2CREA

Solution structure of rsgi ruh-036, an sh3 domain from human cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGLLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGLAPANRLQILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-036, an SH3 domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords HEF-like protein
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2creA00
1PWTA 1GFCA 2GTJA 2DMOA 1Y0MA 2AZVA 1VYUA 2DJQA 1X69A 1K0SA 1X43A 2RF0A 1YCSB 2J05A 1Y57A 4Z89A 3EHQA 1XOVA 1OPLA 2YDLA 3UA6A 1I1JA 2D8JA 2DVJA 2K79A 1GCPA 4D8DA 1HSQA 4Z8AA 1MV0B 2GQIA 4RTZA 2J6KA 1WXTA 2LCSA 2DBMA 1W6XA 3VS5A 4J9GA 1UG1A 1WX6A 1ZUYA 1M8MA 1BBZA 2JMAA 2OAWA 1LCKA 2CH4W 1OEBA 2F2VA 2J6OA 3JV3A 4ZNXA 1KIKA 1VYVA 5EC7A 1KJWA 2DL4A 4RUGA 2YUOA 3PE0A 1K1ZA 2JXBA 3NGPA 2JMCA 2KRSA 2EYYA 1SHGA 1YWOA 1G83A 3I9QA 2I0NA 2GTOA 1NYGA 3ZL7C 2MOXA 1J3TA 2JM8A 1UHCA 4AG2C 2DF6A 1BU1A 2F2WA 4X1VA 1AZGB 2DNUA 4JPBW 1M3BA 1YN8A 3TVTA 2BTTA 1ZSGA 2RQWA 1PKTA 2DRMA 1FYNA 3H41A 2H8HA 1MUZA 2FPEA 1AEYA 1QWFA 1U3OA 4GBQA 2M0YA 1NG2A 1JO8A 2D0NA 3TSZA 4JJDA 2DM1A 2HBWA 3M0TA 2HCKA 4ESRA 2AK5A 1QKXA 1ARKA 1IO6A 2K6DA 4F16A 2KR3A 4CC3A 2GGRA 1GL5A 3ULRB 4HXJA 2L3SA 3EG1A 2D1XA 2B86A 2L3QA 2EYZA 4AG1C 2ENMA 1WLPB 1WXBA 1NLPC 2KT1A 4CC4B 2AZSA 3NHNA 2K2MA 2SEMA 1X27A 4RTWA 1AWJA 1PRLC 1UE9A 4OMLA 2KYMA 3H0IA 5I11A 2JS2A 2AKLA 2PNIA 2PZ1A 1X2KA 2YSQA 1UUEA 2JTEA 2AKKA 2CH4A 5FW9A 2GNCA 1WA7A 4HCKA 2FG0A 3VRYA 1YNZA 3VS7A 4FSSA 2C0IA 4AFQC 2EYWA 3NMZC 4JZ3A 2ROLA 2OJ2A 4J9EA 1AWXA 1W1FA 2JW4A 2KXDA 4GLMA 2CREA 4JJCA 5ECAA 2DE0X 4J9HA 1NEBA 4RTXA 1PNJA 3VS3A 1I0CA 1S1NA 2CT4A 1SRLA 2P4RA 2KNBB 3M0SA 2FRWA 3REAB 2DILA 4M4ZA 1UFFA 2XMFA 1WDXA 1SHFA 3VS0A 5FWBA 2L3PA 1RI9A 2DLPA 2K3BA 4AFSC 1SEMA 1YWPA 3PVLA 2LX7A 4HVVA 4ORZA 3EGUA 1CSKA 2ABLA 3M0QA 1JXMA 2HSPA 1AWOA 1UTIA 5IHIA 1GBRA 3UATA 4HVUA 2LQNA 3CQTA 1TG0A 3NPFA 1WIEA 4OMMA 1UJYA 1QWEA 1WI7A 4AFZC 4EIKA 3UA7A 4J9IA 1GRIA 3R6NA 3A98A 2V1RA 1G2BA 1NEGA 2CDTA 1YP5A 2GBQA 1H8KA 4OMQA 3H0FA 2DBKA 2FPDA 3VS2A 1UGVA 2JS0A 1H92A 2LNHB 4RTUA 1AZEA 2EKHA 4RTYA 3PVQA 2KRMA 4AFUC 2RNAA 1WFWA 1HJDA 2ED1A 1M30A 1HD3A 1PRMC 3EG0A 2VKNA 2KROA 4J9BA 3VRZA 2JT4A 4Z88A 3VS4A 1X2QA 2KRNA 1MV3A 1N5ZA 2KBTA 1VYTA 1ZBJA 5IXFA 2LJ3A 1B07A 1VA7A 4D8KA 5GJVB 1JQQA 2MCNA 3I35A 2C0TA 2VVKA 1SPKA 1CKAA 1W70A 1CKBA 2L0AA 3UF4A 5IXBA 2LJ0A 2O2OA 3SEMA 1E6GA 2A08A 1K76A 2F2XA 4A63B 4LN2A 1WYXA 2M51A 4DEYA 4LNPA 1FMKA 2LP5A 1GCQC 2DL7A 4LUEA 3THKA 2BZYA 1GCQA 1JU5C 3M0UA 2ROTA 2FRYA 1E7OA 3LH5A 3U23A 5FWCA 4E6RA 2K9GA 1U06A 4Y92A 2YUPA 3M0RA 2KE9A 5GJWB 1BK2A 5HCKA 3QWXX 4RTVA 2V1QA 2OI3A 4KRTA 3IQLA 2J7IA 3RBBB 1UHFA 1TUCA 1U5SA 1OV3A 5I22A 2VWFA 2C0OA 2RQRA 2A36A 2QDLA 2EGAA 1KFZA 1Z9QA 1K4US 2ESWA 1SSHA 1X6BA 1K9AA 1OPKA 1AVZC 1JEGA 4DEXA 2EGCA 2YUNA 4J9CA 3EG3A 1ABQA 1GBQA 1QCFA 1AWWA 1NM7A 4LE9A 1T0HA 3I5RA 3EHRA 1M27C 2A28A 4OMOA 2LJ1A 2EPDA 2KEAA 1EFNA 2E5KA 4J9FA 1PHTA 2RN8A 4WCIA 3TSWA 4IIOA 1A0NB 1WXUA 1M3AA 4IIMA 2DL5A 2EQIA 4JZ4A 2X3WD 3FJ5A 2JM9A 1SRMA 2SRCA 1RLQC 2IIMA 1T0JA 2KT8A 2ED0A 5L23A 2W10A 2O9VA 2CSQA 1T3LA 3H0HA 2A37A 5IHNA 4RTTA 2D8HA 2CSIA 4F17A 3EG2A 2EYXA 1E6HA 3VS1A 2HEQA 1AD5A 3I5SA 1QKWA 3M0PA 3O5ZA 4QT7A 1ZX6A 1UJ0A 2LMJA 2J6FA 2EBPA 4K11A 1H3HA 1I07A 2W0ZA 2KGTA 2DA9A 2NUZA 1AOJA 1Z9ZA 2RPNA 1GFDA 2G6FX 2J06A 1NYFA 2CT3A 1RUWA 1UECA 4HVWA 3KFVA 2KYBA 2RQUA 4J9DA 4JJBA 3REBB 2DYBA 2O9SA 3QWYA 2DRKA 2O31A 4LUDA 2K7AA 1RLPC 2CUDA 2NWMA 4CC2A 5IH2A 2O88A 2FEIA 1BB9A 1B3QA 4R0KA 2HDAA 3GBQA 1ZUUA 1V1CA 2LQWA 2PTKA 4OMPA 2EVRA 2X3XD 1OOTA 2FO0A 2RQTA 4CC7A 1KSWA 2L2PA 1X6GA 2DL3A 2LZ6B 1TUDA 4F14A 2MIOA 2RQVA 2YUQA 2FPFA 3SHWA 1NLOC 2KXCA 2ECZA 2DL8A 1ZLMA 2EW3A 3RNJA 2DX1A 1ZUKA 1QLYA 1UDLA 2RMOA 3VS6A 3C0CA 1ABOA 2YT6A 1T3SA 1PKSA 2BZ8A 4OMNA 5IHKA 2CUBA 1JXOA 1M3CA 2BZXA 1K0XA 2EGEA
chains in the Genus database with same CATH superfamily
2GTJA 4PLIA 3QDRB 1Y0MA 4EMHA 1X6OA 3DKMA 1X43A 1K8AR 1Y71A 3QDFA 3CCMA 2OTLQ 3WVDB 1Q7YR 1RAFB 3HPWA 3E1SA 2K79A 4HCCA 1HSQA 4Z8AA 2EKOA 1TS9A 1NZ9A 2LCSA 2J6KA 1WXTA 2L3RA 3UPUA 2DBMA 4C5GA 2LC4A 3VS5A 4J5YA 1UG1A 2K5IA 2QA4T 2YRDA 3CXCS 1BBZA 1D1CA 2RI3A 4EMKB 1QCOA 1VQLQ 3JV3A 2DKGA 4EPCA 2V8KA 2X35A 1O9SA 4XTZA 1BCMA 2JXBA 4M7DD 3PIPA 2JMCA 3G71A 5J26A 1K73R 1UEBA 1QVFS 4JDSA 1PSFA 4FIBA 2DEUA 1TU0B 4XTXA 2EJFA 4AG2C 1K8AC 1BU1A 4PFZA 1AZGB 3V8LA 3C12A 4M78B 2LT4A 4M77C 3RDVA 4M7AC 3L2ZA 2RQWA 3TU4K 4M7DA 1F1BB 4J6YA 5LJ5h 2FL7A 1U3OA 4GBQA 4ZN3A 4BE2A 2M0YA 3T9NA 5LJ5f 2MWPA 4E2FB 1W4SA 4C8QC 3CCSQ 5AT1B 2DM1A 3G6EA 1OU9A 3X25B 2HCKA 4F16A 5HY6A 5LJ3j 1OI1A 1G3YA 2D1XA 2B86A 4PJOD 2ENMA 2EJ9A 1OZ3A 3A5ZB 4B9WA 1Q81C 4RTWA 3N5BB 3OYJA 4C5HA 2X51A 1M2OA 2M16A 2AKLA 3CCUQ 1AT1B 1QVFA 2PNIA 4M75G 1YI2Q 2QA4A 2YSQA 2JN0A 4L59A 2CH4A 5HK0A 2QGFB 3VRYA 4WTOB 2C0IA 4AFQC 3MJXA 2DPPB 3JCMV 4HT8A 2FZGB 2O4XB 1AWXA 4DBHA 3NTHA 2DO3A 1PNJA 2QEXA 1TWBA 2CT4A 4QKUA 4GLKA 4M75F 2FRWA 1VQNQ 1VQ4A 1UFFA 4RG8A 1WDXA 2E70A 2MAMA 1H3ZA 2DLPA 3MHXA 4JRPA 4ANJA 3I55T 4ORZA 3G6ET 1S72A 3A8GB 4J83A 2ABLA 3SWNB 2CP6A 1JXMA 3FB9A 3UATA 4YTLA 1TG0A 1WIEA 1QWEA 3EG9B 4BI8B 1WI7A 4EIKA 1BCOA 2QG9B 4ME7A 3L1AA 3JCMd 2V1RA 2DTOA 3JCMh 2DIQA 3EGXB 1VIEA 3J80E 1H8KA 1HYOA 2IPOB 5C6SA 1MMAA 3V8JA 3BY7A 1ZSZC 4JJNK 4RTYA 3PVQA 1EX4A 4RG2A 1YHQQ 2QEXQ 3JCMJ 1JJ2S 1M2VB 2ED1A 1M30A 1Q7YU 4KBMB 4C8QG 3LH0A 5IXFA 1B07A 1VA7A 1VUBA 1UGSB 1UGQB 3CBOA 2HQXA 1CKAA 4BDYA 1W70A 3UF4A 1VQ6Q 4RKUE 4XU0A 8ATCB 5IXBA 3PIOA 2O2OA 3PMIA 3SEMA 1E6GA 2ZPBB 1H641 1K76A 3V8KA 1N8RU 4BD3A 2F2XA 2QXFA 3OYBA 4LN2A 2RI5A 1WYXA 5AYFA 1FMKA 2LP5A 1M1KU 2HKQB 2E3HA 3M55A 3QHSA 1WGSA 5GAOr 2DL7A 1MHNA 2A7YA 2FRYA 3M5AA 1E7OA 3LH5A 3ZBDA 5GAN2 2HZYA 4E6RA 3CCQA 2CZ7B 3G71T 2JJ9A 4OB0B 2KE9A 5GJWB 4XU2A 2ZZDA 3QWXX 3CCUA 3CCLT 2OI3A 2JNGA 3IQLA 2J7IA 1VQOA 1TUCA 3L2WA 3CPWA 1OV3A 2MPXC 5I22A 3EFRA 4RMOA 1LOJA 1KQSS 2RQRA 5IN1A 2KVQG 1KFZA 3PMTA 1Z9QA 3LWIA 4MDXA 1K4US 1WZOA 4J6XA 2P84A 1QVPA 1AVZC 3BW1A 4J9CA 1ABQA 4NOYA 4C92F 3A8LB 4J7FA 2JUFA 5FLXE 5CKEA 4FYYB 3OYAA 4PJJA 1T0HA 3OYYA 3EHRA 