1SRL A;  2NWM A;  4OMO A;  3C0C A;  1T0H A;  2RMO A;  2A36 A;  1QCF A;  2VWF A;  2ED1 A;  3NPF A;  2LJ0 A;  1OPK A;  4FSS A;  1ARK A;  3EHR A;  2ECZ A;  2BZY A;  4QT7 A;  2DLP A;  1YWO A;  4A63 B;  1SHG A;  2O9V A;  5EC7 A;  3VS5 A;  1NLP C;  1UUE A;  2GQI A;  3U23 A;  3CQT A;  1QWE A;  4RTU A;  5IH2 A;  3M0Q A;  1J3T A;  4JZ3 A;  2RNA A;  3FJ5 A;  3UA7 A;  1VYU A;  2CSI A;  2JMA A;  1GL5 A;  1UGV A;  2H8H A;  5IHN A;  1WLP B;  1NEB A;  1LCK A;  2O88 A;  1CKA A;  2SRC A;  5L23 A;  1AWW A;  2BTT A;  2DL5 A;  2CRE A;  4Y92 A;  1I0C A;  1RI9 A;  2YT6 A;  4J9H A;  4HVW A;  1KJW A;  1M3A A;  4HXJ A;  1ABQ A;  2BZ8 A;  2LX7 A;  2GNC A;  2DBK A;  1VYT A;  2KYB A;  2M0Y A;  2RN8 A;  2DRK A;  3H0I A;  2L3Q A;  4IIO A;  1PKT A;  1TUD A;  2DL7 A;  1GCQ A;  2O2O A;  4CC7 A;  2O31 A;  2L3S A;  1RLQ C;  4Z89 A;  2BZX A;  5FWB A;  1G83 A;  2FRW A;  2RQR A;  4Z88 A;  2AZS A;  1GCP A;  4OMQ A;  4J9E A;  1GCQ C;  1JXM A;  2DE0 X;  2AKK A;  1OEB A;  1UDL A;  1AEY A;  1G2B A;  2KXD A;  1ZLM A;  3EHQ A;  5IHK A;  1JQQ A;  1UEC A;  2ESW A;  3I5R A;  2JS2 A;  2AK5 A;  2JXB A;  2PTK A;  4AG2 C;  2HBW A;  2HEQ A;  1IO6 A;  1OV3 A;  2V1R A;  2KRM A;  3UA6 A;  3EG0 A;  4AG1 C;  1Y57 A;  2W10 A;  2RPN A;  2CSQ A;  2EYW A;  2F2V A;  5FWC A;  4AFS C;  1K76 A;  1PRL C;  2D1X A;  1QWF A;  2C0I A;  2DNU A;  4LNP A;  4KRT A;  1I07 A;  2KE9 A;  2CUB A;  1ZBJ A;  2D8H A;  4HVV A;  2LJ3 A;  4GBQ A;  3QWY A;  2CUD A;  4J9I A;  4RTT A;  1BU1 A;  4RUG A;  1PNJ A;  1AWX A;  2EGA A;  1I1J A;  1ZUU A;  2A37 A;  2F2W A;  4R0K A;  1CKB A;  2EQI A;  2HSP A;  2JW4 A;  2NUZ A;  2OI3 A;  1PKS A;  1BBZ A;  1WXB A;  1JO8 A;  2GBQ A;  1T3L A;  1OOT A;  1UFF A;  1YCS B;  4Z8A A;  1H8K A;  4K11 A;  1E7O A;  1H3H A;  1PWT A;  2YUQ A;  2CT4 A;  2J7I A;  1XOV A;  3I9Q A;  4LUD A;  1A0N B;  2HCK A;  1V1C A;  2L2P A;  4J9D A;  1PHT A;  1JXO A;  5HCK A;  3EG2 A;  1E6G A;  1X2Q A;  4JZ4 A;  4X1V A;  2LZ6 B;  4J9B A;  1GFD A;  1YNZ A;  3JV3 A;  2KEA A;  1FMK A;  1NM7 A;  2KT8 A;  1TUC A;  3VS0 A;  2YUN A;  3M0P A;  4J9F A;  1X2K A;  1UE9 A;  4J9G A;  2KBT A;  4AFU C;  2KXC A;  2L0A A;  4E6R A;  3VS6 A;  1KIK A;  2FG0 A;  5GJW B;  1TG0 A;  1U5S A;  2MCN A;  3H0F A;  1ABO A;  3RBB B;  2LCS A;  2ED0 A;  1MV0 B;  1MUZ A;  1WFW A;  2B86 A;  1M30 A;  1AZG B;  2D8J A;  2KGT A;  3I5S A;  5IHI A;  2KT1 A;  2VKN A;  3RNJ A;  2RQT A;  1SPK A;  2EW3 A;  2ENM A;  1EFN A;  1AWO A;  2GTO A;  1X6G A;  1Z9Z A;  1QKW A;  1UHC A;  2OAW A;  3NGP A;  1Y0M A;  5I22 A;  1QLY A;  1YN8 A;  2PZ1 A;  2O9S A;  3SHW A;  4HVU A;  1NG2 A;  1K0S A;  1NLO C;  4D8K A;  2I0N A;  2DBM A;  1M27 C;  2OJ2 A;  1WI7 A;  4ORZ A;  1N5Z A;  2K7A A;  5FW9 A;  2CH4 W;  4M4Z A;  2K3B A;  1X69 A;  2MIO A;  4LUE A;  1AD5 A;  1WYX A;  4CC2 A;  2J6K A;  3M0U A;  2EBP A;  3REB B;  1AVZ C;  2V1Q A;  2J06 A;  1NEG A;  2FPE A;  4OMN A;  3O5Z A;  3EGU A;  1NYF A;  3H41 A;  2X3W D;  1AOJ A;  2C0O A;  2LP5 A;  3VS2 A;  1SRM A;  1UG1 A;  2L3P A;  2FPD A;  1Z9Q A;  4EIK A;  2DM1 A;  3THK A;  2K2M A;  2M51 A;  4F17 A;  2E5K A;  1GRI A;  4RTV A;  1VYV A;  3IQL A;  1SSH A;  2C0T A;  2G6F X;  2GGR A;  1X43 A;  2FO0 A;  2DX1 A;  2K6D A;  4J9C A;  2DL4 A;  2FEI A;  5ECA A;  3EG3 A;  1S1N A;  4ESR A;  1M3C A;  4OMM A;  4JJD A;  2KRS A;  2ABL A;  2KYM A;  1HSQ A;  4RTY A;  2FRY A;  1WXT A;  3VS3 A;  1UHF A;  2DVJ A;  4ZNX A;  3M0R A;  4JPB W;  1GBQ A;  2QDL A;  1CSK A;  1K4U S;  1RUW A;  1SHF A;  2KR3 A;  3LH5 A;  5I11 A;  3REA B;  4OMP A;  1NYG A;  2RF0 A; 
