2CREA

Solution structure of rsgi ruh-036, an sh3 domain from human cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGLLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGLAPANRLQILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEF-like protein
publication title Solution structure of RSGI RUH-036, an SH3 domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2creA00
3ZL7C 1WFWA 2A36A 4JJCA 1WXBA 1MUZA 2C0OA 3U23A 2D8HA 1M3AA 2EGAA 2RMOA 2EPDA 1B07A 4GLMA 2YUQA 1X6BA 1RLQC 1ABOA 1UHFA 1QKWA 2RQTA 5ECAA 1TUCA 2DL3A 3EG3A 1UTIA 2J7IA 2EYWA 1WI7A 1MV0B 2HEQA 1AWXA 1ABQA 1PKSA 5IH2A 1I1JA 1BB9A 3NPFA 2RQRA 2EYXA 2K6DA 1QCFA 4OMQA 1UECA 1M3BA 2FPEA 2B86A 1U06A 1YWOA 1KFZA 1NM7A 4D8KA 1YCSB 1JQQA 1MV3A 1FYNA 4HCKA 3SHWA 2DL7A 2KXDA 2PTKA 2XMFA 1YN8A 2L3PA 3EGUA 2K79A 3CQTA 3H41A 3UF4A 1AWWA 3M0TA 1M30A 2KYBA 3I5RA 5FWBA 4WCIA 4FSSA 1VYTA 1T3LA 4RTYA 3VS0A 1A0NB 3VS4A 4RTVA 4ESRA 1PRLC 2ED0A 4CC2A 1U5SA 4X1VA 5IHKA 2J6FA 1NEBA 1WA7A 1QWEA 3VS1A 2GTJA 2W10A 1H8KA 4J9FA 2M51A 4D8DA 1SHFA 1YWPA 2KBTA 3QWXX 3PVLA 1T0HA 2MOXA 3VRZA 4OMOA 4HVVA 2PZ1A 2ED1A 3REBB 2EYZA 2NWMA 2RN8A 4F17A 3RNJA 1NLPC 1ARKA 2RQVA 2SEMA 4J9GA 2EVRA 1VA7A 2MIOA 3TSZA 4QT7A 4F14A 1AZGB 4J9DA 1PRMC 1UJ0A 3THKA 2JS2A 4JJDA 3I5SA 2L2PA 2YUOA 1Y57A 3C0CA 1JEGA 1HD3A 2JMAA 1BU1A 2M0YA 2DRKA 3M0PA 1NYFA 2ROLA 2L3QA 2JW4A 1RUWA 2BTTA 1AWOA 2LJ0A 1VYUA 2EW3A 5EC7A 3TSWA 4ZNXA 1B3QA 1NG2A 3EG2A 1ZSGA 2FRWA 1TG0A 1G83A 1WXUA 2LQNA 3VS5A 2KR3A 2JMCA 2AZVA 3LH5A 1ZBJA 3I9QA 2RF0A 1UE9A 4Z88A 1ZX6A 2J6KA 1XOVA 3EG0A 3M0SA 2J6OA 2BZXA 4J9EA 2AKLA 2ECZA 2L3SA 1WX6A 2P4RA 1Y0MA 1Z9QA 2A28A 5HCKA 1PWTA 1X69A 4RTXA 2F2VA 4AG1C 3SEMA 2DYBA 2HSPA 3VS6A 4J9IA 2YDLA 2ENMA 4IIOA 2D8JA 4GBQA 1K76A 1UGVA 2CDTA 3EG1A 1GFCA 1BBZA 4AFSC 5IXBA 1K0XA 2HDAA 2LP5A 3NMZC 1WDXA 2W0ZA 1OPKA 2EGEA 4OMPA 2CUDA 2CT3A 3QWYA 2X3XD 2DVJA 2CUBA 3M0UA 2LZ6B 1E6HA 1QWFA 4JZ4A 2G6FX 1H92A 1G2BA 2DNUA 2EKHA 1VYVA 1U3OA 4JPBW 3REAB 1H3HA 1JU5C 1PKTA 1WYXA 2ABLA 4Y92A 4DEYA 1UJYA 5GJWB 1HSQA 4K11A 2HBWA 4RTZA 1NYGA 2VKNA 2O2OA 1YNZA 1KIKA 2JS0A 4E6RA 4AFZC 3H0HA 2FO0A 2DL4A 4AFUC 1QKXA 1J3TA 1LCKA 1PHTA 1GL5A 4CC4B 2CSIA 2KYMA 1WXTA 2LJ1A 5GJVB 2CT4A 3VS2A 1ZUKA 2C0IA 3UA6A 4J9HA 2DBKA 3PE0A 1RI9A 5IHNA 2K9GA 5IHIA 2JM8A 3I35A 5I11A 2O9SA 4LUEA 1GBRA 1QLYA 2H8HA 1GFDA 2KEAA 1W1FA 3A98A 2NUZA 2EBPA 4LE9A 2KT8A 1S1NA 4F16A 2I0NA 2EQIA 3JV3A 4Z89A 2DL8A 4OMMA 4CC3A 4Z8AA 5IXFA 2K2MA 2DA9A 1UUEA 1V1CA 1GCPA 2IIMA 1K0SA 1SHGA 4IIMA 1N5ZA 1X2KA 1JXMA 1FMKA 2L0AA 1M27C 2CSQA 1X2QA 2GTOA 1RLPC 1OOTA 2EGCA 4RTUA 3TVTA 2PNIA 2LMJA 1AWJA 4M4ZA 1AZEA 1K9AA 2KNBB 2BZYA 4RTWA 2YUNA 1YP5A 1AD5A 1WLPB 2GGRA 4LNPA 1HJDA 1GCQA 3NGPA 1JO8A 1NLOC 3H0IA 1SRLA 4AG2C 3VS7A 2ROTA 3H0FA 4A63B 2EYYA 2FRYA 2DLPA 1CSKA 2CH4A 2J06A 1ZLMA 2KRNA 2LJ3A 4J9CA 3RBBB 1GRIA 1OV3A 2RQUA 2KROA 1IO6A 2K7AA 4R0KA 4CC7A 2DRMA 1UFFA 1Z9ZA 2C0TA 1GBQA 3M0RA 2DJQA 1OEBA 2SRCA 1E7OA 1SEMA 2OAWA 2O88A 2DL5A 1KSWA 3EHQA 1SPKA 5L23A 2CH4W 4JZ3A 2GNCA 2YUPA 1EFNA 1UG1A 2OI3A 2RQWA 2A08A 2JXBA 1SRMA 2RPNA 5FWCA 1WIEA 2O31A 5FW9A 1X43A 1BK2A 3VS3A 4HVUA 2KRMA 2E5KA 2JT4A 2KT1A 2YT6A 3GBQA 3FJ5A 2D0NA 1AOJA 4OMNA 2V1QA 2BZ8A 2KRSA 3R6NA 3M0QA 1AVZC 2DMOA 3EHRA 2KGTA 2LCSA 3UA7A 1ZUYA 2OJ2A 2DILA 1PNJA 2VVKA 1UHCA 1CKBA 1OPLA 3IQLA 3VRYA 1X27A 2CREA 2FPDA 4ORZA 1ZUUA 2DE0X 2A37A 4OMLA 1W6XA 2YSQA 4AFQC 2GQIA 2FG0A 2GBQA 2JTEA 3PVQA 4EIKA 1AEYA 4HXJA 4LUDA 1TUDA 3UATA 1K4US 1E6GA 1K1ZA 4HVWA 3ULRB 1CKAA 1JXOA 1W70A 2DM1A 4KRTA 2VWFA 2QDLA 3KFVA 1NEGA 4LN2A 2K3BA 2HCKA 1UDLA 4JJBA 2MCNA 2DX1A 2DF6A 4RUGA 1T3SA 2J05A 2D1XA 2RNAA 1M3CA 4RTTA 2KE9A 2F2WA 1M8MA 2ESWA 1I0CA 2AKKA 1SSHA 4J9BA 3O5ZA 2LX7A 2O9VA 2LNHB 1I07A 1KJWA 1GCQC 1X6GA 2JM9A 2FPFA 2DBMA 3NHNA 1T0JA 2FEIA 2KXCA 2F2XA 2LQWA 2V1RA 2AZSA 2AK5A 5I22A 2X3WD 4DEXA
chains in the Genus database with same CATH superfamily
1O9SA 1WFWA 1WHKA 2C0OA 1M3AA 3JB9F 4BDZA 1RAEB 1QP3A 1IB8A 1N8RC 1Y96A 3HSBA 1M1FA 2D0QB 4GLMA 1W2BA 1X6BA 2COZA 1JJ2S 5GAN6 3EFSA 1ABOA 1UHFA 1BI1A 2RQTA 1WJRA 4OB1B 3FRNA 5LJ3j 1PKSA 2CP6A 3QYHB 4XU0A 1YFNA 2K6DA 1UECA 1M3BA 1K73C 2C06A 3CCLT 3CBMA 3G4ST 1PCXA 1U06A 4QQDA 5CIUA 3JCMh 1MV3A 1VQ4T 2KXDA 5HK0A 5GAN5 4J5YA 3CQTA 3HP9A 3L1AA 2ZPIB 2EQUA 2DK3A 4LDYA 3KBGA 4IUPA 4WCIA 4FSSA 2JVVA 3L2ZA 4RTYA 3V8KA 3OA6A 1U1TA 1IXDA 4X1VA 4ELZC 1QWEA 5CKEA 3PIOA 2RHXA 4KGXB 2K3XA 1S72T 1C6VX 4ATOA 3JCMb 5D6XA 4D8DA 1SHFA 5GAOn 2VASA 2MOXA 3ER0A 4OMOA 2QEXQ 3DB3A 3REBB 1YJWQ 2EYZA 1FXXA 3CC2Q 1KQ2A 5FU7C 1NLPC 5LJ5g 1ACMB 1N8RU 5FRMA 3TSZA 1M2OA 2RJEA 2RHZA 1AZGB 4B9WA 2KQWA 2VGMA 2E4HA 1PRMC 2JZ2A 5D6YA 3QSUA 2M9UA 3I5SA 2LVMA 2L2PA 2YUOA 3C0CA 3P8BB 5I21A 1KC8C 4XQ3A 2M0YA 3M0PA 3CPWP 2QAZA 4M75F 3CCUQ 1RUWA 3ZEHA 2EWNA 1WGSA 2LC4A 4OB2B 3QIIA 2QTXA 1TG0A 3OYLA 1R77A 1K73U 1G83A 1WXUA 2LQNA 1KD1R 1ZBXA 1NPRA 1Q7YR 3RERA 3I9QA 4L6V5 3EG0A 3MP6A 3TCJA 2BZXA 2GF7A 2A7YA 1WX6A 2EJGA 3M5AA 3TQ7P 1YJWA 3EG9B 3CC2A 1VQNA 1Y0MA 4RCCA 4N4IA 4A4KA 5GMKj 1B7TA 5CKFA 4RTXA 5FU7B 3SEMA 2HSPA 6AT1B 3HRTA 3P8DA 5CK9A 3CCSQ 4IIOA 4E7LA 2CDTA 1GFCA 4II1A 2E70A 1OZ3A 2K4YA 2LP5A 3NMZC 3EFOA 3CD6Q 3CCVQ 3OYBA 4X34A 1K8AR 3R6OA 1VQPQ 3CCUA 4IUTA 3G7ZA 3CCEQ 2EKHA 2XDBA 1U3OA 1JU5C 1D1AA 1PKTA 1WYXA 4MMKA 1WPYA 2WSFE 1HSQA 1VQ9Q 3E9GA 3OMCA 4C0GA 1UEBA 2JN0A 3H0HA 4AFUC 1KC8U 1RL2A 1GL5A 1G3SA 1SF9A 2P4TA 4CC4B 2CSIA 1VUBA 4F7UA 3VS2A 2C0IA 2CZ0B 3CCSA 1D0XA 3OYNA 1OULA 3M54A 3QJ6A 2JM8A 4R56A 1QVFS 2K5LA 2O9SA 3D7SB 3JCMV 3CD6A 1MMDA 4MZMA 1FWZA 5A0GA 4XTZA 1W1FA 3A98A 3M58A 3LH0A 1EZZB 3MEUA 4O5VA 3S3NA 1VQ8T 4FYWB 4OMFB 4Z89A 3CCEA 4PJNA 3CMAA 5LJ3f 2K2MA 5IN1A 4KT0E 2VYTA 1K0SA 1UGPB 1X2KA 1FMKA 4KGVB 5KCOA 1OOTA 2EGCA 2EJFA 3V8JA 2PNIA 4XU3A 2QQBA 3AT1B 4M4ZA 3CCLQ 3OQ5A 3G4SQ 1SSFA 2F1LA 3SWNA 5A0DA 2LQ8A 1VQ4Q 1HJDA 1D3BB 1GCQA 1NZ9A 1VQOT 3M4GA 4QVZA 5HY6A 2OTJT 1NLOC 1TSFA 2ROTA 5KH6A 5GAOm 3H0FA 2O4XA 2EYYA 2MPXC 2DLPA 2FVUA 2AIRB 3QHSA 3EAEA 3L2QA 4J9CA 1OV3A 2RI2A 4CC7A 2DRMA 1IREB 1GBQA 3M0RA 2DJQA 1OEBA 3CXCP 2NUTB 2DEQA 4BUGA 1FX7A 2A3LA 4ZTFA 2O88A 