5GAN5 1D1BA 3OYLA 4M78G 2EPDA 1PD1A 3OMCA 3EGDA 2K3XA 1XJWB 1G3SA 2O4XA 1IHWA 4J7IA 2R5MA 3G6EQ 1EIFA 1KC8U 2RJDA 3V7CA 7AT1B 2XDDA 1KQ2A 4PL6A 1LVKA 5A0LA 2KT8A 5L23A 2O9VA 5LJ3h 1MNEA 1VOMA 4C0FA 1T3LA 1G3WA 2CSIA 2R57A 5LJ3f 1RADB 5GANj 3VS1A 2VASA 1R8OB 1KD1U 4K11A 1H3HA 2EQMA 4E47A 1WHJA 1TUGB 1KD1R 4IKFA 2E5QA 1GXIE 3E9GA 4J8OA 4JS5A 2XDPA 3GOXA 3OW2A 2CT3A 1TH7A 1I4K1 1YCYA 1RUWA 2VC8A 2VGNA 4WF2A 1UECA 3DB3A 2KYBA 1VQ9Q 2RQUA 4HT9A 1TSFA 3QWYA 5GANh 1I8FA 2RH2A 2DRKA 1WPYA 2Y4XA 2K7AA 1Q81U 1QW1A 5D6WA 4CC2A 1B3QA 2HDAA 4N4GA 4DBRA 1V1CA 1VQ5T 4CC7A 1X01A 1KK7A 2Z0WA 3I55Q 4AT1B 3OS1A 3CCJA 2HNIA 1NLOC 4QVCA 3M59A 2FHDA 1YJ9Q 2BKDN 3UT1A 2RM4A 4CI0C 1ZUKA 2XICA 2X4WA 2YT6A 1T3SA 2D6FA 3HRUA 2CUBA 9ATCB 2DIGA 1JXOA 2BZXA 3CMAT 4C92C 1GFCA 5FU6B 2RI2A 2DJQA 4JLIA 1LPLA 3RMQA 5GAN3 1K0SA 5A0DA 3JSCA 4MZTA 1Y57A 2RHZA 3S6WA 3EHQA 4M78D 2A0FB 2EJGA 1U8RA 3AT1B 4M7DG 3UA6A 3BDLA 2D8JA 3QJ6A 1N8RR 1MV0B 2GCXA 3NTIA 4M75C 5KCOA 2LQKA 2ZCFB 2VXEA 4J9GA 3RESA 1ZUYA 1SG5A 2JMAA 1LCKA 2CH4W 3OW2S 2DJZA 1S72T 1QQJA 4EMKA 2YRCA 3I55A 2KQWA 4FYXB 4RUGA 1OX8A 5KCHA 3RR6A 2DTHA 1K1ZA 4E7IA 4FSXA 3META 2EYYA 1RAHB 1ZA1B 3BE3A 3F70A 2KI7A 1YWOA 2I0NA 1FX7A 5FROA 2GTOA 1NYGA 3ZL7C 1Q7YC 3JB9F 3FIFA 4DOVA 2JM8A 2ZGWA 2F1LA 2O01E 2CP7A 1IRXA 1VQMT 3NFCA 4M77B 4M7AB 3VUBA 4X1VA 5DLOA 4PK4A 2DNUA 5GAN6 5CQYA 4O5VA 1WQWA 1WHMA 5KYUB 5LJ3g 1ZSGA 2H8HA 1MUZA 3OW2P 1AEYA 4QVZA 5GAN4 1O75A 3G4SQ 1NG2A 5GMKl 2F69A 2KSSA 4ELZC 3INZA 1RL2A 2D0NA 4E7ZA 1D0YA 3CCRA 3CCEQ 2HBWA 1JJ2A 4M77G 4M7AG 1M1KC 4DBQA 1ARKA 1IGQA 1Q81R 1VQ7A 2PUKB 2HKNA 4IURA 4CC3A 5KYYA 1GL5A 1LJOA 3QYGB 4M77F 4M7AF 4C8QD 1WLPB 1WXBA 1NLPC 1Q86R 1PSEA 2QA4Q 4BACA 1WHHA 3Q1JA 2JTFA 2SEMA 4OMLA 2DETA 3C4SA 4F7UB 1M90U 2CYZB 2PZ1A 1X2KA 1LNXA 2P4TA 3M54A 2OTLT 2AKKA 2LCLA 3HRSA 1D3BB 2RD1A 1RAEB 4HCKA 1MMDA 4LD6A 3VS7A 3NMZC 2WSCE 2RHIA 2OJ2A 4HKEA 3G7ZA 4GLMA 1YI2A 3E9FA 2G3RA 1M90R 3SD4A 3JCMc 2RHUA 3MPUB 1FMVA 2AT1B 3REAB 1SHFA 5FWBA 5GAMg 3EG9A 4NS5A 1SEMA 2RJCA 5KYUA 1NE8A 3EGUA 3QG1A 2NLUA 3OBWA 4PJOB 2MYSA 5KH6A 1AWOA 1UTIA 5IHIA 3X20B 4N0AA 5CAIA 3WVEB 2VXFA 4X9CA 5J3BA 3QBYA 3QZ9B 4OMMA 3OYEA 1NJIC 2V8IA 3VKIA 1PG5B 3R6NA 5GAOl 3A98A 1QVFP 1WJSA 1B7TA 3A8HB 4IUVA 3M53A 4M75D 2CDTA 1YP5A 2GBQA 2DBKA 2FPDA 2JTMA 3VS2A 1XQHA 4QQDA 4RTUA 1AZEA 2EKHA 2L8DA 4XTWA 3J7AF 1HJDA 1U1SA 3V7RA 1VQ8A 1HD3A 3J81E 1D09B 4R55A 2JT4A 2EWNA 2WACA 3ZFJA 2E6NA 2KRNA 5CKFA 3JRZA 3GPLA 1ZBJA 4D8KA 2WSEE 3SWNA 4BDZA 2MCNA 1JB0E 3I35A 3E19A 4C0GA 4ATOA 2L0AA 1CKBA 3CBPA 4IUQA 1W2BP 1K9MR 2E12A 5LL6S 3TQ7P 2EYQA 3G71Q 3HKSA 2NUTA 3H6ZA 3GF5A 4VUBA 4A63B 1QVGP 3QUIA 4L5GA 3THKA 1JU5C 2IG0A 4C92A 1YJWA 1NPRA 5GAMf 1U06A 4FYVB 3ASKA 5GMKh 2E1HA 4L6V5 4KRTA 5HKCA 1U5SA 4EMKC 1I5OB 2VWFA 2C0OA 2BE7D 2EGAA 2QQAA 3RKWA 3PNWC 2ESWA 1SSHA 3QKJA 1IB8A 3OS5A 3CCRQ 1ZA2B 2ZPGB 1JEGA 4DEXA 1KG1A 3P8BB 1MMNA 2KK4A 1AWWA 1QCFA 4LDVA 3OBYA 2V26A 4M75E 4Q5WA 4C92B 3I5RA 4BI4A 2A28A 3HFOA 2LJ1A 2M02A 3DLLA 4FYWB 3JCMW 2XHCA 1BYMA 1QP2A 1PHTA 4WCIA 2JOYA 2CP0A 1A0NB 3TCJA 5GAOp 2AHJB 2P0QA 3OYKA 2MMPA 2JZ2A 4JZ4A 4PNOA 1R0BG 5I21A 3A8OB 5LJ5j 1VQ7Q 4C92G 2PUOB 1WJRA 1WHLA 5CCAA 1C6VX 3MP6A 1RAAB 3H0HA 3DLMA 4KGZB 2A37A 5IHNA 3CPFA 4RTTA 2E10A 4UC4A 3S3OA 4F17A 3CMAA 4QVDA 3CCQT 2HEQA 2LQ8A 4OB1B 1QKWA 3M0PA 3O5ZA 2HQHA 5GAOq 3G4ST 2J6FA 4RCBA 2EBPA 4A4GA 2DA9A 2D0QB 2NUZA 2HQEA 1GFDA 2G6FX 4MMLA 3JB9D 2GF7A 2CKKA 4PLLA 1V76A 4C8QA 4HVWA 2FB7A 3OQ5A 3REBB 5GAOn 2O9SA 3ZEHA 3OS2A 3OYMA 1HXDA 2HSEB 3M58A 1Q95G 1RLPC 5IH2A 2NWMA 3JB9H 4OGCA 3NTKA 4M77A 4R0KA 4M7AA 4V2SA 2GQVA 2PTKA 2CP3A 4OMPA 4C8QE 1OOTA 5A0GA 1YJ9A 3QXEB 3CPWS 3OYNA 2ZPFB 5CO7A 1KC8C 3CC4Q 2LDMA 3EH1A 2DL3A 3LX7A 3CC7Q 3OA6A 2MIOA 2RQVA 4C8QF 2LVMA 3CPWP 5GMKm 1WHKA 3CCRT 3LW5E 1OQKA 4PFOA 1Q86U 2DX1A 3VS6A 1ABOA 3OY9A 1I5LA 2MF2A 2XU8A 4NL2A 1VQ5A 1R77A 5CIUA 1ZBXA 2OTLA 1K0XA 2CZ0B 1BI2A 1PWTA 2LRQA 2DMOA 1VQPQ 2PVDB 3JCMe 1VQNA 1VYUA 1X69A 3FEOA 3L42A 1VQKQ 2RF0A 2J05A 4MZPA 1QVGA 1XOVA 5GMKe 4PJMA 1OPLA 2QQSA 2DAQA 4M77E 3MEVA 3MP1A 4M7AE 5KYYB 2DVJA 1GCPA 4D8DA 1VQLA 1P92A 3HP9A 5HK3A 1NJIR 4C0DC 4PKCC 1VQKA 4PJNA 1VQ4T 1Q82C 1WX6A 1M8MA 3ER0A 3OYFA 2XK0A 3CCMQ 3RERA 2CGHA 1FMWA 1U1TA 2J6OA 3TREA 5KYXB 4ZNXA 2E6ZA 2KDSA 1KIKA 1YIJA 3FRNA 1KJWA 2DL4A 3E2UA 2YUOA 3CCVQ 1YFNA 2KRSA 1D3BA 5DLQE 2OTJQ 2HBPA 4GY5A 1G83A 1ACMB 3V7SA 1M8VA 5LJ3d 2K2VA 1RACB 2MOXA 2COYA 2E65A 1J3TA 1OX9A 3JB9I 3X24B 5LJ5g 4R56A 2OTJT 1UHCA 2RK2A 4OMFB 4KH1B 1X75C 2F2WA 3RKXA 2LT1A 1M3BA 3TVTA 5M9OA 3QJYA 1PKTA 2DRMA 1FYNA 3H41A 1NPPA 2FPEA 1QWFA 2L89A 1JO8A 2VV5A 4KUIA 4DBFA 1QCNA 3TSZA 5IT9E 5GAN7 3MEAA 2AK5A 1TTHB 2BUDA 2QI2A 1IO6A 2EIFA 1AHJB 2GGRA 3ULRB 1KC8R 2L3SA 2L3QA 4LDWA 4AG1C 1YJWT 2KT1A 1PCXA 1M1KR 4DOWA 4OF1A 2K2MA 3CMAQ 4PJOA 3A1PA 5DM7R 1PRLC 2BIVA 3EFOB 2KYMA 3H0IA 3GLXA 3I56T 2JS2A 2DXCA 4KT0E 4QW2A 1BIBA 1SF9A 1BIAA 3RIRA 2RK1A 3GNFB 1VQKT 2E41A 4JLGA 2GNCA 4NL3A 2VGMA 3VJPA 2ROLA 4J9EA 4IUUA 1W1FA 2KXDA 5EG2A 2MI6A 2CREA 1N9SA 2PU9B 2DE0X 4J9HA 1NEBA 4RTXA 1BI3A 1I0CA 1YJNQ 1S1NA 1JRIA 1SRLA 2P4RA 3M0SA 3JB9G 2X9HA 4MZMA 1VQ8T 2DILA 4M4ZA 2R58A 2XMFA 3VS0A 1C1AA 2L3PA 1RI9A 4AFSC 1JJ2P 3OYIA 2LX7A 4M78A 4XQ3A 1SKUB 3OMGA 3CXCA 1TXQA 1D0ZA 2NYSA 2LQNA 2XI9A 3NPFA 3PT9A 4ELYC 4XTUA 4AFZC 4C92D 2CZ1B 3PGGA 2B8AA 4QQGA 3UA7A 4C0ZA 5KYXA 1GRIA 4XTYA 2RA2A 2A3LA 1VQ9T 1N9RA 1M90C 1VQ6T 1IHVA 2OTJA 4OMQA 3H0FA 3JB9J 2PVOB 1UGVA 2JS0A 4FL6A 4KULA 3CC7A 3QO3A 2QQ9A 2RNAA 3FC3A 1WFWA 3HFNA 2QASA 1OU8A 1PRMC 2VKNA 2HMAA 2KROA 3EG0A 3MEWA 4Z88A 4J9BA 3JCMg 1X2QA 4EMGA 1N5ZA 2X4YA 3RMSA 1ZSZB 1M2VA 1JQQA 5GJVB 1TOVA 1JBMA 4J6WA 4FM4B 2QTXA 2VVKA 1SPKA 3EGDB 2QQBA 3VU3C 3CCSA 2YLBA 2LJ0A 5KYWB 5LJ5e 1VQLT 3CBMA 2A08A 2RO0A 3HSBA 3OS0A 5KE2A 4A4HA 2CP5A 2M51A 4C92E 4LNPA 5LJ3e 2ZPHB 1YHQT 2RJFA 3HRTA 5L8RE 1Q86C 4LUEA 2BZYA 1GCQA 5GANe 5FU6C 1M1GA 3M56A 1NBEB 3HTRA 3UWNA 3CC7T 2YUPA 3M0RA 1BK2A 5HCKA 2I2LA 4RTVA 2AIRB 1VQ7T 4FT2A 2XKOC 1KD1C 1VQ8Q 4LD9K 4BE0A 3CD6Q 1B34B 4N4HA 2HL3A 2K3YA 1X6BA 3VV0A 3C95A 4TVRA 1W2BS 1OPKA 4B9XA 