#chains in the Genus database with same CATH topology
 3CEY A;  3OQ5 A;  4DOW A;  1MV3 A;  1WHG A;  3C4S A;  3JCM d;  4N0A A;  4M7D G;  1M8M A;  2MYS A;  2CT3 A;  2V8I A;  2PVO B;  1ZX6 A;  1C0M A;  4XTV A;  1LJO A;  2FHD A;  2HL3 A;  1UJ0 A;  4ATO A;  3LWH A;  3DLM A;  2V8K A;  3VRZ A;  3CME T;  2MMP A;  2GTJ A;  2WSE E;  3A98 A;  2E1H A;  4RTX A;  3TSZ A;  2EFI A;  3R6N A;  1PC0 A;  4E7Z A;  3OA6 A;  2RJE A;  1H92 A;  1SSF A;  1ZUK A;  4F7U B;  2EVR A;  1JU5 C;  1YJ9 A;  1RAD B;  3KFV A;  4X34 A;  3JSC A;  2VV5 A;  2K4Y A;  3BFM A;  3HTR A;  4A4E A;  4C92 G;  1SF9 A;  3FDR A;  1UJY A;  5GAO l;  1VIF A;  4RTZ A;  1HXD A;  1M4Z A;  3CCS A;  2CZ7 B;  2P0Q A;  2VVK A;  2X3X D;  2A28 A;  3JCM V;  4CI0 C;  2A3L A;  3GNG A;  2EGE A;  4M78 F;  3OYL A;  4DBF A;  4KUL A;  4MML A;  1N8R R;  2YSQ A;  2KAF A;  2RK1 A;  1AWJ A;  2A08 A;  2QQB A;  4XAX B;  4M75 A;  3V8K A;  4M7A E;  1YWP A;  3CME A;  2DA9 A;  3MEU A;  4M7D D;  4OML A;  4FSX A;  2JNG A;  2XD0 A;  4LE9 A;  2RQV A;  4JJB A;  1KFZ A;  2DMO A;  3PNW C;  5FU7 B;  4EMG A;  1WQ7 A;  2JM9 A;  2J6O A;  1IB8 A;  3L2U A;  3KXT A;  3L1A A;  2BIV A;  4A54 A;  2LQW A;  2RJD A;  5C6S A;  3PIP A;  1QKX A;  2CP0 A;  3CCS Q;  2CZ6 B;  3J80 E;  2EQM A;  5GAM j;  1D3B A;  1AZE A;  4IIM A;  1VQP Q;  1ZSG A;  4RTW A;  2EYY A;  2M0O A;  1UGS B;  2KRN A;  2DIL A;  1U1S A;  2FVU A;  1HYO A;  2RQW A;  4LN2 A;  1KC8 C;  2OX7 A;  4M78 C;  4D8D A;  4BDY A;  3OYC A;  3M56 A;  4XK8 E;  4KH1 B;  3SWN B;  3M55 A;  5HKC A;  1WA7 A;  2MI6 A;  3CPF A;  2QEX A;  2XU8 A;  2E64 A;  3QWX X;  3E2U A;  2RQU A;  1S72 T;  3TQ7 P;  1VQ5 A;  2JM8 A;  4PJL A;  2MWO A;  5CR2 A;  4MDW A;  2RMO A;  3HKS A;  2A36 A;  3OYD A;  3A8L B;  4OGC A;  1YJN T;  1UGR B;  1SHG A;  5EC7 A;  3VS5 A;  1XJW B;  2KVQ G;  1EIF A;  9ATC B;  3U23 A;  1QWE A;  1XQH A;  1VQO A;  1NJI U;  4C5I A;  3FJ5 A;  3UA7 A;  4XU1 A;  1VYU A;  1AT1 B;  1M9S A;  1TH7 A;  2JMA A;  2H8H A;  3V8L A;  1WLP B;  1YCY A;  2DKG A;  1LCK A;  2O88 A;  2COZ A;  1ZHI A;  2BTT A;  4Y92 A;  4QQ6 A;  3INZ A;  3CCV T;  1I0C A;  1KJW A;  3I56 T;  5CKB A;  2P4T A;  4JUV A;  3RES A;  4LD9 K;  3FEO A;  2DBK A;  5KYN A;  1K9M U;  4ZGJ B;  1BIB A;  2GFU A;  5CIU A;  5LJ5 d;  2KYB A;  4M78 E;  1WNL A;  2DRK A;  3H0I A;  3X25 B;  1YIT T;  2M1H A;  2M16 A;  3C12 A;  2DO3 A;  3JB9 I;  4HCB A;  2O31 A;  2D0Q B;  5LJ3 f;  1X75 C;  1WZO A;  1BCO A;  1OUL A;  1G83 A;  2RQR A;  2PQW A;  4OMQ A;  4J9E A;  2PVG B;  2HMA A;  3CMA T;  4M7D B;  1AEY A;  2KXD A;  3RKX A;  3CCQ Q;  3CC4 Q;  3OMG A;  1Y96 A;  1QP3 A;  2GQV A;  3KUF A;  1WHJ A;  1OV3 A;  3CC7 T;  4Z02 A;  3UA6 A;  2DTO A;  2W10 A;  4AFS C;  3RUX A;  1RAE B;  1MMD A;  5GAO r;  4KRT A;  4P5N A;  4RG8 A;  5GAN d;  1I07 A;  1YHQ T;  4GLK A;  1ZBJ A;  1D1B A;  2E10 A;  2WSC E;  3QZ9 B;  4XTX A;  1K73 C;  5GAN j;  1QVF S;  2HQE A;  2EQU A;  4PJO B;  1ZUU A;  1Y07 A;  5FU6 B;  3L2R A;  2EQI A;  2HSP A;  2OI3 A;  3JCM f;  1PKS A;  1BBZ A;  4KUD K;  4MZM A;  3NTK A;  1QVG A;  2CT4 A;  2J7I A;  2EQJ A;  5LJ3 g;  5IT9 E;  1V1C A;  4E7K A;  1UGP B;  2EJ9 A;  2YRC A;  1E6G A;  4J9B A;  2LQ8 A;  3JV3 A;  3BDU A;  1NM7 A;  5I2S A;  4M78 D;  2QG9 B;  1VQL A;  3AHU A;  1UE9 A;  3JCM