2DD5A 2DL5A 2DXUA 5FROA 2XU8A 4LDUA 2ZAEA 2CH4W 2DPPB 2E10A 2QQRA 1VQLQ 2DERA 2YUPA 1EFNA 2OI3A 2RQWA 4ZTJA 3CCLA 3G4SA 2QGFB 2QI2A 5GMKm 2O31A 1X43A 3VS3A 4HVUA 1VQ4A 3RMSA 1BCMA 2JT4A 3GNFB 1G8XA 2MMPA 2ZPEB 1QMCA 4QQ6A 2M16A 2V1QA 3EGDA 1D1CA 1AVZC 3DLMA 4C5HA 2V8JA 2M0OA 3UA7A 1ZUYA 2OJ2A 4M78A 2DILA 2VVKA 3VRYA 2LCLA 1QVGP 1SKUB 2EYQA 1OU8A 2FPDA 4ORZA 2E12A 2DE0X 3EGXB 4CI0C 4C8QG 1G3TA 4EIKA 1AEYA 2IVWA 1S72A 4HXJA 1KD1C 3UATA 5KYUA 2MYSA 1K1ZA 4HVWA 1Q7YC 1RABB 1MHNA 1LPLA 1R0CB 2HL3A 2VWFA 3VUBA 2QDLA 2IPOB 2HKNA 2ZPGB 2K3BA 1UDLA 4JJBA 2X4WA 3EH1A 4FYXB 2EQJA 2DX1A 2DF6A 3JAME 2VGNA 1T3SA 2XHCA 1BIAA 2RNAA 3UT1A 3UPUA 2DD4A 2ESWA 4DA4A 2COYA 3QBYA 4EMKA 3OYAA 2NUPA 1KJWA 1X6GA 3V7SA 2DBMA 2KAFA 1K8AC 2KXCA 4O6JA 3PMTA 2XK0A 2AZSA 2AK5A 2QQAA 5I22A 3CEYA 2QEXT 4MZTA 5LJ3h 3C95A 5IAYA 3MJXA 2QG9B 4JJCA 1IHVA 4RMOA 5GAMh 3JCMf 1N27A 1AT1B 2R5MA 2QDYB 5CAIA 1PSEA 1RAFB 3JCMP 3HFOA 2MAMA 1PD1A 3URGA 4M7AA 4MZPA 4ME7A 1TUGB 4GY5A 1QKWA 3VJPA 2PUKB 1WI7A 2K3YA 1MV0B 3GOXA 2HEQA 2K2VA 2L89A 3MO8A 5IH2A 2HL5C 1KD1U 4OMQA 1Q7YU 2E41A 2CGHA 1U1SA 2RA2A 2FPEA 2B86A 1KFZA 2P0KA 1VQ8Q 1BKBA 4HCKA 2DL7A 3FB9A 3E9FA 2WACA 3KXTA 3L2RA 4ANJA 3M0TA 4JS5A 5AT1B 2HQHA 1JJ2P 4KGZB 1LJOA 2RH2A 2QK0A 3OYJA 4N4GA 3MKDA 1T3LA 3G71T 1Y96B 1VQ7Q 4RKUE 3H6ZA 3VV0A 5GAN2 2F5KA 3BDLA 2JTMA 1V29B 2ED0A 3CBOA 1U5SA 3M53A 5IHKA 2J6FA 4FL6A 2DETA 5GANg 3RUXA 2KVQG 2LTOA 1VQ6T 1K8AU 4PJOG 3JCMX 3CCVT 1VQOQ 1KQSA 1YWPA 2OTJQ 1BI2A 3QWXX 4PJJA 1VQPT 4FSXA 3VRZA 1QCOA 4HVVA 4QQGA 4BI8B 3S3MA 4P5NA 2NWMA 2RN8A 1VQMT 2VUBA 3HL8A 2HQXA 4RG2A 2DJZA 5GANd 4XTUA 4M75A 4BE1A 3AHUA 1VQ8A 3X25B 4F14A 1UGRB 4J9DA 1VQ9T 4KH0B 1UJ0A 2X4XA 3THKA 3SDZA 4C0DC 2JS2A 4JJDA 4PJMA 4JJNK 4OGEA 4C5EA 1YBYA 1JRIA 5CKHA 1HD3A 5KYWB 2L3QA 3OS1A 5J39A 3J81E 1AWOA 1WJQA 3RR6A 5M9OA 4J83A 4ZNXA 3EG2A 1NG2A 1ZSGA 3DLLA 2FRWA 5A0LA 4NOYA 2KR3A 2JMCA 5DY9A 2LDMA 2OTLT 3JSCA 1VQOA 4C92G 3M0SA 2AKLA 3GP8A 2P4RA 1Z9QA 1N9RA 2A28A 3C4SA 1PWTA 1TWBA 2F2VA 4AG1C 4OB0B 1VIEA 4J9IA 2YDLA 2ENMA 2DEUA 1SG5A 4C8QD 2D8JA 1QQJA 2RK2A 1RI0A 2Y4YA 1QP2A 4EDUA 4AFSC 2BKDN 5IXBA 2HQEA 5GAMj 4PFOA 3SD4A 4C0DB 1VQKT 1YHQT 2CUDA 3WVDB 1KQSS 3BW1A 2CUBA 2LZ6B 3UDCA 4C92C 2OAUA 4IUQA 4PJOB 1E6HA 3INZA 2MF2A 1H92A 1IGQA 1YJNQ 1VYVA 3X26B 3REAB 4J6XA 1H3HA 2EFIA 3S6WA 2ABLA 4DEYA 5HK3A 3QDRB 1VOMA 5GJWB 3ZFJA 2O2OA 3CPFA 1M1KR 4J6YA 1KIKA 2JS0A 2FO0A 1QKXA 3CMEQ 3CCRT 5L8RE 3N5BB 1PHTA 1I4K1 1WXTA 5GJVB 3UA6A 4J9HA 2DBKA 1OU9A 1IHWA 4V2SA 3FJPA 2K9GA 1Q95G 3H8ZA 2D9TA 1VQLT 4JRIA 5I11A 5KYYA 1I8FA 2PUOB 4M77G 4XTVA 3Q1JA 1W2BS 4BI4A 2EBPA 3MPUB 2KT8A 2I0NA 2EQKA 2EQIA 2I2LA 4OF1A 1BYMA 4C92B 2RHYA 2DL8A 1XQHA 4BD3A 4CC3A 2E6ZA 3V8LA 3C94A 5IXFA 4J6WA 2DA9A 5LJ5d 1V1CA 2X4YA 3VYGA 5GMKi 4RTUA 1AZEA 4BB7A 1KG1A 2KNBB 1X75C 4M77C 1AD5A 1WLPB 4QVDA 2GGRA 4LNPA 1WHJA 1QVFP 3BDUA 1RADB 3MEWA 3NGPA 1JO8A 3LX7A 3A8GB 2QEXA 1SRLA 3X20B 2HBPA 2ZPFB 5GAN4 4PJLA 4XU2A 8ATCB 3PGGA 3G71Q 4C8QF 2CH4A 2MI6A 2J06A 1ZLMA 2KRNA 3DB4A 4PLLA 4C92E 4A53A 2BIVA 4PJOD 1M9SA 1UFFA 5GANj 4M78G 1VQ6Q 3RIRA 1RAAB 1N6AA 2JTFA 2V8KA 2CKKA 9ATCB 1E7OA 3FDRA 2OAWA 5J3BA 1LVKA 1KSWA 3EHQA 3OYYA 2MWPA 1ZSZC 1VQMQ 4JZ3A 4OVAA 3TREA 3SFMA 2HD0A 2P84A 2Z0WA 3M59A 4BE0A 2RHIA 2A08A 2JXBA 4A54A 2RJFA 2FZGB 1Q86R 4M77B 1G3YA 3OBWA 2YT6A 3HPWA 5KCHA 3CCMT 2D0NA 1AOJA 2KRSA 3R6NA 2O4XB 3EHRA 2KGTA 2LCSA 1KHCA 3G71A 5J26A 1PNJA 5LJ3e 1PG5B 1CKBA 3LGFA 2E64A 3IQLA 5KYXB 3VUZA 4A4EA 2CREA 1ZHIA 4J8OA 1MNEA 2A37A 1W6XA 2GQIA 4J7FA 4FIBA 3MP8A 5CVIA 1VIFA 4BDYA 4C92D 1VQ6A 2DTOA 1TUDA 2OTLQ 4FT2A 3CCVA 1E6GA 2YHTA 1AHJB 1VQPA 5D7UA 4XK8E 4KRTA 3VYHB 4NS5A 4OP0A 1VQMA 4M7DG 2HCKA 1JB0E 1ZSZB 3EG9A 4A4HA 1M2VB 2QXFA 5C6SA 1WQWA 4M77E 5GAMf 3T9NA 3PNWC 2J05A 1VQ9A 3L2UA 1VQ7T 1M3CA 4RTTA 2F2WA 4PFPA 3MEAA 4LDVA 5CO7A 4M7AG 1VQKQ 3G1JA 3A5ZB 1SSHA 3HRSA 2CZ1B 4E7KA 1YHQQ 8AT1B 2FPFA 1LNXA 1VQ5T 2F2XA 1PD0A 4M7DC 2RB6A 2CZ6B 4DEXA 2X9HA 2A36A 1MUZA 2RHUA 2D8HA 2HMAA 1B34B 4IUVA 2OTLA 3CBPA 4A4GA 1Y07A 2LNVA 2EPDA 1QVPA 4IUUA 1M1KC 1H3ZA 4PJOF 5FU6C 1B07A 3LWIA 3CCRQ 3H9NA 1EX4A 3CCQQ 4PNOA 4LXCA 1TUCA 1ZA1B 2DL3A 1UTIA 2J7IA 4ZN3A 4LDXA 3QUIA 4M77D 5LJ5j 1I1JA 1VQKA 1BB9A 1YHQA 2EYXA 5DLOA 4N0AC 3CXCA 1WZOA 1QCFA 4XTWA 2LX9A 1XJWB 1P92A 1YWOA 1JBMA 4ZGDB 3J7AF 1ZA2B 2PTKA 2XMFA 1YN8A 2CP3A 2VV5A 2L3PA 3EGUA 2K79A 5GMKe 4CRIA 5KE3A 3H41A 3UF4A 3JCMJ 4M7DB 1D0YA 1M30A 1YITQ 5FWBA 3VS0A 2GFUA 4IURA 5LL6S 1A0NB 3RKXA 3EFRA 3WXMB 4E7JA 3OB9A 1XTDA 2EQMA 1PRLC 2DTIA 4C92F 3CCRA 5FU6B 3OW2P 1NEBA 1WA7A 4RCBA 3VS1A 2GTJA 1LOJA 2W10A 1Y71A 3A8OB 1H8KA 2M51A 2KBTA 3PVLA 1T0HA 1D3BA 1OQKA 1I5OB 2ED1A 2VXEA 5LJ3g 1YJNT 2LT4A 1VQLA 4RG8A 2ZPHB 2XICA 1K73R 1NBEB 5GAN8 4J9GA 5I2MA 2EVRA 1M1KU 5CKBA 5GANf 2AHJB 1BI0A 3JRZA 3JCMQ 2RD1A 4L59A 3OYCA 4M78D 4C8QC 4XTYA 3JCMe 4M7DE 1YJ9Q 2P0QA 1Y57A 3HRUA 5LJ3d 3CMET 1BU1A 4FYVB 3SB2A 1MMGA 2GCXA 1NYFA 3QZ9B 2E3IA 2NUTA 1XNIA 2JW4A 2XDPA 2YLBA 3QG1A 5AYFA 2LJ0A 1VYUA 5EC7A 3NTHA 3CXCS 3M9QA 2ATCB 4OB3B 3LH5A 4FCYA 4YTLA 2RF0A 1M90R 2VB6A 1UE9A 1Q86C 4Z88A 2J6KA 4HA8A 2HKQB 3CCMQ 4J9EA 1TOVA 2L3SA 1PC0A 2HNIA 5HCKA 1KK7A 2QASA 3BFMA 1HYOA 2LCCA 2DYBA 3VS6A 4M77F 2M1HA 4D6WA 4JDSA 1UGVA 3QO3A 1WQ7A 2OX7A 3EG1A 3C12A 3HHTB 3P8HA 1EIFA 2HDAA 5CQYA 3EGXA 4C8QB 1M1GA 4OMPA 1OPKA 2EGEA 3TEEA 4JLGA 2CT3A 2X3XD 3MCAB 4M7DD 4JZ4A 2DNUA 2VC8A 4JPBW 3QKJA 3V7RA 3OY9A 5EG2A 1UJYA 4K11A 2DIGA 2RK1A 4BE2A 5GAN3 2ZGWA 3CCJT 2HZYA 3OS2A 4E6RA 3CCMA 4KH1B 3BE3A 2DL4A 2E65A 1J3TA 2WSCE 4JRQA 1RAGB 1LCKA 3LLRA 2PU9B 1VQ5Q 3M4YA 2KYMA 5A2QE 2CT4A 3L42A 3OMGA 1KQSP 3A8HB 3LYIA 5IHIA 1Q82R 3I35A 1OYXA 4C8QE 2F69A 3CC7T 2L8DA 4J7IA 1K9MR 2H8HA 1Q86U 4M78F 3I56T 1GFDA 2KEAA 3S3OA 4LE9A 2NUZA 1S1NA 1FMVA 4L5GA 3JV3A 1NPPA 3EH2A 4OMMA 3JCMc 4HT8A 4WTOB 4Z8AA 1Q81R 2CP2A 3I55T 4PJOC 1M5Q1 1UUEA 3QDFA 5LJ5f 4KUIA 1GCPA 2RO0A 1KQ1A 1SHGA 1VQ7A 2L0AA 1M27C 2GTOA 1RLPC 3TVTA 4JS4A 1AWJA 1IRXA 2XKOC 4DQ2A 1K9AA 4E7HA 2YUNA 1VQ5A 3JCMg 3RKYA 2JUFA 4A4FA 5GANh 4PL6A 2DAQA 2OTJA 2JNGA 4C0FA 1W2BP 3A8MB 4BY6C 3VS7A 4A63B 3O8VA 4DOWA 