2YUNA 2DYIA 3EG3A 3HL8A 1GBQA 2M0OA 1I81A 3L2QA 1NM7A 3SDZA 1VQMA 3I56A 5C0MA 4M78C 5CK9A 4M7DE 4DA4A 2FZCB 2KEAA 2C06A 4FU6A 1EFNA 3JCMQ 2RN8A 1G3TA 2F5KA 3HHTB 1VQMQ 1WHGA 1M3AA 2CZ6B 1ZSZA 4IIMA 2DL5A 1N8RC 2JM9A 1SRMA 2P0KA 4EDUA 2EQUA 1RLQC 2QTVA 3P8HA 2ED0A 2VYTA 2CSQA 2XD0A 3MO8A 3L2RA 2PQWA 3CCJQ 3EG2A 4JRKA 1RAIB 2DXUA 1AD5A 4N0AC 3LLRA 5FU7B 3EGXA 3LWHA 4QT7A 2LMJA 4P5NA 3M9QA 5DY9A 2KGTA 5GMKj 3OYHA 3AHUA 2RPNA 2IVWA 2NUTB 2ZPIB 4HCZA 1NYFA 1S72Q 1FXXA 2PVGB 6AT1B 2HL5C 4Y91A 2E3IA 1EZZB 1PD0A 4J9DA 2DYBA 4O6JA 2YHTA 3CXCP 5GANf 3X26B 2CUDA 4ZGEB 1BB9A 3GNGA 4A4EA 3KXTA 1RABB 2EQKA 3SFMA 3GBQA 2LQWA 2RHYA 2OX7A 2EVRA 3L2VA 2FO0A 2QGGA 2L2PA 5CR2A 4BUGA 3O8VA 4FCYA 4OB2B 1TUDA 3JAME 2ATCB 1VQPT 2YUQA 2DEQA 3SHWA 3CMEA 1Q82R 2DL8A 3RKYA 5I2SA 1KHCA 1ZLMA 1WNLA 3MCAB 3CCVT 3EFSA 1UDLA 2RMOA 3C0CA 3CC4A 4F04B 1PKSA 2BZ8A 4M77D 3URGA 1YITQ 2K5LA 4M7AD 5IAYA 2EQJA 4D6WA 2Y4YA 1KQSA 4AMCA 3GIBA 4E7KA 2AZVA 4ZGJB 4E7JA 3LGLA 3CD6A 3QSUA 1YIJT 1YCSB 1VQ9A 4Z89A 1Y96B 1YI2T 1QP3A 4BY6B 2YDLA 4C0DB 1I1JA 3EAEA 3WXMB 4M78E 5CKBA 4M7DC 3X28B 3CCET 2GQIA 2LNVA 4A4KA 4RTZA 1YIJQ 1BI0A 2DTIA 1W6XA 1YJ9T 1ZHIA 5CVIA 1UGRB 4IUTA 3SB2A 2OAWA 1OEBA 2F2VA 2FYKA 2YWWA 4X9DA 3VYGA 1VYVA 5EC7A 2YRVA 3PE0A 2GFUA 1VQNT 3PFSA 3NGPA 2E4HA 4E7SA 2KAFA 5D7UA 1C0MA 3CC2A 1WJQA 2NUPB 5KYNA 1BI1A 2YXYA 1SHGA 2QK0A 3A8MB 2H3JA 3KBGA 3I9QA 3TEEA 3UDCA 3OYCA 4A4FA 4F7UA 4LDYA 1YITA 2OAUA 1VQ5Q 3KUFA 5GAMj 4XAXB 1B34A 2DF6A 3FDRA 4KH0B 2Y90A 3OSVA 3G4SA 1VIFA 4JPBW 1YN8A 1IXDA 2BTTA 1VQOQ 1W2BA 1RI0A 1OZ2A 1K73U 2GFAA 3CMET 4JJDA 3M0TA 1VQOT 3JCMf 4ESRA 1QKXA 3CCLA 2K6DA 2KR3A 3ME9A 4HXJA 1Y7XA 5CKDA 3EG1A 2EYZA 2XIDA 5GAMe 5KYWA 5FRMA 5GAMd 3S3MA 3CC2Q 4CC4B 3CCMT 2AZSA 3NHNA 4LDXA 1X27A 4DQ2A 1AWJA 1UE9A 5I11A 3DB4A 1OYXA 4C5EA 2EFIA 3QZ5B 1UUEA 4OGEA 2JTEA 4LXCA 4Y28E 1KQSP 5FW9A 3H8ZA 1WA7A 4F7UE 2BE9B 2FG0A 4XK8E 1YJNA 1YNZA 4FSSA 2EYWA 1HK9A 1M9SA 2K4YA 3LYIA 4JZ3A 3GP8A 5GMKi 2JW4A 1VQ4Q 2ZPEB 5ECAA 4JJCA 2K57A 1XTDA 2VB6A 3FLGA 2L5QA 3VS3A 4OB3B 1M4ZA 1MGQA 1G8XA 1N27A 1D1AA 2KNBB 4JRIA 3EH2A 1MNDA 4QQ6A 2XG8D 2HAXA 2K3BA 4PFPA 2DXBA 1YWPA 5GANd 3PVLA 4HVVA 3EFOA 1CSKA 2JVVA 3S3NA 5I2MA 2P0PA 3M0QA 3MP8A 3CCJT 8AT1B 1M1FA 2HSPA 2D9TA 1GBRA 4MMKA 3JCMP 4HVUA 1M5Q1 3CQTA 1ZQ1A 2LX9A 4BY6C 4XTVA 1UJYA 4PJOE 1IGUA 1UB4A 1N6AA 3CEYA 4FT4A 4J9IA 2X4JA 2LTOA 3CC4T 3M4GA 4PJLA 1G2BA 1NEGA 4LDUA 1QMCA 4A53A 1H92A 2LNHB 4II1A 2E64A 3RUXA 4A54A 2KRMA 4AFUC 3OYDA 3CMEQ 2VUBA 1IZ6A 4IUPA 3VRZA 3VS4A 3MEUA 1MV3A 2KBTA 1VYTA 4FW1A 1FWZA 2LJ3A 5FU7C 2RJEA 1YBYA 3CD6T 3R6OA 4PJOF 2C0TA 4JRQA 3OB9A 2XDBA 4KGVB 4ZTJA 4B6MA 2MK5A 3G1JA 1K9MU 4X34A 5FRNA 4OP0A 3CCQQ 2X4XA 4DEYA 1GCQC 4M7DB 1VQ6A 4FW2A 2R5AA 1MMGA 3CCUT 3M0UA 3CCST 2ROTA 1YJNT 1NJIU 3QYHB 3U23A 5FWCA 2K9GA 4Y92A 5CQXA 2RB6A 5GAMh 4JS4A 1XNIA 2V1QA 4E7LA 2K5FA 2DFUA 1SSFA 3RBBB 1UHFA 3M57A 5LJ5d 4N4IA 2A36A 5GAOm 2QDLA 3VYHB 4C5IA 4F7UF 4M7DF 1YITT 2EAYA 3LGFA 2M1HA 3VUZA 1K9AA 2EGCA 3OYGA 1KQ1A 2RHXA 1QVGS 2DD4A 4OVAA 1PM3A 5GAN8 3JCMb 4HCBA 2COZA 2CP2A 2KY9A 2QDYB 3QPHA 4HA8A 1WQ7A 4LE9A 4Z02A 3C94A 1M27C 1Y07A 3D7SB 4OMOA 5GANg 2E5KA 2DERA 4ZN1A 4M75B 4J9FA 3TSWA 4IIOA 4RCCA 5KE3A 1WXUA 2M9UA 4BB7A 3CCEA 2EQIA 3FJPA 2X3WD 5D6XA 2MWOA 3FJ5A 1YJWQ 3CCLQ 2SRCA 1RAGB 3QIIA 4MDWA 2IIMA 1T0JA 2CS7A 3BFMA 4PJOC 4BE1A 2W10A 5CKHA 3L2UA 2DD5A 1K8AU 3BDUA 2DK3A 2D8HA 1R0CB 2EYXA 1E6HA 2QAZA 3P8DA 3CC2T 2LCCA 3I5SA 1ZX6A 1UJ0A 1K73C 1I07A 2W0ZA 4M75A 4F7UG 4BI3A 2ZAEA 1AOJA 1V29B 1Z9ZA 2J06A 3SWNC 1G5VA 3I56Q 1UGPB 2QQRA 3KFVA 1OULA 3M4YA 4JJBA 1KHIA 2DZCA 2F5TX 1Q82U 2YLCA 1Y96A 1IREB 2O31A 4LUDA 2QEXT 2DVEA 2QYZA 3OSSC 2O88A 2FEIA 2FZKB 3MKDA 2HD0A 1ZUUA 2NUPA 4JUVA 5D6YA 2X3XD 2FVUA 4M78F 4KGXB 2RQTA 1BKBA 1KSWA 4ZTFA 5J39A 1K9MC 1X6GA 2V8JA 2LZ6B 4F14A 1DJ7B 3CCVA 4C8QB 4ZGDB 2FPFA 1YHQA 4PJOG 1PC0A 2KXCA 4CRIA 2ECZA 3PTAA 1D0XA 2EW3A 3RNJA 4E7HA 1VQPA 1QLYA 4XU3A 5A2QE 2DZ9A 4KUDK 4OMNA 5IHKA 2WSFE 3JCMX 2COWA 1M3CA 3H9NA 4XU1A 2DXTA 2EGEA 2H3EB 2KMTA
chains in the Genus database with same CATH topology
1PWTA 1GFCA 2GTJA 2DMOA 1Y0MA 2AZVA 1VYUA 2DJQA 1X69A 1K0SA 1X43A 2RF0A 1YCSB 2J05A 1Y57A 4Z89A 3EHQA 1XOVA 1OPLA 2YDLA 3UA6A 1I1JA 2D8JA 2DVJA 2K79A 1GCPA 4D8DA 1HSQA 4Z8AA 1MV0B 2GQIA 4RTZA 2J6KA 1WXTA 2LCSA 2DBMA 1W6XA 3VS5A 4J9GA 1UG1A 1WX6A 1ZUYA 1M8MA 1BBZA 2JMAA 2OAWA 1LCKA 2CH4W 1OEBA 2F2VA 2J6OA 3JV3A 4ZNXA 1KIKA 1VYVA 5EC7A 1KJWA 2DL4A 4RUGA 2YUOA 3PE0A 1K1ZA 2JXBA 3NGPA 2JMCA 2KRSA 2EYYA 1SHGA 1YWOA 1G83A 3I9QA 2I0NA 2GTOA 1NYGA 3ZL7C 2MOXA 1J3TA 2JM8A 1UHCA 4AG2C 2DF6A 1BU1A 2F2WA 4X1VA 1AZGB 2DNUA 4JPBW 1M3BA 1YN8A 3TVTA 2BTTA 1ZSGA 2RQWA 1PKTA 2DRMA 1FYNA 3H41A 2H8HA 1MUZA 2FPEA 1AEYA 1QWFA 1U3OA 4GBQA 2M0YA 1NG2A 1JO8A 2D0NA 3TSZA 4JJDA 2DM1A 2HBWA 3M0TA 2HCKA 4ESRA 2AK5A 1QKXA 1ARKA 1IO6A 2K6DA 4F16A 2KR3A 4CC3A 2GGRA 1GL5A 3ULRB 4HXJA 2L3SA 3EG1A 2D1XA 2B86A 2L3QA 2EYZA 4AG1C 2ENMA 1WLPB 1WXBA 1NLPC 2KT1A 4CC4B 2AZSA 3NHNA 2K2MA 2SEMA 1X27A 4RTWA 1AWJA 1PRLC 1UE9A 4OMLA 2KYMA 3H0IA 5I11A 2JS2A 2AKLA 2PNIA 2PZ1A 1X2KA 2YSQA 1UUEA 2JTEA 2AKKA 2CH4A 5FW9A 2GNCA 1WA7A 4HCKA 2FG0A 3VRYA 1YNZA 3VS7A 4FSSA 2C0IA 4AFQC 2EYWA 3NMZC 4JZ3A 2ROLA 2OJ2A 4J9EA 1AWXA 1W1FA 2JW4A 2KXDA 4GLMA 2CREA 4JJCA 5ECAA 2DE0X 4J9HA 1NEBA 4RTXA 1PNJA 3VS3A 1I0CA 1S1NA 2CT4A 1SRLA 2P4RA 2KNBB 3M0SA 2FRWA 3REAB 2DILA 4M4ZA 1UFFA 2XMFA 1WDXA 1SHFA 3VS0A 5FWBA 2L3PA 1RI9A 2DLPA 2K3BA 4AFSC 1SEMA 1YWPA 3PVLA 2LX7A 4HVVA 4ORZA 3EGUA 1CSKA 2ABLA 3M0QA 1JXMA 2HSPA 1AWOA 1UTIA 5IHIA 1GBRA 3UATA 4HVUA 2LQNA 3CQTA 1TG0A 3NPFA 1WIEA 4OMMA 1UJYA 1QWEA 1WI7A 4AFZC 4EIKA 3UA7A 4J9IA 1GRIA 3R6NA 3A98A 2V1RA 1G2BA 1NEGA 2CDTA 1YP5A 2GBQA 1H8KA 4OMQA 3H0FA 2DBKA 2FPDA 3VS2A 1UGVA 2JS0A 1H92A 2LNHB 4RTUA 1AZEA 2EKHA 4RTYA 3PVQA 2KRMA 4AFUC 2RNAA 1WFWA 1HJDA 2ED1A 1M30A 1HD3A 1PRMC 3EG0A 2VKNA 2KROA 4J9BA 3VRZA 2JT4A 4Z88A 3VS4A 1X2QA 2KRNA 1MV3A 1N5ZA 2KBTA 1VYTA 1ZBJA 5IXFA 2LJ3A 1B07A 1VA7A 4D8KA 5GJVB 1JQQA 2MCNA 3I35A 2C0TA 2VVKA 1SPKA 1CKAA 1W70A 1CKBA 2L0AA 3UF4A 5IXBA 2LJ0A 2O2OA 3SEMA 1E6GA 