Q;  4J9G A;  2KBT A;  2FG0 A;  1U5S A;  2LCS A;  1OU8 A;  3N5B B;  4PJO C;  1G3T A;  1C1A A;  4LXC A;  1M30 A;  2KT1 A;  1RAH B;  2RQT A;  3CCR T;  1PSF A;  1UHC A;  2DFU A;  3VYH B;  2X4J A;  3M57 A;  4WTO B;  5GMK i;  1G3Y A;  3FIF A;  3I56 A;  4C0D B;  1K0S A;  2E41 A;  1NZ9 A;  1VOM A;  4D8K A;  3OSV A;  3QKJ A;  2OJ2 A;  5J3B A;  1WI7 A;  5FW9 A;  1WGS A;  2H3E B;  4KGZ B;  1VQ4 T;  4LUE A;  2F5K A;  2X51 A;  2RJC A;  1RAA B;  3RDV A;  2L8D A;  3REB B;  3VUB A;  3M4G A;  2J06 A;  3A8G B;  2RJF A;  4O6J A;  1AOJ A;  5GMK m;  2LP5 A;  5KYY B;  1SRM A;  2JN0 A;  4PKC C;  3AT1 B;  2FPD A;  2L3P A;  5GAO p;  5GAM d;  2OTL A;  4PFZ A;  2XKO C;  2DM1 A;  4CRI A;  4F17 A;  2DXB A;  3IQL A;  4II1 A;  2C0T A;  5KYY A;  4FU6 A;  2K6D A;  3OS2 A;  3RIR A;  3CXC A;  1W4S A;  2FEI A;  3EG3 A;  3CCL T;  4OMM A;  2DD4 A;  4C5G A;  1HSQ A;  2FRY A;  2DXT A;  2HQX A;  1RAB B;  2CP6 A;  1QP2 A;  2QDL A;  4B9X A;  5DLQ E;  5AYF A;  1K4U S;  1WJS A;  5GAN g;  1SHF A;  2KR3 A;  2VGM A;  4FM4 B;  3JCM P;  5I11 A;  4NS5 A;  1NYG A;  4M77 D;  4XTZ A;  3JB9 G;  1VQ7 A;  3P8H A;  1M3B A;  2JTM A;  3I35 A;  4E7I A;  1K1Z A;  3CD6 A;  1VQ8 Q;  1VQN T;  3CBP A;  4J6W A;  2HAX A;  2YDL A;  1X6O A;  1K9M C;  3JCM W;  5GAN 6;  1UTI A;  4JLG A;  2J6F A;  4J6Y A;  2DXU A;  1I5O B;  3H0H A;  3HPW A;  2LNH B;  2RA2 A;  3J81 E;  1VQ5 Q;  1BI0 A;  3RMQ A;  3E9F A;  3OYY A;  2LNV A;  4LDW A;  2E5Q A;  1HD3 A;  2JVV A;  4E7J A;  3M58 A;  2HBP A;  4WCI A;  1SKU B;  2JT4 A;  2A7Y A;  2YXY A;  3CC2 A;  2AKL A;  3PGG A;  4X9D A;  4VUB A;  3MKD A;  2LC4 A;  1TS9 A;  4KGV B;  4N4I A;  2O4X A;  2DRM A;  2PUO B;  5LJ3 h;  2YUP A;  1QVG P;  4QVZ A;  3OYN A;  2EPD A;  1YJ9 T;  3EFO A;  3CMA Q;  1YIT A;  3SFM A;  3CCV A;  2DER A;  5LJ3 e;  1R77 A;  3PVL A;  5LJ5 j;  4ZTF A;  4L59 A;  1IZ6 A;  1IGU A;  3CCU Q;  4M7A G;  2QQR A;  2HL5 C;  2HNI A;  1K9M R;  3VS7 A;  1YIT Q;  4PJO G;  2DJQ A;  2JJ9 A;  1VQ9 Q;  3V7C A;  1VQM T;  1BK2 A;  4A4F A;  5GMK e;  3EH2 A;  2NUT A;  1I81 A;  2CGH A;  3QYH B;  3M0S A;  3OYF A;  2LJ1 A;  1WIE A;  3NHN A;  1Q86 U;  1VQ6 Q;  1B3Q A;  1M1K R;  2E4H A;  5GMK h;  5FU7 C;  1MMG A;  1VQ5 T;  3FB9 A;  2DAQ A;  1F1B B;  4GY5 A;  5KH6 A;  1R0B G;  4HCZ A;  3JB9 F;  5GAN 7;  3VUZ A;  4PFO A;  3VKI A;  4AFZ C;  2QYZ A;  4RMO A;  4LDY A;  2EKH A;  1YIJ Q;  1TTH B;  3CCR Q;  6AT1 B;  3RER A;  5IXF A;  1WX6 A;  2RB6 A;  3EG1 A;  4DEY A;  1VQ6 T;  1PRM C;  2W0Z A;  1RLP C;  3JCM X;  3GNF B;  3NMZ C;  3HRT A;  3CC7 Q;  1SEM A;  1V29 B;  2GCX A;  3VRY A;  2XDD A;  2M02 A;  5L8R E;  3OYA A;  1LNX A;  1K9A A;  2DXC A;  4E2F B;  5FU6 C;  4BE2 A;  1U8R A;  1SRL A;  2QQ9 A;  1T0H A;  1YJW T;  1QCF A;  1YBY A;  2LJ0 A;  1OPK A;  3CCU A;  4PJO E;  2LT4 A;  2Y4Y A;  3EHR A;  2RHZ A;  4JS4 A;  3LLR A;  4NL3 A;  5IN1 A;  1KHI A;  1PM3 A;  2DLP A;  2KQW A;  4LD6 A;  4A63 B;  1TUG B;  3CCJ T;  3JCM c;  1NLP C;  2KK4 A;  3SD4 A;  5IH2 A;  1ZSZ B;  4ELZ C;  1VQ8 A;  3OBY A;  1NJI C;  2HZY A;  2CSI A;  2LDM A;  1PSE A;  7AT1 B;  4IUQ A;  4N4G A;  1KK7 A;  1CKA A;  2XIC A;  5L23 A;  2RHY A;  4IUU A;  1M90 R;  3SWN C;  3R6O A;  2YT6 A;  2EWN A;  4HVW A;  1M3A A;  2BZ8 A;  5CKF A;  2GNC A;  3FRN A;  4DBQ A;  2DEU A;  2C06 A;  1VQ9 T;  2YLB A;  5GAM e;  2RI3 A;  1Q81 C;  1VQM Q;  4C0G A;  3OS5 A;  4FT4 A;  4KT0 E;  3H9N A;  2HKN A;  4DOV A;  