2FRYA 3NTIA 4NL2A 5DLQE 2XIDA 3JCMd 2BE9B 2YXYA 2LJ3A 3RBBB 3FEOA 2DZCA 1GRIA 3RESA 2VXFA 4PLIA 2K7AA 4R0KA 4M7DF 3ME9A 4F7UG 3MP1A 2SRCA 2BE7D 2R5AA 2KDSA 1SEMA 4FW2A 2EJ9A 1GXIE 4BACA 3ZBDA 3PIPA 5CR2A 3OYMA 3JCMW 3E2UA 4M7AF 1UG1A 4OGCA 2RPNA 5FWCA 1WIEA 4F04B 5HKCA 4LD9K 3QXEB 2KRMA 2BUDA 2LQKA 1DJ7B 4XAXB 4C5IA 4PK4A 4OMNA 3A1PA 2BZ8A 2DXCA 2FB7A 3OYFA 1QW1A 4BY6B 3CCQT 2X51A 2XD0A 2H3JA 5KYWA 5CKDA 2RJCA 4NL3A 2GFAA 4ZGEB 4OMLA 2YSQA 3GF5A 4AFQC 2FG0A 2K5IA 5GAOl 2FHDA 1MNDA 1R0BG 2MWOA 3EFOB 3PVQA 4DOVA 3OBYA 4LUDA 3OYKA 4PJOE 1K4US 4JRPA 1H641 1BI3A 4QW2A 1M90C 3ULRB 1ZQ1A 3QPHA 2E5QA 2DM1A 3OYDA 1YJNA 3KFVA 1NEGA 2V8IA 1VQNQ 2GQVA 2MCNA 4X9CA 1BCOA 1YITT 2DXBA 3G6ET 3WVEB 2JOYA 3ASKA 3SWNC 1F1BB 4Y91A 3VU3C 2AKKA 3CMEA 3O5ZA 2LX7A 2O9VA 4IKFA 1I07A 1GCQC 3CPWA 5GMKl 4F7UB 3J80E 4AMCA 2ZPBB 1UB4A 1WNLA 3GLXA 4PJOA 2LQWA 2V1RA 2ZZDA 1D1BA 4KULA 4ZGJB 2QQSA 4FYYB 1V76A 2PQWA 3QZ5B 3ZL7C 4BI3A 1WXBA 3U23A 1QVFA 5LJ5h 2ZCFB 2EGAA 2RMOA 3CCJQ 4DBFA 3CC4T 2YUQA 2EAYA 2A0FB 1Y7XA 1RLQC 1C0MA 1YJ9T 4HCZA 5ECAA 3EG3A 2EYWA 2KK4A 2E6NA 5GAOr 4PKCC 2CP0A 1AWXA 1ABQA 3CC7Q 1Q82C 3OSSC 3X24B 3V7CA 3NPFA 2RJDA 2RQRA 3SWNB 1G5VA 3E19A 3I56Q 4F7UE 4LD6A 1M90U 3PFSA 4MDWA 1YI2T 1K9MC 1NM7A 2PVDB 4D8KA 1YCSB 1JQQA 4LDWA 3FC3A 3SHWA 1FYNA 1TS9A 3OYEA 3CMAQ 5KYNA 4C92A 2QGGA 3I55Q 4M78C 1AWWA 2M02A 2QQ9A 2DXTA 1Q81C 3UWNA 2KYBA 4DBHA 3I5RA 2YLCA 2YRVA 2HAXA 1VYTA 1OZ2A 4EPCA 3CCJA 3VS4A 4RTVA 2CP7A 1X01A 5GAMe 4ESRA 3BY7A 4EMGA 1YIJT 4CC2A 2E3HA 3CPWS 3PT9A 3JB9G 2Y4XA 2XG8D 2DFUA 4XTXA 4J9FA 4Q5WA 1R8OB 1NJIR 3VKIA 2PZ1A 2QA4T 2FYKA 1D09B 4Z02A 3CC7A 2XI9A 4F17A 5FRNA 1UGSB 3RNJA 4GLKA 1ARKA 2RQVA 2SEMA 2DO3A 3I56A 2X4JA 1VA7A 2MIOA 4QT7A 2JJ9A 3FLGA 4EMKC 2Y90A 5DM7R 3EGDB 1MMNA 1C1AA 3I55A 5GAN7 2PVGB 1JEGA 4M78B 2EIFA 2JMAA 2V26A 2DRKA 4C5GA 2R58A 2ROLA 2YRCA 4VUBA 2BTTA 1X6OA 1RACB 1WHGA 2EW3A 3TSWA 3M56A 1Q82U 2CP5A 1B3QA 3VS5A 5KYUB 1K9MU 4X9DA 4HCCA 2AZVA 5GAOq 1ZBJA 1TXQA 1M4ZA 1ZX6A 1XOVA 4R55A 4M77A 4JRKA 2KI7A 3MHXA 4JUVA 4M7AC 2J6OA 2DYIA 2ECZA 2CYZB 1Q81U 4DBQA 1O75A 1W4SA 2RI5A 2PVOB 1X69A 2HSEB 3JB9J 1TTHB 2K57A 4GBQA 1K76A 5KE2A 5KYXA 1BBZA 2DTHA 4QVCA 1K0XA 4EMKB 4M78E 1MGQA 1WDXA 2NUPB 2W0ZA 3HKSA 2FZKB 2LRQA 1S72Q 2E1HA 1PM3A 3QWYA 2WSEE 2DVJA 3M0UA 1BIBA 1QWFA 2G6FX 1G2BA 2RM4A 2G3RA 4Y92A 1FMWA 4DBRA 1ZSZA 2HBWA 5C0MA 1M2VA 4M75G 4RTZA 3M57A 1NYGA 2VKNA 4FU6A 3G6EQ 1N8RR 3OS0A 2DZ9A 4E7IA 1YNZA 2QTVA 1I5LA 4AFZC 4MMLA 5GANe 5CCAA 5GAOp 4E7SA 4M7AB 4ZN1A 1WJSA 1PSFA 3CCQA 3LGLA 4HCBA 2EKOA 2LJ1A 1QVGA 1ZUKA 2KSSA 3L2WA 3JB9H 3PE0A 3OYHA 1RI9A 2R57A 5IHNA 2AT1B 3OW2A 2FZCB 4M75C 5GAMg 4LUEA 1GBRA 1QLYA 3CC4Q 1B34A 2P0PA 4F7UF 4F16A 1QCNA 1MMAA 4FM4B 3OYIA 1D0ZA 1WHHA 2NYSA 3DKMA 1YITA 5GAMd 2IIMA 3RKWA 3G6EA 1TH7A 4IIMA 1N5ZA 1JXMA 1U8RA 2CSQA 4E7ZA 2NLUA 1X2QA 4M7AE 3GPLA 2LMJA 2L5QA 3RDVA 4HT9A 4B6MA 2BZYA 4RTWA 1YP5A 1YI2Q 1IGUA 1IZ6A 2O01E 1M8VA 5FLXE 2L3RA 1HK9A 2FL7A 1OX9A 3H0IA 4AG2C 1TU0B 1YJWT 2DIQA 3CC2T 1VQNT 4M7DA 1OX8A 4M75B 1HXDA 3CC4A 3A8LB 3FIFA 1CSKA 3MEVA 1YIJQ 3JB9D 4FW1A 3QYGB 4EMHA 2RQUA 3M55A 2CS7A 2KROA 3RMQA 1YJ9A 1IO6A 1KHIA 1KC8R 3GIBA 1Z9ZA 2C0TA 1QVGS 2XDDA 5CQXA 2F5TX 4ELYC 2YWWA 2QYZA 1NJIC 1SPKA 2QA4Q 3CCUT 3TU4K 5L23A 3L2VA 3OW2S 4WF2A 2YRDA 2GNCA 1UGQB 5I2SA 3OSVA 4B9XA 3META 4TVRA 1YI2A 1SRMA 2DVEA 3QJYA 4JLIA 5FW9A 4M7AD 1BK2A 4N0AA 4HKEA 2E5KA 3X28B 4MDXA 2D6FA 2KT1A 3HFNA 3NFCA 3GBQA 3FJ5A 1JJ2A 3M0QA 2DMOA 2LT1A 3HTRA 4M75E 1OI1A 1UHCA 5IT9E 3PMIA 4C0ZA 1OPLA 3JB9I 1RAIB 1X27A 5LJ5e 1YIJA 3CCST 1ZUUA 4N4HA 2IG0A 4KUDK 2GBQA 2DKGA 1G3WA 2JTEA 3F70A 3OS5A 3CD6T 7AT1B 2H3EB 1CKAA 1I81A 1JXOA 4XU1A 1W70A 2QA4A 4UC4A 5D6WA 3CCET 2K5FA 4PFZA 4LN2A 3CMAT 3NTKA 3OYGA 2X35A 3PTAA 2KY9A 4RUGA 3GNGA 1YCYA 2MK5A 3LW5E 2D1XA 2COWA 4FT4A 1N9SA 2KE9A 1WHLA 1M8MA 1RAHB 4E47A 1NE8A 1I0CA 2B8AA 4AT1B 4J9BA 3KUFA 4C8QA 2LNHB 2CZ7B 3E1SA 2JM9A 4E2FB 4KBMB 3NHNA 1T0JA 1NJIU 2FEIA 5GMKh 4QKUA 1WHMA 3LWHA 2RI3A 4Y28E 2X3WD 2KMTA 4M75D 5KYYB
chains in the Genus database with same CATH topology
3ZL7C 1WFWA 2A36A 4JJCA 1WXBA 1MUZA 2C0OA 3U23A 2D8HA 1M3AA 2EGAA 2RMOA 2EPDA 1B07A 4GLMA 2YUQA 1X6BA 1RLQC 1ABOA 1UHFA 1QKWA 2RQTA 5ECAA 1TUCA 2DL3A 3EG3A 1UTIA 2J7IA 2EYWA 1WI7A 1MV0B 2HEQA 1AWXA 1ABQA 1PKSA 5IH2A 1I1JA 1BB9A 3NPFA 2RQRA 2EYXA 2K6DA 1QCFA 4OMQA 1UECA 1M3BA 2FPEA 2B86A 1U06A 1YWOA 1KFZA 1NM7A 4D8KA 1YCSB 1JQQA 1MV3A 1FYNA 4HCKA 3SHWA 2DL7A 2KXDA 2PTKA 2XMFA 1YN8A 2L3PA 3EGUA 2K79A 3CQTA 3H41A 3UF4A 1AWWA 3M0TA 1M30A 2KYBA 3I5RA 5FWBA 4WCIA 4FSSA 1VYTA 1T3LA 4RTYA 3VS0A 1A0NB 3VS4A 4RTVA 4ESRA 1PRLC 2ED0A 4CC2A 1U5SA 4X1VA 5IHKA 2J6FA 1NEBA 1WA7A 1QWEA 3VS1A 2GTJA 2W10A 1H8KA 4J9FA 2M51A 4D8DA 1SHFA 1YWPA 2KBTA 3QWXX 3PVLA 1T0HA 2MOXA 3VRZA 4OMOA 4HVVA 2PZ1A 2ED1A 3REBB 2EYZA 2NWMA 2RN8A 4F17A 3RNJA 1NLPC 1ARKA 2RQVA 2SEMA 4J9GA 2EVRA 1VA7A 2MIOA 3TSZA 4QT7A 4F14A 1AZGB 4J9DA 1PRMC 1UJ0A 3THKA 2JS2A 4JJDA 3I5SA 2L2PA 2YUOA 1Y57A 3C0CA 1JEGA 1HD3A 2JMAA 1BU1A 2M0YA 2DRKA 3M0PA 1NYFA 2ROLA 2L3QA 2JW4A 1RUWA 2BTTA 1AWOA 2LJ0A 1VYUA 2EW3A 5EC7A 3TSWA 4ZNXA 1B3QA 1NG2A 3EG2A 1ZSGA 2FRWA 1TG0A 1G83A 1WXUA 2LQNA 3VS5A 2KR3A 2JMCA 2AZVA 3LH5A 1ZBJA 3I9QA 2RF0A 1UE9A 4Z88A 1ZX6A 2J6KA 1XOVA 3EG0A 3M0SA 2J6OA 2BZXA 4J9EA 2AKLA 2ECZA 2L3SA 1WX6A 2P4RA 1Y0MA 1Z9QA 2A28A 5HCKA 1PWTA 1X69A 4RTXA 2F2VA 4AG1C 3SEMA 2DYBA 2HSPA 3VS6A 4J9IA 2YDLA 2ENMA 4IIOA 2D8JA 4GBQA 1K76A 1UGVA 2CDTA 3EG1A 1GFCA 1BBZA 4AFSC 5IXBA 1K0XA 2HDAA 2LP5A 3NMZC 1WDXA 2W0ZA 1OPKA 2EGEA 4OMPA 2CUDA 2CT3A 3QWYA 2X3XD 2DVJA 2CUBA 3M0UA 2LZ6B 1E6HA 1QWFA 4JZ4A 2G6FX 1H92A 1G2BA 2DNUA 2EKHA 1VYVA 1U3OA 4JPBW 3REAB 1H3HA 1JU5C 1PKTA 1WYXA 2ABLA 4Y92A 4DEYA 1UJYA 5GJWB 1HSQA 4K11A 2HBWA 4RTZA 1NYGA 2VKNA 2O2OA 1YNZA 1KIKA 2JS0A 4E6RA 4AFZC 3H0HA 2FO0A 2DL4A 4AFUC 1QKXA 1J3TA 1LCKA 1PHTA 1GL5A 4CC4B 2CSIA 2KYMA 1WXTA 2LJ1A 5GJVB 2CT4A 3VS2A 1ZUKA 2C0IA 3UA6A 4J9HA 2DBKA 3PE0A 1RI9A 5IHNA 2K9GA 5IHIA 2JM8A 3I35A 5I11A 2O9SA 4LUEA 1GBRA 1QLYA 2H8HA 1GFDA 2KEAA 1W1FA 3A98A 2NUZA 2EBPA 4LE9A 2KT8A 1S1NA 4F16A 