2A08A 1K76A 2F2XA 4A63B 4LN2A 1WYXA 2M51A 4DEYA 4LNPA 1FMKA 2LP5A 1GCQC 2DL7A 4LUEA 3THKA 2BZYA 1GCQA 1JU5C 3M0UA 2ROTA 2FRYA 1E7OA 3LH5A 3U23A 5FWCA 4E6RA 2K9GA 1U06A 4Y92A 2YUPA 3M0RA 2KE9A 5GJWB 1BK2A 5HCKA 3QWXX 4RTVA 2V1QA 2OI3A 4KRTA 3IQLA 2J7IA 3RBBB 1UHFA 1TUCA 1U5SA 1OV3A 5I22A 2VWFA 2C0OA 2RQRA 2A36A 2QDLA 2EGAA 1KFZA 1Z9QA 1K4US 2ESWA 1SSHA 1X6BA 1K9AA 1OPKA 1AVZC 1JEGA 4DEXA 2EGCA 2YUNA 4J9CA 3EG3A 1ABQA 1GBQA 1QCFA 1AWWA 1NM7A 4LE9A 1T0HA 3I5RA 3EHRA 1M27C 2A28A 4OMOA 2LJ1A 2EPDA 2KEAA 1EFNA 2E5KA 4J9FA 1PHTA 2RN8A 4WCIA 3TSWA 4IIOA 1A0NB 1WXUA 1M3AA 4IIMA 2DL5A 2EQIA 4JZ4A 2X3WD 3FJ5A 2JM9A 1SRMA 2SRCA 1RLQC 2IIMA 1T0JA 2KT8A 2ED0A 5L23A 2W10A 2O9VA 2CSQA 1T3LA 3H0HA 2A37A 5IHNA 4RTTA 2D8HA 2CSIA 4F17A 3EG2A 2EYXA 1E6HA 3VS1A 2HEQA 1AD5A 3I5SA 1QKWA 3M0PA 3O5ZA 4QT7A 1ZX6A 1UJ0A 2LMJA 2J6FA 2EBPA 4K11A 1H3HA 1I07A 2W0ZA 2KGTA 2DA9A 2NUZA 1AOJA 1Z9ZA 2RPNA 1GFDA 2G6FX 2J06A 1NYFA 2CT3A 1RUWA 1UECA 4HVWA 3KFVA 2KYBA 2RQUA 4J9DA 4JJBA 3REBB 2DYBA 2O9SA 3QWYA 2DRKA 2O31A 4LUDA 2K7AA 1RLPC 2CUDA 2NWMA 4CC2A 5IH2A 2O88A 2FEIA 1BB9A 1B3QA 4R0KA 2HDAA 3GBQA 1ZUUA 1V1CA 2LQWA 2PTKA 4OMPA 2EVRA 2X3XD 1OOTA 2FO0A 2RQTA 4CC7A 1KSWA 2L2PA 1X6GA 2DL3A 2LZ6B 1TUDA 4F14A 2MIOA 2RQVA 2YUQA 2FPFA 3SHWA 1NLOC 2KXCA 2ECZA 2DL8A 1ZLMA 2EW3A 3RNJA 2DX1A 1ZUKA 1QLYA 1UDLA 2RMOA 3VS6A 3C0CA 1ABOA 2YT6A 1T3SA 1PKSA 2BZ8A 4OMNA 5IHKA 2CUBA 1JXOA 1M3CA 2BZXA 1K0XA 2EGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWT A;  1GFC A;  2GTJ A;  2DMO A;  1Y0M A;  2AZV A;  1VYU A;  2DJQ A;  1X69 A;  1K0S A;  1X43 A;  2RF0 A;  1YCS B;  2J05 A;  1Y57 A;  4Z89 A;  3EHQ A;  1XOV A;  1OPL A;  2YDL A;  3UA6 A;  1I1J A;  2D8J A;  2DVJ A;  2K79 A;  1GCP A;  4D8D A;  1HSQ A;  4Z8A A;  1MV0 B;  2GQI A;  4RTZ A;  2J6K A;  1WXT A;  2LCS A;  2DBM A;  1W6X A;  3VS5 A;  4J9G A;  1UG1 A;  1WX6 A;  1ZUY A;  1M8M A;  1BBZ A;  2JMA A;  2OAW A;  1LCK A;  2CH4 W;  1OEB A;  2F2V A;  2J6O A;  3JV3 A;  4ZNX A;  1KIK A;  1VYV A;  5EC7 A;  1KJW A;  2DL4 A;  4RUG A;  2YUO A;  3PE0 A;  1K1Z A;  2JXB A;  3NGP A;  2JMC A;  2KRS A;  2EYY A;  1SHG A;  1YWO A;  1G83 A;  3I9Q A;  2I0N A;  2GTO A;  1NYG A;  3ZL7 C;  2MOX A;  1J3T A;  2JM8 A;  1UHC A;  4AG2 C;  2DF6 A;  1BU1 A;  2F2W A;  4X1V A;  1AZG B;  2DNU A;  4JPB W;  1M3B A;  1YN8 A;  3TVT A;  2BTT A;  1ZSG A;  2RQW A;  1PKT A;  2DRM A;  1FYN A;  3H41 A;  2H8H A;  1MUZ A;  2FPE A;  1AEY A;  1QWF A;  1U3O A;  4GBQ A;  2M0Y A;  1NG2 A;  1JO8 A;  2D0N A;  3TSZ A;  4JJD A;  2DM1 A;  2HBW A;  3M0T A;  2HCK A;  4ESR A;  2AK5 A;  1QKX A;  1ARK A;  1IO6 A;  2K6D A;  4F16 A;  2KR3 A;  4CC3 A;  2GGR A;  1GL5 A;  3ULR B;  4HXJ A;  2L3S A;  3EG1 A;  2D1X A;  2B86 A;  2L3Q A;  2EYZ A;  4AG1 C;  2ENM A;  1WLP B;  1WXB A;  1NLP C;  2KT1 A;  4CC4 B;  2AZS A;  3NHN A;  2K2M A;  2SEM A;  1X27 A;  4RTW A;  1AWJ A;  1PRL C;  1UE9 A;  4OML A;  2KYM A;  3H0I A;  5I11 A;  2JS2 A;  2AKL A;  2PNI A;  2PZ1 A;  1X2K A;  2YSQ A;  1UUE A;  2JTE A;  2AKK A;  2CH4 A;  5FW9 A;  2GNC A;  1WA7 A;  4HCK A;  2FG0 A;  3VRY A;  1YNZ A;  3VS7 A;  4FSS A;  2C0I A;  4AFQ C;  2EYW A;  3NMZ C;  4JZ3 A;  2ROL A;  2OJ2 A;  4J9E A;  1AWX A;  1W1F A;  2JW4 A;  2KXD A;  4GLM A;  2CRE A;  4JJC A;  5ECA A;  2DE0 X;  4J9H A;  1NEB A;  4RTX A;  1PNJ A;  3VS3 A;  1I0C A;  1S1N A;  2CT4 A;  1SRL A;  2P4R A;  2KNB B;  3M0S A;  2FRW A;  3REA B;  2DIL A;  4M4Z A;  1UFF A;  2XMF A;  1WDX A;  1SHF A;  3VS0 A;  5FWB A;  2L3P A;  1RI9 A;  2DLP A;  2K3B A;  4AFS C;  1SEM A;  1YWP A;  3PVL A;  2LX7 A;  4HVV A;  4ORZ A;  3EGU A;  1CSK A;  2ABL A;  3M0Q A;  1JXM A;  2HSP A;  1AWO A;  1UTI A;  5IHI A;  1GBR A;  3UAT A;  4HVU A;  2LQN A;  3CQT A;  1TG0 A;  3NPF A;  1WIE A;  4OMM A;  1UJY A;  1QWE A;  1WI7 A;  4AFZ C;  4EIK A;  3UA7 A;  4J9I A;  1GRI A;  3R6N A;  3A98 A;  2V1R A;  1G2B A;  1NEG A;  2CDT A;  1YP5 A;  2GBQ A;  1H8K A;  4OMQ A;  3H0F A;  2DBK A;  2FPD A;  3VS2 A;  1UGV A;  2JS0 A;  1H92 A;  2LNH B;  4RTU A;  1AZE A;  2EKH A;  4RTY A;  3PVQ A;  2KRM A;  4AFU C;  2RNA A;  1WFW A;  1HJD A;  2ED1 A;  1M30 A;  1HD3 A;  1PRM C;  3EG0 A;  2VKN A;  2KRO A;  4J9B A;  3VRZ A;  2JT4 A;  4Z88 A;  3VS4 A;  1X2Q A;  2KRN A;  1MV3 A;  1N5Z A;  2KBT A;  1VYT A;  1ZBJ A;  5IXF A;  2LJ3 A;  1B07 A;  1VA7 A;  4D8K A;  5GJV B;  1JQQ A;  2MCN A;  3I35 A;  2C0T A;  2VVK A;  1SPK A;  1CKA A;  1W70 A;  1CKB A;  2L0A A;  3UF4 A;  5IXB A;  2LJ0 A;  2O2O A;  3SEM A;  1E6G A;  2A08 A;  1K76 A;  2F2X A;  4A63 B;  4LN2 A;  1WYX A;  2M51 A;  4DEY A;  4LNP A;  1FMK A;  2LP5 A;  1GCQ C;  2DL7 A;  4LUE A;  3THK A;  2BZY A;  1GCQ A;  1JU5 C;  3M0U A;  2ROT A;  2FRY A;  1E7O A;  3LH5 A;  3U23 A;  5FWC A;  4E6R A;  2K9G A;  1U06 A;  4Y92 A;  2YUP A;  3M0R A;  2KE9 A;  5GJW B;  1BK2 A;  5HCK A;  3QWX X;  4RTV A;  2V1Q A;  2OI3 A;  4KRT A;  3IQL A;  2J7I A;  3RBB B;  1UHF A;  1TUC A;  1U5S A;  1OV3 A;  5I22 A;  2VWF A;  2C0O A;  2RQR A;  2A36 A;  2QDL A;  2EGA A;  1KFZ A;  1Z9Q A;  1K4U S;  2ESW A;  1SSH A;  1X6B A;  1K9A A;  1OPK A;  1AVZ C;  1JEG A;  4DEX A;  2EGC A;  2YUN A;  4J9C A;  3EG3 A;  1ABQ A;  1GBQ A;  1QCF A;  1AWW A;  1NM7 A;  4LE9 A;  1T0H A;  3I5R A;  3EHR A;  1M27 C;  2A28 A;  4OMO A;  2LJ1 A;  2EPD A;  2KEA A;  1EFN A;  2E5K A;  4J9F A;  1PHT A;  2RN8 A;  4WCI A;  3TSW A;  4IIO A;  1A0N B;  1WXU A;  1M3A A;  4IIM A;  2DL5 A;  2EQI A;  4JZ4 A;  2X3W D;  3FJ5 A;  2JM9 A;  1SRM A;  2SRC A;  1RLQ C;  2IIM A;  1T0J A;  2KT8 A;  2ED0 A;  5L23 A;  2W10 A;  2O9V A;  2CSQ A;  1T3L A;  3H0H A;  2A37 A;  5IHN A;  4RTT A;  2D8H A;  2CSI A;  4F17 A;  3EG2 A;  2EYX A;  1E6H A;  3VS1 A;  2HEQ A;  1AD5 A;  3I5S A;  1QKW A;  3M0P A;  3O5Z A;  4QT7 A;  1ZX6 A;  1UJ0 A;  2LMJ A;  2J6F A;  2EBP A;  4K11 A;  1H3H A;  1I07 A;  2W0Z A;  2KGT A;  2DA9 A;  2NUZ A;  1AOJ A;  1Z9Z A;  2RPN A;  1GFD A;  2G6F X;  2J06 A;  1NYF A;  2CT3 A;  1RUW A;  1UEC A;  4HVW A;  3KFV A;  2KYB A;  2RQU A;  4J9D A;  4JJB A;  3REB B;  2DYB A;  2O9S A;  3QWY A;  2DRK A;  2O31 A;  4LUD A;  2K7A A;  1RLP C;  2CUD A;  2NWM A;  4CC2 A;  5IH2 A;  2O88 A;  2FEI A;  1BB9 A;  1B3Q A;  4R0K A;  2HDA A;  3GBQ A;  1ZUU A;  1V1C A;  2LQW A;  2PTK A;  4OMP A;  2EVR A;  2X3X D;  1OOT A;  2FO0 A;  2RQT A;  4CC7 A;  1KSW A;  2L2P A;  1X6G A;  2DL3 A;  2LZ6 B;  1TUD A;  4F14 A;  2MIO A;  2RQV A;  2YUQ A;  2FPF A;  3SHW A;  1NLO C;  2KXC A;  2ECZ A;  2DL8 A;  1ZLM A;  2EW3 A;  3RNJ A;  2DX1 A;  1ZUK A;  1QLY A;  1UDL A;  2RMO A;  3VS6 A;  3C0C A;  1ABO A;  2YT6 A;  1T3S A;  1PKS A;  2BZ8 A;  4OMN A;  5IHK A;  2CUB A;  1JXO A;  1M3C A;  2BZX A;  1K0X A;  2EGE A; 