2M0Y A;  5GAO n;  2RN8 A;  1D09 B;  2RHU A;  2ZPH B;  3MJX A;  1B34 A;  1FX7 A;  5AT1 B;  4IIO A;  4IKF A;  2YLC A;  4FL6 A;  3CCJ Q;  2VUB A;  1PCX A;  4Z89 A;  2BZX A;  5FRN A;  1FMV A;  4F7U G;  4Z88 A;  4DQ2 A;  2AZS A;  5LJ3 d;  1GCP A;  1XTD A;  1GCQ C;  1JXM A;  1VQN A;  1NPP A;  1YJ9 Q;  1YIJ T;  1ZLM A;  2VXE A;  2XHC A;  2YWW A;  5C0M A;  3OYJ A;  5IHK A;  3HFN A;  2DTI A;  1IRX A;  2ESW A;  2AK5 A;  2JXB A;  2PTK A;  2RI5 A;  2KRM A;  1KHC A;  3EG0 A;  1Y57 A;  5KE2 A;  1YHQ A;  2F2V A;  1M1G A;  3ASK A;  4BE0 A;  2OTL Q;  2ZPE B;  1ZSZ A;  2CUB A;  3MHX A;  4HVV A;  3S6W A;  2LJ3 A;  4GBQ A;  4M75 G;  3QWY A;  3L2V A;  3QDR B;  2QI2 A;  4J9I A;  4RTT A;  5LL6 S;  1AHJ B;  1BU1 A;  2CZ0 B;  3GOX A;  5GAO m;  1IHW A;  2EGA A;  3G71 T;  1LOJ A;  1T3L A;  1OOT A;  1UFF A;  3HL8 A;  3ZBD A;  4DA4 A;  2X4Y A;  1H8K A;  1E7O A;  3CMA A;  2YUQ A;  1O75 A;  1BI1 A;  4TVR A;  1XOV A;  4M7A B;  3SDZ A;  1A0N B;  2R58 A;  2XI9 A;  3CD6 Q;  1OZ2 A;  1PHT A;  4F04 B;  4PJM A;  1YJW Q;  1BKB A;  5GAN h;  3VU3 C;  3QII A;  2E70 A;  2FB7 A;  1TUC A;  2EIF A;  3VV0 A;  3FJP A;  2YUN A;  5A2Q E;  1YI2 A;  4E7H A;  2G3R A;  3CCJ A;  5GAN e;  3CCQ A;  1VQO Q;  3VS6 A;  2MF2 A;  4C8Q C;  3H0F A;  1MND A;  3RBB B;  3OYE A;  2ED0 A;  3JB9 J;  5D7U A;  3BY7 A;  4HCC A;  1VUB A;  1Q86 R;  5D6Y A;  3CD6 T;  3CCE A;  5GAM g;  4D6W A;  2VKN A;  3RNJ A;  2V8J A;  4FYX B;  4BD3 A;  1SPK A;  2EW3 A;  4OVA A;  2NUP B;  1EFN A;  2X9H A;  1Z9Z A;  1QKW A;  1KQ1 A;  3D7S B;  3NGP A;  4R55 A;  2HD0 A;  2PZ1 A;  1JJ2 A;  3A1P A;  4IUR A;  3CCE Q;  2KI7 A;  1YHQ Q;  2K7A A;  4M4Z A;  2HQH A;  5CKE A;  3QO3 A;  2P84 A;  2XDB A;  1WYX A;  1P92 A;  3TEE A;  3UDC A;  3G71 Q;  2XID A;  4V2S A;  3QG1 A;  4OMN A;  2QGF B;  4DBR A;  3EGU A;  2ZPB B;  5DM7 R;  3ER0 A;  4BY6 C;  3URG A;  2F1L A;  1VQ4 A;  2E65 A;  1EZZ B;  3S3O A;  4FIB A;  1UG1 A;  1C6V X;  4J7F A;  1Z9Q A;  3A5Z B;  3G1J A;  1OYX A;  1Q86 C;  1M90 U;  2EJG A;  4OB1 B;  1Q82 R;  2X35 A;  2K2M A;  2E5K A;  2GFA A;  4FYW B;  1VYV A;  4PL6 A;  5KYU B;  3G4S Q;  2CZ1 B;  3CCM Q;  4C0D C;  1B34 B;  4UC4 A;  2DL4 A;  4O5V A;  2L3R A;  4J8O A;  2DD5 A;  3LH0 A;  4JRI A;  3G6E A;  2EAY A;  3QHS A;  1GXI E;  3VS3 A;  5GAN 2;  1JJ2 P;  2DVJ A;  4ZNX A;  1CSK A;  1QCN A;  5HY6 A;  4BY6 B;  3I56 Q;  4IUV A;  3CC7 A;  4C92 F;  1RUW A;  5CQY A;  3LH5 A;  4XTW A;  1ACM B;  2VYT A;  5FLX E;  4OMP A;  1YI2 T;  3LX7 A;  2LQN A;  1OI1 A;  4A4H A;  4DEX A;  2CDT A;  3GIB A;  2LQK A;  4J83 A;  3UF4 A;  2E12 A;  4BDZ A;  4PJO F;  4MZP A;  1H64 1;  4C8Q E;  1Q82 U;  2AZV A;  1OPL A;  3CPW S;  3C95 A;  1D1C A;  5I2M A;  1KSW A;  1ZBX A;  4RKU E;  1WQW A;  2DF6 A;  2VGN A;  4C8Q D;  1YP5 A;  5GAN 3;  1KD1 C;  4EPC A;  2XDP A;  5LJ3 j;  1WDX A;  5KYX A;  2OTJ A;  2XK0 A;  2EYX A;  3PVQ A;  1WXU A;  1I4K 1;  4BE1 A;  3TVT A;  2K9G A;  2ZPG B;  1U3O A;  3GBQ A;  4KBM B;  3OYK A;  2YRV A;  1R8O B;  2K5I A;  3WXM B;  3EFR A;  2K79 A;  3CCM A;  2F2X A;  4FT2 A;  3X20 B;  4CC3 A;  4QW2 A;  2EGC A;  1M1K U;  1U06 A;  3X26 B;  1X27 A;  4BB7 A;  3OYH A;  5GJV B;  1GBR A;  5GAN 4;  3ZEH A;  1IHV A;  1OX9 A;  5FRM A;  1W6X A;  1WPY A;  3I55 Q;  2BE7 D;  2KRO A;  1YJN A;  2HDA A;  5A0G A;  1G3W A;  2EYQ A;  3EGD B;  4M77 A;  2CKK A;  2COY A;  2E3I A;  2SEM A;  3UAT A;  1QMC A;  1S72 A;  2CP3 A;  4MMK