2I0NA 2EQIA 3JV3A 4Z89A 2DL8A 4OMMA 4CC3A 4Z8AA 5IXFA 2K2MA 2DA9A 1UUEA 1V1CA 1GCPA 2IIMA 1K0SA 1SHGA 4IIMA 1N5ZA 1X2KA 1JXMA 1FMKA 2L0AA 1M27C 2CSQA 1X2QA 2GTOA 1RLPC 1OOTA 2EGCA 4RTUA 3TVTA 2PNIA 2LMJA 1AWJA 4M4ZA 1AZEA 1K9AA 2KNBB 2BZYA 4RTWA 2YUNA 1YP5A 1AD5A 1WLPB 2GGRA 4LNPA 1HJDA 1GCQA 3NGPA 1JO8A 1NLOC 3H0IA 1SRLA 4AG2C 3VS7A 2ROTA 3H0FA 4A63B 2EYYA 2FRYA 2DLPA 1CSKA 2CH4A 2J06A 1ZLMA 2KRNA 2LJ3A 4J9CA 3RBBB 1GRIA 1OV3A 2RQUA 2KROA 1IO6A 2K7AA 4R0KA 4CC7A 2DRMA 1UFFA 1Z9ZA 2C0TA 1GBQA 3M0RA 2DJQA 1OEBA 2SRCA 1E7OA 1SEMA 2OAWA 2O88A 2DL5A 1KSWA 3EHQA 1SPKA 5L23A 2CH4W 4JZ3A 2GNCA 2YUPA 1EFNA 1UG1A 2OI3A 2RQWA 2A08A 2JXBA 1SRMA 2RPNA 5FWCA 1WIEA 2O31A 5FW9A 1X43A 1BK2A 3VS3A 4HVUA 2KRMA 2E5KA 2JT4A 2KT1A 2YT6A 3GBQA 3FJ5A 2D0NA 1AOJA 4OMNA 2V1QA 2BZ8A 2KRSA 3R6NA 3M0QA 1AVZC 2DMOA 3EHRA 2KGTA 2LCSA 3UA7A 1ZUYA 2OJ2A 2DILA 1PNJA 2VVKA 1UHCA 1CKBA 1OPLA 3IQLA 3VRYA 1X27A 2CREA 2FPDA 4ORZA 1ZUUA 2DE0X 2A37A 4OMLA 1W6XA 2YSQA 4AFQC 2GQIA 2FG0A 2GBQA 2JTEA 3PVQA 4EIKA 1AEYA 4HXJA 4LUDA 1TUDA 3UATA 1K4US 1E6GA 1K1ZA 4HVWA 3ULRB 1CKAA 1JXOA 1W70A 2DM1A 4KRTA 2VWFA 2QDLA 3KFVA 1NEGA 4LN2A 2K3BA 2HCKA 1UDLA 4JJBA 2MCNA 2DX1A 2DF6A 4RUGA 1T3SA 2J05A 2D1XA 2RNAA 1M3CA 4RTTA 2KE9A 2F2WA 1M8MA 2ESWA 1I0CA 2AKKA 1SSHA 4J9BA 3O5ZA 2LX7A 2O9VA 2LNHB 1I07A 1KJWA 1GCQC 1X6GA 2JM9A 2FPFA 2DBMA 3NHNA 1T0JA 2FEIA 2KXCA 2F2XA 2LQWA 2V1RA 2AZSA 2AK5A 5I22A 2X3WD 4DEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL7 C;  1WFW A;  2A36 A;  4JJC A;  1WXB A;  1MUZ A;  2C0O A;  3U23 A;  2D8H A;  1M3A A;  2EGA A;  2RMO A;  2EPD A;  1B07 A;  4GLM A;  2YUQ A;  1X6B A;  1RLQ C;  1ABO A;  1UHF A;  1QKW A;  2RQT A;  5ECA A;  1TUC A;  2DL3 A;  3EG3 A;  1UTI A;  2J7I A;  2EYW A;  1WI7 A;  1MV0 B;  2HEQ A;  1AWX A;  1ABQ A;  1PKS A;  5IH2 A;  1I1J A;  1BB9 A;  3NPF A;  2RQR A;  2EYX A;  2K6D A;  1QCF A;  4OMQ A;  1UEC A;  1M3B A;  2FPE A;  2B86 A;  1U06 A;  1YWO A;  1KFZ A;  1NM7 A;  4D8K A;  1YCS B;  1JQQ A;  1MV3 A;  1FYN A;  4HCK A;  3SHW A;  2DL7 A;  2KXD A;  2PTK A;  2XMF A;  1YN8 A;  2L3P A;  3EGU A;  2K79 A;  3CQT A;  3H41 A;  3UF4 A;  1AWW A;  3M0T A;  1M30 A;  2KYB A;  3I5R A;  5FWB A;  4WCI A;  4FSS A;  1VYT A;  1T3L A;  4RTY A;  3VS0 A;  1A0N B;  3VS4 A;  4RTV A;  4ESR A;  1PRL C;  2ED0 A;  4CC2 A;  1U5S A;  4X1V A;  5IHK A;  2J6F A;  1NEB A;  1WA7 A;  1QWE A;  3VS1 A;  2GTJ A;  2W10 A;  1H8K A;  4J9F A;  2M51 A;  4D8D A;  1SHF A;  1YWP A;  2KBT A;  3QWX X;  3PVL A;  1T0H A;  2MOX A;  3VRZ A;  4OMO A;  4HVV A;  2PZ1 A;  2ED1 A;  3REB B;  2EYZ A;  2NWM A;  2RN8 A;  4F17 A;  3RNJ A;  1NLP C;  1ARK A;  2RQV A;  2SEM A;  4J9G A;  2EVR A;  1VA7 A;  2MIO A;  3TSZ A;  4QT7 A;  4F14 A;  1AZG B;  4J9D A;  1PRM C;  1UJ0 A;  3THK A;  2JS2 A;  4JJD A;  3I5S A;  2L2P A;  2YUO A;  1Y57 A;  3C0C A;  1JEG A;  1HD3 A;  2JMA A;  1BU1 A;  2M0Y A;  2DRK A;  3M0P A;  1NYF A;  2ROL A;  2L3Q A;  2JW4 A;  1RUW A;  2BTT A;  1AWO A;  2LJ0 A;  1VYU A;  2EW3 A;  5EC7 A;  3TSW A;  4ZNX A;  1B3Q A;  1NG2 A;  3EG2 A;  1ZSG A;  2FRW A;  1TG0 A;  1G83 A;  1WXU A;  2LQN A;  3VS5 A;  2KR3 A;  2JMC A;  2AZV A;  3LH5 A;  1ZBJ A;  3I9Q A;  2RF0 A;  1UE9 A;  4Z88 A;  1ZX6 A;  2J6K A;  1XOV A;  3EG0 A;  3M0S A;  2J6O A;  2BZX A;  4J9E A;  2AKL A;  2ECZ A;  2L3S A;  1WX6 A;  2P4R A;  1Y0M A;  1Z9Q A;  2A28 A;  5HCK A;  1PWT A;  1X69 A;  4RTX A;  2F2V A;  4AG1 C;  3SEM A;  2DYB A;  2HSP A;  3VS6 A;  4J9I A;  2YDL A;  2ENM A;  4IIO A;  2D8J A;  4GBQ A;  1K76 A;  1UGV A;  2CDT A;  3EG1 A;  1GFC A;  1BBZ A;  4AFS C;  5IXB A;  1K0X A;  2HDA A;  2LP5 A;  3NMZ C;  1WDX A;  2W0Z A;  1OPK A;  2EGE A;  4OMP A;  2CUD A;  2CT3 A;  3QWY A;  2X3X D;  2DVJ A;  2CUB A;  3M0U A;  2LZ6 B;  1E6H A;  1QWF A;  4JZ4 A;  2G6F X;  1H92 A;  1G2B A;  2DNU A;  2EKH A;  1VYV A;  1U3O A;  4JPB W;  3REA B;  1H3H A;  1JU5 C;  1PKT A;  1WYX A;  2ABL A;  4Y92 A;  4DEY A;  1UJY A;  5GJW B;  1HSQ A;  4K11 A;  2HBW A;  4RTZ A;  1NYG A;  2VKN A;  2O2O A;  1YNZ A;  1KIK A;  2JS0 A;  4E6R A;  4AFZ C;  3H0H A;  2FO0 A;  2DL4 A;  4AFU C;  1QKX A;  1J3T A;  1LCK A;  1PHT A;  1GL5 A;  4CC4 B;  2CSI A;  2KYM A;  1WXT A;  2LJ1 A;  5GJV B;  2CT4 A;  3VS2 A;  1ZUK A;  2C0I A;  3UA6 A;  4J9H A;  2DBK A;  3PE0 A;  1RI9 A;  5IHN A;  2K9G A;  5IHI A;  2JM8 A;  3I35 A;  5I11 A;  2O9S A;  4LUE A;  1GBR A;  1QLY A;  2H8H A;  1GFD A;  2KEA A;  1W1F A;  3A98 A;  2NUZ A;  2EBP A;  4LE9 A;  2KT8 A;  1S1N A;  4F16 A;  2I0N A;  2EQI A;  3JV3 A;  4Z89 A;  2DL8 A;  4OMM A;  4CC3 A;  4Z8A A;  5IXF A;  2K2M A;  2DA9 A;  1UUE A;  1V1C A;  1GCP A;  2IIM A;  1K0S A;  1SHG A;  4IIM A;  1N5Z A;  1X2K A;  1JXM A;  1FMK A;  2L0A A;  1M27 C;  2CSQ A;  1X2Q A;  2GTO A;  1RLP C;  1OOT A;  2EGC A;  4RTU A;  3TVT A;  2PNI A;  2LMJ A;  1AWJ A;  4M4Z A;  1AZE A;  1K9A A;  2KNB B;  2BZY A;  4RTW A;  2YUN A;  1YP5 A;  1AD5 A;  1WLP B;  2GGR A;  4LNP A;  1HJD A;  1GCQ A;  3NGP A;  1JO8 A;  1NLO C;  3H0I A;  1SRL A;  4AG2 C;  3VS7 A;  2ROT A;  3H0F A;  4A63 B;  2EYY A;  2FRY A;  2DLP A;  1CSK A;  2CH4 A;  2J06 A;  1ZLM A;  2KRN A;  2LJ3 A;  4J9C A;  3RBB B;  1GRI A;  1OV3 A;  2RQU A;  2KRO A;  1IO6 A;  2K7A A;  4R0K A;  4CC7 A;  2DRM A;  1UFF A;  1Z9Z A;  2C0T A;  1GBQ A;  3M0R A;  2DJQ A;  1OEB A;  2SRC A;  1E7O A;  1SEM A;  2OAW A;  2O88 A;  2DL5 A;  1KSW A;  3EHQ A;  1SPK A;  5L23 A;  2CH4 W;  4JZ3 A;  2GNC A;  2YUP A;  1EFN A;  1UG1 A;  2OI3 A;  2RQW A;  2A08 A;  2JXB A;  1SRM A;  2RPN A;  5FWC A;  1WIE A;  2O31 A;  5FW9 A;  1X43 A;  1BK2 A;  3VS3 A;  4HVU A;  2KRM A;  2E5K A;  2JT4 A;  2KT1 A;  2YT6 A;  3GBQ A;  3FJ5 A;  2D0N A;  1AOJ A;  4OMN A;  2V1Q A;  2BZ8 A;  2KRS A;  3R6N A;  3M0Q A;  1AVZ C;  2DMO A;  3EHR A;  2KGT A;  2LCS A;  3UA7 A;  1ZUY A;  2OJ2 A;  2DIL A;  1PNJ A;  2VVK A;  1UHC A;  1CKB A;  1OPL A;  3IQL A;  3VRY A;  1X27 A;  2CRE A;  2FPD A;  4ORZ A;  1ZUU A;  2DE0 X;  2A37 A;  4OML A;  1W6X A;  2YSQ A;  4AFQ C;  2GQI A;  2FG0 A;  2GBQ A;  2JTE A;  3PVQ A;  4EIK A;  1AEY A;  4HXJ A;  4LUD A;  1TUD A;  3UAT A;  1K4U S;  1E6G A;  1K1Z A;  4HVW A;  3ULR B;  1CKA A;  1JXO A;  1W70 A;  2DM1 A;  4KRT A;  2VWF A;  2QDL A;  3KFV A;  1NEG A;  4LN2 A;  2K3B A;  2HCK A;  1UDL A;  4JJB A;  2MCN A;  2DX1 A;  2DF6 A;  4RUG A;  1T3S A;  2J05 A;  2D1X A;  2RNA A;  1M3C A;  4RTT A;  2KE9 A;  2F2W A;  1M8M A;  2ESW A;  1I0C A;  2AKK A;  1SSH A;  4J9B A;  3O5Z A;  2LX7 A;  2O9V A;  2LNH B;  1I07 A;  1KJW A;  1GCQ C;  1X6G A;  2JM9 A;  2FPF A;  2DBM A;  3NHN A;  1T0J A;  2FEI A;  2KXC A;  2F2X A;  2LQW A;  2V1R A;  2AZS A;  2AK5 A;  5I22 A;  2X3W D;  4DEX A; 