#chains in the Genus database with same CATH topology
 2GTJ A;  4PLI A;  3QDR B;  1Y0M A;  4EMH A;  1X6O A;  3DKM A;  1X43 A;  1K8A R;  1Y71 A;  3QDF A;  3CCM A;  2OTL Q;  3WVD B;  1Q7Y R;  1RAF B;  3HPW A;  3E1S A;  2K79 A;  4HCC A;  1HSQ A;  4Z8A A;  2EKO A;  1TS9 A;  1NZ9 A;  2LCS A;  2J6K A;  1WXT A;  2L3R A;  3UPU A;  2DBM A;  4C5G A;  2LC4 A;  3VS5 A;  4J5Y A;  1UG1 A;  2K5I A;  2QA4 T;  2YRD A;  3CXC S;  1BBZ A;  1D1C A;  2RI3 A;  4EMK B;  1QCO A;  1VQL Q;  3JV3 A;  2DKG A;  4EPC A;  2V8K A;  2X35 A;  1O9S A;  4XTZ A;  1BCM A;  2JXB A;  4M7D D;  3PIP A;  2JMC A;  3G71 A;  5J26 A;  1K73 R;  1UEB A;  1QVF S;  4JDS A;  1PSF A;  4FIB A;  2DEU A;  1TU0 B;  4XTX A;  2EJF A;  4AG2 C;  1K8A C;  1BU1 A;  4PFZ A;  1AZG B;  3V8L A;  3C12 A;  4M78 B;  2LT4 A;  4M77 C;  3RDV A;  4M7A C;  3L2Z A;  2RQW A;  3TU4 K;  4M7D A;  1F1B B;  4J6Y A;  5LJ5 h;  2FL7 A;  1U3O A;  4GBQ A;  4ZN3 A;  4BE2 A;  2M0Y A;  3T9N A;  5LJ5 f;  2MWP A;  4E2F B;  1W4S A;  4C8Q C;  3CCS Q;  5AT1 B;  2DM1 A;  3G6E A;  1OU9 A;  3X25 B;  2HCK A;  4F16 A;  5HY6 A;  5LJ3 j;  1OI1 A;  1G3Y A;  2D1X A;  2B86 A;  4PJO D;  2ENM A;  2EJ9 A;  1OZ3 A;  3A5Z B;  4B9W A;  1Q81 C;  4RTW A;  3N5B B;  3OYJ A;  4C5H A;  2X51 A;  1M2O A;  2M16 A;  2AKL A;  3CCU Q;  1AT1 B;  1QVF A;  2PNI A;  4M75 G;  1YI2 Q;  2QA4 A;  2YSQ A;  2JN0 A;  4L59 A;  2CH4 A;  5HK0 A;  2QGF B;  3VRY A;  4WTO B;  2C0I A;  4AFQ C;  3MJX A;  2DPP B;  3JCM V;  4HT8 A;  2FZG B;  2O4X B;  1AWX A;  4DBH A;  3NTH A;  2DO3 A;  1PNJ A;  2QEX A;  1TWB A;  2CT4 A;  4QKU A;  4GLK A;  4M75 F;  2FRW A;  1VQN Q;  1VQ4 A;  1UFF A;  4RG8 A;  1WDX A;  2E70 A;  2MAM A;  1H3Z A;  2DLP A;  3MHX A;  4JRP A;  4ANJ A;  3I55 T;  4ORZ A;  3G6E T;  1S72 A;  3A8G B;  4J83 A;  2ABL A;  3SWN B;  2CP6 A;  1JXM A;  3FB9 A;  3UAT A;  4YTL A;  1TG0 A;  1WIE A;  1QWE A;  3EG9 B;  4BI8 B;  1WI7 A;  4EIK A;  1BCO A;  2QG9 B;  4ME7 A;  3L1A A;  3JCM d;  2V1R A;  2DTO A;  3JCM h;  2DIQ A;  3EGX B;  1VIE A;  3J80 E;  1H8K A;  1HYO A;  2IPO B;  5C6S A;  1MMA A;  3V8J A;  3BY7 A;  1ZSZ C;  4JJN K;  4RTY A;  3PVQ A;  1EX4 A;  4RG2 A;  1YHQ Q;  2QEX Q;  3JCM J;  1JJ2 S;  1M2V B;  2ED1 A;  1M30 A;  1Q7Y U;  4KBM B;  4C8Q G;  3LH0 A;  5IXF A;  1B07 A;  1VA7 A;  1VUB A;  1UGS B;  1UGQ B;  3CBO A;  2HQX A;  1CKA A;  4BDY A;  1W70 A;  3UF4 A;  1VQ6 Q;  4RKU E;  4XU0 A;  8ATC B;  5IXB A;  3PIO A;  2O2O A;  3PMI A;  3SEM A;  1E6G A;  2ZPB B;  1H64 1;  1K76 A;  3V8K A;  1N8R U;  4BD3 A;  2F2X A;  2QXF A;  3OYB A;  4LN2 A;  2RI5 A;  1WYX A;  5AYF A;  1FMK A;  2LP5 A;  1M1K U;  2HKQ B;  2E3H A;  3M55 A;  3QHS A;  1WGS A;  5GAO r;  2DL7 A;  1MHN A;  2A7Y A;  2FRY A;  3M5A A;  1E7O A;  3LH5 A;  3ZBD A;  5GAN 2;  2HZY A;  4E6R A;  3CCQ A;  2CZ7 B;  3G71 T;  2JJ9 A;  4OB0 B;  2KE9 A;  5GJW B;  4XU2 A;  2ZZD A;  3QWX X;  3CCU A;  3CCL T;  2OI3 A;  2JNG A;  3IQL A;  2J7I A;  1VQO A;  1TUC A;  3L2W A;  3CPW A;  1OV3 A;  2MPX C;  5I22 A;  3EFR A;  4RMO A;  1LOJ A;  1KQS S;  2RQR A;  5IN1 A;  2KVQ G;  1KFZ A;  3PMT A;  1Z9Q A;  3LWI A;  4MDX A;  1K4U S;  1WZO A;  4J6X A;  2P84 A;  1QVP A;  1AVZ C;  3BW1 A;  4J9C A;  1ABQ A;  4NOY A;  4C92 F;  3A8L B;  4J7F A;  2JUF A;  5FLX E;  5CKE A;  4FYY B;  3OYA A;  4PJJ A;  1T0H A;  3OYY A;  3EHR A;  5GAN 5;  1D1B A;  3OYL A;  4M78 G;  2EPD A;  1PD1 A;  3OMC A;  3EGD A;  2K3X A;  1XJW B;  1G3S A;  2O4X A;  1IHW A;  4J7I A;  2R5M A;  3G6E Q;  1EIF A;  1KC8 U;  2RJD A;  3V7C A;  7AT1 B;  2XDD A;  1KQ2 A;  4PL6 A;  1LVK A;  5A0L A;  2KT8 A;  5L23 A;  2O9V A;  5LJ3 h;  1MNE A;  1VOM A;  4C0F A;  1T3L A;  1G3W A;  2CSI A;  2R57 A;  5LJ3 f;  1RAD B;  5GAN j;  3VS1 A;  2VAS A;  1R8O B;  1KD1 U;  4K11 A;  1H3H A;  2EQM A;  4E47 A;  1WHJ A;  1TUG B;  1KD1 R;  4IKF A;  2E5Q A;  1GXI E;  3E9G A;  4J8O A;  4JS5 A;  2XDP A;  3GOX A;  3OW2 A;  2CT3 A;  1TH7 A;  1I4K 1;  1YCY A;  1RUW A;  2VC8 A;  2VGN A;  4WF2 A;  1UEC A;  3DB3 A;  2KYB A;  1VQ9 Q;  2RQU A;  4HT9 A;  1TSF A;  3QWY A;  5GAN h;  1I8F A;  2RH2 A;  2DRK A;  1WPY A;  2Y4X A;  2K7A A;  1Q81 U;  1QW1 A;  5D6W A;  4CC2 A;  1B3Q A;  2HDA A;  4N4G A;  4DBR A;  1V1C A;  1VQ5 T;  4CC7 A;  1X01 A;  1KK7 A;  2Z0W A;  3I55 Q;  4AT1 B;  3OS1 A;  3CCJ A;  2HNI A;  1NLO C;  4QVC A;  3M59 A;  2FHD A;  1YJ9 Q;  2BKD N;  3UT1 A;  2RM4 A;  4CI0 C;  1ZUK A;  2XIC A;  2X4W A;  2YT6 A;  1T3S A;  2D6F A;  3HRU A;  2CUB A;  9ATC B;  2DIG A;  1JXO A;  2BZX A;  3CMA T;  4C92 C;  1GFC A;  5FU6 B;  2RI2 A;  2DJQ A;  4JLI A;  1LPL A;  3RMQ A;  5GAN 3;  1K0S A;  5A0D A;  3JSC A;  4MZT A;  1Y57 A;  2RHZ A;  3S6W A;  3EHQ A;  4M78 D;  2A0F B;  2EJG A;  1U8R A;  3AT1 B;  4M7D G;  3UA6 A;  3BDL A;  2D8J A;  3QJ6 A;  1N8R R;  1MV0 B;  2GCX A;  3NTI A;  4M75 C;  5KCO A;  2LQK A;  2ZCF B;  2VXE A;  4J9G A;  3RES A;  1ZUY A;  1SG5 A;  2JMA A;  1LCK A;  2CH4 W;  3OW2 S;  2DJZ A;  1S72 T;  1QQJ A;  4EMK A;  2YRC A;  3I55 A;  2KQW A;  4FYX B;  4RUG A;  1OX8 A;  5KCH A;  3RR6 A;  2DTH A;  1K1Z A;  4E7I A;  4FSX A;  3MET A;  2EYY A;  1RAH B;  1ZA1 B;  3BE3 A;  3F70 A;  2KI7 A;  1YWO A;  2I0N A;  1FX7 A;  5FRO A;  2GTO A;  1NYG A;  3ZL7 C;  1Q7Y C;  3JB9 F;  3FIF A;  4DOV A;  2JM8 A;  2ZGW A;  2F1L A;  2O01 E;  2CP7 A;  1IRX A;  1VQM T;  3NFC A;  4M77 B;  4M7A B;  3VUB A;  4X1V A;  5DLO A;  4PK4 A;  2DNU A;  5GAN 6;  5CQY A;  4O5V A;  1WQW A;  1WHM A;  5KYU B;  5LJ3 g;  1ZSG A;  2H8H A;  1MUZ A;  3OW2 P;  1AEY A;  4QVZ A;  5GAN 4;  1O75 A;  3G4S