A;  2QEX T;  3GP8 A;  1W1F A;  1QVF A;  3ULR B;  2YUO A;  4HCK A;  4M77 B;  1JEG A;  1BCM A;  4JJC A;  3L2Z A;  3KBG A;  4OF1 A;  1XNI A;  3LGF A;  1VQN Q;  4M78 A;  2E6Z A;  5KCH A;  1N6A A;  1B07 A;  4YTL A;  2ROL A;  3VS1 A;  3I55 A;  2JS0 A;  4GLM A;  2KSS A;  2JMC A;  3EG9 A;  2JTF A;  4ANJ A;  2X4W A;  3E9G A;  3M5A A;  4C92 E;  3TRE A;  4F14 A;  2ROT A;  4PLL A;  2PVD B;  3CCQ T;  1S72 Q;  3JCM J;  3CCL Q;  2CP5 A;  2PU9 B;  3RKW A;  2P0K A;  4QQG A;  2NWM A;  2D9T A;  3NPF A;  4FSS A;  1ARK A;  1FWZ A;  2KDS A;  4NOY A;  3FC3 A;  1W2B P;  3H8Z A;  4QT7 A;  4C8Q F;  3SB2 A;  2O9V A;  1SG5 A;  4EMH A;  1IXD A;  4M7A D;  5CKH A;  3CQT A;  3QYG B;  4RTU A;  3M0Q A;  1TWB A;  3QXE B;  3J7A F;  3OW2 P;  4B9W A;  2RNA A;  1G8X A;  4M7D A;  3EFS A;  3LWI A;  4J5Y A;  2RO0 A;  4A53 A;  4QVD A;  2QEX Q;  5GMK l;  2Y90 A;  4FW2 A;  1TXQ A;  2DL5 A;  2CRE A;  5GAM f;  3BW1 A;  4N4H A;  1VQ7 Q;  2FZK B;  1RI9 A;  4F7U A;  3CCV Q;  2E3H A;  4J9H A;  3O8V A;  2QDY B;  2LX7 A;  2QA4 Q;  3G7Z A;  1MHN A;  3RKY A;  2Y4X A;  4EMK B;  4AT1 B;  5EG2 A;  4ME7 A;  1VYT A;  3X28 B;  2OAU A;  2L3Q A;  1B7T A;  1PKT A;  1TUD A;  3M59 A;  1K8A R;  4CC7 A;  2R5M A;  3M54 A;  3DKM A;  2O4X B;  1KC8 U;  2FRW A;  3QUI A;  3TU4 K;  3PMT A;  2F69 A;  2DE0 X;  1OEB A;  1I8F A;  2BE9 B;  2DVE A;  2FZC B;  3EHQ A;  3L2Q A;  1KQS S;  2CP7 A;  4ZN1 A;  3I5R A;  2JS2 A;  3NTH A;  5LJ5 g;  4AG2 C;  3CCS T;  2HEQ A;  1IO6 A;  2QA4 T;  5J26 A;  1M90 C;  1ZSZ C;  4M75 E;  3OW2 A;  4AG1 C;  2WSF E;  2EYW A;  5FWC A;  1K76 A;  1PRL C;  1IRE B;  5KYW B;  2IG0 A;  1N8R C;  1N27 A;  4HKE A;  5A0D A;  4XU0 A;  2Z0W A;  1MMN A;  4IUT A;  2CUD A;  2IPO B;  4PK4 A;  1PD1 A;  4BI4 A;  5IAY A;  4M7D C;  4NL2 A;  1MGQ A;  4RUG A;  4JS5 A;  1K8A U;  4JRQ A;  2A37 A;  2EKO A;  1N9R A;  2X4X A;  1H3Z A;  2JW4 A;  3PT9 A;  3SWN A;  2AT1 B;  4Z8A A;  1TSF A;  1YCS B;  3TCJ A;  2ZPF B;  4K11 A;  1H3H A;  1PWT A;  3I9Q A;  2QTX A;  4LUD A;  4XTY A;  2DIQ A;  3GPL A;  1PG5 B;  2L2P A;  5FRO A;  4J9D A;  3Q1J A;  1JXO A;  5HCK A;  3CC2 T;  4C92 B;  3EG2 A;  2K57 A;  2DZ9 A;  1YNZ A;  4M78 B;  1YIJ A;  5KYU A;  4MZT A;  1FMK A;  4C8Q A;  3JCM b;  3VS0 A;  2GF7 A;  2K3Y A;  3DLL A;  2JOY A;  1FXX A;  3CC4 T;  3M0P A;  1M8V A;  4J9F A;  3UPU A;  1X2K A;  1NPR A;  2KXC A;  4AFU C;  2RHX A;  3F70 A;  4PLI A;  4E6R A;  4QQD A;  1KIK A;  1W2B S;  3E19 A;  4E7L A;  1TG0 A;  1MV0 B;  3OMC A;  3PTA A;  4C5E A;  3CME Q;  2COW A;  2JUF A;  5IHI A;  2RK2 A;  5CQX A;  1RAF B;  2ENM A;  3OS1 A;  2GTO A;  3OYI A;  1LVK A;  3OS0 A;  1M2O A;  2EJF A;  3V7R A;  1VQ9 A;  5GAN 8;  5LJ5 h;  2OAW A;  5I22 A;  1Y0M A;  1YN8 A;  2WAC A;  3L42 A;  1KQ2 A;  4M7A C;  1NG2 A;  2I0N A;  4XU2 A;  1M27 C;  2OTL T;  4KUI A;  1N5Z A;  4HA8 A;  3L2W A;  4Y28 E;  1VIE A;  3A8O B;  2K5F A;  4BAC A;  4XQ3 A;  1NBE B;  4CC2 A;  3PIO A;  5CVI A;  1BI3 A;  3M0U A;  2EBP A;  4ZTJ A;  3HHT B;  4FCY A;  3ME9 A;  2X3W D;  5KCO A;  2C0O A;  2PUK B;  3MPU B;  3LGL A;  3LYI A;  1LPL A;  4C92 D;  3HFO A;  3OW2 S;  2AHJ B;  1R0C B;  2MK5 A;  2LVM A;  3G4S T;  3OBW A;  1YJN Q;  3THK A;  2M51 A;  1GRI A;  2O01 E;  4LDU A;  4RTV A;  2V26 A;  5DLO A;  1QVG S;  1WHL A;  2GGR A;  3EAE A;  1X43 A;  1G5V A;  3NTI A;  1VQK Q;  3JCM h;  4J6X A;  4ESR A;  1BYM A;  1D0X A;  4JJD A;  2YRD A;  4RCC A;  1HK9 A;  4RTY