#chains in the Genus database with same CATH topology
 1O9S A;  1WFW A;  1WHK A;  2C0O A;  1M3A A;  3JB9 F;  4BDZ A;  1RAE B;  1QP3 A;  1IB8 A;  1N8R C;  1Y96 A;  3HSB A;  1M1F A;  2D0Q B;  4GLM A;  1W2B A;  1X6B A;  2COZ A;  1JJ2 S;  5GAN 6;  3EFS A;  1ABO A;  1UHF A;  1BI1 A;  2RQT A;  1WJR A;  4OB1 B;  3FRN A;  5LJ3 j;  1PKS A;  2CP6 A;  3QYH B;  4XU0 A;  1YFN A;  2K6D A;  1UEC A;  1M3B A;  1K73 C;  2C06 A;  3CCL T;  3CBM A;  3G4S T;  1PCX A;  1U06 A;  4QQD A;  5CIU A;  3JCM h;  1MV3 A;  1VQ4 T;  2KXD A;  5HK0 A;  5GAN 5;  4J5Y A;  3CQT A;  3HP9 A;  3L1A A;  2ZPI B;  2EQU A;  2DK3 A;  4LDY A;  3KBG A;  4IUP A;  4WCI A;  4FSS A;  2JVV A;  3L2Z A;  4RTY A;  3V8K A;  3OA6 A;  1U1T A;  1IXD A;  4X1V A;  4ELZ C;  1QWE A;  5CKE A;  3PIO A;  2RHX A;  4KGX B;  2K3X A;  1S72 T;  1C6V X;  4ATO A;  3JCM b;  5D6X A;  4D8D A;  1SHF A;  5GAO n;  2VAS A;  2MOX A;  3ER0 A;  4OMO A;  2QEX Q;  3DB3 A;  3REB B;  1YJW Q;  2EYZ A;  1FXX A;  3CC2 Q;  1KQ2 A;  5FU7 C;  1NLP C;  5LJ5 g;  1ACM B;  1N8R U;  5FRM A;  3TSZ A;  1M2O A;  2RJE A;  2RHZ A;  1AZG B;  4B9W A;  2KQW A;  2VGM A;  2E4H A;  1PRM C;  2JZ2 A;  5D6Y A;  3QSU A;  2M9U A;  3I5S A;  2LVM A;  2L2P A;  2YUO A;  3C0C A;  3P8B B;  5I21 A;  1KC8 C;  4XQ3 A;  2M0Y A;  3M0P A;  3CPW P;  2QAZ A;  4M75 F;  3CCU Q;  1RUW A;  3ZEH A;  2EWN A;  1WGS A;  2LC4 A;  4OB2 B;  3QII A;  2QTX A;  1TG0 A;  3OYL A;  1R77 A;  1K73 U;  1G83 A;  1WXU A;  2LQN A;  1KD1 R;  1ZBX A;  1NPR A;  1Q7Y R;  3RER A;  3I9Q A;  4L6V 5;  3EG0 A;  3MP6 A;  3TCJ A;  2BZX A;  2GF7 A;  2A7Y A;  1WX6 A;  2EJG A;  3M5A A;  3TQ7 P;  1YJW A;  3EG9 B;  3CC2 A;  1VQN A;  1Y0M A;  4RCC A;  4N4I A;  4A4K A;  5GMK j;  1B7T A;  5CKF A;  4RTX A;  5FU7 B;  3SEM A;  2HSP A;  6AT1 B;  3HRT A;  3P8D A;  5CK9 A;  3CCS Q;  4IIO A;  4E7L A;  2CDT A;  1GFC A;  4II1 A;  2E70 A;  1OZ3 A;  2K4Y A;  2LP5 A;  3NMZ C;  3EFO A;  3CD6 Q;  3CCV Q;  3OYB A;  4X34 A;  1K8A R;  3R6O A;  1VQP Q;  3CCU A;  4IUT A;  3G7Z A;  3CCE Q;  2EKH A;  2XDB A;  1U3O A;  1JU5 C;  1D1A A;  1PKT A;  1WYX A;  4MMK A;  1WPY A;  2WSF E;  1HSQ A;  1VQ9 Q;  3E9G A;  3OMC A;  4C0G A;  1UEB A;  2JN0 A;  3H0H A;  4AFU C;  1KC8 U;  1RL2 A;  1GL5 A;  1G3S A;  1SF9 A;  2P4T A;  4CC4 B;  2CSI A;  1VUB A;  4F7U A;  3VS2 A;  2C0I A;  2CZ0 B;  3CCS A;  1D0X A;  3OYN A;  1OUL A;  3M54 A;  3QJ6 A;  2JM8 A;  4R56 A;  1QVF S;  2K5L A;  2O9S A;  3D7S B;  3JCM V;  3CD6 A;  1MMD A;  4MZM A;  1FWZ A;  5A0G A;  4XTZ A;  1W1F A;  3A98 A;  3M58 A;  3LH0 A;  1EZZ B;  3MEU A;  4O5V A;  3S3N A;  1VQ8 T;  4FYW B;  4OMF B;  4Z89 A;  3CCE A;  4PJN A;  3CMA A;  5LJ3 f;  2K2M A;  5IN1 A;  4KT0 E;  2VYT A;  1K0S A;  1UGP B;  1X2K A;  1FMK A;  4KGV B;  5KCO A;  1OOT A;  2EGC A;  2EJF A;  3V8J A;  2PNI A;  4XU3 A;  2QQB A;  3AT1 B;  4M4Z A;  3CCL Q;  3OQ5 A;  3G4S Q;  1SSF A;  2F1L A;  3SWN A;  5A0D A;  2LQ8 A;  1VQ4 Q;  1HJD A;  1D3B B;  1GCQ A;  1NZ9 A;  1VQO T;  3M4G A;  4QVZ A;  5HY6 A;  2OTJ T;  1NLO C;  1TSF A;  2ROT A;  5KH6 A;  5GAO m;  3H0F A;  2O4X A;  2EYY A;  2MPX C;  2DLP A;  2FVU A;  2AIR B;  3QHS A;  3EAE A;  3L2Q A;  4J9C A;  1OV3 A;  2RI2 A;  4CC7 A;  2DRM A;  1IRE B;  1GBQ A;  3M0R A;  2DJQ A;  1OEB A;  3CXC P;  2NUT B;  2DEQ A;  4BUG A;  1FX7 A;  2A3L A;  4ZTF A;  2O88 A;  2DD5 A;  2DL5 A;  2DXU A;  5FRO A;  2XU8 A;  4LDU A;  2ZAE A;  2CH4 W;  2DPP B;  2E10 A;  2QQR A;  1VQL Q;  2DER A;  2YUP A;  1EFN A;  2OI3 A;  2RQW A;  4ZTJ A;  3CCL A;  3G4S A;  2QGF B;  2QI2 A;  5GMK m;  2O31 A;  1X43 A;  3VS3 A;  4HVU A;  1VQ4 A;  3RMS A;  1BCM A;  2JT4 A;  3GNF B;  1G8X A;  2MMP A;  2ZPE B;  1QMC A;  4QQ6 A;  2M16 A;  2V1Q A;  3EGD A;  1D1C A;  1AVZ C;  3DLM A;  4C5H A;  2V8J A;  2M0O A;  3UA7 A;  1ZUY A;  2OJ2 A;  4M78 A;  2DIL A;  2VVK A;  3VRY A;  2LCL A;  1QVG P;  1SKU B;  2EYQ A;  1OU8 A;  2FPD A;  4ORZ A;  2E12 A;  2DE0 X;  3EGX B;  4CI0 C;  4C8Q G;  1G3T A;  4EIK A;  1AEY A;  2IVW A;  1S72 A;  4HXJ A;  1KD1 C;  3UAT A;  5KYU A;  2MYS A;  1K1Z A;  4HVW A;  1Q7Y C;  1RAB B;  1MHN A;  1LPL A;  1R0C B;  2HL3 A;  2VWF A;  3VUB A;  2QDL A;  2IPO B;  2HKN A;  2ZPG B;  2K3B A;  1UDL A;  4JJB A;  2X4W A;  3EH1 A;  4FYX B;  2EQJ A;  2DX1 A;  2DF6 A;  3JAM E;  2VGN A;  1T3S A;  2XHC A;  1BIA A;  2RNA A;  3UT1 A;  3UPU A;  2DD4 A;  2ESW A;  4DA4 A;  2COY A;  3QBY A;  4EMK A;  3OYA A;  2NUP A;  1KJW A;  1X6G A;  3V7S A;  2DBM A;  2KAF A;  1K8A C;  2KXC A;  4O6J A;  3PMT A;  2XK0 A;  2AZS A;  2AK5 A;  2QQA A;  5I22 A;  3CEY A;  2QEX T;  4MZT A;  5LJ3 h;  3C95 A;  5IAY A;  3MJX A;  2QG9 B;  4JJC A;  1IHV A;  4RMO A;  5GAM h;  3JCM f;  1N27 A;  1AT1 B;  2R5M A;  2QDY B;  5CAI A;  1PSE A;  1RAF B;  3JCM P;  3HFO A;  2MAM A;  1PD1 A;  3URG A;  4M7A A;  4MZP A;  4ME7 A;  1TUG B;  4GY5 A;  1QKW A;  3VJP A;  2PUK B;  1WI7 A;  2K3Y A;  1MV0 B;  3GOX A;  2HEQ A;  2K2V A;  2L89 A;  3MO8 A;  5IH2 A;  2HL5 C;  1KD1 U;  4OMQ A;  1Q7Y U;  2E41 A;  2CGH A;  1U1S A;  2RA2 A;  2FPE A;  2B86 A;  1KFZ A;  2P0K A;  1VQ8 Q;  1BKB A;  4HCK A;  2DL7 A;  3FB9 A;  3E9F A;  2WAC A;  3KXT A;  3L2R A;  4ANJ A;  3M0T A;  4JS5 A;  5AT1 B;  2HQH A;  1JJ2 P;  4KGZ B;  1LJO A;  2RH2 A;  2QK0 A;  3OYJ A;  4N4G A;  3MKD A;  1T3L A;  3G71 T;  1Y96 B;  1VQ7 Q;  4RKU E;  3H6Z A;  3VV0 A;  5GAN 2;  2F5K A;  3BDL A;  2JTM A;  1V29 B;  2ED0 A;  3CBO A;  1U5S A;  3M53 A;  5IHK A;  2J6F A;  4FL6 A;  2DET A;  5GAN g;  3RUX A;  2KVQ G;  2LTO A;  1VQ6 T;  1K8A U;  4PJO G;  3JCM