Q;  1NG2 A;  5GMK l;  2F69 A;  2KSS A;  4ELZ C;  3INZ A;  1RL2 A;  2D0N A;  4E7Z A;  1D0Y A;  3CCR A;  3CCE Q;  2HBW A;  1JJ2 A;  4M77 G;  4M7A G;  1M1K C;  4DBQ A;  1ARK A;  1IGQ A;  1Q81 R;  1VQ7 A;  2PUK B;  2HKN A;  4IUR A;  4CC3 A;  5KYY A;  1GL5 A;  1LJO A;  3QYG B;  4M77 F;  4M7A F;  4C8Q D;  1WLP B;  1WXB A;  1NLP C;  1Q86 R;  1PSE A;  2QA4 Q;  4BAC A;  1WHH A;  3Q1J A;  2JTF A;  2SEM A;  4OML A;  2DET A;  3C4S A;  4F7U B;  1M90 U;  2CYZ B;  2PZ1 A;  1X2K A;  1LNX A;  2P4T A;  3M54 A;  2OTL T;  2AKK A;  2LCL A;  3HRS A;  1D3B B;  2RD1 A;  1RAE B;  4HCK A;  1MMD A;  4LD6 A;  3VS7 A;  3NMZ C;  2WSC E;  2RHI A;  2OJ2 A;  4HKE A;  3G7Z A;  4GLM A;  1YI2 A;  3E9F A;  2G3R A;  1M90 R;  3SD4 A;  3JCM c;  2RHU A;  3MPU B;  1FMV A;  2AT1 B;  3REA B;  1SHF A;  5FWB A;  5GAM g;  3EG9 A;  4NS5 A;  1SEM A;  2RJC A;  5KYU A;  1NE8 A;  3EGU A;  3QG1 A;  2NLU A;  3OBW A;  4PJO B;  2MYS A;  5KH6 A;  1AWO A;  1UTI A;  5IHI A;  3X20 B;  4N0A A;  5CAI A;  3WVE B;  2VXF A;  4X9C A;  5J3B A;  3QBY A;  3QZ9 B;  4OMM A;  3OYE A;  1NJI C;  2V8I A;  3VKI A;  1PG5 B;  3R6N A;  5GAO l;  3A98 A;  1QVF P;  1WJS A;  1B7T A;  3A8H B;  4IUV A;  3M53 A;  4M75 D;  2CDT A;  1YP5 A;  2GBQ A;  2DBK A;  2FPD A;  2JTM A;  3VS2 A;  1XQH A;  4QQD A;  4RTU A;  1AZE A;  2EKH A;  2L8D A;  4XTW A;  3J7A F;  1HJD A;  1U1S A;  3V7R A;  1VQ8 A;  1HD3 A;  3J81 E;  1D09 B;  4R55 A;  2JT4 A;  2EWN A;  2WAC A;  3ZFJ A;  2E6N A;  2KRN A;  5CKF A;  3JRZ A;  3GPL A;  1ZBJ A;  4D8K A;  2WSE E;  3SWN A;  4BDZ A;  2MCN A;  1JB0 E;  3I35 A;  3E19 A;  4C0G A;  4ATO A;  2L0A A;  1CKB A;  3CBP A;  4IUQ A;  1W2B P;  1K9M R;  2E12 A;  5LL6 S;  3TQ7 P;  2EYQ A;  3G71 Q;  3HKS A;  2NUT A;  3H6Z A;  3GF5 A;  4VUB A;  4A63 B;  1QVG P;  3QUI A;  4L5G A;  3THK A;  1JU5 C;  2IG0 A;  4C92 A;  1YJW A;  1NPR A;  5GAM f;  1U06 A;  4FYV B;  3ASK A;  5GMK h;  2E1H A;  4L6V 5;  4KRT A;  5HKC A;  1U5S A;  4EMK C;  1I5O B;  2VWF A;  2C0O A;  2BE7 D;  2EGA A;  2QQA A;  3RKW A;  3PNW C;  2ESW A;  1SSH A;  3QKJ A;  1IB8 A;  3OS5 A;  3CCR Q;  1ZA2 B;  2ZPG B;  1JEG A;  4DEX A;  1KG1 A;  3P8B B;  1MMN A;  2KK4 A;  1AWW A;  1QCF A;  4LDV A;  3OBY A;  2V26 A;  4M75 E;  4Q5W A;  4C92 B;  3I5R A;  4BI4 A;  2A28 A;  3HFO A;  2LJ1 A;  2M02 A;  3DLL A;  4FYW B;  3JCM W;  2XHC A;  1BYM A;  1QP2 A;  1PHT A;  4WCI A;  2JOY A;  2CP0 A;  1A0N B;  3TCJ A;  5GAO p;  2AHJ B;  2P0Q A;  3OYK A;  2MMP A;  2JZ2 A;  4JZ4 A;  4PNO A;  1R0B G;  5I21 A;  3A8O B;  5LJ5 j;  1VQ7 Q;  4C92 G;  2PUO B;  1WJR A;  1WHL A;  5CCA A;  1C6V X;  3MP6 A;  1RAA B;  3H0H A;  3DLM A;  4KGZ B;  2A37 A;  5IHN A;  3CPF A;  4RTT A;  2E10 A;  4UC4 A;  3S3O A;  4F17 A;  3CMA A;  4QVD A;  3CCQ T;  2HEQ A;  2LQ8 A;  4OB1 B;  1QKW A;  3M0P A;  3O5Z A;  2HQH A;  5GAO q;  3G4S T;  2J6F A;  4RCB A;  2EBP A;  4A4G A;  2DA9 A;  2D0Q B;  2NUZ A;  2HQE A;  1GFD A;  2G6F X;  4MML A;  3JB9 D;  2GF7 A;  2CKK A;  4PLL A;  1V76 A;  4C8Q A;  4HVW A;  2FB7 A;  3OQ5 A;  3REB B;  5GAO n;  2O9S A;  3ZEH A;  3OS2 A;  3OYM A;  1HXD A;  2HSE B;  3M58 A;  1Q95 G;  1RLP C;  5IH2 A;  2NWM A;  3JB9 H;  4OGC A;  3NTK A;  4M77 A;  4R0K A;  4M7A A;  4V2S A;  2GQV A;  2PTK A;  2CP3 A;  4OMP A;  4C8Q E;  1OOT A;  5A0G A;  1YJ9 A;  3QXE B;  3CPW S;  3OYN A;  2ZPF B;  5CO7 A;  1KC8 C;  3CC4 Q;  2LDM A;  3EH1 A;  2DL3 A;  3LX7 A;  3CC7 Q;  3OA6 A;  2MIO A;  2RQV A;  4C8Q F;  2LVM A;  3CPW P;  5GMK m;  1WHK A;  3CCR T;  3LW5 E;  1OQK A;  4PFO A;  1Q86 U;  2DX1 A;  3VS6 A;  1ABO A;  3OY9 A;  1I5L A;  2MF2 A;  2XU8 A;  4NL2 A;  1VQ5 A;  1R77 A;  5CIU A;  1ZBX A;  2OTL A;  1K0X A;  2CZ0 B;  1BI2 A;  1PWT A;  2LRQ A;  2DMO A;  1VQP Q;  2PVD B;  3JCM e;  1VQN A;  1VYU A;  1X69 A;  3FEO A;  3L42 A;  1VQK Q;  2RF0 A;  2J05 A;  4MZP A;  1QVG A;  1XOV A;  5GMK e;  4PJM A;  1OPL A;  2QQS A;  2DAQ A;  4M77 E;  3MEV A;  3MP1 A;  4M7A E;  5KYY B;  2DVJ A;  1GCP A;  4D8D A;  1VQL A;  1P92 A;  3HP9 A;  5HK3 A;  1NJI R;  4C0D C;  4PKC C;  1VQK A;  4PJN A;  1VQ4 T;  1Q82 C;  1WX6 A;  1M8M A;  3ER0 A;  3OYF A;  2XK0 A;  3CCM Q;  3RER A;  2CGH A;  1FMW A;  1U1T A;  2J6O A;  3TRE A;  5KYX B;  4ZNX A;  2E6Z A;  2KDS A;  1KIK A;  1YIJ A;  3FRN A;  1KJW A;  2DL4 A;  3E2U A;  2YUO A;  3CCV Q;  1YFN A;  2KRS A;  1D3B A;  5DLQ E;  2OTJ Q;  2HBP A;  4GY5 A;  1G83 A;  1ACM B;  3V7S A;  1M8V A;  5LJ3 d;  2K2V A;  1RAC B;  2MOX A;  2COY A;  2E65 A;  1J3T A;  1OX9 A;  3JB9 I;  3X24 B;  5LJ5 g;  4R56 A;  2OTJ T;  1UHC A;  2RK2 A;  4OMF B;  4KH1 B;  1X75 C;  2F2W A;  3RKX A;  2LT1 A;  1M3B A;  3TVT A;  5M9O A;  3QJY A;  1PKT A;  2DRM A;  1FYN A;  3H41 A;  1NPP A;  2FPE A;  1QWF A;  2L89 A;  1JO8 A;  2VV5 A;  4KUI A;  4DBF A;  1QCN A;  3TSZ A;  5IT9 E;  5GAN 7;  3MEA A;  2AK5 A;  1TTH B;  2BUD A;  2QI2 A;  1IO6 A;  2EIF A;  1AHJ B;  2GGR A;  3ULR B;  1KC8 R;  2L3S A;  2L3Q A;  4LDW A;  4AG1 C;  1YJW T;  2KT1 A;  1PCX A;  1M1K R;  4DOW A;  4OF1 A;  2K2M A;  3CMA Q;  4PJO A;  3A1P A;  5DM7 R;  1PRL C;  2BIV A;  3EFO B;  2KYM A;  3H0I A;  3GLX A;  3I56 T;  2JS2 A;  2DXC A;  4KT0 E;  4QW2 A;  1BIB A;  1SF9 A;  1BIA A;  3RIR A;  2RK1 A;  3GNF B;  1VQK T;  2E41 A;  4JLG A;  2GNC A;  4NL3 A;  2VGM A;  3VJP A;  2ROL A;  4J9E A;  4IUU A;  1W1F A;  2KXD A;  5EG2 A;  2MI6 A;  2CRE A;  1N9S A;  2PU9 B;  2DE0 X;  4J9H A;  1NEB A;  4RTX A;  1BI3 A;  1I0C A;  1YJN Q;  1S1N A;  1JRI A;  1SRL A;  2P4R A;  3M0S A;  3JB9 G;  2X9H A;  4MZM A;  1VQ8 T;  2DIL A;  4M4Z A;  2R58 A;  2XMF A;  3VS0 A;  1C1A A;  2L3P A;  1RI9 A;  4AFS C;  1JJ2 P;  3OYI A;  2LX7 A;  4M78 A;  4XQ3 A;  1SKU B;  3OMG A;  3CXC A;  1TXQ A;  1D0Z A;  2NYS A;  2LQN A;  2XI9 A;  3NPF A;  3PT9 A;  4ELY C;  4XTU A;  4AFZ C;  4C92 D;  2CZ1 B;  3PGG A;  2B8A A;  4QQG A;  3UA7 A;  4C0Z A;  5KYX A;  1GRI A;  4XTY A;  2RA2 A;  2A3L A;  1VQ9 T;  1N9R A;  1M90 C;  1VQ6 T;  1IHV A;  2OTJ A;  4OMQ A;  3H0F A;  3JB9 J;  2PVO B;  1UGV A;  2JS0 A;  4FL6 A;  4KUL A;  3CC7 A;  3QO3 A;  2QQ9 A;  2RNA A;  3FC3 A;  1WFW A;  3HFN A;  2QAS A;  1OU8 