A;  1W2B A;  4BI3 A;  1VQK T;  1ZA2 B;  2MAM A;  4M77 F;  3BDL A;  4QKU A;  3M0R A;  4JPB W;  4M7A F;  3EFO B;  4XU3 A;  3M53 A;  2KY9 A;  1KG1 A;  1QQJ A;  3QDF A;  3P8D A;  4A4G A;  2LCL A;  2RH2 A;  3REA B;  2ZGW A;  1WHK A;  3HRS A;  3MET A;  1GFC A;  2LMJ A;  4C8Q G;  2DYI A;  4WF2 A;  4F7U F;  2DL3 A;  1VA7 A;  4M7A A;  2L89 A;  1O9S A;  1BB9 A;  2JTE A;  2K3X A;  3MEW A;  4PJJ A;  1X6B A;  2XG8 D;  4AFQ C;  2DYB A;  1UEB A;  2BUD A;  2RI2 A;  3M9Q A;  4N0A C;  1Q82 C;  2FPF A;  1RL2 A;  4CC4 B;  1VQ7 T;  1D0Z A;  2FYK A;  2VAS A;  1JB0 E;  5GAN f;  4FYV B;  1OU9 A;  2ZZD A;  4E7S A;  3EGD A;  5IXB A;  4ZN3 A;  1KD1 U;  1TOV A;  3HRU A;  2QAZ A;  3X24 B;  3ZFJ A;  1JBM A;  3ZL7 C;  2EYZ A;  2L5Q A;  3CCM T;  1OX8 A;  4M77 E;  3MCA B;  1HJD A;  2MWP A;  1DJ7 B;  1E6H A;  1WHM A;  2R5A A;  4EMK C;  1T0J A;  3M4Y A;  3A8H B;  3PE0 A;  4M7D F;  1EX4 A;  3CCL A;  4JRK A;  4EDU A;  2DJZ A;  4F16 A;  1X01 A;  2H3J A;  5GAM h;  2I2L A;  3MP1 A;  2CH4 A;  4M75 C;  3SEM A;  3EG9 B;  3OYB A;  2KNB B;  1VQ4 Q;  2NYS A;  2XMF A;  2J05 A;  1IGQ A;  5CK9 A;  4OB0 B;  4JRP A;  8ATC B;  8AT1 B;  1K0X A;  4E47 A;  1KQS P;  1W70 A;  1RI0 A;  3TSW A;  2P4R A;  3M0T A;  5CCA A;  2QTV A;  4OMF B;  3BE3 A;  1YFN A;  1Q7Y C;  4C0F A;  1Y71 A;  1TU0 B;  3H6Z A;  3VS4 A;  2YHT A;  2D0N A;  3EH1 A;  2IIM A;  2QQS A;  2LT1 A;  4OP0 A;  1ZUY A;  1T3S A;  1N8R U;  2PNI A;  4M75 B;  1QVF P;  3OYM A;  2MOX A;  1VQO T;  5LJ5 f;  1KQS A;  5GMK j;  4M77 G;  3I55 T;  2LCC A;  3QJY A;  2K5L A;  3EGX A;  3T9N A;  1FYN A;  2DTH A;  2DL8 A;  4OMO A;  3C0C A;  2RHI A;  3V8J A;  3LW5 E;  2DZC A;  2DEQ A;  2VWF A;  2ED1 A;  2DET A;  1NJI R;  4PNO A;  2VXF A;  1MNE A;  2ECZ A;  1Q81 R;  2BZY A;  4LDV A;  5KE3 A;  5LJ5 e;  4EMK A;  3MO8 A;  1KD1 R;  1YWO A;  5J39 A;  1VQL T;  1UUE A;  2GQI A;  4ZGD B;  1VQP T;  4AMC A;  1J3T A;  4JZ3 A;  4B6M A;  1V76 A;  4HT9 A;  1GL5 A;  1UGV A;  5IHN A;  4M77 C;  2NUP A;  1NEB A;  5HK3 A;  2OTJ Q;  2SRC A;  1AWW A;  2LX9 A;  1QCO A;  3EGX B;  4HXJ A;  1ABQ A;  2OTJ T;  5A0L A;  4HT8 A;  2ZAE A;  3RR6 A;  2CS7 A;  2QXF A;  4C5H A;  3OSS C;  4C92 A;  2QGG A;  3VYG A;  3CCR A;  4L5G A;  4PFP A;  1UGQ B;  2P0P A;  3JRZ A;  1FMW A;  4DBH A;  3RMS A;  5KYW A;  2DL7 A;  1GCQ A;  2K2V A;  2O2O A;  2QK0 A;  2L3S A;  1D0Y A;  1RLQ C;  4M78 G;  2MPX C;  4PJO A;  5FWB A;  1OQK A;  5D6X A;  5KYX B;  2NUT B;  2F5T X;  2AKK A;  3QSU A;  3DB4 A;  3OY9 A;  1UDL A;  1G2B A;  1BIA A;  1U1T A;  1JQQ A;  1UEC A;  2HBW A;  2V1R A;  4FW1 A;  3UWN A;  2RPN A;  2CSQ A;  3WVD B;  3JCM e;  2BKD N;  1JJ2 S;  2RD1 A;  1VQK A;  1RAG B;  2D1X A;  5DY9 A;  1QWF A;  2C0I A;  2DNU A;  4LNP A;  1WJQ A;  2QQA A;  4M75 D;  3S3M A;  1I5L A;  2KE9 A;  3JB9 D;  4PJN A;  2D8H A;  2RM4 A;  3VJP A;  4QVC A;  2A0F B;  2DIG A;  3QBY A;  2QA4 A;  3CPW A;  1PNJ A;  1AWX A;  1I1J A;  1N9S A;  3PMI A;  2F2W A;  4R0K A;  1CKB A;  1K8A C;  2NUZ A;  5GAO q;  2HSE B;  1VQ8 T;  1WXB A;  1JO8 A;  3G6E T;  4J7I A;  3CXC S;  1YI2 Q;  2GBQ A;  2VB6 A;  2FZG B;  2DPP B;  2D6F A;  3C94 A;  4OGE A;  2LRQ A;  4L6V 5;  1OZ3 A;  4FYY B;  2HCK A;  3HP9 A;  3CPW P;  2KMT A;  4JZ4 A;  1X2Q A;  4X1V A;  4R56 A;  2LZ6 B;  4C92 C;  3S3N A;  2VC8 A;  4Q5W A;  1GFD A;  3MEV A;  3UT1 A;  2KEA A;  2KT8 A;  1Q81 U;  2ZCF B;  1VQP A;  5I21 A;  2M9U A;  4IUP A;  4BUG A;  