X;  3CCV T;  1VQO Q;  1KQS A;  1YWP A;  2OTJ Q;  1BI2 A;  3QWX X;  4PJJ A;  1VQP T;  4FSX A;  3VRZ A;  1QCO A;  4HVV A;  4QQG A;  4BI8 B;  3S3M A;  4P5N A;  2NWM A;  2RN8 A;  1VQM T;  2VUB A;  3HL8 A;  2HQX A;  4RG2 A;  2DJZ A;  5GAN d;  4XTU A;  4M75 A;  4BE1 A;  3AHU A;  1VQ8 A;  3X25 B;  4F14 A;  1UGR B;  4J9D A;  1VQ9 T;  4KH0 B;  1UJ0 A;  2X4X A;  3THK A;  3SDZ A;  4C0D C;  2JS2 A;  4JJD A;  4PJM A;  4JJN K;  4OGE A;  4C5E A;  1YBY A;  1JRI A;  5CKH A;  1HD3 A;  5KYW B;  2L3Q A;  3OS1 A;  5J39 A;  3J81 E;  1AWO A;  1WJQ A;  3RR6 A;  5M9O A;  4J83 A;  4ZNX A;  3EG2 A;  1NG2 A;  1ZSG A;  3DLL A;  2FRW A;  5A0L A;  4NOY A;  2KR3 A;  2JMC A;  5DY9 A;  2LDM A;  2OTL T;  3JSC A;  1VQO A;  4C92 G;  3M0S A;  2AKL A;  3GP8 A;  2P4R A;  1Z9Q A;  1N9R A;  2A28 A;  3C4S A;  1PWT A;  1TWB A;  2F2V A;  4AG1 C;  4OB0 B;  1VIE A;  4J9I A;  2YDL A;  2ENM A;  2DEU A;  1SG5 A;  4C8Q D;  2D8J A;  1QQJ A;  2RK2 A;  1RI0 A;  2Y4Y A;  1QP2 A;  4EDU A;  4AFS C;  2BKD N;  5IXB A;  2HQE A;  5GAM j;  4PFO A;  3SD4 A;  4C0D B;  1VQK T;  1YHQ T;  2CUD A;  3WVD B;  1KQS S;  3BW1 A;  2CUB A;  2LZ6 B;  3UDC A;  4C92 C;  2OAU A;  4IUQ A;  4PJO B;  1E6H A;  3INZ A;  2MF2 A;  1H92 A;  1IGQ A;  1YJN Q;  1VYV A;  3X26 B;  3REA B;  4J6X A;  1H3H A;  2EFI A;  3S6W A;  2ABL A;  4DEY A;  5HK3 A;  3QDR B;  1VOM A;  5GJW B;  3ZFJ A;  2O2O A;  3CPF A;  1M1K R;  4J6Y A;  1KIK A;  2JS0 A;  2FO0 A;  1QKX A;  3CME Q;  3CCR T;  5L8R E;  3N5B B;  1PHT A;  1I4K 1;  1WXT A;  5GJV B;  3UA6 A;  4J9H A;  2DBK A;  1OU9 A;  1IHW A;  4V2S A;  3FJP A;  2K9G A;  1Q95 G;  3H8Z A;  2D9T A;  1VQL T;  4JRI A;  5I11 A;  5KYY A;  1I8F A;  2PUO B;  4M77 G;  4XTV A;  3Q1J A;  1W2B S;  4BI4 A;  2EBP A;  3MPU B;  2KT8 A;  2I0N A;  2EQK A;  2EQI A;  2I2L A;  4OF1 A;  1BYM A;  4C92 B;  2RHY A;  2DL8 A;  1XQH A;  4BD3 A;  4CC3 A;  2E6Z A;  3V8L A;  3C94 A;  5IXF A;  4J6W A;  2DA9 A;  5LJ5 d;  1V1C A;  2X4Y A;  3VYG A;  5GMK i;  4RTU A;  1AZE A;  4BB7 A;  1KG1 A;  2KNB B;  1X75 C;  4M77 C;  1AD5 A;  1WLP B;  4QVD A;  2GGR A;  4LNP A;  1WHJ A;  1QVF P;  3BDU A;  1RAD B;  3MEW A;  3NGP A;  1JO8 A;  3LX7 A;  3A8G B;  2QEX A;  1SRL A;  3X20 B;  2HBP A;  2ZPF B;  5GAN 4;  4PJL A;  4XU2 A;  8ATC B;  3PGG A;  3G71 Q;  4C8Q F;  2CH4 A;  2MI6 A;  2J06 A;  1ZLM A;  2KRN A;  3DB4 A;  4PLL A;  4C92 E;  4A53 A;  2BIV A;  4PJO D;  1M9S A;  1UFF A;  5GAN j;  4M78 G;  1VQ6 Q;  3RIR A;  1RAA B;  1N6A A;  2JTF A;  2V8K A;  2CKK A;  9ATC B;  1E7O A;  3FDR A;  2OAW A;  5J3B A;  1LVK A;  1KSW A;  3EHQ A;  3OYY A;  2MWP A;  1ZSZ C;  1VQM Q;  4JZ3 A;  4OVA A;  3TRE A;  3SFM A;  2HD0 A;  2P84 A;  2Z0W A;  3M59 A;  4BE0 A;  2RHI A;  2A08 A;  2JXB A;  4A54 A;  2RJF A;  2FZG B;  1Q86 R;  4M77 B;  1G3Y A;  3OBW A;  2YT6 A;  3HPW A;  5KCH A;  3CCM T;  2D0N A;  1AOJ A;  2KRS A;  3R6N A;  2O4X B;  3EHR A;  2KGT A;  2LCS A;  1KHC A;  3G71 A;  5J26 A;  1PNJ A;  5LJ3 e;  1PG5 B;  1CKB A;  3LGF A;  2E64 A;  3IQL A;  5KYX B;  3VUZ A;  4A4E A;  2CRE A;  1ZHI A;  4J8O A;  1MNE A;  2A37 A;  1W6X A;  2GQI A;  4J7F A;  4FIB A;  3MP8 A;  5CVI A;  1VIF A;  4BDY A;  4C92 D;  1VQ6 A;  2DTO A;  1TUD A;  2OTL Q;  4FT2 A;  3CCV A;  1E6G A;  2YHT A;  1AHJ B;  1VQP A;  5D7U A;  4XK8 E;  4KRT A;  3VYH B;  4NS5 A;  4OP0 A;  1VQM A;  4M7D G;  2HCK A;  1JB0 E;  1ZSZ B;  3EG9 A;  4A4H A;  1M2V B;  2QXF A;  5C6S A;  1WQW A;  4M77 E;  5GAM f;  3T9N A;  3PNW C;  2J05 A;  1VQ9 A;  3L2U A;  1VQ7 T;  1M3C A;  4RTT A;  2F2W A;  4PFP A;  3MEA A;  4LDV A;  5CO7 A;  4M7A G;  1VQK Q;  3G1J A;  3A5Z B;  1SSH A;  3HRS A;  2CZ1 B;  4E7K A;  1YHQ Q;  8AT1 B;  2FPF A;  1LNX A;  1VQ5 T;  2F2X A;  1PD0 A;  4M7D C;  2RB6 A;  2CZ6 B;  4DEX A;  2X9H A;  2A36 A;  1MUZ A;  2RHU A;  2D8H A;  2HMA A;  1B34 B;  4IUV A;  2OTL A;  3CBP A;  4A4G A;  1Y07 A;  2LNV A;  2EPD A;  1QVP A;  4IUU A;  1M1K C;  1H3Z A;  4PJO F;  5FU6 C;  1B07 A;  3LWI A;  3CCR Q;  3H9N A;  1EX4 A;  3CCQ Q;  4PNO A;  4LXC A;  1TUC A;  1ZA1 B;  2DL3 A;  1UTI A;  2J7I A;  4ZN3 A;  4LDX A;  3QUI A;  4M77 D;  5LJ5 j;  1I1J A;  1VQK A;  1BB9 A;  1YHQ A;  2EYX A;  5DLO A;  4N0A C;  3CXC A;  1WZO A;  1QCF A;  4XTW A;  2LX9 A;  1XJW B;  1P92 A;  1YWO A;  1JBM A;  4ZGD B;  3J7A F;  1ZA2 B;  2PTK A;  2XMF A;  1YN8 A;  2CP3 A;  2VV5 A;  2L3P A;  3EGU A;  2K79 A;  5GMK e;  4CRI A;  5KE3 A;  3H41 A;  3UF4 A;  3JCM J;  4M7D B;  1D0Y A;  1M30 A;  1YIT Q;  5FWB A;  3VS0 A;  2GFU A;  4IUR A;  5LL6 S;  1A0N B;  3RKX A;  3EFR A;  3WXM B;  4E7J A;  3OB9 A;  1XTD A;  2EQM A;  1PRL C;  2DTI A;  4C92 F;  3CCR A;  5FU6 B;  3OW2 P;  1NEB A;  1WA7 A;  4RCB A;  3VS1 A;  2GTJ A;  1LOJ A;  2W10 A;  1Y71 A;  3A8O B;  1H8K A;  2M51 A;  2KBT A;  3PVL A;  1T0H A;  1D3B A;  1OQK A;  1I5O B;  2ED1 A;  2VXE A;  5LJ3 g;  1YJN T;  2LT4 A;  1VQL A;  4RG8 A;  2ZPH B;  2XIC A;  1K73 R;  1NBE B;  5GAN 8;  4J9G A;  5I2M A;  2EVR A;  1M1K U;  5CKB A;  5GAN f;  2AHJ B;  1BI0 A;  3JRZ A;  3JCM Q;  2RD1 A;  4L59 A;  3OYC A;  4M78 D;  4C8Q C;  4XTY A;  3JCM e;  4M7D E;  1YJ9 Q;  2P0Q A;  1Y57 A;  3HRU A;  5LJ3 d;  3CME T;  1BU1 A;  4FYV B;  3SB2 A;  1MMG A;  2GCX A;  1NYF A;  3QZ9 B;  2E3I A;  2NUT A;  1XNI A;  2JW4 A;  2XDP A;  2YLB A;  3QG1 A;  5AYF A;  2LJ0 A;  1VYU A;  5EC7 A;  3NTH A;  3CXC S;  3M9Q A;  2ATC B;  4OB3 B;  3LH5 A;  4FCY A;  4YTL A;  2RF0 A;  1M90 R;  2VB6 A;  1UE9 A;  1Q86 C;  4Z88 A;  2J6K A;  4HA8 A;  2HKQ B;  3CCM Q;  4J9E A;  1TOV A;  2L3S A;  1PC0 A;  2HNI A;  5HCK A;  1KK7 A;  2QAS A;  3BFM A;  1HYO A;  2LCC A;  2DYB A;  3VS6 A;  4M77 F;  2M1H A;  4D6W A;  4JDS A;  1UGV A;  3QO3 A;  1WQ7 A;  2OX7 A;  3EG1 A;  3C12 A;  3HHT B;  3P8H A;  1EIF A;  2HDA A;  5CQY A;  3EGX A;  4C8Q B;  1M1G A;  4OMP A;  1OPK A;  2EGE A;  3TEE A;  4JLG A;  2CT3 A;  2X3X D;  3MCA B;  4M7D D;  4JZ4 A;  2DNU A;  2VC8 A;  4JPB W;  3QKJ A;  3V7R A;  3OY9 A;  5EG2 A;  1UJY A;  4K11 A;  2DIG A;  2RK1 A;  4BE2 A;  5GAN 3;  2ZGW A;  3CCJ T;  2HZY A;  3OS2 A;  4E6R A;  3CCM A;  4KH1 B;  3BE3 A;  2DL4 A;  2E65 A;  1J3T A;  