A;  1PRM C;  2VKN A;  2HMA A;  2KRO A;  3EG0 A;  3MEW A;  4Z88 A;  4J9B A;  3JCM g;  1X2Q A;  4EMG A;  1N5Z A;  2X4Y A;  3RMS A;  1ZSZ B;  1M2V A;  1JQQ A;  5GJV B;  1TOV A;  1JBM A;  4J6W A;  4FM4 B;  2QTX A;  2VVK A;  1SPK A;  3EGD B;  2QQB A;  3VU3 C;  3CCS A;  2YLB A;  2LJ0 A;  5KYW B;  5LJ5 e;  1VQL T;  3CBM A;  2A08 A;  2RO0 A;  3HSB A;  3OS0 A;  5KE2 A;  4A4H A;  2CP5 A;  2M51 A;  4C92 E;  4LNP A;  5LJ3 e;  2ZPH B;  1YHQ T;  2RJF A;  3HRT A;  5L8R E;  1Q86 C;  4LUE A;  2BZY A;  1GCQ A;  5GAN e;  5FU6 C;  1M1G A;  3M56 A;  1NBE B;  3HTR A;  3UWN A;  3CC7 T;  2YUP A;  3M0R A;  1BK2 A;  5HCK A;  2I2L A;  4RTV A;  2AIR B;  1VQ7 T;  4FT2 A;  2XKO C;  1KD1 C;  1VQ8 Q;  4LD9 K;  4BE0 A;  3CD6 Q;  1B34 B;  4N4H A;  2HL3 A;  2K3Y A;  1X6B A;  3VV0 A;  3C95 A;  4TVR A;  1W2B S;  1OPK A;  4B9X A;  2YUN A;  2DYI A;  3EG3 A;  3HL8 A;  1GBQ A;  2M0O A;  1I81 A;  3L2Q A;  1NM7 A;  3SDZ A;  1VQM A;  3I56 A;  5C0M A;  4M78 C;  5CK9 A;  4M7D E;  4DA4 A;  2FZC B;  2KEA A;  2C06 A;  4FU6 A;  1EFN A;  3JCM Q;  2RN8 A;  1G3T A;  2F5K A;  3HHT B;  1VQM Q;  1WHG A;  1M3A A;  2CZ6 B;  1ZSZ A;  4IIM A;  2DL5 A;  1N8R C;  2JM9 A;  1SRM A;  2P0K A;  4EDU A;  2EQU A;  1RLQ C;  2QTV A;  3P8H A;  2ED0 A;  2VYT A;  2CSQ A;  2XD0 A;  3MO8 A;  3L2R A;  2PQW A;  3CCJ Q;  3EG2 A;  4JRK A;  1RAI B;  2DXU A;  1AD5 A;  4N0A C;  3LLR A;  5FU7 B;  3EGX A;  3LWH A;  4QT7 A;  2LMJ A;  4P5N A;  3M9Q A;  5DY9 A;  2KGT A;  5GMK j;  3OYH A;  3AHU A;  2RPN A;  2IVW A;  2NUT B;  2ZPI B;  4HCZ A;  1NYF A;  1S72 Q;  1FXX A;  2PVG B;  6AT1 B;  2HL5 C;  4Y91 A;  2E3I A;  1EZZ B;  1PD0 A;  4J9D A;  2DYB A;  4O6J A;  2YHT A;  3CXC P;  5GAN f;  3X26 B;  2CUD A;  4ZGE B;  1BB9 A;  3GNG A;  4A4E A;  3KXT A;  1RAB B;  2EQK A;  3SFM A;  3GBQ A;  2LQW A;  2RHY A;  2OX7 A;  2EVR A;  3L2V A;  2FO0 A;  2QGG A;  2L2P A;  5CR2 A;  4BUG A;  3O8V A;  4FCY A;  4OB2 B;  1TUD A;  3JAM E;  2ATC B;  1VQP T;  2YUQ A;  2DEQ A;  3SHW A;  3CME A;  1Q82 R;  2DL8 A;  3RKY A;  5I2S A;  1KHC A;  1ZLM A;  1WNL A;  3MCA B;  3CCV T;  3EFS A;  1UDL A;  2RMO A;  3C0C A;  3CC4 A;  4F04 B;  1PKS A;  2BZ8 A;  4M77 D;  3URG A;  1YIT Q;  2K5L A;  4M7A D;  5IAY A;  2EQJ A;  4D6W A;  2Y4Y A;  1KQS A;  4AMC A;  3GIB A;  4E7K A;  2AZV A;  4ZGJ B;  4E7J A;  3LGL A;  3CD6 A;  3QSU A;  1YIJ T;  1YCS B;  1VQ9 A;  4Z89 A;  1Y96 B;  1YI2 T;  1QP3 A;  4BY6 B;  2YDL A;  4C0D B;  1I1J A;  3EAE A;  3WXM B;  4M78 E;  5CKB A;  4M7D C;  3X28 B;  3CCE T;  2GQI A;  2LNV A;  4A4K A;  4RTZ A;  1YIJ Q;  1BI0 A;  2DTI A;  1W6X A;  1YJ9 T;  1ZHI A;  5CVI A;  1UGR B;  4IUT A;  3SB2 A;  2OAW A;  1OEB A;  2F2V A;  2FYK A;  2YWW A;  4X9D A;  3VYG A;  1VYV A;  5EC7 A;  2YRV A;  3PE0 A;  2GFU A;  1VQN T;  3PFS A;  3NGP A;  2E4H A;  4E7S A;  2KAF A;  5D7U A;  1C0M A;  3CC2 A;  1WJQ A;  2NUP B;  5KYN A;  1BI1 A;  2YXY A;  1SHG A;  2QK0 A;  3A8M B;  2H3J A;  3KBG A;  3I9Q A;  3TEE A;  3UDC A;  3OYC A;  4A4F A;  4F7U A;  4LDY A;  1YIT A;  2OAU A;  1VQ5 Q;  3KUF A;  5GAM j;  4XAX B;  1B34 A;  2DF6 A;  3FDR A;  4KH0 B;  2Y90 A;  3OSV A;  3G4S A;  1VIF A;  4JPB W;  1YN8 A;  1IXD A;  2BTT A;  1VQO Q;  1W2B A;  1RI0 A;  1OZ2 A;  1K73 U;  2GFA A;  3CME T;  4JJD A;  3M0T A;  1VQO T;  3JCM f;  4ESR A;  1QKX A;  3CCL A;  2K6D A;  2KR3 A;  3ME9 A;  4HXJ A;  1Y7X A;  5CKD A;  3EG1 A;  2EYZ A;  2XID A;  5GAM e;  5KYW A;  5FRM A;  5GAM d;  3S3M A;  3CC2 Q;  4CC4 B;  3CCM T;  2AZS A;  3NHN A;  4LDX A;  1X27 A;  4DQ2 A;  1AWJ A;  1UE9 A;  5I11 A;  3DB4 A;  1OYX A;  4C5E A;  2EFI A;  3QZ5 B;  1UUE A;  4OGE A;  2JTE A;  4LXC A;  4Y28 E;  1KQS P;  5FW9 A;  3H8Z A;  1WA7 A;  4F7U E;  2BE9 B;  2FG0 A;  4XK8 E;  1YJN A;  1YNZ A;  4FSS A;  2EYW A;  1HK9 A;  1M9S A;  2K4Y A;  3LYI A;  4JZ3 A;  3GP8 A;  5GMK i;  2JW4 A;  1VQ4 Q;  2ZPE B;  5ECA A;  4JJC A;  2K57 A;  1XTD A;  2VB6 A;  3FLG A;  2L5Q A;  3VS3 A;  4OB3 B;  1M4Z A;  1MGQ A;  1G8X A;  1N27 A;  1D1A A;  2KNB B;  4JRI A;  3EH2 A;  1MND A;  4QQ6 A;  2XG8 D;  2HAX A;  2K3B A;  4PFP A;  2DXB A;  1YWP A;  5GAN d;  3PVL A;  4HVV A;  3EFO A;  1CSK A;  2JVV A;  3S3N A;  5I2M A;  2P0P A;  3M0Q A;  3MP8 A;  3CCJ T;  8AT1 B;  1M1F A;  2HSP A;  2D9T A;  1GBR A;  4MMK A;  3JCM P;  4HVU A;  1M5Q 1;  3CQT A;  1ZQ1 A;  2LX9 A;  4BY6 C;  4XTV A;  1UJY A;  4PJO E;  1IGU A;  1UB4 A;  1N6A A;  3CEY A;  4FT4 A;  4J9I A;  2X4J A;  2LTO A;  3CC4 T;  3M4G A;  4PJL A;  1G2B A;  1NEG A;  4LDU A;  1QMC A;  4A53 A;  1H92 A;  2LNH B;  4II1 A;  2E64 A;  3RUX A;  4A54 A;  2KRM A;  4AFU C;  3OYD A;  3CME Q;  2VUB A;  1IZ6 A;  4IUP A;  3VRZ A;  3VS4 A;  3MEU A;  1MV3 A;  2KBT A;  1VYT A;  4FW1 A;  1FWZ A;  2LJ3 A;  5FU7 C;  2RJE A;  1YBY A;  3CD6 T;  3R6O A;  4PJO F;  2C0T A;  4JRQ A;  3OB9 A;  2XDB A;  4KGV B;  4ZTJ A;  4B6M A;  2MK5 A;  3G1J A;  1K9M U;  4X34 A;  5FRN A;  4OP0 A;  3CCQ Q;  2X4X A;  4DEY A;  1GCQ C;  4M7D B;  1VQ6 A;  4FW2 A;  2R5A A;  1MMG A;  3CCU T;  3M0U A;  3CCS T;  2ROT A;  1YJN T;  1NJI U;  3QYH B;  3U23 A;  5FWC A;  2K9G A;  4Y92 A;  5CQX A;  2RB6 A;  5GAM h;  4JS4 A;  1XNI A;  2V1Q A;  4E7L A;  2K5F A;  2DFU A;  1SSF A;  3RBB B;  1UHF A;  3M57 A;  5LJ5 d;  4N4I A;  2A36 A;  5GAO m;  2QDL A;  3VYH B;  4C5I A;  4F7U F;  4M7D F;  1YIT T;  2EAY A;  3LGF A;  2M1H A;  3VUZ A;  1K9A A;  2EGC A;  3OYG A;  1KQ1 A;  2RHX A;  1QVG S;  2DD4 A;  4OVA A;  1PM3 A;  5GAN 8;  3JCM b;  4HCB A;  2COZ A;  2CP2 A;  2KY9 A;  2QDY B;  3QPH A;  4HA8 A;  1WQ7 A;  4LE9 A;  4Z02 A;  3C94 A;  1M27 C;  1Y07 A;  3D7S B;  4OMO A;  5GAN g;  2E5K A;  2DER A;  4ZN1 A;  4M75 B;  4J9F A;  3TSW A;  4IIO A;  4RCC A;  5KE3 A;  1WXU A;  2M9U A;  4BB7 A;  3CCE A;  2EQI A;  3FJP A;  2X3W D;  5D6X A;  2MWO A;  3FJ5 A;  1YJW Q;  3CCL Q;  2SRC A;  1RAG B;  3QII A;  4MDW A;  2IIM A;  1T0J A;  2CS7 A;  3BFM A;  4PJO C;  4BE1 A;  2W10 A;  5CKH A;  3L2U A;  2DD5 A;  1K8A U;  3BDU A;  2DK3 A;  2D8H A;  1R0C B;  2EYX A;  1E6H A;  2QAZ A;  3P8D A;  3CC2 T;  2LCC A;  3I5S A;  1ZX6 A;  1UJ0 A;  1K73 C;  1I07 A;  2W0Z A;  4M75 A;  4F7U G;  4BI3 A;  2ZAE A;  1AOJ A;  1V29 B;  1Z9Z A;  2J06 A;  3SWN C;  1G5V A;  3I56 Q;  1UGP B;  2QQR A;  3KFV A;  1OUL A;  3M4Y A;  4JJB A;  1KHI A;  2DZC A;  2F5T X;  1Q82 U;  2YLC A;  1Y96 A;  1IRE B;  2O31 A;  4LUD A;  2QEX T;  2DVE A;  2QYZ A;  3OSS C;  2O88 A;  2FEI A;  2FZK B;  3MKD A;  2HD0 A;  1ZUU A;  2NUP A;  4JUV A;  5D6Y A;  2X3X D;  2FVU A;  4M78 F;  4KGX B;  2RQT A;  1BKB A;  1KSW A;  4ZTF A;  5J39 A;  1K9M C;  1X6G A;  2V8J A;  2LZ6 B;  4F14 A;  1DJ7 B;  3CCV A;  4C8Q B;  4ZGD B;  2FPF A;  1YHQ A;  4PJO G;  1PC0 A;  2KXC A;  4CRI A;  2ECZ A;  3PTA A;  1D0X A;  2EW3 A;  3RNJ A;  4E7H A;  1VQP A;  1QLY A;  4XU3 A;  5A2Q E;  2DZ9 A;  4KUD K;  4OMN A;  5IHK A;  2WSF E;  3JCM X;  2COW A;  1M3C A;  3H9N A;  4XU1 A;  2DXT A;  2EGE A;  2H3E B;  2KMT A; 