1RAC B;  3CBM A;  1QW1 A;  5CO7 A;  4F7U E;  4OB3 B;  2L0A A;  1K73 R;  5GJW B;  4X9C A;  2MCN A;  1ABO A;  3CC2 Q;  4C0Z A;  1MUZ A;  1WFW A;  2B86 A;  2R57 A;  4M75 F;  3WVE B;  3NFC A;  4BI8 B;  3OYG A;  1AZG B;  2D8J A;  2KGT A;  3I5S A;  1M5Q 1;  3FLG A;  2ZPI B;  2HKQ B;  2QAS A;  1VQ6 A;  3DB3 A;  1AWO A;  1Y96 B;  3CBO A;  1X6G A;  3QZ5 B;  1WHH A;  1M2V B;  3MP8 A;  2ATC B;  1MMA A;  2LTO A;  1QLY A;  3SHW A;  2O9S A;  1M1F A;  4HVU A;  1D1A A;  4A4K A;  1Q7Y R;  1NLO C;  1ZA1 B;  2DBM A;  4ORZ A;  1D3B B;  4KH0 B;  2CH4 W;  4C8Q B;  3E1S A;  2K3B A;  5CAI A;  1Y7X A;  1BI2 A;  4M7D E;  4Y91 A;  1X69 A;  2MIO A;  1AD5 A;  1JRI A;  2CP2 A;  5GAN 5;  3CXC P;  3GF5 A;  2J6K A;  3G6E Q;  5HK0 A;  1AVZ C;  2V1Q A;  2FL7 A;  1NEG A;  4JLI A;  2FPE A;  4XTU A;  3CCE T;  2DK3 A;  3O5Z A;  1NYF A;  3G4S A;  3H41 A;  3JB9 H;  3MEA A;  3HSB A;  1RAI B;  4OB2 B;  4JJN K;  1VQM A;  3VS2 A;  2E6N A;  1UB4 A;  1WJR A;  4JDS A;  1VQL Q;  4KGX B;  3CC4 A;  2B8A A;  4ZGE B;  5D6W A;  1G3S A;  4EIK A;  4LDX A;  3QJ6 A;  3A8M B;  3CCU T;  1QVP A;  1M2V A;  3G71 A;  3GLX A;  5M9O A;  1NE8 A;  2JZ2 A;  2IVW A;  4ELY C;  1YJW A;  2NLU A;  3OB9 A;  1ZQ1 A;  1SSH A;  2G6F X;  1M1K C;  3P8B B;  2FO0 A;  2DX1 A;  3JCM g;  5CKD A;  3V7S A;  2CYZ B;  4J9C A;  4PJO D;  5ECA A;  2EQK A;  1KC8 R;  1S1N A;  1M3C A;  1Q7Y U;  1K73 U;  2KRS A;  2AIR B;  1Q95 G;  4RG2 A;  2ABL A;  2KYM A;  1WXT A;  1PD0 A;  1UHF A;  3MP6 A;  3PFS A;  1GBQ A;  3QPH A;  4RCB A;  3JAM E;  4MDX A;  2RF0 A; 
#chains in the Genus database with same CATH homology
 2LQN A;  1GFC A;  1M3B A;  2LMJ A;  4DEX A;  2CDT A;  1MV3 A;  3I35 A;  1K1Z A;  2DL3 A;  2YDL A;  1VA7 A;  3UF4 A;  1M8M A;  1BB9 A;  1UTI A;  2CT3 A;  2JTE A;  2J6F A;  3H0H A;  1X6B A;  4AFQ C;  1ZX6 A;  2DYB A;  2LNH B;  2AZV A;  1OPL A;  2FPF A;  1UJ0 A;  4CC4 B;  1HD3 A;  4WCI A;  3VRZ A;  1KSW A;  2JT4 A;  2GTJ A;  2AKL A;  2DF6 A;  3A98 A;  4RTX A;  3TSZ A;  1YP5 A;  5IXB A;  3R6N A;  2DRM A;  1WDX A;  1H92 A;  2YUP A;  1ZUK A;  3ZL7 C;  2EVR A;  2EPD A;  3PVQ A;  2EYX A;  1JU5 C;  1WXU A;  3KFV A;  2EYZ A;  3TVT A;  2K9G A;  1U3O A;  3GBQ A;  3PVL A;  1UJY A;  1HJD A;  4RTZ A;  2K79 A;  2F2X A;  2VVK A;  2X3X D;  2A28 A;  4CC3 A;  2EGE A;  2EGC A;  1E6H A;  2YSQ A;  1U06 A;  1T0J A;  1X27 A;  3PE0 A;  3VS7 A;  1AWJ A;  2A08 A;  5GJV B;  1GBR A;  2DJQ A;  1W6X A;  4F16 A;  1BK2 A;  1YWP A;  2KRO A;  2HDA A;  2DA9 A;  4OML A;  2CH4 A;  3SEM A;  3M0S A;  4LE9 A;  2KNB B;  2LJ1 A;  1WIE A;  3NHN A;  2RQV A;  4JJB A;  1KFZ A;  2XMF A;  2DMO A;  2J05 A;  1B3Q A;  2SEM A;  2JM9 A;  3UAT A;  2J6O A;  2LQW A;  1K0X A;  1QKX A;  1W1F A;  1W70 A;  3TSW A;  2P4R A;  3M0T A;  3ULR B;  2YUO A;  4HCK A;  1JEG A;  4JJC A;  4AFZ C;  1AZE A;  2EKH A;  4IIM A;  3VS4 A;  1ZSG A;  4RTW A;  2EYY A;  2D0N A;  1B07 A;  5IXF A;  1WX6 A;  2IIM A;  2ROL A;  2KRN A;  2DIL A;  3VS1 A;  2JS0 A;  1ZUY A;  1T3S A;  2RQW A;  4LN2 A;  3EG1 A;  4GLM A;  4DEY A;  1PRM C;  2JMC A;  2W0Z A;  1RLP C;  4D8D A;  2PNI A;  3NMZ C;  1SEM A;  3VRY A;  2MOX A;  1WA7 A;  4F14 A;  2ROT A;  3QWX X;  2RQU A;  1K9A A;  2JM8 A;  1FYN A;  2DL8 A;  1SRL A;  2NWM A;  4OMO A;  3C0C A;  1T0H A;  2RMO A;  2A36 A;  1QCF A;  2VWF A;  2ED1 A;  3NPF A;  2LJ0 A;  1OPK A;  4FSS A;  1ARK A;  3EHR A;  2ECZ A;  2BZY A;  4QT7 A;  2DLP A;  1YWO