2WSC E;  4JRQ A;  1RAG B;  1LCK A;  3LLR A;  2PU9 B;  1VQ5 Q;  3M4Y A;  2KYM A;  5A2Q E;  2CT4 A;  3L42 A;  3OMG A;  1KQS P;  3A8H B;  3LYI A;  5IHI A;  1Q82 R;  3I35 A;  1OYX A;  4C8Q E;  2F69 A;  3CC7 T;  2L8D A;  4J7I A;  1K9M R;  2H8H A;  1Q86 U;  4M78 F;  3I56 T;  1GFD A;  2KEA A;  3S3O A;  4LE9 A;  2NUZ A;  1S1N A;  1FMV A;  4L5G A;  3JV3 A;  1NPP A;  3EH2 A;  4OMM A;  3JCM c;  4HT8 A;  4WTO B;  4Z8A A;  1Q81 R;  2CP2 A;  3I55 T;  4PJO C;  1M5Q 1;  1UUE A;  3QDF A;  5LJ5 f;  4KUI A;  1GCP A;  2RO0 A;  1KQ1 A;  1SHG A;  1VQ7 A;  2L0A A;  1M27 C;  2GTO A;  1RLP C;  3TVT A;  4JS4 A;  1AWJ A;  1IRX A;  2XKO C;  4DQ2 A;  1K9A A;  4E7H A;  2YUN A;  1VQ5 A;  3JCM g;  3RKY A;  2JUF A;  4A4F A;  5GAN h;  4PL6 A;  2DAQ A;  2OTJ A;  2JNG A;  4C0F A;  1W2B P;  3A8M B;  4BY6 C;  3VS7 A;  4A63 B;  3O8V A;  4DOW A;  2FRY A;  3NTI A;  4NL2 A;  5DLQ E;  2XID A;  3JCM d;  2BE9 B;  2YXY A;  2LJ3 A;  3RBB B;  3FEO A;  2DZC A;  1GRI A;  3RES A;  2VXF A;  4PLI A;  2K7A A;  4R0K A;  4M7D F;  3ME9 A;  4F7U G;  3MP1 A;  2SRC A;  2BE7 D;  2R5A A;  2KDS A;  1SEM A;  4FW2 A;  2EJ9 A;  1GXI E;  4BAC A;  3ZBD A;  3PIP A;  5CR2 A;  3OYM A;  3JCM W;  3E2U A;  4M7A F;  1UG1 A;  4OGC A;  2RPN A;  5FWC A;  1WIE A;  4F04 B;  5HKC A;  4LD9 K;  3QXE B;  2KRM A;  2BUD A;  2LQK A;  1DJ7 B;  4XAX B;  4C5I A;  4PK4 A;  4OMN A;  3A1P A;  2BZ8 A;  2DXC A;  2FB7 A;  3OYF A;  1QW1 A;  4BY6 B;  3CCQ T;  2X51 A;  2XD0 A;  2H3J A;  5KYW A;  5CKD A;  2RJC A;  4NL3 A;  2GFA A;  4ZGE B;  4OML A;  2YSQ A;  3GF5 A;  4AFQ C;  2FG0 A;  2K5I A;  5GAO l;  2FHD A;  1MND A;  1R0B G;  2MWO A;  3EFO B;  3PVQ A;  4DOV A;  3OBY A;  4LUD A;  3OYK A;  4PJO E;  1K4U S;  4JRP A;  1H64 1;  1BI3 A;  4QW2 A;  1M90 C;  3ULR B;  1ZQ1 A;  3QPH A;  2E5Q A;  2DM1 A;  3OYD A;  1YJN A;  3KFV A;  1NEG A;  2V8I A;  1VQN Q;  2GQV A;  2MCN A;  4X9C A;  1BCO A;  1YIT T;  2DXB A;  3G6E T;  3WVE B;  2JOY A;  3ASK A;  3SWN C;  1F1B B;  4Y91 A;  3VU3 C;  2AKK A;  3CME A;  3O5Z A;  2LX7 A;  2O9V A;  4IKF A;  1I07 A;  1GCQ C;  3CPW A;  5GMK l;  4F7U B;  3J80 E;  4AMC A;  2ZPB B;  1UB4 A;  1WNL A;  3GLX A;  4PJO A;  2LQW A;  2V1R A;  2ZZD A;  1D1B A;  4KUL A;  4ZGJ B;  2QQS A;  4FYY B;  1V76 A;  2PQW A;  3QZ5 B;  3ZL7 C;  4BI3 A;  1WXB A;  3U23 A;  1QVF A;  5LJ5 h;  2ZCF B;  2EGA A;  2RMO A;  3CCJ Q;  4DBF A;  3CC4 T;  2YUQ A;  2EAY A;  2A0F B;  1Y7X A;  1RLQ C;  1C0M A;  1YJ9 T;  4HCZ A;  5ECA A;  3EG3 A;  2EYW A;  2KK4 A;  2E6N A;  5GAO r;  4PKC C;  2CP0 A;  1AWX A;  1ABQ A;  3CC7 Q;  1Q82 C;  3OSS C;  3X24 B;  3V7C A;  3NPF A;  2RJD A;  2RQR A;  3SWN B;  1G5V A;  3E19 A;  3I56 Q;  4F7U E;  4LD6 A;  1M90 U;  3PFS A;  4MDW A;  1YI2 T;  1K9M C;  1NM7 A;  2PVD B;  4D8K A;  1YCS B;  1JQQ A;  4LDW A;  3FC3 A;  3SHW A;  1FYN A;  1TS9 A;  3OYE A;  3CMA Q;  5KYN A;  4C92 A;  2QGG A;  3I55 Q;  4M78 C;  1AWW A;  2M02 A;  2QQ9 A;  2DXT A;  1Q81 C;  3UWN A;  2KYB A;  4DBH A;  3I5R A;  2YLC A;  2YRV A;  2HAX A;  1VYT A;  1OZ2 A;  4EPC A;  3CCJ A;  3VS4 A;  4RTV A;  2CP7 A;  1X01 A;  5GAM e;  4ESR A;  3BY7 A;  4EMG A;  1YIJ T;  4CC2 A;  2E3H A;  3CPW S;  3PT9 A;  3JB9 G;  2Y4X A;  2XG8 D;  2DFU A;  4XTX A;  4J9F A;  4Q5W A;  1R8O B;  1NJI R;  3VKI A;  2PZ1 A;  2QA4 T;  2FYK A;  1D09 B;  4Z02 A;  3CC7 A;  2XI9 A;  4F17 A;  5FRN A;  1UGS B;  3RNJ A;  4GLK A;  1ARK A;  2RQV A;  2SEM A;  2DO3 A;  3I56 A;  2X4J A;  1VA7 A;  2MIO A;  4QT7 A;  2JJ9 A;  3FLG A;  4EMK C;  2Y90 A;  5DM7 R;  3EGD B;  1MMN A;  1C1A A;  3I55 A;  5GAN 7;  2PVG B;  1JEG A;  4M78 B;  2EIF A;  2JMA A;  2V26 A;  2DRK A;  4C5G A;  2R58 A;  2ROL A;  2YRC A;  4VUB A;  2BTT A;  1X6O A;  1RAC B;  1WHG A;  2EW3 A;  3TSW A;  3M56 A;  1Q82 U;  2CP5 A;  1B3Q A;  3VS5 A;  5KYU B;  1K9M U;  4X9D A;  4HCC A;  2AZV A;  5GAO q;  1ZBJ A;  1TXQ A;  1M4Z A;  1ZX6 A;  1XOV A;  4R55 A;  4M77 A;  4JRK A;  2KI7 A;  3MHX A;  4JUV A;  4M7A C;  2J6O A;  2DYI A;  2ECZ A;  2CYZ B;  1Q81 U;  4DBQ A;  1O75 A;  1W4S A;  2RI5 A;  2PVO B;  1X69 A;  2HSE B;  3JB9 J;  1TTH B;  2K57 A;  4GBQ A;  1K76 A;  5KE2 A;  5KYX A;  1BBZ A;  2DTH A;  4QVC A;  1K0X A;  4EMK B;  4M78 E;  1MGQ A;  1WDX A;  2NUP B;  2W0Z A;  3HKS A;  2FZK B;  2LRQ A;  1S72 Q;  2E1H A;  1PM3 A;  3QWY A;  2WSE E;  2DVJ A;  3M0U A;  1BIB A;  1QWF A;  2G6F X;  1G2B A;  2RM4 A;  2G3R A;  4Y92 A;  1FMW A;  4DBR A;  1ZSZ A;  2HBW A;  5C0M A;  1M2V A;  4M75 G;  4RTZ A;  3M57 A;  1NYG A;  2VKN A;  4FU6 A;  3G6E Q;  1N8R R;  3OS0 A;  2DZ9 A;  4E7I A;  1YNZ A;  2QTV A;  1I5L A;  4AFZ C;  4MML A;  5GAN e;  5CCA A;  5GAO p;  4E7S A;  4M7A B;  4ZN1 A;  1WJS A;  1PSF A;  3CCQ A;  3LGL A;  4HCB A;  2EKO A;  2LJ1 A;  1QVG A;  1ZUK A;  2KSS A;  3L2W A;  3JB9 H;  3PE0 A;  3OYH A;  1RI9 A;  2R57 A;  5IHN A;  2AT1 B;  3OW2 A;  2FZC B;  4M75 C;  5GAM g;  4LUE A;  1GBR A;  1QLY A;  3CC4 Q;  1B34 A;  2P0P A;  4F7U F;  4F16 A;  1QCN A;  1MMA A;  4FM4 B;  3OYI A;  1D0Z A;  1WHH A;  2NYS A;  3DKM A;  1YIT A;  5GAM d;  2IIM A;  3RKW A;  3G6E A;  1TH7 A;  4IIM A;  1N5Z A;  1JXM A;  1U8R A;  2CSQ A;  4E7Z A;  2NLU A;  1X2Q A;  4M7A E;  3GPL A;  2LMJ A;  2L5Q A;  3RDV A;  4HT9 A;  4B6M A;  2BZY A;  4RTW A;  1YP5 A;  1YI2 Q;  1IGU A;  1IZ6 A;  2O01 E;  1M8V A;  5FLX E;  2L3R A;  1HK9 A;  2FL7 A;  1OX9 A;  3H0I A;  4AG2 C;  1TU0 B;  1YJW T;  2DIQ A;  3CC2 T;  1VQN T;  4M7D A;  1OX8 A;  4M75 B;  1HXD A;  3CC4 A;  3A8L B;  3FIF A;  1CSK A;  3MEV A;  1YIJ Q;  3JB9 D;  4FW1 A;  3QYG B;  4EMH A;  2RQU A;  3M55 A;  2CS7 A;  2KRO A;  3RMQ A;  1YJ9 A;  1IO6 A;  1KHI A;  1KC8 R;  3GIB A;  1Z9Z A;  2C0T A;  1QVG S;  2XDD A;  5CQX A;  2F5T X;  4ELY C;  2YWW A;  2QYZ A;  1NJI C;  1SPK A;  2QA4 Q;  3CCU T;  3TU4 K;  5L23 A;  3L2V A;  3OW2 S;  4WF2 A;  2YRD A;  2GNC A;  1UGQ B;  5I2S A;  3OSV A;  4B9X A;  3MET A;  4TVR A;  1YI2 A;  1SRM A;  2DVE A;  3QJY A;  4JLI A;  5FW9 A;  4M7A D;  1BK2 A;  4N0A A;  4HKE A;  2E5K A;  3X28 B;  4MDX A;  2D6F A;  2KT1 A;  3HFN A;  3NFC A;  3GBQ A;  3FJ5 A;  1JJ2 A;  3M0Q A;  2DMO A;  2LT1 A;  3HTR A;  4M75 E;  1OI1 A;  1UHC A;  5IT9 E;  3PMI A;  4C0Z A;  1OPL A;  3JB9 I;  1RAI B;  1X27 A;  5LJ5 e;  1YIJ A;  3CCS T;  1ZUU A;  4N4H A;  2IG0 A;  4KUD K;  2GBQ A;  2DKG A;  1G3W A;  2JTE A;  3F70 A;  3OS5 A;  3CD6 T;  7AT1 B;  2H3E B;  1CKA A;  1I81 A;  1JXO A;  4XU1 A;  1W70 A;  2QA4 A;  4UC4 A;  5D6W A;  3CCE T;  2K5F A;  4PFZ A;  4LN2 A;  3CMA T;  3NTK A;  3OYG A;  2X35 A;  3PTA A;  2KY9 A;  4RUG A;  3GNG A;  1YCY A;  2MK5 A;  3LW5 E;  2D1X A;  2COW A;  4FT4 A;  1N9S A;  2KE9 A;  1WHL A;  1M8M A;  1RAH B;  4E47 A;  1NE8 A;  1I0C A;  2B8A A;  4AT1 B;  4J9B A;  3KUF A;  4C8Q A;  2LNH B;  2CZ7 B;  3E1S A;  2JM9 A;  4E2F B;  4KBM B;  3NHN A;  1T0J A;  1NJI U;  2FEI A;  5GMK h;  4QKU A;  1WHM A;  3LWH A;  2RI3 A;  4Y28 E;  2X3W D;  2KMT A;  4M75 D;  5KYY B; 