#chains in the Genus database with same CATH homology
 1PWT A;  1GFC A;  2GTJ A;  2DMO A;  1Y0M A;  2AZV A;  1VYU A;  2DJQ A;  1X69 A;  1K0S A;  1X43 A;  2RF0 A;  1YCS B;  2J05 A;  1Y57 A;  4Z89 A;  3EHQ A;  1XOV A;  1OPL A;  2YDL A;  3UA6 A;  1I1J A;  2D8J A;  2DVJ A;  2K79 A;  1GCP A;  4D8D A;  1HSQ A;  4Z8A A;  1MV0 B;  2GQI A;  4RTZ A;  2J6K A;  1WXT A;  2LCS A;  2DBM A;  1W6X A;  3VS5 A;  4J9G A;  1UG1 A;  1WX6 A;  1ZUY A;  1M8M A;  1BBZ A;  2JMA A;  2OAW A;  1LCK A;  2CH4 W;  1OEB A;  2F2V A;  2J6O A;  3JV3 A;  4ZNX A;  1KIK A;  1VYV A;  5EC7 A;  1KJW A;  2DL4 A;  4RUG A;  2YUO A;  3PE0 A;  1K1Z A;  2JXB A;  3NGP A;  2JMC A;  2KRS A;  2EYY A;  1SHG A;  1YWO A;  1G83 A;  3I9Q A;  2I0N A;  2GTO A;  1NYG A;  3ZL7 C;  2MOX A;  1J3T A;  2JM8 A;  1UHC A;  4AG2 C;  2DF6 A;  1BU1 A;  2F2W A;  4X1V A;  1AZG B;  2DNU A;  4JPB W;  1M3B A;  1YN8 A;  3TVT A;  2BTT A;  1ZSG A;  2RQW A;  1PKT A;  2DRM A;  1FYN A;  3H41 A;  2H8H A;  1MUZ A;  2FPE A;  1AEY A;  1QWF A;  1U3O A;  4GBQ A;  2M0Y A;  1NG2 A;  1JO8 A;  2D0N A;  3TSZ A;  4JJD A;  2DM1 A;  2HBW A;  3M0T A;  2HCK A;  4ESR A;  2AK5 A;  1QKX A;  1ARK A;  1IO6 A;  2K6D A;  4F16 A;  2KR3 A;  4CC3 A;  2GGR A;  1GL5 A;  3ULR B;  4HXJ A;  2L3S A;  3EG1 A;  2D1X A;  2B86 A;  2L3Q A;  2EYZ A;  4AG1 C;  2ENM A;  1WLP B;  1WXB A;  1NLP C;  2KT1 A;  4CC4 B;  2AZS A;  3NHN A;  2K2M A;  2SEM A;  1X27 A;  4RTW A;  1AWJ A;  1PRL C;  1UE9 A;  4OML A;  2KYM A;  3H0I A;  5I11 A;  2JS2 A;  2AKL A;  2PNI A;  2PZ1 A;  1X2K A;  2YSQ A;  1UUE A;  2JTE A;  2AKK A;  2CH4 A;  5FW9 A;  2GNC A;  1WA7 A;  4HCK A;  2FG0 A;  3VRY A;  1YNZ A;  3VS7 A;  4FSS A;  2C0I A;  4AFQ C;  2EYW A;  3NMZ C;  4JZ3 A;  2ROL A;  2OJ2 A;  4J9E A;  1AWX A;  1W1F A;  2JW4 A;  2KXD A;  4GLM A;  2CRE A;  4JJC A;  5ECA A;  2DE0 X;  4J9H A;  1NEB A;  4RTX A;  1PNJ A;  3VS3 A;  1I0C A;  1S1N A;  2CT4 A;  1SRL A;  2P4R A;  2KNB B;  3M0S A;  2FRW A;  3REA B;  2DIL A;  4M4Z A;  1UFF A;  2XMF A;  1WDX A;  1SHF A;  3VS0 A;  5FWB A;  2L3P A;  1RI9 A;  2DLP A;  2K3B A;  4AFS C;  1SEM A;  1YWP A;  3PVL A;  2LX7 A;  4HVV A;  4ORZ A;  3EGU A;  1CSK A;  2ABL A;  3M0Q A;  1JXM A;  2HSP A;  1AWO A;  1UTI A;  5IHI A;  1GBR A;  3UAT A;  4HVU A;  2LQN A;  3CQT A;  1TG0 A;  3NPF A;  1WIE A;  4OMM A;  1UJY A;  1QWE A;  1WI7 A;  4AFZ C;  4EIK A;  3UA7 A;  4J9I A;  1GRI A;  3R6N A;  3A98 A;  2V1R A;  1G2B A;  1NEG A;  2CDT A;  1YP5 A;  2GBQ A;  1H8K A;  4OMQ A;  3H0F A;  2DBK A;  2FPD A;  3VS2 A;  1UGV A;  2JS0 A;  1H92 A;  2LNH B;  4RTU A;  1AZE A;  2EKH A;  4RTY A;  3PVQ A;  2KRM A;  4AFU C;  2RNA A;  1WFW A;  1HJD A;  2ED1 A;  1M30 A;  1HD3 A;  1PRM C;  3EG0 A;  2VKN A;  2KRO A;  4J9B A;  3VRZ A;  2JT4 A;  4Z88 A;  3VS4 A;  1X2Q A;  2KRN A;  1MV3 A;  1N5Z A;  2KBT A;  1VYT A;  1ZBJ A;  5IXF A;  2LJ3 A;  1B07 A;  1VA7 A;  4D8K A;  5GJV B;  1JQQ A;  2MCN A;  3I35 A;  2C0T A;  2VVK A;  1SPK A;  1CKA A;  1W70 A;  1CKB A;  2L0A A;  3UF4 A;  5IXB A;  2LJ0 A;  2O2O A;  3SEM A;  1E6G A;  2A08 A;  1K76 A;  2F2X A;  4A63 B;  4LN2 A;  1WYX A;  2M51 A;  4DEY A;  4LNP A;  1FMK A;  2LP5 A;  1GCQ C;  2DL7 A;  4LUE A;  3THK A;  2BZY A;  1GCQ A;  1JU5 C;  3M0U A;  2ROT A;  2FRY A;  1E7O A;  3LH5 A;  3U23 A;  5FWC A;  4E6R A;  2K9G A;  1U06 A;  4Y92 A;  2YUP A;  3M0R A;  2KE9 A;  5GJW B;  1BK2 A;  5HCK A;  3QWX X;  4RTV A;  2V1Q A;  2OI3 A;  4KRT A;  3IQL A;  2J7I A;  3RBB B;  1UHF A;  1TUC A;  1U5S A;  1OV3 A;  5I22 A;  2VWF A;  2C0O A;  2RQR A;  2A36 A;  2QDL A;  2EGA A;  1KFZ A;  1Z9Q A;  1K4U S;  2ESW A;  1SSH A;  1X6B A;  1K9A A;  1OPK A;  1AVZ C;  1JEG A;  4DEX A;  2EGC A;  2YUN A;  4J9C A;  3EG3 A;  1ABQ A;  1GBQ A;  1QCF A;  1AWW A;  1NM7 A;  4LE9 A;  1T0H A;  3I5R A;  3EHR A;  1M27 C;  2A28 A;  4OMO A;  2LJ1 A;  2EPD A;  2KEA A;  1EFN A;  2E5K A;  4J9F A;  1PHT A;  2RN8 A;  4WCI A;  3TSW A;  4IIO A;  1A0N B;  1WXU A;  1M3A A;  4IIM A;  2DL5 A;  2EQI A;  4JZ4 A;  2X3W D;  3FJ5 A;  2JM9 A;  1SRM A;  2SRC A;  1RLQ C;  2IIM A;  1T0J A;  2KT8 A;  2ED0 A;  5L23 A;  2W10 A;  2O9V A;  2CSQ A;  1T3L A;  3H0H A;  2A37 A;  5IHN A;  4RTT A;  2D8H A;  2CSI A;  4F17 A;  3EG2 A;  2EYX A;  1E6H A;  3VS1 A;  2HEQ A;  1AD5 A;  3I5S A;  1QKW A;  3M0P A;  3O5Z A;  4QT7 A;  1ZX6 A;  1UJ0 A;  2LMJ A;  2J6F A;  2EBP A;  4K11 A;  1H3H A;  1I07 A;  2W0Z A;  2KGT A;  2DA9 A;  2NUZ A;  1AOJ A;  1Z9Z A;  2RPN A;  1GFD A;  2G6F X;  2J06 A;  1NYF A;  2CT3 A;  1RUW A;  1UEC A;  4HVW A;  3KFV A;  2KYB A;  2RQU A;  4J9D A;  4JJB A;  3REB B;  2DYB A;  2O9S A;  3QWY A;  2DRK A;  2O31 A;  4LUD A;  2K7A A;  1RLP C;  2CUD A;  2NWM A;  4CC2 A;  5IH2 A;  2O88 A;  2FEI A;  1BB9 A;  1B3Q A;  4R0K A;  2HDA A;  3GBQ A;  1ZUU A;  1V1C A;  2LQW A;  2PTK A;  4OMP A;  2EVR A;  2X3X D;  1OOT A;  2FO0 A;  2RQT A;  4CC7 A;  1KSW A;  2L2P A;  1X6G A;  2DL3 A;  2LZ6 B;  1TUD A;  4F14 A;  2MIO A;  2RQV A;  2YUQ A;  2FPF A;  3SHW A;  1NLO C;  2KXC A;  2ECZ A;  2DL8 A;  1ZLM A;  2EW3 A;  3RNJ A;  2DX1 A;  1ZUK A;  1QLY A;  1UDL A;  2RMO A;  3VS6 A;  3C0C A;  1ABO A;  2YT6 A;  1T3S A;  1PKS A;  2BZ8 A;  4OMN A;  5IHK A;  2CUB A;  1JXO A;  1M3C A;  2BZX A;  1K0X A;  2EGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...