A;  4A63 B;  1SHG A;  2O9V A;  5EC7 A;  3VS5 A;  1NLP C;  1UUE A;  2GQI A;  3U23 A;  3CQT A;  1QWE A;  4RTU A;  5IH2 A;  3M0Q A;  1J3T A;  4JZ3 A;  2RNA A;  3FJ5 A;  3UA7 A;  1VYU A;  2CSI A;  2JMA A;  1GL5 A;  1UGV A;  2H8H A;  5IHN A;  1WLP B;  1NEB A;  1LCK A;  2O88 A;  1CKA A;  2SRC A;  5L23 A;  1AWW A;  2BTT A;  2DL5 A;  2CRE A;  4Y92 A;  1I0C A;  1RI9 A;  2YT6 A;  4J9H A;  4HVW A;  1KJW A;  1M3A A;  4HXJ A;  1ABQ A;  2BZ8 A;  2LX7 A;  2GNC A;  2DBK A;  1VYT A;  2KYB A;  2M0Y A;  2RN8 A;  2DRK A;  3H0I A;  2L3Q A;  4IIO A;  1PKT A;  1TUD A;  2DL7 A;  1GCQ A;  2O2O A;  4CC7 A;  2O31 A;  2L3S A;  1RLQ C;  4Z89 A;  2BZX A;  5FWB A;  1G83 A;  2FRW A;  2RQR A;  4Z88 A;  2AZS A;  1GCP A;  4OMQ A;  4J9E A;  1GCQ C;  1JXM A;  2DE0 X;  2AKK A;  1OEB A;  1UDL A;  1AEY A;  1G2B A;  2KXD A;  1ZLM A;  3EHQ A;  5IHK A;  1JQQ A;  1UEC A;  2ESW A;  3I5R A;  2JS2 A;  2AK5 A;  2JXB A;  2PTK A;  4AG2 C;  2HBW A;  2HEQ A;  1IO6 A;  1OV3 A;  2V1R A;  2KRM A;  3UA6 A;  3EG0 A;  4AG1 C;  1Y57 A;  2W10 A;  2RPN A;  2CSQ A;  2EYW A;  2F2V A;  5FWC A;  4AFS C;  1K76 A;  1PRL C;  2D1X A;  1QWF A;  2C0I A;  2DNU A;  4LNP A;  4KRT A;  1I07 A;  2KE9 A;  2CUB A;  1ZBJ A;  2D8H A;  4HVV A;  2LJ3 A;  4GBQ A;  3QWY A;  2CUD A;  4J9I A;  4RTT A;  1BU1 A;  4RUG A;  1PNJ A;  1AWX A;  2EGA A;  1I1J A;  1ZUU A;  2A37 A;  2F2W A;  4R0K A;  1CKB A;  2EQI A;  2HSP A;  2JW4 A;  2NUZ A;  2OI3 A;  1PKS A;  1BBZ A;  1WXB A;  1JO8 A;  2GBQ A;  1T3L A;  1OOT A;  1UFF A;  1YCS B;  4Z8A A;  1H8K A;  4K11 A;  1E7O A;  1H3H A;  1PWT A;  2YUQ A;  2CT4 A;  2J7I A;  1XOV A;  3I9Q A;  4LUD A;  1A0N B;  2HCK A;  1V1C A;  2L2P A;  4J9D A;  1PHT A;  1JXO A;  5HCK A;  3EG2 A;  1E6G A;  1X2Q A;  4JZ4 A;  4X1V A;  2LZ6 B;  4J9B A;  1GFD A;  1YNZ A;  3JV3 A;  2KEA A;  1FMK A;  1NM7 A;  2KT8 A;  1TUC A;  3VS0 A;  2YUN A;  3M0P A;  4J9F A;  1X2K A;  1UE9 A;  4J9G A;  2KBT A;  4AFU C;  2KXC A;  2L0A A;  4E6R A;  3VS6 A;  1KIK A;  2FG0 A;  5GJW B;  1TG0 A;  1U5S A;  2MCN A;  3H0F A;  1ABO A;  3RBB B;  2LCS A;  2ED0 A;  1MV0 B;  1MUZ A;  1WFW A;  2B86 A;  1M30 A;  1AZG B;  2D8J A;  2KGT A;  3I5S A;  5IHI A;  2KT1 A;  2VKN A;  3RNJ A;  2RQT A;  1SPK A;  2EW3 A;  2ENM A;  1EFN A;  1AWO A;  2GTO A;  1X6G A;  1Z9Z A;  1QKW A;  1UHC A;  2OAW A;  3NGP A;  1Y0M A;  5I22 A;  1QLY A;  1YN8 A;  2PZ1 A;  2O9S A;  3SHW A;  4HVU A;  1NG2 A;  1K0S A;  1NLO C;  4D8K A;  2I0N A;  2DBM A;  1M27 C;  2OJ2 A;  1WI7 A;  4ORZ A;  1N5Z A;  2K7A A;  5FW9 A;  2CH4 W;  4M4Z A;  2K3B A;  1X69 A;  2MIO A;  4LUE A;  1AD5 A;  1WYX A;  4CC2 A;  2J6K A;  3M0U A;  2EBP A;  3REB B;  1AVZ C;  2V1Q A;  2J06 A;  1NEG A;  2FPE A;  4OMN A;  3O5Z A;  3EGU A;  1NYF A;  3H41 A;  2X3W D;  1AOJ A;  2C0O A;  2LP5 A;  3VS2 A;  1SRM A;  1UG1 A;  2L3P A;  2FPD A;  1Z9Q A;  4EIK A;  2DM1 A;  3THK A;  2K2M A;  2M51 A;  4F17 A;  2E5K A;  1GRI A;  4RTV A;  1VYV A;  3IQL A;  1SSH A;  2C0T A;  2G6F X;  2GGR A;  1X43 A;  2FO0 A;  2DX1 A;  2K6D A;  4J9C A;  2DL4 A;  2FEI A;  5ECA A;  3EG3 A;  1S1N A;  4ESR A;  1M3C A;  4OMM A;  4JJD A;  2KRS A;  2ABL A;  2KYM A;  1HSQ A;  4RTY A;  2FRY A;  1WXT A;  3VS3 A;  1UHF A;  2DVJ A;  4ZNX A;  3M0R A;  4JPB W;  1GBQ A;  2QDL A;  1CSK A;  1K4U S;  1RUW A;  1SHF A;  2KR3 A;  3LH5 A;  5I11 A;  3REA B;  4OMP A;  1NYG A;  2RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...