#chains in the Genus database with same CATH homology
 3ZL7 C;  1WFW A;  2A36 A;  4JJC A;  1WXB A;  1MUZ A;  2C0O A;  3U23 A;  2D8H A;  1M3A A;  2EGA A;  2RMO A;  2EPD A;  1B07 A;  4GLM A;  2YUQ A;  1X6B A;  1RLQ C;  1ABO A;  1UHF A;  1QKW A;  2RQT A;  5ECA A;  1TUC A;  2DL3 A;  3EG3 A;  1UTI A;  2J7I A;  2EYW A;  1WI7 A;  1MV0 B;  2HEQ A;  1AWX A;  1ABQ A;  1PKS A;  5IH2 A;  1I1J A;  1BB9 A;  3NPF A;  2RQR A;  2EYX A;  2K6D A;  1QCF A;  4OMQ A;  1UEC A;  1M3B A;  2FPE A;  2B86 A;  1U06 A;  1YWO A;  1KFZ A;  1NM7 A;  4D8K A;  1YCS B;  1JQQ A;  1MV3 A;  1FYN A;  4HCK A;  3SHW A;  2DL7 A;  2KXD A;  2PTK A;  2XMF A;  1YN8 A;  2L3P A;  3EGU A;  2K79 A;  3CQT A;  3H41 A;  3UF4 A;  1AWW A;  3M0T A;  1M30 A;  2KYB A;  3I5R A;  5FWB A;  4WCI A;  4FSS A;  1VYT A;  1T3L A;  4RTY A;  3VS0 A;  1A0N B;  3VS4 A;  4RTV A;  4ESR A;  1PRL C;  2ED0 A;  4CC2 A;  1U5S A;  4X1V A;  5IHK A;  2J6F A;  1NEB A;  1WA7 A;  1QWE A;  3VS1 A;  2GTJ A;  2W10 A;  1H8K A;  4J9F A;  2M51 A;  4D8D A;  1SHF A;  1YWP A;  2KBT A;  3QWX X;  3PVL A;  1T0H A;  2MOX A;  3VRZ A;  4OMO A;  4HVV A;  2PZ1 A;  2ED1 A;  3REB B;  2EYZ A;  2NWM A;  2RN8 A;  4F17 A;  3RNJ A;  1NLP C;  1ARK A;  2RQV A;  2SEM A;  4J9G A;  2EVR A;  1VA7 A;  2MIO A;  3TSZ A;  4QT7 A;  4F14 A;  1AZG B;  4J9D A;  1PRM C;  1UJ0 A;  3THK A;  2JS2 A;  4JJD A;  3I5S A;  2L2P A;  2YUO A;  1Y57 A;  3C0C A;  1JEG A;  1HD3 A;  2JMA A;  1BU1 A;  2M0Y A;  2DRK A;  3M0P A;  1NYF A;  2ROL A;  2L3Q A;  2JW4 A;  1RUW A;  2BTT A;  1AWO A;  2LJ0 A;  1VYU A;  2EW3 A;  5EC7 A;  3TSW A;  4ZNX A;  1B3Q A;  1NG2 A;  3EG2 A;  1ZSG A;  2FRW A;  1TG0 A;  1G83 A;  1WXU A;  2LQN A;  3VS5 A;  2KR3 A;  2JMC A;  2AZV A;  3LH5 A;  1ZBJ A;  3I9Q A;  2RF0 A;  1UE9 A;  4Z88 A;  1ZX6 A;  2J6K A;  1XOV A;  3EG0 A;  3M0S A;  2J6O A;  2BZX A;  4J9E A;  2AKL A;  2ECZ A;  2L3S A;  1WX6 A;  2P4R A;  1Y0M A;  1Z9Q A;  2A28 A;  5HCK A;  1PWT A;  1X69 A;  4RTX A;  2F2V A;  4AG1 C;  3SEM A;  2DYB A;  2HSP A;  3VS6 A;  4J9I A;  2YDL A;  2ENM A;  4IIO A;  2D8J A;  4GBQ A;  1K76 A;  1UGV A;  2CDT A;  3EG1 A;  1GFC A;  1BBZ A;  4AFS C;  5IXB A;  1K0X A;  2HDA A;  2LP5 A;  3NMZ C;  1WDX A;  2W0Z A;  1OPK A;  2EGE A;  4OMP A;  2CUD A;  2CT3 A;  3QWY A;  2X3X D;  2DVJ A;  2CUB A;  3M0U A;  2LZ6 B;  1E6H A;  1QWF A;  4JZ4 A;  2G6F X;  1H92 A;  1G2B A;  2DNU A;  2EKH A;  1VYV A;  1U3O A;  4JPB W;  3REA B;  1H3H A;  1JU5 C;  1PKT A;  1WYX A;  2ABL A;  4Y92 A;  4DEY A;  1UJY A;  5GJW B;  1HSQ A;  4K11 A;  2HBW A;  4RTZ A;  1NYG A;  2VKN A;  2O2O A;  1YNZ A;  1KIK A;  2JS0 A;  4E6R A;  4AFZ C;  3H0H A;  2FO0 A;  2DL4 A;  4AFU C;  1QKX A;  1J3T A;  1LCK A;  1PHT A;  1GL5 A;  4CC4 B;  2CSI A;  2KYM A;  1WXT A;  2LJ1 A;  5GJV B;  2CT4 A;  3VS2 A;  1ZUK A;  2C0I A;  3UA6 A;  4J9H A;  2DBK A;  3PE0 A;  1RI9 A;  5IHN A;  2K9G A;  5IHI A;  2JM8 A;  3I35 A;  5I11 A;  2O9S A;  4LUE A;  1GBR A;  1QLY A;  2H8H A;  1GFD A;  2KEA A;  1W1F A;  3A98 A;  2NUZ A;  2EBP A;  4LE9 A;  2KT8 A;  1S1N A;  4F16 A;  2I0N A;  2EQI A;  3JV3 A;  4Z89 A;  2DL8 A;  4OMM A;  4CC3 A;  4Z8A A;  5IXF A;  2K2M A;  2DA9 A;  1UUE A;  1V1C A;  1GCP A;  2IIM A;  1K0S A;  1SHG A;  4IIM A;  1N5Z A;  1X2K A;  1JXM A;  1FMK A;  2L0A A;  1M27 C;  2CSQ A;  1X2Q A;  2GTO A;  1RLP C;  1OOT A;  2EGC A;  4RTU A;  3TVT A;  2PNI A;  2LMJ A;  1AWJ A;  4M4Z A;  1AZE A;  1K9A A;  2KNB B;  2BZY A;  4RTW A;  2YUN A;  1YP5 A;  1AD5 A;  1WLP B;  2GGR A;  4LNP A;  1HJD A;  1GCQ A;  3NGP A;  1JO8 A;  1NLO C;  3H0I A;  1SRL A;  4AG2 C;  3VS7 A;  2ROT A;  3H0F A;  4A63 B;  2EYY A;  2FRY A;  2DLP A;  1CSK A;  2CH4 A;  2J06 A;  1ZLM A;  2KRN A;  2LJ3 A;  4J9C A;  3RBB B;  1GRI A;  1OV3 A;  2RQU A;  2KRO A;  1IO6 A;  2K7A A;  4R0K A;  4CC7 A;  2DRM A;  1UFF A;  1Z9Z A;  2C0T A;  1GBQ A;  3M0R A;  2DJQ A;  1OEB A;  2SRC A;  1E7O A;  1SEM A;  2OAW A;  2O88 A;  2DL5 A;  1KSW A;  3EHQ A;  1SPK A;  5L23 A;  2CH4 W;  4JZ3 A;  2GNC A;  2YUP A;  1EFN A;  1UG1 A;  2OI3 A;  2RQW A;  2A08 A;  2JXB A;  1SRM A;  2RPN A;  5FWC A;  1WIE A;  2O31 A;  5FW9 A;  1X43 A;  1BK2 A;  3VS3 A;  4HVU A;  2KRM A;  2E5K A;  2JT4 A;  2KT1 A;  2YT6 A;  3GBQ A;  3FJ5 A;  2D0N A;  1AOJ A;  4OMN A;  2V1Q A;  2BZ8 A;  2KRS A;  3R6N A;  3M0Q A;  1AVZ C;  2DMO A;  3EHR A;  2KGT A;  2LCS A;  3UA7 A;  1ZUY A;  2OJ2 A;  2DIL A;  1PNJ A;  2VVK A;  1UHC A;  1CKB A;  1OPL A;  3IQL A;  3VRY A;  1X27 A;  2CRE A;  2FPD A;  4ORZ A;  1ZUU A;  2DE0 X;  2A37 A;  4OML A;  1W6X A;  2YSQ A;  4AFQ C;  2GQI A;  2FG0 A;  2GBQ A;  2JTE A;  3PVQ A;  4EIK A;  1AEY A;  4HXJ A;  4LUD A;  1TUD A;  3UAT A;  1K4U S;  1E6G A;  1K1Z A;  4HVW A;  3ULR B;  1CKA A;  1JXO A;  1W70 A;  2DM1 A;  4KRT A;  2VWF A;  2QDL A;  3KFV A;  1NEG A;  4LN2 A;  2K3B A;  2HCK A;  1UDL A;  4JJB A;  2MCN A;  2DX1 A;  2DF6 A;  4RUG A;  1T3S A;  2J05 A;  2D1X A;  2RNA A;  1M3C A;  4RTT A;  2KE9 A;  2F2W A;  1M8M A;  2ESW A;  1I0C A;  2AKK A;  1SSH A;  4J9B A;  3O5Z A;  2LX7 A;  2O9V A;  2LNH B;  1I07 A;  1KJW A;  1GCQ C;  1X6G A;  2JM9 A;  2FPF A;  2DBM A;  3NHN A;  1T0J A;  2FEI A;  2KXC A;  2F2X A;  2LQW A;  2V1R A;  2AZS A;  2AK5 A;  5I22 A;  2X3W D;  4DEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...